1IBKO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibkO00
4JI1O 4X66O 1X59A 2HHHO 2F4VO 2FKXA 4JI6O 1N32O 4JI2O 4YHHO 4DV5O 5H5NA 4DUYO 1XNQO 5BY1A 2LW7A 4JI4O 3J7AU 1NS1A 4LFBO 4NXMO 1HR0O 1N33O 2UUAO 1IBLO 4JI3O 4GKKO 4DR6O 3OTOO 2UUCO 1R1BA 3F5TA 4DV4O 3SDLA 2E5LO 4DR4O 4JV5O 4DR7O 2UUBO 3RT3C 3R66A 3JAMN 4JYAO 4JI7O 4LF9O 4DR1O 1G1XB 2UU9O 1FJGO 1AB3A 4B3TO 5LL6Y 4DV0O 4DR3O 4LF8O 4DV1O 4NXNO 2ZKOA 1XMOO 4LFCO 4K0KO 4X62O 4DUZO 4AQYO 1FKAO 4OPHA 4GKJO 4JI0O 1DK1A 4LF6O 1I94O 4DV3O 2VQEO 4B3SO 2N74A 1J5EO 4DV7O 4LFAO 1FYJA 3J80N 3T1HO 1IBKO 4JI8O 4DV2O 2DJVA 2AGAA 5BR8O 2Z0AA 1A32A 4LF5O 4KHPO 4LF4O 4DV6O 1XEQA 2UXCO 1R6TA 2VQFO 1XMQO 4YY3O 4A5UB 4LF7O 5LMNO 4DR5O 4B3MO 3T1YO 2UXBO 3M8AA 1HNXO 1N36O 3O65A 1F7YA 4DR2O 2DOSA 1YZBA 4OPAA 5FLXN 1AILA 5IWAO 3J81N 1XNRO 5IT9N 5LMUO 1D2DA 1HNWO 4B3RO 4OX9O 2ZM6O 4JI5O 1KUQA 2JRIA 4X65O 1N34O 1HNZO 4X64O 5BXZA 5A2QN 2UXDO 1IBMO
chains in the Genus database with same CATH superfamily
5LYJA 1QR9A 4JV5B 4CBCA 1Z5WA 5B3SC 1N33O 2W6JG 3BY6A 2P5OA 3SDLA 2DYSC 4UCUA 4UCVA 1GK9A 2M6YA 4ASUG 2LP7A 3W7UA 3AG4B 2OTLV 3JATA 4O4JA 4FZ0A 1E79G 5JJEB 1BT8A 5IE9A 1UPGA 3W7WA 3L75H 3IC9A 3FYIB 3K9AA 2JEUA 4B3SO 2AW9A 3L9DA 3T1HO 1TGOA 3FKSG 5ITZA 2JDIG 1PNMA 1G8MA 4LF5O 3AG1C 3SJCC 3LNNA 1KP3A 4YY3O 1GMGA 4DR2B 3ABTA 4K35A 2UXBO 5L3EA 2CTWA 2LGQA 1TVKB 3SGIA 1G4YB 4L87A 1FXKC 3W7XA 3HR0A 4LR3A 4DV4B 1AVMA 4WF9V 1PD3A 2QTSA 5EBLC 3G67A 2Q68A 3D36C 1GN6A 1HNWO 3OW2U 1SKVA 3CC2V 3CHXA 1ZL8A 3ZMVA 2WLIA 4LF9B 1Q8IA 4FZ1A 5IJ0B 1FJGB 4B3TB 4PDRA 1YCIA 1Q90D 2XTAA 4JI4B 2ZCEA 4IL6Z 4MTFA 3IC7A 4KUMA 1NS1A 1V54C 4CH4A 2XNDG 3K04A 1OCOB 1VQPV 4O4HA 4GKKO 3BEHA 4FIPC 1LUWA 2IJHA 2ITCC 2AZ0A 4C7UA 1Z2GA 3E89A 1Y66A 1M93A 2BTOA 2QM4A 2GDSA 1XL6A 3JASB 2UU9O 1GN2A 2YXHA 5BZBA 4DV0O 4LF8O 4QGPA 4NXNO 1LUVA 2P06A 5JVDB 4IHJA 1CP9A 1WLEA 4P2ZA 3RYCA 3DXRA 4CC6A 3STZC 4PA3A 5LP6C 1OCZC 3SPCA 2HJDA 3ZN0A 4FJCC 1EN5A 3E2EA 1WP7A 2G38A 4I55A 3SYOA 2HLDG 3B8MA 2YC0A 4XDJA 4YIOA 1ORQC 2L6LA 3ZS8C 1AR5A 4DV5B 2IBZH 5IDJA 2YDEA 3MD0A 3CRRA 1PPJH 2GBOA 4FLWA 4UCRA 1IBLB 2CGNA 4BW9A 4IGGA 5IWAO 5H6QA 3ZHRA 1XNRO 2HVKC 3TCUA 1MZEA 2WA4A 4WFGA 5EYPA 5CB4B 4X1YA 3ZMUA 3HKBA 1KKDA 1XNQB 1BQ0A 3WB0A 1R3JC 3QO8A 4J10A 3H1IH 1Q6UA 1QNMA 3JSNA 5FL7G 1VQ5V 2Y0PA 4JF3A 5BY1A 3N2KA 1WNSA 3J7AU 4PI0A 3CD6V 3ZRSA 5EC1C 2W0FC 1VQNV 2P90A 4KFMA 4JV5O 1XQ8A 1RSOB 1O9GA 1XILA 4YJ2B 1WPXA 3MHHC 3X2QC 3ABKB 3UT5B 1Y74B 4H33A 1KC8W 3CC7V 3OAAG 1NT2B 1Q43A 4O4LA 2B5UA 3GB7C 5LL6Y 4DR3O 1EN6A 3LDDA 2BCCH 5E79Z 1XUQA 3LSUA 3APOA 2ZDIA 4I4TA 3B4SA 1I94O 1GM9A 2VRZA 3H01A 2QA4V 2N74A 3RVZA 4TV9A 3RYIA 1J95A 1IBKO 3OD4A 3HKEA 3UKMA 1KQSU 1HNZB 2XASA 3GWOA 4MVSA 1IURA 2VQFO 4LNUB 2C2AA 4JZ2A 2F4VB 4H44B 3JAWB 4B3MO 1VQ8V 4W4LA 4GUNA 5KMGB 1XI1A 3C90A 3OT7A 4DR2O 1XREA 4PJ0Z 3OE7G 4QE9A 5JH7B 1Q3EA 4TQDA 3JAKA 1K5SA 4RWUA 3MHSC 3JD0A 2Q0AA 1YEWA 2FTKA 1S76D 5BMVA 1QR8A 4GX0A 2CDYA 4J41A 1BE3H 4YHHB 2RCVA 4DV1B 3B8NA 1Q7YW 1YDXA 4YJ3B 4JI3B 5LOVB 2YS8A 3JARB 2YSUB 4JI4O 1B06A 4LFAB 3D8CA 4JI8B 3CP1A 2BE3A 1MSWD 5IJ9A 2LO1A 4R7CA 5J9PC 3WB2A 1NJIW 1P7GA 4HBNA 1XOUA 1R3LC 2K1EA 2QKCA 2QEXV 4I7ZB 1V55C 2E74B 1K9MW 1EBOA 1HWYA 1K4DC 3CJHB 1F51A 4X62O 3B09A 2WPDG 2HEPA 1KU9A 3ZHVA 1G6UA 1JJOA 1I08A 1XHXA 1EM1A 3BRCA 3CMEV 5LGUA 4GLXA 5EZYB 3GWKC 1XEQA 1JJ2U 3LSSA 4DO2A 3SPHA 3M7MX 3M99B 3CRMA 1ZUQA 1YVWA 4O2BB 5LHGA 4MW3A 3PJSK 2EILB 4H37A 2EIJB 2DQ0A 1Q5OA 1HR0B 3U0ZA 3OUSA 3TJTA 4TSFG 3T4DA 2W0XA 5FPRA 1EZVH 4WFBV 1BGYH 2JIZG 4LP8A 2DWDC 3RWRD 2XAQA 1VQKV 2EBOA 4K3AA 2H8PC 3P32A 2HHHB 2YIBD 1KUQA 1M57B 2JRIA 3D3QA 2NLJC 1P7BA 1SESA 4RUFA 1CPYA 1TVKA 2EIMC 2ATKC 2BTQB 2Q69A 4DK1A 4ZHQA 2UUAB 2FL4A 1SC5B 4I0XA 1XNQO 2EJ7A 1K34A 1DF5A 2IJIA 4UVCA 4JI7B 3K5NA 2FB5A 1ZX3A 4AI8A 3CX5F 5IJ0A 1Q81W 4JYCA 3OM3B 2QE7G 4JPRA 4Q20A 2HKOA 4NR1A 2RJZA 3THOA 2Q8VA 2Y48A 1G1XB 2F43G 2HVJC 4I50A 4MTXA 2OCCB 3AK2A 2E76B 4FMTA 1UJWB 1VQ4V 3AG4C 2RDCA 2KB1A 4FFBB 2BOBC 1R3KC 2EZPA 4UV8A 2ETNA 3RGBA 3SR2C 1IXMA 2E3CA 4Z2WA 1Q6IA 3CS5A 3S3WA 5EBMC 3BPZA 1H8HG 1N34B 2KSDA 1SQXH 4X64B 5JVDA 1NI8A 4TUYB 3Q4HB 2WLHA 4LF7O 3JD2A 5H2FZ 3OMIB 3P3NA 4DUYB 2WAMA 5LXTA 2P4KA 3RW0A 4RQEA 3K58A 1YI2V 1B3QA 2IH3C 4G28B 4PV1B 2ILMA 1BCCH 3AK3A 4NTWA 1LNQA 3E22B 4P9OA 3ZX6A 1X4TA 3ZHTA 3FB5C 1VEWA 5JWPA 1SZTA 2QWPB 4PI2A 3DGEA 2P67A 2NNUA 4G2KA 5CA0B 5L3CA 3K3WA 2V1DA 3KCXA 3FB8C 4AQYB 5LBQA 1IBMO 4MS2A 4BIUA 1Y4MA 2FKXA 1OZ0A 1N32O 1BZKA 1SQBH 4YHHO 3FAVB 3F7YC 1KD1W 1IZ3A 5GONB 2V7QG 2F95B 1WA8B 4JI3O 1GM8A 2XAFA 5EBWC 5F2VO 3HKCA 3K06A 1AI6A 1DGSA 3A0RA 1L0LH 1MG1A 4FM2A 3A0HZ 1OCOC 1U97A 5C8YA 3K9SA 1VP7A 5LA6B 3CCLV 3JD4A 2QTOA 1XMOO 4LFCO 2Y0IA 2YI9A 1T5EA 4RO2A 3ZRWB 5JQGA 4WBNA 3RN4A 4UCSA 1RSOA 4J7JA 1E1QG 3ICXA 4DV2O 2R9IA 4U7OA 2VWJA 3UT5A 4OX9B 3SYAA 2AGAA 4NB5A 5CMUA 1EFRG 1K73W 2LW1A 3QG5A 4GT1A 1NBMG 4FLUA 1N36B 5EC2C 4MVRA 2Q0OC 3K5LA 1AP6A 4WFAV 4AILC 1YJNV 1Q86W 4JI2B 2EZOA 3KZIZ 4FLZA 4GX1A 1JA8A 1YJ9V 1VF7A 3K0GA 1N0JA 1AJPA 3ETEA 4BWAA 2OTJV 4LCUC 5FLXN 5FNVA 4G27B 2IW5A 3ZRXA 5LP6A 4DR4B 1H38A 4X89A 2QGNA 2ZIOA 3BAAA 4JYAB 3CRAA 2YIDA 4JI5O 4DW0A 3QF7A 2CUGA 2WA3A 4HNAA 1VQ7V 3EVKA 2IM9A 2UXDO 3CXHF 3EHBB 2HHHO 3ETQA 2CTPA 1AI7A 2IU3A 2JK5C 4ZI7A 3OTOB 2HJFC 2Y69B 3C3TA 1KBHA 2VQEB 5IYZA 4LWSB 3BCCH 1J5EB 3OUFA 2WSSG 2PUSA 2UUAO 2EINB 3OTFA 2QWRB 1SA0B 1SQGA 1TUEB 2E5LO 2JVDA 1NZ6A 2Q67A 3R66A 5J2TB 2X6AA 2CH7A 4YJ3A 2X6BA 4JI7O 1B04A 1JX9A 2JS3A 5LMNB 1F23A 1VQOV 5LOVA 1QQCA 3I5DA 3JARA 2ZNIA 3BVOA 4NYKA 2WLLA 4OPHA 2GUZA 3ABKC 2WLJA 1QLNA 3H1HH 4K8XA 1VF5B 2OWOA 4IT5A 1LR1A 1FYJA 1P4RA 4ZOLA 4X1IB 2R9RB 2XOKG 1Z5VA 3S3XA 1JCHA 3D3IA 4Z1MG 4YIPA 3ZEDA 3SPGA 1FD9A 2ZM6B 5JCOA 1XBLA 1AJNA 3HKDA 2QWQB 3AG2B 3WG7B 1ZSPA 2CGOA 2D2CB 5KUMA 4IIJB 3OEHG 2IU0A 2XUMA 2A3QA 3CWBH 2A79B 2R9AA 4O2AB 3OEEG 1SQQH 4XDLA 2XHBA 3OR6C 1F4MA 3JALA 3H1JH 1N0NA 2HR3A 2LFSA 2YXLA 2YEVA 2DE0X 1L0NH 4FM1A 1VF6C 4TV8B 3L71H 1KMIZ 4LC1A 4O2BA 2JEXA 1O9HA 4NXMB 3E8HA 2P6JA 4X1KA 4LF6B 3CB2A 5CBFA 4DK0A 1W0KG 4GX2A 2CE4A 4LH6A 3TGUH 4DR6O 3CCEV 4UVAA 4X20B 4JAVA 1NVPB 3B77A 4DV6B 1DF4A 4K0KB 1THZA 4F6RA 2BTQA 3KKYA 4PA9A 5LHHA 1D5NA 5IYDO 4DR5B 4FPPA 1GH6A 1N8RW 2N04A 1RP3B 5L3BA 4CS2A 1HW7A 1FKAO 4TOIA 5CA1B 1OJHA 1K8AW 5JCOC 5J2UB 1FFXB 5LMUB 4L8JA 2Q9LA 1NVPD 5KHGA 3SYQA 5EIBD 5LYJB 1XMQB 2DJVA 1SETA 1K92A 4DRXA 1A32A 1B6QA 2BSKB 2AZ2A 4PA4A 1Y6XA 4GKJB 4X66B 3LNMB 3JD3A 1K7DA 5B1AB 4FLXA 3IAYA 1FAFA 2QDOA 1K4CC 4FLVA 2ZD9A 2GHYA 4DXWA 1N36O 1OCCC 2JGDA 1W59A 2PYLA 2CAZC 2ZE8A 4JAUA 1YTFB 2ZE6A 1YSCA 2EILC 2EIJC 2V4DA 1RM1B 2CK3G 1DTOA 3RYHB 5AG2A 1R6NA 4YXWG 4DR1B 2MK3A 4Q6GA 5ITZB 4EB6A 4LFBB 4I5SA 3DTUB 2JJ2G 1M57C 4TWKA 1YTFD 1R73A 3E22A 4P30A 4HAMA 3OTOO 5H6RA 4DV4O 3RFRA 2W6IG 2EX3A 2A9HA 3ASNB 4LF4B 5KA6A 1OCRB 1JFFA 1IX9A 4DUZB 5HFMA 1XDCA 1MOFA 4LF9O 2PI4A 1Y76A 1V9PA 1FJGO 3TXSA 3FAVA 3B2EE 4CZZA 5KA5A 4B3TO 4J7ZA 1HNXB 1KP2A 1H8EG 2PGGA 2WLIB 1KB9F 3RBZA 4O4IA 4B7EA 3CE2A 5BR8B 2OCCC 1R3IC 4KHPB 4D6TH 1MSDA 5DM6V 3BHPA 4X65B 4MVMA 4RQFA 1WB7A 1SF9A 4O4HB 4EFBA 2KQXA 4UXNA 4KP4A 1VMGA 3W7TA 2ZE5A 3U10A 3SJBC 1VARA 3R65A 3LDEA 3JSLA 1YZBA 3JD1A 4UB6Z 3CRCA 1ROPA 1OHHG 3ASOB 4KL1A 4U7NA 5KX5B 3K79A 3TK1A 4J7KA 1SQVH 1JOYA 1NU1H 1QHTA 4N21A 1SQPH 4JI1B 2O57A 3W7SA 4JI6B 3UQ8A 1S5JA 2EULA 5GTIZ 2NR5A 5L3GA 1W0JG 2AHZA 2XAJA 3P30A 1SRYA 1AR1B 3ZHUA 2WLMA 2HFEC 1S5LZ 4R8CA 4DV5O 5H5NA 4NXMO 3LDCA 3MAQA 1IBLO 1M56B 3CMAV 3CCUV 3KG2A 1D5AA 3RT3C 3ZBHA 4Z1VA 5IYCO 1AR4A 3QVNA 4YY3B 4HYOA 1CXZB 4PDVA 4UFZA 5EYPB 5L3FA 4DV3B 4TQFA 3ZHSA 4K0KO 1PM9A 1JQ0A 4X1YB 3I55V 3HKBB 2P4VA 3E35A 1AI5A 1YF2A 4NKGB 2BOCC 3H9VA 3OMAB 2Q7HA 1TUBB 2LFRA 4NVPA 3ZMSA 5J2TA 3C3SA 1HNWB 2EIKB 4MVOA 2DYRB 4EKWA 2Z0AA 2QKSA 4JYBA 2HP8A 4QNHB 3N27A 3QNEA 2UXXA 3B40A 1K97A 4CC5A 2XAGA 2B1IA 2DN9A 1XMQO 1HDJA 4UUJC 2YICA 3VQXA 3AG3B 1GM7A 2EJRA 4WCEV 4X1IA 3O65A 3HPLC 3RYFB 5IYBO 2GV9A 4O4LB 3JASA 3ZRVA 2GTSA 1PNKA 2L35A 1I5YA 1D2DA 4I4TB 2M7WA 1NKDA 2B1GA 1DLBA 3NR7A 2OIEA 4EFEA 3CYOA 1HNZO 4DV0B 4LF8B 3RYIB 4NXNB 2DW4A 5BXZA 5KHKA 3HKEB 5JJNB 1H2SB 3ETGA 4J9ZB 4MVUA 1R6KA 4TT3G 4F4LA 2F4VO 3OFNG 2UUCB 2PI5A 4BR6A 2Q5ZA 4MVZA 4DR7B 4LFBO 4MTOA 2UUBB 2H94A 4XDKA 3OMNB 3ABMB 3T2MA 2MW2B 1R1BA 2Y69C 2OYQA 1PKXA 2YUAA 2P7TC 5KHIA 1NQTA 1NH2B 1MA1A 3JAMN 5DECA 4LBEC 2EINC 2Z5UA 5DN6G 4CH6A 5LGTA 5IY5B 3OGIB 4J9YB 3ZHQA 4DV1O 2ZKOA 1GAXA 2XT9A 4DUZO 2A7WA 5CB4A 4DV7B 1YXBA 1JPXA 4BAYA 4MVQA 4JGSA 2OT5A 5IWAB 4X20A 1XNRB 3ETDA 1GRJA 3AG7A 4LFAO 1NH2D 1RPOA 5B1BB 4JI8O 3TXQA 3G4SV 1M5IA 3WB1A 5CN0A 1EZJA 5BR8O 4CH3A 1W2BU 4KHPO 1WN7A 4H0LB 4QPKA 4WFHA 3CCMV 5CA1A 5IJ9B 3APQA 2KG7B 4MSWC 1FFXA 1K33A 2JS5A 4GX5A 2LJ2A 4DYLA 3AG2C 4PA7A 3WG7C 2GSMB 1L1FA 4YJ2A 4OPAA 5A9GA 3VQVA 1Y74A 1GN3A 1JVMA 4FVMA 1EN4A 1SS3A 2BSKA 5LHIA 2QJ1A 1Q6HA 5C93A 3CCSV 3NXSA 4DR3B 1F4NA 4ZBMA 4JI1O 2NN4A 4E2LA 4JI6O 2Q4PA 2RMKB 4DW1A 2PZSA 5D5PA 2ZXWB 1I94B 1S0VA 3SPJA 3ZMTA 1Q82W 4B7KA 1HR0O 1IBKB 3RYHA 3ABLB 3CCRV 1N4CA 2QSAA 1PP9H 4JAAA 1NR1A 4LNUA 1TA8A 3JAWA 2H3OA 3ZN1A 4D7SA 1ZAUA 2VQFB 5KMGA 1BL8A 1M90W 2Y4TA 1VF6A 3UO2A 1RPRA 4B3MB 5JH7A 2P22C 4KXRA 5EIBC 1MABG 1US6A 2OCHA 4NTXA 4R6ZA 1GO3F 3IGAC 4PD4F 4K8ZA 4DV3O 4ZKIA 2ZQMA 4PHZA 4GCZA 2UXCB 4ZHQB 1WP8A 4J42A 4I0XB 1FXHA 5K1XA 3E83A 2GTAA 3K57A 2QWNB 3DSQA 3L73H 3F5WC 4IYIA 5KHHA 4A5UB 1MZFA 1QLEB 4MT8A 2UXNA 1KECA 3CEIA 2YIAA 4FM0A 3JCUZ 4I50B 3J81N 5B1AC 3QO5A 1GTOA 3CJHA 3K0DA 5CBHA 2JJ1G 2IH1C 3E86A 3JCZA 1U96A 5D5QA 1N34O 2PYJA 4QIWF 1FS0G 4X62B 1RM1C 4X64O 4U3JB 5A2QN 5B3SB 4PA6A 2LGWA 2AXTZ 3K08A 5JJJB 4FFKA 4HZ3A 2F66C 5GW7A 4J11A 5K1PA 4DUYO 5KX5A 2DYSB 2LW7A 5EZYA 4JASA 3UM7A 5B5EZ 2X0LA 4CH5A 2KKWA 3K03A 2ODMA 4X9QA 2UUCO 2VS0A 1COWG 2DWEC 2YIBA 2K9PA 4GYCB 5LXTB 3G71V 4DR7O 2UUBO 4UVBA 3E8FA 4H13B 3SPIA 1BMFG 4GZRB 3QO7A 4MTGA 1IXBA 1MNGA 4QJFB 3ASNC 1OCRC 4AQYO 4JTAB 4FK5C 3SJQC 1I7FA 4UCTA 3CCVV 4AHCA 1AP5A 1AJQA 2PY5A 3G6BA 2FMLA 3AG1B 3GVMA 3L72H 4LH7A 4DV7O 1QVGU 3J80N 2ZR2A 1S77D 2F23A 3T1CA 1L8DA 2HG5C 2LQTA 3G80A 3T1YB 1YITV 3OGCC 3H1KH 1R6TA 4D7TA 2Y4UA 4CS4A 1M1KW 1FXKB 5KLVH 3HKCB 3N2GB 2X7RB 3IFXA 3M8AA 2WLKA 1TUBA 5C8YB 1F7YA 3CSXA 1JMKC 3E8GA 5KHJA 2XAHA 1H2GA 2A06H 3AK1A 1ENVA 5JQGB 2IJKA 1HP8A 3CRQA 4WBNB 1PL4A 4OX9O 4BW5A 1K5QA 2R72A 3UO3A 3WFVA 3ASOC 1XL4A 2AHYA 4FFBA 3BFRA 1QCEA 1V54B 5CBGA 4QPJA 2IJJA 1X59A 3JATB 4O4JB 3RYFA 4JI2O 3VQYA 4X8AA 2N05A 3ABUA 1H2NA 2DMXA 4TUYA 5L3DA 3MDSA 3Q4HA 1BHBA 3F5TA 3SYCA 3OR7C 4DR4O 3FB6C 5KUKA 2D3OW 3AEIA 4JYAO 2JGUA 1NR7A 3FFQA 1M56C 5FNVB 4LF7B 3L74H 4JI0B 5LP6B 1OCZB 2QWOB 2CTQA 2DQ3A 2Q6AA 1M4UA 1FFTB 3HB3B 4U3FH 4WFFA 5FPOA 2VQEO 4HNAB 5CA3A 1J5EO 5CA0A 3ZCCA 1M9NA 3CPWU 2RN9A 4CS3A 5GTHZ 2Z3YA 4ZI7B 3STLC 1QVFU 5IYZB 3DC5A 2RQ6A 3P3PA 2UXCO 3K5MA 3L70H 5GONA 1IBMB 3JYCA 3K5OA 1ZL8B 3A2FA 2EIKC 2DYRC 5TISZ 4ICGA 5LMNO 1WA8A 4FLTA 1N32B 4N23A 2A0LA 2F93B 3A8TA 2CH7B 4W4KA 2YI8A 1PL0A 4I9QA 4UB8Z 4QE7A 4B3RB 4PELA 3AG3C 5IT9N 1VQMV 5LA6A 1URFA 4RAIA 1H2LA 1YHQV 2WLLB 1IVSA 2ADQB 2ZINA 2GUZB 1ZWIC 3ZIAG 3EXAA 5B1OA 3G6EV 4BIZA 2ZR3A 3VBBA 2ARHA 2ZM6O 3ZRWA 1BHAA 2KG7A 3CCJV 4ZOLB 4LFCB 1NTZH 4J80A 1XMOB 2E75B 2ADPA 2ZDIC 1SZXA 1N33B 1BSMA 1ZTEA 3HKDB 5H9CA 3ZMZA 2ZE7A 4IHJB 3X2QB 4DV2B 2QM7A 3RYCB 3DXRB 3BA9A 3T4ZA 1YJWV 1NTKH 1ZLZA 4UV9A 3FD9A 4JTCB 3CCQV 1Y67A 4OXSA 2VWKA 1VQLV 4XBFA 3ABMC 3LSQA 3JALB 2QKAA 1AB3A 4I55B 2YEVB 2CTRA 4B3SB 3KCYA 1RFYA 5EK0A 1OCCB 1WB8A 3T1HB 2PTMA 1GN4A 1DK1A 4LF6O 5IY5C 1AI4A 3ML0A 3VOUA 3SYPA 1KKCA 3CXCU 2R70A 4LF5B 3O9OA 4F6EA 4X1KB 5KAIZ 4JI5B 1E1RG 3FYEB 2UXBB 4DV6O 4LWSA 5KAFZ 1VQ6V 3I56V 5B1BC 2UXDB 4JYYA 3UCSC 4DR5O 1SA0A 3T1YO 1TAEA 1K3EA 4F6RB 5DEDA 4ABMA 2FYUH 3U11A 5LMUO 2E5LB 1S72V 3PN1A 2RNBA 3N2KB 4R50A 2WLNA 3RVYA 1BQZA 1I0HA 2WWWA 4WFEA 2PF4E 1IDSA 4B08A 3FB7C 4X88A 1PV0A 4RUEA 1QU7A 1MMMA 4UCOA 1CEZA 5E1AC 4GKJO 1SQFA 4X66O 1H2MA 3IJ4A 4GKKB 4JTDB 4DRXB 3LUTB 1BS3A 1GKFA 3FX7A 1KYOF 1S3JA 1AROP 4EEQA 5B66Z 1WAZA 1V55B 1JR9A 2ZXWC 2ZIMA 4IIJA 2UU9B 4TV9B 3F7VC 1P49A 1H2KA 2JGDB 4U3JA 4O2AA 4IYHA 3ABLC 3CC4V 3VQWA 4DR1O 1P84F 2QM8A 1UFIA 3ZJZA 1I5XA 4NTYA 4PDMA 5HFLA 4JI0O 3H1LH 1S5HC 4TV8A 4P9PA 4EB6B 3TETA 4PDLA 3BA8A 1XHZA 2B9ZA 2ITDC 2YXYA 3EFFK 3DC6A 2Q73A 3WU2Z 4LF4O 3JAKB 3SJAC 4I9WA 4FLYA 5BMVB 5B1NA 1WJZA 3BABA 4BIOA 1NTMH 1FPOA 4E4EA 1JFFB 2Q7EA 2OIGA 1VQ9V 1WPBA 4MW8A 1FXVA 4ZIBA 1HNXO 1SERA 2DOSA 1QLEC 1Y76B 4DR6B 1AILA 3E8BA 2X6CA 2ZNJA 4OGQB 2EIMB 3QTCA 4B3RO 2ZT9B 1FXKA 1QBZA 2Q7GA 4O4IB 3K59A 2QR4A 1YIJV 2F1MA 3N2GA 5LGNA 4X65O 5J2UA 4JZGA 1VIBA 3A0BZ 3D36A 1OV9A 1PNLA
chains in the Genus database with same CATH topology
4JI1O 4X66O 1X59A 2HHHO 2F4VO 2FKXA 4JI6O 1N32O 4JI2O 4YHHO 4DV5O 5H5NA 4DUYO 1XNQO 5BY1A 2LW7A 4JI4O 3J7AU 1NS1A 4LFBO 4NXMO 1HR0O 1N33O 2UUAO 1IBLO 4JI3O 4GKKO 4DR6O 3OTOO 2UUCO 1R1BA 3F5TA 4DV4O 3SDLA 2E5LO 4DR4O 4JV5O 4DR7O 2UUBO 3RT3C 3R66A 3JAMN 4JYAO 4JI7O 4LF9O 4DR1O 1G1XB 2UU9O 1FJGO 1AB3A 4B3TO 5LL6Y 4DV0O 4DR3O 4LF8O 4DV1O 4NXNO 2ZKOA 1XMOO 4LFCO 4K0KO 4X62O 4DUZO 4AQYO 1FKAO 4OPHA 4GKJO 4JI0O 1DK1A 4LF6O 1I94O 4DV3O 2VQEO 4B3SO 2N74A 1J5EO 4DV7O 4LFAO 1FYJA 3J80N 3T1HO 1IBKO 4JI8O 4DV2O 2DJVA 2AGAA 5BR8O 2Z0AA 1A32A 4LF5O 4KHPO 4LF4O 4DV6O 1XEQA 2UXCO 1R6TA 2VQFO 1XMQO 4YY3O 4A5UB 4LF7O 5LMNO 4DR5O 4B3MO 3T1YO 2UXBO 3M8AA 1HNXO 1N36O 3O65A 1F7YA 4DR2O 2DOSA 1YZBA 4OPAA 5FLXN 1AILA 5IWAO 3J81N 1XNRO 5IT9N 5LMUO 1D2DA 1HNWO 4B3RO 4OX9O 2ZM6O 4JI5O 1KUQA 2JRIA 4X65O 1N34O 1HNZO 4X64O 5BXZA 5A2QN 2UXDO 1IBMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 O;  4X66 O;  1X59 A;  2HHH O;  2F4V O;  2FKX A;  4JI6 O;  1N32 O;  4JI2 O;  4YHH O;  4DV5 O;  5H5N A;  4DUY O;  1XNQ O;  5BY1 A;  2LW7 A;  4JI4 O;  3J7A U;  1NS1 A;  4LFB O;  4NXM O;  1HR0 O;  1N33 O;  2UUA O;  1IBL O;  4JI3 O;  4GKK O;  4DR6 O;  3OTO O;  2UUC O;  1R1B A;  3F5T A;  4DV4 O;  3SDL A;  2E5L O;  4DR4 O;  4JV5 O;  4DR7 O;  2UUB O;  3RT3 C;  3R66 A;  3JAM N;  4JYA O;  4JI7 O;  4LF9 O;  4DR1 O;  1G1X B;  2UU9 O;  1FJG O;  1AB3 A;  4B3T O;  5LL6 Y;  4DV0 O;  4DR3 O;  4LF8 O;  4DV1 O;  4NXN O;  2ZKO A;  1XMO O;  4LFC O;  4K0K O;  4X62 O;  4DUZ O;  4AQY O;  1FKA O;  4OPH A;  4GKJ O;  4JI0 O;  1DK1 A;  4LF6 O;  1I94 O;  4DV3 O;  2VQE O;  4B3S O;  2N74 A;  1J5E O;  4DV7 O;  4LFA O;  1FYJ A;  3J80 N;  3T1H O;  1IBK O;  4JI8 O;  4DV2 O;  2DJV A;  2AGA A;  5BR8 O;  2Z0A A;  1A32 A;  4LF5 O;  4KHP O;  4LF4 O;  4DV6 O;  1XEQ A;  2UXC O;  1R6T A;  2VQF O;  1XMQ O;  4YY3 O;  4A5U B;  4LF7 O;  5LMN O;  4DR5 O;  4B3M O;  3T1Y O;  2UXB O;  3M8A A;  1HNX O;  1N36 O;  3O65 A;  1F7Y A;  4DR2 O;  2DOS A;  1YZB A;  4OPA A;  5FLX N;  1AIL A;  5IWA O;  3J81 N;  1XNR O;  5IT9 N;  5LMU O;  1D2D A;  1HNW O;  4B3R O;  4OX9 O;  2ZM6 O;  4JI5 O;  1KUQ A;  2JRI A;  4X65 O;  1N34 O;  1HNZ O;  4X64 O;  5BXZ A;  5A2Q N;  2UXD O;  1IBM O; 
#chains in the Genus database with same CATH topology
 5LYJ A;  1QR9 A;  4JV5 B;  4CBC A;  1Z5W A;  5B3S C;  1N33 O;  2W6J G;  3BY6 A;  2P5O A;  3SDL A;  2DYS C;  4UCU A;  4UCV A;  1GK9 A;  2M6Y A;  4ASU G;  2LP7 A;  3W7U A;  3AG4 B;  2OTL V;  3JAT A;  4O4J A;  4FZ0 A;  1E79 G;  5JJE B;  1BT8 A;  5IE9 A;  1UPG A;  3W7W A;  3L75 H;  3IC9 A;  3FYI B;  3K9A A;  2JEU A;  4B3S O;  2AW9 A;  3L9D A;  3T1H O;  1TGO A;  3FKS G;  5ITZ A;  2JDI G;  1PNM A;  1G8M A;  4LF5 O;  3AG1 C;  3SJC C;  3LNN A;  1KP3 A;  4YY3 O;  1GMG A;  4DR2 B;  3ABT A;  4K35 A;  2UXB O;  5L3E A;  2CTW A;  2LGQ A;  1TVK B;  3SGI A;  1G4Y B;  4L87 A;  1FXK C;  3W7X A;  3HR0 A;  4LR3 A;  4DV4 B;  1AVM A;  4WF9 V;  1PD3 A;  2QTS A;  5EBL C;  3G67 A;  2Q68 A;  3D36 C;  1GN6 A;  1HNW O;  3OW2 U;  1SKV A;  3CC2 V;  3CHX A;  1ZL8 A;  3ZMV A;  2WLI A;  4LF9 B;  1Q8I A;  4FZ1 A;  5IJ0 B;  1FJG B;  4B3T B;  4PDR A;  1YCI A;  1Q90 D;  2XTA A;  4JI4 B;  2ZCE A;  4IL6 Z;  4MTF A;  3IC7 A;  4KUM A;  1NS1 A;  1V54 C;  4CH4 A;  2XND G;  3K04 A;  1OCO B;  1VQP V;  4O4H A;  4GKK O;  3BEH A;  4FIP C;  1LUW A;  2IJH A;  2ITC C;  2AZ0 A;  4C7U A;  1Z2G A;  3E89 A;  1Y66 A;  1M93 A;  2BTO A;  2QM4 A;  2GDS A;  1XL6 A;  3JAS B;  2UU9 O;  1GN2 A;  2YXH A;  5BZB A;  4DV0 O;  4LF8 O;  4QGP A;  4NXN O;  1LUV A;  2P06 A;  5JVD B;  4IHJ A;  1CP9 A;  1WLE A;  4P2Z A;  3RYC A;  3DXR A;  4CC6 A;  3STZ C;  4PA3 A;  5LP6 C;  1OCZ C;  3SPC A;  2HJD A;  3ZN0 A;  4FJC C;  1EN5 A;  3E2E A;  1WP7 A;  2G38 A;  4I55 A;  3SYO A;  2HLD G;  3B8M A;  2YC0 A;  4XDJ A;  4YIO A;  1ORQ C;  2L6L A;  3ZS8 C;  1AR5 A;  4DV5 B;  2IBZ H;  5IDJ A;  2YDE A;  3MD0 A;  3CRR A;  1PPJ H;  2GBO A;  4FLW A;  4UCR A;  1IBL B;  2CGN A;  4BW9 A;  4IGG A;  5IWA O;  5H6Q A;  3ZHR A;  1XNR O;  2HVK C;  3TCU A;  1MZE A;  2WA4 A;  4WFG A;  5EYP A;  5CB4 B;  4X1Y A;  3ZMU A;  3HKB A;  1KKD A;  1XNQ B;  1BQ0 A;  3WB0 A;  1R3J C;  3QO8 A;  4J10 A;  3H1I H;  1Q6U A;  1QNM A;  3JSN A;  5FL7 G;  1VQ5 V;  2Y0P A;  4JF3 A;  5BY1 A;  3N2K A;  1WNS A;  3J7A U;  4PI0 A;  3CD6 V;  3ZRS A;  5EC1 C;  2W0F C;  1VQN V;  2P90 A;  4KFM A;  4JV5 O;  1XQ8 A;  1RSO B;  1O9G A;  1XIL A;  4YJ2 B;  1WPX A;  3MHH C;  3X2Q C;  3ABK B;  3UT5 B;  1Y74 B;  4H33 A;  1KC8 W;  3CC7 V;  3OAA G;  1NT2 B;  1Q43 A;  4O4L A;  2B5U A;  3GB7 C;  5LL6 Y;  4DR3 O;  1EN6 A;  3LDD A;  2BCC H;  5E79 Z;  1XUQ A;  3LSU A;  3APO A;  2ZDI A;  4I4T A;  3B4S A;  1I94 O;  1GM9 A;  2VRZ A;  3H01 A;  2QA4 V;  2N74 A;  3RVZ A;  4TV9 A;  3RYI A;  1J95 A;  1IBK O;  3OD4 A;  3HKE A;  3UKM A;  1KQS U;  1HNZ B;  2XAS A;  3GWO A;  4MVS A;  1IUR A;  2VQF O;  4LNU B;  2C2A A;  4JZ2 A;  2F4V B;  4H44 B;  3JAW B;  4B3M O;  1VQ8 V;  4W4L A;  4GUN A;  5KMG B;  1XI1 A;  3C90 A;  3OT7 A;  4DR2 O;  1XRE A;  4PJ0 Z;  3OE7 G;  4QE9 A;  5JH7 B;  1Q3E A;  4TQD A;  3JAK A;  1K5S A;  4RWU A;  3MHS C;  3JD0 A;  2Q0A A;  1YEW A;  2FTK A;  1S76 D;  5BMV A;  1QR8 A;  4GX0 A;  2CDY A;  4J41 A;  1BE3 H;  4YHH B;  2RCV A;  4DV1 B;  3B8N A;  1Q7Y W;  1YDX A;  4YJ3 B;  4JI3 B;  5LOV B;  2YS8 A;  3JAR B;  2YSU B;  4JI4 O;  1B06 A;  4LFA B;  3D8C A;  4JI8 B;  3CP1 A;  2BE3 A;  1MSW D;  5IJ9 A;  2LO1 A;  4R7C A;  5J9P C;  3WB2 A;  1NJI W;  1P7G A;  4HBN A;  1XOU A;  1R3L C;  2K1E A;  2QKC A;  2QEX V;  4I7Z B;  1V55 C;  2E74 B;  1K9M W;  1EBO A;  1HWY A;  1K4D C;  3CJH B;  1F51 A;  4X62 O;  3B09 A;  2WPD G;  2HEP A;  1KU9 A;  3ZHV A;  1G6U A;  1JJO A;  1I08 A;  1XHX A;  1EM1 A;  3BRC A;  3CME V;  5LGU A;  4GLX A;  5EZY B;  3GWK C;  1XEQ A;  1JJ2 U;  3LSS A;  4DO2 A;  3SPH A;  3M7M X;  3M99 B;  3CRM A;  1ZUQ A;  1YVW A;  4O2B B;  5LHG A;  4MW3 A;  3PJS K;  2EIL B;  4H37 A;  2EIJ B;  2DQ0 A;  1Q5O A;  1HR0 B;  3U0Z A;  3OUS A;  3TJT A;  4TSF G;  3T4D A;  2W0X A;  5FPR A;  1EZV H;  4WFB V;  1BGY H;  2JIZ G;  4LP8 A;  2DWD C;  3RWR D;  2XAQ A;  1VQK V;  2EBO A;  4K3A A;  2H8P C;  3P32 A;  2HHH B;  2YIB D;  1KUQ A;  1M57 B;  2JRI A;  3D3Q A;  2NLJ C;  1P7B A;  1SES A;  4RUF A;  1CPY A;  1TVK A;  2EIM C;  2ATK C;  2BTQ B;  2Q69 A;  4DK1 A;  4ZHQ A;  2UUA B;  2FL4 A;  1SC5 B;  4I0X A;  1XNQ O;  2EJ7 A;  1K34 A;  1DF5 A;  2IJI A;  4UVC A;  4JI7 B;  3K5N A;  2FB5 A;  1ZX3 A;  4AI8 A;  3CX5 F;  5IJ0 A;  1Q81 W;  4JYC A;  3OM3 B;  2QE7 G;  4JPR A;  4Q20 A;  2HKO A;  4NR1 A;  2RJZ A;  3THO A;  2Q8V A;  2Y48 A;  1G1X B;  2F43 G;  2HVJ C;  4I50 A;  4MTX A;  2OCC B;  3AK2 A;  2E76 B;  4FMT A;  1UJW B;  1VQ4 V;  3AG4 C;  2RDC A;  2KB1 A;  4FFB B;  2BOB C;  1R3K C;  2EZP A;  4UV8 A;  2ETN A;  3RGB A;  3SR2 C;  1IXM A;  2E3C A;  4Z2W A;  1Q6I A;  3CS5 A;  3S3W A;  5EBM C;  3BPZ A;  1H8H G;  1N34 B;  2KSD A;  1SQX H;  4X64 B;  5JVD A;  1NI8 A;  4TUY B;  3Q4H B;  2WLH A;  4LF7 O;  3JD2 A;  5H2F Z;  3OMI B;  3P3N A;  4DUY B;  2WAM A;  5LXT A;  2P4K A;  3RW0 A;  4RQE A;  3K58 A;  1YI2 V;  1B3Q A;  2IH3 C;  4G28 B;  4PV1 B;  2ILM A;  1BCC H;  3AK3 A;  4NTW A;  1LNQ A;  3E22 B;  4P9O A;  3ZX6 A;  1X4T A;  3ZHT A;  3FB5 C;  1VEW A;  5JWP A;  1SZT A;  2QWP B;  4PI2 A;  3DGE A;  2P67 A;  2NNU A;  4G2K A;  5CA0 B;  5L3C A;  3K3W A;  2V1D A;  3KCX A;  3FB8 C;  4AQY B;  5LBQ A;  1IBM O;  4MS2 A;  4BIU A;  1Y4M A;  2FKX A;  1OZ0 A;  1N32 O;  1BZK A;  1SQB H;  4YHH O;  3FAV B;  3F7Y C;  1KD1 W;  1IZ3 A;  5GON B;  2V7Q G;  2F95 B;  1WA8 B;  4JI3 O;  1GM8 A;  2XAF A;  5EBW C;  5F2V O;  3HKC A;  3K06 A;  1AI6 A;  1DGS A;  3A0R A;  1L0L H;  1MG1 A;  4FM2 A;  3A0H Z;  1OCO C;  1U97 A;  5C8Y A;  3K9S A;  1VP7 A;  5LA6 B;  3CCL V;  3JD4 A;  2QTO A;  1XMO O;  4LFC O;  2Y0I A;  2YI9 A;  1T5E A;  4RO2 A;  3ZRW B;  5JQG A;  4WBN A;  3RN4 A;  4UCS A;  1RSO A;  4J7J A;  1E1Q G;  3ICX A;  4DV2 O;  2R9I A;  4U7O A;  2VWJ A;  3UT5 A;  4OX9 B;  3SYA A;  2AGA A;  4NB5 A;  5CMU A;  1EFR G;  1K73 W;  2LW1 A;  3QG5 A;  4GT1 A;  1NBM G;  4FLU A;  1N36 B;  5EC2 C;  4MVR A;  2Q0O C;  3K5L A;  1AP6 A;  4WFA V;  4AIL C;  1YJN V;  1Q86 W;  4JI2 B;  2EZO A;  3KZI Z;  4FLZ A;  4GX1 A;  1JA8 A;  1YJ9 V;  1VF7 A;  3K0G A;  1N0J A;  1AJP A;  3ETE A;  4BWA A;  2OTJ V;  4LCU C;  5FLX N;  5FNV A;  4G27 B;  2IW5 A;  3ZRX A;  5LP6 A;  4DR4 B;  1H38 A;  4X89 A;  2QGN A;  2ZIO A;  3BAA A;  4JYA B;  3CRA A;  2YID A;  4JI5 O;  4DW0 A;  3QF7 A;  2CUG A;  2WA3 A;  4HNA A;  1VQ7 V;  3EVK A;  2IM9 A;  2UXD O;  3CXH F;  3EHB B;  2HHH O;  3ETQ A;  2CTP A;  1AI7 A;  2IU3 A;  2JK5 C;  4ZI7 A;  3OTO B;  2HJF C;  2Y69 B;  3C3T A;  1KBH A;  2VQE B;  5IYZ A;  4LWS B;  3BCC H;  1J5E B;  3OUF A;  2WSS G;  2PUS A;  2UUA O;  2EIN B;  3OTF A;  2QWR B;  1SA0 B;  1SQG A;  1TUE B;  2E5L O;  2JVD A;  1NZ6 A;  2Q67 A;  3R66 A;  5J2T B;  2X6A A;  2CH7 A;  4YJ3 A;  2X6B A;  4JI7 O;  1B04 A;  1JX9 A;  2JS3 A;  5LMN B;  1F23 A;  1VQO V;  5LOV A;  1QQC A;  3I5D A;  3JAR A;  2ZNI A;  3BVO A;  4NYK A;  2WLL A;  4OPH A;  2GUZ A;  3ABK C;  2WLJ A;  1QLN A;  3H1H H;  4K8X A;  1VF5 B;  2OWO A;  4IT5 A;  1LR1 A;  1FYJ A;  1P4R A;  4ZOL A;  4X1I B;  2R9R B;  2XOK G;  1Z5V A;  3S3X A;  1JCH A;  3D3I A;  4Z1M G;  4YIP A;  3ZED A;  3SPG A;  1FD9 A;  2ZM6 B;  5JCO A;  1XBL A;  1AJN A;  3HKD A;  2QWQ B;  3AG2 B;  3WG7 B;  1ZSP A;  2CGO A;  2D2C B;  5KUM A;  4IIJ B;  3OEH G;  2IU0 A;  2XUM A;  2A3Q A;  3CWB H;  2A79 B;  2R9A A;  4O2A B;  3OEE G;  1SQQ H;  4XDL A;  2XHB A;  3OR6 C;  1F4M A;  3JAL A;  3H1J H;  1N0N A;  2HR3 A;  2LFS A;  2YXL A;  2YEV A;  2DE0 X;  1L0N H;  4FM1 A;  1VF6 C;  4TV8 B;  3L71 H;  1KMI Z;  4LC1 A;  4O2B A;  2JEX A;  1O9H A;  4NXM B;  3E8H A;  2P6J A;  4X1K A;  4LF6 B;  3CB2 A;  5CBF A;  4DK0 A;  1W0K G;  4GX2 A;  2CE4 A;  4LH6 A;  3TGU H;  4DR6 O;  3CCE V;  4UVA A;  4X20 B;  4JAV A;  1NVP B;  3B77 A;  4DV6 B;  1DF4 A;  4K0K B;  1THZ A;  4F6R A;  2BTQ A;  3KKY A;  4PA9 A;  5LHH A;  1D5N A;  5IYD O;  4DR5 B;  4FPP A;  1GH6 A;  1N8R W;  2N04 A;  1RP3 B;  5L3B A;  4CS2 A;  1HW7 A;  1FKA O;  4TOI A;  5CA1 B;  1OJH A;  1K8A W;  5JCO C;  5J2U B;  1FFX B;  5LMU B;  4L8J A;  2Q9L A;  1NVP D;  5KHG A;  3SYQ A;  5EIB D;  5LYJ B;  1XMQ B;  2DJV A;  1SET A;  1K92 A;  4DRX A;  1A32 A;  1B6Q A;  2BSK B;  2AZ2 A;  4PA4 A;  1Y6X A;  4GKJ B;  4X66 B;  3LNM B;  3JD3 A;  1K7D A;  5B1A B;  4FLX A;  3IAY A;  1FAF A;  2QDO A;  1K4C C;  4FLV A;  2ZD9 A;  2GHY A;  4DXW A;  1N36 O;  1OCC C;  2JGD A;  1W59 A;  2PYL A;  2CAZ C;  2ZE8 A;  4JAU A;  1YTF B;  2ZE6 A;  1YSC A;  2EIL C;  2EIJ C;  2V4D A;  1RM1 B;  2CK3 G;  1DTO A;  3RYH B;  5AG2 A;  1R6N A;  4YXW G;  4DR1 B;  2MK3 A;  4Q6G A;  5ITZ B;  4EB6 A;  4LFB B;  4I5S A;  3DTU B;  2JJ2 G;  1M57 C;  4TWK A;  1YTF D;  1R73 A;  3E22 A;  4P30 A;  4HAM A;  3OTO O;  5H6R A;  4DV4 O;  3RFR A;  2W6I G;  2EX3 A;  2A9H A;  3ASN B;  4LF4 B;  5KA6 A;  1OCR B;  1JFF A;  1IX9 A;  4DUZ B;  5HFM A;  1XDC A;  1MOF A;  4LF9 O;  2PI4 A;  1Y76 A;  1V9P A;  1FJG O;  3TXS A;  3FAV A;  3B2E E;  4CZZ A;  5KA5 A;  4B3T O;  4J7Z A;  1HNX B;  1KP2 A;  1H8E G;  2PGG A;  2WLI B;  1KB9 F;  3RBZ A;  4O4I A;  4B7E A;  3CE2 A;  5BR8 B;  2OCC C;  1R3I C;  4KHP B;  4D6T H;  1MSD A;  5DM6 V;  3BHP A;  4X65 B;  4MVM A;  4RQF A;  1WB7 A;  1SF9 A;  4O4H B;  4EFB A;  2KQX A;  4UXN A;  4KP4 A;  1VMG A;  3W7T A;  2ZE5 A;  3U10 A;  3SJB C;  1VAR A;  3R65 A;  3LDE A;  3JSL A;  1YZB A;  3JD1 A;  4UB6 Z;  3CRC A;  1ROP A;  1OHH G;  3ASO B;  4KL1 A;  4U7N A;  5KX5 B;  3K79 A;  3TK1 A;  4J7K A;  1SQV H;  1JOY A;  1NU1 H;  1QHT A;  4N21 A;  1SQP H;  4JI1 B;  2O57 A;  3W7S A;  4JI6 B;  3UQ8 A;  1S5J A;  2EUL A;  5GTI Z;  2NR5 A;  5L3G A;  1W0J G;  2AHZ A;  2XAJ A;  3P30 A;  1SRY A;  1AR1 B;  3ZHU A;  2WLM A;  2HFE C;  1S5L Z;  4R8C A;  4DV5 O;  5H5N A;  4NXM O;  3LDC A;  3MAQ A;  1IBL O;  1M56 B;  3CMA V;  3CCU V;  3KG2 A;  1D5A A;  3RT3 C;  3ZBH A;  4Z1V A;  5IYC O;  1AR4 A;  3QVN A;  4YY3 B;  4HYO A;  1CXZ B;  4PDV A;  4UFZ A;  5EYP B;  5L3F A;  4DV3 B;  4TQF A;  3ZHS A;  4K0K O;  1PM9 A;  1JQ0 A;  4X1Y B;  3I55 V;  3HKB B;  2P4V A;  3E35 A;  1AI5 A;  1YF2 A;  4NKG B;  2BOC C;  3H9V A;  3OMA B;  2Q7H A;  1TUB B;  2LFR A;  4NVP A;  3ZMS A;  5J2T A;  3C3S A;  1HNW B;  2EIK B;  4MVO A;  2DYR B;  4EKW A;  2Z0A A;  2QKS A;  4JYB A;  2HP8 A;  4QNH B;  3N27 A;  3QNE A;  2UXX A;  3B40 A;  1K97 A;  4CC5 A;  2XAG A;  2B1I A;  2DN9 A;  1XMQ O;  1HDJ A;  4UUJ C;  2YIC A;  3VQX A;  3AG3 B;  1GM7 A;  2EJR A;  4WCE V;  4X1I A;  3O65 A;  3HPL C;  3RYF B;  5IYB O;  2GV9 A;  4O4L B;  3JAS A;  3ZRV A;  2GTS A;  1PNK A;  2L35 A;  1I5Y A;  1D2D A;  4I4T B;  2M7W A;  1NKD A;  2B1G A;  1DLB A;  3NR7 A;  2OIE A;  4EFE A;  3CYO A;  1HNZ O;  4DV0 B;  4LF8 B;  3RYI B;  4NXN B;  2DW4 A;  5BXZ A;  5KHK A;  3HKE B;  5JJN B;  1H2S B;  3ETG A;  4J9Z B;  4MVU A;  1R6K A;  4TT3 G;  4F4L A;  2F4V O;  3OFN G;  2UUC B;  2PI5 A;  4BR6 A;  2Q5Z A;  4MVZ A;  4DR7 B;  4LFB O;  4MTO A;  2UUB B;  2H94 A;  4XDK A;  3OMN B;  3ABM B;  3T2M A;  2MW2 B;  1R1B A;  2Y69 C;  2OYQ A;  1PKX A;  2YUA A;  2P7T C;  5KHI A;  1NQT A;  1NH2 B;  1MA1 A;  3JAM N;  5DEC A;  4LBE C;  2EIN C;  2Z5U A;  5DN6 G;  4CH6 A;  5LGT A;  5IY5 B;  3OGI B;  4J9Y B;  3ZHQ A;  4DV1 O;  2ZKO A;  1GAX A;  2XT9 A;  4DUZ O;  2A7W A;  5CB4 A;  4DV7 B;  1YXB A;  1JPX A;  4BAY A;  4MVQ A;  4JGS A;  2OT5 A;  5IWA B;  4X20 A;  1XNR B;  3ETD A;  1GRJ A;  3AG7 A;  4LFA O;  1NH2 D;  1RPO A;  5B1B B;  4JI8 O;  3TXQ A;  3G4S V;  1M5I A;  3WB1 A;  5CN0 A;  1EZJ A;  5BR8 O;  4CH3 A;  1W2B U;  4KHP O;  1WN7 A;  4H0L B;  4QPK A;  4WFH A;  3CCM V;  5CA1 A;  5IJ9 B;  3APQ A;  2KG7 B;  4MSW C;  1FFX A;  1K33 A;  2JS5 A;  4GX5 A;  2LJ2 A;  4DYL A;  3AG2 C;  4PA7 A;  3WG7 C;  2GSM B;  1L1F A;  4YJ2 A;  4OPA A;  5A9G A;  3VQV A;  1Y74 A;  1GN3 A;  1JVM A;  4FVM A;  1EN4 A;  1SS3 A;  2BSK A;  5LHI A;  2QJ1 A;  1Q6H A;  5C93 A;  3CCS V;  3NXS A;  4DR3 B;  1F4N A;  4ZBM A;  4JI1 O;  2NN4 A;  4E2L A;  4JI6 O;  2Q4P A;  2RMK B;  4DW1 A;  2PZS A;  5D5P A;  2ZXW B;  1I94 B;  1S0V A;  3SPJ A;  3ZMT A;  1Q82 W;  4B7K A;  1HR0 O;  1IBK B;  3RYH A;  3ABL B;  3CCR V;  1N4C A;  2QSA A;  1PP9 H;  4JAA A;  1NR1 A;  4LNU A;  1TA8 A;  3JAW A;  2H3O A;  3ZN1 A;  4D7S A;  1ZAU A;  2VQF B;  5KMG A;  1BL8 A;  1M90 W;  2Y4T A;  1VF6 A;  3UO2 A;  1RPR A;  4B3M B;  5JH7 A;  2P22 C;  4KXR A;  5EIB C;  1MAB G;  1US6 A;  2OCH A;  4NTX A;  4R6Z A;  1GO3 F;  3IGA C;  4PD4 F;  4K8Z A;  4DV3 O;  4ZKI A;  2ZQM A;  4PHZ A;  4GCZ A;  2UXC B;  4ZHQ B;  1WP8 A;  4J42 A;  4I0X B;  1FXH A;  5K1X A;  3E83 A;  2GTA A;  3K57 A;  2QWN B;  3DSQ A;  3L73 H;  3F5W C;  4IYI A;  5KHH A;  4A5U B;  1MZF A;  1QLE B;  4MT8 A;  2UXN A;  1KEC A;  3CEI A;  2YIA A;  4FM0 A;  3JCU Z;  4I50 B;  3J81 N;  5B1A C;  3QO5 A;  1GTO A;  3CJH A;  3K0D A;  5CBH A;  2JJ1 G;  2IH1 C;  3E86 A;  3JCZ A;  1U96 A;  5D5Q A;  1N34 O;  2PYJ A;  4QIW F;  1FS0 G;  4X62 B;  1RM1 C;  4X64 O;  4U3J B;  5A2Q N;  5B3S B;  4PA6 A;  2LGW A;  2AXT Z;  3K08 A;  5JJJ B;  4FFK A;  4HZ3 A;  2F66 C;  5GW7 A;  4J11 A;  5K1P A;  4DUY O;  5KX5 A;  2DYS B;  2LW7 A;  5EZY A;  4JAS A;  3UM7 A;  5B5E Z;  2X0L A;  4CH5 A;  2KKW A;  3K03 A;  2ODM A;  4X9Q A;  2UUC O;  2VS0 A;  1COW G;  2DWE C;  2YIB A;  2K9P A;  4GYC B;  5LXT B;  3G71 V;  4DR7 O;  2UUB O;  4UVB A;  3E8F A;  4H13 B;  3SPI A;  1BMF G;  4GZR B;  3QO7 A;  4MTG A;  1IXB A;  1MNG A;  4QJF B;  3ASN C;  1OCR C;  4AQY O;  4JTA B;  4FK5 C;  3SJQ C;  1I7F A;  4UCT A;  3CCV V;  4AHC A;  1AP5 A;  1AJQ A;  2PY5 A;  3G6B A;  2FML A;  3AG1 B;  3GVM A;  3L72 H;  4LH7 A;  4DV7 O;  1QVG U;  3J80 N;  2ZR2 A;  1S77 D;  2F23 A;  3T1C A;  1L8D A;  2HG5 C;  2LQT A;  3G80 A;  3T1Y B;  1YIT V;  3OGC C;  3H1K H;  1R6T A;  4D7T A;  2Y4U A;  4CS4 A;  1M1K W;  1FXK B;  5KLV H;  3HKC B;  3N2G B;  2X7R B;  3IFX A;  3M8A A;  2WLK A;  1TUB A;  5C8Y B;  1F7Y A;  3CSX A;  1JMK C;  3E8G A;  5KHJ A;  2XAH A;  1H2G A;  2A06 H;  3AK1 A;  1ENV A;  5JQG B;  2IJK A;  1HP8 A;  3CRQ A;  4WBN B;  1PL4 A;  4OX9 O;  4BW5 A;  1K5Q A;  2R72 A;  3UO3 A;  3WFV A;  3ASO C;  1XL4 A;  2AHY A;  4FFB A;  3BFR A;  1QCE A;  1V54 B;  5CBG A;  4QPJ A;  2IJJ A;  1X59 A;  3JAT B;  4O4J B;  3RYF A;  4JI2 O;  3VQY A;  4X8A A;  2N05 A;  3ABU A;  1H2N A;  2DMX A;  4TUY A;  5L3D A;  3MDS A;  3Q4H A;  1BHB A;  3F5T A;  3SYC A;  3OR7 C;  4DR4 O;  3FB6 C;  5KUK A;  2D3O W;  3AEI A;  4JYA O;  2JGU A;  1NR7 A;  3FFQ A;  1M56 C;  5FNV B;  4LF7 B;  3L74 H;  4JI0 B;  5LP6 B;  1OCZ B;  2QWO B;  2CTQ A;  2DQ3 A;  2Q6A A;  1M4U A;  1FFT B;  3HB3 B;  4U3F H;  4WFF A;  5FPO A;  2VQE O;  4HNA B;  5CA3 A;  1J5E O;  5CA0 A;  3ZCC A;  1M9N A;  3CPW U;  2RN9 A;  4CS3 A;  5GTH Z;  2Z3Y A;  4ZI7 B;  3STL C;  1QVF U;  5IYZ B;  3DC5 A;  2RQ6 A;  3P3P A;  2UXC O;  3K5M A;  3L70 H;  5GON A;  1IBM B;  3JYC A;  3K5O A;  1ZL8 B;  3A2F A;  2EIK C;  2DYR C;  5TIS Z;  4ICG A;  5LMN O;  1WA8 A;  4FLT A;  1N32 B;  4N23 A;  2A0L A;  2F93 B;  3A8T A;  2CH7 B;  4W4K A;  2YI8 A;  1PL0 A;  4I9Q A;  4UB8 Z;  4QE7 A;  4B3R B;  4PEL A;  3AG3 C;  5IT9 N;  1VQM V;  5LA6 A;  1URF A;  4RAI A;  1H2L A;  1YHQ V;  2WLL B;  1IVS A;  2ADQ B;  2ZIN A;  2GUZ B;  1ZWI C;  3ZIA G;  3EXA A;  5B1O A;  3G6E V;  4BIZ A;  2ZR3 A;  3VBB A;  2ARH A;  2ZM6 O;  3ZRW A;  1BHA A;  2KG7 A;  3CCJ V;  4ZOL B;  4LFC B;  1NTZ H;  4J80 A;  1XMO B;  2E75 B;  2ADP A;  2ZDI C;  1SZX A;  1N33 B;  1BSM A;  1ZTE A;  3HKD B;  5H9C A;  3ZMZ A;  2ZE7 A;  4IHJ B;  3X2Q B;  4DV2 B;  2QM7 A;  3RYC B;  3DXR B;  3BA9 A;  3T4Z A;  1YJW V;  1NTK H;  1ZLZ A;  4UV9 A;  3FD9 A;  4JTC B;  3CCQ V;  1Y67 A;  4OXS A;  2VWK A;  1VQL V;  4XBF A;  3ABM C;  3LSQ A;  3JAL B;  2QKA A;  1AB3 A;  4I55 B;  2YEV B;  2CTR A;  4B3S B;  3KCY A;  1RFY A;  5EK0 A;  1OCC B;  1WB8 A;  3T1H B;  2PTM A;  1GN4 A;  1DK1 A;  4LF6 O;  5IY5 C;  1AI4 A;  3ML0 A;  3VOU A;  3SYP A;  1KKC A;  3CXC U;  2R70 A;  4LF5 B;  3O9O A;  4F6E A;  4X1K B;  5KAI Z;  4JI5 B;  1E1R G;  3FYE B;  2UXB B;  4DV6 O;  4LWS A;  5KAF Z;  1VQ6 V;  3I56 V;  5B1B C;  2UXD B;  4JYY A;  3UCS C;  4DR5 O;  1SA0 A;  3T1Y O;  1TAE A;  1K3E A;  4F6R B;  5DED A;  4ABM A;  2FYU H;  3U11 A;  5LMU O;  2E5L B;  1S72 V;  3PN1 A;  2RNB A;  3N2K B;  4R50 A;  2WLN A;  3RVY A;  1BQZ A;  1I0H A;  2WWW A;  4WFE A;  2PF4 E;  1IDS A;  4B08 A;  3FB7 C;  4X88 A;  1PV0 A;  4RUE A;  1QU7 A;  1MMM A;  4UCO A;  1CEZ A;  5E1A C;  4GKJ O;  1SQF A;  4X66 O;  1H2M A;  3IJ4 A;  4GKK B;  4JTD B;  4DRX B;  3LUT B;  1BS3 A;  1GKF A;  3FX7 A;  1KYO F;  1S3J A;  1ARO P;  4EEQ A;  5B66 Z;  1WAZ A;  1V55 B;  1JR9 A;  2ZXW C;  2ZIM A;  4IIJ A;  2UU9 B;  4TV9 B;  3F7V C;  1P49 A;  1H2K A;  2JGD B;  4U3J A;  4O2A A;  4IYH A;  3ABL C;  3CC4 V;  3VQW A;  4DR1 O;  1P84 F;  2QM8 A;  1UFI A;  3ZJZ A;  1I5X A;  4NTY A;  4PDM A;  5HFL A;  4JI0 O;  3H1L H;  1S5H C;  4TV8 A;  4P9P A;  4EB6 B;  3TET A;  4PDL A;  3BA8 A;  1XHZ A;  2B9Z A;  2ITD C;  2YXY A;  3EFF K;  3DC6 A;  2Q73 A;  3WU2 Z;  4LF4 O;  3JAK B;  3SJA C;  4I9W A;  4FLY A;  5BMV B;  5B1N A;  1WJZ A;  3BAB A;  4BIO A;  1NTM H;  1FPO A;  4E4E A;  1JFF B;  2Q7E A;  2OIG A;  1VQ9 V;  1WPB A;  4MW8 A;  1FXV A;  4ZIB A;  1HNX O;  1SER A;  2DOS A;  1QLE C;  1Y76 B;  4DR6 B;  1AIL A;  3E8B A;  2X6C A;  2ZNJ A;  4OGQ B;  2EIM B;  3QTC A;  4B3R O;  2ZT9 B;  1FXK A;  1QBZ A;  2Q7G A;  4O4I B;  3K59 A;  2QR4 A;  1YIJ V;  2F1M A;  3N2G A;  5LGN A;  4X65 O;  5J2U A;  4JZG A;  1VIB A;  3A0B Z;  3D36 A;  1OV9 A;  1PNL A; 
#chains in the Genus database with same CATH homology
 4JI1 O;  4X66 O;  1X59 A;  2HHH O;  2F4V O;  2FKX A;  4JI6 O;  1N32 O;  4JI2 O;  4YHH O;  4DV5 O;  5H5N A;  4DUY O;  1XNQ O;  5BY1 A;  2LW7 A;  4JI4 O;  3J7A U;  1NS1 A;  4LFB O;  4NXM O;  1HR0 O;  1N33 O;  2UUA O;  1IBL O;  4JI3 O;  4GKK O;  4DR6 O;  3OTO O;  2UUC O;  1R1B A;  3F5T A;  4DV4 O;  3SDL A;  2E5L O;  4DR4 O;  4JV5 O;  4DR7 O;  2UUB O;  3RT3 C;  3R66 A;  3JAM N;  4JYA O;  4JI7 O;  4LF9 O;  4DR1 O;  1G1X B;  2UU9 O;  1FJG O;  1AB3 A;  4B3T O;  5LL6 Y;  4DV0 O;  4DR3 O;  4LF8 O;  4DV1 O;  4NXN O;  2ZKO A;  1XMO O;  4LFC O;  4K0K O;  4X62 O;  4DUZ O;  4AQY O;  1FKA O;  4OPH A;  4GKJ O;  4JI0 O;  1DK1 A;  4LF6 O;  1I94 O;  4DV3 O;  2VQE O;  4B3S O;  2N74 A;  1J5E O;  4DV7 O;  4LFA O;  1FYJ A;  3J80 N;  3T1H O;  1IBK O;  4JI8 O;  4DV2 O;  2DJV A;  2AGA A;  5BR8 O;  2Z0A A;  1A32 A;  4LF5 O;  4KHP O;  4LF4 O;  4DV6 O;  1XEQ A;  2UXC O;  1R6T A;  2VQF O;  1XMQ O;  4YY3 O;  4A5U B;  4LF7 O;  5LMN O;  4DR5 O;  4B3M O;  3T1Y O;  2UXB O;  3M8A A;  1HNX O;  1N36 O;  3O65 A;  1F7Y A;  4DR2 O;  2DOS A;  1YZB A;  4OPA A;  5FLX N;  1AIL A;  5IWA O;  3J81 N;  1XNR O;  5IT9 N;  5LMU O;  1D2D A;  1HNW O;  4B3R O;  4OX9 O;  2ZM6 O;  4JI5 O;  1KUQ A;  2JRI A;  4X65 O;  1N34 O;  1HNZ O;  4X64 O;  5BXZ A;  5A2Q N;  2UXD O;  1IBM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...