1BHBA

Three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
67
Chain Sequence
AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords BACTERIORHODOPSIN
publication title Three-dimensional structure of (1-71)bacterioopsin solubilized in methanol/chloroform and SDS micelles determined by 15N-1H heteronuclear NMR spectroscopy.
pubmed doi rcsb
source organism Halobacterium salinarum
total genus 21
structure length 67
sequence length 69
ec nomenclature
pdb deposition date 1993-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.170 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bhbA00
1BHAA 1BHBA
chains in the Genus database with same CATH superfamily
4DR4B 4JV5O 4JI4O 2EJRA 4EB6B 1K8AW 4GT1A 2P67A 2QR4A 2EINC 4E4EA 1OV9A 2YIDA 3ABLB 1VQ5V 3A0RA 4BIZA 4FLTA 3SYPA 4G27B 1FAFA 4WF9V 1ZSPA 3F7YC 3OEEG 1OCZC 1KKDA 5L3BA 1N4CA 5JCOC 5CA0B 1R6TA 5LGNA 1QHTA 4LR3A 4NYKA 1NQTA 4DYLA 3KKYA 1TUEB 2OTJV 3N27A 3WB0A 1JA8A 4I4TB 3ABKB 4I5SA 4GX1A 2F4VO 4ASUG 1FXKC 3R65A 2DW4A 2BE3A 4K0KB 4RAIA 2UXCO 4JI8O 4CH3A 1Q8IA 2UUAO 5LP6A 1FXKA 4GKJB 2ZINA 3RYFA 1AR1B 4NVPA 1ZUQA 2BOBC 1EM1A 3JD2A 2NLJC 3SJQC 3DSQA 1RPOA 2PF4E 4MTOA 1Y74B 2LFSA 3Q4HB 4JV5B 1YHQV 4JI4B 1M93A 1PM9A 4UV9A 4F6RB 5KUMA 5CA1B 4NXNB 4JI0O 2ADPA 4KP4A 1OZ0A 2Q67A 4XDLA 2PGGA 4C7UA 3UCSC 3CPWU 2ADQB 3ZMSA 1MMMA 4F6EA 3QF7A 3MHHC 3P32A 4LF6O 1TUBB 1IZ3A 4B3TO 4X20A 1UJWB 4JI2O 3PN1A 5B1OA 2DN9A 3KG2A 5H5NA 2LW7A 2CUGA 1NVPB 3ZHTA 5L3GA 4LF4B 3E22B 2F4VB 2HP8A 3D36C 3LDEA 3LNMB 1AI4A 2Q0OC 3ASOB 1BHAA 1PL0A 3CXCU 2UXCB 3CMAV 1BS3A 4IIJA 2FYUH 3CEIA 2UUAB 2GSMB 2WLIA 4X1KB 2O57A 1YJWV 1S0VA 2BOCC 4GX0A 2EIJC 2JGDB 5B3SB 1M57C 4TV8A 2JK5C 3L9DA 1BL8A 5JJNB 3JSLA 2BSKA 1Q5OA 3VQXA 2GUZB 3AG1C 3ZIAG 3C90A 5IYBO 2ETNA 3FB5C 4DV7O 4JI0B 2RQ6A 3B8MA 3FYIB 1WPXA 2QDOA 4G2KA 2VWJA 3AG2B 3J80N 4J7ZA 1SQXH 1AJQA 4B3MB 4TSFG 4UVCA 4LF8O 2P90A 2Q4PA 3L72H 3CJHA 3HKCB 1KBHA 1RSOB 4LF6B 2Q69A 2D2CB 1WJZA 4UVAA 2CDYA 2BTQB 5KAFZ 1M90W 1GH6A 2V1DA 3JALA 4XDKA 3CRAA 4TV9A 3ASNB 2ZXWC 3RWRD 4GX5A 4NTXA 3W7XA 2WAMA 5EZYB 4WFEA 1I94O 4MVSA 4JYAO 5DN6G 2E3CA 4H13B 2P4VA 5LMNO 4WCEV 2QKAA 4I0XA 2CH7B 3ZHUA 1OCCC 2QEXV 3ETDA 3OW2U 3AK1A 5K1XA 1IXBA 4JI1B 2EJ7A 1MZEA 5KAIZ 4UCOA 2ZCEA 3JD1A 1O9HA 3ZRWA 4DV7B 3MDSA 2QKSA 3J7AU 2W0FC 3K03A 1GK9A 1GTOA 5IJ0A 2ZDIC 4HBNA 1YEWA 2LP7A 4U3JB 1NBMG 1VQPV 1XMQB 3W7SA 5BXZA 3K08A 4HNAB 3K0DA 1VQNV 3IC7A 4TQDA 4EB6A 4BW5A 1K97A 1P49A 2YS8A 4PA6A 4AILC 1FD9A 2XT9A 4TUYB 4KHPO 3B2EE 2UU9O 2H8PC 3WU2Z 2YDEA 4FZ1A 4K3AA 4JYAB 3SPJA 3FFQA 5CA0A 3T1YO 1MNGA 4GX2A 1PP9H 3K3WA 2GTSA 3RN4A 4RQEA 4I4TA 1EN4A 1Q6IA 3ZMVA 3W7TA 4N23A 5CBHA 1RM1C 1KP2A 3JD4A 1GM8A 4O4JB 3HKEB 4RQFA 3DGEA 4MTGA 2L6LA 4QIWF 3STZC 5BY1A 1QBZA 3CE2A 2QWRB 3CCRV 1R3IC 3CWBH 1AB3A 1MSDA 4BIOA 3UM7A 3AK2A 3K57A 1N33O 4EEQA 1Y74A 3Q4HA 1M4UA 1CXZB 3ETEA 3RVZA 4ZHQB 4PJ0Z 4F6RA 2CAZC 3BA8A 4FLYA 4CH6A 5CA1A 3JAKB 5JJEB 1N34O 4DK1A 2IH3C 1YTFB 5LOVA 1T5EA 4YIPA 4I9QA 2QSAA 5FL7G 2EINB 2AXTZ 3MHSC 4O4IB 2DE0X 1YIJV 1TUBA 3P30A 3T1YB 4FVMA 2AHZA 2EIKB 4FJCC 5IWAO 3ETGA 4PI2A 2IJIA 2ZQMA 1GKFA 3ASOC 5AG2A 1CPYA 4RO2A 2HKOA 1I08A 3CCJV 3E22A 4MT8A 2X6AA 4JYBA 1Q82W 2YIAA 4X66O 4OXSA 5B3SC 2AZ0A 3IAYA 3L75H 1KB9F 1K34A 3J81N 1S72V 4X1KA 1KKCA 2ZE5A 3OAAG 4CZZA 2JGDA 2WLHA 5IT9N 1Q86W 2W0XA 2JJ1G 5JJJB 2PYJA 1OJHA 3CCEV 2DYRC 3OMNB 1N33B 3AG2C 1R6KA 2YI9A 1R3LC 2GUZA 1XQ8A 4ZOLB 4LH6A 3ZRSA 4MW8A 1N34B 2ZE8A 5IYZB 4JI6O 5H2FZ 1QR9A 2EZPA 2RDCA 4FFKA 5B1BC 3K5MA 2JEXA 1VQMV 3HKCA 1RSOA 4PI0A 1WAZA 3FAVB 1NTZH 1K5QA 3OE7G 2X6CA 3N2KB 5IWAB 2BTQA 1VIBA 1TAEA 2Q73A 1YITV 1W0KG 1DF4A 3WB2A 1NI8A 3A2FA 3S3WA 1JMKC 4IGGA 2QWNB 5DM6V 2ZR2A 5EZYA 2YI8A 1G8MA 4ICGA 1L0LH 1K5SA 5CB4B 2XTAA 4UB6Z 1SKVA 4BAYA 2IJHA 1GO3F 2CH7A 3JAMN 1IBLO 3ZHRA 1G6UA 4DW0A 4TT3G 4J41A 3T1HO 1Q43A 4OX9O 3CS5A 1BZKA 2JS5A 2QTOA 3OR7C 4JI7B 2IBZH 2EIJB 3K79A 1M57B 2X0LA 5KA6A 3U10A 1RP3B 1K9MW 5CA3A 1AI6A 4JI6B 3BPZA 1BQZA 4JYYA 1WB8A 1J5EB 1H2NA 3CRQA 3IGAC 1N8RW 2N05A 4WFGA 1FYJA 1V55C 4YHHO 4X1YA 3ZHVA 1QLNA 1US6A 4U3JA 3MAQA 2IJJA 2K9PA 1U97A 4HNAA 3RGBA 4LF7O 4NKGB 1FXHA 1D5NA 3CB2A 4TUYA 4BWAA 4XBFA 1SQBH 4FM0A 4QGPA 3SGIA 5L3EA 5J2TB 4MTXA 4P9PA 1F51A 3UKMA 1HNXO 1Z2GA 2BCCH 3U11A 2M6YA 4E2LA 1VARA 4G28B 2R70A 3ZMTA 3T1HB 5BR8O 5JQGB 1GMGA 4YXWG 1YXBA 1G1XB 4O4JA 1FJGO 1OCCB 2Y48A 3HKEA 1KYOF 4FFBB 3CMEV 3TXQA 2ATKC 2VQEO 1HNZB 1NU1H 5KMGB 2PI4A 3N2GB 3GB7C 4YHHB 4KL1A 2MK3A 5LA6A 4Z1VA 1JFFB 2YXLA 4FPPA 2B1GA 4WBNB 1H8HG 1WLEA 3BCCH 4P9OA 1AJPA 2PI5A 5FPRA 3P3NA 4LF7B 4ZHQA 2V4DA 3FB8C 3CD6V 2FKXA 2ZE6A 3RYCB 1LUVA 3E83A 1QVFU 4K35A 1SZXA 3ZRXA 2EIKC 5LGUA 4LWSB 1VF7A 1YJ9V 4DRXA 1HWYA 3ETQA 4O4IA 4LF5O 1WA8B 3B4SA 2YEVB 2WLNA 4IHJB 4CC5A 1HNXB 4GKKO 1WP7A 4PD4F 5EIBC 4DR2O 2UXDB 3E89A 1SQQH 3AK3A 3ZRVA 5BR8B 5JCOA 3TCUA 1VQOV 4LFAO 1EFRG 4DR1B 2R9RB 1FJGB 1GN2A 1AILA 3QG5A 2E75B 1VMGA 2NN4A 1EN6A 1RM1B 4AQYO 1NH2B 3SPGA 2ZNIA 3L70H 1AP6A 5KX5A 4FM2A 1XUQA 2HJDA 5ITZB 5D5QA 2RN9A 4FLVA 3SDLA 5K1PA 2ZM6O 1FXVA 4ZOLA 2OT5A 1BSMA 4UV8A 3WB1A 1Y67A 3X2QB 5IYZA 2E5LO 2IH1C 2Z0AA 1MSWD 1PL4A 4IYIA 3THOA 3JARB 1K4DC 5GONB 3JATB 1ZX3A 2WLMA 4ZIBA 4LF5B 3K5NA 1VF5B 1JCHA 2JEUA 3OGCC 1VEWA 3FAVA 1SQPH 1BGYH 4BR6A 1K33A 2P22C 2JDIG 2XUMA 4GKKB 3N2KA 4DR2B 2HG5C 4PA4A 2QWQB 1ROPA 1B04A 4Z1MG 1J95A 4UCRA 3ICXA 4MVOA 3BEHA 2Q8VA 2A3QA 4JI8B 1PNMA 3D36A 1R73A 4H37A 5CB4A 5H6RA 3K58A 3HKBB 1I0HA 3BAAA 1QLEC 2ZM6B 1MOFA 3CSXA 3BA9A 3OM3B 2DYRB 4GYCB 1F23A 1EN5A 1P7GA 5DEDA 3BVOA 3M99B 1V9PA 5H6QA 3I56V 1JR9A 1ENVA 3HPLC 4B3TB 3RVYA 5B1BB 2ILMA 4JI2B 4DR3O 3T2MA 4B08A 1XNRO 2CK3G 1NTMH 5J2UB 1K7DA 4PA7A 4H33A 4FLUA 1GN3A 4A5UB 4B3RO 4LFBO 3DC6A 1VQ9V 4U7NA 5CN0A 1LUWA 4PA9A 5J2TA 2F43G 3VBBA 1EBOA 5LBQA 1SF9A 3WFVA 1NKDA 1L0NH 2EZOA 2WPDG 2QWPB 2DWEC 2KG7B 3L73H 3ABUA 4I9WA 2P5OA 3L74H 1KP3A 1DF5A 3EVKA 1W2BU 5JQGA 3D3IA 4CS2A 4XDJA 3CYOA 1JVMA 4GZRB 4FFBA 3JD0A 1I5XA 1FFTB 1YI2V 1XBLA 2GHYA 1MA1A 4OPHA 3JD3A 5KMGA 4WFHA 3N2GA 1ZLZA 2CE4A 3K9SA 4LF8B 1JFFA 2HEPA 5EC1C 2OIGA 3CX5F 4WBNA 3OEHG 4JAAA 4CS3A 2ZIOA 3FB7C 4O4LB 2MW2B 2Y4TA 3SJAC 1V55B 2B1IA 2ZDIA 1ZWIC 4DR3B 2PZSA 4RUEA 3OT7A 3K06A 3I55V 1VQ7V 5IY5C 1E1QG 2FB5A 3RYCA 2RCVA 1VP7A 4O2BB 4HZ3A 3FB6C 3O65A 4D6TH 4LFBB 2H3OA 4HYOA 1X59A 4LWSA 5LL6Y 1FFXB 3LDCA 1I94B 2VQFO 3HR0A 1WA8A 5EYPB 5H9CA 1D2DA 4IHJA 1HNWO 5LMNB 5JH7B 4GLXA 1R3KC 1XMOO 2ZIMA 4Q6GA 1GM7A 1TVKB 4RUFA 3ZMUA 1G4YB 2E76B 5CBGA 4WFAV 2X6BA 3K04A 2AGAA 1HP8A 1QNMA 1XL4A 2N74A 4DV6O 2C2AA 2LQTA 4NTYA 2E74B 2W6IG 2OCCC 4W4KA 4EFBA 2Q6AA 4J42A 2UUBO 3AG4C 4AI8A 4B3SO 1S77D 4H44B 3X2QC 5ITZA 5LYJB 4BW9A 4FLWA 4ZBMA 3CP1A 2QE7G 4I7ZB 4KHPB 2WLLB 2UU9B 4F4LA 1YDXA 4DR6O 2JRIA 3JASB 3JARA 5GONA 5HFMA 1OCOC 3JATA 3VQYA 5IJ9B 1AJNA 3K59A 1VF6C 2Y0PA 3VOUA 1HNWB 2DQ0A 2YICA 1NR7A 2A7WA 1VF6A 4DR7O 4JAVA 1E79G 4DO2A 3BY6A 4DV0O 1S5JA 2Q9LA 4GUNA 1FPOA 2LGWA 3M7MX 3G6EV 1S5LZ 1THZA 4UVBA 4CBCA 3WG7C 4DV6B 2DJVA 4UCSA 3K9AA 3F7VC 3HKBA 4B3SB 2JJ2G 2YUAA 4X65O 4JI5O 3OMAB 2ITDC 2XNDG 1UPGA 3QNEA 1MZFA 3EFFK 1ZL8B 3LUTB 4PDMA 1H2SB 5KUKA 4DR6B 3QO5A 2M7WA 1KD1W 4DV1O 4CC6A 2G38A 1SA0B 4RWUA 3SYQA 2XAGA 1PD3A 1IDSA 2Z3YA 4FMTA 4UCTA 4JZGA 1NTKH 4CH4A 3LSQA 4DR7B 1PV0A 2RMKB 3ABTA 4J7KA 3RYHB 2XAJA 3CCLV 2GTAA 4FIPC 5J2UA 3T1CA 2KSDA 3U0ZA 4X66B 1B6QA 1N0NA 1H2KA 4NR1A 2OCHA 2EX3A 2BTOA 1YTFD 2QGNA 5L3FA 4DV3O 4UUJC 2RNBA 3AG3B 1DGSA 1H2MA 3AEIA 3G67A 1QQCA 3S3XA 2KG7A 3MD0A 4P2ZA 4GCZA 2YIBA 4X65B 3ABMC 1N0JA 4JI5B 1YSCA 4R7CA 2R9IA 4FLXA 2EIMB 4DUZO 1SQGA 3P3PA 1YZBA 2QWOB 3CXHF 1QLEB 1IBMO 1AR4A 3ZHSA 3K0GA 2DYSC 4DV1B 1HR0O 2HJFC 4JI3O 2A0LA 1AI5A 4LF9O 2QTSA 3FKSG 3W7UA 1M56C 4O4LA 4LH7A 2F95B 3SYAA 3STLC 2P6JA 4EFEA 5EK0A 1TGOA 4FZ0A 1VQLV 4FLZA 2GV9A 4H0LB 4D7SA 2HFEC 1SZTA 4LP8A 4O2BA 4LBEC 4DXWA 4CH5A 2FTKA 1VQ4V 2IW5A 1HDJA 3FYEB 2Q7HA 1FFXA 4DV3B 1LR1A 4JYCA 5EYPA 1CEZA 1PKXA 2PY5A 5JH7A 1IBLB 1F4NA 3A0HZ 4UB8Z 2LW1A 3B09A 3QVNA 4OX9B 3CCVV 1KMIZ 1S5HC 4DUZB 4UXNA 4PA3A 3VQWA 1TVKA 5EBLC 1N36O 1V54C 4JTDB 1N32O 1E1RG 5FNVB 4PDVA 1W59A 1IBMB 2QKCA 1HR0B 4I55B 1B3QA 4JI3B 2GDSA 2JIZG 4LF9B 3SPIA 3EHBB 5LYJA 2AZ2A 3E8HA 2A79B 4K0KO 3JAWB 5DECA 3ZX6A 1TA8A 2JGUA 1YCIA 4TQFA 3JAKA 1AI7A 1Y76B 2WLLA 1DLBA 3IJ4A 3OR6C 3JASA 4BIUA 1PPJH 3H1KH 3CC4V 4DV4O 5BZBA 5IJ9A 2X7RB 5IY5B 4TWKA 3E35A 4X89A 3TK1A 2K1EA 1URFA 1JPXA 4Q20A 4DR5O 1R3JC 1K3EA 5B1AB 4YJ2B 4R8CA 4NXNO 2W6JG 2FMLA 5CMUA 3CRRA 1KECA 4CS4A 4PDRA 3SJCC 4JGSA 4UCUA 2A06H 4UCVA 4PHZA 4X88A 1F7YA 4O2AB 1N36B 5J9PC 1N32B 1F4MA 3E8GA 3T4ZA 2VQEB 3SPCA 4U7OA 4DV5O 2VS0A 3KZIZ 2Y69B 5LMUO 4LF4O 2IJKA 2WA4A 4JPRA 5LP6C 4PELA 3G80A 4MTFA 5LHGA 5CBFA 2OCCB 1JOYA 2DOSA 3H1JH 1JQ0A 1ZL8A 3AG4B 5IE9A 4JASA 3APQA 2EULA 4Z2WA 4L87A 2QM7A 4B7KA 4YIOA 4IT5A 4MW3A 5D5PA 4DV4B 1SA0A 3SR2C 2XAHA 4ZKIA 1GN4A 1QR8A 1OCRC 2WLKA 2CTPA 1H2LA 4DR5B 3TJTA 1I5YA 1OCOB 2ZD9A 4KXRA 1XL6A 1SQVH 2XASA 3RT3C 5LOVB 2DMXA 1RPRA 1FS0G 3H1LH 3RYHA 3HKDB 4FK5C 4LFAB 3QTCA 4B3MO 1Y6XA 3JSNA 3AG3C 4KFMA 2EILC 4MSWC 3E8BA 2ZKOA 1COWG 1WPBA 2P7TC 1RFYA 1QVGU 4JTCB 2JVDA 3NXSA 2IM9A 2PTMA 1KUQA 4X1IB 4DV5B 4AQYB 1EZJA 4JZ2A 4L8JA 2EIMC 4IYHA 3B8NA 5LMUB 4JTAB 2LO1A 2Q7EA 5E79Z 1HW7A 3WG7B 1SETA 5LHIA 4MVMA 2L35A 2CTRA 2F1MA 5LXTB 3CCSV 2UXNA 2E5LB 3ZEDA 3RFRA 3K5OA 2LJ2A 1MABG 3ZN0A 2KKWA 3ZS8C 2CGOA 2KQXA 1KQSU 1SESA 4JI1O 1NH2D 3FX7A 2N04A 2JS3A 3H1HH 1IXMA 4W4LA 3RYIB 1K73W 3CCQV 4EKWA 3ZN1A 1XREA 4WFBV 2YXYA 1WB7A 5EBMC 3DXRB 1XHXA 1XEQA 1A32A 3OUSA 1NS1A 1XMQO 5KHJA 1VQKV 1BE3H 1ORQC 1Q90D 3OD4A 2HVJC 4DV2O 1OHHG 1Z5VA 1U96A 3BRCA 3CRCA 1ZAUA 1BCCH 4LNUB 2OTLV 1NVPD 2VWKA 3ZJZA 5FNVA 3ABMB 5F2VO 1YJNV 2IU3A 3G6BA 4O4HB 3OTFA 1IVSA 4I55A 3BFRA 1BHBA 1O9GA 1K92A 5BMVB 4IL6Z 1L1FA 1Q6UA 2ZE7A 2DYSB 4U3FH 3VQVA 3LDDA 3JAWA 1K4CC 1XNRB 2B9ZA 5A9GA 4AHCA 1Q81W 1I7FA 2ZR3A 1Y76A 1M56B 3DC5A 4LC1A 5C8YB 4X1YB 3SYOA 4QNHB 4HAMA 2ODMA 1M1KW 4B3RB 5B1AC 4NXMO 1GAXA 3SPHA 3ABLC 3B40A 3I5DA 3UT5B 4ZI7B 2R9AA 2D3OW 2YEVA 1NJIW 1AROP 2V7QG 1Q7YW 5JVDB 2ZT9B 4J9YB 4DV2B 4MVZA 1Z5WA 4YJ2A 3TXSA 3OMIB 1XI1A 3E2EA 4FM1A 1H38A 5B5EZ 2HVKC 3G4SV 5C93A 5JWPA 2FL4A 1BQ0A 4DUYO 4O2AA 2Y69C 3ML0A 4MVRA 3ABKC 2CTWA 2DQ3A 2P4KA 5FLXN 1CP9A 2OYQA 5E1AC 2LFRA 2XOKG 2Y4UA 3GVMA 5KLVH 3TETA 1V54B 2B5UA 2A9HA 3ZHQA 4DW1A 4MVUA 3F5WC 4PV1B 4UFZA 4ABMA 1P7BA 3JCUZ 4I50B 4R6ZA 2YIBD 1L8DA 5IYCO 2HHHO 4DK0A 4X64O 3OFNG 2IU0A 4N21A 1EZVH 1AVMA 5GTHZ 2WLJA 3C3SA 2ZNJA 5LA6B 3G71V 1Q3EA 2NNUA 3UQ8A 1WN7A 4YJ3B 1M9NA 4NXMB 2VQFB 4JF3A 4YY3O 3E86A 1Y4MA 1LNQA 1IURA 1VQ8V 1NZ6A 2VRZA 1JX9A 5HFLA 1H8EG 2Q68A 2ITCC 2Q0AA 3M8AA 3CCMV 3B77A 3A0BZ 1XMOB 3HKDA 1NR1A 4DRXB 4DUYB 1JJOA 1DTOA 3OUFA 2Z5UA 2YC0A 4J11A 5TISZ 4X1IA 3CC2V 1OCZB 2DWDC 4QJFB 5B66Z 3H01A 2UUBB 2UXBO 1XOUA 2AHYA 1M5IA 1S3JA 2UXXA 4X8AA 2QM4A 3PJSK 4K8ZA 2HHHB 2R72A 3TGUH 3ZMZA 4K8XA 1R6NA 4X64B 5LXTA 4J9ZB 5LP6B 1FXKB 2F66C 3RYFB 4LFCO 3JCZA 5KX5B 1B06A 2CGNA 3KCXA 3LNNA 1P84F 5GTIZ 3KCYA 3IFXA 3CC7V 3CHXA 2HR3A 4YY3B 4JI7O 2Q7GA 1IBKO 5IDJA 5EBWC 3RYIA 1WNSA 3BHPA 1KU9A 1J5EO 2QA4V 1OCRB 1SQFA 4DV0B 3DXRA 2QJ1A 4NB5A 5GW7A 4PDLA 5FPOA 1H2GA 3QO8A 1YVWA 1QU7A 5KHHA 4X20B 3ASNC 2Q5ZA 1SS3A 1FKAO 2WA3A 1IX9A 2LGQA 5L3DA 5KHKA 3OTOO 3ZCCA 1NT2B 5LGTA 2EILB 3ZBHA 1AR5A 4QE9A 2OWOA 4QPKA 2UXBB 3DTUB 2NR5A 3APOA 4MVQA 3C3TA 2YSUB 2YXHA 4LNUA 4OGQB 2UUCO 4IIJB 4J7JA 3BABA 3T4DA 1XNQO 2P06A 2WLIB 3SJBC 2EBOA 5LHHA 5EIBD 4LFCB 1BMFG 4O4HA 3E8FA 3H1IH 1XDCA 4TV8B 1DK1A 2PYLA 1ZTEA 2BSKB 2AW9A 5L3CA 2OIEA 1GRJA 5BMVA 1IBKB 1JJ2U 3HB3B 5B1NA 4MS2A 3O9OA 3QO7A 4X62O 1XHZA 4J10A 3RBZA 1HNZO 2HLDG 4B7EA 1W0JG 3AG1B 1VQ6V 1P4RA 4D7TA 5C8YA 3FD9A 1WP8A 3F5TA 3CJHB 4R50A 3CRMA 3OGIB 3RW0A 4LCUC 4NTWA 1UFIA 3LSUA 3A8TA 3UT5A 4ZI7A 1GN6A 3OTOB 1YF2A 4DR4O 2RJZA 5A2QN 1Q6HA 5EC2C 5JVDA 4OPAA 1XILA 3JALB 4J80A 1PNLA 4TV9B 4JAUA 4QPJA 1GM9A 3CCUV 3IC9A 5KHIA 3NR7A 2CTQA 3W7WA 3SYCA 3D3QA 3UO3A 2KB1A 2UUCB 1XNQB 4X9QA 3JYCA 2H94A 2ZXWB 4KUMA 1S76D 3K5LA 1D5AA 4I0XB 3H9VA 2XAFA 2UXDO 1AP5A 2WSSG 1R1BA 1QCEA 3GWOA 1Y66A 1KC8W 1X4TA 2F93B 4DR1O 3UO2A 5IYDO 4P30A 4I50A 3ZRWB 4X62B 3D8CA 5KA5A 2Y0IA 1SC5B 1MG1A 2PUSA 1PNKA 2ARHA 3LSSA 3R66A 2WWWA 4GKJO 5IJ0B 3GWKC 1SRYA 3EXAA 3L71H 1BT8A 4QE7A 3AG7A 4WFFA 2XHBA 1SERA 4YJ3A 2XAQA 2F23A 5KHGA 2GBOA 4TOIA 2QM8A
chains in the Genus database with same CATH topology
2X6BA 3K04A 2EJRA 1K8AW 4GT1A 2P67A 1KQSU 1SESA 2EINC 1XL4A 5DM6V 1NH2D 2C2AA 3ABLB 1VQ5V 3A0RA 2W6IG 2ZR2A 4BIZA 1IXMA 2OCCC 3SYPA 1G8MA 4G27B 2Q6AA 3CCQV 1K73W 4EKWA 3ZN1A 3AG4C 1S77D 4WFBV 1K5SA 3X2QC 4WF9V 3OEEG 3F7YC 4BAYA 1OCZC 2IJHA 1GO3F 5EBMC 4ZBMA 5L3BA 1KKDA 3CP1A 2QE7G 5LGNA 4TT3G 1NQTA 2QTOA 3OR7C 3OUSA 1TUEB 2EIJB 3K79A 2OTJV 1M57B 2WLLB 2X0LA 5KA6A 4F4LA 3ABKB 4I5SA 5HFMA 1OCOC 1VQKV 4GX1A 1K9MW 5CA3A 1AI6A 4ASUG 1FXKC 1AJNA 1ORQC 3R65A 2HVJC 1OHHG 3IGAC 2DW4A 3VOUA 1N8RW 4WFGA 1V55C 4RAIA 1QLNA 2DQ0A 1NR7A 1FXKA 2IJJA 1AR1B 4JAVA 2OTLV 1E79G 4DO2A 1NVPD 3BY6A 3ZJZA 2BOBC 3ABMB 3JD2A 2NLJC 1YJNV 2IU3A 3SJQC 1FXHA 1RPOA 4MTOA 2LFSA 3G6EV 1BHBA 1YHQV 4UV9A 5KUMA 1THZA 4UVBA 4CBCA 3WG7C 4XBFA 1K92A 4KP4A 1OZ0A 2Q67A 4XDLA 1L1FA 5L3EA 2DYSB 3K9AA 3F7VC 3CPWU 3LDDA 4MTXA 4P9PA 2JJ2G 1F51A 3ZMSA 3UKMA 1K4CC 3MHHC 3P32A 3OMAB 2ITDC 4E2LA 2XNDG 4G28B 1Q81W 3QNEA 2ZR3A 1M56B 3ZMTA 4LC1A 3EFFK 3SYOA 1UJWB 4QNHB 4HAMA 1M1KW 1GMGA 3LUTB 4PDMA 5B1AC 4YXWG 5B1OA 3KG2A 3SPHA 3ABLC 2Y48A 1OCCB 5KUKA 3QO5A 2D3OW 1NVPB 2M7WA 3CMEV 1KD1W 5L3GA 2YEVA 3LDEA 3LNMB 1NJIW 1AROP 2ATKC 2V7QG 1Q7YW 4J9YB 1AI4A 3ASOB 4MVZA 3SYQA 2XAGA 1BHAA 3OMIB 1PD3A 4FMTA 2Z3YA 1PL0A 2PI4A 3CXCU 3GB7C 3CMAV 3E2EA 1H38A 2MK3A 4FPPA 2B1GA 2HVKC 2GSMB 2WLIA 3G4SV 5C93A 1YJWV 1H8HG 3LSQA 1S0VA 1WLEA 2BOCC 4GX0A 3ABTA 2EIJC 4P9OA 1M57C 5B3SB 2JK5C 2Y69C 1AJPA 2XAJA 3ML0A 4MVRA 1BL8A 3CCLV 2PI5A 4FIPC 3ABKC 2DQ3A 1CP9A 3T1CA 5E1AC 3FB8C 2LFRA 2XOKG 3CD6V 1B6QA 3E83A 1YTFD 3TETA 1QVFU 3AG1C 5L3FA 3ZIAG 3ZRXA 1V54B 2B5UA 2A9HA 5IYBO 2EIKC 4UUJC 5LGUA 3FB5C 4MVUA 3F5WC 3B8MA 3FYIB 3AG3B 1WPXA 1YJ9V 4G2KA 1HWYA 3AEIA 1P7BA 3AG2B 4R6ZA 3MD0A 4P2ZA 2YEVB 4GCZA 1AJQA 2WLNA 4TSFG 3ABMC 4UVCA 2P90A 5IYCO 1YSCA 4R7CA 3OFNG 2R9IA 4N21A 2IU0A 2Q69A 2EIMB 3E89A 2WLJA 4UVAA 3G71V 3ZRVA 3TCUA 1VQOV 2NNUA 1EFRG 1M9NA 2R9RB 1M90W 1QLEB 2V1DA 3K0GA 4XDKA 2DYSC 4JF3A 3E86A 2HJFC 1Y4MA 1LNQA 3ASNB 2ZXWC 1VQ8V 1RM1B 1JX9A 4GX5A 1NH2B 2A0LA 3SPGA 1AI5A 3FKSG 5HFLA 1H8EG 2Q68A 2ITCC 3W7XA 3W7UA 3CCMV 2WAMA 1M56C 4WFEA 3B77A 4MVSA 3SYAA 3STLC 2P6JA 5DN6G 5EK0A 1NR1A 4WCEV 1VQLV 1OCCC 1DTOA 2HFEC 1SZTA 2QEXV 1FXVA 4LP8A 3OUFA 3ETDA 4LBEC 2Z5UA 4DXWA 3OW2U 2FTKA 2OT5A 1VQ4V 4UV8A 2IW5A 3X2QB 3CC2V 1OCZB 2IH1C 3FYEB 1MSWD 2DWDC 4QJFB 3JD1A 3ZRWA 4JYCA 1K4DC 3H01A 1CEZA 1PKXA 2AHYA 2QKSA 2WLMA 2W0FC 1S3JA 2UXXA 4X8AA 1F4NA 1JCHA 3K03A 3PJSK 2JEUA 1GK9A 3OGCC 1GTOA 1K33A 2ZDIC 2JDIG 3ZMZA 1R6NA 2HG5C 1S5HC 2LP7A 4J9ZB 1NBMG 4PA4A 1FXKB 3CCVV 1VQPV 4UXNA 1ROPA 4PA3A 3JCZA 3W7SA 5EBLC 4Z1MG 1V54C 1J95A 3K08A 4JTDB 1E1RG 4PDVA 3K0DA 1VQNV 3IC7A 4BW5A 3IFXA 3CC7V 4MVOA 1K97A 2HR3A 3BEHA 4PA6A 5IDJA 5EBWC 1PNMA 2H8PC 3D36A 2JIZG 1R73A 4H37A 3SPIA 2QA4V 3EHBB 1OCRB 5H6RA 3E8HA 2A79B 3SPJA 4GX2A 5GW7A 3K3WA 4PDLA 1QLEC 1H2GA 1AI7A 3QO8A 2WLLA 1DLBA 4RQEA 1MOFA 3ASNC 3ZMVA 3OR6C 3OM3B 4N23A 4BIUA 5CBHA 3W7TA 1RM1C 5L3DA 3CC4V 1KP2A 3JD4A 2DYRB 1GM8A 3ZCCA 5BZBA 5LGTA 2X7RB 2EILB 5IY5B 4TWKA 3E35A 4QE9A 1F23A 4QPKA 4X89A 3TK1A 2K1EA 3DTUB 1JPXA 4Q20A 1R3JC 4RQFA 1K3EA 3DGEA 4MTGA 3M99B 4MVQA 4QIWF 5B1AB 5H6QA 3STZC 4R8CA 3I56V 2W6JG 1QBZA 2YSUB 5CMUA 1ENVA 1KECA 4PDRA 3HPLC 4JGSA 3RVYA 3CCRV 3T4DA 5B1BB 1R3IC 2WLIB 2EBOA 5LHHA 3T2MA 1BMFG 3UM7A 4X88A 3E8FA 5J9PC 2CK3G 1F4MA 3ETEA 3E8GA 1K7DA 3RVZA 3T4ZA 4PA7A 4H33A 3SPCA 4U7OA 5L3CA 1VQ9V 4U7NA 2IH3C 5CN0A 1JJ2U 1YTFB 2Y69B 3HB3B 4PA9A 5B1NA 2F43G 4MS2A 3VBBA 3QO7A 1EBOA 2IJKA 4JPRA 5FL7G 5LBQA 3RBZA 2EINB 3WFVA 1NKDA 4PELA 3MHSC 2EZOA 4MTFA 2HLDG 2WPDG 5CBFA 5LHGA 1W0JG 2DWEC 1YIJV 3AG1B 3P30A 3ABUA 4I9WA 1P4RA 1VQ6V 2OCCB 2AHZA 1JOYA 1KP3A 1DF5A 2EIKB 4FJCC 1W2BU 1JQ0A 3ETGA 3AG4B 4R50A 3D3IA 4JASA 3RW0A 2IJIA 2ZQMA 1GKFA 2QM7A 3ASOC 4L87A 4LCUC 4XDJA 1CPYA 4RO2A 2HKOA 3CYOA 1JVMA 3JD0A 1I5XA 1FFTB 4MW3A 1YI2V 3CCJV 4MT8A 2XAHA 2X6AA 4JYBA 1Q82W 2GHYA 5EC2C 4ZKIA 1QR8A 1OCRC 1PNLA 3JD3A 4OXSA 5B3SC 4WFHA 2WLKA 4JAUA 4QPJA 1GM9A 3CCUV 1I5YA 1K34A 1OCOB 5EC1C 1S72V 2ZD9A 3W7WA 1XL6A 3SYCA 3OEHG 3OAAG 4CZZA 2XASA 2KB1A 2WLHA 1RPRA 3FB7C 1FS0G 1Q86W 1V55B 2B1IA 2JJ1G 2H94A 3JYCA 2ZDIA 1ZWIC 2ZXWB 4FK5C 4KUMA 4RUEA 1S76D 3K06A 3CCEV 3I55V 2DYRC 3AG3C 3OMNB 1VQ7V 2XAFA 2EILC 1E1QG 4KFMA 4MSWC 5IY5C 3AG2C 1R6KA 3E8BA 1R3LC 2WSSG 1COWG 2P7TC 1QCEA 1QVGU 4JTCB 3GWOA 1Y66A 4HZ3A 1KC8W 3ZRSA 3FB6C 3NXSA 4HYOA 4MW8A 1EZJA 5IYDO 2EIMC 4P30A 3LDCA 1QR9A 3B8NA 2EZPA 3ZRWB 4JTAB 5B1BC 5H9CA 5KA5A 3WG7B 1MG1A 2JEXA 1PNKA 1SETA 1R3KC 3LSSA 1VQMV 2WWWA 5LHIA 4MVMA 1K5QA 3OE7G 2X6CA 1SRYA 4QE7A 4WFFA 1SERA 2XAQA 3CCSV 2UXNA 1GM7A 4RUFA 1YITV 3ZMUA 1G4YB 1MABG 3ZN0A 5CBGA 1W0KG 1DF4A 4WFAV 2QM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHA A;  1BHB A; 
#chains in the Genus database with same CATH topology
 4DR4 B;  4JV5 O;  4JI4 O;  2EJR A;  4EB6 B;  1K8A W;  4GT1 A;  2P67 A;  2QR4 A;  2EIN C;  4E4E A;  1OV9 A;  2YID A;  3ABL B;  1VQ5 V;  3A0R A;  4BIZ A;  4FLT A;  3SYP A;  4G27 B;  1FAF A;  4WF9 V;  1ZSP A;  3F7Y C;  3OEE G;  1OCZ C;  1KKD A;  5L3B A;  1N4C A;  5JCO C;  5CA0 B;  1R6T A;  5LGN A;  1QHT A;  4LR3 A;  4NYK A;  1NQT A;  4DYL A;  3KKY A;  1TUE B;  2OTJ V;  3N27 A;  3WB0 A;  1JA8 A;  4I4T B;  3ABK B;  4I5S A;  4GX1 A;  2F4V O;  4ASU G;  1FXK C;  3R65 A;  2DW4 A;  2BE3 A;  4K0K B;  4RAI A;  2UXC O;  4JI8 O;  4CH3 A;  1Q8I A;  2UUA O;  5LP6 A;  1FXK A;  4GKJ B;  2ZIN A;  3RYF A;  1AR1 B;  4NVP A;  1ZUQ A;  2BOB C;  1EM1 A;  3JD2 A;  2NLJ C;  3SJQ C;  3DSQ A;  1RPO A;  2PF4 E;  4MTO A;  1Y74 B;  2LFS A;  3Q4H B;  4JV5 B;  1YHQ V;  4JI4 B;  1M93 A;  1PM9 A;  4UV9 A;  4F6R B;  5KUM A;  5CA1 B;  4NXN B;  4JI0 O;  2ADP A;  4KP4 A;  1OZ0 A;  2Q67 A;  4XDL A;  2PGG A;  4C7U A;  3UCS C;  3CPW U;  2ADQ B;  3ZMS A;  1MMM A;  4F6E A;  3QF7 A;  3MHH C;  3P32 A;  4LF6 O;  1TUB B;  1IZ3 A;  4B3T O;  4X20 A;  1UJW B;  4JI2 O;  3PN1 A;  5B1O A;  2DN9 A;  3KG2 A;  5H5N A;  2LW7 A;  2CUG A;  1NVP B;  3ZHT A;  5L3G A;  4LF4 B;  3E22 B;  2F4V B;  2HP8 A;  3D36 C;  3LDE A;  3LNM B;  1AI4 A;  2Q0O C;  3ASO B;  1BHA A;  1PL0 A;  3CXC U;  2UXC B;  3CMA V;  1BS3 A;  4IIJ A;  2FYU H;  3CEI A;  2UUA B;  2GSM B;  2WLI A;  4X1K B;  2O57 A;  1YJW V;  1S0V A;  2BOC C;  4GX0 A;  2EIJ C;  2JGD B;  5B3S B;  1M57 C;  4TV8 A;  2JK5 C;  3L9D A;  1BL8 A;  5JJN B;  3JSL A;  2BSK A;  1Q5O A;  3VQX A;  2GUZ B;  3AG1 C;  3ZIA G;  3C90 A;  5IYB O;  2ETN A;  3FB5 C;  4DV7 O;  4JI0 B;  2RQ6 A;  3B8M A;  3FYI B;  1WPX A;  2QDO A;  4G2K A;  2VWJ A;  3AG2 B;  3J80 N;  4J7Z A;  1SQX H;  1AJQ A;  4B3M B;  4TSF G;  4UVC A;  4LF8 O;  2P90 A;  2Q4P A;  3L72 H;  3CJH A;  3HKC B;  1KBH A;  1RSO B;  4LF6 B;  2Q69 A;  2D2C B;  1WJZ A;  4UVA A;  2CDY A;  2BTQ B;  5KAF Z;  1M90 W;  1GH6 A;  2V1D A;  3JAL A;  4XDK A;  3CRA A;  4TV9 A;  3ASN B;  2ZXW C;  3RWR D;  4GX5 A;  4NTX A;  3W7X A;  2WAM A;  5EZY B;  4WFE A;  1I94 O;  4MVS A;  4JYA O;  5DN6 G;  2E3C A;  4H13 B;  2P4V A;  5LMN O;  4WCE V;  2QKA A;  4I0X A;  2CH7 B;  3ZHU A;  1OCC C;  2QEX V;  3ETD A;  3OW2 U;  3AK1 A;  5K1X A;  1IXB A;  4JI1 B;  2EJ7 A;  1MZE A;  5KAI Z;  4UCO A;  2ZCE A;  3JD1 A;  1O9H A;  3ZRW A;  4DV7 B;  3MDS A;  2QKS A;  3J7A U;  2W0F C;  3K03 A;  1GK9 A;  1GTO A;  5IJ0 A;  2ZDI C;  4HBN A;  1YEW A;  2LP7 A;  4U3J B;  1NBM G;  1VQP V;  1XMQ B;  3W7S A;  5BXZ A;  3K08 A;  4HNA B;  3K0D A;  1VQN V;  3IC7 A;  4TQD A;  4EB6 A;  4BW5 A;  1K97 A;  1P49 A;  2YS8 A;  4PA6 A;  4AIL C;  1FD9 A;  2XT9 A;  4TUY B;  4KHP O;  3B2E E;  2UU9 O;  2H8P C;  3WU2 Z;  2YDE A;  4FZ1 A;  4K3A A;  4JYA B;  3SPJ A;  3FFQ A;  5CA0 A;  3T1Y O;  1MNG A;  4GX2 A;  1PP9 H;  3K3W A;  2GTS A;  3RN4 A;  4RQE A;  4I4T A;  1EN4 A;  1Q6I A;  3ZMV A;  3W7T A;  4N23 A;  5CBH A;  1RM1 C;  1KP2 A;  3JD4 A;  1GM8 A;  4O4J B;  3HKE B;  4RQF A;  3DGE A;  4MTG A;  2L6L A;  4QIW F;  3STZ C;  5BY1 A;  1QBZ A;  3CE2 A;  2QWR B;  3CCR V;  1R3I C;  3CWB H;  1AB3 A;  1MSD A;  4BIO A;  3UM7 A;  3AK2 A;  3K57 A;  1N33 O;  4EEQ A;  1Y74 A;  3Q4H A;  1M4U A;  1CXZ B;  3ETE A;  3RVZ A;  4ZHQ B;  4PJ0 Z;  4F6R A;  2CAZ C;  3BA8 A;  4FLY A;  4CH6 A;  5CA1 A;  3JAK B;  5JJE B;  1N34 O;  4DK1 A;  2IH3 C;  1YTF B;  5LOV A;  1T5E A;  4YIP A;  4I9Q A;  2QSA A;  5FL7 G;  2EIN B;  2AXT Z;  3MHS C;  4O4I B;  2DE0 X;  1YIJ V;  1TUB A;  3P30 A;  3T1Y B;  4FVM A;  2AHZ A;  2EIK B;  4FJC C;  5IWA O;  3ETG A;  4PI2 A;  2IJI A;  2ZQM A;  1GKF A;  3ASO C;  5AG2 A;  1CPY A;  4RO2 A;  2HKO A;  1I08 A;  3CCJ V;  3E22 A;  4MT8 A;  2X6A A;  4JYB A;  1Q82 W;  2YIA A;  4X66 O;  4OXS A;  5B3S C;  2AZ0 A;  3IAY A;  3L75 H;  1KB9 F;  1K34 A;  3J81 N;  1S72 V;  4X1K A;  1KKC A;  2ZE5 A;  3OAA G;  4CZZ A;  2JGD A;  2WLH A;  5IT9 N;  1Q86 W;  2W0X A;  2JJ1 G;  5JJJ B;  2PYJ A;  1OJH A;  3CCE V;  2DYR C;  3OMN B;  1N33 B;  3AG2 C;  1R6K A;  2YI9 A;  1R3L C;  2GUZ A;  1XQ8 A;  4ZOL B;  4LH6 A;  3ZRS A;  4MW8 A;  1N34 B;  2ZE8 A;  5IYZ B;  4JI6 O;  5H2F Z;  1QR9 A;  2EZP A;  2RDC A;  4FFK A;  5B1B C;  3K5M A;  2JEX A;  1VQM V;  3HKC A;  1RSO A;  4PI0 A;  1WAZ A;  3FAV B;  1NTZ H;  1K5Q A;  3OE7 G;  2X6C A;  3N2K B;  5IWA B;  2BTQ A;  1VIB A;  1TAE A;  2Q73 A;  1YIT V;  1W0K G;  1DF4 A;  3WB2 A;  1NI8 A;  3A2F A;  3S3W A;  1JMK C;  4IGG A;  2QWN B;  5DM6 V;  2ZR2 A;  5EZY A;  2YI8 A;  1G8M A;  4ICG A;  1L0L H;  1K5S A;  5CB4 B;  2XTA A;  4UB6 Z;  1SKV A;  4BAY A;  2IJH A;  1GO3 F;  2CH7 A;  3JAM N;  1IBL O;  3ZHR A;  1G6U A;  4DW0 A;  4TT3 G;  4J41 A;  3T1H O;  1Q43 A;  4OX9 O;  3CS5 A;  1BZK A;  2JS5 A;  2QTO A;  3OR7 C;  4JI7 B;  2IBZ H;  2EIJ B;  3K79 A;  1M57 B;  2X0L A;  5KA6 A;  3U10 A;  1RP3 B;  1K9M W;  5CA3 A;  1AI6 A;  4JI6 B;  3BPZ A;  1BQZ A;  4JYY A;  1WB8 A;  1J5E B;  1H2N A;  3CRQ A;  3IGA C;  1N8R W;  2N05 A;  4WFG A;  1FYJ A;  1V55 C;  4YHH O;  4X1Y A;  3ZHV A;  1QLN A;  1US6 A;  4U3J A;  3MAQ A;  2IJJ A;  2K9P A;  1U97 A;  4HNA A;  3RGB A;  4LF7 O;  4NKG B;  1FXH A;  1D5N A;  3CB2 A;  4TUY A;  4BWA A;  4XBF A;  1SQB H;  4FM0 A;  4QGP A;  3SGI A;  5L3E A;  5J2T B;  4MTX A;  4P9P A;  1F51 A;  3UKM A;  1HNX O;  1Z2G A;  2BCC H;  3U11 A;  2M6Y A;  4E2L A;  1VAR A;  4G28 B;  2R70 A;  3ZMT A;  3T1H B;  5BR8 O;  5JQG B;  1GMG A;  4YXW G;  1YXB A;  1G1X B;  4O4J A;  1FJG O;  1OCC B;  2Y48 A;  3HKE A;  1KYO F;  4FFB B;  3CME V;  3TXQ A;  2ATK C;  2VQE O;  1HNZ B;  1NU1 H;  5KMG B;  2PI4 A;  3N2G B;  3GB7 C;  4YHH B;  4KL1 A;  2MK3 A;  5LA6 A;  4Z1V A;  1JFF B;  2YXL A;  4FPP A;  2B1G A;  4WBN B;  1H8H G;  1WLE A;  3BCC H;  4P9O A;  1AJP A;  2PI5 A;  5FPR A;  3P3N A;  4LF7 B;  4ZHQ A;  2V4D A;  3FB8 C;  3CD6 V;  2FKX A;  2ZE6 A;  3RYC B;  1LUV A;  3E83 A;  1QVF U;  4K35 A;  1SZX A;  3ZRX A;  2EIK C;  5LGU A;  4LWS B;  1VF7 A;  1YJ9 V;  4DRX A;  1HWY A;  3ETQ A;  4O4I A;  4LF5 O;  1WA8 B;  3B4S A;  2YEV B;  2WLN A;  4IHJ B;  4CC5 A;  1HNX B;  4GKK O;  1WP7 A;  4PD4 F;  5EIB C;  4DR2 O;  2UXD B;  3E89 A;  1SQQ H;  3AK3 A;  3ZRV A;  5BR8 B;  5JCO A;  3TCU A;  1VQO V;  4LFA O;  1EFR G;  4DR1 B;  2R9R B;  1FJG B;  1GN2 A;  1AIL A;  3QG5 A;  2E75 B;  1VMG A;  2NN4 A;  1EN6 A;  1RM1 B;  4AQY O;  1NH2 B;  3SPG A;  2ZNI A;  3L70 H;  1AP6 A;  5KX5 A;  4FM2 A;  1XUQ A;  2HJD A;  5ITZ B;  5D5Q A;  2RN9 A;  4FLV A;  3SDL A;  5K1P A;  2ZM6 O;  1FXV A;  4ZOL A;  2OT5 A;  1BSM A;  4UV8 A;  3WB1 A;  1Y67 A;  3X2Q B;  5IYZ A;  2E5L O;  2IH1 C;  2Z0A A;  1MSW D;  1PL4 A;  4IYI A;  3THO A;  3JAR B;  1K4D C;  5GON B;  3JAT B;  1ZX3 A;  2WLM A;  4ZIB A;  4LF5 B;  3K5N A;  1VF5 B;  1JCH A;  2JEU A;  3OGC C;  1VEW A;  3FAV A;  1SQP H;  1BGY H;  4BR6 A;  1K33 A;  2P22 C;  2JDI G;  2XUM A;  4GKK B;  3N2K A;  4DR2 B;  2HG5 C;  4PA4 A;  2QWQ B;  1ROP A;  1B04 A;  4Z1M G;  1J95 A;  4UCR A;  3ICX A;  4MVO A;  3BEH A;  2Q8V A;  2A3Q A;  4JI8 B;  1PNM A;  3D36 A;  1R73 A;  4H37 A;  5CB4 A;  5H6R A;  3K58 A;  3HKB B;  1I0H A;  3BAA A;  1QLE C;  2ZM6 B;  1MOF A;  3CSX A;  3BA9 A;  3OM3 B;  2DYR B;  4GYC B;  1F23 A;  1EN5 A;  1P7G A;  5DED A;  3BVO A;  3M99 B;  1V9P A;  5H6Q A;  3I56 V;  1JR9 A;  1ENV A;  3HPL C;  4B3T B;  3RVY A;  5B1B B;  2ILM A;  4JI2 B;  4DR3 O;  3T2M A;  4B08 A;  1XNR O;  2CK3 G;  1NTM H;  5J2U B;  1K7D A;  4PA7 A;  4H33 A;  4FLU A;  1GN3 A;  4A5U B;  4B3R O;  4LFB O;  3DC6 A;  1VQ9 V;  4U7N A;  5CN0 A;  1LUW A;  4PA9 A;  5J2T A;  2F43 G;  3VBB A;  1EBO A;  5LBQ A;  1SF9 A;  3WFV A;  1NKD A;  1L0N H;  2EZO A;  2WPD G;  2QWP B;  2DWE C;  2KG7 B;  3L73 H;  3ABU A;  4I9W A;  2P5O A;  3L74 H;  1KP3 A;  1DF5 A;  3EVK A;  1W2B U;  5JQG A;  3D3I A;  4CS2 A;  4XDJ A;  3CYO A;  1JVM A;  4GZR B;  4FFB A;  3JD0 A;  1I5X A;  1FFT B;  1YI2 V;  1XBL A;  2GHY A;  1MA1 A;  4OPH A;  3JD3 A;  5KMG A;  4WFH A;  3N2G A;  1ZLZ A;  2CE4 A;  3K9S A;  4LF8 B;  1JFF A;  2HEP A;  5EC1 C;  2OIG A;  3CX5 F;  4WBN A;  3OEH G;  4JAA A;  4CS3 A;  2ZIO A;  3FB7 C;  4O4L B;  2MW2 B;  2Y4T A;  3SJA C;  1V55 B;  2B1I A;  2ZDI A;  1ZWI C;  4DR3 B;  2PZS A;  4RUE A;  3OT7 A;  3K06 A;  3I55 V;  1VQ7 V;  5IY5 C;  1E1Q G;  2FB5 A;  3RYC A;  2RCV A;  1VP7 A;  4O2B B;  4HZ3 A;  3FB6 C;  3O65 A;  4D6T H;  4LFB B;  2H3O A;  4HYO A;  1X59 A;  4LWS A;  5LL6 Y;  1FFX B;  3LDC A;  1I94 B;  2VQF O;  3HR0 A;  1WA8 A;  5EYP B;  5H9C A;  1D2D A;  4IHJ A;  1HNW O;  5LMN B;  5JH7 B;  4GLX A;  1R3K C;  1XMO O;  2ZIM A;  4Q6G A;  1GM7 A;  1TVK B;  4RUF A;  3ZMU A;  1G4Y B;  2E76 B;  5CBG A;  4WFA V;  2X6B A;  3K04 A;  2AGA A;  1HP8 A;  1QNM A;  1XL4 A;  2N74 A;  4DV6 O;  2C2A A;  2LQT A;  4NTY A;  2E74 B;  2W6I G;  2OCC C;  4W4K A;  4EFB A;  2Q6A A;  4J42 A;  2UUB O;  3AG4 C;  4AI8 A;  4B3S O;  1S77 D;  4H44 B;  3X2Q C;  5ITZ A;  5LYJ B;  4BW9 A;  4FLW A;  4ZBM A;  3CP1 A;  2QE7 G;  4I7Z B;  4KHP B;  2WLL B;  2UU9 B;  4F4L A;  1YDX A;  4DR6 O;  2JRI A;  3JAS B;  3JAR A;  5GON A;  5HFM A;  1OCO C;  3JAT A;  3VQY A;  5IJ9 B;  1AJN A;  3K59 A;  1VF6 C;  2Y0P A;  3VOU A;  1HNW B;  2DQ0 A;  2YIC A;  1NR7 A;  2A7W A;  1VF6 A;  4DR7 O;  4JAV A;  1E79 G;  4DO2 A;  3BY6 A;  4DV0 O;  1S5J A;  2Q9L A;  4GUN A;  1FPO A;  2LGW A;  3M7M X;  3G6E V;  1S5L Z;  1THZ A;  4UVB A;  4CBC A;  3WG7 C;  4DV6 B;  2DJV A;  4UCS A;  3K9A A;  3F7V C;  3HKB A;  4B3S B;  2JJ2 G;  2YUA A;  4X65 O;  4JI5 O;  3OMA B;  2ITD C;  2XND G;  1UPG A;  3QNE A;  1MZF A;  3EFF K;  1ZL8 B;  3LUT B;  4PDM A;  1H2S B;  5KUK A;  4DR6 B;  3QO5 A;  2M7W A;  1KD1 W;  4DV1 O;  4CC6 A;  2G38 A;  1SA0 B;  4RWU A;  3SYQ A;  2XAG A;  1PD3 A;  1IDS A;  2Z3Y A;  4FMT A;  4UCT A;  4JZG A;  1NTK H;  4CH4 A;  3LSQ A;  4DR7 B;  1PV0 A;  2RMK B;  3ABT A;  4J7K A;  3RYH B;  2XAJ A;  3CCL V;  2GTA A;  4FIP C;  5J2U A;  3T1C A;  2KSD A;  3U0Z A;  4X66 B;  1B6Q A;  1N0N A;  1H2K A;  4NR1 A;  2OCH A;  2EX3 A;  2BTO A;  1YTF D;  2QGN A;  5L3F A;  4DV3 O;  4UUJ C;  2RNB A;  3AG3 B;  1DGS A;  1H2M A;  3AEI A;  3G67 A;  1QQC A;  3S3X A;  2KG7 A;  3MD0 A;  4P2Z A;  4GCZ A;  2YIB A;  4X65 B;  3ABM C;  1N0J A;  4JI5 B;  1YSC A;  4R7C A;  2R9I A;  4FLX A;  2EIM B;  4DUZ O;  1SQG A;  3P3P A;  1YZB A;  2QWO B;  3CXH F;  1QLE B;  1IBM O;  1AR4 A;  3ZHS A;  3K0G A;  2DYS C;  4DV1 B;  1HR0 O;  2HJF C;  4JI3 O;  2A0L A;  1AI5 A;  4LF9 O;  2QTS A;  3FKS G;  3W7U A;  1M56 C;  4O4L A;  4LH7 A;  2F95 B;  3SYA A;  3STL C;  2P6J A;  4EFE A;  5EK0 A;  1TGO A;  4FZ0 A;  1VQL V;  4FLZ A;  2GV9 A;  4H0L B;  4D7S A;  2HFE C;  1SZT A;  4LP8 A;  4O2B A;  4LBE C;  4DXW A;  4CH5 A;  2FTK A;  1VQ4 V;  2IW5 A;  1HDJ A;  3FYE B;  2Q7H A;  1FFX A;  4DV3 B;  1LR1 A;  4JYC A;  5EYP A;  1CEZ A;  1PKX A;  2PY5 A;  5JH7 A;  1IBL B;  1F4N A;  3A0H Z;  4UB8 Z;  2LW1 A;  3B09 A;  3QVN A;  4OX9 B;  3CCV V;  1KMI Z;  1S5H C;  4DUZ B;  4UXN A;  4PA3 A;  3VQW A;  1TVK A;  5EBL C;  1N36 O;  1V54 C;  4JTD B;  1N32 O;  1E1R G;  5FNV B;  4PDV A;  1W59 A;  1IBM B;  2QKC A;  1HR0 B;  4I55 B;  1B3Q A;  4JI3 B;  2GDS A;  2JIZ G;  4LF9 B;  3SPI A;  3EHB B;  5LYJ A;  2AZ2 A;  3E8H A;  2A79 B;  4K0K O;  3JAW B;  5DEC A;  3ZX6 A;  1TA8 A;  2JGU A;  1YCI A;  4TQF A;  3JAK A;  1AI7 A;  1Y76 B;  2WLL A;  1DLB A;  3IJ4 A;  3OR6 C;  3JAS A;  4BIU A;  1PPJ H;  3H1K H;  3CC4 V;  4DV4 O;  5BZB A;  5IJ9 A;  2X7R B;  5IY5 B;  4TWK A;  3E35 A;  4X89 A;  3TK1 A;  2K1E A;  1URF A;  1JPX A;  4Q20 A;  4DR5 O;  1R3J C;  1K3E A;  5B1A B;  4YJ2 B;  4R8C A;  4NXN O;  2W6J G;  2FML A;  5CMU A;  3CRR A;  1KEC A;  4CS4 A;  4PDR A;  3SJC C;  4JGS A;  4UCU A;  2A06 H;  4UCV A;  4PHZ A;  4X88 A;  1F7Y A;  4O2A B;  1N36 B;  5J9P C;  1N32 B;  1F4M A;  3E8G A;  3T4Z A;  2VQE B;  3SPC A;  4U7O A;  4DV5 O;  2VS0 A;  3KZI Z;  2Y69 B;  5LMU O;  4LF4 O;  2IJK A;  2WA4 A;  4JPR A;  5LP6 C;  4PEL A;  3G80 A;  4MTF A;  5LHG A;  5CBF A;  2OCC B;  1JOY A;  2DOS A;  3H1J H;  1JQ0 A;  1ZL8 A;  3AG4 B;  5IE9 A;  4JAS A;  3APQ A;  2EUL A;  4Z2W A;  4L87 A;  2QM7 A;  4B7K A;  4YIO A;  4IT5 A;  4MW3 A;  5D5P A;  4DV4 B;  1SA0 A;  3SR2 C;  2XAH A;  4ZKI A;  1GN4 A;  1QR8 A;  1OCR C;  2WLK A;  2CTP A;  1H2L A;  4DR5 B;  3TJT A;  1I5Y A;  1OCO B;  2ZD9 A;  4KXR A;  1XL6 A;  1SQV H;  2XAS A;  3RT3 C;  5LOV B;  2DMX A;  1RPR A;  1FS0 G;  3H1L H;  3RYH A;  3HKD B;  4FK5 C;  4LFA B;  3QTC A;  4B3M O;  1Y6X A;  3JSN A;  3AG3 C;  4KFM A;  2EIL C;  4MSW C;  3E8B A;  2ZKO A;  1COW G;  1WPB A;  2P7T C;  1RFY A;  1QVG U;  4JTC B;  2JVD A;  3NXS A;  2IM9 A;  2PTM A;  1KUQ A;  4X1I B;  4DV5 B;  4AQY B;  1EZJ A;  4JZ2 A;  4L8J A;  2EIM C;  4IYH A;  3B8N A;  5LMU B;  4JTA B;  2LO1 A;  2Q7E A;  5E79 Z;  1HW7 A;  3WG7 B;  1SET A;  5LHI A;  4MVM A;  2L35 A;  2CTR A;  2F1M A;  5LXT B;  3CCS V;  2UXN A;  2E5L B;  3ZED A;  3RFR A;  3K5O A;  2LJ2 A;  1MAB G;  3ZN0 A;  2KKW A;  3ZS8 C;  2CGO A;  2KQX A;  1KQS U;  1SES A;  4JI1 O;  1NH2 D;  3FX7 A;  2N04 A;  2JS3 A;  3H1H H;  1IXM A;  4W4L A;  3RYI B;  1K73 W;  3CCQ V;  4EKW A;  3ZN1 A;  1XRE A;  4WFB V;  2YXY A;  1WB7 A;  5EBM C;  3DXR B;  1XHX A;  1XEQ A;  1A32 A;  3OUS A;  1NS1 A;  1XMQ O;  5KHJ A;  1VQK V;  1BE3 H;  1ORQ C;  1Q90 D;  3OD4 A;  2HVJ C;  4DV2 O;  1OHH G;  1Z5V A;  1U96 A;  3BRC A;  3CRC A;  1ZAU A;  1BCC H;  4LNU B;  2OTL V;  1NVP D;  2VWK A;  3ZJZ A;  5FNV A;  3ABM B;  5F2V O;  1YJN V;  2IU3 A;  3G6B A;  4O4H B;  3OTF A;  1IVS A;  4I55 A;  3BFR A;  1BHB A;  1O9G A;  1K92 A;  5BMV B;  4IL6 Z;  1L1F A;  1Q6U A;  2ZE7 A;  2DYS B;  4U3F H;  3VQV A;  3LDD A;  3JAW A;  1K4C C;  1XNR B;  2B9Z A;  5A9G A;  4AHC A;  1Q81 W;  1I7F A;  2ZR3 A;  1Y76 A;  1M56 B;  3DC5 A;  4LC1 A;  5C8Y B;  4X1Y B;  3SYO A;  4QNH B;  4HAM A;  2ODM A;  1M1K W;  4B3R B;  5B1A C;  4NXM O;  1GAX A;  3SPH A;  3ABL C;  3B40 A;  3I5D A;  3UT5 B;  4ZI7 B;  2R9A A;  2D3O W;  2YEV A;  1NJI W;  1ARO P;  2V7Q G;  1Q7Y W;  5JVD B;  2ZT9 B;  4J9Y B;  4DV2 B;  4MVZ A;  1Z5W A;  4YJ2 A;  3TXS A;  3OMI B;  1XI1 A;  3E2E A;  4FM1 A;  1H38 A;  5B5E Z;  2HVK C;  3G4S V;  5C93 A;  5JWP A;  2FL4 A;  1BQ0 A;  4DUY O;  4O2A A;  2Y69 C;  3ML0 A;  4MVR A;  3ABK C;  2CTW A;  2DQ3 A;  2P4K A;  5FLX N;  1CP9 A;  2OYQ A;  5E1A C;  2LFR A;  2XOK G;  2Y4U A;  3GVM A;  5KLV H;  3TET A;  1V54 B;  2B5U A;  2A9H A;  3ZHQ A;  4DW1 A;  4MVU A;  3F5W C;  4PV1 B;  4UFZ A;  4ABM A;  1P7B A;  3JCU Z;  4I50 B;  4R6Z A;  2YIB D;  1L8D A;  5IYC O;  2HHH O;  4DK0 A;  4X64 O;  3OFN G;  2IU0 A;  4N21 A;  1EZV H;  1AVM A;  5GTH Z;  2WLJ A;  3C3S A;  2ZNJ A;  5LA6 B;  3G71 V;  1Q3E A;  2NNU A;  3UQ8 A;  1WN7 A;  4YJ3 B;  1M9N A;  4NXM B;  2VQF B;  4JF3 A;  4YY3 O;  3E86 A;  1Y4M A;  1LNQ A;  1IUR A;  1VQ8 V;  1NZ6 A;  2VRZ A;  1JX9 A;  5HFL A;  1H8E G;  2Q68 A;  2ITC C;  2Q0A A;  3M8A A;  3CCM V;  3B77 A;  3A0B Z;  1XMO B;  3HKD A;  1NR1 A;  4DRX B;  4DUY B;  1JJO A;  1DTO A;  3OUF A;  2Z5U A;  2YC0 A;  4J11 A;  5TIS Z;  4X1I A;  3CC2 V;  1OCZ B;  2DWD C;  4QJF B;  5B66 Z;  3H01 A;  2UUB B;  2UXB O;  1XOU A;  2AHY A;  1M5I A;  1S3J A;  2UXX A;  4X8A A;  2QM4 A;  3PJS K;  4K8Z A;  2HHH B;  2R72 A;  3TGU H;  3ZMZ A;  4K8X A;  1R6N A;  4X64 B;  5LXT A;  4J9Z B;  5LP6 B;  1FXK B;  2F66 C;  3RYF B;  4LFC O;  3JCZ A;  5KX5 B;  1B06 A;  2CGN A;  3KCX A;  3LNN A;  1P84 F;  5GTI Z;  3KCY A;  3IFX A;  3CC7 V;  3CHX A;  2HR3 A;  4YY3 B;  4JI7 O;  2Q7G A;  1IBK O;  5IDJ A;  5EBW C;  3RYI A;  1WNS A;  3BHP A;  1KU9 A;  1J5E O;  2QA4 V;  1OCR B;  1SQF A;  4DV0 B;  3DXR A;  2QJ1 A;  4NB5 A;  5GW7 A;  4PDL A;  5FPO A;  1H2G A;  3QO8 A;  1YVW A;  1QU7 A;  5KHH A;  4X20 B;  3ASN C;  2Q5Z A;  1SS3 A;  1FKA O;  2WA3 A;  1IX9 A;  2LGQ A;  5L3D A;  5KHK A;  3OTO O;  3ZCC A;  1NT2 B;  5LGT A;  2EIL B;  3ZBH A;  1AR5 A;  4QE9 A;  2OWO A;  4QPK A;  2UXB B;  3DTU B;  2NR5 A;  3APO A;  4MVQ A;  3C3T A;  2YSU B;  2YXH A;  4LNU A;  4OGQ B;  2UUC O;  4IIJ B;  4J7J A;  3BAB A;  3T4D A;  1XNQ O;  2P06 A;  2WLI B;  3SJB C;  2EBO A;  5LHH A;  5EIB D;  4LFC B;  1BMF G;  4O4H A;  3E8F A;  3H1I H;  1XDC A;  4TV8 B;  1DK1 A;  2PYL A;  1ZTE A;  2BSK B;  2AW9 A;  5L3C A;  2OIE A;  1GRJ A;  5BMV A;  1IBK B;  1JJ2 U;  3HB3 B;  5B1N A;  4MS2 A;  3O9O A;  3QO7 A;  4X62 O;  1XHZ A;  4J10 A;  3RBZ A;  1HNZ O;  2HLD G;  4B7E A;  1W0J G;  3AG1 B;  1VQ6 V;  1P4R A;  4D7T A;  5C8Y A;  3FD9 A;  1WP8 A;  3F5T A;  3CJH B;  4R50 A;  3CRM A;  3OGI B;  3RW0 A;  4LCU C;  4NTW A;  1UFI A;  3LSU A;  3A8T A;  3UT5 A;  4ZI7 A;  1GN6 A;  3OTO B;  1YF2 A;  4DR4 O;  2RJZ A;  5A2Q N;  1Q6H A;  5EC2 C;  5JVD A;  4OPA A;  1XIL A;  3JAL B;  4J80 A;  1PNL A;  4TV9 B;  4JAU A;  4QPJ A;  1GM9 A;  3CCU V;  3IC9 A;  5KHI A;  3NR7 A;  2CTQ A;  3W7W A;  3SYC A;  3D3Q A;  3UO3 A;  2KB1 A;  2UUC B;  1XNQ B;  4X9Q A;  3JYC A;  2H94 A;  2ZXW B;  4KUM A;  1S76 D;  3K5L A;  1D5A A;  4I0X B;  3H9V A;  2XAF A;  2UXD O;  1AP5 A;  2WSS G;  1R1B A;  1QCE A;  3GWO A;  1Y66 A;  1KC8 W;  1X4T A;  2F93 B;  4DR1 O;  3UO2 A;  5IYD O;  4P30 A;  4I50 A;  3ZRW B;  4X62 B;  3D8C A;  5KA5 A;  2Y0I A;  1SC5 B;  1MG1 A;  2PUS A;  1PNK A;  2ARH A;  3LSS A;  3R66 A;  2WWW A;  4GKJ O;  5IJ0 B;  3GWK C;  1SRY A;  3EXA A;  3L71 H;  1BT8 A;  4QE7 A;  3AG7 A;  4WFF A;  2XHB A;  1SER A;  4YJ3 A;  2XAQ A;  2F23 A;  5KHG A;  2GBO A;  4TOI A;  2QM8 A; 
#chains in the Genus database with same CATH homology
 2X6B A;  3K04 A;  2EJR A;  1K8A W;  4GT1 A;  2P67 A;  1KQS U;  1SES A;  2EIN C;  1XL4 A;  5DM6 V;  1NH2 D;  2C2A A;  3ABL B;  1VQ5 V;  3A0R A;  2W6I G;  2ZR2 A;  4BIZ A;  1IXM A;  2OCC C;  3SYP A;  1G8M A;  4G27 B;  2Q6A A;  3CCQ V;  1K73 W;  4EKW A;  3ZN1 A;  3AG4 C;  1S77 D;  4WFB V;  1K5S A;  3X2Q C;  4WF9 V;  3OEE G;  3F7Y C;  4BAY A;  1OCZ C;  2IJH A;  1GO3 F;  5EBM C;  4ZBM A;  5L3B A;  1KKD A;  3CP1 A;  2QE7 G;  5LGN A;  4TT3 G;  1NQT A;  2QTO A;  3OR7 C;  3OUS A;  1TUE B;  2EIJ B;  3K79 A;  2OTJ V;  1M57 B;  2WLL B;  2X0L A;  5KA6 A;  4F4L A;  3ABK B;  4I5S A;  5HFM A;  1OCO C;  1VQK V;  4GX1 A;  1K9M W;  5CA3 A;  1AI6 A;  4ASU G;  1FXK C;  1AJN A;  1ORQ C;  3R65 A;  2HVJ C;  1OHH G;  3IGA C;  2DW4 A;  3VOU A;  1N8R W;  4WFG A;  1V55 C;  4RAI A;  1QLN A;  2DQ0 A;  1NR7 A;  1FXK A;  2IJJ A;  1AR1 B;  4JAV A;  2OTL V;  1E79 G;  4DO2 A;  1NVP D;  3BY6 A;  3ZJZ A;  2BOB C;  3ABM B;  3JD2 A;  2NLJ C;  1YJN V;  2IU3 A;  3SJQ C;  1FXH A;  1RPO A;  4MTO A;  2LFS A;  3G6E V;  1BHB A;  1YHQ V;  4UV9 A;  5KUM A;  1THZ A;  4UVB A;  4CBC A;  3WG7 C;  4XBF A;  1K92 A;  4KP4 A;  1OZ0 A;  2Q67 A;  4XDL A;  1L1F A;  5L3E A;  2DYS B;  3K9A A;  3F7V C;  3CPW U;  3LDD A;  4MTX A;  4P9P A;  2JJ2 G;  1F51 A;  3ZMS A;  3UKM A;  1K4C C;  3MHH C;  3P32 A;  3OMA B;  2ITD C;  4E2L A;  2XND G;  4G28 B;  1Q81 W;  3QNE A;  2ZR3 A;  1M56 B;  3ZMT A;  4LC1 A;  3EFF K;  3SYO A;  1UJW B;  4QNH B;  4HAM A;  1M1K W;  1GMG A;  3LUT B;  4PDM A;  5B1A C;  4YXW G;  5B1O A;  3KG2 A;  3SPH A;  3ABL C;  2Y48 A;  1OCC B;  5KUK A;  3QO5 A;  2D3O W;  1NVP B;  2M7W A;  3CME V;  1KD1 W;  5L3G A;  2YEV A;  3LDE A;  3LNM B;  1NJI W;  1ARO P;  2ATK C;  2V7Q G;  1Q7Y W;  4J9Y B;  1AI4 A;  3ASO B;  4MVZ A;  3SYQ A;  2XAG A;  1BHA A;  3OMI B;  1PD3 A;  4FMT A;  2Z3Y A;  1PL0 A;  2PI4 A;  3CXC U;  3GB7 C;  3CMA V;  3E2E A;  1H38 A;  2MK3 A;  4FPP A;  2B1G A;  2HVK C;  2GSM B;  2WLI A;  3G4S V;  5C93 A;  1YJW V;  1H8H G;  3LSQ A;  1S0V A;  1WLE A;  2BOC C;  4GX0 A;  3ABT A;  2EIJ C;  4P9O A;  1M57 C;  5B3S B;  2JK5 C;  2Y69 C;  1AJP A;  2XAJ A;  3ML0 A;  4MVR A;  1BL8 A;  3CCL V;  2PI5 A;  4FIP C;  3ABK C;  2DQ3 A;  1CP9 A;  3T1C A;  5E1A C;  3FB8 C;  2LFR A;  2XOK G;  3CD6 V;  1B6Q A;  3E83 A;  1YTF D;  3TET A;  1QVF U;  3AG1 C;  5L3F A;  3ZIA G;  3ZRX A;  1V54 B;  2B5U A;  2A9H A;  5IYB O;  2EIK C;  4UUJ C;  5LGU A;  3FB5 C;  4MVU A;  3F5W C;  3B8M A;  3FYI B;  3AG3 B;  1WPX A;  1YJ9 V;  4G2K A;  1HWY A;  3AEI A;  1P7B A;  3AG2 B;  4R6Z A;  3MD0 A;  4P2Z A;  2YEV B;  4GCZ A;  1AJQ A;  2WLN A;  4TSF G;  3ABM C;  4UVC A;  2P90 A;  5IYC O;  1YSC A;  4R7C A;  3OFN G;  2R9I A;  4N21 A;  2IU0 A;  2Q69 A;  2EIM B;  3E89 A;  2WLJ A;  4UVA A;  3G71 V;  3ZRV A;  3TCU A;  1VQO V;  2NNU A;  1EFR G;  1M9N A;  2R9R B;  1M90 W;  1QLE B;  2V1D A;  3K0G A;  4XDK A;  2DYS C;  4JF3 A;  3E86 A;  2HJF C;  1Y4M A;  1LNQ A;  3ASN B;  2ZXW C;  1VQ8 V;  1RM1 B;  1JX9 A;  4GX5 A;  1NH2 B;  2A0L A;  3SPG A;  1AI5 A;  3FKS G;  5HFL A;  1H8E G;  2Q68 A;  2ITC C;  3W7X A;  3W7U A;  3CCM V;  2WAM A;  1M56 C;  4WFE A;  3B77 A;  4MVS A;  3SYA A;  3STL C;  2P6J A;  5DN6 G;  5EK0 A;  1NR1 A;  4WCE V;  1VQL V;  1OCC C;  1DTO A;  2HFE C;  1SZT A;  2QEX V;  1FXV A;  4LP8 A;  3OUF A;  3ETD A;  4LBE C;  2Z5U A;  4DXW A;  3OW2 U;  2FTK A;  2OT5 A;  1VQ4 V;  4UV8 A;  2IW5 A;  3X2Q B;  3CC2 V;  1OCZ B;  2IH1 C;  3FYE B;  1MSW D;  2DWD C;  4QJF B;  3JD1 A;  3ZRW A;  4JYC A;  1K4D C;  3H01 A;  1CEZ A;  1PKX A;  2AHY A;  2QKS A;  2WLM A;  2W0F C;  1S3J A;  2UXX A;  4X8A A;  1F4N A;  1JCH A;  3K03 A;  3PJS K;  2JEU A;  1GK9 A;  3OGC C;  1GTO A;  1K33 A;  2ZDI C;  2JDI G;  3ZMZ A;  1R6N A;  2HG5 C;  1S5H C;  2LP7 A;  4J9Z B;  1NBM G;  4PA4 A;  1FXK B;  3CCV V;  1VQP V;  4UXN A;  1ROP A;  4PA3 A;  3JCZ A;  3W7S A;  5EBL C;  4Z1M G;  1V54 C;  1J95 A;  3K08 A;  4JTD B;  1E1R G;  4PDV A;  3K0D A;  1VQN V;  3IC7 A;  4BW5 A;  3IFX A;  3CC7 V;  4MVO A;  1K97 A;  2HR3 A;  3BEH A;  4PA6 A;  5IDJ A;  5EBW C;  1PNM A;  2H8P C;  3D36 A;  2JIZ G;  1R73 A;  4H37 A;  3SPI A;  2QA4 V;  3EHB B;  1OCR B;  5H6R A;  3E8H A;  2A79 B;  3SPJ A;  4GX2 A;  5GW7 A;  3K3W A;  4PDL A;  1QLE C;  1H2G A;  1AI7 A;  3QO8 A;  2WLL A;  1DLB A;  4RQE A;  1MOF A;  3ASN C;  3ZMV A;  3OR6 C;  3OM3 B;  4N23 A;  4BIU A;  5CBH A;  3W7T A;  1RM1 C;  5L3D A;  3CC4 V;  1KP2 A;  3JD4 A;  2DYR B;  1GM8 A;  3ZCC A;  5BZB A;  5LGT A;  2X7R B;  2EIL B;  5IY5 B;  4TWK A;  3E35 A;  4QE9 A;  1F23 A;  4QPK A;  4X89 A;  3TK1 A;  2K1E A;  3DTU B;  1JPX A;  4Q20 A;  1R3J C;  4RQF A;  1K3E A;  3DGE A;  4MTG A;  3M99 B;  4MVQ A;  4QIW F;  5B1A B;  5H6Q A;  3STZ C;  4R8C A;  3I56 V;  2W6J G;  1QBZ A;  2YSU B;  5CMU A;  1ENV A;  1KEC A;  4PDR A;  3HPL C;  4JGS A;  3RVY A;  3CCR V;  3T4D A;  5B1B B;  1R3I C;  2WLI B;  2EBO A;  5LHH A;  3T2M A;  1BMF G;  3UM7 A;  4X88 A;  3E8F A;  5J9P C;  2CK3 G;  1F4M A;  3ETE A;  3E8G A;  1K7D A;  3RVZ A;  3T4Z A;  4PA7 A;  4H33 A;  3SPC A;  4U7O A;  5L3C A;  1VQ9 V;  4U7N A;  2IH3 C;  5CN0 A;  1JJ2 U;  1YTF B;  2Y69 B;  3HB3 B;  4PA9 A;  5B1N A;  2F43 G;  4MS2 A;  3VBB A;  3QO7 A;  1EBO A;  2IJK A;  4JPR A;  5FL7 G;  5LBQ A;  3RBZ A;  2EIN B;  3WFV A;  1NKD A;  4PEL A;  3MHS C;  2EZO A;  4MTF A;  2HLD G;  2WPD G;  5CBF A;  5LHG A;  1W0J G;  2DWE C;  1YIJ V;  3AG1 B;  3P30 A;  3ABU A;  4I9W A;  1P4R A;  1VQ6 V;  2OCC B;  2AHZ A;  1JOY A;  1KP3 A;  1DF5 A;  2EIK B;  4FJC C;  1W2B U;  1JQ0 A;  3ETG A;  3AG4 B;  4R50 A;  3D3I A;  4JAS A;  3RW0 A;  2IJI A;  2ZQM A;  1GKF A;  2QM7 A;  3ASO C;  4L87 A;  4LCU C;  4XDJ A;  1CPY A;  4RO2 A;  2HKO A;  3CYO A;  1JVM A;  3JD0 A;  1I5X A;  1FFT B;  4MW3 A;  1YI2 V;  3CCJ V;  4MT8 A;  2XAH A;  2X6A A;  4JYB A;  1Q82 W;  2GHY A;  5EC2 C;  4ZKI A;  1QR8 A;  1OCR C;  1PNL A;  3JD3 A;  4OXS A;  5B3S C;  4WFH A;  2WLK A;  4JAU A;  4QPJ A;  1GM9 A;  3CCU V;  1I5Y A;  1K34 A;  1OCO B;  5EC1 C;  1S72 V;  2ZD9 A;  3W7W A;  1XL6 A;  3SYC A;  3OEH G;  3OAA G;  4CZZ A;  2XAS A;  2KB1 A;  2WLH A;  1RPR A;  3FB7 C;  1FS0 G;  1Q86 W;  1V55 B;  2B1I A;  2JJ1 G;  2H94 A;  3JYC A;  2ZDI A;  1ZWI C;  2ZXW B;  4FK5 C;  4KUM A;  4RUE A;  1S76 D;  3K06 A;  3CCE V;  3I55 V;  2DYR C;  3AG3 C;  3OMN B;  1VQ7 V;  2XAF A;  2EIL C;  1E1Q G;  4KFM A;  4MSW C;  5IY5 C;  3AG2 C;  1R6K A;  3E8B A;  1R3L C;  2WSS G;  1COW G;  2P7T C;  1QCE A;  1QVG U;  4JTC B;  3GWO A;  1Y66 A;  4HZ3 A;  1KC8 W;  3ZRS A;  3FB6 C;  3NXS A;  4HYO A;  4MW8 A;  1EZJ A;  5IYD O;  2EIM C;  4P30 A;  3LDC A;  1QR9 A;  3B8N A;  2EZP A;  3ZRW B;  4JTA B;  5B1B C;  5H9C A;  5KA5 A;  3WG7 B;  1MG1 A;  2JEX A;  1PNK A;  1SET A;  1R3K C;  3LSS A;  1VQM V;  2WWW A;  5LHI A;  4MVM A;  1K5Q A;  3OE7 G;  2X6C A;  1SRY A;  4QE7 A;  4WFF A;  1SER A;  2XAQ A;  3CCS V;  2UXN A;  1GM7 A;  4RUF A;  1YIT V;  3ZMU A;  1G4Y B;  1MAB G;  3ZN0 A;  5CBG A;  1W0K G;  1DF4 A;  4WFA V;  2QM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...