1YJNV

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yjnV00
3G71V 3G6EV 1JJ2U 5DM6V 3CD6V 1K9MW 2QA4V 3CCUV 1VQ7V 1VQLV 1Q86W 1N8RW 1VQ4V 3CCEV 2OTLV 2OTJV 1KD1W 3CCVV 1YJ9V 1W2BU 1VQNV 3I56V 1VQ5V 1K73W 3CCMV 1VQOV 3OW2U 3CC4V 3CCJV 1YHQV 1YIJV 1K8AW 1QVFU 1YJWV 3G4SV 1VQ9V 3CMAV 1QVGU 3CC2V 3CC7V 1NJIW 3CXCU 1Q7YW 3CMEV 3CPWU 3CCRV 1Q82W 1KC8W 2QEXV 1YITV 3I55V 4WF9V 1S72V 2D3OW 1VQ6V 3CCSV 3CCLV 4WFBV 1M1KW 1Q81W 1VQMV 4WFAV 1YI2V 4WCEV 1VQKV 1R73A 1M90W 1KQSU 1YJNV 1VQPV 1VQ8V 3CCQV
chains in the Genus database with same CATH superfamily
2WLIA 5CB4A 3THOA 1S5JA 1WPXA 3ABMC 4I0XB 4JAAA 3NR7A 3APQA 3QO5A 2ZXWC 1SERA 1QVFU 3QTCA 2YIBD 5LYJB 1ZTEA 1KC8W 2GSMB 4AHCA 4UVBA 2N05A 3JD4A 2CGOA 2Y69B 4K0KB 4HBNA 1NH2B 3N2GB 2F66C 1P4RA 4DR2B 3OTOO 2QWOB 4HZ3A 4DR7O 4FFBB 1GM9A 1GKFA 1R3IC 2KQXA 3S3WA 3F5TA 2XAQA 2PGGA 2H94A 3OEEG 5FPRA 1YI2V 4LH6A 5KHJA 2QM8A 3TGUH 2O57A 3OUFA 5GONB 4JI5O 1SQPH 1SQFA 3A0HZ 5E1AC 1Y4MA 2DYSB 3W7SA 4MTFA 4LR3A 4KL1A 4NB5A 3ABKB 4W4KA 1MSDA 4ABMA 4J7JA 1S72V 1K4CC 4LBEC 4QNHB 1DK1A 1SA0B 2Q67A 2WWWA 3ZMZA 1GN2A 1QLEC 1M9NA 4NXNB 2ZE8A 5IWAB 4X65O 5EBMC 3VQWA 5IYZB 4O4JA 1ENVA 2WLIB 5CB4B 4X89A 2XAGA 3G67A 5JCOC 2PI4A 2VWKA 2NLJC 1BCCH 4LF5O 2N04A 1FS0G 2RNBA 1LUVA 2F43G 4FLYA 4IT5A 5D5QA 4XDLA 1TGOA 1HDJA 5F2VO 1VIBA 2HR3A 2YI9A 2ZDIC 1DGSA 2Q9LA 4BIOA 2CE4A 2C2AA 2LP7A 3WU2Z 3B09A 4J80A 1NVPB 4LFAB 1GK9A 2UXDB 1QBZA 5EC1C 4MVZA 1NS1A 4UXNA 1RP3B 2P4KA 1W59A 4DUZO 3CRAA 3L9DA 3SJBC 2ZR2A 1B06A 1Y67A 4WF9V 1GN4A 4O2AA 3A0BZ 4B3RO 4HNAA 4X62B 1RM1B 5FPOA 1Y66A 3ASOB 2ADQB 2X6BA 1N34B 4O4JB 2WLLA 4FLWA 4B3MB 4JYAB 2DYRC 5JCOA 3ABMB 3J80N 4O4LA 2ZXWB 5IWAO 2QKSA 3LUTB 3OM3B 2ATKC 3IFXA 2OTJV 2IU3A 4YJ2A 3LSUA 1MZFA 1UJWB 5CBFA 4E4EA 3DXRA 2D2CB 4GX2A 2ZNIA 5E79Z 2ZDIA 1ZAUA 1JCHA 4JI4B 2IJKA 4BW5A 4LH7A 4DYLA 3UKMA 3SYOA 4PD4F 1K97A 2EZOA 4P9OA 2LJ2A 2XOKG 3L70H 1XILA 2YI8A 3HPLC 2LGQA 2PF4E 5FL7G 3FYIB 3F7YC 2QM7A 1AROP 3JAMN 4KHPB 3JSNA 4LFAO 4AI8A 3RYHA 4FLXA 3K04A 3K3WA 1YEWA 5ITZA 3K06A 4O2AB 3UO2A 4HNAB 1HNWB 3ZMSA 2ILMA 2ZD9A 3T1YO 2LW7A 3SJAC 3CCMV 5C93A 1QLEB 2JGDB 1VQ9V 1QVGU 1P49A 3DGEA 5IJ9A 2BOBC 4B08A 1N4CA 2JVDA 5LHGA 3ETGA 2WLLB 1FFXA 3A2FA 4QIWF 4O4LB 5HFMA 1YJ9V 3HKEA 3JYCA 2Q8VA 1KKDA 1VF5B 1TUBA 1R3JC 4UV8A 2FYUH 4H33A 4OGQB 3DXRB 4GKJB 2QSAA 3UT5A 2AXTZ 1SF9A 1VQKV 2WLKA 3FYEB 3JD3A 4K3AA 3BEHA 1TUEB 3TXQA 1HR0O 4X66O 3FKSG 3ASNC 1GMGA 4CS4A 4DRXA 2YXHA 3MD0A 2UUCB 5B3SC 5C8YA 3JD1A 4H44B 1H2MA 1Y6XA 2UUAO 1UFIA 1R73A 2A06H 4MW3A 1MNGA 2DWDC 4ZIBA 1DF5A 3RYHB 3RYCA 2IJHA 1D5NA 3K08A 1PL4A 5L3EA 3MHSC 3JAKA 4LF6B 5ITZB 3T4ZA 2RN9A 1L8DA 3S3XA 2FL4A 1IBKO 4TV8A 3W7XA 1N36B 1R6NA 1BMFG 2E5LO 2EIJC 2DMXA 1QR8A 4JASA 3ABUA 4DV7B 2ZCEA 4LFCB 3QVNA 3K5MA 5IJ9B 3JALA 2UU9O 4IYHA 3CCUV 4X20A 5IJ0A 2DYRB 2VRZA 2LFRA 4DW1A 5EK0A 3E89A 4LF4O 3JD0A 1FFXB 3GVMA 1RPRA 3IAYA 3HKEB 4G28B 3GB7C 2QKCA 4EFBA 3AG1C 2ZKOA 3JCUZ 1TUBB 4AILC 1OV9A 3E22A 4QE7A 1VQMV 2UXCB 2VQFO 1E79G 3C90A 2EBOA 1Z5WA 3UT5B 3WB0A 4LF9B 1FJGO 4BW9A 1KUQA 1WJZA 3ZS8C 1VF6C 2WLNA 4CZZA 4WFEA 1SQQH 5CBGA 2HVJC 4JI1B 1NU1H 1FD9A 4GKJO 4GZRB 4JZGA 4RO2A 2W6IG 4DRXB 3X2QC 2GTAA 1JFFA 5C8YB 3QO8A 3RT3C 4BIZA 2UXXA 3CCEV 5JJEB 5JH7A 3RYCB 2YIDA 1TVKA 4U7OA 3G80A 3JAKB 3GWKC 2K1EA 3WB1A 4UUJC 2OIGA 1SZTA 1BQZA 4YIPA 5LL6Y 4FJCC 2ZINA 3KCYA 4TV8B 5JVDA 4RQFA 4LF8B 2XUMA 3LDDA 1S5HC 3K9AA 2DWEC 3JALB 4PJ0Z 1Q5OA 4NYKA 2IJJA 3VOUA 2DW4A 5IJ0B 3E8HA 2GBOA 5DECA 4JV5B 5B66Z 1Q82W 4XBFA 3SPCA 2JIZG 1Q8IA 2YIAA 2Y4UA 2QTOA 2FMLA 4YY3B 2EILC 4MVSA 2YC0A 2UUBB 2ZIMA 4O2BA 3DC5A 3KG2A 4DR6B 2GV9A 3E22B 2CTQA 4RUEA 3DTUB 4LFBO 3TK1A 4AQYB 4D7TA 1VF6A 2HFEC 2IJIA 2WA4A 4WBNA 2YXYA 3QNEA 3ASNB 3L72H 3TXSA 5LXTA 3T4DA 5B3SB 1R6TA 5DM6V 2QDOA 3E8FA 3A8TA 1Q3EA 4JTCB 1VQ7V 1JFFB 3AK1A 4DUYO 4P9PA 1S5LZ 4FVMA 4PI0A 3SYQA 1ZSPA 4WFFA 1Z5VA 1M93A 2PUSA 3U0ZA 2HP8A 4JI1O 2JRIA 4OX9B 3RN4A 3AG2C 3OR6C 1GN3A 5JH7B 2EIKC 2FB5A 4FZ0A 4WFGA 4JYYA 4TQDA 4U3FH 3UO3A 3QF7A 4DV4B 4DR4B 5HFLA 5JVDB 1OJHA 1QHTA 2EIJB 3K0DA 5H6RA 2WLMA 1W0KG 2E74B 2BCCH 2RQ6A 3H1HH 4WFBV 1HNXB 2DQ3A 1YTFD 1OCOC 4JF3A 5IT9N 2B1GA 2Q0AA 4PDRA 3TJTA 2YIBA 3AG1B 1RFYA 3U11A 4MW8A 1GN6A 4X8AA 1XL4A 4J10A 3L74H 1PKXA 1NZ6A 3W7TA 1JQ0A 5J2UA 4DV0O 5A9GA 4I9QA 3ZRSA 2QWPB 4WBNB 3CXHF 1BSMA 3FX7A 4MVRA 5LXTB 1WA8A 3X2QB 1Q6HA 4I9WA 4MVQA 2VS0A 3K5LA 1SQGA 1D2DA 2UXBB 3P30A 5KHIA 3CP1A 3CHXA 3ZRWA 3SYAA 3F5WC 2YICA 2E76B 4D7SA 1KYOF 2QM4A 4DR3B 4DV5B 1EFRG 3OT7A 3N27A 2P06A 4EEQA 5LMNB 3T1HO 2P67A 1XEQA 4FLVA 4XDKA 5L3CA 3ZCCA 4JI7O 1Z2GA 2KKWA 5LMUB 5BXZA 4JPRA 3H1JH 2Q7EA 5GTIZ 3U10A 1XNRB 3SR2C 1B04A 1AI5A 4DXWA 1YJNV 4DV4O 4PDLA 4IYIA 1SQBH 4PHZA 2LW1A 4DV6O 1JJOA 4IIJA 1HNZB 2CTPA 4RUFA 4P30A 1JPXA 4MS2A 3CE2A 1J5EO 2EILB 1PD3A 4PA3A 4E2LA 2Z5UA 2PTMA 1AR4A 3LSSA 3CCLV 1WP8A 2A3QA 5GW7A 2QTSA 4ZOLA 5J2UB 1K9MW 1VQLV 1EZJA 3LSQA 1DF4A 2Z0AA 2EIMC 2LO1A 2KSDA 3OR7C 1WA8B 4KUMA 4DR1B 4GX1A 3AG4C 3W7UA 2VQEB 2IH3C 3KCXA 3EHBB 1NKDA 3CEIA 2DQ0A 1CP9A 3PJSK 3AG2B 1CEZA 1JR9A 3ZRWB 2EIKB 4FPPA 4PA4A 4JAVA 3SPHA 1HWYA 1VMGA 3MHHC 3G4SV 3ZN1A 5BMVA 4DV1B 4Z1VA 1OZ0A 1FFTB 1QCEA 3HKBA 4K0KO 4GCZA 5B5EZ 3BA9A 1VQ8V 4CH6A 3T2MA 2V4DA 4DV5O 4DR2O 1BGYH 1I94B 1T5EA 4I55A 3ZHRA 4TSFG 4IIJB 4B3TB 1OCOB 1BZKA 1NTZH 4MVOA 1P7GA 3H1LH 2P22C 3CX5F 3CRQA 2R9IA 3J7AU 3RVYA 3L73H 4H37A 4OPHA 3CWBH 1L0NH 1PNLA 1W2BU 1YCIA 2K9PA 4Z1MG 4ZOLB 1F51A 2MK3A 4GKKB 3E2EA 5IYDO 1AI6A 1XUQA 4UB8Z 3ZMVA 5CA0A 2CGNA 3LDEA 1AR1B 1E1QG 2ZE6A 5KHHA 4NXNO 3CD6V 3OMAB 1KD1W 4MTOA 2XAHA 5LGUA 1BS3A 1K92A 3I56V 1AP5A 1BE3H 1BT8A 3CSXA 2B9ZA 4HAMA 3RYIA 3QG5A 3CCSV 2YDEA 3WG7C 1L0LH 5D5PA 2Q0OC 3B40A 4BR6A 5BMVB 5AG2A 4I5SA 5LGNA 4WCEV 1WLEA 3HKBB 2ZE7A 2OWOA 2OCCC 4UVCA 5B1AC 2NR5A 1XMQB 2DE0X 3BVOA 2F93B 3GWOA 3R66A 1SESA 2IU0A 2KB1A 1XMOB 2W6JG 2UXDO 3ZHQA 1WP7A 2P7TC 4F6EA 5CBHA 1VF7A 1XDCA 4CH5A 1R3LC 2F4VB 4K8XA 1IXBA 5IYCO 3HKCA 3ZBHA 4JI0B 4R7CA 4FK5C 4X62O 4PA6A 1FXVA 2EIMB 3G6EV 1A32A 5CA0B 1AR5A 2LGWA 5J2TA 3AG4B 4TUYA 3K59A 4GKKO 1PM9A 3BPZA 3KKYA 1YZBA 1QNMA 3AK2A 1N34O 4YJ2B 3C3SA 1PV0A 4B3MO 1KKCA 3PN1A 1SC5B 4JYAO 2D3OW 2RDCA 3CS5A 2QGNA 4MSWC 1XNQB 5FLXN 5J9PC 4J7ZA 1GAXA 2AGAA 5L3DA 3RYIB 4EB6A 1X59A 3ETEA 2XHBA 1OCRC 3P32A 4TOIA 4JZ2A 1RSOA 1F7YA 5LP6C 3E8GA 3D8CA 4B3SB 2CDYA 3B4SA 4IGGA 3OAAG 4FM0A 4DR5B 1RPOA 4JI4O 2ITDC 5L3BA 3CB2A 3STZC 1O9GA 3BHPA 5CA3A 3ZHSA 2Q5ZA 5L3GA 3AG3C 1CXZB 3EXAA 1XMQO 1X4TA 3B8MA 2PZSA 4KHPO 2CH7A 3FD9A 2P90A 2GHYA 2ZT9B 4R50A 3HKCB 1AJNA 4LWSA 4LP8A 2NNUA 1F23A 1HNWO 2JK5C 1N8RW 1WB8A 1H8HG 4UCUA 3CRRA 3JD2A 2AHZA 1GM8A 2X6CA 2P5OA 4PI2A 3FB6C 2Q6AA 4UCRA 1VQOV 5J2TB 5LHIA 4TUYB 1XQ8A 1FXHA 4ZHQA 2R70A 2QJ1A 4J42A 4ICGA 1KQSU 3SJQC 2HHHB 3ZHUA 4Z2WA 2QKAA 4MVMA 3CCVV 4EB6B 3WG7B 4JI6B 5JJNB 1K5SA 5LP6A 1PPJH 1Q6UA 3BA8A 5B1OA 1Q7YW 4JI2B 1WPBA 2OCCB 2OIEA 4GT1A 5B1AB 3IGAC 3JARA 4CS3A 2YS8A 1N33B 4TV9A 1AI7A 5B1BC 4YHHB 2BOCC 4FFKA 2P4VA 4I4TA 3UCSC 2FKXA 3ABLC 5GTHZ 1IBMB 3TETA 1EM1A 1SETA 1UPGA 4B3SO 1KMIZ 4PDMA 1GM7A 2UUCO 1SKVA 4P2ZA 4YJ3A 1NR7A 2Y48A 3CPWU 4QE9A 5EBLC 4QPKA 3VQXA 1M1KW 4CH3A 2CH7B 3HR0A 1H8EG 4JI8B 2ZIOA 2ZNJA 1SZXA 4LF7B 5KHKA 4UVAA 4LF6O 4PA7A 3SYPA 4NKGB 4JI3B 4BAYA 3P3NA 2A0LA 4X20B 1LUWA 1N36O 3B8NA 4KXRA 1Q90D 2JEXA 3FB7C 5BR8B 1EN6A 4DV7O 4LFCO 1GRJA 4ZHQB 4DK0A 2QA4V 1OCCC 4EFEA 2BTOA 1ZL8A 2IM9A 4UB6Z 2WLJA 5EIBD 4QPJA 5B1NA 1IVSA 2RJZA 1QU7A 2W0FC 1N32B 3CRMA 1OCRB 4J7KA 3K58A 3EFFK 2JJ1G 2EJRA 2UXCO 2HHHO 2BE3A 3H01A 5EBWC 5LP6B 1IBLB 3BCCH 4RQEA 5EZYA 1N0JA 3L71H 4NXMB 3OE7G 5KA5A 4LF9O 2H3OA 5DN6G 3JARB 3E83A 2AHYA 3ETQA 4TV9B 5IE9A 1TAEA 4QJFB 3M8AA 4OXSA 1ROPA 4I4TB 5CMUA 3OW2U 5JQGA 3CC4V 2CAZC 2YUAA 1B3QA 5H5NA 4EKWA 4NTYA 3RBZA 3AG3B 5EYPA 1N33O 1K34A 1TVKB 5IYBO 2A7WA 2H8PC 4MTXA 1R1BA 4DV2B 4TWKA 2JS3A 4F6RA 4N21A 2OTLV 1S3JA 4J9ZB 3ZRXA 1EZVH 3OTOB 2Y4TA 3ZMTA 4DR7B 4XDJA 5LOVA 1H38A 1IDSA 2ETNA 1ZX3A 2HJFC 2QEXV 1WAZA 1PP9H 1QQCA 2JEUA 2V7QG 4CC6A 2BTQA 3RWRD 1Y76A 4LF8O 1VEWA 4J9YB 2G38A 3NXSA 3E86A 4JI5B 4U3JA 4FM1A 4O2BB 4JI3O 3RYFA 5LA6A 1K5QA 2F23A 1ZL8B 4JV5O 4GLXA 1JVMA 3D3IA 3OMIB 3AK3A 4YY3O 2UXNA 4A5UB 1NH2D 2UUBO 4DR6O 3CCQV 2YEVA 4G27B 4C7UA 1MZEA 5KMGA 4X65B 5EZYB 3H1IH 4ZBMA 2Q7HA 3OGIB 5B1BB 4X1IA 4DO2A 4AQYO 3E35A 5KHGA 2PI5A 2HG5C 1V9PA 2N74A 3AG7A 5JJJB 2Y0IA 3ABLB 5JQGB 4LF5B 3I5DA 4NTWA 2XAFA 1BQ0A 4I50A 1VQPV 1YTFB 1JA8A 5EYPB 3LNMB 3BFRA 3DC6A 1M5IA 1H2SB 5KAIZ 1HW7A 1G4YB 3D36C 1YF2A 2M6YA 4F6RB 1S76D 4OX9O 1S77D 2DN9A 2M7WA 3CC7V 2PYLA 3CMEV 5LOVB 4FZ1A 3KZIZ 2L35A 4CC5A 5K1XA 4DV2O 2QWNB 3R65A 4U7NA 1MABG 1BL8A 4FLUA 2BTQB 3B2EE 2LFSA 4DR4O 1Y76B 2AZ0A 2ITCC 4DUZB 1U96A 4K35A 3G6BA 1KBHA 4U3JB 3EVKA 1PNKA 1AP6A 1OCCB 1YITV 4JTAB 3RYFB 5LA6B 1HNXO 2IW5A 2QWRB 2X7RB 5KUKA 4B3RB 1WNSA 1Q86W 3JASA 1XHZA 2YEVB 1Y74A 4DW0A 2YXLA 2PYJA 5KMGB 4GX5A 3SPGA 1FAFA 3M7MX 3MAQA 2DJVA 3SJCC 4X1IB 2QE7G 4Q6GA 5EC2C 1NVPD 1GO3F 1VARA 4LCUC 4K8ZA 4I50B 1PNMA 3FB5C 2MW2B 3ZEDA 1ZLZA 4R8CA 3W7WA 2Q73A 1YJWV 3D36A 3CC2V 2UXBO 5LHHA 2XTAA 4GUNA 1H2LA 4I7ZB 1Q81W 1M90W 4KFMA 1THZA 2ARHA 1NTKH 3STLC 2X0LA 4DR3O 1MA1A 3C3TA 4X1YA 5LMNO 1I5YA 3L75H 1H2GA 3P3PA 3BAAA 3RGBA 1OHHG 5IDJA 5LMUO 4NTXA 4RWUA 1XNRO 2RMKB 1DTOA 4JAUA 1ZWIC 2HJDA 2HEPA 3K03A 3FB8C 1HNZO 1P7BA 1H2KA 5LGTA 1AI4A 4W4LA 1GTOA 3ETDA 3T1YB 2QR4A 3JASB 3F7VC 3LDCA 2OCHA 1Y74B 5H9CA 3ZJZA 1V55C 2X6AA 4HYOA 4JTDB 2PY5A 4OPAA 3A0RA 4IL6Z 2LQTA 2CTWA 4PA9A 2JGDA 4N23A 2Z3YA 4UFZA 1NQTA 4CBCA 3JSLA 4DR1O 5IY5C 3K9SA 2BSKA 1ZUQA 4X88A 1FYJA 4NXMO 2VQEO 3JAWA 3CRCA 3UQ8A 3N2KA 1XHXA 3O9OA 1COWG 2EZPA 2JDIG 1IXMA 4LC1A 3IC7A 4YIOA 1K3EA 1M56C 1NI8A 2AZ2A 5TISZ 1V54C 1LNQA 1HR0B 4X66B 1VQNV 2KG7A 2XAJA 1YDXA 1M57C 1CPYA 1TA8A 2F95B 3M99B 2EULA 4DV1O 4X1YB 3JCZA 4I55B 3LNNA 4L8JA 2UUAB 1I0HA 3OTFA 4FLZA 5KUMA 1SQXH 1G8MA 3CJHA 2QWQB 2B5UA 4DK1A 1QR9A 1YVWA 1I94O 4D6TH 4FM2A 3JATA 3ZIAG 1MG1A 1K73W 4B3TO 2JJ2G 1XI1A 1XOUA 4UV9A 2A79B 3CCRV 2WLHA 2XNDG 1OCZC 1IBKB 1FPOA 1KP2A 2OT5A 2RCVA 2E5LB 2EINC 4YXWG 1N0NA 2WPDG 3FFQA 2Q69A 1K33A 4IHJA 1EBOA 1P84F 3UM7A 2UU9B 1YSCA 1AJPA 3APOA 3WFVA 4LF4B 2VWJA 1U97A 2W0XA 2DOSA 3HB3B 1E1RG 1MSWD 1IURA 4JYBA 4WFHA 3BRCA 1Q6IA 2BSKB 4WFAV 4X1KA 1FXKC 1Q43A 2HVKC 1SQVH 5A2QN 3JAWB 2VQFB 1VP7A 3N2KB 3IC9A 1PL0A 1O9HA 2WA3A 1FJGB 3Q4HA 1URFA 5BZBA 1IZ3A 3OFNG 1YHQV 3E8BA 1F4MA 2GTSA 2KG7B 5BY1A 1I7FA 1I08A 5DEDA 3FAVA 1NT2B 4BWAA 2ZR3A 1R6KA 3IJ4A 2V1DA 3CJHB 5KA6A 2IH1C 3TCUA 4B7KA 4LNUA 5CA1A 2YSUB 1XREA 3QO7A 2P6JA 3JATB 3ZN0A 1IX9A 3K79A 1XMOO 1FKAO 1AB3A 4GX0A 5EIBC 3VQYA 1ORQC 3ZHVA 4CS2A 1AILA 3B77A 1V55B 2IBZH 3ML0A 2F4VO 2CTRA 1WB7A 4IHJB 3WB2A 3SPJA 1WN7A 2FTKA 1M4UA 5CN0A 1JOYA 4JI0O 3RVZA 5L3FA 4O4IA 2OYQA 1VQ6V 1AVMA 2Q68A 5KX5A 1S0VA 1US6A 4H13B 3OGCC 4FIPC 5IY5B 1B6QA 1KB9F 4MTGA 4PV1B 3ZX6A 1FXKA 4X1KB 4CH4A 1AJQA 4R6ZA 1KP3A 4UCVA 1M56B 3VBBA 1K8AW 4LFBB 3ICXA 2JS5A 1RSOB 3Q4HB 1V54B 3OUSA 1NBMG 1K7DA 1XNQO 1MMMA 2ADPA 1XL6A 1M57B 1F4NA 2ZM6B 3FAVB 4DUYB 1JMKC 3ZMUA 3CYOA 3H1KH 4TT3G 1LR1A 2GUZA 4UCSA 5JWPA 3RFRA 4DR5O 1EN5A 2EX3A 4KP4A 2CK3G 4LNUB 1YXBA 2R9RB 5CA1B 4PDVA 1NR1A 3RW0A 2XT9A 1JJ2U 1OCZB 4LWSB 1QLNA 1NTMH 2Y69C 2EINB 1VQ5V 2JGUA 4L87A 1W0JG 3HKDA 4J41A 2E3CA 1KECA 3VQVA 2ZE5A 4F4LA 5K1PA 4O4IB 5H2FZ 3K0GA 3T1CA 5FNVA 1R3KC 4RAIA 4BIUA 5KX5B 1G6UA 2HLDG 1K4DC 3DSQA 1J95A 1SS3A 4JGSA 3SGIA 1JX9A 1KU9A 1GH6A 1EN4A 1DLBA 2B1IA 2GDSA 5LBQA 4ZI7A 1FXKB 2NN4A 4X64B 4DV3B 3I55V 4UCTA 1G1XB 3BY6A 2DYSC 3ZHTA 4DV0B 3H9VA 4O4HA 3ABKC 3D3QA 3SPIA 3OEHG 4MT8A 2AW9A 4TQFA 2ZQMA 2XASA 4JI6O 3CCJV 2L6LA 3CMAV 2E75B 3J81N 4JI2O 3OD4A 2GUZB 1HP8A 4B7EA 2ODMA 4YJ3B 2ZM6O 4YHHO 4I0XA 5KAFZ 4MVUA 4JYCA 4NVPA 4Q20A 1IBMO 5LYJA 2CUGA 3SDLA 4ZKIA 3K57A 1YIJV 3T1HB 2Y0PA 4GYCB 1BHBA 3SYCA 4JI7B 4PELA 4UCOA 3N2GA 3HKDB 4FMTA 4X9QA 3ABTA 4G2KA 3K5NA 4JI8O 2WSSG 1VQ4V 4LF7O 4FFBA 4DV6B 1SRYA 5FNVB 3MDSA 2A9HA 4FLTA 1J5EB 2Q7GA 1D5AA 1BHAA 1NJIW 5BR8O 3AEIA 4ZI7B 1H2NA 5GONA 4ASUG 4NR1A 2R9AA 1MOFA 3G71V 5H6QA 2F1MA 1XBLA 3K5OA 4O4HB 2R72A 1RM1C 5KLVH 2Q4PA 1L1FA 3ZRVA 4X64O 1N32O 2HKOA 4QGPA 1SA0A 4J11A 3BABA 3O65A 3CXCU 4DV3O 4H0LB 2WAMA 3ASOC 1IBLO 5IYZA 3OMNB 1I5XA 2EJ7A
chains in the Genus database with same CATH topology
3ETEA 2WLIA 3FB8C 1OCRC 3P32A 1P7BA 1S5HC 1WPXA 3K9AA 5LGTA 2DWEC 3ABMC 1AI4A 3QO5A 1GTOA 2IJJA 3ETDA 2ZXWC 3E8GA 3VOUA 2DW4A 1SERA 3F7VC 1QVFU 3E8HA 3LDCA 1KC8W 3OAAG 1Q82W 5H9CA 3SPCA 2GSMB 4XBFA 1RPOA 1V55C 2JIZG 2X6AA 4HYOA 3ZJZA 2ITDC 2QTOA 4UVBA 5L3BA 3JD4A 4JTDB 2Y69B 3STZC 2EILC 1NH2B 4MVSA 5CA3A 3KG2A 3A0RA 1P4RA 5L3GA 4PA9A 3AG3C 4N23A 2Z3YA 4HZ3A 4RUEA 3DTUB 1NQTA 4CBCA 1GM9A 3B8MA 1GKFA 1R3IC 3TK1A 5IY5C 4X88A 2HFEC 2IJIA 2XAQA 2P90A 2GHYA 3QNEA 3ASNB 2H94A 4R50A 1COWG 2EZPA 1AJNA 1IXMA 2JDIG 3OEEG 4LC1A 3IC7A 1YI2V 2QM8A 1K3EA 1M56C 4LP8A 3T4DA 2NNUA 5B3SB 3OUFA 5DM6V 1F23A 3E8FA 4JTCB 1VQ7V 2JK5C 1V54C 1N8RW 1LNQA 1H8HG 3JD2A 4P9PA 1VQNV 2AHZA 1GM8A 2X6CA 2XAJA 4WFFA 5E1AC 3SYQA 1Y4MA 3FB6C 2DYSB 3W7SA 1M57C 2Q6AA 1CPYA 4MTFA 1VQOV 5LHIA 3M99B 3ABKB 3JCZA 1FXHA 3AG2C 3OR6C 1S72V 2EIKC 1K4CC 4LBEC 4QNHB 2Q67A 2WWWA 1KQSU 4WFGA 3SJQC 3ZMZA 5KUMA 1QLEC 1M9NA 1G8MA 2B5UA 5EBMC 1QR9A 4MVMA 5HFLA 3CCVV 1ENVA 2EIJB 3K0DA 3WG7B 3ZIAG 2WLIB 1MG1A 1K73W 2JJ2G 4X89A 2XAGA 1K5SA 5H6RA 2WLMA 1W0KG 5B1OA 4UV9A 2PI4A 1Q7YW 2A79B 3CCRV 2WLHA 2XNDG 2NLJC 1OCZC 2OCCB 1KP2A 2OT5A 4GT1A 5B1AB 1FS0G 3IGAC 4WFBV 2EINC 1AI7A 2F43G 4YXWG 2WPDG 5B1BC 2DQ3A 1YTFD 2Q69A 1OCOC 1K33A 4JF3A 4XDLA 2BOCC 1EBOA 2B1GA 3UM7A 4PDRA 3AG1B 3ABLC 3TETA 1YSCA 1SETA 1AJPA 3WFVA 3LDDA 4MW8A 4PDMA 1GM7A 2HR3A 2ZDIC 4P2ZA 1NR7A 4X8AA 1XL4A 2Y48A 3HB3B 1E1RG 3CPWU 4QE9A 1MSWD 1PKXA 4QPKA 5EBLC 3W7TA 2C2AA 1JQ0A 2LP7A 4JYBA 4WFHA 1NVPB 1M1KW 4WFAV 1GK9A 1QBZA 5EC1C 3ZRSA 1H8EG 1FXKC 2HVKC 4MVZA 4MVRA 4UXNA 1PL0A 4UVAA 3X2QB 4I9WA 5BZBA 4PA7A 4MVQA 3OFNG 3SYPA 1YHQV 3E8BA 1F4MA 4BAYA 2A0LA 2ZR2A 3B8NA 4WF9V 2JEXA 3FB7C 3P30A 3CP1A 3ZRWA 3SYAA 1RM1B 3F5WC 2ZR3A 2QA4V 1OCCC 1R6KA 1EFRG 2V1DA 5KA6A 1Y66A 2IH1C 3TCUA 3ASOB 2WLJA 2P67A 4QPJA 4XDKA 5L3CA 5B1NA 3ZCCA 2X6BA 2W0FC 2YSUB 3QO7A 2P6JA 4JPRA 2WLLA 1OCRB 3ZN0A 3K79A 3EFFK 2JJ1G 2DYRC 2EJRA 4GX0A 3ABMB 3H01A 5EBWC 1AI5A 1ORQC 2ZXWB 4DXWA 4RQEA 1YJNV 2QKSA 3LUTB 4PDLA 3OM3B 2ATKC 3IFXA 3B77A 3OE7G 5KA5A 5DN6G 2OTJV 3E83A 2AHYA 2IU3A 4RUFA 4P30A 1JPXA 1V55B 3ML0A 1UJWB 4MS2A 4QJFB 3SPJA 5CBFA 2FTKA 2EILB 4OXSA 1PD3A 1ROPA 5CMUA 3OW2U 3CC4V 5CN0A 1JOYA 4GX2A 4PA3A 4E2LA 3RVZA 5L3FA 2Z5UA 4EKWA 3RBZA 3AG3B 2ZDIA 1VQ6V 1JCHA 3LSSA 2IJKA 2Q68A 3CCLV 1K34A 4BW5A 1S0VA 5IYBO 2H8PC 4MTXA 3UKMA 3SYOA 5GW7A 3OGCC 4TWKA 4FIPC 5IY5B 1K97A 1B6QA 2EZOA 4P9OA 4N21A 4MTGA 1K9MW 1VQLV 2OTLV 1EZJA 1S3JA 2XOKG 4J9ZB 1FXKA 1AJQA 3HPLC 3ZRXA 5FL7G 3FYIB 3ZMTA 3LSQA 4R6ZA 1DF4A 2EIMC 4XDJA 1KP3A 1H38A 1M56B 3VBBA 1K8AW 3F7YC 3OR7C 4KUMA 4GX1A 2QM7A 1AROP 2HJFC 1V54B 2QEXV 3AG4C 3OUSA 1NBMG 1K7DA 2JEUA 2V7QG 3W7UA 1XL6A 2IH3C 1M57B 3K04A 3K3WA 1F4NA 3EHBB 1NKDA 2DQ0A 1CP9A 3K06A 4J9YB 3PJSK 3AG2B 3NXSA 1CEZA 3E86A 3ZRWB 2EIKB 3ZMUA 3CYOA 4FPPA 4PA4A 4JAVA 3SPHA 3ZMSA 2ZD9A 4TT3G 3CCMV 1HWYA 1K5QA 5C93A 1QLEB 3MHHC 3G4SV 1VQ9V 3ZN1A 1QVGU 1JVMA 3D3IA 3OMIB 1OZ0A 1FFTB 1QCEA 3DGEA 4KP4A 2CK3G 2BOBC 2R9RB 4GCZA 2UXNA 4PDVA 5LHGA 1NR1A 3RW0A 1NH2D 3ETGA 2WLLB 1VQ8V 3CCQV 3T2MA 2YEVA 4G27B 1JJ2U 4QIWF 1OCZB 5HFMA 1YJ9V 1QLNA 3JYCA 4ZBMA 2Y69C 2EINB 1VQ5V 1KKDA 4L87A 4TSFG 5B1BB 1W0JG 4DO2A 1OCOB 3E35A 1R3JC 2PI5A 2HG5C 4UV8A 4H33A 4MVOA 1KECA 3ABLB 4F4LA 2XAFA 3K0GA 2R9IA 1VQKV 2WLKA 1VQPV 3T1CA 1YTFB 3RVYA 3FYEB 3JD3A 1R3KC 3LNMB 4H37A 4RAIA 4BIUA 1PNLA 3BEHA 1TUEB 2HLDG 1K4DC 1J95A 1W2BU 4JGSA 4Z1MG 3FKSG 3ASNC 1GMGA 1G4YB 1JX9A 1F51A 1S76D 2MK3A 3E2EA 1DLBA 2B1IA 5LBQA 1FXKB 1S77D 3MD0A 5B3SC 2M7WA 3CC7V 5IYDO 3CMEV 3JD1A 3I55V 1AI6A 3ZMVA 3BY6A 3LDEA 2DYSC 1AR1B 1E1QG 3R65A 4U7NA 1R73A 1MABG 4MW3A 1BL8A 3ABKC 3SPIA 2DWDC 3OEHG 1DF5A 4MT8A 3CD6V 2LFSA 3OMAB 2IJHA 3K08A 5L3EA 1KD1W 4MTOA 2XAHA 3MHSC 5LGUA 1K92A 2ZQMA 3I56V 2XASA 2ITCC 3T4ZA 3CCJV 3CMAV 1PNKA 1OCCB 4HAMA 3W7XA 1YITV 1R6NA 4JTAB 3CCSV 1BMFG 2IW5A 2EIJC 3WG7C 1QR8A 4JASA 2X7RB 5KUKA 3ABUA 4I5SA 5LGNA 4WCEV 1WLEA 4MVUA 4JYCA 3CCUV 1Q86W 4Q20A 2OCCC 4UVCA 2DYRB 5B1AC 2LFRA 5EK0A 2YEVB 3E89A 4ZKIA 3JD0A 1RPRA 1YIJV 4GX5A 1BHBA 3GWOA 4G28B 3SPGA 3SYCA 3GB7C 4PELA 1SESA 3AG1C 2IU0A 2KB1A 2QE7G 4FMTA 2W6JG 5EC2C 3ABTA 4G2KA 1NVPD 4QE7A 1VQMV 1GO3F 1E79G 4LCUC 2WSSG 2EBOA 1VQ4V 2P7TC 5CBHA 1SRYA 1PNMA 1R3LC 3FB5C 2A9HA 2WLNA 4CZZA 4R8CA 3W7WA 4WFEA 5IYCO 5CBGA 2HVJC 1YJWV 1BHAA 3D36A 3CC2V 5LHHA 1NJIW 4RO2A 2W6IG 3AEIA 4R7CA 4FK5C 3X2QC 4PA6A 1Q81W 1FXVA 2EIMB 1M90W 4KFMA 1THZA 3QO8A 4ASUG 4BIZA 1MOFA 3G71V 3G6EV 3STLC 2UXXA 5H6QA 2X0LA 3CCEV 3AG4B 1I5YA 1H2GA 1RM1C 1OHHG 4U7OA 1L1FA 3ZRVA 5IDJA 2HKOA 2K1EA 3CXCU 4UUJC 1SZTA 2WAMA 2D3OW 4MSWC 3ASOC 5J9PC 1DTOA 4FJCC 1ZWIC 4JAUA 3OMNB 5L3DA 4RQFA 1I5XA 3K03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 V;  3G6E V;  1JJ2 U;  5DM6 V;  3CD6 V;  1K9M W;  2QA4 V;  3CCU V;  1VQ7 V;  1VQL V;  1Q86 W;  1N8R W;  1VQ4 V;  3CCE V;  2OTL V;  2OTJ V;  1KD1 W;  3CCV V;  1YJ9 V;  1W2B U;  1VQN V;  3I56 V;  1VQ5 V;  1K73 W;  3CCM V;  1VQO V;  3OW2 U;  3CC4 V;  3CCJ V;  1YHQ V;  1YIJ V;  1K8A W;  1QVF U;  1YJW V;  3G4S V;  1VQ9 V;  3CMA V;  1QVG U;  3CC2 V;  3CC7 V;  1NJI W;  3CXC U;  1Q7Y W;  3CME V;  3CPW U;  3CCR V;  1Q82 W;  1KC8 W;  2QEX V;  1YIT V;  3I55 V;  4WF9 V;  1S72 V;  2D3O W;  1VQ6 V;  3CCS V;  3CCL V;  4WFB V;  1M1K W;  1Q81 W;  1VQM V;  4WFA V;  1YI2 V;  4WCE V;  1VQK V;  1R73 A;  1M90 W;  1KQS U;  1YJN V;  1VQP V;  1VQ8 V;  3CCQ V; 
#chains in the Genus database with same CATH topology
 2WLI A;  5CB4 A;  3THO A;  1S5J A;  1WPX A;  3ABM C;  4I0X B;  4JAA A;  3NR7 A;  3APQ A;  3QO5 A;  2ZXW C;  1SER A;  1QVF U;  3QTC A;  2YIB D;  5LYJ B;  1ZTE A;  1KC8 W;  2GSM B;  4AHC A;  4UVB A;  2N05 A;  3JD4 A;  2CGO A;  2Y69 B;  4K0K B;  4HBN A;  1NH2 B;  3N2G B;  2F66 C;  1P4R A;  4DR2 B;  3OTO O;  2QWO B;  4HZ3 A;  4DR7 O;  4FFB B;  1GM9 A;  1GKF A;  1R3I C;  2KQX A;  3S3W A;  3F5T A;  2XAQ A;  2PGG A;  2H94 A;  3OEE G;  5FPR A;  1YI2 V;  4LH6 A;  5KHJ A;  2QM8 A;  3TGU H;  2O57 A;  3OUF A;  5GON B;  4JI5 O;  1SQP H;  1SQF A;  3A0H Z;  5E1A C;  1Y4M A;  2DYS B;  3W7S A;  4MTF A;  4LR3 A;  4KL1 A;  4NB5 A;  3ABK B;  4W4K A;  1MSD A;  4ABM A;  4J7J A;  1S72 V;  1K4C C;  4LBE C;  4QNH B;  1DK1 A;  1SA0 B;  2Q67 A;  2WWW A;  3ZMZ A;  1GN2 A;  1QLE C;  1M9N A;  4NXN B;  2ZE8 A;  5IWA B;  4X65 O;  5EBM C;  3VQW A;  5IYZ B;  4O4J A;  1ENV A;  2WLI B;  5CB4 B;  4X89 A;  2XAG A;  3G67 A;  5JCO C;  2PI4 A;  2VWK A;  2NLJ C;  1BCC H;  4LF5 O;  2N04 A;  1FS0 G;  2RNB A;  1LUV A;  2F43 G;  4FLY A;  4IT5 A;  5D5Q A;  4XDL A;  1TGO A;  1HDJ A;  5F2V O;  1VIB A;  2HR3 A;  2YI9 A;  2ZDI C;  1DGS A;  2Q9L A;  4BIO A;  2CE4 A;  2C2A A;  2LP7 A;  3WU2 Z;  3B09 A;  4J80 A;  1NVP B;  4LFA B;  1GK9 A;  2UXD B;  1QBZ A;  5EC1 C;  4MVZ A;  1NS1 A;  4UXN A;  1RP3 B;  2P4K A;  1W59 A;  4DUZ O;  3CRA A;  3L9D A;  3SJB C;  2ZR2 A;  1B06 A;  1Y67 A;  4WF9 V;  1GN4 A;  4O2A A;  3A0B Z;  4B3R O;  4HNA A;  4X62 B;  1RM1 B;  5FPO A;  1Y66 A;  3ASO B;  2ADQ B;  2X6B A;  1N34 B;  4O4J B;  2WLL A;  4FLW A;  4B3M B;  4JYA B;  2DYR C;  5JCO A;  3ABM B;  3J80 N;  4O4L A;  2ZXW B;  5IWA O;  2QKS A;  3LUT B;  3OM3 B;  2ATK C;  3IFX A;  2OTJ V;  2IU3 A;  4YJ2 A;  3LSU A;  1MZF A;  1UJW B;  5CBF A;  4E4E A;  3DXR A;  2D2C B;  4GX2 A;  2ZNI A;  5E79 Z;  2ZDI A;  1ZAU A;  1JCH A;  4JI4 B;  2IJK A;  4BW5 A;  4LH7 A;  4DYL A;  3UKM A;  3SYO A;  4PD4 F;  1K97 A;  2EZO A;  4P9O A;  2LJ2 A;  2XOK G;  3L70 H;  1XIL A;  2YI8 A;  3HPL C;  2LGQ A;  2PF4 E;  5FL7 G;  3FYI B;  3F7Y C;  2QM7 A;  1ARO P;  3JAM N;  4KHP B;  3JSN A;  4LFA O;  4AI8 A;  3RYH A;  4FLX A;  3K04 A;  3K3W A;  1YEW A;  5ITZ A;  3K06 A;  4O2A B;  3UO2 A;  4HNA B;  1HNW B;  3ZMS A;  2ILM A;  2ZD9 A;  3T1Y O;  2LW7 A;  3SJA C;  3CCM V;  5C93 A;  1QLE B;  2JGD B;  1VQ9 V;  1QVG U;  1P49 A;  3DGE A;  5IJ9 A;  2BOB C;  4B08 A;  1N4C A;  2JVD A;  5LHG A;  3ETG A;  2WLL B;  1FFX A;  3A2F A;  4QIW F;  4O4L B;  5HFM A;  1YJ9 V;  3HKE A;  3JYC A;  2Q8V A;  1KKD A;  1VF5 B;  1TUB A;  1R3J C;  4UV8 A;  2FYU H;  4H33 A;  4OGQ B;  3DXR B;  4GKJ B;  2QSA A;  3UT5 A;  2AXT Z;  1SF9 A;  1VQK V;  2WLK A;  3FYE B;  3JD3 A;  4K3A A;  3BEH A;  1TUE B;  3TXQ A;  1HR0 O;  4X66 O;  3FKS G;  3ASN C;  1GMG A;  4CS4 A;  4DRX A;  2YXH A;  3MD0 A;  2UUC B;  5B3S C;  5C8Y A;  3JD1 A;  4H44 B;  1H2M A;  1Y6X A;  2UUA O;  1UFI A;  1R73 A;  2A06 H;  4MW3 A;  1MNG A;  2DWD C;  4ZIB A;  1DF5 A;  3RYH B;  3RYC A;  2IJH A;  1D5N A;  3K08 A;  1PL4 A;  5L3E A;  3MHS C;  3JAK A;  4LF6 B;  5ITZ B;  3T4Z A;  2RN9 A;  1L8D A;  3S3X A;  2FL4 A;  1IBK O;  4TV8 A;  3W7X A;  1N36 B;  1R6N A;  1BMF G;  2E5L O;  2EIJ C;  2DMX A;  1QR8 A;  4JAS A;  3ABU A;  4DV7 B;  2ZCE A;  4LFC B;  3QVN A;  3K5M A;  5IJ9 B;  3JAL A;  2UU9 O;  4IYH A;  3CCU V;  4X20 A;  5IJ0 A;  2DYR B;  2VRZ A;  2LFR A;  4DW1 A;  5EK0 A;  3E89 A;  4LF4 O;  3JD0 A;  1FFX B;  3GVM A;  1RPR A;  3IAY A;  3HKE B;  4G28 B;  3GB7 C;  2QKC A;  4EFB A;  3AG1 C;  2ZKO A;  3JCU Z;  1TUB B;  4AIL C;  1OV9 A;  3E22 A;  4QE7 A;  1VQM V;  2UXC B;  2VQF O;  1E79 G;  3C90 A;  2EBO A;  1Z5W A;  3UT5 B;  3WB0 A;  4LF9 B;  1FJG O;  4BW9 A;  1KUQ A;  1WJZ A;  3ZS8 C;  1VF6 C;  2WLN A;  4CZZ A;  4WFE A;  1SQQ H;  5CBG A;  2HVJ C;  4JI1 B;  1NU1 H;  1FD9 A;  4GKJ O;  4GZR B;  4JZG A;  4RO2 A;  2W6I G;  4DRX B;  3X2Q C;  2GTA A;  1JFF A;  5C8Y B;  3QO8 A;  3RT3 C;  4BIZ A;  2UXX A;  3CCE V;  5JJE B;  5JH7 A;  3RYC B;  2YID A;  1TVK A;  4U7O A;  3G80 A;  3JAK B;  3GWK C;  2K1E A;  3WB1 A;  4UUJ C;  2OIG A;  1SZT A;  1BQZ A;  4YIP A;  5LL6 Y;  4FJC C;  2ZIN A;  3KCY A;  4TV8 B;  5JVD A;  4RQF A;  4LF8 B;  2XUM A;  3LDD A;  1S5H C;  3K9A A;  2DWE C;  3JAL B;  4PJ0 Z;  1Q5O A;  4NYK A;  2IJJ A;  3VOU A;  2DW4 A;  5IJ0 B;  3E8H A;  2GBO A;  5DEC A;  4JV5 B;  5B66 Z;  1Q82 W;  4XBF A;  3SPC A;  2JIZ G;  1Q8I A;  2YIA A;  2Y4U A;  2QTO A;  2FML A;  4YY3 B;  2EIL C;  4MVS A;  2YC0 A;  2UUB B;  2ZIM A;  4O2B A;  3DC5 A;  3KG2 A;  4DR6 B;  2GV9 A;  3E22 B;  2CTQ A;  4RUE A;  3DTU B;  4LFB O;  3TK1 A;  4AQY B;  4D7T A;  1VF6 A;  2HFE C;  2IJI A;  2WA4 A;  4WBN A;  2YXY A;  3QNE A;  3ASN B;  3L72 H;  3TXS A;  5LXT A;  3T4D A;  5B3S B;  1R6T A;  5DM6 V;  2QDO A;  3E8F A;  3A8T A;  1Q3E A;  4JTC B;  1VQ7 V;  1JFF B;  3AK1 A;  4DUY O;  4P9P A;  1S5L Z;  4FVM A;  4PI0 A;  3SYQ A;  1ZSP A;  4WFF A;  1Z5V A;  1M93 A;  2PUS A;  3U0Z A;  2HP8 A;  4JI1 O;  2JRI A;  4OX9 B;  3RN4 A;  3AG2 C;  3OR6 C;  1GN3 A;  5JH7 B;  2EIK C;  2FB5 A;  4FZ0 A;  4WFG A;  4JYY A;  4TQD A;  4U3F H;  3UO3 A;  3QF7 A;  4DV4 B;  4DR4 B;  5HFL A;  5JVD B;  1OJH A;  1QHT A;  2EIJ B;  3K0D A;  5H6R A;  2WLM A;  1W0K G;  2E74 B;  2BCC H;  2RQ6 A;  3H1H H;  4WFB V;  1HNX B;  2DQ3 A;  1YTF D;  1OCO C;  4JF3 A;  5IT9 N;  2B1G A;  2Q0A A;  4PDR A;  3TJT A;  2YIB A;  3AG1 B;  1RFY A;  3U11 A;  4MW8 A;  1GN6 A;  4X8A A;  1XL4 A;  4J10 A;  3L74 H;  1PKX A;  1NZ6 A;  3W7T A;  1JQ0 A;  5J2U A;  4DV0 O;  5A9G A;  4I9Q A;  3ZRS A;  2QWP B;  4WBN B;  3CXH F;  1BSM A;  3FX7 A;  4MVR A;  5LXT B;  1WA8 A;  3X2Q B;  1Q6H A;  4I9W A;  4MVQ A;  2VS0 A;  3K5L A;  1SQG A;  1D2D A;  2UXB B;  3P30 A;  5KHI A;  3CP1 A;  3CHX A;  3ZRW A;  3SYA A;  3F5W C;  2YIC A;  2E76 B;  4D7S A;  1KYO F;  2QM4 A;  4DR3 B;  4DV5 B;  1EFR G;  3OT7 A;  3N27 A;  2P06 A;  4EEQ A;  5LMN B;  3T1H O;  2P67 A;  1XEQ A;  4FLV A;  4XDK A;  5L3C A;  3ZCC A;  4JI7 O;  1Z2G A;  2KKW A;  5LMU B;  5BXZ A;  4JPR A;  3H1J H;  2Q7E A;  5GTI Z;  3U10 A;  1XNR B;  3SR2 C;  1B04 A;  1AI5 A;  4DXW A;  1YJN V;  4DV4 O;  4PDL A;  4IYI A;  1SQB H;  4PHZ A;  2LW1 A;  4DV6 O;  1JJO A;  4IIJ A;  1HNZ B;  2CTP A;  4RUF A;  4P30 A;  1JPX A;  4MS2 A;  3CE2 A;  1J5E O;  2EIL B;  1PD3 A;  4PA3 A;  4E2L A;  2Z5U A;  2PTM A;  1AR4 A;  3LSS A;  3CCL V;  1WP8 A;  2A3Q A;  5GW7 A;  2QTS A;  4ZOL A;  5J2U B;  1K9M W;  1VQL V;  1EZJ A;  3LSQ A;  1DF4 A;  2Z0A A;  2EIM C;  2LO1 A;  2KSD A;  3OR7 C;  1WA8 B;  4KUM A;  4DR1 B;  4GX1 A;  3AG4 C;  3W7U A;  2VQE B;  2IH3 C;  3KCX A;  3EHB B;  1NKD A;  3CEI A;  2DQ0 A;  1CP9 A;  3PJS K;  3AG2 B;  1CEZ A;  1JR9 A;  3ZRW B;  2EIK B;  4FPP A;  4PA4 A;  4JAV A;  3SPH A;  1HWY A;  1VMG A;  3MHH C;  3G4S V;  3ZN1 A;  5BMV A;  4DV1 B;  4Z1V A;  1OZ0 A;  1FFT B;  1QCE A;  3HKB A;  4K0K O;  4GCZ A;  5B5E Z;  3BA9 A;  1VQ8 V;  4CH6 A;  3T2M A;  2V4D A;  4DV5 O;  4DR2 O;  1BGY H;  1I94 B;  1T5E A;  4I55 A;  3ZHR A;  4TSF G;  4IIJ B;  4B3T B;  1OCO B;  1BZK A;  1NTZ H;  4MVO A;  1P7G A;  3H1L H;  2P22 C;  3CX5 F;  3CRQ A;  2R9I A;  3J7A U;  3RVY A;  3L73 H;  4H37 A;  4OPH A;  3CWB H;  1L0N H;  1PNL A;  1W2B U;  1YCI A;  2K9P A;  4Z1M G;  4ZOL B;  1F51 A;  2MK3 A;  4GKK B;  3E2E A;  5IYD O;  1AI6 A;  1XUQ A;  4UB8 Z;  3ZMV A;  5CA0 A;  2CGN A;  3LDE A;  1AR1 B;  1E1Q G;  2ZE6 A;  5KHH A;  4NXN O;  3CD6 V;  3OMA B;  1KD1 W;  4MTO A;  2XAH A;  5LGU A;  1BS3 A;  1K92 A;  3I56 V;  1AP5 A;  1BE3 H;  1BT8 A;  3CSX A;  2B9Z A;  4HAM A;  3RYI A;  3QG5 A;  3CCS V;  2YDE A;  3WG7 C;  1L0L H;  5D5P A;  2Q0O C;  3B40 A;  4BR6 A;  5BMV B;  5AG2 A;  4I5S A;  5LGN A;  4WCE V;  1WLE A;  3HKB B;  2ZE7 A;  2OWO A;  2OCC C;  4UVC A;  5B1A C;  2NR5 A;  1XMQ B;  2DE0 X;  3BVO A;  2F93 B;  3GWO A;  3R66 A;  1SES A;  2IU0 A;  2KB1 A;  1XMO B;  2W6J G;  2UXD O;  3ZHQ A;  1WP7 A;  2P7T C;  4F6E A;  5CBH A;  1VF7 A;  1XDC A;  4CH5 A;  1R3L C;  2F4V B;  4K8X A;  1IXB A;  5IYC O;  3HKC A;  3ZBH A;  4JI0 B;  4R7C A;  4FK5 C;  4X62 O;  4PA6 A;  1FXV A;  2EIM B;  3G6E V;  1A32 A;  5CA0 B;  1AR5 A;  2LGW A;  5J2T A;  3AG4 B;  4TUY A;  3K59 A;  4GKK O;  1PM9 A;  3BPZ A;  3KKY A;  1YZB A;  1QNM A;  3AK2 A;  1N34 O;  4YJ2 B;  3C3S A;  1PV0 A;  4B3M O;  1KKC A;  3PN1 A;  1SC5 B;  4JYA O;  2D3O W;  2RDC A;  3CS5 A;  2QGN A;  4MSW C;  1XNQ B;  5FLX N;  5J9P C;  4J7Z A;  1GAX A;  2AGA A;  5L3D A;  3RYI B;  4EB6 A;  1X59 A;  3ETE A;  2XHB A;  1OCR C;  3P32 A;  4TOI A;  4JZ2 A;  1RSO A;  1F7Y A;  5LP6 C;  3E8G A;  3D8C A;  4B3S B;  2CDY A;  3B4S A;  4IGG A;  3OAA G;  4FM0 A;  4DR5 B;  1RPO A;  4JI4 O;  2ITD C;  5L3B A;  3CB2 A;  3STZ C;  1O9G A;  3BHP A;  5CA3 A;  3ZHS A;  2Q5Z A;  5L3G A;  3AG3 C;  1CXZ B;  3EXA A;  1XMQ O;  1X4T A;  3B8M A;  2PZS A;  4KHP O;  2CH7 A;  3FD9 A;  2P90 A;  2GHY A;  2ZT9 B;  4R50 A;  3HKC B;  1AJN A;  4LWS A;  4LP8 A;  2NNU A;  1F23 A;  1HNW O;  2JK5 C;  1N8R W;  1WB8 A;  1H8H G;  4UCU A;  3CRR A;  3JD2 A;  2AHZ A;  1GM8 A;  2X6C A;  2P5O A;  4PI2 A;  3FB6 C;  2Q6A A;  4UCR A;  1VQO V;  5J2T B;  5LHI A;  4TUY B;  1XQ8 A;  1FXH A;  4ZHQ A;  2R70 A;  2QJ1 A;  4J42 A;  4ICG A;  1KQS U;  3SJQ C;  2HHH B;  3ZHU A;  4Z2W A;  2QKA A;  4MVM A;  3CCV V;  4EB6 B;  3WG7 B;  4JI6 B;  5JJN B;  1K5S A;  5LP6 A;  1PPJ H;  1Q6U A;  3BA8 A;  5B1O A;  1Q7Y W;  4JI2 B;  1WPB A;  2OCC B;  2OIE A;  4GT1 A;  5B1A B;  3IGA C;  3JAR A;  4CS3 A;  2YS8 A;  1N33 B;  4TV9 A;  1AI7 A;  5B1B C;  4YHH B;  2BOC C;  4FFK A;  2P4V A;  4I4T A;  3UCS C;  2FKX A;  3ABL C;  5GTH Z;  1IBM B;  3TET A;  1EM1 A;  1SET A;  1UPG A;  4B3S O;  1KMI Z;  4PDM A;  1GM7 A;  2UUC O;  1SKV A;  4P2Z A;  4YJ3 A;  1NR7 A;  2Y48 A;  3CPW U;  4QE9 A;  5EBL C;  4QPK A;  3VQX A;  1M1K W;  4CH3 A;  2CH7 B;  3HR0 A;  1H8E G;  4JI8 B;  2ZIO A;  2ZNJ A;  1SZX A;  4LF7 B;  5KHK A;  4UVA A;  4LF6 O;  4PA7 A;  3SYP A;  4NKG B;  4JI3 B;  4BAY A;  3P3N A;  2A0L A;  4X20 B;  1LUW A;  1N36 O;  3B8N A;  4KXR A;  1Q90 D;  2JEX A;  3FB7 C;  5BR8 B;  1EN6 A;  4DV7 O;  4LFC O;  1GRJ A;  4ZHQ B;  4DK0 A;  2QA4 V;  1OCC C;  4EFE A;  2BTO A;  1ZL8 A;  2IM9 A;  4UB6 Z;  2WLJ A;  5EIB D;  4QPJ A;  5B1N A;  1IVS A;  2RJZ A;  1QU7 A;  2W0F C;  1N32 B;  3CRM A;  1OCR B;  4J7K A;  3K58 A;  3EFF K;  2JJ1 G;  2EJR A;  2UXC O;  2HHH O;  2BE3 A;  3H01 A;  5EBW C;  5LP6 B;  1IBL B;  3BCC H;  4RQE A;  5EZY A;  1N0J A;  3L71 H;  4NXM B;  3OE7 G;  5KA5 A;  4LF9 O;  2H3O A;  5DN6 G;  3JAR B;  3E83 A;  2AHY A;  3ETQ A;  4TV9 B;  5IE9 A;  1TAE A;  4QJF B;  3M8A A;  4OXS A;  1ROP A;  4I4T B;  5CMU A;  3OW2 U;  5JQG A;  3CC4 V;  2CAZ C;  2YUA A;  1B3Q A;  5H5N A;  4EKW A;  4NTY A;  3RBZ A;  3AG3 B;  5EYP A;  1N33 O;  1K34 A;  1TVK B;  5IYB O;  2A7W A;  2H8P C;  4MTX A;  1R1B A;  4DV2 B;  4TWK A;  2JS3 A;  4F6R A;  4N21 A;  2OTL V;  1S3J A;  4J9Z B;  3ZRX A;  1EZV H;  3OTO B;  2Y4T A;  3ZMT A;  4DR7 B;  4XDJ A;  5LOV A;  1H38 A;  1IDS A;  2ETN A;  1ZX3 A;  2HJF C;  2QEX V;  1WAZ A;  1PP9 H;  1QQC A;  2JEU A;  2V7Q G;  4CC6 A;  2BTQ A;  3RWR D;  1Y76 A;  4LF8 O;  1VEW A;  4J9Y B;  2G38 A;  3NXS A;  3E86 A;  4JI5 B;  4U3J A;  4FM1 A;  4O2B B;  4JI3 O;  3RYF A;  5LA6 A;  1K5Q A;  2F23 A;  1ZL8 B;  4JV5 O;  4GLX A;  1JVM A;  3D3I A;  3OMI B;  3AK3 A;  4YY3 O;  2UXN A;  4A5U B;  1NH2 D;  2UUB O;  4DR6 O;  3CCQ V;  2YEV A;  4G27 B;  4C7U A;  1MZE A;  5KMG A;  4X65 B;  5EZY B;  3H1I H;  4ZBM A;  2Q7H A;  3OGI B;  5B1B B;  4X1I A;  4DO2 A;  4AQY O;  3E35 A;  5KHG A;  2PI5 A;  2HG5 C;  1V9P A;  2N74 A;  3AG7 A;  5JJJ B;  2Y0I A;  3ABL B;  5JQG B;  4LF5 B;  3I5D A;  4NTW A;  2XAF A;  1BQ0 A;  4I50 A;  1VQP V;  1YTF B;  1JA8 A;  5EYP B;  3LNM B;  3BFR A;  3DC6 A;  1M5I A;  1H2S B;  5KAI Z;  1HW7 A;  1G4Y B;  3D36 C;  1YF2 A;  2M6Y A;  4F6R B;  1S76 D;  4OX9 O;  1S77 D;  2DN9 A;  2M7W A;  3CC7 V;  2PYL A;  3CME V;  5LOV B;  4FZ1 A;  3KZI Z;  2L35 A;  4CC5 A;  5K1X A;  4DV2 O;  2QWN B;  3R65 A;  4U7N A;  1MAB G;  1BL8 A;  4FLU A;  2BTQ B;  3B2E E;  2LFS A;  4DR4 O;  1Y76 B;  2AZ0 A;  2ITC C;  4DUZ B;  1U96 A;  4K35 A;  3G6B A;  1KBH A;  4U3J B;  3EVK A;  1PNK A;  1AP6 A;  1OCC B;  1YIT V;  4JTA B;  3RYF B;  5LA6 B;  1HNX O;  2IW5 A;  2QWR B;  2X7R B;  5KUK A;  4B3R B;  1WNS A;  1Q86 W;  3JAS A;  1XHZ A;  2YEV B;  1Y74 A;  4DW0 A;  2YXL A;  2PYJ A;  5KMG B;  4GX5 A;  3SPG A;  1FAF A;  3M7M X;  3MAQ A;  2DJV A;  3SJC C;  4X1I B;  2QE7 G;  4Q6G A;  5EC2 C;  1NVP D;  1GO3 F;  1VAR A;  4LCU C;  4K8Z A;  4I50 B;  1PNM A;  3FB5 C;  2MW2 B;  3ZED A;  1ZLZ A;  4R8C A;  3W7W A;  2Q73 A;  1YJW V;  3D36 A;  3CC2 V;  2UXB O;  5LHH A;  2XTA A;  4GUN A;  1H2L A;  4I7Z B;  1Q81 W;  1M90 W;  4KFM A;  1THZ A;  2ARH A;  1NTK H;  3STL C;  2X0L A;  4DR3 O;  1MA1 A;  3C3T A;  4X1Y A;  5LMN O;  1I5Y A;  3L75 H;  1H2G A;  3P3P A;  3BAA A;  3RGB A;  1OHH G;  5IDJ A;  5LMU O;  4NTX A;  4RWU A;  1XNR O;  2RMK B;  1DTO A;  4JAU A;  1ZWI C;  2HJD A;  2HEP A;  3K03 A;  3FB8 C;  1HNZ O;  1P7B A;  1H2K A;  5LGT A;  1AI4 A;  4W4L A;  1GTO A;  3ETD A;  3T1Y B;  2QR4 A;  3JAS B;  3F7V C;  3LDC A;  2OCH A;  1Y74 B;  5H9C A;  3ZJZ A;  1V55 C;  2X6A A;  4HYO A;  4JTD B;  2PY5 A;  4OPA A;  3A0R A;  4IL6 Z;  2LQT A;  2CTW A;  4PA9 A;  2JGD A;  4N23 A;  2Z3Y A;  4UFZ A;  1NQT A;  4CBC A;  3JSL A;  4DR1 O;  5IY5 C;  3K9S A;  2BSK A;  1ZUQ A;  4X88 A;  1FYJ A;  4NXM O;  2VQE O;  3JAW A;  3CRC A;  3UQ8 A;  3N2K A;  1XHX A;  3O9O A;  1COW G;  2EZP A;  2JDI G;  1IXM A;  4LC1 A;  3IC7 A;  4YIO A;  1K3E A;  1M56 C;  1NI8 A;  2AZ2 A;  5TIS Z;  1V54 C;  1LNQ A;  1HR0 B;  4X66 B;  1VQN V;  2KG7 A;  2XAJ A;  1YDX A;  1M57 C;  1CPY A;  1TA8 A;  2F95 B;  3M99 B;  2EUL A;  4DV1 O;  4X1Y B;  3JCZ A;  4I55 B;  3LNN A;  4L8J A;  2UUA B;  1I0H A;  3OTF A;  4FLZ A;  5KUM A;  1SQX H;  1G8M A;  3CJH A;  2QWQ B;  2B5U A;  4DK1 A;  1QR9 A;  1YVW A;  1I94 O;  4D6T H;  4FM2 A;  3JAT A;  3ZIA G;  1MG1 A;  1K73 W;  4B3T O;  2JJ2 G;  1XI1 A;  1XOU A;  4UV9 A;  2A79 B;  3CCR V;  2WLH A;  2XND G;  1OCZ C;  1IBK B;  1FPO A;  1KP2 A;  2OT5 A;  2RCV A;  2E5L B;  2EIN C;  4YXW G;  1N0N A;  2WPD G;  3FFQ A;  2Q69 A;  1K33 A;  4IHJ A;  1EBO A;  1P84 F;  3UM7 A;  2UU9 B;  1YSC A;  1AJP A;  3APO A;  3WFV A;  4LF4 B;  2VWJ A;  1U97 A;  2W0X A;  2DOS A;  3HB3 B;  1E1R G;  1MSW D;  1IUR A;  4JYB A;  4WFH A;  3BRC A;  1Q6I A;  2BSK B;  4WFA V;  4X1K A;  1FXK C;  1Q43 A;  2HVK C;  1SQV H;  5A2Q N;  3JAW B;  2VQF B;  1VP7 A;  3N2K B;  3IC9 A;  1PL0 A;  1O9H A;  2WA3 A;  1FJG B;  3Q4H A;  1URF A;  5BZB A;  1IZ3 A;  3OFN G;  1YHQ V;  3E8B A;  1F4M A;  2GTS A;  2KG7 B;  5BY1 A;  1I7F A;  1I08 A;  5DED A;  3FAV A;  1NT2 B;  4BWA A;  2ZR3 A;  1R6K A;  3IJ4 A;  2V1D A;  3CJH B;  5KA6 A;  2IH1 C;  3TCU A;  4B7K A;  4LNU A;  5CA1 A;  2YSU B;  1XRE A;  3QO7 A;  2P6J A;  3JAT B;  3ZN0 A;  1IX9 A;  3K79 A;  1XMO O;  1FKA O;  1AB3 A;  4GX0 A;  5EIB C;  3VQY A;  1ORQ C;  3ZHV A;  4CS2 A;  1AIL A;  3B77 A;  1V55 B;  2IBZ H;  3ML0 A;  2F4V O;  2CTR A;  1WB7 A;  4IHJ B;  3WB2 A;  3SPJ A;  1WN7 A;  2FTK A;  1M4U A;  5CN0 A;  1JOY A;  4JI0 O;  3RVZ A;  5L3F A;  4O4I A;  2OYQ A;  1VQ6 V;  1AVM A;  2Q68 A;  5KX5 A;  1S0V A;  1US6 A;  4H13 B;  3OGC C;  4FIP C;  5IY5 B;  1B6Q A;  1KB9 F;  4MTG A;  4PV1 B;  3ZX6 A;  1FXK A;  4X1K B;  4CH4 A;  1AJQ A;  4R6Z A;  1KP3 A;  4UCV A;  1M56 B;  3VBB A;  1K8A W;  4LFB B;  3ICX A;  2JS5 A;  1RSO B;  3Q4H B;  1V54 B;  3OUS A;  1NBM G;  1K7D A;  1XNQ O;  1MMM A;  2ADP A;  1XL6 A;  1M57 B;  1F4N A;  2ZM6 B;  3FAV B;  4DUY B;  1JMK C;  3ZMU A;  3CYO A;  3H1K H;  4TT3 G;  1LR1 A;  2GUZ A;  4UCS A;  5JWP A;  3RFR A;  4DR5 O;  1EN5 A;  2EX3 A;  4KP4 A;  2CK3 G;  4LNU B;  1YXB A;  2R9R B;  5CA1 B;  4PDV A;  1NR1 A;  3RW0 A;  2XT9 A;  1JJ2 U;  1OCZ B;  4LWS B;  1QLN A;  1NTM H;  2Y69 C;  2EIN B;  1VQ5 V;  2JGU A;  4L87 A;  1W0J G;  3HKD A;  4J41 A;  2E3C A;  1KEC A;  3VQV A;  2ZE5 A;  4F4L A;  5K1P A;  4O4I B;  5H2F Z;  3K0G A;  3T1C A;  5FNV A;  1R3K C;  4RAI A;  4BIU A;  5KX5 B;  1G6U A;  2HLD G;  1K4D C;  3DSQ A;  1J95 A;  1SS3 A;  4JGS A;  3SGI A;  1JX9 A;  1KU9 A;  1GH6 A;  1EN4 A;  1DLB A;  2B1I A;  2GDS A;  5LBQ A;  4ZI7 A;  1FXK B;  2NN4 A;  4X64 B;  4DV3 B;  3I55 V;  4UCT A;  1G1X B;  3BY6 A;  2DYS C;  3ZHT A;  4DV0 B;  3H9V A;  4O4H A;  3ABK C;  3D3Q A;  3SPI A;  3OEH G;  4MT8 A;  2AW9 A;  4TQF A;  2ZQM A;  2XAS A;  4JI6 O;  3CCJ V;  2L6L A;  3CMA V;  2E75 B;  3J81 N;  4JI2 O;  3OD4 A;  2GUZ B;  1HP8 A;  4B7E A;  2ODM A;  4YJ3 B;  2ZM6 O;  4YHH O;  4I0X A;  5KAF Z;  4MVU A;  4JYC A;  4NVP A;  4Q20 A;  1IBM O;  5LYJ A;  2CUG A;  3SDL A;  4ZKI A;  3K57 A;  1YIJ V;  3T1H B;  2Y0P A;  4GYC B;  1BHB A;  3SYC A;  4JI7 B;  4PEL A;  4UCO A;  3N2G A;  3HKD B;  4FMT A;  4X9Q A;  3ABT A;  4G2K A;  3K5N A;  4JI8 O;  2WSS G;  1VQ4 V;  4LF7 O;  4FFB A;  4DV6 B;  1SRY A;  5FNV B;  3MDS A;  2A9H A;  4FLT A;  1J5E B;  2Q7G A;  1D5A A;  1BHA A;  1NJI W;  5BR8 O;  3AEI A;  4ZI7 B;  1H2N A;  5GON A;  4ASU G;  4NR1 A;  2R9A A;  1MOF A;  3G71 V;  5H6Q A;  2F1M A;  1XBL A;  3K5O A;  4O4H B;  2R72 A;  1RM1 C;  5KLV H;  2Q4P A;  1L1F A;  3ZRV A;  4X64 O;  1N32 O;  2HKO A;  4QGP A;  1SA0 A;  4J11 A;  3BAB A;  3O65 A;  3CXC U;  4DV3 O;  4H0L B;  2WAM A;  3ASO C;  1IBL O;  5IYZ A;  3OMN B;  1I5X A;  2EJ7 A; 
#chains in the Genus database with same CATH homology
 3ETE A;  2WLI A;  3FB8 C;  1OCR C;  3P32 A;  1P7B A;  1S5H C;  1WPX A;  3K9A A;  5LGT A;  2DWE C;  3ABM C;  1AI4 A;  3QO5 A;  1GTO A;  2IJJ A;  3ETD A;  2ZXW C;  3E8G A;  3VOU A;  2DW4 A;  1SER A;  3F7V C;  1QVF U;  3E8H A;  3LDC A;  1KC8 W;  3OAA G;  1Q82 W;  5H9C A;  3SPC A;  2GSM B;  4XBF A;  1RPO A;  1V55 C;  2JIZ G;  2X6A A;  4HYO A;  3ZJZ A;  2ITD C;  2QTO A;  4UVB A;  5L3B A;  3JD4 A;  4JTD B;  2Y69 B;  3STZ C;  2EIL C;  1NH2 B;  4MVS A;  5CA3 A;  3KG2 A;  3A0R A;  1P4R A;  5L3G A;  4PA9 A;  3AG3 C;  4N23 A;  2Z3Y A;  4HZ3 A;  4RUE A;  3DTU B;  1NQT A;  4CBC A;  1GM9 A;  3B8M A;  1GKF A;  1R3I C;  3TK1 A;  5IY5 C;  4X88 A;  2HFE C;  2IJI A;  2XAQ A;  2P90 A;  2GHY A;  3QNE A;  3ASN B;  2H94 A;  4R50 A;  1COW G;  2EZP A;  1AJN A;  1IXM A;  2JDI G;  3OEE G;  4LC1 A;  3IC7 A;  1YI2 V;  2QM8 A;  1K3E A;  1M56 C;  4LP8 A;  3T4D A;  2NNU A;  5B3S B;  3OUF A;  5DM6 V;  1F23 A;  3E8F A;  4JTC B;  1VQ7 V;  2JK5 C;  1V54 C;  1N8R W;  1LNQ A;  1H8H G;  3JD2 A;  4P9P A;  1VQN V;  2AHZ A;  1GM8 A;  2X6C A;  2XAJ A;  4WFF A;  5E1A C;  3SYQ A;  1Y4M A;  3FB6 C;  2DYS B;  3W7S A;  1M57 C;  2Q6A A;  1CPY A;  4MTF A;  1VQO V;  5LHI A;  3M99 B;  3ABK B;  3JCZ A;  1FXH A;  3AG2 C;  3OR6 C;  1S72 V;  2EIK C;  1K4C C;  4LBE C;  4QNH B;  2Q67 A;  2WWW A;  1KQS U;  4WFG A;  3SJQ C;  3ZMZ A;  5KUM A;  1QLE C;  1M9N A;  1G8M A;  2B5U A;  5EBM C;  1QR9 A;  4MVM A;  5HFL A;  3CCV V;  1ENV A;  2EIJ B;  3K0D A;  3WG7 B;  3ZIA G;  2WLI B;  1MG1 A;  1K73 W;  2JJ2 G;  4X89 A;  2XAG A;  1K5S A;  5H6R A;  2WLM A;  1W0K G;  5B1O A;  4UV9 A;  2PI4 A;  1Q7Y W;  2A79 B;  3CCR V;  2WLH A;  2XND G;  2NLJ C;  1OCZ C;  2OCC B;  1KP2 A;  2OT5 A;  4GT1 A;  5B1A B;  1FS0 G;  3IGA C;  4WFB V;  2EIN C;  1AI7 A;  2F43 G;  4YXW G;  2WPD G;  5B1B C;  2DQ3 A;  1YTF D;  2Q69 A;  1OCO C;  1K33 A;  4JF3 A;  4XDL A;  2BOC C;  1EBO A;  2B1G A;  3UM7 A;  4PDR A;  3AG1 B;  3ABL C;  3TET A;  1YSC A;  1SET A;  1AJP A;  3WFV A;  3LDD A;  4MW8 A;  4PDM A;  1GM7 A;  2HR3 A;  2ZDI C;  4P2Z A;  1NR7 A;  4X8A A;  1XL4 A;  2Y48 A;  3HB3 B;  1E1R G;  3CPW U;  4QE9 A;  1MSW D;  1PKX A;  4QPK A;  5EBL C;  3W7T A;  2C2A A;  1JQ0 A;  2LP7 A;  4JYB A;  4WFH A;  1NVP B;  1M1K W;  4WFA V;  1GK9 A;  1QBZ A;  5EC1 C;  3ZRS A;  1H8E G;  1FXK C;  2HVK C;  4MVZ A;  4MVR A;  4UXN A;  1PL0 A;  4UVA A;  3X2Q B;  4I9W A;  5BZB A;  4PA7 A;  4MVQ A;  3OFN G;  3SYP A;  1YHQ V;  3E8B A;  1F4M A;  4BAY A;  2A0L A;  2ZR2 A;  3B8N A;  4WF9 V;  2JEX A;  3FB7 C;  3P30 A;  3CP1 A;  3ZRW A;  3SYA A;  1RM1 B;  3F5W C;  2ZR3 A;  2QA4 V;  1OCC C;  1R6K A;  1EFR G;  2V1D A;  5KA6 A;  1Y66 A;  2IH1 C;  3TCU A;  3ASO B;  2WLJ A;  2P67 A;  4QPJ A;  4XDK A;  5L3C A;  5B1N A;  3ZCC A;  2X6B A;  2W0F C;  2YSU B;  3QO7 A;  2P6J A;  4JPR A;  2WLL A;  1OCR B;  3ZN0 A;  3K79 A;  3EFF K;  2JJ1 G;  2DYR C;  2EJR A;  4GX0 A;  3ABM B;  3H01 A;  5EBW C;  1AI5 A;  1ORQ C;  2ZXW B;  4DXW A;  4RQE A;  1YJN V;  2QKS A;  3LUT B;  4PDL A;  3OM3 B;  2ATK C;  3IFX A;  3B77 A;  3OE7 G;  5KA5 A;  5DN6 G;  2OTJ V;  3E83 A;  2AHY A;  2IU3 A;  4RUF A;  4P30 A;  1JPX A;  1V55 B;  3ML0 A;  1UJW B;  4MS2 A;  4QJF B;  3SPJ A;  5CBF A;  2FTK A;  2EIL B;  4OXS A;  1PD3 A;  1ROP A;  5CMU A;  3OW2 U;  3CC4 V;  5CN0 A;  1JOY A;  4GX2 A;  4PA3 A;  4E2L A;  3RVZ A;  5L3F A;  2Z5U A;  4EKW A;  3RBZ A;  3AG3 B;  2ZDI A;  1VQ6 V;  1JCH A;  3LSS A;  2IJK A;  2Q68 A;  3CCL V;  1K34 A;  4BW5 A;  1S0V A;  5IYB O;  2H8P C;  4MTX A;  3UKM A;  3SYO A;  5GW7 A;  3OGC C;  4TWK A;  4FIP C;  5IY5 B;  1K97 A;  1B6Q A;  2EZO A;  4P9O A;  4N21 A;  4MTG A;  1K9M W;  1VQL V;  2OTL V;  1EZJ A;  1S3J A;  2XOK G;  4J9Z B;  1FXK A;  1AJQ A;  3HPL C;  3ZRX A;  5FL7 G;  3FYI B;  3ZMT A;  3LSQ A;  4R6Z A;  1DF4 A;  2EIM C;  4XDJ A;  1KP3 A;  1H38 A;  1M56 B;  3VBB A;  1K8A W;  3F7Y C;  3OR7 C;  4KUM A;  4GX1 A;  2QM7 A;  1ARO P;  2HJF C;  1V54 B;  2QEX V;  3AG4 C;  3OUS A;  1NBM G;  1K7D A;  2JEU A;  2V7Q G;  3W7U A;  1XL6 A;  2IH3 C;  1M57 B;  3K04 A;  3K3W A;  1F4N A;  3EHB B;  1NKD A;  2DQ0 A;  1CP9 A;  3K06 A;  4J9Y B;  3PJS K;  3AG2 B;  3NXS A;  1CEZ A;  3E86 A;  3ZRW B;  2EIK B;  3ZMU A;  3CYO A;  4FPP A;  4PA4 A;  4JAV A;  3SPH A;  3ZMS A;  2ZD9 A;  4TT3 G;  3CCM V;  1HWY A;  1K5Q A;  5C93 A;  1QLE B;  3MHH C;  3G4S V;  1VQ9 V;  3ZN1 A;  1QVG U;  1JVM A;  3D3I A;  3OMI B;  1OZ0 A;  1FFT B;  1QCE A;  3DGE A;  4KP4 A;  2CK3 G;  2BOB C;  2R9R B;  4GCZ A;  2UXN A;  4PDV A;  5LHG A;  1NR1 A;  3RW0 A;  1NH2 D;  3ETG A;  2WLL B;  1VQ8 V;  3CCQ V;  3T2M A;  2YEV A;  4G27 B;  1JJ2 U;  4QIW F;  1OCZ B;  5HFM A;  1YJ9 V;  1QLN A;  3JYC A;  4ZBM A;  2Y69 C;  2EIN B;  1VQ5 V;  1KKD A;  4L87 A;  4TSF G;  5B1B B;  1W0J G;  4DO2 A;  1OCO B;  3E35 A;  1R3J C;  2PI5 A;  2HG5 C;  4UV8 A;  4H33 A;  4MVO A;  1KEC A;  3ABL B;  4F4L A;  2XAF A;  3K0G A;  2R9I A;  1VQK V;  2WLK A;  1VQP V;  3T1C A;  1YTF B;  3RVY A;  3FYE B;  3JD3 A;  1R3K C;  3LNM B;  4H37 A;  4RAI A;  4BIU A;  1PNL A;  3BEH A;  1TUE B;  2HLD G;  1K4D C;  1J95 A;  1W2B U;  4JGS A;  4Z1M G;  3FKS G;  3ASN C;  1GMG A;  1G4Y B;  1JX9 A;  1F51 A;  1S76 D;  2MK3 A;  3E2E A;  1DLB A;  2B1I A;  5LBQ A;  1FXK B;  1S77 D;  3MD0 A;  5B3S C;  2M7W A;  3CC7 V;  5IYD O;  3CME V;  3JD1 A;  3I55 V;  1AI6 A;  3ZMV A;  3BY6 A;  3LDE A;  2DYS C;  1AR1 B;  1E1Q G;  3R65 A;  4U7N A;  1R73 A;  1MAB G;  4MW3 A;  1BL8 A;  3ABK C;  3SPI A;  2DWD C;  3OEH G;  1DF5 A;  4MT8 A;  3CD6 V;  2LFS A;  3OMA B;  2IJH A;  3K08 A;  5L3E A;  1KD1 W;  4MTO A;  2XAH A;  3MHS C;  5LGU A;  1K92 A;  2ZQM A;  3I56 V;  2XAS A;  2ITC C;  3T4Z A;  3CCJ V;  3CMA V;  1PNK A;  1OCC B;  4HAM A;  3W7X A;  1YIT V;  1R6N A;  4JTA B;  3CCS V;  1BMF G;  2IW5 A;  2EIJ C;  3WG7 C;  1QR8 A;  4JAS A;  2X7R B;  5KUK A;  3ABU A;  4I5S A;  5LGN A;  4WCE V;  1WLE A;  4MVU A;  4JYC A;  3CCU V;  1Q86 W;  4Q20 A;  2OCC C;  4UVC A;  2DYR B;  5B1A C;  2LFR A;  5EK0 A;  2YEV B;  3E89 A;  4ZKI A;  3JD0 A;  1RPR A;  1YIJ V;  4GX5 A;  1BHB A;  3GWO A;  4G28 B;  3SPG A;  3SYC A;  3GB7 C;  4PEL A;  1SES A;  3AG1 C;  2IU0 A;  2KB1 A;  2QE7 G;  4FMT A;  2W6J G;  5EC2 C;  3ABT A;  4G2K A;  1NVP D;  4QE7 A;  1VQM V;  1GO3 F;  1E79 G;  4LCU C;  2WSS G;  2EBO A;  1VQ4 V;  2P7T C;  5CBH A;  1SRY A;  1PNM A;  1R3L C;  3FB5 C;  2A9H A;  2WLN A;  4CZZ A;  4R8C A;  3W7W A;  4WFE A;  5IYC O;  5CBG A;  2HVJ C;  1YJW V;  1BHA A;  3D36 A;  3CC2 V;  5LHH A;  1NJI W;  4RO2 A;  2W6I G;  3AEI A;  4R7C A;  4FK5 C;  3X2Q C;  4PA6 A;  1Q81 W;  1FXV A;  2EIM B;  1M90 W;  4KFM A;  1THZ A;  3QO8 A;  4ASU G;  4BIZ A;  1MOF A;  3G71 V;  3G6E V;  3STL C;  2UXX A;  5H6Q A;  2X0L A;  3CCE V;  3AG4 B;  1I5Y A;  1H2G A;  1RM1 C;  1OHH G;  4U7O A;  1L1F A;  3ZRV A;  5IDJ A;  2HKO A;  2K1E A;  3CXC U;  4UUJ C;  1SZT A;  2WAM A;  2D3O W;  4MSW C;  3ASO C;  5J9P C;  1DTO A;  4FJC C;  1ZWI C;  4JAU A;  3OMN B;  5L3D A;  4RQF A;  1I5X A;  3K03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...