1IBKO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibkO00
1NS1A 2E5LO 4LFAO 4B3SO 4GKJO 1FYJA 4DUYO 4JV5O 4A5UB 4X65O 1XMOO 2DJVA 4GKKO 2VQFO 2HHHO 4LF5O 2UUBO 4JI8O 4AQYO 4DUZO 2JRIA 4JI4O 1N36O 2Z0AA 1HNXO 1AB3A 2AGAA 1HNZO 1IBMO 1X59A 3SDLA 4DR3O 4B3TO 4OPAA 4JI5O 1XNRO 4OPHA 4DV1O 2UXBO 4X66O 2N74A 1IBKO 5A2QN 3J7AU 4DR2O 4DR5O 4YHHO 2DOSA 1N33O 3T1YO 4DV2O 4JI1O 5LMNO 1J5EO 4KHPO 4JYAO 4DV7O 4LF6O 4YY3O 2LW7A 2F4VO 1XEQA 4LF9O 2FKXA 3T1HO 5IWAO 4JI7O 3JAMN 4LF8O 2UXDO 5LMUO 1FKAO 4B3RO 5BY1A 1N34O 1R1BA 4LF7O 2UUAO 4DR7O 4LFBO 1I94O 4K0KO 3RT3C 1XNQO 5LL6Y 2UXCO 4DV6O 3OTOO 1F7YA 1FJGO 1G1XB 1A32A 4OX9O 1YZBA 4X64O 4LFCO 4DR6O 4DR1O 3J81N 3J80N 4X62O 1DK1A 4DV4O 5BR8O 4DV3O 1HNWO 5BXZA 5IT9N 4JI0O 5H5NA 1R6TA 1D2DA 4B3MO 1KUQA 2VQEO 4DR4O 2UUCO 3R66A 4JI6O 4DV0O 4NXMO 4LF4O 2ZM6O 1IBLO 4JI2O 5FLXN 3F5TA 4DV5O 3O65A 4NXNO 2ZKOA 1N32O 4JI3O 2UU9O 1XMQO 3M8AA 1HR0O 1AILA
chains in the Genus database with same CATH superfamily
3LDDA 3ZHQA 3BCCH 4JZ2A 2DN9A 1MNGA 5A9GA 4FLYA 1LUWA 3WB2A 2JJ2G 4GX0A 1XMOO 1I08A 4IYIA 4LF4B 4ASUG 1LUVA 1VARA 1G8MA 1HNZO 4NKGB 1I0HA 1JQ0A 4TV8A 1VQ9V 3N2GB 2YXHA 4DRXA 3ZN0A 2ZQMA 4B3TO 1CXZB 3CJHB 2JGDB 3W7SA 4GKKB 4J9ZB 4O2BA 4LWSB 3RGBA 4F6RB 3C3SA 1WB7A 3APQA 2JS3A 4YY3B 4ZKIA 4TV9A 2H8PC 1JX9A 2OCHA 4KHPO 3B2EE 1VF7A 1H8EG 4LC1A 1FS0G 5FL7G 5IYZB 2BTQB 2H3OA 4B3RO 5IYBO 4AILC 3KCYA 2LGWA 1I94O 2B1GA 1RM1B 4DV6O 1K5QA 4JI1B 2OTLV 1TVKB 2W0XA 4PA7A 4DR6O 3QO5A 1HNWB 1Y76A 3ETQA 2B9ZA 3QVNA 5BR8O 2Z3YA 4Q6GA 1COWG 3B77A 4L8JA 2CGNA 2LP7A 1R6TA 3X2QB 1ZAUA 2A0LA 2DQ3A 4ZI7A 1XNQB 1FJGB 2KG7A 4H37A 1Q86W 1HWYA 1I5XA 4OX9B 4LFCB 4DR1B 4UCUA 2YDEA 3S3XA 4IHJB 4LH7A 4BIOA 2OCCB 3PN1A 3HPLC 2E5LO 5FPOA 1XHZA 1NZ6A 2L6LA 2HHHB 4ZOLA 2LW1A 5HFLA 1YTFD 2Q7EA 5LGTA 2ZM6B 1N32B 4DUZO 2Q6AA 4OXSA 2RNBA 3NXSA 2QKSA 2V7QG 1UPGA 3G80A 3QNEA 4DR3O 1ZL8B 2RMKB 1VF5B 4OPHA 1AR1B 4DV1O 2UXBO 1XL6A 1KD1W 3SYAA 3UKMA 2BTOA 3BY6A 1XQ8A 1V54B 3L70H 1GMGA 4UV8A 2P22C 5KUMA 1Y74B 4PJ0Z 3R65A 4LF9O 4LBEC 3RN4A 1WN7A 2G38A 3SJQC 3JARA 4J80A 5TISZ 1QR8A 5ITZB 2P5OA 2PUSA 4DR7O 1FFXA 2PGGA 3K04A 4GT1A 5BMVB 2HG5C 3ZRWA 3OM3B 3K03A 4UFZA 3E22B 4WFAV 4O4JA 1J95A 5EIBC 1Q7YW 4LF8B 3CE2A 1VF6A 4GUNA 4DR4B 2QM7A 4QNHB 2CGOA 2Q67A 4MT8A 1VQNV 3LNNA 3BEHA 4IT5A 5JVDA 4MVRA 3JASB 3R66A 2O57A 3DC5A 2PZSA 5KHHA 5LOVB 3ASNC 4QPKA 1H2LA 2QR4A 4O4IA 3UT5A 3B8MA 2BSKA 2XASA 3ASOB 3W7TA 1FYJA 5KX5A 1Z5WA 4I55B 1W0KG 3EFFK 3JD0A 3DTUB 4FFBA 4WFFA 2GTAA 3QF7A 3AG4B 2YIBD 4O4LB 2A9HA 1FXKA 1JOYA 2DYSB 4JTDB 3ABKC 2OTJV 1LR1A 1H2SB 1U97A 2KSDA 3I56V 3LDCA 4YJ3B 3L75H 3ZIAG 3HKDB 1BQ0A 1SQXH 1QQCA 1YXBA 3ABTA 1VQ4V 3N27A 4I4TA 2XAHA 4ZHQA 1VQ7V 5LHIA 3J7AU 1BSMA 1HNXB 2CTQA 3WB1A 3FB8C 1YVWA 1N33O 4BIUA 3CRRA 3CHXA 4FK5C 4EEQA 4JAUA 4LF6O 3CSXA 5KHIA 1G6UA 1AP6A 4PDMA 4K0KB 4RQEA 2YXLA 3WG7B 1YEWA 1E1RG 3KCXA 1XL4A 5B1BC 1XBLA 3CCEV 3RVYA 4TV8B 3RT3C 4G2KA 4YHHB 4FLUA 4DRXB 5LMNB 4UCVA 1GN3A 4UCOA 2NR5A 3ZX6A 2L35A 3EVKA 1KKDA 4O2BB 3FB5C 3ZS8C 1N0JA 3OEEG 4X88A 4TV9B 3TGUH 3OT7A 3CRMA 2QSAA 3AG1B 3VBBA 1K4DC 5LP6C 2B5UA 3H1LH 2XAJA 3G6BA 3P3PA 2D2CB 2R70A 3M8AA 2JGUA 2YSUB 3FD9A 3D8CA 2YICA 1HR0O 5B1AC 2ATKC 5JJJB 1YDXA 2AZ2A 1Y66A 3UCSC 3E8FA 5LHHA 1SQFA 1V55B 1Y76B 1L1FA 1YJWV 4R50A 1JA8A 4D7TA 1IBMB 2CAZC 1NH2B 4JI4O 3OEHG 1QCEA 4UV9A 2GHYA 3DXRA 1XNRB 4ZI7B 3GWOA 2N04A 4HAMA 3FYIB 1D5AA 3A0BZ 1WP7A 3K0GA 3H1IH 4J7KA 2A3QA 1SQPH 5EIBD 3PJSK 3LSUA 5FPRA 2H94A 4F4LA 3IAYA 2IU0A 1V54C 5H6RA 1K3EA 4PA6A 3ZHRA 1YHQV 3RYHA 4DV7O 4ZOLB 2JJ1G 2Q4PA 2CTRA 2Q73A 3VOUA 3ZHVA 1IZ3A 3JD4A 1FXHA 1IBKB 3CCMV 5EBMC 4KFMA 5BY1A 4LF7O 2HKOA 1NQTA 1B6QA 1SC5B 3CCLV 1EBOA 2BOCC 3P3NA 4X64O 5DN6G 5IWAB 1R3KC 2F66C 4P2ZA 1WJZA 2XAQA 3D3IA 2DWEC 1AI7A 1EN6A 5H2FZ 2OYQA 3BFRA 2WA4A 2UXCB 2YEVA 3K5NA 2VQEO 1MOFA 3IGAC 1RPRA 1BE3H 2IJIA 1AI5A 3JARB 2UU9B 4HZ3A 2NLJC 1FXVA 1M5IA 3FAVB 2PYJA 5LBQA 1LNQA 4BIZA 4PA3A 1FFXB 3CXHF 2WLMA 3AG4C 3ZRWB 1K8AW 2OIEA 3SR2C 1S5LZ 3CX5F 2DYSC 4O4JB 1KBHA 2VS0A 2KB1A 4DV5B 4IGGA 1HNZB 5CB4A 1GM7A 3A2FA 2RJZA 4JAVA 3D36C 1M57C 4MTXA 3BVOA 5JVDB 5B3SC 1HW7A 1VQOV 3F5WC 4DUYB 5EBLC 4JF3A 4J9YB 3K06A 4NR1A 5GTIZ 2ODMA 4O4IB 1I7FA 3UT5B 5L3BA 2D3OW 4IIJA 2BSKB 4MW3A 2CH7A 4KHPB 2ZE6A 4X9QA 1SQBH 4MVOA 1H38A 2DE0X 2EINB 2ZXWB 5D5PA 4FFBB 3AG2C 1AVMA 1AR5A 1SZTA 5L3EA 1PPJH 4B3RB 1FXKB 4BW5A 5LMUO 1KQSU 1I94B 1S0VA 4BW9A 4P9PA 3LDEA 4DR5B 4DW0A 4B08A 5CMUA 4DV2B 5L3CA 2QTOA 3AG7A 1O9GA 1YZBA 4FZ1A 3T1HB 2M6YA 5CN0A 1DK1A 4GX2A 1SQVH 3S3WA 3E83A 3FYEB 4K3AA 1IVSA 3RYFA 4X20A 4WCEV 3RYIB 3HKEA 2HR3A 2B1IA 4U7NA 3MHSC 1PV0A 3OAAG 1V9PA 4FLTA 3K5OA 3STZC 2HJFC 5JH7B 5FLXN 2BOBC 4K35A 1SKVA 1XREA 1VP7A 2E5LB 1AJPA 2ITCC 3SYCA 2X6AA 4U3JA 4FVMA 3K79A 4X1IB 4GKJO 3L72H 3EHBB 4QGPA 1V55C 4LH6A 3CPWU 3BHPA 4DV0B 2M7WA 1AJNA 3AK1A 3JSLA 2P4VA 1HP8A 2ZE8A 2EJRA 1QR9A 4JI3B 3LSQA 2QDOA 3SJBC 4WFEA 3C90A 4DK1A 1JVMA 5J2UA 2A79B 4JI5O 4LNUA 4UVAA 4CS3A 3F7VC 2ILMA 4UB6Z 3M99B 2VQFB 1QNMA 2VWJA 1XILA 4H13B 5LGNA 3RBZA 3U0ZA 3ZBHA 1EM1A 1WPXA 3ZRVA 1Q6HA 1N0NA 1VEWA 1K97A 5LXTA 5E79Z 2P67A 3L73H 3JYCA 4CC5A 1BGYH 1SA0B 5D5QA 2E74B 2Y48A 3A8TA 4IYHA 1H2GA 1R73A 4GLXA 2CDYA 4LFBO 3AK3A 1AI4A 1GH6A 3DXRB 4I9QA 3E2EA 1NTZH 2CK3G 1GN2A 5KMGA 1RSOA 4TT3G 3W7XA 3H9VA 2HP8A 2AZ0A 4DV4O 2UXDB 4P30A 1ORQC 4TWKA 3OTFA 3OR7C 3CP1A 4RO2A 5KAFZ 2P6JA 1S76D 3ABMC 4KP4A 2QE7G 1GN6A 2HJDA 3RYHB 4YJ2A 2WSSG 4JI2O 3F5TA 1VMGA 2NN4A 4PI2A 3WFVA 1XMQO 4J41A 3I55V 1JCHA 2E75B 3OMNB 1WPBA 1N4CA 2QWRB 4LFAO 3CD6V 4B3MB 1Z2GA 4X65O 4C7UA 4IL6Z 2UUBO 1VF6C 2QWOB 2FB5A 4ZIBA 1YITV 3ZRXA 5LHGA 2YEVB 4B3SB 3QO8A 4TOIA 1EZVH 5H6QA 2BCCH 2OWOA 1PM9A 4JV5B 1K5SA 1RFYA 2R9AA 2QJ1A 5A2QN 1BT8A 4KUMA 1Q6IA 4LF6B 1XHXA 2XUMA 4HYOA 4YIOA 4XDKA 2JIZG 1J5EO 4JGSA 5DEDA 1AI6A 5LA6A 2YXYA 2F4VO 4R6ZA 3K9AA 5EZYA 2IJKA 2LO1A 1N8RW 1KKCA 4J7ZA 1Q3EA 5IJ9A 1Y6XA 5CA0A 5CB4B 5DM6V 2RDCA 5JJNB 2F1MA 5LL6Y 4HNAA 3JD2A 1M93A 5FNVA 1A32A 2C2AA 1W2BU 2XNDG 5GW7A 4X62O 4DV3O 1NTMH 3FB7C 2PYLA 4IIJB 3CWBH 1IXMA 2CH7B 3MHHC 3M7MX 4DK0A 4MTOA 3P30A 2IU3A 2YIBA 4PDLA 4KXRA 4JI6O 4FPPA 4LF4O 2EILC 2P7TC 3JAKA 1RPOA 3ZMUA 5K1PA 2EIMB 4FJCC 4GX5A 4PA9A 1K7DA 1SS3A 1F4NA 3I5DA 4KL1A 5EYPA 3ABLB 2F95B 2R9IA 2DW4A 2WA3A 3WU2Z 1QLNA 4GKKO 1QVFU 1FD9A 1BHAA 1OCOB 4X20B 1AB3A 3HKEB 5JCOC 3RVZA 2XAFA 2JDIG 3F7YC 1K9MW 5KA5A 5LYJA 4MW8A 2GUZB 4I0XB 3SPCA 4AHCA 1YJ9V 2N74A 2VRZA 4RWUA 2GV9A 4AQYB 2E3CA 4UB8Z 4JYCA 4DV7B 4U3JB 3T4ZA 2Q9LA 4JI1O 4PI0A 2WLNA 3JALA 2JS5A 1GO3F 4LP8A 4JI7O 3JAMN 4U3FH 1FKAO 1Q6UA 3OGIB 4H33A 1XNQO 1QLEB 1K92A 2YI8A 4G28B 3T1YB 4X64B 1FJGO 5J2UB 4NYKA 4JYAB 4LNUB 1K4CC 1THZA 1R3JC 1NVPD 4OX9O 4LFCO 1TA8A 4DR1O 3GVMA 3J80N 4YIPA 3KG2A 5BXZA 5KHKA 2X7RB 2VQEB 2YS8A 3AG3B 5H5NA 5KHGA 2Q0AA 2YUAA 4CBCA 2PY5A 2WLKA 2P90A 5LXTB 1IXBA 3OTOB 2UUCO 1RM1C 1JMKC 3FFQA 4NXMO 5J9PC 2ZM6O 2DMXA 2KKWA 1WNSA 4CH6A 3CCQV 4NXNO 1N32O 3CC7V 3N2KA 2QWNB 1W0JG 2Y69B 1JJOA 4JAAA 2XHBA 3X2QC 1L0NH 5AG2A 5KMGB 1RSOB 2WAMA 4I50A 3K5LA 2WPDG 3JCZA 1S5HC 1IBLB 4NTXA 2GTSA 3HR0A 4O2AA 1NI8A 3A0RA 4CH4A 4J7JA 2OCCC 1OCZB 4CH5A 2ARHA 3E8GA 1YTFB 4DO2A 1Y4MA 1Q5OA 2WLIA 3ZMTA 4FLZA 1OCRB 5CA1A 2QKAA 4LF5B 2QWPB 1XUQA 5EBWC 4XDLA 2PI4A 2W6JG 2DOSA 2HEPA 4PA4A 3JD1A 4J11A 4WBNA 5EK0A 2MK3A 4D6TH 1KP2A 4X66B 2KG7B 2JEUA 4LF8O 4FMTA 4E2LA 4HBNA 3ETEA 3HB3B 2HVKC 2ZDIC 2IW5A 2V1DA 1MABG 2YIAA 3CC2V 2IBZH 4RQFA 2GBOA 4F6RA 2EIJB 1SESA 1GM9A 3BA8A 1CP9A 2JK5C 1PL4A 4DYLA 5IYCO 2P4KA 2JEXA 1N34B 3OE7G 3O9OA 4R8CA 2ZD9A 3ZHSA 4PDVA 5L3GA 2UUAB 2Y0PA 4JYBA 5LA6B 1I5YA 1MZFA 1XOUA 4MVUA 2F93B 3HKBA 5EZYB 3QTCA 3CMAV 2AW9A 1FPOA 3O65A 4EFEA 3W7UA 5IJ9B 2KQXA 3E86A 1M90W 4JI0B 2ZT9B 1YJNV 2Q7GA 4HNAB 2LJ2A 5FNVB 5KA6A 4XBFA 3VQWA 2IJJA 3WB0A 1Q81W 1IX9A 3KKYA 2ZE7A 4JI8O 2EJ7A 4PHZA 3UM7A 1AJQA 1HNXO 1P49A 3ASOC 1KECA 2YIDA 3JSNA 1S3JA 5IY5B 3BPZA 5LP6A 4QE7A 1AROP 1XMOB 3K3WA 3JAKB 2WLHA 4GYCB 4EKWA 5B66Z 4CC6A 1X4TA 4DR2O 2LFRA 2RCVA 3STLC 1GN4A 1Q90D 4YHHO 1UFIA 1XDCA 1QU7A 1U96A 5EYPB 1YSCA 2ZCEA 5LMNO 2A7WA 3CCSV 1HDJA 2CTWA 4UUJC 4WFGA 4B3TB 1ZSPA 1R3IC 2FKXA 2ZNIA 4UXNA 4Q20A 1YIJV 5KLVH 3CCRV 4LFBB 4AI8A 1H2MA 1R1BA 1QLEC 2CUGA 3ZMSA 4Z1VA 3HKCA 1L8DA 1US6A 3LSSA 3CS5A 1F7YA 1QVGU 2UXXA 1G1XB 5LYJB 1VQ5V 3RYCA 1VQLV 1OJHA 5H9CA 4CS4A 4FLWA 5KX5B 3OUFA 5C8YA 1M56B 3SYOA 2WLLA 3AG3C 2X6CA 1D2DA 3WG7C 1MSDA 1H2KA 1PKXA 4DV6B 2VWKA 3E8BA 1RP3B 4H44B 1QHTA 1P7GA 3JALB 4DR6B 4JZGA 5ITZA 1IURA 4ABMA 2LFSA 1WLEA 5BR8B 2IM9A 4I4TB 1YI2V 1Q8IA 4ZHQB 1EFRG 4X65B 4MVMA 3E22A 4X1YA 3TETA 4A5UB 4CZZA 3AG1C 1WAZA 2DWDC 1N36O 3B40A 3FKSG 1OCZC 3B8NA 3H1JH 1CEZA 4MVQA 4RUFA 4MSWC 1MMMA 3JAWA 1PNMA 1OCRC 3BRCA 1IBKO 1DF4A 3CB2A 1ZWIC 5IE9A 4JPRA 4DUZB 3L71H 1SQQH 2Q5ZA 4BWAA 3G6EV 1NJIW 4JTAB 1J5EB 4I55A 3CC4V 1H8HG 2OIGA 3CRQA 4DR3B 4O4LA 4GX1A 2LW7A 3ZHTA 2YI9A 4I50B 3VQYA 5IWAO 4DV1B 2CTPA 2UXBB 1BZKA 2R9RB 1T5EA 1JFFA 4O2AB 2IH1C 3D36A 4CS2A 2EZOA 5IDJA 1GKFA 4CH3A 4TUYA 1YF2A 2UXCO 4FM0A 3T4DA 2EIJC 3CRAA 4LF9B 2XOKG 5CA1B 2QTSA 2HVJC 4DW1A 5B1NA 4JASA 5KAIZ 1S77D 1IDSA 3A0HZ 4DR7B 2FTKA 4JI6B 4MVSA 4WBNB 3IC9A 1NR7A 4NTWA 4TQFA 4QPJA 3IC7A 1AP5A 4DV5O 3ABKB 3IFXA 1B3QA 5BZBA 4YXWG 3GWKC 1NS1A 3G71V 3OD4A 4DUYO 1NT2B 4UCSA 3OW2U 2QKCA 4LCUC 1K33A 3U10A 4UCRA 3ETGA 2XT9A 3DSQA 3UQ8A 2Z0AA 2BE3A 4DXWA 4I7ZB 3U11A 4E4EA 4PD4F 1CPYA 4WF9V 5IY5C 3DGEA 2DYRB 2W6IG 3HKBB 1S5JA 3CMEV 2FYUH 4GZRB 4L87A 5B1BB 3SPJA 4DR5O 2WWWA 1FAFA 1R6NA 4DV2O 1KU9A 4JI7B 1BHBA 4B7KA 3T1HO 1VQKV 2EIKB 3RFRA 2EULA 2GDSA 1VIBA 4ICGA 1N33B 1SQGA 3ICXA 3RWRD 4MTGA 1P84F 2EINC 5LP6B 1BCCH 2ZXWC 1M56C 4UCTA 3P32A 1FXKC 5B1AB 1OZ0A 2UUCB 1KUQA 1H2NA 4NXMB 4U7OA 3TK1A 4NXNB 4DV0O 3CYOA 4ZBMA 3SJCC 5GONA 2JVDA 4K8XA 4JI3O 2ADPA 1TUBA 1NH2D 4PELA 5L3DA 1F4MA 3HKCB 4Z2WA 5B1OA 3SPGA 1UJWB 3RYCB 3JATA 4I5SA 2DJVA 1XI1A 5C8YB 4O4HA 2VQFO 2WLLB 3BA9A 4LR3A 5J2TA 1KP3A 1VQPV 2ZIOA 2JRIA 1NTKH 3VQVA 1HR0B 4WFBV 1DF5A 3QG5A 1TUEB 3ETDA 3FAVA 2PI5A 3ZEDA 4NTYA 2ZR3A 5B5EZ 4JI4B 5E1AC 3MDSA 3CXCU 3THOA 2IJHA 1B04A 3SJAC 5IJ0A 2V4DA 1M4UA 3RYFB 3APOA 4QE9A 1ZX3A 4RAIA 1B06A 4X1YB 4YY3O 1XEQA 3LUTB 4J10A 3ML0A 5CBGA 3H1KH 2UXDO 2AHZA 3KZIZ 1NBMG 1ROPA 3DC6A 1L0LH 2ZR2A 3E35A 2ITDC 1M9NA 2Q0OC 1JPXA 3JAWB 3TXSA 4D7SA 2NNUA 2LQTA 3UO2A 1WA8A 1ENVA 4P9OA 5C93A 1HNWO 2Y0IA 1ZTEA 3LNMB 4LF7B 4R7CA 4X1KA 4B3MO 3CRCA 1OV9A 3G67A 3Q4HA 2A06H 3ZN1A 3IJ4A 2F43G 3QO7A 1MG1A 1O9HA 2Y4UA 5KHJA 1JFFB 1KMIZ 3ZHUA 1NKDA 2GSMB 5IYDO 1R6KA 4TUYB 1BL8A 1M57B 4TQDA 3CCJV 2IH3C 5B3SB 1SETA 3CCUV 4B3SO 1PD3A 4JV5O 4JI8B 1KYOF 3AK2A 3FB6C 2HHHO 3RYIA 1EN5A 3K59A 1TAEA 2K1EA 1SF9A 3ZCCA 1P7BA 3OFNG 3K58A 2AGAA 3TCUA 5K1XA 4J42A 4B7EA 2DYRC 3B4SA 5JQGA 1Q43A 5JH7A 3AG2B 4JTCB 2AHYA 4RUEA 4DR2B 2R72A 4K8ZA 2UXNA 1Z5VA 2Q7HA 3JCUZ 1JJ2U 3ZJZA 4X1IA 3SPIA 2QM8A 1GM8A 5LGUA 4PDRA 2QEXV 4QIWF 4XDJA 4EB6A 1P4RA 2X6BA 3AEIA 2EIKC 2EZPA 5KUKA 3NR7A 4YJ2B 3TXQA 5JCOA 4MS2A 1PNLA 2HFEC 1GRJA 1VQ6V 2ADQB 1WB8A 3ABUA 3BABA 3H1HH 4PV1B 3MD0A 4I9WA 3ZMVA 5DECA 4UVBA 1G4YB 5LMUB 1GAXA 2WLJA 5IT9N 1KC8W 1BS3A 1DLBA 3N2GA 3SPHA 1SA0A 4DR4O 3MAQA 1SZXA 2AXTZ 3CJHA 2JGDA 1DTOA 4JYYA 1OCCB 1E79G 2ZKOA 4LWSA 2X0LA 3JD3A 2EBOA 3K0DA 2Q69A 1AILA 3C3TA 1MZEA 2QWQB 4MVZA 4TSFG 2K9PA 3L74H 1JR9A 1BMFG 3CCVV 2CE4A 1N36B 1NU1H 5F2VO 4N23A 2RN9A 4AQYO 5CBFA 5JJEB 1SERA 5IYZA 2BTQA 1NR1A 2EIMC 1SRYA 5GTHZ 5JWPA 4EFBA 1KB9F 5CA0B 3SDLA 2Q8VA 1R3LC 4GKJB 1EZJA 3K08A 1GK9A 4OPAA 1OHHG 1TVKA 1W59A 4W4KA 3ABLC 2PTMA 3GB7C 5GONB 3K57A 4NB5A 1TUBB 3D3QA 1OCOC 3T1YO 4GCZA 2P06A 4JYAO 4N21A 3T2MA 4JI5B 3JATB 3T1CA 2LGQA 2ZINA 3K5MA 4O4HB 2N05A 5J2TB 4FZ0A 4IHJA 4F6EA 5L3FA 3ABMB 5EC1C 3ZRSA 4K0KO 1TGOA 2ETNA 3OTOO 3H01A 4WFHA 1PL0A 1ZUQA 4Z1MG 1PNKA 1Y67A 2RQ6A 2Y4TA 4FIPC 1AR4A 5IJ0B 1FFTB 3E8HA 5HFMA 2F23A 4MTFA 3TJTA 3L9DA 1QBZA 1NVPB 1E1QG 1ZL8A 1S72V 1IBLO 3VQXA 5EC2C 4DV4B 1GTOA 2ZDIA 2W0FC 3E89A 3OGCC 4FLVA 2FMLA 3K9SA 2ZE5A 2E76B 3W7WA 4BR6A 1YCIA 1VQ8V 1Y74A 1F51A 1BQZA 4FFKA 1URFA 4JI2B 1WA8B 4LF5O 1K34A 3RW0A 3BAAA 3SGIA 1XMQB 4FLXA 4FM2A 1MSWD 1IBMO 4X1KB 1X59A 4LFAB 5BMVA 5CBHA 2Y69C 3Q4HB 1XNRO 1ZLZA 2ZNJA 4X66O 3G4SV 3OR6C 2MW2B 2UUBB 4OGQB 3CEIA 4X8AA 4X89A 1PP9H 3OMAB 3ZMZA 2QA4V 4UVCA 3JASA 1WP8A 3SYQA 1M1KW 3OUSA 4G27B 5LOVA 2DQ0A 2XAGA 1DGSA 5CA3A 2QM4A 1N34O 2QGNA 2ZIMA 2UUAO 2Q68A 2GUZA 3FX7A 4I0XA 3N2KB 5JQGB 1Q82W 1F23A 2HLDG 2EILB 2FL4A 3SYPA 1MA1A 4BAYA 1K73W 1D5NA 2F4VB 3J81N 2XTAA 4W4LA 2PF4E 2EX3A 4FM1A 4JI0O 4EB6B 3UO3A 1VQMV 3EXAA 3B09A 2Z5UA 4YJ3A 4H0LB 1OCCC 3HKDA 2OT5A 4NVPA 4X62B 3ASNB 3OMIB 2WLIB 2UU9O 4DV3B 2YC0A 1EN4A 4QJFB
chains in the Genus database with same CATH topology
1NS1A 2E5LO 4LFAO 4B3SO 4GKJO 1FYJA 4DUYO 4JV5O 4A5UB 4X65O 1XMOO 2DJVA 4GKKO 2VQFO 2HHHO 4LF5O 2UUBO 4JI8O 4AQYO 4DUZO 2JRIA 4JI4O 1N36O 2Z0AA 1HNXO 1AB3A 2AGAA 1HNZO 1IBMO 1X59A 3SDLA 4DR3O 4B3TO 4OPAA 4JI5O 1XNRO 4OPHA 4DV1O 2UXBO 4X66O 2N74A 1IBKO 5A2QN 3J7AU 4DR2O 4DR5O 4YHHO 2DOSA 1N33O 3T1YO 4DV2O 4JI1O 5LMNO 1J5EO 4KHPO 4JYAO 4DV7O 4LF6O 4YY3O 2LW7A 2F4VO 1XEQA 4LF9O 2FKXA 3T1HO 5IWAO 4JI7O 3JAMN 4LF8O 2UXDO 5LMUO 1FKAO 4B3RO 5BY1A 1N34O 1R1BA 4LF7O 2UUAO 4DR7O 4LFBO 1I94O 4K0KO 3RT3C 1XNQO 5LL6Y 2UXCO 4DV6O 3OTOO 1F7YA 1FJGO 1G1XB 1A32A 4OX9O 1YZBA 4X64O 4LFCO 4DR6O 4DR1O 3J81N 3J80N 4X62O 1DK1A 4DV4O 5BR8O 4DV3O 1HNWO 5BXZA 5IT9N 4JI0O 5H5NA 1R6TA 1D2DA 4B3MO 1KUQA 2VQEO 4DR4O 2UUCO 3R66A 4JI6O 4DV0O 4NXMO 4LF4O 2ZM6O 1IBLO 4JI2O 5FLXN 3F5TA 4DV5O 3O65A 4NXNO 2ZKOA 1N32O 4JI3O 2UU9O 1XMQO 3M8AA 1HR0O 1AILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NS1 A;  2E5L O;  4LFA O;  4B3S O;  4GKJ O;  1FYJ A;  4DUY O;  4JV5 O;  4A5U B;  4X65 O;  1XMO O;  2DJV A;  4GKK O;  2VQF O;  2HHH O;  4LF5 O;  2UUB O;  4JI8 O;  4AQY O;  4DUZ O;  2JRI A;  4JI4 O;  1N36 O;  2Z0A A;  1HNX O;  1AB3 A;  2AGA A;  1HNZ O;  1IBM O;  1X59 A;  3SDL A;  4DR3 O;  4B3T O;  4OPA A;  4JI5 O;  1XNR O;  4OPH A;  4DV1 O;  2UXB O;  4X66 O;  2N74 A;  1IBK O;  5A2Q N;  3J7A U;  4DR2 O;  4DR5 O;  4YHH O;  2DOS A;  1N33 O;  3T1Y O;  4DV2 O;  4JI1 O;  5LMN O;  1J5E O;  4KHP O;  4JYA O;  4DV7 O;  4LF6 O;  4YY3 O;  2LW7 A;  2F4V O;  1XEQ A;  4LF9 O;  2FKX A;  3T1H O;  5IWA O;  4JI7 O;  3JAM N;  4LF8 O;  2UXD O;  5LMU O;  1FKA O;  4B3R O;  5BY1 A;  1N34 O;  1R1B A;  4LF7 O;  2UUA O;  4DR7 O;  4LFB O;  1I94 O;  4K0K O;  3RT3 C;  1XNQ O;  5LL6 Y;  2UXC O;  4DV6 O;  3OTO O;  1F7Y A;  1FJG O;  1G1X B;  1A32 A;  4OX9 O;  1YZB A;  4X64 O;  4LFC O;  4DR6 O;  4DR1 O;  3J81 N;  3J80 N;  4X62 O;  1DK1 A;  4DV4 O;  5BR8 O;  4DV3 O;  1HNW O;  5BXZ A;  5IT9 N;  4JI0 O;  5H5N A;  1R6T A;  1D2D A;  4B3M O;  1KUQ A;  2VQE O;  4DR4 O;  2UUC O;  3R66 A;  4JI6 O;  4DV0 O;  4NXM O;  4LF4 O;  2ZM6 O;  1IBL O;  4JI2 O;  5FLX N;  3F5T A;  4DV5 O;  3O65 A;  4NXN O;  2ZKO A;  1N32 O;  4JI3 O;  2UU9 O;  1XMQ O;  3M8A A;  1HR0 O;  1AIL A; 
#chains in the Genus database with same CATH topology
 3LDD A;  3ZHQ A;  3BCC H;  4JZ2 A;  2DN9 A;  1MNG A;  5A9G A;  4FLY A;  1LUW A;  3WB2 A;  2JJ2 G;  4GX0 A;  1XMO O;  1I08 A;  4IYI A;  4LF4 B;  4ASU G;  1LUV A;  1VAR A;  1G8M A;  1HNZ O;  4NKG B;  1I0H A;  1JQ0 A;  4TV8 A;  1VQ9 V;  3N2G B;  2YXH A;  4DRX A;  3ZN0 A;  2ZQM A;  4B3T O;  1CXZ B;  3CJH B;  2JGD B;  3W7S A;  4GKK B;  4J9Z B;  4O2B A;  4LWS B;  3RGB A;  4F6R B;  3C3S A;  1WB7 A;  3APQ A;  2JS3 A;  4YY3 B;  4ZKI A;  4TV9 A;  2H8P C;  1JX9 A;  2OCH A;  4KHP O;  3B2E E;  1VF7 A;  1H8E G;  4LC1 A;  1FS0 G;  5FL7 G;  5IYZ B;  2BTQ B;  2H3O A;  4B3R O;  5IYB O;  4AIL C;  3KCY A;  2LGW A;  1I94 O;  2B1G A;  1RM1 B;  4DV6 O;  1K5Q A;  4JI1 B;  2OTL V;  1TVK B;  2W0X A;  4PA7 A;  4DR6 O;  3QO5 A;  1HNW B;  1Y76 A;  3ETQ A;  2B9Z A;  3QVN A;  5BR8 O;  2Z3Y A;  4Q6G A;  1COW G;  3B77 A;  4L8J A;  2CGN A;  2LP7 A;  1R6T A;  3X2Q B;  1ZAU A;  2A0L A;  2DQ3 A;  4ZI7 A;  1XNQ B;  1FJG B;  2KG7 A;  4H37 A;  1Q86 W;  1HWY A;  1I5X A;  4OX9 B;  4LFC B;  4DR1 B;  4UCU A;  2YDE A;  3S3X A;  4IHJ B;  4LH7 A;  4BIO A;  2OCC B;  3PN1 A;  3HPL C;  2E5L O;  5FPO A;  1XHZ A;  1NZ6 A;  2L6L A;  2HHH B;  4ZOL A;  2LW1 A;  5HFL A;  1YTF D;  2Q7E A;  5LGT A;  2ZM6 B;  1N32 B;  4DUZ O;  2Q6A A;  4OXS A;  2RNB A;  3NXS A;  2QKS A;  2V7Q G;  1UPG A;  3G80 A;  3QNE A;  4DR3 O;  1ZL8 B;  2RMK B;  1VF5 B;  4OPH A;  1AR1 B;  4DV1 O;  2UXB O;  1XL6 A;  1KD1 W;  3SYA A;  3UKM A;  2BTO A;  3BY6 A;  1XQ8 A;  1V54 B;  3L70 H;  1GMG A;  4UV8 A;  2P22 C;  5KUM A;  1Y74 B;  4PJ0 Z;  3R65 A;  4LF9 O;  4LBE C;  3RN4 A;  1WN7 A;  2G38 A;  3SJQ C;  3JAR A;  4J80 A;  5TIS Z;  1QR8 A;  5ITZ B;  2P5O A;  2PUS A;  4DR7 O;  1FFX A;  2PGG A;  3K04 A;  4GT1 A;  5BMV B;  2HG5 C;  3ZRW A;  3OM3 B;  3K03 A;  4UFZ A;  3E22 B;  4WFA V;  4O4J A;  1J95 A;  5EIB C;  1Q7Y W;  4LF8 B;  3CE2 A;  1VF6 A;  4GUN A;  4DR4 B;  2QM7 A;  4QNH B;  2CGO A;  2Q67 A;  4MT8 A;  1VQN V;  3LNN A;  3BEH A;  4IT5 A;  5JVD A;  4MVR A;  3JAS B;  3R66 A;  2O57 A;  3DC5 A;  2PZS A;  5KHH A;  5LOV B;  3ASN C;  4QPK A;  1H2L A;  2QR4 A;  4O4I A;  3UT5 A;  3B8M A;  2BSK A;  2XAS A;  3ASO B;  3W7T A;  1FYJ A;  5KX5 A;  1Z5W A;  4I55 B;  1W0K G;  3EFF K;  3JD0 A;  3DTU B;  4FFB A;  4WFF A;  2GTA A;  3QF7 A;  3AG4 B;  2YIB D;  4O4L B;  2A9H A;  1FXK A;  1JOY A;  2DYS B;  4JTD B;  3ABK C;  2OTJ V;  1LR1 A;  1H2S B;  1U97 A;  2KSD A;  3I56 V;  3LDC A;  4YJ3 B;  3L75 H;  3ZIA G;  3HKD B;  1BQ0 A;  1SQX H;  1QQC A;  1YXB A;  3ABT A;  1VQ4 V;  3N27 A;  4I4T A;  2XAH A;  4ZHQ A;  1VQ7 V;  5LHI A;  3J7A U;  1BSM A;  1HNX B;  2CTQ A;  3WB1 A;  3FB8 C;  1YVW A;  1N33 O;  4BIU A;  3CRR A;  3CHX A;  4FK5 C;  4EEQ A;  4JAU A;  4LF6 O;  3CSX A;  5KHI A;  1G6U A;  1AP6 A;  4PDM A;  4K0K B;  4RQE A;  2YXL A;  3WG7 B;  1YEW A;  1E1R G;  3KCX A;  1XL4 A;  5B1B C;  1XBL A;  3CCE V;  3RVY A;  4TV8 B;  3RT3 C;  4G2K A;  4YHH B;  4FLU A;  4DRX B;  5LMN B;  4UCV A;  1GN3 A;  4UCO A;  2NR5 A;  3ZX6 A;  2L35 A;  3EVK A;  1KKD A;  4O2B B;  3FB5 C;  3ZS8 C;  1N0J A;  3OEE G;  4X88 A;  4TV9 B;  3TGU H;  3OT7 A;  3CRM A;  2QSA A;  3AG1 B;  3VBB A;  1K4D C;  5LP6 C;  2B5U A;  3H1L H;  2XAJ A;  3G6B A;  3P3P A;  2D2C B;  2R70 A;  3M8A A;  2JGU A;  2YSU B;  3FD9 A;  3D8C A;  2YIC A;  1HR0 O;  5B1A C;  2ATK C;  5JJJ B;  1YDX A;  2AZ2 A;  1Y66 A;  3UCS C;  3E8F A;  5LHH A;  1SQF A;  1V55 B;  1Y76 B;  1L1F A;  1YJW V;  4R50 A;  1JA8 A;  4D7T A;  1IBM B;  2CAZ C;  1NH2 B;  4JI4 O;  3OEH G;  1QCE A;  4UV9 A;  2GHY A;  3DXR A;  1XNR B;  4ZI7 B;  3GWO A;  2N04 A;  4HAM A;  3FYI B;  1D5A A;  3A0B Z;  1WP7 A;  3K0G A;  3H1I H;  4J7K A;  2A3Q A;  1SQP H;  5EIB D;  3PJS K;  3LSU A;  5FPR A;  2H94 A;  4F4L A;  3IAY A;  2IU0 A;  1V54 C;  5H6R A;  1K3E A;  4PA6 A;  3ZHR A;  1YHQ V;  3RYH A;  4DV7 O;  4ZOL B;  2JJ1 G;  2Q4P A;  2CTR A;  2Q73 A;  3VOU A;  3ZHV A;  1IZ3 A;  3JD4 A;  1FXH A;  1IBK B;  3CCM V;  5EBM C;  4KFM A;  5BY1 A;  4LF7 O;  2HKO A;  1NQT A;  1B6Q A;  1SC5 B;  3CCL V;  1EBO A;  2BOC C;  3P3N A;  4X64 O;  5DN6 G;  5IWA B;  1R3K C;  2F66 C;  4P2Z A;  1WJZ A;  2XAQ A;  3D3I A;  2DWE C;  1AI7 A;  1EN6 A;  5H2F Z;  2OYQ A;  3BFR A;  2WA4 A;  2UXC B;  2YEV A;  3K5N A;  2VQE O;  1MOF A;  3IGA C;  1RPR A;  1BE3 H;  2IJI A;  1AI5 A;  3JAR B;  2UU9 B;  4HZ3 A;  2NLJ C;  1FXV A;  1M5I A;  3FAV B;  2PYJ A;  5LBQ A;  1LNQ A;  4BIZ A;  4PA3 A;  1FFX B;  3CXH F;  2WLM A;  3AG4 C;  3ZRW B;  1K8A W;  2OIE A;  3SR2 C;  1S5L Z;  3CX5 F;  2DYS C;  4O4J B;  1KBH A;  2VS0 A;  2KB1 A;  4DV5 B;  4IGG A;  1HNZ B;  5CB4 A;  1GM7 A;  3A2F A;  2RJZ A;  4JAV A;  3D36 C;  1M57 C;  4MTX A;  3BVO A;  5JVD B;  5B3S C;  1HW7 A;  1VQO V;  3F5W C;  4DUY B;  5EBL C;  4JF3 A;  4J9Y B;  3K06 A;  4NR1 A;  5GTI Z;  2ODM A;  4O4I B;  1I7F A;  3UT5 B;  5L3B A;  2D3O W;  4IIJ A;  2BSK B;  4MW3 A;  2CH7 A;  4KHP B;  2ZE6 A;  4X9Q A;  1SQB H;  4MVO A;  1H38 A;  2DE0 X;  2EIN B;  2ZXW B;  5D5P A;  4FFB B;  3AG2 C;  1AVM A;  1AR5 A;  1SZT A;  5L3E A;  1PPJ H;  4B3R B;  1FXK B;  4BW5 A;  5LMU O;  1KQS U;  1I94 B;  1S0V A;  4BW9 A;  4P9P A;  3LDE A;  4DR5 B;  4DW0 A;  4B08 A;  5CMU A;  4DV2 B;  5L3C A;  2QTO A;  3AG7 A;  1O9G A;  1YZB A;  4FZ1 A;  3T1H B;  2M6Y A;  5CN0 A;  1DK1 A;  4GX2 A;  1SQV H;  3S3W A;  3E83 A;  3FYE B;  4K3A A;  1IVS A;  3RYF A;  4X20 A;  4WCE V;  3RYI B;  3HKE A;  2HR3 A;  2B1I A;  4U7N A;  3MHS C;  1PV0 A;  3OAA G;  1V9P A;  4FLT A;  3K5O A;  3STZ C;  2HJF C;  5JH7 B;  5FLX N;  2BOB C;  4K35 A;  1SKV A;  1XRE A;  1VP7 A;  2E5L B;  1AJP A;  2ITC C;  3SYC A;  2X6A A;  4U3J A;  4FVM A;  3K79 A;  4X1I B;  4GKJ O;  3L72 H;  3EHB B;  4QGP A;  1V55 C;  4LH6 A;  3CPW U;  3BHP A;  4DV0 B;  2M7W A;  1AJN A;  3AK1 A;  3JSL A;  2P4V A;  1HP8 A;  2ZE8 A;  2EJR A;  1QR9 A;  4JI3 B;  3LSQ A;  2QDO A;  3SJB C;  4WFE A;  3C90 A;  4DK1 A;  1JVM A;  5J2U A;  2A79 B;  4JI5 O;  4LNU A;  4UVA A;  4CS3 A;  3F7V C;  2ILM A;  4UB6 Z;  3M99 B;  2VQF B;  1QNM A;  2VWJ A;  1XIL A;  4H13 B;  5LGN A;  3RBZ A;  3U0Z A;  3ZBH A;  1EM1 A;  1WPX A;  3ZRV A;  1Q6H A;  1N0N A;  1VEW A;  1K97 A;  5LXT A;  5E79 Z;  2P67 A;  3L73 H;  3JYC A;  4CC5 A;  1BGY H;  1SA0 B;  5D5Q A;  2E74 B;  2Y48 A;  3A8T A;  4IYH A;  1H2G A;  1R73 A;  4GLX A;  2CDY A;  4LFB O;  3AK3 A;  1AI4 A;  1GH6 A;  3DXR B;  4I9Q A;  3E2E A;  1NTZ H;  2CK3 G;  1GN2 A;  5KMG A;  1RSO A;  4TT3 G;  3W7X A;  3H9V A;  2HP8 A;  2AZ0 A;  4DV4 O;  2UXD B;  4P30 A;  1ORQ C;  4TWK A;  3OTF A;  3OR7 C;  3CP1 A;  4RO2 A;  5KAF Z;  2P6J A;  1S76 D;  3ABM C;  4KP4 A;  2QE7 G;  1GN6 A;  2HJD A;  3RYH B;  4YJ2 A;  2WSS G;  4JI2 O;  3F5T A;  1VMG A;  2NN4 A;  4PI2 A;  3WFV A;  1XMQ O;  4J41 A;  3I55 V;  1JCH A;  2E75 B;  3OMN B;  1WPB A;  1N4C A;  2QWR B;  4LFA O;  3CD6 V;  4B3M B;  1Z2G A;  4X65 O;  4C7U A;  4IL6 Z;  2UUB O;  1VF6 C;  2QWO B;  2FB5 A;  4ZIB A;  1YIT V;  3ZRX A;  5LHG A;  2YEV B;  4B3S B;  3QO8 A;  4TOI A;  1EZV H;  5H6Q A;  2BCC H;  2OWO A;  1PM9 A;  4JV5 B;  1K5S A;  1RFY A;  2R9A A;  2QJ1 A;  5A2Q N;  1BT8 A;  4KUM A;  1Q6I A;  4LF6 B;  1XHX A;  2XUM A;  4HYO A;  4YIO A;  4XDK A;  2JIZ G;  1J5E O;  4JGS A;  5DED A;  1AI6 A;  5LA6 A;  2YXY A;  2F4V O;  4R6Z A;  3K9A A;  5EZY A;  2IJK A;  2LO1 A;  1N8R W;  1KKC A;  4J7Z A;  1Q3E A;  5IJ9 A;  1Y6X A;  5CA0 A;  5CB4 B;  5DM6 V;  2RDC A;  5JJN B;  2F1M A;  5LL6 Y;  4HNA A;  3JD2 A;  1M93 A;  5FNV A;  1A32 A;  2C2A A;  1W2B U;  2XND G;  5GW7 A;  4X62 O;  4DV3 O;  1NTM H;  3FB7 C;  2PYL A;  4IIJ B;  3CWB H;  1IXM A;  2CH7 B;  3MHH C;  3M7M X;  4DK0 A;  4MTO A;  3P30 A;  2IU3 A;  2YIB A;  4PDL A;  4KXR A;  4JI6 O;  4FPP A;  4LF4 O;  2EIL C;  2P7T C;  3JAK A;  1RPO A;  3ZMU A;  5K1P A;  2EIM B;  4FJC C;  4GX5 A;  4PA9 A;  1K7D A;  1SS3 A;  1F4N A;  3I5D A;  4KL1 A;  5EYP A;  3ABL B;  2F95 B;  2R9I A;  2DW4 A;  2WA3 A;  3WU2 Z;  1QLN A;  4GKK O;  1QVF U;  1FD9 A;  1BHA A;  1OCO B;  4X20 B;  1AB3 A;  3HKE B;  5JCO C;  3RVZ A;  2XAF A;  2JDI G;  3F7Y C;  1K9M W;  5KA5 A;  5LYJ A;  4MW8 A;  2GUZ B;  4I0X B;  3SPC A;  4AHC A;  1YJ9 V;  2N74 A;  2VRZ A;  4RWU A;  2GV9 A;  4AQY B;  2E3C A;  4UB8 Z;  4JYC A;  4DV7 B;  4U3J B;  3T4Z A;  2Q9L A;  4JI1 O;  4PI0 A;  2WLN A;  3JAL A;  2JS5 A;  1GO3 F;  4LP8 A;  4JI7 O;  3JAM N;  4U3F H;  1FKA O;  1Q6U A;  3OGI B;  4H33 A;  1XNQ O;  1QLE B;  1K92 A;  2YI8 A;  4G28 B;  3T1Y B;  4X64 B;  1FJG O;  5J2U B;  4NYK A;  4JYA B;  4LNU B;  1K4C C;  1THZ A;  1R3J C;  1NVP D;  4OX9 O;  4LFC O;  1TA8 A;  4DR1 O;  3GVM A;  3J80 N;  4YIP A;  3KG2 A;  5BXZ A;  5KHK A;  2X7R B;  2VQE B;  2YS8 A;  3AG3 B;  5H5N A;  5KHG A;  2Q0A A;  2YUA A;  4CBC A;  2PY5 A;  2WLK A;  2P90 A;  5LXT B;  1IXB A;  3OTO B;  2UUC O;  1RM1 C;  1JMK C;  3FFQ A;  4NXM O;  5J9P C;  2ZM6 O;  2DMX A;  2KKW A;  1WNS A;  4CH6 A;  3CCQ V;  4NXN O;  1N32 O;  3CC7 V;  3N2K A;  2QWN B;  1W0J G;  2Y69 B;  1JJO A;  4JAA A;  2XHB A;  3X2Q C;  1L0N H;  5AG2 A;  5KMG B;  1RSO B;  2WAM A;  4I50 A;  3K5L A;  2WPD G;  3JCZ A;  1S5H C;  1IBL B;  4NTX A;  2GTS A;  3HR0 A;  4O2A A;  1NI8 A;  3A0R A;  4CH4 A;  4J7J A;  2OCC C;  1OCZ B;  4CH5 A;  2ARH A;  3E8G A;  1YTF B;  4DO2 A;  1Y4M A;  1Q5O A;  2WLI A;  3ZMT A;  4FLZ A;  1OCR B;  5CA1 A;  2QKA A;  4LF5 B;  2QWP B;  1XUQ A;  5EBW C;  4XDL A;  2PI4 A;  2W6J G;  2DOS A;  2HEP A;  4PA4 A;  3JD1 A;  4J11 A;  4WBN A;  5EK0 A;  2MK3 A;  4D6T H;  1KP2 A;  4X66 B;  2KG7 B;  2JEU A;  4LF8 O;  4FMT A;  4E2L A;  4HBN A;  3ETE A;  3HB3 B;  2HVK C;  2ZDI C;  2IW5 A;  2V1D A;  1MAB G;  2YIA A;  3CC2 V;  2IBZ H;  4RQF A;  2GBO A;  4F6R A;  2EIJ B;  1SES A;  1GM9 A;  3BA8 A;  1CP9 A;  2JK5 C;  1PL4 A;  4DYL A;  5IYC O;  2P4K A;  2JEX A;  1N34 B;  3OE7 G;  3O9O A;  4R8C A;  2ZD9 A;  3ZHS A;  4PDV A;  5L3G A;  2UUA B;  2Y0P A;  4JYB A;  5LA6 B;  1I5Y A;  1MZF A;  1XOU A;  4MVU A;  2F93 B;  3HKB A;  5EZY B;  3QTC A;  3CMA V;  2AW9 A;  1FPO A;  3O65 A;  4EFE A;  3W7U A;  5IJ9 B;  2KQX A;  3E86 A;  1M90 W;  4JI0 B;  2ZT9 B;  1YJN V;  2Q7G A;  4HNA B;  2LJ2 A;  5FNV B;  5KA6 A;  4XBF A;  3VQW A;  2IJJ A;  3WB0 A;  1Q81 W;  1IX9 A;  3KKY A;  2ZE7 A;  4JI8 O;  2EJ7 A;  4PHZ A;  3UM7 A;  1AJQ A;  1HNX O;  1P49 A;  3ASO C;  1KEC A;  2YID A;  3JSN A;  1S3J A;  5IY5 B;  3BPZ A;  5LP6 A;  4QE7 A;  1ARO P;  1XMO B;  3K3W A;  3JAK B;  2WLH A;  4GYC B;  4EKW A;  5B66 Z;  4CC6 A;  1X4T A;  4DR2 O;  2LFR A;  2RCV A;  3STL C;  1GN4 A;  1Q90 D;  4YHH O;  1UFI A;  1XDC A;  1QU7 A;  1U96 A;  5EYP B;  1YSC A;  2ZCE A;  5LMN O;  2A7W A;  3CCS V;  1HDJ A;  2CTW A;  4UUJ C;  4WFG A;  4B3T B;  1ZSP A;  1R3I C;  2FKX A;  2ZNI A;  4UXN A;  4Q20 A;  1YIJ V;  5KLV H;  3CCR V;  4LFB B;  4AI8 A;  1H2M A;  1R1B A;  1QLE C;  2CUG A;  3ZMS A;  4Z1V A;  3HKC A;  1L8D A;  1US6 A;  3LSS A;  3CS5 A;  1F7Y A;  1QVG U;  2UXX A;  1G1X B;  5LYJ B;  1VQ5 V;  3RYC A;  1VQL V;  1OJH A;  5H9C A;  4CS4 A;  4FLW A;  5KX5 B;  3OUF A;  5C8Y A;  1M56 B;  3SYO A;  2WLL A;  3AG3 C;  2X6C A;  1D2D A;  3WG7 C;  1MSD A;  1H2K A;  1PKX A;  4DV6 B;  2VWK A;  3E8B A;  1RP3 B;  4H44 B;  1QHT A;  1P7G A;  3JAL B;  4DR6 B;  4JZG A;  5ITZ A;  1IUR A;  4ABM A;  2LFS A;  1WLE A;  5BR8 B;  2IM9 A;  4I4T B;  1YI2 V;  1Q8I A;  4ZHQ B;  1EFR G;  4X65 B;  4MVM A;  3E22 A;  4X1Y A;  3TET A;  4A5U B;  4CZZ A;  3AG1 C;  1WAZ A;  2DWD C;  1N36 O;  3B40 A;  3FKS G;  1OCZ C;  3B8N A;  3H1J H;  1CEZ A;  4MVQ A;  4RUF A;  4MSW C;  1MMM A;  3JAW A;  1PNM A;  1OCR C;  3BRC A;  1IBK O;  1DF4 A;  3CB2 A;  1ZWI C;  5IE9 A;  4JPR A;  4DUZ B;  3L71 H;  1SQQ H;  2Q5Z A;  4BWA A;  3G6E V;  1NJI W;  4JTA B;  1J5E B;  4I55 A;  3CC4 V;  1H8H G;  2OIG A;  3CRQ A;  4DR3 B;  4O4L A;  4GX1 A;  2LW7 A;  3ZHT A;  2YI9 A;  4I50 B;  3VQY A;  5IWA O;  4DV1 B;  2CTP A;  2UXB B;  1BZK A;  2R9R B;  1T5E A;  1JFF A;  4O2A B;  2IH1 C;  3D36 A;  4CS2 A;  2EZO A;  5IDJ A;  1GKF A;  4CH3 A;  4TUY A;  1YF2 A;  2UXC O;  4FM0 A;  3T4D A;  2EIJ C;  3CRA A;  4LF9 B;  2XOK G;  5CA1 B;  2QTS A;  2HVJ C;  4DW1 A;  5B1N A;  4JAS A;  5KAI Z;  1S77 D;  1IDS A;  3A0H Z;  4DR7 B;  2FTK A;  4JI6 B;  4MVS A;  4WBN B;  3IC9 A;  1NR7 A;  4NTW A;  4TQF A;  4QPJ A;  3IC7 A;  1AP5 A;  4DV5 O;  3ABK B;  3IFX A;  1B3Q A;  5BZB A;  4YXW G;  3GWK C;  1NS1 A;  3G71 V;  3OD4 A;  4DUY O;  1NT2 B;  4UCS A;  3OW2 U;  2QKC A;  4LCU C;  1K33 A;  3U10 A;  4UCR A;  3ETG A;  2XT9 A;  3DSQ A;  3UQ8 A;  2Z0A A;  2BE3 A;  4DXW A;  4I7Z B;  3U11 A;  4E4E A;  4PD4 F;  1CPY A;  4WF9 V;  5IY5 C;  3DGE A;  2DYR B;  2W6I G;  3HKB B;  1S5J A;  3CME V;  2FYU H;  4GZR B;  4L87 A;  5B1B B;  3SPJ A;  4DR5 O;  2WWW A;  1FAF A;  1R6N A;  4DV2 O;  1KU9 A;  4JI7 B;  1BHB A;  4B7K A;  3T1H O;  1VQK V;  2EIK B;  3RFR A;  2EUL A;  2GDS A;  1VIB A;  4ICG A;  1N33 B;  1SQG A;  3ICX A;  3RWR D;  4MTG A;  1P84 F;  2EIN C;  5LP6 B;  1BCC H;  2ZXW C;  1M56 C;  4UCT A;  3P32 A;  1FXK C;  5B1A B;  1OZ0 A;  2UUC B;  1KUQ A;  1H2N A;  4NXM B;  4U7O A;  3TK1 A;  4NXN B;  4DV0 O;  3CYO A;  4ZBM A;  3SJC C;  5GON A;  2JVD A;  4K8X A;  4JI3 O;  2ADP A;  1TUB A;  1NH2 D;  4PEL A;  5L3D A;  1F4M A;  3HKC B;  4Z2W A;  5B1O A;  3SPG A;  1UJW B;  3RYC B;  3JAT A;  4I5S A;  2DJV A;  1XI1 A;  5C8Y B;  4O4H A;  2VQF O;  2WLL B;  3BA9 A;  4LR3 A;  5J2T A;  1KP3 A;  1VQP V;  2ZIO A;  2JRI A;  1NTK H;  3VQV A;  1HR0 B;  4WFB V;  1DF5 A;  3QG5 A;  1TUE B;  3ETD A;  3FAV A;  2PI5 A;  3ZED A;  4NTY A;  2ZR3 A;  5B5E Z;  4JI4 B;  5E1A C;  3MDS A;  3CXC U;  3THO A;  2IJH A;  1B04 A;  3SJA C;  5IJ0 A;  2V4D A;  1M4U A;  3RYF B;  3APO A;  4QE9 A;  1ZX3 A;  4RAI A;  1B06 A;  4X1Y B;  4YY3 O;  1XEQ A;  3LUT B;  4J10 A;  3ML0 A;  5CBG A;  3H1K H;  2UXD O;  2AHZ A;  3KZI Z;  1NBM G;  1ROP A;  3DC6 A;  1L0L H;  2ZR2 A;  3E35 A;  2ITD C;  1M9N A;  2Q0O C;  1JPX A;  3JAW B;  3TXS A;  4D7S A;  2NNU A;  2LQT A;  3UO2 A;  1WA8 A;  1ENV A;  4P9O A;  5C93 A;  1HNW O;  2Y0I A;  1ZTE A;  3LNM B;  4LF7 B;  4R7C A;  4X1K A;  4B3M O;  3CRC A;  1OV9 A;  3G67 A;  3Q4H A;  2A06 H;  3ZN1 A;  3IJ4 A;  2F43 G;  3QO7 A;  1MG1 A;  1O9H A;  2Y4U A;  5KHJ A;  1JFF B;  1KMI Z;  3ZHU A;  1NKD A;  2GSM B;  5IYD O;  1R6K A;  4TUY B;  1BL8 A;  1M57 B;  4TQD A;  3CCJ V;  2IH3 C;  5B3S B;  1SET A;  3CCU V;  4B3S O;  1PD3 A;  4JV5 O;  4JI8 B;  1KYO F;  3AK2 A;  3FB6 C;  2HHH O;  3RYI A;  1EN5 A;  3K59 A;  1TAE A;  2K1E A;  1SF9 A;  3ZCC A;  1P7B A;  3OFN G;  3K58 A;  2AGA A;  3TCU A;  5K1X A;  4J42 A;  4B7E A;  2DYR C;  3B4S A;  5JQG A;  1Q43 A;  5JH7 A;  3AG2 B;  4JTC B;  2AHY A;  4RUE A;  4DR2 B;  2R72 A;  4K8Z A;  2UXN A;  1Z5V A;  2Q7H A;  3JCU Z;  1JJ2 U;  3ZJZ A;  4X1I A;  3SPI A;  2QM8 A;  1GM8 A;  5LGU A;  4PDR A;  2QEX V;  4QIW F;  4XDJ A;  4EB6 A;  1P4R A;  2X6B A;  3AEI A;  2EIK C;  2EZP A;  5KUK A;  3NR7 A;  4YJ2 B;  3TXQ A;  5JCO A;  4MS2 A;  1PNL A;  2HFE C;  1GRJ A;  1VQ6 V;  2ADQ B;  1WB8 A;  3ABU A;  3BAB A;  3H1H H;  4PV1 B;  3MD0 A;  4I9W A;  3ZMV A;  5DEC A;  4UVB A;  1G4Y B;  5LMU B;  1GAX A;  2WLJ A;  5IT9 N;  1KC8 W;  1BS3 A;  1DLB A;  3N2G A;  3SPH A;  1SA0 A;  4DR4 O;  3MAQ A;  1SZX A;  2AXT Z;  3CJH A;  2JGD A;  1DTO A;  4JYY A;  1OCC B;  1E79 G;  2ZKO A;  4LWS A;  2X0L A;  3JD3 A;  2EBO A;  3K0D A;  2Q69 A;  1AIL A;  3C3T A;  1MZE A;  2QWQ B;  4MVZ A;  4TSF G;  2K9P A;  3L74 H;  1JR9 A;  1BMF G;  3CCV V;  2CE4 A;  1N36 B;  1NU1 H;  5F2V O;  4N23 A;  2RN9 A;  4AQY O;  5CBF A;  5JJE B;  1SER A;  5IYZ A;  2BTQ A;  1NR1 A;  2EIM C;  1SRY A;  5GTH Z;  5JWP A;  4EFB A;  1KB9 F;  5CA0 B;  3SDL A;  2Q8V A;  1R3L C;  4GKJ B;  1EZJ A;  3K08 A;  1GK9 A;  4OPA A;  1OHH G;  1TVK A;  1W59 A;  4W4K A;  3ABL C;  2PTM A;  3GB7 C;  5GON B;  3K57 A;  4NB5 A;  1TUB B;  3D3Q A;  1OCO C;  3T1Y O;  4GCZ A;  2P06 A;  4JYA O;  4N21 A;  3T2M A;  4JI5 B;  3JAT B;  3T1C A;  2LGQ A;  2ZIN A;  3K5M A;  4O4H B;  2N05 A;  5J2T B;  4FZ0 A;  4IHJ A;  4F6E A;  5L3F A;  3ABM B;  5EC1 C;  3ZRS A;  4K0K O;  1TGO A;  2ETN A;  3OTO O;  3H01 A;  4WFH A;  1PL0 A;  1ZUQ A;  4Z1M G;  1PNK A;  1Y67 A;  2RQ6 A;  2Y4T A;  4FIP C;  1AR4 A;  5IJ0 B;  1FFT B;  3E8H A;  5HFM A;  2F23 A;  4MTF A;  3TJT A;  3L9D A;  1QBZ A;  1NVP B;  1E1Q G;  1ZL8 A;  1S72 V;  1IBL O;  3VQX A;  5EC2 C;  4DV4 B;  1GTO A;  2ZDI A;  2W0F C;  3E89 A;  3OGC C;  4FLV A;  2FML A;  3K9S A;  2ZE5 A;  2E76 B;  3W7W A;  4BR6 A;  1YCI A;  1VQ8 V;  1Y74 A;  1F51 A;  1BQZ A;  4FFK A;  1URF A;  4JI2 B;  1WA8 B;  4LF5 O;  1K34 A;  3RW0 A;  3BAA A;  3SGI A;  1XMQ B;  4FLX A;  4FM2 A;  1MSW D;  1IBM O;  4X1K B;  1X59 A;  4LFA B;  5BMV A;  5CBH A;  2Y69 C;  3Q4H B;  1XNR O;  1ZLZ A;  2ZNJ A;  4X66 O;  3G4S V;  3OR6 C;  2MW2 B;  2UUB B;  4OGQ B;  3CEI A;  4X8A A;  4X89 A;  1PP9 H;  3OMA B;  3ZMZ A;  2QA4 V;  4UVC A;  3JAS A;  1WP8 A;  3SYQ A;  1M1K W;  3OUS A;  4G27 B;  5LOV A;  2DQ0 A;  2XAG A;  1DGS A;  5CA3 A;  2QM4 A;  1N34 O;  2QGN A;  2ZIM A;  2UUA O;  2Q68 A;  2GUZ A;  3FX7 A;  4I0X A;  3N2K B;  5JQG B;  1Q82 W;  1F23 A;  2HLD G;  2EIL B;  2FL4 A;  3SYP A;  1MA1 A;  4BAY A;  1K73 W;  1D5N A;  2F4V B;  3J81 N;  2XTA A;  4W4L A;  2PF4 E;  2EX3 A;  4FM1 A;  4JI0 O;  4EB6 B;  3UO3 A;  1VQM V;  3EXA A;  3B09 A;  2Z5U A;  4YJ3 A;  4H0L B;  1OCC C;  3HKD A;  2OT5 A;  4NVP A;  4X62 B;  3ASN B;  3OMI B;  2WLI B;  2UU9 O;  4DV3 B;  2YC0 A;  1EN4 A;  4QJF B; 
#chains in the Genus database with same CATH homology
 1NS1 A;  2E5L O;  4LFA O;  4B3S O;  4GKJ O;  1FYJ A;  4DUY O;  4JV5 O;  4A5U B;  4X65 O;  1XMO O;  2DJV A;  4GKK O;  2VQF O;  2HHH O;  4LF5 O;  2UUB O;  4JI8 O;  4AQY O;  4DUZ O;  2JRI A;  4JI4 O;  1N36 O;  2Z0A A;  1HNX O;  1AB3 A;  2AGA A;  1HNZ O;  1IBM O;  1X59 A;  3SDL A;  4DR3 O;  4B3T O;  4OPA A;  4JI5 O;  1XNR O;  4OPH A;  4DV1 O;  2UXB O;  4X66 O;  2N74 A;  1IBK O;  5A2Q N;  3J7A U;  4DR2 O;  4DR5 O;  4YHH O;  2DOS A;  1N33 O;  3T1Y O;  4DV2 O;  4JI1 O;  5LMN O;  1J5E O;  4KHP O;  4JYA O;  4DV7 O;  4LF6 O;  4YY3 O;  2LW7 A;  2F4V O;  1XEQ A;  4LF9 O;  2FKX A;  3T1H O;  5IWA O;  4JI7 O;  3JAM N;  4LF8 O;  2UXD O;  5LMU O;  1FKA O;  4B3R O;  5BY1 A;  1N34 O;  1R1B A;  4LF7 O;  2UUA O;  4DR7 O;  4LFB O;  1I94 O;  4K0K O;  3RT3 C;  1XNQ O;  5LL6 Y;  2UXC O;  4DV6 O;  3OTO O;  1F7Y A;  1FJG O;  1G1X B;  1A32 A;  4OX9 O;  1YZB A;  4X64 O;  4LFC O;  4DR6 O;  4DR1 O;  3J81 N;  3J80 N;  4X62 O;  1DK1 A;  4DV4 O;  5BR8 O;  4DV3 O;  1HNW O;  5BXZ A;  5IT9 N;  4JI0 O;  5H5N A;  1R6T A;  1D2D A;  4B3M O;  1KUQ A;  2VQE O;  4DR4 O;  2UUC O;  3R66 A;  4JI6 O;  4DV0 O;  4NXM O;  4LF4 O;  2ZM6 O;  1IBL O;  4JI2 O;  5FLX N;  3F5T A;  4DV5 O;  3O65 A;  4NXN O;  2ZKO A;  1N32 O;  4JI3 O;  2UU9 O;  1XMQ O;  3M8A A;  1HR0 O;  1AIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...