1IBLO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1iblO00
2E5LO 2DOSA 1IBKO 1HR0O 4OPAA 1HNZO 1R6TA 4X66O 4DR2O 1FJGO 3SDLA 1IBLO 4LF4O 3J81N 3J7AU 2UXCO 4JI6O 1N32O 4X62O 4YHHO 1DK1A 4DV1O 4GKJO 2UUBO 4LF8O 3T1YO 3O65A 5IT9N 2ZKOA 4DR1O 3OTOO 5IWAO 4A5UB 1N36O 5BR8O 4LF5O 4JI1O 4B3RO 1HNWO 4OPHA 4LFCO 4JI5O 2UUCO 1G1XB 1R1BA 1FYJA 1N34O 4LF6O 4LFBO 2N74A 4LF9O 2Z0AA 1D2DA 5BXZA 4DV7O 4DV2O 4NXNO 1XNQO 4JI7O 5LMNO 4B3SO 4DUZO 1AB3A 4DR3O 4OX9O 4B3TO 4B3MO 4DR4O 4JI3O 1N33O 4YY3O 1AILA 4DV0O 4X65O 4JYAO 2UXBO 1I94O 5A2QN 2UXDO 1A32A 2UU9O 4JI4O 4DV5O 4DV6O 2AGAA 4JI2O 5BY1A 4GKKO 2JRIA 4AQYO 4LF7O 1IBMO 4KHPO 4JI0O 5FLXN 4X64O 2UUAO 3RT3C 3J80N 4K0KO 3R66A 4DR5O 4NXMO 1XMQO 2FKXA 1YZBA 5LL6Y 2VQFO 2ZM6O 4JI8O 2LW7A 4DUYO 2HHHO 1F7YA 1J5EO 1NS1A 2DJVA 3F5TA 4DV4O 3T1HO 1FKAO 1KUQA 1X59A 1HNXO 2F4VO 5H5NA 1XMOO 3JAMN 4DR7O 4DV3O 1XEQA 5LMUO 3M8AA 1XNRO 4JV5O 4DR6O 4LFAO 2VQEO
chains in the Genus database with same CATH superfamily
4WF9V 4LFAB 3K5NA 4J7JA 4P9OA 2GHYA 5B1AB 1JA8A 3E22B 5EIBD 2ZE6A 1IBLO 5LXTB 5KA5A 1YI2V 4QJFB 4LH7A 3N27A 4MVRA 5IE9A 5LP6C 3JATB 1QCEA 2E76B 4YHHO 1GN3A 4HZ3A 2PYLA 3VQVA 5IWAO 1GN2A 1NQTA 3UCSC 1O9GA 4O2BA 3LNNA 4X20A 5LHGA 3CCLV 4X65B 4H44B 1GH6A 3FKSG 2XT9A 4P2ZA 5KHJA 2EJ7A 4FMTA 3SJCC 2YXHA 3WB1A 3JD1A 4U7NA 5B1BB 3UKMA 1AB3A 5EIBC 3SYQA 2FB5A 4FLYA 3D8CA 3OTOB 3HKBB 2HP8A 1SQXH 2ZDIA 3GWKC 5B66Z 4X65O 4P9PA 3SJBC 5EBWC 4BIOA 5GW7A 1YJ9V 3OMAB 1M56B 2NLJC 2E5LB 4AILC 4FK5C 4WFAV 2RCVA 3CHXA 2XNDG 1WPBA 4JI0O 4DV5B 4JI2B 3ZMVA 1SF9A 1SQFA 2JGDA 4ZOLB 4B3RB 1XBLA 4I4TB 1MMMA 3JD0A 2X6CA 4JI8O 4GLXA 2F95B 4FFKA 5IYCO 1OCRB 4I55A 2CUGA 1ZLZA 1AJQA 3G6BA 2A06H 1HNXO 3CMEV 1XHZA 4UV8A 3K9SA 4LF4B 3STZC 4DR7O 1FJGB 2AXTZ 2EIMB 3B77A 1VQKV 4I50A 4E4EA 1ORQC 3JAWA 1N0JA 1DLBA 4IHJA 2DYSB 4DR2B 2R70A 3AG2C 2ZT9B 1K5QA 5FPRA 2R9AA 3ABMC 2Q7EA 4DV1O 2WSSG 1Z2GA 2QEXV 1TAEA 1PP9H 5LGUA 3IGAC 4LF5O 2B1GA 1Y76A 3ZRWA 5BR8B 2QWQB 1JQ0A 1N34O 2Q7GA 4X20B 1G8MA 1NI8A 4UVAA 3RYCB 2XAFA 1COWG 4YXWG 3ZIAG 2ADPA 5L3BA 5B3SC 5H6QA 3T1HB 2UUBB 2QWRB 3N2GA 4LH6A 4JI3O 1YSCA 2X6AA 1R3LC 1AI7A 4B7KA 1N8RW 5EYPA 2D3OW 3ZHSA 4MTGA 4UCRA 1B3QA 4DV5O 4JI2O 4J9YB 4K8ZA 2JRIA 1I5YA 3ZHUA 4FM1A 1IBMO 2EZPA 1V9PA 2F4VB 4J80A 4GX1A 2W0FC 2UXBB 1W59A 3B09A 3TXQA 1OCRC 4MTXA 2P6JA 3H1KH 3WU2Z 2H8PC 1JJ2U 1FXKA 5K1PA 3JALA 4PDRA 2EJRA 4K0KB 4DV4O 4O4HA 1KUQA 3BABA 1F4NA 3CEIA 1B04A 4I9QA 2A79B 1XNQB 1OCCC 4GKJB 4DR6O 4QPKA 5DECA 2Y0IA 3UT5B 4EKWA 1VF7A 3H1LH 3JD4A 1FJGO 3OGIB 2WPDG 3KZIZ 1AI5A 1SQPH 3C3SA 3F7YC 4PA4A 3AEIA 1CP9A 2DYRB 1HNZB 3RBZA 1BS3A 2XOKG 1RM1C 1LR1A 1HNWO 4CH3A 5LHHA 5BZBA 3K3WA 2Q5ZA 4DV7B 3IC7A 2H3OA 4DV2O 1XILA 4X9QA 3PN1A 2V7QG 1YVWA 4IYHA 1EN5A 3S3WA 1KKDA 5AG2A 2YS8A 2LGQA 5IJ0A 4AQYB 3P3NA 2BOCC 5LGTA 3SGIA 4DR5B 2Q6AA 3N2KB 3CYOA 4UCTA 3LNMB 3D3IA 1SQVH 4PA6A 3RGBA 1NH2B 1BQZA 2W0XA 2NNUA 2EBOA 4KP4A 2KQXA 3QO7A 2A7WA 2F93B 3RN4A 2Y0PA 2XAQA 1JJOA 1VIBA 3PJSK 3OTFA 1N0NA 1US6A 2Y4TA 4RUFA 4B3SB 1XMOO 1IBLB 1MG1A 1XNRO 2DN9A 1UFIA 4LFAO 2WLMA 2DOSA 3U11A 1BZKA 2EILB 4C7UA 1GM8A 1S5LZ 3AK3A 5KUKA 2X7RB 4Z1VA 4X64B 1HDJA 3ABKB 2JDIG 1H8EG 1TUEB 2IH1C 2CH7A 4ASUG 1QR9A 5LP6B 4TUYB 1DF4A 4NB5A 1QVGU 3AG1C 1VQ5V 2HVKC 4X88A 5CA1A 2B5UA 2XAHA 4GUNA 4PDMA 1IURA 1PV0A 3OEEG 3MDSA 1KYOF 1V55C 4DR4B 1ZWIC 2A9HA 2GTSA 1QQCA 5LMNO 1WNSA 3AG4B 4X1YA 4U3FH 4DRXA 2YIBA 4CZZA 4JI6B 3C3TA 3IFXA 4LF9B 2H94A 3C90A 3ASNB 1ZL8A 4RWUA 2Y48A 2WLLB 4JI5B 4LFCB 3TK1A 3U0ZA 2UXDO 4GKKB 2ZNIA 4D6TH 2AGAA 3B2EE 1GK9A 5H9CA 2P90A 1Y74B 3LUTB 4YJ3A 1R73A 1O9HA 4KHPO 4K35A 4RUEA 4JV5B 1BT8A 5E79Z 3ZHRA 3APQA 1M9NA 1XMQO 2QGNA 4I5SA 1EN6A 1BHBA 2YC0A 3CJHB 3N2KA 3CJHA 1VQMV 2HFEC 2CTQA 2WLIA 1NBMG 5C8YB 3I5DA 3ZRXA 1XREA 3U10A 2EILC 1VQ6V 1HR0O 3ETGA 4OPAA 1IDSA 5FNVB 3TXSA 3F7VC 1EN4A 1QLNA 2HLDG 5K1XA 3TGUH 2PZSA 1H2SB 5L3FA 4HAMA 5L3EA 3CRCA 4R6ZA 2JGUA 3I56V 1FS0G 3P30A 4WFFA 4TUYA 4MW3A 1F23A 2HEPA 2R9IA 4QNHB 3CPWU 4NTXA 4LF6O 2ZIMA 4QIWF 3WB2A 1XL4A 4MVZA 1FD9A 2HG5C 1D2DA 2AZ2A 5BXZA 4W4LA 4DV7O 3CCVV 1HNWB 5GTIZ 3ZRVA 2ZXWB 4YIOA 3ETDA 4TQDA 4OX9O 4WBNA 4DK1A 2ZD9A 5KHGA 3E86A 2BTOA 1IXMA 2YI8A 3BVOA 1QLEB 3QTCA 5JJJB 1R6KA 1IXBA 1NTKH 3SPJA 4I0XA 3K06A 5J9PC 4B3MB 1YJNV 4J11A 4K0KO 1S77D 3CCQV 5BMVB 4U3JB 1H2NA 2B1IA 1V54B 2YIAA 3G4SV 2PUSA 2M7WA 2RQ6A 2UXDB 4YJ3B 1JR9A 3SYCA 3M8AA 1KBHA 3CRRA 2VQEO 1PL4A 4LC1A 2WLNA 3MHHC 1RPOA 2ATKC 3Q4HB 1I08A 5A9GA 1NR7A 1LUVA 2ZIOA 1H2MA 2YIBD 2QR4A 2OYQA 4UCVA 3MD0A 3ABUA 1AR5A 1ZAUA 3E22A 2UUBO 1V54C 5LXTA 1CPYA 3RYCA 1JPXA 4PELA 1H2LA 1S0VA 4LWSB 3CMAV 1Q8IA 4ZHQA 4ZHQB 1S3JA 4JYAB 1GO3F 1GM9A 2W6IG 5EC1C 1Z5WA 3UM7A 1Y4MA 2GUZA 1IBMB 3CC7V 1BQ0A 2UXXA 2PI5A 5IJ9A 4O2BB 1AJPA 1QHTA 4DV3B 2ZQMA 4DW1A 4HNAB 2BSKA 1XMQB 4DUZO 4G28B 3KCYA 4JAUA 3JARA 4ZIBA 4DR1B 2Q68A 1IVSA 1QLEC 4UCSA 3FD9A 1AJNA 2VS0A 4DXWA 5LP6A 1ZTEA 3W7XA 4UCOA 5A2QN 3BRCA 1XDCA 2RDCA 4GKKO 5EBMC 4DK0A 2OCCC 1AR1B 4AQYO 4JZGA 2FMLA 4BWAA 3ZMTA 3M7MX 5KLVH 2VQEB 3QG5A 3CCUV 1YJWV 3HKCA 1F4MA 2YXYA 1R3JC 3BY6A 3SJQC 3JASB 2OT5A 2YUAA 4JGSA 4X1YB 3OT7A 4JZ2A 4UFZA 4JI8B 2ETNA 2O57A 1FXKC 4OXSA 4F6EA 1RM1B 2EIMC 3A2FA 3T4ZA 2ZM6B 2DWEC 4I55B 3VQYA 4GZRB 4PDVA 3JASA 4IHJB 3FYEB 5IY5C 1ENVA 1H2KA 1S5HC 4J7ZA 1MSDA 1U96A 4ICGA 4LF4O 4UVBA 2DYRC 4O4JB 2V1DA 2Y69B 5CA0A 4TV8B 1S72V 4ABMA 1Q82W 3OUSA 4FJCC 4NTYA 3ZRWB 3QVNA 4GKJO 2Y69C 1WB7A 1LNQA 2DQ3A 3AG3B 4HBNA 4OX9B 2OCCB 3OEHG 5ITZB 4GT1A 1MSWD 2IH3C 1WN7A 1LUWA 4B3RO 4OPHA 2UUAB 4L8JA 1R6NA 3ZBHA 4LF8B 2AHYA 3K59A 5JJEB 2NN4A 1SRYA 4IYIA 5B3SB 3G6EV 4LF6B 4CH4A 2ZR2A 3CCEV 2JS5A 4P30A 2GTAA 4H37A 4IL6Z 1SZTA 1MOFA 3CRQA 3ZN1A 3TCUA 2ZDIC 4FLXA 4O2AA 3ZHQA 3JAKA 5CA3A 5IYDO 3JCZA 2EIKC 1S76D 4ZKIA 5L3CA 5GTHZ 4FPPA 1BHAA 1BMFG 2QSAA 3IC9A 5JCOA 3BFRA 4PI0A 3E8HA 4UB8Z 2WA4A 3P3PA 3TJTA 3VBBA 1NS1A 3F5TA 3SR2C 2P4KA 1SS3A 4IIJB 2EIJC 4L87A 3BA8A 1SESA 4DV1B 4JV5O 4XDLA 2JVDA 4CBCA 4UV9A 2ITCC 4KUMA 3SYAA 1N33B 4I50B 4DR2O 1I94B 2OIEA 1QU7A 4TWKA 1IX9A 4G27B 1KD1W 3J81N 2Q7HA 2ILMA 4JI6O 2LP7A 1N32O 3UQ8A 3SYOA 3ZEDA 1DK1A 4F6RB 1GN4A 1N32B 1VMGA 4DR7B 1I7FA 3JSLA 5BR8O 3K9AA 2IU3A 4NXMB 2BCCH 1SZXA 1XHXA 2N74A 2QKCA 3T1YB 5LA6A 2D2CB 3WG7C 1URFA 3K0GA 3OFNG 3ZS8C 2OCHA 1KP2A 5JVDB 1BE3H 5IYZB 4PDLA 1JMKC 4TV9B 3DC6A 3A8TA 1L0NH 4DUYB 1Q7YW 4JYAO 4XDKA 5J2TB 1A32A 2P67A 2GDSA 1W0KG 2L6LA 1ZUQA 1BSMA 3ZMUA 2XAJA 3A0RA 3L72H 1M90W 2DQ0A 3JAKB 2GUZB 2E74B 1M1KW 5FNVA 2IJHA 1U97A 3OD4A 4AHCA 3AK2A 2QDOA 4JI1B 4H13B 3B40A 3W7UA 4TSFG 3FB6C 1SC5B 4FVMA 3H1HH 3DC5A 5HFMA 3GB7C 2IJKA 1EZJA 3CE2A 5KHHA 3ML0A 1VF6A 4PI2A 4FZ0A 3ZMZA 1NR1A 1ZX3A 4X1KB 4RO2A 2LFRA 1MZFA 4MVSA 2Q69A 5DM6V 2LW1A 3ZCCA 4K3AA 1IBKO 2WLKA 3JALB 1AR4A 1P7BA 3SPIA 4DO2A 3HKDB 3VQWA 5CBFA 3R65A 4NTWA 3FYIB 1Q43A 1NVPB 2VWKA 3OM3B 1GTOA 2QKAA 5KAIZ 2LGWA 4ZI7B 1P7GA 4WBNB 3UO3A 2C2AA 4KL1A 3SPCA 2Z5UA 3KKYA 3I55V 1Q6UA 2EX3A 2HR3A 4JI7O 2EINB 1ZL8B 4ZI7A 4B3MO 2E75B 1NTZH 1WAZA 4JYCA 2P5OA 5LGNA 1WLEA 2LO1A 2XTAA 2GSMB 1YTFD 4GX0A 1XL6A 3ABMB 1SQBH 3OR6C 2DE0X 4JTAB 1G4YB 3EVKA 5KUMA 1OCZB 1KU9A 4FLUA 3OW2U 2CGNA 4JPRA 4MTFA 2YEVB 5FL7G 1H38A 2Q0AA 5KX5A 2A3QA 2PTMA 3N2GB 3TETA 3AG2B 3CC4V 4CS2A 1YZBA 2ZE8A 3ICXA 1WA8B 2Q73A 2ZM6O 1FAFA 5JQGB 2BE3A 1IBKB 5JQGA 4X1IA 1OJHA 2G38A 4CS4A 3JATA 1ZSPA 1TUBB 3EXAA 1FXHA 2YEVA 2RMKB 2F4VO 4CC6A 1YTFB 4PHZA 1VQ9V 4N23A 4NXNB 3LDEA 5EYPB 3K03A 3W7TA 1UJWB 1PD3A 4X1IB 2P06A 5C8YA 4YHHB 3SDLA 3D3QA 1VQ4V 4DR3B 1TUBA 1M4UA 2QM8A 4FLZA 1VQPV 3JARB 5L3DA 4O2AB 4D7TA 1HW7A 1M56C 1YDXA 3T1CA 1M5IA 4DR1O 4A5UB 3DGEA 2ZNJA 1Q90D 1KMIZ 5EZYA 1PNLA 2KKWA 4LFCO 1JX9A 4BW9A 1FYJA 4LF9O 1BCCH 1F51A 5CB4A 5JCOC 1D5AA 4NXNO 2N04A 4JYBA 1OCCB 4J42A 2QWOB 3ABLC 1OV9A 4DV6B 1N34B 1NKDA 5H2FZ 2X0LA 3VQXA 5CA1B 2WLJA 3K79A 2ZR3A 4KHPB 4GX5A 1K34A 1J95A 1YEWA 4O4LB 1AILA 1WJZA 1P4RA 2LQTA 1NU1H 5GONA 2BTQA 1Q6IA 4LP8A 4JASA 1KKCA 4UXNA 3E35A 1BGYH 4MVQA 1PL0A 1XI1A 5H6RA 1HP8A 4WFEA 2EZOA 2RJZA 4UVCA 4X64O 3OMNB 4LNUA 2IM9A 2ZINA 3H1JH 1T5EA 3CWBH 3OUFA 1XNRB 1YCIA 1AI6A 4KFMA 1UPGA 1VEWA 1FKAO 1MABG 2JEUA 1PM9A 3T2MA 3T4DA 4EB6A 3ASOB 1RSOA 1AVMA 1XEQA 4TV8A 4FLWA 4JI0B 1EM1A 2E5LO 5CBHA 4JYYA 5IY5B 1NTMH 3WB0A 2ARHA 4QGPA 4FFBB 2UXCO 4EB6B 1OHHG 2AHZA 2WLHA 2QWNB 2IBZH 4R8CA 3O65A 3OTOO 1RPRA 2XHBA 1Q6HA 5D5PA 1HWYA 3HKBA 1R1BA 1CXZB 2BSKB 1R3IC 2HJDA 1QBZA 2Z3YA 2CTPA 3ABLB 1K33A 2QTOA 4PD4F 5KA6A 5CB4B 1MA1A 2RNBA 1N36B 3RVYA 5IWAB 3LSSA 3ETQA 3E89A 4FIPC 1FPOA 4DV2B 1GKFA 1Q86W 5EZYB 2CDYA 2WAMA 1YXBA 1IZ3A 2Y4UA 3O9OA 3JCUZ 4I4TA 4O4IA 4YY3B 3HKCB 2YIDA 1NZ6A 2KG7B 3LDCA 1W2BU 3BAAA 1WB8A 3CSXA 4WFBV 1H2GA 1M57B 3J80N 2CE4A 1VQ7V 1EZVH 2HKOA 3FB7C 4E2LA 4DUYO 4IT5A 1N4CA 1OCOB 1CEZA 1TVKA 3AG4C 5EBLC 2FYUH 1JCHA 4X62B 1OCOC 2P7TC 1L0LH 2F43G 2CGOA 2P22C 3JAMN 4YJ2B 5LA6B 1K4DC 3K57A 4PA7A 3E8FA 3BCCH 1K97A 1Q5OA 1RSOB 3A0BZ 3Q4HA 1HNZO 2QE7G 3JAWB 1EFRG 1Y76B 2YDEA 5ITZA 1KECA 3AG3C 4F4LA 4CS3A 1E1RG 4HYOA 4B3TB 4G2KA 3CS5A 2ZKOA 1VQNV 2EULA 3B4SA 4EFEA 5IYBO 2YICA 4PA9A 3CRAA 3ZRSA 5LMNB 4I9WA 4LFBO 3CD6V 5CMUA 1J5EB 3JD2A 4GX2A 4N21A 3WFVA 3CB2A 4PV1B 4JI3B 2QWPB 4LFBB 3IJ4A 2ZE5A 4DUZB 4TOIA 1W0JG 2IJIA 2PYJA 1WP8A 2OIGA 4B3SO 2Q67A 2IW5A 5EC2C 3LSQA 3HB3B 2OTLV 4PJ0Z 1B06A 4MT8A 5BY1A 5L3GA 4JTCB 1FFTB 3L9DA 2DMXA 5IDJA 3BHPA 3L74H 4AI8A 1DF5A 2VQFO 1KB9F 2FL4A 3ZN0A 1RFYA 2HHHO 2IU0A 2PGGA 2AZ0A 3UT5A 3VOUA 1YITV 2R72A 3EFFK 5HFLA 4BR6A 3G71V 4O4IB 4OGQB 3OGCC 3AG7A 3E2EA 2KSDA 3ZJZA 5JH7B 4J10A 1K92A 1YIJV 2JJ1G 3ZHVA 5JJNB 1PPJH 5FPOA 3RYIB 1ROPA 4K8XA 1B6QA 1VQOV 1K7DA 1QNMA 2F66C 4I7ZB 5B1BC 2QM4A 4BIUA 4QE7A 4O4JA 4JI7B 1SA0B 1M93A 4XDJA 4X62O 2MK3A 4B08A 1QR8A 5IT9N 2Q8VA 4FM0A 4NKGB 3K58A 1N36O 1TGOA 4GCZA 3MAQA 1Y67A 2UUCB 2RN9A 2YSUB 3B8NA 2UUCO 4F6RA 1TA8A 3ABTA 5IYZA 4TV9A 5DEDA 3GVMA 1XNQO 5J2UA 3DXRB 1WPXA 1YF2A 1SQQH 1QVFU 2JIZG 1K8AW 1Y74A 1Q3EA 1PNKA 4LBEC 4DV4B 3K5LA 5B5EZ 1MZEA 5LBQA 4JI4B 4RQFA 2UXBO 5EK0A 1PKXA 5J2UB 3OE7G 2UU9O 1OCZC 2QM7A 3QF7A 4Q20A 2K9PA 4NVPA 3ZX6A 2Q9LA 3F5WC 4LWSA 1PNMA 2WA3A 2LJ2A 3CCMV 3ZMSA 2CTRA 4DYLA 2UUAO 3E83A 3L75H 3CX5F 4NR1A 4X1KA 3FAVB 2QTSA 4PA3A 4KXRA 5KAFZ 1J5EO 2DJVA 3T1HO 2YI9A 3JD3A 2OTJV 4MVOA 4CH6A 5TISZ 3FB5C 1FXKB 1BL8A 3CXCU 4DV3O 2VRZA 4O4HB 4W4KA 4EEQA 2CH7B 1E79G 3SYPA 1SKVA 1K9MW 2Q0OC 3BEHA 2WWWA 2DYSC 3HR0A 1NJIW 4LF7B 3RYFB 2X6BA 4J9ZB 4LF5B 1AROP 1VF6C 5KHKA 4IIJA 3J7AU 5KMGB 1H8HG 3KG2A 5KMGA 1DTOA 3RYHA 3T1YO 2QKSA 1SA0A 3RWRD 3HKDA 3E8GA 3SJAC 5JH7A 3G80A 5DN6G 2F23A 3A0HZ 4JI5O 2PI4A 1G1XB 3W7WA 1I5XA 3DSQA 4MSWC 3H01A 2ZXWC 3ASOC 3CP1A 5F2VO 1GM7A 2HHHB 4U3JA 2EINC 1VP7A 2E3CA 2VQFB 2BTQB 1SETA 1FFXA 2B9ZA 4DR4O 4R50A 3W7SA 1N33O 2CAZC 1L8DA 2GBOA 4WFHA 4YY3O 3X2QB 5B1OA 1R3KC 5LOVB 2DW4A 2MW2B 2K1EA 4MTOA 5LOVA 3ETEA 3RFRA 4FM2A 4X8AA 4GYCB 3H1IH 5CA0B 2N05A 2JJ2G 1GN6A 4DV6O 3ZHTA 1EBOA 1VQLV 4LF7O 3BA9A 3L71H 3B8MA 4DV0B 2JS3A 4UB6Z 2WLIB 1WA8A 3CCRV 1DGSA 2R9RB 4MVUA 5J2TA 3R66A 3JYCA 3K5OA 2FKXA 3K0DA 3APOA 3G67A 3HPLC 1VF5B 3X2QC 5LMUB 3LDDA 3RVZA 1VARA 1P49A 1X59A 3QNEA 2OWOA 1JOYA 4FFBA 1Y66A 1K5SA 4D7SA 3CCSV 3NXSA 4FLVA 2GV9A 4FZ1A 2UXCB 4UCUA 1WP7A 4X66O 3HKEB 3FAVA 3K5MA 3L73H 2UXNA 5IJ9B 4X89A 2UU9B 2V4DA 2P4VA 3CC2V 3CXHF 1P84F 4QPJA 3H9VA 4LF8O 2IJJA 4JAVA 2CK3G 2NR5A 1G6UA 2BOBC 2JEXA 4Z2WA 3OMIB 3K08A 1S5JA 2KB1A 3RYFA 3BPZA 2YXLA 3FB8C 2ITDC 4U7OA 1YHQV 3AK1A 3RYIA 1SERA 1Q81W 4TQFA 3D36C 5CBGA 3L70H 4QE9A 1D5NA 4CH5A 4LCUC 1TVKB 3STLC 4WCEV 3P32A 4Z1MG 3CRMA 1FFXB 2VWJA 2M6YA 2DWDC 5KHIA 4MW8A 2EIKB 4LNUB 4RQEA 3S3XA 5KX5B 4H33A 2QJ1A 4I0XB 2A0LA 1GMGA 4BW5A 2HVJC 3EHBB 5GONB 1AI4A 1SQGA 5FLXN 3DXRA 1K4CC 4Q6GA 1Z5VA 1M57C 4X66B 5LL6Y 1XOUA 3FFQA 2LW7A 1JVMA 1XQ8A 1GAXA 1KP3A 4DR6B 5JVDA 3JSNA 3QO8A 2QA4V 1OZ0A 2AW9A 1NT2B 1KC8W 3DTUB 1VQ8V 5LMUO 1Y6XA 3LSUA 4B7EA 4H0LB 1HR0B 3GWOA 4CC5A 1XUQA 1V55B 1R6TA 2ADQB 4TT3G 1K3EA 1FXVA 2ZE7A 2FTKA 3HKEA 1NH2D 2XUMA 3ASNC 3D36A 4HNAA 4J41A 1RP3B 3IAYA 4BAYA 4MVMA 5LYJA 2CTWA 5C93A 1AP5A 4JI1O 4R7CA 5LYJB 4BIZA 5D5QA 1L1FA 4MS2A 2Z0AA 1K73W 3CCJV 2ODMA 4WFGA 3WG7B 1XMOB 3OR7C 4UUJC 2XAGA 5JWPA 3ABKC 4DR3O 2JK5C 4B3TO 4YIPA 5B1AC 1MNGA 4XBFA 4DW0A 4FLTA 2L35A 3RW0A 4DV0O 1THZA 3RYHB 5LHIA 2PF4E 3AG1B 1I94O 2ZCEA 4JI4O 1KQSU 4JTDB 1E1QG 4J7KA 4IGGA 3OAAG 1I0HA 2F1MA 1JFFA 4DRXB 2JGDB 3E8BA 4ZOLA 3SPHA 3UO2A 2W6JG 5B1NA 1AP6A 1GRJA 4O4LA 3FX7A 3RT3C 4DR5O 4NXMO 2KG7A 5E1AC 1NVPD 3NR7A 4LR3A 3SPGA 3THOA 1F7YA 4ZBMA 2LFSA 4YJ2A 1JFFB 1X4TA 2EIJB 2PY5A 3QO5A 5BMVA 3KCXA 2WLLA 5H5NA 4NYKA 1HNXB 3M99B 2Q4PA 4JAAA 4RAIA 4JF3A 3K04A 5CN0A 5IJ0B 4EFBA 3MHSC 2HJFC 2XASA
chains in the Genus database with same CATH topology
2E5LO 2DOSA 1IBKO 1HR0O 4OPAA 1HNZO 1R6TA 4X66O 4DR2O 1FJGO 3SDLA 1IBLO 4LF4O 3J81N 3J7AU 2UXCO 4JI6O 1N32O 4X62O 4YHHO 1DK1A 4DV1O 4GKJO 2UUBO 4LF8O 3T1YO 3O65A 5IT9N 2ZKOA 4DR1O 3OTOO 5IWAO 4A5UB 1N36O 5BR8O 4LF5O 4JI1O 4B3RO 1HNWO 4OPHA 4LFCO 4JI5O 2UUCO 1G1XB 1R1BA 1FYJA 1N34O 4LF6O 4LFBO 2N74A 4LF9O 2Z0AA 1D2DA 5BXZA 4DV7O 4DV2O 4NXNO 1XNQO 4JI7O 5LMNO 4B3SO 4DUZO 1AB3A 4DR3O 4OX9O 4B3TO 4B3MO 4DR4O 4JI3O 1N33O 4YY3O 1AILA 4DV0O 4X65O 4JYAO 2UXBO 1I94O 5A2QN 2UXDO 1A32A 2UU9O 4JI4O 4DV5O 4DV6O 2AGAA 4JI2O 5BY1A 4GKKO 2JRIA 4AQYO 4LF7O 1IBMO 4KHPO 4JI0O 5FLXN 4X64O 2UUAO 3RT3C 3J80N 4K0KO 3R66A 4DR5O 4NXMO 1XMQO 2FKXA 1YZBA 5LL6Y 2VQFO 2ZM6O 4JI8O 2LW7A 4DUYO 2HHHO 1F7YA 1J5EO 1NS1A 2DJVA 3F5TA 4DV4O 3T1HO 1FKAO 1KUQA 1X59A 1HNXO 2F4VO 5H5NA 1XMOO 3JAMN 4DR7O 4DV3O 1XEQA 5LMUO 3M8AA 1XNRO 4JV5O 4DR6O 4LFAO 2VQEO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L O;  2DOS A;  1IBK O;  1HR0 O;  4OPA A;  1HNZ O;  1R6T A;  4X66 O;  4DR2 O;  1FJG O;  3SDL A;  1IBL O;  4LF4 O;  3J81 N;  3J7A U;  2UXC O;  4JI6 O;  1N32 O;  4X62 O;  4YHH O;  1DK1 A;  4DV1 O;  4GKJ O;  2UUB O;  4LF8 O;  3T1Y O;  3O65 A;  5IT9 N;  2ZKO A;  4DR1 O;  3OTO O;  5IWA O;  4A5U B;  1N36 O;  5BR8 O;  4LF5 O;  4JI1 O;  4B3R O;  1HNW O;  4OPH A;  4LFC O;  4JI5 O;  2UUC O;  1G1X B;  1R1B A;  1FYJ A;  1N34 O;  4LF6 O;  4LFB O;  2N74 A;  4LF9 O;  2Z0A A;  1D2D A;  5BXZ A;  4DV7 O;  4DV2 O;  4NXN O;  1XNQ O;  4JI7 O;  5LMN O;  4B3S O;  4DUZ O;  1AB3 A;  4DR3 O;  4OX9 O;  4B3T O;  4B3M O;  4DR4 O;  4JI3 O;  1N33 O;  4YY3 O;  1AIL A;  4DV0 O;  4X65 O;  4JYA O;  2UXB O;  1I94 O;  5A2Q N;  2UXD O;  1A32 A;  2UU9 O;  4JI4 O;  4DV5 O;  4DV6 O;  2AGA A;  4JI2 O;  5BY1 A;  4GKK O;  2JRI A;  4AQY O;  4LF7 O;  1IBM O;  4KHP O;  4JI0 O;  5FLX N;  4X64 O;  2UUA O;  3RT3 C;  3J80 N;  4K0K O;  3R66 A;  4DR5 O;  4NXM O;  1XMQ O;  2FKX A;  1YZB A;  5LL6 Y;  2VQF O;  2ZM6 O;  4JI8 O;  2LW7 A;  4DUY O;  2HHH O;  1F7Y A;  1J5E O;  1NS1 A;  2DJV A;  3F5T A;  4DV4 O;  3T1H O;  1FKA O;  1KUQ A;  1X59 A;  1HNX O;  2F4V O;  5H5N A;  1XMO O;  3JAM N;  4DR7 O;  4DV3 O;  1XEQ A;  5LMU O;  3M8A A;  1XNR O;  4JV5 O;  4DR6 O;  4LFA O;  2VQE O; 
#chains in the Genus database with same CATH topology
 4WF9 V;  4LFA B;  3K5N A;  4J7J A;  4P9O A;  2GHY A;  5B1A B;  1JA8 A;  3E22 B;  5EIB D;  2ZE6 A;  1IBL O;  5LXT B;  5KA5 A;  1YI2 V;  4QJF B;  4LH7 A;  3N27 A;  4MVR A;  5IE9 A;  5LP6 C;  3JAT B;  1QCE A;  2E76 B;  4YHH O;  1GN3 A;  4HZ3 A;  2PYL A;  3VQV A;  5IWA O;  1GN2 A;  1NQT A;  3UCS C;  1O9G A;  4O2B A;  3LNN A;  4X20 A;  5LHG A;  3CCL V;  4X65 B;  4H44 B;  1GH6 A;  3FKS G;  2XT9 A;  4P2Z A;  5KHJ A;  2EJ7 A;  4FMT A;  3SJC C;  2YXH A;  3WB1 A;  3JD1 A;  4U7N A;  5B1B B;  3UKM A;  1AB3 A;  5EIB C;  3SYQ A;  2FB5 A;  4FLY A;  3D8C A;  3OTO B;  3HKB B;  2HP8 A;  1SQX H;  2ZDI A;  3GWK C;  5B66 Z;  4X65 O;  4P9P A;  3SJB C;  5EBW C;  4BIO A;  5GW7 A;  1YJ9 V;  3OMA B;  1M56 B;  2NLJ C;  2E5L B;  4AIL C;  4FK5 C;  4WFA V;  2RCV A;  3CHX A;  2XND G;  1WPB A;  4JI0 O;  4DV5 B;  4JI2 B;  3ZMV A;  1SF9 A;  1SQF A;  2JGD A;  4ZOL B;  4B3R B;  1XBL A;  4I4T B;  1MMM A;  3JD0 A;  2X6C A;  4JI8 O;  4GLX A;  2F95 B;  4FFK A;  5IYC O;  1OCR B;  4I55 A;  2CUG A;  1ZLZ A;  1AJQ A;  3G6B A;  2A06 H;  1HNX O;  3CME V;  1XHZ A;  4UV8 A;  3K9S A;  4LF4 B;  3STZ C;  4DR7 O;  1FJG B;  2AXT Z;  2EIM B;  3B77 A;  1VQK V;  4I50 A;  4E4E A;  1ORQ C;  3JAW A;  1N0J A;  1DLB A;  4IHJ A;  2DYS B;  4DR2 B;  2R70 A;  3AG2 C;  2ZT9 B;  1K5Q A;  5FPR A;  2R9A A;  3ABM C;  2Q7E A;  4DV1 O;  2WSS G;  1Z2G A;  2QEX V;  1TAE A;  1PP9 H;  5LGU A;  3IGA C;  4LF5 O;  2B1G A;  1Y76 A;  3ZRW A;  5BR8 B;  2QWQ B;  1JQ0 A;  1N34 O;  2Q7G A;  4X20 B;  1G8M A;  1NI8 A;  4UVA A;  3RYC B;  2XAF A;  1COW G;  4YXW G;  3ZIA G;  2ADP A;  5L3B A;  5B3S C;  5H6Q A;  3T1H B;  2UUB B;  2QWR B;  3N2G A;  4LH6 A;  4JI3 O;  1YSC A;  2X6A A;  1R3L C;  1AI7 A;  4B7K A;  1N8R W;  5EYP A;  2D3O W;  3ZHS A;  4MTG A;  4UCR A;  1B3Q A;  4DV5 O;  4JI2 O;  4J9Y B;  4K8Z A;  2JRI A;  1I5Y A;  3ZHU A;  4FM1 A;  1IBM O;  2EZP A;  1V9P A;  2F4V B;  4J80 A;  4GX1 A;  2W0F C;  2UXB B;  1W59 A;  3B09 A;  3TXQ A;  1OCR C;  4MTX A;  2P6J A;  3H1K H;  3WU2 Z;  2H8P C;  1JJ2 U;  1FXK A;  5K1P A;  3JAL A;  4PDR A;  2EJR A;  4K0K B;  4DV4 O;  4O4H A;  1KUQ A;  3BAB A;  1F4N A;  3CEI A;  1B04 A;  4I9Q A;  2A79 B;  1XNQ B;  1OCC C;  4GKJ B;  4DR6 O;  4QPK A;  5DEC A;  2Y0I A;  3UT5 B;  4EKW A;  1VF7 A;  3H1L H;  3JD4 A;  1FJG O;  3OGI B;  2WPD G;  3KZI Z;  1AI5 A;  1SQP H;  3C3S A;  3F7Y C;  4PA4 A;  3AEI A;  1CP9 A;  2DYR B;  1HNZ B;  3RBZ A;  1BS3 A;  2XOK G;  1RM1 C;  1LR1 A;  1HNW O;  4CH3 A;  5LHH A;  5BZB A;  3K3W A;  2Q5Z A;  4DV7 B;  3IC7 A;  2H3O A;  4DV2 O;  1XIL A;  4X9Q A;  3PN1 A;  2V7Q G;  1YVW A;  4IYH A;  1EN5 A;  3S3W A;  1KKD A;  5AG2 A;  2YS8 A;  2LGQ A;  5IJ0 A;  4AQY B;  3P3N A;  2BOC C;  5LGT A;  3SGI A;  4DR5 B;  2Q6A A;  3N2K B;  3CYO A;  4UCT A;  3LNM B;  3D3I A;  1SQV H;  4PA6 A;  3RGB A;  1NH2 B;  1BQZ A;  2W0X A;  2NNU A;  2EBO A;  4KP4 A;  2KQX A;  3QO7 A;  2A7W A;  2F93 B;  3RN4 A;  2Y0P A;  2XAQ A;  1JJO A;  1VIB A;  3PJS K;  3OTF A;  1N0N A;  1US6 A;  2Y4T A;  4RUF A;  4B3S B;  1XMO O;  1IBL B;  1MG1 A;  1XNR O;  2DN9 A;  1UFI A;  4LFA O;  2WLM A;  2DOS A;  3U11 A;  1BZK A;  2EIL B;  4C7U A;  1GM8 A;  1S5L Z;  3AK3 A;  5KUK A;  2X7R B;  4Z1V A;  4X64 B;  1HDJ A;  3ABK B;  2JDI G;  1H8E G;  1TUE B;  2IH1 C;  2CH7 A;  4ASU G;  1QR9 A;  5LP6 B;  4TUY B;  1DF4 A;  4NB5 A;  1QVG U;  3AG1 C;  1VQ5 V;  2HVK C;  4X88 A;  5CA1 A;  2B5U A;  2XAH A;  4GUN A;  4PDM A;  1IUR A;  1PV0 A;  3OEE G;  3MDS A;  1KYO F;  1V55 C;  4DR4 B;  1ZWI C;  2A9H A;  2GTS A;  1QQC A;  5LMN O;  1WNS A;  3AG4 B;  4X1Y A;  4U3F H;  4DRX A;  2YIB A;  4CZZ A;  4JI6 B;  3C3T A;  3IFX A;  4LF9 B;  2H94 A;  3C90 A;  3ASN B;  1ZL8 A;  4RWU A;  2Y48 A;  2WLL B;  4JI5 B;  4LFC B;  3TK1 A;  3U0Z A;  2UXD O;  4GKK B;  2ZNI A;  4D6T H;  2AGA A;  3B2E E;  1GK9 A;  5H9C A;  2P90 A;  1Y74 B;  3LUT B;  4YJ3 A;  1R73 A;  1O9H A;  4KHP O;  4K35 A;  4RUE A;  4JV5 B;  1BT8 A;  5E79 Z;  3ZHR A;  3APQ A;  1M9N A;  1XMQ O;  2QGN A;  4I5S A;  1EN6 A;  1BHB A;  2YC0 A;  3CJH B;  3N2K A;  3CJH A;  1VQM V;  2HFE C;  2CTQ A;  2WLI A;  1NBM G;  5C8Y B;  3I5D A;  3ZRX A;  1XRE A;  3U10 A;  2EIL C;  1VQ6 V;  1HR0 O;  3ETG A;  4OPA A;  1IDS A;  5FNV B;  3TXS A;  3F7V C;  1EN4 A;  1QLN A;  2HLD G;  5K1X A;  3TGU H;  2PZS A;  1H2S B;  5L3F A;  4HAM A;  5L3E A;  3CRC A;  4R6Z A;  2JGU A;  3I56 V;  1FS0 G;  3P30 A;  4WFF A;  4TUY A;  4MW3 A;  1F23 A;  2HEP A;  2R9I A;  4QNH B;  3CPW U;  4NTX A;  4LF6 O;  2ZIM A;  4QIW F;  3WB2 A;  1XL4 A;  4MVZ A;  1FD9 A;  2HG5 C;  1D2D A;  2AZ2 A;  5BXZ A;  4W4L A;  4DV7 O;  3CCV V;  1HNW B;  5GTI Z;  3ZRV A;  2ZXW B;  4YIO A;  3ETD A;  4TQD A;  4OX9 O;  4WBN A;  4DK1 A;  2ZD9 A;  5KHG A;  3E86 A;  2BTO A;  1IXM A;  2YI8 A;  3BVO A;  1QLE B;  3QTC A;  5JJJ B;  1R6K A;  1IXB A;  1NTK H;  3SPJ A;  4I0X A;  3K06 A;  5J9P C;  4B3M B;  1YJN V;  4J11 A;  4K0K O;  1S77 D;  3CCQ V;  5BMV B;  4U3J B;  1H2N A;  2B1I A;  1V54 B;  2YIA A;  3G4S V;  2PUS A;  2M7W A;  2RQ6 A;  2UXD B;  4YJ3 B;  1JR9 A;  3SYC A;  3M8A A;  1KBH A;  3CRR A;  2VQE O;  1PL4 A;  4LC1 A;  2WLN A;  3MHH C;  1RPO A;  2ATK C;  3Q4H B;  1I08 A;  5A9G A;  1NR7 A;  1LUV A;  2ZIO A;  1H2M A;  2YIB D;  2QR4 A;  2OYQ A;  4UCV A;  3MD0 A;  3ABU A;  1AR5 A;  1ZAU A;  3E22 A;  2UUB O;  1V54 C;  5LXT A;  1CPY A;  3RYC A;  1JPX A;  4PEL A;  1H2L A;  1S0V A;  4LWS B;  3CMA V;  1Q8I A;  4ZHQ A;  4ZHQ B;  1S3J A;  4JYA B;  1GO3 F;  1GM9 A;  2W6I G;  5EC1 C;  1Z5W A;  3UM7 A;  1Y4M A;  2GUZ A;  1IBM B;  3CC7 V;  1BQ0 A;  2UXX A;  2PI5 A;  5IJ9 A;  4O2B B;  1AJP A;  1QHT A;  4DV3 B;  2ZQM A;  4DW1 A;  4HNA B;  2BSK A;  1XMQ B;  4DUZ O;  4G28 B;  3KCY A;  4JAU A;  3JAR A;  4ZIB A;  4DR1 B;  2Q68 A;  1IVS A;  1QLE C;  4UCS A;  3FD9 A;  1AJN A;  2VS0 A;  4DXW A;  5LP6 A;  1ZTE A;  3W7X A;  4UCO A;  5A2Q N;  3BRC A;  1XDC A;  2RDC A;  4GKK O;  5EBM C;  4DK0 A;  2OCC C;  1AR1 B;  4AQY O;  4JZG A;  2FML A;  4BWA A;  3ZMT A;  3M7M X;  5KLV H;  2VQE B;  3QG5 A;  3CCU V;  1YJW V;  3HKC A;  1F4M A;  2YXY A;  1R3J C;  3BY6 A;  3SJQ C;  3JAS B;  2OT5 A;  2YUA A;  4JGS A;  4X1Y B;  3OT7 A;  4JZ2 A;  4UFZ A;  4JI8 B;  2ETN A;  2O57 A;  1FXK C;  4OXS A;  4F6E A;  1RM1 B;  2EIM C;  3A2F A;  3T4Z A;  2ZM6 B;  2DWE C;  4I55 B;  3VQY A;  4GZR B;  4PDV A;  3JAS A;  4IHJ B;  3FYE B;  5IY5 C;  1ENV A;  1H2K A;  1S5H C;  4J7Z A;  1MSD A;  1U96 A;  4ICG A;  4LF4 O;  4UVB A;  2DYR C;  4O4J B;  2V1D A;  2Y69 B;  5CA0 A;  4TV8 B;  1S72 V;  4ABM A;  1Q82 W;  3OUS A;  4FJC C;  4NTY A;  3ZRW B;  3QVN A;  4GKJ O;  2Y69 C;  1WB7 A;  1LNQ A;  2DQ3 A;  3AG3 B;  4HBN A;  4OX9 B;  2OCC B;  3OEH G;  5ITZ B;  4GT1 A;  1MSW D;  2IH3 C;  1WN7 A;  1LUW A;  4B3R O;  4OPH A;  2UUA B;  4L8J A;  1R6N A;  3ZBH A;  4LF8 B;  2AHY A;  3K59 A;  5JJE B;  2NN4 A;  1SRY A;  4IYI A;  5B3S B;  3G6E V;  4LF6 B;  4CH4 A;  2ZR2 A;  3CCE V;  2JS5 A;  4P30 A;  2GTA A;  4H37 A;  4IL6 Z;  1SZT A;  1MOF A;  3CRQ A;  3ZN1 A;  3TCU A;  2ZDI C;  4FLX A;  4O2A A;  3ZHQ A;  3JAK A;  5CA3 A;  5IYD O;  3JCZ A;  2EIK C;  1S76 D;  4ZKI A;  5L3C A;  5GTH Z;  4FPP A;  1BHA A;  1BMF G;  2QSA A;  3IC9 A;  5JCO A;  3BFR A;  4PI0 A;  3E8H A;  4UB8 Z;  2WA4 A;  3P3P A;  3TJT A;  3VBB A;  1NS1 A;  3F5T A;  3SR2 C;  2P4K A;  1SS3 A;  4IIJ B;  2EIJ C;  4L87 A;  3BA8 A;  1SES A;  4DV1 B;  4JV5 O;  4XDL A;  2JVD A;  4CBC A;  4UV9 A;  2ITC C;  4KUM A;  3SYA A;  1N33 B;  4I50 B;  4DR2 O;  1I94 B;  2OIE A;  1QU7 A;  4TWK A;  1IX9 A;  4G27 B;  1KD1 W;  3J81 N;  2Q7H A;  2ILM A;  4JI6 O;  2LP7 A;  1N32 O;  3UQ8 A;  3SYO A;  3ZED A;  1DK1 A;  4F6R B;  1GN4 A;  1N32 B;  1VMG A;  4DR7 B;  1I7F A;  3JSL A;  5BR8 O;  3K9A A;  2IU3 A;  4NXM B;  2BCC H;  1SZX A;  1XHX A;  2N74 A;  2QKC A;  3T1Y B;  5LA6 A;  2D2C B;  3WG7 C;  1URF A;  3K0G A;  3OFN G;  3ZS8 C;  2OCH A;  1KP2 A;  5JVD B;  1BE3 H;  5IYZ B;  4PDL A;  1JMK C;  4TV9 B;  3DC6 A;  3A8T A;  1L0N H;  4DUY B;  1Q7Y W;  4JYA O;  4XDK A;  5J2T B;  1A32 A;  2P67 A;  2GDS A;  1W0K G;  2L6L A;  1ZUQ A;  1BSM A;  3ZMU A;  2XAJ A;  3A0R A;  3L72 H;  1M90 W;  2DQ0 A;  3JAK B;  2GUZ B;  2E74 B;  1M1K W;  5FNV A;  2IJH A;  1U97 A;  3OD4 A;  4AHC A;  3AK2 A;  2QDO A;  4JI1 B;  4H13 B;  3B40 A;  3W7U A;  4TSF G;  3FB6 C;  1SC5 B;  4FVM A;  3H1H H;  3DC5 A;  5HFM A;  3GB7 C;  2IJK A;  1EZJ A;  3CE2 A;  5KHH A;  3ML0 A;  1VF6 A;  4PI2 A;  4FZ0 A;  3ZMZ A;  1NR1 A;  1ZX3 A;  4X1K B;  4RO2 A;  2LFR A;  1MZF A;  4MVS A;  2Q69 A;  5DM6 V;  2LW1 A;  3ZCC A;  4K3A A;  1IBK O;  2WLK A;  3JAL B;  1AR4 A;  1P7B A;  3SPI A;  4DO2 A;  3HKD B;  3VQW A;  5CBF A;  3R65 A;  4NTW A;  3FYI B;  1Q43 A;  1NVP B;  2VWK A;  3OM3 B;  1GTO A;  2QKA A;  5KAI Z;  2LGW A;  4ZI7 B;  1P7G A;  4WBN B;  3UO3 A;  2C2A A;  4KL1 A;  3SPC A;  2Z5U A;  3KKY A;  3I55 V;  1Q6U A;  2EX3 A;  2HR3 A;  4JI7 O;  2EIN B;  1ZL8 B;  4ZI7 A;  4B3M O;  2E75 B;  1NTZ H;  1WAZ A;  4JYC A;  2P5O A;  5LGN A;  1WLE A;  2LO1 A;  2XTA A;  2GSM B;  1YTF D;  4GX0 A;  1XL6 A;  3ABM B;  1SQB H;  3OR6 C;  2DE0 X;  4JTA B;  1G4Y B;  3EVK A;  5KUM A;  1OCZ B;  1KU9 A;  4FLU A;  3OW2 U;  2CGN A;  4JPR A;  4MTF A;  2YEV B;  5FL7 G;  1H38 A;  2Q0A A;  5KX5 A;  2A3Q A;  2PTM A;  3N2G B;  3TET A;  3AG2 B;  3CC4 V;  4CS2 A;  1YZB A;  2ZE8 A;  3ICX A;  1WA8 B;  2Q73 A;  2ZM6 O;  1FAF A;  5JQG B;  2BE3 A;  1IBK B;  5JQG A;  4X1I A;  1OJH A;  2G38 A;  4CS4 A;  3JAT A;  1ZSP A;  1TUB B;  3EXA A;  1FXH A;  2YEV A;  2RMK B;  2F4V O;  4CC6 A;  1YTF B;  4PHZ A;  1VQ9 V;  4N23 A;  4NXN B;  3LDE A;  5EYP B;  3K03 A;  3W7T A;  1UJW B;  1PD3 A;  4X1I B;  2P06 A;  5C8Y A;  4YHH B;  3SDL A;  3D3Q A;  1VQ4 V;  4DR3 B;  1TUB A;  1M4U A;  2QM8 A;  4FLZ A;  1VQP V;  3JAR B;  5L3D A;  4O2A B;  4D7T A;  1HW7 A;  1M56 C;  1YDX A;  3T1C A;  1M5I A;  4DR1 O;  4A5U B;  3DGE A;  2ZNJ A;  1Q90 D;  1KMI Z;  5EZY A;  1PNL A;  2KKW A;  4LFC O;  1JX9 A;  4BW9 A;  1FYJ A;  4LF9 O;  1BCC H;  1F51 A;  5CB4 A;  5JCO C;  1D5A A;  4NXN O;  2N04 A;  4JYB A;  1OCC B;  4J42 A;  2QWO B;  3ABL C;  1OV9 A;  4DV6 B;  1N34 B;  1NKD A;  5H2F Z;  2X0L A;  3VQX A;  5CA1 B;  2WLJ A;  3K79 A;  2ZR3 A;  4KHP B;  4GX5 A;  1K34 A;  1J95 A;  1YEW A;  4O4L B;  1AIL A;  1WJZ A;  1P4R A;  2LQT A;  1NU1 H;  5GON A;  2BTQ A;  1Q6I A;  4LP8 A;  4JAS A;  1KKC A;  4UXN A;  3E35 A;  1BGY H;  4MVQ A;  1PL0 A;  1XI1 A;  5H6R A;  1HP8 A;  4WFE A;  2EZO A;  2RJZ A;  4UVC A;  4X64 O;  3OMN B;  4LNU A;  2IM9 A;  2ZIN A;  3H1J H;  1T5E A;  3CWB H;  3OUF A;  1XNR B;  1YCI A;  1AI6 A;  4KFM A;  1UPG A;  1VEW A;  1FKA O;  1MAB G;  2JEU A;  1PM9 A;  3T2M A;  3T4D A;  4EB6 A;  3ASO B;  1RSO A;  1AVM A;  1XEQ A;  4TV8 A;  4FLW A;  4JI0 B;  1EM1 A;  2E5L O;  5CBH A;  4JYY A;  5IY5 B;  1NTM H;  3WB0 A;  2ARH A;  4QGP A;  4FFB B;  2UXC O;  4EB6 B;  1OHH G;  2AHZ A;  2WLH A;  2QWN B;  2IBZ H;  4R8C A;  3O65 A;  3OTO O;  1RPR A;  2XHB A;  1Q6H A;  5D5P A;  1HWY A;  3HKB A;  1R1B A;  1CXZ B;  2BSK B;  1R3I C;  2HJD A;  1QBZ A;  2Z3Y A;  2CTP A;  3ABL B;  1K33 A;  2QTO A;  4PD4 F;  5KA6 A;  5CB4 B;  1MA1 A;  2RNB A;  1N36 B;  3RVY A;  5IWA B;  3LSS A;  3ETQ A;  3E89 A;  4FIP C;  1FPO A;  4DV2 B;  1GKF A;  1Q86 W;  5EZY B;  2CDY A;  2WAM A;  1YXB A;  1IZ3 A;  2Y4U A;  3O9O A;  3JCU Z;  4I4T A;  4O4I A;  4YY3 B;  3HKC B;  2YID A;  1NZ6 A;  2KG7 B;  3LDC A;  1W2B U;  3BAA A;  1WB8 A;  3CSX A;  4WFB V;  1H2G A;  1M57 B;  3J80 N;  2CE4 A;  1VQ7 V;  1EZV H;  2HKO A;  3FB7 C;  4E2L A;  4DUY O;  4IT5 A;  1N4C A;  1OCO B;  1CEZ A;  1TVK A;  3AG4 C;  5EBL C;  2FYU H;  1JCH A;  4X62 B;  1OCO C;  2P7T C;  1L0L H;  2F43 G;  2CGO A;  2P22 C;  3JAM N;  4YJ2 B;  5LA6 B;  1K4D C;  3K57 A;  4PA7 A;  3E8F A;  3BCC H;  1K97 A;  1Q5O A;  1RSO B;  3A0B Z;  3Q4H A;  1HNZ O;  2QE7 G;  3JAW B;  1EFR G;  1Y76 B;  2YDE A;  5ITZ A;  1KEC A;  3AG3 C;  4F4L A;  4CS3 A;  1E1R G;  4HYO A;  4B3T B;  4G2K A;  3CS5 A;  2ZKO A;  1VQN V;  2EUL A;  3B4S A;  4EFE A;  5IYB O;  2YIC A;  4PA9 A;  3CRA A;  3ZRS A;  5LMN B;  4I9W A;  4LFB O;  3CD6 V;  5CMU A;  1J5E B;  3JD2 A;  4GX2 A;  4N21 A;  3WFV A;  3CB2 A;  4PV1 B;  4JI3 B;  2QWP B;  4LFB B;  3IJ4 A;  2ZE5 A;  4DUZ B;  4TOI A;  1W0J G;  2IJI A;  2PYJ A;  1WP8 A;  2OIG A;  4B3S O;  2Q67 A;  2IW5 A;  5EC2 C;  3LSQ A;  3HB3 B;  2OTL V;  4PJ0 Z;  1B06 A;  4MT8 A;  5BY1 A;  5L3G A;  4JTC B;  1FFT B;  3L9D A;  2DMX A;  5IDJ A;  3BHP A;  3L74 H;  4AI8 A;  1DF5 A;  2VQF O;  1KB9 F;  2FL4 A;  3ZN0 A;  1RFY A;  2HHH O;  2IU0 A;  2PGG A;  2AZ0 A;  3UT5 A;  3VOU A;  1YIT V;  2R72 A;  3EFF K;  5HFL A;  4BR6 A;  3G71 V;  4O4I B;  4OGQ B;  3OGC C;  3AG7 A;  3E2E A;  2KSD A;  3ZJZ A;  5JH7 B;  4J10 A;  1K92 A;  1YIJ V;  2JJ1 G;  3ZHV A;  5JJN B;  1PPJ H;  5FPO A;  3RYI B;  1ROP A;  4K8X A;  1B6Q A;  1VQO V;  1K7D A;  1QNM A;  2F66 C;  4I7Z B;  5B1B C;  2QM4 A;  4BIU A;  4QE7 A;  4O4J A;  4JI7 B;  1SA0 B;  1M93 A;  4XDJ A;  4X62 O;  2MK3 A;  4B08 A;  1QR8 A;  5IT9 N;  2Q8V A;  4FM0 A;  4NKG B;  3K58 A;  1N36 O;  1TGO A;  4GCZ A;  3MAQ A;  1Y67 A;  2UUC B;  2RN9 A;  2YSU B;  3B8N A;  2UUC O;  4F6R A;  1TA8 A;  3ABT A;  5IYZ A;  4TV9 A;  5DED A;  3GVM A;  1XNQ O;  5J2U A;  3DXR B;  1WPX A;  1YF2 A;  1SQQ H;  1QVF U;  2JIZ G;  1K8A W;  1Y74 A;  1Q3E A;  1PNK A;  4LBE C;  4DV4 B;  3K5L A;  5B5E Z;  1MZE A;  5LBQ A;  4JI4 B;  4RQF A;  2UXB O;  5EK0 A;  1PKX A;  5J2U B;  3OE7 G;  2UU9 O;  1OCZ C;  2QM7 A;  3QF7 A;  4Q20 A;  2K9P A;  4NVP A;  3ZX6 A;  2Q9L A;  3F5W C;  4LWS A;  1PNM A;  2WA3 A;  2LJ2 A;  3CCM V;  3ZMS A;  2CTR A;  4DYL A;  2UUA O;  3E83 A;  3L75 H;  3CX5 F;  4NR1 A;  4X1K A;  3FAV B;  2QTS A;  4PA3 A;  4KXR A;  5KAF Z;  1J5E O;  2DJV A;  3T1H O;  2YI9 A;  3JD3 A;  2OTJ V;  4MVO A;  4CH6 A;  5TIS Z;  3FB5 C;  1FXK B;  1BL8 A;  3CXC U;  4DV3 O;  2VRZ A;  4O4H B;  4W4K A;  4EEQ A;  2CH7 B;  1E79 G;  3SYP A;  1SKV A;  1K9M W;  2Q0O C;  3BEH A;  2WWW A;  2DYS C;  3HR0 A;  1NJI W;  4LF7 B;  3RYF B;  2X6B A;  4J9Z B;  4LF5 B;  1ARO P;  1VF6 C;  5KHK A;  4IIJ A;  3J7A U;  5KMG B;  1H8H G;  3KG2 A;  5KMG A;  1DTO A;  3RYH A;  3T1Y O;  2QKS A;  1SA0 A;  3RWR D;  3HKD A;  3E8G A;  3SJA C;  5JH7 A;  3G80 A;  5DN6 G;  2F23 A;  3A0H Z;  4JI5 O;  2PI4 A;  1G1X B;  3W7W A;  1I5X A;  3DSQ A;  4MSW C;  3H01 A;  2ZXW C;  3ASO C;  3CP1 A;  5F2V O;  1GM7 A;  2HHH B;  4U3J A;  2EIN C;  1VP7 A;  2E3C A;  2VQF B;  2BTQ B;  1SET A;  1FFX A;  2B9Z A;  4DR4 O;  4R50 A;  3W7S A;  1N33 O;  2CAZ C;  1L8D A;  2GBO A;  4WFH A;  4YY3 O;  3X2Q B;  5B1O A;  1R3K C;  5LOV B;  2DW4 A;  2MW2 B;  2K1E A;  4MTO A;  5LOV A;  3ETE A;  3RFR A;  4FM2 A;  4X8A A;  4GYC B;  3H1I H;  5CA0 B;  2N05 A;  2JJ2 G;  1GN6 A;  4DV6 O;  3ZHT A;  1EBO A;  1VQL V;  4LF7 O;  3BA9 A;  3L71 H;  3B8M A;  4DV0 B;  2JS3 A;  4UB6 Z;  2WLI B;  1WA8 A;  3CCR V;  1DGS A;  2R9R B;  4MVU A;  5J2T A;  3R66 A;  3JYC A;  3K5O A;  2FKX A;  3K0D A;  3APO A;  3G67 A;  3HPL C;  1VF5 B;  3X2Q C;  5LMU B;  3LDD A;  3RVZ A;  1VAR A;  1P49 A;  1X59 A;  3QNE A;  2OWO A;  1JOY A;  4FFB A;  1Y66 A;  1K5S A;  4D7S A;  3CCS V;  3NXS A;  4FLV A;  2GV9 A;  4FZ1 A;  2UXC B;  4UCU A;  1WP7 A;  4X66 O;  3HKE B;  3FAV A;  3K5M A;  3L73 H;  2UXN A;  5IJ9 B;  4X89 A;  2UU9 B;  2V4D A;  2P4V A;  3CC2 V;  3CXH F;  1P84 F;  4QPJ A;  3H9V A;  4LF8 O;  2IJJ A;  4JAV A;  2CK3 G;  2NR5 A;  1G6U A;  2BOB C;  2JEX A;  4Z2W A;  3OMI B;  3K08 A;  1S5J A;  2KB1 A;  3RYF A;  3BPZ A;  2YXL A;  3FB8 C;  2ITD C;  4U7O A;  1YHQ V;  3AK1 A;  3RYI A;  1SER A;  1Q81 W;  4TQF A;  3D36 C;  5CBG A;  3L70 H;  4QE9 A;  1D5N A;  4CH5 A;  4LCU C;  1TVK B;  3STL C;  4WCE V;  3P32 A;  4Z1M G;  3CRM A;  1FFX B;  2VWJ A;  2M6Y A;  2DWD C;  5KHI A;  4MW8 A;  2EIK B;  4LNU B;  4RQE A;  3S3X A;  5KX5 B;  4H33 A;  2QJ1 A;  4I0X B;  2A0L A;  1GMG A;  4BW5 A;  2HVJ C;  3EHB B;  5GON B;  1AI4 A;  1SQG A;  5FLX N;  3DXR A;  1K4C C;  4Q6G A;  1Z5V A;  1M57 C;  4X66 B;  5LL6 Y;  1XOU A;  3FFQ A;  2LW7 A;  1JVM A;  1XQ8 A;  1GAX A;  1KP3 A;  4DR6 B;  5JVD A;  3JSN A;  3QO8 A;  2QA4 V;  1OZ0 A;  2AW9 A;  1NT2 B;  1KC8 W;  3DTU B;  1VQ8 V;  5LMU O;  1Y6X A;  3LSU A;  4B7E A;  4H0L B;  1HR0 B;  3GWO A;  4CC5 A;  1XUQ A;  1V55 B;  1R6T A;  2ADQ B;  4TT3 G;  1K3E A;  1FXV A;  2ZE7 A;  2FTK A;  3HKE A;  1NH2 D;  2XUM A;  3ASN C;  3D36 A;  4HNA A;  4J41 A;  1RP3 B;  3IAY A;  4BAY A;  4MVM A;  5LYJ A;  2CTW A;  5C93 A;  1AP5 A;  4JI1 O;  4R7C A;  5LYJ B;  4BIZ A;  5D5Q A;  1L1F A;  4MS2 A;  2Z0A A;  1K73 W;  3CCJ V;  2ODM A;  4WFG A;  3WG7 B;  1XMO B;  3OR7 C;  4UUJ C;  2XAG A;  5JWP A;  3ABK C;  4DR3 O;  2JK5 C;  4B3T O;  4YIP A;  5B1A C;  1MNG A;  4XBF A;  4DW0 A;  4FLT A;  2L35 A;  3RW0 A;  4DV0 O;  1THZ A;  3RYH B;  5LHI A;  2PF4 E;  3AG1 B;  1I94 O;  2ZCE A;  4JI4 O;  1KQS U;  4JTD B;  1E1Q G;  4J7K A;  4IGG A;  3OAA G;  1I0H A;  2F1M A;  1JFF A;  4DRX B;  2JGD B;  3E8B A;  4ZOL A;  3SPH A;  3UO2 A;  2W6J G;  5B1N A;  1AP6 A;  1GRJ A;  4O4L A;  3FX7 A;  3RT3 C;  4DR5 O;  4NXM O;  2KG7 A;  5E1A C;  1NVP D;  3NR7 A;  4LR3 A;  3SPG A;  3THO A;  1F7Y A;  4ZBM A;  2LFS A;  4YJ2 A;  1JFF B;  1X4T A;  2EIJ B;  2PY5 A;  3QO5 A;  5BMV A;  3KCX A;  2WLL A;  5H5N A;  4NYK A;  1HNX B;  3M99 B;  2Q4P A;  4JAA A;  4RAI A;  4JF3 A;  3K04 A;  5CN0 A;  5IJ0 B;  4EFB A;  3MHS C;  2HJF C;  2XAS A; 
#chains in the Genus database with same CATH homology
 2E5L O;  2DOS A;  1IBK O;  1HR0 O;  4OPA A;  1HNZ O;  1R6T A;  4X66 O;  4DR2 O;  1FJG O;  3SDL A;  1IBL O;  4LF4 O;  3J81 N;  3J7A U;  2UXC O;  4JI6 O;  1N32 O;  4X62 O;  4YHH O;  1DK1 A;  4DV1 O;  4GKJ O;  2UUB O;  4LF8 O;  3T1Y O;  3O65 A;  5IT9 N;  2ZKO A;  4DR1 O;  3OTO O;  5IWA O;  4A5U B;  1N36 O;  5BR8 O;  4LF5 O;  4JI1 O;  4B3R O;  1HNW O;  4OPH A;  4LFC O;  4JI5 O;  2UUC O;  1G1X B;  1R1B A;  1FYJ A;  1N34 O;  4LF6 O;  4LFB O;  2N74 A;  4LF9 O;  2Z0A A;  1D2D A;  5BXZ A;  4DV7 O;  4DV2 O;  4NXN O;  1XNQ O;  4JI7 O;  5LMN O;  4B3S O;  4DUZ O;  1AB3 A;  4DR3 O;  4OX9 O;  4B3T O;  4B3M O;  4DR4 O;  4JI3 O;  1N33 O;  4YY3 O;  1AIL A;  4DV0 O;  4X65 O;  4JYA O;  2UXB O;  1I94 O;  5A2Q N;  2UXD O;  1A32 A;  2UU9 O;  4JI4 O;  4DV5 O;  4DV6 O;  2AGA A;  4JI2 O;  5BY1 A;  4GKK O;  2JRI A;  4AQY O;  4LF7 O;  1IBM O;  4KHP O;  4JI0 O;  5FLX N;  4X64 O;  2UUA O;  3RT3 C;  3J80 N;  4K0K O;  3R66 A;  4DR5 O;  4NXM O;  1XMQ O;  2FKX A;  1YZB A;  5LL6 Y;  2VQF O;  2ZM6 O;  4JI8 O;  2LW7 A;  4DUY O;  2HHH O;  1F7Y A;  1J5E O;  1NS1 A;  2DJV A;  3F5T A;  4DV4 O;  3T1H O;  1FKA O;  1KUQ A;  1X59 A;  1HNX O;  2F4V O;  5H5N A;  1XMO O;  3JAM N;  4DR7 O;  4DV3 O;  1XEQ A;  5LMU O;  3M8A A;  1XNR O;  4JV5 O;  4DR6 O;  4LFA O;  2VQE O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...