1IBKO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibkO00
4DR5O 1R6TA 2E5LO 1YZBA 2VQEO 4DR2O 4JI7O 4OX9O 4DV4O 1F7YA 4JI1O 1IBKO 4JI2O 4JI3O 4JI8O 4LF5O 2JRIA 3JAMN 2UU9O 4DR6O 1KUQA 4LF7O 1NS1A 2UUCO 1A32A 1HNXO 5IWAO 4DR3O 2DJVA 1X59A 2AGAA 4DV3O 5LL6Y 4DUYO 4JI6O 4X66O 4LFCO 4OPHA 4LF4O 4DV6O 1FKAO 1XNRO 5BXZA 2FKXA 3J81N 1HNZO 5FLXN 2DOSA 4DV5O 1IBMO 1HNWO 3R66A 4LF8O 3SDLA 4DR1O 1D2DA 4LFAO 4JI0O 3F5TA 4LF6O 3M8AA 3RT3C 4B3RO 4GKJO 3J7AU 4K0KO 3J80N 1I94O 4KHPO 4DUZO 1HR0O 4JYAO 2LW7A 4DR4O 4OPAA 3T1YO 1AILA 3OTOO 1N34O 4A5UB 5LMNO 2VQFO 1FJGO 4JI5O 2ZKOA 1XMOO 4YHHO 4DV0O 2UXDO 2ZM6O 1AB3A 5A2QN 4JI4O 3O65A 2Z0AA 5BY1A 2HHHO 4X62O 4NXMO 1R1BA 1XEQA 4B3MO 1DK1A 4NXNO 4AQYO 4YY3O 4LF9O 2UXCO 2UUBO 2N74A 2F4VO 1N32O 4JV5O 1XNQO 1G1XB 1IBLO 5BR8O 1N33O 5H5NA 1FYJA 4DV1O 4DV7O 3T1HO 4DR7O 1J5EO 2UXBO 4GKKO 4LFBO 5LMUO 4X64O 4DV2O 4B3SO 4X65O 5IT9N 1XMQO 4B3TO 2UUAO 1N36O
chains in the Genus database with same CATH superfamily
5GONA 3QO8A 5B1OA 3W7SA 2QWOB 4GX2A 5H9CA 3DXRA 4B3RB 2QKCA 1GH6A 4J7KA 3UT5B 1NS1A 3F5WC 2LFRA 2OWOA 1SZXA 3FAVA 4JYCA 1NH2B 5LGTA 2AGAA 5KHJA 4DV3O 4G27B 2HVKC 3G4SV 4X89A 2VWKA 5B1AC 1VQ4V 2UXDB 2IBZH 5LOVB 3DTUB 3KKYA 3CJHA 2WLIB 1AP5A 1XNRO 4U3JB 1OCOB 2F93B 4AQYB 1WJZA 2EZOA 2DOSA 5JH7A 4PV1B 1YVWA 1K9MW 4UUJC 2JJ1G 3H1KH 3C3TA 2KB1A 1MSWD 3CWBH 3ZRXA 5K1XA 2LO1A 1OV9A 1CPYA 1R3JC 2VS0A 3J80N 2X7RB 4JYAO 4NB5A 4TT3G 3ZEDA 4PDRA 2JJ2G 3ZX6A 4FZ0A 2R9RB 3ABMB 1IVSA 4X65B 4J42A 5LYJB 3OM3B 1YITV 5CB4A 2Y4TA 3HKCA 4PDMA 3SJAC 5A2QN 2CAZC 2CTPA 4P9PA 4YIOA 4UB6Z 5IYBO 2Q69A 3RBZA 4O4JA 4LH7A 5KAFZ 1N32O 4MTFA 2YI8A 2BSKA 5GONB 2PI4A 2AZ0A 4CH5A 4J11A 3OT7A 4RO2A 4GKKO 3DXRB 1LUWA 3OTFA 1U96A 4JZ2A 3ASNB 4WFFA 4DV2O 2ITDC 2OIEA 1F4MA 2R9IA 2V4DA 2Q7EA 3L9DA 1HNZB 2Y69C 1N36O 3ZRWA 1R6TA 4DR2O 3LDEA 2E74B 2WLKA 3IFXA 4JI1O 1F23A 1S76D 4ZI7B 1IBKO 1MABG 1VARA 3PN1A 3SR2C 4JI8O 4DRXB 4HAMA 3ZBHA 2D2CB 2ZNIA 1OCOC 1MG1A 4I50A 4X1KB 2ZE8A 1DTOA 4DR3O 1I5XA 3ZHVA 3SJCC 1W59A 4BWAA 5KUMA 3SJBC 2QR4A 1XQ8A 2EILB 4CS3A 1H2KA 4N23A 4KFMA 5CA3A 1V54B 2B1GA 1I08A 3UQ8A 4GCZA 3ABMC 3BHPA 4DR1O 1AR5A 3CCVV 2F66C 1YIJV 5BR8B 2KQXA 1JA8A 1GN3A 4I7ZB 1KB9F 4WBNA 3JAWA 1WB7A 1PL4A 4I4TA 1H8EG 4QPKA 4J7ZA 3VQVA 3CS5A 4AILC 1QU7A 4YHHO 4CZZA 2YICA 2UXCB 2HVJC 4WFHA 2BSKB 2IJIA 4X62O 4MT8A 3QVNA 2BTQA 3KCXA 2UU9B 4TV8A 4LF9O 1NTKH 2UUBO 1BT8A 3ASNC 3MHSC 2YIBA 4FK5C 1TUBB 1JX9A 4CH3A 3BA9A 2IJKA 3I56V 1H2GA 4B3SB 1GN4A 3ABKB 4FPPA 5BZBA 1D5AA 2OYQA 5IJ0A 2WSSG 2V1DA 2AHZA 2XT9A 1RPOA 4PA3A 2X6AA 2F23A 3U10A 4I50B 4J9YB 4DV5B 3E8HA 2E5LO 4J80A 4DW0A 4JAUA 3CHXA 4J9ZB 1H8HG 4XDLA 1L1FA 4LF5O 2ZXWB 3SPHA 2LJ2A 1V54C 5IDJA 4H37A 1YF2A 2VQFB 3B2EE 3DC6A 3E8FA 4DUYO 2ZM6B 5JVDB 4JI4B 1OCZB 4UVBA 1HW7A 3K04A 1Y6XA 1XUQA 2GUZA 4UCSA 3JAWB 1Q81W 4DK1A 1SZTA 1W2BU 1ZLZA 1AR4A 3BY6A 1ZX3A 2H94A 4MTGA 1D2DA 1BGYH 4UVAA 1E1QG 3E35A 2JDIG 2A7WA 1P4RA 3T1HB 3L74H 1SS3A 3T2MA 4FM0A 2LW7A 2WLLB 4DR4O 4X64B 2BTQB 1CEZA 3Q4HB 4TV8B 5L3EA 1UPGA 3AG3B 3ABUA 2JEUA 4IL6Z 2ZIMA 2Z0AA 4I9QA 1RM1B 2QTOA 3ABKC 1XHZA 3ETEA 3GWKC 3IJ4A 1NTZH 5IJ9B 4WFGA 2UXBB 2KG7A 1R3LC 3WU2Z 5LA6A 1XNQO 3SPIA 4LWSA 3CRRA 1WP8A 4UCUA 1KBHA 5EC2C 2BE3A 4MTOA 4PA9A 4U7NA 5IY5C 3LDDA 1HDJA 3S3WA 3GB7C 4O2AB 2AW9A 1B3QA 2ZXWC 3ML0A 5DM6V 1JR9A 1URFA 4FFKA 1YZBA 2X6CA 4JI7O 1LR1A 4FFBA 5K1PA 4G28B 1JPXA 4QPJA 2ETNA 4JI0B 2HEPA 1NZ6A 1KUQA 4LF7O 2DW4A 4FMTA 3DSQA 1IXBA 4GZRB 2UUCO 4JYBA 1B6QA 3G6EV 3FFQA 4FJCC 1EN5A 3BRCA 1FJGB 1VIBA 3NXSA 1MOFA 2WLMA 4LF4O 2C2AA 2AHYA 5D5QA 4HNAA 1FPOA 3SPCA 2XAHA 2HFEC 4LP8A 1QBZA 2ZT9B 1L8DA 3JASA 3K57A 5B5EZ 1KKDA 5DECA 5ITZA 4F6RA 5D5PA 1HNWO 1ZWIC 2EIKB 3CYOA 1YTFD 3CE2A 4RWUA 3BCCH 1YJWV 3FB6C 1NVPD 4X1YB 3L71H 3TETA 4XBFA 3OEHG 5FNVA 4Z1VA 1JOYA 2KG7B 1Q5OA 4P30A 4OGQB 3JSLA 5LA6B 2DE0X 3SPGA 3UO3A 4BIZA 3OGIB 5JCOC 1WA8A 3U11A 4EKWA 4NXMO 2QM8A 1IBLB 4PA4A 4DR6B 5CA1B 3BABA 5GTIZ 2GV9A 2PF4E 1S5HC 1FXHA 2H3OA 1YCIA 1WN7A 3VOUA 1YXBA 3FB7C 3AG7A 4MVOA 3JATA 5IT9N 4RAIA 4B3TO 2JGDA 1CP9A 2GTAA 4QNHB 5FPOA 2Q7HA 3I55V 1LUVA 3HKDA 1BL8A 1VQ7V 1FAFA 4HZ3A 4PI0A 4FZ1A 5GTHZ 4CC6A 3CMAV 1FXKA 1XL6A 1SA0B 3OTOB 3ZS8C 3AG4C 1KD1W 5ITZB 5IWAO 2DJVA 2K9PA 2ODMA 2YIDA 4F6RB 1M56B 3ZMSA 4JYYA 2EIKC 4X66O 3E2EA 1RPRA 3QO5A 1JMKC 3APQA 3J81N 4YY3B 4EFBA 1FD9A 4MVUA 3LUTB 2E75B 3P3PA 5KA5A 4P2ZA 3D36A 1IXMA 2WWWA 1N4CA 4DXWA 5E1AC 3FD9A 1WA8B 2LFSA 2A06H 2QTSA 1NJIW 2HJDA 1N8RW 4BW9A 4P9OA 1EBOA 1N34O 1BHAA 5LMNO 3EHBB 3ETQA 1UJWB 4NXNB 1SQGA 3OMIB 4JI5O 2ZKOA 4UCOA 1XMOO 2WA4A 2VQEB 3ZN0A 5BY1A 5LHHA 2QWRB 1K4DC 4XDKA 3JATB 5EBWC 3OEEG 3LSQA 4D6TH 1IURA 3E8GA 1BZKA 1Y4MA 1Y76A 3OGCC 5J2TB 4Z2WA 1BCCH 4NTWA 2HKOA 2ZINA 2B9ZA 5B1BB 4D7TA 2L35A 3HKDB 1H38A 4NKGB 1GM9A 4ZIBA 2FB5A 4QE7A 4JI2B 1SQBH 1FXKB 1RFYA 3SYPA 5CBFA 5L3DA 3CSXA 4JASA 1P84F 1QHTA 1SF9A 3UCSC 4DR5O 4LF8B 2DYSB 4TQDA 1M56C 3FB8C 4ZHQB 1AROP 1ZTEA 3ZHSA 3DC5A 5EBLC 3C3SA 2JRIA 3B77A 4Q6GA 3B09A 3TGUH 1JCHA 5KUKA 1KP2A 3IAYA 1OCCB 4MW3A 2PYJA 2Q68A 4MVZA 4GX0A 3AG1C 4UVCA 1F51A 1Q82W 4DV0B 4JI6O 4TV9A 5LP6A 2P5OA 2QA4V 2HHHB 1FKAO 4IGGA 3IC7A 1VQMV 3CCLV 3M7MX 2FKXA 3RYIA 1SKVA 2EJ7A 2FMLA 3TJTA 2LP7A 2P22C 3H1IH 4L8JA 1I7FA 1JFFA 4I0XA 3CPWU 2IH1C 3OFNG 3H01A 1VQOV 3WB2A 2Y4UA 5CMUA 3D8CA 3N2GA 2HR3A 3N2KA 4AHCA 3K59A 1WPXA 4NVPA 4DK0A 2WLJA 2YI9A 2YDEA 1AI4A 2PYLA 1YJNV 1H2NA 1LNQA 3T1CA 4YIPA 2MK3A 5B1BC 2Q6AA 1U97A 2XAFA 4DV7B 1ZAUA 2ZNJA 2UXCO 1J5EB 2WLHA 1AI6A 4B7EA 1AR1B 1VEWA 4RQEA 3RYCB 1MA1A 3ZRVA 4ZKIA 4JF3A 1G1XB 3JSNA 1VF7A 1S0VA 2DYSC 4W4KA 4RQFA 1NR7A 1VQ8V 2RQ6A 1QLEB 4MTXA 4B3SO 1QR8A 4G2KA 4JPRA 1XMQO 2CGOA 1OCCC 1AJPA 3BA8A 3QNEA 4R7CA 1F7YA 4EFEA 1Q7YW 2M7WA 3K9AA 5LP6B 1IZ3A 3E8BA 4K0KB 4W4LA 3K79A 4FLXA 1E1RG 4U7OA 3JCUZ 1UFIA 3RYIB 1HNXO 1GRJA 1H2LA 3P3NA 4JTAB 1XOUA 1VQPV 5KLVH 2DMXA 4X9QA 1ZSPA 1JFFB 1VF6C 3FAVB 4I0XB 4WFAV 4KL1A 1BE3H 1K97A 1OCRB 3BPZA 3N2GB 1Y74A 3N2KB 5FLXN 2XNDG 4MVSA 3CJHB 2VRZA 2F4VB 2BOBC 4ZOLA 4LF6O 1ROPA 4GKJO 5JH7B 1TGOA 2UXXA 3LNNA 3BAAA 4TWKA 3ZRSA 4DUZO 3HR0A 5EK0A 5EIBC 4ZBMA 4LFBB 2JS5A 3JD4A 3S3XA 2HP8A 2PUSA 3HKBA 3L73H 1YEWA 5DN6G 1F4NA 1AB3A 3CRQA 3VQXA 1RP3B 1ZL8A 1PPJH 1DLBA 2XOKG 5CB4B 1XEQA 4LC1A 3HKCB 5E79Z 1DK1A 4YJ2A 3QF7A 3BFRA 3X2QB 1THZA 2PI5A 1GAXA 4X8AA 1S72V 1PL0A 4FLVA 1R6KA 1Q6HA 2QM4A 2NNUA 5EYPA 3W7WA 4DV1O 4O4JB 4U3FH 1R3KC 5KHIA 2UXBO 2EZPA 3H1JH 1XNRB 2ZR2A 5EZYA 4UXNA 1JVMA 1PNMA 3ZHRA 2R9AA 3EXAA 2P90A 2F95B 2LGWA 2W6IG 3RFRA 3K3WA 2ZE7A 4JI3O 2EIMB 2IJHA 2QKAA 3ZRWB 1BSMA 4MSWC 4JYAB 3ABTA 1OCRC 4JTCB 1QVGU 2Y0PA 1G4YB 1NR1A 3WG7B 4GX5A 5KMGA 4LFCO 4ZOLB 4EB6A 2CK3G 2RN9A 2EILC 4BIOA 2IM9A 3HB3B 5LXTA 1N32B 2ILMA 4O2BA 4IT5A 4ICGA 4YXWG 5GW7A 1QNMA 1JQ0A 1SQXH 1HR0O 5KHHA 4GKKB 3G67A 2LGQA 3T1YO 4DV2B 2EIJB 1FS0G 2XUMA 1JJ2U 4K35A 1S5JA 3X2QC 4WBNB 2CDYA 1N36B 3WFVA 4FLTA 4I4TB 1R6NA 4RUFA 4DR2B 5EYPB 4JI1B 1S77D 2NLJC 4B3MO 1VQKV 5B1NA 5B66Z 4JI8B 3VQWA 3B4SA 2Q73A 5IYDO 3OMAB 4PA7A 4DR3B 4JV5O 1IBLO 2B1IA 3ICXA 1N33O 1AJNA 1Q90D 2QE7G 1HWYA 2ZCEA 2YEVA 5LMUO 3A0BZ 2EIMC 3A0RA 2Q7GA 2UXNA 5IJ0B 4R50A 5H6QA 3VQYA 2RNBA 1Q8IA 4JZGA 2RJZA 4DR1B 3WG7C 2YXHA 4IIJA 1TVKA 3G80A 3CCSV 1GKFA 1MZEA 4I55A 1BQZA 2QWPB 3JD2A 2DN9A 4WF9V 5LXTB 4YHHB 3TCUA 4OPHA 3BVOA 4X62B 4QIWF 1CXZB 3A8TA 4LCUC 2FL4A 2EULA 5L3GA 2ZDIA 1DGSA 3JARA 4LF9B 1PNKA 1IBMO 1OCZC 1SQPH 3OUSA 4MW8A 3O9OA 3K0DA 4X20A 1O9GA 1KQSU 2GUZB 3SGIA 4LFAO 2F43G 3CCUV 4K8XA 3CCRV 1EM1A 3I5DA 4OPAA 4H0LB 4E2LA 1K7DA 2JIZG 1I5YA 1AILA 1TA8A 5J2UA 1COWG 4DW1A 3RYHA 2RMKB 2DYRB 4I5SA 2E5LB 3W7UA 1R1BA 1XILA 1JJOA 4TOIA 4NXNO 3AG3C 4X88A 5L3BA 4PJ0Z 3P30A 4DR7B 5FPRA 1RM1C 2GSMB 2CTRA 3EVKA 4O4HA 4F4LA 3F7VC 1BQ0A 5LGNA 1MMMA 3CC2V 5JJEB 2ATKC 4QGPA 2H8PC 2OIGA 2W0XA 3RYFA 4LWSB 5JQGA 1R73A 3ZHTA 4LNUA 4B7KA 1K4CC 1WB8A 1PP9H 3ZMZA 5KA6A 1Z5VA 3AEIA 3LSSA 2UUAO 1O9HA 2LQTA 2NR5A 4OX9O 2CH7A 3A2FA 4FLYA 2Q67A 3CRCA 1L0LH 4JI2O 3CD6V 1M5IA 2JGUA 3OW2U 3JAMN 1IDSA 5IYZA 2L6LA 4FFBB 3LNMB 1KP3A 4TQFA 3H1HH 1S5LZ 4UB8Z 5LHGA 1NH2D 2QKSA 4X20B 1XL4A 3CEIA 2DQ0A 2ZQMA 5TISZ 2P06A 1GN6A 5A9GA 3WB1A 4GUNA 1K34A 3CCEV 4ABMA 3ZJZA 1XHXA 4KHPB 4HNAB 4R8CA 2Q4PA 5EIBD 3JASB 1XNQB 5KAIZ 4DO2A 4B3RO 5JJJB 1Q6IA 2IU3A 1VP7A 5J9PC 1S3JA 2XHBA 2ITCC 3OAAG 1QVFU 3ZMUA 3JYCA 3L75H 3F7YC 1KU9A 1KC8W 3QO7A 3JAKA 3CXHF 3IC9A 2ZE6A 1GTOA 4QE9A 2UXDO 4UCVA 4YJ3A 1SQQH 4JI7B 1SESA 1V55B 2Z3YA 3M99B 2Q9LA 5FNVB 4AQYO 2O57A 3KCYA 4MVMA 4JGSA 4MS2A 4LF7B 3JALA 3SYQA 3ZHUA 2UUCB 3N27A 4WFEA 3K0GA 4K8ZA 1H2MA 2CH7B 4DV7O 1Q86W 2HG5C 2P6JA 1J5EO 4LF4B 2ZIOA 4JAVA 2D3OW 5CA0A 3FYEB 1OHHG 2HLDG 3GWOA 4X65O 2BOCC 3EFFK 3TXSA 5IYZB 4LH6A 4PDVA 2OTJV 3OR6C 2EX3A 2A0LA 1HNWB 1P49A 1WAZA 3E83A 2EBOA 3RN4A 3TK1A 2PGGA 3UT5A 2JGDB 2JK5C 2QDOA 1XBLA 4DV6B 5LOVA 2QJ1A 4LBEC 2WLIA 4U3JA 1NT2B 3JCZA 5LL6Y 5EBMC 2YC0A 1GM8A 3CX5F 2XTAA 3RVZA 1GMGA 2B5UA 5BXZA 1B06A 2A79B 1HNZO 2R70A 3CC7V 3JAKB 3SJQC 4YJ3B 5LYJA 3JD0A 1V55C 1EZVH 5IE9A 3RWRD 2YXYA 1BS3A 2QSAA 4CS2A 1PV0A 2WA3A 3TXQA 1FXVA 3AK2A 2ADQB 4B3TB 1YDXA 1IX9A 1N0JA 2DQ3A 2F1MA 4PHZA 1G8MA 2JEXA 1EN6A 1OZ0A 5CA0B 3MAQA 4KUMA 3SYCA 4I9WA 5IWAB 4O4IA 1M57B 5BR8O 2JVDA 4TUYA 4X66B 2Y69B 1SRYA 2ZE5A 3RW0A 1Y76B 2KSDA 4DV4B 3ZMTA 4PD4F 4LR3A 2PY5A 1XREA 4ZI7A 1NQTA 5EC1C 4DRXA 4CH4A 1VQLV 3A0HZ 1VQ6V 5BMVA 4X1KA 1FXKC 5DEDA 5C93A 3ASOB 1P7BA 2UU9O 5HFMA 2CTQA 1YSCA 3CP1A 2OCCB 1N34B 3ETDA 5LMNB 4CS4A 4JI5B 1XMOB 3K08A 2RCVA 4FM2A 5C8YA 2M6YA 4FM1A 1M9NA 3LSUA 4NTXA 3HKEA 4BAYA 5CBGA 1SERA 1K8AW 4FLUA 4MVQA 4TV9B 3CCMV 4HYOA 1FFXA 1NI8A 4O4LA 1ORQC 3D36C 1I94B 4DV5O 5KHKA 4BIUA 4F6EA 2E76B 2ARHA 3OD4A 4PI2A 2A9HA 4A5UB 5JWPA 2E3CA 2VQFO 2ZM6O 4DR5B 4OXSA 2YIBD 4O4IB 4JI4O 1Z5WA 1M57C 3E89A 3O65A 1KMIZ 4KXRA 5H2FZ 3G6BA 1V9PA 4PA6A 1D5NA 4TUYB 1TUBA 2LW1A 3R65A 3T4ZA 1W0KG 3UKMA 1L0NH 2Y48A 1VMGA 3SYAA 1RSOA 1US6A 1SETA 4GX1A 5F2VO 4NTYA 1AVMA 3B8NA 4JI6B 3T1HO 5BMVB 4BR6A 3VBBA 4X64O 1QLNA 1WPBA 3ASOC 3JD3A 4D7SA 4WCEV 2OCCC 1AJQA 1QLEC 3K06A 3D3QA 5C8YB 4DV3B 1T5EA 4X1IA 3IGAC 3HKEB 5JVDA 2RDCA 1FFXB 5LP6C 4O4LB 4UV8A 2YXLA 1PNLA 2ZR3A 2QWNB 2CE4A 1B04A 3HPLC 3ZIAG 5JJNB 4FLZA 1GM7A 2YIAA 3K5MA 3K9SA 1Q43A 2MW2B 2OCHA 4Q20A 3SDLA 3WB0A 2WLLA 2PZSA 1DF5A 1Y74B 4JI0O 5LBQA 3Q4HA 1M90W 3RT3C 1HP8A 1PM9A 2Q0OC 1FJGO 1XMQB 1RSOB 2Z5UA 1KKCA 3ZMVA 5IJ9A 3HKBB 4JTDB 3SPJA 4EEQA 4CBCA 4UCRA 4GT1A 5JCOA 3MDSA 4B08A 1ZL8B 4H13B 1NU1H 1HNXB 5IY5B 4O2AA 4YJ2B 3OUFA 2IH3C 2GTSA 1PD3A 4DR7O 2QGNA 4X1IB 2XAGA 3STLC 1VQNV 1IBKB 5H6RA 4TSFG 1ZUQA 4QJFB 5EZYB 1Q6UA 5HFLA 4LF6B 1QQCA 4HBNA 2IJJA 4GKJB 5FL7G 1EFRG 4DR6O 1AP6A 4CC5A 2PTMA 4DUZB 2JS3A 1MNGA 5L3FA 2WPDG 3CMEV 4IHJA 3KG2A 2P4VA 3MD0A 2XAJA 2ADPA 3JD1A 4FVMA 2X0LA 1MSDA 1YHQV 3CCQV 2WAMA 3OE7G 5KMGB 4XDJA 1QR9A 4GYCB 4EB6B 1ENVA 3R66A 1N0NA 3RVYA 3CRMA 3F5TA 3M8AA 1AI5A 4DV1B 4X1YA 3J7AU 5B3SB 4KHPO 1W0JG 3ZN1A 1H2SB 4C7UA 3OTOO 4O2BB 2DWDC 1J95A 2CGNA 1GO3F 5CA1A 2UUBB 2Y0IA 2EIJC 3UM7A 3L70H 2BCCH 1Y66A 3AK1A 2FYUH 4JI3B 3THOA 4Z1MG 1K3EA 4YY3O 1K92A 4KP4A 1VQ5V 3FKSG 2N74A 3CRAA 4ASUG 5KX5A 4PELA 4J10A 1FYJA 4LFCB 2YSUB 3H9VA 4AI8A 2CTWA 1I0HA 3L72H 2P4KA 3ABLB 3ETGA 4LF5B 4IHJB 2YEVB 1SQVH 3SYOA 3ZHQA 3STZC 2VQEO 3K5NA 1SA0A 2DWEC 3AG4B 2EINB 3FB5C 1BMFG 4DUYB 3AK3A 1HR0B 1EZJA 5CN0A 3T1YB 1A32A 3LDCA 2HJFC 2NN4A 4H44B 4MVRA 2GDSA 4IIJB 1X59A 3C90A 1TVKB 3K58A 1SC5B 2AXTZ 3FX7A 3OMNB 3D3IA 4I55B 3H1LH 2W0FC 4DV6O 1XI1A 1K5SA 4JAAA 2A3QA 1BHBA 4B3MB 5B3SC 3ZCCA 1Q3EA 3E22A 2VWJA 4DR4B 4LF8O 4J41A 2N05A 2EJRA 4JV5B 3K5LA 3CCJV 1VF5B 3JARB 4RUEA 3CC4V 1N33B 3QG5A 1GK9A 4FLWA 4E4EA 2W6JG 4IYHA 1OJHA 3B40A 4L87A 1FFTB 5LMUB 2Q5ZA 3CXCU 2CUGA 4UCTA 2IW5A 3PJSK 4GLXA 4DYLA 2Q8VA 5KX5B 4DV0O 3AG2B 5J2UB 2N04A 3APOA 2HHHO 2FTKA 3RYHB 4FIPC 1NKDA 2DYRC 5J2TA 4J7JA 3CB2A 3BEHA 5LHIA 3ABLC 2YUAA 4UFZA 1K5QA 2XAQA 5H5NA 3RGBA 2V7QG 1EN4A 4O4HB 3G71V 3UO2A 1R3IC 2EINC 3GVMA 3DGEA 1K73W 3W7TA 4ZHQA 1IBMB 2YS8A 4NR1A 3RYFB 5JQGB 4LNUB 4DV4O 2GHYA 4NYKA 4LFAB 4BW5A 4PDLA 2P67A 3KZIZ 3AG1B 2QWQB 1KYOF 3W7XA 2OT5A 3NR7A 3K5OA 1WLEA 1WNSA 1Y67A 3E22B 2Q0AA 1AI7A 4WFBV 1M1KW 3E86A 3FYIB 2OTLV 2R72A 2XASA 1Z2GA 2ZDIC 1TUEB 5L3CA 2QM7A 1K33A 5AG2A 1DF4A 1VF6A 2AZ2A 2IU0A 1X4TA 1SQFA 5B1AB 2X6BA 1VQ9V 1M4UA 3AG2C 4K0KO 1YI2V 1I94O 1QCEA 4H33A 1NBMG 3K03A 4CH6A 5IYCO 3T4DA 4NXMB 2BTOA 4UV9A 5LGUA 3QTCA 2GBOA 2UUAB 1P7GA 3OR7C 1PKXA 4OX9B 2WLNA 2G38A 1E79G 1G6UA 3RYCA 1YTFB 1YJ9V 2QEXV 5CBHA 2K1EA 4K3AA 3B8MA 2F4VO 3P32A 4IYIA 1MZFA 1M93A 4R6ZA 1NVPB 1KECA 5KHGA 3U0ZA 1XDCA 3JALB 1WP7A 4LFBO 2KKWA 3MHHC 4N21A 2P7TC 1NTMH 2ZD9A 1GN2A 1TAEA
chains in the Genus database with same CATH topology
4DR5O 1R6TA 2E5LO 1YZBA 2VQEO 4DR2O 4JI7O 4OX9O 4DV4O 1F7YA 4JI1O 1IBKO 4JI2O 4JI3O 4JI8O 4LF5O 2JRIA 3JAMN 2UU9O 4DR6O 1KUQA 4LF7O 1NS1A 2UUCO 1A32A 1HNXO 5IWAO 4DR3O 2DJVA 1X59A 2AGAA 4DV3O 5LL6Y 4DUYO 4JI6O 4X66O 4LFCO 4OPHA 4LF4O 4DV6O 1FKAO 1XNRO 5BXZA 2FKXA 3J81N 1HNZO 5FLXN 2DOSA 4DV5O 1IBMO 1HNWO 3R66A 4LF8O 3SDLA 4DR1O 1D2DA 4LFAO 4JI0O 3F5TA 4LF6O 3M8AA 3RT3C 4B3RO 4GKJO 3J7AU 4K0KO 3J80N 1I94O 4KHPO 4DUZO 1HR0O 4JYAO 2LW7A 4DR4O 4OPAA 3T1YO 1AILA 3OTOO 1N34O 4A5UB 5LMNO 2VQFO 1FJGO 4JI5O 2ZKOA 1XMOO 4YHHO 4DV0O 2UXDO 2ZM6O 1AB3A 5A2QN 4JI4O 3O65A 2Z0AA 5BY1A 2HHHO 4X62O 4NXMO 1R1BA 1XEQA 4B3MO 1DK1A 4NXNO 4AQYO 4YY3O 4LF9O 2UXCO 2UUBO 2N74A 2F4VO 1N32O 4JV5O 1XNQO 1G1XB 1IBLO 5BR8O 1N33O 5H5NA 1FYJA 4DV1O 4DV7O 3T1HO 4DR7O 1J5EO 2UXBO 4GKKO 4LFBO 5LMUO 4X64O 4DV2O 4B3SO 4X65O 5IT9N 1XMQO 4B3TO 2UUAO 1N36O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 O;  1R6T A;  2E5L O;  1YZB A;  2VQE O;  4DR2 O;  4JI7 O;  4OX9 O;  4DV4 O;  1F7Y A;  4JI1 O;  1IBK O;  4JI2 O;  4JI3 O;  4JI8 O;  4LF5 O;  2JRI A;  3JAM N;  2UU9 O;  4DR6 O;  1KUQ A;  4LF7 O;  1NS1 A;  2UUC O;  1A32 A;  1HNX O;  5IWA O;  4DR3 O;  2DJV A;  1X59 A;  2AGA A;  4DV3 O;  5LL6 Y;  4DUY O;  4JI6 O;  4X66 O;  4LFC O;  4OPH A;  4LF4 O;  4DV6 O;  1FKA O;  1XNR O;  5BXZ A;  2FKX A;  3J81 N;  1HNZ O;  5FLX N;  2DOS A;  4DV5 O;  1IBM O;  1HNW O;  3R66 A;  4LF8 O;  3SDL A;  4DR1 O;  1D2D A;  4LFA O;  4JI0 O;  3F5T A;  4LF6 O;  3M8A A;  3RT3 C;  4B3R O;  4GKJ O;  3J7A U;  4K0K O;  3J80 N;  1I94 O;  4KHP O;  4DUZ O;  1HR0 O;  4JYA O;  2LW7 A;  4DR4 O;  4OPA A;  3T1Y O;  1AIL A;  3OTO O;  1N34 O;  4A5U B;  5LMN O;  2VQF O;  1FJG O;  4JI5 O;  2ZKO A;  1XMO O;  4YHH O;  4DV0 O;  2UXD O;  2ZM6 O;  1AB3 A;  5A2Q N;  4JI4 O;  3O65 A;  2Z0A A;  5BY1 A;  2HHH O;  4X62 O;  4NXM O;  1R1B A;  1XEQ A;  4B3M O;  1DK1 A;  4NXN O;  4AQY O;  4YY3 O;  4LF9 O;  2UXC O;  2UUB O;  2N74 A;  2F4V O;  1N32 O;  4JV5 O;  1XNQ O;  1G1X B;  1IBL O;  5BR8 O;  1N33 O;  5H5N A;  1FYJ A;  4DV1 O;  4DV7 O;  3T1H O;  4DR7 O;  1J5E O;  2UXB O;  4GKK O;  4LFB O;  5LMU O;  4X64 O;  4DV2 O;  4B3S O;  4X65 O;  5IT9 N;  1XMQ O;  4B3T O;  2UUA O;  1N36 O; 
#chains in the Genus database with same CATH topology
 5GON A;  3QO8 A;  5B1O A;  3W7S A;  2QWO B;  4GX2 A;  5H9C A;  3DXR A;  4B3R B;  2QKC A;  1GH6 A;  4J7K A;  3UT5 B;  1NS1 A;  3F5W C;  2LFR A;  2OWO A;  1SZX A;  3FAV A;  4JYC A;  1NH2 B;  5LGT A;  2AGA A;  5KHJ A;  4DV3 O;  4G27 B;  2HVK C;  3G4S V;  4X89 A;  2VWK A;  5B1A C;  1VQ4 V;  2UXD B;  2IBZ H;  5LOV B;  3DTU B;  3KKY A;  3CJH A;  2WLI B;  1AP5 A;  1XNR O;  4U3J B;  1OCO B;  2F93 B;  4AQY B;  1WJZ A;  2EZO A;  2DOS A;  5JH7 A;  4PV1 B;  1YVW A;  1K9M W;  4UUJ C;  2JJ1 G;  3H1K H;  3C3T A;  2KB1 A;  1MSW D;  3CWB H;  3ZRX A;  5K1X A;  2LO1 A;  1OV9 A;  1CPY A;  1R3J C;  2VS0 A;  3J80 N;  2X7R B;  4JYA O;  4NB5 A;  4TT3 G;  3ZED A;  4PDR A;  2JJ2 G;  3ZX6 A;  4FZ0 A;  2R9R B;  3ABM B;  1IVS A;  4X65 B;  4J42 A;  5LYJ B;  3OM3 B;  1YIT V;  5CB4 A;  2Y4T A;  3HKC A;  4PDM A;  3SJA C;  5A2Q N;  2CAZ C;  2CTP A;  4P9P A;  4YIO A;  4UB6 Z;  5IYB O;  2Q69 A;  3RBZ A;  4O4J A;  4LH7 A;  5KAF Z;  1N32 O;  4MTF A;  2YI8 A;  2BSK A;  5GON B;  2PI4 A;  2AZ0 A;  4CH5 A;  4J11 A;  3OT7 A;  4RO2 A;  4GKK O;  3DXR B;  1LUW A;  3OTF A;  1U96 A;  4JZ2 A;  3ASN B;  4WFF A;  4DV2 O;  2ITD C;  2OIE A;  1F4M A;  2R9I A;  2V4D A;  2Q7E A;  3L9D A;  1HNZ B;  2Y69 C;  1N36 O;  3ZRW A;  1R6T A;  4DR2 O;  3LDE A;  2E74 B;  2WLK A;  3IFX A;  4JI1 O;  1F23 A;  1S76 D;  4ZI7 B;  1IBK O;  1MAB G;  1VAR A;  3PN1 A;  3SR2 C;  4JI8 O;  4DRX B;  4HAM A;  3ZBH A;  2D2C B;  2ZNI A;  1OCO C;  1MG1 A;  4I50 A;  4X1K B;  2ZE8 A;  1DTO A;  4DR3 O;  1I5X A;  3ZHV A;  3SJC C;  1W59 A;  4BWA A;  5KUM A;  3SJB C;  2QR4 A;  1XQ8 A;  2EIL B;  4CS3 A;  1H2K A;  4N23 A;  4KFM A;  5CA3 A;  1V54 B;  2B1G A;  1I08 A;  3UQ8 A;  4GCZ A;  3ABM C;  3BHP A;  4DR1 O;  1AR5 A;  3CCV V;  2F66 C;  1YIJ V;  5BR8 B;  2KQX A;  1JA8 A;  1GN3 A;  4I7Z B;  1KB9 F;  4WBN A;  3JAW A;  1WB7 A;  1PL4 A;  4I4T A;  1H8E G;  4QPK A;  4J7Z A;  3VQV A;  3CS5 A;  4AIL C;  1QU7 A;  4YHH O;  4CZZ A;  2YIC A;  2UXC B;  2HVJ C;  4WFH A;  2BSK B;  2IJI A;  4X62 O;  4MT8 A;  3QVN A;  2BTQ A;  3KCX A;  2UU9 B;  4TV8 A;  4LF9 O;  1NTK H;  2UUB O;  1BT8 A;  3ASN C;  3MHS C;  2YIB A;  4FK5 C;  1TUB B;  1JX9 A;  4CH3 A;  3BA9 A;  2IJK A;  3I56 V;  1H2G A;  4B3S B;  1GN4 A;  3ABK B;  4FPP A;  5BZB A;  1D5A A;  2OYQ A;  5IJ0 A;  2WSS G;  2V1D A;  2AHZ A;  2XT9 A;  1RPO A;  4PA3 A;  2X6A A;  2F23 A;  3U10 A;  4I50 B;  4J9Y B;  4DV5 B;  3E8H A;  2E5L O;  4J80 A;  4DW0 A;  4JAU A;  3CHX A;  4J9Z B;  1H8H G;  4XDL A;  1L1F A;  4LF5 O;  2ZXW B;  3SPH A;  2LJ2 A;  1V54 C;  5IDJ A;  4H37 A;  1YF2 A;  2VQF B;  3B2E E;  3DC6 A;  3E8F A;  4DUY O;  2ZM6 B;  5JVD B;  4JI4 B;  1OCZ B;  4UVB A;  1HW7 A;  3K04 A;  1Y6X A;  1XUQ A;  2GUZ A;  4UCS A;  3JAW B;  1Q81 W;  4DK1 A;  1SZT A;  1W2B U;  1ZLZ A;  1AR4 A;  3BY6 A;  1ZX3 A;  2H94 A;  4MTG A;  1D2D A;  1BGY H;  4UVA A;  1E1Q G;  3E35 A;  2JDI G;  2A7W A;  1P4R A;  3T1H B;  3L74 H;  1SS3 A;  3T2M A;  4FM0 A;  2LW7 A;  2WLL B;  4DR4 O;  4X64 B;  2BTQ B;  1CEZ A;  3Q4H B;  4TV8 B;  5L3E A;  1UPG A;  3AG3 B;  3ABU A;  2JEU A;  4IL6 Z;  2ZIM A;  2Z0A A;  4I9Q A;  1RM1 B;  2QTO A;  3ABK C;  1XHZ A;  3ETE A;  3GWK C;  3IJ4 A;  1NTZ H;  5IJ9 B;  4WFG A;  2UXB B;  2KG7 A;  1R3L C;  3WU2 Z;  5LA6 A;  1XNQ O;  3SPI A;  4LWS A;  3CRR A;  1WP8 A;  4UCU A;  1KBH A;  5EC2 C;  2BE3 A;  4MTO A;  4PA9 A;  4U7N A;  5IY5 C;  3LDD A;  1HDJ A;  3S3W A;  3GB7 C;  4O2A B;  2AW9 A;  1B3Q A;  2ZXW C;  3ML0 A;  5DM6 V;  1JR9 A;  1URF A;  4FFK A;  1YZB A;  2X6C A;  4JI7 O;  1LR1 A;  4FFB A;  5K1P A;  4G28 B;  1JPX A;  4QPJ A;  2ETN A;  4JI0 B;  2HEP A;  1NZ6 A;  1KUQ A;  4LF7 O;  2DW4 A;  4FMT A;  3DSQ A;  1IXB A;  4GZR B;  2UUC O;  4JYB A;  1B6Q A;  3G6E V;  3FFQ A;  4FJC C;  1EN5 A;  3BRC A;  1FJG B;  1VIB A;  3NXS A;  1MOF A;  2WLM A;  4LF4 O;  2C2A A;  2AHY A;  5D5Q A;  4HNA A;  1FPO A;  3SPC A;  2XAH A;  2HFE C;  4LP8 A;  1QBZ A;  2ZT9 B;  1L8D A;  3JAS A;  3K57 A;  5B5E Z;  1KKD A;  5DEC A;  5ITZ A;  4F6R A;  5D5P A;  1HNW O;  1ZWI C;  2EIK B;  3CYO A;  1YTF D;  3CE2 A;  4RWU A;  3BCC H;  1YJW V;  3FB6 C;  1NVP D;  4X1Y B;  3L71 H;  3TET A;  4XBF A;  3OEH G;  5FNV A;  4Z1V A;  1JOY A;  2KG7 B;  1Q5O A;  4P30 A;  4OGQ B;  3JSL A;  5LA6 B;  2DE0 X;  3SPG A;  3UO3 A;  4BIZ A;  3OGI B;  5JCO C;  1WA8 A;  3U11 A;  4EKW A;  4NXM O;  2QM8 A;  1IBL B;  4PA4 A;  4DR6 B;  5CA1 B;  3BAB A;  5GTI Z;  2GV9 A;  2PF4 E;  1S5H C;  1FXH A;  2H3O A;  1YCI A;  1WN7 A;  3VOU A;  1YXB A;  3FB7 C;  3AG7 A;  4MVO A;  3JAT A;  5IT9 N;  4RAI A;  4B3T O;  2JGD A;  1CP9 A;  2GTA A;  4QNH B;  5FPO A;  2Q7H A;  3I55 V;  1LUV A;  3HKD A;  1BL8 A;  1VQ7 V;  1FAF A;  4HZ3 A;  4PI0 A;  4FZ1 A;  5GTH Z;  4CC6 A;  3CMA V;  1FXK A;  1XL6 A;  1SA0 B;  3OTO B;  3ZS8 C;  3AG4 C;  1KD1 W;  5ITZ B;  5IWA O;  2DJV A;  2K9P A;  2ODM A;  2YID A;  4F6R B;  1M56 B;  3ZMS A;  4JYY A;  2EIK C;  4X66 O;  3E2E A;  1RPR A;  3QO5 A;  1JMK C;  3APQ A;  3J81 N;  4YY3 B;  4EFB A;  1FD9 A;  4MVU A;  3LUT B;  2E75 B;  3P3P A;  5KA5 A;  4P2Z A;  3D36 A;  1IXM A;  2WWW A;  1N4C A;  4DXW A;  5E1A C;  3FD9 A;  1WA8 B;  2LFS A;  2A06 H;  2QTS A;  1NJI W;  2HJD A;  1N8R W;  4BW9 A;  4P9O A;  1EBO A;  1N34 O;  1BHA A;  5LMN O;  3EHB B;  3ETQ A;  1UJW B;  4NXN B;  1SQG A;  3OMI B;  4JI5 O;  2ZKO A;  4UCO A;  1XMO O;  2WA4 A;  2VQE B;  3ZN0 A;  5BY1 A;  5LHH A;  2QWR B;  1K4D C;  4XDK A;  3JAT B;  5EBW C;  3OEE G;  3LSQ A;  4D6T H;  1IUR A;  3E8G A;  1BZK A;  1Y4M A;  1Y76 A;  3OGC C;  5J2T B;  4Z2W A;  1BCC H;  4NTW A;  2HKO A;  2ZIN A;  2B9Z A;  5B1B B;  4D7T A;  2L35 A;  3HKD B;  1H38 A;  4NKG B;  1GM9 A;  4ZIB A;  2FB5 A;  4QE7 A;  4JI2 B;  1SQB H;  1FXK B;  1RFY A;  3SYP A;  5CBF A;  5L3D A;  3CSX A;  4JAS A;  1P84 F;  1QHT A;  1SF9 A;  3UCS C;  4DR5 O;  4LF8 B;  2DYS B;  4TQD A;  1M56 C;  3FB8 C;  4ZHQ B;  1ARO P;  1ZTE A;  3ZHS A;  3DC5 A;  5EBL C;  3C3S A;  2JRI A;  3B77 A;  4Q6G A;  3B09 A;  3TGU H;  1JCH A;  5KUK A;  1KP2 A;  3IAY A;  1OCC B;  4MW3 A;  2PYJ A;  2Q68 A;  4MVZ A;  4GX0 A;  3AG1 C;  4UVC A;  1F51 A;  1Q82 W;  4DV0 B;  4JI6 O;  4TV9 A;  5LP6 A;  2P5O A;  2QA4 V;  2HHH B;  1FKA O;  4IGG A;  3IC7 A;  1VQM V;  3CCL V;  3M7M X;  2FKX A;  3RYI A;  1SKV A;  2EJ7 A;  2FML A;  3TJT A;  2LP7 A;  2P22 C;  3H1I H;  4L8J A;  1I7F A;  1JFF A;  4I0X A;  3CPW U;  2IH1 C;  3OFN G;  3H01 A;  1VQO V;  3WB2 A;  2Y4U A;  5CMU A;  3D8C A;  3N2G A;  2HR3 A;  3N2K A;  4AHC A;  3K59 A;  1WPX A;  4NVP A;  4DK0 A;  2WLJ A;  2YI9 A;  2YDE A;  1AI4 A;  2PYL A;  1YJN V;  1H2N A;  1LNQ A;  3T1C A;  4YIP A;  2MK3 A;  5B1B C;  2Q6A A;  1U97 A;  2XAF A;  4DV7 B;  1ZAU A;  2ZNJ A;  2UXC O;  1J5E B;  2WLH A;  1AI6 A;  4B7E A;  1AR1 B;  1VEW A;  4RQE A;  3RYC B;  1MA1 A;  3ZRV A;  4ZKI A;  4JF3 A;  1G1X B;  3JSN A;  1VF7 A;  1S0V A;  2DYS C;  4W4K A;  4RQF A;  1NR7 A;  1VQ8 V;  2RQ6 A;  1QLE B;  4MTX A;  4B3S O;  1QR8 A;  4G2K A;  4JPR A;  1XMQ O;  2CGO A;  1OCC C;  1AJP A;  3BA8 A;  3QNE A;  4R7C A;  1F7Y A;  4EFE A;  1Q7Y W;  2M7W A;  3K9A A;  5LP6 B;  1IZ3 A;  3E8B A;  4K0K B;  4W4L A;  3K79 A;  4FLX A;  1E1R G;  4U7O A;  3JCU Z;  1UFI A;  3RYI B;  1HNX O;  1GRJ A;  1H2L A;  3P3N A;  4JTA B;  1XOU A;  1VQP V;  5KLV H;  2DMX A;  4X9Q A;  1ZSP A;  1JFF B;  1VF6 C;  3FAV B;  4I0X B;  4WFA V;  4KL1 A;  1BE3 H;  1K97 A;  1OCR B;  3BPZ A;  3N2G B;  1Y74 A;  3N2K B;  5FLX N;  2XND G;  4MVS A;  3CJH B;  2VRZ A;  2F4V B;  2BOB C;  4ZOL A;  4LF6 O;  1ROP A;  4GKJ O;  5JH7 B;  1TGO A;  2UXX A;  3LNN A;  3BAA A;  4TWK A;  3ZRS A;  4DUZ O;  3HR0 A;  5EK0 A;  5EIB C;  4ZBM A;  4LFB B;  2JS5 A;  3JD4 A;  3S3X A;  2HP8 A;  2PUS A;  3HKB A;  3L73 H;  1YEW A;  5DN6 G;  1F4N A;  1AB3 A;  3CRQ A;  3VQX A;  1RP3 B;  1ZL8 A;  1PPJ H;  1DLB A;  2XOK G;  5CB4 B;  1XEQ A;  4LC1 A;  3HKC B;  5E79 Z;  1DK1 A;  4YJ2 A;  3QF7 A;  3BFR A;  3X2Q B;  1THZ A;  2PI5 A;  1GAX A;  4X8A A;  1S72 V;  1PL0 A;  4FLV A;  1R6K A;  1Q6H A;  2QM4 A;  2NNU A;  5EYP A;  3W7W A;  4DV1 O;  4O4J B;  4U3F H;  1R3K C;  5KHI A;  2UXB O;  2EZP A;  3H1J H;  1XNR B;  2ZR2 A;  5EZY A;  4UXN A;  1JVM A;  1PNM A;  3ZHR A;  2R9A A;  3EXA A;  2P90 A;  2F95 B;  2LGW A;  2W6I G;  3RFR A;  3K3W A;  2ZE7 A;  4JI3 O;  2EIM B;  2IJH A;  2QKA A;  3ZRW B;  1BSM A;  4MSW C;  4JYA B;  3ABT A;  1OCR C;  4JTC B;  1QVG U;  2Y0P A;  1G4Y B;  1NR1 A;  3WG7 B;  4GX5 A;  5KMG A;  4LFC O;  4ZOL B;  4EB6 A;  2CK3 G;  2RN9 A;  2EIL C;  4BIO A;  2IM9 A;  3HB3 B;  5LXT A;  1N32 B;  2ILM A;  4O2B A;  4IT5 A;  4ICG A;  4YXW G;  5GW7 A;  1QNM A;  1JQ0 A;  1SQX H;  1HR0 O;  5KHH A;  4GKK B;  3G67 A;  2LGQ A;  3T1Y O;  4DV2 B;  2EIJ B;  1FS0 G;  2XUM A;  1JJ2 U;  4K35 A;  1S5J A;  3X2Q C;  4WBN B;  2CDY A;  1N36 B;  3WFV A;  4FLT A;  4I4T B;  1R6N A;  4RUF A;  4DR2 B;  5EYP B;  4JI1 B;  1S77 D;  2NLJ C;  4B3M O;  1VQK V;  5B1N A;  5B66 Z;  4JI8 B;  3VQW A;  3B4S A;  2Q73 A;  5IYD O;  3OMA B;  4PA7 A;  4DR3 B;  4JV5 O;  1IBL O;  2B1I A;  3ICX A;  1N33 O;  1AJN A;  1Q90 D;  2QE7 G;  1HWY A;  2ZCE A;  2YEV A;  5LMU O;  3A0B Z;  2EIM C;  3A0R A;  2Q7G A;  2UXN A;  5IJ0 B;  4R50 A;  5H6Q A;  3VQY A;  2RNB A;  1Q8I A;  4JZG A;  2RJZ A;  4DR1 B;  3WG7 C;  2YXH A;  4IIJ A;  1TVK A;  3G80 A;  3CCS V;  1GKF A;  1MZE A;  4I55 A;  1BQZ A;  2QWP B;  3JD2 A;  2DN9 A;  4WF9 V;  5LXT B;  4YHH B;  3TCU A;  4OPH A;  3BVO A;  4X62 B;  4QIW F;  1CXZ B;  3A8T A;  4LCU C;  2FL4 A;  2EUL A;  5L3G A;  2ZDI A;  1DGS A;  3JAR A;  4LF9 B;  1PNK A;  1IBM O;  1OCZ C;  1SQP H;  3OUS A;  4MW8 A;  3O9O A;  3K0D A;  4X20 A;  1O9G A;  1KQS U;  2GUZ B;  3SGI A;  4LFA O;  2F43 G;  3CCU V;  4K8X A;  3CCR V;  1EM1 A;  3I5D A;  4OPA A;  4H0L B;  4E2L A;  1K7D A;  2JIZ G;  1I5Y A;  1AIL A;  1TA8 A;  5J2U A;  1COW G;  4DW1 A;  3RYH A;  2RMK B;  2DYR B;  4I5S A;  2E5L B;  3W7U A;  1R1B A;  1XIL A;  1JJO A;  4TOI A;  4NXN O;  3AG3 C;  4X88 A;  5L3B A;  4PJ0 Z;  3P30 A;  4DR7 B;  5FPR A;  1RM1 C;  2GSM B;  2CTR A;  3EVK A;  4O4H A;  4F4L A;  3F7V C;  1BQ0 A;  5LGN A;  1MMM A;  3CC2 V;  5JJE B;  2ATK C;  4QGP A;  2H8P C;  2OIG A;  2W0X A;  3RYF A;  4LWS B;  5JQG A;  1R73 A;  3ZHT A;  4LNU A;  4B7K A;  1K4C C;  1WB8 A;  1PP9 H;  3ZMZ A;  5KA6 A;  1Z5V A;  3AEI A;  3LSS A;  2UUA O;  1O9H A;  2LQT A;  2NR5 A;  4OX9 O;  2CH7 A;  3A2F A;  4FLY A;  2Q67 A;  3CRC A;  1L0L H;  4JI2 O;  3CD6 V;  1M5I A;  2JGU A;  3OW2 U;  3JAM N;  1IDS A;  5IYZ A;  2L6L A;  4FFB B;  3LNM B;  1KP3 A;  4TQF A;  3H1H H;  1S5L Z;  4UB8 Z;  5LHG A;  1NH2 D;  2QKS A;  4X20 B;  1XL4 A;  3CEI A;  2DQ0 A;  2ZQM A;  5TIS Z;  2P06 A;  1GN6 A;  5A9G A;  3WB1 A;  4GUN A;  1K34 A;  3CCE V;  4ABM A;  3ZJZ A;  1XHX A;  4KHP B;  4HNA B;  4R8C A;  2Q4P A;  5EIB D;  3JAS B;  1XNQ B;  5KAI Z;  4DO2 A;  4B3R O;  5JJJ B;  1Q6I A;  2IU3 A;  1VP7 A;  5J9P C;  1S3J A;  2XHB A;  2ITC C;  3OAA G;  1QVF U;  3ZMU A;  3JYC A;  3L75 H;  3F7Y C;  1KU9 A;  1KC8 W;  3QO7 A;  3JAK A;  3CXH F;  3IC9 A;  2ZE6 A;  1GTO A;  4QE9 A;  2UXD O;  4UCV A;  4YJ3 A;  1SQQ H;  4JI7 B;  1SES A;  1V55 B;  2Z3Y A;  3M99 B;  2Q9L A;  5FNV B;  4AQY O;  2O57 A;  3KCY A;  4MVM A;  4JGS A;  4MS2 A;  4LF7 B;  3JAL A;  3SYQ A;  3ZHU A;  2UUC B;  3N27 A;  4WFE A;  3K0G A;  4K8Z A;  1H2M A;  2CH7 B;  4DV7 O;  1Q86 W;  2HG5 C;  2P6J A;  1J5E O;  4LF4 B;  2ZIO A;  4JAV A;  2D3O W;  5CA0 A;  3FYE B;  1OHH G;  2HLD G;  3GWO A;  4X65 O;  2BOC C;  3EFF K;  3TXS A;  5IYZ B;  4LH6 A;  4PDV A;  2OTJ V;  3OR6 C;  2EX3 A;  2A0L A;  1HNW B;  1P49 A;  1WAZ A;  3E83 A;  2EBO A;  3RN4 A;  3TK1 A;  2PGG A;  3UT5 A;  2JGD B;  2JK5 C;  2QDO A;  1XBL A;  4DV6 B;  5LOV A;  2QJ1 A;  4LBE C;  2WLI A;  4U3J A;  1NT2 B;  3JCZ A;  5LL6 Y;  5EBM C;  2YC0 A;  1GM8 A;  3CX5 F;  2XTA A;  3RVZ A;  1GMG A;  2B5U A;  5BXZ A;  1B06 A;  2A79 B;  1HNZ O;  2R70 A;  3CC7 V;  3JAK B;  3SJQ C;  4YJ3 B;  5LYJ A;  3JD0 A;  1V55 C;  1EZV H;  5IE9 A;  3RWR D;  2YXY A;  1BS3 A;  2QSA A;  4CS2 A;  1PV0 A;  2WA3 A;  3TXQ A;  1FXV A;  3AK2 A;  2ADQ B;  4B3T B;  1YDX A;  1IX9 A;  1N0J A;  2DQ3 A;  2F1M A;  4PHZ A;  1G8M A;  2JEX A;  1EN6 A;  1OZ0 A;  5CA0 B;  3MAQ A;  4KUM A;  3SYC A;  4I9W A;  5IWA B;  4O4I A;  1M57 B;  5BR8 O;  2JVD A;  4TUY A;  4X66 B;  2Y69 B;  1SRY A;  2ZE5 A;  3RW0 A;  1Y76 B;  2KSD A;  4DV4 B;  3ZMT A;  4PD4 F;  4LR3 A;  2PY5 A;  1XRE A;  4ZI7 A;  1NQT A;  5EC1 C;  4DRX A;  4CH4 A;  1VQL V;  3A0H Z;  1VQ6 V;  5BMV A;  4X1K A;  1FXK C;  5DED A;  5C93 A;  3ASO B;  1P7B A;  2UU9 O;  5HFM A;  2CTQ A;  1YSC A;  3CP1 A;  2OCC B;  1N34 B;  3ETD A;  5LMN B;  4CS4 A;  4JI5 B;  1XMO B;  3K08 A;  2RCV A;  4FM2 A;  5C8Y A;  2M6Y A;  4FM1 A;  1M9N A;  3LSU A;  4NTX A;  3HKE A;  4BAY A;  5CBG A;  1SER A;  1K8A W;  4FLU A;  4MVQ A;  4TV9 B;  3CCM V;  4HYO A;  1FFX A;  1NI8 A;  4O4L A;  1ORQ C;  3D36 C;  1I94 B;  4DV5 O;  5KHK A;  4BIU A;  4F6E A;  2E76 B;  2ARH A;  3OD4 A;  4PI2 A;  2A9H A;  4A5U B;  5JWP A;  2E3C A;  2VQF O;  2ZM6 O;  4DR5 B;  4OXS A;  2YIB D;  4O4I B;  4JI4 O;  1Z5W A;  1M57 C;  3E89 A;  3O65 A;  1KMI Z;  4KXR A;  5H2F Z;  3G6B A;  1V9P A;  4PA6 A;  1D5N A;  4TUY B;  1TUB A;  2LW1 A;  3R65 A;  3T4Z A;  1W0K G;  3UKM A;  1L0N H;  2Y48 A;  1VMG A;  3SYA A;  1RSO A;  1US6 A;  1SET A;  4GX1 A;  5F2V O;  4NTY A;  1AVM A;  3B8N A;  4JI6 B;  3T1H O;  5BMV B;  4BR6 A;  3VBB A;  4X64 O;  1QLN A;  1WPB A;  3ASO C;  3JD3 A;  4D7S A;  4WCE V;  2OCC C;  1AJQ A;  1QLE C;  3K06 A;  3D3Q A;  5C8Y B;  4DV3 B;  1T5E A;  4X1I A;  3IGA C;  3HKE B;  5JVD A;  2RDC A;  1FFX B;  5LP6 C;  4O4L B;  4UV8 A;  2YXL A;  1PNL A;  2ZR3 A;  2QWN B;  2CE4 A;  1B04 A;  3HPL C;  3ZIA G;  5JJN B;  4FLZ A;  1GM7 A;  2YIA A;  3K5M A;  3K9S A;  1Q43 A;  2MW2 B;  2OCH A;  4Q20 A;  3SDL A;  3WB0 A;  2WLL A;  2PZS A;  1DF5 A;  1Y74 B;  4JI0 O;  5LBQ A;  3Q4H A;  1M90 W;  3RT3 C;  1HP8 A;  1PM9 A;  2Q0O C;  1FJG O;  1XMQ B;  1RSO B;  2Z5U A;  1KKC A;  3ZMV A;  5IJ9 A;  3HKB B;  4JTD B;  3SPJ A;  4EEQ A;  4CBC A;  4UCR A;  4GT1 A;  5JCO A;  3MDS A;  4B08 A;  1ZL8 B;  4H13 B;  1NU1 H;  1HNX B;  5IY5 B;  4O2A A;  4YJ2 B;  3OUF A;  2IH3 C;  2GTS A;  1PD3 A;  4DR7 O;  2QGN A;  4X1I B;  2XAG A;  3STL C;  1VQN V;  1IBK B;  5H6R A;  4TSF G;  1ZUQ A;  4QJF B;  5EZY B;  1Q6U A;  5HFL A;  4LF6 B;  1QQC A;  4HBN A;  2IJJ A;  4GKJ B;  5FL7 G;  1EFR G;  4DR6 O;  1AP6 A;  4CC5 A;  2PTM A;  4DUZ B;  2JS3 A;  1MNG A;  5L3F A;  2WPD G;  3CME V;  4IHJ A;  3KG2 A;  2P4V A;  3MD0 A;  2XAJ A;  2ADP A;  3JD1 A;  4FVM A;  2X0L A;  1MSD A;  1YHQ V;  3CCQ V;  2WAM A;  3OE7 G;  5KMG B;  4XDJ A;  1QR9 A;  4GYC B;  4EB6 B;  1ENV A;  3R66 A;  1N0N A;  3RVY A;  3CRM A;  3F5T A;  3M8A A;  1AI5 A;  4DV1 B;  4X1Y A;  3J7A U;  5B3S B;  4KHP O;  1W0J G;  3ZN1 A;  1H2S B;  4C7U A;  3OTO O;  4O2B B;  2DWD C;  1J95 A;  2CGN A;  1GO3 F;  5CA1 A;  2UUB B;  2Y0I A;  2EIJ C;  3UM7 A;  3L70 H;  2BCC H;  1Y66 A;  3AK1 A;  2FYU H;  4JI3 B;  3THO A;  4Z1M G;  1K3E A;  4YY3 O;  1K92 A;  4KP4 A;  1VQ5 V;  3FKS G;  2N74 A;  3CRA A;  4ASU G;  5KX5 A;  4PEL A;  4J10 A;  1FYJ A;  4LFC B;  2YSU B;  3H9V A;  4AI8 A;  2CTW A;  1I0H A;  3L72 H;  2P4K A;  3ABL B;  3ETG A;  4LF5 B;  4IHJ B;  2YEV B;  1SQV H;  3SYO A;  3ZHQ A;  3STZ C;  2VQE O;  3K5N A;  1SA0 A;  2DWE C;  3AG4 B;  2EIN B;  3FB5 C;  1BMF G;  4DUY B;  3AK3 A;  1HR0 B;  1EZJ A;  5CN0 A;  3T1Y B;  1A32 A;  3LDC A;  2HJF C;  2NN4 A;  4H44 B;  4MVR A;  2GDS A;  4IIJ B;  1X59 A;  3C90 A;  1TVK B;  3K58 A;  1SC5 B;  2AXT Z;  3FX7 A;  3OMN B;  3D3I A;  4I55 B;  3H1L H;  2W0F C;  4DV6 O;  1XI1 A;  1K5S A;  4JAA A;  2A3Q A;  1BHB A;  4B3M B;  5B3S C;  3ZCC A;  1Q3E A;  3E22 A;  2VWJ A;  4DR4 B;  4LF8 O;  4J41 A;  2N05 A;  2EJR A;  4JV5 B;  3K5L A;  3CCJ V;  1VF5 B;  3JAR B;  4RUE A;  3CC4 V;  1N33 B;  3QG5 A;  1GK9 A;  4FLW A;  4E4E A;  2W6J G;  4IYH A;  1OJH A;  3B40 A;  4L87 A;  1FFT B;  5LMU B;  2Q5Z A;  3CXC U;  2CUG A;  4UCT A;  2IW5 A;  3PJS K;  4GLX A;  4DYL A;  2Q8V A;  5KX5 B;  4DV0 O;  3AG2 B;  5J2U B;  2N04 A;  3APO A;  2HHH O;  2FTK A;  3RYH B;  4FIP C;  1NKD A;  2DYR C;  5J2T A;  4J7J A;  3CB2 A;  3BEH A;  5LHI A;  3ABL C;  2YUA A;  4UFZ A;  1K5Q A;  2XAQ A;  5H5N A;  3RGB A;  2V7Q G;  1EN4 A;  4O4H B;  3G71 V;  3UO2 A;  1R3I C;  2EIN C;  3GVM A;  3DGE A;  1K73 W;  3W7T A;  4ZHQ A;  1IBM B;  2YS8 A;  4NR1 A;  3RYF B;  5JQG B;  4LNU B;  4DV4 O;  2GHY A;  4NYK A;  4LFA B;  4BW5 A;  4PDL A;  2P67 A;  3KZI Z;  3AG1 B;  2QWQ B;  1KYO F;  3W7X A;  2OT5 A;  3NR7 A;  3K5O A;  1WLE A;  1WNS A;  1Y67 A;  3E22 B;  2Q0A A;  1AI7 A;  4WFB V;  1M1K W;  3E86 A;  3FYI B;  2OTL V;  2R72 A;  2XAS A;  1Z2G A;  2ZDI C;  1TUE B;  5L3C A;  2QM7 A;  1K33 A;  5AG2 A;  1DF4 A;  1VF6 A;  2AZ2 A;  2IU0 A;  1X4T A;  1SQF A;  5B1A B;  2X6B A;  1VQ9 V;  1M4U A;  3AG2 C;  4K0K O;  1YI2 V;  1I94 O;  1QCE A;  4H33 A;  1NBM G;  3K03 A;  4CH6 A;  5IYC O;  3T4D A;  4NXM B;  2BTO A;  4UV9 A;  5LGU A;  3QTC A;  2GBO A;  2UUA B;  1P7G A;  3OR7 C;  1PKX A;  4OX9 B;  2WLN A;  2G38 A;  1E79 G;  1G6U A;  3RYC A;  1YTF B;  1YJ9 V;  2QEX V;  5CBH A;  2K1E A;  4K3A A;  3B8M A;  2F4V O;  3P32 A;  4IYI A;  1MZF A;  1M93 A;  4R6Z A;  1NVP B;  1KEC A;  5KHG A;  3U0Z A;  1XDC A;  3JAL B;  1WP7 A;  4LFB O;  2KKW A;  3MHH C;  4N21 A;  2P7T C;  1NTM H;  2ZD9 A;  1GN2 A;  1TAE A; 
#chains in the Genus database with same CATH homology
 4DR5 O;  1R6T A;  2E5L O;  1YZB A;  2VQE O;  4DR2 O;  4JI7 O;  4OX9 O;  4DV4 O;  1F7Y A;  4JI1 O;  1IBK O;  4JI2 O;  4JI3 O;  4JI8 O;  4LF5 O;  2JRI A;  3JAM N;  2UU9 O;  4DR6 O;  1KUQ A;  4LF7 O;  1NS1 A;  2UUC O;  1A32 A;  1HNX O;  5IWA O;  4DR3 O;  2DJV A;  1X59 A;  2AGA A;  4DV3 O;  5LL6 Y;  4DUY O;  4JI6 O;  4X66 O;  4LFC O;  4OPH A;  4LF4 O;  4DV6 O;  1FKA O;  1XNR O;  5BXZ A;  2FKX A;  3J81 N;  1HNZ O;  5FLX N;  2DOS A;  4DV5 O;  1IBM O;  1HNW O;  3R66 A;  4LF8 O;  3SDL A;  4DR1 O;  1D2D A;  4LFA O;  4JI0 O;  3F5T A;  4LF6 O;  3M8A A;  3RT3 C;  4B3R O;  4GKJ O;  3J7A U;  4K0K O;  3J80 N;  1I94 O;  4KHP O;  4DUZ O;  1HR0 O;  4JYA O;  2LW7 A;  4DR4 O;  4OPA A;  3T1Y O;  1AIL A;  3OTO O;  1N34 O;  4A5U B;  5LMN O;  2VQF O;  1FJG O;  4JI5 O;  2ZKO A;  1XMO O;  4YHH O;  4DV0 O;  2UXD O;  2ZM6 O;  1AB3 A;  5A2Q N;  4JI4 O;  3O65 A;  2Z0A A;  5BY1 A;  2HHH O;  4X62 O;  4NXM O;  1R1B A;  1XEQ A;  4B3M O;  1DK1 A;  4NXN O;  4AQY O;  4YY3 O;  4LF9 O;  2UXC O;  2UUB O;  2N74 A;  2F4V O;  1N32 O;  4JV5 O;  1XNQ O;  1G1X B;  1IBL O;  5BR8 O;  1N33 O;  5H5N A;  1FYJ A;  4DV1 O;  4DV7 O;  3T1H O;  4DR7 O;  1J5E O;  2UXB O;  4GKK O;  4LFB O;  5LMU O;  4X64 O;  4DV2 O;  4B3S O;  4X65 O;  5IT9 N;  1XMQ O;  4B3T O;  2UUA O;  1N36 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...