1URFA

Hr1b domain from prk1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
GIPATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQADQLENQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTEIN KINASE C-LIKE 1
publication title Molecular Dissection of the Interaction between the Small G Proteins Rac1 and Rhoa and Protein Kinase C-Related Kinase 1 (Prk1)
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 81
sequence length 81
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02185 HR1 Hr1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1urfA00
4IGGA 4NB5A 2RMKB 4NKGB 1CXZB 1UPGA 4DYLA 1US6A 2HJDA 2Q0OC 1URFA 1RFYA
chains in the Genus database with same CATH superfamily
3JD1A 4UVBA 4LCUC 1F23A 2ZDIC 1AI6A 4DR5O 4ZKIA 1CPYA 5J2UB 4PDMA 2WLKA 1WP8A 3A8TA 3ZJZA 2YXLA 4FFBA 1NH2D 1DF5A 2GUZB 4TQDA 3IC9A 5IWAO 1VQ4V 4KUMA 1BHAA 1P4RA 4GX5A 4I0XB 2F43G 2B9ZA 4JYCA 3EHBB 5FPRA 1KU9A 3VQYA 3H01A 5DECA 2UXXA 4LF6B 4ZI7A 4TSFG 3P32A 2BTQB 2IM9A 3AG3B 2FB5A 5KAIZ 1FXKC 3X2QC 1US6A 2HJDA 4JV5B 4JI4B 2YXHA 4DV0O 1QVGU 3VOUA 4EEQA 4JI6B 2IJJA 2YEVA 2LW1A 1TAEA 1PKXA 1VP7A 3ZHTA 3HKCB 2Q7GA 4X1YB 1NVPB 2EJ7A 3B40A 5LA6A 3AG1B 1KMIZ 4PJ0Z 3RYFA 4X1IA 3N27A 1EM1A 4YY3B 4RQFA 2WA3A 4KFMA 1AR1B 1MZEA 4JI5O 4KP4A 4J41A 2DYSC 2K9PA 4DV6B 3ZMSA 1YEWA 1WP7A 1CEZA 4OXSA 3ZS8C 3QVNA 4I50B 2ZQMA 3ZRWB 4O2AB 4Q20A 1AROP 3WG7C 3K58A 3ZIAG 5LP6C 3E35A 5LMNB 1NKDA 1PV0A 4JI0B 2RCVA 5J2TA 5LOVA 3AG2C 2DYRB 4X8AA 3KKYA 2R9AA 1GM8A 1Q86W 3C90A 3BFRA 3OGCC 3TK1A 1K5QA 3AEIA 3EFFK 3N2KB 4ZIBA 3RBZA 2M6YA 3TGUH 1YCIA 4TUYB 1QR9A 3F5TA 2EINC 1VQKV 1OHHG 3ZMVA 3NR7A 4JAVA 2ATKC 4X1KB 1Q8IA 1R6NA 2EIMC 4UCVA 5FPOA 4JI1B 2PGGA 1JA8A 1GAXA 2AGAA 3HKBA 4MVZA 2ZR3A 1NI8A 4P30A 4FFBB 4X66O 4D6TH 4N21A 3R65A 4MVOA 4PI0A 3SPHA 2W6JG 5JVDB 2ZE7A 1K9MW 4JI2B 1B6QA 1K5SA 1N36B 3UO2A 4K0KB 2UXDB 1YTFD 4I9QA 3T1CA 1OZ0A 2A9HA 3CXHF 3CCUV 1J95A 4NTYA 5K1XA 3ZN0A 1KP2A 4X20A 1ZUQA 1H8EG 1XNRO 1FFTB 3DC6A 1EN6A 3BEHA 1FFXA 1U96A 1M57C 5LA6B 3RYFB 2CE4A 4X1IB 3CXCU 4J7JA 1F7YA 4X64B 5IDJA 1Y67A 1F4NA 4DW1A 2Q8VA 1RM1B 1I94B 4LF6O 1SQVH 4YJ2A 2QM8A 4B08A 1Q82W 4D7SA 1ZSPA 5J2TB 4JV5O 3JSNA 4JI4O 1Q6HA 4ABMA 4JI6O 3ZRVA 5KMGA 1N34B 1XDCA 3AG4B 2VWJA 4CS3A 4B7KA 4DV2B 3G67A 2NR5A 3OEEG 2EBOA 4FLZA 1EN4A 2UXNA 4JF3A 3JATA 4H37A 3D36C 1M1KW 4JGSA 1HNZB 4YY3O 1OCZB 3E2EA 3HKBB 2RJZA 3RVYA 3TJTA 5LGUA 5BXZA 2F95B 4DV6O 1PL0A 4LF8B 2P7TC 3O9OA 3ASNC 2C2AA 2ZXWB 3KCYA 5LMNO 2DWDC 1M4UA 4JI0O 5H5NA 5B1BC 2R9IA 4R7CA 2PI4A 4UB8Z 4CS4A 3JAKB 1W0JG 4TV9A 1NZ6A 3LDDA 3ABLC 5CBHA 4RAIA 2QJ1A 3SYPA 5JQGA 2ZIOA 1XREA 3ZHSA 3L9DA 3O65A 1QR8A 1N33B 3VQXA 1M56B 4DR1B 4X20B 5KAFZ 3HKEA 1WB7A 4UCUA 2Z5UA 2JS5A 5LYJA 5H6QA 4JI1O 1T5EA 1FFXB 4X62B 1NQTA 3KG2A 4RQEA 2A7WA 1KECA 3DC5A 2QA4V 3RWRD 1JOYA 4U3JA 3UCSC 2IH3C 2WAMA 5CB4B 4JI2O 1HDJA 1V9PA 2RQ6A 5CA3A 4I55A 1N36O 1R3LC 4YJ2B 1IBLB 2UXDO 4K0KO 3LSQA 1NTKH 4LWSA 3JCUZ 1FAFA 1HR0B 2Q4PA 3G6BA 4UXNA 1YITV 2YIDA 2EILC 5KMGB 4FLWA 2JS3A 1VQNV 3B8NA 2NLJC 4YIOA 4A5UB 1BL8A 1YIJV 3WFVA 4C7UA 2V1DA 4PV1B 1XMQB 2HHHB 3RVZA 1I08A 4P9PA 3FB7C 1QBZA 4YHHB 2CDYA 1XI1A 1WN7A 3HKDA 4DV7B 4X64O 1AI5A 1LUVA 1NS1A 1L0NH 1FYJA 4DYLA 1PL4A 5EYPA 1UJWB 1I94O 1M90W 4BIUA 3ZCCA 2JK5C 1VEWA 3K5LA 3E8HA 2OIGA 3QTCA 5C93A 4EKWA 4PA6A 1ZX3A 1N32B 5JCOC 1SS3A 1VF7A 3SPGA 1N34O 1K7DA 1Y76B 1B06A 3K5OA 2IJHA 1DF4A 3ZEDA 4DV2O 1IZ3A 5JQGB 3HPLC 5FLXN 3JARA 1GKFA 4FK5C 1QVFU 3HKEB 3OGIB 2HLDG 3C3TA 2GV9A 3STZC 2X6CA 5LYJB 1HNZO 1RFYA 1CP9A 4FLUA 4JYBA 2L6LA 1HNWB 2JGUA 4Q6GA 3N2GA 3JD4A 4NR1A 4H0LB 1FPOA 1NT2B 1K73W 4LF8O 2Y69C 4I4TA 2ILMA 4GX0A 4J10A 1JR9A 2H3OA 1OCRB 4B3TB 2CTQA 1Q43A 1RPOA 1BE3H 1RP3B 2HJFC 2OCCC 3FB8C 4I55B 3DSQA 4FM1A 4X9QA 4I0XA 4LWSB 2UU9B 2ZKOA 4DXWA 3CHXA 2QTSA 3IFXA 4GKJO 2DMXA 5JWPA 3GVMA 4GUNA 1N33O 2YIBA 4FIPC 3OTOB 4DR1O 5LHHA 1HWYA 3OE7G 1PPJH 1TUEB 5GONB 2UUCB 1TGOA 2BSKA 4PA3A 4PDRA 4X62O 3OMAB 4QIWF 2JEXA 4LFCB 1K33A 1X59A 1BQZA 3HKDB 3CMEV 4B3RB 2AHZA 3D8CA 3TETA 4EFEA 4CZZA 1WNSA 1XHXA 1QCEA 3CEIA 5EYPB 3OW2U 4K3AA 1VQOV 3L71H 4ASUG 1SQFA 2FKXA 1XBLA 1IBLO 2JJ2G 1FXKA 2XAQA 1HR0O 1NTMH 4B7EA 3K04A 4LF4B 4R50A 4J7ZA 1PD3A 4MS2A 3ZRWA 1ZLZA 3ML0A 5D5QA 3NXSA 5EZYA 5H2FZ 4O4JA 1UFIA 3CMAV 2JRIA 1SQBH 1VF6C 1NR7A 1XMQO 2HHHO 3B8MA 4IGGA 2F66C 3HB3B 4YHHO 1R3IC 4TUYA 1MZFA 4DV7O 3A0BZ 2CAZC 5KX5A 4BIOA 3K5NA 2XT9A 1Z2GA 3N2GB 3APQA 4O4LA 4CH3A 3K57A 1IXBA 3DTUB 4I4TB 5CBFA 3ICXA 5LP6A 3ZRXA 4DW0A 1XUQA 3CX5F 2DWEC 4UB6Z 5IJ0A 1OCCB 2ITCC 5JVDA 4IIJA 5IY5B 1H2MA 4DK0A 1B04A 2PI5A 1N32O 3RYIA 4LF7B 3GWKC 4LNUA 1H2NA 1FD9A 2F93B 5HFMA 3SJQC 1S5JA 1XL4A 3ABMB 3F5WC 4IHJB 1S77D 3AK2A 1AI4A 4KHPB 2QE7G 4FLTA 3BAAA 5BY1A 1BQ0A 2BSKB 5LGNA 3QNEA 1VARA 2Z0AA 1K92A 1HNWO 4FMTA 5LMUB 2IU0A 1MSDA 3CJHB 2E75B 3TXSA 4B3TO 1WLEA 5B66Z 3K0DA 2E74B 4F4LA 1OJHA 1V54C 1OV9A 1GM9A 2BOCC 2DYRC 4PA4A 3X2QB 1FXKB 1PNMA 4G2KA 5CA0B 4FZ0A 2UU9O 4DV3B 1OCOB 5GTIZ 1EBOA 3U0ZA 4PA7A 1GN3A 2HG5C 3B77A 4J9YB 2A79B 1X4TA 2Q73A 1Y74A 4WFAV 4JI7B 3OTOO 5EZYB 4O4JB 1O9HA 2HVJC 5L3EA 5A2QN 2IU3A 2GHYA 4QGPA 2D2CB 2UUCO 1DLBA 4F6RA 2DOSA 1GM7A 2QTOA 4PD4F 3ASOB 4LFCO 2DQ0A 3A0HZ 1SA0B 3APOA 1H38A 4B3RO 1GN2A 4FLXA 2DYSB 5IJ9A 1W0KG 5KX5B 4MT8A 1M93A 1BZKA 3ZHRA 3GWOA 2R72A 4O4LB 3UM7A 5KHIA 3ZMTA 2ETNA 3WG7B 2WLJA 5LP6B 3CC2V 2QWOB 4LF4O 1PNKA 2R70A 5IJ0B 3H1LH 3AG2B 4IIJB 4MVSA 2DE0X 3ABKC 2P67A 3RYIB 3BA8A 5KHHA 3E86A 1MA1A 1WPBA 4PA9A 3RW0A 3S3XA 4NTXA 3JAKA 2XAFA 3ZMZA 5LXTA 4B3MB 4LNUB 1QLNA 2EINB 4I9WA 2N04A 2Q69A 1S72V 4K8XA 4NTWA 1URFA 2F4VB 3JASB 1GO3F 1AILA 2EIMB 1SRYA 4JAUA 4BAYA 2ZINA 5EC1C 1Z5VA 3VBBA 2IH1C 4RUEA 3EXAA 2WA4A 4DUYB 1RPRA 3K0GA 1R6TA 2Y4TA 3BRCA 2DW4A 3CE2A 2AXTZ 1AR5A 4LF9B 2QKCA 3H1KH 4Z1MG 3H1JH 3CCJV 2F23A 1K34A 3OM3B 5AG2A 1QLEB 1WAZA 1JCHA 5CB4A 3CRAA 5LL6Y 3OR6C 3BHPA 4CC5A 2EJRA 1BS3A 4O2BA 2UUBB 1ENVA 4IYHA 1KKCA 4LF7O 1P7BA 1SQQH 5EBMC 1Y74B 3SJCC 1K8AW 4KHPO 1SESA 4TOIA 1DK1A 5KA6A 1VQ9V 4XDJA 4LP8A 4BR6A 3A2FA 2N74A 4F6RB 1M57B 1NVPD 3K9SA 4DR3O 1KB9F 4O4HA 3UO3A 4DV1B 3CRRA 4MW8A 3QF7A 4JTCB 5LMUO 2E3CA 2Q68A 4J7KA 2V7QG 5IJ9B 5A9GA 2CTRA 2WLHA 3P3NA 3K9AA 4PELA 2RDCA 1B3QA 2YSUB 2GDSA 1VIBA 3CRCA 5L3BA 1M5IA 1H8HG 2P90A 1KYOF 2WLLA 1YJ9V 5H6RA 5IE9A 2H8PC 3T1HB 4DV3O 4UUJC 4BWAA 3F7VC 5K1PA 1IBKB 5EC2C 4JI3B 3PN1A 4JI7O 1N0NA 1Q6IA 1Y6XA 1M56C 3CCRV 2CH7B 5LXTB 3ABUA 2A0LA 1EFRG 1J5EB 3ZHQA 4I7ZB 2Y4UA 1Y76A 2FTKA 1L8DA 2GTAA 2ARHA 4CS2A 4RO2A 4GKJB 3AK1A 2EX3A 3RFRA 1G4YB 3L72H 5BMVA 4FVMA 2OTJV 4PDLA 4B3SB 4R6ZA 3JD2A 4GCZA 2QEXV 2KKWA 4DR6B 1Q3EA 2QR4A 5JH7B 4MTXA 1S76D 5HFLA 2XOKG 4BW5A 2EIKC 3OFNG 3SPIA 3ASNB 3LUTB 2N05A 1JX9A 4YIPA 2WSSG 5DEDA 2XHBA 4JZ2A 5JCOA 3ABLB 2Y0PA 3C3SA 2VWKA 2ODMA 4O2BB 3L74H 4U7NA 3FB6C 1YSCA 4B3MO 5L3FA 4MVMA 4CH5A 3UT5A 1R73A 4LFAB 4PDVA 5CA1A 1BT8A 4GZRB 2IBZH 2ZIMA 3LDCA 3K03A 1FXHA 3RYCA 2F4VO 3CCQV 3KZIZ 4QE7A 4HZ3A 1SC5B 4RUFA 3I55V 2PYLA 3JAWB 4O4HB 3OUFA 2OYQA 1FXVA 4DUYO 5LBQA 5GONA 2WLMA 2OCHA 1VQ6V 2RMKB 2E76B 4CC6A 1F51A 2UXCO 4LF9O 1A32A 2WLNA 3ZHUA 4ICGA 2UUAB 2HEPA 4MW3A 2WLLB 1MSWD 1MG1A 4AI8A 5KUKA 2O57A 2ZM6B 2UUBO 2EILB 4UV8A 5B1OA 1LR1A 5B3SC 4MTGA 3CC4V 3FKSG 5IYCO 2AW9A 3L75H 3CWBH 3OMIB 1AJNA 1BCCH 2ITDC 1YF2A 1XOUA 4E2LA 1R1BA 5L3DA 2Q9LA 4DK1A 4DV1O 4RWUA 5KHJA 5BMVB 5LHIA 3SJBC 3CCEV 1NH2B 1KD1W 1ZAUA 2F1MA 2KSDA 4EFBA 2QGNA 3PJSK 4WFFA 3K79A 3P3PA 4W4KA 3CYOA 3G80A 5BZBA 4H13B 3T1HO 2LGWA 1HW7A 3M7MX 3DXRA 4GT1A 2CK3G 1IBKO 4JI3O 3AK3A 2XAGA 5L3GA 3TCUA 5IYZA 2QKAA 2P4VA 3UKMA 2NNUA 4J42A 1XEQA 1O9GA 3G71V 1J5EO 3BA9A 3OUSA 3UT5B 1XQ8A 5CA1B 1K97A 3E22A 4AQYB 3RYCB 2OIEA 2HVKC 4J9ZB 2MK3A 2ZT9B 1PM9A 4JZGA 4P2ZA 4HAMA 2IJKA 1Z5WA 2WWWA 4IHJA 4MTOA 2W0FC 4B3SO 4DR6O 4P9OA 4OGQB 1KBHA 3H1HH 2ZDIA 3ETDA 1VMGA 2Y69B 3SYCA 5LHGA 4IT5A 1EN5A 4JTAB 2ADPA 1YI2V 3IC7A 1SQGA 4X65B 2W0XA 4MTFA 2EIJC 2OCCB 3LSUA 3IAYA 2QDOA 3CJHA 4GKKB 2H94A 3BABA 4BW9A 1W59A 2ADQB 1D5AA 5FNVA 3JCZA 2YDEA 2Q0OC 5B1AC 3OR7C 2YIAA 3GB7C 2Q6AA 1R3JC 4J11A 4LFAO 5CA0A 2X7RB 4UCTA 2PUSA 3LSSA 2QWNB 4K8ZA 1YZBA 4UVCA 3T4ZA 4KL1A 3MHHC 3SR2C 4UFZA 2VQEB 2Q7EA 5E79Z 3FAVA 3E83A 3H1IH 2X0LA 2OTLV 1AR4A 4DR2B 2HKOA 4LFBO 2KB1A 1D2DA 2OWOA 3ETGA 4XDKA 3B09A 3L73H 2QM4A 2K1EA 3B4SA 3CP1A 2E5LB 2GBOA 2XTAA 1CXZB 4HYOA 1SA0A 4OX9B 1SZTA 2UUAO 2VQFB 5IY5C 1N0JA 4IL6Z 1V55B 1SQXH 2JVDA 3FYEB 1PNLA 2YI8A 2ZM6O 1S5HC 4NXMB 3D3IA 3RYHA 3DXRB 1YTFB 4NYKA 3AG3C 3SPJA 5IYZB 5KHGA 2WLIB 1WA8A 1QU7A 3MD0A 5DN6G 5F2VO 2VS0A 3WB0A 1VQPV 1H2KA 1E79G 4JASA 2YS8A 3E22B 1IX9A 2JIZG 5EIBD 1XNQB 4K35A 2Q67A 4Z2WA 3T1YB 2BOBC 1BHBA 3FFQA 3JASA 1P84F 1AJQA 1TVKA 3AG1C 4QPJA 2QWRB 4GX2A 5CMUA 1COWG 2YC0A 4DR3B 3J7AU 4L8JA 1JJOA 2PTMA 3JD3A 4FM0A 1YVWA 4MVUA 4JYAB 1OCOC 3ZRSA 2XASA 2LGQA 1DGSA 5FNVB 1E1RG 5GW7A 2RN9A 3ETQA 2Y48A 1SERA 4PHZA 1GRJA 1ROPA 4AQYO 4LR3A 3K5MA 4TWKA 4F6EA 3ASOC 2L35A 4WBNA 1BMFG 3CCLV 3G6EV 3FAVB 5EBLC 2LFRA 1VQLV 3RT3C 3Q4HA 3I5DA 2X6BA 1G8MA 3T2MA 5ITZA 1VQ5V 4AILC 3JYCA 3KCXA 4X65O 4DV4B 3I56V 5H9CA 4R8CA 4ZHQA 1V54B 3CB2A 1QNMA 4QJFB 4L87A 2Q0AA 3R66A 4GKKO 5BR8B 3J80N 5JJEB 1JFFA 2KQXA 4XBFA 1F4MA 1Q90D 3CCVV 1H2SB 1TUBA 3RYHB 1JVMA 4JI8B 2M7WA 1FKAO 1GH6A 4JPRA 3LNMB 1M9NA 1VQ8V 1WA8B 2G38A 3CCSV 4FZ1A 2CGOA 1E1QG 3FD9A 4H44B 1GTOA 2LQTA 3M99B 2VQEO 2CUGA 3U10A 1I5XA 2CH7A 2PF4E 3E8BA 4WF9V 1Q7YW 3QO8A 2ZD9A 1GMGA 4DR2O 1UPGA 1LNQA 1N4CA 4GYCB 1JPXA 4GX1A 2P6JA 3RN4A 3MDSA 3D36A 1TVKB 2FYUH 3AG7A 2E5LO 2BTOA 2EZPA 4QNHB 4OX9O 3U11A 1I5YA 3SGIA 4ZI7B 2VQFO 2Q7HA 4MVRA 1QLEC 3EVKA 5JH7A 1RM1C 1L0LH 4G27B 4NXMO 3ABKB 5D5PA 1HNXB 1P7GA 2UXCB 5B5EZ 2HFEC 1MABG 5IYDO 2YEVB 1MMMA 1NU1H 3CRQA 3THOA 4WFEA 1DTOA 1D5NA 4JTDB 3QO7A 2YIBD 4IYIA 3AG4C 4W4LA 1AP6A 3H9VA 3T4DA 2Y0IA 2FL4A 1IBMB 4WBNB 1VF5B 1XNQO 3T1YO 2XAHA 3SYQA 2LFSA 1Q6UA 2NN4A 4UCSA 1VQMV 3Q4HB 2QKSA 4DV5B 1Q81W 3CRMA 1EZJA 1LUWA 1AB3A 5ITZB 1OCZC 3JAWA 1AVMA 3ZN1A 3B2EE 1QHTA 2HP8A 3F7YC 4ZHQB 3ZMUA 5LOVB 1ZL8A 2WPDG 2QWQB 4JYAO 2YICA 1I0HA 4FLVA 4DR4B 1NJIW 2ZXWC 2BE3A 1JFFB 1PP9H 2YI9A 1YJNV 2B1IA 4NXNB 2QM7A 2R9RB 1TUBB 3QG5A 1KUQA 4O4IA 3OEHG 5JJNB 2YUAA 5KA5A 4TT3G 5L3CA 1N8RW 4FM2A 1BGYH 3P30A 3W7XA 4YJ3A 5CBGA 3W7UA 1H2LA 4PI2A 4DUZB 4NKGB 4E4EA 3BPZA 1KC8W 3VQVA 1YDXA 3WB1A 1GN6A 1H2GA 2UXBB 2OT5A 2GSMB 1XL6A 1K3EA 1FJGB 4J80A 2P4KA 3CSXA 4DV4O 1G1XB 2ZNJA 2DJVA 1YJWV 1HP8A 1K4DC 5BR8O 3FYIB 5KHKA 3W7TA 2PZSA 4DR7B 4YXWG 1IURA 4NVPA 4JI8O 3BVOA 1MOFA 5B1BB 5FL7G 2Z3YA 2JEUA 2GTSA 4UCOA 1XILA 3ETEA 2CGNA 4G28B 3D3QA 4HBNA 1G6UA 3JSLA 2CTPA 3K59A 1SQPH 3MAQA 4BIZA 2JGDA 2ZNIA 3DGEA 1KKDA 2AZ2A 2XAJA 4Z1VA 2P5OA 2B1GA 3E8FA 1S0VA 1SF9A 3VQWA 3HR0A 4ZOLA 3OAAG 2VRZA 2EIKB 1IVSA 3STLC 1RSOA 4XDLA 3SPCA 1FS0G 1THZA 3IJ4A 3BY6A 3ZHVA 4LFBB 1YHQV 3L70H 5C8YA 1SKVA 3BCCH 1ZL8B 2IJIA 1HNXO 2BCCH 3E8GA 3JALA 3SJAC 3K06A 4LF5B 2JDIG 3RGBA 4D7TA 5GTHZ 4X88A 2ZR2A 2YXYA 5CN0A 4O4IB 4WFGA 3CCMV 3OT7A 4DRXA 4GLXA 1P49A 1ORQC 2RNBA 3JATB 2LO1A 1Y66A 3SYAA 3SYOA 3S3WA 1IBMO 4YJ3B 4MVQA 1XMOB 3W7WA 2LP7A 4WCEV 3TXQA 1MNGA 3CD6V 4TV8A 3OTFA 1SZXA 4DV5O 3ABTA 4DR5B 5EIBC 1WJZA 1JQ0A 4EB6A 1NR1A 1SETA 5EK0A 1IDSA 4LH7A 3SDLA 1ZWIC 1QQCA 1GK9A 5IWAB 2A06H 5DM6V 4TV9B 2PY5A 4DR4O 4FJCC 1BSMA 2ZCEA 4HNAA 3OMNB 1OCRC 4NXNO 5B3SB 3JD0A 4JYYA 2MW2B 1AI7A 1I7FA 5IT9N 2KG7A 1ZTEA 3G4SV 3ZBHA 2X6AA 4DV0B 4FPPA 2XNDG 2B5UA 2ZE6A 1U97A 3UQ8A 3M8AA 2FMLA 2WLIA 3WB2A 2IW5A 2JGDB 4DUZO 1VF6A 2ZE5A 1JJ2U 2V4DA 4U3JB 2HR3A 2UXBO 4TQFA 5J2UA 3E89A 2PYJA 1JMKC 3CS5A 1S3JA 1FJGO 3WU2Z 2LW7A 4ZOLB 3ZX6A 2AZ0A 1NBMG 2GUZA 1XHZA 4JI5B 1S5LZ 1RSOB 4CH4A 4UV9A 5LGTA 4FLYA 3OD4A 4DO2A 2P22C 5C8YB 4DR7O 1KP3A 3CPWU 5IYBO 2BTQA 3JALB 3MHSC 4MSWC 2D3OW 3LNNA 4UCRA 3LDEA 2LJ2A 4UVAA 1KQSU 1IXMA 2QWPB 5KLVH 1TA8A 4LH6A 4LBEC 2QSAA 2DQ3A 4KXRA 3IGAC 4X89A 2CTWA 3K08A 4JAAA 4AHCA 4DRXB 3W7SA 1Y4MA 2XUMA 3FX7A 2W6IG 3HKCA 4ZBMA 4X1YA 4FFKA 1Q5OA 1VQ7V 4U3FH 1WPXA 5EBWC 1AJPA 4TV8B 5J9PC 3A0RA 4QE9A 1R6KA 2AHYA 2A3QA 4LC1A 3K3WA 2JJ1G 4EB6B 4WFBV 4OPAA 1NTZH 1L1FA 2EIJB 5KUMA 4X66B 4OPHA 2ZE8A 1V55C 4I50A 2EULA 4O2AA 4I5SA 1GN4A 1R3KC 2EZOA 1WB8A 4HNAB 4WFHA 2DN9A 5B1AB 4LF5O 3FB5C 3J81N 1OCCC 4U7OA 1YXBA 2KG7B 3JARB 3JAMN 3CC7V 5B1NA 1AP5A 1EZVH 5TISZ 3N2KA 4CBCA 2P06A 5E1AC 4QPKA 4N23A 1K4CC 4H33A 1W2BU 4NB5A 3QO5A 1XMOO 2Q5ZA 4CH6A 3ABMC 5JJJB 1XNRB 4X1KA
chains in the Genus database with same CATH topology
4IGGA 4NB5A 2RMKB 4NKGB 1CXZB 1UPGA 4DYLA 1US6A 2HJDA 2Q0OC 1URFA 1RFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGG A;  4NB5 A;  2RMK B;  4NKG B;  1CXZ B;  1UPG A;  4DYL A;  1US6 A;  2HJD A;  2Q0O C;  1URF A;  1RFY A; 
#chains in the Genus database with same CATH topology
 3JD1 A;  4UVB A;  4LCU C;  1F23 A;  2ZDI C;  1AI6 A;  4DR5 O;  4ZKI A;  1CPY A;  5J2U B;  4PDM A;  2WLK A;  1WP8 A;  3A8T A;  3ZJZ A;  2YXL A;  4FFB A;  1NH2 D;  1DF5 A;  2GUZ B;  4TQD A;  3IC9 A;  5IWA O;  1VQ4 V;  4KUM A;  1BHA A;  1P4R A;  4GX5 A;  4I0X B;  2F43 G;  2B9Z A;  4JYC A;  3EHB B;  5FPR A;  1KU9 A;  3VQY A;  3H01 A;  5DEC A;  2UXX A;  4LF6 B;  4ZI7 A;  4TSF G;  3P32 A;  2BTQ B;  2IM9 A;  3AG3 B;  2FB5 A;  5KAI Z;  1FXK C;  3X2Q C;  1US6 A;  2HJD A;  4JV5 B;  4JI4 B;  2YXH A;  4DV0 O;  1QVG U;  3VOU A;  4EEQ A;  4JI6 B;  2IJJ A;  2YEV A;  2LW1 A;  1TAE A;  1PKX A;  1VP7 A;  3ZHT A;  3HKC B;  2Q7G A;  4X1Y B;  1NVP B;  2EJ7 A;  3B40 A;  5LA6 A;  3AG1 B;  1KMI Z;  4PJ0 Z;  3RYF A;  4X1I A;  3N27 A;  1EM1 A;  4YY3 B;  4RQF A;  2WA3 A;  4KFM A;  1AR1 B;  1MZE A;  4JI5 O;  4KP4 A;  4J41 A;  2DYS C;  2K9P A;  4DV6 B;  3ZMS A;  1YEW A;  1WP7 A;  1CEZ A;  4OXS A;  3ZS8 C;  3QVN A;  4I50 B;  2ZQM A;  3ZRW B;  4O2A B;  4Q20 A;  1ARO P;  3WG7 C;  3K58 A;  3ZIA G;  5LP6 C;  3E35 A;  5LMN B;  1NKD A;  1PV0 A;  4JI0 B;  2RCV A;  5J2T A;  5LOV A;  3AG2 C;  2DYR B;  4X8A A;  3KKY A;  2R9A A;  1GM8 A;  1Q86 W;  3C90 A;  3BFR A;  3OGC C;  3TK1 A;  1K5Q A;  3AEI A;  3EFF K;  3N2K B;  4ZIB A;  3RBZ A;  2M6Y A;  3TGU H;  1YCI A;  4TUY B;  1QR9 A;  3F5T A;  2EIN C;  1VQK V;  1OHH G;  3ZMV A;  3NR7 A;  4JAV A;  2ATK C;  4X1K B;  1Q8I A;  1R6N A;  2EIM C;  4UCV A;  5FPO A;  4JI1 B;  2PGG A;  1JA8 A;  1GAX A;  2AGA A;  3HKB A;  4MVZ A;  2ZR3 A;  1NI8 A;  4P30 A;  4FFB B;  4X66 O;  4D6T H;  4N21 A;  3R65 A;  4MVO A;  4PI0 A;  3SPH A;  2W6J G;  5JVD B;  2ZE7 A;  1K9M W;  4JI2 B;  1B6Q A;  1K5S A;  1N36 B;  3UO2 A;  4K0K B;  2UXD B;  1YTF D;  4I9Q A;  3T1C A;  1OZ0 A;  2A9H A;  3CXH F;  3CCU V;  1J95 A;  4NTY A;  5K1X A;  3ZN0 A;  1KP2 A;  4X20 A;  1ZUQ A;  1H8E G;  1XNR O;  1FFT B;  3DC6 A;  1EN6 A;  3BEH A;  1FFX A;  1U96 A;  1M57 C;  5LA6 B;  3RYF B;  2CE4 A;  4X1I B;  3CXC U;  4J7J A;  1F7Y A;  4X64 B;  5IDJ A;  1Y67 A;  1F4N A;  4DW1 A;  2Q8V A;  1RM1 B;  1I94 B;  4LF6 O;  1SQV H;  4YJ2 A;  2QM8 A;  4B08 A;  1Q82 W;  4D7S A;  1ZSP A;  5J2T B;  4JV5 O;  3JSN A;  4JI4 O;  1Q6H A;  4ABM A;  4JI6 O;  3ZRV A;  5KMG A;  1N34 B;  1XDC A;  3AG4 B;  2VWJ A;  4CS3 A;  4B7K A;  4DV2 B;  3G67 A;  2NR5 A;  3OEE G;  2EBO A;  4FLZ A;  1EN4 A;  2UXN A;  4JF3 A;  3JAT A;  4H37 A;  3D36 C;  1M1K W;  4JGS A;  1HNZ B;  4YY3 O;  1OCZ B;  3E2E A;  3HKB B;  2RJZ A;  3RVY A;  3TJT A;  5LGU A;  5BXZ A;  2F95 B;  4DV6 O;  1PL0 A;  4LF8 B;  2P7T C;  3O9O A;  3ASN C;  2C2A A;  2ZXW B;  3KCY A;  5LMN O;  2DWD C;  1M4U A;  4JI0 O;  5H5N A;  5B1B C;  2R9I A;  4R7C A;  2PI4 A;  4UB8 Z;  4CS4 A;  3JAK B;  1W0J G;  4TV9 A;  1NZ6 A;  3LDD A;  3ABL C;  5CBH A;  4RAI A;  2QJ1 A;  3SYP A;  5JQG A;  2ZIO A;  1XRE A;  3ZHS A;  3L9D A;  3O65 A;  1QR8 A;  1N33 B;  3VQX A;  1M56 B;  4DR1 B;  4X20 B;  5KAF Z;  3HKE A;  1WB7 A;  4UCU A;  2Z5U A;  2JS5 A;  5LYJ A;  5H6Q A;  4JI1 O;  1T5E A;  1FFX B;  4X62 B;  1NQT A;  3KG2 A;  4RQE A;  2A7W A;  1KEC A;  3DC5 A;  2QA4 V;  3RWR D;  1JOY A;  4U3J A;  3UCS C;  2IH3 C;  2WAM A;  5CB4 B;  4JI2 O;  1HDJ A;  1V9P A;  2RQ6 A;  5CA3 A;  4I55 A;  1N36 O;  1R3L C;  4YJ2 B;  1IBL B;  2UXD O;  4K0K O;  3LSQ A;  1NTK H;  4LWS A;  3JCU Z;  1FAF A;  1HR0 B;  2Q4P A;  3G6B A;  4UXN A;  1YIT V;  2YID A;  2EIL C;  5KMG B;  4FLW A;  2JS3 A;  1VQN V;  3B8N A;  2NLJ C;  4YIO A;  4A5U B;  1BL8 A;  1YIJ V;  3WFV A;  4C7U A;  2V1D A;  4PV1 B;  1XMQ B;  2HHH B;  3RVZ A;  1I08 A;  4P9P A;  3FB7 C;  1QBZ A;  4YHH B;  2CDY A;  1XI1 A;  1WN7 A;  3HKD A;  4DV7 B;  4X64 O;  1AI5 A;  1LUV A;  1NS1 A;  1L0N H;  1FYJ A;  4DYL A;  1PL4 A;  5EYP A;  1UJW B;  1I94 O;  1M90 W;  4BIU A;  3ZCC A;  2JK5 C;  1VEW A;  3K5L A;  3E8H A;  2OIG A;  3QTC A;  5C93 A;  4EKW A;  4PA6 A;  1ZX3 A;  1N32 B;  5JCO C;  1SS3 A;  1VF7 A;  3SPG A;  1N34 O;  1K7D A;  1Y76 B;  1B06 A;  3K5O A;  2IJH A;  1DF4 A;  3ZED A;  4DV2 O;  1IZ3 A;  5JQG B;  3HPL C;  5FLX N;  3JAR A;  1GKF A;  4FK5 C;  1QVF U;  3HKE B;  3OGI B;  2HLD G;  3C3T A;  2GV9 A;  3STZ C;  2X6C A;  5LYJ B;  1HNZ O;  1RFY A;  1CP9 A;  4FLU A;  4JYB A;  2L6L A;  1HNW B;  2JGU A;  4Q6G A;  3N2G A;  3JD4 A;  4NR1 A;  4H0L B;  1FPO A;  1NT2 B;  1K73 W;  4LF8 O;  2Y69 C;  4I4T A;  2ILM A;  4GX0 A;  4J10 A;  1JR9 A;  2H3O A;  1OCR B;  4B3T B;  2CTQ A;  1Q43 A;  1RPO A;  1BE3 H;  1RP3 B;  2HJF C;  2OCC C;  3FB8 C;  4I55 B;  3DSQ A;  4FM1 A;  4X9Q A;  4I0X A;  4LWS B;  2UU9 B;  2ZKO A;  4DXW A;  3CHX A;  2QTS A;  3IFX A;  4GKJ O;  2DMX A;  5JWP A;  3GVM A;  4GUN A;  1N33 O;  2YIB A;  4FIP C;  3OTO B;  4DR1 O;  5LHH A;  1HWY A;  3OE7 G;  1PPJ H;  1TUE B;  5GON B;  2UUC B;  1TGO A;  2BSK A;  4PA3 A;  4PDR A;  4X62 O;  3OMA B;  4QIW F;  2JEX A;  4LFC B;  1K33 A;  1X59 A;  1BQZ A;  3HKD B;  3CME V;  4B3R B;  2AHZ A;  3D8C A;  3TET A;  4EFE A;  4CZZ A;  1WNS A;  1XHX A;  1QCE A;  3CEI A;  5EYP B;  3OW2 U;  4K3A A;  1VQO V;  3L71 H;  4ASU G;  1SQF A;  2FKX A;  1XBL A;  1IBL O;  2JJ2 G;  1FXK A;  2XAQ A;  1HR0 O;  1NTM H;  4B7E A;  3K04 A;  4LF4 B;  4R50 A;  4J7Z A;  1PD3 A;  4MS2 A;  3ZRW A;  1ZLZ A;  3ML0 A;  5D5Q A;  3NXS A;  5EZY A;  5H2F Z;  4O4J A;  1UFI A;  3CMA V;  2JRI A;  1SQB H;  1VF6 C;  1NR7 A;  1XMQ O;  2HHH O;  3B8M A;  4IGG A;  2F66 C;  3HB3 B;  4YHH O;  1R3I C;  4TUY A;  1MZF A;  4DV7 O;  3A0B Z;  2CAZ C;  5KX5 A;  4BIO A;  3K5N A;  2XT9 A;  1Z2G A;  3N2G B;  3APQ A;  4O4L A;  4CH3 A;  3K57 A;  1IXB A;  3DTU B;  4I4T B;  5CBF A;  3ICX A;  5LP6 A;  3ZRX A;  4DW0 A;  1XUQ A;  3CX5 F;  2DWE C;  4UB6 Z;  5IJ0 A;  1OCC B;  2ITC C;  5JVD A;  4IIJ A;  5IY5 B;  1H2M A;  4DK0 A;  1B04 A;  2PI5 A;  1N32 O;  3RYI A;  4LF7 B;  3GWK C;  4LNU A;  1H2N A;  1FD9 A;  2F93 B;  5HFM A;  3SJQ C;  1S5J A;  1XL4 A;  3ABM B;  3F5W C;  4IHJ B;  1S77 D;  3AK2 A;  1AI4 A;  4KHP B;  2QE7 G;  4FLT A;  3BAA A;  5BY1 A;  1BQ0 A;  2BSK B;  5LGN A;  3QNE A;  1VAR A;  2Z0A A;  1K92 A;  1HNW O;  4FMT A;  5LMU B;  2IU0 A;  1MSD A;  3CJH B;  2E75 B;  3TXS A;  4B3T O;  1WLE A;  5B66 Z;  3K0D A;  2E74 B;  4F4L A;  1OJH A;  1V54 C;  1OV9 A;  1GM9 A;  2BOC C;  2DYR C;  4PA4 A;  3X2Q B;  1FXK B;  1PNM A;  4G2K A;  5CA0 B;  4FZ0 A;  2UU9 O;  4DV3 B;  1OCO B;  5GTI Z;  1EBO A;  3U0Z A;  4PA7 A;  1GN3 A;  2HG5 C;  3B77 A;  4J9Y B;  2A79 B;  1X4T A;  2Q73 A;  1Y74 A;  4WFA V;  4JI7 B;  3OTO O;  5EZY B;  4O4J B;  1O9H A;  2HVJ C;  5L3E A;  5A2Q N;  2IU3 A;  2GHY A;  4QGP A;  2D2C B;  2UUC O;  1DLB A;  4F6R A;  2DOS A;  1GM7 A;  2QTO A;  4PD4 F;  3ASO B;  4LFC O;  2DQ0 A;  3A0H Z;  1SA0 B;  3APO A;  1H38 A;  4B3R O;  1GN2 A;  4FLX A;  2DYS B;  5IJ9 A;  1W0K G;  5KX5 B;  4MT8 A;  1M93 A;  1BZK A;  3ZHR A;  3GWO A;  2R72 A;  4O4L B;  3UM7 A;  5KHI A;  3ZMT A;  2ETN A;  3WG7 B;  2WLJ A;  5LP6 B;  3CC2 V;  2QWO B;  4LF4 O;  1PNK A;  2R70 A;  5IJ0 B;  3H1L H;  3AG2 B;  4IIJ B;  4MVS A;  2DE0 X;  3ABK C;  2P67 A;  3RYI B;  3BA8 A;  5KHH A;  3E86 A;  1MA1 A;  1WPB A;  4PA9 A;  3RW0 A;  3S3X A;  4NTX A;  3JAK A;  2XAF A;  3ZMZ A;  5LXT A;  4B3M B;  4LNU B;  1QLN A;  2EIN B;  4I9W A;  2N04 A;  2Q69 A;  1S72 V;  4K8X A;  4NTW A;  1URF A;  2F4V B;  3JAS B;  1GO3 F;  1AIL A;  2EIM B;  1SRY A;  4JAU A;  4BAY A;  2ZIN A;  5EC1 C;  1Z5V A;  3VBB A;  2IH1 C;  4RUE A;  3EXA A;  2WA4 A;  4DUY B;  1RPR A;  3K0G A;  1R6T A;  2Y4T A;  3BRC A;  2DW4 A;  3CE2 A;  2AXT Z;  1AR5 A;  4LF9 B;  2QKC A;  3H1K H;  4Z1M G;  3H1J H;  3CCJ V;  2F23 A;  1K34 A;  3OM3 B;  5AG2 A;  1QLE B;  1WAZ A;  1JCH A;  5CB4 A;  3CRA A;  5LL6 Y;  3OR6 C;  3BHP A;  4CC5 A;  2EJR A;  1BS3 A;  4O2B A;  2UUB B;  1ENV A;  4IYH A;  1KKC A;  4LF7 O;  1P7B A;  1SQQ H;  5EBM C;  1Y74 B;  3SJC C;  1K8A W;  4KHP O;  1SES A;  4TOI A;  1DK1 A;  5KA6 A;  1VQ9 V;  4XDJ A;  4LP8 A;  4BR6 A;  3A2F A;  2N74 A;  4F6R B;  1M57 B;  1NVP D;  3K9S A;  4DR3 O;  1KB9 F;  4O4H A;  3UO3 A;  4DV1 B;  3CRR A;  4MW8 A;  3QF7 A;  4JTC B;  5LMU O;  2E3C A;  2Q68 A;  4J7K A;  2V7Q G;  5IJ9 B;  5A9G A;  2CTR A;  2WLH A;  3P3N A;  3K9A A;  4PEL A;  2RDC A;  1B3Q A;  2YSU B;  2GDS A;  1VIB A;  3CRC A;  5L3B A;  1M5I A;  1H8H G;  2P90 A;  1KYO F;  2WLL A;  1YJ9 V;  5H6R A;  5IE9 A;  2H8P C;  3T1H B;  4DV3 O;  4UUJ C;  4BWA A;  3F7V C;  5K1P A;  1IBK B;  5EC2 C;  4JI3 B;  3PN1 A;  4JI7 O;  1N0N A;  1Q6I A;  1Y6X A;  1M56 C;  3CCR V;  2CH7 B;  5LXT B;  3ABU A;  2A0L A;  1EFR G;  1J5E B;  3ZHQ A;  4I7Z B;  2Y4U A;  1Y76 A;  2FTK A;  1L8D A;  2GTA A;  2ARH A;  4CS2 A;  4RO2 A;  4GKJ B;  3AK1 A;  2EX3 A;  3RFR A;  1G4Y B;  3L72 H;  5BMV A;  4FVM A;  2OTJ V;  4PDL A;  4B3S B;  4R6Z A;  3JD2 A;  4GCZ A;  2QEX V;  2KKW A;  4DR6 B;  1Q3E A;  2QR4 A;  5JH7 B;  4MTX A;  1S76 D;  5HFL A;  2XOK G;  4BW5 A;  2EIK C;  3OFN G;  3SPI A;  3ASN B;  3LUT B;  2N05 A;  1JX9 A;  4YIP A;  2WSS G;  5DED A;  2XHB A;  4JZ2 A;  5JCO A;  3ABL B;  2Y0P A;  3C3S A;  2VWK A;  2ODM A;  4O2B B;  3L74 H;  4U7N A;  3FB6 C;  1YSC A;  4B3M O;  5L3F A;  4MVM A;  4CH5 A;  3UT5 A;  1R73 A;  4LFA B;  4PDV A;  5CA1 A;  1BT8 A;  4GZR B;  2IBZ H;  2ZIM A;  3LDC A;  3K03 A;  1FXH A;  3RYC A;  2F4V O;  3CCQ V;  3KZI Z;  4QE7 A;  4HZ3 A;  1SC5 B;  4RUF A;  3I55 V;  2PYL A;  3JAW B;  4O4H B;  3OUF A;  2OYQ A;  1FXV A;  4DUY O;  5LBQ A;  5GON A;  2WLM A;  2OCH A;  1VQ6 V;  2RMK B;  2E76 B;  4CC6 A;  1F51 A;  2UXC O;  4LF9 O;  1A32 A;  2WLN A;  3ZHU A;  4ICG A;  2UUA B;  2HEP A;  4MW3 A;  2WLL B;  1MSW D;  1MG1 A;  4AI8 A;  5KUK A;  2O57 A;  2ZM6 B;  2UUB O;  2EIL B;  4UV8 A;  5B1O A;  1LR1 A;  5B3S C;  4MTG A;  3CC4 V;  3FKS G;  5IYC O;  2AW9 A;  3L75 H;  3CWB H;  3OMI B;  1AJN A;  1BCC H;  2ITD C;  1YF2 A;  1XOU A;  4E2L A;  1R1B A;  5L3D A;  2Q9L A;  4DK1 A;  4DV1 O;  4RWU A;  5KHJ A;  5BMV B;  5LHI A;  3SJB C;  3CCE V;  1NH2 B;  1KD1 W;  1ZAU A;  2F1M A;  2KSD A;  4EFB A;  2QGN A;  3PJS K;  4WFF A;  3K79 A;  3P3P A;  4W4K A;  3CYO A;  3G80 A;  5BZB A;  4H13 B;  3T1H O;  2LGW A;  1HW7 A;  3M7M X;  3DXR A;  4GT1 A;  2CK3 G;  1IBK O;  4JI3 O;  3AK3 A;  2XAG A;  5L3G A;  3TCU A;  5IYZ A;  2QKA A;  2P4V A;  3UKM A;  2NNU A;  4J42 A;  1XEQ A;  1O9G A;  3G71 V;  1J5E O;  3BA9 A;  3OUS A;  3UT5 B;  1XQ8 A;  5CA1 B;  1K97 A;  3E22 A;  4AQY B;  3RYC B;  2OIE A;  2HVK C;  4J9Z B;  2MK3 A;  2ZT9 B;  1PM9 A;  4JZG A;  4P2Z A;  4HAM A;  2IJK A;  1Z5W A;  2WWW A;  4IHJ A;  4MTO A;  2W0F C;  4B3S O;  4DR6 O;  4P9O A;  4OGQ B;  1KBH A;  3H1H H;  2ZDI A;  3ETD A;  1VMG A;  2Y69 B;  3SYC A;  5LHG A;  4IT5 A;  1EN5 A;  4JTA B;  2ADP A;  1YI2 V;  3IC7 A;  1SQG A;  4X65 B;  2W0X A;  4MTF A;  2EIJ C;  2OCC B;  3LSU A;  3IAY A;  2QDO A;  3CJH A;  4GKK B;  2H94 A;  3BAB A;  4BW9 A;  1W59 A;  2ADQ B;  1D5A A;  5FNV A;  3JCZ A;  2YDE A;  2Q0O C;  5B1A C;  3OR7 C;  2YIA A;  3GB7 C;  2Q6A A;  1R3J C;  4J11 A;  4LFA O;  5CA0 A;  2X7R B;  4UCT A;  2PUS A;  3LSS A;  2QWN B;  4K8Z A;  1YZB A;  4UVC A;  3T4Z A;  4KL1 A;  3MHH C;  3SR2 C;  4UFZ A;  2VQE B;  2Q7E A;  5E79 Z;  3FAV A;  3E83 A;  3H1I H;  2X0L A;  2OTL V;  1AR4 A;  4DR2 B;  2HKO A;  4LFB O;  2KB1 A;  1D2D A;  2OWO A;  3ETG A;  4XDK A;  3B09 A;  3L73 H;  2QM4 A;  2K1E A;  3B4S A;  3CP1 A;  2E5L B;  2GBO A;  2XTA A;  1CXZ B;  4HYO A;  1SA0 A;  4OX9 B;  1SZT A;  2UUA O;  2VQF B;  5IY5 C;  1N0J A;  4IL6 Z;  1V55 B;  1SQX H;  2JVD A;  3FYE B;  1PNL A;  2YI8 A;  2ZM6 O;  1S5H C;  4NXM B;  3D3I A;  3RYH A;  3DXR B;  1YTF B;  4NYK A;  3AG3 C;  3SPJ A;  5IYZ B;  5KHG A;  2WLI B;  1WA8 A;  1QU7 A;  3MD0 A;  5DN6 G;  5F2V O;  2VS0 A;  3WB0 A;  1VQP V;  1H2K A;  1E79 G;  4JAS A;  2YS8 A;  3E22 B;  1IX9 A;  2JIZ G;  5EIB D;  1XNQ B;  4K35 A;  2Q67 A;  4Z2W A;  3T1Y B;  2BOB C;  1BHB A;  3FFQ A;  3JAS A;  1P84 F;  1AJQ A;  1TVK A;  3AG1 C;  4QPJ A;  2QWR B;  4GX2 A;  5CMU A;  1COW G;  2YC0 A;  4DR3 B;  3J7A U;  4L8J A;  1JJO A;  2PTM A;  3JD3 A;  4FM0 A;  1YVW A;  4MVU A;  4JYA B;  1OCO C;  3ZRS A;  2XAS A;  2LGQ A;  1DGS A;  5FNV B;  1E1R G;  5GW7 A;  2RN9 A;  3ETQ A;  2Y48 A;  1SER A;  4PHZ A;  1GRJ A;  1ROP A;  4AQY O;  4LR3 A;  3K5M A;  4TWK A;  4F6E A;  3ASO C;  2L35 A;  4WBN A;  1BMF G;  3CCL V;  3G6E V;  3FAV B;  5EBL C;  2LFR A;  1VQL V;  3RT3 C;  3Q4H A;  3I5D A;  2X6B A;  1G8M A;  3T2M A;  5ITZ A;  1VQ5 V;  4AIL C;  3JYC A;  3KCX A;  4X65 O;  4DV4 B;  3I56 V;  5H9C A;  4R8C A;  4ZHQ A;  1V54 B;  3CB2 A;  1QNM A;  4QJF B;  4L87 A;  2Q0A A;  3R66 A;  4GKK O;  5BR8 B;  3J80 N;  5JJE B;  1JFF A;  2KQX A;  4XBF A;  1F4M A;  1Q90 D;  3CCV V;  1H2S B;  1TUB A;  3RYH B;  1JVM A;  4JI8 B;  2M7W A;  1FKA O;  1GH6 A;  4JPR A;  3LNM B;  1M9N A;  1VQ8 V;  1WA8 B;  2G38 A;  3CCS V;  4FZ1 A;  2CGO A;  1E1Q G;  3FD9 A;  4H44 B;  1GTO A;  2LQT A;  3M99 B;  2VQE O;  2CUG A;  3U10 A;  1I5X A;  2CH7 A;  2PF4 E;  3E8B A;  4WF9 V;  1Q7Y W;  3QO8 A;  2ZD9 A;  1GMG A;  4DR2 O;  1UPG A;  1LNQ A;  1N4C A;  4GYC B;  1JPX A;  4GX1 A;  2P6J A;  3RN4 A;  3MDS A;  3D36 A;  1TVK B;  2FYU H;  3AG7 A;  2E5L O;  2BTO A;  2EZP A;  4QNH B;  4OX9 O;  3U11 A;  1I5Y A;  3SGI A;  4ZI7 B;  2VQF O;  2Q7H A;  4MVR A;  1QLE C;  3EVK A;  5JH7 A;  1RM1 C;  1L0L H;  4G27 B;  4NXM O;  3ABK B;  5D5P A;  1HNX B;  1P7G A;  2UXC B;  5B5E Z;  2HFE C;  1MAB G;  5IYD O;  2YEV B;  1MMM A;  1NU1 H;  3CRQ A;  3THO A;  4WFE A;  1DTO A;  1D5N A;  4JTD B;  3QO7 A;  2YIB D;  4IYI A;  3AG4 C;  4W4L A;  1AP6 A;  3H9V A;  3T4D A;  2Y0I A;  2FL4 A;  1IBM B;  4WBN B;  1VF5 B;  1XNQ O;  3T1Y O;  2XAH A;  3SYQ A;  2LFS A;  1Q6U A;  2NN4 A;  4UCS A;  1VQM V;  3Q4H B;  2QKS A;  4DV5 B;  1Q81 W;  3CRM A;  1EZJ A;  1LUW A;  1AB3 A;  5ITZ B;  1OCZ C;  3JAW A;  1AVM A;  3ZN1 A;  3B2E E;  1QHT A;  2HP8 A;  3F7Y C;  4ZHQ B;  3ZMU A;  5LOV B;  1ZL8 A;  2WPD G;  2QWQ B;  4JYA O;  2YIC A;  1I0H A;  4FLV A;  4DR4 B;  1NJI W;  2ZXW C;  2BE3 A;  1JFF B;  1PP9 H;  2YI9 A;  1YJN V;  2B1I A;  4NXN B;  2QM7 A;  2R9R B;  1TUB B;  3QG5 A;  1KUQ A;  4O4I A;  3OEH G;  5JJN B;  2YUA A;  5KA5 A;  4TT3 G;  5L3C A;  1N8R W;  4FM2 A;  1BGY H;  3P30 A;  3W7X A;  4YJ3 A;  5CBG A;  3W7U A;  1H2L A;  4PI2 A;  4DUZ B;  4NKG B;  4E4E A;  3BPZ A;  1KC8 W;  3VQV A;  1YDX A;  3WB1 A;  1GN6 A;  1H2G A;  2UXB B;  2OT5 A;  2GSM B;  1XL6 A;  1K3E A;  1FJG B;  4J80 A;  2P4K A;  3CSX A;  4DV4 O;  1G1X B;  2ZNJ A;  2DJV A;  1YJW V;  1HP8 A;  1K4D C;  5BR8 O;  3FYI B;  5KHK A;  3W7T A;  2PZS A;  4DR7 B;  4YXW G;  1IUR A;  4NVP A;  4JI8 O;  3BVO A;  1MOF A;  5B1B B;  5FL7 G;  2Z3Y A;  2JEU A;  2GTS A;  4UCO A;  1XIL A;  3ETE A;  2CGN A;  4G28 B;  3D3Q A;  4HBN A;  1G6U A;  3JSL A;  2CTP A;  3K59 A;  1SQP H;  3MAQ A;  4BIZ A;  2JGD A;  2ZNI A;  3DGE A;  1KKD A;  2AZ2 A;  2XAJ A;  4Z1V A;  2P5O A;  2B1G A;  3E8F A;  1S0V A;  1SF9 A;  3VQW A;  3HR0 A;  4ZOL A;  3OAA G;  2VRZ A;  2EIK B;  1IVS A;  3STL C;  1RSO A;  4XDL A;  3SPC A;  1FS0 G;  1THZ A;  3IJ4 A;  3BY6 A;  3ZHV A;  4LFB B;  1YHQ V;  3L70 H;  5C8Y A;  1SKV A;  3BCC H;  1ZL8 B;  2IJI A;  1HNX O;  2BCC H;  3E8G A;  3JAL A;  3SJA C;  3K06 A;  4LF5 B;  2JDI G;  3RGB A;  4D7T A;  5GTH Z;  4X88 A;  2ZR2 A;  2YXY A;  5CN0 A;  4O4I B;  4WFG A;  3CCM V;  3OT7 A;  4DRX A;  4GLX A;  1P49 A;  1ORQ C;  2RNB A;  3JAT B;  2LO1 A;  1Y66 A;  3SYA A;  3SYO A;  3S3W A;  1IBM O;  4YJ3 B;  4MVQ A;  1XMO B;  3W7W A;  2LP7 A;  4WCE V;  3TXQ A;  1MNG A;  3CD6 V;  4TV8 A;  3OTF A;  1SZX A;  4DV5 O;  3ABT A;  4DR5 B;  5EIB C;  1WJZ A;  1JQ0 A;  4EB6 A;  1NR1 A;  1SET A;  5EK0 A;  1IDS A;  4LH7 A;  3SDL A;  1ZWI C;  1QQC A;  1GK9 A;  5IWA B;  2A06 H;  5DM6 V;  4TV9 B;  2PY5 A;  4DR4 O;  4FJC C;  1BSM A;  2ZCE A;  4HNA A;  3OMN B;  1OCR C;  4NXN O;  5B3S B;  3JD0 A;  4JYY A;  2MW2 B;  1AI7 A;  1I7F A;  5IT9 N;  2KG7 A;  1ZTE A;  3G4S V;  3ZBH A;  2X6A A;  4DV0 B;  4FPP A;  2XND G;  2B5U A;  2ZE6 A;  1U97 A;  3UQ8 A;  3M8A A;  2FML A;  2WLI A;  3WB2 A;  2IW5 A;  2JGD B;  4DUZ O;  1VF6 A;  2ZE5 A;  1JJ2 U;  2V4D A;  4U3J B;  2HR3 A;  2UXB O;  4TQF A;  5J2U A;  3E89 A;  2PYJ A;  1JMK C;  3CS5 A;  1S3J A;  1FJG O;  3WU2 Z;  2LW7 A;  4ZOL B;  3ZX6 A;  2AZ0 A;  1NBM G;  2GUZ A;  1XHZ A;  4JI5 B;  1S5L Z;  1RSO B;  4CH4 A;  4UV9 A;  5LGT A;  4FLY A;  3OD4 A;  4DO2 A;  2P22 C;  5C8Y B;  4DR7 O;  1KP3 A;  3CPW U;  5IYB O;  2BTQ A;  3JAL B;  3MHS C;  4MSW C;  2D3O W;  3LNN A;  4UCR A;  3LDE A;  2LJ2 A;  4UVA A;  1KQS U;  1IXM A;  2QWP B;  5KLV H;  1TA8 A;  4LH6 A;  4LBE C;  2QSA A;  2DQ3 A;  4KXR A;  3IGA C;  4X89 A;  2CTW A;  3K08 A;  4JAA A;  4AHC A;  4DRX B;  3W7S A;  1Y4M A;  2XUM A;  3FX7 A;  2W6I G;  3HKC A;  4ZBM A;  4X1Y A;  4FFK A;  1Q5O A;  1VQ7 V;  4U3F H;  1WPX A;  5EBW C;  1AJP A;  4TV8 B;  5J9P C;  3A0R A;  4QE9 A;  1R6K A;  2AHY A;  2A3Q A;  4LC1 A;  3K3W A;  2JJ1 G;  4EB6 B;  4WFB V;  4OPA A;  1NTZ H;  1L1F A;  2EIJ B;  5KUM A;  4X66 B;  4OPH A;  2ZE8 A;  1V55 C;  4I50 A;  2EUL A;  4O2A A;  4I5S A;  1GN4 A;  1R3K C;  2EZO A;  1WB8 A;  4HNA B;  4WFH A;  2DN9 A;  5B1A B;  4LF5 O;  3FB5 C;  3J81 N;  1OCC C;  4U7O A;  1YXB A;  2KG7 B;  3JAR B;  3JAM N;  3CC7 V;  5B1N A;  1AP5 A;  1EZV H;  5TIS Z;  3N2K A;  4CBC A;  2P06 A;  5E1A C;  4QPK A;  4N23 A;  1K4C C;  4H33 A;  1W2B U;  4NB5 A;  3QO5 A;  1XMO O;  2Q5Z A;  4CH6 A;  3ABM C;  5JJJ B;  1XNR B;  4X1K A; 
#chains in the Genus database with same CATH homology
 4IGG A;  4NB5 A;  2RMK B;  4NKG B;  1CXZ B;  1UPG A;  4DYL A;  1US6 A;  2HJD A;  2Q0O C;  1URF A;  1RFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...