1IBLO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1iblO00
3T1YO 4LFAO 4B3TO 3OTOO 3O65A 1HNWO 5LMUO 4JV5O 3J80N 4DUYO 2UU9O 1DK1A 4X62O 4X64O 4OX9O 4DV4O 2UUAO 1NS1A 4DV2O 4NXNO 4B3SO 1YZBA 1HNZO 3F5TA 4LF5O 4JYAO 2LW7A 4NXMO 3RT3C 4DR7O 4DR3O 4LF7O 5BR8O 3T1HO 4X66O 4DR6O 4DV5O 2FKXA 1XNRO 1G1XB 2VQEO 4JI3O 5FLXN 2UXCO 4LF6O 4LF8O 4JI5O 5IWAO 5BXZA 4YY3O 4OPHA 4JI2O 2AGAA 1N33O 4A5UB 2N74A 1J5EO 1XMOO 1FJGO 1XEQA 1R1BA 1XNQO 1IBKO 4K0KO 4OPAA 4KHPO 1IBLO 4DR2O 2ZKOA 4DV1O 4JI7O 4JI0O 2HHHO 1HR0O 5LL6Y 1F7YA 4B3RO 1N34O 1AILA 4DUZO 2JRIA 4LFBO 4X65O 4JI8O 1FYJA 1IBMO 1D2DA 2DOSA 2ZM6O 4DR1O 4YHHO 4JI4O 2E5LO 4DV0O 1X59A 4DR4O 1N32O 4DV3O 4DV6O 4GKKO 1R6TA 4GKJO 4AQYO 1FKAO 5A2QN 5IT9N 3JAMN 4DR5O 2DJVA 2Z0AA 2F4VO 4LF4O 3J81N 1AB3A 2UUCO 1XMQO 3J7AU 4B3MO 3SDLA 4JI1O 4JI6O 5LMNO 2UXBO 1I94O 4LFCO 2VQFO 4DV7O 1HNXO 5H5NA 2UUBO 2UXDO 1KUQA 4LF9O 3M8AA 3R66A 1N36O 1A32A 5BY1A
chains in the Genus database with same CATH superfamily
5EC2C 4P2ZA 4LF4B 2D3OW 1SZXA 2Q7GA 1M56B 3ZMVA 3LDDA 4MVMA 5JVDA 4X62B 4JV5O 3SJBC 3SPHA 3JD3A 2X0LA 4LFCB 1PPJH 2CTQA 4DK0A 3WB2A 1JQ0A 1GTOA 2IH3C 3I55V 2YICA 1GO3F 3QNEA 2HR3A 3FB6C 2GDSA 3LSUA 3Q4HB 5KMGA 4UCUA 2XAFA 2LP7A 4MTXA 5IWAB 3WB0A 4ABMA 1DTOA 4JI5O 4BAYA 3U10A 3T1CA 2DYRB 4P30A 2YXLA 3JALB 2BSKB 2CAZC 2Q9LA 4E4EA 3DGEA 3ZHRA 1QQCA 1GN2A 2IH1C 4UXNA 2E76B 1W0KG 4H0LB 1YIJV 5H6RA 3FFQA 2JJ2G 2HVKC 2HHHO 3BCCH 3D3QA 2B9ZA 5IYBO 3CCVV 5LL6Y 5B3SC 2X7RB 4K8XA 1BQ0A 4KXRA 2YEVA 2WLMA 1GH6A 4PD4F 5CBFA 1M57C 1B6QA 3C3SA 4FK5C 2Q5ZA 3AG1C 2X6BA 3OEEG 4DV0O 4AQYB 1NVPB 2WLLA 4PDVA 4U3JA 1YJ9V 3JAWA 3X2QB 4N21A 2DN9A 2YDEA 4MVOA 2UUCB 1SA0A 4LF4O 2P4VA 4KP4A 2ZT9B 1XHXA 2QWOB 2DYSB 3ICXA 2KG7B 3IAYA 3RYHA 3CJHB 4I4TA 2ZM6B 5EIBC 1Q7YW 4LFCO 3MHHC 1SETA 3RYFA 1KKCA 4DV3B 3ZMTA 3CPWU 1ZUQA 3CC7V 2UXDO 1H2MA 3UCSC 1MA1A 4LNUB 4MS2A 2EINB 3AG2B 1K97A 4XDLA 4DRXA 3PN1A 3UO2A 3ZHTA 3P30A 4NTWA 5B1NA 3E8HA 3BPZA 1PD3A 4O4HB 2RJZA 1GM8A 1M56C 1DK1A 2JIZG 1XQ8A 4WFGA 5IJ0A 1K4CC 5IYZB 4WCEV 2QKSA 1R6KA 2LGWA 4I9QA 4ICGA 4LH7A 3G80A 2WSSG 3G6BA 1XNRO 4LF6B 5HFMA 2GBOA 1SRYA 4NVPA 3OW2U 3GWOA 2MK3A 2UUAB 4QNHB 1Q8IA 2DYRC 3QF7A 1FJGO 4GX2A 1RSOA 4UVAA 2OCHA 2MW2B 2BE3A 3VQXA 3ZRWA 4OPAA 4HNAA 4DR6B 3TCUA 2NNUA 3KCXA 1D5AA 4FPPA 1HR0O 1KP2A 3FAVB 1GMGA 1YSCA 1AILA 4JI2B 3ABTA 2NLJC 2QKAA 4B08A 2XOKG 4FM1A 2UXNA 2ZM6O 4YHHO 3MHSC 1Q6UA 1IBKB 4DV3O 3EFFK 1W59A 3JSLA 4B3RB 3M7MX 1NR7A 4PI2A 4RUEA 3X2QC 3W7WA 3BRCA 2R70A 5LXTB 3OT7A 5LA6B 4FMTA 2Z5UA 3ZHQA 3SPIA 5EZYB 4AI8A 1S3JA 1HNXB 2DYSC 2HG5C 4WFHA 2R9IA 3P3NA 3D3IA 2B5UA 4DV7O 3D36C 2HLDG 3BA9A 3GB7C 3IJ4A 2AZ2A 4J80A 2XAJA 4UCTA 1UFIA 1H2SB 3T1YO 3BAAA 4UCVA 3AG2C 2Z3YA 3O65A 1SQBH 2L6LA 2XAGA 3BY6A 2H3OA 1VF6A 1MZFA 3RYHB 2UUAO 1NBMG 4HAMA 3HKBA 1YZBA 4FLUA 1RFYA 4WBNA 3ETQA 1MZEA 4DR7O 3G67A 1QHTA 4DR6O 4DRXB 3OGIB 1MMMA 2RCVA 1HNWB 2P22C 4Z1VA 1OCOB 2ZNIA 1SS3A 2GUZB 4TUYB 1Y4MA 5HFLA 4JI2O 4I7ZB 4D7SA 1K7DA 1NI8A 2HVJC 2V1DA 4MVZA 1M1KW 1HNZB 2YS8A 1GK9A 1U96A 4LF5B 3TK1A 1K73W 4R8CA 1IBKO 3JD1A 4DR3B 4DR2O 4GUNA 1JR9A 4FJCC 4KL1A 1EN5A 2Q67A 1AJQA 3CHXA 3SYQA 4B3RO 3DTUB 4LFBB 4D7TA 1OCZB 3FYIB 4MVSA 2DOSA 4TV9A 2E5LO 5IY5B 2PYLA 2PF4E 5A2QN 1NR1A 3KG2A 1F4NA 1Z5WA 5H6QA 4OGQB 2W6IG 1WA8B 2ODMA 1AB3A 4DXWA 4JYBA 3F7VC 2WLKA 4U7NA 1AR5A 1OV9A 3VOUA 1BL8A 2ITDC 2PTMA 2DQ0A 1O9GA 3F5WC 3OE7G 4CS3A 3GVMA 5J2UA 4ZI7A 4F6RA 1BZKA 3K5OA 2FL4A 1HNWO 3LSSA 1AI5A 2OIGA 4BW9A 1M4UA 4F4LA 3RYCB 2ITCC 5BZBA 1TGOA 3ABKB 5E1AC 4GZRB 1JPXA 2QDOA 3ASOC 1HNZO 3F5TA 4NYKA 4LF5O 5FNVA 1PL0A 4TQDA 4PHZA 4DR3O 4NR1A 4PDLA 2JEXA 2WPDG 1O9HA 4FLTA 2ZD9A 4O2BA 1CEZA 2UXCO 4X8AA 3CB2A 1VQLV 3B40A 1QLEB 3ZMZA 1BQZA 2PY5A 1EZJA 5LGNA 5AG2A 4X20A 1WJZA 4K0KB 3ETGA 4PJ0Z 1UPGA 1XNQO 5EBMC 3E35A 4DV5B 1L0LH 5L3DA 2HEPA 2JEUA 1ZX3A 1URFA 4L8JA 1VQ8V 4CC5A 1OCZC 1NTKH 1P7GA 1EN4A 4AHCA 4MTOA 3OM3B 2QWNB 1IBLB 4GT1A 3ZS8C 1FKAO 2CK3G 4IL6Z 2YIBD 3JAMN 1Y74B 4DR5O 2D2CB 1S76D 2F4VO 4J10A 4WFFA 2WLJA 5CB4B 3ETDA 4JI1O 1QR9A 4IIJB 2RQ6A 3ZRSA 3I5DA 1SQPH 3A8TA 3ZN1A 2P4KA 1AJPA 3WG7B 2EULA 1DF4A 4UB6Z 1WB7A 1GM9A 3CCJV 4X1KB 3OR6C 3CEIA 2IU3A 4YIPA 4CZZA 4DV4O 2Q0OC 4X1YB 4GYCB 1JJ2U 3ZMUA 2C2AA 2JVDA 3ABKC 1FXKA 3LNMB 4DV5O 4IYIA 4RWUA 5EBWC 5KHJA 2B1IA 3H1HH 5LMUB 5IJ9A 1LUWA 4EFBA 2E74B 2CTPA 4FLVA 1AI4A 5CA1A 4TOIA 1QLEC 1TVKA 1XEQA 1VF6C 4FLXA 1IBLO 4DV1O 4LWSB 2X6CA 3L74H 3TXQA 1V9PA 2A9HA 3N2GA 1H2NA 5JJJB 4DUZB 3K5LA 1E1QG 4O2BB 2CGNA 1VEWA 2HFEC 4PELA 1IDSA 4P9PA 3BHPA 1WNSA 2Q73A 5KLVH 2H8PC 3BA8A 1VQNV 4I55B 1N32O 1ZTEA 3B77A 4J9ZB 1VQ7V 2EIKB 4G27B 1WP8A 2Q7HA 1NU1H 4EKWA 2BTOA 4O4LA 5IYCO 3DC5A 3QO5A 4XDKA 1QVGU 3HKDB 1ZWIC 3LUTB 3JD2A 5LGTA 2ADQB 1M57B 2ZDIC 1M90W 1F23A 3EVKA 2Q8VA 4FLYA 4DR1B 5JCOC 2CTRA 2UUBB 3OD4A 3JASA 4IGGA 4YJ3A 4QJFB 3R66A 4NTXA 2QTSA 1ENVA 2FTKA 1AP5A 2ILMA 4LCUC 4O4JA 3A0BZ 2UU9B 3WG7C 5LMUO 1JJOA 1GRJA 4DV2B 3CXCU 2JGDA 1NT2B 4TSFG 4TV8B 2YXHA 2P7TC 2FMLA 1Y66A 4MT8A 4YJ2A 1Q3EA 4PA6A 4DK1A 4PDRA 5LP6A 3L75H 2YIDA 2FYUH 1QU7A 2JS3A 2EJRA 4JI3O 4GLXA 3JAKA 5KX5B 2QWQB 5LYJA 1N33B 2P67A 3H1IH 3L70H 4MTFA 4B3SB 4MW3A 5EYPB 2WWWA 3ABMC 1Q82W 1XREA 5ITZB 5BR8B 3JARA 1OCCB 4JI0O 2ZE8A 5JQGA 4FFBA 2M7WA 1LR1A 2GTAA 1P49A 1MABG 4YXWG 4ZHQA 2QTOA 3UT5A 5CA1B 4NTYA 2ATKC 4DR4B 2R9RB 4DV6B 4DR1O 1PNMA 2JGUA 2OYQA 1X59A 1TVKB 2HJDA 1KB9F 2Q0AA 3RYIA 1BS3A 1UJWB 4IHJB 2JJ1G 1US6A 2EIKC 3T4DA 1SQFA 1XMQB 5F2VO 3E86A 4X65B 3J81N 4JI8B 3J7AU 1LUVA 2PGGA 5KAIZ 1NTZH 3AEIA 1XDCA 4FFKA 1L1FA 3ZRVA 4UCOA 5KHKA 4I0XA 2WLHA 2E75B 3OMIB 3QO8A 1TUBB 3STZC 2LFSA 1XILA 1XHZA 2KSDA 3DSQA 1Y76A 5LMNB 3K9SA 4X62O 5A9GA 3G71V 1MSDA 5L3EA 2BTQA 4B3SO 2Y0PA 1R3JC 4XDJA 4KFMA 4HBNA 5BR8O 3OUFA 5GTHZ 4B7EA 4BR6A 5C8YB 4QPJA 4CS2A 5EIBD 5IWAO 2KQXA 5KAFZ 5JH7B 1G6UA 1AJNA 2GTSA 1ZAUA 3JD4A 3A0HZ 2Y69B 4RQEA 4JI7B 3OFNG 3HKEB 1H8HG 3HPLC 3SJQC 1GN4A 2WLNA 1OCCC 4MSWC 3UQ8A 5EK0A 1FXKC 5KHIA 5JVDB 2A3QA 4X65O 1K33A 4JI8O 2EIJB 1FYJA 3CD6V 1F51A 1J5EB 1BT8A 3ZIAG 4N23A 2A0LA 1VQ5V 2ZE7A 2YIBA 2K9PA 4PI0A 3CRRA 3K5NA 4AQYO 3OGCC 1R6NA 2DJVA 5KMGB 2Q69A 3K59A 2UUCO 2Q68A 1SF9A 4U3FH 2CH7A 4EFEA 1JX9A 5LMNO 1JOYA 1S5LZ 3CWBH 3VQWA 4FLWA 1KUQA 1DGSA 3CC2V 1HDJA 3I56V 3SYCA 1EBOA 4JTAB 2QJ1A 2QEXV 3H1JH 2EZPA 4OX9B 1IURA 4JYCA 3CE2A 4UVBA 2YEVB 5TISZ 4B7KA 2L35A 3F7YC 3TGUH 2IBZH 1YVWA 2ZXWC 4IT5A 4UV8A 1KBHA 1YJWV 2WLLB 3CS5A 2BOCC 4U3JB 4Q6GA 3CRQA 3JAWB 4LF6O 4DUYB 1SA0B 2XUMA 5BXZA 4OPHA 1YEWA 4PV1B 5LHHA 2ZNJA 3OAAG 4I50A 3S3WA 3ASOB 3JD0A 4JAUA 4I4TB 1J5EO 2QKCA 3ZMSA 2HJFC 3RYFB 4NXMB 2GSMB 1K3EA 4ZOLA 3JATA 2EIMB 3OMNB 2Y69C 5B66Z 2HKOA 1JCHA 4O2AA 5BMVA 5C93A 3HKCA 1OJHA 2IW5A 1E1RG 3BVOA 2XAHA 4QE9A 4UVCA 3QG5A 5IJ0B 2EIJC 1K4DC 1YITV 3CYOA 1E79G 2EX3A 3CMEV 5J9PC 1L0NH 2GV9A 4O4IA 4DW1A 5GW7A 1WPXA 1IBMB 5E79Z 2JK5C 2ZE6A 3SPJA 3ZEDA 1QLNA 4J42A 1HNXO 5DM6V 1K5QA 1RSOB 1SESA 1KQSU 1YTFD 2P90A 3ZRWB 4HNAB 2AHYA 2DWDC 4CH4A 4X88A 1XUQA 1Q6HA 1AR4A 2PI5A 3N27A 4DUYO 4H44B 3CCLV 1NS1A 1EN6A 1PM9A 3HB3B 1NQTA 4NXMO 2VRZA 4LC1A 1OZ0A 1ZL8A 5GTIZ 3FKSG 1H2KA 3L9DA 2AGAA 1VQ6V 5B1BB 1G8MA 1NH2D 4EEQA 4MW8A 2ZINA 1R1BA 3W7TA 1CPYA 1GM7A 4LF7B 4H33A 2PZSA 2WLIA 2XASA 1N8RW 2VQEB 1VARA 4E2LA 4LF8B 1NZ6A 2EIMC 3OTFA 1R3KC 1HWYA 3E83A 4W4KA 2AHZA 4LFBO 1IBMO 5CBHA 2LQTA 4I50B 1S5HC 3UO3A 3HKBB 3MD0A 1WPBA 1VQ9V 4TQFA 3IGAC 1TA8A 1PNKA 4WBNB 5CBGA 5FPRA 3E8FA 4DO2A 1VQMV 4B3MB 1WN7A 4JI6B 1Q81W 4PA3A 2F23A 2QWPB 5GONA 2AZ0A 2ZCEA 3BEHA 4RQFA 1SZTA 4LFAB 3AG4B 2ZQMA 5BY1A 4CS4A 4QE7A 3O9OA 1W0JG 5J2TA 3ZCCA 4D6TH 3KZIZ 3SYAA 3E89A 1FFXA 3ABLC 3WFVA 4LP8A 4TV9B 4QPKA 1N36B 5JJNB 1WLEA 4JAAA 1VF7A 3N2KA 5CA0A 1FS0G 4LF7O 2VQEO 1IXMA 1OHHG 4GX0A 2IJJA 2M6YA 3SYOA 4LF8O 3E8BA 5LOVA 3AK2A 5L3FA 3CX5F 1P4RA 3IC7A 1XMOB 3T4ZA 4XBFA 3ZHUA 2LW1A 4JYAB 4R6ZA 1H8EG 2XAQA 4MVUA 4K0KO 5B1BC 4FZ1A 2ZKOA 4X66B 4WFEA 1KECA 5J2UB 5EC1C 4ZI7B 4F6RB 3RFRA 1IZ3A 2W0XA 1Z2GA 2YI9A 3W7XA 1V55B 3ABMB 1D2DA 1JA8A 1YCIA 3U0ZA 1J95A 1RP3B 4TWKA 3FB8C 1N0NA 5FL7G 5IT9N 5FNVB 2A7WA 4EB6A 2V7QG 3JALA 2UXBB 4K3AA 2BSKA 4W4LA 5IDJA 5LGUA 4UV9A 3SJCC 1ROPA 2YXYA 2DE0X 2WAMA 4X20B 2ZR3A 2QWRB 1G4YB 1QBZA 5CN0A 1KU9A 3W7UA 1N36O 1BSMA 4X89A 2Q4PA 3MDSA 3OEHG 5DECA 4BIZA 3OR7C 4JV5B 1MNGA 3AG4C 4JZGA 5CA3A 2FB5A 1R73A 4MTGA 4K8ZA 1Q6IA 2QE7G 2V4DA 1I94B 1PNLA 1N4CA 3IFXA 2CDYA 2UXXA 4JYAO 3IC9A 4RUFA 3K06A 2DMXA 4X66O 1FXHA 3CCSV 1HP8A 3OTOB 1YI2V 2KG7A 1SQGA 1B3QA 3D36A 3K58A 1GAXA 3L72H 4LBEC 1XL6A 4UCSA 3CSXA 1V54B 5KUMA 4LNUA 1ZLZA 3CP1A 1Q5OA 2HHHB 1PKXA 4H13B 1XBLA 1BHAA 4WFAV 5JJEB 2O57A 1DF5A 3STLC 4O4HA 4CBCA 3MAQA 4DUZO 1AI6A 4FIPC 5IYZA 5CMUA 2VS0A 1KMIZ 4G2KA 1V55C 2P06A 3QTCA 1FD9A 5H2FZ 1NKDA 1MG1A 1AROP 2Z0AA 1FXKB 3ZBHA 1EZVH 1BMFG 1R3IC 1RPRA 1I5YA 2KKWA 5IJ9B 1T5EA 3FB7C 1I94O 3M99B 2UXDB 2OCCC 1NTMH 4DW0A 3TETA 1KC8W 2UUBO 1R3LC 3LNNA 3KKYA 3K5MA 2ARHA 1A32A 2OTLV 3DXRA 3FAVA 2RNBA 3ZHSA 1FXVA 4EB6B 3N2GB 1JMKC 3OTOO 2LFRA 1K92A 4PA9A 2UU9O 4OXSA 4J41A 2IM9A 3P3PA 3K04A 4H37A 4DV2O 5D5PA 4J9YB 3ASNB 2QR4A 2IJKA 1MSWD 4ASUG 2CGOA 1KP3A 3AG3B 1XNRB 4GX1A 3E22A 1QVFU 3CRCA 3TJTA 1M93A 4O4LB 2EZOA 1G1XB 1ORQC 5LXTA 1QCEA 4CH3A 5LA6A 1BE3H 2Q7EA 4X1IA 5EZYA 1XI1A 1FJGB 2ZXWB 2YIAA 5FPOA 1N33O 2A06H 5B1OA 3UKMA 3K9AA 4CH6A 2IJHA 4WF9V 3ETEA 3DC6A 3JASB 1V54C 4YJ3B 1HR0B 3E2EA 4O4JB 1VP7A 3RN4A 1GKFA 3FD9A 4GX5A 4YHHB 1VQ4V 1N0JA 2JGDB 2H94A 2GHYA 1IX9A 4DR4O 4DV6O 3VQYA 4WFBV 2G38A 2JDIG 1KYOF 4YJ2B 5L3BA 1YF2A 4F6EA 1N34B 5LP6B 3WU2Z 3SGIA 2GUZA 3L73H 4TUYA 4UFZA 1VQKV 1OCRB 1XMQO 5LHGA 1JVMA 3JAKB 5LYJB 4DV7B 3APQA 3NXSA 1PP9H 3M8AA 1PL4A 4MVRA 3T1YB 3JARB 4IYHA 2ETNA 4FM2A 2XHBA 3JSNA 5DEDA 5JQGB 1F4MA 3JCZA 4FFBB 4FM0A 1THZA 2AW9A 2R9AA 2PYJA 3SPGA 4ZHQB 1MOFA 1XOUA 3C3TA 3UT5B 1Y6XA 1BCCH 1YTFB 2X6AA 3RVYA 4DR7B 5K1PA 3ASNC 1WA8A 4Z2WA 3RYIB 3THOA 3LSQA 3DXRB 3BABA 3AG3C 2F43G 5FLXN 2P5OA 3G4SV 3H1KH 2PI4A 4JYYA 2Y48A 4X64B 4UUJC 1S72V 2KB1A 3SJAC 1Q43A 3RWRD 3B09A 4DR2B 4PDMA 2LGQA 3SR2C 4I0XB 1NVPD 1Z5VA 3UM7A 4JI7O 1ZSPA 3E22B 2VWJA 2F93B 2R72A 2EILB 2NR5A 1VQPV 1N34O 3SYPA 4YY3B 3B2EE 1EFRG 3RYCA 4X1IB 1Y76B 4QGPA 2E5LB 4L87A 4P9OA 1NH2B 3H9VA 1AP6A 1FFTB 4KHPB 2N05A 3BFRA 1GN3A 3K79A 2BTQB 2F66C 5K1XA 1BGYH 1K34A 2BOBC 2W0FC 4Q20A 2EINC 4Z1MG 1M5IA 2XT9A 2RDCA 5LP6C 3FYEB 1WB8A 3K3WA 2OIEA 3ZX6A 1H2GA 1VIBA 3SDLA 1OCRC 1AR1B 1X4TA 3VQVA 3CRAA 4LH6A 1VMGA 2QM8A 2WA3A 1FAFA 3RW0A 4JZ2A 4I5SA 4G28B 3CCRV 3RVZA 1H2LA 3ZJZA 1I0HA 1XL4A 3ZHVA 1KKDA 3AK3A 3CCQV 4BIUA 3KCYA 4LR3A 1SQXH 3EXAA 3J80N 5KHHA 4X64O 4OX9O 3R65A 3FB5C 1COWG 2NN4A 4I9WA 3TXSA 2LW7A 1Y74A 4JAVA 2ZDIA 4PA7A 4R7CA 4K35A 2UXCB 3T2MA 5JCOA 1CXZB 2ZR2A 1SQQH 1H38A 5CB4A 3GWKC 4HYOA 1EM1A 4NB5A 3APOA 4YY3O 3ABLB 2ZIOA 1M9NA 4NXNB 4NKGB 1FPOA 4IIJA 1XNQB 2CH7B 2N74A 3B8MA 4KHPO 4MVQA 4X1KA 4QIWF 1Q90D 1YHQV 3AG7A 5KUKA 4TT3G 4RAIA 3A2FA 4J7JA 2JRIA 2IJIA 1NJIW 2EILC 4C7UA 3PJSK 5L3GA 5KA6A 3A0RA 4X1YA 4DYLA 1S5JA 3OUSA 1QNMA 2W6JG 4DR5B 5EBLC 2F4VB 3H1LH 2F1MA 3K0GA 4JI1B 1I7FA 1K9MW 4UB8Z 4GKJB 2YUAA 4LWSA 3D8CA 3JCUZ 2RMKB 3L71H 2CE4A 4ZOLB 3LDEA 3JATB 2QGNA 4X9QA 3CCMV 4O2AB 3ZN0A 1WAZA 5BMVB 3HKCB 1SKVA 1AVMA 2RN9A 4DV4B 2QM7A 1IVSA 1K5SA 1RM1B 5B1AB 1LNQA 1OCOC 3ZRXA 3EHBB 5JWPA 2VQFB 1PV0A 1I08A 1U97A 2F95B 2QSAA 4I55A 3SPCA 4NXNO 4LF9B 1QR8A 3CC4V 4JTDB 3RT3C 3HKDA 3CCUV 2PUSA 4JTCB 5L3CA 4O4IB 4B3TB 2HP8A 4CC6A 2OT5A 1S77D 1YDXA 2B1GA 3C90A 4A5UB 2ZE5A 4BWAA 2A79B 1KD1W 4DV1B 3NR7A 2LO1A 4BIOA 2XTAA 3T1HB 4FLZA 5IE9A 3CXHF 5IY5C 2OWOA 3JYCA 4YIOA 2AXTZ 1GN6A 1B06A 4GCZA 3G6EV 3K57A 1F7YA 4FZ0A 3U11A 4AILC 1Q86W 3WB1A 5DN6G 1W2BU 3B8NA 1DLBA 4TV8A 1JFFA 3VBBA 1N32B 1B04A 2OTJV 4J11A 2E3CA 4U7OA 3FX7A 4GKJO 4UCRA 3ML0A 5LBQA 1VQOV 4ZIBA 1CP9A 5KX5A 1SQVH 3RGBA 1ZL8B 1AI7A 3H01A 4R50A 3CCEV 1TUEB 3K08A 1P7BA 5EYPA 3W7SA 2YC0A 4B3MO 4JI4B 4JI6O 3HR0A 2P6JA 2VQFO 4GKKB 5ITZA 1RPOA 2VWKA 3Q4HA 2Q6AA 4LF9O 2CUGA 2Y0IA 3S3XA 2WLIB 3CMAV 4J7KA 1BHBA 4JF3A 4LFAO 1SERA 3ABUA 4B3TO 4BW5A 1Y67A 4CH5A 2Y4UA 5B5EZ 2OCCB 2CTWA 5KHGA 2Y4TA 1VF5B 1RM1C 5B1AC 1L8DA 4KUMA 2EBOA 4IHJA 1S0VA 1YJNV 4JI3B 3T1HO 2FKXA 4FVMA 2K1EA 5LHIA 4JGSA 4J7ZA 2EJ7A 3K0DA 3P32A 3QO7A 5IYDO 2DW4A 2N04A 1XMOO 2DWEC 2ZIMA 1TUBA 5D5QA 4JI0B 5B3SB 5GONB 1YXBA 1WP7A 3QVNA 1D5NA 3CRMA 4JI5B 4ZKIA 2JS5A 4JPRA 1I5XA 2YSUB 3AG1B 5J2TB 3E8GA 3CJHA 2XNDG 1IXBA 1K8AW 2YI8A 2IU0A 4JI4O 1TAEA 2DQ3A 3AK1A 1FFXB 4GKKO 4RO2A 1P84F 1R6TA 2QM4A 3LDCA 3OMAB 5H9CA 2QA4V 5C8YA 3N2KB 3B4SA 4ZBMA 5CA0B 1SC5B 5KA5A 5JH7A 2WA4A 5LOVB 1HW7A 2BCCH 2UXBO 1JFFB 4DV0B 2LJ2A 3HKEA 4PA4A 5H5NA 2ADPA 3K03A 4HZ3A 4JASA 3RBZA
chains in the Genus database with same CATH topology
3T1YO 4LFAO 4B3TO 3OTOO 3O65A 1HNWO 5LMUO 4JV5O 3J80N 4DUYO 2UU9O 1DK1A 4X62O 4X64O 4OX9O 4DV4O 2UUAO 1NS1A 4DV2O 4NXNO 4B3SO 1YZBA 1HNZO 3F5TA 4LF5O 4JYAO 2LW7A 4NXMO 3RT3C 4DR7O 4DR3O 4LF7O 5BR8O 3T1HO 4X66O 4DR6O 4DV5O 2FKXA 1XNRO 1G1XB 2VQEO 4JI3O 5FLXN 2UXCO 4LF6O 4LF8O 4JI5O 5IWAO 5BXZA 4YY3O 4OPHA 4JI2O 2AGAA 1N33O 4A5UB 2N74A 1J5EO 1XMOO 1FJGO 1XEQA 1R1BA 1XNQO 1IBKO 4K0KO 4OPAA 4KHPO 1IBLO 4DR2O 2ZKOA 4DV1O 4JI7O 4JI0O 2HHHO 1HR0O 5LL6Y 1F7YA 4B3RO 1N34O 1AILA 4DUZO 2JRIA 4LFBO 4X65O 4JI8O 1FYJA 1IBMO 1D2DA 2DOSA 2ZM6O 4DR1O 4YHHO 4JI4O 2E5LO 4DV0O 1X59A 4DR4O 1N32O 4DV3O 4DV6O 4GKKO 1R6TA 4GKJO 4AQYO 1FKAO 5A2QN 5IT9N 3JAMN 4DR5O 2DJVA 2Z0AA 2F4VO 4LF4O 3J81N 1AB3A 2UUCO 1XMQO 3J7AU 4B3MO 3SDLA 4JI1O 4JI6O 5LMNO 2UXBO 1I94O 4LFCO 2VQFO 4DV7O 1HNXO 5H5NA 2UUBO 2UXDO 1KUQA 4LF9O 3M8AA 3R66A 1N36O 1A32A 5BY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y O;  4LFA O;  4B3T O;  3OTO O;  3O65 A;  1HNW O;  5LMU O;  4JV5 O;  3J80 N;  4DUY O;  2UU9 O;  1DK1 A;  4X62 O;  4X64 O;  4OX9 O;  4DV4 O;  2UUA O;  1NS1 A;  4DV2 O;  4NXN O;  4B3S O;  1YZB A;  1HNZ O;  3F5T A;  4LF5 O;  4JYA O;  2LW7 A;  4NXM O;  3RT3 C;  4DR7 O;  4DR3 O;  4LF7 O;  5BR8 O;  3T1H O;  4X66 O;  4DR6 O;  4DV5 O;  2FKX A;  1XNR O;  1G1X B;  2VQE O;  4JI3 O;  5FLX N;  2UXC O;  4LF6 O;  4LF8 O;  4JI5 O;  5IWA O;  5BXZ A;  4YY3 O;  4OPH A;  4JI2 O;  2AGA A;  1N33 O;  4A5U B;  2N74 A;  1J5E O;  1XMO O;  1FJG O;  1XEQ A;  1R1B A;  1XNQ O;  1IBK O;  4K0K O;  4OPA A;  4KHP O;  1IBL O;  4DR2 O;  2ZKO A;  4DV1 O;  4JI7 O;  4JI0 O;  2HHH O;  1HR0 O;  5LL6 Y;  1F7Y A;  4B3R O;  1N34 O;  1AIL A;  4DUZ O;  2JRI A;  4LFB O;  4X65 O;  4JI8 O;  1FYJ A;  1IBM O;  1D2D A;  2DOS A;  2ZM6 O;  4DR1 O;  4YHH O;  4JI4 O;  2E5L O;  4DV0 O;  1X59 A;  4DR4 O;  1N32 O;  4DV3 O;  4DV6 O;  4GKK O;  1R6T A;  4GKJ O;  4AQY O;  1FKA O;  5A2Q N;  5IT9 N;  3JAM N;  4DR5 O;  2DJV A;  2Z0A A;  2F4V O;  4LF4 O;  3J81 N;  1AB3 A;  2UUC O;  1XMQ O;  3J7A U;  4B3M O;  3SDL A;  4JI1 O;  4JI6 O;  5LMN O;  2UXB O;  1I94 O;  4LFC O;  2VQF O;  4DV7 O;  1HNX O;  5H5N A;  2UUB O;  2UXD O;  1KUQ A;  4LF9 O;  3M8A A;  3R66 A;  1N36 O;  1A32 A;  5BY1 A; 
#chains in the Genus database with same CATH topology
 5EC2 C;  4P2Z A;  4LF4 B;  2D3O W;  1SZX A;  2Q7G A;  1M56 B;  3ZMV A;  3LDD A;  4MVM A;  5JVD A;  4X62 B;  4JV5 O;  3SJB C;  3SPH A;  3JD3 A;  2X0L A;  4LFC B;  1PPJ H;  2CTQ A;  4DK0 A;  3WB2 A;  1JQ0 A;  1GTO A;  2IH3 C;  3I55 V;  2YIC A;  1GO3 F;  3QNE A;  2HR3 A;  3FB6 C;  2GDS A;  3LSU A;  3Q4H B;  5KMG A;  4UCU A;  2XAF A;  2LP7 A;  4MTX A;  5IWA B;  3WB0 A;  4ABM A;  1DTO A;  4JI5 O;  4BAY A;  3U10 A;  3T1C A;  2DYR B;  4P30 A;  2YXL A;  3JAL B;  2BSK B;  2CAZ C;  2Q9L A;  4E4E A;  3DGE A;  3ZHR A;  1QQC A;  1GN2 A;  2IH1 C;  4UXN A;  2E76 B;  1W0K G;  4H0L B;  1YIJ V;  5H6R A;  3FFQ A;  2JJ2 G;  2HVK C;  2HHH O;  3BCC H;  3D3Q A;  2B9Z A;  5IYB O;  3CCV V;  5LL6 Y;  5B3S C;  2X7R B;  4K8X A;  1BQ0 A;  4KXR A;  2YEV A;  2WLM A;  1GH6 A;  4PD4 F;  5CBF A;  1M57 C;  1B6Q A;  3C3S A;  4FK5 C;  2Q5Z A;  3AG1 C;  2X6B A;  3OEE G;  4DV0 O;  4AQY B;  1NVP B;  2WLL A;  4PDV A;  4U3J A;  1YJ9 V;  3JAW A;  3X2Q B;  4N21 A;  2DN9 A;  2YDE A;  4MVO A;  2UUC B;  1SA0 A;  4LF4 O;  2P4V A;  4KP4 A;  2ZT9 B;  1XHX A;  2QWO B;  2DYS B;  3ICX A;  2KG7 B;  3IAY A;  3RYH A;  3CJH B;  4I4T A;  2ZM6 B;  5EIB C;  1Q7Y W;  4LFC O;  3MHH C;  1SET A;  3RYF A;  1KKC A;  4DV3 B;  3ZMT A;  3CPW U;  1ZUQ A;  3CC7 V;  2UXD O;  1H2M A;  3UCS C;  1MA1 A;  4LNU B;  4MS2 A;  2EIN B;  3AG2 B;  1K97 A;  4XDL A;  4DRX A;  3PN1 A;  3UO2 A;  3ZHT A;  3P30 A;  4NTW A;  5B1N A;  3E8H A;  3BPZ A;  1PD3 A;  4O4H B;  2RJZ A;  1GM8 A;  1M56 C;  1DK1 A;  2JIZ G;  1XQ8 A;  4WFG A;  5IJ0 A;  1K4C C;  5IYZ B;  4WCE V;  2QKS A;  1R6K A;  2LGW A;  4I9Q A;  4ICG A;  4LH7 A;  3G80 A;  2WSS G;  3G6B A;  1XNR O;  4LF6 B;  5HFM A;  2GBO A;  1SRY A;  4NVP A;  3OW2 U;  3GWO A;  2MK3 A;  2UUA B;  4QNH B;  1Q8I A;  2DYR C;  3QF7 A;  1FJG O;  4GX2 A;  1RSO A;  4UVA A;  2OCH A;  2MW2 B;  2BE3 A;  3VQX A;  3ZRW A;  4OPA A;  4HNA A;  4DR6 B;  3TCU A;  2NNU A;  3KCX A;  1D5A A;  4FPP A;  1HR0 O;  1KP2 A;  3FAV B;  1GMG A;  1YSC A;  1AIL A;  4JI2 B;  3ABT A;  2NLJ C;  2QKA A;  4B08 A;  2XOK G;  4FM1 A;  2UXN A;  2ZM6 O;  4YHH O;  3MHS C;  1Q6U A;  1IBK B;  4DV3 O;  3EFF K;  1W59 A;  3JSL A;  4B3R B;  3M7M X;  1NR7 A;  4PI2 A;  4RUE A;  3X2Q C;  3W7W A;  3BRC A;  2R70 A;  5LXT B;  3OT7 A;  5LA6 B;  4FMT A;  2Z5U A;  3ZHQ A;  3SPI A;  5EZY B;  4AI8 A;  1S3J A;  1HNX B;  2DYS C;  2HG5 C;  4WFH A;  2R9I A;  3P3N A;  3D3I A;  2B5U A;  4DV7 O;  3D36 C;  2HLD G;  3BA9 A;  3GB7 C;  3IJ4 A;  2AZ2 A;  4J80 A;  2XAJ A;  4UCT A;  1UFI A;  1H2S B;  3T1Y O;  3BAA A;  4UCV A;  3AG2 C;  2Z3Y A;  3O65 A;  1SQB H;  2L6L A;  2XAG A;  3BY6 A;  2H3O A;  1VF6 A;  1MZF A;  3RYH B;  2UUA O;  1NBM G;  4HAM A;  3HKB A;  1YZB A;  4FLU A;  1RFY A;  4WBN A;  3ETQ A;  1MZE A;  4DR7 O;  3G67 A;  1QHT A;  4DR6 O;  4DRX B;  3OGI B;  1MMM A;  2RCV A;  1HNW B;  2P22 C;  4Z1V A;  1OCO B;  2ZNI A;  1SS3 A;  2GUZ B;  4TUY B;  1Y4M A;  5HFL A;  4JI2 O;  4I7Z B;  4D7S A;  1K7D A;  1NI8 A;  2HVJ C;  2V1D A;  4MVZ A;  1M1K W;  1HNZ B;  2YS8 A;  1GK9 A;  1U96 A;  4LF5 B;  3TK1 A;  1K73 W;  4R8C A;  1IBK O;  3JD1 A;  4DR3 B;  4DR2 O;  4GUN A;  1JR9 A;  4FJC C;  4KL1 A;  1EN5 A;  2Q67 A;  1AJQ A;  3CHX A;  3SYQ A;  4B3R O;  3DTU B;  4LFB B;  4D7T A;  1OCZ B;  3FYI B;  4MVS A;  2DOS A;  4TV9 A;  2E5L O;  5IY5 B;  2PYL A;  2PF4 E;  5A2Q N;  1NR1 A;  3KG2 A;  1F4N A;  1Z5W A;  5H6Q A;  4OGQ B;  2W6I G;  1WA8 B;  2ODM A;  1AB3 A;  4DXW A;  4JYB A;  3F7V C;  2WLK A;  4U7N A;  1AR5 A;  1OV9 A;  3VOU A;  1BL8 A;  2ITD C;  2PTM A;  2DQ0 A;  1O9G A;  3F5W C;  3OE7 G;  4CS3 A;  3GVM A;  5J2U A;  4ZI7 A;  4F6R A;  1BZK A;  3K5O A;  2FL4 A;  1HNW O;  3LSS A;  1AI5 A;  2OIG A;  4BW9 A;  1M4U A;  4F4L A;  3RYC B;  2ITC C;  5BZB A;  1TGO A;  3ABK B;  5E1A C;  4GZR B;  1JPX A;  2QDO A;  3ASO C;  1HNZ O;  3F5T A;  4NYK A;  4LF5 O;  5FNV A;  1PL0 A;  4TQD A;  4PHZ A;  4DR3 O;  4NR1 A;  4PDL A;  2JEX A;  2WPD G;  1O9H A;  4FLT A;  2ZD9 A;  4O2B A;  1CEZ A;  2UXC O;  4X8A A;  3CB2 A;  1VQL V;  3B40 A;  1QLE B;  3ZMZ A;  1BQZ A;  2PY5 A;  1EZJ A;  5LGN A;  5AG2 A;  4X20 A;  1WJZ A;  4K0K B;  3ETG A;  4PJ0 Z;  1UPG A;  1XNQ O;  5EBM C;  3E35 A;  4DV5 B;  1L0L H;  5L3D A;  2HEP A;  2JEU A;  1ZX3 A;  1URF A;  4L8J A;  1VQ8 V;  4CC5 A;  1OCZ C;  1NTK H;  1P7G A;  1EN4 A;  4AHC A;  4MTO A;  3OM3 B;  2QWN B;  1IBL B;  4GT1 A;  3ZS8 C;  1FKA O;  2CK3 G;  4IL6 Z;  2YIB D;  3JAM N;  1Y74 B;  4DR5 O;  2D2C B;  1S76 D;  2F4V O;  4J10 A;  4WFF A;  2WLJ A;  5CB4 B;  3ETD A;  4JI1 O;  1QR9 A;  4IIJ B;  2RQ6 A;  3ZRS A;  3I5D A;  1SQP H;  3A8T A;  3ZN1 A;  2P4K A;  1AJP A;  3WG7 B;  2EUL A;  1DF4 A;  4UB6 Z;  1WB7 A;  1GM9 A;  3CCJ V;  4X1K B;  3OR6 C;  3CEI A;  2IU3 A;  4YIP A;  4CZZ A;  4DV4 O;  2Q0O C;  4X1Y B;  4GYC B;  1JJ2 U;  3ZMU A;  2C2A A;  2JVD A;  3ABK C;  1FXK A;  3LNM B;  4DV5 O;  4IYI A;  4RWU A;  5EBW C;  5KHJ A;  2B1I A;  3H1H H;  5LMU B;  5IJ9 A;  1LUW A;  4EFB A;  2E74 B;  2CTP A;  4FLV A;  1AI4 A;  5CA1 A;  4TOI A;  1QLE C;  1TVK A;  1XEQ A;  1VF6 C;  4FLX A;  1IBL O;  4DV1 O;  4LWS B;  2X6C A;  3L74 H;  3TXQ A;  1V9P A;  2A9H A;  3N2G A;  1H2N A;  5JJJ B;  4DUZ B;  3K5L A;  1E1Q G;  4O2B B;  2CGN A;  1VEW A;  2HFE C;  4PEL A;  1IDS A;  4P9P A;  3BHP A;  1WNS A;  2Q73 A;  5KLV H;  2H8P C;  3BA8 A;  1VQN V;  4I55 B;  1N32 O;  1ZTE A;  3B77 A;  4J9Z B;  1VQ7 V;  2EIK B;  4G27 B;  1WP8 A;  2Q7H A;  1NU1 H;  4EKW A;  2BTO A;  4O4L A;  5IYC O;  3DC5 A;  3QO5 A;  4XDK A;  1QVG U;  3HKD B;  1ZWI C;  3LUT B;  3JD2 A;  5LGT A;  2ADQ B;  1M57 B;  2ZDI C;  1M90 W;  1F23 A;  3EVK A;  2Q8V A;  4FLY A;  4DR1 B;  5JCO C;  2CTR A;  2UUB B;  3OD4 A;  3JAS A;  4IGG A;  4YJ3 A;  4QJF B;  3R66 A;  4NTX A;  2QTS A;  1ENV A;  2FTK A;  1AP5 A;  2ILM A;  4LCU C;  4O4J A;  3A0B Z;  2UU9 B;  3WG7 C;  5LMU O;  1JJO A;  1GRJ A;  4DV2 B;  3CXC U;  2JGD A;  1NT2 B;  4TSF G;  4TV8 B;  2YXH A;  2P7T C;  2FML A;  1Y66 A;  4MT8 A;  4YJ2 A;  1Q3E A;  4PA6 A;  4DK1 A;  4PDR A;  5LP6 A;  3L75 H;  2YID A;  2FYU H;  1QU7 A;  2JS3 A;  2EJR A;  4JI3 O;  4GLX A;  3JAK A;  5KX5 B;  2QWQ B;  5LYJ A;  1N33 B;  2P67 A;  3H1I H;  3L70 H;  4MTF A;  4B3S B;  4MW3 A;  5EYP B;  2WWW A;  3ABM C;  1Q82 W;  1XRE A;  5ITZ B;  5BR8 B;  3JAR A;  1OCC B;  4JI0 O;  2ZE8 A;  5JQG A;  4FFB A;  2M7W A;  1LR1 A;  2GTA A;  1P49 A;  1MAB G;  4YXW G;  4ZHQ A;  2QTO A;  3UT5 A;  5CA1 B;  4NTY A;  2ATK C;  4DR4 B;  2R9R B;  4DV6 B;  4DR1 O;  1PNM A;  2JGU A;  2OYQ A;  1X59 A;  1TVK B;  2HJD A;  1KB9 F;  2Q0A A;  3RYI A;  1BS3 A;  1UJW B;  4IHJ B;  2JJ1 G;  1US6 A;  2EIK C;  3T4D A;  1SQF A;  1XMQ B;  5F2V O;  3E86 A;  4X65 B;  3J81 N;  4JI8 B;  3J7A U;  1LUV A;  2PGG A;  5KAI Z;  1NTZ H;  3AEI A;  1XDC A;  4FFK A;  1L1F A;  3ZRV A;  4UCO A;  5KHK A;  4I0X A;  2WLH A;  2E75 B;  3OMI B;  3QO8 A;  1TUB B;  3STZ C;  2LFS A;  1XIL A;  1XHZ A;  2KSD A;  3DSQ A;  1Y76 A;  5LMN B;  3K9S A;  4X62 O;  5A9G A;  3G71 V;  1MSD A;  5L3E A;  2BTQ A;  4B3S O;  2Y0P A;  1R3J C;  4XDJ A;  4KFM A;  4HBN A;  5BR8 O;  3OUF A;  5GTH Z;  4B7E A;  4BR6 A;  5C8Y B;  4QPJ A;  4CS2 A;  5EIB D;  5IWA O;  2KQX A;  5KAF Z;  5JH7 B;  1G6U A;  1AJN A;  2GTS A;  1ZAU A;  3JD4 A;  3A0H Z;  2Y69 B;  4RQE A;  4JI7 B;  3OFN G;  3HKE B;  1H8H G;  3HPL C;  3SJQ C;  1GN4 A;  2WLN A;  1OCC C;  4MSW C;  3UQ8 A;  5EK0 A;  1FXK C;  5KHI A;  5JVD B;  2A3Q A;  4X65 O;  1K33 A;  4JI8 O;  2EIJ B;  1FYJ A;  3CD6 V;  1F51 A;  1J5E B;  1BT8 A;  3ZIA G;  4N23 A;  2A0L A;  1VQ5 V;  2ZE7 A;  2YIB A;  2K9P A;  4PI0 A;  3CRR A;  3K5N A;  4AQY O;  3OGC C;  1R6N A;  2DJV A;  5KMG B;  2Q69 A;  3K59 A;  2UUC O;  2Q68 A;  1SF9 A;  4U3F H;  2CH7 A;  4EFE A;  1JX9 A;  5LMN O;  1JOY A;  1S5L Z;  3CWB H;  3VQW A;  4FLW A;  1KUQ A;  1DGS A;  3CC2 V;  1HDJ A;  3I56 V;  3SYC A;  1EBO A;  4JTA B;  2QJ1 A;  2QEX V;  3H1J H;  2EZP A;  4OX9 B;  1IUR A;  4JYC A;  3CE2 A;  4UVB A;  2YEV B;  5TIS Z;  4B7K A;  2L35 A;  3F7Y C;  3TGU H;  2IBZ H;  1YVW A;  2ZXW C;  4IT5 A;  4UV8 A;  1KBH A;  1YJW V;  2WLL B;  3CS5 A;  2BOC C;  4U3J B;  4Q6G A;  3CRQ A;  3JAW B;  4LF6 O;  4DUY B;  1SA0 B;  2XUM A;  5BXZ A;  4OPH A;  1YEW A;  4PV1 B;  5LHH A;  2ZNJ A;  3OAA G;  4I50 A;  3S3W A;  3ASO B;  3JD0 A;  4JAU A;  4I4T B;  1J5E O;  2QKC A;  3ZMS A;  2HJF C;  3RYF B;  4NXM B;  2GSM B;  1K3E A;  4ZOL A;  3JAT A;  2EIM B;  3OMN B;  2Y69 C;  5B66 Z;  2HKO A;  1JCH A;  4O2A A;  5BMV A;  5C93 A;  3HKC A;  1OJH A;  2IW5 A;  1E1R G;  3BVO A;  2XAH A;  4QE9 A;  4UVC A;  3QG5 A;  5IJ0 B;  2EIJ C;  1K4D C;  1YIT V;  3CYO A;  1E79 G;  2EX3 A;  3CME V;  5J9P C;  1L0N H;  2GV9 A;  4O4I A;  4DW1 A;  5GW7 A;  1WPX A;  1IBM B;  5E79 Z;  2JK5 C;  2ZE6 A;  3SPJ A;  3ZED A;  1QLN A;  4J42 A;  1HNX O;  5DM6 V;  1K5Q A;  1RSO B;  1SES A;  1KQS U;  1YTF D;  2P90 A;  3ZRW B;  4HNA B;  2AHY A;  2DWD C;  4CH4 A;  4X88 A;  1XUQ A;  1Q6H A;  1AR4 A;  2PI5 A;  3N27 A;  4DUY O;  4H44 B;  3CCL V;  1NS1 A;  1EN6 A;  1PM9 A;  3HB3 B;  1NQT A;  4NXM O;  2VRZ A;  4LC1 A;  1OZ0 A;  1ZL8 A;  5GTI Z;  3FKS G;  1H2K A;  3L9D A;  2AGA A;  1VQ6 V;  5B1B B;  1G8M A;  1NH2 D;  4EEQ A;  4MW8 A;  2ZIN A;  1R1B A;  3W7T A;  1CPY A;  1GM7 A;  4LF7 B;  4H33 A;  2PZS A;  2WLI A;  2XAS A;  1N8R W;  2VQE B;  1VAR A;  4E2L A;  4LF8 B;  1NZ6 A;  2EIM C;  3OTF A;  1R3K C;  1HWY A;  3E83 A;  4W4K A;  2AHZ A;  4LFB O;  1IBM O;  5CBH A;  2LQT A;  4I50 B;  1S5H C;  3UO3 A;  3HKB B;  3MD0 A;  1WPB A;  1VQ9 V;  4TQF A;  3IGA C;  1TA8 A;  1PNK A;  4WBN B;  5CBG A;  5FPR A;  3E8F A;  4DO2 A;  1VQM V;  4B3M B;  1WN7 A;  4JI6 B;  1Q81 W;  4PA3 A;  2F23 A;  2QWP B;  5GON A;  2AZ0 A;  2ZCE A;  3BEH A;  4RQF A;  1SZT A;  4LFA B;  3AG4 B;  2ZQM A;  5BY1 A;  4CS4 A;  4QE7 A;  3O9O A;  1W0J G;  5J2T A;  3ZCC A;  4D6T H;  3KZI Z;  3SYA A;  3E89 A;  1FFX A;  3ABL C;  3WFV A;  4LP8 A;  4TV9 B;  4QPK A;  1N36 B;  5JJN B;  1WLE A;  4JAA A;  1VF7 A;  3N2K A;  5CA0 A;  1FS0 G;  4LF7 O;  2VQE O;  1IXM A;  1OHH G;  4GX0 A;  2IJJ A;  2M6Y A;  3SYO A;  4LF8 O;  3E8B A;  5LOV A;  3AK2 A;  5L3F A;  3CX5 F;  1P4R A;  3IC7 A;  1XMO B;  3T4Z A;  4XBF A;  3ZHU A;  2LW1 A;  4JYA B;  4R6Z A;  1H8E G;  2XAQ A;  4MVU A;  4K0K O;  5B1B C;  4FZ1 A;  2ZKO A;  4X66 B;  4WFE A;  1KEC A;  5J2U B;  5EC1 C;  4ZI7 B;  4F6R B;  3RFR A;  1IZ3 A;  2W0X A;  1Z2G A;  2YI9 A;  3W7X A;  1V55 B;  3ABM B;  1D2D A;  1JA8 A;  1YCI A;  3U0Z A;  1J95 A;  1RP3 B;  4TWK A;  3FB8 C;  1N0N A;  5FL7 G;  5IT9 N;  5FNV B;  2A7W A;  4EB6 A;  2V7Q G;  3JAL A;  2UXB B;  4K3A A;  2BSK A;  4W4L A;  5IDJ A;  5LGU A;  4UV9 A;  3SJC C;  1ROP A;  2YXY A;  2DE0 X;  2WAM A;  4X20 B;  2ZR3 A;  2QWR B;  1G4Y B;  1QBZ A;  5CN0 A;  1KU9 A;  3W7U A;  1N36 O;  1BSM A;  4X89 A;  2Q4P A;  3MDS A;  3OEH G;  5DEC A;  4BIZ A;  3OR7 C;  4JV5 B;  1MNG A;  3AG4 C;  4JZG A;  5CA3 A;  2FB5 A;  1R73 A;  4MTG A;  4K8Z A;  1Q6I A;  2QE7 G;  2V4D A;  1I94 B;  1PNL A;  1N4C A;  3IFX A;  2CDY A;  2UXX A;  4JYA O;  3IC9 A;  4RUF A;  3K06 A;  2DMX A;  4X66 O;  1FXH A;  3CCS V;  1HP8 A;  3OTO B;  1YI2 V;  2KG7 A;  1SQG A;  1B3Q A;  3D36 A;  3K58 A;  1GAX A;  3L72 H;  4LBE C;  1XL6 A;  4UCS A;  3CSX A;  1V54 B;  5KUM A;  4LNU A;  1ZLZ A;  3CP1 A;  1Q5O A;  2HHH B;  1PKX A;  4H13 B;  1XBL A;  1BHA A;  4WFA V;  5JJE B;  2O57 A;  1DF5 A;  3STL C;  4O4H A;  4CBC A;  3MAQ A;  4DUZ O;  1AI6 A;  4FIP C;  5IYZ A;  5CMU A;  2VS0 A;  1KMI Z;  4G2K A;  1V55 C;  2P06 A;  3QTC A;  1FD9 A;  5H2F Z;  1NKD A;  1MG1 A;  1ARO P;  2Z0A A;  1FXK B;  3ZBH A;  1EZV H;  1BMF G;  1R3I C;  1RPR A;  1I5Y A;  2KKW A;  5IJ9 B;  1T5E A;  3FB7 C;  1I94 O;  3M99 B;  2UXD B;  2OCC C;  1NTM H;  4DW0 A;  3TET A;  1KC8 W;  2UUB O;  1R3L C;  3LNN A;  3KKY A;  3K5M A;  2ARH A;  1A32 A;  2OTL V;  3DXR A;  3FAV A;  2RNB A;  3ZHS A;  1FXV A;  4EB6 B;  3N2G B;  1JMK C;  3OTO O;  2LFR A;  1K92 A;  4PA9 A;  2UU9 O;  4OXS A;  4J41 A;  2IM9 A;  3P3P A;  3K04 A;  4H37 A;  4DV2 O;  5D5P A;  4J9Y B;  3ASN B;  2QR4 A;  2IJK A;  1MSW D;  4ASU G;  2CGO A;  1KP3 A;  3AG3 B;  1XNR B;  4GX1 A;  3E22 A;  1QVF U;  3CRC A;  3TJT A;  1M93 A;  4O4L B;  2EZO A;  1G1X B;  1ORQ C;  5LXT A;  1QCE A;  4CH3 A;  5LA6 A;  1BE3 H;  2Q7E A;  4X1I A;  5EZY A;  1XI1 A;  1FJG B;  2ZXW B;  2YIA A;  5FPO A;  1N33 O;  2A06 H;  5B1O A;  3UKM A;  3K9A A;  4CH6 A;  2IJH A;  4WF9 V;  3ETE A;  3DC6 A;  3JAS B;  1V54 C;  4YJ3 B;  1HR0 B;  3E2E A;  4O4J B;  1VP7 A;  3RN4 A;  1GKF A;  3FD9 A;  4GX5 A;  4YHH B;  1VQ4 V;  1N0J A;  2JGD B;  2H94 A;  2GHY A;  1IX9 A;  4DR4 O;  4DV6 O;  3VQY A;  4WFB V;  2G38 A;  2JDI G;  1KYO F;  4YJ2 B;  5L3B A;  1YF2 A;  4F6E A;  1N34 B;  5LP6 B;  3WU2 Z;  3SGI A;  2GUZ A;  3L73 H;  4TUY A;  4UFZ A;  1VQK V;  1OCR B;  1XMQ O;  5LHG A;  1JVM A;  3JAK B;  5LYJ B;  4DV7 B;  3APQ A;  3NXS A;  1PP9 H;  3M8A A;  1PL4 A;  4MVR A;  3T1Y B;  3JAR B;  4IYH A;  2ETN A;  4FM2 A;  2XHB A;  3JSN A;  5DED A;  5JQG B;  1F4M A;  3JCZ A;  4FFB B;  4FM0 A;  1THZ A;  2AW9 A;  2R9A A;  2PYJ A;  3SPG A;  4ZHQ B;  1MOF A;  1XOU A;  3C3T A;  3UT5 B;  1Y6X A;  1BCC H;  1YTF B;  2X6A A;  3RVY A;  4DR7 B;  5K1P A;  3ASN C;  1WA8 A;  4Z2W A;  3RYI B;  3THO A;  3LSQ A;  3DXR B;  3BAB A;  3AG3 C;  2F43 G;  5FLX N;  2P5O A;  3G4S V;  3H1K H;  2PI4 A;  4JYY A;  2Y48 A;  4X64 B;  4UUJ C;  1S72 V;  2KB1 A;  3SJA C;  1Q43 A;  3RWR D;  3B09 A;  4DR2 B;  4PDM A;  2LGQ A;  3SR2 C;  4I0X B;  1NVP D;  1Z5V A;  3UM7 A;  4JI7 O;  1ZSP A;  3E22 B;  2VWJ A;  2F93 B;  2R72 A;  2EIL B;  2NR5 A;  1VQP V;  1N34 O;  3SYP A;  4YY3 B;  3B2E E;  1EFR G;  3RYC A;  4X1I B;  1Y76 B;  4QGP A;  2E5L B;  4L87 A;  4P9O A;  1NH2 B;  3H9V A;  1AP6 A;  1FFT B;  4KHP B;  2N05 A;  3BFR A;  1GN3 A;  3K79 A;  2BTQ B;  2F66 C;  5K1X A;  1BGY H;  1K34 A;  2BOB C;  2W0F C;  4Q20 A;  2EIN C;  4Z1M G;  1M5I A;  2XT9 A;  2RDC A;  5LP6 C;  3FYE B;  1WB8 A;  3K3W A;  2OIE A;  3ZX6 A;  1H2G A;  1VIB A;  3SDL A;  1OCR C;  1AR1 B;  1X4T A;  3VQV A;  3CRA A;  4LH6 A;  1VMG A;  2QM8 A;  2WA3 A;  1FAF A;  3RW0 A;  4JZ2 A;  4I5S A;  4G28 B;  3CCR V;  3RVZ A;  1H2L A;  3ZJZ A;  1I0H A;  1XL4 A;  3ZHV A;  1KKD A;  3AK3 A;  3CCQ V;  4BIU A;  3KCY A;  4LR3 A;  1SQX H;  3EXA A;  3J80 N;  5KHH A;  4X64 O;  4OX9 O;  3R65 A;  3FB5 C;  1COW G;  2NN4 A;  4I9W A;  3TXS A;  2LW7 A;  1Y74 A;  4JAV A;  2ZDI A;  4PA7 A;  4R7C A;  4K35 A;  2UXC B;  3T2M A;  5JCO A;  1CXZ B;  2ZR2 A;  1SQQ H;  1H38 A;  5CB4 A;  3GWK C;  4HYO A;  1EM1 A;  4NB5 A;  3APO A;  4YY3 O;  3ABL B;  2ZIO A;  1M9N A;  4NXN B;  4NKG B;  1FPO A;  4IIJ A;  1XNQ B;  2CH7 B;  2N74 A;  3B8M A;  4KHP O;  4MVQ A;  4X1K A;  4QIW F;  1Q90 D;  1YHQ V;  3AG7 A;  5KUK A;  4TT3 G;  4RAI A;  3A2F A;  4J7J A;  2JRI A;  2IJI A;  1NJI W;  2EIL C;  4C7U A;  3PJS K;  5L3G A;  5KA6 A;  3A0R A;  4X1Y A;  4DYL A;  1S5J A;  3OUS A;  1QNM A;  2W6J G;  4DR5 B;  5EBL C;  2F4V B;  3H1L H;  2F1M A;  3K0G A;  4JI1 B;  1I7F A;  1K9M W;  4UB8 Z;  4GKJ B;  2YUA A;  4LWS A;  3D8C A;  3JCU Z;  2RMK B;  3L71 H;  2CE4 A;  4ZOL B;  3LDE A;  3JAT B;  2QGN A;  4X9Q A;  3CCM V;  4O2A B;  3ZN0 A;  1WAZ A;  5BMV B;  3HKC B;  1SKV A;  1AVM A;  2RN9 A;  4DV4 B;  2QM7 A;  1IVS A;  1K5S A;  1RM1 B;  5B1A B;  1LNQ A;  1OCO C;  3ZRX A;  3EHB B;  5JWP A;  2VQF B;  1PV0 A;  1I08 A;  1U97 A;  2F95 B;  2QSA A;  4I55 A;  3SPC A;  4NXN O;  4LF9 B;  1QR8 A;  3CC4 V;  4JTD B;  3RT3 C;  3HKD A;  3CCU V;  2PUS A;  4JTC B;  5L3C A;  4O4I B;  4B3T B;  2HP8 A;  4CC6 A;  2OT5 A;  1S77 D;  1YDX A;  2B1G A;  3C90 A;  4A5U B;  2ZE5 A;  4BWA A;  2A79 B;  1KD1 W;  4DV1 B;  3NR7 A;  2LO1 A;  4BIO A;  2XTA A;  3T1H B;  4FLZ A;  5IE9 A;  3CXH F;  5IY5 C;  2OWO A;  3JYC A;  4YIO A;  2AXT Z;  1GN6 A;  1B06 A;  4GCZ A;  3G6E V;  3K57 A;  1F7Y A;  4FZ0 A;  3U11 A;  4AIL C;  1Q86 W;  3WB1 A;  5DN6 G;  1W2B U;  3B8N A;  1DLB A;  4TV8 A;  1JFF A;  3VBB A;  1N32 B;  1B04 A;  2OTJ V;  4J11 A;  2E3C A;  4U7O A;  3FX7 A;  4GKJ O;  4UCR A;  3ML0 A;  5LBQ A;  1VQO V;  4ZIB A;  1CP9 A;  5KX5 A;  1SQV H;  3RGB A;  1ZL8 B;  1AI7 A;  3H01 A;  4R50 A;  3CCE V;  1TUE B;  3K08 A;  1P7B A;  5EYP A;  3W7S A;  2YC0 A;  4B3M O;  4JI4 B;  4JI6 O;  3HR0 A;  2P6J A;  2VQF O;  4GKK B;  5ITZ A;  1RPO A;  2VWK A;  3Q4H A;  2Q6A A;  4LF9 O;  2CUG A;  2Y0I A;  3S3X A;  2WLI B;  3CMA V;  4J7K A;  1BHB A;  4JF3 A;  4LFA O;  1SER A;  3ABU A;  4B3T O;  4BW5 A;  1Y67 A;  4CH5 A;  2Y4U A;  5B5E Z;  2OCC B;  2CTW A;  5KHG A;  2Y4T A;  1VF5 B;  1RM1 C;  5B1A C;  1L8D A;  4KUM A;  2EBO A;  4IHJ A;  1S0V A;  1YJN V;  4JI3 B;  3T1H O;  2FKX A;  4FVM A;  2K1E A;  5LHI A;  4JGS A;  4J7Z A;  2EJ7 A;  3K0D A;  3P32 A;  3QO7 A;  5IYD O;  2DW4 A;  2N04 A;  1XMO O;  2DWE C;  2ZIM A;  1TUB A;  5D5Q A;  4JI0 B;  5B3S B;  5GON B;  1YXB A;  1WP7 A;  3QVN A;  1D5N A;  3CRM A;  4JI5 B;  4ZKI A;  2JS5 A;  4JPR A;  1I5X A;  2YSU B;  3AG1 B;  5J2T B;  3E8G A;  3CJH A;  2XND G;  1IXB A;  1K8A W;  2YI8 A;  2IU0 A;  4JI4 O;  1TAE A;  2DQ3 A;  3AK1 A;  1FFX B;  4GKK O;  4RO2 A;  1P84 F;  1R6T A;  2QM4 A;  3LDC A;  3OMA B;  5H9C A;  2QA4 V;  5C8Y A;  3N2K B;  3B4S A;  4ZBM A;  5CA0 B;  1SC5 B;  5KA5 A;  5JH7 A;  2WA4 A;  5LOV B;  1HW7 A;  2BCC H;  2UXB O;  1JFF B;  4DV0 B;  2LJ2 A;  3HKE A;  4PA4 A;  5H5N A;  2ADP A;  3K03 A;  4HZ3 A;  4JAS A;  3RBZ A; 
#chains in the Genus database with same CATH homology
 3T1Y O;  4LFA O;  4B3T O;  3OTO O;  3O65 A;  1HNW O;  5LMU O;  4JV5 O;  3J80 N;  4DUY O;  2UU9 O;  1DK1 A;  4X62 O;  4X64 O;  4OX9 O;  4DV4 O;  2UUA O;  1NS1 A;  4DV2 O;  4NXN O;  4B3S O;  1YZB A;  1HNZ O;  3F5T A;  4LF5 O;  4JYA O;  2LW7 A;  4NXM O;  3RT3 C;  4DR7 O;  4DR3 O;  4LF7 O;  5BR8 O;  3T1H O;  4X66 O;  4DR6 O;  4DV5 O;  2FKX A;  1XNR O;  1G1X B;  2VQE O;  4JI3 O;  5FLX N;  2UXC O;  4LF6 O;  4LF8 O;  4JI5 O;  5IWA O;  5BXZ A;  4YY3 O;  4OPH A;  4JI2 O;  2AGA A;  1N33 O;  4A5U B;  2N74 A;  1J5E O;  1XMO O;  1FJG O;  1XEQ A;  1R1B A;  1XNQ O;  1IBK O;  4K0K O;  4OPA A;  4KHP O;  1IBL O;  4DR2 O;  2ZKO A;  4DV1 O;  4JI7 O;  4JI0 O;  2HHH O;  1HR0 O;  5LL6 Y;  1F7Y A;  4B3R O;  1N34 O;  1AIL A;  4DUZ O;  2JRI A;  4LFB O;  4X65 O;  4JI8 O;  1FYJ A;  1IBM O;  1D2D A;  2DOS A;  2ZM6 O;  4DR1 O;  4YHH O;  4JI4 O;  2E5L O;  4DV0 O;  1X59 A;  4DR4 O;  1N32 O;  4DV3 O;  4DV6 O;  4GKK O;  1R6T A;  4GKJ O;  4AQY O;  1FKA O;  5A2Q N;  5IT9 N;  3JAM N;  4DR5 O;  2DJV A;  2Z0A A;  2F4V O;  4LF4 O;  3J81 N;  1AB3 A;  2UUC O;  1XMQ O;  3J7A U;  4B3M O;  3SDL A;  4JI1 O;  4JI6 O;  5LMN O;  2UXB O;  1I94 O;  4LFC O;  2VQF O;  4DV7 O;  1HNX O;  5H5N A;  2UUB O;  2UXD O;  1KUQ A;  4LF9 O;  3M8A A;  3R66 A;  1N36 O;  1A32 A;  5BY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...