1IBLO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1iblO00
4DV1O 4X66O 3RT3C 3R66A 4OPAA 4JI6O 1N32O 5BY1A 1HNZO 1R6TA 4LF5O 1N33O 2UUCO 3O65A 1AILA 2UUBO 4LFCO 3T1YO 4JI5O 5H5NA 1R1BA 1HNWO 1KUQA 4DV2O 2UU9O 2LW7A 1A32A 4DR7O 4AQYO 1IBLO 4K0KO 4B3SO 4DV3O 4X65O 1I94O 2Z0AA 5IT9N 1FKAO 4DR6O 4DUYO 5LMNO 1YZBA 1HR0O 5IWAO 4NXMO 1XEQA 2VQFO 4B3MO 2N74A 5LMUO 1DK1A 2FKXA 4JV5O 4NXNO 5A2QN 3J80N 5FLXN 3J7AU 2HHHO 4DV6O 2UXCO 2UUAO 1XMQO 1FJGO 2VQEO 1XNQO 4GKJO 1D2DA 1HNXO 4DR1O 2DJVA 3M8AA 1N36O 4X64O 2ZM6O 3F5TA 4LF6O 1IBKO 4B3RO 4JI8O 4A5UB 2UXDO 4JI2O 5BXZA 4DUZO 4JI3O 2UXBO 4DR3O 4YY3O 1XNRO 4DV5O 4YHHO 2F4VO 2E5LO 2AGAA 2JRIA 1G1XB 3T1HO 3J81N 5LL6Y 4B3TO 4DV4O 4JI7O 4OX9O 4LFAO 1N34O 1IBMO 4DV0O 4LF7O 1X59A 4LFBO 1FYJA 4JI1O 4LF9O 2ZKOA 3OTOO 4JYAO 4GKKO 4X62O 4DV7O 4KHPO 1J5EO 4LF4O 1XMOO 3JAMN 4JI0O 5BR8O 1NS1A 4OPHA 2DOSA 3SDLA 1F7YA 4DR5O 4DR4O 4JI4O 4DR2O 4LF8O 1AB3A
chains in the Genus database with same CATH superfamily
4UUJC 1S0VA 1QVGU 1PP9H 4ZKIA 2R9AA 4U3FH 2EJRA 3ZHRA 1OCRB 4G2KA 4O4JB 4JI0B 2QWRB 1KUQA 2P4KA 2F4VB 2E5LB 1Q86W 4B3SO 4OX9B 4YIOA 2JDIG 3DGEA 1W59A 1TUBB 1XHZA 2QWOB 1YJWV 2ZR3A 3H1KH 3WB0A 4QNHB 4H44B 4WCEV 2FB5A 1Q8IA 1MSDA 3AG4C 5FNVB 2WLLB 2VQEO 3OE7G 1SQVH 5CA0B 4LWSA 3S3WA 1YCIA 2UXDO 2RQ6A 5IJ9B 3P3PA 2Q7EA 2UXBO 3K03A 5IYZA 1V55C 1V9PA 3U11A 1GRJA 1ORQC 4RUEA 4GKJB 1SQXH 1K5SA 1N36B 2Q73A 2OCHA 2PY5A 2JVDA 4LF6B 4EB6A 4NXMB 1OCCB 2H3OA 1QVFU 2PYLA 2V1DA 4FMTA 2X0LA 5CBFA 3ZRWA 3SR2C 3JD4A 1IXBA 5CBHA 2ZR2A 1AVMA 3ZJZA 3CJHB 1BT8A 3D36C 4OPAA 1XI1A 5A9GA 2C2AA 2FYUH 4X62B 2KG7B 4O4HA 4B7KA 2F95B 1JA8A 1SC5B 1XNRB 1GM9A 2PTMA 2R9RB 1NKDA 3OEEG 1GKFA 1VQPV 2Q8VA 1VF7A 3ZHSA 2ADQB 3IC7A 2EILB 3EFFK 4RWUA 1BHBA 2YI8A 2HLDG 2BOBC 4K8ZA 3ASNB 1NR1A 3AG7A 3FAVA 3VQYA 5GTHZ 4DK1A 1OV9A 3ABKC 3SPIA 1NZ6A 5GONA 4UB6Z 1DF5A 5LHHA 5LYJB 2KKWA 2JJ1G 1Y76B 3LDDA 2ZM6O 1EZJA 3OGCC 4Z1VA 2BSKA 4PI2A 4JI8O 2YDEA 4JV5B 5EK0A 2P7TC 4WFAV 4X20B 4DK0A 1YDXA 1ZUQA 3OUFA 4CC6A 1IBKB 2ODMA 3L73H 5LBQA 4MVMA 4GKKO 3CRCA 3LDCA 3QVNA 1EZVH 1ZWIC 3H1IH 1VQ4V 4H0LB 1SF9A 2L35A 3H1JH 3CMEV 3D36A 3RYIA 2IW5A 3E8HA 2ZIMA 4QPJA 1SESA 1E79G 3JARB 2DQ0A 3JALA 5KAFZ 3RGBA 1Q82W 1GO3F 4JASA 1FFXB 5IYBO 1YJNV 4TWKA 2QWQB 4QIWF 3X2QC 2WLHA 3G80A 4HNAA 4DR4B 4BIZA 1L1FA 3CXCU 2F1MA 3ZRVA 1HW7A 4X66B 4DV0B 5IWAO 1H38A 2CTPA 1B04A 5H6RA 4WFGA 4IHJA 3VQXA 4R50A 4DV2B 2AXTZ 2QM4A 5LXTA 2OT5A 5IYZB 2UXCO 5KHHA 1XNQO 1NQTA 1AP6A 1ENVA 1P4RA 5DM6V 1L0LH 4FFBB 3IJ4A 1I5YA 2Q67A 4B3RO 5KHKA 1X4TA 4EB6B 3OM3B 1IZ3A 1Z5WA 2UUBB 2O57A 4LFCB 1WA8B 4UXNA 5CMUA 5LHIA 1M56B 2XNDG 3P30A 1OCRC 2P22C 2QKAA 2XT9A 3AEIA 2QE7G 4FLXA 3ZRWB 3P3NA 1BQZA 2AW9A 1KU9A 5L3GA 2LFSA 3UQ8A 4HYOA 3OT7A 1N4CA 1R3LC 3VQVA 3RN4A 4LF9O 1JFFB 5K1XA 3FFQA 1WP8A 5EZYB 2LQTA 4JZGA 3B2EE 2YC0A 4D7TA 4K3AA 4FM1A 3T1HB 3FX7A 1F7YA 4EFBA 1AI4A 3B77A 4LF7B 4P30A 5H6QA 4Z2WA 4PDVA 3E83A 3CCLV 2EIKC 2ATKC 3ZCCA 2PUSA 3KCXA 3FAVB 3APQA 1HNWO 4YJ3A 5ITZA 1FFTB 3CCJV 4BW5A 4H33A 3D8CA 5EBWC 4K0KO 4YIPA 3U0ZA 1COWG 5GONB 1KC8W 4XDKA 1N8RW 2BOCC 1HR0O 1RSOB 1Z2GA 1D5NA 4RQEA 3IAYA 1V55B 1R6NA 1SA0A 1M93A 3T4ZA 3ETDA 2RNBA 4B08A 1SZXA 1M9NA 2YIBA 3BHPA 3LSSA 1P7BA 2HVKC 4MT8A 4FZ0A 2NNUA 3N2GA 3C3SA 5CBGA 1N33B 5CB4A 3JAWA 1TVKA 3ZHTA 1H2KA 4YHHO 3GVMA 5IJ0B 4AQYB 2N05A 2GV9A 2B9ZA 3RYIB 5BZBA 2LJ2A 4DYLA 1I08A 5B66Z 4B3MB 1LUWA 2PI4A 4UVBA 2BCCH 4DXWA 4Z1MG 1JCHA 1JVMA 2UXBB 1VQLV 4OXSA 3E8FA 4TUYB 5JVDB 4KHPO 3CE2A 1RM1C 3CX5F 3JAMN 2HR3A 5HFLA 3CS5A 2DOSA 1NR7A 2LGQA 3K5NA 4DR1B 2EZPA 1AJQA 2WPDG 4BW9A 3P32A 2CTRA 2W0XA 2P67A 1WN7A 3LDEA 1Q43A 1HNZO 4U3JA 3OGIB 3ABKB 1P7GA 1VQ8V 4D7SA 4IHJB 3SJBC 3FB5C 2OIEA 1W0JG 1L8DA 4X65O 3NR7A 1WB7A 2E3CA 1H2GA 3AK1A 4R6ZA 1IXMA 4X1KA 2QWPB 3SGIA 1Q7YW 4X1IA 3AK2A 2YSUB 3J80N 5BR8B 2UUAO 4K35A 4NKGB 1FXVA 3SJAC 3M8AA 2WLNA 2A06H 4GX1A 2IBZH 3ZMTA 1MMMA 2D2CB 3MHSC 3CYOA 2Y48A 2EINC 3T1YB 4JPRA 2ZIOA 2RN9A 5LA6B 1G1XB 1XREA 1D5AA 4JAAA 1F4NA 4R7CA 3ICXA 3H9VA 4I4TB 2LP7A 2ZM6B 4UV8A 4FM0A 4UCVA 1IBMO 1THZA 3LUTB 2IJKA 3BRCA 3FD9A 3QG5A 3X2QB 3SYAA 3G67A 5J2UB 3BAAA 3LSUA 4O4LA 3ZMVA 1XMQB 2V7QG 3ABMC 5EC1C 4DR5O 2GDSA 1Q6UA 4L8JA 4IGGA 3L75H 2KB1A 1Y74B 4FVMA 3LSQA 5F2VO 4FJCC 4JI2B 4GKKB 3UT5A 1AILA 2ZD9A 3DTUB 4KL1A 4JI5O 4DV5B 3CRRA 4GLXA 4RQFA 4MTOA 3ABTA 3ETEA 3ZHQA 2QGNA 1PNLA 5IY5C 1H2SB 2QSAA 3OW2U 4DV3O 4L87A 2IM9A 3SPCA 2VQFO 4NYKA 3OTOB 1PKXA 1N0JA 3SYQA 2OCCC 3N2GB 1XMOB 2HHHO 5CB4B 3JAWB 4IIJB 5KA6A 2QDOA 1WAZA 4DR2B 3HKEA 3G6EV 5E79Z 5IWAB 1MNGA 4AILC 3STZC 1S77D 5KHJA 2X6AA 2NR5A 3K0GA 3E89A 4JI3O 2CH7B 2R9IA 2X7RB 4JTCB 3CEIA 2XASA 3QO7A 5EBMC 3E22A 3B4SA 3L74H 2PF4E 1JOYA 2AHYA 4DV4O 4ZHQB 3JASB 4QE7A 4MTFA 2XAFA 2YEVB 4DUYB 3WU2Z 4TV8A 4NTYA 2EIKB 3A0BZ 4LNUA 3CRAA 4LBEC 3HKBB 1KD1W 5C8YA 4NR1A 4DV7O 1NTMH 1QLEC 1NI8A 1K92A 4U3JB 3EVKA 1NS1A 3SPGA 1QHTA 2X6BA 1RPOA 1H2LA 3RYHB 3FYIB 4JGSA 3ZHVA 5KLVH 5LGUA 3JD3A 4DV1O 3Q4HA 4JI6O 1SQFA 4LF9B 4C7UA 1YITV 2ZE8A 3H1LH 3HKDA 4LF5O 4TOIA 1S76D 4CH6A 2QR4A 4JAVA 4PJ0Z 3E2EA 2VWKA 2UU9O 2LW7A 4DR7O 3CMAV 4J80A 2M6YA 5DEDA 1WLEA 2Z0AA 5FPOA 1VQ9V 4LFAB 1FS0G 1K3EA 4DRXB 4FLVA 1RP3B 4JYAB 1B3QA 1SQBH 3NXSA 1GH6A 2ZXWC 3QNEA 1HNWB 2XAGA 1HP8A 1K97A 4OGQB 2IJIA 4N21A 5LOVA 4CBCA 3FB7C 1GAXA 3F7YC 4X64O 4LF8B 1I0HA 4E2LA 1HR0B 1PL4A 3M7MX 4BWAA 3K58A 4DW0A 1GN6A 3ZRXA 1RM1B 3G71V 4X8AA 5KUMA 4DUZO 3CXHF 4HAMA 3ZEDA 5B3SC 1ROPA 1XBLA 2H94A 2P90A 1E1QG 1BHAA 3STLC 2P4VA 3JATA 3JCZA 5B1AC 4B3TO 1MSWD 2GUZA 1OHHG 4DW1A 3DC6A 1GTOA 4G27B 3RYFA 1JX9A 4JI1O 1RFYA 1J5EO 3DSQA 1VQ5V 1K34A 2XHBA 1PNKA 2HP8A 1TGOA 2Q9LA 3JAKA 3SDLA 5DN6G 3WG7C 1K73W 3BVOA 4ICGA 1K5QA 2A3QA 1M1KW 1VQKV 3BA8A 1E1RG 1P49A 1VF5B 2OWOA 4UB8Z 1DGSA 4PI0A 1NJIW 2P6JA 4DO2A 1XL4A 1NH2D 2QTSA 4J9ZB 2PYJA 2E74B 5D5QA 4B7EA 4I0XA 4MW8A 5KHIA 1A32A 4MVSA 1URFA 3F7VC 4Q6GA 3CCQV 3CPWU 3TK1A 4JI7B 2Y0PA 4DR6O 4QJFB 2EINB 1HNZB 2A9HA 4RO2A 1K9MW 4YJ2A 4ZI7A 2AZ2A 4F6RA 1VEWA 3AG2C 3FKSG 4JTDB 5B5EZ 3BABA 1VQ7V 1QR8A 4J10A 1SZTA 4LH7A 4X9QA 4X65B 5IDJA 3E22B 3N2KA 4FIPC 4I55A 3D3QA 1CP9A 3F5TA 2QWNB 3UO3A 1YTFB 4BIOA 3I55V 1N32B 4LWSB 4LNUB 3JSLA 4GX2A 1BGYH 1LR1A 4ZIBA 1I5XA 1M90W 1AJPA 1XQ8A 3ABMB 3K59A 5LP6A 2HJFC 5C8YB 3ZMZA 2F4VO 2E5LO 4TQFA 1VQNV 4OX9O 1I94B 2A0LA 1VF6A 2YIBD 3W7SA 3K5LA 2ZT9B 5JJEB 4EEQA 4LFBO 3F5WC 2P5OA 3CP1A 1CEZA 4KXRA 5IY5B 1U96A 1LUVA 1VP7A 3JYCA 3CCRV 1QCEA 4OPHA 4MVQA 4RAIA 2Q4PA 1IBMB 4XDLA 2OCCB 3BY6A 2ZE5A 2F43G 4ABMA 3KCYA 3E8BA 1KECA 1AJNA 1IX9A 4UVCA 4O4HB 2G38A 1HWYA 1XDCA 1DF4A 4I5SA 4DR5B 1IBLO 2BTQA 3QO5A 2CGNA 4JTAB 4FFKA 3BFRA 5LOVB 2ZE7A 4NXMO 5KMGA 4EFEA 1BZKA 3FB6C 4MTGA 4GYCB 3K57A 2B5UA 4LF4B 2KQXA 2RMKB 2V4DA 1H8EG 5GW7A 3CRMA 4FLTA 1MA1A 3IFXA 1WPBA 1N0NA 2DJVA 4DV3B 4TV9A 4FK5C 3SJQC 2Q7HA 4O2BA 1H8HG 2GUZB 2DYSC 1ZX3A 2EJ7A 2VQFB 1AR5A 1QLEB 1PNMA 3DXRA 2YXYA 5JH7A 4HBNA 2NLJC 2BSKB 1Q90D 2WLKA 4DR3O 1AI5A 2YS8A 2RCVA 1XNRO 5KX5A 2ARHA 3E35A 5LL6Y 1WP7A 2UXXA 3DC5A 3MDSA 4B3SB 2BE3A 3JAKB 2GHYA 2EZOA 3VBBA 1ZL8A 4E4EA 1FYJA 1CXZB 1QNMA 3K5MA 5EC2C 3OMNB 3H01A 1CPYA 1YHQV 1H2NA 2WLIA 4J7JA 3HKCA 2VQEB 4I0XB 2Y4UA 4J9YB 1BS3A 3ETGA 2IH1C 4CH5A 2ZXWB 2JS5A 1M57C 1EN5A 4O4JA 2UXDB 3LNNA 3OMAB 4PDMA 5EYPA 1WNSA 3THOA 1YIJV 4YJ2B 4ZI7B 1H2MA 1NT2B 3JALB 4PV1B 5H5NA 2A79B 3EXAA 4I9QA 4NVPA 1SQGA 2JJ2G 2XUMA 1I7FA 4HNAB 4DV1B 2XTAA 5B3SB 4I55B 2EBOA 3CRQA 1V54C 3UCSC 4GZRB 2WLLA 5B1AB 3UM7A 2A7WA 5B1BC 1K4CC 4DR7B 2YIAA 1SERA 1FXKC 4ASUG 5LP6B 3RVZA 5LXTB 3B8NA 1NU1H 1VQOV 1KBHA 2OIGA 4PA7A 3W7WA 5IJ9A 3AG1C 1EN6A 1KP3A 5LHGA 2E75B 2Y0IA 3WG7B 2HEPA 2WLMA 1EN4A 2B1IA 3OTFA 3O9OA 1QQCA 3VQWA 5J9PC 4X64B 1N34O 4XBFA 4IYHA 4AI8A 4DV0O 1AROP 3E86A 1JJ2U 3MAQA 4DUZB 1YSCA 4GX0A 1P84F 4G28B 2X6CA 2Y4TA 4GCZA 2Q5ZA 4UCUA 2ADPA 3ZMUA 3FB8C 3RBZA 1NH2B 2RJZA 4B3TB 4NTWA 3ABLC 3T4DA 1YTFD 3TGUH 2DWDC 2FL4A 2KG7A 3AG2B 4JI1B 2YUAA 4JI8B 1R6TA 3H1HH 5L3BA 3KKYA 5KMGB 4BAYA 1R3KC 3T1CA 2UUCO 1XUQA 2UUBO 2Y69C 4LFCO 3W7TA 2OTLV 2JK5C 4ZOLA 3K5OA 4HZ3A 1AR1B 5HFMA 5D5PA 2HVJC 3ZMSA 3R65A 4YJ3B 5ITZB 1M4UA 4UCTA 1SQPH 4MVOA 3I5DA 1PPJH 4O2BB 2N74A 5LMUO 4CS3A 3A0RA 1IVSA 1B06A 1RPRA 3K06A 1FXKA 3JCUZ 1O9GA 5JCOC 4JYCA 5C93A 3DXRB 3ZHUA 1MZEA 5JH7B 4DV6O 1SA0B 1FJGO 5AG2A 1Y76A 3HB3B 3IGAC 2CDYA 1Y66A 3AG3C 1WJZA 2JIZG 1QLNA 4DR6B 4RUFA 4I7ZB 3K08A 4P2ZA 2ZE6A 4A5UB 4J11A 4PA3A 2XAQA 3CCVV 3U10A 4IT5A 4YY3O 5KUKA 1TVKB 2AGAA 2WLJA 4D6TH 4N23A 2WWWA 2H8PC 5IYCO 2R70A 2ZDIA 4H13B 1O9HA 1R6KA 4AHCA 5EYPB 2DYRC 2UXCB 3CC7V 1XNQB 1PV0A 5L3EA 5JJNB 2QM7A 3ZN1A 4CH4A 3JARA 1JMKC 4KUMA 3SJCC 4LFBB 3QO8A 3R66A 4J7ZA 4B3RB 3TJTA 5BY1A 2ILMA 1FFXA 3ZN0A 1N33O 4FLWA 4PDLA 3TETA 4JAUA 1J95A 2D3OW 1GN2A 3I56V 3OR6C 1UJWB 3PJSK 4AQYO 3T2MA 2CTWA 2DYSB 1SKVA 1PD3A 3ZS8C 5JCOA 3JD2A 4FPPA 1VMGA 2JEXA 2QA4V 3LNMB 3RWRD 4XDJA 4F6EA 1WB8A 1XEQA 4B3MO 4W4LA 1ZAUA 4CZZA 1BMFG 1DK1A 1SETA 5IYDO 1BQ0A 3C90A 4X1KB 5IE9A 2UXNA 2QKSA 4FFBA 4X1IB 5FL7G 2MW2B 1IBLB 4DR1O 3E8GA 5B1OA 1Q6HA 1GM7A 5E1AC 5H9CA 5H2FZ 2VS0A 1WA8A 3W7XA 2MK3A 1AP5A 2Q7GA 4O4IA 4PA6A 1K7DA 4PHZA 1Y67A 4LP8A 1F51A 5TISZ 4UCSA 4K0KB 3APOA 3ZRSA 1M57B 2QM8A 1JFFA 3ZX6A 3SYOA 1X59A 5EZYA 2IJJA 1KQSU 5J2TA 2PI5A 1US6A 5CA1A 5LGTA 2LGWA 4DR3B 2HKOA 2F66C 1MG1A 3K9SA 1KKDA 5BR8O 5K1PA 2WAMA 3EHBB 4ZOLB 3WB1A 4MW3A 5DECA 4BR6A 2L6LA 4JI4O 4O4LB 1V54B 5LP6C 3ASOB 3RT3C 1IURA 4GUNA 5B1BB 2WSSG 3OEHG 2XAHA 2R72A 5B1NA 1QU7A 1VF6C 2QEXV 3T1YO 1FXKB 3UT5B 4YHHB 3BA9A 2WA4A 1QBZA 3CB2A 3WB2A 1VIBA 1RSOA 2Q69A 1YF2A 2GBOA 3AG1B 4MSWC 1JR9A 1Q6IA 3L70H 5LMNO 2EIJC 1OCZC 3CCMV 1G8MA 1XOUA 2DWEC 1R73A 1TUEB 2PZSA 3HR0A 4NXNO 1ZSPA 5JQGA 2DMXA 3A2FA 4KHPB 1WPXA 4WFEA 2EIMC 3JSNA 1XMQO 3VOUA 4TSFG 1HNXO 2Z5UA 4P9PA 1OCOC 2M7WA 1VQ6V 1XL6A 4U7OA 3M99B 4J7KA 3A0HZ 3HKEB 3IC9A 1LNQA 2LO1A 4MVZA 4IL6Z 1U97A 2W0FC 4JI2O 1F4MA 4UV9A 3SYPA 1S72V 5IJ0A 5KHGA 2F23A 3ABLB 4DV5O 2OYQA 4K8XA 5KAIZ 2ZNIA 4UCRA 2FMLA 1KB9F 5EBLC 1S3JA 3B40A 4LH6A 4KP4A 5CA3A 2RDCA 4MS2A 3ML0A 2IH3C 4TUYA 2Y69B 5JVDA 3OTOO 4TV8B 3SPHA 4MVUA 4YXWG 1XMOO 2DE0X 4JI0O 2EX3A 1W2BU 3RYCA 2UUAB 3RFRA 1BE3H 2CE4A 4O2AA 1S5LZ 1KYOF 3CCSV 4WF9V 4UCOA 4DR2O 1N34B 2YXHA 4U7NA 1AB3A 5L3CA 2IJHA 5EIBD 2CGOA 3FYEB 4JYYA 1W0KG 2HFEC 1GM8A 1XILA 2JGDA 3Q4HB 3O65A 1SQQH 2ZCEA 1EBOA 4GX5A 3HKDB 1NTZH 3OR7C 4QE9A 5EIBC 1Q81W 2Z3YA 3G6BA 3AG3B 4X88A 1VQMV 5BMVA 1BSMA 2EULA 3L9DA 4DUYO 1YI2V 4H37A 1NVPB 4TT3G 1HDJA 1GN3A 4NB5A 2FKXA 2UUCB 1SRYA 5A2QN 4NTXA 2YXLA 1K8AW 3J7AU 1KP2A 1DTOA 2B1GA 2NN4A 1DLBA 3TCUA 2W6JG 3CC2V 4GKJO 4O4IB 3S3XA 1N36O 3L72H 4QPKA 3CHXA 4J42A 4LF6O 3GB7C 1IDSA 2GSMB 1NTKH 5LMUB 3SPJA 2DQ3A 2JGUA 3ABUA 1YVWA 2DYRB 2BTOA 1TA8A 5LA6A 5J2TB 1ZLZA 1FAFA 4I9WA 4DV6B 4I4TA 5CA1B 4JI5B 4P9OA 1FJGB 4I50A 1L0NH 3J81N 1PM9A 1KKCA 4PELA 3JATB 4LFAO 4QGPA 1Y6XA 3TXQA 2KSDA 4WBNA 1R3JC 4JYAO 3AG4B 4LC1A 5J2UA 4X62O 3RYFB 4FM2A 3PN1A 4YY3B 4X1YA 3OFNG 4FLYA 1GK9A 1YEWA 2HHHB 5JJJB 2N04A 3CCUV 1BCCH 1Y74A 1JPXA 3B09A 3OUSA 4LF8O 5GTIZ 4UVAA 2P06A 4UFZA 2K9PA 2ZQMA 2AHZA 4CS2A 1Q3EA 2AZ0A 1TAEA 1Y4MA 4BIUA 4JI3B 1NBMG 2Q6AA 1SS3A 3G4SV 3K9AA 1OCCC 1AI7A 1R1BA 5JQGB 2YI9A 2W6IG 1AI6A 3UO2A 4MVRA 4DV4B 2F93B 1MABG 2ITDC 3OD4A 2CUGA 1FKAO 1OJHA 5L3DA 1AR4A 2DN9A 1FD9A 5JWPA 1UFIA 5LGNA 3W7UA 4JV5O 4DV7B 4IIJA 2Q0OC 5FLXN 4JYBA 4F6RB 3TXSA 1S5JA 1M5IA 4JZ2A 1OZ0A 1TUBA 2WA3A 2HJDA 1UPGA 4WFHA 3MHHC 3QF7A 1IBKO 3N2KB 4JI6B 2CH7A 2EILC 2PGGA 4LF5B 4ZBMA 2GTAA 5BXZA 4EKWA 4TQDA 3ASNC 3L71H 3ASOC 3OAAG 4JF3A 5FNVA 1F23A 4FZ1A 1K4DC 3AK3A 1GMGA 2VRZA 3JASA 4GT1A 4ZHQA 3ZBHA 1JQ0A 2UU9B 2JEUA 3CC4V 2YEVA 2JRIA 4PA9A 5CA0A 3N27A 1VARA 2CK3G 3RYCB 4JI7O 4PD4F 4O2AB 4CH3A 1K33A 4FLZA 2Q68A 1B6QA 2ZINA 3HKBA 1EFRG 4IYIA 3RW0A 4Q20A 1MOFA 2GTSA 1QR9A 2CAZC 1XHXA 4LR3A 1JJOA 3A8TA 1FXHA 2JGDB 3RYHA 4FLUA 3K0DA 2EIJB 3CWBH 4DR4O 1OCZB 2YIDA 3K04A 5BMVB 4X89A 1R3IC 2HG5C 1GN4A 4X66O 4PA4A 1N32O 2DW4A 2LFRA 1MZFA 3BEHA 2EIMB 4KFMA 1G4YB 3SYCA 1PL0A 3K79A 1YXBA 4DV2O 1OCOB 2XAJA 2IU3A 3JD0A 3OMIB 3CJHA 2ZDIC 4JI4B 4DRXA 1I94O 5IT9N 4CS4A 4WFFA 1EM1A 4J41A 1YZBA 3CCEV 5L3FA 2BTQB 3D3IA 3CSXA 4MTXA 4W4KA 5FPRA 2QTOA 1J5EB 4WFBV 3B8MA 1T5EA 2QJ1A 2QKCA 3C3TA 3GWOA 2LW1A 1S5HC 2VWJA 1D2DA 4F4LA 2E76B 3BPZA 4I50B 2OTJV 3UKMA 5LMNB 2YICA 4TV9B 3RVYA 4LCUC 4PDRA 3KZIZ 4NXNB 2ITCC 3BCCH 4WBNB 1Q5OA 1BL8A 5LYJA 2XOKG 2IU0A 4X1YB 2K1EA 1YJ9V 5KA5A 3QTCA 3T1HO 1HNXB 1KMIZ 2FTKA 3KG2A 3HPLC 3GWKC 5KX5B 3K3WA 1NVPD 2ETNA 3MD0A 4LF7O 3ETQA 2ZKOA 2Q0AA 2CTQA 4CC5A 1ZL8B 4R8CA 3ZIAG 4LF4O 3CD6V 4X20A 1G6UA 3WFVA 1FPOA 5CN0A 1ZTEA 3JD1A 2ZNJA 2WLIB 1M56C 2JS3A 3HKCB 1Z5VA
chains in the Genus database with same CATH topology
4DV1O 4X66O 3RT3C 3R66A 4OPAA 4JI6O 1N32O 5BY1A 1HNZO 1R6TA 4LF5O 1N33O 2UUCO 3O65A 1AILA 2UUBO 4LFCO 3T1YO 4JI5O 5H5NA 1R1BA 1HNWO 1KUQA 4DV2O 2UU9O 2LW7A 1A32A 4DR7O 4AQYO 1IBLO 4K0KO 4B3SO 4DV3O 4X65O 1I94O 2Z0AA 5IT9N 1FKAO 4DR6O 4DUYO 5LMNO 1YZBA 1HR0O 5IWAO 4NXMO 1XEQA 2VQFO 4B3MO 2N74A 5LMUO 1DK1A 2FKXA 4JV5O 4NXNO 5A2QN 3J80N 5FLXN 3J7AU 2HHHO 4DV6O 2UXCO 2UUAO 1XMQO 1FJGO 2VQEO 1XNQO 4GKJO 1D2DA 1HNXO 4DR1O 2DJVA 3M8AA 1N36O 4X64O 2ZM6O 3F5TA 4LF6O 1IBKO 4B3RO 4JI8O 4A5UB 2UXDO 4JI2O 5BXZA 4DUZO 4JI3O 2UXBO 4DR3O 4YY3O 1XNRO 4DV5O 4YHHO 2F4VO 2E5LO 2AGAA 2JRIA 1G1XB 3T1HO 3J81N 5LL6Y 4B3TO 4DV4O 4JI7O 4OX9O 4LFAO 1N34O 1IBMO 4DV0O 4LF7O 1X59A 4LFBO 1FYJA 4JI1O 4LF9O 2ZKOA 3OTOO 4JYAO 4GKKO 4X62O 4DV7O 4KHPO 1J5EO 4LF4O 1XMOO 3JAMN 4JI0O 5BR8O 1NS1A 4OPHA 2DOSA 3SDLA 1F7YA 4DR5O 4DR4O 4JI4O 4DR2O 4LF8O 1AB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 O;  4X66 O;  3RT3 C;  3R66 A;  4OPA A;  4JI6 O;  1N32 O;  5BY1 A;  1HNZ O;  1R6T A;  4LF5 O;  1N33 O;  2UUC O;  3O65 A;  1AIL A;  2UUB O;  4LFC O;  3T1Y O;  4JI5 O;  5H5N A;  1R1B A;  1HNW O;  1KUQ A;  4DV2 O;  2UU9 O;  2LW7 A;  1A32 A;  4DR7 O;  4AQY O;  1IBL O;  4K0K O;  4B3S O;  4DV3 O;  4X65 O;  1I94 O;  2Z0A A;  5IT9 N;  1FKA O;  4DR6 O;  4DUY O;  5LMN O;  1YZB A;  1HR0 O;  5IWA O;  4NXM O;  1XEQ A;  2VQF O;  4B3M O;  2N74 A;  5LMU O;  1DK1 A;  2FKX A;  4JV5 O;  4NXN O;  5A2Q N;  3J80 N;  5FLX N;  3J7A U;  2HHH O;  4DV6 O;  2UXC O;  2UUA O;  1XMQ O;  1FJG O;  2VQE O;  1XNQ O;  4GKJ O;  1D2D A;  1HNX O;  4DR1 O;  2DJV A;  3M8A A;  1N36 O;  4X64 O;  2ZM6 O;  3F5T A;  4LF6 O;  1IBK O;  4B3R O;  4JI8 O;  4A5U B;  2UXD O;  4JI2 O;  5BXZ A;  4DUZ O;  4JI3 O;  2UXB O;  4DR3 O;  4YY3 O;  1XNR O;  4DV5 O;  4YHH O;  2F4V O;  2E5L O;  2AGA A;  2JRI A;  1G1X B;  3T1H O;  3J81 N;  5LL6 Y;  4B3T O;  4DV4 O;  4JI7 O;  4OX9 O;  4LFA O;  1N34 O;  1IBM O;  4DV0 O;  4LF7 O;  1X59 A;  4LFB O;  1FYJ A;  4JI1 O;  4LF9 O;  2ZKO A;  3OTO O;  4JYA O;  4GKK O;  4X62 O;  4DV7 O;  4KHP O;  1J5E O;  4LF4 O;  1XMO O;  3JAM N;  4JI0 O;  5BR8 O;  1NS1 A;  4OPH A;  2DOS A;  3SDL A;  1F7Y A;  4DR5 O;  4DR4 O;  4JI4 O;  4DR2 O;  4LF8 O;  1AB3 A; 
#chains in the Genus database with same CATH topology
 4UUJ C;  1S0V A;  1QVG U;  1PP9 H;  4ZKI A;  2R9A A;  4U3F H;  2EJR A;  3ZHR A;  1OCR B;  4G2K A;  4O4J B;  4JI0 B;  2QWR B;  1KUQ A;  2P4K A;  2F4V B;  2E5L B;  1Q86 W;  4B3S O;  4OX9 B;  4YIO A;  2JDI G;  3DGE A;  1W59 A;  1TUB B;  1XHZ A;  2QWO B;  1YJW V;  2ZR3 A;  3H1K H;  3WB0 A;  4QNH B;  4H44 B;  4WCE V;  2FB5 A;  1Q8I A;  1MSD A;  3AG4 C;  5FNV B;  2WLL B;  2VQE O;  3OE7 G;  1SQV H;  5CA0 B;  4LWS A;  3S3W A;  1YCI A;  2UXD O;  2RQ6 A;  5IJ9 B;  3P3P A;  2Q7E A;  2UXB O;  3K03 A;  5IYZ A;  1V55 C;  1V9P A;  3U11 A;  1GRJ A;  1ORQ C;  4RUE A;  4GKJ B;  1SQX H;  1K5S A;  1N36 B;  2Q73 A;  2OCH A;  2PY5 A;  2JVD A;  4LF6 B;  4EB6 A;  4NXM B;  1OCC B;  2H3O A;  1QVF U;  2PYL A;  2V1D A;  4FMT A;  2X0L A;  5CBF A;  3ZRW A;  3SR2 C;  3JD4 A;  1IXB A;  5CBH A;  2ZR2 A;  1AVM A;  3ZJZ A;  3CJH B;  1BT8 A;  3D36 C;  4OPA A;  1XI1 A;  5A9G A;  2C2A A;  2FYU H;  4X62 B;  2KG7 B;  4O4H A;  4B7K A;  2F95 B;  1JA8 A;  1SC5 B;  1XNR B;  1GM9 A;  2PTM A;  2R9R B;  1NKD A;  3OEE G;  1GKF A;  1VQP V;  2Q8V A;  1VF7 A;  3ZHS A;  2ADQ B;  3IC7 A;  2EIL B;  3EFF K;  4RWU A;  1BHB A;  2YI8 A;  2HLD G;  2BOB C;  4K8Z A;  3ASN B;  1NR1 A;  3AG7 A;  3FAV A;  3VQY A;  5GTH Z;  4DK1 A;  1OV9 A;  3ABK C;  3SPI A;  1NZ6 A;  5GON A;  4UB6 Z;  1DF5 A;  5LHH A;  5LYJ B;  2KKW A;  2JJ1 G;  1Y76 B;  3LDD A;  2ZM6 O;  1EZJ A;  3OGC C;  4Z1V A;  2BSK A;  4PI2 A;  4JI8 O;  2YDE A;  4JV5 B;  5EK0 A;  2P7T C;  4WFA V;  4X20 B;  4DK0 A;  1YDX A;  1ZUQ A;  3OUF A;  4CC6 A;  1IBK B;  2ODM A;  3L73 H;  5LBQ A;  4MVM A;  4GKK O;  3CRC A;  3LDC A;  3QVN A;  1EZV H;  1ZWI C;  3H1I H;  1VQ4 V;  4H0L B;  1SF9 A;  2L35 A;  3H1J H;  3CME V;  3D36 A;  3RYI A;  2IW5 A;  3E8H A;  2ZIM A;  4QPJ A;  1SES A;  1E79 G;  3JAR B;  2DQ0 A;  3JAL A;  5KAF Z;  3RGB A;  1Q82 W;  1GO3 F;  4JAS A;  1FFX B;  5IYB O;  1YJN V;  4TWK A;  2QWQ B;  4QIW F;  3X2Q C;  2WLH A;  3G80 A;  4HNA A;  4DR4 B;  4BIZ A;  1L1F A;  3CXC U;  2F1M A;  3ZRV A;  1HW7 A;  4X66 B;  4DV0 B;  5IWA O;  1H38 A;  2CTP A;  1B04 A;  5H6R A;  4WFG A;  4IHJ A;  3VQX A;  4R50 A;  4DV2 B;  2AXT Z;  2QM4 A;  5LXT A;  2OT5 A;  5IYZ B;  2UXC O;  5KHH A;  1XNQ O;  1NQT A;  1AP6 A;  1ENV A;  1P4R A;  5DM6 V;  1L0L H;  4FFB B;  3IJ4 A;  1I5Y A;  2Q67 A;  4B3R O;  5KHK A;  1X4T A;  4EB6 B;  3OM3 B;  1IZ3 A;  1Z5W A;  2UUB B;  2O57 A;  4LFC B;  1WA8 B;  4UXN A;  5CMU A;  5LHI A;  1M56 B;  2XND G;  3P30 A;  1OCR C;  2P22 C;  2QKA A;  2XT9 A;  3AEI A;  2QE7 G;  4FLX A;  3ZRW B;  3P3N A;  1BQZ A;  2AW9 A;  1KU9 A;  5L3G A;  2LFS A;  3UQ8 A;  4HYO A;  3OT7 A;  1N4C A;  1R3L C;  3VQV A;  3RN4 A;  4LF9 O;  1JFF B;  5K1X A;  3FFQ A;  1WP8 A;  5EZY B;  2LQT A;  4JZG A;  3B2E E;  2YC0 A;  4D7T A;  4K3A A;  4FM1 A;  3T1H B;  3FX7 A;  1F7Y A;  4EFB A;  1AI4 A;  3B77 A;  4LF7 B;  4P30 A;  5H6Q A;  4Z2W A;  4PDV A;  3E83 A;  3CCL V;  2EIK C;  2ATK C;  3ZCC A;  2PUS A;  3KCX A;  3FAV B;  3APQ A;  1HNW O;  4YJ3 A;  5ITZ A;  1FFT B;  3CCJ V;  4BW5 A;  4H33 A;  3D8C A;  5EBW C;  4K0K O;  4YIP A;  3U0Z A;  1COW G;  5GON B;  1KC8 W;  4XDK A;  1N8R W;  2BOC C;  1HR0 O;  1RSO B;  1Z2G A;  1D5N A;  4RQE A;  3IAY A;  1V55 B;  1R6N A;  1SA0 A;  1M93 A;  3T4Z A;  3ETD A;  2RNB A;  4B08 A;  1SZX A;  1M9N A;  2YIB A;  3BHP A;  3LSS A;  1P7B A;  2HVK C;  4MT8 A;  4FZ0 A;  2NNU A;  3N2G A;  3C3S A;  5CBG A;  1N33 B;  5CB4 A;  3JAW A;  1TVK A;  3ZHT A;  1H2K A;  4YHH O;  3GVM A;  5IJ0 B;  4AQY B;  2N05 A;  2GV9 A;  2B9Z A;  3RYI B;  5BZB A;  2LJ2 A;  4DYL A;  1I08 A;  5B66 Z;  4B3M B;  1LUW A;  2PI4 A;  4UVB A;  2BCC H;  4DXW A;  4Z1M G;  1JCH A;  1JVM A;  2UXB B;  1VQL V;  4OXS A;  3E8F A;  4TUY B;  5JVD B;  4KHP O;  3CE2 A;  1RM1 C;  3CX5 F;  3JAM N;  2HR3 A;  5HFL A;  3CS5 A;  2DOS A;  1NR7 A;  2LGQ A;  3K5N A;  4DR1 B;  2EZP A;  1AJQ A;  2WPD G;  4BW9 A;  3P32 A;  2CTR A;  2W0X A;  2P67 A;  1WN7 A;  3LDE A;  1Q43 A;  1HNZ O;  4U3J A;  3OGI B;  3ABK B;  1P7G A;  1VQ8 V;  4D7S A;  4IHJ B;  3SJB C;  3FB5 C;  2OIE A;  1W0J G;  1L8D A;  4X65 O;  3NR7 A;  1WB7 A;  2E3C A;  1H2G A;  3AK1 A;  4R6Z A;  1IXM A;  4X1K A;  2QWP B;  3SGI A;  1Q7Y W;  4X1I A;  3AK2 A;  2YSU B;  3J80 N;  5BR8 B;  2UUA O;  4K35 A;  4NKG B;  1FXV A;  3SJA C;  3M8A A;  2WLN A;  2A06 H;  4GX1 A;  2IBZ H;  3ZMT A;  1MMM A;  2D2C B;  3MHS C;  3CYO A;  2Y48 A;  2EIN C;  3T1Y B;  4JPR A;  2ZIO A;  2RN9 A;  5LA6 B;  1G1X B;  1XRE A;  1D5A A;  4JAA A;  1F4N A;  4R7C A;  3ICX A;  3H9V A;  4I4T B;  2LP7 A;  2ZM6 B;  4UV8 A;  4FM0 A;  4UCV A;  1IBM O;  1THZ A;  3LUT B;  2IJK A;  3BRC A;  3FD9 A;  3QG5 A;  3X2Q B;  3SYA A;  3G67 A;  5J2U B;  3BAA A;  3LSU A;  4O4L A;  3ZMV A;  1XMQ B;  2V7Q G;  3ABM C;  5EC1 C;  4DR5 O;  2GDS A;  1Q6U A;  4L8J A;  4IGG A;  3L75 H;  2KB1 A;  1Y74 B;  4FVM A;  3LSQ A;  5F2V O;  4FJC C;  4JI2 B;  4GKK B;  3UT5 A;  1AIL A;  2ZD9 A;  3DTU B;  4KL1 A;  4JI5 O;  4DV5 B;  3CRR A;  4GLX A;  4RQF A;  4MTO A;  3ABT A;  3ETE A;  3ZHQ A;  2QGN A;  1PNL A;  5IY5 C;  1H2S B;  2QSA A;  3OW2 U;  4DV3 O;  4L87 A;  2IM9 A;  3SPC A;  2VQF O;  4NYK A;  3OTO B;  1PKX A;  1N0J A;  3SYQ A;  2OCC C;  3N2G B;  1XMO B;  2HHH O;  5CB4 B;  3JAW B;  4IIJ B;  5KA6 A;  2QDO A;  1WAZ A;  4DR2 B;  3HKE A;  3G6E V;  5E79 Z;  5IWA B;  1MNG A;  4AIL C;  3STZ C;  1S77 D;  5KHJ A;  2X6A A;  2NR5 A;  3K0G A;  3E89 A;  4JI3 O;  2CH7 B;  2R9I A;  2X7R B;  4JTC B;  3CEI A;  2XAS A;  3QO7 A;  5EBM C;  3E22 A;  3B4S A;  3L74 H;  2PF4 E;  1JOY A;  2AHY A;  4DV4 O;  4ZHQ B;  3JAS B;  4QE7 A;  4MTF A;  2XAF A;  2YEV B;  4DUY B;  3WU2 Z;  4TV8 A;  4NTY A;  2EIK B;  3A0B Z;  4LNU A;  3CRA A;  4LBE C;  3HKB B;  1KD1 W;  5C8Y A;  4NR1 A;  4DV7 O;  1NTM H;  1QLE C;  1NI8 A;  1K92 A;  4U3J B;  3EVK A;  1NS1 A;  3SPG A;  1QHT A;  2X6B A;  1RPO A;  1H2L A;  3RYH B;  3FYI B;  4JGS A;  3ZHV A;  5KLV H;  5LGU A;  3JD3 A;  4DV1 O;  3Q4H A;  4JI6 O;  1SQF A;  4LF9 B;  4C7U A;  1YIT V;  2ZE8 A;  3H1L H;  3HKD A;  4LF5 O;  4TOI A;  1S76 D;  4CH6 A;  2QR4 A;  4JAV A;  4PJ0 Z;  3E2E A;  2VWK A;  2UU9 O;  2LW7 A;  4DR7 O;  3CMA V;  4J80 A;  2M6Y A;  5DED A;  1WLE A;  2Z0A A;  5FPO A;  1VQ9 V;  4LFA B;  1FS0 G;  1K3E A;  4DRX B;  4FLV A;  1RP3 B;  4JYA B;  1B3Q A;  1SQB H;  3NXS A;  1GH6 A;  2ZXW C;  3QNE A;  1HNW B;  2XAG A;  1HP8 A;  1K97 A;  4OGQ B;  2IJI A;  4N21 A;  5LOV A;  4CBC A;  3FB7 C;  1GAX A;  3F7Y C;  4X64 O;  4LF8 B;  1I0H A;  4E2L A;  1HR0 B;  1PL4 A;  3M7M X;  4BWA A;  3K58 A;  4DW0 A;  1GN6 A;  3ZRX A;  1RM1 B;  3G71 V;  4X8A A;  5KUM A;  4DUZ O;  3CXH F;  4HAM A;  3ZED A;  5B3S C;  1ROP A;  1XBL A;  2H94 A;  2P90 A;  1E1Q G;  1BHA A;  3STL C;  2P4V A;  3JAT A;  3JCZ A;  5B1A C;  4B3T O;  1MSW D;  2GUZ A;  1OHH G;  4DW1 A;  3DC6 A;  1GTO A;  4G27 B;  3RYF A;  1JX9 A;  4JI1 O;  1RFY A;  1J5E O;  3DSQ A;  1VQ5 V;  1K34 A;  2XHB A;  1PNK A;  2HP8 A;  1TGO A;  2Q9L A;  3JAK A;  3SDL A;  5DN6 G;  3WG7 C;  1K73 W;  3BVO A;  4ICG A;  1K5Q A;  2A3Q A;  1M1K W;  1VQK V;  3BA8 A;  1E1R G;  1P49 A;  1VF5 B;  2OWO A;  4UB8 Z;  1DGS A;  4PI0 A;  1NJI W;  2P6J A;  4DO2 A;  1XL4 A;  1NH2 D;  2QTS A;  4J9Z B;  2PYJ A;  2E74 B;  5D5Q A;  4B7E A;  4I0X A;  4MW8 A;  5KHI A;  1A32 A;  4MVS A;  1URF A;  3F7V C;  4Q6G A;  3CCQ V;  3CPW U;  3TK1 A;  4JI7 B;  2Y0P A;  4DR6 O;  4QJF B;  2EIN B;  1HNZ B;  2A9H A;  4RO2 A;  1K9M W;  4YJ2 A;  4ZI7 A;  2AZ2 A;  4F6R A;  1VEW A;  3AG2 C;  3FKS G;  4JTD B;  5B5E Z;  3BAB A;  1VQ7 V;  1QR8 A;  4J10 A;  1SZT A;  4LH7 A;  4X9Q A;  4X65 B;  5IDJ A;  3E22 B;  3N2K A;  4FIP C;  4I55 A;  3D3Q A;  1CP9 A;  3F5T A;  2QWN B;  3UO3 A;  1YTF B;  4BIO A;  3I55 V;  1N32 B;  4LWS B;  4LNU B;  3JSL A;  4GX2 A;  1BGY H;  1LR1 A;  4ZIB A;  1I5X A;  1M90 W;  1AJP A;  1XQ8 A;  3ABM B;  3K59 A;  5LP6 A;  2HJF C;  5C8Y B;  3ZMZ A;  2F4V O;  2E5L O;  4TQF A;  1VQN V;  4OX9 O;  1I94 B;  2A0L A;  1VF6 A;  2YIB D;  3W7S A;  3K5L A;  2ZT9 B;  5JJE B;  4EEQ A;  4LFB O;  3F5W C;  2P5O A;  3CP1 A;  1CEZ A;  4KXR A;  5IY5 B;  1U96 A;  1LUV A;  1VP7 A;  3JYC A;  3CCR V;  1QCE A;  4OPH A;  4MVQ A;  4RAI A;  2Q4P A;  1IBM B;  4XDL A;  2OCC B;  3BY6 A;  2ZE5 A;  2F43 G;  4ABM A;  3KCY A;  3E8B A;  1KEC A;  1AJN A;  1IX9 A;  4UVC A;  4O4H B;  2G38 A;  1HWY A;  1XDC A;  1DF4 A;  4I5S A;  4DR5 B;  1IBL O;  2BTQ A;  3QO5 A;  2CGN A;  4JTA B;  4FFK A;  3BFR A;  5LOV B;  2ZE7 A;  4NXM O;  5KMG A;  4EFE A;  1BZK A;  3FB6 C;  4MTG A;  4GYC B;  3K57 A;  2B5U A;  4LF4 B;  2KQX A;  2RMK B;  2V4D A;  1H8E G;  5GW7 A;  3CRM A;  4FLT A;  1MA1 A;  3IFX A;  1WPB A;  1N0N A;  2DJV A;  4DV3 B;  4TV9 A;  4FK5 C;  3SJQ C;  2Q7H A;  4O2B A;  1H8H G;  2GUZ B;  2DYS C;  1ZX3 A;  2EJ7 A;  2VQF B;  1AR5 A;  1QLE B;  1PNM A;  3DXR A;  2YXY A;  5JH7 A;  4HBN A;  2NLJ C;  2BSK B;  1Q90 D;  2WLK A;  4DR3 O;  1AI5 A;  2YS8 A;  2RCV A;  1XNR O;  5KX5 A;  2ARH A;  3E35 A;  5LL6 Y;  1WP7 A;  2UXX A;  3DC5 A;  3MDS A;  4B3S B;  2BE3 A;  3JAK B;  2GHY A;  2EZO A;  3VBB A;  1ZL8 A;  4E4E A;  1FYJ A;  1CXZ B;  1QNM A;  3K5M A;  5EC2 C;  3OMN B;  3H01 A;  1CPY A;  1YHQ V;  1H2N A;  2WLI A;  4J7J A;  3HKC A;  2VQE B;  4I0X B;  2Y4U A;  4J9Y B;  1BS3 A;  3ETG A;  2IH1 C;  4CH5 A;  2ZXW B;  2JS5 A;  1M57 C;  1EN5 A;  4O4J A;  2UXD B;  3LNN A;  3OMA B;  4PDM A;  5EYP A;  1WNS A;  3THO A;  1YIJ V;  4YJ2 B;  4ZI7 B;  1H2M A;  1NT2 B;  3JAL B;  4PV1 B;  5H5N A;  2A79 B;  3EXA A;  4I9Q A;  4NVP A;  1SQG A;  2JJ2 G;  2XUM A;  1I7F A;  4HNA B;  4DV1 B;  2XTA A;  5B3S B;  4I55 B;  2EBO A;  3CRQ A;  1V54 C;  3UCS C;  4GZR B;  2WLL A;  5B1A B;  3UM7 A;  2A7W A;  5B1B C;  1K4C C;  4DR7 B;  2YIA A;  1SER A;  1FXK C;  4ASU G;  5LP6 B;  3RVZ A;  5LXT B;  3B8N A;  1NU1 H;  1VQO V;  1KBH A;  2OIG A;  4PA7 A;  3W7W A;  5IJ9 A;  3AG1 C;  1EN6 A;  1KP3 A;  5LHG A;  2E75 B;  2Y0I A;  3WG7 B;  2HEP A;  2WLM A;  1EN4 A;  2B1I A;  3OTF A;  3O9O A;  1QQC A;  3VQW A;  5J9P C;  4X64 B;  1N34 O;  4XBF A;  4IYH A;  4AI8 A;  4DV0 O;  1ARO P;  3E86 A;  1JJ2 U;  3MAQ A;  4DUZ B;  1YSC A;  4GX0 A;  1P84 F;  4G28 B;  2X6C A;  2Y4T A;  4GCZ A;  2Q5Z A;  4UCU A;  2ADP A;  3ZMU A;  3FB8 C;  3RBZ A;  1NH2 B;  2RJZ A;  4B3T B;  4NTW A;  3ABL C;  3T4D A;  1YTF D;  3TGU H;  2DWD C;  2FL4 A;  2KG7 A;  3AG2 B;  4JI1 B;  2YUA A;  4JI8 B;  1R6T A;  3H1H H;  5L3B A;  3KKY A;  5KMG B;  4BAY A;  1R3K C;  3T1C A;  2UUC O;  1XUQ A;  2UUB O;  2Y69 C;  4LFC O;  3W7T A;  2OTL V;  2JK5 C;  4ZOL A;  3K5O A;  4HZ3 A;  1AR1 B;  5HFM A;  5D5P A;  2HVJ C;  3ZMS A;  3R65 A;  4YJ3 B;  5ITZ B;  1M4U A;  4UCT A;  1SQP H;  4MVO A;  3I5D A;  1PPJ H;  4O2B B;  2N74 A;  5LMU O;  4CS3 A;  3A0R A;  1IVS A;  1B06 A;  1RPR A;  3K06 A;  1FXK A;  3JCU Z;  1O9G A;  5JCO C;  4JYC A;  5C93 A;  3DXR B;  3ZHU A;  1MZE A;  5JH7 B;  4DV6 O;  1SA0 B;  1FJG O;  5AG2 A;  1Y76 A;  3HB3 B;  3IGA C;  2CDY A;  1Y66 A;  3AG3 C;  1WJZ A;  2JIZ G;  1QLN A;  4DR6 B;  4RUF A;  4I7Z B;  3K08 A;  4P2Z A;  2ZE6 A;  4A5U B;  4J11 A;  4PA3 A;  2XAQ A;  3CCV V;  3U10 A;  4IT5 A;  4YY3 O;  5KUK A;  1TVK B;  2AGA A;  2WLJ A;  4D6T H;  4N23 A;  2WWW A;  2H8P C;  5IYC O;  2R70 A;  2ZDI A;  4H13 B;  1O9H A;  1R6K A;  4AHC A;  5EYP B;  2DYR C;  2UXC B;  3CC7 V;  1XNQ B;  1PV0 A;  5L3E A;  5JJN B;  2QM7 A;  3ZN1 A;  4CH4 A;  3JAR A;  1JMK C;  4KUM A;  3SJC C;  4LFB B;  3QO8 A;  3R66 A;  4J7Z A;  4B3R B;  3TJT A;  5BY1 A;  2ILM A;  1FFX A;  3ZN0 A;  1N33 O;  4FLW A;  4PDL A;  3TET A;  4JAU A;  1J95 A;  2D3O W;  1GN2 A;  3I56 V;  3OR6 C;  1UJW B;  3PJS K;  4AQY O;  3T2M A;  2CTW A;  2DYS B;  1SKV A;  1PD3 A;  3ZS8 C;  5JCO A;  3JD2 A;  4FPP A;  1VMG A;  2JEX A;  2QA4 V;  3LNM B;  3RWR D;  4XDJ A;  4F6E A;  1WB8 A;  1XEQ A;  4B3M O;  4W4L A;  1ZAU A;  4CZZ A;  1BMF G;  1DK1 A;  1SET A;  5IYD O;  1BQ0 A;  3C90 A;  4X1K B;  5IE9 A;  2UXN A;  2QKS A;  4FFB A;  4X1I B;  5FL7 G;  2MW2 B;  1IBL B;  4DR1 O;  3E8G A;  5B1O A;  1Q6H A;  1GM7 A;  5E1A C;  5H9C A;  5H2F Z;  2VS0 A;  1WA8 A;  3W7X A;  2MK3 A;  1AP5 A;  2Q7G A;  4O4I A;  4PA6 A;  1K7D A;  4PHZ A;  1Y67 A;  4LP8 A;  1F51 A;  5TIS Z;  4UCS A;  4K0K B;  3APO A;  3ZRS A;  1M57 B;  2QM8 A;  1JFF A;  3ZX6 A;  3SYO A;  1X59 A;  5EZY A;  2IJJ A;  1KQS U;  5J2T A;  2PI5 A;  1US6 A;  5CA1 A;  5LGT A;  2LGW A;  4DR3 B;  2HKO A;  2F66 C;  1MG1 A;  3K9S A;  1KKD A;  5BR8 O;  5K1P A;  2WAM A;  3EHB B;  4ZOL B;  3WB1 A;  4MW3 A;  5DEC A;  4BR6 A;  2L6L A;  4JI4 O;  4O4L B;  1V54 B;  5LP6 C;  3ASO B;  3RT3 C;  1IUR A;  4GUN A;  5B1B B;  2WSS G;  3OEH G;  2XAH A;  2R72 A;  5B1N A;  1QU7 A;  1VF6 C;  2QEX V;  3T1Y O;  1FXK B;  3UT5 B;  4YHH B;  3BA9 A;  2WA4 A;  1QBZ A;  3CB2 A;  3WB2 A;  1VIB A;  1RSO A;  2Q69 A;  1YF2 A;  2GBO A;  3AG1 B;  4MSW C;  1JR9 A;  1Q6I A;  3L70 H;  5LMN O;  2EIJ C;  1OCZ C;  3CCM V;  1G8M A;  1XOU A;  2DWE C;  1R73 A;  1TUE B;  2PZS A;  3HR0 A;  4NXN O;  1ZSP A;  5JQG A;  2DMX A;  3A2F A;  4KHP B;  1WPX A;  4WFE A;  2EIM C;  3JSN A;  1XMQ O;  3VOU A;  4TSF G;  1HNX O;  2Z5U A;  4P9P A;  1OCO C;  2M7W A;  1VQ6 V;  1XL6 A;  4U7O A;  3M99 B;  4J7K A;  3A0H Z;  3HKE B;  3IC9 A;  1LNQ A;  2LO1 A;  4MVZ A;  4IL6 Z;  1U97 A;  2W0F C;  4JI2 O;  1F4M A;  4UV9 A;  3SYP A;  1S72 V;  5IJ0 A;  5KHG A;  2F23 A;  3ABL B;  4DV5 O;  2OYQ A;  4K8X A;  5KAI Z;  2ZNI A;  4UCR A;  2FML A;  1KB9 F;  5EBL C;  1S3J A;  3B40 A;  4LH6 A;  4KP4 A;  5CA3 A;  2RDC A;  4MS2 A;  3ML0 A;  2IH3 C;  4TUY A;  2Y69 B;  5JVD A;  3OTO O;  4TV8 B;  3SPH A;  4MVU A;  4YXW G;  1XMO O;  2DE0 X;  4JI0 O;  2EX3 A;  1W2B U;  3RYC A;  2UUA B;  3RFR A;  1BE3 H;  2CE4 A;  4O2A A;  1S5L Z;  1KYO F;  3CCS V;  4WF9 V;  4UCO A;  4DR2 O;  1N34 B;  2YXH A;  4U7N A;  1AB3 A;  5L3C A;  2IJH A;  5EIB D;  2CGO A;  3FYE B;  4JYY A;  1W0K G;  2HFE C;  1GM8 A;  1XIL A;  2JGD A;  3Q4H B;  3O65 A;  1SQQ H;  2ZCE A;  1EBO A;  4GX5 A;  3HKD B;  1NTZ H;  3OR7 C;  4QE9 A;  5EIB C;  1Q81 W;  2Z3Y A;  3G6B A;  3AG3 B;  4X88 A;  1VQM V;  5BMV A;  1BSM A;  2EUL A;  3L9D A;  4DUY O;  1YI2 V;  4H37 A;  1NVP B;  4TT3 G;  1HDJ A;  1GN3 A;  4NB5 A;  2FKX A;  2UUC B;  1SRY A;  5A2Q N;  4NTX A;  2YXL A;  1K8A W;  3J7A U;  1KP2 A;  1DTO A;  2B1G A;  2NN4 A;  1DLB A;  3TCU A;  2W6J G;  3CC2 V;  4GKJ O;  4O4I B;  3S3X A;  1N36 O;  3L72 H;  4QPK A;  3CHX A;  4J42 A;  4LF6 O;  3GB7 C;  1IDS A;  2GSM B;  1NTK H;  5LMU B;  3SPJ A;  2DQ3 A;  2JGU A;  3ABU A;  1YVW A;  2DYR B;  2BTO A;  1TA8 A;  5LA6 A;  5J2T B;  1ZLZ A;  1FAF A;  4I9W A;  4DV6 B;  4I4T A;  5CA1 B;  4JI5 B;  4P9O A;  1FJG B;  4I50 A;  1L0N H;  3J81 N;  1PM9 A;  1KKC A;  4PEL A;  3JAT B;  4LFA O;  4QGP A;  1Y6X A;  3TXQ A;  2KSD A;  4WBN A;  1R3J C;  4JYA O;  3AG4 B;  4LC1 A;  5J2U A;  4X62 O;  3RYF B;  4FM2 A;  3PN1 A;  4YY3 B;  4X1Y A;  3OFN G;  4FLY A;  1GK9 A;  1YEW A;  2HHH B;  5JJJ B;  2N04 A;  3CCU V;  1BCC H;  1Y74 A;  1JPX A;  3B09 A;  3OUS A;  4LF8 O;  5GTI Z;  4UVA A;  2P06 A;  4UFZ A;  2K9P A;  2ZQM A;  2AHZ A;  4CS2 A;  1Q3E A;  2AZ0 A;  1TAE A;  1Y4M A;  4BIU A;  4JI3 B;  1NBM G;  2Q6A A;  1SS3 A;  3G4S V;  3K9A A;  1OCC C;  1AI7 A;  1R1B A;  5JQG B;  2YI9 A;  2W6I G;  1AI6 A;  3UO2 A;  4MVR A;  4DV4 B;  2F93 B;  1MAB G;  2ITD C;  3OD4 A;  2CUG A;  1FKA O;  1OJH A;  5L3D A;  1AR4 A;  2DN9 A;  1FD9 A;  5JWP A;  1UFI A;  5LGN A;  3W7U A;  4JV5 O;  4DV7 B;  4IIJ A;  2Q0O C;  5FLX N;  4JYB A;  4F6R B;  3TXS A;  1S5J A;  1M5I A;  4JZ2 A;  1OZ0 A;  1TUB A;  2WA3 A;  2HJD A;  1UPG A;  4WFH A;  3MHH C;  3QF7 A;  1IBK O;  3N2K B;  4JI6 B;  2CH7 A;  2EIL C;  2PGG A;  4LF5 B;  4ZBM A;  2GTA A;  5BXZ A;  4EKW A;  4TQD A;  3ASN C;  3L71 H;  3ASO C;  3OAA G;  4JF3 A;  5FNV A;  1F23 A;  4FZ1 A;  1K4D C;  3AK3 A;  1GMG A;  2VRZ A;  3JAS A;  4GT1 A;  4ZHQ A;  3ZBH A;  1JQ0 A;  2UU9 B;  2JEU A;  3CC4 V;  2YEV A;  2JRI A;  4PA9 A;  5CA0 A;  3N27 A;  1VAR A;  2CK3 G;  3RYC B;  4JI7 O;  4PD4 F;  4O2A B;  4CH3 A;  1K33 A;  4FLZ A;  2Q68 A;  1B6Q A;  2ZIN A;  3HKB A;  1EFR G;  4IYI A;  3RW0 A;  4Q20 A;  1MOF A;  2GTS A;  1QR9 A;  2CAZ C;  1XHX A;  4LR3 A;  1JJO A;  3A8T A;  1FXH A;  2JGD B;  3RYH A;  4FLU A;  3K0D A;  2EIJ B;  3CWB H;  4DR4 O;  1OCZ B;  2YID A;  3K04 A;  5BMV B;  4X89 A;  1R3I C;  2HG5 C;  1GN4 A;  4X66 O;  4PA4 A;  1N32 O;  2DW4 A;  2LFR A;  1MZF A;  3BEH A;  2EIM B;  4KFM A;  1G4Y B;  3SYC A;  1PL0 A;  3K79 A;  1YXB A;  4DV2 O;  1OCO B;  2XAJ A;  2IU3 A;  3JD0 A;  3OMI B;  3CJH A;  2ZDI C;  4JI4 B;  4DRX A;  1I94 O;  5IT9 N;  4CS4 A;  4WFF A;  1EM1 A;  4J41 A;  1YZB A;  3CCE V;  5L3F A;  2BTQ B;  3D3I A;  3CSX A;  4MTX A;  4W4K A;  5FPR A;  2QTO A;  1J5E B;  4WFB V;  3B8M A;  1T5E A;  2QJ1 A;  2QKC A;  3C3T A;  3GWO A;  2LW1 A;  1S5H C;  2VWJ A;  1D2D A;  4F4L A;  2E76 B;  3BPZ A;  4I50 B;  2OTJ V;  3UKM A;  5LMN B;  2YIC A;  4TV9 B;  3RVY A;  4LCU C;  4PDR A;  3KZI Z;  4NXN B;  2ITC C;  3BCC H;  4WBN B;  1Q5O A;  1BL8 A;  5LYJ A;  2XOK G;  2IU0 A;  4X1Y B;  2K1E A;  1YJ9 V;  5KA5 A;  3QTC A;  3T1H O;  1HNX B;  1KMI Z;  2FTK A;  3KG2 A;  3HPL C;  3GWK C;  5KX5 B;  3K3W A;  1NVP D;  2ETN A;  3MD0 A;  4LF7 O;  3ETQ A;  2ZKO A;  2Q0A A;  2CTQ A;  4CC5 A;  1ZL8 B;  4R8C A;  3ZIA G;  4LF4 O;  3CD6 V;  4X20 A;  1G6U A;  3WFV A;  1FPO A;  5CN0 A;  1ZTE A;  3JD1 A;  2ZNJ A;  2WLI B;  1M56 C;  2JS3 A;  3HKC B;  1Z5V A; 
#chains in the Genus database with same CATH homology
 4DV1 O;  4X66 O;  3RT3 C;  3R66 A;  4OPA A;  4JI6 O;  1N32 O;  5BY1 A;  1HNZ O;  1R6T A;  4LF5 O;  1N33 O;  2UUC O;  3O65 A;  1AIL A;  2UUB O;  4LFC O;  3T1Y O;  4JI5 O;  5H5N A;  1R1B A;  1HNW O;  1KUQ A;  4DV2 O;  2UU9 O;  2LW7 A;  1A32 A;  4DR7 O;  4AQY O;  1IBL O;  4K0K O;  4B3S O;  4DV3 O;  4X65 O;  1I94 O;  2Z0A A;  5IT9 N;  1FKA O;  4DR6 O;  4DUY O;  5LMN O;  1YZB A;  1HR0 O;  5IWA O;  4NXM O;  1XEQ A;  2VQF O;  4B3M O;  2N74 A;  5LMU O;  1DK1 A;  2FKX A;  4JV5 O;  4NXN O;  5A2Q N;  3J80 N;  5FLX N;  3J7A U;  2HHH O;  4DV6 O;  2UXC O;  2UUA O;  1XMQ O;  1FJG O;  2VQE O;  1XNQ O;  4GKJ O;  1D2D A;  1HNX O;  4DR1 O;  2DJV A;  3M8A A;  1N36 O;  4X64 O;  2ZM6 O;  3F5T A;  4LF6 O;  1IBK O;  4B3R O;  4JI8 O;  4A5U B;  2UXD O;  4JI2 O;  5BXZ A;  4DUZ O;  4JI3 O;  2UXB O;  4DR3 O;  4YY3 O;  1XNR O;  4DV5 O;  4YHH O;  2F4V O;  2E5L O;  2AGA A;  2JRI A;  1G1X B;  3T1H O;  3J81 N;  5LL6 Y;  4B3T O;  4DV4 O;  4JI7 O;  4OX9 O;  4LFA O;  1N34 O;  1IBM O;  4DV0 O;  4LF7 O;  1X59 A;  4LFB O;  1FYJ A;  4JI1 O;  4LF9 O;  2ZKO A;  3OTO O;  4JYA O;  4GKK O;  4X62 O;  4DV7 O;  4KHP O;  1J5E O;  4LF4 O;  1XMO O;  3JAM N;  4JI0 O;  5BR8 O;  1NS1 A;  4OPH A;  2DOS A;  3SDL A;  1F7Y A;  4DR5 O;  4DR4 O;  4JI4 O;  4DR2 O;  4LF8 O;  1AB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...