1BHBA

Three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
67
Chain Sequence
AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of (1-71)bacterioopsin solubilized in methanol/chloroform and SDS micelles determined by 15N-1H heteronuclear NMR spectroscopy.
pubmed doi rcsb
source organism Halobacterium salinarum
molecule tags Photoreceptor
molecule keywords BACTERIORHODOPSIN
total genus 21
structure length 67
sequence length 69
ec nomenclature
pdb deposition date 1993-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.170 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bhbA00
1BHBA 1BHAA
chains in the Genus database with same CATH superfamily
2B9ZA 1SZTA 5B1NA 3AG3C 5B1BB 4B3RB 3ML0A 1CXZB 2Y4UA 3SJCC 5JWPA 2P90A 3KCXA 2G38A 1M57C 3X2QC 1FXKC 1V55C 2ZE5A 4O4IB 4IHJB 3K0GA 1XNQO 4DYLA 2FMLA 1DLBA 1SF9A 3QVNA 4IGGA 3SGIA 4NVPA 4X1IA 3IGAC 4B3SB 4WFAV 1QQCA 3QG5A 1Q6IA 2C2AA 3WB1A 2PYJA 2HJFC 4I55A 1YEWA 2Y69B 4I9QA 2DYRC 1W0KG 1EN6A 5KHIA 1MG1A 3HKCB 3U10A 1S77D 1BHBA 2WAMA 3LNMB 2DQ0A 2W6JG 4NTXA 2LW1A 4X89A 4D7TA 1NTZH 1SQQH 5LOVA 1ZUQA 1XL6A 3Q4HA 2Q68A 1K97A 4ZKIA 5KHJA 4MSWC 2CUGA 3ICXA 4R7CA 4DV3O 1BGYH 3B77A 4TWKA 2YIAA 2ZIOA 4Z1MG 2HR3A 4KL1A 1EZVH 4FLXA 3ASNC 4MVRA 2LGQA 4EFEA 1Q7YW 5J2UB 3JD3A 2DMXA 4HYOA 1OHHG 2EZPA 3SPIA 3SPJA 1BT8A 1V9PA 3ABKB 2FTKA 5A9GA 4MVOA 2ZNIA 3P32A 5EYPB 2IJHA 4DV4O 3BPZA 4JI3B 3APQA 1HR0B 4HNAB 1B06A 1XUQA 2CE4A 3FAVB 2Q67A 2Y4TA 2GBOA 4WFHA 2GSMB 3VQWA 5GONB 3F5TA 3TXQA 4CH5A 3T1CA 1QLEC 5BR8O 2ILMA 1N4CA 2RNBA 1L0LH 1NTKH 2OIEA 2F1MA 1R1BA 4JZGA 4JF3A 2WLMA 4JI7B 1XEQA 3FFQA 2IH1C 2W0FC 3LSSA 3D3IA 4DR5O 4ZIBA 3N2GA 2WLKA 5GTIZ 1VF7A 1FKAO 3MDSA 3K9AA 1KP2A 2ITCC 1SQXH 2WA4A 2Y48A 2N05A 4O4JA 4P9OA 5TISZ 2BCCH 3W7TA 2VRZA 5BZBA 3CE2A 1Z2GA 2IM9A 1K9MW 5J9PC 3ZMZA 2N04A 4DRXB 3ZRSA 1WPXA 1Z5VA 2OYQA 1R3IC 1GH6A 2UUBB 1UPGA 2QWNB 1ZSPA 4X62B 4FLWA 3CHXA 4R6ZA 1TUBA 2NN4A 3BY6A 1NKDA 4B3TO 3JAKB 3E22B 2ODMA 2R72A 2A79B 2H3OA 2JDIG 2QEXV 2PZSA 2LJ2A 3JD4A 3H01A 2Q4PA 1F7YA 1PNKA 2HG5C 2JRIA 4X66O 2BTQB 2UXBO 3CCVV 1Y74A 1YJ9V 1NVPD 1YITV 4IYHA 2CTRA 1AI5A 3N2KB 2RDCA 3CCMV 1XQ8A 2A3QA 2JGUA 2EINB 3AG4B 5JCOC 2WLLA 2GTAA 1R6NA 1XHXA 2BSKB 2N74A 2E3CA 1F4MA 2YI9A 3D36A 3L75H 2M7WA 2DYSC 3FYEB 3GWOA 4AQYB 1Y76B 1AR5A 4MTOA 1SESA 1WLEA 1OCRC 4DR4B 4UVAA 3CCQV 4PV1B 4BAYA 3H1JH 2QE7G 1AILA 2Y0PA 2Q0OC 3CRAA 3FKSG 3ZHQA 1V54B 2XT9A 2Z5UA 3ZBHA 3U0ZA 4LF6B 3JARA 3CC7V 2CTQA 3CCUV 3TETA 2GTSA 3T1HO 4UCOA 2YSUB 4Z1VA 2JGDB 3H9VA 1TAEA 5BMVB 2QM4A 4MTGA 2GDSA 4JYAB 1YF2A 2UUCO 5LP6C 1HNZO 4QE7A 1OCZB 4LFCO 2UUCB 4LH7A 3APOA 1YXBA 4B3TB 2ATKC 1GN6A 2VWJA 3OMNB 5EYPA 1XMQO 2ZM6O 4X8AA 1K8AW 2Q9LA 5CN0A 5B3SC 4XDLA 4J11A 3OD4A 3ZMTA 2CDYA 2NNUA 1NR1A 1GRJA 3SDLA 1KBHA 1XREA 5GONA 4PDLA 2GUZB 2UXCO 5LMNO 1CPYA 2EIKC 3T4ZA 1ZL8B 4IYIA 4TUYA 1BHAA 2OTJV 2PGGA 1NH2B 2OCCC 4H33A 3BRCA 4J41A 4X65B 4DV7B 3ZCCA 3FYIB 2JIZG 5JH7B 4NKGB 5H2FZ 2HKOA 1MMMA 5LOVB 1NJIW 1VF6C 3CD6V 2B1GA 3OW2U 4RQEA 1TGOA 4TV8B 4O4LB 3CSXA 1S5JA 3MHSC 4YXWG 3HKDB 4J7ZA 5IJ9A 1SRYA 3CCRV 4FM0A 4FLVA 3ASOB 2DWDC 1AJQA 1SA0B 1R6TA 5IWAB 2F66C 4X66B 2VQFO 3LNNA 3BA9A 2LQTA 2CTWA 1J95A 3D8CA 2MW2B 4TQDA 5K1PA 3AG1B 2CGNA 1Q90D 4OPAA 4UVCA 4CH4A 1JPXA 2LP7A 3W7UA 4K8XA 5EC1C 1M56C 3E8HA 4YJ3A 1Q81W 3A0RA 2IH3C 4PA9A 4I9WA 2CAZC 1A32A 1YTFD 5EZYA 2DJVA 2UXDO 4JI3O 2YIBA 1KKCA 3E83A 4I5SA 3D36C 1IX9A 3CJHA 3EHBB 1NTMH 1NT2B 1DTOA 2GHYA 1JA8A 4FLUA 3WB0A 3T2MA 3ABUA 1GM7A 1I94B 1I94O 3BCCH 4JPRA 4W4KA 4HZ3A 2LO1A 1W0JG 1Q5OA 2F4VO 2ARHA 5EBWC 1L0NH 4ZHQA 4TOIA 3KKYA 4DUZO 2A7WA 3E89A 2QWPB 2BTOA 2UUAB 1KMIZ 1G8MA 3OEHG 5H5NA 5IE9A 4PDRA 4B3SO 5IY5B 3F7VC 4NXNO 1QLNA 1EM1A 4JI6B 3AG7A 2VS0A 4IT5A 4DV2B 1KD1W 2AHZA 3ABTA 3ASNB 3M99B 1RM1B 4DR7B 2UU9O 2WLLB 3JAMN 3CRMA 3T1YO 1R73A 2QWQB 2WLIB 2QWRB 3OUFA 1K34A 5C8YA 5B1AB 3QNEA 1YI2V 2RMKB 4DV1B 1DGSA 4TT3G 1VQOV 1AJNA 3AEIA 4CZZA 4AHCA 2JS3A 3THOA 3ZMVA 5CA0B 1US6A 3EXAA 2OT5A 4JI1O 3C3SA 2CH7A 1VQ7V 1M1KW 3J7AU 3AG2C 4DR3O 4JI4O 5KUKA 3IC7A 4EFBA 1K5QA 4DXWA 4X65O 2PI4A 1S76D 2KG7A 2F43G 3MHHC 1P7GA 1IZ3A 1I0HA 3JAWA 2BOBC 2Q7EA 1WB7A 4NXMB 1IDSA 5KHGA 4JV5O 2A9HA 4FIPC 4YHHB 1XHZA 5FNVB 4I50A 4UB6Z 3UO3A 4RUEA 4LR3A 1E1RG 1H2KA 3CMAV 3A2FA 2EIMC 1WA8A 1IXBA 3KZIZ 3ETDA 5H6RA 2RN9A 2E5LO 4DV4B 1WB8A 2V7QG 3ABMB 2ZM6B 3JATA 4MS2A 3VQVA 1Y76A 1KYOF 5B1BC 1SS3A 2FB5A 1VF5B 1ZX3A 4ICGA 3OR6C 3K08A 4FVMA 4NYKA 4QPKA 2UUAO 3OEEG 1H2NA 2X6CA 2JEUA 4H44B 1ROPA 5CA3A 3N2KA 5LMNB 4CH6A 4PA6A 1KQSU 5L3FA 4DV0B 1URFA 2WWWA 4CC5A 5LHIA 3ZHVA 3G4SV 4U3JB 3OM3B 1P84F 4IIJA 1ZAUA 1YJNV 5F2VO 1S0VA 4DUZB 1PD3A 1GK9A 3IFXA 3BFRA 2F4VB 4DR2B 3ZN0A 2EJRA 4LNUA 4FM2A 1KUQA 2EBOA 3OGIB 4I7ZB 1N32B 2P5OA 2D2CB 1X59A 5JQGA 3LDEA 5KX5B 3P3NA 3UT5B 4IL6Z 1PV0A 1ZLZA 4FFBA 3RVZA 4I50B 3E35A 1OCRB 1CP9A 3ZHUA 2OCHA 5IJ9B 2XAGA 2ADQB 1DK1A 2HEPA 2LW7A 2CH7B 1K7DA 1YSCA 4GUNA 4DR3B 2V1DA 3VOUA 1NBMG 4ZBMA 3SPGA 2P22C 4UUJC 4CC6A 3B2EE 4O2AA 2OIGA 2ETNA 5EBLC 5JVDA 2YUAA 1Q86W 4LF5O 2VQFB 2HHHB 1Q43A 4PELA 2AXTZ 4MVUA 2F95B 5CBFA 4LF9O 2B1IA 2IJJA 3RW0A 1MNGA 1BL8A 2P7TC 1WP7A 4WBNB 4DV7O 4KHPB 4YY3O 3IAYA 4O4HA 4LF7B 1AP5A 5LP6B 4YJ2A 4I0XA 3G71V 3OGCC 4DV6B 2WPDG 1XL4A 1H2MA 1AJPA 2R9RB 1IBMO 1IBMB 1G1XB 2QSAA 1VQKV 4QGPA 1M93A 4UV9A 4PDVA 2Q5ZA 4X64O 1NR7A 2V4DA 2D3OW 1FFXA 1SZXA 1UFIA 4EKWA 2F23A 3K04A 4U3FH 2Q7HA 2ZNJA 2DWEC 1WAZA 1PPJH 3JARB 4FPPA 4OX9O 3AK1A 2XAFA 5DEDA 3JAWB 5EZYB 2DN9A 4MVQA 4XDJA 3O65A 1JR9A 3RN4A 3SYPA 1HDJA 2W6IG 3CC4V 4JYBA 1VARA 2A0LA 4GT1A 5FPOA 1PKXA 4IIJB 2JS5A 2ADPA 3K79A 3HKCA 3CRQA 3E8BA 1QVFU 2WLNA 4AQYO 1FYJA 2X0LA 1H8EG 3E86A 4TQFA 4B3MO 3WU2Z 1FAFA 2UU9B 4B3MB 5CB4A 2EJ7A 3H1LH 3AK2A 5L3DA 3OFNG 2ZDIC 3P30A 1PL4A 1NH2D 3IC9A 1YHQV 5EIBC 3MAQA 4UCTA 1HP8A 1F4NA 1AR1B 3JSNA 1SKVA 2ZE7A 2W0XA 4WF9V 2ZD9A 3AG3B 4EEQA 5IT9N 3HKEA 3B4SA 4LWSA 1Y67A 1OCCC 2UXBB 1M57B 4BIZA 4GYCB 4DV6O 1DF5A 1QU7A 3OTOO 1IXMA 2L6LA 3K9SA 3OMIB 2XOKG 1QBZA 1V54C 2GUZA 1QR8A 3ZRWA 3K06A 2E75B 4JV5B 1PP9H 2P6JA 1PL0A 3ETEA 4B3RO 1NQTA 4OXSA 4K0KO 2WLIA 3CX5F 4X20A 3BHPA 1L8DA 1BQ0A 2QM7A 2ZIMA 3X2QB 1FXKB 3ABLC 1QHTA 1IVSA 3JAKA 1LUVA 1YZBA 3ZRVA 4CS4A 1M5IA 4MVZA 2ZDIA 3B40A 5C8YB 4LFBB 3I55V 1T5EA 5KMGB 2K1EA 4LFBO 3SR2C 1Y74B 4JGSA 3CS5A 1YCIA 5EK0A 4ZOLB 1AVMA 3TGUH 4DR2O 4MVMA 4PA3A 4JAUA 4JI6O 4X1KA 3CXHF 1ZL8A 1N34O 4LF4B 1Z5WA 2Q7GA 3Q4HB 3BABA 3P3PA 1FJGO 1M9NA 4PA4A 5EC2C 4J10A 2B5UA 2Y0IA 2R9AA 2ZKOA 3UM7A 1TVKB 3RT3C 3K3WA 2QTSA 4FLYA 1I08A 2ZQMA 1OZ0A 5LGTA 2YDEA 2UXCB 4DUYB 2Q69A 3DC5A 4JYCA 1TA8A 2P06A 3JASB 4MVSA 5KAFZ 4O4HB 4J9YB 2BTQA 1XNRB 3RYIB 1FXKA 2KSDA 1Q82W 3OT7A 3HR0A 3N2GB 3DC6A 1SA0A 2EIJB 4UCRA 1P7BA 4DV3B 1B3QA 2JGDA 1LNQA 5B1OA 5KAIZ 5B66Z 4O2AB 3AG1C 2FKXA 3SPHA 2HFEC 2X7RB 2F93B 1YTFB 4DV5O 3KG2A 5JJJB 4R50A 5BXZA 4NXMO 1EFRG 5GW7A 2NR5A 3CWBH 1QLEB 5KLVH 2ZE6A 3PJSK 3JALA 1K92A 1V55B 1K4DC 4BIUA 4D6TH 5B5EZ 4ZI7A 3J80N 4TV9B 3RWRD 2UXDB 4X88A 3L73H 1JCHA 3RYHA 1N0NA 4LNUB 2XHBA 1E79G 4QNHB 1PM9A 1SQFA 4OPHA 1IBLB 1GKFA 3L9DA 4BW5A 1HNWO 2HJDA 1RPRA 3CCEV 5BY1A 2DE0X 2H94A 1H8HG 1VQLV 2LGWA 2XAHA 3RYCA 3OE7G 1FJGB 4F6EA 2KKWA 4LF4O 3B09A 2WA3A 3QO5A 4LP8A 2QDOA 1R3KC 2KQXA 1AI4A 1JFFA 3ETGA 1U97A 4NXNB 1XBLA 4HNAA 1N36O 4PDMA 5C93A 1K33A 4KFMA 4H37A 3A0HZ 4LC1A 1FS0G 4NTWA 2HLDG 1TVKA 1HR0O 1AB3A 4Q20A 1VIBA 2Q8VA 5IJ0A 1NI8A 1EN4A 4E4EA 1Q6UA 3STZC 4RQFA 3NXSA 1THZA 2QKCA 1VQ8V 4GX0A 5DECA 5IYBO 2IBZH 1KECA 4K8ZA 4IHJA 3HKBB 5L3BA 2WLHA 1UJWB 4L8JA 1QVGU 3SPCA 2Z0AA 3DSQA 1JJ2U 5LXTA 1S5LZ 2KG7B 5H9CA 1FFTB 1RP3B 3ZIAG 1XMOB 4UCVA 2AHYA 3I5DA 1S3JA 2IW5A 3B8NA 4KHPO 4X64B 1W2BU 4PJ0Z 1GTOA 2ZT9B 2PYLA 3WG7C 2EIMB 1VQ5V 1GN2A 1GMGA 3JYCA 1IURA 2UXNA 3I56V 4K0KB 2HP8A 5J2TB 1SQVH 1MZFA 4BR6A 3O9OA 4JAAA 4KUMA 4NB5A 5IYZA 1M90W 1BS3A 3L71H 4R8CA 4B7KA 1MABG 1WNSA 1MA1A 1XDCA 1SQGA 1JQ0A 3OR7C 2AGAA 1Y4MA 1HNZB 5KUMA 2YS8A 1EN5A 2QKAA 2AZ2A 4B08A 4I4TB 3ZEDA 1P4RA 2HVJC 3HB3B 3STLC 2DW4A 3M8AA 4NTYA 4D7SA 1CEZA 3B8MA 5A2QN 5B3SB 5LGUA 4PD4F 3CRCA 4UCUA 4J9ZB 4GX2A 4C7UA 4F4LA 4FZ0A 4O4JB 4DR6O 2QM8A 4N23A 1ENVA 4HAMA 1WP8A 5J2UA 2JEXA 4JI2O 5JQGB 3LUTB 2M6YA 4ZOLA 3JCZA 4J42A 1RPOA 5LYJB 1VQ9V 5KHKA 4X62O 1GM8A 3K03A 4JI0O 1VMGA 2LFRA 4I0XB 4DR4O 1RSOB 4K35A 2IJIA 5K1XA 2DOSA 2YC0A 4PI0A 5L3CA 3E8GA 3ZMSA 2QR4A 3E8FA 5HFLA 1OJHA 3FAVA 4FZ1A 4JI8B 1N33O 2OTLV 5LMUO 4XDKA 1GM9A 2ZCEA 5E79Z 1GN3A 4DW0A 2IU3A 4RAIA 3D3QA 5LXTB 5D5QA 1I7FA 5LP6A 4OGQB 4H13B 3RYIA 1AROP 5LGNA 2R70A 4I55B 3G6BA 3HKBA 4DO2A 1H2SB 1Q8IA 1XMQB 2ZR2A 2EINC 3AG4C 4LFAB 4LFAO 2PI5A 3JASA 4X1IB 4X20B 5HFMA 1BE3H 1KKDA 3L74H 2E76B 4QPJA 2ZXWC 3JALB 4JZ2A 4O4LA 3LSUA 2AW9A 3SYCA 2E74B 4DR1B 3ETQA 4UCSA 3LDDA 4CS2A 1FD9A 1O9GA 3T1HB 4RO2A 2ITDC 3CYOA 4GLXA 1N32O 1OCZC 1B04A 1F51A 5LA6A 4QIWF 2IJKA 2L35A 2YIBD 3ZRXA 4E2LA 4MT8A 3HKEB 3LSQA 5FLXN 2DYRB 4QE9A 1G6UA 3K5OA 1AI6A 3OTFA 1D2DA 4ABMA 3QO7A 1RFYA 3C90A 3RFRA 3H1HH 3H1IH 5LL6Y 3IJ4A 3R66A 1HNXO 2PUSA 4O2BB 3BEHA 3OUSA 3RYFB 5IYCO 2CGOA 4DR6B 2CK3G 5JJEB 3RYHB 5FPRA 1RM1C 3K5LA 1IBKB 1OCOC 1K5SA 1Y6XA 3GWKC 1JJOA 4GX5A 1WA8B 4CH3A 4JTCB 2YIDA 2EIJC 2PTMA 3GB7C 1B6QA 4KXRA 1MOFA 1W59A 1K4CC 2MK3A 1ZWIC 3JSLA 4DK0A 2JJ2G 3CP1A 1NZ6A 5JCOA 3ZS8C 1H38A 5LA6B 3CMEV 4FLZA 1N0JA 1SQBH 4O4IA 2EX3A 4G28B 3VQYA 4P2ZA 4ZHQB 2RJZA 1HWYA 3EFFK 3AG2B 5KMGA 3JATB 3FB5C 5JH7A 1G4YB 3K5MA 1VEWA 3ABMC 1FFXB 4MTFA 2HVKC 1YVWA 2P4KA 4UB8Z 4FK5C 4WFGA 5IWAO 5CB4B 2YICA 4JI4B 2EILB 2Q0AA 5KX5A 2E5LB 3JD1A 1XNQB 1SC5B 3QF7A 2YI8A 4YIPA 2BSKA 4DV5B 5GTHZ 4LBEC 1DF4A 1XMOO 3ASOC 4AI8A 3ZJZA 3KCYA 4DK1A 1I5YA 1HNWB 3J81N 3TK1A 4QJFB 3FB6C 3W7SA 4G2KA 3BVOA 2BE3A 2X6AA 5CA0A 2H8PC 1BQZA 2XNDG 5EBMC 4JASA 3ABLB 5CBGA 3W7WA 4YHHO 1MSWD 4LF8O 2LFSA 1M56B 3ZHSA 2BOCC 5EIBD 4UXNA 3DXRB 3SJBC 3RVYA 3K0DA 3CRRA 4WCEV 3A0BZ 3SYQA 1VP7A 1LR1A 4G27B 5IY5C 1FXHA 3FX7A 4CBCA 4DR7O 2Q6AA 5AG2A 4GKJO 2YEVB 1QCEA 4FLTA 2QKSA 1YIJV 4X9QA 1N36B 1WPBA 4JTAB 3K59A 1IBLO 1XI1A 4RWUA 3CPWU 2QJ1A 4LF8B 1L1FA 1S5HC 4JYAO 1N8RW 2Y69C 5KA5A 1VF6A 1E1QG 2YXLA 4DV2O 3UCSC 5B1AC 1VQPV 3ZN1A 2EULA 5CA1B 1KC8W 3BAAA 3ZHRA 4P30A 3SYOA 2JVDA 2Z3YA 3JCUZ 3T1YB 4DV0O 2PF4E 4NR1A 4BWAA 1MSDA 2RQ6A 3GVMA 5IDJA 1J5EO 4AILC 2QGNA 1HNXB 2AZ0A 3OMAB 4DUYO 4K3AA 4U7NA 3ZHTA 3G67A 1NS1A 4B7EA 4U7OA 1SETA 2DYSB 2HHHO 1WJZA 1GAXA 4WBNA 1K3EA 4WFFA 3OTOB 1QNMA 2VWKA 4JI0B 3WG7B 2RCVA 2WSSG 4BIOA 3CCSV 1EBOA 5L3GA 1RSOA 3S3WA 3VBBA 3MD0A 4L87A 3N27A 1KP3A 2O57A 4LFCB 1EZJA 4WFBV 4GKKO 2NLJC 1WN7A 3CEIA 2JJ1G 4EB6A 3G80A 3ZRWB 3VQXA 3CB2A 4LH6A 3ABKC 4WFEA 3ZX6A 1HW7A 3K58A 5ITZA 3UKMA 2FL4A 3M7MX 1JVMA 3CCJV 3G6EV 4DR1O 4H0LB 1YJWV 4FFBB 3CXCU 4YIOA 3R65A 1SERA 4F6RA 4LWSB 1XILA 4UVBA 5KA6A 2YEVA 3A8TA 3U11A 4I4TA 5FL7G 4ASUG 1R3JC 3QTCA 5IJ0B 1AP6A 4XBFA 3RGBA 2VQEO 4N21A 4RUFA 5JVDB 2ZR3A 4LCUC 2CTPA 1GN4A 1AR4A 4UV8A 3FB7C 1KU9A 5H6QA 4FM1A 1N34B 1JFFB 4MW3A 4GX1A 1GO3F 5LMUB 2YXYA 1XOUA 4Z2WA 5LBQA 4MTXA 3E2EA 2ZE8A 3FB8C 5LHGA 1H2GA 4X1YA 3EVKA 1TUBB 3UT5A 3K5NA 2QA4V 4MW8A 4FMTA 1FXVA 1OCCB 5LYJA 3DGEA 4DW1A 1X4TA 4EB6B 3C3TA 2P4VA 4LF7O 4GCZA 5BR8B 4YY3B 2DQ3A 4P9PA 4TSFG 3PN1A 1LUWA 1Q3EA 4X1KB 1U96A 2WLJA 1PNLA 4JI2B 5CMUA 5FNVA 4PA7A 3BA8A 4JTDB 4UFZA 3RBZA 3H1KH 2XTAA 1JX9A 4LF6O 4FJCC 1I5XA 5ITZB 3T4DA 1TUEB 4HBNA 1SQPH 1ORQC 4LF5B 3ZMUA 3UO2A 4KP4A 1KB9F 4GKKB 1NU1H 2P67A 2YXHA 4YJ2B 2XUMA 4CS3A 1S72V 4GZRB 5J2TA 1BCCH 2FYUH 1F23A 3JD0A 5CA1A 4JI7O 5D5PA 3F5WC 4OX9B 3RYFA 2XASA 4PI2A 3W7XA 3SJAC 2VQEB 2EZOA 1MZEA 5CBHA 4BW9A 1VQNV 1M4UA 3SYAA 5LHHA 5E1AC 3TCUA 5IYDO 3OAAG 1OV9A 3CCLV 3JD2A 5BMVA 1O9HA 5KHHA 1Q6HA 4TV9A 1OCOB 4U3JA 2PY5A 5DM6V 1JMKC 1D5AA 5JJNB 2Q73A 3DTUB 1BMFG 1P49A 2XAJA 1VQ6V 3UQ8A 1K73W 4JAVA 3L72H 1ZTEA 4J80A 2UUBO 3F7YC 2UXXA 4DRXA 4YJ3B 4X1YB 1QR9A 4JYYA 1IBKO 3CJHB 2JK5C 3L70H 1XNRO 2QTOA 3DXRA 4TUYB 2OWOA 1VQ4V 5IYZB 1Y66A 1COWG 4PHZA 1D5NA 2EIKB 5L3EA 1YDXA 4A5UB 4J7KA 4Q6GA 2EILC 3SJQC 2GV9A 4O2BA 1J5EB 2OCCB 4GKJB 4JI8O 1N33B 1PNMA 3CC2V 2X6BA 4FFKA 1FPOA 3WFVA 1NVPB 2QWOB 3HKDA 4JI5B 3TXSA 3AK3A 2IU0A 3TJTA 4TV8A 1R3LC 4LF9B 3FD9A 3QO8A 1BZKA 3NR7A 1VQMV 4JI1B 3K57A 3WB2A 4F6RB 4W4LA 1BSMA 1H2LA 3RYCB 4ZI7B 2ZINA 5DN6G 2KB1A 2A06H 3S3XA 3E22A 1R6KA 4DV1O 1AI7A 1JOYA 2R9IA 3HPLC 3LDCA 4J7JA 4DR5B 4JI5O 2ZXWB 2XAQA 2K9PA
chains in the Genus database with same CATH topology
1M9NA 3ABMC 4PA4A 1SZTA 5EC2C 1G8MA 3AG3C 5B1NA 2B5UA 4MTFA 5B1BB 2HVKC 3OEHG 3UM7A 3ML0A 4FK5C 2P90A 3K3WA 4PDRA 4WFGA 1M57C 5IY5B 3X2QC 1FXKC 1V55C 3F7VC 2ZQMA 2EILB 1OZ0A 1QLNA 5LGTA 3K0GA 3JD1A 1DLBA 2Q69A 1KD1W 4JYCA 4MVSA 2AHZA 3IGAC 3ABTA 3ASNB 3M99B 4WFAV 1RM1B 2WLLB 2C2AA 4LBEC 1DF4A 1R73A 2HJFC 4J9YB 2WLIB 3ASOC 3OUFA 1K34A 3ZJZA 2Y69B 1FXKA 2DYRC 1I5YA 1Q82W 1W0KG 5B1AB 1MG1A 2EIJB 3QNEA 1P7BA 1YI2V 1S77D 3TK1A 4TT3G 1BHBA 2WAMA 4QJFB 1AJNA 1VQOV 1LNQA 3AEIA 3FB6C 2DQ0A 3LNMB 5B1OA 4CZZA 3W7SA 4G2KA 2W6JG 3ZMVA 3AG1C 2X6AA 3SPHA 2HFEC 2X7RB 2H8PC 1YTFB 2OT5A 2XNDG 4X89A 5EBMC 1VQ7V 4JASA 3ABLB 5CBGA 3W7WA 1M1KW 1MSWD 3AG2C 3KG2A 2LFSA 1M56B 4R50A 2BOCC 5KUKA 1EFRG 3IC7A 4UXNA 1XL6A 5GW7A 1QLEB 3RVYA 1K5QA 3K0DA 2Q68A 4DXWA 2PI4A 4WCEV 1S76D 3SYQA 2F43G 1K97A 3MHHC 3PJSK 1K92A 4G27B 4ZKIA 5IY5C 2BOBC 1V55B 1FXHA 4MSWC 1K4DC 4R7CA 4BIUA 4CBCA 2Q6AA 3B77A 2YEVB 1QCEA 4TWKA 2QKSA 1YIJV 4Z1MG 2HR3A 2A9HA 4JTAB 4FIPC 4X88A 3CPWU 3ASNC 1JCHA 4MVRA 1L1FA 1S5HC 1Q7YW 4RUEA 3JD3A 1E1RG 1N8RW 2Y69C 5KA5A 1E79G 3CMAV 4HYOA 1E1QG 1OHHG 2EIMC 4QNHB 5B1AC 2EZPA 3ETDA 3SPIA 5H6RA 3SPJA 1VQPV 1GKFA 3ZN1A 3ABKB 4BW5A 1KC8W 2FTKA 2V7QG 3ABMB 4MVOA 3P32A 1RPRA 2IJHA 4MS2A 4P30A 3CCEV 3SYOA 5B1BC 2H94A 1H8HG 1VQLV 2Z3YA 2XAHA 3OR6C 3K08A 3OE7G 2Q67A 4QPKA 4WFHA 2GSMB 3OEEG 5IDJA 2X6CA 2JEUA 3QO5A 1ROPA 3OMAB 4LP8A 4U7NA 5CA3A 1R3KC 1AI4A 4U7OA 3T1CA 1QLEC 3ETGA 1SETA 2DYSB 4PDMA 4PA6A 1K3EA 4WFFA 5C93A 1KQSU 1K33A 5L3FA 4KFMA 3WG7B 4H37A 4LC1A 2WWWA 1FS0G 4JF3A 2WLMA 2WSSG 5LHIA 2HLDG 3CCSV 2IH1C 2W0FC 3LSSA 3G4SV 3OM3B 3D3IA 1EBOA 4Q20A 1YJNV 5L3GA 2WLKA 1S0VA 1PD3A 1GK9A 3IFXA 3MD0A 3K9AA 3VBBA 1KP2A 4L87A 3STZC 2ITCC 4RQFA 1KP3A 3NXSA 2Y48A 1THZA 1EZJA 4WFBV 3ZN0A 1VQ8V 2EJRA 2NLJC 4GX0A 2EBOA 2JJ1G 4P9OA 3ZRWB 5IYBO 3W7TA 3ABKC 4WFEA 5BZBA 1KECA 3LDEA 3UKMA 1K9MW 1JVMA 5J9PC 5L3BA 2WLHA 3CCJV 3ZMZA 3G6EV 1UJWB 1QVGU 3SPCA 1WPXA 3ZRSA 1YJWV 3RVZA 1R3IC 3CXCU 1JJ2U 3R65A 3E35A 1OCRB 1CP9A 1SERA 5H9CA 1FFTB 3ZIAG 2XAGA 2AHYA 4R6ZA 4UVBA 1S3JA 3B8NA 2IW5A 3BY6A 5KA6A 2YEVA 1K7DA 1YSCA 5FL7G 4ASUG 1R3JC 1NKDA 1W2BU 2V1DA 3VOUA 1NBMG 2A79B 2JDIG 4ZBMA 3SPGA 1GTOA 4XBFA 2QEXV 3JD4A 4UUJC 3WG7C 2EIMB 3H01A 1VQ5V 1GMGA 3JYCA 4N21A 4RUFA 5EBLC 1PNKA 2HG5C 2UXNA 2ZR3A 3I56V 1Q86W 4LCUC 4PELA 4MVUA 5CBFA 4KUMA 4UV8A 2B1IA 2IJJA 3FB7C 4R8CA 5H6QA 3CCVV 1YJ9V 1M90W 1NVPD 1YITV 1MABG 3RW0A 4MW3A 1BL8A 4GX1A 2P7TC 1AI5A 1GO3F 3CCMV 1JQ0A 2EINB 3AG4B 3OR7C 2WLLA 1R6NA 1Y4MA 5KUMA 5LBQA 1F4MA 3D36A 4MTXA 3E2EA 3G71V 2M7WA 3OGCC 2DYSC 3FYEB 3FB8C 2WPDG 3GWOA 1P4RA 2HVJC 1H2GA 3HB3B 5LHGA 1XL4A 1SESA 2DW4A 1WLEA 4MTOA 3STLC 2QA4V 4MW8A 1AJPA 4FMTA 1OCRC 1FXVA 1CEZA 4UVAA 3CCQV 3B8MA 1OCCB 2R9RB 3DGEA 5B3SB 5LGUA 4BAYA 4J9ZB 4GX2A 4F4LA 4GCZA 1VQKV 2QE7G 2QM8A 4N23A 1ENVA 4HAMA 2DQ3A 4P9PA 4TSFG 4UV9A 2JEXA 2WLJA 1PNLA 4PDVA 3FKSG 1V54B 1NR7A 5CMUA 4PA7A 3LUTB 2Z5UA 2D3OW 3JCZA 1RPOA 1VQ9V 4JTDB 4EKWA 3RBZA 3K04A 1GM8A 3K03A 1JX9A 2DWEC 3CC7V 4FPPA 4FJCC 3CCUV 2LFRA 3TETA 1I5XA 2XAFA 3T4DA 1TUEB 2IJIA 2YSUB 4MVQA 1ORQC 4XDJA 4MTGA 3ZMUA 5L3CA 3E8GA 3ZMSA 3SYPA 4KP4A 3E8FA 2W6IG 5HFLA 3CC4V 4QE7A 1OCZB 4JYBA 2P67A 2A0LA 4GT1A 2OTLV 1S72V 1PKXA 4XDKA 2ATKC 1GM9A 3OMNB 3K79A 1F23A 3E8BA 4X8AA 3JD0A 1QVFU 2WLNA 1K8AW 5CN0A 2IU3A 5B3SC 4RAIA 2X0LA 3F5WC 4XDLA 1H8EG 3E86A 2XASA 3ZMTA 2NNUA 1NR1A 1AROP 3W7XA 5LGNA 5L3DA 2EZOA 4PDLA 3OFNG 2ZDIC 4DO2A 5CBHA 3P30A 2ZR2A 1CPYA 3AG4C 2EINC 2EIKC 3T4ZA 2PI5A 1NH2D 1VQNV 3SYAA 5HFMA 1BHAA 1YHQV 1KKDA 2OTJV 5LHHA 5E1AC 1NH2B 1F4NA 4QPJA 2OCCC 3TCUA 3OAAG 2ZXWC 1AR1B 5IYDO 4H33A 4WF9V 2ZD9A 3AG3B 3CCLV 3JD2A 3SYCA 3ZCCA 3FYIB 2JIZG 1OCOB 3LDDA 2HKOA 1OCCC 1M57B 3CD6V 1NJIW 5DM6V 2B1GA 4RO2A 4BIZA 3OW2U 4RQEA 2ITDC 1DF5A 3DTUB 3CYOA 1BMFG 1OCZC 2XAJA 3MHSC 4YXWG 1IXMA 3OMIB 1F51A 1VQ6V 4QIWF 1K73W 2XOKG 1QBZA 4JAVA 1SRYA 3CCRV 1V54C 2IJKA 1QR8A 3ZRWA 3ZRXA 3K06A 3F7YC 4E2LA 4MT8A 3LSQA 3ASOB 2UXXA 2DWDC 1AJQA 2P6JA 1PL0A 1QR9A 2DYRB 3ETEA 4QE9A 2JK5C 2QTOA 1NQTA 4OXSA 1AI6A 2WLIA 1VQ4V 1Y66A 1COWG 1J95A 3QO7A 3AG1B 2QM7A 2EIKB 5L3EA 3X2QB 1FXKB 4UVCA 2EILC 3ABLC 1JPXA 2LP7A 3SJQC 3W7UA 3BEHA 3OUSA 1M56C 3E8HA 5EC1C 1Q81W 2OCCB 3A0RA 5IYCO 2IH3C 4PA9A 1PNMA 4I9WA 2X6BA 2CK3G 3CC2V 3ZRVA 1YTFD 1RM1C 4MVZA 1OCOC 2ZDIA 3WFVA 1NVPB 1K5SA 4GX5A 3I55V 3E83A 2IU0A 2K1EA 1R3LC 4I5SA 4JTCB 4JGSA 3EHBB 3QO8A 2EIJC 3GB7C 1DTOA 5EK0A 1B6QA 2GHYA 1VQMV 1MOFA 2MK3A 1K4CC 1ZWIC 3T2MA 3ABUA 1GM7A 2JJ2G 3CP1A 1H38A 4JPRA 3CMEV 4HZ3A 4MVMA 4PA3A 1W0JG 5DN6G 2KB1A 4G28B 1R6KA 4JAUA 4P2ZA 5EBWC 1AI7A 1HWYA 3EFFK 1JOYA 2R9IA 3AG2B 3HPLC 3E89A 3LDCA 3FB5C 1G4YB 2ZXWB 2XAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHB A;  1BHA A; 
#chains in the Genus database with same CATH topology
 2B9Z A;  1SZT A;  5B1N A;  3AG3 C;  5B1B B;  4B3R B;  3ML0 A;  1CXZ B;  2Y4U A;  3SJC C;  5JWP A;  2P90 A;  3KCX A;  2G38 A;  1M57 C;  3X2Q C;  1FXK C;  1V55 C;  2ZE5 A;  4O4I B;  4IHJ B;  3K0G A;  1XNQ O;  4DYL A;  2FML A;  1DLB A;  1SF9 A;  3QVN A;  4IGG A;  3SGI A;  4NVP A;  4X1I A;  3IGA C;  4B3S B;  4WFA V;  1QQC A;  3QG5 A;  1Q6I A;  2C2A A;  3WB1 A;  2PYJ A;  2HJF C;  4I55 A;  1YEW A;  2Y69 B;  4I9Q A;  2DYR C;  1W0K G;  1EN6 A;  5KHI A;  1MG1 A;  3HKC B;  3U10 A;  1S77 D;  1BHB A;  2WAM A;  3LNM B;  2DQ0 A;  2W6J G;  4NTX A;  2LW1 A;  4X89 A;  4D7T A;  1NTZ H;  1SQQ H;  5LOV A;  1ZUQ A;  1XL6 A;  3Q4H A;  2Q68 A;  1K97 A;  4ZKI A;  5KHJ A;  4MSW C;  2CUG A;  3ICX A;  4R7C A;  4DV3 O;  1BGY H;  3B77 A;  4TWK A;  2YIA A;  2ZIO A;  4Z1M G;  2HR3 A;  4KL1 A;  1EZV H;  4FLX A;  3ASN C;  4MVR A;  2LGQ A;  4EFE A;  1Q7Y W;  5J2U B;  3JD3 A;  2DMX A;  4HYO A;  1OHH G;  2EZP A;  3SPI A;  3SPJ A;  1BT8 A;  1V9P A;  3ABK B;  2FTK A;  5A9G A;  4MVO A;  2ZNI A;  3P32 A;  5EYP B;  2IJH A;  4DV4 O;  3BPZ A;  4JI3 B;  3APQ A;  1HR0 B;  4HNA B;  1B06 A;  1XUQ A;  2CE4 A;  3FAV B;  2Q67 A;  2Y4T A;  2GBO A;  4WFH A;  2GSM B;  3VQW A;  5GON B;  3F5T A;  3TXQ A;  4CH5 A;  3T1C A;  1QLE C;  5BR8 O;  2ILM A;  1N4C A;  2RNB A;  1L0L H;  1NTK H;  2OIE A;  2F1M A;  1R1B A;  4JZG A;  4JF3 A;  2WLM A;  4JI7 B;  1XEQ A;  3FFQ A;  2IH1 C;  2W0F C;  3LSS A;  3D3I A;  4DR5 O;  4ZIB A;  3N2G A;  2WLK A;  5GTI Z;  1VF7 A;  1FKA O;  3MDS A;  3K9A A;  1KP2 A;  2ITC C;  1SQX H;  2WA4 A;  2Y48 A;  2N05 A;  4O4J A;  4P9O A;  5TIS Z;  2BCC H;  3W7T A;  2VRZ A;  5BZB A;  3CE2 A;  1Z2G A;  2IM9 A;  1K9M W;  5J9P C;  3ZMZ A;  2N04 A;  4DRX B;  3ZRS A;  1WPX A;  1Z5V A;  2OYQ A;  1R3I C;  1GH6 A;  2UUB B;  1UPG A;  2QWN B;  1ZSP A;  4X62 B;  4FLW A;  3CHX A;  4R6Z A;  1TUB A;  2NN4 A;  3BY6 A;  1NKD A;  4B3T O;  3JAK B;  3E22 B;  2ODM A;  2R72 A;  2A79 B;  2H3O A;  2JDI G;  2QEX V;  2PZS A;  2LJ2 A;  3JD4 A;  3H01 A;  2Q4P A;  1F7Y A;  1PNK A;  2HG5 C;  2JRI A;  4X66 O;  2BTQ B;  2UXB O;  3CCV V;  1Y74 A;  1YJ9 V;  1NVP D;  1YIT V;  4IYH A;  2CTR A;  1AI5 A;  3N2K B;  2RDC A;  3CCM V;  1XQ8 A;  2A3Q A;  2JGU A;  2EIN B;  3AG4 B;  5JCO C;  2WLL A;  2GTA A;  1R6N A;  1XHX A;  2BSK B;  2N74 A;  2E3C A;  1F4M A;  2YI9 A;  3D36 A;  3L75 H;  2M7W A;  2DYS C;  3FYE B;  3GWO A;  4AQY B;  1Y76 B;  1AR5 A;  4MTO A;  1SES A;  1WLE A;  1OCR C;  4DR4 B;  4UVA A;  3CCQ V;  4PV1 B;  4BAY A;  3H1J H;  2QE7 G;  1AIL A;  2Y0P A;  2Q0O C;  3CRA A;  3FKS G;  3ZHQ A;  1V54 B;  2XT9 A;  2Z5U A;  3ZBH A;  3U0Z A;  4LF6 B;  3JAR A;  3CC7 V;  2CTQ A;  3CCU V;  3TET A;  2GTS A;  3T1H O;  4UCO A;  2YSU B;  4Z1V A;  2JGD B;  3H9V A;  1TAE A;  5BMV B;  2QM4 A;  4MTG A;  2GDS A;  4JYA B;  1YF2 A;  2UUC O;  5LP6 C;  1HNZ O;  4QE7 A;  1OCZ B;  4LFC O;  2UUC B;  4LH7 A;  3APO A;  1YXB A;  4B3T B;  2ATK C;  1GN6 A;  2VWJ A;  3OMN B;  5EYP A;  1XMQ O;  2ZM6 O;  4X8A A;  1K8A W;  2Q9L A;  5CN0 A;  5B3S C;  4XDL A;  4J11 A;  3OD4 A;  3ZMT A;  2CDY A;  2NNU A;  1NR1 A;  1GRJ A;  3SDL A;  1KBH A;  1XRE A;  5GON A;  4PDL A;  2GUZ B;  2UXC O;  5LMN O;  1CPY A;  2EIK C;  3T4Z A;  1ZL8 B;  4IYI A;  4TUY A;  1BHA A;  2OTJ V;  2PGG A;  1NH2 B;  2OCC C;  4H33 A;  3BRC A;  4J41 A;  4X65 B;  4DV7 B;  3ZCC A;  3FYI B;  2JIZ G;  5JH7 B;  4NKG B;  5H2F Z;  2HKO A;  1MMM A;  5LOV B;  1NJI W;  1VF6 C;  3CD6 V;  2B1G A;  3OW2 U;  4RQE A;  1TGO A;  4TV8 B;  4O4L B;  3CSX A;  1S5J A;  3MHS C;  4YXW G;  3HKD B;  4J7Z A;  5IJ9 A;  1SRY A;  3CCR V;  4FM0 A;  4FLV A;  3ASO B;  2DWD C;  1AJQ A;  1SA0 B;  1R6T A;  5IWA B;  2F66 C;  4X66 B;  2VQF O;  3LNN A;  3BA9 A;  2LQT A;  2CTW A;  1J95 A;  3D8C A;  2MW2 B;  4TQD A;  5K1P A;  3AG1 B;  2CGN A;  1Q90 D;  4OPA A;  4UVC A;  4CH4 A;  1JPX A;  2LP7 A;  3W7U A;  4K8X A;  5EC1 C;  1M56 C;  3E8H A;  4YJ3 A;  1Q81 W;  3A0R A;  2IH3 C;  4PA9 A;  4I9W A;  2CAZ C;  1A32 A;  1YTF D;  5EZY A;  2DJV A;  2UXD O;  4JI3 O;  2YIB A;  1KKC A;  3E83 A;  4I5S A;  3D36 C;  1IX9 A;  3CJH A;  3EHB B;  1NTM H;  1NT2 B;  1DTO A;  2GHY A;  1JA8 A;  4FLU A;  3WB0 A;  3T2M A;  3ABU A;  1GM7 A;  1I94 B;  1I94 O;  3BCC H;  4JPR A;  4W4K A;  4HZ3 A;  2LO1 A;  1W0J G;  1Q5O A;  2F4V O;  2ARH A;  5EBW C;  1L0N H;  4ZHQ A;  4TOI A;  3KKY A;  4DUZ O;  2A7W A;  3E89 A;  2QWP B;  2BTO A;  2UUA B;  1KMI Z;  1G8M A;  3OEH G;  5H5N A;  5IE9 A;  4PDR A;  4B3S O;  5IY5 B;  3F7V C;  4NXN O;  1QLN A;  1EM1 A;  4JI6 B;  3AG7 A;  2VS0 A;  4IT5 A;  4DV2 B;  1KD1 W;  2AHZ A;  3ABT A;  3ASN B;  3M99 B;  1RM1 B;  4DR7 B;  2UU9 O;  2WLL B;  3JAM N;  3CRM A;  3T1Y O;  1R73 A;  2QWQ B;  2WLI B;  2QWR B;  3OUF A;  1K34 A;  5C8Y A;  5B1A B;  3QNE A;  1YI2 V;  2RMK B;  4DV1 B;  1DGS A;  4TT3 G;  1VQO V;  1AJN A;  3AEI A;  4CZZ A;  4AHC A;  2JS3 A;  3THO A;  3ZMV A;  5CA0 B;  1US6 A;  3EXA A;  2OT5 A;  4JI1 O;  3C3S A;  2CH7 A;  1VQ7 V;  1M1K W;  3J7A U;  3AG2 C;  4DR3 O;  4JI4 O;  5KUK A;  3IC7 A;  4EFB A;  1K5Q A;  4DXW A;  4X65 O;  2PI4 A;  1S76 D;  2KG7 A;  2F43 G;  3MHH C;  1P7G A;  1IZ3 A;  1I0H A;  3JAW A;  2BOB C;  2Q7E A;  1WB7 A;  4NXM B;  1IDS A;  5KHG A;  4JV5 O;  2A9H A;  4FIP C;  4YHH B;  1XHZ A;  5FNV B;  4I50 A;  4UB6 Z;  3UO3 A;  4RUE A;  4LR3 A;  1E1R G;  1H2K A;  3CMA V;  3A2F A;  2EIM C;  1WA8 A;  1IXB A;  3KZI Z;  3ETD A;  5H6R A;  2RN9 A;  2E5L O;  4DV4 B;  1WB8 A;  2V7Q G;  3ABM B;  2ZM6 B;  3JAT A;  4MS2 A;  3VQV A;  1Y76 A;  1KYO F;  5B1B C;  1SS3 A;  2FB5 A;  1VF5 B;  1ZX3 A;  4ICG A;  3OR6 C;  3K08 A;  4FVM A;  4NYK A;  4QPK A;  2UUA O;  3OEE G;  1H2N A;  2X6C A;  2JEU A;  4H44 B;  1ROP A;  5CA3 A;  3N2K A;  5LMN B;  4CH6 A;  4PA6 A;  1KQS U;  5L3F A;  4DV0 B;  1URF A;  2WWW A;  4CC5 A;  5LHI A;  3ZHV A;  3G4S V;  4U3J B;  3OM3 B;  1P84 F;  4IIJ A;  1ZAU A;  1YJN V;  5F2V O;  1S0V A;  4DUZ B;  1PD3 A;  1GK9 A;  3IFX A;  3BFR A;  2F4V B;  4DR2 B;  3ZN0 A;  2EJR A;  4LNU A;  4FM2 A;  1KUQ A;  2EBO A;  3OGI B;  4I7Z B;  1N32 B;  2P5O A;  2D2C B;  1X59 A;  5JQG A;  3LDE A;  5KX5 B;  3P3N A;  3UT5 B;  4IL6 Z;  1PV0 A;  1ZLZ A;  4FFB A;  3RVZ A;  4I50 B;  3E35 A;  1OCR B;  1CP9 A;  3ZHU A;  2OCH A;  5IJ9 B;  2XAG A;  2ADQ B;  1DK1 A;  2HEP A;  2LW7 A;  2CH7 B;  1K7D A;  1YSC A;  4GUN A;  4DR3 B;  2V1D A;  3VOU A;  1NBM G;  4ZBM A;  3SPG A;  2P22 C;  4UUJ C;  4CC6 A;  3B2E E;  4O2A A;  2OIG A;  2ETN A;  5EBL C;  5JVD A;  2YUA A;  1Q86 W;  4LF5 O;  2VQF B;  2HHH B;  1Q43 A;  4PEL A;  2AXT Z;  4MVU A;  2F95 B;  5CBF A;  4LF9 O;  2B1I A;  2IJJ A;  3RW0 A;  1MNG A;  1BL8 A;  2P7T C;  1WP7 A;  4WBN B;  4DV7 O;  4KHP B;  4YY3 O;  3IAY A;  4O4H A;  4LF7 B;  1AP5 A;  5LP6 B;  4YJ2 A;  4I0X A;  3G71 V;  3OGC C;  4DV6 B;  2WPD G;  1XL4 A;  1H2M A;  1AJP A;  2R9R B;  1IBM O;  1IBM B;  1G1X B;  2QSA A;  1VQK V;  4QGP A;  1M93 A;  4UV9 A;  4PDV A;  2Q5Z A;  4X64 O;  1NR7 A;  2V4D A;  2D3O W;  1FFX A;  1SZX A;  1UFI A;  4EKW A;  2F23 A;  3K04 A;  4U3F H;  2Q7H A;  2ZNJ A;  2DWE C;  1WAZ A;  1PPJ H;  3JAR B;  4FPP A;  4OX9 O;  3AK1 A;  2XAF A;  5DED A;  3JAW B;  5EZY B;  2DN9 A;  4MVQ A;  4XDJ A;  3O65 A;  1JR9 A;  3RN4 A;  3SYP A;  1HDJ A;  2W6I G;  3CC4 V;  4JYB A;  1VAR A;  2A0L A;  4GT1 A;  5FPO A;  1PKX A;  4IIJ B;  2JS5 A;  2ADP A;  3K79 A;  3HKC A;  3CRQ A;  3E8B A;  1QVF U;  2WLN A;  4AQY O;  1FYJ A;  2X0L A;  1H8E G;  3E86 A;  4TQF A;  4B3M O;  3WU2 Z;  1FAF A;  2UU9 B;  4B3M B;  5CB4 A;  2EJ7 A;  3H1L H;  3AK2 A;  5L3D A;  3OFN G;  2ZDI C;  3P30 A;  1PL4 A;  1NH2 D;  3IC9 A;  1YHQ V;  5EIB C;  3MAQ A;  4UCT A;  1HP8 A;  1F4N A;  1AR1 B;  3JSN A;  1SKV A;  2ZE7 A;  2W0X A;  4WF9 V;  2ZD9 A;  3AG3 B;  4EEQ A;  5IT9 N;  3HKE A;  3B4S A;  4LWS A;  1Y67 A;  1OCC C;  2UXB B;  1M57 B;  4BIZ A;  4GYC B;  4DV6 O;  1DF5 A;  1QU7 A;  3OTO O;  1IXM A;  2L6L A;  3K9S A;  3OMI B;  2XOK G;  1QBZ A;  1V54 C;  2GUZ A;  1QR8 A;  3ZRW A;  3K06 A;  2E75 B;  4JV5 B;  1PP9 H;  2P6J A;  1PL0 A;  3ETE A;  4B3R O;  1NQT A;  4OXS A;  4K0K O;  2WLI A;  3CX5 F;  4X20 A;  3BHP A;  1L8D A;  1BQ0 A;  2QM7 A;  2ZIM A;  3X2Q B;  1FXK B;  3ABL C;  1QHT A;  1IVS A;  3JAK A;  1LUV A;  1YZB A;  3ZRV A;  4CS4 A;  1M5I A;  4MVZ A;  2ZDI A;  3B40 A;  5C8Y B;  4LFB B;  3I55 V;  1T5E A;  5KMG B;  2K1E A;  4LFB O;  3SR2 C;  1Y74 B;  4JGS A;  3CS5 A;  1YCI A;  5EK0 A;  4ZOL B;  1AVM A;  3TGU H;  4DR2 O;  4MVM A;  4PA3 A;  4JAU A;  4JI6 O;  4X1K A;  3CXH F;  1ZL8 A;  1N34 O;  4LF4 B;  1Z5W A;  2Q7G A;  3Q4H B;  3BAB A;  3P3P A;  1FJG O;  1M9N A;  4PA4 A;  5EC2 C;  4J10 A;  2B5U A;  2Y0I A;  2R9A A;  2ZKO A;  3UM7 A;  1TVK B;  3RT3 C;  3K3W A;  2QTS A;  4FLY A;  1I08 A;  2ZQM A;  1OZ0 A;  5LGT A;  2YDE A;  2UXC B;  4DUY B;  2Q69 A;  3DC5 A;  4JYC A;  1TA8 A;  2P06 A;  3JAS B;  4MVS A;  5KAF Z;  4O4H B;  4J9Y B;  2BTQ A;  1XNR B;  3RYI B;  1FXK A;  2KSD A;  1Q82 W;  3OT7 A;  3HR0 A;  3N2G B;  3DC6 A;  1SA0 A;  2EIJ B;  4UCR A;  1P7B A;  4DV3 B;  1B3Q A;  2JGD A;  1LNQ A;  5B1O A;  5KAI Z;  5B66 Z;  4O2A B;  3AG1 C;  2FKX A;  3SPH A;  2HFE C;  2X7R B;  2F93 B;  1YTF B;  4DV5 O;  3KG2 A;  5JJJ B;  4R50 A;  5BXZ A;  4NXM O;  1EFR G;  5GW7 A;  2NR5 A;  3CWB H;  1QLE B;  5KLV H;  2ZE6 A;  3PJS K;  3JAL A;  1K92 A;  1V55 B;  1K4D C;  4BIU A;  4D6T H;  5B5E Z;  4ZI7 A;  3J80 N;  4TV9 B;  3RWR D;  2UXD B;  4X88 A;  3L73 H;  1JCH A;  3RYH A;  1N0N A;  4LNU B;  2XHB A;  1E79 G;  4QNH B;  1PM9 A;  1SQF A;  4OPH A;  1IBL B;  1GKF A;  3L9D A;  4BW5 A;  1HNW O;  2HJD A;  1RPR A;  3CCE V;  5BY1 A;  2DE0 X;  2H94 A;  1H8H G;  1VQL V;  2LGW A;  2XAH A;  3RYC A;  3OE7 G;  1FJG B;  4F6E A;  2KKW A;  4LF4 O;  3B09 A;  2WA3 A;  3QO5 A;  4LP8 A;  2QDO A;  1R3K C;  2KQX A;  1AI4 A;  1JFF A;  3ETG A;  1U97 A;  4NXN B;  1XBL A;  4HNA A;  1N36 O;  4PDM A;  5C93 A;  1K33 A;  4KFM A;  4H37 A;  3A0H Z;  4LC1 A;  1FS0 G;  4NTW A;  2HLD G;  1TVK A;  1HR0 O;  1AB3 A;  4Q20 A;  1VIB A;  2Q8V A;  5IJ0 A;  1NI8 A;  1EN4 A;  4E4E A;  1Q6U A;  3STZ C;  4RQF A;  3NXS A;  1THZ A;  2QKC A;  1VQ8 V;  4GX0 A;  5DEC A;  5IYB O;  2IBZ H;  1KEC A;  4K8Z A;  4IHJ A;  3HKB B;  5L3B A;  2WLH A;  1UJW B;  4L8J A;  1QVG U;  3SPC A;  2Z0A A;  3DSQ A;  1JJ2 U;  5LXT A;  1S5L Z;  2KG7 B;  5H9C A;  1FFT B;  1RP3 B;  3ZIA G;  1XMO B;  4UCV A;  2AHY A;  3I5D A;  1S3J A;  2IW5 A;  3B8N A;  4KHP O;  4X64 B;  1W2B U;  4PJ0 Z;  1GTO A;  2ZT9 B;  2PYL A;  3WG7 C;  2EIM B;  1VQ5 V;  1GN2 A;  1GMG A;  3JYC A;  1IUR A;  2UXN A;  3I56 V;  4K0K B;  2HP8 A;  5J2T B;  1SQV H;  1MZF A;  4BR6 A;  3O9O A;  4JAA A;  4KUM A;  4NB5 A;  5IYZ A;  1M90 W;  1BS3 A;  3L71 H;  4R8C A;  4B7K A;  1MAB G;  1WNS A;  1MA1 A;  1XDC A;  1SQG A;  1JQ0 A;  3OR7 C;  2AGA A;  1Y4M A;  1HNZ B;  5KUM A;  2YS8 A;  1EN5 A;  2QKA A;  2AZ2 A;  4B08 A;  4I4T B;  3ZED A;  1P4R A;  2HVJ C;  3HB3 B;  3STL C;  2DW4 A;  3M8A A;  4NTY A;  4D7S A;  1CEZ A;  3B8M A;  5A2Q N;  5B3S B;  5LGU A;  4PD4 F;  3CRC A;  4UCU A;  4J9Z B;  4GX2 A;  4C7U A;  4F4L A;  4FZ0 A;  4O4J B;  4DR6 O;  2QM8 A;  4N23 A;  1ENV A;  4HAM A;  1WP8 A;  5J2U A;  2JEX A;  4JI2 O;  5JQG B;  3LUT B;  2M6Y A;  4ZOL A;  3JCZ A;  4J42 A;  1RPO A;  5LYJ B;  1VQ9 V;  5KHK A;  4X62 O;  1GM8 A;  3K03 A;  4JI0 O;  1VMG A;  2LFR A;  4I0X B;  4DR4 O;  1RSO B;  4K35 A;  2IJI A;  5K1X A;  2DOS A;  2YC0 A;  4PI0 A;  5L3C A;  3E8G A;  3ZMS A;  2QR4 A;  3E8F A;  5HFL A;  1OJH A;  3FAV A;  4FZ1 A;  4JI8 B;  1N33 O;  2OTL V;  5LMU O;  4XDK A;  1GM9 A;  2ZCE A;  5E79 Z;  1GN3 A;  4DW0 A;  2IU3 A;  4RAI A;  3D3Q A;  5LXT B;  5D5Q A;  1I7F A;  5LP6 A;  4OGQ B;  4H13 B;  3RYI A;  1ARO P;  5LGN A;  2R70 A;  4I55 B;  3G6B A;  3HKB A;  4DO2 A;  1H2S B;  1Q8I A;  1XMQ B;  2ZR2 A;  2EIN C;  3AG4 C;  4LFA B;  4LFA O;  2PI5 A;  3JAS A;  4X1I B;  4X20 B;  5HFM A;  1BE3 H;  1KKD A;  3L74 H;  2E76 B;  4QPJ A;  2ZXW C;  3JAL B;  4JZ2 A;  4O4L A;  3LSU A;  2AW9 A;  3SYC A;  2E74 B;  4DR1 B;  3ETQ A;  4UCS A;  3LDD A;  4CS2 A;  1FD9 A;  1O9G A;  3T1H B;  4RO2 A;  2ITD C;  3CYO A;  4GLX A;  1N32 O;  1OCZ C;  1B04 A;  1F51 A;  5LA6 A;  4QIW F;  2IJK A;  2L35 A;  2YIB D;  3ZRX A;  4E2L A;  4MT8 A;  3HKE B;  3LSQ A;  5FLX N;  2DYR B;  4QE9 A;  1G6U A;  3K5O A;  1AI6 A;  3OTF A;  1D2D A;  4ABM A;  3QO7 A;  1RFY A;  3C90 A;  3RFR A;  3H1H H;  3H1I H;  5LL6 Y;  3IJ4 A;  3R66 A;  1HNX O;  2PUS A;  4O2B B;  3BEH A;  3OUS A;  3RYF B;  5IYC O;  2CGO A;  4DR6 B;  2CK3 G;  5JJE B;  3RYH B;  5FPR A;  1RM1 C;  3K5L A;  1IBK B;  1OCO C;  1K5S A;  1Y6X A;  3GWK C;  1JJO A;  4GX5 A;  1WA8 B;  4CH3 A;  4JTC B;  2YID A;  2EIJ C;  2PTM A;  3GB7 C;  1B6Q A;  4KXR A;  1MOF A;  1W59 A;  1K4C C;  2MK3 A;  1ZWI C;  3JSL A;  4DK0 A;  2JJ2 G;  3CP1 A;  1NZ6 A;  5JCO A;  3ZS8 C;  1H38 A;  5LA6 B;  3CME V;  4FLZ A;  1N0J A;  1SQB H;  4O4I A;  2EX3 A;  4G28 B;  3VQY A;  4P2Z A;  4ZHQ B;  2RJZ A;  1HWY A;  3EFF K;  3AG2 B;  5KMG A;  3JAT B;  3FB5 C;  5JH7 A;  1G4Y B;  3K5M A;  1VEW A;  3ABM C;  1FFX B;  4MTF A;  2HVK C;  1YVW A;  2P4K A;  4UB8 Z;  4FK5 C;  4WFG A;  5IWA O;  5CB4 B;  2YIC A;  4JI4 B;  2EIL B;  2Q0A A;  5KX5 A;  2E5L B;  3JD1 A;  1XNQ B;  1SC5 B;  3QF7 A;  2YI8 A;  4YIP A;  2BSK A;  4DV5 B;  5GTH Z;  4LBE C;  1DF4 A;  1XMO O;  3ASO C;  4AI8 A;  3ZJZ A;  3KCY A;  4DK1 A;  1I5Y A;  1HNW B;  3J81 N;  3TK1 A;  4QJF B;  3FB6 C;  3W7S A;  4G2K A;  3BVO A;  2BE3 A;  2X6A A;  5CA0 A;  2H8P C;  1BQZ A;  2XND G;  5EBM C;  4JAS A;  3ABL B;  5CBG A;  3W7W A;  4YHH O;  1MSW D;  4LF8 O;  2LFS A;  1M56 B;  3ZHS A;  2BOC C;  5EIB D;  4UXN A;  3DXR B;  3SJB C;  3RVY A;  3K0D A;  3CRR A;  4WCE V;  3A0B Z;  3SYQ A;  1VP7 A;  1LR1 A;  4G27 B;  5IY5 C;  1FXH A;  3FX7 A;  4CBC A;  4DR7 O;  2Q6A A;  5AG2 A;  4GKJ O;  2YEV B;  1QCE A;  4FLT A;  2QKS A;  1YIJ V;  4X9Q A;  1N36 B;  1WPB A;  4JTA B;  3K59 A;  1IBL O;  1XI1 A;  4RWU A;  3CPW U;  2QJ1 A;  4LF8 B;  1L1F A;  1S5H C;  4JYA O;  1N8R W;  2Y69 C;  5KA5 A;  1VF6 A;  1E1Q G;  2YXL A;  4DV2 O;  3UCS C;  5B1A C;  1VQP V;  3ZN1 A;  2EUL A;  5CA1 B;  1KC8 W;  3BAA A;  3ZHR A;  4P30 A;  3SYO A;  2JVD A;  2Z3Y A;  3JCU Z;  3T1Y B;  4DV0 O;  2PF4 E;  4NR1 A;  4BWA A;  1MSD A;  2RQ6 A;  3GVM A;  5IDJ A;  1J5E O;  4AIL C;  2QGN A;  1HNX B;  2AZ0 A;  3OMA B;  4DUY O;  4K3A A;  4U7N A;  3ZHT A;  3G67 A;  1NS1 A;  4B7E A;  4U7O A;  1SET A;  2DYS B;  2HHH O;  1WJZ A;  1GAX A;  4WBN A;  1K3E A;  4WFF A;  3OTO B;  1QNM A;  2VWK A;  4JI0 B;  3WG7 B;  2RCV A;  2WSS G;  4BIO A;  3CCS V;  1EBO A;  5L3G A;  1RSO A;  3S3W A;  3VBB A;  3MD0 A;  4L87 A;  3N27 A;  1KP3 A;  2O57 A;  4LFC B;  1EZJ A;  4WFB V;  4GKK O;  2NLJ C;  1WN7 A;  3CEI A;  2JJ1 G;  4EB6 A;  3G80 A;  3ZRW B;  3VQX A;  3CB2 A;  4LH6 A;  3ABK C;  4WFE A;  3ZX6 A;  1HW7 A;  3K58 A;  5ITZ A;  3UKM A;  2FL4 A;  3M7M X;  1JVM A;  3CCJ V;  3G6E V;  4DR1 O;  4H0L B;  1YJW V;  4FFB B;  3CXC U;  4YIO A;  3R65 A;  1SER A;  4F6R A;  4LWS B;  1XIL A;  4UVB A;  5KA6 A;  2YEV A;  3A8T A;  3U11 A;  4I4T A;  5FL7 G;  4ASU G;  1R3J C;  3QTC A;  5IJ0 B;  1AP6 A;  4XBF A;  3RGB A;  2VQE O;  4N21 A;  4RUF A;  5JVD B;  2ZR3 A;  4LCU C;  2CTP A;  1GN4 A;  1AR4 A;  4UV8 A;  3FB7 C;  1KU9 A;  5H6Q A;  4FM1 A;  1N34 B;  1JFF B;  4MW3 A;  4GX1 A;  1GO3 F;  5LMU B;  2YXY A;  1XOU A;  4Z2W A;  5LBQ A;  4MTX A;  3E2E A;  2ZE8 A;  3FB8 C;  5LHG A;  1H2G A;  4X1Y A;  3EVK A;  1TUB B;  3UT5 A;  3K5N A;  2QA4 V;  4MW8 A;  4FMT A;  1FXV A;  1OCC B;  5LYJ A;  3DGE A;  4DW1 A;  1X4T A;  4EB6 B;  3C3T A;  2P4V A;  4LF7 O;  4GCZ A;  5BR8 B;  4YY3 B;  2DQ3 A;  4P9P A;  4TSF G;  3PN1 A;  1LUW A;  1Q3E A;  4X1K B;  1U96 A;  2WLJ A;  1PNL A;  4JI2 B;  5CMU A;  5FNV A;  4PA7 A;  3BA8 A;  4JTD B;  4UFZ A;  3RBZ A;  3H1K H;  2XTA A;  1JX9 A;  4LF6 O;  4FJC C;  1I5X A;  5ITZ B;  3T4D A;  1TUE B;  4HBN A;  1SQP H;  1ORQ C;  4LF5 B;  3ZMU A;  3UO2 A;  4KP4 A;  1KB9 F;  4GKK B;  1NU1 H;  2P67 A;  2YXH A;  4YJ2 B;  2XUM A;  4CS3 A;  1S72 V;  4GZR B;  5J2T A;  1BCC H;  2FYU H;  1F23 A;  3JD0 A;  5CA1 A;  4JI7 O;  5D5P A;  3F5W C;  4OX9 B;  3RYF A;  2XAS A;  4PI2 A;  3W7X A;  3SJA C;  2VQE B;  2EZO A;  1MZE A;  5CBH A;  4BW9 A;  1VQN V;  1M4U A;  3SYA A;  5LHH A;  5E1A C;  3TCU A;  5IYD O;  3OAA G;  1OV9 A;  3CCL V;  3JD2 A;  5BMV A;  1O9H A;  5KHH A;  1Q6H A;  4TV9 A;  1OCO B;  4U3J A;  2PY5 A;  5DM6 V;  1JMK C;  1D5A A;  5JJN B;  2Q73 A;  3DTU B;  1BMF G;  1P49 A;  2XAJ A;  1VQ6 V;  3UQ8 A;  1K73 W;  4JAV A;  3L72 H;  1ZTE A;  4J80 A;  2UUB O;  3F7Y C;  2UXX A;  4DRX A;  4YJ3 B;  4X1Y B;  1QR9 A;  4JYY A;  1IBK O;  3CJH B;  2JK5 C;  3L70 H;  1XNR O;  2QTO A;  3DXR A;  4TUY B;  2OWO A;  1VQ4 V;  5IYZ B;  1Y66 A;  1COW G;  4PHZ A;  1D5N A;  2EIK B;  5L3E A;  1YDX A;  4A5U B;  4J7K A;  4Q6G A;  2EIL C;  3SJQ C;  2GV9 A;  4O2B A;  1J5E B;  2OCC B;  4GKJ B;  4JI8 O;  1N33 B;  1PNM A;  3CC2 V;  2X6B A;  4FFK A;  1FPO A;  3WFV A;  1NVP B;  2QWO B;  3HKD A;  4JI5 B;  3TXS A;  3AK3 A;  2IU0 A;  3TJT A;  4TV8 A;  1R3L C;  4LF9 B;  3FD9 A;  3QO8 A;  1BZK A;  3NR7 A;  1VQM V;  4JI1 B;  3K57 A;  3WB2 A;  4F6R B;  4W4L A;  1BSM A;  1H2L A;  3RYC B;  4ZI7 B;  2ZIN A;  5DN6 G;  2KB1 A;  2A06 H;  3S3X A;  3E22 A;  1R6K A;  4DV1 O;  1AI7 A;  1JOY A;  2R9I A;  3HPL C;  3LDC A;  4J7J A;  4DR5 B;  4JI5 O;  2ZXW B;  2XAQ A;  2K9P A; 
#chains in the Genus database with same CATH homology
 1M9N A;  3ABM C;  4PA4 A;  1SZT A;  5EC2 C;  1G8M A;  3AG3 C;  5B1N A;  2B5U A;  4MTF A;  5B1B B;  2HVK C;  3OEH G;  3UM7 A;  3ML0 A;  4FK5 C;  2P90 A;  3K3W A;  4PDR A;  4WFG A;  1M57 C;  5IY5 B;  3X2Q C;  1FXK C;  1V55 C;  3F7V C;  2ZQM A;  2EIL B;  1OZ0 A;  1QLN A;  5LGT A;  3K0G A;  3JD1 A;  1DLB A;  2Q69 A;  1KD1 W;  4JYC A;  4MVS A;  2AHZ A;  3IGA C;  3ABT A;  3ASN B;  3M99 B;  4WFA V;  1RM1 B;  2WLL B;  2C2A A;  4LBE C;  1DF4 A;  1R73 A;  2HJF C;  4J9Y B;  2WLI B;  3ASO C;  3OUF A;  1K34 A;  3ZJZ A;  2Y69 B;  1FXK A;  2DYR C;  1I5Y A;  1Q82 W;  1W0K G;  5B1A B;  1MG1 A;  2EIJ B;  3QNE A;  1P7B A;  1YI2 V;  1S77 D;  3TK1 A;  4TT3 G;  1BHB A;  2WAM A;  4QJF B;  1AJN A;  1VQO V;  1LNQ A;  3AEI A;  3FB6 C;  2DQ0 A;  3LNM B;  5B1O A;  4CZZ A;  3W7S A;  4G2K A;  2W6J G;  3ZMV A;  3AG1 C;  2X6A A;  3SPH A;  2HFE C;  2X7R B;  2H8P C;  1YTF B;  2OT5 A;  2XND G;  4X89 A;  5EBM C;  1VQ7 V;  4JAS A;  3ABL B;  5CBG A;  3W7W A;  1M1K W;  1MSW D;  3AG2 C;  3KG2 A;  2LFS A;  1M56 B;  4R50 A;  2BOC C;  5KUK A;  1EFR G;  3IC7 A;  4UXN A;  1XL6 A;  5GW7 A;  1QLE B;  3RVY A;  1K5Q A;  3K0D A;  2Q68 A;  4DXW A;  2PI4 A;  4WCE V;  1S76 D;  3SYQ A;  2F43 G;  1K97 A;  3MHH C;  3PJS K;  1K92 A;  4G27 B;  4ZKI A;  5IY5 C;  2BOB C;  1V55 B;  1FXH A;  4MSW C;  1K4D C;  4R7C A;  4BIU A;  4CBC A;  2Q6A A;  3B77 A;  2YEV B;  1QCE A;  4TWK A;  2QKS A;  1YIJ V;  4Z1M G;  2HR3 A;  2A9H A;  4JTA B;  4FIP C;  4X88 A;  3CPW U;  3ASN C;  1JCH A;  4MVR A;  1L1F A;  1S5H C;  1Q7Y W;  4RUE A;  3JD3 A;  1E1R G;  1N8R W;  2Y69 C;  5KA5 A;  1E79 G;  3CMA V;  4HYO A;  1E1Q G;  1OHH G;  2EIM C;  4QNH B;  5B1A C;  2EZP A;  3ETD A;  3SPI A;  5H6R A;  3SPJ A;  1VQP V;  1GKF A;  3ZN1 A;  3ABK B;  4BW5 A;  1KC8 W;  2FTK A;  2V7Q G;  3ABM B;  4MVO A;  3P32 A;  1RPR A;  2IJH A;  4MS2 A;  4P30 A;  3CCE V;  3SYO A;  5B1B C;  2H94 A;  1H8H G;  1VQL V;  2Z3Y A;  2XAH A;  3OR6 C;  3K08 A;  3OE7 G;  2Q67 A;  4QPK A;  4WFH A;  2GSM B;  3OEE G;  5IDJ A;  2X6C A;  2JEU A;  3QO5 A;  1ROP A;  3OMA B;  4LP8 A;  4U7N A;  5CA3 A;  1R3K C;  1AI4 A;  4U7O A;  3T1C A;  1QLE C;  3ETG A;  1SET A;  2DYS B;  4PDM A;  4PA6 A;  1K3E A;  4WFF A;  5C93 A;  1KQS U;  1K33 A;  5L3F A;  4KFM A;  3WG7 B;  4H37 A;  4LC1 A;  2WWW A;  1FS0 G;  4JF3 A;  2WLM A;  2WSS G;  5LHI A;  2HLD G;  3CCS V;  2IH1 C;  2W0F C;  3LSS A;  3G4S V;  3OM3 B;  3D3I A;  1EBO A;  4Q20 A;  1YJN V;  5L3G A;  2WLK A;  1S0V A;  1PD3 A;  1GK9 A;  3IFX A;  3MD0 A;  3K9A A;  3VBB A;  1KP2 A;  4L87 A;  3STZ C;  2ITC C;  4RQF A;  1KP3 A;  3NXS A;  2Y48 A;  1THZ A;  1EZJ A;  4WFB V;  3ZN0 A;  1VQ8 V;  2EJR A;  2NLJ C;  4GX0 A;  2EBO A;  2JJ1 G;  4P9O A;  3ZRW B;  5IYB O;  3W7T A;  3ABK C;  4WFE A;  5BZB A;  1KEC A;  3LDE A;  3UKM A;  1K9M W;  1JVM A;  5J9P C;  5L3B A;  2WLH A;  3CCJ V;  3ZMZ A;  3G6E V;  1UJW B;  1QVG U;  3SPC A;  1WPX A;  3ZRS A;  1YJW V;  3RVZ A;  1R3I C;  3CXC U;  1JJ2 U;  3R65 A;  3E35 A;  1OCR B;  1CP9 A;  1SER A;  5H9C A;  1FFT B;  3ZIA G;  2XAG A;  2AHY A;  4R6Z A;  4UVB A;  1S3J A;  3B8N A;  2IW5 A;  3BY6 A;  5KA6 A;  2YEV A;  1K7D A;  1YSC A;  5FL7 G;  4ASU G;  1R3J C;  1NKD A;  1W2B U;  2V1D A;  3VOU A;  1NBM G;  2A79 B;  2JDI G;  4ZBM A;  3SPG A;  1GTO A;  4XBF A;  2QEX V;  3JD4 A;  4UUJ C;  3WG7 C;  2EIM B;  3H01 A;  1VQ5 V;  1GMG A;  3JYC A;  4N21 A;  4RUF A;  5EBL C;  1PNK A;  2HG5 C;  2UXN A;  2ZR3 A;  3I56 V;  1Q86 W;  4LCU C;  4PEL A;  4MVU A;  5CBF A;  4KUM A;  4UV8 A;  2B1I A;  2IJJ A;  3FB7 C;  4R8C A;  5H6Q A;  3CCV V;  1YJ9 V;  1M90 W;  1NVP D;  1YIT V;  1MAB G;  3RW0 A;  4MW3 A;  1BL8 A;  4GX1 A;  2P7T C;  1AI5 A;  1GO3 F;  3CCM V;  1JQ0 A;  2EIN B;  3AG4 B;  3OR7 C;  2WLL A;  1R6N A;  1Y4M A;  5KUM A;  5LBQ A;  1F4M A;  3D36 A;  4MTX A;  3E2E A;  3G71 V;  2M7W A;  3OGC C;  2DYS C;  3FYE B;  3FB8 C;  2WPD G;  3GWO A;  1P4R A;  2HVJ C;  1H2G A;  3HB3 B;  5LHG A;  1XL4 A;  1SES A;  2DW4 A;  1WLE A;  4MTO A;  3STL C;  2QA4 V;  4MW8 A;  1AJP A;  4FMT A;  1OCR C;  1FXV A;  1CEZ A;  4UVA A;  3CCQ V;  3B8M A;  1OCC B;  2R9R B;  3DGE A;  5B3S B;  5LGU A;  4BAY A;  4J9Z B;  4GX2 A;  4F4L A;  4GCZ A;  1VQK V;  2QE7 G;  2QM8 A;  4N23 A;  1ENV A;  4HAM A;  2DQ3 A;  4P9P A;  4TSF G;  4UV9 A;  2JEX A;  2WLJ A;  1PNL A;  4PDV A;  3FKS G;  1V54 B;  1NR7 A;  5CMU A;  4PA7 A;  3LUT B;  2Z5U A;  2D3O W;  3JCZ A;  1RPO A;  1VQ9 V;  4JTD B;  4EKW A;  3RBZ A;  3K04 A;  1GM8 A;  3K03 A;  1JX9 A;  2DWE C;  3CC7 V;  4FPP A;  4FJC C;  3CCU V;  2LFR A;  3TET A;  1I5X A;  2XAF A;  3T4D A;  1TUE B;  2IJI A;  2YSU B;  4MVQ A;  1ORQ C;  4XDJ A;  4MTG A;  3ZMU A;  5L3C A;  3E8G A;  3ZMS A;  3SYP A;  4KP4 A;  3E8F A;  2W6I G;  5HFL A;  3CC4 V;  4QE7 A;  1OCZ B;  4JYB A;  2P67 A;  2A0L A;  4GT1 A;  2OTL V;  1S72 V;  1PKX A;  4XDK A;  2ATK C;  1GM9 A;  3OMN B;  3K79 A;  1F23 A;  3E8B A;  4X8A A;  3JD0 A;  1QVF U;  2WLN A;  1K8A W;  5CN0 A;  2IU3 A;  5B3S C;  4RAI A;  2X0L A;  3F5W C;  4XDL A;  1H8E G;  3E86 A;  2XAS A;  3ZMT A;  2NNU A;  1NR1 A;  1ARO P;  3W7X A;  5LGN A;  5L3D A;  2EZO A;  4PDL A;  3OFN G;  2ZDI C;  4DO2 A;  5CBH A;  3P30 A;  2ZR2 A;  1CPY A;  3AG4 C;  2EIN C;  2EIK C;  3T4Z A;  2PI5 A;  1NH2 D;  1VQN V;  3SYA A;  5HFM A;  1BHA A;  1YHQ V;  1KKD A;  2OTJ V;  5LHH A;  5E1A C;  1NH2 B;  1F4N A;  4QPJ A;  2OCC C;  3TCU A;  3OAA G;  2ZXW C;  1AR1 B;  5IYD O;  4H33 A;  4WF9 V;  2ZD9 A;  3AG3 B;  3CCL V;  3JD2 A;  3SYC A;  3ZCC A;  3FYI B;  2JIZ G;  1OCO B;  3LDD A;  2HKO A;  1OCC C;  1M57 B;  3CD6 V;  1NJI W;  5DM6 V;  2B1G A;  4RO2 A;  4BIZ A;  3OW2 U;  4RQE A;  2ITD C;  1DF5 A;  3DTU B;  3CYO A;  1BMF G;  1OCZ C;  2XAJ A;  3MHS C;  4YXW G;  1IXM A;  3OMI B;  1F51 A;  1VQ6 V;  4QIW F;  1K73 W;  2XOK G;  1QBZ A;  4JAV A;  1SRY A;  3CCR V;  1V54 C;  2IJK A;  1QR8 A;  3ZRW A;  3ZRX A;  3K06 A;  3F7Y C;  4E2L A;  4MT8 A;  3LSQ A;  3ASO B;  2UXX A;  2DWD C;  1AJQ A;  2P6J A;  1PL0 A;  1QR9 A;  2DYR B;  3ETE A;  4QE9 A;  2JK5 C;  2QTO A;  1NQT A;  4OXS A;  1AI6 A;  2WLI A;  1VQ4 V;  1Y66 A;  1COW G;  1J95 A;  3QO7 A;  3AG1 B;  2QM7 A;  2EIK B;  5L3E A;  3X2Q B;  1FXK B;  4UVC A;  2EIL C;  3ABL C;  1JPX A;  2LP7 A;  3SJQ C;  3W7U A;  3BEH A;  3OUS A;  1M56 C;  3E8H A;  5EC1 C;  1Q81 W;  2OCC B;  3A0R A;  5IYC O;  2IH3 C;  4PA9 A;  1PNM A;  4I9W A;  2X6B A;  2CK3 G;  3CC2 V;  3ZRV A;  1YTF D;  1RM1 C;  4MVZ A;  1OCO C;  2ZDI A;  3WFV A;  1NVP B;  1K5S A;  4GX5 A;  3I55 V;  3E83 A;  2IU0 A;  2K1E A;  1R3L C;  4I5S A;  4JTC B;  4JGS A;  3EHB B;  3QO8 A;  2EIJ C;  3GB7 C;  1DTO A;  5EK0 A;  1B6Q A;  2GHY A;  1VQM V;  1MOF A;  2MK3 A;  1K4C C;  1ZWI C;  3T2M A;  3ABU A;  1GM7 A;  2JJ2 G;  3CP1 A;  1H38 A;  4JPR A;  3CME V;  4HZ3 A;  4MVM A;  4PA3 A;  1W0J G;  5DN6 G;  2KB1 A;  4G28 B;  1R6K A;  4JAU A;  4P2Z A;  5EBW C;  1AI7 A;  1HWY A;  3EFF K;  1JOY A;  2R9I A;  3AG2 B;  3HPL C;  3E89 A;  3LDC A;  3FB5 C;  1G4Y B;  2ZXW B;  2XAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...