1YJNV

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yjnV00
3I55V 1N8RW 1KD1W 3CCSV 3CCQV 3I56V 1YJWV 1VQPV 1QVFU 1K73W 1VQKV 1QVGU 3CMAV 3G4SV 1W2BU 1Q81W 4WFBV 1NJIW 3CXCU 1M1KW 1JJ2U 3CCJV 3CPWU 1VQ9V 1VQMV 1YJNV 3CC2V 1KQSU 1R73A 3CCLV 1Q86W 3CCRV 1M90W 2QEXV 3CC4V 1VQ6V 2OTJV 4WCEV 1YHQV 1YI2V 3CCMV 3CCUV 3G71V 3CC7V 2D3OW 3CMEV 3CCEV 1VQ7V 1K8AW 1YJ9V 3G6EV 1Q7YW 1VQOV 1Q82W 1VQ5V 4WFAV 1VQ8V 4WF9V 1S72V 1K9MW 1VQLV 2QA4V 5DM6V 3OW2U 1YIJV 1YITV 1VQNV 3CD6V 1VQ4V 2OTLV 1KC8W 3CCVV
chains in the Genus database with same CATH superfamily
3CEIA 1S3JA 2P4VA 3MAQA 1I08A 4O4LB 4PI0A 2XT9A 1DTOA 2Q5ZA 5GW7A 3RGBA 3W7UA 2YIAA 4UV9A 2Y48A 2F93B 2ILMA 4JYAO 4RAIA 4A5UB 5IJ0A 1V9PA 3F7VC 3TXQA 3AG7A 1WLEA 3A0BZ 2EIJC 3K5MA 5DECA 5K1XA 4DR4B 1CPYA 1NH2B 4P30A 3T4DA 2QE7G 3T1YO 3N27A 4CC5A 4J11A 4DO2A 1VQOV 3ETQA 2Q4PA 1MMMA 4DW0A 2ZNIA 2JK5C 2NR5A 4ZI7B 5JQGB 2XASA 3UT5A 5H5NA 4UB6Z 2CTQA 4DV3O 2B5UA 1FJGB 3AG3C 2LO1A 5D5PA 5IYBO 1X4TA 3FB6C 2W0FC 4J41A 5IYZB 3B09A 3STZC 4LP8A 4DV7B 4WFFA 3PN1A 4DR3O 4O4JB 2ETNA 1M4UA 4JI6B 2Y0IA 4ASUG 2ZM6B 3VQWA 2RDCA 1OCZC 3BVOA 5CBHA 5CA1A 4QPJA 4MVOA 4CH6A 4ZOLA 5B1OA 3OGCC 4YXWG 3CCJV 1TVKB 1QR9A 1XMOO 4TV9A 3ZMUA 3H1KH 4LF9O 1AP6A 4BW9A 2ZT9B 4B3MB 3N2GA 3CCUV 1QHTA 2VQFB 5GONB 4DUZO 3F7YC 1AB3A 4PJ0Z 3JD3A 3T1HB 2CE4A 2CTPA 3CB2A 3MD0A 1Y67A 1N4CA 2R9IA 3ZMSA 3ASOC 3ZMTA 2RJZA 5LP6C 1S5HC 4FFBB 4JAAA 5LMUB 2DYRB 4J9ZB 2WLIB 3HKBB 1AI6A 1KYOF 1PV0A 1WPXA 1FXKA 3K0GA 4O2BA 5J2TA 5IWAB 1MNGA 4LR3A 4UCTA 3E86A 1VP7A 4LFCO 1JFFA 5CBFA 1R1BA 3BPZA 1SETA 4PA6A 5L3BA 1VARA 2P4KA 4JYBA 1WP8A 1NT2B 3ZHUA 4WFHA 2WLKA 3L72H 4JI5O 1OCCB 3U11A 5EZYB 5LOVA 1CEZA 4MW3A 4TUYA 4YJ3A 2QKAA 1KQSU 1OHHG 1NR1A 4WFEA 4WBNA 2GUZA 3CC7V 3HKEA 3CCEV 1EZVH 4NXNO 4PHZA 3LNNA 3E2EA 4UVAA 2EILC 4MVMA 1QBZA 3ABKB 2UXBB 3CRMA 4MTXA 4UCUA 1FAFA 4X20B 4CBCA 4L8JA 4PD4F 1BQZA 3W7TA 1SF9A 2LGWA 2ADPA 1R6NA 3RYIA 4FM2A 1EZJA 2ZNJA 5KAIZ 1KU9A 1H2GA 3AG2C 4IGGA 3RWRD 2E3CA 1G4YB 4AI8A 1GRJA 5L3DA 3ZRWA 4O4IB 1XQ8A 4NTYA 4CH5A 1K34A 2ADQB 1D2DA 1KB9F 3L70H 5H9CA 3UO3A 1VQ7V 5BXZA 4LF8O 4Z1VA 4Q6GA 2ZCEA 1VQNV 2QR4A 1DLBA 1Y4MA 4JAVA 5FLXN 2PZSA 5IDJA 2P5OA 5IY5C 1EFRG 2K9PA 3CE2A 3ZHVA 2EIKC 2LW7A 4LF4B 1ZWIC 1ZLZA 2A3QA 3BHPA 2BSKA 2PTMA 3BA9A 1AI4A 4UCVA 5E79Z 5KHJA 5KA5A 5LP6A 3LDCA 1SQBH 1PNKA 5B3SC 2JGUA 3JALA 5KAFZ 2IW5A 2BE3A 4OPHA 3SYAA 2PI4A 1FXVA 1K33A 3L71H 2RQ6A 4TQDA 1SQXH 2OWOA 5LMNO 2YXLA 3JAKB 2LQTA 1WP7A 1R3JC 3E22A 1H8EG 3S3XA 1NTMH 1SKVA 2AZ2A 5DN6G 4EB6A 5IYDO 1SQQH 3CPWU 3OD4A 1BL8A 5BMVB 2UXNA 3ZS8C 1OZ0A 1Y76A 3BRCA 3KZIZ 3KG2A 2DW4A 4K8ZA 3T2MA 3C90A 3MHSC 3ZCCA 5KHGA 5ITZB 3CCQV 4PDRA 5GTHZ 3LSSA 1XBLA 3OGIB 4O4HB 4YIPA 3ABTA 1I94O 2W0XA 2QSAA 1KBHA 3AG1C 2F66C 4QNHB 4DV4O 2P90A 2WA3A 3OMNB 3K79A 3IC7A 1QU7A 4TV8B 1VF7A 2MW2B 3VOUA 1JJOA 1YTFB 2WLJA 3APQA 4FLTA 1SQPH 4DR1B 4I9QA 3AEIA 1AR5A 1E1QG 4FZ0A 2OCCB 2B9ZA 3H1IH 2O57A 3AG4B 3LSQA 3IAYA 2EIMB 3B8NA 1JR9A 4D7TA 1I0HA 3CSXA 3P3PA 3FX7A 2ZXWC 3I5DA 4X9QA 1IBLO 1QVGU 2YDEA 2QM8A 1I5YA 1PL4A 5EYPB 4FZ1A 2M7WA 4UB8Z 2YUAA 2BTQB 2YC0A 4J7ZA 1AI7A 4JI8B 3A2FA 1N34B 2UXCB 1Y74B 4AHCA 1Q82W 4DV1O 1TUBB 4GX1A 2LP7A 3R66A 2PF4E 2Q68A 5KA6A 4FLXA 3B2EE 3F5TA 4DR5O 2ZIMA 3QG5A 2N04A 5J2UA 4CC6A 2RCVA 5LHHA 3CCRV 2PY5A 3AK1A 1XNRB 1ZX3A 1YHQV 2KB1A 5H6QA 4FLZA 3KCXA 4JI3B 4K0KO 2OTLV 3DSQA 4I7ZB 4UVBA 1Q6HA 1E79G 2HVJC 2HKOA 2E5LO 4DR4O 5J9PC 5JVDA 2UUAB 2IU3A 4K35A 4UV8A 4DK1A 4P9PA 1K5SA 2DQ0A 1B04A 1I5XA 1NQTA 4GKJB 4DR2B 3I56V 4UCSA 4Q20A 1S5JA 3IFXA 5B5EZ 3ABMC 2EX3A 3SPCA 1EN5A 2A7WA 3RT3C 3OTOO 5IYCO 4FJCC 4FLUA 3CCLV 1HDJA 2D2CB 2XOKG 4UUJC 4YY3O 3CRAA 2UU9B 4CS3A 4DV7O 3D3QA 1RM1C 3IC9A 1NVPD 4JI6O 4MVSA 2IH3C 1ZSPA 1NZ6A 2Q9LA 2R9AA 2N74A 1LNQA 1PD3A 5KHIA 4FFKA 3SJBC 5JH7A 2GHYA 5KX5B 2PGGA 1IURA 3WG7C 1QLNA 2Z5UA 2ZE7A 2CH7A 4QGPA 2JDIG 3EXAA 5B1BC 1R3LC 2VQFO 5TISZ 5IJ9A 2IJIA 4YHHO 1MG1A 1BSMA 2HJDA 1XHZA 1XHXA 1GM9A 1VF5B 2CTWA 5IT9N 2F95B 1NBMG 4PDVA 2QKSA 4DV6O 1GO3F 2FYUH 1IXBA 2VQEO 3CJHA 1YJ9V 4B3TB 2QA4V 4GLXA 3SPIA 4CS4A 3E8GA 2ZIOA 1H8HG 1SZTA 4I55A 4I4TA 4MVZA 1R6TA 2ZQMA 4F6RA 1NI8A 4I0XA 1SESA 5IWAO 3RYHB 2UXDB 2YI9A 2FMLA 3G71V 2CGOA 4B7EA 3M7MX 2E75B 4DR7O 5LHIA 3CP1A 1RSOA 1BGYH 4JAUA 1JQ0A 4JTDB 2QWPB 5CA1B 4O2AB 1BQ0A 4JI2B 4DV2B 3SPGA 4ZOLB 4BW5A 2WLLB 2XAQA 1LUWA 1YVWA 3C3SA 1HW7A 2YIBD 3N2GB 2KG7B 4X1YB 1BMFG 2ATKC 2WLHA 4PA4A 3OEEG 1SA0A 4JGSA 1SQGA 2KKWA 1F7YA 4WFBV 2JGDA 4PA9A 3ZMZA 3GWOA 1L0LH 3U0ZA 4P2ZA 3CWBH 2K1EA 4JV5O 1QLEB 3P3NA 2X6BA 2ARHA 1S76D 2BTOA 2CAZC 1AJNA 1ZL8A 2DYSB 3GWKC 4GX0A 3N2KA 4YIOA 1VQPV 1HNXO 1G1XB 1KECA 2QWQB 1GMGA 1FXKB 2F4VO 4O2BB 3ZHTA 2AXTZ 2DQ3A 2V7QG 1MOFA 4GUNA 2DE0X 1Z5WA 4QE7A 4G27B 2YIBA 2F23A 4G2KA 2WA4A 1F4NA 2HHHB 1XMQB 1H2KA 4GCZA 4DYLA 2DYRC 2HP8A 1N33B 5LOVB 4LNUA 1YJNV 5KMGA 3H1LH 3BABA 3RVZA 1ORQC 4TUYB 2BOCC 1O9HA 1GAXA 1VQ9V 2QWRB 3K58A 1P49A 4PA3A 1PKXA 1NTKH 3CCVV 1XEQA 4O4LA 1HNWB 4B3SB 5L3GA 3ZBHA 2LFSA 4MW8A 3JCUZ 1WN7A 1EM1A 3QF7A 2WLMA 3CRCA 3GVMA 3TCUA 1F23A 4BIUA 5JWPA 1OCCC 3O65A 3CRQA 5JCOC 4WF9V 3EHBB 1K7DA 4FLVA 3RYIB 3K04A 3B40A 5CA3A 3BEHA 1VQ4V 1QNMA 4JZGA 3CXHF 4X89A 4ZHQB 2CTRA 3WB1A 3ZRWB 5LGTA 4OX9B 1KP2A 4TT3G 3WU2Z 3CC2V 1Z2GA 5L3CA 3DXRB 1NR7A 4H13B 3ABKC 5EC1C 1RP3B 2QTSA 3TXSA 5LYJB 3JASA 1SQVH 3E35A 2M6YA 5IYZA 4LF7B 2R9RB 3JAWA 1QVFU 1IBMB 3JARA 1JOYA 5B1NA 3IGAC 4AQYO 3ZRXA 4O4JA 2OCHA 1ZUQA 4YJ2A 1P7BA 2UXXA 3ICXA 3B8MA 5KLVH 4RUFA 1SRYA 2A79B 5FNVA 3VQVA 4B08A 3JATB 2Q7GA 2BSKB 3K0DA 2Z0AA 3LDEA 1TVKA 1GTOA 3TJTA 3CMAV 3OUFA 1A32A 4JYYA 3ZX6A 3SJCC 4JI7B 1YSCA 5KUMA 4IHJB 5GONA 1M90W 2Y0PA 4JYAB 4DR1O 3LUTB 3QO8A 1HR0B 2W6IG 2RMKB 4R7CA 3CC4V 5F2VO 4I9WA 2ZR2A 4WFGA 2ZE8A 4DV0B 4H44B 4X66B 4LF5O 3FFQA 3E22B 1K4DC 4FFBA 3W7XA 5AG2A 3T1YB 2ZKOA 2PI5A 4DXWA 4EB6B 1IX9A 1IBKB 2WLIA 2AHYA 3LNMB 4NR1A 3EVKA 4JI0B 2H8PC 1H38A 1GH6A 4LFAO 4UVCA 1CP9A 4DV3B 1J5EO 4DR6O 1YZBA 2UXCO 1N34O 4J7KA 4HNAA 1Y76B 3BCCH 4KFMA 3ZN0A 4J42A 2A0LA 1YJWV 2NLJC 3B4SA 3B77A 3U10A 2Q67A 3X2QB 4CS2A 2ZD9A 5CBGA 2OIEA 1KMIZ 1FKAO 1V55B 2R70A 3JD4A 5LXTA 3SR2C 4KHPB 3T1CA 1LUVA 3E89A 5EZYA 4B3RB 2KQXA 4DRXB 5JCOA 1NTZH 2QKCA 4JI3O 1V54B 3JSNA 1SERA 2FKXA 3CCSV 1XMOB 4LF6B 1PL0A 4E4EA 3J81N 1D5NA 2IH1C 3KKYA 2QWNB 2FTKA 2YSUB 4HBNA 4X1KB 3HKDB 1BCCH 3HPLC 2Z3YA 2W6JG 1AR4A 1Y66A 3SJQC 5EIBC 2LW1A 3THOA 2UUAO 2RNBA 1XDCA 1K92A 2UUCO 3JYCA 3FYEB 2X0LA 3K3WA 5FPRA 4IIJA 5C8YA 2JEUA 4LC1A 3S3WA 1JVMA 2R72A 4EFBA 4LFCB 2UUBB 2OCCC 4RUEA 2CDYA 5CA0B 3I55V 1N8RW 2EZOA 3HKCA 3AG4C 3UQ8A 2JJ2G 2DMXA 1G8MA 2EIMC 5EBWC 1MABG 5HFMA 4ZBMA 4LH7A 3Q4HB 3SPJA 4KUMA 2D3OW 1XNQO 2P06A 4RQEA 4JI5B 1OJHA 2BCCH 1XL6A 5LL6Y 3G80A 2AHZA 3ZN1A 5JJEB 3RYCB 1M9NA 2HR3A 2Y4TA 1Q81W 4NXNB 1FYJA 1AP5A 1R3IC 5CN0A 1R73A 1MZFA 2ZINA 1GN2A 1M56B 1OV9A 1SQFA 2YEVB 4NKGB 3OW2U 1N32O 3VQXA 2HG5C 4B3TO 4U3JB 2ITDC 1GM7A 4CH4A 3ZHRA 3F5WC 1UFIA 3P32A 3JAKA 4RO2A 3ZRVA 5FPOA 2Q7EA 4LCUC 3UM7A 1WA8B 5LA6B 1PNMA 3QO7A 3JD1A 1WB7A 4XDLA 3ETEA 4KL1A 3CYOA 4GKKO 2VWJA 5BMVA 4X1IA 1M93A 4U3FH 1X59A 4LF8B 2OTJV 2FB5A 5H2FZ 5D5QA 3UKMA 2JRIA 4JTAB 5JH7B 4DV2O 5CB4A 2JS5A 4NB5A 5ITZA 1WPBA 4FM1A 2CH7B 2IU0A 1FFXA 1W59A 4O4HA 4L87A 3A0HZ 3OFNG 4BR6A 5DEDA 1R6KA 5IJ9B 2A06H 3ABLB 1Q6IA 1U96A 4MTOA 1W2BU 5L3EA 1MA1A 2IJJA 2CUGA 1VQ6V 2XTAA 3RYFB 1Q7YW 1OCOB 2Y69B 2KSDA 3W7WA 3CJHB 1COWG 3CHXA 1NVPB 4FIPC 5B1AB 3OTFA 1NJIW 5LMNB 4ZIBA 4I55B 3FB5C 3A8TA 4MVQA 4I4TB 2PYLA 1FJGO 3ML0A 1RFYA 1THZA 4PDLA 3D36C 3OUSA 4X88A 4F6RB 2XAFA 4I0XB 3E8FA 1N36B 3NR7A 4HAMA 3OR6C 1OCRB 2XAGA 4R6ZA 5EYPA 1R3KC 2XAHA 2ZM6O 1G6UA 1FPOA 1UJWB 1Y74A 1CXZB 1XMQO 2LJ2A 1TUBA 2ZE6A 1Q90D 3CMEV 2ZDIC 1VQ5V 1H2MA 1Q8IA 3LSUA 4B3MO 4FLWA 1I94B 1PM9A 3RW0A 1HNZB 3J80N 1D5AA 3AK2A 3WB2A 5IJ0B 3T1HO 1HNWO 4B3SO 3DGEA 4F4LA 1XOUA 3ETDA 1M57B 3D3IA 2JGDB 3E8BA 2B1IA 3K5OA 5DM6V 1S77D 1AJPA 2EJRA 3UCSC 5LMUO 3K9AA 2WLNA 1J95A 1VIBA 3UT5B 1ZL8B 4NXMB 4LFBB 2Q73A 3ZHSA 3ZHQA 4LH6A 1VQMV 4MVUA 3DC6A 3OEHG 3K5LA 1K5QA 4OX9O 1YEWA 1JPXA 2WPDG 5BY1A 4TQFA 4X62B 3VBBA 4D7SA 3AK3A 1IVSA 3ASNB 3H9VA 4K8XA 3JD0A 1GK9A 5A2QN 3GB7C 2NN4A 3OR7C 1QLEC 1T5EA 3ZJZA 5LBQA 3O9OA 2BOBC 2EINB 5C93A 3K5NA 1IBMO 3T4ZA 4BIOA 4W4LA 3SYQA 2VRZA 4NTXA 4DV1B 1EN6A 4J80A 2DYSC 2YXYA 1F51A 1H2NA 4PA7A 4TV9B 1QQCA 4LWSA 2E76B 1P7GA 1FXKC 2YIDA 2HFEC 1DF4A 4ABMA 4DR5B 2P7TC 4JF3A 2PUSA 3TK1A 4MS2A 4F6EA 1K4CC 5KX5A 2UXBO 1B06A 3BA8A 3CXCU 1M1KW 1DK1A 2ODMA 5L3FA 3K9SA 3FAVA 3TETA 4K0KB 1WNSA 4JI7O 2QM7A 3D36A 1TA8A 1SS3A 4MSWC 1JX9A 4UXNA 2DN9A 1PPJH 3CX5F 1B3QA 4PV1B 1K3EA 1HR0O 1KKDA 4I50A 3PJSK 2E5LB 2XNDG 1ZTEA 2EULA 4X65B 1N0NA 4DV0O 2WAMA 2QDOA 4X66O 3SPHA 5J2TB 4OPAA 2E74B 4JI4B 1P4RA 1JFFB 1ZAUA 1XUQA 3OMIB 4IL6Z 1BHBA 1IBKO 1F4MA 1N0JA 4JI0O 2QTOA 2ZDIA 1LR1A 4R8CA 3VQYA 3C3TA 3JASB 4JPRA 2OYQA 2A9HA 2CK3G 3OTOB 1NH2D 3RYHA 2DWDC 2VS0A 2YXHA 4YY3B 5JJNB 3JAWB 5CMUA 1GN3A 1JJ2U 4P9OA 3HR0A 5K1PA 3JARB 3K08A 4DUYB 1KUQA 1U97A 4YJ2B 4YJ3B 1VMGA 2EIJB 2G38A 4LF4O 3MDSA 1AROP 4WBNB 4GT1A 2GUZB 5FNVB 1Y6XA 1QR8A 5IE9A 3HKEB 3DC5A 1IDSA 1BE3H 4O2AA 1KP3A 4KHPO 1TAEA 4U7OA 4B3RO 1AJQA 3BAAA 3OAAG 2WLLA 4IYIA 4LF6O 2P22C 2EZPA 5BR8B 2LGQA 1US6A 1EBOA 1MZEA 3AG3B 2KG7A 1MSDA 1PNLA 1K8AW 4X1YA 4BAYA 4YHHB 4GX5A 3SDLA 4FK5C 3E83A 3SYCA 1L1FA 1ROPA 1KC8W 2ZR3A 4DV5B 2Q69A 1OCZB 4DV6B 3H1HH 1XI1A 2VQEB 4I5SA 3L73H 1Q86W 1AI5A 4JI1B 1BZKA 4ZI7A 5JQGA 3G6EV 2WSSG 4UFZA 3MHHC 4EFEA 5EBMC 3G6BA 4HNAB 3HB3B 3L74H 2UUBO 4X64B 4CH3A 1AVMA 2F43G 1NKDA 2X6CA 2WWWA 4DR7B 1WJZA 3CCMV 2GTSA 2HLDG 3RFRA 5KUKA 2DWEC 3ASOB 4U7NA 2Q6AA 5LXTB 3APOA 3M99B 5LP6B 1M5IA 3RVYA 3E8HA 3A0RA 3JALB 4OGQB 4FLYA 3SJAC 4QIWF 2P67A 1JCHA 2AGAA 1XREA 5GTIZ 2CGNA 5EC2C 4LBEC 3SYPA 4H33A 1VQLV 1FFTB 2F1MA 3FYIB 3X2QC 4NYKA 3M8AA 1VQKV 1FXHA 1V55C 3J7AU 2X7RB 4JV5B 4H0LB 5HFLA 3WB0A 4PELA 4JTCB 2OIGA 2LFRA 1EN4A 1V54C 2JIZG 1ENVA 5JJJB 1WAZA 3HKBA 2JEXA 4N23A 4IIJB 5BZBA 5C8YB 1HNXB 1AR1B 4PI2A 4JI8O 4ZHQA 1B6QA 2F4VB 1KD1W 1K73W 3DXRA 4Z1MG 4DR3B 2EILB 3HKCB 5LYJA 3K57A 4AILC 3STLC 1DF5A 2XUMA 4UCRA 2L6LA 2PYJA 4D6TH 1YIJV 1XNRO 4QJFB 4QE9A 1MSWD 1JA8A 3DTUB 3SGIA 2QGNA 1L8DA 4LF9B 4EEQA 3AG2B 4E2LA 3K59A 3JATA 4JYCA 4DUZB 5KHHA 1TGOA 4MTGA 1S5LZ 2MK3A 5H6RA 1S72V 4FM0A 1NU1H 4X20A 2P6JA 2H94A 4IHJA 4J7JA 1BT8A 1WB8A 4GKJO 4DR2O 4WCEV 4Z2WA 2HVKC 2GBOA 4G28B 2Q0AA 2VWKA 5IY5B 1YF2A 2Q0OC 1K9MW 4HZ3A 2EIKB 4BWAA 1FD9A 4O4IA 3OM3B 3QO5A 2UU9O 1N36O 3TGUH 1M56C 3CS5A 5LGNA 2H3OA 5B3SB 3FB8C 4GZRB 1BHAA 1Q43A 2C2AA 4X1IB 4J9YB 4GYCB 3NXSA 3FD9A 1NS1A 1URFA 2GSMB 4FMTA 3JAMN 3ZRSA 1O9GA 1VEWA 5J2UB 4JASA 4RWUA 4AQYB 5CB4B 1XL4A 1FFXB 1Z5VA 1Q5OA 3EFFK 3QNEA 3G4SV 3ZMVA 1SC5B 1UPGA 1QCEA 4ZKIA 1HNZO 1P84F 1H2SB 3OT7A 4DRXA 5B66Z 1RPOA 3G67A 2YS8A 2RN9A 4C7UA 5JVDB 2XAJA 5EIBD 4W4KA 4X1KA 3HKDA 1S0VA 5LHGA 4MVRA 3D8CA 5KHKA 2EJ7A 1GN4A 4RQFA 4HYOA 4NXMO 4LFBO 3FB7C 3RN4A 1K97A 2V1DA 2JJ1G 3ABLC 2UXDO 5EBLC 4LF5B 5E1AC 1YITV 4DK0A 3BFRA 1YTFD 3IJ4A 4X62O 3AG1B 4TOIA 1YDXA 1GKFA 1OCOC 1VF6C 2Y69C 4H37A 4IYHA 4LFAB 1Q3EA 4GX2A 1J5EB 4DR6B 3K03A 3JSLA 2GV9A 4JI2O 5CA0A 4KP4A 4UCOA 5B1AC 2ITCC 4BIZA 4JZ2A 5LGUA 2X6AA 4B7KA 1GN6A 1BS3A 3Q4HA 1I7FA 3WFVA 4NTWA 4MTFA 2XHBA 4IT5A 1OCRC 4ICGA 2ZXWB 3SYOA 3RBZA 3ABUA 2V4DA 2JS3A 4TV8A 3RYCA 3K06A 2GTAA 4K3AA 2IM9A 4X8AA 2Q7HA 5FL7G 2OT5A 1W0KG 2YEVA 3OMAB 1GM8A 3L75H 2IJHA 1TUEB 2YICA 4CZZA 4X65O 3JCZA 2ZE5A 3ZEDA 1SZXA 4U3JA 1YXBA 2YI8A 1HP8A 4JI4O 2Q8VA 3CRRA 2UUCB 3BY6A 1M57C 2QWOB 2BTQA 1RSOB 1YCIA 1L0NH 1RPRA 1E1RG 3P30A 1WA8A 2JVDA 5LA6A 2HHHO 4KXRA 3JD2A 2FL4A 3L9DA 1N33O 4DUYO 3CD6V 2AW9A 3QVNA 3KCYA 4LWSB 3W7SA 2IJKA 1AILA 1XNQB 3LDDA 5A9GA 1SA0B 4QPKA 2GDSA 4DV4B 3ASNC 2DJVA 2HJFC 3FAVB 3ABMB 1FS0G 4FPPA 5BR8O 4WFAV 5EK0A 2EINC 1HWYA 2B1GA 4PDMA 1DGSA 3ZIAG 2DOSA 4FVMA 3H1JH 3RYFA 4I50B 1RM1B 3N2KB 4DW1A 4TWKA 4DV5O 4TSFG 1VF6A 2QEXV 1XILA 2EBOA 2QM4A 1YI2V 1N32B 1JMKC 1VQ8V 4J10A 2AZ0A 1KKCA 4JI1O 1IBLB 4N21A 3UO2A 3WG7B 2IBZH 4XDKA 3ETGA 4XBFA 3H01A 2N05A 4LF7O 1Q6UA 5B1BB 3OE7G 4XDJA 1IZ3A 3R65A 4MT8A 4NVPA 1IXMA 2HEPA 4X64O 4LNUB 4OXSA 4EKWA 5KMGB 1PP9H 2L35A 2QJ1A 2NNUA 2Y4UA 1W0JG 3FKSG 4R50A 4GKKB 3QTCA 1H2LA
chains in the Genus database with same CATH topology
1S3JA 5EBMC 3HB3B 4UVBA 1K92A 1E79G 3FYEB 2X0LA 3JYCA 2F43G 1DTOA 2HVJC 1NKDA 2HKOA 3K3WA 2X6CA 2WWWA 5GW7A 3W7UA 3CCMV 5J9PC 4UV9A 2Y48A 2JEUA 2IU3A 4UV8A 4LC1A 2HLDG 5KUKA 2DWEC 3ASOB 4P9PA 1K5SA 4U7NA 1JVMA 2DQ0A 4RAIA 1I5XA 2Q6AA 3M99B 1NQTA 2OCCC 4RUEA 3RVYA 3I55V 1N8RW 3E8HA 3A0RA 3I56V 2EZOA 3F7VC 4Q20A 3IFXA 3AG4C 1WLEA 2JJ2G 3ABMC 2EIJC 1G8MA 2EIMC 5EBWC 3SPCA 1MABG 5HFMA 1CPYA 1NH2B 4QIWF 4ZBMA 5IYCO 2P67A 1JCHA 4FJCC 4P30A 3CCLV 2XOKG 3SPJA 4UUJC 3T4DA 4KUMA 2QE7G 2D3OW 5EC2C 4LBEC 4RQEA 3SYPA 4DO2A 4H33A 1VQOV 1VQLV 1FFTB 2JK5C 1XL6A 1RM1C 2XASA 1NVPD 3FYIB 4MVSA 3X2QC 2IH3C 2AHZA 3ZN1A 2B5UA 3AG3C 1VQKV 1FXHA 1M9NA 5IYBO 1V55C 1LNQA 2HR3A 1PD3A 2X7RB 3FB6C 2W0FC 1Q81W 5HFLA 1R3IC 4PELA 4JTCB 5CN0A 1R73A 3STZC 4LP8A 2LFRA 4WFFA 2GHYA 1V54C 1M56B 3WG7C 2JIZG 2Z5UA 1ENVA 1QLNA 2YEVB 2JEXA 4N23A 5BZBA 4ASUG 1OCZC 3OW2U 1AR1B 2JDIG 5B1BC 5CBHA 1R3LC 1B6QA 2HG5C 2IJIA 2ITDC 4QPJA 1KD1W 1MG1A 4MVOA 1GM7A 1K73W 3F5WC 4Z1MG 5B1OA 3OGCC 4YXWG 1GM9A 3P32A 3CCJV 2EILB 1QR9A 4RO2A 3ZMUA 3ZRVA 1NBMG 4PDVA 2QKSA 4LCUC 3UM7A 3STLC 3CCUV 1GO3F 1DF5A 1YJ9V 1PNMA 3QO7A 2QA4V 3JD1A 3F7YC 1YIJV 3SPIA 4QJFB 4QE9A 3JD3A 1MSWD 4XDLA 3ETEA 3DTUB 3E8GA 1H8HG 1SZTA 3CYOA 3MD0A 4MVZA 3AG2B 2ZQMA 2R9IA 3ZMSA 3ASOC 2OTLV 4E2LA 3ZMTA 1SESA 4JYCA 2OTJV 1S5HC 3UKMA 3G71V 4JTAB 4MTGA 2DYRB 2MK3A 5H6RA 1S72V 4J9ZB 2WLIB 5LHIA 3CP1A 2IU0A 1AI6A 4L87A 4JAUA 1JQ0A 2P6JA 3OFNG 1WPXA 1FXKA 4JTDB 3K0GA 1R6KA 2H94A 4MTOA 3ABLB 3E86A 1W2BU 5CBFA 1SETA 4PA6A 5L3EA 2IJJA 3SPGA 5L3BA 4BW5A 1VQ6V 4WCEV 2HVKC 2WLLB 2XAQA 4G28B 4JYBA 5IY5B 1Q7YW 1K9MW 1OCOB 2Y69B 4HZ3A 2EIKB 4WFHA 3OM3B 3QO5A 3W7WA 1COWG 2WLKA 1OCCB 1BMFG 2ATKC 2WLHA 1M56C 4PA4A 3OEEG 1NVPB 5LGNA 4JGSA 4FIPC 5B1AB 4MW3A 5B3SB 1CEZA 3FB8C 4WFBV 1NJIW 3FB5C 4MVQA 1BHAA 4PA9A 3ZMZA 3ML0A 3GWOA 2C2AA 1KQSU 1OHHG 1THZA 4J9YB 1NR1A 4P2ZA 4PDLA 4WFEA 3OUSA 4X88A 3NXSA 2XAFA 2K1EA 2GSMB 3CC7V 1QLEB 4FMTA 3CCEV 3ZRSA 2X6BA 3E8FA 4JASA 1S76D 3E2EA 4UVAA 2EILC 4HAMA 4MVMA 3OR6C 1OCRB 1AJNA 1QBZA 1XL4A 2XAGA 3ABKB 2DYSB 4R6ZA 4GX0A 1R3KC 4MTXA 2XAHA 1VQPV 4CBCA 1KECA 3EFFK 3QNEA 1GMGA 1UJWB 3ZMVA 1FXKB 3G4SV 3W7TA 1QCEA 4ZKIA 2DQ3A 2V7QG 1MOFA 1R6NA 3CMEV 1EZJA 1RPOA 2ZDIC 1VQ5V 4QE7A 4G27B 1H2GA 3AG2C 1G4YB 4G2KA 5L3DA 2XAJA 1F4NA 3ZRWA 3RW0A 4GCZA 1K34A 2DYRC 1S0VA 5LHGA 3DGEA 4MVRA 1YJNV 4F4LA 4RQFA 3ETDA 3RVZA 1ORQC 1M57B 3D3IA 4HYOA 5H9CA 3FB7C 2BOCC 2B1IA 3E8BA 1VQ7V 1K97A 2V1DA 1VQ9V 2JJ1G 3ABLC 5EBLC 5E1AC 5DM6V 1YITV 1VQNV 1S77D 1DLBA 1AJPA 1Y4MA 4JAVA 4PA3A 1PKXA 2EJRA 3CCVV 3K9AA 1YTFD 5L3GA 2WLNA 3AG1B 5IDJA 2LFSA 1J95A 5IY5C 1EFRG 4MW8A 1GKFA 1OCOC 2Y69C 4H37A 2EIKC 1ZWIC 1VQMV 4MVUA 3OEHG 2WLMA 4GX2A 3TCUA 1F23A 1K5QA 3K03A 4BIUA 1AI4A 1OCCC 5KA5A 1JPXA 3LDCA 4KP4A 2WPDG 1PNKA 5B1AC 3EHBB 1K7DA 5B3SC 4WF9V 3K04A 2ITCC 3VBBA 3BEHA 5CA3A 1VQ4V 2IW5A 4BIZA 3ASNB 5LGUA 3JD0A 2X6AA 1GK9A 3GB7C 3SYAA 3OR7C 1QLEC 2PI4A 4X89A 3ZJZA 5LBQA 3ZRWB 5LGTA 2BOBC 1KP2A 2EINB 4TT3G 3WFVA 5C93A 1FXVA 1K33A 3T4ZA 3CC2V 3SYQA 5L3CA 4MTFA 1OCRC 1NR7A 2ZXWB 3ABKC 2DYSC 3SYOA 1F51A 5EC1C 4PA7A 3RBZA 3ABUA 3E35A 1FXKC 2HFEC 3K06A 1DF4A 1R3JC 2P7TC 1H8EG 2R9RB 4JF3A 1QVFU 3TK1A 4MS2A 5DN6G 1JOYA 5IYDO 4X8AA 5B1NA 1K4CC 3IGAC 3ZRXA 5FL7G 2OT5A 3CXCU 1W0KG 1M1KW 2YEVA 5L3FA 3OMAB 3CPWU 1GM8A 1P7BA 1BL8A 2UXXA 2IJHA 1TUEB 3B8MA 4CZZA 2UXNA 4RUFA 1SRYA 2A79B 3TETA 1OZ0A 3JCZA 2QM7A 3D36A 4MSWC 1JX9A 4UXNA 3KG2A 2DW4A 3T2MA 3K0DA 3MHSC 1K3EA 3BY6A 1KKDA 1M57C 3ZCCA 3LDEA 3CCQV 4PDRA 3LSSA 3PJSK 1GTOA 3CMAV 2XNDG 3OUFA 1RPRA 1E1RG 3ABTA 3P30A 2WAMA 3SPHA 1YSCA 5KUMA 1M90W 3JD2A 1P4RA 3LUTB 3OMIB 3AG1C 3QO8A 1BHBA 2W6IG 4QNHB 1F4MA 2P90A 4R7CA 3CD6V 2QTOA 2ZDIA 4R8CA 3OMNB 3CC4V 3K79A 3IC7A 4JPRA 2A9HA 4I9WA 2CK3G 2ZR2A 4WFGA 3W7SA 3VOUA 1NH2D 2IJKA 2DWDC 1K4DC 1YTFB 2WLJA 3W7XA 5CMUA 1JJ2U 4P9OA 2PI5A 3LDDA 3AEIA 4DXWA 1E1QG 4QPKA 3K08A 2OCCB 2WLIA 3ASNC 2AHYA 3LNMB 2HJFC 3AG4B 3LSQA 2H8PC 3ABMB 1FS0G 2EIJB 2EIMB 4FPPA 1H38A 4UVCA 1CP9A 3B8NA 4WFAV 1AROP 5EK0A 4GT1A 2EINC 1HWYA 2B1GA 1QR8A 4KFMA 4PDMA 3ZN0A 1KP3A 2A0LA 2ZXWC 4U7OA 1YJWV 3ZIAG 1AJQA 2NLJC 1QVGU 3OAAG 2QM8A 1I5YA 3B77A 2WLLA 1RM1B 2Q67A 2M7WA 4TWKA 4TSFG 2EZPA 3X2QB 2QEXV 1EBOA 2ZD9A 1AI7A 2EBOA 5CBGA 3AG3B 1YI2V 1PNLA 1K8AW 1V55B 3JD4A 1Q82W 4BAYA 1VQ8V 4GX5A 3T1CA 4FK5C 3E89A 3E83A 4GX1A 3SYCA 1L1FA 1ROPA 2LP7A 1KC8W 2ZR3A 2Q68A 4N21A 1V54B 1SERA 3WG7B 3CCSV 5KA6A 1PL0A 2Q69A 3ETGA 4XDKA 4XBFA 2IH1C 3H01A 1OCZB 5B1BB 2FTKA 2YSUB 3OE7G 4XDJA 4I5SA 3R65A 5LHHA 1Q86W 3HPLC 3CCRV 1AI5A 4MT8A 2Z3YA 2W6JG 1YHQV 1IXMA 2KB1A 5H6QA 1Y66A 4OXSA 4EKWA 3G6EV 2WSSG 3SJQC 2NNUA 3FKSG 1W0JG 4R50A 3MHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 V;  1N8R W;  1KD1 W;  3CCS V;  3CCQ V;  3I56 V;  1YJW V;  1VQP V;  1QVF U;  1K73 W;  1VQK V;  1QVG U;  3CMA V;  3G4S V;  1W2B U;  1Q81 W;  4WFB V;  1NJI W;  3CXC U;  1M1K W;  1JJ2 U;  3CCJ V;  3CPW U;  1VQ9 V;  1VQM V;  1YJN V;  3CC2 V;  1KQS U;  1R73 A;  3CCL V;  1Q86 W;  3CCR V;  1M90 W;  2QEX V;  3CC4 V;  1VQ6 V;  2OTJ V;  4WCE V;  1YHQ V;  1YI2 V;  3CCM V;  3CCU V;  3G71 V;  3CC7 V;  2D3O W;  3CME V;  3CCE V;  1VQ7 V;  1K8A W;  1YJ9 V;  3G6E V;  1Q7Y W;  1VQO V;  1Q82 W;  1VQ5 V;  4WFA V;  1VQ8 V;  4WF9 V;  1S72 V;  1K9M W;  1VQL V;  2QA4 V;  5DM6 V;  3OW2 U;  1YIJ V;  1YIT V;  1VQN V;  3CD6 V;  1VQ4 V;  2OTL V;  1KC8 W;  3CCV V; 
#chains in the Genus database with same CATH topology
 3CEI A;  1S3J A;  2P4V A;  3MAQ A;  1I08 A;  4O4L B;  4PI0 A;  2XT9 A;  1DTO A;  2Q5Z A;  5GW7 A;  3RGB A;  3W7U A;  2YIA A;  4UV9 A;  2Y48 A;  2F93 B;  2ILM A;  4JYA O;  4RAI A;  4A5U B;  5IJ0 A;  1V9P A;  3F7V C;  3TXQ A;  3AG7 A;  1WLE A;  3A0B Z;  2EIJ C;  3K5M A;  5DEC A;  5K1X A;  4DR4 B;  1CPY A;  1NH2 B;  4P30 A;  3T4D A;  2QE7 G;  3T1Y O;  3N27 A;  4CC5 A;  4J11 A;  4DO2 A;  1VQO V;  3ETQ A;  2Q4P A;  1MMM A;  4DW0 A;  2ZNI A;  2JK5 C;  2NR5 A;  4ZI7 B;  5JQG B;  2XAS A;  3UT5 A;  5H5N A;  4UB6 Z;  2CTQ A;  4DV3 O;  2B5U A;  1FJG B;  3AG3 C;  2LO1 A;  5D5P A;  5IYB O;  1X4T A;  3FB6 C;  2W0F C;  4J41 A;  5IYZ B;  3B09 A;  3STZ C;  4LP8 A;  4DV7 B;  4WFF A;  3PN1 A;  4DR3 O;  4O4J B;  2ETN A;  1M4U A;  4JI6 B;  2Y0I A;  4ASU G;  2ZM6 B;  3VQW A;  2RDC A;  1OCZ C;  3BVO A;  5CBH A;  5CA1 A;  4QPJ A;  4MVO A;  4CH6 A;  4ZOL A;  5B1O A;  3OGC C;  4YXW G;  3CCJ V;  1TVK B;  1QR9 A;  1XMO O;  4TV9 A;  3ZMU A;  3H1K H;  4LF9 O;  1AP6 A;  4BW9 A;  2ZT9 B;  4B3M B;  3N2G A;  3CCU V;  1QHT A;  2VQF B;  5GON B;  4DUZ O;  3F7Y C;  1AB3 A;  4PJ0 Z;  3JD3 A;  3T1H B;  2CE4 A;  2CTP A;  3CB2 A;  3MD0 A;  1Y67 A;  1N4C A;  2R9I A;  3ZMS A;  3ASO C;  3ZMT A;  2RJZ A;  5LP6 C;  1S5H C;  4FFB B;  4JAA A;  5LMU B;  2DYR B;  4J9Z B;  2WLI B;  3HKB B;  1AI6 A;  1KYO F;  1PV0 A;  1WPX A;  1FXK A;  3K0G A;  4O2B A;  5J2T A;  5IWA B;  1MNG A;  4LR3 A;  4UCT A;  3E86 A;  1VP7 A;  4LFC O;  1JFF A;  5CBF A;  1R1B A;  3BPZ A;  1SET A;  4PA6 A;  5L3B A;  1VAR A;  2P4K A;  4JYB A;  1WP8 A;  1NT2 B;  3ZHU A;  4WFH A;  2WLK A;  3L72 H;  4JI5 O;  1OCC B;  3U11 A;  5EZY B;  5LOV A;  1CEZ A;  4MW3 A;  4TUY A;  4YJ3 A;  2QKA A;  1KQS U;  1OHH G;  1NR1 A;  4WFE A;  4WBN A;  2GUZ A;  3CC7 V;  3HKE A;  3CCE V;  1EZV H;  4NXN O;  4PHZ A;  3LNN A;  3E2E A;  4UVA A;  2EIL C;  4MVM A;  1QBZ A;  3ABK B;  2UXB B;  3CRM A;  4MTX A;  4UCU A;  1FAF A;  4X20 B;  4CBC A;  4L8J A;  4PD4 F;  1BQZ A;  3W7T A;  1SF9 A;  2LGW A;  2ADP A;  1R6N A;  3RYI A;  4FM2 A;  1EZJ A;  2ZNJ A;  5KAI Z;  1KU9 A;  1H2G A;  3AG2 C;  4IGG A;  3RWR D;  2E3C A;  1G4Y B;  4AI8 A;  1GRJ A;  5L3D A;  3ZRW A;  4O4I B;  1XQ8 A;  4NTY A;  4CH5 A;  1K34 A;  2ADQ B;  1D2D A;  1KB9 F;  3L70 H;  5H9C A;  3UO3 A;  1VQ7 V;  5BXZ A;  4LF8 O;  4Z1V A;  4Q6G A;  2ZCE A;  1VQN V;  2QR4 A;  1DLB A;  1Y4M A;  4JAV A;  5FLX N;  2PZS A;  5IDJ A;  2P5O A;  5IY5 C;  1EFR G;  2K9P A;  3CE2 A;  3ZHV A;  2EIK C;  2LW7 A;  4LF4 B;  1ZWI C;  1ZLZ A;  2A3Q A;  3BHP A;  2BSK A;  2PTM A;  3BA9 A;  1AI4 A;  4UCV A;  5E79 Z;  5KHJ A;  5KA5 A;  5LP6 A;  3LDC A;  1SQB H;  1PNK A;  5B3S C;  2JGU A;  3JAL A;  5KAF Z;  2IW5 A;  2BE3 A;  4OPH A;  3SYA A;  2PI4 A;  1FXV A;  1K33 A;  3L71 H;  2RQ6 A;  4TQD A;  1SQX H;  2OWO A;  5LMN O;  2YXL A;  3JAK B;  2LQT A;  1WP7 A;  1R3J C;  3E22 A;  1H8E G;  3S3X A;  1NTM H;  1SKV A;  2AZ2 A;  5DN6 G;  4EB6 A;  5IYD O;  1SQQ H;  3CPW U;  3OD4 A;  1BL8 A;  5BMV B;  2UXN A;  3ZS8 C;  1OZ0 A;  1Y76 A;  3BRC A;  3KZI Z;  3KG2 A;  2DW4 A;  4K8Z A;  3T2M A;  3C90 A;  3MHS C;  3ZCC A;  5KHG A;  5ITZ B;  3CCQ V;  4PDR A;  5GTH Z;  3LSS A;  1XBL A;  3OGI B;  4O4H B;  4YIP A;  3ABT A;  1I94 O;  2W0X A;  2QSA A;  1KBH A;  3AG1 C;  2F66 C;  4QNH B;  4DV4 O;  2P90 A;  2WA3 A;  3OMN B;  3K79 A;  3IC7 A;  1QU7 A;  4TV8 B;  1VF7 A;  2MW2 B;  3VOU A;  1JJO A;  1YTF B;  2WLJ A;  3APQ A;  4FLT A;  1SQP H;  4DR1 B;  4I9Q A;  3AEI A;  1AR5 A;  1E1Q G;  4FZ0 A;  2OCC B;  2B9Z A;  3H1I H;  2O57 A;  3AG4 B;  3LSQ A;  3IAY A;  2EIM B;  3B8N A;  1JR9 A;  4D7T A;  1I0H A;  3CSX A;  3P3P A;  3FX7 A;  2ZXW C;  3I5D A;  4X9Q A;  1IBL O;  1QVG U;  2YDE A;  2QM8 A;  1I5Y A;  1PL4 A;  5EYP B;  4FZ1 A;  2M7W A;  4UB8 Z;  2YUA A;  2BTQ B;  2YC0 A;  4J7Z A;  1AI7 A;  4JI8 B;  3A2F A;  1N34 B;  2UXC B;  1Y74 B;  4AHC A;  1Q82 W;  4DV1 O;  1TUB B;  4GX1 A;  2LP7 A;  3R66 A;  2PF4 E;  2Q68 A;  5KA6 A;  4FLX A;  3B2E E;  3F5T A;  4DR5 O;  2ZIM A;  3QG5 A;  2N04 A;  5J2U A;  4CC6 A;  2RCV A;  5LHH A;  3CCR V;  2PY5 A;  3AK1 A;  1XNR B;  1ZX3 A;  1YHQ V;  2KB1 A;  5H6Q A;  4FLZ A;  3KCX A;  4JI3 B;  4K0K O;  2OTL V;  3DSQ A;  4I7Z B;  4UVB A;  1Q6H A;  1E79 G;  2HVJ C;  2HKO A;  2E5L O;  4DR4 O;  5J9P C;  5JVD A;  2UUA B;  2IU3 A;  4K35 A;  4UV8 A;  4DK1 A;  4P9P A;  1K5S A;  2DQ0 A;  1B04 A;  1I5X A;  1NQT A;  4GKJ B;  4DR2 B;  3I56 V;  4UCS A;  4Q20 A;  1S5J A;  3IFX A;  5B5E Z;  3ABM C;  2EX3 A;  3SPC A;  1EN5 A;  2A7W A;  3RT3 C;  3OTO O;  5IYC O;  4FJC C;  4FLU A;  3CCL V;  1HDJ A;  2D2C B;  2XOK G;  4UUJ C;  4YY3 O;  3CRA A;  2UU9 B;  4CS3 A;  4DV7 O;  3D3Q A;  1RM1 C;  3IC9 A;  1NVP D;  4JI6 O;  4MVS A;  2IH3 C;  1ZSP A;  1NZ6 A;  2Q9L A;  2R9A A;  2N74 A;  1LNQ A;  1PD3 A;  5KHI A;  4FFK A;  3SJB C;  5JH7 A;  2GHY A;  5KX5 B;  2PGG A;  1IUR A;  3WG7 C;  1QLN A;  2Z5U A;  2ZE7 A;  2CH7 A;  4QGP A;  2JDI G;  3EXA A;  5B1B C;  1R3L C;  2VQF O;  5TIS Z;  5IJ9 A;  2IJI A;  4YHH O;  1MG1 A;  1BSM A;  2HJD A;  1XHZ A;  1XHX A;  1GM9 A;  1VF5 B;  2CTW A;  5IT9 N;  2F95 B;  1NBM G;  4PDV A;  2QKS A;  4DV6 O;  1GO3 F;  2FYU H;  1IXB A;  2VQE O;  3CJH A;  1YJ9 V;  4B3T B;  2QA4 V;  4GLX A;  3SPI A;  4CS4 A;  3E8G A;  2ZIO A;  1H8H G;  1SZT A;  4I55 A;  4I4T A;  4MVZ A;  1R6T A;  2ZQM A;  4F6R A;  1NI8 A;  4I0X A;  1SES A;  5IWA O;  3RYH B;  2UXD B;  2YI9 A;  2FML A;  3G71 V;  2CGO A;  4B7E A;  3M7M X;  2E75 B;  4DR7 O;  5LHI A;  3CP1 A;  1RSO A;  1BGY H;  4JAU A;  1JQ0 A;  4JTD B;  2QWP B;  5CA1 B;  4O2A B;  1BQ0 A;  4JI2 B;  4DV2 B;  3SPG A;  4ZOL B;  4BW5 A;  2WLL B;  2XAQ A;  1LUW A;  1YVW A;  3C3S A;  1HW7 A;  2YIB D;  3N2G B;  2KG7 B;  4X1Y B;  1BMF G;  2ATK C;  2WLH A;  4PA4 A;  3OEE G;  1SA0 A;  4JGS A;  1SQG A;  2KKW A;  1F7Y A;  4WFB V;  2JGD A;  4PA9 A;  3ZMZ A;  3GWO A;  1L0L H;  3U0Z A;  4P2Z A;  3CWB H;  2K1E A;  4JV5 O;  1QLE B;  3P3N A;  2X6B A;  2ARH A;  1S76 D;  2BTO A;  2CAZ C;  1AJN A;  1ZL8 A;  2DYS B;  3GWK C;  4GX0 A;  3N2K A;  4YIO A;  1VQP V;  1HNX O;  1G1X B;  1KEC A;  2QWQ B;  1GMG A;  1FXK B;  2F4V O;  4O2B B;  3ZHT A;  2AXT Z;  2DQ3 A;  2V7Q G;  1MOF A;  4GUN A;  2DE0 X;  1Z5W A;  4QE7 A;  4G27 B;  2YIB A;  2F23 A;  4G2K A;  2WA4 A;  1F4N A;  2HHH B;  1XMQ B;  1H2K A;  4GCZ A;  4DYL A;  2DYR C;  2HP8 A;  1N33 B;  5LOV B;  4LNU A;  1YJN V;  5KMG A;  3H1L H;  3BAB A;  3RVZ A;  1ORQ C;  4TUY B;  2BOC C;  1O9H A;  1GAX A;  1VQ9 V;  2QWR B;  3K58 A;  1P49 A;  4PA3 A;  1PKX A;  1NTK H;  3CCV V;  1XEQ A;  4O4L A;  1HNW B;  4B3S B;  5L3G A;  3ZBH A;  2LFS A;  4MW8 A;  3JCU Z;  1WN7 A;  1EM1 A;  3QF7 A;  2WLM A;  3CRC A;  3GVM A;  3TCU A;  1F23 A;  4BIU A;  5JWP A;  1OCC C;  3O65 A;  3CRQ A;  5JCO C;  4WF9 V;  3EHB B;  1K7D A;  4FLV A;  3RYI B;  3K04 A;  3B40 A;  5CA3 A;  3BEH A;  1VQ4 V;  1QNM A;  4JZG A;  3CXH F;  4X89 A;  4ZHQ B;  2CTR A;  3WB1 A;  3ZRW B;  5LGT A;  4OX9 B;  1KP2 A;  4TT3 G;  3WU2 Z;  3CC2 V;  1Z2G A;  5L3C A;  3DXR B;  1NR7 A;  4H13 B;  3ABK C;  5EC1 C;  1RP3 B;  2QTS A;  3TXS A;  5LYJ B;  3JAS A;  1SQV H;  3E35 A;  2M6Y A;  5IYZ A;  4LF7 B;  2R9R B;  3JAW A;  1QVF U;  1IBM B;  3JAR A;  1JOY A;  5B1N A;  3IGA C;  4AQY O;  3ZRX A;  4O4J A;  2OCH A;  1ZUQ A;  4YJ2 A;  1P7B A;  2UXX A;  3ICX A;  3B8M A;  5KLV H;  4RUF A;  1SRY A;  2A79 B;  5FNV A;  3VQV A;  4B08 A;  3JAT B;  2Q7G A;  2BSK B;  3K0D A;  2Z0A A;  3LDE A;  1TVK A;  1GTO A;  3TJT A;  3CMA V;  3OUF A;  1A32 A;  4JYY A;  3ZX6 A;  3SJC C;  4JI7 B;  1YSC A;  5KUM A;  4IHJ B;  5GON A;  1M90 W;  2Y0P A;  4JYA B;  4DR1 O;  3LUT B;  3QO8 A;  1HR0 B;  2W6I G;  2RMK B;  4R7C A;  3CC4 V;  5F2V O;  4I9W A;  2ZR2 A;  4WFG A;  2ZE8 A;  4DV0 B;  4H44 B;  4X66 B;  4LF5 O;  3FFQ A;  3E22 B;  1K4D C;  4FFB A;  3W7X A;  5AG2 A;  3T1Y B;  2ZKO A;  2PI5 A;  4DXW A;  4EB6 B;  1IX9 A;  1IBK B;  2WLI A;  2AHY A;  3LNM B;  4NR1 A;  3EVK A;  4JI0 B;  2H8P C;  1H38 A;  1GH6 A;  4LFA O;  4UVC A;  1CP9 A;  4DV3 B;  1J5E O;  4DR6 O;  1YZB A;  2UXC O;  1N34 O;  4J7K A;  4HNA A;  1Y76 B;  3BCC H;  4KFM A;  3ZN0 A;  4J42 A;  2A0L A;  1YJW V;  2NLJ C;  3B4S A;  3B77 A;  3U10 A;  2Q67 A;  3X2Q B;  4CS2 A;  2ZD9 A;  5CBG A;  2OIE A;  1KMI Z;  1FKA O;  1V55 B;  2R70 A;  3JD4 A;  5LXT A;  3SR2 C;  4KHP B;  3T1C A;  1LUV A;  3E89 A;  5EZY A;  4B3R B;  2KQX A;  4DRX B;  5JCO A;  1NTZ H;  2QKC A;  4JI3 O;  1V54 B;  3JSN A;  1SER A;  2FKX A;  3CCS V;  1XMO B;  4LF6 B;  1PL0 A;  4E4E A;  3J81 N;  1D5N A;  2IH1 C;  3KKY A;  2QWN B;  2FTK A;  2YSU B;  4HBN A;  4X1K B;  3HKD B;  1BCC H;  3HPL C;  2Z3Y A;  2W6J G;  1AR4 A;  1Y66 A;  3SJQ C;  5EIB C;  2LW1 A;  3THO A;  2UUA O;  2RNB A;  1XDC A;  1K92 A;  2UUC O;  3JYC A;  3FYE B;  2X0L A;  3K3W A;  5FPR A;  4IIJ A;  5C8Y A;  2JEU A;  4LC1 A;  3S3W A;  1JVM A;  2R72 A;  4EFB A;  4LFC B;  2UUB B;  2OCC C;  4RUE A;  2CDY A;  5CA0 B;  3I55 V;  1N8R W;  2EZO A;  3HKC A;  3AG4 C;  3UQ8 A;  2JJ2 G;  2DMX A;  1G8M A;  2EIM C;  5EBW C;  1MAB G;  5HFM A;  4ZBM A;  4LH7 A;  3Q4H B;  3SPJ A;  4KUM A;  2D3O W;  1XNQ O;  2P06 A;  4RQE A;  4JI5 B;  1OJH A;  2BCC H;  1XL6 A;  5LL6 Y;  3G80 A;  2AHZ A;  3ZN1 A;  5JJE B;  3RYC B;  1M9N A;  2HR3 A;  2Y4T A;  1Q81 W;  4NXN B;  1FYJ A;  1AP5 A;  1R3I C;  5CN0 A;  1R73 A;  1MZF A;  2ZIN A;  1GN2 A;  1M56 B;  1OV9 A;  1SQF A;  2YEV B;  4NKG B;  3OW2 U;  1N32 O;  3VQX A;  2HG5 C;  4B3T O;  4U3J B;  2ITD C;  1GM7 A;  4CH4 A;  3ZHR A;  3F5W C;  1UFI A;  3P32 A;  3JAK A;  4RO2 A;  3ZRV A;  5FPO A;  2Q7E A;  4LCU C;  3UM7 A;  1WA8 B;  5LA6 B;  1PNM A;  3QO7 A;  3JD1 A;  1WB7 A;  4XDL A;  3ETE A;  4KL1 A;  3CYO A;  4GKK O;  2VWJ A;  5BMV A;  4X1I A;  1M93 A;  4U3F H;  1X59 A;  4LF8 B;  2OTJ V;  2FB5 A;  5H2F Z;  5D5Q A;  3UKM A;  2JRI A;  4JTA B;  5JH7 B;  4DV2 O;  5CB4 A;  2JS5 A;  4NB5 A;  5ITZ A;  1WPB A;  4FM1 A;  2CH7 B;  2IU0 A;  1FFX A;  1W59 A;  4O4H A;  4L87 A;  3A0H Z;  3OFN G;  4BR6 A;  5DED A;  1R6K A;  5IJ9 B;  2A06 H;  3ABL B;  1Q6I A;  1U96 A;  4MTO A;  1W2B U;  5L3E A;  1MA1 A;  2IJJ A;  2CUG A;  1VQ6 V;  2XTA A;  3RYF B;  1Q7Y W;  1OCO B;  2Y69 B;  2KSD A;  3W7W A;  3CJH B;  1COW G;  3CHX A;  1NVP B;  4FIP C;  5B1A B;  3OTF A;  1NJI W;  5LMN B;  4ZIB A;  4I55 B;  3FB5 C;  3A8T A;  4MVQ A;  4I4T B;  2PYL A;  1FJG O;  3ML0 A;  1RFY A;  1THZ A;  4PDL A;  3D36 C;  3OUS A;  4X88 A;  4F6R B;  2XAF A;  4I0X B;  3E8F A;  1N36 B;  3NR7 A;  4HAM A;  3OR6 C;  1OCR B;  2XAG A;  4R6Z A;  5EYP A;  1R3K C;  2XAH A;  2ZM6 O;  1G6U A;  1FPO A;  1UJW B;  1Y74 A;  1CXZ B;  1XMQ O;  2LJ2 A;  1TUB A;  2ZE6 A;  1Q90 D;  3CME V;  2ZDI C;  1VQ5 V;  1H2M A;  1Q8I A;  3LSU A;  4B3M O;  4FLW A;  1I94 B;  1PM9 A;  3RW0 A;  1HNZ B;  3J80 N;  1D5A A;  3AK2 A;  3WB2 A;  5IJ0 B;  3T1H O;  1HNW O;  4B3S O;  3DGE A;  4F4L A;  1XOU A;  3ETD A;  1M57 B;  3D3I A;  2JGD B;  3E8B A;  2B1I A;  3K5O A;  5DM6 V;  1S77 D;  1AJP A;  2EJR A;  3UCS C;  5LMU O;  3K9A A;  2WLN A;  1J95 A;  1VIB A;  3UT5 B;  1ZL8 B;  4NXM B;  4LFB B;  2Q73 A;  3ZHS A;  3ZHQ A;  4LH6 A;  1VQM V;  4MVU A;  3DC6 A;  3OEH G;  3K5L A;  1K5Q A;  4OX9 O;  1YEW A;  1JPX A;  2WPD G;  5BY1 A;  4TQF A;  4X62 B;  3VBB A;  4D7S A;  3AK3 A;  1IVS A;  3ASN B;  3H9V A;  4K8X A;  3JD0 A;  1GK9 A;  5A2Q N;  3GB7 C;  2NN4 A;  3OR7 C;  1QLE C;  1T5E A;  3ZJZ A;  5LBQ A;  3O9O A;  2BOB C;  2EIN B;  5C93 A;  3K5N A;  1IBM O;  3T4Z A;  4BIO A;  4W4L A;  3SYQ A;  2VRZ A;  4NTX A;  4DV1 B;  1EN6 A;  4J80 A;  2DYS C;  2YXY A;  1F51 A;  1H2N A;  4PA7 A;  4TV9 B;  1QQC A;  4LWS A;  2E76 B;  1P7G A;  1FXK C;  2YID A;  2HFE C;  1DF4 A;  4ABM A;  4DR5 B;  2P7T C;  4JF3 A;  2PUS A;  3TK1 A;  4MS2 A;  4F6E A;  1K4C C;  5KX5 A;  2UXB O;  1B06 A;  3BA8 A;  3CXC U;  1M1K W;  1DK1 A;  2ODM A;  5L3F A;  3K9S A;  3FAV A;  3TET A;  4K0K B;  1WNS A;  4JI7 O;  2QM7 A;  3D36 A;  1TA8 A;  1SS3 A;  4MSW C;  1JX9 A;  4UXN A;  2DN9 A;  1PPJ H;  3CX5 F;  1B3Q A;  4PV1 B;  1K3E A;  1HR0 O;  1KKD A;  4I50 A;  3PJS K;  2E5L B;  2XND G;  1ZTE A;  2EUL A;  4X65 B;  1N0N A;  4DV0 O;  2WAM A;  2QDO A;  4X66 O;  3SPH A;  5J2T B;  4OPA A;  2E74 B;  4JI4 B;  1P4R A;  1JFF B;  1ZAU A;  1XUQ A;  3OMI B;  4IL6 Z;  1BHB A;  1IBK O;  1F4M A;  1N0J A;  4JI0 O;  2QTO A;  2ZDI A;  1LR1 A;  4R8C A;  3VQY A;  3C3T A;  3JAS B;  4JPR A;  2OYQ A;  2A9H A;  2CK3 G;  3OTO B;  1NH2 D;  3RYH A;  2DWD C;  2VS0 A;  2YXH A;  4YY3 B;  5JJN B;  3JAW B;  5CMU A;  1GN3 A;  1JJ2 U;  4P9O A;  3HR0 A;  5K1P A;  3JAR B;  3K08 A;  4DUY B;  1KUQ A;  1U97 A;  4YJ2 B;  4YJ3 B;  1VMG A;  2EIJ B;  2G38 A;  4LF4 O;  3MDS A;  1ARO P;  4WBN B;  4GT1 A;  2GUZ B;  5FNV B;  1Y6X A;  1QR8 A;  5IE9 A;  3HKE B;  3DC5 A;  1IDS A;  1BE3 H;  4O2A A;  1KP3 A;  4KHP O;  1TAE A;  4U7O A;  4B3R O;  1AJQ A;  3BAA A;  3OAA G;  2WLL A;  4IYI A;  4LF6 O;  2P22 C;  2EZP A;  5BR8 B;  2LGQ A;  1US6 A;  1EBO A;  1MZE A;  3AG3 B;  2KG7 A;  1MSD A;  1PNL A;  1K8A W;  4X1Y A;  4BAY A;  4YHH B;  4GX5 A;  3SDL A;  4FK5 C;  3E83 A;  3SYC A;  1L1F A;  1ROP A;  1KC8 W;  2ZR3 A;  4DV5 B;  2Q69 A;  1OCZ B;  4DV6 B;  3H1H H;  1XI1 A;  2VQE B;  4I5S A;  3L73 H;  1Q86 W;  1AI5 A;  4JI1 B;  1BZK A;  4ZI7 A;  5JQG A;  3G6E V;  2WSS G;  4UFZ A;  3MHH C;  4EFE A;  5EBM C;  3G6B A;  4HNA B;  3HB3 B;  3L74 H;  2UUB O;  4X64 B;  4CH3 A;  1AVM A;  2F43 G;  1NKD A;  2X6C A;  2WWW A;  4DR7 B;  1WJZ A;  3CCM V;  2GTS A;  2HLD G;  3RFR A;  5KUK A;  2DWE C;  3ASO B;  4U7N A;  2Q6A A;  5LXT B;  3APO A;  3M99 B;  5LP6 B;  1M5I A;  3RVY A;  3E8H A;  3A0R A;  3JAL B;  4OGQ B;  4FLY A;  3SJA C;  4QIW F;  2P67 A;  1JCH A;  2AGA A;  1XRE A;  5GTI Z;  2CGN A;  5EC2 C;  4LBE C;  3SYP A;  4H33 A;  1VQL V;  1FFT B;  2F1M A;  3FYI B;  3X2Q C;  4NYK A;  3M8A A;  1VQK V;  1FXH A;  1V55 C;  3J7A U;  2X7R B;  4JV5 B;  4H0L B;  5HFL A;  3WB0 A;  4PEL A;  4JTC B;  2OIG A;  2LFR A;  1EN4 A;  1V54 C;  2JIZ G;  1ENV A;  5JJJ B;  1WAZ A;  3HKB A;  2JEX A;  4N23 A;  4IIJ B;  5BZB A;  5C8Y B;  1HNX B;  1AR1 B;  4PI2 A;  4JI8 O;  4ZHQ A;  1B6Q A;  2F4V B;  1KD1 W;  1K73 W;  3DXR A;  4Z1M G;  4DR3 B;  2EIL B;  3HKC B;  5LYJ A;  3K57 A;  4AIL C;  3STL C;  1DF5 A;  2XUM A;  4UCR A;  2L6L A;  2PYJ A;  4D6T H;  1YIJ V;  1XNR O;  4QJF B;  4QE9 A;  1MSW D;  1JA8 A;  3DTU B;  3SGI A;  2QGN A;  1L8D A;  4LF9 B;  4EEQ A;  3AG2 B;  4E2L A;  3K59 A;  3JAT A;  4JYC A;  4DUZ B;  5KHH A;  1TGO A;  4MTG A;  1S5L Z;  2MK3 A;  5H6R A;  1S72 V;  4FM0 A;  1NU1 H;  4X20 A;  2P6J A;  2H94 A;  4IHJ A;  4J7J A;  1BT8 A;  1WB8 A;  4GKJ O;  4DR2 O;  4WCE V;  4Z2W A;  2HVK C;  2GBO A;  4G28 B;  2Q0A A;  2VWK A;  5IY5 B;  1YF2 A;  2Q0O C;  1K9M W;  4HZ3 A;  2EIK B;  4BWA A;  1FD9 A;  4O4I A;  3OM3 B;  3QO5 A;  2UU9 O;  1N36 O;  3TGU H;  1M56 C;  3CS5 A;  5LGN A;  2H3O A;  5B3S B;  3FB8 C;  4GZR B;  1BHA A;  1Q43 A;  2C2A A;  4X1I B;  4J9Y B;  4GYC B;  3NXS A;  3FD9 A;  1NS1 A;  1URF A;  2GSM B;  4FMT A;  3JAM N;  3ZRS A;  1O9G A;  1VEW A;  5J2U B;  4JAS A;  4RWU A;  4AQY B;  5CB4 B;  1XL4 A;  1FFX B;  1Z5V A;  1Q5O A;  3EFF K;  3QNE A;  3G4S V;  3ZMV A;  1SC5 B;  1UPG A;  1QCE A;  4ZKI A;  1HNZ O;  1P84 F;  1H2S B;  3OT7 A;  4DRX A;  5B66 Z;  1RPO A;  3G67 A;  2YS8 A;  2RN9 A;  4C7U A;  5JVD B;  2XAJ A;  5EIB D;  4W4K A;  4X1K A;  3HKD A;  1S0V A;  5LHG A;  4MVR A;  3D8C A;  5KHK A;  2EJ7 A;  1GN4 A;  4RQF A;  4HYO A;  4NXM O;  4LFB O;  3FB7 C;  3RN4 A;  1K97 A;  2V1D A;  2JJ1 G;  3ABL C;  2UXD O;  5EBL C;  4LF5 B;  5E1A C;  1YIT V;  4DK0 A;  3BFR A;  1YTF D;  3IJ4 A;  4X62 O;  3AG1 B;  4TOI A;  1YDX A;  1GKF A;  1OCO C;  1VF6 C;  2Y69 C;  4H37 A;  4IYH A;  4LFA B;  1Q3E A;  4GX2 A;  1J5E B;  4DR6 B;  3K03 A;  3JSL A;  2GV9 A;  4JI2 O;  5CA0 A;  4KP4 A;  4UCO A;  5B1A C;  2ITC C;  4BIZ A;  4JZ2 A;  5LGU A;  2X6A A;  4B7K A;  1GN6 A;  1BS3 A;  3Q4H A;  1I7F A;  3WFV A;  4NTW A;  4MTF A;  2XHB A;  4IT5 A;  1OCR C;  4ICG A;  2ZXW B;  3SYO A;  3RBZ A;  3ABU A;  2V4D A;  2JS3 A;  4TV8 A;  3RYC A;  3K06 A;  2GTA A;  4K3A A;  2IM9 A;  4X8A A;  2Q7H A;  5FL7 G;  2OT5 A;  1W0K G;  2YEV A;  3OMA B;  1GM8 A;  3L75 H;  2IJH A;  1TUE B;  2YIC A;  4CZZ A;  4X65 O;  3JCZ A;  2ZE5 A;  3ZED A;  1SZX A;  4U3J A;  1YXB A;  2YI8 A;  1HP8 A;  4JI4 O;  2Q8V A;  3CRR A;  2UUC B;  3BY6 A;  1M57 C;  2QWO B;  2BTQ A;  1RSO B;  1YCI A;  1L0N H;  1RPR A;  1E1R G;  3P30 A;  1WA8 A;  2JVD A;  5LA6 A;  2HHH O;  4KXR A;  3JD2 A;  2FL4 A;  3L9D A;  1N33 O;  4DUY O;  3CD6 V;  2AW9 A;  3QVN A;  3KCY A;  4LWS B;  3W7S A;  2IJK A;  1AIL A;  1XNQ B;  3LDD A;  5A9G A;  1SA0 B;  4QPK A;  2GDS A;  4DV4 B;  3ASN C;  2DJV A;  2HJF C;  3FAV B;  3ABM B;  1FS0 G;  4FPP A;  5BR8 O;  4WFA V;  5EK0 A;  2EIN C;  1HWY A;  2B1G A;  4PDM A;  1DGS A;  3ZIA G;  2DOS A;  4FVM A;  3H1J H;  3RYF A;  4I50 B;  1RM1 B;  3N2K B;  4DW1 A;  4TWK A;  4DV5 O;  4TSF G;  1VF6 A;  2QEX V;  1XIL A;  2EBO A;  2QM4 A;  1YI2 V;  1N32 B;  1JMK C;  1VQ8 V;  4J10 A;  2AZ0 A;  1KKC A;  4JI1 O;  1IBL B;  4N21 A;  3UO2 A;  3WG7 B;  2IBZ H;  4XDK A;  3ETG A;  4XBF A;  3H01 A;  2N05 A;  4LF7 O;  1Q6U A;  5B1B B;  3OE7 G;  4XDJ A;  1IZ3 A;  3R65 A;  4MT8 A;  4NVP A;  1IXM A;  2HEP A;  4X64 O;  4LNU B;  4OXS A;  4EKW A;  5KMG B;  1PP9 H;  2L35 A;  2QJ1 A;  2NNU A;  2Y4U A;  1W0J G;  3FKS G;  4R50 A;  4GKK B;  3QTC A;  1H2L A; 
#chains in the Genus database with same CATH homology
 1S3J A;  5EBM C;  3HB3 B;  4UVB A;  1K92 A;  1E79 G;  3FYE B;  2X0L A;  3JYC A;  2F43 G;  1DTO A;  2HVJ C;  1NKD A;  2HKO A;  3K3W A;  2X6C A;  2WWW A;  5GW7 A;  3W7U A;  3CCM V;  5J9P C;  4UV9 A;  2Y48 A;  2JEU A;  2IU3 A;  4UV8 A;  4LC1 A;  2HLD G;  5KUK A;  2DWE C;  3ASO B;  4P9P A;  1K5S A;  4U7N A;  1JVM A;  2DQ0 A;  4RAI A;  1I5X A;  2Q6A A;  3M99 B;  1NQT A;  2OCC C;  4RUE A;  3RVY A;  3I55 V;  1N8R W;  3E8H A;  3A0R A;  3I56 V;  2EZO A;  3F7V C;  4Q20 A;  3IFX A;  3AG4 C;  1WLE A;  2JJ2 G;  3ABM C;  2EIJ C;  1G8M A;  2EIM C;  5EBW C;  3SPC A;  1MAB G;  5HFM A;  1CPY A;  1NH2 B;  4QIW F;  4ZBM A;  5IYC O;  2P67 A;  1JCH A;  4FJC C;  4P30 A;  3CCL V;  2XOK G;  3SPJ A;  4UUJ C;  3T4D A;  4KUM A;  2QE7 G;  2D3O W;  5EC2 C;  4LBE C;  4RQE A;  3SYP A;  4DO2 A;  4H33 A;  1VQO V;  1VQL V;  1FFT B;  2JK5 C;  1XL6 A;  1RM1 C;  2XAS A;  1NVP D;  3FYI B;  4MVS A;  3X2Q C;  2IH3 C;  2AHZ A;  3ZN1 A;  2B5U A;  3AG3 C;  1VQK V;  1FXH A;  1M9N A;  5IYB O;  1V55 C;  1LNQ A;  2HR3 A;  1PD3 A;  2X7R B;  3FB6 C;  2W0F C;  1Q81 W;  5HFL A;  1R3I C;  4PEL A;  4JTC B;  5CN0 A;  1R73 A;  3STZ C;  4LP8 A;  2LFR A;  4WFF A;  2GHY A;  1V54 C;  1M56 B;  3WG7 C;  2JIZ G;  2Z5U A;  1ENV A;  1QLN A;  2YEV B;  2JEX A;  4N23 A;  5BZB A;  4ASU G;  1OCZ C;  3OW2 U;  1AR1 B;  2JDI G;  5B1B C;  5CBH A;  1R3L C;  1B6Q A;  2HG5 C;  2IJI A;  2ITD C;  4QPJ A;  1KD1 W;  1MG1 A;  4MVO A;  1GM7 A;  1K73 W;  3F5W C;  4Z1M G;  5B1O A;  3OGC C;  4YXW G;  1GM9 A;  3P32 A;  3CCJ V;  2EIL B;  1QR9 A;  4RO2 A;  3ZMU A;  3ZRV A;  1NBM G;  4PDV A;  2QKS A;  4LCU C;  3UM7 A;  3STL C;  3CCU V;  1GO3 F;  1DF5 A;  1YJ9 V;  1PNM A;  3QO7 A;  2QA4 V;  3JD1 A;  3F7Y C;  1YIJ V;  3SPI A;  4QJF B;  4QE9 A;  3JD3 A;  1MSW D;  4XDL A;  3ETE A;  3DTU B;  3E8G A;  1H8H G;  1SZT A;  3CYO A;  3MD0 A;  4MVZ A;  3AG2 B;  2ZQM A;  2R9I A;  3ZMS A;  3ASO C;  2OTL V;  4E2L A;  3ZMT A;  1SES A;  4JYC A;  2OTJ V;  1S5H C;  3UKM A;  3G71 V;  4JTA B;  4MTG A;  2DYR B;  2MK3 A;  5H6R A;  1S72 V;  4J9Z B;  2WLI B;  5LHI A;  3CP1 A;  2IU0 A;  1AI6 A;  4L87 A;  4JAU A;  1JQ0 A;  2P6J A;  3OFN G;  1WPX A;  1FXK A;  4JTD B;  3K0G A;  1R6K A;  2H94 A;  4MTO A;  3ABL B;  3E86 A;  1W2B U;  5CBF A;  1SET A;  4PA6 A;  5L3E A;  2IJJ A;  3SPG A;  5L3B A;  4BW5 A;  1VQ6 V;  4WCE V;  2HVK C;  2WLL B;  2XAQ A;  4G28 B;  4JYB A;  5IY5 B;  1Q7Y W;  1K9M W;  1OCO B;  2Y69 B;  4HZ3 A;  2EIK B;  4WFH A;  3OM3 B;  3QO5 A;  3W7W A;  1COW G;  2WLK A;  1OCC B;  1BMF G;  2ATK C;  2WLH A;  1M56 C;  4PA4 A;  3OEE G;  1NVP B;  5LGN A;  4JGS A;  4FIP C;  5B1A B;  4MW3 A;  5B3S B;  1CEZ A;  3FB8 C;  4WFB V;  1NJI W;  3FB5 C;  4MVQ A;  1BHA A;  4PA9 A;  3ZMZ A;  3ML0 A;  3GWO A;  2C2A A;  1KQS U;  1OHH G;  1THZ A;  4J9Y B;  1NR1 A;  4P2Z A;  4PDL A;  4WFE A;  3OUS A;  4X88 A;  3NXS A;  2XAF A;  2K1E A;  2GSM B;  3CC7 V;  1QLE B;  4FMT A;  3CCE V;  3ZRS A;  2X6B A;  3E8F A;  4JAS A;  1S76 D;  3E2E A;  4UVA A;  2EIL C;  4HAM A;  4MVM A;  3OR6 C;  1OCR B;  1AJN A;  1QBZ A;  1XL4 A;  2XAG A;  3ABK B;  2DYS B;  4R6Z A;  4GX0 A;  1R3K C;  4MTX A;  2XAH A;  1VQP V;  4CBC A;  1KEC A;  3EFF K;  3QNE A;  1GMG A;  1UJW B;  3ZMV A;  1FXK B;  3G4S V;  3W7T A;  1QCE A;  4ZKI A;  2DQ3 A;  2V7Q G;  1MOF A;  1R6N A;  3CME V;  1EZJ A;  1RPO A;  2ZDI C;  1VQ5 V;  4QE7 A;  4G27 B;  1H2G A;  3AG2 C;  1G4Y B;  4G2K A;  5L3D A;  2XAJ A;  1F4N A;  3ZRW A;  3RW0 A;  4GCZ A;  1K34 A;  2DYR C;  1S0V A;  5LHG A;  3DGE A;  4MVR A;  1YJN V;  4F4L A;  4RQF A;  3ETD A;  3RVZ A;  1ORQ C;  1M57 B;  3D3I A;  4HYO A;  5H9C A;  3FB7 C;  2BOC C;  2B1I A;  3E8B A;  1VQ7 V;  1K97 A;  2V1D A;  1VQ9 V;  2JJ1 G;  3ABL C;  5EBL C;  5E1A C;  5DM6 V;  1YIT V;  1VQN V;  1S77 D;  1DLB A;  1AJP A;  1Y4M A;  4JAV A;  4PA3 A;  1PKX A;  2EJR A;  3CCV V;  3K9A A;  1YTF D;  5L3G A;  2WLN A;  3AG1 B;  5IDJ A;  2LFS A;  1J95 A;  5IY5 C;  1EFR G;  4MW8 A;  1GKF A;  1OCO C;  2Y69 C;  4H37 A;  2EIK C;  1ZWI C;  1VQM V;  4MVU A;  3OEH G;  2WLM A;  4GX2 A;  3TCU A;  1F23 A;  1K5Q A;  3K03 A;  4BIU A;  1AI4 A;  1OCC C;  5KA5 A;  1JPX A;  3LDC A;  4KP4 A;  2WPD G;  1PNK A;  5B1A C;  3EHB B;  1K7D A;  5B3S C;  4WF9 V;  3K04 A;  2ITC C;  3VBB A;  3BEH A;  5CA3 A;  1VQ4 V;  2IW5 A;  4BIZ A;  3ASN B;  5LGU A;  3JD0 A;  2X6A A;  1GK9 A;  3GB7 C;  3SYA A;  3OR7 C;  1QLE C;  2PI4 A;  4X89 A;  3ZJZ A;  5LBQ A;  3ZRW B;  5LGT A;  2BOB C;  1KP2 A;  2EIN B;  4TT3 G;  3WFV A;  5C93 A;  1FXV A;  1K33 A;  3T4Z A;  3CC2 V;  3SYQ A;  5L3C A;  4MTF A;  1OCR C;  1NR7 A;  2ZXW B;  3ABK C;  2DYS C;  3SYO A;  1F51 A;  5EC1 C;  4PA7 A;  3RBZ A;  3ABU A;  3E35 A;  1FXK C;  2HFE C;  3K06 A;  1DF4 A;  1R3J C;  2P7T C;  1H8E G;  2R9R B;  4JF3 A;  1QVF U;  3TK1 A;  4MS2 A;  5DN6 G;  1JOY A;  5IYD O;  4X8A A;  5B1N A;  1K4C C;  3IGA C;  3ZRX A;  5FL7 G;  2OT5 A;  3CXC U;  1W0K G;  1M1K W;  2YEV A;  5L3F A;  3OMA B;  3CPW U;  1GM8 A;  1P7B A;  1BL8 A;  2UXX A;  2IJH A;  1TUE B;  3B8M A;  4CZZ A;  2UXN A;  4RUF A;  1SRY A;  2A79 B;  3TET A;  1OZ0 A;  3JCZ A;  2QM7 A;  3D36 A;  4MSW C;  1JX9 A;  4UXN A;  3KG2 A;  2DW4 A;  3T2M A;  3K0D A;  3MHS C;  1K3E A;  3BY6 A;  1KKD A;  1M57 C;  3ZCC A;  3LDE A;  3CCQ V;  4PDR A;  3LSS A;  3PJS K;  1GTO A;  3CMA V;  2XND G;  3OUF A;  1RPR A;  1E1R G;  3ABT A;  3P30 A;  2WAM A;  3SPH A;  1YSC A;  5KUM A;  1M90 W;  3JD2 A;  1P4R A;  3LUT B;  3OMI B;  3AG1 C;  3QO8 A;  1BHB A;  2W6I G;  4QNH B;  1F4M A;  2P90 A;  4R7C A;  3CD6 V;  2QTO A;  2ZDI A;  4R8C A;  3OMN B;  3CC4 V;  3K79 A;  3IC7 A;  4JPR A;  2A9H A;  4I9W A;  2CK3 G;  2ZR2 A;  4WFG A;  3W7S A;  3VOU A;  1NH2 D;  2IJK A;  2DWD C;  1K4D C;  1YTF B;  2WLJ A;  3W7X A;  5CMU A;  1JJ2 U;  4P9O A;  2PI5 A;  3LDD A;  3AEI A;  4DXW A;  1E1Q G;  4QPK A;  3K08 A;  2OCC B;  2WLI A;  3ASN C;  2AHY A;  3LNM B;  2HJF C;  3AG4 B;  3LSQ A;  2H8P C;  3ABM B;  1FS0 G;  2EIJ B;  2EIM B;  4FPP A;  1H38 A;  4UVC A;  1CP9 A;  3B8N A;  4WFA V;  1ARO P;  5EK0 A;  4GT1 A;  2EIN C;  1HWY A;  2B1G A;  1QR8 A;  4KFM A;  4PDM A;  3ZN0 A;  1KP3 A;  2A0L A;  2ZXW C;  4U7O A;  1YJW V;  3ZIA G;  1AJQ A;  2NLJ C;  1QVG U;  3OAA G;  2QM8 A;  1I5Y A;  3B77 A;  2WLL A;  1RM1 B;  2Q67 A;  2M7W A;  4TWK A;  4TSF G;  2EZP A;  3X2Q B;  2QEX V;  1EBO A;  2ZD9 A;  1AI7 A;  2EBO A;  5CBG A;  3AG3 B;  1YI2 V;  1PNL A;  1K8A W;  1V55 B;  3JD4 A;  1Q82 W;  4BAY A;  1VQ8 V;  4GX5 A;  3T1C A;  4FK5 C;  3E89 A;  3E83 A;  4GX1 A;  3SYC A;  1L1F A;  1ROP A;  2LP7 A;  1KC8 W;  2ZR3 A;  2Q68 A;  4N21 A;  1V54 B;  1SER A;  3WG7 B;  3CCS V;  5KA6 A;  1PL0 A;  2Q69 A;  3ETG A;  4XDK A;  4XBF A;  2IH1 C;  3H01 A;  1OCZ B;  5B1B B;  2FTK A;  2YSU B;  3OE7 G;  4XDJ A;  4I5S A;  3R65 A;  5LHH A;  1Q86 W;  3HPL C;  3CCR V;  1AI5 A;  4MT8 A;  2Z3Y A;  2W6J G;  1YHQ V;  1IXM A;  2KB1 A;  5H6Q A;  1Y66 A;  4OXS A;  4EKW A;  3G6E V;  2WSS G;  3SJQ C;  2NNU A;  3FKS G;  1W0J G;  4R50 A;  3MHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...