1IBKO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibkO00
4B3SO 4DV7O 2UUAO 1F7YA 1IBMO 4LF8O 4DUYO 1R1BA 4DV4O 1XEQA 4B3RO 4DV0O 2E5LO 2N74A 3R66A 2Z0AA 3SDLA 1N33O 4NXMO 2UUBO 1HNWO 3F5TA 5LL6Y 4DV5O 4LFCO 2UUCO 1D2DA 5LMUO 2ZKOA 2DJVA 3OTOO 1FJGO 5BY1A 4JI2O 4NXNO 4A5UB 4GKKO 4X66O 1R6TA 3J81N 4DUZO 4KHPO 4LFAO 2AGAA 2LW7A 3J7AU 2UXBO 4DR1O 4LF5O 4JI3O 2UXDO 4JYAO 5H5NA 4OPAA 5BXZA 4GKJO 4YHHO 4DR6O 4LFBO 1X59A 4JI5O 4LF4O 1IBKO 4AQYO 4DR3O 3M8AA 1HR0O 2FKXA 1DK1A 4X64O 4OX9O 4LF7O 4LF6O 5FLXN 3T1HO 1XMOO 1KUQA 3J80N 4X62O 4OPHA 4B3TO 4JI4O 1A32A 2ZM6O 4DR5O 4DV2O 3T1YO 3O65A 5A2QN 4DV1O 1FYJA 4K0KO 4JI1O 4JI8O 1XNQO 2UXCO 4DV6O 5BR8O 2VQEO 1XNRO 1N36O 4JV5O 4LF9O 1IBLO 4DV3O 3JAMN 4DR2O 1J5EO 3RT3C 1HNZO 1N34O 1XMQO 5LMNO 1N32O 1YZBA 4JI6O 1NS1A 1AILA 5IWAO 4DR4O 2UU9O 4B3MO 4JI0O 1I94O 2VQFO 1FKAO 4JI7O 4DR7O 4X65O 5IT9N 1G1XB 2F4VO 1HNXO 1AB3A 2HHHO 2JRIA 4YY3O 2DOSA
chains in the Genus database with same CATH superfamily
1YHQV 2Y69B 3U10A 3CYOA 3D3QA 1TA8A 3DC6A 4J9YB 5LXTB 2B9ZA 1GN4A 1M9NA 3LUTB 1H2LA 1HNWB 5LMUB 2VWKA 4X64B 2ZKOA 1US6A 2OCHA 1FJGO 4FFKA 5BY1A 2OYQA 2VRZA 5B1OA 4DO2A 1VQ7V 4A5UB 3KZIZ 3TETA 5B1NA 4UCVA 1W2BU 3ASOC 2AXTZ 2UXDO 1Y74A 1WNSA 4ICGA 2CGOA 3M7MX 4DW0A 3HR0A 2H3OA 3L74H 2WLNA 1KP2A 4AQYO 5B1BC 1KD1W 1KKDA 1DK1A 2Q7EA 1QBZA 2WLHA 1S72V 3E22A 4UB6Z 4LWSA 2ARHA 4CH3A 4I5SA 3WG7C 1MG1A 2P06A 4JI0B 4X88A 4DV2O 5CA1B 2JS3A 4IHJB 2DWEC 2OCCC 1FD9A 3W7TA 4IYHA 1JCHA 1N36O 3H1IH 1ROPA 4NTYA 2DN9A 1XMQO 1QVFU 3RYCA 3K9SA 4I50A 2ZM6B 3DGEA 3OE7G 1M93A 2BOCC 3K5OA 4O2AB 1F51A 1P49A 4ZI7A 5LHIA 4I50B 4OX9B 3B8MA 4Z1VA 2P6JA 3PN1A 4DR6B 3B77A 4FJCC 5CA0A 1N0JA 4JPRA 5KLVH 3SPIA 1VQLV 3R66A 1GO3F 4TV8B 4YJ3A 3CJHA 1VQPV 3MD0A 3E89A 5CA1A 5LOVB 3C3SA 3LNMB 5DECA 1SQGA 3AEIA 3E8FA 1F4NA 4GKKO 5B1BB 1VQ4V 3C90A 4DR3B 4EEQA 4UVBA 2R70A 2YXHA 4DR1O 4JI3O 4Q20A 4W4LA 4WFBV 5KHGA 2E3CA 5LGTA 2DYRB 1JX9A 1GM8A 3BY6A 1KKCA 4G28B 4G2KA 3A0BZ 3UO2A 4YHHB 4LF6B 2Q8VA 2X6BA 2RNBA 1PNKA 1XDCA 2PUSA 2ZDIC 2CUGA 1Q3EA 1EN6A 2HP8A 4O4JA 4I4TB 3K5MA 1AJQA 2CDYA 2PZSA 4J7ZA 1VIBA 1SRYA 1JMKC 2ATKC 4OX9O 3JALA 2YXLA 4J7JA 4LH6A 1ZWIC 2DYSC 4Q6GA 1EZVH 4IIJA 3O9OA 2QGNA 3OMAB 2IH1C 1XNQO 2B5UA 3FD9A 1PM9A 3A0HZ 4MTGA 5BR8O 1WAZA 1JFFB 4U7NA 5KUKA 4MVZA 3GB7C 3JAMN 3H01A 1N34O 1AILA 3EVKA 4I7ZB 5JJJB 3EFFK 4I4TA 4KFMA 5LGNA 4PA3A 1WPXA 1QHTA 4JYAB 1K33A 4TV9B 4GUNA 2HHHO 1M56C 3QF7A 3IC7A 2UUAB 1GRJA 2PI5A 1SKVA 3OUFA 4DRXA 2C2AA 3UT5A 1PL0A 3H1JH 2JEUA 1B06A 3K03A 4LFCO 5KA6A 1VP7A 2YIBA 5CBGA 4NXNO 1CPYA 4IT5A 4JI2B 1ZX3A 4RQFA 1N8RW 2LW7A 2UXBO 1N0NA 4JYBA 1NBMG 4GX1A 5KAFZ 1RM1C 1VQ8V 2PF4E 1LR1A 1LUWA 3ZMSA 1BT8A 5GTHZ 2F66C 4DW1A 1IDSA 2IBZH 1VARA 3LDCA 4EB6A 3F7YC 2XOKG 3SPHA 4J42A 4X64O 1ZSPA 1QCEA 2EIKC 4CBCA 2LFRA 1Q82W 4WFEA 1H38A 3IAYA 3ASOB 3ZN1A 1XMOO 3I56V 3SPGA 4GX5A 4JI4O 2CTQA 4B7EA 1JA8A 2R9AA 1O9GA 2LP7A 4WFFA 2K9PA 2QEXV 1GMGA 4JV5O 1VF6C 3HKBB 2DYRC 1QVGU 1KU9A 2JK5C 1OCZC 1RP3B 4K0KB 5FL7G 1H8HG 2YIBD 5KX5B 3JASA 4MW3A 3C3TA 4B08A 1NU1H 1YEWA 4WF9V 1J5EB 3SPCA 3ZHUA 1S5JA 3HB3B 5KHHA 4J10A 2KB1A 1K34A 3CRAA 1V55B 2Q67A 2ADQB 4J7KA 4Z2WA 4MTFA 4R50A 5IY5C 4OXSA 3CEIA 2LQTA 3GVMA 1DLBA 1L8DA 3RBZA 4DUZB 1S0VA 1K97A 2JEXA 2M6YA 1H8EG 1NTMH 2AHYA 3UKMA 4JTAB 4RAIA 4LF5O 1M1KW 3SYPA 1RPOA 1P4RA 1XQ8A 4X8AA 4HBNA 1QNMA 2FYUH 2BTQB 3ZX6A 3OEHG 4UUJC 3OR6C 1DF5A 2W0XA 3ICXA 3DTUB 3TCUA 3AK2A 3X2QB 4JTDB 1COWG 4GX2A 1HR0O 2FKXA 1JVMA 3JARB 4IL6Z 4GKJB 2FL4A 3JCUZ 3ETDA 3HKEA 4B3TO 1TUEB 2CH7B 3O65A 5GTIZ 3R65A 4IYIA 1ORQC 2YXYA 3NXSA 1H2NA 1QLEC 3ABTA 1S77D 1HDJA 1HNZO 2DW4A 2XUMA 5DEDA 3BA9A 3BABA 1NS1A 2WWWA 2UU9O 2LGQA 2YIDA 3STZC 4LP8A 1DF4A 4CH6A 3WB1A 1LNQA 1AI6A 1F23A 1PD3A 4JGSA 2UUAO 4TUYB 3K0DA 3RVZA 2P22C 2E5LO 1SC5B 1BQZA 4DR7B 2Q0OC 3HKCB 2VQFB 1NVPB 3T1YB 4NXMO 3FB8C 5JVDB 2ILMA 4DV5B 2ZXWB 4NKGB 1O9HA 4R6ZA 3FKSG 3FYEB 2ZCEA 3SJQC 3N2GA 1WN7A 3H1KH 5B1AB 1XMQB 4YJ2A 2WLLB 3RYIB 4DUZO 5IYZB 2IU0A 3PJSK 3J7AU 4DXWA 1Q5OA 1NKDA 1XILA 2RJZA 1Y67A 4PDVA 3I55V 1G6UA 4MVQA 5LP6A 2WLIB 5LYJB 2JJ1G 2Q7HA 4B3MB 3QVNA 1AROP 1JJ2U 1I5XA 3A0RA 1K92A 3RYFB 2ZQMA 2RMKB 1OCZB 5CN0A 3FX7A 3ZRWB 3SJBC 1B3QA 1I5YA 1Q6IA 3L75H 4O4LA 5L3EA 4YY3B 3ZRVA 1KUQA 3HKBA 4FZ0A 3J80N 4MVOA 3AK1A 3E2EA 2W6JG 4RWUA 2P67A 3LSQA 4KXRA 5A2QN 4O2BB 1M90W 4G27B 1AR4A 4JV5B 3MDSA 2HEPA 2XNDG 2ZINA 4PA7A 4CS2A 3CMAV 2H8PC 2ZT9B 2QTOA 1P84F 4I0XB 1TUBA 1I94O 4PI0A 2VQFO 3CMEV 4FK5C 4DR7O 4LNUB 5KMGA 4DV3B 5B1AC 2QWPB 2PI4A 2DOSA 4I0XA 2P7TC 2HVKC 2Y0IA 2GTSA 4PA9A 1F4MA 1U97A 5F2VO 4XDKA 1BE3H 4OGQB 5KA5A 3ABMC 2UUBB 3MAQA 1GKFA 1M56B 1ZLZA 4EKWA 3ZIAG 2Q6AA 3AG2B 5CA3A 3K57A 5IDJA 2PGGA 3BHPA 1BL8A 5IJ0B 4DUYB 2G38A 4CC6A 5EIBD 5E1AC 2AW9A 5L3GA 2H94A 4BW9A 2KKWA 3FB5C 2UXCB 2EJ7A 3APOA 4UFZA 5JCOC 4GX0A 1ZUQA 4P9OA 1TVKB 5BMVA 1Y74B 2A0LA 1K3EA 1WB7A 2EILC 3JD2A 1R3JC 4CS3A 3A2FA 1SA0A 2EULA 4YJ2B 2ZM6O 1GM9A 3ZHQA 2XAGA 4UV9A 1UJWB 4JI1O 2VQEB 2VQEO 5L3BA 2R72A 1FFTB 1YJWV 1D5NA 4RUFA 2RCVA 4CZZA 4JI0O 5JCOA 3ASNB 5E79Z 3ZHVA 4O4JB 1I94B 1JR9A 1G1XB 1WA8B 2F4VO 5JJEB 1TVKA 2JRIA 3OGIB 1HWYA 5CB4B 4X89A 5CBHA 1BCCH 2QKCA 3D36C 5LHHA 3OFNG 2QTSA 3QG5A 1BSMA 3JSLA 1Y76B 4NVPA 4JYYA 5CMUA 1NH2B 1U96A 3RGBA 2LGWA 4TT3G 2UUCO 1HNXB 2CK3G 4HNAA 2P4KA 1GTOA 3G80A 4JI2O 2MW2B 1T5EA 4PDRA 4JI6B 5C8YB 1QU7A 4TSFG 3CCMV 4TV8A 4GLXA 4J80A 3JSNA 3H9VA 3BAAA 2GHYA 5H5NA 3VQVA 5KHIA 1SS3A 2JDIG 2QA4V 1JJOA 2XTAA 1QR9A 1V54B 3ZMUA 4ZI7B 1OCCC 3TXSA 2EZPA 1XL4A 3CX5F 3JAWA 4QGPA 4FLZA 4X1IB 1S5HC 4P9PA 3JD0A 2QM7A 2GUZA 4HZ3A 2IW5A 4MTXA 4LF7O 4LF6O 3HKDB 1WB8A 2XASA 5ITZB 4LC1A 4MVSA 2KQXA 2Q4PA 4LF8B 4DR5O 4R8CA 4YIPA 1IZ3A 3T1YO 2UXBB 2CTWA 1BS3A 2E5LB 3QO8A 4IHJA 1BHBA 1L0NH 4UCUA 3ZJZA 4UCRA 4DV7B 3RT3C 4H33A 1YXBA 4QE7A 4O4LB 1SQVH 3L9DA 3CCQV 5DM6V 2F23A 1QLNA 3JD1A 2ZE7A 4B3MO 4UV8A 2HJFC 4JASA 3BRCA 4GT1A 3MHSC 3OMNB 4L87A 1SQXH 1SQPH 4W4KA 3CSXA 5IE9A 1AB3A 2JGDB 4FZ1A 3K5NA 3OM3B 2V7QG 4DV7O 1GM7A 3K04A 2EJRA 4DUYO 4X62B 1TAEA 4NB5A 4HAMA 3JAKA 3MHHC 2QKSA 3P3NA 1EN4A 3QO5A 3IC9A 4ZBMA 2DJVA 1YCIA 5EYPB 4CC5A 1WP7A 2Y4UA 4LF7B 1Y6XA 4I9QA 5HFMA 4GKKB 3GWOA 1V54C 4B3RB 2EILB 4LFBB 2AGAA 5L3DA 1PPJH 3BCCH 3E83A 1GN3A 2W0FC 1AJNA 3RN4A 4EB6B 2GV9A 3X2QC 4XBFA 1KBHA 3K59A 1IBKO 1MMMA 1SETA 4PELA 4C7UA 1N36B 4MVRA 3F7VC 4KL1A 4X20A 3ETEA 4ZOLA 4NTWA 4PDMA 3F5WC 4YXWG 1K5QA 4OPHA 1PKXA 3ABLB 5H9CA 2X6AA 5TISZ 1WPBA 4U3JB 5IJ9B 5D5PA 4LF9O 3UT5B 3CCJV 1IURA 4LBEC 4X1KA 4JI4B 3K5LA 2YI9A 4GZRB 3CRCA 4GCZA 1ENVA 3LSSA 3CXCU 3G71V 2EIKB 2ZXWC 4O4HA 4FIPC 2L6LA 2JS5A 1YTFB 1ZAUA 4B3RO 4DV0O 1NQTA 1KMIZ 3B8NA 3N27A 2UUBO 2Z3YA 4JZGA 3AG7A 4I55B 5KHJA 4WBNA 5GONA 4FLWA 2EX3A 4L8JA 4MS2A 1M4UA 3OEEG 4X9QA 3IJ4A 2QWNB 4LFAB 1SA0B 1Y4MA 1FS0G 3JALB 2D3OW 1AJPA 4FMTA 4TWKA 3JAKB 3CCEV 1VQ5V 3DXRA 5EIBC 1R3KC 1N4CA 3T1HB 2NR5A 2HJDA 4JYCA 2O57A 4JI5O 2N04A 5J9PC 4K8ZA 1OCOC 4QPKA 3G4SV 2HR3A 1R6KA 2GBOA 1VF6A 2WLMA 2F1MA 3SYAA 1ZTEA 3SJCC 4TOIA 1R3IC 4B3SB 1SZXA 3K58A 4FLVA 5J2UB 1BQ0A 1NZ6A 5JQGB 2B1GA 3SYOA 2IH3C 3E86A 5KAIZ 3G6BA 3CRMA 3OTFA 1K4CC 1XNRO 2YEVB 4IGGA 1IBLO 1OHHG 3IGAC 2WSSG 3CE2A 1YDXA 2GUZB 4QJFB 1KC8W 4N21A 4MSWC 1PV0A 4JI7O 4WCEV 4O2AA 4LNUA 4X65O 1M57B 3CS5A 3SJAC 2Q73A 4LCUC 4D7SA 4JAAA 3T4ZA 4RO2A 2DWDC 5FPRA 1THZA 1H2GA 3WB0A 1K9MW 2XAHA 3SYCA 1YITV 3ETGA 3P32A 2EIJC 1R1BA 2HVJC 2BSKA 1XNQB 4E4EA 2Z0AA 2HLDG 2QJ1A 3F5TA 4DV5O 1VEWA 1Z5WA 4J11A 3P30A 1PNLA 5EBWC 2Z5UA 5LMNB 1QR8A 1CP9A 4FLYA 3JCZA 4MVMA 3WU2Z 3OAAG 1BGYH 5JQGA 3FYIB 4LWSB 1OCRB 4HNAB 4PA4A 3IFXA 4P30A 3VOUA 3ZRWA 3ABUA 5KUMA 4U3FH 1Z5VA 2ZE5A 4DRXB 1AR5A 3FB6C 4OPAA 1OJHA 2A9HA 1EM1A 4DK0A 1CXZB 5EK0A 1YSCA 2YIAA 3K3WA 2F43G 2XAFA 3L70H 3M8AA 3TK1A 1UPGA 3ZMTA 1AR1B 1YI2V 2Y4TA 4JF3A 2Q69A 3JATB 2R9IA 4D7TA 1FXKC 3GWKC 5BZBA 3OW2U 2GSMB 2WLLA 3RYIA 3BPZA 2B1IA 1JFFA 3QNEA 1YF2A 2ZIOA 4TQFA 3RVYA 5BR8B 1MA1A 4H0LB 2ZE8A 2DYSB 1Q43A 3HKCA 2QWOB 4DV3O 5LXTA 2M7WA 4MVUA 1EBOA 4TUYA 1SZTA 2OIEA 3KCXA 1N33B 1WJZA 2ADPA 2WLJA 2CE4A 4N23A 4PA6A 1SQFA 3KCYA 1KYOF 2QWRB 4FFBA 3QTCA 1D5AA 3H1LH 1EFRG 4KP4A 1B04A 2FTKA 1SESA 5J2TA 1E1QG 3K79A 4NR1A 4U3JA 3ZCCA 5IJ9A 4UCOA 4X1YB 1L1FA 1OV9A 3OTOO 3VBBA 5EBLC 4AHCA 4FLTA 3HPLC 1NVPD 4X66O 5GW7A 4ZOLB 3VQWA 3JARA 2JJ2G 3AG4B 1XBLA 4KUMA 2WPDG 3EXAA 2FMLA 3UCSC 1R6NA 1AVMA 5BXZA 1QLEB 4F6EA 3Q4HA 4DR6O 2ITDC 4MTOA 2EIJB 4LFBO 1X59A 1W0KG 1MABG 1VQOV 1RM1B 5DN6G 2YUAA 2LW1A 2EIMB 1TUBB 3ABMB 4JI1B 1HP8A 3LNNA 1XREA 1NR7A 3AG3C 2ZD9A 5LA6B 5LBQA 2PYLA 1M57C 2EINC 3D8CA 3QO7A 2QE7G 2YEVA 2Q5ZA 4DV2B 1NT2B 1FPOA 2RDCA 5EYPA 3N2KB 4I9WA 1GN6A 2AZ0A 2IM9A 2ZNIA 3UQ8A 5D5QA 2IJHA 1K8AW 1J5EO 3K9AA 5J2UA 4RQEA 3FB7C 3ZHRA 5K1PA 4DR4O 2NNUA 1CEZA 3RYFA 2P4VA 4LF9B 4AILC 2CTPA 5KX5A 5LYJA 2WLIA 4E2LA 3CRRA 2ETNA 3T2MA 2IJJA 2YS8A 1BHAA 4PJ0Z 5LP6B 4WFAV 1Q7YW 4NXNB 4H13B 1FFXB 4LR3A 3SDLA 3AG4C 1W59A 2PY5A 4ABMA 4PDLA 4U7OA 2RN9A 2RQ6A 2DE0X 2OIGA 3B09A 2P5OA 3SPJA 4F6RB 1JPXA 3L71H 4KHPB 2V1DA 4WBNB 2A79B 4UVAA 4I55A 1K7DA 3TGUH 4O4IB 3RYHA 2OT5A 3TXQA 5JVDA 3AG3B 5IY5B 2XHBA 1XNRB 4DV1B 1MZFA 1H2MA 1S5LZ 1QQCA 4YHHO 4EFBA 1NTZH 4FLXA 2Q0AA 4UB8Z 2AHZA 3LDEA 3VQXA 4DV0B 4H44B 2ZR3A 3ABKC 1I08A 1FXKA 3CC4V 5JJNB 4K3AA 4DYLA 1FXVA 1W0JG 2YC0A 1IX9A 3STLC 1GK9A 1PL4A 4B3TB 4X62O 3OD4A 2CTRA 2V4DA 5JH7B 1KECA 4UCTA 2A06H 5JH7A 4ZKIA 4FPPA 5L3CA 4DV6O 1MSDA 2OTLV 2WLKA 1HR0B 4J9ZB 1Y76A 3L73H 5J2TB 1NJIW 2DQ3A 1E79G 3APQA 3ML0A 1YZBA 2WAMA 3U0ZA 2AZ2A 1SQBH 3G67A 5CB4A 4FFBB 1TGOA 2BE3A 2CAZC 3CHXA 1FXKB 3T1CA 4BAYA 3BVOA 4TV9A 5K1XA 2K1EA 1Q6HA 3B40A 2Y0PA 3SGIA 4LF8O 2OTJV 3L72H 1IBKB 2QM4A 1SERA 1N33O 2Y69C 1DGSA 3RYHB 4X65B 2LO1A 2PYJA 3CCLV 3OMIB 1OCRC 2KSDA 4F6RA 2LJ2A 4UXNA 5AG2A 4YIOA 3TJTA 2XT9A 3SYQA 1Y66A 2W6IG 3ABKB 4NTXA 1MZEA 3ZEDA 3J81N 4Z1MG 4KHPO 3JATA 3FAVB 4WFGA 2HFEC 4ASUG 1OCOB 1RPRA 5BMVB 1AI5A 1PP9H 4DV4B 4P2ZA 4AQYB 4B7KA 1S76D 1V9PA 4ZHQA 4DR3O 3CB2A 3B2EE 4UVCA 2UUCB 4FM0A 1YJ9V 3LDDA 1OZ0A 2IJKA 3K0GA 1I0HA 3T1HO 4ZIBA 3ZHSA 2BCCH 4JI7B 4DV1O 3N2KA 4BIUA 4DV6B 3K06A 1KB9F 4YJ3B 2F4VB 1XHXA 1FJGB 5ITZA 5EZYB 2HHHB 2BSKB 3D3IA 4XDJA 1IBLB 5EC1C 5LA6A 2OCCB 3W7UA 4QPJA 3ZMVA 1P7GA 5IWAO 2UXXA 1J95A 3I5DA 1G8MA 3CXHF 5KMGB 2HKOA 4LF5B 3W7WA 3JAWB 2VS0A 2N05A 5LGUA 4FVMA 3BFRA 4B3SO 3Q4HB 1F7YA 1IBMO 2YDEA 2Q7GA 3AG1B 1YJNV 2N74A 4NXMB 3ZN0A 3EHBB 3B4SA 1HNWO 4HYOA 1VQ6V 4NYKA 2D2CB 1Q6UA 5C8YA 2ZDIA 4WFHA 3UM7A 4RUEA 4JTCB 2EBOA 4EFEA 1ZL8A 3D36A 4JAVA 4X1YA 3E22B 1M5IA 1XL6A 1JQ0A 3OTOB 1K5SA 4JYAO 2R9RB 2E75B 2ZE6A 2IJIA 3CCVV 1Q81W 2MK3A 4FLUA 4DR4B 1WA8A 2PTMA 5C93A 1MNGA 4JZ2A 1EN5A 2ITCC 4PV1B 1R73A 2L35A 4BWAA 3FAVA 4LFCB 1IXMA 1KQSU 3DSQA 5IYZA 2Q9LA 1XMOB 5FLXN 2JGUA 1RFYA 2XAJA 1VQNV 4BW5A 3N2GB 4BIOA 4JI8O 1IXBA 4JI8B 4IIJB 3T4DA 3ASNC 2EZOA 4MT8A 3RFRA 4PD4F 4F4LA 1VQKV 1N32O 3OGCC 1WP8A 4JI6O 3KKYA 2HG5C 1FXHA 4O4HB 2Y48A 2GTAA 2UU9B 5HFLA 1GH6A 3E8BA 3SR2C 1HNXO 1Q8IA 1MSWD 1VMGA 1XHZA 4JI3B 2ZR2A 3S3WA 1AP5A 4YY3O 1DTOA 1G4YB 3U11A 4DR2B 1I7FA 1NI8A 4AI8A 4DV4O 1XEQA 1AP6A 4CH4A 2WA3A 3ZRSA 1GAXA 3H1HH 5L3FA 3CP1A 3FFQA 5LL6Y 3W7XA 2QDOA 2QKAA 3JD3A 1ZL8B 1FAFA 5IJ0A 2YICA 1YTFD 2F95B 2GDSA 1RSOA 2CH7A 1H2SB 5LOVA 5B5EZ 1UFIA 4DK1A 2VWJA 4X20B 2WA4A 3OR7C 4LFAO 4TQDA 3CJHB 1VQ9V 3AG2C 2E76B 2XAQA 1OCCB 2KG7A 5IYDO 1XOUA 2FB5A 3RW0A 1IVSA 5CA0B 3WFVA 2LFSA 3ZS8C 3CC7V 4PHZA 2JVDA 1IBMB 1N34B 3CRQA 4LF4O 2YSUB 2ZIMA 3AG1C 4LF4B 1X4TA 2EINB 3CCRV 1K73W 3ZHTA 1SF9A 5JWPA 5KHKA 1BZKA 4CS4A 1AI7A 2QM8A 4O4IA 3RYCB 4D6TH 3G6EV 1NH2D 1BMFG 4BIZA 1XUQA 3CD6V 5EZYA 1Q90D 2NLJC 4MW8A 4R7CA 1LUVA 2JIZG 3DC5A 4O2BA 2UXCO 1Z2GA 2ODMA 1VQMV 1NR1A 2P90A 3THOA 1HNZB 1MOFA 1FFXA 2X7RB 1K4DC 2QWQB 1L0LH 1R3LC 1WLEA 2CGNA 2Q68A 5LHGA 5LP6C 3E8HA 1FKAO 2JGDA 3ETQA 5B3SB 5IT9N 4DR1B 4ZHQB 3CCUV 2UXDB 4JAUA 3CCSV 1XI1A 2OWOA 3JASB 4GKJO 2NN4A 2X6CA 5B66Z 3ZBHA 3BEHA 3CC2V 1GN2A 3ZMZA 4K8XA 3UO3A 3DXRB 2BTOA 5FPOA 4GYCB 2QSAA 1URFA 2ZNJA 1JOYA 1YIJV 5IYCO 4QNHB 4XDLA 1D2DA 5LMUO 2DMXA 1S3JA 1YVWA 4PI2A 3CWBH 1B6QA 1P7BA 1R6TA 2YI8A 2DQ0A 3HKDA 5GONB 1V55C 3NR7A 3CPWU 3AK3A 5H2FZ 3A8TA 4BR6A 4DR5B 4QE9A 4X1IA 5IYBO 3BA8A 3JYCA 2A7WA 3OUSA 5EBMC 4QIWF 1PNMA 3OT7A 3JD4A 1N32B 1HW7A 5IWAB 5FNVA 2A3QA 3ZRXA 4K35A 1NTKH 4H37A 1EZJA 1H2KA 3S3XA 3E35A 5EC2C 3M99B 1Q86W 2KG7B 5CBFA 3ABLC 2UXNA 4X1KB 4FM1A 4X66B 2E74B 1SQQH 4LH7A 2QR4A 5H6QA 1A32A 1RSOB 2BOBC 4UCSA 1FYJA 4K0KO 4FM2A 3VQYA 5B3SC 3K08A 3HKEB 1KP3A 2X0LA 4DR2O 5LMNO 1AI4A 3W7SA 2F93B 1E1RG 3E8GA 4J41A 3WG7B 1VF5B 3KG2A 4JI5B 4CH5A 5H6RA 3RWRD 3P3PA 5A9GA 2IU3A 1VF7A 2EIMC 3LSUA 3WB2A 5FNVB 2BTQA
chains in the Genus database with same CATH topology
4B3SO 4DV7O 2UUAO 1F7YA 1IBMO 4LF8O 4DUYO 1R1BA 4DV4O 1XEQA 4B3RO 4DV0O 2E5LO 2N74A 3R66A 2Z0AA 3SDLA 1N33O 4NXMO 2UUBO 1HNWO 3F5TA 5LL6Y 4DV5O 4LFCO 2UUCO 1D2DA 5LMUO 2ZKOA 2DJVA 3OTOO 1FJGO 5BY1A 4JI2O 4NXNO 4A5UB 4GKKO 4X66O 1R6TA 3J81N 4DUZO 4KHPO 4LFAO 2AGAA 2LW7A 3J7AU 2UXBO 4DR1O 4LF5O 4JI3O 2UXDO 4JYAO 5H5NA 4OPAA 5BXZA 4GKJO 4YHHO 4DR6O 4LFBO 1X59A 4JI5O 4LF4O 1IBKO 4AQYO 4DR3O 3M8AA 1HR0O 2FKXA 1DK1A 4X64O 4OX9O 4LF7O 4LF6O 5FLXN 3T1HO 1XMOO 1KUQA 3J80N 4X62O 4OPHA 4B3TO 4JI4O 1A32A 2ZM6O 4DR5O 4DV2O 3T1YO 3O65A 5A2QN 4DV1O 1FYJA 4K0KO 4JI1O 4JI8O 1XNQO 2UXCO 4DV6O 5BR8O 2VQEO 1XNRO 1N36O 4JV5O 4LF9O 1IBLO 4DV3O 3JAMN 4DR2O 1J5EO 3RT3C 1HNZO 1N34O 1XMQO 5LMNO 1N32O 1YZBA 4JI6O 1NS1A 1AILA 5IWAO 4DR4O 2UU9O 4B3MO 4JI0O 1I94O 2VQFO 1FKAO 4JI7O 4DR7O 4X65O 5IT9N 1G1XB 2F4VO 1HNXO 1AB3A 2HHHO 2JRIA 4YY3O 2DOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S O;  4DV7 O;  2UUA O;  1F7Y A;  1IBM O;  4LF8 O;  4DUY O;  1R1B A;  4DV4 O;  1XEQ A;  4B3R O;  4DV0 O;  2E5L O;  2N74 A;  3R66 A;  2Z0A A;  3SDL A;  1N33 O;  4NXM O;  2UUB O;  1HNW O;  3F5T A;  5LL6 Y;  4DV5 O;  4LFC O;  2UUC O;  1D2D A;  5LMU O;  2ZKO A;  2DJV A;  3OTO O;  1FJG O;  5BY1 A;  4JI2 O;  4NXN O;  4A5U B;  4GKK O;  4X66 O;  1R6T A;  3J81 N;  4DUZ O;  4KHP O;  4LFA O;  2AGA A;  2LW7 A;  3J7A U;  2UXB O;  4DR1 O;  4LF5 O;  4JI3 O;  2UXD O;  4JYA O;  5H5N A;  4OPA A;  5BXZ A;  4GKJ O;  4YHH O;  4DR6 O;  4LFB O;  1X59 A;  4JI5 O;  4LF4 O;  1IBK O;  4AQY O;  4DR3 O;  3M8A A;  1HR0 O;  2FKX A;  1DK1 A;  4X64 O;  4OX9 O;  4LF7 O;  4LF6 O;  5FLX N;  3T1H O;  1XMO O;  1KUQ A;  3J80 N;  4X62 O;  4OPH A;  4B3T O;  4JI4 O;  1A32 A;  2ZM6 O;  4DR5 O;  4DV2 O;  3T1Y O;  3O65 A;  5A2Q N;  4DV1 O;  1FYJ A;  4K0K O;  4JI1 O;  4JI8 O;  1XNQ O;  2UXC O;  4DV6 O;  5BR8 O;  2VQE O;  1XNR O;  1N36 O;  4JV5 O;  4LF9 O;  1IBL O;  4DV3 O;  3JAM N;  4DR2 O;  1J5E O;  3RT3 C;  1HNZ O;  1N34 O;  1XMQ O;  5LMN O;  1N32 O;  1YZB A;  4JI6 O;  1NS1 A;  1AIL A;  5IWA O;  4DR4 O;  2UU9 O;  4B3M O;  4JI0 O;  1I94 O;  2VQF O;  1FKA O;  4JI7 O;  4DR7 O;  4X65 O;  5IT9 N;  1G1X B;  2F4V O;  1HNX O;  1AB3 A;  2HHH O;  2JRI A;  4YY3 O;  2DOS A; 
#chains in the Genus database with same CATH topology
 1YHQ V;  2Y69 B;  3U10 A;  3CYO A;  3D3Q A;  1TA8 A;  3DC6 A;  4J9Y B;  5LXT B;  2B9Z A;  1GN4 A;  1M9N A;  3LUT B;  1H2L A;  1HNW B;  5LMU B;  2VWK A;  4X64 B;  2ZKO A;  1US6 A;  2OCH A;  1FJG O;  4FFK A;  5BY1 A;  2OYQ A;  2VRZ A;  5B1O A;  4DO2 A;  1VQ7 V;  4A5U B;  3KZI Z;  3TET A;  5B1N A;  4UCV A;  1W2B U;  3ASO C;  2AXT Z;  2UXD O;  1Y74 A;  1WNS A;  4ICG A;  2CGO A;  3M7M X;  4DW0 A;  3HR0 A;  2H3O A;  3L74 H;  2WLN A;  1KP2 A;  4AQY O;  5B1B C;  1KD1 W;  1KKD A;  1DK1 A;  2Q7E A;  1QBZ A;  2WLH A;  1S72 V;  3E22 A;  4UB6 Z;  4LWS A;  2ARH A;  4CH3 A;  4I5S A;  3WG7 C;  1MG1 A;  2P06 A;  4JI0 B;  4X88 A;  4DV2 O;  5CA1 B;  2JS3 A;  4IHJ B;  2DWE C;  2OCC C;  1FD9 A;  3W7T A;  4IYH A;  1JCH A;  1N36 O;  3H1I H;  1ROP A;  4NTY A;  2DN9 A;  1XMQ O;  1QVF U;  3RYC A;  3K9S A;  4I50 A;  2ZM6 B;  3DGE A;  3OE7 G;  1M93 A;  2BOC C;  3K5O A;  4O2A B;  1F51 A;  1P49 A;  4ZI7 A;  5LHI A;  4I50 B;  4OX9 B;  3B8M A;  4Z1V A;  2P6J A;  3PN1 A;  4DR6 B;  3B77 A;  4FJC C;  5CA0 A;  1N0J A;  4JPR A;  5KLV H;  3SPI A;  1VQL V;  3R66 A;  1GO3 F;  4TV8 B;  4YJ3 A;  3CJH A;  1VQP V;  3MD0 A;  3E89 A;  5CA1 A;  5LOV B;  3C3S A;  3LNM B;  5DEC A;  1SQG A;  3AEI A;  3E8F A;  1F4N A;  4GKK O;  5B1B B;  1VQ4 V;  3C90 A;  4DR3 B;  4EEQ A;  4UVB A;  2R70 A;  2YXH A;  4DR1 O;  4JI3 O;  4Q20 A;  4W4L A;  4WFB V;  5KHG A;  2E3C A;  5LGT A;  2DYR B;  1JX9 A;  1GM8 A;  3BY6 A;  1KKC A;  4G28 B;  4G2K A;  3A0B Z;  3UO2 A;  4YHH B;  4LF6 B;  2Q8V A;  2X6B A;  2RNB A;  1PNK A;  1XDC A;  2PUS A;  2ZDI C;  2CUG A;  1Q3E A;  1EN6 A;  2HP8 A;  4O4J A;  4I4T B;  3K5M A;  1AJQ A;  2CDY A;  2PZS A;  4J7Z A;  1VIB A;  1SRY A;  1JMK C;  2ATK C;  4OX9 O;  3JAL A;  2YXL A;  4J7J A;  4LH6 A;  1ZWI C;  2DYS C;  4Q6G A;  1EZV H;  4IIJ A;  3O9O A;  2QGN A;  3OMA B;  2IH1 C;  1XNQ O;  2B5U A;  3FD9 A;  1PM9 A;  3A0H Z;  4MTG A;  5BR8 O;  1WAZ A;  1JFF B;  4U7N A;  5KUK A;  4MVZ A;  3GB7 C;  3JAM N;  3H01 A;  1N34 O;  1AIL A;  3EVK A;  4I7Z B;  5JJJ B;  3EFF K;  4I4T A;  4KFM A;  5LGN A;  4PA3 A;  1WPX A;  1QHT A;  4JYA B;  1K33 A;  4TV9 B;  4GUN A;  2HHH O;  1M56 C;  3QF7 A;  3IC7 A;  2UUA B;  1GRJ A;  2PI5 A;  1SKV A;  3OUF A;  4DRX A;  2C2A A;  3UT5 A;  1PL0 A;  3H1J H;  2JEU A;  1B06 A;  3K03 A;  4LFC O;  5KA6 A;  1VP7 A;  2YIB A;  5CBG A;  4NXN O;  1CPY A;  4IT5 A;  4JI2 B;  1ZX3 A;  4RQF A;  1N8R W;  2LW7 A;  2UXB O;  1N0N A;  4JYB A;  1NBM G;  4GX1 A;  5KAF Z;  1RM1 C;  1VQ8 V;  2PF4 E;  1LR1 A;  1LUW A;  3ZMS A;  1BT8 A;  5GTH Z;  2F66 C;  4DW1 A;  1IDS A;  2IBZ H;  1VAR A;  3LDC A;  4EB6 A;  3F7Y C;  2XOK G;  3SPH A;  4J42 A;  4X64 O;  1ZSP A;  1QCE A;  2EIK C;  4CBC A;  2LFR A;  1Q82 W;  4WFE A;  1H38 A;  3IAY A;  3ASO B;  3ZN1 A;  1XMO O;  3I56 V;  3SPG A;  4GX5 A;  4JI4 O;  2CTQ A;  4B7E A;  1JA8 A;  2R9A A;  1O9G A;  2LP7 A;  4WFF A;  2K9P A;  2QEX V;  1GMG A;  4JV5 O;  1VF6 C;  3HKB B;  2DYR C;  1QVG U;  1KU9 A;  2JK5 C;  1OCZ C;  1RP3 B;  4K0K B;  5FL7 G;  1H8H G;  2YIB D;  5KX5 B;  3JAS A;  4MW3 A;  3C3T A;  4B08 A;  1NU1 H;  1YEW A;  4WF9 V;  1J5E B;  3SPC A;  3ZHU A;  1S5J A;  3HB3 B;  5KHH A;  4J10 A;  2KB1 A;  1K34 A;  3CRA A;  1V55 B;  2Q67 A;  2ADQ B;  4J7K A;  4Z2W A;  4MTF A;  4R50 A;  5IY5 C;  4OXS A;  3CEI A;  2LQT A;  3GVM A;  1DLB A;  1L8D A;  3RBZ A;  4DUZ B;  1S0V A;  1K97 A;  2JEX A;  2M6Y A;  1H8E G;  1NTM H;  2AHY A;  3UKM A;  4JTA B;  4RAI A;  4LF5 O;  1M1K W;  3SYP A;  1RPO A;  1P4R A;  1XQ8 A;  4X8A A;  4HBN A;  1QNM A;  2FYU H;  2BTQ B;  3ZX6 A;  3OEH G;  4UUJ C;  3OR6 C;  1DF5 A;  2W0X A;  3ICX A;  3DTU B;  3TCU A;  3AK2 A;  3X2Q B;  4JTD B;  1COW G;  4GX2 A;  1HR0 O;  2FKX A;  1JVM A;  3JAR B;  4IL6 Z;  4GKJ B;  2FL4 A;  3JCU Z;  3ETD A;  3HKE A;  4B3T O;  1TUE B;  2CH7 B;  3O65 A;  5GTI Z;  3R65 A;  4IYI A;  1ORQ C;  2YXY A;  3NXS A;  1H2N A;  1QLE C;  3ABT A;  1S77 D;  1HDJ A;  1HNZ O;  2DW4 A;  2XUM A;  5DED A;  3BA9 A;  3BAB A;  1NS1 A;  2WWW A;  2UU9 O;  2LGQ A;  2YID A;  3STZ C;  4LP8 A;  1DF4 A;  4CH6 A;  3WB1 A;  1LNQ A;  1AI6 A;  1F23 A;  1PD3 A;  4JGS A;  2UUA O;  4TUY B;  3K0D A;  3RVZ A;  2P22 C;  2E5L O;  1SC5 B;  1BQZ A;  4DR7 B;  2Q0O C;  3HKC B;  2VQF B;  1NVP B;  3T1Y B;  4NXM O;  3FB8 C;  5JVD B;  2ILM A;  4DV5 B;  2ZXW B;  4NKG B;  1O9H A;  4R6Z A;  3FKS G;  3FYE B;  2ZCE A;  3SJQ C;  3N2G A;  1WN7 A;  3H1K H;  5B1A B;  1XMQ B;  4YJ2 A;  2WLL B;  3RYI B;  4DUZ O;  5IYZ B;  2IU0 A;  3PJS K;  3J7A U;  4DXW A;  1Q5O A;  1NKD A;  1XIL A;  2RJZ A;  1Y67 A;  4PDV A;  3I55 V;  1G6U A;  4MVQ A;  5LP6 A;  2WLI B;  5LYJ B;  2JJ1 G;  2Q7H A;  4B3M B;  3QVN A;  1ARO P;  1JJ2 U;  1I5X A;  3A0R A;  1K92 A;  3RYF B;  2ZQM A;  2RMK B;  1OCZ B;  5CN0 A;  3FX7 A;  3ZRW B;  3SJB C;  1B3Q A;  1I5Y A;  1Q6I A;  3L75 H;  4O4L A;  5L3E A;  4YY3 B;  3ZRV A;  1KUQ A;  3HKB A;  4FZ0 A;  3J80 N;  4MVO A;  3AK1 A;  3E2E A;  2W6J G;  4RWU A;  2P67 A;  3LSQ A;  4KXR A;  5A2Q N;  4O2B B;  1M90 W;  4G27 B;  1AR4 A;  4JV5 B;  3MDS A;  2HEP A;  2XND G;  2ZIN A;  4PA7 A;  4CS2 A;  3CMA V;  2H8P C;  2ZT9 B;  2QTO A;  1P84 F;  4I0X B;  1TUB A;  1I94 O;  4PI0 A;  2VQF O;  3CME V;  4FK5 C;  4DR7 O;  4LNU B;  5KMG A;  4DV3 B;  5B1A C;  2QWP B;  2PI4 A;  2DOS A;  4I0X A;  2P7T C;  2HVK C;  2Y0I A;  2GTS A;  4PA9 A;  1F4M A;  1U97 A;  5F2V O;  4XDK A;  1BE3 H;  4OGQ B;  5KA5 A;  3ABM C;  2UUB B;  3MAQ A;  1GKF A;  1M56 B;  1ZLZ A;  4EKW A;  3ZIA G;  2Q6A A;  3AG2 B;  5CA3 A;  3K57 A;  5IDJ A;  2PGG A;  3BHP A;  1BL8 A;  5IJ0 B;  4DUY B;  2G38 A;  4CC6 A;  5EIB D;  5E1A C;  2AW9 A;  5L3G A;  2H94 A;  4BW9 A;  2KKW A;  3FB5 C;  2UXC B;  2EJ7 A;  3APO A;  4UFZ A;  5JCO C;  4GX0 A;  1ZUQ A;  4P9O A;  1TVK B;  5BMV A;  1Y74 B;  2A0L A;  1K3E A;  1WB7 A;  2EIL C;  3JD2 A;  1R3J C;  4CS3 A;  3A2F A;  1SA0 A;  2EUL A;  4YJ2 B;  2ZM6 O;  1GM9 A;  3ZHQ A;  2XAG A;  4UV9 A;  1UJW B;  4JI1 O;  2VQE B;  2VQE O;  5L3B A;  2R72 A;  1FFT B;  1YJW V;  1D5N A;  4RUF A;  2RCV A;  4CZZ A;  4JI0 O;  5JCO A;  3ASN B;  5E79 Z;  3ZHV A;  4O4J B;  1I94 B;  1JR9 A;  1G1X B;  1WA8 B;  2F4V O;  5JJE B;  1TVK A;  2JRI A;  3OGI B;  1HWY A;  5CB4 B;  4X89 A;  5CBH A;  1BCC H;  2QKC A;  3D36 C;  5LHH A;  3OFN G;  2QTS A;  3QG5 A;  1BSM A;  3JSL A;  1Y76 B;  4NVP A;  4JYY A;  5CMU A;  1NH2 B;  1U96 A;  3RGB A;  2LGW A;  4TT3 G;  2UUC O;  1HNX B;  2CK3 G;  4HNA A;  2P4K A;  1GTO A;  3G80 A;  4JI2 O;  2MW2 B;  1T5E A;  4PDR A;  4JI6 B;  5C8Y B;  1QU7 A;  4TSF G;  3CCM V;  4TV8 A;  4GLX A;  4J80 A;  3JSN A;  3H9V A;  3BAA A;  2GHY A;  5H5N A;  3VQV A;  5KHI A;  1SS3 A;  2JDI G;  2QA4 V;  1JJO A;  2XTA A;  1QR9 A;  1V54 B;  3ZMU A;  4ZI7 B;  1OCC C;  3TXS A;  2EZP A;  1XL4 A;  3CX5 F;  3JAW A;  4QGP A;  4FLZ A;  4X1I B;  1S5H C;  4P9P A;  3JD0 A;  2QM7 A;  2GUZ A;  4HZ3 A;  2IW5 A;  4MTX A;  4LF7 O;  4LF6 O;  3HKD B;  1WB8 A;  2XAS A;  5ITZ B;  4LC1 A;  4MVS A;  2KQX A;  2Q4P A;  4LF8 B;  4DR5 O;  4R8C A;  4YIP A;  1IZ3 A;  3T1Y O;  2UXB B;  2CTW A;  1BS3 A;  2E5L B;  3QO8 A;  4IHJ A;  1BHB A;  1L0N H;  4UCU A;  3ZJZ A;  4UCR A;  4DV7 B;  3RT3 C;  4H33 A;  1YXB A;  4QE7 A;  4O4L B;  1SQV H;  3L9D A;  3CCQ V;  5DM6 V;  2F23 A;  1QLN A;  3JD1 A;  2ZE7 A;  4B3M O;  4UV8 A;  2HJF C;  4JAS A;  3BRC A;  4GT1 A;  3MHS C;  3OMN B;  4L87 A;  1SQX H;  1SQP H;  4W4K A;  3CSX A;  5IE9 A;  1AB3 A;  2JGD B;  4FZ1 A;  3K5N A;  3OM3 B;  2V7Q G;  4DV7 O;  1GM7 A;  3K04 A;  2EJR A;  4DUY O;  4X62 B;  1TAE A;  4NB5 A;  4HAM A;  3JAK A;  3MHH C;  2QKS A;  3P3N A;  1EN4 A;  3QO5 A;  3IC9 A;  4ZBM A;  2DJV A;  1YCI A;  5EYP B;  4CC5 A;  1WP7 A;  2Y4U A;  4LF7 B;  1Y6X A;  4I9Q A;  5HFM A;  4GKK B;  3GWO A;  1V54 C;  4B3R B;  2EIL B;  4LFB B;  2AGA A;  5L3D A;  1PPJ H;  3BCC H;  3E83 A;  1GN3 A;  2W0F C;  1AJN A;  3RN4 A;  4EB6 B;  2GV9 A;  3X2Q C;  4XBF A;  1KBH A;  3K59 A;  1IBK O;  1MMM A;  1SET A;  4PEL A;  4C7U A;  1N36 B;  4MVR A;  3F7V C;  4KL1 A;  4X20 A;  3ETE A;  4ZOL A;  4NTW A;  4PDM A;  3F5W C;  4YXW G;  1K5Q A;  4OPH A;  1PKX A;  3ABL B;  5H9C A;  2X6A A;  5TIS Z;  1WPB A;  4U3J B;  5IJ9 B;  5D5P A;  4LF9 O;  3UT5 B;  3CCJ V;  1IUR A;  4LBE C;  4X1K A;  4JI4 B;  3K5L A;  2YI9 A;  4GZR B;  3CRC A;  4GCZ A;  1ENV A;  3LSS A;  3CXC U;  3G71 V;  2EIK B;  2ZXW C;  4O4H A;  4FIP C;  2L6L A;  2JS5 A;  1YTF B;  1ZAU A;  4B3R O;  4DV0 O;  1NQT A;  1KMI Z;  3B8N A;  3N27 A;  2UUB O;  2Z3Y A;  4JZG A;  3AG7 A;  4I55 B;  5KHJ A;  4WBN A;  5GON A;  4FLW A;  2EX3 A;  4L8J A;  4MS2 A;  1M4U A;  3OEE G;  4X9Q A;  3IJ4 A;  2QWN B;  4LFA B;  1SA0 B;  1Y4M A;  1FS0 G;  3JAL B;  2D3O W;  1AJP A;  4FMT A;  4TWK A;  3JAK B;  3CCE V;  1VQ5 V;  3DXR A;  5EIB C;  1R3K C;  1N4C A;  3T1H B;  2NR5 A;  2HJD A;  4JYC A;  2O57 A;  4JI5 O;  2N04 A;  5J9P C;  4K8Z A;  1OCO C;  4QPK A;  3G4S V;  2HR3 A;  1R6K A;  2GBO A;  1VF6 A;  2WLM A;  2F1M A;  3SYA A;  1ZTE A;  3SJC C;  4TOI A;  1R3I C;  4B3S B;  1SZX A;  3K58 A;  4FLV A;  5J2U B;  1BQ0 A;  1NZ6 A;  5JQG B;  2B1G A;  3SYO A;  2IH3 C;  3E86 A;  5KAI Z;  3G6B A;  3CRM A;  3OTF A;  1K4C C;  1XNR O;  2YEV B;  4IGG A;  1IBL O;  1OHH G;  3IGA C;  2WSS G;  3CE2 A;  1YDX A;  2GUZ B;  4QJF B;  1KC8 W;  4N21 A;  4MSW C;  1PV0 A;  4JI7 O;  4WCE V;  4O2A A;  4LNU A;  4X65 O;  1M57 B;  3CS5 A;  3SJA C;  2Q73 A;  4LCU C;  4D7S A;  4JAA A;  3T4Z A;  4RO2 A;  2DWD C;  5FPR A;  1THZ A;  1H2G A;  3WB0 A;  1K9M W;  2XAH A;  3SYC A;  1YIT V;  3ETG A;  3P32 A;  2EIJ C;  1R1B A;  2HVJ C;  2BSK A;  1XNQ B;  4E4E A;  2Z0A A;  2HLD G;  2QJ1 A;  3F5T A;  4DV5 O;  1VEW A;  1Z5W A;  4J11 A;  3P30 A;  1PNL A;  5EBW C;  2Z5U A;  5LMN B;  1QR8 A;  1CP9 A;  4FLY A;  3JCZ A;  4MVM A;  3WU2 Z;  3OAA G;  1BGY H;  5JQG A;  3FYI B;  4LWS B;  1OCR B;  4HNA B;  4PA4 A;  3IFX A;  4P30 A;  3VOU A;  3ZRW A;  3ABU A;  5KUM A;  4U3F H;  1Z5V A;  2ZE5 A;  4DRX B;  1AR5 A;  3FB6 C;  4OPA A;  1OJH A;  2A9H A;  1EM1 A;  4DK0 A;  1CXZ B;  5EK0 A;  1YSC A;  2YIA A;  3K3W A;  2F43 G;  2XAF A;  3L70 H;  3M8A A;  3TK1 A;  1UPG A;  3ZMT A;  1AR1 B;  1YI2 V;  2Y4T A;  4JF3 A;  2Q69 A;  3JAT B;  2R9I A;  4D7T A;  1FXK C;  3GWK C;  5BZB A;  3OW2 U;  2GSM B;  2WLL A;  3RYI A;  3BPZ A;  2B1I A;  1JFF A;  3QNE A;  1YF2 A;  2ZIO A;  4TQF A;  3RVY A;  5BR8 B;  1MA1 A;  4H0L B;  2ZE8 A;  2DYS B;  1Q43 A;  3HKC A;  2QWO B;  4DV3 O;  5LXT A;  2M7W A;  4MVU A;  1EBO A;  4TUY A;  1SZT A;  2OIE A;  3KCX A;  1N33 B;  1WJZ A;  2ADP A;  2WLJ A;  2CE4 A;  4N23 A;  4PA6 A;  1SQF A;  3KCY A;  1KYO F;  2QWR B;  4FFB A;  3QTC A;  1D5A A;  3H1L H;  1EFR G;  4KP4 A;  1B04 A;  2FTK A;  1SES A;  5J2T A;  1E1Q G;  3K79 A;  4NR1 A;  4U3J A;  3ZCC A;  5IJ9 A;  4UCO A;  4X1Y B;  1L1F A;  1OV9 A;  3OTO O;  3VBB A;  5EBL C;  4AHC A;  4FLT A;  3HPL C;  1NVP D;  4X66 O;  5GW7 A;  4ZOL B;  3VQW A;  3JAR A;  2JJ2 G;  3AG4 B;  1XBL A;  4KUM A;  2WPD G;  3EXA A;  2FML A;  3UCS C;  1R6N A;  1AVM A;  5BXZ A;  1QLE B;  4F6E A;  3Q4H A;  4DR6 O;  2ITD C;  4MTO A;  2EIJ B;  4LFB O;  1X59 A;  1W0K G;  1MAB G;  1VQO V;  1RM1 B;  5DN6 G;  2YUA A;  2LW1 A;  2EIM B;  1TUB B;  3ABM B;  4JI1 B;  1HP8 A;  3LNN A;  1XRE A;  1NR7 A;  3AG3 C;  2ZD9 A;  5LA6 B;  5LBQ A;  2PYL A;  1M57 C;  2EIN C;  3D8C A;  3QO7 A;  2QE7 G;  2YEV A;  2Q5Z A;  4DV2 B;  1NT2 B;  1FPO A;  2RDC A;  5EYP A;  3N2K B;  4I9W A;  1GN6 A;  2AZ0 A;  2IM9 A;  2ZNI A;  3UQ8 A;  5D5Q A;  2IJH A;  1K8A W;  1J5E O;  3K9A A;  5J2U A;  4RQE A;  3FB7 C;  3ZHR A;  5K1P A;  4DR4 O;  2NNU A;  1CEZ A;  3RYF A;  2P4V A;  4LF9 B;  4AIL C;  2CTP A;  5KX5 A;  5LYJ A;  2WLI A;  4E2L A;  3CRR A;  2ETN A;  3T2M A;  2IJJ A;  2YS8 A;  1BHA A;  4PJ0 Z;  5LP6 B;  4WFA V;  1Q7Y W;  4NXN B;  4H13 B;  1FFX B;  4LR3 A;  3SDL A;  3AG4 C;  1W59 A;  2PY5 A;  4ABM A;  4PDL A;  4U7O A;  2RN9 A;  2RQ6 A;  2DE0 X;  2OIG A;  3B09 A;  2P5O A;  3SPJ A;  4F6R B;  1JPX A;  3L71 H;  4KHP B;  2V1D A;  4WBN B;  2A79 B;  4UVA A;  4I55 A;  1K7D A;  3TGU H;  4O4I B;  3RYH A;  2OT5 A;  3TXQ A;  5JVD A;  3AG3 B;  5IY5 B;  2XHB A;  1XNR B;  4DV1 B;  1MZF A;  1H2M A;  1S5L Z;  1QQC A;  4YHH O;  4EFB A;  1NTZ H;  4FLX A;  2Q0A A;  4UB8 Z;  2AHZ A;  3LDE A;  3VQX A;  4DV0 B;  4H44 B;  2ZR3 A;  3ABK C;  1I08 A;  1FXK A;  3CC4 V;  5JJN B;  4K3A A;  4DYL A;  1FXV A;  1W0J G;  2YC0 A;  1IX9 A;  3STL C;  1GK9 A;  1PL4 A;  4B3T B;  4X62 O;  3OD4 A;  2CTR A;  2V4D A;  5JH7 B;  1KEC A;  4UCT A;  2A06 H;  5JH7 A;  4ZKI A;  4FPP A;  5L3C A;  4DV6 O;  1MSD A;  2OTL V;  2WLK A;  1HR0 B;  4J9Z B;  1Y76 A;  3L73 H;  5J2T B;  1NJI W;  2DQ3 A;  1E79 G;  3APQ A;  3ML0 A;  1YZB A;  2WAM A;  3U0Z A;  2AZ2 A;  1SQB H;  3G67 A;  5CB4 A;  4FFB B;  1TGO A;  2BE3 A;  2CAZ C;  3CHX A;  1FXK B;  3T1C A;  4BAY A;  3BVO A;  4TV9 A;  5K1X A;  2K1E A;  1Q6H A;  3B40 A;  2Y0P A;  3SGI A;  4LF8 O;  2OTJ V;  3L72 H;  1IBK B;  2QM4 A;  1SER A;  1N33 O;  2Y69 C;  1DGS A;  3RYH B;  4X65 B;  2LO1 A;  2PYJ A;  3CCL V;  3OMI B;  1OCR C;  2KSD A;  4F6R A;  2LJ2 A;  4UXN A;  5AG2 A;  4YIO A;  3TJT A;  2XT9 A;  3SYQ A;  1Y66 A;  2W6I G;  3ABK B;  4NTX A;  1MZE A;  3ZED A;  3J81 N;  4Z1M G;  4KHP O;  3JAT A;  3FAV B;  4WFG A;  2HFE C;  4ASU G;  1OCO B;  1RPR A;  5BMV B;  1AI5 A;  1PP9 H;  4DV4 B;  4P2Z A;  4AQY B;  4B7K A;  1S76 D;  1V9P A;  4ZHQ A;  4DR3 O;  3CB2 A;  3B2E E;  4UVC A;  2UUC B;  4FM0 A;  1YJ9 V;  3LDD A;  1OZ0 A;  2IJK A;  3K0G A;  1I0H A;  3T1H O;  4ZIB A;  3ZHS A;  2BCC H;  4JI7 B;  4DV1 O;  3N2K A;  4BIU A;  4DV6 B;  3K06 A;  1KB9 F;  4YJ3 B;  2F4V B;  1XHX A;  1FJG B;  5ITZ A;  5EZY B;  2HHH B;  2BSK B;  3D3I A;  4XDJ A;  1IBL B;  5EC1 C;  5LA6 A;  2OCC B;  3W7U A;  4QPJ A;  3ZMV A;  1P7G A;  5IWA O;  2UXX A;  1J95 A;  3I5D A;  1G8M A;  3CXH F;  5KMG B;  2HKO A;  4LF5 B;  3W7W A;  3JAW B;  2VS0 A;  2N05 A;  5LGU A;  4FVM A;  3BFR A;  4B3S O;  3Q4H B;  1F7Y A;  1IBM O;  2YDE A;  2Q7G A;  3AG1 B;  1YJN V;  2N74 A;  4NXM B;  3ZN0 A;  3EHB B;  3B4S A;  1HNW O;  4HYO A;  1VQ6 V;  4NYK A;  2D2C B;  1Q6U A;  5C8Y A;  2ZDI A;  4WFH A;  3UM7 A;  4RUE A;  4JTC B;  2EBO A;  4EFE A;  1ZL8 A;  3D36 A;  4JAV A;  4X1Y A;  3E22 B;  1M5I A;  1XL6 A;  1JQ0 A;  3OTO B;  1K5S A;  4JYA O;  2R9R B;  2E75 B;  2ZE6 A;  2IJI A;  3CCV V;  1Q81 W;  2MK3 A;  4FLU A;  4DR4 B;  1WA8 A;  2PTM A;  5C93 A;  1MNG A;  4JZ2 A;  1EN5 A;  2ITC C;  4PV1 B;  1R73 A;  2L35 A;  4BWA A;  3FAV A;  4LFC B;  1IXM A;  1KQS U;  3DSQ A;  5IYZ A;  2Q9L A;  1XMO B;  5FLX N;  2JGU A;  1RFY A;  2XAJ A;  1VQN V;  4BW5 A;  3N2G B;  4BIO A;  4JI8 O;  1IXB A;  4JI8 B;  4IIJ B;  3T4D A;  3ASN C;  2EZO A;  4MT8 A;  3RFR A;  4PD4 F;  4F4L A;  1VQK V;  1N32 O;  3OGC C;  1WP8 A;  4JI6 O;  3KKY A;  2HG5 C;  1FXH A;  4O4H B;  2Y48 A;  2GTA A;  2UU9 B;  5HFL A;  1GH6 A;  3E8B A;  3SR2 C;  1HNX O;  1Q8I A;  1MSW D;  1VMG A;  1XHZ A;  4JI3 B;  2ZR2 A;  3S3W A;  1AP5 A;  4YY3 O;  1DTO A;  1G4Y B;  3U11 A;  4DR2 B;  1I7F A;  1NI8 A;  4AI8 A;  4DV4 O;  1XEQ A;  1AP6 A;  4CH4 A;  2WA3 A;  3ZRS A;  1GAX A;  3H1H H;  5L3F A;  3CP1 A;  3FFQ A;  5LL6 Y;  3W7X A;  2QDO A;  2QKA A;  3JD3 A;  1ZL8 B;  1FAF A;  5IJ0 A;  2YIC A;  1YTF D;  2F95 B;  2GDS A;  1RSO A;  2CH7 A;  1H2S B;  5LOV A;  5B5E Z;  1UFI A;  4DK1 A;  2VWJ A;  4X20 B;  2WA4 A;  3OR7 C;  4LFA O;  4TQD A;  3CJH B;  1VQ9 V;  3AG2 C;  2E76 B;  2XAQ A;  1OCC B;  2KG7 A;  5IYD O;  1XOU A;  2FB5 A;  3RW0 A;  1IVS A;  5CA0 B;  3WFV A;  2LFS A;  3ZS8 C;  3CC7 V;  4PHZ A;  2JVD A;  1IBM B;  1N34 B;  3CRQ A;  4LF4 O;  2YSU B;  2ZIM A;  3AG1 C;  4LF4 B;  1X4T A;  2EIN B;  3CCR V;  1K73 W;  3ZHT A;  1SF9 A;  5JWP A;  5KHK A;  1BZK A;  4CS4 A;  1AI7 A;  2QM8 A;  4O4I A;  3RYC B;  4D6T H;  3G6E V;  1NH2 D;  1BMF G;  4BIZ A;  1XUQ A;  3CD6 V;  5EZY A;  1Q90 D;  2NLJ C;  4MW8 A;  4R7C A;  1LUV A;  2JIZ G;  3DC5 A;  4O2B A;  2UXC O;  1Z2G A;  2ODM A;  1VQM V;  1NR1 A;  2P90 A;  3THO A;  1HNZ B;  1MOF A;  1FFX A;  2X7R B;  1K4D C;  2QWQ B;  1L0L H;  1R3L C;  1WLE A;  2CGN A;  2Q68 A;  5LHG A;  5LP6 C;  3E8H A;  1FKA O;  2JGD A;  3ETQ A;  5B3S B;  5IT9 N;  4DR1 B;  4ZHQ B;  3CCU V;  2UXD B;  4JAU A;  3CCS V;  1XI1 A;  2OWO A;  3JAS B;  4GKJ O;  2NN4 A;  2X6C A;  5B66 Z;  3ZBH A;  3BEH A;  3CC2 V;  1GN2 A;  3ZMZ A;  4K8X A;  3UO3 A;  3DXR B;  2BTO A;  5FPO A;  4GYC B;  2QSA A;  1URF A;  2ZNJ A;  1JOY A;  1YIJ V;  5IYC O;  4QNH B;  4XDL A;  1D2D A;  5LMU O;  2DMX A;  1S3J A;  1YVW A;  4PI2 A;  3CWB H;  1B6Q A;  1P7B A;  1R6T A;  2YI8 A;  2DQ0 A;  3HKD A;  5GON B;  1V55 C;  3NR7 A;  3CPW U;  3AK3 A;  5H2F Z;  3A8T A;  4BR6 A;  4DR5 B;  4QE9 A;  4X1I A;  5IYB O;  3BA8 A;  3JYC A;  2A7W A;  3OUS A;  5EBM C;  4QIW F;  1PNM A;  3OT7 A;  3JD4 A;  1N32 B;  1HW7 A;  5IWA B;  5FNV A;  2A3Q A;  3ZRX A;  4K35 A;  1NTK H;  4H37 A;  1EZJ A;  1H2K A;  3S3X A;  3E35 A;  5EC2 C;  3M99 B;  1Q86 W;  2KG7 B;  5CBF A;  3ABL C;  2UXN A;  4X1K B;  4FM1 A;  4X66 B;  2E74 B;  1SQQ H;  4LH7 A;  2QR4 A;  5H6Q A;  1A32 A;  1RSO B;  2BOB C;  4UCS A;  1FYJ A;  4K0K O;  4FM2 A;  3VQY A;  5B3S C;  3K08 A;  3HKE B;  1KP3 A;  2X0L A;  4DR2 O;  5LMN O;  1AI4 A;  3W7S A;  2F93 B;  1E1R G;  3E8G A;  4J41 A;  3WG7 B;  1VF5 B;  3KG2 A;  4JI5 B;  4CH5 A;  5H6R A;  3RWR D;  3P3P A;  5A9G A;  2IU3 A;  1VF7 A;  2EIM C;  3LSU A;  3WB2 A;  5FNV B;  2BTQ A; 
#chains in the Genus database with same CATH homology
 4B3S O;  4DV7 O;  2UUA O;  1F7Y A;  1IBM O;  4LF8 O;  4DUY O;  1R1B A;  4DV4 O;  1XEQ A;  4B3R O;  4DV0 O;  2E5L O;  2N74 A;  3R66 A;  2Z0A A;  3SDL A;  1N33 O;  4NXM O;  2UUB O;  1HNW O;  3F5T A;  5LL6 Y;  4DV5 O;  4LFC O;  2UUC O;  1D2D A;  5LMU O;  2ZKO A;  2DJV A;  3OTO O;  1FJG O;  5BY1 A;  4JI2 O;  4NXN O;  4A5U B;  4GKK O;  4X66 O;  1R6T A;  3J81 N;  4DUZ O;  4KHP O;  4LFA O;  2AGA A;  2LW7 A;  3J7A U;  2UXB O;  4DR1 O;  4LF5 O;  4JI3 O;  2UXD O;  4JYA O;  5H5N A;  4OPA A;  5BXZ A;  4GKJ O;  4YHH O;  4DR6 O;  4LFB O;  1X59 A;  4JI5 O;  4LF4 O;  1IBK O;  4AQY O;  4DR3 O;  3M8A A;  1HR0 O;  2FKX A;  1DK1 A;  4X64 O;  4OX9 O;  4LF7 O;  4LF6 O;  5FLX N;  3T1H O;  1XMO O;  1KUQ A;  3J80 N;  4X62 O;  4OPH A;  4B3T O;  4JI4 O;  1A32 A;  2ZM6 O;  4DR5 O;  4DV2 O;  3T1Y O;  3O65 A;  5A2Q N;  4DV1 O;  1FYJ A;  4K0K O;  4JI1 O;  4JI8 O;  1XNQ O;  2UXC O;  4DV6 O;  5BR8 O;  2VQE O;  1XNR O;  1N36 O;  4JV5 O;  4LF9 O;  1IBL O;  4DV3 O;  3JAM N;  4DR2 O;  1J5E O;  3RT3 C;  1HNZ O;  1N34 O;  1XMQ O;  5LMN O;  1N32 O;  1YZB A;  4JI6 O;  1NS1 A;  1AIL A;  5IWA O;  4DR4 O;  2UU9 O;  4B3M O;  4JI0 O;  1I94 O;  2VQF O;  1FKA O;  4JI7 O;  4DR7 O;  4X65 O;  5IT9 N;  1G1X B;  2F4V O;  1HNX O;  1AB3 A;  2HHH O;  2JRI A;  4YY3 O;  2DOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...