1URFA

Hr1b domain from prk1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
GIPATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQADQLENQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C-LIKE 1
publication title Molecular Dissection of the Interaction between the Small G Proteins Rac1 and Rhoa and Protein Kinase C-Related Kinase 1 (Prk1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 81
sequence length 81
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02185 HR1 Hr1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1urfA00
2RMKB 4NB5A 4IGGA 1US6A 1CXZB 1RFYA 4DYLA 1URFA 2HJDA 4NKGB 2Q0OC 1UPGA
chains in the Genus database with same CATH superfamily
1WJZA 2WLLB 1P49A 1M5IA 4LNUB 3QF7A 1Y76B 2IH3C 4TQDA 4O2AA 2M6YA 4GKKB 4QPKA 4AI8A 2XHBA 5KAFZ 4I5SA 2XAFA 4UVCA 1E1RG 3VQVA 2F4VO 3AG1B 3M99B 1J5EO 2JVDA 4P2ZA 2OYQA 2LQTA 4YY3O 1MABG 1BMFG 2RMKB 3ZN1A 4AQYO 2QEXV 3N2GA 4X1YB 3X2QB 2EJ7A 1CPYA 3CCSV 3APOA 4DUYO 4MVMA 3E2EA 4W4KA 1K4CC 3G6BA 4RO2A 1AILA 2QTOA 3MHHC 2YIAA 4JYCA 5LMUO 5B5EZ 1GMGA 1M9NA 3JSLA 3FKSG 5BXZA 1B04A 4I55B 1WB8A 1R73A 3RYIB 2M7WA 2RQ6A 1K7DA 2IW5A 3A0BZ 3QNEA 1TUEB 1K92A 4IHJA 2A3QA 1XHXA 5E79Z 3SDLA 4GZRB 1DF4A 4GUNA 4JI4O 3E22A 4IT5A 2E5LB 2BSKA 5FLXN 3CMEV 3BHPA 2LGQA 1H2KA 4FJCC 1COWG 1DGSA 3NR7A 3C3TA 3K58A 2LGWA 2IJIA 1AB3A 1KKCA 4OX9B 3AG4B 3K5NA 1Q7YW 3CCQV 1E79G 1JFFB 1R3KC 5IYCO 2IJJA 2W0FC 4L8JA 1G6UA 1M57B 3RYFB 3QVNA 1PKXA 1KBHA 2PF4E 3CX5F 2YDEA 2FMLA 3R65A 4OXSA 2AHYA 1Y74A 4KXRA 1N32O 3K79A 1N0NA 2QA4V 5LHHA 4FFBA 2WLJA 5CA3A 5E1AC 4ZKIA 1VQOV 4MVRA 3M7MX 5KHGA 5H6RA 5JJJB 5EBLC 3BPZA 2OIGA 4DR6O 1THZA 2YXYA 4TV8A 2XUMA 2OCHA 5KMGB 4BIOA 4NTXA 1AR5A 2NLJC 1BE3H 4B3RB 1F7YA 4K3AA 4UVAA 3H1HH 4LFAO 4JI3B 1EZVH 1ZTEA 2QWQB 3OMIB 3HB3B 1WB7A 4LF7B 3SPJA 1IBMO 1M4UA 5IWAB 4LF6B 2JDIG 1KYOF 2Y0PA 2VWJA 4NXMO 2ZKOA 5IY5B 2B9ZA 5HFLA 2EZPA 3QG5A 3LNNA 3ZEDA 4LF9B 2WLNA 5IYBO 3I56V 2IBZH 1YJWV 3ZBHA 1HNXB 1SQPH 2QJ1A 3L71H 4DR4B 4K8ZA 3OR6C 1SRYA 3HKCB 4X1IA 5KAIZ 1K34A 4FLZA 1UJWB 3B4SA 4QE7A 1H8EG 4QNHB 4ICGA 2P6JA 1JCHA 2PYLA 1FFXB 4U3FH 2D2CB 2YI8A 3ZRWA 1NVPB 2LP7A 1O9HA 3OFNG 4DUZB 1P7BA 1K8AW 1BGYH 2QWNB 3ABKC 2UXCB 4FZ1A 2HP8A 1NQTA 5LOVA 4ZIBA 1OCZB 2HG5C 3W7XA 1KQSU 1P4RA 2Q8VA 3N2KB 1OHHG 4FM1A 5EBWC 4DR3O 1ENVA 1SF9A 4QPJA 3T2MA 1FJGO 4UCVA 1ZSPA 3W7SA 1PL0A 3OM3B 3GB7C 3IGAC 4PJ0Z 2Q68A 1I08A 2Q0OC 3OEHG 4ASUG 4I4TA 1M90W 3CE2A 1TA8A 3Q4HA 2Q0AA 1RPRA 3CCMV 1K9MW 5EYPB 1VQPV 1SA0A 1FXVA 4D7SA 3L74H 2CE4A 4IIJA 2IU0A 3B77A 4DV7O 1W2BU 2Q4PA 1YTFD 5ITZA 3JASA 4LC1A 1M56C 1XMOB 3E83A 1CXZB 2VQFB 3T4DA 3LNMB 5KHKA 4IL6Z 4NXNB 4EKWA 4DR2B 4I50A 3FB5C 1H38A 1SETA 4N23A 3OT7A 1HNZO 1I5XA 4DV5B 1XNRB 2Y0IA 2YUAA 3E35A 4UCUA 1VF5B 1N33B 1GH6A 2N05A 3UQ8A 4YJ2A 4FLUA 4TWKA 3F7YC 2HKOA 2QM8A 2WAMA 4GT1A 1QLNA 3JCZA 5JCOC 1ZAUA 1TUBA 4P9PA 3SYCA 1OCRC 1JA8A 2HJFC 1Q6IA 4W4LA 1PNLA 2AXTZ 3WG7B 5IYZB 2ZM6B 4TUYB 2P90A 3EVKA 3RYCB 1Q8IA 4NB5A 5KA6A 2GSMB 5FPRA 2EILC 3K06A 2GUZA 5LXTA 1ZL8B 2DW4A 1NU1H 2UUAB 1KP2A 1AR4A 3BEHA 1DLBA 3CJHB 2AGAA 4DV6B 4MTOA 4PD4F 3RWRD 1GN4A 3JD3A 3WFVA 5GTIZ 4PHZA 1V54C 2HVJC 3FAVB 2NN4A 3FYIB 5C93A 4YHHO 2ITCC 2Q69A 4GX0A 4J10A 1VQ9V 1V55C 1BHAA 5BY1A 1PM9A 3BY6A 5FNVB 5LP6C 1R3IC 2VWKA 5F2VO 1JJ2U 2PZSA 2AZ0A 3CXCU 1TVKA 4PELA 1Y6XA 2OT5A 3ABTA 5JCOA 2O57A 4JYBA 2A9HA 4J7KA 4E4EA 1D5AA 1L0NH 5BR8B 5DEDA 4O4LA 1BHBA 3L9DA 3SYOA 3SJQC 4ZI7B 4YIOA 1Z5WA 4BIZA 3KKYA 3OTOB 4CC5A 4DV4O 1IBKB 1BS3A 3ZMUA 2YIBD 3TJTA 3U0ZA 1N0JA 1H2NA 4L87A 1RPOA 4JI1B 1QLEC 1IXMA 2YEVA 4B3MB 5D5QA 1JR9A 2EIMC 1RSOB 5HFMA 4HAMA 2X6AA 2DYSC 4BWAA 5CA0A 1HR0O 1KECA 4F6RA 1XMQB 1NVPD 4DV3O 2AHZA 2KQXA 4UB8Z 1R1BA 5LP6A 3LUTB 2K1EA 1MSWD 3G80A 3OUSA 2R72A 3CHXA 1J5EB 3A0RA 1VQ5V 4DV1B 5DN6G 4LR3A 2GHYA 4X1KB 2ETNA 4FMTA 1T5EA 3AK2A 4AQYB 4PDLA 1H2LA 2EX3A 2XTAA 5J9PC 5L3BA 4IGGA 2UUCB 2B1GA 1ZWIC 1XNQO 1MMMA 2PY5A 2F1MA 3K5OA 4JI2O 3UT5B 3TXSA 2EIKC 1OCOC 5LMUB 1PNKA 4O4HA 5DM6V 3UO3A 1XL4A 1BQZA 3FB6C 1P84F 2JS5A 3CRQA 1GAXA 4BR6A 1VARA 2HLDG 1N34B 3BA9A 4JI0O 1AI4A 3JCUZ 4D6TH 2OCCC 5D5PA 4JI6O 2QKCA 4ZHQB 4JI4B 2A0LA 4MSWC 3ICXA 5BMVA 2QKAA 4DV0B 5EC1C 4JI8B 5J2UA 1JOYA 1RM1C 1R6TA 2NNUA 4BAYA 3ABLC 2DYRB 4EFEA 4LNUA 3ZHUA 4GKJO 5B3SB 1BZKA 4LF4B 1JJOA 1Y76A 2LW1A 2XASA 1KD1W 4XDLA 4FM2A 4JPRA 4X62O 2PI5A 4DR5B 2OTLV 3WU2Z 4AHCA 2WLMA 3CCEV 3DTUB 5K1XA 5L3CA 3HKBA 4HYOA 4BIUA 3L73H 4B3SO 1SESA 1XREA 1MA1A 1MOFA 3ABUA 4DV2O 4UCTA 5JH7A 1LUVA 2H94A 5J2TB 2DN9A 2PYJA 3KCXA 4U3JA 4X1YA 2IU3A 1FKAO 5JVDB 1QU7A 2W0XA 2B1IA 4DR6B 4ZBMA 3OR7C 2ZXWB 2V1DA 1GN3A 5LYJA 5FL7G 1EN4A 1JVMA 1YHQV 3HKDA 4LFAB 4JI7B 2YS8A 5H5NA 1W0KG 5KX5A 3RGBA 1IBMB 1WNSA 5A9GA 4JZ2A 4XBFA 3JAKB 2YICA 4B3TB 1QR8A 4GYCB 4EB6B 2BTQA 2XT9A 3RBZA 4X66B 4FPPA 1WA8B 3PN1A 3JARB 3ZIAG 4NTWA 4LFBO 1NT2B 4RUFA 4P9OA 2Q7HA 2X6CA 1HDJA 1K3EA 3CXHF 4I0XB 2PGGA 2C2AA 3TCUA 4LFCO 3TK1A 4D7TA 1N36O 3OMNB 4DK1A 1SQBH 5EC2C 4CS2A 1W59A 1QQCA 1NH2B 3CCUV 3JAMN 1I94O 3G4SV 4Z1VA 3ZHVA 2ODMA 2AZ2A 3VQYA 4O2AB 1WPBA 4TSFG 2Q6AA 1Z2GA 3JALA 3RYHA 3BFRA 3CC7V 3CEIA 4Q20A 3SR2C 1S5LZ 3OTFA 2ZE7A 3ABLB 2K9PA 2EINB 1FXHA 2Y48A 4PA4A 2QSAA 1TAEA 4I9QA 1H8HG 4TV9A 4A5UB 4DYLA 1EBOA 2E74B 2R9AA 1SERA 1OJHA 4JTDB 4WF9V 4FVMA 2YC0A 2QKSA 2DMXA 4J41A 1FJGB 1B6QA 4YIPA 4JTCB 3UKMA 3JD1A 2ZNIA 1NZ6A 1Q86W 1IZ3A 3DC6A 4C7UA 3JSNA 3AEIA 4PA9A 4EFBA 3S3XA 3UO2A 2EJRA 4QE9A 3JATA 2DJVA 4BW9A 1IVSA 3ZS8C 4ZOLA 3ZHTA 4IHJB 2HFEC 4GCZA 3FB8C 3TETA 1Q6HA 2CTQA 4MT8A 4K0KO 5B1BC 1SC5B 3K59A 2YIBA 2EIJC 1OZ0A 2PTMA 3E22B 1M93A 2L35A 4UCSA 4NTYA 2BSKB 2QE7G 5GONB 1R6NA 4FLXA 2QM7A 3P3PA 2QR4A 2BCCH 3BRCA 1K4DC 1R3JC 1WAZA 3ZN0A 1NS1A 3ASNC 1WP8A 2ATKC 4PI2A 1HNZB 4PV1B 5JQGA 2CTPA 1L1FA 2X0LA 3E8FA 1FD9A 1US6A 3JD2A 4XDKA 4GKKO 3ZX6A 1NBMG 3I55V 1YZBA 2JK5C 3CSXA 2XAGA 1K5SA 3DC5A 5JWPA 1Y74B 1RFYA 2W6JG 1WP7A 4JAVA 3HKEA 1AJQA 2L6LA 1LUWA 3QO8A 4KFMA 4CH3A 2H8PC 2P4VA 3UM7A 4MTFA 2X7RB 4TV8B 5LMNO 5B1AC 2XNDG 5CA1A 3LSSA 1XL6A 4G27B 1QVGU 5LHGA 3QTCA 4Q6GA 1AI6A 1U97A 4MVQA 3QO5A 2WLKA 4X8AA 3QO7A 4LF5B 1B06A 3H9VA 5CB4A 4JV5O 3F5WC 2XAHA 4LP8A 3JD4A 4O4JA 4HBNA 5IYDO 3WB2A 1VQ7V 3LDDA 2ITDC 2BE3A 5IJ9A 5L3FA 2HJDA 1XQ8A 1BQ0A 1VMGA 1ORQC 2LJ2A 3J80N 4J7ZA 3ABMC 2ZD9A 1KP3A 4O2BA 4R8CA 1CEZA 2XOKG 2JS3A 4OX9O 5TISZ 1G8MA 4X1IB 3AK3A 1HP8A 3CCVV 1YEWA 1FXKA 1VF6C 3GVMA 2KKWA 1OCCC 4DV4B 4DW1A 1EN5A 4X64B 3ZRWB 4UV9A 1KU9A 1ZX3A 3MDSA 3STLC 2UXDO 1QR9A 4QGPA 1NH2D 4H37A 3FD9A 1H2SB 2UXBB 3K9SA 5LOVB 1HR0B 1HNWO 4Z2WA 3JAWA 4K35A 5DECA 4DV3B 2Y69C 3ZMVA 4MVUA 3ZRSA 2LW7A 2IJKA 4X20A 1GN2A 1YDXA 4JI3O 4DRXA 3AG2C 2OWOA 2KG7A 4X65B 4LF7O 5EZYA 2JGDA 1K33A 2P5OA 5IWAO 4PA3A 4HNAA 5LL6Y 4FFKA 5KHHA 5CBHA 3BA8A 4PA7A 1IX9A 4I4TB 2A06H 3Q4HB 1Q3EA 2JEUA 4OGQB 1SA0B 2GBOA 2CDYA 5C8YA 3U10A 5B1OA 2CUGA 5L3GA 4LF9O 4IIJB 2ZE6A 4H44B 3OGCC 3P30A 1NR7A 4J80A 1VF6A 4UV8A 5ITZB 4GLXA 1IBLO 1GKFA 2ZIOA 3JASB 4NR1A 2JJ2G 3S3WA 3SYAA 3A2FA 4DR1O 1SKVA 4CH6A 4WFEA 2LO1A 1L0LH 4I50B 4KUMA 1G1XB 1KB9F 2W6IG 3ABKB 4UXNA 1FAFA 1YI2V 3SYQA 2WLIA 3DXRA 4MW8A 3AG3C 1Q90D 5BZBA 3OEEG 3OUFA 2R9RB 4YJ2B 4MVZA 2QWOB 1TGOA 4GKJB 1TUBB 3BCCH 4LF8O 2UXCO 1CP9A 1X4TA 2ZT9B 4P30A 4F4LA 3E8GA 4WFGA 4UUJC 1XI1A 1NI8A 3ZHQA 4X62B 2CAZC 5IDJA 3SPCA 4JTAB 1NR1A 3O65A 2GUZB 3MD0A 1YVWA 4DR7B 5LXTB 1YSCA 1H2GA 3CRCA 2Y4TA 3ASOC 3KG2A 3W7UA 4H33A 4U7NA 3K0GA 1MG1A 2A7WA 1M56B 4LH6A 3FX7A 1SQGA 4LWSA 4O4IA 3ZMTA 3E8HA 3D3QA 4G2KA 2P06A 5H9CA 1PPJH 2XAQA 1EM1A 2DE0X 2WWWA 1HW7A 2E3CA 3KCYA 4JI5O 1YITV 2ILMA 1XMOO 3ETQA 3ETDA 1JPXA 4MW3A 3IFXA 2F4VB 1TVKB 3AG2B 4DR2O 1VQ4V 1AP5A 1L8DA 4HZ3A 3H1IH 1AI5A 1OCRB 3CWBH 1BSMA 1NTKH 5IJ0A 4YY3B 1XNRO 1YXBA 4J11A 1XDCA 4LFBB 2CH7A 1JX9A 4E2LA 2UXXA 1NKDA 4O4LB 1N33O 5KUKA 2EILB 1QCEA 4NYKA 4DUYB 1FS0G 3AG1C 4CS3A 4LFCB 5JJEB 1E1QG 3LDCA 4GX5A 1URFA 4N21A 2YI9A 3CD6V 5LA6A 2ZM6O 3F5TA 4WBNA 1Q82W 4KL1A 3X2QC 3CCLV 1V54B 1EFRG 3C90A 2YEVB 1PP9H 3CYOA 1S72V 4YJ3A 4CBCA 2Q7GA 2F66C 2DOSA 3JD0A 2UUAO 1S76D 1V55B 3ML0A 2UU9O 5CA0B 1F4MA 5LBQA 4F6RB 4DV6O 4MVSA 3TXQA 1QBZA 4OPAA 3AG7A 2V7QG 3H01A 3RT3C 1S5HC 5LP6B 5LGNA 2CGOA 3VQWA 2WLLA 3RVYA 1GO3F 2ZE5A 2A79B 5KLVH 3T1CA 1FPOA 3CRMA 1W0JG 4JAUA 3IC9A 3CCRV 1YF2A 3T1YO 1QHTA 4LCUC 3OE7G 2Y4UA 1I5YA 3CS5A 1S0VA 3VQXA 3IC7A 4BW5A 1BCCH 2UUBO 1NJIW 4X9QA 3R66A 1S5JA 4UB6Z 5L3DA 2E76B 3H1JH 4DO2A 3L75H 4I7ZB 3AG4C 4KHPO 1N32B 3H1LH 3A8TA 4O4HB 1QVFU 2JGUA 1F23A 3AK1A 3GWKC 1QLEB 3JARA 3MHSC 4KP4A 4WFFA 2EIMB 2Z3YA 2MK3A 2DYSB 4JYYA 3SJCC 1O9GA 3N27A 4K0KB 3OTOO 3K03A 5BMVB 1SQFA 3H1KH 4WFBV 3CPWU 3LDEA 1WLEA 1SZTA 2E75B 5J2UB 5KHJA 4U7OA 1F4NA 3ETEA 5IE9A 4WCEV 4I55A 4CZZA 4B3MO 1XOUA 3RYIA 1GN6A 2HR3A 2BTOA 3HPLC 2HHHO 3K9AA 3SPHA 4FLWA 2EBOA 4AILC 4Z1MG 4RUEA 4NXMB 1H2MA 3SJBC 1XMQO 1KUQA 1PD3A 3CRAA 3HKBB 3LSQA 1R3LC 1MZFA 1Y66A 2YIDA 3P32A 5LGUA 2VRZA 4DV1O 5JH7B 2EIKB 2GTAA 1DTOA 1VEWA 1OCOB 3APQA 1AR1B 4TT3G 4PDVA 1JFFA 5IY5C 3CC4V 3K0DA 4U3JB 1XBLA 4JYAO 2H3OA 4CH5A 1LR1A 2QDOA 4J7JA 1PNMA 5EK0A 4RQEA 1KKDA 3RYFA 2UUCO 3ZRVA 5LMNB 1IURA 2OCCB 2FYUH 1YTFB 4JGSA 2KB1A 1VP7A 4JF3A 5LYJB 5LGTA 3HKDB 2Q7EA 5IT9N 1RM1B 4JV5B 3B2EE 3K08A 4UVBA 5KX5B 3T1HO 1R6KA 1MNGA 3VBBA 2RN9A 2ZNJA 4K8XA 1ZUQA 3CRRA 1XILA 1N34O 4B08A 5KMGA 2BTQB 2ZR3A 5GW7A 4DR3B 3N2GB 4DV0O 2XAJA 4JI8O 5GONA 2JEXA 4I9WA 1NTZH 2P67A 3ZHRA 4RQFA 4DK0A 1VQ6V 4LF4O 1OCZC 1Y67A 4F6EA 1YIJV 1N8RW 2VS0A 2VQEO 2WA4A 5KUMA 2P4KA 4DR5O 1M1KW 2ADPA 2MW2B 3D3IA 1WN7A 4DV7B 1SQVH 2JRIA 5A2QN 3MAQA 2IH1C 2NR5A 3JALB 4IYHA 3RYHB 2ZINA 3BABA 1DF5A 2UXDB 2F23A 4B7KA 2JJ1G 3HKCA 1YJ9V 5EIBD 2P7TC 3IJ4A 3K5LA 2LFRA 1AJNA 1HNWB 4TV9B 3P3NA 1FFXA 1K97A 3THOA 3D8CA 4FIPC 3ZCCA 4JI7O 1SQQH 1Q43A 4EEQA 1PL4A 3B40A 4B3TO 3LSUA 3OW2U 5K1PA 2GDSA 4UCRA 1FFTB 3JATB 4RAIA 4X66O 3N2KA 3FFQA 4FFBB 4UFZA 3WB0A 2ZQMA 1LNQA 3OAAG 2Z0AA 1FXKC 2FKXA 5B66Z 3CCJV 2GTSA 2RJZA 5CN0A 4J9ZB 4ZOLB 1V9PA 3J81N 1IBLB 1J95A 1NTMH 1Q6UA 2JIZG 1K73W 2CGNA 3WG7C 3L70H 2BOBC 2ARHA 1P7GA 4H13B 4DR1B 1AROP 4NKGB 1X59A 1XUQA 5EYPA 1Q81W 4YHHB 3CMAV 3K04A 5JQGB 2ZE8A 3CC2V 1IXBA 2G38A 4H0LB 3K3WA 4FZ0A 5B1NA 3FB7C 1Y4MA 2E5LO 1ROPA 4PA6A 1XEQA 3JYCA 2RNBA 4LF8B 3SPGA 3A0HZ 1N4CA 2IM9A 3W7TA 2GV9A 3EFFK 1U96A 4OPHA 2RDCA 4PDMA 3HKEB 3RN4A 3C3SA 4MTXA 5JJNB 1VF7A 1ZLZA 1D5NA 3OGIB 4YXWG 2HEPA 1HWYA 3IAYA 2EULA 5CA1B 3ZMZA 2YXHA 2DQ3A 2QM4A 2QWPB 2EZOA 3FYEB 4QIWF 4FLVA 5B1BB 2X6BA 4CH4A 5IYZA 2EIJB 4TUYA 3RYCA 2Q5ZA 5CB4B 1Z5VA 2N74A 4TQFA 3B8NA 4O4JB 1Q5OA 1ZL8A 2Q67A 3ASNB 2WPDG 4JZGA 3CJHA 1GTOA 4JI5B 3W7WA 1GM7A 3B8MA 5IJ9B 1VQMV 3E86A 4B3RO 3FAVA 3CP1A 1KMIZ 3I5DA 3OMAB 1XHZA 3K57A 3GWOA 2WLHA 4UCOA 4LH7A 3ZHSA 2PUSA 4LF6O 4O2BB 3UCSC 3U11A 5L3EA 4MTGA 2OTJV 1F51A 4LBEC 2YXLA 2LFSA 1AI7A 1BT8A 5FNVA 1S77D 5EBMC 2Q9LA 1SS3A 3J7AU 1FXKB 1WPXA 1XNQB 4JI2B 2F93B 3WB1A 1HNXO 5B1AB 3CB2A 1GK9A 2R9IA 4DR4O 4XDJA 1VQKV 2D3OW 4JI0B 1EZJA 4ZI7A 3K5MA 3SYPA 4JI6B 2UU9B 2FL4A 1MZEA 3JAWB 4RWUA 1UFIA 2DQ0A 4X89A 5LHIA 3BVOA 1YJNV 4IYIA 4X20B 5AG2A 4DRXB 5EIBC 4DUZO 3D36C 4LF5O 2KG7B 3HR0A 1AJPA 2IJHA 5EZYB 1RSOA 2JGDB 1B3QA 1VQNV 3ABMB 4HNAB 1QNMA 3T1YB 1VQLV 3EHBB 1I7FA 1VQ8V 2AW9A 3T4ZA 2QGNA 1A32A 2UUBB 5C8YB 2DYRC 1AVMA 4B3SB 4J42A 1JQ0A 5B3SC 4DV2B 1OCCB 2CK3G 4PI0A 4KHPB 1SQXH 3EXAA 4X1KA 4R6ZA 1IDSA 5FPOA 1RP3B 2PI4A 2DWEC 4PDRA 1UPGA 2WLIB 3DGEA 3DXRB 4R50A 3UT5A 1GRJA 2ZIMA 4X64O 1I0HA 2Y69B 3G67A 2ZDIC 4J9YB 4GX1A 2VQFO 1BL8A 2DWDC 3G71V 4NXNO 2HHHB 3D36A 1S3JA 2QTSA 4TOIA 1KC8W 2UXBO 2ZXWC 4NVPA 4FK5C 2FB5A 4ZHQA 4DV5O 1DK1A 4JAAA 1PV0A 4CS4A 3E89A 5KA5A 4X65O 1N36B 5H2FZ 4FM0A 2WA3A 2ZR2A 2HVKC 5KHIA 1AP6A 4R7CA 5CMUA 5CBFA 5GTHZ 3KZIZ 3ZRXA 4JYAB 4LWSB 1VIBA 3RFRA 2R70A 4O4IB 2ADQB 3O9OA 3SJAC 3L72H 1I94B 2YSUB 2CTRA 3OD4A 1YCIA 3M8AA 2OIEA 5CBGA 3AG3B 1GM8A 3DSQA 2P22C 3ZJZA 3STZC 5J2TA 3E8BA 4ABMA 4X88A 2ZDIA 3T1HB 3VOUA 3B09A 3F7VC 3TGUH 3RVZA 1FYJA 5JVDA 4MVOA 1JMKC 1OV9A 2N04A 2Z5UA 2BOCC 3SGIA 3RW0A 5IJ0B 3ZMSA 4DXWA 2CH7B 2WSSG 4FLTA 3PJSK 2B5UA 4DW0A 4GX2A 2RCVA 2EINC 2QWRB 4CC6A 3JAKA 5H6QA 2KSDA 4G28B 2UXNA 3ASOB 2F43G 2CTWA 5LA6B 3NXSA 4EB6A 4WBNB 4B7EA 1WA8A 2VQEB 4WFHA 2ZCEA 2Q73A 2FTKA 3ETGA 5BR8O 4WFAV 1EN6A 4FLYA 4YJ3B 4JASA 2F95B 1M57C 4DR7O 1SZXA 4QJFB 4I0XA 3SPIA 1K5QA 1MSDA 1IBKO 2V4DA 3BAAA 1D2DA 1G4YB 4MS2A 3G6EV 1GM9A 4JI1O
chains in the Genus database with same CATH topology
2RMKB 4NB5A 4IGGA 1US6A 1CXZB 1RFYA 4DYLA 1URFA 2HJDA 4NKGB 2Q0OC 1UPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMK B;  4NB5 A;  4IGG A;  1US6 A;  1CXZ B;  1RFY A;  4DYL A;  1URF A;  2HJD A;  4NKG B;  2Q0O C;  1UPG A; 
#chains in the Genus database with same CATH topology
 1WJZ A;  2WLL B;  1P49 A;  1M5I A;  4LNU B;  3QF7 A;  1Y76 B;  2IH3 C;  4TQD A;  4O2A A;  2M6Y A;  4GKK B;  4QPK A;  4AI8 A;  2XHB A;  5KAF Z;  4I5S A;  2XAF A;  4UVC A;  1E1R G;  3VQV A;  2F4V O;  3AG1 B;  3M99 B;  1J5E O;  2JVD A;  4P2Z A;  2OYQ A;  2LQT A;  4YY3 O;  1MAB G;  1BMF G;  2RMK B;  3ZN1 A;  4AQY O;  2QEX V;  3N2G A;  4X1Y B;  3X2Q B;  2EJ7 A;  1CPY A;  3CCS V;  3APO A;  4DUY O;  4MVM A;  3E2E A;  4W4K A;  1K4C C;  3G6B A;  4RO2 A;  1AIL A;  2QTO A;  3MHH C;  2YIA A;  4JYC A;  5LMU O;  5B5E Z;  1GMG A;  1M9N A;  3JSL A;  3FKS G;  5BXZ A;  1B04 A;  4I55 B;  1WB8 A;  1R73 A;  3RYI B;  2M7W A;  2RQ6 A;  1K7D A;  2IW5 A;  3A0B Z;  3QNE A;  1TUE B;  1K92 A;  4IHJ A;  2A3Q A;  1XHX A;  5E79 Z;  3SDL A;  4GZR B;  1DF4 A;  4GUN A;  4JI4 O;  3E22 A;  4IT5 A;  2E5L B;  2BSK A;  5FLX N;  3CME V;  3BHP A;  2LGQ A;  1H2K A;  4FJC C;  1COW G;  1DGS A;  3NR7 A;  3C3T A;  3K58 A;  2LGW A;  2IJI A;  1AB3 A;  1KKC A;  4OX9 B;  3AG4 B;  3K5N A;  1Q7Y W;  3CCQ V;  1E79 G;  1JFF B;  1R3K C;  5IYC O;  2IJJ A;  2W0F C;  4L8J A;  1G6U A;  1M57 B;  3RYF B;  3QVN A;  1PKX A;  1KBH A;  2PF4 E;  3CX5 F;  2YDE A;  2FML A;  3R65 A;  4OXS A;  2AHY A;  1Y74 A;  4KXR A;  1N32 O;  3K79 A;  1N0N A;  2QA4 V;  5LHH A;  4FFB A;  2WLJ A;  5CA3 A;  5E1A C;  4ZKI A;  1VQO V;  4MVR A;  3M7M X;  5KHG A;  5H6R A;  5JJJ B;  5EBL C;  3BPZ A;  2OIG A;  4DR6 O;  1THZ A;  2YXY A;  4TV8 A;  2XUM A;  2OCH A;  5KMG B;  4BIO A;  4NTX A;  1AR5 A;  2NLJ C;  1BE3 H;  4B3R B;  1F7Y A;  4K3A A;  4UVA A;  3H1H H;  4LFA O;  4JI3 B;  1EZV H;  1ZTE A;  2QWQ B;  3OMI B;  3HB3 B;  1WB7 A;  4LF7 B;  3SPJ A;  1IBM O;  1M4U A;  5IWA B;  4LF6 B;  2JDI G;  1KYO F;  2Y0P A;  2VWJ A;  4NXM O;  2ZKO A;  5IY5 B;  2B9Z A;  5HFL A;  2EZP A;  3QG5 A;  3LNN A;  3ZED A;  4LF9 B;  2WLN A;  5IYB O;  3I56 V;  2IBZ H;  1YJW V;  3ZBH A;  1HNX B;  1SQP H;  2QJ1 A;  3L71 H;  4DR4 B;  4K8Z A;  3OR6 C;  1SRY A;  3HKC B;  4X1I A;  5KAI Z;  1K34 A;  4FLZ A;  1UJW B;  3B4S A;  4QE7 A;  1H8E G;  4QNH B;  4ICG A;  2P6J A;  1JCH A;  2PYL A;  1FFX B;  4U3F H;  2D2C B;  2YI8 A;  3ZRW A;  1NVP B;  2LP7 A;  1O9H A;  3OFN G;  4DUZ B;  1P7B A;  1K8A W;  1BGY H;  2QWN B;  3ABK C;  2UXC B;  4FZ1 A;  2HP8 A;  1NQT A;  5LOV A;  4ZIB A;  1OCZ B;  2HG5 C;  3W7X A;  1KQS U;  1P4R A;  2Q8V A;  3N2K B;  1OHH G;  4FM1 A;  5EBW C;  4DR3 O;  1ENV A;  1SF9 A;  4QPJ A;  3T2M A;  1FJG O;  4UCV A;  1ZSP A;  3W7S A;  1PL0 A;  3OM3 B;  3GB7 C;  3IGA C;  4PJ0 Z;  2Q68 A;  1I08 A;  2Q0O C;  3OEH G;  4ASU G;  4I4T A;  1M90 W;  3CE2 A;  1TA8 A;  3Q4H A;  2Q0A A;  1RPR A;  3CCM V;  1K9M W;  5EYP B;  1VQP V;  1SA0 A;  1FXV A;  4D7S A;  3L74 H;  2CE4 A;  4IIJ A;  2IU0 A;  3B77 A;  4DV7 O;  1W2B U;  2Q4P A;  1YTF D;  5ITZ A;  3JAS A;  4LC1 A;  1M56 C;  1XMO B;  3E83 A;  1CXZ B;  2VQF B;  3T4D A;  3LNM B;  5KHK A;  4IL6 Z;  4NXN B;  4EKW A;  4DR2 B;  4I50 A;  3FB5 C;  1H38 A;  1SET A;  4N23 A;  3OT7 A;  1HNZ O;  1I5X A;  4DV5 B;  1XNR B;  2Y0I A;  2YUA A;  3E35 A;  4UCU A;  1VF5 B;  1N33 B;  1GH6 A;  2N05 A;  3UQ8 A;  4YJ2 A;  4FLU A;  4TWK A;  3F7Y C;  2HKO A;  2QM8 A;  2WAM A;  4GT1 A;  1QLN A;  3JCZ A;  5JCO C;  1ZAU A;  1TUB A;  4P9P A;  3SYC A;  1OCR C;  1JA8 A;  2HJF C;  1Q6I A;  4W4L A;  1PNL A;  2AXT Z;  3WG7 B;  5IYZ B;  2ZM6 B;  4TUY B;  2P90 A;  3EVK A;  3RYC B;  1Q8I A;  4NB5 A;  5KA6 A;  2GSM B;  5FPR A;  2EIL C;  3K06 A;  2GUZ A;  5LXT A;  1ZL8 B;  2DW4 A;  1NU1 H;  2UUA B;  1KP2 A;  1AR4 A;  3BEH A;  1DLB A;  3CJH B;  2AGA A;  4DV6 B;  4MTO A;  4PD4 F;  3RWR D;  1GN4 A;  3JD3 A;  3WFV A;  5GTI Z;  4PHZ A;  1V54 C;  2HVJ C;  3FAV B;  2NN4 A;  3FYI B;  5C93 A;  4YHH O;  2ITC C;  2Q69 A;  4GX0 A;  4J10 A;  1VQ9 V;  1V55 C;  1BHA A;  5BY1 A;  1PM9 A;  3BY6 A;  5FNV B;  5LP6 C;  1R3I C;  2VWK A;  5F2V O;  1JJ2 U;  2PZS A;  2AZ0 A;  3CXC U;  1TVK A;  4PEL A;  1Y6X A;  2OT5 A;  3ABT A;  5JCO A;  2O57 A;  4JYB A;  2A9H A;  4J7K A;  4E4E A;  1D5A A;  1L0N H;  5BR8 B;  5DED A;  4O4L A;  1BHB A;  3L9D A;  3SYO A;  3SJQ C;  4ZI7 B;  4YIO A;  1Z5W A;  4BIZ A;  3KKY A;  3OTO B;  4CC5 A;  4DV4 O;  1IBK B;  1BS3 A;  3ZMU A;  2YIB D;  3TJT A;  3U0Z A;  1N0J A;  1H2N A;  4L87 A;  1RPO A;  4JI1 B;  1QLE C;  1IXM A;  2YEV A;  4B3M B;  5D5Q A;  1JR9 A;  2EIM C;  1RSO B;  5HFM A;  4HAM A;  2X6A A;  2DYS C;  4BWA A;  5CA0 A;  1HR0 O;  1KEC A;  4F6R A;  1XMQ B;  1NVP D;  4DV3 O;  2AHZ A;  2KQX A;  4UB8 Z;  1R1B A;  5LP6 A;  3LUT B;  2K1E A;  1MSW D;  3G80 A;  3OUS A;  2R72 A;  3CHX A;  1J5E B;  3A0R A;  1VQ5 V;  4DV1 B;  5DN6 G;  4LR3 A;  2GHY A;  4X1K B;  2ETN A;  4FMT A;  1T5E A;  3AK2 A;  4AQY B;  4PDL A;  1H2L A;  2EX3 A;  2XTA A;  5J9P C;  5L3B A;  4IGG A;  2UUC B;  2B1G A;  1ZWI C;  1XNQ O;  1MMM A;  2PY5 A;  2F1M A;  3K5O A;  4JI2 O;  3UT5 B;  3TXS A;  2EIK C;  1OCO C;  5LMU B;  1PNK A;  4O4H A;  5DM6 V;  3UO3 A;  1XL4 A;  1BQZ A;  3FB6 C;  1P84 F;  2JS5 A;  3CRQ A;  1GAX A;  4BR6 A;  1VAR A;  2HLD G;  1N34 B;  3BA9 A;  4JI0 O;  1AI4 A;  3JCU Z;  4D6T H;  2OCC C;  5D5P A;  4JI6 O;  2QKC A;  4ZHQ B;  4JI4 B;  2A0L A;  4MSW C;  3ICX A;  5BMV A;  2QKA A;  4DV0 B;  5EC1 C;  4JI8 B;  5J2U A;  1JOY A;  1RM1 C;  1R6T A;  2NNU A;  4BAY A;  3ABL C;  2DYR B;  4EFE A;  4LNU A;  3ZHU A;  4GKJ O;  5B3S B;  1BZK A;  4LF4 B;  1JJO A;  1Y76 A;  2LW1 A;  2XAS A;  1KD1 W;  4XDL A;  4FM2 A;  4JPR A;  4X62 O;  2PI5 A;  4DR5 B;  2OTL V;  3WU2 Z;  4AHC A;  2WLM A;  3CCE V;  3DTU B;  5K1X A;  5L3C A;  3HKB A;  4HYO A;  4BIU A;  3L73 H;  4B3S O;  1SES A;  1XRE A;  1MA1 A;  1MOF A;  3ABU A;  4DV2 O;  4UCT A;  5JH7 A;  1LUV A;  2H94 A;  5J2T B;  2DN9 A;  2PYJ A;  3KCX A;  4U3J A;  4X1Y A;  2IU3 A;  1FKA O;  5JVD B;  1QU7 A;  2W0X A;  2B1I A;  4DR6 B;  4ZBM A;  3OR7 C;  2ZXW B;  2V1D A;  1GN3 A;  5LYJ A;  5FL7 G;  1EN4 A;  1JVM A;  1YHQ V;  3HKD A;  4LFA B;  4JI7 B;  2YS8 A;  5H5N A;  1W0K G;  5KX5 A;  3RGB A;  1IBM B;  1WNS A;  5A9G A;  4JZ2 A;  4XBF A;  3JAK B;  2YIC A;  4B3T B;  1QR8 A;  4GYC B;  4EB6 B;  2BTQ A;  2XT9 A;  3RBZ A;  4X66 B;  4FPP A;  1WA8 B;  3PN1 A;  3JAR B;  3ZIA G;  4NTW A;  4LFB O;  1NT2 B;  4RUF A;  4P9O A;  2Q7H A;  2X6C A;  1HDJ A;  1K3E A;  3CXH F;  4I0X B;  2PGG A;  2C2A A;  3TCU A;  4LFC O;  3TK1 A;  4D7T A;  1N36 O;  3OMN B;  4DK1 A;  1SQB H;  5EC2 C;  4CS2 A;  1W59 A;  1QQC A;  1NH2 B;  3CCU V;  3JAM N;  1I94 O;  3G4S V;  4Z1V A;  3ZHV A;  2ODM A;  2AZ2 A;  3VQY A;  4O2A B;  1WPB A;  4TSF G;  2Q6A A;  1Z2G A;  3JAL A;  3RYH A;  3BFR A;  3CC7 V;  3CEI A;  4Q20 A;  3SR2 C;  1S5L Z;  3OTF A;  2ZE7 A;  3ABL B;  2K9P A;  2EIN B;  1FXH A;  2Y48 A;  4PA4 A;  2QSA A;  1TAE A;  4I9Q A;  1H8H G;  4TV9 A;  4A5U B;  4DYL A;  1EBO A;  2E74 B;  2R9A A;  1SER A;  1OJH A;  4JTD B;  4WF9 V;  4FVM A;  2YC0 A;  2QKS A;  2DMX A;  4J41 A;  1FJG B;  1B6Q A;  4YIP A;  4JTC B;  3UKM A;  3JD1 A;  2ZNI A;  1NZ6 A;  1Q86 W;  1IZ3 A;  3DC6 A;  4C7U A;  3JSN A;  3AEI A;  4PA9 A;  4EFB A;  3S3X A;  3UO2 A;  2EJR A;  4QE9 A;  3JAT A;  2DJV A;  4BW9 A;  1IVS A;  3ZS8 C;  4ZOL A;  3ZHT A;  4IHJ B;  2HFE C;  4GCZ A;  3FB8 C;  3TET A;  1Q6H A;  2CTQ A;  4MT8 A;  4K0K O;  5B1B C;  1SC5 B;  3K59 A;  2YIB A;  2EIJ C;  1OZ0 A;  2PTM A;  3E22 B;  1M93 A;  2L35 A;  4UCS A;  4NTY A;  2BSK B;  2QE7 G;  5GON B;  1R6N A;  4FLX A;  2QM7 A;  3P3P A;  2QR4 A;  2BCC H;  3BRC A;  1K4D C;  1R3J C;  1WAZ A;  3ZN0 A;  1NS1 A;  3ASN C;  1WP8 A;  2ATK C;  4PI2 A;  1HNZ B;  4PV1 B;  5JQG A;  2CTP A;  1L1F A;  2X0L A;  3E8F A;  1FD9 A;  1US6 A;  3JD2 A;  4XDK A;  4GKK O;  3ZX6 A;  1NBM G;  3I55 V;  1YZB A;  2JK5 C;  3CSX A;  2XAG A;  1K5S A;  3DC5 A;  5JWP A;  1Y74 B;  1RFY A;  2W6J G;  1WP7 A;  4JAV A;  3HKE A;  1AJQ A;  2L6L A;  1LUW A;  3QO8 A;  4KFM A;  4CH3 A;  2H8P C;  2P4V A;  3UM7 A;  4MTF A;  2X7R B;  4TV8 B;  5LMN O;  5B1A C;  2XND G;  5CA1 A;  3LSS A;  1XL6 A;  4G27 B;  1QVG U;  5LHG A;  3QTC A;  4Q6G A;  1AI6 A;  1U97 A;  4MVQ A;  3QO5 A;  2WLK A;  4X8A A;  3QO7 A;  4LF5 B;  1B06 A;  3H9V A;  5CB4 A;  4JV5 O;  3F5W C;  2XAH A;  4LP8 A;  3JD4 A;  4O4J A;  4HBN A;  5IYD O;  3WB2 A;  1VQ7 V;  3LDD A;  2ITD C;  2BE3 A;  5IJ9 A;  5L3F A;  2HJD A;  1XQ8 A;  1BQ0 A;  1VMG A;  1ORQ C;  2LJ2 A;  3J80 N;  4J7Z A;  3ABM C;  2ZD9 A;  1KP3 A;  4O2B A;  4R8C A;  1CEZ A;  2XOK G;  2JS3 A;  4OX9 O;  5TIS Z;  1G8M A;  4X1I B;  3AK3 A;  1HP8 A;  3CCV V;  1YEW A;  1FXK A;  1VF6 C;  3GVM A;  2KKW A;  1OCC C;  4DV4 B;  4DW1 A;  1EN5 A;  4X64 B;  3ZRW B;  4UV9 A;  1KU9 A;  1ZX3 A;  3MDS A;  3STL C;  2UXD O;  1QR9 A;  4QGP A;  1NH2 D;  4H37 A;  3FD9 A;  1H2S B;  2UXB B;  3K9S A;  5LOV B;  1HR0 B;  1HNW O;  4Z2W A;  3JAW A;  4K35 A;  5DEC A;  4DV3 B;  2Y69 C;  3ZMV A;  4MVU A;  3ZRS A;  2LW7 A;  2IJK A;  4X20 A;  1GN2 A;  1YDX A;  4JI3 O;  4DRX A;  3AG2 C;  2OWO A;  2KG7 A;  4X65 B;  4LF7 O;  5EZY A;  2JGD A;  1K33 A;  2P5O A;  5IWA O;  4PA3 A;  4HNA A;  5LL6 Y;  4FFK A;  5KHH A;  5CBH A;  3BA8 A;  4PA7 A;  1IX9 A;  4I4T B;  2A06 H;  3Q4H B;  1Q3E A;  2JEU A;  4OGQ B;  1SA0 B;  2GBO A;  2CDY A;  5C8Y A;  3U10 A;  5B1O A;  2CUG A;  5L3G A;  4LF9 O;  4IIJ B;  2ZE6 A;  4H44 B;  3OGC C;  3P30 A;  1NR7 A;  4J80 A;  1VF6 A;  4UV8 A;  5ITZ B;  4GLX A;  1IBL O;  1GKF A;  2ZIO A;  3JAS B;  4NR1 A;  2JJ2 G;  3S3W A;  3SYA A;  3A2F A;  4DR1 O;  1SKV A;  4CH6 A;  4WFE A;  2LO1 A;  1L0L H;  4I50 B;  4KUM A;  1G1X B;  1KB9 F;  2W6I G;  3ABK B;  4UXN A;  1FAF A;  1YI2 V;  3SYQ A;  2WLI A;  3DXR A;  4MW8 A;  3AG3 C;  1Q90 D;  5BZB A;  3OEE G;  3OUF A;  2R9R B;  4YJ2 B;  4MVZ A;  2QWO B;  1TGO A;  4GKJ B;  1TUB B;  3BCC H;  4LF8 O;  2UXC O;  1CP9 A;  1X4T A;  2ZT9 B;  4P30 A;  4F4L A;  3E8G A;  4WFG A;  4UUJ C;  1XI1 A;  1NI8 A;  3ZHQ A;  4X62 B;  2CAZ C;  5IDJ A;  3SPC A;  4JTA B;  1NR1 A;  3O65 A;  2GUZ B;  3MD0 A;  1YVW A;  4DR7 B;  5LXT B;  1YSC A;  1H2G A;  3CRC A;  2Y4T A;  3ASO C;  3KG2 A;  3W7U A;  4H33 A;  4U7N A;  3K0G A;  1MG1 A;  2A7W A;  1M56 B;  4LH6 A;  3FX7 A;  1SQG A;  4LWS A;  4O4I A;  3ZMT A;  3E8H A;  3D3Q A;  4G2K A;  2P06 A;  5H9C A;  1PPJ H;  2XAQ A;  1EM1 A;  2DE0 X;  2WWW A;  1HW7 A;  2E3C A;  3KCY A;  4JI5 O;  1YIT V;  2ILM A;  1XMO O;  3ETQ A;  3ETD A;  1JPX A;  4MW3 A;  3IFX A;  2F4V B;  1TVK B;  3AG2 B;  4DR2 O;  1VQ4 V;  1AP5 A;  1L8D A;  4HZ3 A;  3H1I H;  1AI5 A;  1OCR B;  3CWB H;  1BSM A;  1NTK H;  5IJ0 A;  4YY3 B;  1XNR O;  1YXB A;  4J11 A;  1XDC A;  4LFB B;  2CH7 A;  1JX9 A;  4E2L A;  2UXX A;  1NKD A;  4O4L B;  1N33 O;  5KUK A;  2EIL B;  1QCE A;  4NYK A;  4DUY B;  1FS0 G;  3AG1 C;  4CS3 A;  4LFC B;  5JJE B;  1E1Q G;  3LDC A;  4GX5 A;  1URF A;  4N21 A;  2YI9 A;  3CD6 V;  5LA6 A;  2ZM6 O;  3F5T A;  4WBN A;  1Q82 W;  4KL1 A;  3X2Q C;  3CCL V;  1V54 B;  1EFR G;  3C90 A;  2YEV B;  1PP9 H;  3CYO A;  1S72 V;  4YJ3 A;  4CBC A;  2Q7G A;  2F66 C;  2DOS A;  3JD0 A;  2UUA O;  1S76 D;  1V55 B;  3ML0 A;  2UU9 O;  5CA0 B;  1F4M A;  5LBQ A;  4F6R B;  4DV6 O;  4MVS A;  3TXQ A;  1QBZ A;  4OPA A;  3AG7 A;  2V7Q G;  3H01 A;  3RT3 C;  1S5H C;  5LP6 B;  5LGN A;  2CGO A;  3VQW A;  2WLL A;  3RVY A;  1GO3 F;  2ZE5 A;  2A79 B;  5KLV H;  3T1C A;  1FPO A;  3CRM A;  1W0J G;  4JAU A;  3IC9 A;  3CCR V;  1YF2 A;  3T1Y O;  1QHT A;  4LCU C;  3OE7 G;  2Y4U A;  1I5Y A;  3CS5 A;  1S0V A;  3VQX A;  3IC7 A;  4BW5 A;  1BCC H;  2UUB O;  1NJI W;  4X9Q A;  3R66 A;  1S5J A;  4UB6 Z;  5L3D A;  2E76 B;  3H1J H;  4DO2 A;  3L75 H;  4I7Z B;  3AG4 C;  4KHP O;  1N32 B;  3H1L H;  3A8T A;  4O4H B;  1QVF U;  2JGU A;  1F23 A;  3AK1 A;  3GWK C;  1QLE B;  3JAR A;  3MHS C;  4KP4 A;  4WFF A;  2EIM B;  2Z3Y A;  2MK3 A;  2DYS B;  4JYY A;  3SJC C;  1O9G A;  3N27 A;  4K0K B;  3OTO O;  3K03 A;  5BMV B;  1SQF A;  3H1K H;  4WFB V;  3CPW U;  3LDE A;  1WLE A;  1SZT A;  2E75 B;  5J2U B;  5KHJ A;  4U7O A;  1F4N A;  3ETE A;  5IE9 A;  4WCE V;  4I55 A;  4CZZ A;  4B3M O;  1XOU A;  3RYI A;  1GN6 A;  2HR3 A;  2BTO A;  3HPL C;  2HHH O;  3K9A A;  3SPH A;  4FLW A;  2EBO A;  4AIL C;  4Z1M G;  4RUE A;  4NXM B;  1H2M A;  3SJB C;  1XMQ O;  1KUQ A;  1PD3 A;  3CRA A;  3HKB B;  3LSQ A;  1R3L C;  1MZF A;  1Y66 A;  2YID A;  3P32 A;  5LGU A;  2VRZ A;  4DV1 O;  5JH7 B;  2EIK B;  2GTA A;  1DTO A;  1VEW A;  1OCO B;  3APQ A;  1AR1 B;  4TT3 G;  4PDV A;  1JFF A;  5IY5 C;  3CC4 V;  3K0D A;  4U3J B;  1XBL A;  4JYA O;  2H3O A;  4CH5 A;  1LR1 A;  2QDO A;  4J7J A;  1PNM A;  5EK0 A;  4RQE A;  1KKD A;  3RYF A;  2UUC O;  3ZRV A;  5LMN B;  1IUR A;  2OCC B;  2FYU H;  1YTF B;  4JGS A;  2KB1 A;  1VP7 A;  4JF3 A;  5LYJ B;  5LGT A;  3HKD B;  2Q7E A;  5IT9 N;  1RM1 B;  4JV5 B;  3B2E E;  3K08 A;  4UVB A;  5KX5 B;  3T1H O;  1R6K A;  1MNG A;  3VBB A;  2RN9 A;  2ZNJ A;  4K8X A;  1ZUQ A;  3CRR A;  1XIL A;  1N34 O;  4B08 A;  5KMG A;  2BTQ B;  2ZR3 A;  5GW7 A;  4DR3 B;  3N2G B;  4DV0 O;  2XAJ A;  4JI8 O;  5GON A;  2JEX A;  4I9W A;  1NTZ H;  2P67 A;  3ZHR A;  4RQF A;  4DK0 A;  1VQ6 V;  4LF4 O;  1OCZ C;  1Y67 A;  4F6E A;  1YIJ V;  1N8R W;  2VS0 A;  2VQE O;  2WA4 A;  5KUM A;  2P4K A;  4DR5 O;  1M1K W;  2ADP A;  2MW2 B;  3D3I A;  1WN7 A;  4DV7 B;  1SQV H;  2JRI A;  5A2Q N;  3MAQ A;  2IH1 C;  2NR5 A;  3JAL B;  4IYH A;  3RYH B;  2ZIN A;  3BAB A;  1DF5 A;  2UXD B;  2F23 A;  4B7K A;  2JJ1 G;  3HKC A;  1YJ9 V;  5EIB D;  2P7T C;  3IJ4 A;  3K5L A;  2LFR A;  1AJN A;  1HNW B;  4TV9 B;  3P3N A;  1FFX A;  1K97 A;  3THO A;  3D8C A;  4FIP C;  3ZCC A;  4JI7 O;  1SQQ H;  1Q43 A;  4EEQ A;  1PL4 A;  3B40 A;  4B3T O;  3LSU A;  3OW2 U;  5K1P A;  2GDS A;  4UCR A;  1FFT B;  3JAT B;  4RAI A;  4X66 O;  3N2K A;  3FFQ A;  4FFB B;  4UFZ A;  3WB0 A;  2ZQM A;  1LNQ A;  3OAA G;  2Z0A A;  1FXK C;  2FKX A;  5B66 Z;  3CCJ V;  2GTS A;  2RJZ A;  5CN0 A;  4J9Z B;  4ZOL B;  1V9P A;  3J81 N;  1IBL B;  1J95 A;  1NTM H;  1Q6U A;  2JIZ G;  1K73 W;  2CGN A;  3WG7 C;  3L70 H;  2BOB C;  2ARH A;  1P7G A;  4H13 B;  4DR1 B;  1ARO P;  4NKG B;  1X59 A;  1XUQ A;  5EYP A;  1Q81 W;  4YHH B;  3CMA V;  3K04 A;  5JQG B;  2ZE8 A;  3CC2 V;  1IXB A;  2G38 A;  4H0L B;  3K3W A;  4FZ0 A;  5B1N A;  3FB7 C;  1Y4M A;  2E5L O;  1ROP A;  4PA6 A;  1XEQ A;  3JYC A;  2RNB A;  4LF8 B;  3SPG A;  3A0H Z;  1N4C A;  2IM9 A;  3W7T A;  2GV9 A;  3EFF K;  1U96 A;  4OPH A;  2RDC A;  4PDM A;  3HKE B;  3RN4 A;  3C3S A;  4MTX A;  5JJN B;  1VF7 A;  1ZLZ A;  1D5N A;  3OGI B;  4YXW G;  2HEP A;  1HWY A;  3IAY A;  2EUL A;  5CA1 B;  3ZMZ A;  2YXH A;  2DQ3 A;  2QM4 A;  2QWP B;  2EZO A;  3FYE B;  4QIW F;  4FLV A;  5B1B B;  2X6B A;  4CH4 A;  5IYZ A;  2EIJ B;  4TUY A;  3RYC A;  2Q5Z A;  5CB4 B;  1Z5V A;  2N74 A;  4TQF A;  3B8N A;  4O4J B;  1Q5O A;  1ZL8 A;  2Q67 A;  3ASN B;  2WPD G;  4JZG A;  3CJH A;  1GTO A;  4JI5 B;  3W7W A;  1GM7 A;  3B8M A;  5IJ9 B;  1VQM V;  3E86 A;  4B3R O;  3FAV A;  3CP1 A;  1KMI Z;  3I5D A;  3OMA B;  1XHZ A;  3K57 A;  3GWO A;  2WLH A;  4UCO A;  4LH7 A;  3ZHS A;  2PUS A;  4LF6 O;  4O2B B;  3UCS C;  3U11 A;  5L3E A;  4MTG A;  2OTJ V;  1F51 A;  4LBE C;  2YXL A;  2LFS A;  1AI7 A;  1BT8 A;  5FNV A;  1S77 D;  5EBM C;  2Q9L A;  1SS3 A;  3J7A U;  1FXK B;  1WPX A;  1XNQ B;  4JI2 B;  2F93 B;  3WB1 A;  1HNX O;  5B1A B;  3CB2 A;  1GK9 A;  2R9I A;  4DR4 O;  4XDJ A;  1VQK V;  2D3O W;  4JI0 B;  1EZJ A;  4ZI7 A;  3K5M A;  3SYP A;  4JI6 B;  2UU9 B;  2FL4 A;  1MZE A;  3JAW B;  4RWU A;  1UFI A;  2DQ0 A;  4X89 A;  5LHI A;  3BVO A;  1YJN V;  4IYI A;  4X20 B;  5AG2 A;  4DRX B;  5EIB C;  4DUZ O;  3D36 C;  4LF5 O;  2KG7 B;  3HR0 A;  1AJP A;  2IJH A;  5EZY B;  1RSO A;  2JGD B;  1B3Q A;  1VQN V;  3ABM B;  4HNA B;  1QNM A;  3T1Y B;  1VQL V;  3EHB B;  1I7F A;  1VQ8 V;  2AW9 A;  3T4Z A;  2QGN A;  1A32 A;  2UUB B;  5C8Y B;  2DYR C;  1AVM A;  4B3S B;  4J42 A;  1JQ0 A;  5B3S C;  4DV2 B;  1OCC B;  2CK3 G;  4PI0 A;  4KHP B;  1SQX H;  3EXA A;  4X1K A;  4R6Z A;  1IDS A;  5FPO A;  1RP3 B;  2PI4 A;  2DWE C;  4PDR A;  1UPG A;  2WLI B;  3DGE A;  3DXR B;  4R50 A;  3UT5 A;  1GRJ A;  2ZIM A;  4X64 O;  1I0H A;  2Y69 B;  3G67 A;  2ZDI C;  4J9Y B;  4GX1 A;  2VQF O;  1BL8 A;  2DWD C;  3G71 V;  4NXN O;  2HHH B;  3D36 A;  1S3J A;  2QTS A;  4TOI A;  1KC8 W;  2UXB O;  2ZXW C;  4NVP A;  4FK5 C;  2FB5 A;  4ZHQ A;  4DV5 O;  1DK1 A;  4JAA A;  1PV0 A;  4CS4 A;  3E89 A;  5KA5 A;  4X65 O;  1N36 B;  5H2F Z;  4FM0 A;  2WA3 A;  2ZR2 A;  2HVK C;  5KHI A;  1AP6 A;  4R7C A;  5CMU A;  5CBF A;  5GTH Z;  3KZI Z;  3ZRX A;  4JYA B;  4LWS B;  1VIB A;  3RFR A;  2R70 A;  4O4I B;  2ADQ B;  3O9O A;  3SJA C;  3L72 H;  1I94 B;  2YSU B;  2CTR A;  3OD4 A;  1YCI A;  3M8A A;  2OIE A;  5CBG A;  3AG3 B;  1GM8 A;  3DSQ A;  2P22 C;  3ZJZ A;  3STZ C;  5J2T A;  3E8B A;  4ABM A;  4X88 A;  2ZDI A;  3T1H B;  3VOU A;  3B09 A;  3F7V C;  3TGU H;  3RVZ A;  1FYJ A;  5JVD A;  4MVO A;  1JMK C;  1OV9 A;  2N04 A;  2Z5U A;  2BOC C;  3SGI A;  3RW0 A;  5IJ0 B;  3ZMS A;  4DXW A;  2CH7 B;  2WSS G;  4FLT A;  3PJS K;  2B5U A;  4DW0 A;  4GX2 A;  2RCV A;  2EIN C;  2QWR B;  4CC6 A;  3JAK A;  5H6Q A;  2KSD A;  4G28 B;  2UXN A;  3ASO B;  2F43 G;  2CTW A;  5LA6 B;  3NXS A;  4EB6 A;  4WBN B;  4B7E A;  1WA8 A;  2VQE B;  4WFH A;  2ZCE A;  2Q73 A;  2FTK A;  3ETG A;  5BR8 O;  4WFA V;  1EN6 A;  4FLY A;  4YJ3 B;  4JAS A;  2F95 B;  1M57 C;  4DR7 O;  1SZX A;  4QJF B;  4I0X A;  3SPI A;  1K5Q A;  1MSD A;  1IBK O;  2V4D A;  3BAA A;  1D2D A;  1G4Y B;  4MS2 A;  3G6E V;  1GM9 A;  4JI1 O; 
#chains in the Genus database with same CATH homology
 2RMK B;  4NB5 A;  4IGG A;  1US6 A;  1CXZ B;  1RFY A;  4DYL A;  1URF A;  2HJD A;  4NKG B;  2Q0O C;  1UPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...