1YJNV

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yjnV00
1VQPV 3CC2V 3CPWU 3CCRV 2D3OW 3I56V 1YHQV 3CCLV 3G71V 3CCUV 1YITV 1YJ9V 1KC8W 1K8AW 3CXCU 2QEXV 1YIJV 4WCEV 3CCSV 1YJWV 3CCEV 1VQLV 1M90W 1VQMV 1VQ4V 3G6EV 1VQNV 1VQ9V 1YJNV 1M1KW 1VQOV 1Q82W 1R73A 1QVGU 1KQSU 2QA4V 1K9MW 3CCQV 3CC7V 3CMEV 1VQKV 1KD1W 4WFAV 1N8RW 1VQ5V 3G4SV 1VQ7V 3I55V 1S72V 4WFBV 1Q81W 3CCMV 2OTJV 3OW2U 3CMAV 2OTLV 1Q7YW 1JJ2U 1W2BU 4WF9V 3CCJV 1K73W 1QVFU 5DM6V 1NJIW 3CCVV 1YI2V 1VQ8V 1VQ6V 3CD6V 3CC4V 1Q86W
chains in the Genus database with same CATH superfamily
1AVMA 1Q90D 1BGYH 4OX9B 1F4NA 2YICA 1GMGA 3FX7A 4DK1A 4ZI7B 5FPOA 2G38A 4TQFA 3FD9A 1AP5A 4FFBB 1JJ2U 2DQ0A 4MS2A 5KA6A 2HJFC 3B77A 1IXBA 2BSKB 3SYQA 5LOVA 3RGBA 3Q4HB 1XEQA 3E8BA 4LF9O 3UT5B 4Q20A 5IJ9A 4DV0O 4PDMA 1NU1H 3VQXA 4PA9A 1JPXA 1RPOA 4OXSA 2GHYA 3JASB 1K4CC 2F43G 4FLVA 4MT8A 2ZR3A 1MOFA 2V7QG 2ZE8A 1G4YB 2Y69C 5JWPA 4YXWG 3RYCB 2Q69A 1VARA 1E1RG 3JAMN 5CA3A 3H1HH 2ZINA 5AG2A 1R6KA 2F4VB 4LF8O 4XDKA 4ZIBA 2IJJA 1M56C 2ATKC 3BRCA 1QLEC 4J7JA 4ABMA 1N33O 1TVKA 1U96A 2R9RB 3IJ4A 1FJGB 5IYDO 5GTHZ 1XNQO 4NXNB 4GX1A 4D7SA 4DR7O 1VP7A 4X1KB 1GO3F 4EFEA 1WLEA 2F23A 1YJNV 3EVKA 2WLIA 1MMMA 4JI3B 3DXRA 3A8TA 4B3TO 2UUCB 2P90A 4BR6A 5KAFZ 3CCMV 1BCCH 3E86A 2M7WA 1FFTB 2ITDC 3J7AU 2UUAB 3KCYA 3AG3B 1SQBH 2Z5UA 5J9PC 5ITZB 5TISZ 4LF4O 3JD1A 3ZMVA 4JYCA 1GTOA 2IW5A 1Z5VA 3LDEA 4NTYA 5BZBA 3ZRWA 2OCCC 4UVCA 3K58A 1CPYA 3E83A 3DTUB 1MNGA 3MDSA 1HDJA 2FL4A 3CCRV 2UXCO 3CCLV 2H8PC 1URFA 1M9NA 4JI7O 1NQTA 1Q82W 2QJ1A 1J95A 3E35A 2RJZA 3ICXA 2Q7EA 5C8YB 4QPJA 1T5EA 2Q73A 1F4MA 3ASNC 4FMTA 4B3RO 4DXWA 5LA6B 3BY6A 2EZOA 1W0JG 1JJOA 1AROP 1NS1A 4RUEA 4J41A 4OPHA 2KKWA 4HAMA 2DWDC 2YXYA 4DV4O 3ZRSA 3B8MA 1L8DA 1M5IA 1EN6A 4X64B 2JGDB 4F6RA 4PDVA 4LNUB 1PL4A 5FL7G 3JAWA 1X4TA 1R3IC 4GCZA 3ETEA 4QE9A 1Z5WA 2HKOA 3IC9A 3SYPA 4IL6Z 2YSUB 2N74A 4XDLA 4O4LB 1ENVA 2AW9A 3D8CA 5EZYB 1Q5OA 2X6CA 3ZIAG 3OT7A 3M99B 1LUWA 3KG2A 3RYHB 1BHAA 4JI5O 4DR3B 5CA1A 4DV2B 3K08A 4MVOA 2VQFB 2Y69B 4JGSA 1R3LC 3HKCA 3CJHB 1Q81W 5LHGA 3DSQA 1R3JC 2EILC 1I94O 4O2BB 3T1HB 4FK5C 4JZ2A 4MTFA 3BABA 3RYIA 2EX3A 3QO5A 3F5TA 2JS3A 4W4KA 1Q3EA 1GN2A 4KUMA 5DECA 1I7FA 1PD3A 1M56B 2QM4A 3U10A 1QLEB 3TETA 2QKAA 3ETGA 3LDCA 4J9YB 2DQ3A 2ILMA 3K0DA 1KYOF 2GTSA 1O9HA 4EB6B 4X1IA 5A2QN 3D36C 3L74H 1AJPA 4FIPC 4LWSA 1YEWA 1U97A 1IXMA 2ZXWC 4O4JA 3LSQA 4LF9B 1VQ8V 4UCSA 4DV0B 1H8HG 3CYOA 4WFGA 2QWRB 2KSDA 3T1YB 1BQ0A 4FLXA 1M90W 4IGGA 2L35A 4IYHA 1XUQA 2M6YA 3ZJZA 2OCCB 1N8RW 4I9QA 4DV7O 3UM7A 3JCZA 5L3BA 5EK0A 1V55C 3RVYA 4ZBMA 5BMVB 2X6AA 4GZRB 2HLDG 3HR0A 2QWQB 4LF8B 1PM9A 1YSCA 1TUEB 5J2UB 3ASNB 1VQOV 1RPRA 3ZRWB 2CUGA 1N33B 3HPLC 3P30A 2QE7G 2IJIA 4JAUA 1M57C 3ABTA 3N2GB 1XNQB 2Q6AA 1NI8A 2QWPB 4JTCB 3LNNA 4DR7B 4X62O 1Y76B 4UV9A 2W6JG 4FJCC 2GUZA 4RQEA 1HNZO 4B3TB 1Y66A 5GONB 2XAHA 2DJVA 1QVGU 1FKAO 1GM7A 3LSSA 3FB8C 4NVPA 3RW0A 4U7NA 1WPXA 2AXTZ 1SRYA 3R66A 1ZL8A 4FM0A 5IYZA 1UPGA 1AJNA 1YCIA 4LF4B 1MZEA 1SQPH 4F6RB 5CBGA 3DC5A 3JALB 3SJBC 1I0HA 4O4HB 1N4CA 4JTDB 4WCEV 1YJWV 4GUNA 2BTQB 2ZDIC 1ZSPA 4PA3A 1FXKA 2PUSA 3RWRD 2CE4A 3CXHF 5IYCO 5LGNA 1L1FA 1NTZH 2UXCB 1K7DA 3JARB 1AI7A 4LFAO 2X6BA 1SQGA 5KHHA 4JI7B 3BHPA 2Y0IA 1JFFA 1YTFD 4O4IA 2YXHA 1LUVA 2P22C 1FPOA 4B3RB 1P7BA 1PPJH 4I4TA 3H1KH 4LF6O 2P6JA 4DV4B 2EULA 1GKFA 1SQVH 5F2VO 5CB4B 4FFBA 4AQYO 1NR7A 3VQYA 2JJ2G 2IM9A 3X2QC 2BSKA 5IYBO 3C90A 1IX9A 4N21A 2EZPA 1TGOA 3Q4HA 5IJ0B 3UT5A 3MHSC 1QU7A 3CMEV 2IH1C 2ZCEA 4DUYO 1YTFB 4PHZA 1V9PA 4B3SO 4KL1A 4YY3O 2A06H 1JX9A 4JI2O 2JVDA 3RT3C 3JASA 3WB2A 2WPDG 2WLHA 4DW1A 4JYAB 4JI5B 5LBQA 4LH7A 1YDXA 1EN4A 4LP8A 2GTAA 3RYCA 4HYOA 4QPKA 1XMQO 3OGIB 1I94B 1OJHA 4EFBA 1WB7A 1SKVA 1R6NA 2YEVA 1F51A 2WLJA 2A79B 4J9ZB 1OCOC 4CH4A 3M8AA 2C2AA 4X9QA 1VQ9V 1M57B 1VIBA 3QNEA 4X1KA 1DK1A 2OTJV 1SS3A 1I5YA 3UQ8A 4X66O 4LH6A 2UXNA 4LF5O 2ZNIA 4IT5A 2CH7B 3O65A 1R1BA 3B40A 5ITZA 1GN6A 1P4RA 2ZR2A 4IHJB 3W7XA 3B09A 2E76B 1VMGA 2ETNA 4LF7O 4MVQA 3WFVA 2CGOA 3E8HA 3CS5A 5L3GA 4BW5A 3BFRA 3MD0A 4DV7B 1SA0B 1G1XB 4MVSA 4H37A 2GDSA 3P3NA 2JK5C 2QWNB 4DR6B 4QNHB 4KXRA 3TJTA 2WAMA 2OIGA 4I0XB 4DV1O 2PGGA 4PELA 1K34A 2XNDG 4LR3A 1NH2D 1AB3A 5C8YA 2D3OW 1O9GA 5LA6A 4JI4O 4MVZA 4X89A 2UU9O 1AR1B 1I5XA 3LNMB 1JQ0A 4JAVA 1SC5B 3E22B 1F23A 4LNUA 4X62B 1HP8A 3PN1A 3QF7A 4L8JA 1GN3A 3ZMSA 2X7RB 3RVZA 5EBMC 3GVMA 4EKWA 2ARHA 4JF3A 1HNZB 5JJJB 1AI6A 1QLNA 1BZKA 4O4LA 2Q0OC 2UXDO 3O9OA 5EYPB 4I4TB 3OEHG 1G6UA 4IYIA 5EZYA 1NH2B 1CP9A 1L0NH 4WFAV 3ABUA 3RYHA 2NN4A 3GWOA 4BIOA 2CTWA 1GK9A 2L6LA 1TAEA 5BY1A 4WF9V 3CCVV 2AHZA 1ZAUA 1RM1C 3CJHA 3VQVA 2GSMB 4C7UA 2ZM6O 1JMKC 1N0NA 2PI4A 4JASA 4O2BA 1YIJV 2KG7B 3LUTB 2K9PA 2QDOA 4GKJO 3K5NA 2W0XA 3K5OA 2AZ2A 3G4SV 1AILA 4LFAB 3WB1A 1QQCA 1SF9A 4U3JB 4FVMA 1OCOB 5KHKA 3CHXA 2WLMA 4U3FH 4FFKA 2IU0A 4F6EA 1B04A 3H9VA 2VWKA 1WPBA 4EB6A 1SQXH 4LF6B 5EC1C 2DE0X 1NVPB 2ZD9A 2IJHA 1TUBB 3C3TA 1B06A 5L3FA 2YEVB 4AQYB 3BCCH 1YI2V 5KA5A 1VQ6V 3APQA 5DN6G 1VF7A 5KMGB 3CEIA 1JR9A 4OGQB 5CBFA 2LJ2A 2YIBD 4DR5O 3ZHTA 4GKKB 4CH5A 4DUYB 4MTOA 4B3SB 1BQZA 4YY3B 3IGAC 2DYRC 4JI2B 3N2KB 3ETDA 3K79A 5BR8O 5FPRA 4P2ZA 3K9AA 2LGWA 3JD0A 3ML0A 4E4EA 3QO8A 4MVRA 2DN9A 1XMQB 1J5EO 1YITV 1SERA 1EZJA 4LFBO 5IE9A 1QCEA 4JI8O 5BMVA 2XAFA 2ZKOA 5LL6Y 3L73H 2PZSA 4TV8B 4DV5O 2EJRA 2LGQA 2QM8A 2N05A 3D3QA 2H3OA 5J2UA 1TA8A 4WFEA 3BPZA 4BW9A 4R6ZA 2CTPA 4JAAA 3W7TA 2GBOA 5DM6V 4TOIA 1PNLA 1BS3A 1P84F 3N2GA 1PNKA 2WLLA 4JYBA 2W6IG 5BXZA 4K35A 4QGPA 3CXCU 4I7ZB 3CP1A 4H13B 1Y76A 2FMLA 3K06A 3J81N 1R73A 2LW7A 3P3PA 1CXZB 2F66C 5GONA 1Y4MA 2HFEC 3SJQC 4X66B 4BWAA 3L71H 4JI0O 3QO7A 1YF2A 1FFXB 1NTMH 5H6RA 2HHHO 4J7ZA 5B5EZ 1EM1A 1K3EA 3RYFB 3JALA 1ROPA 4O4HA 2R9IA 1WB8A 3OMAB 3F7YC 1FS0G 4LF7B 4YHHO 1RM1B 4X1YB 4DV3O 2BTQA 2JS5A 2N04A 5LMNO 2MK3A 1QVFU 3LDDA 1VF6C 3MAQA 4AI8A 3JARA 3ZCCA 1EFRG 1ORQC 1DF5A 3SR2C 2RMKB 2CK3G 3TCUA 1IBKO 1AR5A 2JEUA 3ABMC 3H1JH 4IIJB 2XT9A 4DV1B 1VQ7V 2A7WA 3KKYA 4TT3G 1Q7YW 4JI4B 3ZRVA 4QE7A 1HNWO 1S5HC 2UU9B 2E75B 5CA0B 2ZQMA 3BA9A 3D36A 1VF5B 4DR4O 1XDCA 3B8NA 3SYCA 5CB4A 2RDCA 4NXMB 3F7VC 1Q6HA 4DUZO 1KP3A 3CRMA 3RN4A 2OT5A 2QKSA 1Q6UA 2RCVA 1D5NA 4EEQA 5IJ0A 3BVOA 3KCXA 1NT2B 4UXNA 5DEDA 2AZ0A 2UXDB 1K97A 4UCOA 5B66Z 4J80A 3IFXA 2Y0PA 1E1QG 2DYRB 2PYLA 3E89A 4Z1MG 4P9OA 3FKSG 3F5WC 4TSFG 3L9DA 1MSWD 3AG2C 1BT8A 1ZLZA 2WSSG 3I55V 2B5UA 3CMAV 1XMOO 1COWG 1IBLO 2ZM6B 2EJ7A 3CCJV 2CGNA 1XHZA 2QR4A 2WA3A 3GWKC 4GKJB 4CH3A 4UB8Z 5JQGB 2JDIG 1ZUQA 2JGUA 5IWAO 2RN9A 4B3MO 4TUYB 3ZHUA 1S72V 3R65A 4YJ3B 5JCOA 5L3EA 5JJNB 3JSNA 4K8ZA 1GN4A 3T4DA 2XTAA 3FB7C 2NR5A 3W7SA 1RFYA 4XDJA 3QTCA 2CH7A 5EBWC 1XL4A 2WLLB 4P9PA 2IH3C 4IHJA 4DR5B 3SPIA 2YDEA 1F7YA 5JCOC 3H1IH 1N32O 1UFIA 1YVWA 3ABLB 4FZ0A 4I50B 4ZKIA 4FM1A 1KB9F 5B1BC 3JCUZ 2JEXA 2Q67A 5BR8B 1AI5A 2ZDIA 1SA0A 2Q0AA 2QSAA 4MVMA 3ZRXA 3ZX6A 2XAGA 1J5EB 4K3AA 4PA4A 1B3QA 4DV6O 4LFBB 4FLYA 4JI8B 4I0XA 4FZ1A 3ABMB 4DV5B 4I9WA 3ZMUA 1Y74B 2QM7A 1I08A 1VQMV 3ETQA 1HNXO 1GAXA 3SYAA 1H8EG 2FKXA 1PV0A 5LP6C 5KLVH 4OX9O 2ADPA 1UJWB 1HW7A 2P4KA 3E22A 1W2BU 4LC1A 1K73W 2CTQA 4L87A 1PL0A 1OCRC 1W0KG 1M93A 4PA6A 3OUSA 4AILC 1SQFA 2VWJA 2EIJC 4J42A 1G8MA 4BAYA 3ZHVA 2Y48A 1DF4A 1K9MW 5JH7B 3HKEB 3CC7V 5H6QA 5B3SC 4JI0B 1AP6A 5EYPA 3K3WA 3SPGA 3K03A 4JV5O 1S0VA 1IDSA 2IBZH 2AHYA 2HHHB 1SZTA 3JATA 3WU2Z 2Y4TA 3JD3A 4PI2A 3K5LA 2OYQA 4W4LA 2KQXA 3AG2B 1BE3H 4YHHB 3UCSC 1SZXA 4DV3B 1XL6A 1EN5A 2KG7A 4KHPO 4UB6Z 5LMNB 1S77D 4YJ2B 2CTRA 3SPJA 2RQ6A 3BAAA 3NR7A 3KZIZ 2YUAA 3OFNG 3G6BA 2W0FC 4U3JA 1IBKB 4ASUG 1K8AW 1JCHA 2QEXV 1QR8A 1M1KW 3CCQV 3ZN1A 4DYLA 4AHCA 1HNWB 3ZMTA 3AG7A 4I55B 5KAIZ 2P06A 1ZTEA 1KKCA 1IBMO 2ZE6A 4MTXA 1RSOB 3HKDA 1QBZA 4YIOA 2ZE7A 4DR4B 2QTOA 3CRCA 1TUBA 1HR0O 4Z2WA 1BHBA 4DUZB 5KMGA 4JI6O 4RUFA 3WG7C 3OR6C 3CRRA 3TGUH 4UCVA 3H1LH 3CE2A 2EBOA 3L75H 3ZHQA 3AK2A 4LBEC 5B1OA 2BCCH 2F1MA 4LCUC 2A3QA 1FXHA 4DRXB 4D6TH 4NTXA 1AI4A 3N2KA 3SGIA 5B1BB 1XNRO 2UUBO 1ZWIC 1YJ9V 1OZ0A 2Q7GA 3AK1A 1XMOB 4FLWA 3ASOC 1NZ6A 1KD1W 1IBLB 5JVDB 1PP9H 3J80N 4WBNB 4TV8A 1K5SA 5EIBC 5GW7A 1XBLA 1H2GA 2P67A 2YIBA 2Y4UA 4QJFB 3JAKB 3CX5F 5LP6B 2EIKC 2Q8VA 4A5UB 5IWAB 4B3MB 1K4DC 4DR1O 4FLUA 2VS0A 1OCRB 2XOKG 3FB5C 3RBZA 1CEZA 5B1NA 4H33A 4LFCO 2YS8A 1MG1A 2EIJB 2XASA 4PA7A 5B1AC 3VBBA 2R70A 1Q43A 1JOYA 5L3CA 2MW2B 4FLTA 3QG5A 3OEEG 2BOCC 5B3SB 2E74B 1NTKH 1FFXA 1P49A 3CRQA 4MSWC 1ZX3A 2WWWA 3RYFA 1N32B 3CD6V 3OTFA 4X1YA 3HB3B 3BEHA 3GB7C 4ZOLB 3K57A 4K8XA 3G80A 5FNVB 1VQ5V 4DV6B 3JATB 5KUMA 2H94A 1OCZC 4IIJA 2A9HA 1NJIW 3WB0A 3E8GA 4KFMA 1HNXB 1NVPD 2QWOB 5LYJB 1D5AA 2ZIOA 4JPRA 1JVMA 5CA0A 4UCRA 5LXTB 4RO2A 1OV9A 2PYJA 2DMXA 2LW1A 4UCTA 1Y67A 1FYJA 3T2MA 5A9GA 5KUKA 1GH6A 1IZ3A 4DW0A 1K92A 1S5JA 2EIMC 4GX5A 4MW8A 1EBOA 5EIBD 2BE3A 3WG7B 5KX5A 2PF4E 1QR9A 3SJAC 3T1YO 4JV5B 2P5OA 3ZMZA 3HKDB 1H2NA 2YC0A 2YI9A 4UFZA 2JIZG 3K0GA 3ABKC 3ASOB 4J11A 4CS4A 3EXAA 4X8AA 5KHJA 5J2TB 4KHPB 1WP7A 3IAYA 1HWYA 2ZNJA 4DO2A 2UXBO 5LHIA 4RQFA 3EHBB 1AJQA 5JQGA 3A0RA 2P4VA 4TUYA 1MABG 2EIKB 4UCUA 5H9CA 1KP2A 1H2MA 4YJ3A 5D5QA 3APOA 1VQNV 2YI8A 4BIZA 1IBMB 1WP8A 5B1AB 3IC7A 4DR2O 1FAFA 1HR0B 3OUFA 2AGAA 4O2AB 3VOUA 3L72H 3OTOO 1XHXA 4JI6B 2P7TC 1OCCC 4J10A 2VRZA 3OGCC 1S3JA 2Q4PA 4WFHA 4RWUA 1GRJA 3HKBB 3E2EA 3D3IA 3S3XA 3AG1B 4GLXA 2OIEA 4G28B 4I50A 4MW3A 3OMIB 3OR7C 3ZHRA 1XNRB 1R3KC 1M4UA 1XOUA 2UUBB 1VEWA 2UXXA 4HNAB 4CS2A 4LF5B 3K04A 5CMUA 2O57A 3TXSA 5IT9N 1VF6A 2OCHA 1H2LA 4J7KA 4UUJC 4NYKA 4B08A 3T1CA 2LO1A 4YIPA 3RFRA 1OCZB 5LHHA 2VQEO 1Y74A 3ABLC 1SQQH 5C93A 3ZN0A 2XAQA 1PNMA 2WLNA 4WFBV 4MTGA 1FD9A 1N0JA 3EFFK 4JTAB 3FAVB 5K1XA 3SDLA 5L3DA 4JI1O 2HEPA 2QGNA 2QTSA 3JD4A 3UKMA 4GYCB 4DR1B 2E3CA 4NB5A 4LFCB 1MSDA 1S5LZ 2EIMB 2Z3YA 4FLZA 2XAJA 2D2CB 1N34O 2YIDA 4NTWA 5JH7A 3HKEA 4GX2A 3A2FA 2XHBA 1YXBA 5IY5C 2KB1A 2K1EA 4JYAO 1MA1A 2LQTA 2RNBA 3G67A 3UO3A 1Q8IA 1V54C 4Q6GA 1N36O 2E5LO 3JSLA 5LOVB 2YIAA 1L0LH 4HBNA 3ABKB 5KX5B 4BIUA 5IJ9B 4I5SA 1WN7A 1KMIZ 3CCUV 4TWKA 4YJ2A 3UO2A 1EZVH 2DYSC 1LR1A 3K5MA 2QKCA 4OPAA 3G6EV 1IVSA 3E8FA 1WAZA 3FYEB 4CC6A 1LNQA 2B1IA 5K1PA 4X65O 4CH6A 4I55A 2PTMA 1XILA 4UVAA 1RSOA 5E1AC 5LGTA 1BMFG 1KQSU 1US6A 1JA8A 2PY5A 4UV8A 1H2KA 1TVKB 2OTLV 1OCCB 2F93B 4FPPA 3ZHSA 3C3SA 4TQDA 2LP7A 2V1DA 1AR4A 4R8CA 2LFSA 4DRXA 5JJEB 3W7WA 1QHTA 3LSUA 5H2FZ 4DK0A 2WLIB 3SYOA 3DXRB 3PJSK 1QNMA 3THOA 3B4SA 2B9ZA 4PI0A 3DGEA 4R50A 3CWBH 5E79Z 5FLXN 1P7GA 1Z2GA 1E79G 4DR6O 4K0KO 5JVDA 2Q68A 2PI5A 3U0ZA 3AEIA 3CC4V 4WBNA 2ZT9B 3N27A 3I5DA 3I56V 4TV9A 2Q7HA 2UXBB 1SESA 3QVNA 4PDRA 3VQWA 3JAKA 5LP6A 2DWEC 2ZE5A 4N23A 2HVKC 2JRIA 4D7TA 1X59A 3CB2A 2Z0AA 4RAIA 4PV1B 3AG4C 1DLBA 3CPWU 4KP4A 1XI1A 2DW4A 4ICGA 1WA8A 5LMUO 5IDJA 4UVBA 3STZC 3FYIB 2EINC 4DR2B 4HZ3A 3L70H 3ZBHA 3OTOB 4PJ0Z 2FTKA 5IY5B 2HVJC 4X88A 2OWOA 5HFMA 2IJKA 2HP8A 3OAAG 2NLJC 4Z1VA 3JAWB 3P32A 2LFRA 1NR1A 4R7CA 1Y6XA 4CBCA 1V54B 4XBFA 3B2EE 2EILB 3SPCA 3U11A 1B6QA 1BSMA 2JJ1G 4ZOLA 4FM2A 3OD4A 4PDLA 3JYCA 5FNVA 2DYSB 1YZBA 4ZHQA 4JYYA 1WJZA 1PKXA 4G27B 4U7OA 2HG5C 1YHQV 3TK1A 1R6TA 3G71V 1KC8W 4X20A 2R9AA 2X0LA 5CA1B 2VQEB 3NXSA 3CCEV 3TXQA 3SPHA 3HKCB 1A32A 1IURA 1OHHG 5LYJA 4PD4F 2F4VO 1FXKC 1H2SB 3RYIB 5EBLC 4JI1B 4ZI7A 1BL8A 5LXTA 1XREA 3FB6C 5HFLA 4F4LA 3DC6A 3S3WA 1KKDA 3A0HZ 1GM8A 3A0BZ 4E2LA 1VQPV 2WLKA 2IU3A 2ZIMA 1FJGO 4NXNO 1N34B 2HR3A 2ZXWB 4GKKO 1DTOA 4JZGA 3K9SA 3CRAA 1KBHA 2GV9A 3STLC 4X1IB 3AK3A 4JI3O 3FFQA 5KHIA 2UUCO 3OM3B 3K59A 3CC2V 4LWSB 3W7UA 1Q6IA 1K33A 2UUAO 4GT1A 5CBHA 1VQLV 1N36B 2E5LB 1V55B 4O4JB 5J2TA 2F95B 4CZZA 5D5PA 3CSXA 4H44B 3OE7G 1THZA 4P30A 2FYUH 2HJDA 1KECA 4MVUA 4NKGB 4B7EA 1VQ4V 2ITCC 1MZFA 2CDYA 4X65B 4B7KA 3AG4B 1S76D 2BTOA 1KU9A 4G2KA 1Q86W 4TV9B 1KUQA 2NNUA 4CC5A 4O2AA 2EINB 2ADQB 3SJCC 1D2DA 3MHHC 2YXLA 1DGSA 2Q9LA 4CS3A 4X64O 2DOSA 1SETA 3HKBA 1RP3B 2R72A 1W59A 2V4DA 1H38A 2A0LA 2GUZB 5EC2C 1WA8B 2Q5ZA 2WA4A 4HNAA 3CCSV 3AG3C 3OMNB 3BA8A 1NKDA 2FB5A 3ZS8C 1VQKV 4K0KB 1FXVA 1ZL8B 5IYZB 1GM9A 4DR3O 3OW2U 3JD2A 3AG1C 2XUMA 4DV2O 2VQFO 3ZEDA 1WNSA 2ODMA 5CN0A 2BOBC 3FAVA 3M7MX 2CAZC 3T1HO 5GTIZ 1K5QA 5H5NA 4GX0A 4QIWF 1NBMG 1FXKB 5KHGA 2B1GA 2QA4V 2JGDA 5LGUA 4NXMO 1XQ8A 4NR1A 4ZHQB 4WFFA 3H01A 1JFFB 4O4IB 3X2QB 4H0LB 3T4ZA 4X20B 5LMUB
chains in the Genus database with same CATH topology
2WPDG 2WLHA 3T4DA 5LBQA 4UUJC 3FB7C 4LP8A 3T1CA 4HYOA 3W7SA 4QPKA 4XDJA 1F4NA 1GMGA 1OCZB 5LHHA 3ABLC 5EBWC 1XL4A 5C93A 3ZN0A 2XAQA 1PNMA 2WLNA 4WFBV 4MTGA 3EFFK 1JJ2U 2DQ0A 2WLLB 4JTAB 4MS2A 4P9PA 5KA6A 2IH3C 2HJFC 3SPIA 3B77A 3SYQA 1R6NA 5L3DA 2YEVA 1F51A 2WLJA 2A79B 3E8BA 3JD4A 3ABLB 4J9ZB 1OCOC 3UKMA 4ZKIA 4Q20A 2C2AA 4PDMA 5B1BC 1VQ9V 2JEXA 1M57B 2Q67A 4PA9A 1AI5A 1JPXA 1RPOA 4OXSA 3QNEA 2EIMB 2GHYA 2Z3YA 2ZDIA 1K4CC 2F43G 2XAJA 4MVMA 2OTJV 3ZRXA 4MT8A 2ZR3A 1MOFA 2XAGA 2V7QG 1I5YA 4GX2A 1G4YB 4PA4A 2Y69C 4YXWG 2Q69A 2UXNA 5IY5C 1E1RG 3ABMB 5CA3A 4I9WA 3ZMUA 2KB1A 2QM7A 2K1EA 1VQMV 1R6KA 3SYAA 1H8EG 1P4RA 2ZR2A 4XDKA 3W7XA 1V54C 1UJWB 2IJJA 1M56C 1W2BU 2ATKC 4LC1A 1K73W 1QLEC 3ABKB 4MVQA 4L87A 1PL0A 3WFVA 1OCRC 4BIUA 1W0KG 2R9RB 3E8HA 4I5SA 5IYDO 4PA6A 3OUSA 2EIJC 4GX1A 3CCUV 4TWKA 5L3GA 1G8MA 2DYSC 4BAYA 1GO3F 4BW5A 3G6EV 2Y48A 3MD0A 4MVSA 4H37A 1DF4A 1WLEA 1YJNV 1K9MW 3E8FA 3CC7V 5H6QA 2WLIA 5B3SC 2JK5C 4QNHB 3K3WA 2P90A 3SPGA 3FYEB 2WAMA 3K03A 3CCMV 1S0VA 1LNQA 2B1IA 2AHYA 3E86A 2M7WA 4PELA 1FFTB 2ITDC 1K34A 1SZTA 2XNDG 1NH2D 3AG3B 2D3OW 2Z5UA 5J9PC 4UVAA 4MVZA 3JD3A 4X89A 3JD1A 3ZMVA 3AG2B 5E1AC 1I5XA 4JYCA 1AR1B 1GTOA 3LNMB 2IW5A 5LGTA 1BMFG 1KQSU 1JQ0A 1XL6A 3LDEA 4JAVA 1F23A 4UV8A 5BZBA 3ZRWA 2OCCC 4UVCA 2OTLV 1OCCB 4FPPA 1S77D 3ZMSA 2X7RB 1CPYA 3E83A 3DTUB 2LP7A 2V1DA 3RVZA 5EBMC 3SPJA 4EKWA 4R8CA 4JF3A 2LFSA 3OFNG 1AI6A 3CCRV 2W0FC 1QLNA 3W7WA 3CCLV 4ASUG 2H8PC 1K8AW 1JCHA 2QEXV 2WLIB 3SYOA 1QR8A 1M9NA 1NQTA 3OEHG 3PJSK 1M1KW 1NH2B 1Q82W 1CP9A 3CCQV 1J95A 4WFAV 3DGEA 3ABUA 4R50A 3ZN1A 3E35A 3ZMTA 4QPJA 3ASNC 1F4MA 3GWOA 1GK9A 4FMTA 4DXWA 1E79G 3BY6A 2EZOA 1W0JG 4WF9V 4MTXA 1AROP 2Q68A 4RUEA 1QBZA 3CCVV 2AHZA 2PI5A 3AEIA 2QTOA 1RM1C 3CC4V 4HAMA 2DWDC 3ZRSA 2GSMB 1BHBA 3I56V 3B8MA 2PI4A 4JASA 1YIJV 4PDVA 1SESA 3LUTB 4RUFA 5FL7G 3WG7C 3OR6C 4PDRA 1R3IC 2DWEC 4N23A 3G4SV 2EBOA 2HVKC 4LBEC 4GCZA 3ETEA 5B1OA 4QE9A 4LCUC 2HKOA 1FXHA 3SYPA 2YSUB 1AI4A 1OCOB 4XDLA 4RAIA 1ENVA 3AG4C 2WLMA 5B1BB 1DLBA 3CPWU 4KP4A 2IU0A 2X6CA 1ZWIC 3ZIAG 1YJ9V 3M99B 2DW4A 1OZ0A 3KG2A 5IDJA 1BHAA 4UVBA 3STZC 3FYIB 2EINC 5EC1C 4HZ3A 3ASOC 1KD1W 3K08A 4MVOA 1NVPB 2ZD9A 2Y69B 4JGSA 2IJHA 2FTKA 1R3LC 1Q81W 5LHGA 5L3FA 1K5SA 1R3JC 5GW7A 2EILC 2YEVB 5IY5B 2HVJC 4X88A 1YI2V 1H2GA 5HFMA 5KA5A 2IJKA 1VQ6V 2P67A 4FK5C 5DN6G 4MTFA 3OAAG 2NLJC 3QO5A 3P32A 2LFRA 1NR1A 5CBFA 4QJFB 2EIKC 4R7CA 4CBCA 1V54B 4MTOA 4XBFA 2EILB 4KUMA 1PD3A 1M56B 3SPCA 1B6QA 3IGAC 1QLEB 1K4DC 2DYRC 2JJ1G 3TETA 1OCRB 2XOKG 3FB5C 3RBZA 3ETDA 3ETGA 3LDCA 4J9YB 1CEZA 5B1NA 3K79A 4H33A 4P2ZA 2DQ3A 1MG1A 2EIJB 2XASA 3JYCA 3K9AA 4PA7A 4PDLA 3K0DA 5B1AC 3VBBA 2DYSB 3JD0A 3ML0A 1PKXA 3QO8A 4G27B 4MVRA 4U7OA 1JOYA 2HG5C 5L3CA 1YHQV 3TK1A 3G71V 1YITV 1KC8W 1SERA 1EZJA 2X0LA 1QCEA 2BOCC 3OEEG 5B3SB 3NXSA 3CCEV 1AJPA 2XAFA 4FIPC 3SPHA 4MSWC 2EJRA 1OHHG 2QM8A 2WWWA 4WFEA 1FXKC 5EBLC 4R6ZA 1BL8A 1IXMA 3W7TA 2ZXWC 3FB6C 3LSQA 3CD6V 5HFLA 5DM6V 4F4LA 1VQ8V 1PNLA 1KKDA 1GM8A 4E2LA 1H8HG 1PNKA 1VQPV 2WLLA 3CYOA 4JYBA 3HB3B 4WFGA 3BEHA 2WLKA 2W6IG 2IU3A 3CXCU 3GB7C 3CP1A 1M90W 3ZJZA 3K06A 1R73A 2OCCB 2HR3A 2ZXWB 1DTOA 1N8RW 1VQ5V 1Y4MA 2HFEC 5KUMA 3UM7A 2H94A 3JCZA 3SJQC 5L3BA 5EK0A 3STLC 1OCZC 1V55C 2A9HA 3RVYA 1NJIW 3QO7A 4ZBMA 2X6AA 3OM3B 2HLDG 3E8GA 4KFMA 3CC2V 1NVPD 5H6RA 3W7UA 1K33A 4GT1A 5CBHA 1K3EA 4JPRA 1VQLV 1YSCA 1TUEB 3ASNB 1JVMA 1VQOV 1ROPA 1RPRA 1V55B 2R9IA 3ZRWB 3OMAB 3F7YC 4RO2A 1FS0G 3HPLC 3P30A 2QE7G 2IJIA 1RM1B 4JAUA 3T2MA 4CZZA 1M57C 3ABTA 5KUKA 2Q6AA 4JTCB 1K92A 2EIMC 4GX5A 4MW8A 1EBOA 2MK3A 1QVFU 3LDDA 3WG7B 3OE7G 1THZA 4P30A 4UV9A 1KECA 3ZCCA 4MVUA 2W6JG 1EFRG 4FJCC 1ORQC 1DF5A 4RQEA 1VQ4V 1Y66A 2CK3G 2XAHA 3TCUA 1QR9A 2ITCC 1QVGU 2JEUA 3ABMC 1VQ7V 1GM7A 3ZMZA 3LSSA 3FB8C 3RW0A 3AG4B 4U7NA 1WPXA 4TT3G 1Q7YW 1S76D 1SRYA 3ZRVA 4QE7A 4G2KA 1AJNA 2JIZG 1S5HC 1Q86W 2NNUA 5CBGA 2EINB 2ZQMA 3K0GA 3ABKC 3ASOB 4JTDB 3D36A 4WCEV 3B8NA 3SYCA 4X8AA 1YJWV 3MHHC 3F7VC 1KP3A 2OT5A 2QKSA 1HWYA 4DO2A 1SETA 5LHIA 4RQFA 2ZDIC 3EHBB 4PA3A 1AJQA 1FXKA 5IYCO 5LGNA 3A0RA 1L1FA 1K7DA 1H38A 1AI7A 4UXNA 2A0LA 2X6BA 1MABG 2EIKB 5EC2C 5H9CA 1KP2A 1K97A 1YTFD 3IFXA 1E1QG 3CCSV 2DYRB 3E89A 1VQNV 3AG3C 3OMNB 4P9OA 4Z1MG 3FKSG 1NKDA 3F5WC 4TSFG 4BIZA 1P7BA 1VQKV 5B1AB 1FXVA 1MSWD 3AG2C 3I55V 2WSSG 3IC7A 2B5UA 1GM9A 2P6JA 3JD2A 3OUFA 3CMAV 3AG1C 3OW2U 1COWG 1GKFA 3VOUA 3CCJV 2P7TC 1OCCC 3OGCC 1NR7A 1S3JA 2BOBC 5CN0A 2JJ2G 4WFHA 1K5QA 3X2QC 5IYBO 4GX0A 3E2EA 1NBMG 3D3IA 1FXKB 2EZPA 3AG1B 2B1GA 4N21A 4QIWF 2JDIG 4G28B 2QA4V 3MHSC 5LGUA 3CMEV 2IH1C 4MW3A 1YTFB 3OMIB 3OR7C 1S72V 4WFFA 3R65A 3H01A 1R3KC 1JX9A 2UXXA 3X2QB 3K04A 3T4ZA 5L3EA 5CMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP V;  3CC2 V;  3CPW U;  3CCR V;  2D3O W;  3I56 V;  1YHQ V;  3CCL V;  3G71 V;  3CCU V;  1YIT V;  1YJ9 V;  1KC8 W;  1K8A W;  3CXC U;  2QEX V;  1YIJ V;  4WCE V;  3CCS V;  1YJW V;  3CCE V;  1VQL V;  1M90 W;  1VQM V;  1VQ4 V;  3G6E V;  1VQN V;  1VQ9 V;  1YJN V;  1M1K W;  1VQO V;  1Q82 W;  1R73 A;  1QVG U;  1KQS U;  2QA4 V;  1K9M W;  3CCQ V;  3CC7 V;  3CME V;  1VQK V;  1KD1 W;  4WFA V;  1N8R W;  1VQ5 V;  3G4S V;  1VQ7 V;  3I55 V;  1S72 V;  4WFB V;  1Q81 W;  3CCM V;  2OTJ V;  3OW2 U;  3CMA V;  2OTL V;  1Q7Y W;  1JJ2 U;  1W2B U;  4WF9 V;  3CCJ V;  1K73 W;  1QVF U;  5DM6 V;  1NJI W;  3CCV V;  1YI2 V;  1VQ8 V;  1VQ6 V;  3CD6 V;  3CC4 V;  1Q86 W; 
#chains in the Genus database with same CATH topology
 1AVM A;  1Q90 D;  1BGY H;  4OX9 B;  1F4N A;  2YIC A;  1GMG A;  3FX7 A;  4DK1 A;  4ZI7 B;  5FPO A;  2G38 A;  4TQF A;  3FD9 A;  1AP5 A;  4FFB B;  1JJ2 U;  2DQ0 A;  4MS2 A;  5KA6 A;  2HJF C;  3B77 A;  1IXB A;  2BSK B;  3SYQ A;  5LOV A;  3RGB A;  3Q4H B;  1XEQ A;  3E8B A;  4LF9 O;  3UT5 B;  4Q20 A;  5IJ9 A;  4DV0 O;  4PDM A;  1NU1 H;  3VQX A;  4PA9 A;  1JPX A;  1RPO A;  4OXS A;  2GHY A;  3JAS B;  1K4C C;  2F43 G;  4FLV A;  4MT8 A;  2ZR3 A;  1MOF A;  2V7Q G;  2ZE8 A;  1G4Y B;  2Y69 C;  5JWP A;  4YXW G;  3RYC B;  2Q69 A;  1VAR A;  1E1R G;  3JAM N;  5CA3 A;  3H1H H;  2ZIN A;  5AG2 A;  1R6K A;  2F4V B;  4LF8 O;  4XDK A;  4ZIB A;  2IJJ A;  1M56 C;  2ATK C;  3BRC A;  1QLE C;  4J7J A;  4ABM A;  1N33 O;  1TVK A;  1U96 A;  2R9R B;  3IJ4 A;  1FJG B;  5IYD O;  5GTH Z;  1XNQ O;  4NXN B;  4GX1 A;  4D7S A;  4DR7 O;  1VP7 A;  4X1K B;  1GO3 F;  4EFE A;  1WLE A;  2F23 A;  1YJN V;  3EVK A;  2WLI A;  1MMM A;  4JI3 B;  3DXR A;  3A8T A;  4B3T O;  2UUC B;  2P90 A;  4BR6 A;  5KAF Z;  3CCM V;  1BCC H;  3E86 A;  2M7W A;  1FFT B;  2ITD C;  3J7A U;  2UUA B;  3KCY A;  3AG3 B;  1SQB H;  2Z5U A;  5J9P C;  5ITZ B;  5TIS Z;  4LF4 O;  3JD1 A;  3ZMV A;  4JYC A;  1GTO A;  2IW5 A;  1Z5V A;  3LDE A;  4NTY A;  5BZB A;  3ZRW A;  2OCC C;  4UVC A;  3K58 A;  1CPY A;  3E83 A;  3DTU B;  1MNG A;  3MDS A;  1HDJ A;  2FL4 A;  3CCR V;  2UXC O;  3CCL V;  2H8P C;  1URF A;  1M9N A;  4JI7 O;  1NQT A;  1Q82 W;  2QJ1 A;  1J95 A;  3E35 A;  2RJZ A;  3ICX A;  2Q7E A;  5C8Y B;  4QPJ A;  1T5E A;  2Q73 A;  1F4M A;  3ASN C;  4FMT A;  4B3R O;  4DXW A;  5LA6 B;  3BY6 A;  2EZO A;  1W0J G;  1JJO A;  1ARO P;  1NS1 A;  4RUE A;  4J41 A;  4OPH A;  2KKW A;  4HAM A;  2DWD C;  2YXY A;  4DV4 O;  3ZRS A;  3B8M A;  1L8D A;  1M5I A;  1EN6 A;  4X64 B;  2JGD B;  4F6R A;  4PDV A;  4LNU B;  1PL4 A;  5FL7 G;  3JAW A;  1X4T A;  1R3I C;  4GCZ A;  3ETE A;  4QE9 A;  1Z5W A;  2HKO A;  3IC9 A;  3SYP A;  4IL6 Z;  2YSU B;  2N74 A;  4XDL A;  4O4L B;  1ENV A;  2AW9 A;  3D8C A;  5EZY B;  1Q5O A;  2X6C A;  3ZIA G;  3OT7 A;  3M99 B;  1LUW A;  3KG2 A;  3RYH B;  1BHA A;  4JI5 O;  4DR3 B;  5CA1 A;  4DV2 B;  3K08 A;  4MVO A;  2VQF B;  2Y69 B;  4JGS A;  1R3L C;  3HKC A;  3CJH B;  1Q81 W;  5LHG A;  3DSQ A;  1R3J C;  2EIL C;  1I94 O;  4O2B B;  3T1H B;  4FK5 C;  4JZ2 A;  4MTF A;  3BAB A;  3RYI A;  2EX3 A;  3QO5 A;  3F5T A;  2JS3 A;  4W4K A;  1Q3E A;  1GN2 A;  4KUM A;  5DEC A;  1I7F A;  1PD3 A;  1M56 B;  2QM4 A;  3U10 A;  1QLE B;  3TET A;  2QKA A;  3ETG A;  3LDC A;  4J9Y B;  2DQ3 A;  2ILM A;  3K0D A;  1KYO F;  2GTS A;  1O9H A;  4EB6 B;  4X1I A;  5A2Q N;  3D36 C;  3L74 H;  1AJP A;  4FIP C;  4LWS A;  1YEW A;  1U97 A;  1IXM A;  2ZXW C;  4O4J A;  3LSQ A;  4LF9 B;  1VQ8 V;  4UCS A;  4DV0 B;  1H8H G;  3CYO A;  4WFG A;  2QWR B;  2KSD A;  3T1Y B;  1BQ0 A;  4FLX A;  1M90 W;  4IGG A;  2L35 A;  4IYH A;  1XUQ A;  2M6Y A;  3ZJZ A;  2OCC B;  1N8R W;  4I9Q A;  4DV7 O;  3UM7 A;  3JCZ A;  5L3B A;  5EK0 A;  1V55 C;  3RVY A;  4ZBM A;  5BMV B;  2X6A A;  4GZR B;  2HLD G;  3HR0 A;  2QWQ B;  4LF8 B;  1PM9 A;  1YSC A;  1TUE B;  5J2U B;  3ASN B;  1VQO V;  1RPR A;  3ZRW B;  2CUG A;  1N33 B;  3HPL C;  3P30 A;  2QE7 G;  2IJI A;  4JAU A;  1M57 C;  3ABT A;  3N2G B;  1XNQ B;  2Q6A A;  1NI8 A;  2QWP B;  4JTC B;  3LNN A;  4DR7 B;  4X62 O;  1Y76 B;  4UV9 A;  2W6J G;  4FJC C;  2GUZ A;  4RQE A;  1HNZ O;  4B3T B;  1Y66 A;  5GON B;  2XAH A;  2DJV A;  1QVG U;  1FKA O;  1GM7 A;  3LSS A;  3FB8 C;  4NVP A;  3RW0 A;  4U7N A;  1WPX A;  2AXT Z;  1SRY A;  3R66 A;  1ZL8 A;  4FM0 A;  5IYZ A;  1UPG A;  1AJN A;  1YCI A;  4LF4 B;  1MZE A;  1SQP H;  4F6R B;  5CBG A;  3DC5 A;  3JAL B;  3SJB C;  1I0H A;  4O4H B;  1N4C A;  4JTD B;  4WCE V;  1YJW V;  4GUN A;  2BTQ B;  2ZDI C;  1ZSP A;  4PA3 A;  1FXK A;  2PUS A;  3RWR D;  2CE4 A;  3CXH F;  5IYC O;  5LGN A;  1L1F A;  1NTZ H;  2UXC B;  1K7D A;  3JAR B;  1AI7 A;  4LFA O;  2X6B A;  1SQG A;  5KHH A;  4JI7 B;  3BHP A;  2Y0I A;  1JFF A;  1YTF D;  4O4I A;  2YXH A;  1LUV A;  2P22 C;  1FPO A;  4B3R B;  1P7B A;  1PPJ H;  4I4T A;  3H1K H;  4LF6 O;  2P6J A;  4DV4 B;  2EUL A;  1GKF A;  1SQV H;  5F2V O;  5CB4 B;  4FFB A;  4AQY O;  1NR7 A;  3VQY A;  2JJ2 G;  2IM9 A;  3X2Q C;  2BSK A;  5IYB O;  3C90 A;  1IX9 A;  4N21 A;  2EZP A;  1TGO A;  3Q4H A;  5IJ0 B;  3UT5 A;  3MHS C;  1QU7 A;  3CME V;  2IH1 C;  2ZCE A;  4DUY O;  1YTF B;  4PHZ A;  1V9P A;  4B3S O;  4KL1 A;  4YY3 O;  2A06 H;  1JX9 A;  4JI2 O;  2JVD A;  3RT3 C;  3JAS A;  3WB2 A;  2WPD G;  2WLH A;  4DW1 A;  4JYA B;  4JI5 B;  5LBQ A;  4LH7 A;  1YDX A;  1EN4 A;  4LP8 A;  2GTA A;  3RYC A;  4HYO A;  4QPK A;  1XMQ O;  3OGI B;  1I94 B;  1OJH A;  4EFB A;  1WB7 A;  1SKV A;  1R6N A;  2YEV A;  1F51 A;  2WLJ A;  2A79 B;  4J9Z B;  1OCO C;  4CH4 A;  3M8A A;  2C2A A;  4X9Q A;  1VQ9 V;  1M57 B;  1VIB A;  3QNE A;  4X1K A;  1DK1 A;  2OTJ V;  1SS3 A;  1I5Y A;  3UQ8 A;  4X66 O;  4LH6 A;  2UXN A;  4LF5 O;  2ZNI A;  4IT5 A;  2CH7 B;  3O65 A;  1R1B A;  3B40 A;  5ITZ A;  1GN6 A;  1P4R A;  2ZR2 A;  4IHJ B;  3W7X A;  3B09 A;  2E76 B;  1VMG A;  2ETN A;  4LF7 O;  4MVQ A;  3WFV A;  2CGO A;  3E8H A;  3CS5 A;  5L3G A;  4BW5 A;  3BFR A;  3MD0 A;  4DV7 B;  1SA0 B;  1G1X B;  4MVS A;  4H37 A;  2GDS A;  3P3N A;  2JK5 C;  2QWN B;  4DR6 B;  4QNH B;  4KXR A;  3TJT A;  2WAM A;  2OIG A;  4I0X B;  4DV1 O;  2PGG A;  4PEL A;  1K34 A;  2XND G;  4LR3 A;  1NH2 D;  1AB3 A;  5C8Y A;  2D3O W;  1O9G A;  5LA6 A;  4JI4 O;  4MVZ A;  4X89 A;  2UU9 O;  1AR1 B;  1I5X A;  3LNM B;  1JQ0 A;  4JAV A;  1SC5 B;  3E22 B;  1F23 A;  4LNU A;  4X62 B;  1HP8 A;  3PN1 A;  3QF7 A;  4L8J A;  1GN3 A;  3ZMS A;  2X7R B;  3RVZ A;  5EBM C;  3GVM A;  4EKW A;  2ARH A;  4JF3 A;  1HNZ B;  5JJJ B;  1AI6 A;  1QLN A;  1BZK A;  4O4L A;  2Q0O C;  2UXD O;  3O9O A;  5EYP B;  4I4T B;  3OEH G;  1G6U A;  4IYI A;  5EZY A;  1NH2 B;  1CP9 A;  1L0N H;  4WFA V;  3ABU A;  3RYH A;  2NN4 A;  3GWO A;  4BIO A;  2CTW A;  1GK9 A;  2L6L A;  1TAE A;  5BY1 A;  4WF9 V;  3CCV V;  2AHZ A;  1ZAU A;  1RM1 C;  3CJH A;  3VQV A;  2GSM B;  4C7U A;  2ZM6 O;  1JMK C;  1N0N A;  2PI4 A;  4JAS A;  4O2B A;  1YIJ V;  2KG7 B;  3LUT B;  2K9P A;  2QDO A;  4GKJ O;  3K5N A;  2W0X A;  3K5O A;  2AZ2 A;  3G4S V;  1AIL A;  4LFA B;  3WB1 A;  1QQC A;  1SF9 A;  4U3J B;  4FVM A;  1OCO B;  5KHK A;  3CHX A;  2WLM A;  4U3F H;  4FFK A;  2IU0 A;  4F6E A;  1B04 A;  3H9V A;  2VWK A;  1WPB A;  4EB6 A;  1SQX H;  4LF6 B;  5EC1 C;  2DE0 X;  1NVP B;  2ZD9 A;  2IJH A;  1TUB B;  3C3T A;  1B06 A;  5L3F A;  2YEV B;  4AQY B;  3BCC H;  1YI2 V;  5KA5 A;  1VQ6 V;  3APQ A;  5DN6 G;  1VF7 A;  5KMG B;  3CEI A;  1JR9 A;  4OGQ B;  5CBF A;  2LJ2 A;  2YIB D;  4DR5 O;  3ZHT A;  4GKK B;  4CH5 A;  4DUY B;  4MTO A;  4B3S B;  1BQZ A;  4YY3 B;  3IGA C;  2DYR C;  4JI2 B;  3N2K B;  3ETD A;  3K79 A;  5BR8 O;  5FPR A;  4P2Z A;  3K9A A;  2LGW A;  3JD0 A;  3ML0 A;  4E4E A;  3QO8 A;  4MVR A;  2DN9 A;  1XMQ B;  1J5E O;  1YIT V;  1SER A;  1EZJ A;  4LFB O;  5IE9 A;  1QCE A;  4JI8 O;  5BMV A;  2XAF A;  2ZKO A;  5LL6 Y;  3L73 H;  2PZS A;  4TV8 B;  4DV5 O;  2EJR A;  2LGQ A;  2QM8 A;  2N05 A;  3D3Q A;  2H3O A;  5J2U A;  1TA8 A;  4WFE A;  3BPZ A;  4BW9 A;  4R6Z A;  2CTP A;  4JAA A;  3W7T A;  2GBO A;  5DM6 V;  4TOI A;  1PNL A;  1BS3 A;  1P84 F;  3N2G A;  1PNK A;  2WLL A;  4JYB A;  2W6I G;  5BXZ A;  4K35 A;  4QGP A;  3CXC U;  4I7Z B;  3CP1 A;  4H13 B;  1Y76 A;  2FML A;  3K06 A;  3J81 N;  1R73 A;  2LW7 A;  3P3P A;  1CXZ B;  2F66 C;  5GON A;  1Y4M A;  2HFE C;  3SJQ C;  4X66 B;  4BWA A;  3L71 H;  4JI0 O;  3QO7 A;  1YF2 A;  1FFX B;  1NTM H;  5H6R A;  2HHH O;  4J7Z A;  5B5E Z;  1EM1 A;  1K3E A;  3RYF B;  3JAL A;  1ROP A;  4O4H A;  2R9I A;  1WB8 A;  3OMA B;  3F7Y C;  1FS0 G;  4LF7 B;  4YHH O;  1RM1 B;  4X1Y B;  4DV3 O;  2BTQ A;  2JS5 A;  2N04 A;  5LMN O;  2MK3 A;  1QVF U;  3LDD A;  1VF6 C;  3MAQ A;  4AI8 A;  3JAR A;  3ZCC A;  1EFR G;  1ORQ C;  1DF5 A;  3SR2 C;  2RMK B;  2CK3 G;  3TCU A;  1IBK O;  1AR5 A;  2JEU A;  3ABM C;  3H1J H;  4IIJ B;  2XT9 A;  4DV1 B;  1VQ7 V;  2A7W A;  3KKY A;  4TT3 G;  1Q7Y W;  4JI4 B;  3ZRV A;  4QE7 A;  1HNW O;  1S5H C;  2UU9 B;  2E75 B;  5CA0 B;  2ZQM A;  3BA9 A;  3D36 A;  1VF5 B;  4DR4 O;  1XDC A;  3B8N A;  3SYC A;  5CB4 A;  2RDC A;  4NXM B;  3F7V C;  1Q6H A;  4DUZ O;  1KP3 A;  3CRM A;  3RN4 A;  2OT5 A;  2QKS A;  1Q6U A;  2RCV A;  1D5N A;  4EEQ A;  5IJ0 A;  3BVO A;  3KCX A;  1NT2 B;  4UXN A;  5DED A;  2AZ0 A;  2UXD B;  1K97 A;  4UCO A;  5B66 Z;  4J80 A;  3IFX A;  2Y0P A;  1E1Q G;  2DYR B;  2PYL A;  3E89 A;  4Z1M G;  4P9O A;  3FKS G;  3F5W C;  4TSF G;  3L9D A;  1MSW D;  3AG2 C;  1BT8 A;  1ZLZ A;  2WSS G;  3I55 V;  2B5U A;  3CMA V;  1XMO O;  1COW G;  1IBL O;  2ZM6 B;  2EJ7 A;  3CCJ V;  2CGN A;  1XHZ A;  2QR4 A;  2WA3 A;  3GWK C;  4GKJ B;  4CH3 A;  4UB8 Z;  5JQG B;  2JDI G;  1ZUQ A;  2JGU A;  5IWA O;  2RN9 A;  4B3M O;  4TUY B;  3ZHU A;  1S72 V;  3R65 A;  4YJ3 B;  5JCO A;  5L3E A;  5JJN B;  3JSN A;  4K8Z A;  1GN4 A;  3T4D A;  2XTA A;  3FB7 C;  2NR5 A;  3W7S A;  1RFY A;  4XDJ A;  3QTC A;  2CH7 A;  5EBW C;  1XL4 A;  2WLL B;  4P9P A;  2IH3 C;  4IHJ A;  4DR5 B;  3SPI A;  2YDE A;  1F7Y A;  5JCO C;  3H1I H;  1N32 O;  1UFI A;  1YVW A;  3ABL B;  4FZ0 A;  4I50 B;  4ZKI A;  4FM1 A;  1KB9 F;  5B1B C;  3JCU Z;  2JEX A;  2Q67 A;  5BR8 B;  1AI5 A;  2ZDI A;  1SA0 A;  2Q0A A;  2QSA A;  4MVM A;  3ZRX A;  3ZX6 A;  2XAG A;  1J5E B;  4K3A A;  4PA4 A;  1B3Q A;  4DV6 O;  4LFB B;  4FLY A;  4JI8 B;  4I0X A;  4FZ1 A;  3ABM B;  4DV5 B;  4I9W A;  3ZMU A;  1Y74 B;  2QM7 A;  1I08 A;  1VQM V;  3ETQ A;  1HNX O;  1GAX A;  3SYA A;  1H8E G;  2FKX A;  1PV0 A;  5LP6 C;  5KLV H;  4OX9 O;  2ADP A;  1UJW B;  1HW7 A;  2P4K A;  3E22 A;  1W2B U;  4LC1 A;  1K73 W;  2CTQ A;  4L87 A;  1PL0 A;  1OCR C;  1W0K G;  1M93 A;  4PA6 A;  3OUS A;  4AIL C;  1SQF A;  2VWJ A;  2EIJ C;  4J42 A;  1G8M A;  4BAY A;  3ZHV A;  2Y48 A;  1DF4 A;  1K9M W;  5JH7 B;  3HKE B;  3CC7 V;  5H6Q A;  5B3S C;  4JI0 B;  1AP6 A;  5EYP A;  3K3W A;  3SPG A;  3K03 A;  4JV5 O;  1S0V A;  1IDS A;  2IBZ H;  2AHY A;  2HHH B;  1SZT A;  3JAT A;  3WU2 Z;  2Y4T A;  3JD3 A;  4PI2 A;  3K5L A;  2OYQ A;  4W4L A;  2KQX A;  3AG2 B;  1BE3 H;  4YHH B;  3UCS C;  1SZX A;  4DV3 B;  1XL6 A;  1EN5 A;  2KG7 A;  4KHP O;  4UB6 Z;  5LMN B;  1S77 D;  4YJ2 B;  2CTR A;  3SPJ A;  2RQ6 A;  3BAA A;  3NR7 A;  3KZI Z;  2YUA A;  3OFN G;  3G6B A;  2W0F C;  4U3J A;  1IBK B;  4ASU G;  1K8A W;  1JCH A;  2QEX V;  1QR8 A;  1M1K W;  3CCQ V;  3ZN1 A;  4DYL A;  4AHC A;  1HNW B;  3ZMT A;  3AG7 A;  4I55 B;  5KAI Z;  2P06 A;  1ZTE A;  1KKC A;  1IBM O;  2ZE6 A;  4MTX A;  1RSO B;  3HKD A;  1QBZ A;  4YIO A;  2ZE7 A;  4DR4 B;  2QTO A;  3CRC A;  1TUB A;  1HR0 O;  4Z2W A;  1BHB A;  4DUZ B;  5KMG A;  4JI6 O;  4RUF A;  3WG7 C;  3OR6 C;  3CRR A;  3TGU H;  4UCV A;  3H1L H;  3CE2 A;  2EBO A;  3L75 H;  3ZHQ A;  3AK2 A;  4LBE C;  5B1O A;  2BCC H;  2F1M A;  4LCU C;  2A3Q A;  1FXH A;  4DRX B;  4D6T H;  4NTX A;  1AI4 A;  3N2K A;  3SGI A;  5B1B B;  1XNR O;  2UUB O;  1ZWI C;  1YJ9 V;  1OZ0 A;  2Q7G A;  3AK1 A;  1XMO B;  4FLW A;  3ASO C;  1NZ6 A;  1KD1 W;  1IBL B;  5JVD B;  1PP9 H;  3J80 N;  4WBN B;  4TV8 A;  1K5S A;  5EIB C;  5GW7 A;  1XBL A;  1H2G A;  2P67 A;  2YIB A;  2Y4U A;  4QJF B;  3JAK B;  3CX5 F;  5LP6 B;  2EIK C;  2Q8V A;  4A5U B;  5IWA B;  4B3M B;  1K4D C;  4DR1 O;  4FLU A;  2VS0 A;  1OCR B;  2XOK G;  3FB5 C;  3RBZ A;  1CEZ A;  5B1N A;  4H33 A;  4LFC O;  2YS8 A;  1MG1 A;  2EIJ B;  2XAS A;  4PA7 A;  5B1A C;  3VBB A;  2R70 A;  1Q43 A;  1JOY A;  5L3C A;  2MW2 B;  4FLT A;  3QG5 A;  3OEE G;  2BOC C;  5B3S B;  2E74 B;  1NTK H;  1FFX A;  1P49 A;  3CRQ A;  4MSW C;  1ZX3 A;  2WWW A;  3RYF A;  1N32 B;  3CD6 V;  3OTF A;  4X1Y A;  3HB3 B;  3BEH A;  3GB7 C;  4ZOL B;  3K57 A;  4K8X A;  3G80 A;  5FNV B;  1VQ5 V;  4DV6 B;  3JAT B;  5KUM A;  2H94 A;  1OCZ C;  4IIJ A;  2A9H A;  1NJI W;  3WB0 A;  3E8G A;  4KFM A;  1HNX B;  1NVP D;  2QWO B;  5LYJ B;  1D5A A;  2ZIO A;  4JPR A;  1JVM A;  5CA0 A;  4UCR A;  5LXT B;  4RO2 A;  1OV9 A;  2PYJ A;  2DMX A;  2LW1 A;  4UCT A;  1Y67 A;  1FYJ A;  3T2M A;  5A9G A;  5KUK A;  1GH6 A;  1IZ3 A;  4DW0 A;  1K92 A;  1S5J A;  2EIM C;  4GX5 A;  4MW8 A;  1EBO A;  5EIB D;  2BE3 A;  3WG7 B;  5KX5 A;  2PF4 E;  1QR9 A;  3SJA C;  3T1Y O;  4JV5 B;  2P5O A;  3ZMZ A;  3HKD B;  1H2N A;  2YC0 A;  2YI9 A;  4UFZ A;  2JIZ G;  3K0G A;  3ABK C;  3ASO B;  4J11 A;  4CS4 A;  3EXA A;  4X8A A;  5KHJ A;  5J2T B;  4KHP B;  1WP7 A;  3IAY A;  1HWY A;  2ZNJ A;  4DO2 A;  2UXB O;  5LHI A;  4RQF A;  3EHB B;  1AJQ A;  5JQG A;  3A0R A;  2P4V A;  4TUY A;  1MAB G;  2EIK B;  4UCU A;  5H9C A;  1KP2 A;  1H2M A;  4YJ3 A;  5D5Q A;  3APO A;  1VQN V;  2YI8 A;  4BIZ A;  1IBM B;  1WP8 A;  5B1A B;  3IC7 A;  4DR2 O;  1FAF A;  1HR0 B;  3OUF A;  2AGA A;  4O2A B;  3VOU A;  3L72 H;  3OTO O;  1XHX A;  4JI6 B;  2P7T C;  1OCC C;  4J10 A;  2VRZ A;  3OGC C;  1S3J A;  2Q4P A;  4WFH A;  4RWU A;  1GRJ A;  3HKB B;  3E2E A;  3D3I A;  3S3X A;  3AG1 B;  4GLX A;  2OIE A;  4G28 B;  4I50 A;  4MW3 A;  3OMI B;  3OR7 C;  3ZHR A;  1XNR B;  1R3K C;  1M4U A;  1XOU A;  2UUB B;  1VEW A;  2UXX A;  4HNA B;  4CS2 A;  4LF5 B;  3K04 A;  5CMU A;  2O57 A;  3TXS A;  5IT9 N;  1VF6 A;  2OCH A;  1H2L A;  4J7K A;  4UUJ C;  4NYK A;  4B08 A;  3T1C A;  2LO1 A;  4YIP A;  3RFR A;  1OCZ B;  5LHH A;  2VQE O;  1Y74 A;  3ABL C;  1SQQ H;  5C93 A;  3ZN0 A;  2XAQ A;  1PNM A;  2WLN A;  4WFB V;  4MTG A;  1FD9 A;  1N0J A;  3EFF K;  4JTA B;  3FAV B;  5K1X A;  3SDL A;  5L3D A;  4JI1 O;  2HEP A;  2QGN A;  2QTS A;  3JD4 A;  3UKM A;  4GYC B;  4DR1 B;  2E3C A;  4NB5 A;  4LFC B;  1MSD A;  1S5L Z;  2EIM B;  2Z3Y A;  4FLZ A;  2XAJ A;  2D2C B;  1N34 O;  2YID A;  4NTW A;  5JH7 A;  3HKE A;  4GX2 A;  3A2F A;  2XHB A;  1YXB A;  5IY5 C;  2KB1 A;  2K1E A;  4JYA O;  1MA1 A;  2LQT A;  2RNB A;  3G67 A;  3UO3 A;  1Q8I A;  1V54 C;  4Q6G A;  1N36 O;  2E5L O;  3JSL A;  5LOV B;  2YIA A;  1L0L H;  4HBN A;  3ABK B;  5KX5 B;  4BIU A;  5IJ9 B;  4I5S A;  1WN7 A;  1KMI Z;  3CCU V;  4TWK A;  4YJ2 A;  3UO2 A;  1EZV H;  2DYS C;  1LR1 A;  3K5M A;  2QKC A;  4OPA A;  3G6E V;  1IVS A;  3E8F A;  1WAZ A;  3FYE B;  4CC6 A;  1LNQ A;  2B1I A;  5K1P A;  4X65 O;  4CH6 A;  4I55 A;  2PTM A;  1XIL A;  4UVA A;  1RSO A;  5E1A C;  5LGT A;  1BMF G;  1KQS U;  1US6 A;  1JA8 A;  2PY5 A;  4UV8 A;  1H2K A;  1TVK B;  2OTL V;  1OCC B;  2F93 B;  4FPP A;  3ZHS A;  3C3S A;  4TQD A;  2LP7 A;  2V1D A;  1AR4 A;  4R8C A;  2LFS A;  4DRX A;  5JJE B;  3W7W A;  1QHT A;  3LSU A;  5H2F Z;  4DK0 A;  2WLI B;  3SYO A;  3DXR B;  3PJS K;  1QNM A;  3THO A;  3B4S A;  2B9Z A;  4PI0 A;  3DGE A;  4R50 A;  3CWB H;  5E79 Z;  5FLX N;  1P7G A;  1Z2G A;  1E79 G;  4DR6 O;  4K0K O;  5JVD A;  2Q68 A;  2PI5 A;  3U0Z A;  3AEI A;  3CC4 V;  4WBN A;  2ZT9 B;  3N27 A;  3I5D A;  3I56 V;  4TV9 A;  2Q7H A;  2UXB B;  1SES A;  3QVN A;  4PDR A;  3VQW A;  3JAK A;  5LP6 A;  2DWE C;  2ZE5 A;  4N23 A;  2HVK C;  2JRI A;  4D7T A;  1X59 A;  3CB2 A;  2Z0A A;  4RAI A;  4PV1 B;  3AG4 C;  1DLB A;  3CPW U;  4KP4 A;  1XI1 A;  2DW4 A;  4ICG A;  1WA8 A;  5LMU O;  5IDJ A;  4UVB A;  3STZ C;  3FYI B;  2EIN C;  4DR2 B;  4HZ3 A;  3L70 H;  3ZBH A;  3OTO B;  4PJ0 Z;  2FTK A;  5IY5 B;  2HVJ C;  4X88 A;  2OWO A;  5HFM A;  2IJK A;  2HP8 A;  3OAA G;  2NLJ C;  4Z1V A;  3JAW B;  3P32 A;  2LFR A;  1NR1 A;  4R7C A;  1Y6X A;  4CBC A;  1V54 B;  4XBF A;  3B2E E;  2EIL B;  3SPC A;  3U11 A;  1B6Q A;  1BSM A;  2JJ1 G;  4ZOL A;  4FM2 A;  3OD4 A;  4PDL A;  3JYC A;  5FNV A;  2DYS B;  1YZB A;  4ZHQ A;  4JYY A;  1WJZ A;  1PKX A;  4G27 B;  4U7O A;  2HG5 C;  1YHQ V;  3TK1 A;  1R6T A;  3G71 V;  1KC8 W;  4X20 A;  2R9A A;  2X0L A;  5CA1 B;  2VQE B;  3NXS A;  3CCE V;  3TXQ A;  3SPH A;  3HKC B;  1A32 A;  1IUR A;  1OHH G;  5LYJ A;  4PD4 F;  2F4V O;  1FXK C;  1H2S B;  3RYI B;  5EBL C;  4JI1 B;  4ZI7 A;  1BL8 A;  5LXT A;  1XRE A;  3FB6 C;  5HFL A;  4F4L A;  3DC6 A;  3S3W A;  1KKD A;  3A0H Z;  1GM8 A;  3A0B Z;  4E2L A;  1VQP V;  2WLK A;  2IU3 A;  2ZIM A;  1FJG O;  4NXN O;  1N34 B;  2HR3 A;  2ZXW B;  4GKK O;  1DTO A;  4JZG A;  3K9S A;  3CRA A;  1KBH A;  2GV9 A;  3STL C;  4X1I B;  3AK3 A;  4JI3 O;  3FFQ A;  5KHI A;  2UUC O;  3OM3 B;  3K59 A;  3CC2 V;  4LWS B;  3W7U A;  1Q6I A;  1K33 A;  2UUA O;  4GT1 A;  5CBH A;  1VQL V;  1N36 B;  2E5L B;  1V55 B;  4O4J B;  5J2T A;  2F95 B;  4CZZ A;  5D5P A;  3CSX A;  4H44 B;  3OE7 G;  1THZ A;  4P30 A;  2FYU H;  2HJD A;  1KEC A;  4MVU A;  4NKG B;  4B7E A;  1VQ4 V;  2ITC C;  1MZF A;  2CDY A;  4X65 B;  4B7K A;  3AG4 B;  1S76 D;  2BTO A;  1KU9 A;  4G2K A;  1Q86 W;  4TV9 B;  1KUQ A;  2NNU A;  4CC5 A;  4O2A A;  2EIN B;  2ADQ B;  3SJC C;  1D2D A;  3MHH C;  2YXL A;  1DGS A;  2Q9L A;  4CS3 A;  4X64 O;  2DOS A;  1SET A;  3HKB A;  1RP3 B;  2R72 A;  1W59 A;  2V4D A;  1H38 A;  2A0L A;  2GUZ B;  5EC2 C;  1WA8 B;  2Q5Z A;  2WA4 A;  4HNA A;  3CCS V;  3AG3 C;  3OMN B;  3BA8 A;  1NKD A;  2FB5 A;  3ZS8 C;  1VQK V;  4K0K B;  1FXV A;  1ZL8 B;  5IYZ B;  1GM9 A;  4DR3 O;  3OW2 U;  3JD2 A;  3AG1 C;  2XUM A;  4DV2 O;  2VQF O;  3ZED A;  1WNS A;  2ODM A;  5CN0 A;  2BOB C;  3FAV A;  3M7M X;  2CAZ C;  3T1H O;  5GTI Z;  1K5Q A;  5H5N A;  4GX0 A;  4QIW F;  1NBM G;  1FXK B;  5KHG A;  2B1G A;  2QA4 V;  2JGD A;  5LGU A;  4NXM O;  1XQ8 A;  4NR1 A;  4ZHQ B;  4WFF A;  3H01 A;  1JFF B;  4O4I B;  3X2Q B;  4H0L B;  3T4Z A;  4X20 B;  5LMU B; 
#chains in the Genus database with same CATH homology
 2WPD G;  2WLH A;  3T4D A;  5LBQ A;  4UUJ C;  3FB7 C;  4LP8 A;  3T1C A;  4HYO A;  3W7S A;  4QPK A;  4XDJ A;  1F4N A;  1GMG A;  1OCZ B;  5LHH A;  3ABL C;  5EBW C;  1XL4 A;  5C93 A;  3ZN0 A;  2XAQ A;  1PNM A;  2WLN A;  4WFB V;  4MTG A;  3EFF K;  1JJ2 U;  2DQ0 A;  2WLL B;  4JTA B;  4MS2 A;  4P9P A;  5KA6 A;  2IH3 C;  2HJF C;  3SPI A;  3B77 A;  3SYQ A;  1R6N A;  5L3D A;  2YEV A;  1F51 A;  2WLJ A;  2A79 B;  3E8B A;  3JD4 A;  3ABL B;  4J9Z B;  1OCO C;  3UKM A;  4ZKI A;  4Q20 A;  2C2A A;  4PDM A;  5B1B C;  1VQ9 V;  2JEX A;  1M57 B;  2Q67 A;  4PA9 A;  1AI5 A;  1JPX A;  1RPO A;  4OXS A;  3QNE A;  2EIM B;  2GHY A;  2Z3Y A;  2ZDI A;  1K4C C;  2F43 G;  2XAJ A;  4MVM A;  2OTJ V;  3ZRX A;  4MT8 A;  2ZR3 A;  1MOF A;  2XAG A;  2V7Q G;  1I5Y A;  4GX2 A;  1G4Y B;  4PA4 A;  2Y69 C;  4YXW G;  2Q69 A;  2UXN A;  5IY5 C;  1E1R G;  3ABM B;  5CA3 A;  4I9W A;  3ZMU A;  2KB1 A;  2QM7 A;  2K1E A;  1VQM V;  1R6K A;  3SYA A;  1H8E G;  1P4R A;  2ZR2 A;  4XDK A;  3W7X A;  1V54 C;  1UJW B;  2IJJ A;  1M56 C;  1W2B U;  2ATK C;  4LC1 A;  1K73 W;  1QLE C;  3ABK B;  4MVQ A;  4L87 A;  1PL0 A;  3WFV A;  1OCR C;  4BIU A;  1W0K G;  2R9R B;  3E8H A;  4I5S A;  5IYD O;  4PA6 A;  3OUS A;  2EIJ C;  4GX1 A;  3CCU V;  4TWK A;  5L3G A;  1G8M A;  2DYS C;  4BAY A;  1GO3 F;  4BW5 A;  3G6E V;  2Y48 A;  3MD0 A;  4MVS A;  4H37 A;  1DF4 A;  1WLE A;  1YJN V;  1K9M W;  3E8F A;  3CC7 V;  5H6Q A;  2WLI A;  5B3S C;  2JK5 C;  4QNH B;  3K3W A;  2P90 A;  3SPG A;  3FYE B;  2WAM A;  3K03 A;  3CCM V;  1S0V A;  1LNQ A;  2B1I A;  2AHY A;  3E86 A;  2M7W A;  4PEL A;  1FFT B;  2ITD C;  1K34 A;  1SZT A;  2XND G;  1NH2 D;  3AG3 B;  2D3O W;  2Z5U A;  5J9P C;  4UVA A;  4MVZ A;  3JD3 A;  4X89 A;  3JD1 A;  3ZMV A;  3AG2 B;  5E1A C;  1I5X A;  4JYC A;  1AR1 B;  1GTO A;  3LNM B;  2IW5 A;  5LGT A;  1BMF G;  1KQS U;  1JQ0 A;  1XL6 A;  3LDE A;  4JAV A;  1F23 A;  4UV8 A;  5BZB A;  3ZRW A;  2OCC C;  4UVC A;  2OTL V;  1OCC B;  4FPP A;  1S77 D;  3ZMS A;  2X7R B;  1CPY A;  3E83 A;  3DTU B;  2LP7 A;  2V1D A;  3RVZ A;  5EBM C;  3SPJ A;  4EKW A;  4R8C A;  4JF3 A;  2LFS A;  3OFN G;  1AI6 A;  3CCR V;  2W0F C;  1QLN A;  3W7W A;  3CCL V;  4ASU G;  2H8P C;  1K8A W;  1JCH A;  2QEX V;  2WLI B;  3SYO A;  1QR8 A;  1M9N A;  1NQT A;  3OEH G;  3PJS K;  1M1K W;  1NH2 B;  1Q82 W;  1CP9 A;  3CCQ V;  1J95 A;  4WFA V;  3DGE A;  3ABU A;  4R50 A;  3ZN1 A;  3E35 A;  3ZMT A;  4QPJ A;  3ASN C;  1F4M A;  3GWO A;  1GK9 A;  4FMT A;  4DXW A;  1E79 G;  3BY6 A;  2EZO A;  1W0J G;  4WF9 V;  4MTX A;  1ARO P;  2Q68 A;  4RUE A;  1QBZ A;  3CCV V;  2AHZ A;  2PI5 A;  3AEI A;  2QTO A;  1RM1 C;  3CC4 V;  4HAM A;  2DWD C;  3ZRS A;  2GSM B;  1BHB A;  3I56 V;  3B8M A;  2PI4 A;  4JAS A;  1YIJ V;  4PDV A;  1SES A;  3LUT B;  4RUF A;  5FL7 G;  3WG7 C;  3OR6 C;  4PDR A;  1R3I C;  2DWE C;  4N23 A;  3G4S V;  2EBO A;  2HVK C;  4LBE C;  4GCZ A;  3ETE A;  5B1O A;  4QE9 A;  4LCU C;  2HKO A;  1FXH A;  3SYP A;  2YSU B;  1AI4 A;  1OCO B;  4XDL A;  4RAI A;  1ENV A;  3AG4 C;  2WLM A;  5B1B B;  1DLB A;  3CPW U;  4KP4 A;  2IU0 A;  2X6C A;  1ZWI C;  3ZIA G;  1YJ9 V;  3M99 B;  2DW4 A;  1OZ0 A;  3KG2 A;  5IDJ A;  1BHA A;  4UVB A;  3STZ C;  3FYI B;  2EIN C;  5EC1 C;  4HZ3 A;  3ASO C;  1KD1 W;  3K08 A;  4MVO A;  1NVP B;  2ZD9 A;  2Y69 B;  4JGS A;  2IJH A;  2FTK A;  1R3L C;  1Q81 W;  5LHG A;  5L3F A;  1K5S A;  1R3J C;  5GW7 A;  2EIL C;  2YEV B;  5IY5 B;  2HVJ C;  4X88 A;  1YI2 V;  1H2G A;  5HFM A;  5KA5 A;  2IJK A;  1VQ6 V;  2P67 A;  4FK5 C;  5DN6 G;  4MTF A;  3OAA G;  2NLJ C;  3QO5 A;  3P32 A;  2LFR A;  1NR1 A;  5CBF A;  4QJF B;  2EIK C;  4R7C A;  4CBC A;  1V54 B;  4MTO A;  4XBF A;  2EIL B;  4KUM A;  1PD3 A;  1M56 B;  3SPC A;  1B6Q A;  3IGA C;  1QLE B;  1K4D C;  2DYR C;  2JJ1 G;  3TET A;  1OCR B;  2XOK G;  3FB5 C;  3RBZ A;  3ETD A;  3ETG A;  3LDC A;  4J9Y B;  1CEZ A;  5B1N A;  3K79 A;  4H33 A;  4P2Z A;  2DQ3 A;  1MG1 A;  2EIJ B;  2XAS A;  3JYC A;  3K9A A;  4PA7 A;  4PDL A;  3K0D A;  5B1A C;  3VBB A;  2DYS B;  3JD0 A;  3ML0 A;  1PKX A;  3QO8 A;  4G27 B;  4MVR A;  4U7O A;  1JOY A;  2HG5 C;  5L3C A;  1YHQ V;  3TK1 A;  3G71 V;  1YIT V;  1KC8 W;  1SER A;  1EZJ A;  2X0L A;  1QCE A;  2BOC C;  3OEE G;  5B3S B;  3NXS A;  3CCE V;  1AJP A;  2XAF A;  4FIP C;  3SPH A;  4MSW C;  2EJR A;  1OHH G;  2QM8 A;  2WWW A;  4WFE A;  1FXK C;  5EBL C;  4R6Z A;  1BL8 A;  1IXM A;  3W7T A;  2ZXW C;  3FB6 C;  3LSQ A;  3CD6 V;  5HFL A;  5DM6 V;  4F4L A;  1VQ8 V;  1PNL A;  1KKD A;  1GM8 A;  4E2L A;  1H8H G;  1PNK A;  1VQP V;  2WLL A;  3CYO A;  4JYB A;  3HB3 B;  4WFG A;  3BEH A;  2WLK A;  2W6I G;  2IU3 A;  3CXC U;  3GB7 C;  3CP1 A;  1M90 W;  3ZJZ A;  3K06 A;  1R73 A;  2OCC B;  2HR3 A;  2ZXW B;  1DTO A;  1N8R W;  1VQ5 V;  1Y4M A;  2HFE C;  5KUM A;  3UM7 A;  2H94 A;  3JCZ A;  3SJQ C;  5L3B A;  5EK0 A;  3STL C;  1OCZ C;  1V55 C;  2A9H A;  3RVY A;  1NJI W;  3QO7 A;  4ZBM A;  2X6A A;  3OM3 B;  2HLD G;  3E8G A;  4KFM A;  3CC2 V;  1NVP D;  5H6R A;  3W7U A;  1K33 A;  4GT1 A;  5CBH A;  1K3E A;  4JPR A;  1VQL V;  1YSC A;  1TUE B;  3ASN B;  1JVM A;  1VQO V;  1ROP A;  1RPR A;  1V55 B;  2R9I A;  3ZRW B;  3OMA B;  3F7Y C;  4RO2 A;  1FS0 G;  3HPL C;  3P30 A;  2QE7 G;  2IJI A;  1RM1 B;  4JAU A;  3T2M A;  4CZZ A;  1M57 C;  3ABT A;  5KUK A;  2Q6A A;  4JTC B;  1K92 A;  2EIM C;  4GX5 A;  4MW8 A;  1EBO A;  2MK3 A;  1QVF U;  3LDD A;  3WG7 B;  3OE7 G;  1THZ A;  4P30 A;  4UV9 A;  1KEC A;  3ZCC A;  4MVU A;  2W6J G;  1EFR G;  4FJC C;  1ORQ C;  1DF5 A;  4RQE A;  1VQ4 V;  1Y66 A;  2CK3 G;  2XAH A;  3TCU A;  1QR9 A;  2ITC C;  1QVG U;  2JEU A;  3ABM C;  1VQ7 V;  1GM7 A;  3ZMZ A;  3LSS A;  3FB8 C;  3RW0 A;  3AG4 B;  4U7N A;  1WPX A;  4TT3 G;  1Q7Y W;  1S76 D;  1SRY A;  3ZRV A;  4QE7 A;  4G2K A;  1AJN A;  2JIZ G;  1S5H C;  1Q86 W;  2NNU A;  5CBG A;  2EIN B;  2ZQM A;  3K0G A;  3ABK C;  3ASO B;  4JTD B;  3D36 A;  4WCE V;  3B8N A;  3SYC A;  4X8A A;  1YJW V;  3MHH C;  3F7V C;  1KP3 A;  2OT5 A;  2QKS A;  1HWY A;  4DO2 A;  1SET A;  5LHI A;  4RQF A;  2ZDI C;  3EHB B;  4PA3 A;  1AJQ A;  1FXK A;  5IYC O;  5LGN A;  3A0R A;  1L1F A;  1K7D A;  1H38 A;  1AI7 A;  4UXN A;  2A0L A;  2X6B A;  1MAB G;  2EIK B;  5EC2 C;  5H9C A;  1KP2 A;  1K97 A;  1YTF D;  3IFX A;  1E1Q G;  3CCS V;  2DYR B;  3E89 A;  1VQN V;  3AG3 C;  3OMN B;  4P9O A;  4Z1M G;  3FKS G;  1NKD A;  3F5W C;  4TSF G;  4BIZ A;  1P7B A;  1VQK V;  5B1A B;  1FXV A;  1MSW D;  3AG2 C;  3I55 V;  2WSS G;  3IC7 A;  2B5U A;  1GM9 A;  2P6J A;  3JD2 A;  3OUF A;  3CMA V;  3AG1 C;  3OW2 U;  1COW G;  1GKF A;  3VOU A;  3CCJ V;  2P7T C;  1OCC C;  3OGC C;  1NR7 A;  1S3J A;  2BOB C;  5CN0 A;  2JJ2 G;  4WFH A;  1K5Q A;  3X2Q C;  5IYB O;  4GX0 A;  3E2E A;  1NBM G;  3D3I A;  1FXK B;  2EZP A;  3AG1 B;  2B1G A;  4N21 A;  4QIW F;  2JDI G;  4G28 B;  2QA4 V;  3MHS C;  5LGU A;  3CME V;  2IH1 C;  4MW3 A;  1YTF B;  3OMI B;  3OR7 C;  1S72 V;  4WFF A;  3R65 A;  3H01 A;  1R3K C;  1JX9 A;  2UXX A;  3X2Q B;  3K04 A;  3T4Z A;  5L3E A;  5CMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...