4DR6O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr6O00
3M8AA 3J80N 1F7YA 2Z0AA 3OTOO 1J5EO 3T1HO 2VQEO 2UXDO 1KUQA 4DV6O 3J81N 2LW7A 1D2DA 1R6TA 4JI4O 1AB3A 4LF7O 4JV5O 4X66O 1N33O 3RT3C 1A32A 2E5LO 2N74A 1IBKO 5FLXN 4LFBO 5LMUO 2F4VO 1XNRO 1NS1A 3T1YO 1DK1A 2UUBO 4LFAO 5IT9N 4DV5O 2UUAO 2VQFO 2JRIA 4LFCO 5H5NA 5BXZA 4DR5O 4X62O 4DV1O 1HNZO 4JI1O 4K0KO 2DOSA 4DV7O 4DV2O 2AGAA 3O65A 4A5UB 1FKAO 3J7AU 1IBLO 2UXBO 1IBMO 2HHHO 3R66A 4JI3O 1FYJA 1HR0O 4KHPO 4B3SO 1N32O 5IWAO 4YHHO 4JYAO 5LMNO 4DV0O 1XEQA 4DV3O 4LF5O 4JI8O 4B3TO 4NXMO 1YZBA 3JAMN 4B3MO 4OPHA 4DV4O 2UXCO 4DUYO 1AILA 4JI0O 4X64O 1X59A 1XMQO 4OPAA 4OX9O 5BY1A 1XMOO 4JI2O 1FJGO 4DR2O 4DR6O 1R1BA 2UU9O 4DR7O 4B3RO 4LF4O 4YY3O 4LF9O 1G1XB 5BR8O 1N36O 4JI5O 3F5TA 2FKXA 5LL6Y 4JI7O 2DJVA 4LF8O 4GKKO 4X65O 2ZKOA 1N34O 4DR4O 2UUCO 3SDLA 4LF6O 1XNQO 4AQYO 4DR1O 4GKJO 4DR3O 4JI6O 2ZM6O 1I94O 5A2QN 1HNXO 1HNWO 4NXNO 4DUZO
chains in the Genus database with same CATH superfamily
2PUSA 2OCCC 3GWKC 1V55B 3N2KB 5EBWC 4X20A 4X66B 3OD4A 4X89A 1S5LZ 2KSDA 2E5LB 2UUCB 2XTAA 3SJCC 1XNQB 1NJIW 2XAHA 2Q68A 5BMVB 2Q73A 2IBZH 1JR9A 2G38A 3SPHA 3OTOB 2R9AA 5B1AB 3UO2A 5JCOA 4FLZA 2JRIA 3MAQA 4X62B 1CP9A 4MTOA 1JFFB 1GM9A 4DV1O 2QEXV 4PDMA 3JALA 2QM4A 4X1IB 1NTZH 4PA9A 5B1NA 3CB2A 2V7QG 4DV2O 4TV8A 4CH5A 3ASNB 1NH2B 2P6JA 5J2TB 3FYIB 2ATKC 4JI3O 4CC5A 5CA0A 1KP2A 4DV0O 2IH1C 5IDJA 2DE0X 1M5IA 4EFEA 4DUYO 2FMLA 3TXQA 1GKFA 3OUSA 1GN6A 3L9DA 4JI2O 1FJGO 4P2ZA 2JEUA 1THZA 1YCIA 4B3RO 4KHPB 1KC8W 1E1RG 2PYJA 1JOYA 1YF2A 1H2MA 4O4LB 2XUMA 1Q3EA 3JATA 4NXMB 4AHCA 5AG2A 2YIDA 2UUCO 1PL4A 4P9PA 3ZS8C 1XNQO 3JARA 2FTKA 3RN4A 3CJHA 3OMIB 5KUKA 4O4IA 3OTOO 4XBFA 5KA6A 2VQEO 5IYDO 3CCQV 4TSFG 1QR8A 5BZBA 3H9VA 3JAKA 2M7WA 4NTYA 2KKWA 1K4DC 5EK0A 4RQEA 2HVJC 5EIBC 1VQMV 2F4VO 3QO8A 3Q4HB 3LDCA 4R8CA 5KMGB 2BTQA 2Q6AA 2JJ1G 1RSOA 4DR5O 3E35A 1MA1A 4UXNA 5JWPA 1YI2V 5LOVB 3X2QC 1JQ0A 1MSDA 3O65A 2OYQA 2CAZC 3PN1A 5LHHA 2W0FC 1K73W 4L87A 4KHPO 1DF4A 1OCOC 2ZQMA 1X4TA 2X6CA 3ZHTA 1SERA 3CRQA 3QNEA 4CH4A 1LUWA 1WP7A 3OM3B 3AEIA 4NXMO 1US6A 5KUMA 2VWJA 2UXCO 2V1DA 3BAAA 3ABUA 2IJHA 1ZUQA 2JJ2G 2WWWA 3OMAB 2YXYA 5BY1A 3OR7C 2YI9A 1BQZA 3K03A 2HHHB 3FYEB 4LF9O 3ZHRA 1YHQV 2EIJB 4YXWG 5LXTA 1Q82W 2DYSB 5TISZ 1G6UA 5KX5A 2ITCC 1KMIZ 1SRYA 1MZEA 3SDLA 1NR1A 2W0XA 5EBLC 3SPCA 4ZOLB 4RQFA 3UCSC 3ABKB 1SA0B 3M8AA 3IGAC 2NR5A 2ZXWB 4QE7A 1VF5B 1DF5A 3RW0A 3CMAV 3CC7V 4GKKB 4B08A 2ZDIA 4GLXA 1VQ7V 3FFQA 2BTOA 1WA8A 5LYJB 1ZX3A 5CBFA 2KG7B 3K5OA 2N05A 2ZM6B 2JGUA 4UCTA 5JH7B 2XAQA 4EB6A 2WLJA 3HB3B 1QLNA 4IL6Z 1AP5A 5IE9A 2UXDB 3G6EV 2JGDB 3RYCA 2F95B 2VQFO 1CPYA 4LF7B 5JVDB 3GB7C 2IU3A 2WSSG 3SYCA 3QO7A 5K1XA 1VQNV 1SZXA 1Q90D 4OXSA 1IBKB 1E1QG 5EIBD 1S76D 2IJKA 3B8MA 4HBNA 5C93A 3F5WC 2Q7GA 4HNAB 2HHHO 1J95A 4LWSB 4JAUA 1UPGA 2IM9A 4H37A 3A0BZ 1NTKH 4TUYA 5J2UB 3DC5A 3HKEB 3IC9A 3EVKA 4X1KA 1IX9A 4PD4F 3RYHB 1LUVA 4GX0A 3TXSA 4BIUA 5KHHA 4DO2A 2EINC 3K0DA 2VRZA 3OW2U 3ZCCA 4I50A 1R1BA 3IFXA 2R72A 1CEZA 4YY3O 2P06A 1P7BA 3H1KH 1UFIA 4Z1MG 3ZRWA 3F5TA 2EULA 3ASOC 3JYCA 1Y74B 4GKKO 1MNGA 1M4UA 2DMXA 4X65O 4B3MB 3CHXA 4JI0B 3ZMTA 3E89A 3CCUV 1SQPH 2PZSA 2ZM6O 1HNXO 4YIPA 2IJJA 4CS3A 3SYAA 3E22A 4PA4A 4DV6B 2AZ0A 5IYZB 2UXDO 2CK3G 2OTLV 4QPJA 3OUFA 4LF7O 2D2CB 1QNMA 2CTRA 1SQVH 1H8HG 2F43G 1OCCC 1IBKO 3N2GB 2WAMA 4KL1A 2BE3A 4FM0A 1TGOA 5J9PC 2X0LA 1MZFA 5FL7G 2ZDIC 1KU9A 4EEQA 1I08A 2UUBO 1AI5A 5C8YA 3QG5A 2EIKB 3JD2A 2DYRC 1B06A 4I4TB 4UCVA 2HKOA 1GM7A 3AG4C 1VQ6V 2YEVA 2Y69B 2NLJC 3CCRV 4MW8A 3H01A 1SQFA 2OTJV 2PI5A 3VQYA 5E1AC 1EN5A 4FJCC 4DV5B 3K0GA 4YHHO 5FPRA 2WLKA 3F7YC 1B04A 1AI6A 1ZWIC 3CMEV 4LF5B 4YJ3A 1VP7A 3P30A 1NT2B 5GONB 1SQGA 4B3MO 4FLUA 4JI0O 3RYIA 4ZHQA 1Q5OA 2ZT9B 4HZ3A 3ML0A 4ZI7B 1N32B 2IU0A 2R9RB 3E83A 3WFVA 1VQPV 1Y76B 4JI7B 1PNKA 5LMNB 3LDDA 3RVYA 4I55B 3QF7A 2PTMA 3AG1C 2XAFA 1WLEA 2CTWA 2LFRA 3P32A 5H2FZ 4DR2B 5A2QN 3DXRB 3FB5C 3ZHQA 2PGGA 1OCZC 3T1HB 3TK1A 3H1LH 1N0JA 1N36B 1S77D 1QLEC 3ZHSA 1MSWD 5CA1A 3AG3C 4K35A 1RPOA 3CCVV 4O4JA 5L3EA 3CS5A 2PF4E 2YXLA 1XDCA 4NTXA 2A06H 4W4KA 3SR2C 2EIMB 4WBNB 1S5HC 1DK1A 1H2GA 4LFAO 3BA8A 2ZNJA 1RM1C 4DV5O 2ILMA 4H0LB 1H2SB 1I5YA 1SESA 4J7KA 3OEHG 5H5NA 2ZCEA 3VOUA 3H1JH 4JI1B 3CC2V 1YTFD 4GZRB 4TT3G 4DV7B 3ZIAG 5JJJB 4TV9A 4F4LA 4RWUA 5KAIZ 3T1YB 1BT8A 1OCRC 3SYOA 4AI8A 1JMKC 1N32O 1K8AW 3DC6A 1ZLZA 3S3XA 1MABG 3OTFA 5LMNO 5ITZB 3AG2B 3JCUZ 3OEEG 5GTHZ 3BPZA 4PI0A 4U7OA 5LHIA 3OGIB 1I5XA 5IJ9A 4DRXA 1AILA 2Q0AA 3D3IA 4O4HB 2QKCA 4OX9O 3EFFK 3JD4A 1TVKB 1XMOO 2UXBB 4YIOA 4DR2O 2CH7B 3CP1A 4MVRA 3APOA 2A79B 1N36O 2JDIG 3G71V 3G4SV 2LQTA 4MVMA 4ZOLA 4LC1A 2Q7EA 2ZKOA 1ZTEA 2HEPA 1EN6A 1GO3F 4JF3A 2ODMA 3OFNG 2HLDG 2QSAA 3VQWA 2Z0AA 4LH7A 3JASA 4GT1A 3OR6C 5LGUA 1FPOA 3CPWU 2LW7A 3OE7G 5LBQA 1Y67A 3ZN1A 1EM1A 1GAXA 1FXHA 4UCUA 4J7ZA 4HAMA 2RQ6A 2JGDA 3T1YO 2ZR3A 2KB1A 2ZR2A 3CXCU 1AJNA 4J42A 3KG2A 4G27B 4WFHA 4JTCB 3UT5A 4FZ1A 2WLMA 1GMGA 1D5AA 2EZOA 2ZE7A 2O57A 4LWSA 2UXBO 5DECA 1FFTB 2E76B 3KCXA 5J2UA 2L35A 1ZL8A 3ICXA 1VIBA 4N23A 3BA9A 4DV3O 1HWYA 4UCRA 5B1BC 4ZIBA 3WU2Z 4J80A 2YIBA 5EC1C 2M6YA 1YEWA 3CEIA 3WB2A 3ABLC 1BMFG 1COWG 4JYYA 1M1KW 2EJRA 5KHJA 4FLWA 4PI2A 2DJVA 3FB8C 2QKAA 4U3JB 2CUGA 3CSXA 1K7DA 1VQ9V 4LF6O 3K59A 1F51A 2L6LA 1HNWO 1YJWV 4UV9A 3OAAG 1F7YA 3WB0A 4PA6A 4PJ0Z 3IJ4A 4UFZA 4DW0A 2HJDA 1D2DA 1WN7A 2GUZB 4X66O 3N2GA 2EBOA 5LGTA 2QKSA 2E5LO 3EHBB 2JVDA 4MVSA 4JI6B 4I0XB 1I94B 4NYKA 1WJZA 1Z2GA 4TQDA 4NXNB 2H3OA 3RBZA 1NS1A 4I4TA 5EZYB 1SC5B 3LNMB 1IDSA 2Q7HA 3L72H 4X62O 3K5NA 1DLBA 3B09A 2ZE5A 2Y0IA 1NQTA 2WLIB 1F23A 1V54C 5LMUB 1K5SA 1PKXA 3AG7A 1GN3A 3HKDA 2IW5A 2YC0A 2YUAA 3K79A 1VEWA 3L73H 1K92A 2DWEC 3ZMVA 4D7TA 2WLLA 3A2FA 5B3SC 1GH6A 2JIZG 1FXKA 1VF7A 5L3FA 1KB9F 1O9HA 4W4LA 3EXAA 4ZKIA 4WCEV 2QR4A 3FAVB 4FIPC 4WFAV 2OCCB 4X1YA 3DGEA 2CTPA 2B1GA 2FL4A 3N27A 5JCOC 1YVWA 4RUFA 2QTSA 1M57C 1HR0B 2B5UA 3RYFB 3IAYA 3A8TA 2OIEA 5LP6A 5GW7A 4PA7A 3M99B 1R3JC 2EJ7A 5EC2C 3WG7C 4E2LA 3DXRA 4DR1B 2XHBA 2AHZA 4FLYA 1XMQB 4BW5A 1PPJH 4JI6O 1I94O 1T5EA 3S3WA 2AW9A 3FB7C 4UVAA 4NXNO 2AZ2A 4JTAB 4JASA 3ABMC 2ADPA 1R6KA 2YS8A 2PI4A 3SJBC 2BSKA 1AB3A 3U10A 1XL6A 4I5SA 4DW1A 2OWOA 4YJ2B 4WBNA 1U96A 4TOIA 1QVGU 5LMUO 3W7WA 3B4SA 2E3CA 1N8RW 3HKCB 2LGQA 2UXNA 1AROP 3CE2A 4PDLA 5BXZA 4NKGB 4DK1A 2QWOB 1K3EA 4FFBB 5IY5C 4B7EA 1WPBA 3STZC 5KA5A 4CS4A 4UCSA 3GWOA 4JZGA 1VQ5V 2YSUB 1OJHA 4IIJA 4AILC 1HR0O 4TWKA 1GRJA 3SJAC 1AP6A 4O2BB 4JGSA 4IYHA 3K57A 4OPHA 1HP8A 1XMQO 3B2EE 1BQ0A 3CD6V 4TQFA 3AK2A 1FXKC 1IBMB 2UXXA 4FM2A 1Z5WA 1G1XB 5IWAB 5FNVB 4FLTA 2ZE8A 1CXZB 2HJFC 3HKBB 1O9GA 3K04A 4X20B 5KHIA 3LNNA 4X64B 3ETGA 4IHJA 5D5QA 4QGPA 4U3FH 5LP6C 2W6JG 2Y0PA 2YXHA 2KQXA 2YIBD 1TUBA 2F66C 2GDSA 3X2QB 3L75H 3QO5A 3ABTA 4MSWC 1XBLA 1ORQC 3R65A 2ETNA 3JALB 3VBBA 3C3SA 3FB6C 1FAFA 1JJOA 1OCOB 2EILC 4IT5A 2P4KA 4H13B 5CA3A 1VQOV 1BHBA 4XDJA 4TV8B 3N2KA 1J5EB 5IYCO 4QIWF 1XILA 4G28B 2DWDC 1H8EG 3JD3A 1JPXA 4J41A 4LNUB 1N33B 5CN0A 1WB8A 3WB1A 5BMVA 1M56C 1DGSA 4PDVA 3CRCA 4CH3A 2WLNA 2R70A 3ETEA 2HG5C 2RDCA 1TA8A 1URFA 2C2AA 4D6TH 1IBMO 1XHXA 1JFFA 3JD1A 5IWAO 3VQXA 1R3KC 4QE9A 4K8ZA 4LFCB 4HYOA 1XEQA 4X1IA 2LFSA 2E75B 4RAIA 3JATB 4EKWA 4MTXA 4X64O 1ENVA 2PY5A 3G67A 5J2TA 3JARB 1GM8A 4LH6A 4OGQB 1Q8IA 2P7TC 3CRMA 1BS3A 2X6AA 4B3SB 1QU7A 2FB5A 3CJHB 3SJQC 4PHZA 3CCLV 5CMUA 5EYPB 4JI8B 1NR7A 2CGOA 4I9WA 1NVPD 2MW2B 3JSLA 1B3QA 2JS5A 3JAKB 4MVOA 2ZIMA 1L0LH 2LW1A 1Q6HA 4DR6B 3CWBH 3TCUA 2DN9A 3ZX6A 4O4LA 4Z2WA 3NR7A 1IXBA 4FMTA 1NKDA 1SS3A 1J5EO 1FFXB 2IH3C 4DV6O 3J81N 1MG1A 5B5EZ 2BTQB 1GK9A 4DR4B 1N33O 1A32A 3T4ZA 1FXVA 1K9MW 2YDEA 4GKJB 4JPRA 4FM1A 1BCCH 5FLXN 2LJ2A 5K1PA 1PD3A 5LHGA 3BHPA 2HR3A 1EZVH 3UO3A 1TUEB 2X6BA 4J9YB 4D7SA 3W7SA 3APQA 3H1IH 2NN4A 4JI4B 4LFCO 2EINB 3AK1A 1EZJA 3LSSA 3T2MA 4R7CA 3SYQA 2CE4A 1V55C 2WLHA 1P4RA 4JAVA 2F1MA 4LFBB 1IBLB 2AGAA 3Q4HA 1HW7A 4N21A 3ASOB 4JYCA 4P30A 5KLVH 4BW9A 1PNMA 4NB5A 3CRAA 3ZHVA 3K3WA 3CRRA 5JJEB 5KMGA 5L3CA 1YJNV 2UUAB 4B3SO 3FAVA 1NZ6A 5LXTB 4LF5O 4JI8O 5KX5B 5B1AC 2ZE6A 5LOVA 1ZAUA 1I0HA 1XQ8A 1AR1B 3ZMSA 2XOKG 3CCJV 4FLVA 4DR6O 2H94A 2A9HA 4LBEC 2QGNA 1IVSA 4I9QA 5CBHA 5JJNB 2BCCH 4JI5B 3D3QA 3K9AA 3W7UA 1YXBA 1W59A 1OCCB 3ASNC 5LL6Y 4JI7O 3THOA 2RN9A 2Q4PA 4DR4O 4KFMA 2V4DA 1IZ3A 1WA8B 2CTQA 2RMKB 4GKJO 4JAAA 2XNDG 3K08A 2DYRB 2X7RB 3B77A 2F93B 1Q43A 1IXMA 2EZPA 4EB6B 3ZRXA 3MHHC 1Y6XA 2W6IG 3T1HO 3AG4B 2ZNIA 4MW3A 5E79Z 4KUMA 4LF8B 1R6TA 4JI4O 4KXRA 4RO2A 2AXTZ 3HR0A 1KD1W 4NTWA 4J9ZB 3CXHF 4NVPA 1SA0A 3C90A 4LFBO 1KYOF 4JZ2A 3KCYA 3I5DA 3E8BA 1K33A 5DEDA 2UUAO 3TJTA 3DTUB 3H1HH 5B1OA 5LYJA 1SF9A 4UB6Z 2KG7A 4TUYB 4ABMA 5JH7A 3CCEV 4JI1O 4DXWA 4DV2B 1KP3A 3P3PA 4DV7O 4BWAA 4I7ZB 4UVCA 2HVKC 1WP8A 1YIJV 1JJ2U 4H44B 4KP4A 2QE7G 1GN2A 2A0LA 5JVDA 2K1EA 3AG1B 4DV0B 1EFRG 5CB4B 3ZRWB 3BEHA 1OCZB 4JYBA 3JD0A 3SYPA 1W0KG 1KBHA 4Q6GA 4MTFA 1X59A 1DTOA 1VQLV 4JI2B 1XI1A 3L74H 5KHKA 2Q0OC 1QLEB 3BRCA 4HNAA 3AG3B 3A0HZ 5FNVA 2D3OW 4CC6A 1JX9A 2GV9A 1PL0A 2WA4A 3HKBA 2Q5ZA 3HKEA 3CCMV 3E22B 4RUEA 4LF8O 2MK3A 3RYHA 4B7KA 1S72V 4QPKA 1UJWB 3LUTB 1BE3H 1F4NA 3HPLC 1V9PA 3BCCH 1RM1B 4K8XA 3LDEA 1RP3B 3MDSA 5GTIZ 4R6ZA 2VQEB 3ZEDA 2Q69A 3FD9A 1K4CC 1Y74A 2Y4UA 1KUQA 3ZRVA 5KAFZ 1NH2D 5C8YB 2RCVA 2RJZA 4U7NA 1OCRB 2EIJC 4O2AB 2DYSC 2FYUH 1W2BU 2F4VB 1KKDA 2YEVB 1R3LC 5L3BA 3LSUA 4PELA 3TETA 5IYZA 1XOUA 2QWNB 5IT9N 4LNUA 3OMNB 4LP8A 4DR5B 3JCZA 3ABKC 1Z5VA 3STLC 2LGWA 3K9SA 4YJ3B 2ZXWC 1G8MA 1R3IC 4GX1A 2WA3A 2DOSA 3RYIB 2ZIOA 4ZHQB 3BFRA 3J7AU 1TAEA 1N0NA 1D5NA 2GSMB 4P9OA 2P5OA 5FPOA 3QTCA 4EFBA 1PP9H 1EBOA 4H33A 2UXCB 3JAMN 1YITV 2Z3YA 3O9OA 4OPAA 5IJ0B 2P90A 1E79G 5L3GA 4LF9B 4E4EA 3B8NA 5EYPA 1H2NA 2FKXA 1QR9A 5GONA 1S5JA 5CA1B 2OCHA 2Y4TA 4ASUG 1K34A 1L0NH 1Q6UA 1AR4A 1KKCA 1AVMA 4O4JB 1PM9A 4ZI7A 1EN4A 1FFXA 4DR7B 1Y76A 4ICGA 2BOBC 4GX2A 3E8GA 2QWQB 3ZHUA 4Z1VA 4DK0A 4I55A 1QBZA 3KKYA 4J10A 3CYOA 2ARHA 2VWKA 1BGYH 1S3JA 3RWRD 1VMGA 1SETA 2QWPB 1JA8A 2Y48A 3MHSC 1Q6IA 4TV9B 4DUZB 3LSQA 1H2KA 3G6BA 1H38A 3ETDA 3JAWB 4WFGA 5B1BB 2VQFB 1SQBH 2DQ3A 3ABLB 2GTAA 2HP8A 1MMMA 4F6RB 1BZKA 5IJ9B 4BR6A 4DRXB 4J7JA 3D36A 2EX3A 4A5UB 3R66A 1Y4MA 4XDKA 4IYIA 2Z5UA 1YSCA 5H6RA 1AJQA 3C3TA 2P67A 1HNZB 5A9GA 3U11A 2EIKC 1JVMA 1OZ0A 1K5QA 5JQGB 4FFKA 4YY3B 4DR7O 2GTSA 2AHYA 2Y69C 5H9CA 5ITZA 3JASB 3ETQA 2ITDC 1H2LA 4X65B 1GTOA 4FLXA 4B3TB 4O4HA 3GVMA 3SPJA 4DV4B 2Q9LA 1TVKA 3T4DA 4PA3A 3BVOA 3F7VC 4C7UA 4DR1O 2CH7A 1AR5A 1GN4A 1Q81W 1HNXB 1NBMG 4QNHB 3D8CA 4DUZO 1L1FA 5LA6B 4PDRA 3VQVA 2GBOA 1VQ4V 3BABA 1Q7YW 1V54B 2XAGA 5EBMC 4MS2A 3RT3C 4AQYB 2N74A 2JK5C 3UT5B 5B3SB 2XAJA 2P4VA 3P3NA 3AK3A 1W0JG 2K9PA 2UUBB 1AJPA 1VARA 4FK5C 1FS0G 4L8JA 4UV8A 2DW4A 4UB8Z 2A3QA 4XDLA 4IGGA 4X9QA 4JV5B 1ZL8B 1VQKV 5H6QA 3E86A 5LGNA 1M57B 1HNZO 3K06A 1WPXA 4FVMA 2B1IA 1N4CA 1PV0A 1XNRB 3SPIA 2NNUA 3ZN0A 1KECA 4WFFA 2YICA 1ZSPA 2A7WA 4YHHB 1SQXH 3WG7B 5CB4A 1FYJA 4UCOA 4X88A 3K5LA 2EIMC 4B3TO 3D36C 5CA0B 4DV4O 3OT7A 4K0KB 1R73A 2R9IA 3L70H 3ABMB 2N04A 1YDXA 2LO1A 3NXSA 3QVNA 1B6QA 2ADQB 2WPDG 3I55V 4CS2A 2YIAA 4MVQA 2IJIA 1WAZA 1XL4A 2QA4V 4AQYO 1K97A 1SQQH 1Y66A 3AG2C 2UU9B 3UM7A 3JSNA 1Q86W 3BY6A 1M9NA 5IY5B 4U3JA 3DSQA 5D5PA 4O4IB 3CX5F 4BIOA 4QJFB 5HFMA 3UQ8A 4O2AA 2ZD9A 4GYCB 3ZBHA 4F6EA 4JV5O 2QJ1A 3RVZA 4R50A 1M93A 3ZMUA 1MOFA 2QM7A 2E74B 1XNRO 3T1CA 1OHHG 1RFYA 4LFAB 3HKDB 1SZTA 4BAYA 5IYBO 1IURA 1NVPB 2QWRB 1F4MA 2GUZA 2BOCC 1XHZA 1P7GA 2HFEC 2WLLB 1JCHA 3A0RA 1FXKB 4I0XA 1RSOB 4PV1B 4K0KO 2DQ0A 2Q8VA 4G2KA 4X1YB 5EZYA 4CH6A 1NU1H 2QDOA 3E8FA 1VF6A 1P84F 3SGIA 1QHTA 4CZZA 4FPPA 1BHAA 3K58A 5DM6V 5LP6B 3FX7A 3MD0A 5IJ0A 4LR3A 2WLIA 3RFRA 2PYLA 2OT5A 4OX9B 1XMOB 3PJSK 1AI7A 2JS3A 3ZMZA 4GUNA 3CCSV 2CGNA 2UU9O 3B40A 1LNQA 2OIGA 1M90W 4WF9V 4MVZA 2P22C 4JYAB 1QVFU 1S0VA 2EILB 1WB7A 1AI4A 2BSKB 1NTMH 3U0ZA 4WFBV 3W7TA 1L8DA 2JEXA 4UVBA 4LF4B 3J80N 3RYFA 1QQCA 4MTGA 4Q20A 5DN6G 5BR8B 1LR1A 1M56B 3TGUH 1YTFB 1BL8A 2VS0A 1WNSA 1KQSU 1N34B 3FKSG 2QTOA 3RGBA 5HFLA 5KHGA 4GCZA 4DR3B 2B9ZA 2GHYA 1OV9A 3JAWA 1SKVA 4BIZA 4GX5A 1G4YB 2Q67A 1R6NA 5L3DA 4IIJB 4FZ0A 4F6RA 3RYCB 1ROPA 4YJ2A 3I56V 3K5MA 3ZRSA 2XASA 1HDJA 5CBGA 4ZBMA 1XUQA 3HKCA 2H8PC 3IC7A 1FKAO 1IBLO 2RNBA 2ZINA 3ZJZA 1QCEA 2QM8A 4JYAO 4DV3B 4DV1B 4FFBA 3G80A 4JTDB 4WFEA 1YZBA 3KZIZ 4LCUC 5JQGA 1YJ9V 1BSMA 1P49A 1XREA 3SPGA 5B66Z 4CBCA 2XT9A 4NR1A 3M7MX 1VF6C 1NI8A 4X1KB 2LP7A 3CC4V 4J11A 1VQ8V 4IHJB 4LF4O 4JI3B 3E8HA 3UKMA 3L71H 4I50B 4O2BA 5BR8O 4JI5O 2YI8A 4X8AA 1TUBB 3OGCC 3E2EA 5F2VO 4LF6B 3W7XA 1N34O 1I7FA 1RPRA 4DUYB 1U97A 4MT8A 4UUJC 1FD9A 4DR3O 2CDYA 1FJGB 5LA6A 1HNWB 4K3AA 1PNLA 4DYLA 4MVUA 2F23A 4B3RB
chains in the Genus database with same CATH topology
3M8AA 3J80N 1F7YA 2Z0AA 3OTOO 1J5EO 3T1HO 2VQEO 2UXDO 1KUQA 4DV6O 3J81N 2LW7A 1D2DA 1R6TA 4JI4O 1AB3A 4LF7O 4JV5O 4X66O 1N33O 3RT3C 1A32A 2E5LO 2N74A 1IBKO 5FLXN 4LFBO 5LMUO 2F4VO 1XNRO 1NS1A 3T1YO 1DK1A 2UUBO 4LFAO 5IT9N 4DV5O 2UUAO 2VQFO 2JRIA 4LFCO 5H5NA 5BXZA 4DR5O 4X62O 4DV1O 1HNZO 4JI1O 4K0KO 2DOSA 4DV7O 4DV2O 2AGAA 3O65A 4A5UB 1FKAO 3J7AU 1IBLO 2UXBO 1IBMO 2HHHO 3R66A 4JI3O 1FYJA 1HR0O 4KHPO 4B3SO 1N32O 5IWAO 4YHHO 4JYAO 5LMNO 4DV0O 1XEQA 4DV3O 4LF5O 4JI8O 4B3TO 4NXMO 1YZBA 3JAMN 4B3MO 4OPHA 4DV4O 2UXCO 4DUYO 1AILA 4JI0O 4X64O 1X59A 1XMQO 4OPAA 4OX9O 5BY1A 1XMOO 4JI2O 1FJGO 4DR2O 4DR6O 1R1BA 2UU9O 4DR7O 4B3RO 4LF4O 4YY3O 4LF9O 1G1XB 5BR8O 1N36O 4JI5O 3F5TA 2FKXA 5LL6Y 4JI7O 2DJVA 4LF8O 4GKKO 4X65O 2ZKOA 1N34O 4DR4O 2UUCO 3SDLA 4LF6O 1XNQO 4AQYO 4DR1O 4GKJO 4DR3O 4JI6O 2ZM6O 1I94O 5A2QN 1HNXO 1HNWO 4NXNO 4DUZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8A A;  3J80 N;  1F7Y A;  2Z0A A;  3OTO O;  1J5E O;  3T1H O;  2VQE O;  2UXD O;  1KUQ A;  4DV6 O;  3J81 N;  2LW7 A;  1D2D A;  1R6T A;  4JI4 O;  1AB3 A;  4LF7 O;  4JV5 O;  4X66 O;  1N33 O;  3RT3 C;  1A32 A;  2E5L O;  2N74 A;  1IBK O;  5FLX N;  4LFB O;  5LMU O;  2F4V O;  1XNR O;  1NS1 A;  3T1Y O;  1DK1 A;  2UUB O;  4LFA O;  5IT9 N;  4DV5 O;  2UUA O;  2VQF O;  2JRI A;  4LFC O;  5H5N A;  5BXZ A;  4DR5 O;  4X62 O;  4DV1 O;  1HNZ O;  4JI1 O;  4K0K O;  2DOS A;  4DV7 O;  4DV2 O;  2AGA A;  3O65 A;  4A5U B;  1FKA O;  3J7A U;  1IBL O;  2UXB O;  1IBM O;  2HHH O;  3R66 A;  4JI3 O;  1FYJ A;  1HR0 O;  4KHP O;  4B3S O;  1N32 O;  5IWA O;  4YHH O;  4JYA O;  5LMN O;  4DV0 O;  1XEQ A;  4DV3 O;  4LF5 O;  4JI8 O;  4B3T O;  4NXM O;  1YZB A;  3JAM N;  4B3M O;  4OPH A;  4DV4 O;  2UXC O;  4DUY O;  1AIL A;  4JI0 O;  4X64 O;  1X59 A;  1XMQ O;  4OPA A;  4OX9 O;  5BY1 A;  1XMO O;  4JI2 O;  1FJG O;  4DR2 O;  4DR6 O;  1R1B A;  2UU9 O;  4DR7 O;  4B3R O;  4LF4 O;  4YY3 O;  4LF9 O;  1G1X B;  5BR8 O;  1N36 O;  4JI5 O;  3F5T A;  2FKX A;  5LL6 Y;  4JI7 O;  2DJV A;  4LF8 O;  4GKK O;  4X65 O;  2ZKO A;  1N34 O;  4DR4 O;  2UUC O;  3SDL A;  4LF6 O;  1XNQ O;  4AQY O;  4DR1 O;  4GKJ O;  4DR3 O;  4JI6 O;  2ZM6 O;  1I94 O;  5A2Q N;  1HNX O;  1HNW O;  4NXN O;  4DUZ O; 
#chains in the Genus database with same CATH topology
 2PUS A;  2OCC C;  3GWK C;  1V55 B;  3N2K B;  5EBW C;  4X20 A;  4X66 B;  3OD4 A;  4X89 A;  1S5L Z;  2KSD A;  2E5L B;  2UUC B;  2XTA A;  3SJC C;  1XNQ B;  1NJI W;  2XAH A;  2Q68 A;  5BMV B;  2Q73 A;  2IBZ H;  1JR9 A;  2G38 A;  3SPH A;  3OTO B;  2R9A A;  5B1A B;  3UO2 A;  5JCO A;  4FLZ A;  2JRI A;  3MAQ A;  4X62 B;  1CP9 A;  4MTO A;  1JFF B;  1GM9 A;  4DV1 O;  2QEX V;  4PDM A;  3JAL A;  2QM4 A;  4X1I B;  1NTZ H;  4PA9 A;  5B1N A;  3CB2 A;  2V7Q G;  4DV2 O;  4TV8 A;  4CH5 A;  3ASN B;  1NH2 B;  2P6J A;  5J2T B;  3FYI B;  2ATK C;  4JI3 O;  4CC5 A;  5CA0 A;  1KP2 A;  4DV0 O;  2IH1 C;  5IDJ A;  2DE0 X;  1M5I A;  4EFE A;  4DUY O;  2FML A;  3TXQ A;  1GKF A;  3OUS A;  1GN6 A;  3L9D A;  4JI2 O;  1FJG O;  4P2Z A;  2JEU A;  1THZ A;  1YCI A;  4B3R O;  4KHP B;  1KC8 W;  1E1R G;  2PYJ A;  1JOY A;  1YF2 A;  1H2M A;  4O4L B;  2XUM A;  1Q3E A;  3JAT A;  4NXM B;  4AHC A;  5AG2 A;  2YID A;  2UUC O;  1PL4 A;  4P9P A;  3ZS8 C;  1XNQ O;  3JAR A;  2FTK A;  3RN4 A;  3CJH A;  3OMI B;  5KUK A;  4O4I A;  3OTO O;  4XBF A;  5KA6 A;  2VQE O;  5IYD O;  3CCQ V;  4TSF G;  1QR8 A;  5BZB A;  3H9V A;  3JAK A;  2M7W A;  4NTY A;  2KKW A;  1K4D C;  5EK0 A;  4RQE A;  2HVJ C;  5EIB C;  1VQM V;  2F4V O;  3QO8 A;  3Q4H B;  3LDC A;  4R8C A;  5KMG B;  2BTQ A;  2Q6A A;  2JJ1 G;  1RSO A;  4DR5 O;  3E35 A;  1MA1 A;  4UXN A;  5JWP A;  1YI2 V;  5LOV B;  3X2Q C;  1JQ0 A;  1MSD A;  3O65 A;  2OYQ A;  2CAZ C;  3PN1 A;  5LHH A;  2W0F C;  1K73 W;  4L87 A;  4KHP O;  1DF4 A;  1OCO C;  2ZQM A;  1X4T A;  2X6C A;  3ZHT A;  1SER A;  3CRQ A;  3QNE A;  4CH4 A;  1LUW A;  1WP7 A;  3OM3 B;  3AEI A;  4NXM O;  1US6 A;  5KUM A;  2VWJ A;  2UXC O;  2V1D A;  3BAA A;  3ABU A;  2IJH A;  1ZUQ A;  2JJ2 G;  2WWW A;  3OMA B;  2YXY A;  5BY1 A;  3OR7 C;  2YI9 A;  1BQZ A;  3K03 A;  2HHH B;  3FYE B;  4LF9 O;  3ZHR A;  1YHQ V;  2EIJ B;  4YXW G;  5LXT A;  1Q82 W;  2DYS B;  5TIS Z;  1G6U A;  5KX5 A;  2ITC C;  1KMI Z;  1SRY A;  1MZE A;  3SDL A;  1NR1 A;  2W0X A;  5EBL C;  3SPC A;  4ZOL B;  4RQF A;  3UCS C;  3ABK B;  1SA0 B;  3M8A A;  3IGA C;  2NR5 A;  2ZXW B;  4QE7 A;  1VF5 B;  1DF5 A;  3RW0 A;  3CMA V;  3CC7 V;  4GKK B;  4B08 A;  2ZDI A;  4GLX A;  1VQ7 V;  3FFQ A;  2BTO A;  1WA8 A;  5LYJ B;  1ZX3 A;  5CBF A;  2KG7 B;  3K5O A;  2N05 A;  2ZM6 B;  2JGU A;  4UCT A;  5JH7 B;  2XAQ A;  4EB6 A;  2WLJ A;  3HB3 B;  1QLN A;  4IL6 Z;  1AP5 A;  5IE9 A;  2UXD B;  3G6E V;  2JGD B;  3RYC A;  2F95 B;  2VQF O;  1CPY A;  4LF7 B;  5JVD B;  3GB7 C;  2IU3 A;  2WSS G;  3SYC A;  3QO7 A;  5K1X A;  1VQN V;  1SZX A;  1Q90 D;  4OXS A;  1IBK B;  1E1Q G;  5EIB D;  1S76 D;  2IJK A;  3B8M A;  4HBN A;  5C93 A;  3F5W C;  2Q7G A;  4HNA B;  2HHH O;  1J95 A;  4LWS B;  4JAU A;  1UPG A;  2IM9 A;  4H37 A;  3A0B Z;  1NTK H;  4TUY A;  5J2U B;  3DC5 A;  3HKE B;  3IC9 A;  3EVK A;  4X1K A;  1IX9 A;  4PD4 F;  3RYH B;  1LUV A;  4GX0 A;  3TXS A;  4BIU A;  5KHH A;  4DO2 A;  2EIN C;  3K0D A;  2VRZ A;  3OW2 U;  3ZCC A;  4I50 A;  1R1B A;  3IFX A;  2R72 A;  1CEZ A;  4YY3 O;  2P06 A;  1P7B A;  3H1K H;  1UFI A;  4Z1M G;  3ZRW A;  3F5T A;  2EUL A;  3ASO C;  3JYC A;  1Y74 B;  4GKK O;  1MNG A;  1M4U A;  2DMX A;  4X65 O;  4B3M B;  3CHX A;  4JI0 B;  3ZMT A;  3E89 A;  3CCU V;  1SQP H;  2PZS A;  2ZM6 O;  1HNX O;  4YIP A;  2IJJ A;  4CS3 A;  3SYA A;  3E22 A;  4PA4 A;  4DV6 B;  2AZ0 A;  5IYZ B;  2UXD O;  2CK3 G;  2OTL V;  4QPJ A;  3OUF A;  4LF7 O;  2D2C B;  1QNM A;  2CTR A;  1SQV H;  1H8H G;  2F43 G;  1OCC C;  1IBK O;  3N2G B;  2WAM A;  4KL1 A;  2BE3 A;  4FM0 A;  1TGO A;  5J9P C;  2X0L A;  1MZF A;  5FL7 G;  2ZDI C;  1KU9 A;  4EEQ A;  1I08 A;  2UUB O;  1AI5 A;  5C8Y A;  3QG5 A;  2EIK B;  3JD2 A;  2DYR C;  1B06 A;  4I4T B;  4UCV A;  2HKO A;  1GM7 A;  3AG4 C;  1VQ6 V;  2YEV A;  2Y69 B;  2NLJ C;  3CCR V;  4MW8 A;  3H01 A;  1SQF A;  2OTJ V;  2PI5 A;  3VQY A;  5E1A C;  1EN5 A;  4FJC C;  4DV5 B;  3K0G A;  4YHH O;  5FPR A;  2WLK A;  3F7Y C;  1B04 A;  1AI6 A;  1ZWI C;  3CME V;  4LF5 B;  4YJ3 A;  1VP7 A;  3P30 A;  1NT2 B;  5GON B;  1SQG A;  4B3M O;  4FLU A;  4JI0 O;  3RYI A;  4ZHQ A;  1Q5O A;  2ZT9 B;  4HZ3 A;  3ML0 A;  4ZI7 B;  1N32 B;  2IU0 A;  2R9R B;  3E83 A;  3WFV A;  1VQP V;  1Y76 B;  4JI7 B;  1PNK A;  5LMN B;  3LDD A;  3RVY A;  4I55 B;  3QF7 A;  2PTM A;  3AG1 C;  2XAF A;  1WLE A;  2CTW A;  2LFR A;  3P32 A;  5H2F Z;  4DR2 B;  5A2Q N;  3DXR B;  3FB5 C;  3ZHQ A;  2PGG A;  1OCZ C;  3T1H B;  3TK1 A;  3H1L H;  1N0J A;  1N36 B;  1S77 D;  1QLE C;  3ZHS A;  1MSW D;  5CA1 A;  3AG3 C;  4K35 A;  1RPO A;  3CCV V;  4O4J A;  5L3E A;  3CS5 A;  2PF4 E;  2YXL A;  1XDC A;  4NTX A;  2A06 H;  4W4K A;  3SR2 C;  2EIM B;  4WBN B;  1S5H C;  1DK1 A;  1H2G A;  4LFA O;  3BA8 A;  2ZNJ A;  1RM1 C;  4DV5 O;  2ILM A;  4H0L B;  1H2S B;  1I5Y A;  1SES A;  4J7K A;  3OEH G;  5H5N A;  2ZCE A;  3VOU A;  3H1J H;  4JI1 B;  3CC2 V;  1YTF D;  4GZR B;  4TT3 G;  4DV7 B;  3ZIA G;  5JJJ B;  4TV9 A;  4F4L A;  4RWU A;  5KAI Z;  3T1Y B;  1BT8 A;  1OCR C;  3SYO A;  4AI8 A;  1JMK C;  1N32 O;  1K8A W;  3DC6 A;  1ZLZ A;  3S3X A;  1MAB G;  3OTF A;  5LMN O;  5ITZ B;  3AG2 B;  3JCU Z;  3OEE G;  5GTH Z;  3BPZ A;  4PI0 A;  4U7O A;  5LHI A;  3OGI B;  1I5X A;  5IJ9 A;  4DRX A;  1AIL A;  2Q0A A;  3D3I A;  4O4H B;  2QKC A;  4OX9 O;  3EFF K;  3JD4 A;  1TVK B;  1XMO O;  2UXB B;  4YIO A;  4DR2 O;  2CH7 B;  3CP1 A;  4MVR A;  3APO A;  2A79 B;  1N36 O;  2JDI G;  3G71 V;  3G4S V;  2LQT A;  4MVM A;  4ZOL A;  4LC1 A;  2Q7E A;  2ZKO A;  1ZTE A;  2HEP A;  1EN6 A;  1GO3 F;  4JF3 A;  2ODM A;  3OFN G;  2HLD G;  2QSA A;  3VQW A;  2Z0A A;  4LH7 A;  3JAS A;  4GT1 A;  3OR6 C;  5LGU A;  1FPO A;  3CPW U;  2LW7 A;  3OE7 G;  5LBQ A;  1Y67 A;  3ZN1 A;  1EM1 A;  1GAX A;  1FXH A;  4UCU A;  4J7Z A;  4HAM A;  2RQ6 A;  2JGD A;  3T1Y O;  2ZR3 A;  2KB1 A;  2ZR2 A;  3CXC U;  1AJN A;  4J42 A;  3KG2 A;  4G27 B;  4WFH A;  4JTC B;  3UT5 A;  4FZ1 A;  2WLM A;  1GMG A;  1D5A A;  2EZO A;  2ZE7 A;  2O57 A;  4LWS A;  2UXB O;  5DEC A;  1FFT B;  2E76 B;  3KCX A;  5J2U A;  2L35 A;  1ZL8 A;  3ICX A;  1VIB A;  4N23 A;  3BA9 A;  4DV3 O;  1HWY A;  4UCR A;  5B1B C;  4ZIB A;  3WU2 Z;  4J80 A;  2YIB A;  5EC1 C;  2M6Y A;  1YEW A;  3CEI A;  3WB2 A;  3ABL C;  1BMF G;  1COW G;  4JYY A;  1M1K W;  2EJR A;  5KHJ A;  4FLW A;  4PI2 A;  2DJV A;  3FB8 C;  2QKA A;  4U3J B;  2CUG A;  3CSX A;  1K7D A;  1VQ9 V;  4LF6 O;  3K59 A;  1F51 A;  2L6L A;  1HNW O;  1YJW V;  4UV9 A;  3OAA G;  1F7Y A;  3WB0 A;  4PA6 A;  4PJ0 Z;  3IJ4 A;  4UFZ A;  4DW0 A;  2HJD A;  1D2D A;  1WN7 A;  2GUZ B;  4X66 O;  3N2G A;  2EBO A;  5LGT A;  2QKS A;  2E5L O;  3EHB B;  2JVD A;  4MVS A;  4JI6 B;  4I0X B;  1I94 B;  4NYK A;  1WJZ A;  1Z2G A;  4TQD A;  4NXN B;  2H3O A;  3RBZ A;  1NS1 A;  4I4T A;  5EZY B;  1SC5 B;  3LNM B;  1IDS A;  2Q7H A;  3L72 H;  4X62 O;  3K5N A;  1DLB A;  3B09 A;  2ZE5 A;  2Y0I A;  1NQT A;  2WLI B;  1F23 A;  1V54 C;  5LMU B;  1K5S A;  1PKX A;  3AG7 A;  1GN3 A;  3HKD A;  2IW5 A;  2YC0 A;  2YUA A;  3K79 A;  1VEW A;  3L73 H;  1K92 A;  2DWE C;  3ZMV A;  4D7T A;  2WLL A;  3A2F A;  5B3S C;  1GH6 A;  2JIZ G;  1FXK A;  1VF7 A;  5L3F A;  1KB9 F;  1O9H A;  4W4L A;  3EXA A;  4ZKI A;  4WCE V;  2QR4 A;  3FAV B;  4FIP C;  4WFA V;  2OCC B;  4X1Y A;  3DGE A;  2CTP A;  2B1G A;  2FL4 A;  3N27 A;  5JCO C;  1YVW A;  4RUF A;  2QTS A;  1M57 C;  1HR0 B;  2B5U A;  3RYF B;  3IAY A;  3A8T A;  2OIE A;  5LP6 A;  5GW7 A;  4PA7 A;  3M99 B;  1R3J C;  2EJ7 A;  5EC2 C;  3WG7 C;  4E2L A;  3DXR A;  4DR1 B;  2XHB A;  2AHZ A;  4FLY A;  1XMQ B;  4BW5 A;  1PPJ H;  4JI6 O;  1I94 O;  1T5E A;  3S3W A;  2AW9 A;  3FB7 C;  4UVA A;  4NXN O;  2AZ2 A;  4JTA B;  4JAS A;  3ABM C;  2ADP A;  1R6K A;  2YS8 A;  2PI4 A;  3SJB C;  2BSK A;  1AB3 A;  3U10 A;  1XL6 A;  4I5S A;  4DW1 A;  2OWO A;  4YJ2 B;  4WBN A;  1U96 A;  4TOI A;  1QVG U;  5LMU O;  3W7W A;  3B4S A;  2E3C A;  1N8R W;  3HKC B;  2LGQ A;  2UXN A;  1ARO P;  3CE2 A;  4PDL A;  5BXZ A;  4NKG B;  4DK1 A;  2QWO B;  1K3E A;  4FFB B;  5IY5 C;  4B7E A;  1WPB A;  3STZ C;  5KA5 A;  4CS4 A;  4UCS A;  3GWO A;  4JZG A;  1VQ5 V;  2YSU B;  1OJH A;  4IIJ A;  4AIL C;  1HR0 O;  4TWK A;  1GRJ A;  3SJA C;  1AP6 A;  4O2B B;  4JGS A;  4IYH A;  3K57 A;  4OPH A;  1HP8 A;  1XMQ O;  3B2E E;  1BQ0 A;  3CD6 V;  4TQF A;  3AK2 A;  1FXK C;  1IBM B;  2UXX A;  4FM2 A;  1Z5W A;  1G1X B;  5IWA B;  5FNV B;  4FLT A;  2ZE8 A;  1CXZ B;  2HJF C;  3HKB B;  1O9G A;  3K04 A;  4X20 B;  5KHI A;  3LNN A;  4X64 B;  3ETG A;  4IHJ A;  5D5Q A;  4QGP A;  4U3F H;  5LP6 C;  2W6J G;  2Y0P A;  2YXH A;  2KQX A;  2YIB D;  1TUB A;  2F66 C;  2GDS A;  3X2Q B;  3L75 H;  3QO5 A;  3ABT A;  4MSW C;  1XBL A;  1ORQ C;  3R65 A;  2ETN A;  3JAL B;  3VBB A;  3C3S A;  3FB6 C;  1FAF A;  1JJO A;  1OCO B;  2EIL C;  4IT5 A;  2P4K A;  4H13 B;  5CA3 A;  1VQO V;  1BHB A;  4XDJ A;  4TV8 B;  3N2K A;  1J5E B;  5IYC O;  4QIW F;  1XIL A;  4G28 B;  2DWD C;  1H8E G;  3JD3 A;  1JPX A;  4J41 A;  4LNU B;  1N33 B;  5CN0 A;  1WB8 A;  3WB1 A;  5BMV A;  1M56 C;  1DGS A;  4PDV A;  3CRC A;  4CH3 A;  2WLN A;  2R70 A;  3ETE A;  2HG5 C;  2RDC A;  1TA8 A;  1URF A;  2C2A A;  4D6T H;  1IBM O;  1XHX A;  1JFF A;  3JD1 A;  5IWA O;  3VQX A;  1R3K C;  4QE9 A;  4K8Z A;  4LFC B;  4HYO A;  1XEQ A;  4X1I A;  2LFS A;  2E75 B;  4RAI A;  3JAT B;  4EKW A;  4MTX A;  4X64 O;  1ENV A;  2PY5 A;  3G67 A;  5J2T A;  3JAR B;  1GM8 A;  4LH6 A;  4OGQ B;  1Q8I A;  2P7T C;  3CRM A;  1BS3 A;  2X6A A;  4B3S B;  1QU7 A;  2FB5 A;  3CJH B;  3SJQ C;  4PHZ A;  3CCL V;  5CMU A;  5EYP B;  4JI8 B;  1NR7 A;  2CGO A;  4I9W A;  1NVP D;  2MW2 B;  3JSL A;  1B3Q A;  2JS5 A;  3JAK B;  4MVO A;  2ZIM A;  1L0L H;  2LW1 A;  1Q6H A;  4DR6 B;  3CWB H;  3TCU A;  2DN9 A;  3ZX6 A;  4O4L A;  4Z2W A;  3NR7 A;  1IXB A;  4FMT A;  1NKD A;  1SS3 A;  1J5E O;  1FFX B;  2IH3 C;  4DV6 O;  3J81 N;  1MG1 A;  5B5E Z;  2BTQ B;  1GK9 A;  4DR4 B;  1N33 O;  1A32 A;  3T4Z A;  1FXV A;  1K9M W;  2YDE A;  4GKJ B;  4JPR A;  4FM1 A;  1BCC H;  5FLX N;  2LJ2 A;  5K1P A;  1PD3 A;  5LHG A;  3BHP A;  2HR3 A;  1EZV H;  3UO3 A;  1TUE B;  2X6B A;  4J9Y B;  4D7S A;  3W7S A;  3APQ A;  3H1I H;  2NN4 A;  4JI4 B;  4LFC O;  2EIN B;  3AK1 A;  1EZJ A;  3LSS A;  3T2M A;  4R7C A;  3SYQ A;  2CE4 A;  1V55 C;  2WLH A;  1P4R A;  4JAV A;  2F1M A;  4LFB B;  1IBL B;  2AGA A;  3Q4H A;  1HW7 A;  4N21 A;  3ASO B;  4JYC A;  4P30 A;  5KLV H;  4BW9 A;  1PNM A;  4NB5 A;  3CRA A;  3ZHV A;  3K3W A;  3CRR A;  5JJE B;  5KMG A;  5L3C A;  1YJN V;  2UUA B;  4B3S O;  3FAV A;  1NZ6 A;  5LXT B;  4LF5 O;  4JI8 O;  5KX5 B;  5B1A C;  2ZE6 A;  5LOV A;  1ZAU A;  1I0H A;  1XQ8 A;  1AR1 B;  3ZMS A;  2XOK G;  3CCJ V;  4FLV A;  4DR6 O;  2H94 A;  2A9H A;  4LBE C;  2QGN A;  1IVS A;  4I9Q A;  5CBH A;  5JJN B;  2BCC H;  4JI5 B;  3D3Q A;  3K9A A;  3W7U A;  1YXB A;  1W59 A;  1OCC B;  3ASN C;  5LL6 Y;  4JI7 O;  3THO A;  2RN9 A;  2Q4P A;  4DR4 O;  4KFM A;  2V4D A;  1IZ3 A;  1WA8 B;  2CTQ A;  2RMK B;  4GKJ O;  4JAA A;  2XND G;  3K08 A;  2DYR B;  2X7R B;  3B77 A;  2F93 B;  1Q43 A;  1IXM A;  2EZP A;  4EB6 B;  3ZRX A;  3MHH C;  1Y6X A;  2W6I G;  3T1H O;  3AG4 B;  2ZNI A;  4MW3 A;  5E79 Z;  4KUM A;  4LF8 B;  1R6T A;  4JI4 O;  4KXR A;  4RO2 A;  2AXT Z;  3HR0 A;  1KD1 W;  4NTW A;  4J9Z B;  3CXH F;  4NVP A;  1SA0 A;  3C90 A;  4LFB O;  1KYO F;  4JZ2 A;  3KCY A;  3I5D A;  3E8B A;  1K33 A;  5DED A;  2UUA O;  3TJT A;  3DTU B;  3H1H H;  5B1O A;  5LYJ A;  1SF9 A;  4UB6 Z;  2KG7 A;  4TUY B;  4ABM A;  5JH7 A;  3CCE V;  4JI1 O;  4DXW A;  4DV2 B;  1KP3 A;  3P3P A;  4DV7 O;  4BWA A;  4I7Z B;  4UVC A;  2HVK C;  1WP8 A;  1YIJ V;  1JJ2 U;  4H44 B;  4KP4 A;  2QE7 G;  1GN2 A;  2A0L A;  5JVD A;  2K1E A;  3AG1 B;  4DV0 B;  1EFR G;  5CB4 B;  3ZRW B;  3BEH A;  1OCZ B;  4JYB A;  3JD0 A;  3SYP A;  1W0K G;  1KBH A;  4Q6G A;  4MTF A;  1X59 A;  1DTO A;  1VQL V;  4JI2 B;  1XI1 A;  3L74 H;  5KHK A;  2Q0O C;  1QLE B;  3BRC A;  4HNA A;  3AG3 B;  3A0H Z;  5FNV A;  2D3O W;  4CC6 A;  1JX9 A;  2GV9 A;  1PL0 A;  2WA4 A;  3HKB A;  2Q5Z A;  3HKE A;  3CCM V;  3E22 B;  4RUE A;  4LF8 O;  2MK3 A;  3RYH A;  4B7K A;  1S72 V;  4QPK A;  1UJW B;  3LUT B;  1BE3 H;  1F4N A;  3HPL C;  1V9P A;  3BCC H;  1RM1 B;  4K8X A;  3LDE A;  1RP3 B;  3MDS A;  5GTI Z;  4R6Z A;  2VQE B;  3ZED A;  2Q69 A;  3FD9 A;  1K4C C;  1Y74 A;  2Y4U A;  1KUQ A;  3ZRV A;  5KAF Z;  1NH2 D;  5C8Y B;  2RCV A;  2RJZ A;  4U7N A;  1OCR B;  2EIJ C;  4O2A B;  2DYS C;  2FYU H;  1W2B U;  2F4V B;  1KKD A;  2YEV B;  1R3L C;  5L3B A;  3LSU A;  4PEL A;  3TET A;  5IYZ A;  1XOU A;  2QWN B;  5IT9 N;  4LNU A;  3OMN B;  4LP8 A;  4DR5 B;  3JCZ A;  3ABK C;  1Z5V A;  3STL C;  2LGW A;  3K9S A;  4YJ3 B;  2ZXW C;  1G8M A;  1R3I C;  4GX1 A;  2WA3 A;  2DOS A;  3RYI B;  2ZIO A;  4ZHQ B;  3BFR A;  3J7A U;  1TAE A;  1N0N A;  1D5N A;  2GSM B;  4P9O A;  2P5O A;  5FPO A;  3QTC A;  4EFB A;  1PP9 H;  1EBO A;  4H33 A;  2UXC B;  3JAM N;  1YIT V;  2Z3Y A;  3O9O A;  4OPA A;  5IJ0 B;  2P90 A;  1E79 G;  5L3G A;  4LF9 B;  4E4E A;  3B8N A;  5EYP A;  1H2N A;  2FKX A;  1QR9 A;  5GON A;  1S5J A;  5CA1 B;  2OCH A;  2Y4T A;  4ASU G;  1K34 A;  1L0N H;  1Q6U A;  1AR4 A;  1KKC A;  1AVM A;  4O4J B;  1PM9 A;  4ZI7 A;  1EN4 A;  1FFX A;  4DR7 B;  1Y76 A;  4ICG A;  2BOB C;  4GX2 A;  3E8G A;  2QWQ B;  3ZHU A;  4Z1V A;  4DK0 A;  4I55 A;  1QBZ A;  3KKY A;  4J10 A;  3CYO A;  2ARH A;  2VWK A;  1BGY H;  1S3J A;  3RWR D;  1VMG A;  1SET A;  2QWP B;  1JA8 A;  2Y48 A;  3MHS C;  1Q6I A;  4TV9 B;  4DUZ B;  3LSQ A;  1H2K A;  3G6B A;  1H38 A;  3ETD A;  3JAW B;  4WFG A;  5B1B B;  2VQF B;  1SQB H;  2DQ3 A;  3ABL B;  2GTA A;  2HP8 A;  1MMM A;  4F6R B;  1BZK A;  5IJ9 B;  4BR6 A;  4DRX B;  4J7J A;  3D36 A;  2EX3 A;  4A5U B;  3R66 A;  1Y4M A;  4XDK A;  4IYI A;  2Z5U A;  1YSC A;  5H6R A;  1AJQ A;  3C3T A;  2P67 A;  1HNZ B;  5A9G A;  3U11 A;  2EIK C;  1JVM A;  1OZ0 A;  1K5Q A;  5JQG B;  4FFK A;  4YY3 B;  4DR7 O;  2GTS A;  2AHY A;  2Y69 C;  5H9C A;  5ITZ A;  3JAS B;  3ETQ A;  2ITD C;  1H2L A;  4X65 B;  1GTO A;  4FLX A;  4B3T B;  4O4H A;  3GVM A;  3SPJ A;  4DV4 B;  2Q9L A;  1TVK A;  3T4D A;  4PA3 A;  3BVO A;  3F7V C;  4C7U A;  4DR1 O;  2CH7 A;  1AR5 A;  1GN4 A;  1Q81 W;  1HNX B;  1NBM G;  4QNH B;  3D8C A;  4DUZ O;  1L1F A;  5LA6 B;  4PDR A;  3VQV A;  2GBO A;  1VQ4 V;  3BAB A;  1Q7Y W;  1V54 B;  2XAG A;  5EBM C;  4MS2 A;  3RT3 C;  4AQY B;  2N74 A;  2JK5 C;  3UT5 B;  5B3S B;  2XAJ A;  2P4V A;  3P3N A;  3AK3 A;  1W0J G;  2K9P A;  2UUB B;  1AJP A;  1VAR A;  4FK5 C;  1FS0 G;  4L8J A;  4UV8 A;  2DW4 A;  4UB8 Z;  2A3Q A;  4XDL A;  4IGG A;  4X9Q A;  4JV5 B;  1ZL8 B;  1VQK V;  5H6Q A;  3E86 A;  5LGN A;  1M57 B;  1HNZ O;  3K06 A;  1WPX A;  4FVM A;  2B1I A;  1N4C A;  1PV0 A;  1XNR B;  3SPI A;  2NNU A;  3ZN0 A;  1KEC A;  4WFF A;  2YIC A;  1ZSP A;  2A7W A;  4YHH B;  1SQX H;  3WG7 B;  5CB4 A;  1FYJ A;  4UCO A;  4X88 A;  3K5L A;  2EIM C;  4B3T O;  3D36 C;  5CA0 B;  4DV4 O;  3OT7 A;  4K0K B;  1R73 A;  2R9I A;  3L70 H;  3ABM B;  2N04 A;  1YDX A;  2LO1 A;  3NXS A;  3QVN A;  1B6Q A;  2ADQ B;  2WPD G;  3I55 V;  4CS2 A;  2YIA A;  4MVQ A;  2IJI A;  1WAZ A;  1XL4 A;  2QA4 V;  4AQY O;  1K97 A;  1SQQ H;  1Y66 A;  3AG2 C;  2UU9 B;  3UM7 A;  3JSN A;  1Q86 W;  3BY6 A;  1M9N A;  5IY5 B;  4U3J A;  3DSQ A;  5D5P A;  4O4I B;  3CX5 F;  4BIO A;  4QJF B;  5HFM A;  3UQ8 A;  4O2A A;  2ZD9 A;  4GYC B;  3ZBH A;  4F6E A;  4JV5 O;  2QJ1 A;  3RVZ A;  4R50 A;  1M93 A;  3ZMU A;  1MOF A;  2QM7 A;  2E74 B;  1XNR O;  3T1C A;  1OHH G;  1RFY A;  4LFA B;  3HKD B;  1SZT A;  4BAY A;  5IYB O;  1IUR A;  1NVP B;  2QWR B;  1F4M A;  2GUZ A;  2BOC C;  1XHZ A;  1P7G A;  2HFE C;  2WLL B;  1JCH A;  3A0R A;  1FXK B;  4I0X A;  1RSO B;  4PV1 B;  4K0K O;  2DQ0 A;  2Q8V A;  4G2K A;  4X1Y B;  5EZY A;  4CH6 A;  1NU1 H;  2QDO A;  3E8F A;  1VF6 A;  1P84 F;  3SGI A;  1QHT A;  4CZZ A;  4FPP A;  1BHA A;  3K58 A;  5DM6 V;  5LP6 B;  3FX7 A;  3MD0 A;  5IJ0 A;  4LR3 A;  2WLI A;  3RFR A;  2PYL A;  2OT5 A;  4OX9 B;  1XMO B;  3PJS K;  1AI7 A;  2JS3 A;  3ZMZ A;  4GUN A;  3CCS V;  2CGN A;  2UU9 O;  3B40 A;  1LNQ A;  2OIG A;  1M90 W;  4WF9 V;  4MVZ A;  2P22 C;  4JYA B;  1QVF U;  1S0V A;  2EIL B;  1WB7 A;  1AI4 A;  2BSK B;  1NTM H;  3U0Z A;  4WFB V;  3W7T A;  1L8D A;  2JEX A;  4UVB A;  4LF4 B;  3J80 N;  3RYF A;  1QQC A;  4MTG A;  4Q20 A;  5DN6 G;  5BR8 B;  1LR1 A;  1M56 B;  3TGU H;  1YTF B;  1BL8 A;  2VS0 A;  1WNS A;  1KQS U;  1N34 B;  3FKS G;  2QTO A;  3RGB A;  5HFL A;  5KHG A;  4GCZ A;  4DR3 B;  2B9Z A;  2GHY A;  1OV9 A;  3JAW A;  1SKV A;  4BIZ A;  4GX5 A;  1G4Y B;  2Q67 A;  1R6N A;  5L3D A;  4IIJ B;  4FZ0 A;  4F6R A;  3RYC B;  1ROP A;  4YJ2 A;  3I56 V;  3K5M A;  3ZRS A;  2XAS A;  1HDJ A;  5CBG A;  4ZBM A;  1XUQ A;  3HKC A;  2H8P C;  3IC7 A;  1FKA O;  1IBL O;  2RNB A;  2ZIN A;  3ZJZ A;  1QCE A;  2QM8 A;  4JYA O;  4DV3 B;  4DV1 B;  4FFB A;  3G80 A;  4JTD B;  4WFE A;  1YZB A;  3KZI Z;  4LCU C;  5JQG A;  1YJ9 V;  1BSM A;  1P49 A;  1XRE A;  3SPG A;  5B66 Z;  4CBC A;  2XT9 A;  4NR1 A;  3M7M X;  1VF6 C;  1NI8 A;  4X1K B;  2LP7 A;  3CC4 V;  4J11 A;  1VQ8 V;  4IHJ B;  4LF4 O;  4JI3 B;  3E8H A;  3UKM A;  3L71 H;  4I50 B;  4O2B A;  5BR8 O;  4JI5 O;  2YI8 A;  4X8A A;  1TUB B;  3OGC C;  3E2E A;  5F2V O;  4LF6 B;  3W7X A;  1N34 O;  1I7F A;  1RPR A;  4DUY B;  1U97 A;  4MT8 A;  4UUJ C;  1FD9 A;  4DR3 O;  2CDY A;  1FJG B;  5LA6 A;  1HNW B;  4K3A A;  1PNL A;  4DYL A;  4MVU A;  2F23 A;  4B3R B; 
#chains in the Genus database with same CATH homology
 3M8A A;  3J80 N;  1F7Y A;  2Z0A A;  3OTO O;  1J5E O;  3T1H O;  2VQE O;  2UXD O;  1KUQ A;  4DV6 O;  3J81 N;  2LW7 A;  1D2D A;  1R6T A;  4JI4 O;  1AB3 A;  4LF7 O;  4JV5 O;  4X66 O;  1N33 O;  3RT3 C;  1A32 A;  2E5L O;  2N74 A;  1IBK O;  5FLX N;  4LFB O;  5LMU O;  2F4V O;  1XNR O;  1NS1 A;  3T1Y O;  1DK1 A;  2UUB O;  4LFA O;  5IT9 N;  4DV5 O;  2UUA O;  2VQF O;  2JRI A;  4LFC O;  5H5N A;  5BXZ A;  4DR5 O;  4X62 O;  4DV1 O;  1HNZ O;  4JI1 O;  4K0K O;  2DOS A;  4DV7 O;  4DV2 O;  2AGA A;  3O65 A;  4A5U B;  1FKA O;  3J7A U;  1IBL O;  2UXB O;  1IBM O;  2HHH O;  3R66 A;  4JI3 O;  1FYJ A;  1HR0 O;  4KHP O;  4B3S O;  1N32 O;  5IWA O;  4YHH O;  4JYA O;  5LMN O;  4DV0 O;  1XEQ A;  4DV3 O;  4LF5 O;  4JI8 O;  4B3T O;  4NXM O;  1YZB A;  3JAM N;  4B3M O;  4OPH A;  4DV4 O;  2UXC O;  4DUY O;  1AIL A;  4JI0 O;  4X64 O;  1X59 A;  1XMQ O;  4OPA A;  4OX9 O;  5BY1 A;  1XMO O;  4JI2 O;  1FJG O;  4DR2 O;  4DR6 O;  1R1B A;  2UU9 O;  4DR7 O;  4B3R O;  4LF4 O;  4YY3 O;  4LF9 O;  1G1X B;  5BR8 O;  1N36 O;  4JI5 O;  3F5T A;  2FKX A;  5LL6 Y;  4JI7 O;  2DJV A;  4LF8 O;  4GKK O;  4X65 O;  2ZKO A;  1N34 O;  4DR4 O;  2UUC O;  3SDL A;  4LF6 O;  1XNQ O;  4AQY O;  4DR1 O;  4GKJ O;  4DR3 O;  4JI6 O;  2ZM6 O;  1I94 O;  5A2Q N;  1HNX O;  1HNW O;  4NXN O;  4DUZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...