1BHBA

Three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
67
Chain Sequence
AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIORHODOPSIN
publication title Three-dimensional structure of (1-71)bacterioopsin solubilized in methanol/chloroform and SDS micelles determined by 15N-1H heteronuclear NMR spectroscopy.
pubmed doi rcsb
source organism Halobacterium salinarum
molecule tags Photoreceptor
total genus 21
structure length 67
sequence length 69
ec nomenclature
pdb deposition date 1993-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.170 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bhbA00
1BHBA 1BHAA
chains in the Genus database with same CATH superfamily
3N2GA 1WPXA 5JWPA 4YIOA 5IY5B 1DF5A 1AR4A 2WLMA 3T1YB 3JD3A 3ASOB 1S76D 1LUVA 4W4LA 3M8AA 3HB3B 3TK1A 2ODMA 5A9GA 3K79A 2D3OW 3BA8A 2PY5A 5GTIZ 2BSKB 2UXBB 3SPGA 4DR7O 1QLNA 2KKWA 1XDCA 1VQ5V 4TV9B 3CSXA 3TJTA 2NR5A 3L75H 2PZSA 3FAVB 5IJ0B 4K3AA 4AHCA 3CCEV 2EIKB 4PHZA 2MK3A 3OTOO 4HNAB 4J9YB 4X1KA 4WFEA 1GN4A 3BCCH 5KHGA 4DR2B 2GV9A 1PNMA 1ZTEA 1YF2A 4JF3A 4DK1A 4DV5B 3WG7B 2QM8A 1I08A 5EIBD 4RO2A 2E74B 4KXRA 4C7UA 4IGGA 5LHGA 5LXTB 5HFMA 1X59A 5GTHZ 1EM1A 4JI7O 3OAAG 3KKYA 1RPOA 1VF6A 4UVBA 4JAVA 4DO2A 4YHHB 2X6BA 2DMXA 2AW9A 4LCUC 1S3JA 2OCCC 2V7QG 5L3DA 5ITZA 2LW1A 5LMUB 2E5LB 3DSQA 4JI2O 3VBBA 3ZRVA 1JFFB 2WLKA 1WPBA 1PPJH 1YEWA 3WB1A 4B3TO 1H38A 4MVOA 3R65A 3U0ZA 1JQ0A 2UU9B 3N2GB 2GBOA 1Y66A 3SPHA 1I0HA 3ASNB 2R9RB 1HNWB 4MW8A 2EIMB 5LYJA 1VQ6V 1CXZB 4FFKA 3JAKA 4GX0A 4LFBB 2E75B 4JV5B 1THZA 1CPYA 3OR6C 4JI3O 5EK0A 3KCYA 2XAHA 2BCCH 3K57A 1GRJA 4JI1B 2LGQA 1ZWIC 1W0KG 3UKMA 1WP8A 4PELA 4JZGA 4PA7A 1JX9A 4X1KB 4ZBMA 1R3KC 1MOFA 1M57B 2N04A 3QO5A 2YXLA 4QE9A 1WLEA 1MSDA 4F6RA 2JVDA 1D2DA 3RFRA 4K8XA 3BHPA 1K7DA 2ZE5A 1XBLA 1Y74A 4PDRA 3ZHUA 1VQ7V 1G4YB 2ADPA 2HG5C 1YJ9V 2FTKA 3OM3B 3MAQA 3TCUA 2DWDC 3ZS8C 1IXBA 5B3SB 3CCVV 4GKKB 4D7TA 2X6CA 3WFVA 1R73A 5ITZB 1XMOO 4X8AA 2XNDG 2WPDG 3L70H 3B2EE 4FFBA 5H2FZ 3K06A 4O4IA 5KHIA 2F1MA 1PM9A 1JJOA 4MVSA 2BTOA 3IAYA 3JAKB 3JD2A 1AR5A 4OPAA 2UUAO 4O4HA 1COWG 4DR3B 2M6YA 2ARHA 3EHBB 5B1AC 2WLIA 1OCZB 1VQKV 3TGUH 5EZYA 1JR9A 1NZ6A 2Z3YA 1HNZB 2JGUA 1SQXH 4KHPO 4LWSA 4P2ZA 3A0HZ 3K5MA 3HKEA 1XUQA 4WFHA 2ADQB 5KX5A 4Q20A 3APOA 2JS3A 5IY5C 3E8BA 1H2GA 2D2CB 4X89A 3ETDA 2QKSA 1NTMH 4F6RB 3D3IA 3FYIB 1B3QA 3ASOC 2E3CA 4G28B 4FPPA 1UPGA 4O2BB 2Z0AA 2UXDB 2VRZA 1Y74B 4O2AA 1WA8A 2YIAA 3IC9A 5IJ9A 5D5PA 4FLUA 4AILC 1SERA 4TOIA 1UFIA 3G6EV 2EIKC 4KL1A 3ZMVA 2JEXA 3L73H 2Q0OC 3P30A 1OJHA 4FIPC 4B3RB 1NS1A 5E79Z 4A5UB 4FFBB 3TXQA 4JYAB 3I56V 2Q5ZA 2Y4UA 2YS8A 3JSLA 1PNKA 4W4KA 1L0NH 1QLEB 2GSMB 5B1BC 3SDLA 2LFSA 3G6BA 3QVNA 4K0KB 4Z2WA 4O4HB 2X6AA 5K1PA 3CRQA 4DR1O 1NTKH 3K9SA 2P4VA 4WFAV 2WLIB 1SZXA 3HKDA 2XOKG 4ICGA 1S72V 2UUCO 1Z2GA 4MTOA 4RAIA 4U7OA 2A9HA 3LNNA 1E1RG 1RM1B 4IL6Z 1G1XB 4LFCB 4LWSB 2HVJC 4IYIA 3HKEB 4KP4A 2WSSG 2Y0IA 3ZMTA 5KX5B 1VQ4V 3ASNC 2HP8A 3C3TA 4GKJO 4DV7B 2IU3A 1KU9A 1SQPH 4B7KA 4Z1MG 4LF4O 2F4VB 4DR4B 4PA3A 3ABTA 3ZRSA 1WA8B 1JVMA 1SS3A 1AB3A 2CK3G 1R3LC 5KUMA 2QKCA 3SJAC 2QDOA 1KYOF 2JGDA 1P7GA 5IJ9B 1JOYA 1LUWA 4I9WA 2YSUB 4N21A 3OUSA 4CH4A 2UUBO 4FLZA 3G67A 4NXMB 1S5JA 4BR6A 3L72H 1M57C 4U3FH 4DW0A 5IT9N 4JASA 1XL4A 5LBQA 1WB8A 2IU0A 2QKAA 1GAXA 3CMEV 4DUZB 3WB0A 2VQFO 1V54C 4CZZA 4DV4B 2QM7A 1QBZA 3Q4HA 1N34B 1XHZA 5EC2C 4DV3O 1S5LZ 2XUMA 2YXHA 5LGNA 3W7WA 4UCVA 3K5LA 3K0DA 3JARA 1YDXA 1AJQA 2H8PC 5EIBC 1VF6C 2JJ2G 2HR3A 4PI2A 5B3SC 1YZBA 2WLHA 4TQDA 3E8FA 4FM1A 1NU1H 4B3SB 3SYOA 4LF7O 3HKDB 5KHJA 4E2LA 4LH6A 4B3MO 1XMQB 2CTRA 2BTQA 3CWBH 1H2KA 3ZHTA 1XQ8A 3CEIA 4MW3A 1XNQO 4H13B 4JYCA 4TSFG 4EFBA 1L0LH 3GWOA 1SQQH 4B7EA 3ABMC 2DYSB 4H44B 2AZ0A 3O9OA 1K4CC 5BR8O 1Q6IA 2PYJA 4JPRA 2P4KA 1BQZA 2EINB 4JI5O 2LO1A 4BAYA 5EBLC 4PV1B 2QGNA 2JGDB 3OTOB 1YI2V 1R3IC 2RJZA 1A32A 1OCZC 4J80A 2PGGA 1I5YA 1Y4MA 3ZMUA 2VS0A 5FPRA 3ZBHA 2QEXV 1FS0G 2ZNIA 3BRCA 3APQA 1AI4A 5CBHA 5IWAO 3AEIA 5H6QA 1K8AW 1E79G 2NN4A 2PF4E 1EBOA 4QIWF 3FKSG 2FYUH 2DQ0A 2HJDA 3Q4HB 4LNUA 2ZIOA 1F23A 3U10A 1KUQA 4L8JA 4HBNA 3MD0A 2Q4PA 2ZT9B 4DUYB 4RUEA 4QGPA 4XDLA 4JI2B 4DR5O 1HNXB 1VQMV 1AP6A 1JJ2U 4H33A 2PI5A 1CP9A 5EBWC 1BS3A 2XAQA 1AJNA 5CB4A 2BTQB 4IIJA 3A2FA 2CDYA 3CX5F 4NXNO 4R7CA 3H1KH 1MMMA 5IE9A 1Q6UA 3VQXA 3ZX6A 1NKDA 4JI3B 4L87A 3ZJZA 5D5QA 4LF8B 2RCVA 1QLEC 2CH7A 4H37A 3OMNB 1AI7A 1FFTB 1OV9A 4RUFA 4XDJA 1U97A 2EIJB 1HW7A 5B1NA 4WFFA 1IBMB 1K4DC 4AI8A 2W0XA 3L74H 2EZOA 3ZMSA 3STZC 5J2TA 2XAJA 1RM1C 3K5OA 1WAZA 1L1FA 4JI4O 4J41A 3K3WA 5LHHA 2GTSA 1CEZA 4R8CA 2OWOA 2FMLA 3SGIA 4LF9O 4PDVA 4KUMA 1BGYH 1ZAUA 2ZDIA 4LR3A 2ZNJA 1RSOA 2JK5C 1B04A 1U96A 3CCMV 1K3EA 1PV0A 3N2KA 3U11A 3W7SA 3FFQA 4IT5A 2CE4A 1YHQV 1GK9A 4LF6B 3CPWU 4DXWA 4EKWA 4CS3A 5LL6Y 4MTXA 4HYOA 2LP7A 1R3JC 3HR0A 5CB4B 4IIJB 2QWOB 2JDIG 2UXCO 4F6EA 3ZRXA 4YJ3A 4X64B 1BL8A 1XOUA 4Q6GA 1H2SB 3G80A 1JPXA 3T1HO 1KBHA 1IXMA 3QF7A 4TV8A 1QR9A 5KHKA 2CH7B 4ZKIA 3L9DA 1NR1A 2AHZA 2NLJC 1UJWB 3RT3C 4DW1A 4GYCB 4DV1O 4FM0A 1D5NA 4DR6O 4FJCC 1XHXA 2ZR3A 4X66O 1SQVH 2HLDG 4I4TA 4I9QA 5J2TB 1R6NA 1Q5OA 3AG2B 1Q90D 1N32O 2Q7GA 1I94O 3LSSA 3QNEA 4IHJA 5FPOA 2P5OA 3RYCA 1FXKA 1N33B 4JI8B 2DYSC 2X7RB 3H1JH 4U7NA 1IURA 5IDJA 3JASA 1ZL8A 4UVCA 2IH3C 3E8HA 1VQPV 1HR0B 2HHHB 2DWEC 2EINC 4UV9A 1GN2A 2EBOA 1DLBA 3AG4B 2XTAA 1RSOB 2A06H 5DECA 4P9PA 2CTQA 5LMNB 3N2KB 5FNVA 2ZM6O 4LF5O 4DV2B 2B9ZA 3QO8A 4I55A 1PL0A 5JVDA 4DV6O 3W7XA 1NR7A 5JJNB 1IVSA 2E76B 4OXSA 3HKBA 1K97A 2HKOA 1FJGB 2VQEO 2MW2B 3AG3B 1TGOA 1E1QG 4PDLA 1NQTA 2HJFC 4YY3O 5CMUA 2ATKC 4YJ3B 3QG5A 1YCIA 3SYQA 1XNRO 1EFRG 5HFLA 4TV8B 3C3SA 5C8YA 4X62B 3T1YO 4FK5C 3GVMA 2JEUA 5TISZ 2ZR2A 2AGAA 5DEDA 2VWJA 2H94A 3X2QB 1R1BA 2UXBO 4UCTA 1AILA 3J81N 4GX1A 4GZRB 1GO3F 3SYCA 3DC6A 2QWQB 1YJWV 3P3PA 3CCUV 4I4TB 4QNHB 2LJ2A 5B66Z 1FXHA 2X0LA 1JCHA 2OYQA 5LYJB 1DTOA 1V55B 1RPRA 2Y69B 1FXKB 1RP3B 2V1DA 3T2MA 4DR2O 3FB8C 3JASB 1ZL8B 4DV5O 3H1IH 4OX9B 2GDSA 3S3WA 2Y48A 5B1OA 2EIJC 1OZ0A 5CBGA 2GUZA 4G2KA 3CHXA 1EZJA 1BQ0A 4J7ZA 5FNVB 1IBKO 3ABUA 4HAMA 1F51A 4I55B 4QPJA 5JVDB 4YHHO 3HKBB 5LMUO 2E5LO 4WFGA 2P22C 1AI6A 2ITDC 1QNMA 4GX2A 1NJIW 1KECA 3SJQC 3THOA 2ZIMA 5C8YB 1Q82W 1HNWO 3D36A 1S5HC 4EEQA 3MHSC 2A79B 1OCOB 3BPZA 1M9NA 2XASA 3ETGA 1SRYA 3F5TA 1GM9A 4I0XA 4AQYB 3ABLB 1BHBA 1VQ9V 4K35A 3WG7C 4O4IB 4CH6A 1H2NA 3NXSA 3FB5C 4JI1O 4QE7A 2N05A 2QWRB 2VWKA 1F4NA 3IC7A 5FLXN 4JI5B 1SQFA 4YIPA 2EX3A 3MHHC 4JZ2A 1TUEB 5CN0A 1Q3EA 1O9HA 3JATA 4JI6B 3CCSV 3RYFA 3UO3A 1YSCA 1Z5VA 1FXVA 4UB8Z 4CS4A 5BZBA 3E83A 1TAEA 5BXZA 2P06A 1YXBA 3I5DA 1J5EO 2QWNB 2GUZB 5EZYB 1BHAA 1K92A 2EJ7A 3FD9A 3RBZA 5BMVA 1T5EA 3AG2C 3S3XA 4GKKO 1N4CA 3OTFA 5L3FA 2EIMC 4ASUG 2R9AA 3PN1A 2ITCC 3R66A 4PA4A 2JJ1G 2EJRA 3ZCCA 4O2AB 3F7YC 3JAWA 2Q68A 2CTPA 2YXYA 4DR5B 2ZDIC 3EXAA 3K59A 2BE3A 3AG4C 3H1LH 2QA4V 3W7TA 2FB5A 3CMAV 4JI0B 1AI5A 1QCEA 3G71V 3STLC 3ZRWA 5EBMC 1G8MA 1W2BU 5GW7A 2KG7A 1XI1A 2DN9A 3A0RA 1TVKA 1SZTA 2W0FC 1WN7A 4DR3O 1HWYA 4I0XB 3WU2Z 1K33A 3NR7A 4NXNB 4D7SA 2YIBD 1W59A 4FM2A 4DV0B 3AG3C 4OPHA 1Q6HA 4LFAB 2XAGA 4MTFA 4NYKA 3BFRA 2CAZC 3OFNG 4MVQA 1PL4A 3ETQA 4O4LA 3CE2A 1KP3A 2YIBA 3UCSC 3AK1A 4JYYA 2IBZH 4MSWC 2OIEA 3JATB 1EN6A 4FLXA 3RWRD 3RYFB 2V4DA 3LNMB 4B08A 1SKVA 1SA0A 1NTZH 2DYRB 3X2QC 1NVPD 3RGBA 2UXDO 1GTOA 1SQGA 4LC1A 2A7WA 5J9PC 4JI4B 5BMVB 1FKAO 2RN9A 5KA6A 2LQTA 2RDCA 2K9PA 1GMGA 2QM4A 4DR7B 1V55C 4UCOA 1W0JG 2Y69C 3SJBC 1FXKC 3K9AA 4B3RO 3BA9A 3VQWA 2WA3A 3E89A 3JAWB 2QR4A 3K0GA 1M56B 3VQYA 4UCSA 3DXRA 3B09A 4JYAO 2LGWA 5AG2A 1BSMA 1R6TA 4UFZA 3CRRA 1KQSU 1D5AA 5DN6G 2OCHA 3JYCA 3ZRWB 5A2QN 2KG7B 3F5WC 4PA6A 1DK1A 1TVKB 4K0KO 4GCZA 2RMKB 4CC6A 3OMIB 4J7JA 1EN4A 3I55V 2UXCB 2G38A 2HEPA 2YIDA 3A8TA 1GN6A 1G6UA 4HZ3A 5H9CA 5GONA 4WBNA 3CC7V 4JI7B 3LUTB 3T1HB 2F43G 1N0JA 1F7YA 1ZX3A 1EZVH 3ABKB 4BIOA 3MDSA 3C90A 3PJSK 1ZSPA 1VF5B 3HKCA 5K1XA 4LFCO 4O4LB 1KKDA 4NTWA 5C93A 1YVWA 2F95B 1I7FA 4J7KA 3JARB 3JCUZ 4DRXA 2P90A 1IBLO 2DW4A 1NH2D 4B3TB 2AZ2A 4DR4O 2UXNA 1US6A 1SA0B 5KAIZ 3IFXA 2CGNA 1Q86W 5LOVA 4X65O 2Y0PA 4CC5A 4OGQB 1I94B 3ABLC 1SETA 3D8CA 3K5NA 4KFMA 3OGCC 3D3QA 1NVPB 3OT7A 5JCOA 3JD1A 3SPIA 2PI4A 2P6JA 2HVKC 3T1CA 3DC5A 4PDMA 3E35A 4JAAA 1K9MW 5LHIA 1N36O 4MVUA 3DXRB 4DUZO 2HFEC 3UQ8A 1MZFA 4ZHQA 5CBFA 2ZM6B 4DV4O 2AXTZ 1V9PA 1N34O 4XBFA 4DV6B 1K34A 4JYBA 3WB2A 4P30A 3J7AU 2B1IA 1HDJA 1ENVA 3ZN1A 3QTCA 2QJ1A 3LSUA 2Z5UA 1M1KW 4JAUA 4B3SO 2KB1A 3CYOA 1QR8A 1GH6A 1VF7A 5GONB 4WBNB 3LDEA 4UXNA 4LNUB 1XMQO 5IYZA 2P67A 3ML0A 1F4MA 3HKCB 4I7ZB 3JAMN 2YEVA 3ZHSA 3JD4A 3J80N 1WJZA 4PA9A 3DTUB 1XMOB 3JD0A 2K1EA 1M4UA 4RWUA 4JTDB 4DRXB 3JSNA 3CB2A 3D36C 1JA8A 2FKXA 2A3QA 2EULA 4X1YA 2JS5A 1GKFA 5IYDO 2O57A 5LOVB 2ZKOA 3G4SV 1MNGA 4NR1A 3FYEB 1K5SA 1NH2B 5KA5A 2CUGA 2UUAB 4IYHA 3F7VC 4FMTA 5KLVH 2DQ3A 3CXCU 2CTWA 2RQ6A 4MVZA 2ZXWB 4E4EA 2PUSA 3A0BZ 1VP7A 1S0VA 3H9VA 1SQBH 4NVPA 1NI8A 4QJFB 1VIBA 4KHPB 3EVKA 5B1BB 1IBKB 1OCCB 4ZHQB 2DYRC 1SF9A 3TETA 3ZIAG 1GM8A 3GB7C 4TUYA 1KB9F 4CH5A 4PD4F 1P7BA 3H01A 4DUYO 4CBCA 2KQXA 5KUKA 1B6QA 1HNXO 2W6IG 4EB6A 1RFYA 4BW5A 1KC8W 1BE3H 1XREA 3OEHG 2PYLA 1KMIZ 4TQFA 4CH3A 1Q8IA 3M7MX 3CXHF 3O65A 5IYCO 3UT5A 3B8NA 4N23A 4X20A 1Y6XA 4FVMA 5IYZB 1M56C 1Q43A 3CJHA 2YEVB 1H8EG 4J10A 3BABA 3BVOA 3DGEA 2L6LA 2OIGA 2R9IA 3FX7A 1OCRB 3BY6A 5B5EZ 2WLNA 4LF8O 2C2AA 3B77A 1NBMG 5JQGA 5LA6A 2BOCC 3CCLV 4X1YB 1OHHG 2N74A 3KG2A 2WA4A 4YXWG 3TXSA 2F66C 2M7WA 3RVZA 1IBMO 3RYHA 3K08A 4UV8A 3K04A 2IH1C 1PNLA 1NT2B 3ABKC 5CA1A 1VQLV 3VOUA 4NTXA 4DR1B 4U3JA 4TT3G 4J9ZB 1LNQA 4DK0A 1V54B 4O2BA 3B8MA 2UUCB 2OTJV 2DJVA 1XEQA 3GWKC 1VEWA 1J5EB 4JGSA 3KCXA 4WFBV 2Q73A 5JH7A 3CRAA 1AP5A 1QVGU 1URFA 3OUFA 4RQFA 3SYPA 4TUYB 1LR1A 1HP8A 5L3BA 4GKJB 3CP1A 3AK3A 1DF4A 1Q81W 2IM9A 2YDEA 1JMKC 1Y76A 4LF4B 2Y4TA 2ZE7A 4IHJB 5L3EA 2Q69A 3RYCB 3K58A 5IYBO 4FLWA 2JRIA 1MG1A 4EB6B 4DYLA 4X1IA 3H1HH 4LF6O 3T4DA 3CCQV 3UT5B 1MZEA 1QQCA 2UUBB 4X20B 1EN5A 3ABMB 3AG7A 1QVFU 3CJHB 2IJJA 4X64O 3T4ZA 5KMGA 3SYAA 3N27A 1ZLZA 5LP6A 4UB6Z 3CRCA 3KZIZ 1ROPA 1L8DA 2DE0X 1N0NA 2VQFB 5JQGB 5LA6B 4MS2A 1Q7YW 1H8HG 2PTMA 4J42A 3RN4A 1J95A 4R50A 3ETEA 2YI9A 4DV3B 5JJJB 2OT5A 3RYHB 4X9QA 3ZN0A 1BMFG 5KHHA 4PI0A 3UM7A 3M99B 2WLLA 1YTFD 5CA1B 2UU9O 2F23A 2QSAA 2ETNA 4U3JB 5LGTA 1DGSA 4MT8A 1B06A 2GTAA 4LF7B 1Y67A 4B3MB 4JI8O 1N33O 4LFBO 2EILB 4JV5O 2A0LA 3AG1B 1WB7A 2NNUA 2BOBC 5JH7B 4QPKA 1VARA 5FL7G 1XNQB 1HR0O 2HHHO 2UXXA 2R72A 1VQ8V 2F93B 2WLJA 5EYPA 3K03A 1Y76B 4BIZA 5BR8B 5LMNO 1SC5B 2Q7HA 2W6JG 4ZOLA 4BW9A 4DV2O 1P84F 1M90W 3VQVA 5JCOC 4X1IB 1TUBA 3ZHQA 2EZPA 1K5QA 1WP7A 1GM7A 1MA1A 1FJGO 2ZXWC 4MVRA 2ZQMA 1FPOA 1I5XA 2IJIA 2P7TC 2ZE6A 1OCCC 3RW0A 4WCEV 5KMGB 1P49A 4YJ2A 5IWAB 2WAMA 4UUJC 5LP6B 5J2UA 1FD9A 1K73W 1BZKA 3P32A 4X62O 3B4SA 1FAFA 3SPJA 1BT8A 4K8ZA 4XDKA 1PP9H 1XILA 3OEEG 2YI8A 2WLLB 1IBLB 5EC1C 3CC4V 4MTGA 1H2LA 4NTYA 3ZHRA 2RNBA 2Q7EA 4LBEC 1FFXA 2OTLV 2QTOA 4LH7A 4X65B 3E8GA 1H2MA 1OCRC 3OE7G 1XL6A 3OD4A 2XHBA 1YTFB 3OR7C 1FYJA 3L71H 4OX9O 2Q67A 1KKCA 4O4JA 5EYPB 1AJPA 3ICXA 3BAAA 5JJEB 1HNZO 1Z5WA 3QO7A 3RYIA 3AK2A 2LW7A 4R6ZA 3SPCA 3UO2A 4ZOLB 2B5UA 1N36B 2LFRA 3JCZA 3W7UA 1TUBB 1VQNV 2ZD9A 1YIJV 3B40A 1IZ3A 5H5NA 4D6TH 3LDDA 5KAFZ 2Q0AA 1WNSA 2ILMA 3FB7C 1M93A 4ZI7A 3CC2V 3E22A 4YJ2B 2OCCB 3BEHA 5J2UB 4UCRA 2CGOA 4J11A 4I50A 1VMGA 1PKXA 2JIZG 3CRMA 4RQEA 4LF9B 4H0LB 5CA0A 3OW2U 3CS5A 1O9GA 4LP8A 3RVYA 2XT9A 4AQYO 2KSDA 3OMAB 3CCJV 5DM6V 3CCRV 3JALA 2IJHA 1MSWD 4JTAB 4ABMA 4WF9V 1AR1B 1IX9A 3CD6V 1FFXB 4GT1A 1KD1W 4MVMA 4JI6O 2H3OA 2ZINA 3OGIB 2QTSA 1S77D 2L35A 2B1GA 1YITV 4I5SA 1QHTA 1BCCH 3IGAC 4TWKA 3ZHVA 4EFEA 5H6RA 4O4JB 2ZE8A 4G27B 3RYIB 1KP2A 4UCUA 2R70A 3ZEDA 1M5IA 1IDSA 4BIUA 4DV1B 1AROP 2BSKA 3LSQA 1N8RW 2QWPB 4DR6B 4DV7O 4GLXA 1ORQC 4TV9A 2DOSA 3EFFK 4X66B 4PJ0Z 2Q9LA 4NKGB 4CS2A 2F4VO 3E2EA 2EILC 1OCOC 3AG1C 3FAVA 3IJ4A 1PD3A 5IJ0A 5CA3A 4UVAA 1N32B 2Q8VA 4P9OA 4ZI7B 4ZIBA 1QU7A 4HNAA 3E22B 3LDCA 2AHYA 2XAFA 5L3CA 4I50B 1ZUQA 4JI0O 2WWWA 4NXMO 1YJNV 1R6KA 3P3NA 4JTCB 4GX5A 1MABG 5BY1A 5CA0B 2YC0A 1X4TA 2IJKA 4X88A 2IW5A 4NB5A 4F4LA 1SESA 4GUNA 5LGUA 2YUAA 5LXTA 5E1AC 4FZ1A 1P4RA 1TA8A 4DV0O 3JALB 4LF5B 4LFAO 3E86A 3SJCC 2GHYA 5F2VO 1AVMA 2Q6AA 4FLTA 4FLVA 4FZ0A 3SR2C 5B1AB 4Z1VA 2VQEB 5LP6C 3HPLC 3FB6C 4YY3B 1VQOV 1JFFA 2FL4A 2QE7G 2ZCEA 3ZMZA 4FLYA 1XNRB 1GN3A 2YICA 4BWAA 5L3GA
chains in the Genus database with same CATH topology
1WPXA 3NXSA 3FB5C 3K08A 4MW3A 4UV8A 3K04A 4QE7A 4JYCA 4TSFG 5IY5B 2IH1C 1DF5A 2WLMA 1PNLA 3GWOA 3JD3A 3ABKC 1VQLV 3VOUA 3ASOB 1F4NA 3ABMC 3IC7A 1S76D 2DYSB 3HB3B 4TT3G 3TK1A 4J9ZB 3K79A 2D3OW 3MHHC 1LNQA 1K4CC 1TUEB 1V54B 5CN0A 3SPGA 4JPRA 3B8MA 2EINB 1QLNA 2OTJV 3CCSV 1VQ5V 4JGSA 1YSCA 1FXVA 4BAYA 5EBLC 4WFBV 5BZBA 3E83A 1YI2V 1R3IC 1QVGU 1OCZC 3OUFA 4RQFA 3CCEV 2EIKB 3SYPA 1I5YA 1Y4MA 2MK3A 1BHAA 1K92A 3ZMUA 3RBZA 4J9YB 5L3BA 3CP1A 2QEXV 1DF4A 1Q81W 1FS0G 4WFEA 3AG2C 1AI4A 1PNMA 5L3EA 2Q69A 5CBHA 4JF3A 3AEIA 5IYBO 2EIMC 5H6QA 5L3FA 4ASUG 1K8AW 1E79G 1MG1A 2ITCC 3WG7B 2QM8A 4PA4A 1EBOA 2JJ1G 4QIWF 2EJRA 4RO2A 3FKSG 3ZCCA 3T4DA 5LHGA 2DQ0A 3F7YC 3CCQV 2Q68A 1F23A 5HFMA 3ABMB 1QVFU 2ZDIC 3AG4C 3OAAG 2IJJA 1RPOA 3MD0A 2QA4V 3W7TA 3CMAV 3T4ZA 1AI5A 1QCEA 4JAVA 4UVBA 4RUEA 3SYAA 4DO2A 3G71V 4XDLA 3STLC 2X6BA 5EBMC 1G8MA 3ZRWA 1VQMV 1W2BU 1JJ2U 4LCUC 5GW7A 1S3JA 2OCCC 2V7QG 5L3DA 1ROPA 3A0RA 4H33A 2PI5A 1SZTA 2W0FC 4MS2A 1CP9A 5EBWC 3VBBA 3ZRVA 1Q7YW 1H8HG 2WLKA 1HWYA 1J95A 4R50A 1K33A 1H38A 2XAQA 1AJNA 4MVOA 3ETEA 3R65A 2OT5A 1JQ0A 3AG3C 3ZN0A 1Y66A 1BMFG 3SPHA 2XAGA 4MTFA 3ASNB 4R7CA 3UM7A 3M99B 3OFNG 2R9RB 2WLLA 4MVQA 2EIMB 4MW8A 1YTFD 1VQ6V 1NKDA 4L87A 3ZJZA 1KP3A 4GX0A 5LGTA 1QLEC 4H37A 4MT8A 1THZA 1CPYA 3OR6C 3OMNB 1AI7A 4MSWC 1FFTB 5EK0A 4RUFA 4XDJA 2XAHA 2EILB 2A0LA 2EIJB 3AG1B 3LNMB 5B1NA 4WFFA 2NNUA 2BOBC 1K4DC 2DYRB 4QPKA 3X2QC 1NVPD 1GTOA 5FL7G 4LC1A 2UXXA 1ZWIC 1W0KG 3UKMA 2EZOA 3ZMSA 3STZC 5J9PC 4PELA 1VQ8V 4PA7A 2WLJA 1JX9A 2XAJA 4ZBMA 1RM1C 1R3KC 3K03A 5KA6A 1MOFA 1M57B 4BIZA 3QO5A 1GMGA 1L1FA 4QE9A 1WLEA 2W6JG 3K3WA 5LHHA 1V55C 1W0JG 2Y69C 1CEZA 1FXKC 1K7DA 3K9AA 4R8CA 1M90W 2EZPA 1K5QA 3E89A 4PDVA 1GM7A 4PDRA 2ZXWC 4KUMA 4MVRA 2ZQMA 3K0GA 1M56B 1VQ7V 1G4YB 2ZDIA 2HG5C 2JK5C 1YJ9V 2FTKA 1I5XA 3CCMV 1K3EA 3OM3B 2IJIA 3TCUA 2DWDC 2P7TC 1OCCC 3RW0A 4WCEV 1KQSU 5B3SB 3CCVV 5DN6G 3W7SA 2X6CA 2WAMA 3JYCA 4UUJC 3ZRWB 3WFVA 1R73A 3F5WC 4PA6A 1K73W 1YHQV 3P32A 1GK9A 4GCZA 3CPWU 3OMIB 4X8AA 2XNDG 3I55V 2WPDG 4DXWA 4EKWA 4MTXA 4HYOA 2LP7A 1R3JC 3SPJA 3K06A 4HZ3A 5H9CA 2JDIG 3CC7V 3LUTB 3ZRXA 2F43G 4XDKA 1BL8A 3OEEG 3ABKB 4MVSA 3PJSK 2WLLB 1JPXA 1KKDA 5EC1C 3CC4V 1IXMA 4MTGA 5C93A 1QR9A 3JD2A 4ZKIA 1NR1A 2AHZA 1COWG 4LBEC 2NLJC 2P90A 2OTLV 2QTOA 3EHBB 1UJWB 2DW4A 1NH2D 3E8GA 5B1AC 1OCRC 3OE7G 1XL6A 2WLIA 2UXNA 1OCZB 1YTFB 3OR7C 1VQKV 4FJCC 3IFXA 1Q86W 2ZR3A 2Z3YA 3ABLC 2HLDG 1SETA 2Q67A 4P2ZA 1R6NA 4WFHA 3AG2B 4KFMA 1AJPA 3OGCC 3LSSA 3QNEA 4Q20A 3QO7A 5IY5C 3E8BA 1H2GA 4X89A 4R6ZA 3ETDA 2QKSA 3SPCA 1NVPB 1FXKA 3D3IA 3FYIB 3ASOC 3JD1A 4G28B 2DYSC 2B5UA 2X7RB 3SPIA 4U7NA 2PI4A 2P6JA 2HVKC 5IDJA 3T1CA 2LFRA 3JCZA 4PDMA 3W7UA 4FPPA 1VQNV 4UVCA 2IH3C 3E8HA 2ZD9A 3E35A 1YIJV 1K9MW 1VQPV 5LHIA 2DWEC 2EINC 3LDDA 4UV9A 4MVUA 2EBOA 1DLBA 3AG4B 2HFEC 3FB7C 5CBFA 4P9PA 3CC2V 1SERA 4XBFA 3G6EV 2EIKC 1K34A 4JYBA 2OCCB 4P30A 3ZMVA 2JEXA 3BEHA 2B1IA 1ENVA 3P30A 3QO8A 1PL0A 4FIPC 1PKXA 3W7XA 1NR7A 2JIZG 4RQEA 3ZN1A 4OXSA 1K97A 2HKOA 2Z5UA 1M1KW 4JAUA 3AG3B 2KB1A 3CYOA 1QR8A 1E1QG 3I56V 4PDLA 1NQTA 2HJFC 3OW2U 3LDEA 5CMUA 2ATKC 4UXNA 4LP8A 1PNKA 3RVYA 3SYQA 2P67A 3ML0A 1EFRG 3OMAB 3CCJV 5HFLA 1F4MA 5DM6V 3CCRV 2YEVA 1QLEB 2IJHA 2GSMB 3JD4A 5B1BC 1MSWD 2LFSA 4JTAB 4FK5C 3DTUB 4PA9A 4WF9V 2JEUA 2X6AA 1AR1B 3CD6V 3JD0A 2K1EA 4JTDB 2ZR2A 4GT1A 1KD1W 2H94A 3X2QB 4WFAV 2WLIB 4MVMA 2XOKG 1S72V 4GX1A 1GKFA 1GO3F 4MTOA 4RAIA 5IYDO 1S77D 2B1GA 4U7OA 1YITV 4I5SA 3SYCA 3G4SV 2A9HA 1YJWV 3IGAC 4TWKA 3CCUV 1E1RG 3FYEB 1RM1B 4QNHB 5H6RA 1K5SA 2HVJC 1FXHA 4G27B 4KP4A 2X0LA 1NH2B 1JCHA 2WSSG 5KA5A 3ZMTA 1VQ4V 3ASNC 1DTOA 3F7VC 1V55B 4FMTA 1RPRA 2IU3A 2Y69B 1KP2A 1FXKB 2V1DA 3T2MA 4BIUA 2DQ3A 1AROP 4Z1MG 3LSQA 3CXCU 1N8RW 3FB8C 4PA3A 3ABTA 4MVZA 2ZXWB 3ZRSA 1JVMA 1ORQC 1S0VA 2CK3G 1R3LC 3EFFK 5KUMA 2Y48A 3E2EA 5B1OA 2EILC 4QJFB 2EIJC 1OZ0A 1OCOC 3AG1C 5B1BB 5CBGA 1OCCB 1JOYA 4I9WA 1PD3A 2DYRC 2YSUB 4N21A 3OUSA 4UVAA 5CA3A 3TETA 3ZIAG 1GM8A 3GB7C 4G2KA 4P9OA 1EZJA 3LDCA 2AHYA 2XAFA 5L3CA 3ABUA 4HAMA 1F51A 1P7BA 3H01A 4CBCA 4QPJA 1M57C 2WWWA 5KUKA 1B6QA 1YJNV 4JASA 1R6KA 2W6IG 1XL4A 5LBQA 4BW5A 4JTCB 4GX5A 2IU0A 1KC8W 3OEHG 4WFGA 1AI6A 1MABG 3CMEV 1V54C 2IJKA 4X88A 4CZZA 2IW5A 4F4LA 2QM7A 1SESA 5IYCO 1QBZA 2ITDC 5LGUA 5E1AC 3B8NA 4N23A 4GX2A 1P4RA 1NJIW 5EC2C 1M56C 1KECA 3SJQC 2YEVB 1H8EG 5LGNA 3W7WA 3E86A 2GHYA 3K0DA 1Q82W 2Q6AA 3DGEA 2H8PC 1AJQA 2JJ2G 3D36A 1S5HC 2HR3A 2R9IA 5B1AB 5B3SC 3MHSC 1OCRB 2WLHA 3BY6A 2A79B 2WLNA 3E8FA 2C2AA 3B77A 3HPLC 1NBMG 1OCOB 2XASA 1M9NA 3ETGA 1SRYA 3FB6C 2BOCC 3SYOA 3CCLV 1VQOV 2QE7G 4E2LA 1GM9A 1OHHG 3ZMZA 1BHBA 3ABLB 3KG2A 4YXWG 1VQ9V 3WG7C 2M7WA 3RVZA 5L3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHB A;  1BHA A; 
#chains in the Genus database with same CATH topology
 3N2G A;  1WPX A;  5JWP A;  4YIO A;  5IY5 B;  1DF5 A;  1AR4 A;  2WLM A;  3T1Y B;  3JD3 A;  3ASO B;  1S76 D;  1LUV A;  4W4L A;  3M8A A;  3HB3 B;  3TK1 A;  2ODM A;  5A9G A;  3K79 A;  2D3O W;  3BA8 A;  2PY5 A;  5GTI Z;  2BSK B;  2UXB B;  3SPG A;  4DR7 O;  1QLN A;  2KKW A;  1XDC A;  1VQ5 V;  4TV9 B;  3CSX A;  3TJT A;  2NR5 A;  3L75 H;  2PZS A;  3FAV B;  5IJ0 B;  4K3A A;  4AHC A;  3CCE V;  2EIK B;  4PHZ A;  2MK3 A;  3OTO O;  4HNA B;  4J9Y B;  4X1K A;  4WFE A;  1GN4 A;  3BCC H;  5KHG A;  4DR2 B;  2GV9 A;  1PNM A;  1ZTE A;  1YF2 A;  4JF3 A;  4DK1 A;  4DV5 B;  3WG7 B;  2QM8 A;  1I08 A;  5EIB D;  4RO2 A;  2E74 B;  4KXR A;  4C7U A;  4IGG A;  5LHG A;  5LXT B;  5HFM A;  1X59 A;  5GTH Z;  1EM1 A;  4JI7 O;  3OAA G;  3KKY A;  1RPO A;  1VF6 A;  4UVB A;  4JAV A;  4DO2 A;  4YHH B;  2X6B A;  2DMX A;  2AW9 A;  4LCU C;  1S3J A;  2OCC C;  2V7Q G;  5L3D A;  5ITZ A;  2LW1 A;  5LMU B;  2E5L B;  3DSQ A;  4JI2 O;  3VBB A;  3ZRV A;  1JFF B;  2WLK A;  1WPB A;  1PPJ H;  1YEW A;  3WB1 A;  4B3T O;  1H38 A;  4MVO A;  3R65 A;  3U0Z A;  1JQ0 A;  2UU9 B;  3N2G B;  2GBO A;  1Y66 A;  3SPH A;  1I0H A;  3ASN B;  2R9R B;  1HNW B;  4MW8 A;  2EIM B;  5LYJ A;  1VQ6 V;  1CXZ B;  4FFK A;  3JAK A;  4GX0 A;  4LFB B;  2E75 B;  4JV5 B;  1THZ A;  1CPY A;  3OR6 C;  4JI3 O;  5EK0 A;  3KCY A;  2XAH A;  2BCC H;  3K57 A;  1GRJ A;  4JI1 B;  2LGQ A;  1ZWI C;  1W0K G;  3UKM A;  1WP8 A;  4PEL A;  4JZG A;  4PA7 A;  1JX9 A;  4X1K B;  4ZBM A;  1R3K C;  1MOF A;  1M57 B;  2N04 A;  3QO5 A;  2YXL A;  4QE9 A;  1WLE A;  1MSD A;  4F6R A;  2JVD A;  1D2D A;  3RFR A;  4K8X A;  3BHP A;  1K7D A;  2ZE5 A;  1XBL A;  1Y74 A;  4PDR A;  3ZHU A;  1VQ7 V;  1G4Y B;  2ADP A;  2HG5 C;  1YJ9 V;  2FTK A;  3OM3 B;  3MAQ A;  3TCU A;  2DWD C;  3ZS8 C;  1IXB A;  5B3S B;  3CCV V;  4GKK B;  4D7T A;  2X6C A;  3WFV A;  1R73 A;  5ITZ B;  1XMO O;  4X8A A;  2XND G;  2WPD G;  3L70 H;  3B2E E;  4FFB A;  5H2F Z;  3K06 A;  4O4I A;  5KHI A;  2F1M A;  1PM9 A;  1JJO A;  4MVS A;  2BTO A;  3IAY A;  3JAK B;  3JD2 A;  1AR5 A;  4OPA A;  2UUA O;  4O4H A;  1COW G;  4DR3 B;  2M6Y A;  2ARH A;  3EHB B;  5B1A C;  2WLI A;  1OCZ B;  1VQK V;  3TGU H;  5EZY A;  1JR9 A;  1NZ6 A;  2Z3Y A;  1HNZ B;  2JGU A;  1SQX H;  4KHP O;  4LWS A;  4P2Z A;  3A0H Z;  3K5M A;  3HKE A;  1XUQ A;  4WFH A;  2ADQ B;  5KX5 A;  4Q20 A;  3APO A;  2JS3 A;  5IY5 C;  3E8B A;  1H2G A;  2D2C B;  4X89 A;  3ETD A;  2QKS A;  1NTM H;  4F6R B;  3D3I A;  3FYI B;  1B3Q A;  3ASO C;  2E3C A;  4G28 B;  4FPP A;  1UPG A;  4O2B B;  2Z0A A;  2UXD B;  2VRZ A;  1Y74 B;  4O2A A;  1WA8 A;  2YIA A;  3IC9 A;  5IJ9 A;  5D5P A;  4FLU A;  4AIL C;  1SER A;  4TOI A;  1UFI A;  3G6E V;  2EIK C;  4KL1 A;  3ZMV A;  2JEX A;  3L73 H;  2Q0O C;  3P30 A;  1OJH A;  4FIP C;  4B3R B;  1NS1 A;  5E79 Z;  4A5U B;  4FFB B;  3TXQ A;  4JYA B;  3I56 V;  2Q5Z A;  2Y4U A;  2YS8 A;  3JSL A;  1PNK A;  4W4K A;  1L0N H;  1QLE B;  2GSM B;  5B1B C;  3SDL A;  2LFS A;  3G6B A;  3QVN A;  4K0K B;  4Z2W A;  4O4H B;  2X6A A;  5K1P A;  3CRQ A;  4DR1 O;  1NTK H;  3K9S A;  2P4V A;  4WFA V;  2WLI B;  1SZX A;  3HKD A;  2XOK G;  4ICG A;  1S72 V;  2UUC O;  1Z2G A;  4MTO A;  4RAI A;  4U7O A;  2A9H A;  3LNN A;  1E1R G;  1RM1 B;  4IL6 Z;  1G1X B;  4LFC B;  4LWS B;  2HVJ C;  4IYI A;  3HKE B;  4KP4 A;  2WSS G;  2Y0I A;  3ZMT A;  5KX5 B;  1VQ4 V;  3ASN C;  2HP8 A;  3C3T A;  4GKJ O;  4DV7 B;  2IU3 A;  1KU9 A;  1SQP H;  4B7K A;  4Z1M G;  4LF4 O;  2F4V B;  4DR4 B;  4PA3 A;  3ABT A;  3ZRS A;  1WA8 B;  1JVM A;  1SS3 A;  1AB3 A;  2CK3 G;  1R3L C;  5KUM A;  2QKC A;  3SJA C;  2QDO A;  1KYO F;  2JGD A;  1P7G A;  5IJ9 B;  1JOY A;  1LUW A;  4I9W A;  2YSU B;  4N21 A;  3OUS A;  4CH4 A;  2UUB O;  4FLZ A;  3G67 A;  4NXM B;  1S5J A;  4BR6 A;  3L72 H;  1M57 C;  4U3F H;  4DW0 A;  5IT9 N;  4JAS A;  1XL4 A;  5LBQ A;  1WB8 A;  2IU0 A;  2QKA A;  1GAX A;  3CME V;  4DUZ B;  3WB0 A;  2VQF O;  1V54 C;  4CZZ A;  4DV4 B;  2QM7 A;  1QBZ A;  3Q4H A;  1N34 B;  1XHZ A;  5EC2 C;  4DV3 O;  1S5L Z;  2XUM A;  2YXH A;  5LGN A;  3W7W A;  4UCV A;  3K5L A;  3K0D A;  3JAR A;  1YDX A;  1AJQ A;  2H8P C;  5EIB C;  1VF6 C;  2JJ2 G;  2HR3 A;  4PI2 A;  5B3S C;  1YZB A;  2WLH A;  4TQD A;  3E8F A;  4FM1 A;  1NU1 H;  4B3S B;  3SYO A;  4LF7 O;  3HKD B;  5KHJ A;  4E2L A;  4LH6 A;  4B3M O;  1XMQ B;  2CTR A;  2BTQ A;  3CWB H;  1H2K A;  3ZHT A;  1XQ8 A;  3CEI A;  4MW3 A;  1XNQ O;  4H13 B;  4JYC A;  4TSF G;  4EFB A;  1L0L H;  3GWO A;  1SQQ H;  4B7E A;  3ABM C;  2DYS B;  4H44 B;  2AZ0 A;  3O9O A;  1K4C C;  5BR8 O;  1Q6I A;  2PYJ A;  4JPR A;  2P4K A;  1BQZ A;  2EIN B;  4JI5 O;  2LO1 A;  4BAY A;  5EBL C;  4PV1 B;  2QGN A;  2JGD B;  3OTO B;  1YI2 V;  1R3I C;  2RJZ A;  1A32 A;  1OCZ C;  4J80 A;  2PGG A;  1I5Y A;  1Y4M A;  3ZMU A;  2VS0 A;  5FPR A;  3ZBH A;  2QEX V;  1FS0 G;  2ZNI A;  3BRC A;  3APQ A;  1AI4 A;  5CBH A;  5IWA O;  3AEI A;  5H6Q A;  1K8A W;  1E79 G;  2NN4 A;  2PF4 E;  1EBO A;  4QIW F;  3FKS G;  2FYU H;  2DQ0 A;  2HJD A;  3Q4H B;  4LNU A;  2ZIO A;  1F23 A;  3U10 A;  1KUQ A;  4L8J A;  4HBN A;  3MD0 A;  2Q4P A;  2ZT9 B;  4DUY B;  4RUE A;  4QGP A;  4XDL A;  4JI2 B;  4DR5 O;  1HNX B;  1VQM V;  1AP6 A;  1JJ2 U;  4H33 A;  2PI5 A;  1CP9 A;  5EBW C;  1BS3 A;  2XAQ A;  1AJN A;  5CB4 A;  2BTQ B;  4IIJ A;  3A2F A;  2CDY A;  3CX5 F;  4NXN O;  4R7C A;  3H1K H;  1MMM A;  5IE9 A;  1Q6U A;  3VQX A;  3ZX6 A;  1NKD A;  4JI3 B;  4L87 A;  3ZJZ A;  5D5Q A;  4LF8 B;  2RCV A;  1QLE C;  2CH7 A;  4H37 A;  3OMN B;  1AI7 A;  1FFT B;  1OV9 A;  4RUF A;  4XDJ A;  1U97 A;  2EIJ B;  1HW7 A;  5B1N A;  4WFF A;  1IBM B;  1K4D C;  4AI8 A;  2W0X A;  3L74 H;  2EZO A;  3ZMS A;  3STZ C;  5J2T A;  2XAJ A;  1RM1 C;  3K5O A;  1WAZ A;  1L1F A;  4JI4 O;  4J41 A;  3K3W A;  5LHH A;  2GTS A;  1CEZ A;  4R8C A;  2OWO A;  2FML A;  3SGI A;  4LF9 O;  4PDV A;  4KUM A;  1BGY H;  1ZAU A;  2ZDI A;  4LR3 A;  2ZNJ A;  1RSO A;  2JK5 C;  1B04 A;  1U96 A;  3CCM V;  1K3E A;  1PV0 A;  3N2K A;  3U11 A;  3W7S A;  3FFQ A;  4IT5 A;  2CE4 A;  1YHQ V;  1GK9 A;  4LF6 B;  3CPW U;  4DXW A;  4EKW A;  4CS3 A;  5LL6 Y;  4MTX A;  4HYO A;  2LP7 A;  1R3J C;  3HR0 A;  5CB4 B;  4IIJ B;  2QWO B;  2JDI G;  2UXC O;  4F6E A;  3ZRX A;  4YJ3 A;  4X64 B;  1BL8 A;  1XOU A;  4Q6G A;  1H2S B;  3G80 A;  1JPX A;  3T1H O;  1KBH A;  1IXM A;  3QF7 A;  4TV8 A;  1QR9 A;  5KHK A;  2CH7 B;  4ZKI A;  3L9D A;  1NR1 A;  2AHZ A;  2NLJ C;  1UJW B;  3RT3 C;  4DW1 A;  4GYC B;  4DV1 O;  4FM0 A;  1D5N A;  4DR6 O;  4FJC C;  1XHX A;  2ZR3 A;  4X66 O;  1SQV H;  2HLD G;  4I4T A;  4I9Q A;  5J2T B;  1R6N A;  1Q5O A;  3AG2 B;  1Q90 D;  1N32 O;  2Q7G A;  1I94 O;  3LSS A;  3QNE A;  4IHJ A;  5FPO A;  2P5O A;  3RYC A;  1FXK A;  1N33 B;  4JI8 B;  2DYS C;  2X7R B;  3H1J H;  4U7N A;  1IUR A;  5IDJ A;  3JAS A;  1ZL8 A;  4UVC A;  2IH3 C;  3E8H A;  1VQP V;  1HR0 B;  2HHH B;  2DWE C;  2EIN C;  4UV9 A;  1GN2 A;  2EBO A;  1DLB A;  3AG4 B;  2XTA A;  1RSO B;  2A06 H;  5DEC A;  4P9P A;  2CTQ A;  5LMN B;  3N2K B;  5FNV A;  2ZM6 O;  4LF5 O;  4DV2 B;  2B9Z A;  3QO8 A;  4I55 A;  1PL0 A;  5JVD A;  4DV6 O;  3W7X A;  1NR7 A;  5JJN B;  1IVS A;  2E76 B;  4OXS A;  3HKB A;  1K97 A;  2HKO A;  1FJG B;  2VQE O;  2MW2 B;  3AG3 B;  1TGO A;  1E1Q G;  4PDL A;  1NQT A;  2HJF C;  4YY3 O;  5CMU A;  2ATK C;  4YJ3 B;  3QG5 A;  1YCI A;  3SYQ A;  1XNR O;  1EFR G;  5HFL A;  4TV8 B;  3C3S A;  5C8Y A;  4X62 B;  3T1Y O;  4FK5 C;  3GVM A;  2JEU A;  5TIS Z;  2ZR2 A;  2AGA A;  5DED A;  2VWJ A;  2H94 A;  3X2Q B;  1R1B A;  2UXB O;  4UCT A;  1AIL A;  3J81 N;  4GX1 A;  4GZR B;  1GO3 F;  3SYC A;  3DC6 A;  2QWQ B;  1YJW V;  3P3P A;  3CCU V;  4I4T B;  4QNH B;  2LJ2 A;  5B66 Z;  1FXH A;  2X0L A;  1JCH A;  2OYQ A;  5LYJ B;  1DTO A;  1V55 B;  1RPR A;  2Y69 B;  1FXK B;  1RP3 B;  2V1D A;  3T2M A;  4DR2 O;  3FB8 C;  3JAS B;  1ZL8 B;  4DV5 O;  3H1I H;  4OX9 B;  2GDS A;  3S3W A;  2Y48 A;  5B1O A;  2EIJ C;  1OZ0 A;  5CBG A;  2GUZ A;  4G2K A;  3CHX A;  1EZJ A;  1BQ0 A;  4J7Z A;  5FNV B;  1IBK O;  3ABU A;  4HAM A;  1F51 A;  4I55 B;  4QPJ A;  5JVD B;  4YHH O;  3HKB B;  5LMU O;  2E5L O;  4WFG A;  2P22 C;  1AI6 A;  2ITD C;  1QNM A;  4GX2 A;  1NJI W;  1KEC A;  3SJQ C;  3THO A;  2ZIM A;  5C8Y B;  1Q82 W;  1HNW O;  3D36 A;  1S5H C;  4EEQ A;  3MHS C;  2A79 B;  1OCO B;  3BPZ A;  1M9N A;  2XAS A;  3ETG A;  1SRY A;  3F5T A;  1GM9 A;  4I0X A;  4AQY B;  3ABL B;  1BHB A;  1VQ9 V;  4K35 A;  3WG7 C;  4O4I B;  4CH6 A;  1H2N A;  3NXS A;  3FB5 C;  4JI1 O;  4QE7 A;  2N05 A;  2QWR B;  2VWK A;  1F4N A;  3IC7 A;  5FLX N;  4JI5 B;  1SQF A;  4YIP A;  2EX3 A;  3MHH C;  4JZ2 A;  1TUE B;  5CN0 A;  1Q3E A;  1O9H A;  3JAT A;  4JI6 B;  3CCS V;  3RYF A;  3UO3 A;  1YSC A;  1Z5V A;  1FXV A;  4UB8 Z;  4CS4 A;  5BZB A;  3E83 A;  1TAE A;  5BXZ A;  2P06 A;  1YXB A;  3I5D A;  1J5E O;  2QWN B;  2GUZ B;  5EZY B;  1BHA A;  1K92 A;  2EJ7 A;  3FD9 A;  3RBZ A;  5BMV A;  1T5E A;  3AG2 C;  3S3X A;  4GKK O;  1N4C A;  3OTF A;  5L3F A;  2EIM C;  4ASU G;  2R9A A;  3PN1 A;  2ITC C;  3R66 A;  4PA4 A;  2JJ1 G;  2EJR A;  3ZCC A;  4O2A B;  3F7Y C;  3JAW A;  2Q68 A;  2CTP A;  2YXY A;  4DR5 B;  2ZDI C;  3EXA A;  3K59 A;  2BE3 A;  3AG4 C;  3H1L H;  2QA4 V;  3W7T A;  2FB5 A;  3CMA V;  4JI0 B;  1AI5 A;  1QCE A;  3G71 V;  3STL C;  3ZRW A;  5EBM C;  1G8M A;  1W2B U;  5GW7 A;  2KG7 A;  1XI1 A;  2DN9 A;  3A0R A;  1TVK A;  1SZT A;  2W0F C;  1WN7 A;  4DR3 O;  1HWY A;  4I0X B;  3WU2 Z;  1K33 A;  3NR7 A;  4NXN B;  4D7S A;  2YIB D;  1W59 A;  4FM2 A;  4DV0 B;  3AG3 C;  4OPH A;  1Q6H A;  4LFA B;  2XAG A;  4MTF A;  4NYK A;  3BFR A;  2CAZ C;  3OFN G;  4MVQ A;  1PL4 A;  3ETQ A;  4O4L A;  3CE2 A;  1KP3 A;  2YIB A;  3UCS C;  3AK1 A;  4JYY A;  2IBZ H;  4MSW C;  2OIE A;  3JAT B;  1EN6 A;  4FLX A;  3RWR D;  3RYF B;  2V4D A;  3LNM B;  4B08 A;  1SKV A;  1SA0 A;  1NTZ H;  2DYR B;  3X2Q C;  1NVP D;  3RGB A;  2UXD O;  1GTO A;  1SQG A;  4LC1 A;  2A7W A;  5J9P C;  4JI4 B;  5BMV B;  1FKA O;  2RN9 A;  5KA6 A;  2LQT A;  2RDC A;  2K9P A;  1GMG A;  2QM4 A;  4DR7 B;  1V55 C;  4UCO A;  1W0J G;  2Y69 C;  3SJB C;  1FXK C;  3K9A A;  4B3R O;  3BA9 A;  3VQW A;  2WA3 A;  3E89 A;  3JAW B;  2QR4 A;  3K0G A;  1M56 B;  3VQY A;  4UCS A;  3DXR A;  3B09 A;  4JYA O;  2LGW A;  5AG2 A;  1BSM A;  1R6T A;  4UFZ A;  3CRR A;  1KQS U;  1D5A A;  5DN6 G;  2OCH A;  3JYC A;  3ZRW B;  5A2Q N;  2KG7 B;  3F5W C;  4PA6 A;  1DK1 A;  1TVK B;  4K0K O;  4GCZ A;  2RMK B;  4CC6 A;  3OMI B;  4J7J A;  1EN4 A;  3I55 V;  2UXC B;  2G38 A;  2HEP A;  2YID A;  3A8T A;  1GN6 A;  1G6U A;  4HZ3 A;  5H9C A;  5GON A;  4WBN A;  3CC7 V;  4JI7 B;  3LUT B;  3T1H B;  2F43 G;  1N0J A;  1F7Y A;  1ZX3 A;  1EZV H;  3ABK B;  4BIO A;  3MDS A;  3C90 A;  3PJS K;  1ZSP A;  1VF5 B;  3HKC A;  5K1X A;  4LFC O;  4O4L B;  1KKD A;  4NTW A;  5C93 A;  1YVW A;  2F95 B;  1I7F A;  4J7K A;  3JAR B;  3JCU Z;  4DRX A;  2P90 A;  1IBL O;  2DW4 A;  1NH2 D;  4B3T B;  2AZ2 A;  4DR4 O;  2UXN A;  1US6 A;  1SA0 B;  5KAI Z;  3IFX A;  2CGN A;  1Q86 W;  5LOV A;  4X65 O;  2Y0P A;  4CC5 A;  4OGQ B;  1I94 B;  3ABL C;  1SET A;  3D8C A;  3K5N A;  4KFM A;  3OGC C;  3D3Q A;  1NVP B;  3OT7 A;  5JCO A;  3JD1 A;  3SPI A;  2PI4 A;  2P6J A;  2HVK C;  3T1C A;  3DC5 A;  4PDM A;  3E35 A;  4JAA A;  1K9M W;  5LHI A;  1N36 O;  4MVU A;  3DXR B;  4DUZ O;  2HFE C;  3UQ8 A;  1MZF A;  4ZHQ A;  5CBF A;  2ZM6 B;  4DV4 O;  2AXT Z;  1V9P A;  1N34 O;  4XBF A;  4DV6 B;  1K34 A;  4JYB A;  3WB2 A;  4P30 A;  3J7A U;  2B1I A;  1HDJ A;  1ENV A;  3ZN1 A;  3QTC A;  2QJ1 A;  3LSU A;  2Z5U A;  1M1K W;  4JAU A;  4B3S O;  2KB1 A;  3CYO A;  1QR8 A;  1GH6 A;  1VF7 A;  5GON B;  4WBN B;  3LDE A;  4UXN A;  4LNU B;  1XMQ O;  5IYZ A;  2P67 A;  3ML0 A;  1F4M A;  3HKC B;  4I7Z B;  3JAM N;  2YEV A;  3ZHS A;  3JD4 A;  3J80 N;  1WJZ A;  4PA9 A;  3DTU B;  1XMO B;  3JD0 A;  2K1E A;  1M4U A;  4RWU A;  4JTD B;  4DRX B;  3JSN A;  3CB2 A;  3D36 C;  1JA8 A;  2FKX A;  2A3Q A;  2EUL A;  4X1Y A;  2JS5 A;  1GKF A;  5IYD O;  2O57 A;  5LOV B;  2ZKO A;  3G4S V;  1MNG A;  4NR1 A;  3FYE B;  1K5S A;  1NH2 B;  5KA5 A;  2CUG A;  2UUA B;  4IYH A;  3F7V C;  4FMT A;  5KLV H;  2DQ3 A;  3CXC U;  2CTW A;  2RQ6 A;  4MVZ A;  2ZXW B;  4E4E A;  2PUS A;  3A0B Z;  1VP7 A;  1S0V A;  3H9V A;  1SQB H;  4NVP A;  1NI8 A;  4QJF B;  1VIB A;  4KHP B;  3EVK A;  5B1B B;  1IBK B;  1OCC B;  4ZHQ B;  2DYR C;  1SF9 A;  3TET A;  3ZIA G;  1GM8 A;  3GB7 C;  4TUY A;  1KB9 F;  4CH5 A;  4PD4 F;  1P7B A;  3H01 A;  4DUY O;  4CBC A;  2KQX A;  5KUK A;  1B6Q A;  1HNX O;  2W6I G;  4EB6 A;  1RFY A;  4BW5 A;  1KC8 W;  1BE3 H;  1XRE A;  3OEH G;  2PYL A;  1KMI Z;  4TQF A;  4CH3 A;  1Q8I A;  3M7M X;  3CXH F;  3O65 A;  5IYC O;  3UT5 A;  3B8N A;  4N23 A;  4X20 A;  1Y6X A;  4FVM A;  5IYZ B;  1M56 C;  1Q43 A;  3CJH A;  2YEV B;  1H8E G;  4J10 A;  3BAB A;  3BVO A;  3DGE A;  2L6L A;  2OIG A;  2R9I A;  3FX7 A;  1OCR B;  3BY6 A;  5B5E Z;  2WLN A;  4LF8 O;  2C2A A;  3B77 A;  1NBM G;  5JQG A;  5LA6 A;  2BOC C;  3CCL V;  4X1Y B;  1OHH G;  2N74 A;  3KG2 A;  2WA4 A;  4YXW G;  3TXS A;  2F66 C;  2M7W A;  3RVZ A;  1IBM O;  3RYH A;  3K08 A;  4UV8 A;  3K04 A;  2IH1 C;  1PNL A;  1NT2 B;  3ABK C;  5CA1 A;  1VQL V;  3VOU A;  4NTX A;  4DR1 B;  4U3J A;  4TT3 G;  4J9Z B;  1LNQ A;  4DK0 A;  1V54 B;  4O2B A;  3B8M A;  2UUC B;  2OTJ V;  2DJV A;  1XEQ A;  3GWK C;  1VEW A;  1J5E B;  4JGS A;  3KCX A;  4WFB V;  2Q73 A;  5JH7 A;  3CRA A;  1AP5 A;  1QVG U;  1URF A;  3OUF A;  4RQF A;  3SYP A;  4TUY B;  1LR1 A;  1HP8 A;  5L3B A;  4GKJ B;  3CP1 A;  3AK3 A;  1DF4 A;  1Q81 W;  2IM9 A;  2YDE A;  1JMK C;  1Y76 A;  4LF4 B;  2Y4T A;  2ZE7 A;  4IHJ B;  5L3E A;  2Q69 A;  3RYC B;  3K58 A;  5IYB O;  4FLW A;  2JRI A;  1MG1 A;  4EB6 B;  4DYL A;  4X1I A;  3H1H H;  4LF6 O;  3T4D A;  3CCQ V;  3UT5 B;  1MZE A;  1QQC A;  2UUB B;  4X20 B;  1EN5 A;  3ABM B;  3AG7 A;  1QVF U;  3CJH B;  2IJJ A;  4X64 O;  3T4Z A;  5KMG A;  3SYA A;  3N27 A;  1ZLZ A;  5LP6 A;  4UB6 Z;  3CRC A;  3KZI Z;  1ROP A;  1L8D A;  2DE0 X;  1N0N A;  2VQF B;  5JQG B;  5LA6 B;  4MS2 A;  1Q7Y W;  1H8H G;  2PTM A;  4J42 A;  3RN4 A;  1J95 A;  4R50 A;  3ETE A;  2YI9 A;  4DV3 B;  5JJJ B;  2OT5 A;  3RYH B;  4X9Q A;  3ZN0 A;  1BMF G;  5KHH A;  4PI0 A;  3UM7 A;  3M99 B;  2WLL A;  1YTF D;  5CA1 B;  2UU9 O;  2F23 A;  2QSA A;  2ETN A;  4U3J B;  5LGT A;  1DGS A;  4MT8 A;  1B06 A;  2GTA A;  4LF7 B;  1Y67 A;  4B3M B;  4JI8 O;  1N33 O;  4LFB O;  2EIL B;  4JV5 O;  2A0L A;  3AG1 B;  1WB7 A;  2NNU A;  2BOB C;  5JH7 B;  4QPK A;  1VAR A;  5FL7 G;  1XNQ B;  1HR0 O;  2HHH O;  2UXX A;  2R72 A;  1VQ8 V;  2F93 B;  2WLJ A;  5EYP A;  3K03 A;  1Y76 B;  4BIZ A;  5BR8 B;  5LMN O;  1SC5 B;  2Q7H A;  2W6J G;  4ZOL A;  4BW9 A;  4DV2 O;  1P84 F;  1M90 W;  3VQV A;  5JCO C;  4X1I B;  1TUB A;  3ZHQ A;  2EZP A;  1K5Q A;  1WP7 A;  1GM7 A;  1MA1 A;  1FJG O;  2ZXW C;  4MVR A;  2ZQM A;  1FPO A;  1I5X A;  2IJI A;  2P7T C;  2ZE6 A;  1OCC C;  3RW0 A;  4WCE V;  5KMG B;  1P49 A;  4YJ2 A;  5IWA B;  2WAM A;  4UUJ C;  5LP6 B;  5J2U A;  1FD9 A;  1K73 W;  1BZK A;  3P32 A;  4X62 O;  3B4S A;  1FAF A;  3SPJ A;  1BT8 A;  4K8Z A;  4XDK A;  1PP9 H;  1XIL A;  3OEE G;  2YI8 A;  2WLL B;  1IBL B;  5EC1 C;  3CC4 V;  4MTG A;  1H2L A;  4NTY A;  3ZHR A;  2RNB A;  2Q7E A;  4LBE C;  1FFX A;  2OTL V;  2QTO A;  4LH7 A;  4X65 B;  3E8G A;  1H2M A;  1OCR C;  3OE7 G;  1XL6 A;  3OD4 A;  2XHB A;  1YTF B;  3OR7 C;  1FYJ A;  3L71 H;  4OX9 O;  2Q67 A;  1KKC A;  4O4J A;  5EYP B;  1AJP A;  3ICX A;  3BAA A;  5JJE B;  1HNZ O;  1Z5W A;  3QO7 A;  3RYI A;  3AK2 A;  2LW7 A;  4R6Z A;  3SPC A;  3UO2 A;  4ZOL B;  2B5U A;  1N36 B;  2LFR A;  3JCZ A;  3W7U A;  1TUB B;  1VQN V;  2ZD9 A;  1YIJ V;  3B40 A;  1IZ3 A;  5H5N A;  4D6T H;  3LDD A;  5KAF Z;  2Q0A A;  1WNS A;  2ILM A;  3FB7 C;  1M93 A;  4ZI7 A;  3CC2 V;  3E22 A;  4YJ2 B;  2OCC B;  3BEH A;  5J2U B;  4UCR A;  2CGO A;  4J11 A;  4I50 A;  1VMG A;  1PKX A;  2JIZ G;  3CRM A;  4RQE A;  4LF9 B;  4H0L B;  5CA0 A;  3OW2 U;  3CS5 A;  1O9G A;  4LP8 A;  3RVY A;  2XT9 A;  4AQY O;  2KSD A;  3OMA B;  3CCJ V;  5DM6 V;  3CCR V;  3JAL A;  2IJH A;  1MSW D;  4JTA B;  4ABM A;  4WF9 V;  1AR1 B;  1IX9 A;  3CD6 V;  1FFX B;  4GT1 A;  1KD1 W;  4MVM A;  4JI6 O;  2H3O A;  2ZIN A;  3OGI B;  2QTS A;  1S77 D;  2L35 A;  2B1G A;  1YIT V;  4I5S A;  1QHT A;  1BCC H;  3IGA C;  4TWK A;  3ZHV A;  4EFE A;  5H6R A;  4O4J B;  2ZE8 A;  4G27 B;  3RYI B;  1KP2 A;  4UCU A;  2R70 A;  3ZED A;  1M5I A;  1IDS A;  4BIU A;  4DV1 B;  1ARO P;  2BSK A;  3LSQ A;  1N8R W;  2QWP B;  4DR6 B;  4DV7 O;  4GLX A;  1ORQ C;  4TV9 A;  2DOS A;  3EFF K;  4X66 B;  4PJ0 Z;  2Q9L A;  4NKG B;  4CS2 A;  2F4V O;  3E2E A;  2EIL C;  1OCO C;  3AG1 C;  3FAV A;  3IJ4 A;  1PD3 A;  5IJ0 A;  5CA3 A;  4UVA A;  1N32 B;  2Q8V A;  4P9O A;  4ZI7 B;  4ZIB A;  1QU7 A;  4HNA A;  3E22 B;  3LDC A;  2AHY A;  2XAF A;  5L3C A;  4I50 B;  1ZUQ A;  4JI0 O;  2WWW A;  4NXM O;  1YJN V;  1R6K A;  3P3N A;  4JTC B;  4GX5 A;  1MAB G;  5BY1 A;  5CA0 B;  2YC0 A;  1X4T A;  2IJK A;  4X88 A;  2IW5 A;  4NB5 A;  4F4L A;  1SES A;  4GUN A;  5LGU A;  2YUA A;  5LXT A;  5E1A C;  4FZ1 A;  1P4R A;  1TA8 A;  4DV0 O;  3JAL B;  4LF5 B;  4LFA O;  3E86 A;  3SJC C;  2GHY A;  5F2V O;  1AVM A;  2Q6A A;  4FLT A;  4FLV A;  4FZ0 A;  3SR2 C;  5B1A B;  4Z1V A;  2VQE B;  5LP6 C;  3HPL C;  3FB6 C;  4YY3 B;  1VQO V;  1JFF A;  2FL4 A;  2QE7 G;  2ZCE A;  3ZMZ A;  4FLY A;  1XNR B;  1GN3 A;  2YIC A;  4BWA A;  5L3G A; 
#chains in the Genus database with same CATH homology
 1WPX A;  3NXS A;  3FB5 C;  3K08 A;  4MW3 A;  4UV8 A;  3K04 A;  4QE7 A;  4JYC A;  4TSF G;  5IY5 B;  2IH1 C;  1DF5 A;  2WLM A;  1PNL A;  3GWO A;  3JD3 A;  3ABK C;  1VQL V;  3VOU A;  3ASO B;  1F4N A;  3ABM C;  3IC7 A;  1S76 D;  2DYS B;  3HB3 B;  4TT3 G;  3TK1 A;  4J9Z B;  3K79 A;  2D3O W;  3MHH C;  1LNQ A;  1K4C C;  1TUE B;  1V54 B;  5CN0 A;  3SPG A;  4JPR A;  3B8M A;  2EIN B;  1QLN A;  2OTJ V;  3CCS V;  1VQ5 V;  4JGS A;  1YSC A;  1FXV A;  4BAY A;  5EBL C;  4WFB V;  5BZB A;  3E83 A;  1YI2 V;  1R3I C;  1QVG U;  1OCZ C;  3OUF A;  4RQF A;  3CCE V;  2EIK B;  3SYP A;  1I5Y A;  1Y4M A;  2MK3 A;  1BHA A;  1K92 A;  3ZMU A;  3RBZ A;  4J9Y B;  5L3B A;  3CP1 A;  2QEX V;  1DF4 A;  1Q81 W;  1FS0 G;  4WFE A;  3AG2 C;  1AI4 A;  1PNM A;  5L3E A;  2Q69 A;  5CBH A;  4JF3 A;  3AEI A;  5IYB O;  2EIM C;  5H6Q A;  5L3F A;  4ASU G;  1K8A W;  1E79 G;  1MG1 A;  2ITC C;  3WG7 B;  2QM8 A;  4PA4 A;  1EBO A;  2JJ1 G;  4QIW F;  2EJR A;  4RO2 A;  3FKS G;  3ZCC A;  3T4D A;  5LHG A;  2DQ0 A;  3F7Y C;  3CCQ V;  2Q68 A;  1F23 A;  5HFM A;  3ABM B;  1QVF U;  2ZDI C;  3AG4 C;  3OAA G;  2IJJ A;  1RPO A;  3MD0 A;  2QA4 V;  3W7T A;  3CMA V;  3T4Z A;  1AI5 A;  1QCE A;  4JAV A;  4UVB A;  4RUE A;  3SYA A;  4DO2 A;  3G71 V;  4XDL A;  3STL C;  2X6B A;  5EBM C;  1G8M A;  3ZRW A;  1VQM V;  1W2B U;  1JJ2 U;  4LCU C;  5GW7 A;  1S3J A;  2OCC C;  2V7Q G;  5L3D A;  1ROP A;  3A0R A;  4H33 A;  2PI5 A;  1SZT A;  2W0F C;  4MS2 A;  1CP9 A;  5EBW C;  3VBB A;  3ZRV A;  1Q7Y W;  1H8H G;  2WLK A;  1HWY A;  1J95 A;  4R50 A;  1K33 A;  1H38 A;  2XAQ A;  1AJN A;  4MVO A;  3ETE A;  3R65 A;  2OT5 A;  1JQ0 A;  3AG3 C;  3ZN0 A;  1Y66 A;  1BMF G;  3SPH A;  2XAG A;  4MTF A;  3ASN B;  4R7C A;  3UM7 A;  3M99 B;  3OFN G;  2R9R B;  2WLL A;  4MVQ A;  2EIM B;  4MW8 A;  1YTF D;  1VQ6 V;  1NKD A;  4L87 A;  3ZJZ A;  1KP3 A;  4GX0 A;  5LGT A;  1QLE C;  4H37 A;  4MT8 A;  1THZ A;  1CPY A;  3OR6 C;  3OMN B;  1AI7 A;  4MSW C;  1FFT B;  5EK0 A;  4RUF A;  4XDJ A;  2XAH A;  2EIL B;  2A0L A;  2EIJ B;  3AG1 B;  3LNM B;  5B1N A;  4WFF A;  2NNU A;  2BOB C;  1K4D C;  2DYR B;  4QPK A;  3X2Q C;  1NVP D;  1GTO A;  5FL7 G;  4LC1 A;  2UXX A;  1ZWI C;  1W0K G;  3UKM A;  2EZO A;  3ZMS A;  3STZ C;  5J9P C;  4PEL A;  1VQ8 V;  4PA7 A;  2WLJ A;  1JX9 A;  2XAJ A;  4ZBM A;  1RM1 C;  1R3K C;  3K03 A;  5KA6 A;  1MOF A;  1M57 B;  4BIZ A;  3QO5 A;  1GMG A;  1L1F A;  4QE9 A;  1WLE A;  2W6J G;  3K3W A;  5LHH A;  1V55 C;  1W0J G;  2Y69 C;  1CEZ A;  1FXK C;  1K7D A;  3K9A A;  4R8C A;  1M90 W;  2EZP A;  1K5Q A;  3E89 A;  4PDV A;  1GM7 A;  4PDR A;  2ZXW C;  4KUM A;  4MVR A;  2ZQM A;  3K0G A;  1M56 B;  1VQ7 V;  1G4Y B;  2ZDI A;  2HG5 C;  2JK5 C;  1YJ9 V;  2FTK A;  1I5X A;  3CCM V;  1K3E A;  3OM3 B;  2IJI A;  3TCU A;  2DWD C;  2P7T C;  1OCC C;  3RW0 A;  4WCE V;  1KQS U;  5B3S B;  3CCV V;  5DN6 G;  3W7S A;  2X6C A;  2WAM A;  3JYC A;  4UUJ C;  3ZRW B;  3WFV A;  1R73 A;  3F5W C;  4PA6 A;  1K73 W;  1YHQ V;  3P32 A;  1GK9 A;  4GCZ A;  3CPW U;  3OMI B;  4X8A A;  2XND G;  3I55 V;  2WPD G;  4DXW A;  4EKW A;  4MTX A;  4HYO A;  2LP7 A;  1R3J C;  3SPJ A;  3K06 A;  4HZ3 A;  5H9C A;  2JDI G;  3CC7 V;  3LUT B;  3ZRX A;  2F43 G;  4XDK A;  1BL8 A;  3OEE G;  3ABK B;  4MVS A;  3PJS K;  2WLL B;  1JPX A;  1KKD A;  5EC1 C;  3CC4 V;  1IXM A;  4MTG A;  5C93 A;  1QR9 A;  3JD2 A;  4ZKI A;  1NR1 A;  2AHZ A;  1COW G;  4LBE C;  2NLJ C;  2P90 A;  2OTL V;  2QTO A;  3EHB B;  1UJW B;  2DW4 A;  1NH2 D;  3E8G A;  5B1A C;  1OCR C;  3OE7 G;  1XL6 A;  2WLI A;  2UXN A;  1OCZ B;  1YTF B;  3OR7 C;  1VQK V;  4FJC C;  3IFX A;  1Q86 W;  2ZR3 A;  2Z3Y A;  3ABL C;  2HLD G;  1SET A;  2Q67 A;  4P2Z A;  1R6N A;  4WFH A;  3AG2 B;  4KFM A;  1AJP A;  3OGC C;  3LSS A;  3QNE A;  4Q20 A;  3QO7 A;  5IY5 C;  3E8B A;  1H2G A;  4X89 A;  4R6Z A;  3ETD A;  2QKS A;  3SPC A;  1NVP B;  1FXK A;  3D3I A;  3FYI B;  3ASO C;  3JD1 A;  4G28 B;  2DYS C;  2B5U A;  2X7R B;  3SPI A;  4U7N A;  2PI4 A;  2P6J A;  2HVK C;  5IDJ A;  3T1C A;  2LFR A;  3JCZ A;  4PDM A;  3W7U A;  4FPP A;  1VQN V;  4UVC A;  2IH3 C;  3E8H A;  2ZD9 A;  3E35 A;  1YIJ V;  1K9M W;  1VQP V;  5LHI A;  2DWE C;  2EIN C;  3LDD A;  4UV9 A;  4MVU A;  2EBO A;  1DLB A;  3AG4 B;  2HFE C;  3FB7 C;  5CBF A;  4P9P A;  3CC2 V;  1SER A;  4XBF A;  3G6E V;  2EIK C;  1K34 A;  4JYB A;  2OCC B;  4P30 A;  3ZMV A;  2JEX A;  3BEH A;  2B1I A;  1ENV A;  3P30 A;  3QO8 A;  1PL0 A;  4FIP C;  1PKX A;  3W7X A;  1NR7 A;  2JIZ G;  4RQE A;  3ZN1 A;  4OXS A;  1K97 A;  2HKO A;  2Z5U A;  1M1K W;  4JAU A;  3AG3 B;  2KB1 A;  3CYO A;  1QR8 A;  1E1Q G;  3I56 V;  4PDL A;  1NQT A;  2HJF C;  3OW2 U;  3LDE A;  5CMU A;  2ATK C;  4UXN A;  4LP8 A;  1PNK A;  3RVY A;  3SYQ A;  2P67 A;  3ML0 A;  1EFR G;  3OMA B;  3CCJ V;  5HFL A;  1F4M A;  5DM6 V;  3CCR V;  2YEV A;  1QLE B;  2IJH A;  2GSM B;  3JD4 A;  5B1B C;  1MSW D;  2LFS A;  4JTA B;  4FK5 C;  3DTU B;  4PA9 A;  4WF9 V;  2JEU A;  2X6A A;  1AR1 B;  3CD6 V;  3JD0 A;  2K1E A;  4JTD B;  2ZR2 A;  4GT1 A;  1KD1 W;  2H94 A;  3X2Q B;  4WFA V;  2WLI B;  4MVM A;  2XOK G;  1S72 V;  4GX1 A;  1GKF A;  1GO3 F;  4MTO A;  4RAI A;  5IYD O;  1S77 D;  2B1G A;  4U7O A;  1YIT V;  4I5S A;  3SYC A;  3G4S V;  2A9H A;  1YJW V;  3IGA C;  4TWK A;  3CCU V;  1E1R G;  3FYE B;  1RM1 B;  4QNH B;  5H6R A;  1K5S A;  2HVJ C;  1FXH A;  4G27 B;  4KP4 A;  2X0L A;  1NH2 B;  1JCH A;  2WSS G;  5KA5 A;  3ZMT A;  1VQ4 V;  3ASN C;  1DTO A;  3F7V C;  1V55 B;  4FMT A;  1RPR A;  2IU3 A;  2Y69 B;  1KP2 A;  1FXK B;  2V1D A;  3T2M A;  4BIU A;  2DQ3 A;  1ARO P;  4Z1M G;  3LSQ A;  3CXC U;  1N8R W;  3FB8 C;  4PA3 A;  3ABT A;  4MVZ A;  2ZXW B;  3ZRS A;  1JVM A;  1ORQ C;  1S0V A;  2CK3 G;  1R3L C;  3EFF K;  5KUM A;  2Y48 A;  3E2E A;  5B1O A;  2EIL C;  4QJF B;  2EIJ C;  1OZ0 A;  1OCO C;  3AG1 C;  5B1B B;  5CBG A;  1OCC B;  1JOY A;  4I9W A;  1PD3 A;  2DYR C;  2YSU B;  4N21 A;  3OUS A;  4UVA A;  5CA3 A;  3TET A;  3ZIA G;  1GM8 A;  3GB7 C;  4G2K A;  4P9O A;  1EZJ A;  3LDC A;  2AHY A;  2XAF A;  5L3C A;  3ABU A;  4HAM A;  1F51 A;  1P7B A;  3H01 A;  4CBC A;  4QPJ A;  1M57 C;  2WWW A;  5KUK A;  1B6Q A;  1YJN V;  4JAS A;  1R6K A;  2W6I G;  1XL4 A;  5LBQ A;  4BW5 A;  4JTC B;  4GX5 A;  2IU0 A;  1KC8 W;  3OEH G;  4WFG A;  1AI6 A;  1MAB G;  3CME V;  1V54 C;  2IJK A;  4X88 A;  4CZZ A;  2IW5 A;  4F4L A;  2QM7 A;  1SES A;  5IYC O;  1QBZ A;  2ITD C;  5LGU A;  5E1A C;  3B8N A;  4N23 A;  4GX2 A;  1P4R A;  1NJI W;  5EC2 C;  1M56 C;  1KEC A;  3SJQ C;  2YEV B;  1H8E G;  5LGN A;  3W7W A;  3E86 A;  2GHY A;  3K0D A;  1Q82 W;  2Q6A A;  3DGE A;  2H8P C;  1AJQ A;  2JJ2 G;  3D36 A;  1S5H C;  2HR3 A;  2R9I A;  5B1A B;  5B3S C;  3MHS C;  1OCR B;  2WLH A;  3BY6 A;  2A79 B;  2WLN A;  3E8F A;  2C2A A;  3B77 A;  3HPL C;  1NBM G;  1OCO B;  2XAS A;  1M9N A;  3ETG A;  1SRY A;  3FB6 C;  2BOC C;  3SYO A;  3CCL V;  1VQO V;  2QE7 G;  4E2L A;  1GM9 A;  1OHH G;  3ZMZ A;  1BHB A;  3ABL B;  3KG2 A;  4YXW G;  1VQ9 V;  3WG7 C;  2M7W A;  3RVZ A;  5L3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...