1URFA

Hr1b domain from prk1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
GIPATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQADQLENQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C-LIKE 1
publication title Molecular Dissection of the Interaction between the Small G Proteins Rac1 and Rhoa and Protein Kinase C-Related Kinase 1 (Prk1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 81
sequence length 81
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02185 HR1 Hr1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1urfA00
1URFA 1RFYA 1US6A 1UPGA 2Q0OC 1CXZB 2HJDA 2RMKB 4IGGA 4NKGB 4DYLA 4NB5A
chains in the Genus database with same CATH superfamily
2B1GA 1YIJV 1HNWB 3T1HB 1M1KW 4X1IA 5L3DA 3ZMSA 1N34O 3AG2B 1EN5A 2YIDA 2P6JA 1COWG 2PGGA 4Z1MG 4LF9B 4J80A 3CXCU 1VF5B 4YJ2B 4W4KA 1GN6A 1VQPV 1PL4A 5EBWC 5LP6C 4KXRA 4OPAA 4PHZA 3L73H 4RQEA 1YHQV 4PDRA 2YXHA 2OIGA 1WN7A 5KMGB 4GX5A 1IBKO 2P4VA 4DRXB 3SYPA 3CC7V 4HNAA 3MAQA 3OMIB 4X64B 5AG2A 1R6NA 2AW9A 4PDLA 1OZ0A 1M4UA 2AGAA 1S72V 2CK3G 1V54B 1CPYA 4DV1B 5LP6A 1FS0G 4AILC 1EM1A 1Q82W 3H01A 1S5JA 4B3MO 2N04A 4TUYB 3JD2A 4YJ3A 4DW0A 5B1AC 1XOUA 1XHZA 2HEPA 5KX5A 2X6CA 1VIBA 2Y0IA 1WB8A 1XL4A 5KHJA 4L87A 4X9QA 1AI4A 4O4HA 1OJHA 4DUYO 1KYOF 1XI1A 2XT9A 1I94B 5EZYA 4GKKO 3U11A 1QLEC 2LFSA 1XHXA 1GH6A 1LNQA 1JR9A 1J5EB 2QJ1A 1DGSA 1NVPD 2WLMA 1G8MA 4JGSA 4NXNO 1W2BU 1R6KA 3CS5A 5BZBA 1SESA 3ABUA 4F6RA 2YUAA 2E76B 4AHCA 2ARHA 5CA3A 2ZE6A 3SPCA 3FB7C 4UB6Z 4UFZA 1IBMB 5LL6Y 1W59A 3AG1C 2RN9A 3OR7C 5JH7A 3K5OA 5H6QA 3L74H 1NJIW 1RSOB 1ZUQA 3M7MX 1IDSA 1QVFU 4X66B 1WAZA 1DF5A 3K04A 2CH7A 2L6LA 2Q5ZA 2QWOB 4H33A 2LW7A 4GX0A 1XMOO 2BOCC 4YY3O 3OAAG 2W0FC 5EIBD 3HKCA 3ZHTA 4O4HB 1Q6IA 4IYIA 4UV9A 2OIEA 4YHHB 2E74B 1OCOC 4DR4O 1LR1A 1PL0A 5EZYB 4JI4O 1K7DA 4IGGA 1V55B 1Z5WA 5KLVH 3DC5A 4DK1A 1BHAA 2QA4V 1FFXB 4JI5O 3AEIA 4JZ2A 4CC6A 4PDVA 1KD1W 4DV3O 5CB4A 4H13B 2HVJC 3RFRA 1LUWA 3JD3A 1YCIA 4LFBO 2UUBB 2Y69B 3O9OA 1M93A 3ZMZA 1FKAO 3OGIB 5C8YB 1BQ0A 1I7FA 1JA8A 5JH7B 4DV7O 4LFAB 2Q68A 3WB0A 1YITV 2Q73A 2WSSG 3WB1A 5LA6B 4YIOA 1QR8A 4EEQA 2R9AA 1Z5VA 2GUZA 3E83A 5KHKA 1N34B 4ABMA 1JFFB 4O4JA 1TUBA 5L3CA 3STLC 3CCMV 3RVYA 4U3JA 2V1DA 2KG7B 3ZRSA 3K08A 3W7TA 3K5NA 2LJ2A 3M8AA 1NKDA 4FLTA 1M56C 1AP5A 5FPOA 1Q90D 5IWAO 1X4TA 4LH7A 3TK1A 1TVKA 2NLJC 5C93A 1IBKB 4IL6Z 1WA8B 5CB4B 2GBOA 2QWPB 4I0XA 3B4SA 1BQZA 4QPJA 2E75B 2ITDC 1GM9A 4DR5O 2QEXV 3ZRWB 2WLNA 1YEWA 2Y4UA 1RP3B 1VQ5V 4JI3O 5JWPA 1M5IA 2QKSA 4MVMA 4B3MB 3CSXA 3JAKA 4TQFA 4JI7O 2DYSB 4BIZA 3P3PA 4DV0O 1PV0A 1ZTEA 2EIMC 2YC0A 1D2DA 3P32A 4GLXA 2KQXA 4FFBB 1EN6A 4JYCA 2XAQA 2QGNA 2OTLV 4X1KA 2JJ2G 1NZ6A 1KKCA 3EVKA 4DUYB 1VEWA 5J2TB 2Q8VA 3HKEA 4GKKB 4F4LA 2QTOA 2Q0OC 2WLJA 3J81N 1KUQA 3DC6A 2X7RB 1OHHG 2ZCEA 4JF3A 4R6ZA 4FLWA 1FJGB 3TETA 4NXNB 4PA3A 3LNMB 3SPIA 4NVPA 1EFRG 1X59A 1YDXA 3FFQA 1JPXA 2BSKA 2X6AA 1SQBH 4LF8O 1TA8A 4FJCC 1J95A 3HKBA 2YI9A 3E8BA 5IJ0A 3E8FA 2UXDB 3STZC 2IW5A 1P7GA 3TCUA 2AXTZ 1AB3A 2DWEC 5KA5A 2DYRB 5EYPB 5LOVB 1JJOA 3ABMC 3FB8C 3BPZA 4EFEA 4JAUA 2RCVA 4JV5B 5H2FZ 3F7YC 1BMFG 4GX1A 4N23A 3CPWU 1A32A 2UU9O 3OMNB 1XMOB 3DXRA 4YY3B 4LBEC 3RVZA 4FVMA 4FFKA 1BHBA 2EINC 1HNXO 4X1KB 1XREA 2OCCB 1GM8A 1WP8A 5KHGA 4DR4B 2GHYA 2QKAA 1ROPA 3TXSA 4JI4B 3ZX6A 4FM0A 3E35A 4UCOA 3RWRD 1S77D 1Y74A 1GM7A 4MVRA 3D36C 1AI7A 2YICA 3ZMTA 4QE9A 2WPDG 4DV3B 3K5LA 2ZE7A 3SR2C 3CX5F 2XTAA 4LFBB 2EIKC 1YJWV 5B1BB 2G38A 4IIJA 4K8XA 4UCUA 4RQFA 5IJ0B 3T1YO 3ASNB 4PV1B 1R3JC 3GVMA 3N2GB 3BA8A 4DV7B 4ZHQB 2ZQMA 3VOUA 5BMVB 3ETGA 3A2FA 3D36A 3K57A 1PM9A 3BRCA 4UUJC 3K58A 2EX3A 3OW2U 3QF7A 4MVOA 3DXRB 1OCZC 4I50B 3NR7A 5LMUB 4B3RO 1U97A 1UJWB 1XNQO 2NNUA 4DV4O 5JJNB 5IWAB 2Z0AA 3ETQA 3ZJZA 3RYFB 3KZIZ 3H1KH 4U3FH 1THZA 3Q4HB 1F4MA 1B3QA 2YIAA 2L35A 3FYIB 3E22A 4JI6O 2EILB 2LW1A 2CGOA 1IVSA 1SQGA 5FLXN 1GAXA 3M99B 3KG2A 3FAVA 3CYOA 2YIBD 2OT5A 1U96A 2W6JG 2PUSA 4WFAV 4X1YB 1Y76A 4JI1O 4IHJA 3X2QC 2UXNA 4IIJB 2JGUA 2LGQA 4DR5B 5IT9N 4CH6A 4JI3B 1LUVA 5B5EZ 1SA0B 5A9GA 3ABLB 4JYYA 4TWKA 5LHGA 2EJ7A 4JYAB 4JI7B 1QBZA 1KQSU 1MA1A 2LQTA 4DV0B 3OTFA 2DE0X 3K06A 1FYJA 1I5YA 4LF4O 5IY5B 1AR1B 1VF6C 4ZI7B 1RPRA 3K5MA 3MDSA 1M9NA 4PA9A 5DEDA 1Y6XA 4G28B 1GKFA 1SQVH 3JD1A 5LGNA 1CEZA 2E3CA 1YSCA 3UO3A 2ILMA 1H2NA 4JI0O 4PI0A 2CDYA 3JAWB 4KFMA 1GRJA 1YJNV 2IBZH 5L3GA 4G2KA 1VF6A 3CCUV 4DR6O 2XUMA 3IC9A 2JIZG 1XBLA 1K33A 1VQKV 3K0DA 1K73W 2F66C 1W0JG 1FXHA 1GN2A 1N4CA 5GONA 4LF8B 2BTQA 1Y4MA 1HNZO 5H9CA 1H2MA 2AHZA 1SQFA 2AHYA 4DYLA 2F4VO 1RM1C 1VQ6V 3APOA 2RMKB 4DK0A 4HAMA 1KU9A 5IJ9A 4R8CA 2Q7EA 1MZEA 2UU9B 4XDJA 3OE7G 2BOBC 4AQYO 4RUFA 1QHTA 2HJDA 3QO5A 4FIPC 1HNXB 1WB7A 4EFBA 4DR1O 4DR7O 5JVDA 4FMTA 3C90A 3BABA 1FXKB 3S3WA 1P4RA 5JQGA 1AR4A 4NYKA 1FAFA 5L3FA 1VQLV 1US6A 4LWSA 4MW8A 4CZZA 3FYEB 4R50A 2HLDG 3K59A 3OMAB 2WLKA 2JS5A 2OYQA 2IH1C 4I9WA 2ADQB 3CE2A 3ETEA 3IC7A 2DWDC 4O2AA 3BAAA 1HR0O 2YIBA 4X1IB 4A5UB 1ENVA 3TXQA 3CMEV 1M90W 2A3QA 4OXSA 1ZWIC 3ABKC 1BL8A 1PD3A 2W0XA 3ZRVA 3FB6C 4FZ1A 3CCSV 2A79B 4E2LA 3BY6A 3AG4C 1V55C 5L3EA 4LF6O 2EZPA 1SETA 2D3OW 5KHHA 4B3RB 3ZHUA 1K4DC 4NTXA 3WG7C 5J2UA 1B6QA 1ZL8A 5JVDB 3I55V 1XNQB 1UPGA 5B66Z 2EBOA 3CCQV 3SPHA 3KKYA 1NR7A 2R9RB 2LO1A 4JTDB 3LSUA 4HNAB 3SJCC 1K34A 1QQCA 4LWSB 2VQFO 5DECA 2FMLA 4JI6B 1SKVA 1NTKH 2Q7GA 3A8TA 4DV2O 4RAIA 1G4YB 3EXAA 5LP6B 2K9PA 1G6UA 3TJTA 4PELA 4JI2O 4JI1B 2WLIA 1KB9F 3JATA 2UXCB 2Y4TA 4O2AB 4F6EA 3ASOC 4FLUA 3K79A 4IYHA 1L1FA 3T2MA 3OFNG 1MZFA 1WNSA 2QM4A 4YJ3B 3UM7A 5LBQA 1W0KG 1WPBA 1AJPA 3O65A 3OD4A 5KX5B 3N2KA 4X65O 2D2CB 2M6YA 1B06A 5TISZ 4OPHA 2EULA 4UCSA 2UUCO 4LF4B 4WFBV 4JTAB 4TV9A 1MG1A 4MW3A 3JALA 3RYHA 3SYCA 1NU1H 5J2UB 2WAMA 1K5QA 2P22C 4U7OA 3JSNA 2ZE8A 3E8GA 4EB6A 1YTFD 4JTCB 4MTOA 4YXWG 4JI0B 3LDCA 4H44B 4MSWC 4F6RB 3J80N 3SYOA 2QSAA 4DR3B 4G27B 5E1AC 4FM1A 2ZDIC 1R73A 1QLEB 2OTJV 5CA1A 2HHHO 3VQVA 5F2VO 2DW4A 1M57C 2WLIB 1HNZB 3OM3B 4J42A 4UCVA 3ZHVA 1N0JA 3ZEDA 3OEHG 3PN1A 1NTMH 3HKDA 1L8DA 3WFVA 2CH7B 2ODMA 2F4VB 1URFA 2ADPA 4DXWA 1R1BA 3N2KB 3U0ZA 3SJAC 1YI2V 3CRRA 3HKCB 1QLNA 3G71V 3PJSK 4WFEA 3I56V 4HZ3A 4I5SA 1AR5A 1L0LH 5HFLA 3MHHC 2WA4A 3AG1B 4AQYB 5IYCO 1XEQA 3UO2A 3B8NA 3JALB 5LMNO 1DLBA 1BT8A 3F5WC 4DR1B 4DR7B 3APQA 4WBNA 3IJ4A 1UFIA 4DV6O 5ITZA 1XDCA 1AILA 4O2BA 2FYUH 1NR1A 5LGUA 3MHSC 4CS2A 5D5PA 2EJRA 3L71H 1H8EG 1OCOB 1YXBA 3SPJA 4X89A 3E86A 2JK5C 2VRZA 4JYBA 2HVKC 4OX9O 4H37A 1Q43A 5CA1B 4DUZO 1Q3EA 2FTKA 3CRAA 4MT8A 1MABG 5EIBC 3ZCCA 5GTHZ 1HR0B 4WF9V 2PTMA 3HKDB 3ZMVA 2A9HA 2GUZB 2Y48A 2M7WA 2WWWA 4O4JB 1TUBB 1R6TA 3S3XA 1S5HC 4U3JB 3ZMUA 4KUMA 5D5QA 2KSDA 5LYJA 4GYCB 3CCEV 2Z5UA 3GWOA 3JARA 5DN6G 4GZRB 4MVSA 1B04A 2A0LA 4LF6B 2QR4A 2P7TC 1HWYA 2Q9LA 2HJFC 2KB1A 4CH5A 4MVUA 5LXTA 1JQ0A 3G4SV 1AI5A 1AJQA 4WBNB 1TVKB 5JJJB 3CD6V 5IYZA 3CB2A 2X0LA 4KP4A 5CA0A 4I0XB 2VQFB 3AK2A 3ASNC 4Z1VA 2RJZA 4DV2B 3W7XA 3VQYA 1AP6A 1M56B 2P4KA 1Y66A 1PKXA 2Y0PA 1FFTB 3CRQA 4JPRA 3ZHRA 1I08A 4JI2B 3G6BA 1K9MW 1S0VA 1RFYA 3RN4A 3OT7A 3E2EA 3JAKB 4GKJO 3B8MA 1MSDA 3SYAA 1SQQH 2ZINA 4FM2A 3I5DA 5BR8O 1OCRC 3OUSA 4W4LA 2JS3A 2FL4A 1ZX3A 2XAGA 2CTWA 2MW2B 5CN0A 5EBLC 3T1HO 4NXMO 5LYJB 2Q69A 2UUCB 1K5SA 2EIJC 3JARB 1PNMA 4X20A 4P30A 3RYCA 2ZT9B 4JZGA 3HKEB 4XDLA 2H3OA 3B2EE 3FB5C 2JJ1G 1OCCC 4JI5B 5B1NA 2RQ6A 3L9DA 4ZOLA 2EIMB 2ZXWC 4TSFG 4WFHA 1VQMV 1F51A 5IYZB 1FD9A 2ZNIA 5IE9A 4IT5A 3CCJV 5CA0B 3ZN1A 2BSKB 2XOKG 4FLVA 2OWOA 2ZM6O 3HKBB 3L70H 4CC5A 3A0RA 1Y67A 2Q4PA 3JCUZ 4X64O 2YDEA 2XAHA 2HHHB 2GSMB 3EHBB 2EZOA 1S76D 1VQNV 4K8ZA 3SYQA 1XNRO 2X6BA 4FK5C 2IH3C 2WLLA 4DV5O 1OV9A 2P90A 5BY1A 4N21A 2LGWA 2VQEO 1SERA 1ORQC 4L8JA 2YS8A 1EBOA 1ZLZA 5H5NA 4LR3A 4UB8Z 2F23A 4X20B 2QM7A 3A0HZ 3AG3C 5B3SB 2QM8A 5LMNB 3ABMB 4B3SO 4LFCO 1N0NA 1Y74B 1SS3A 3IGAC 4LF7O 2VWKA 3DGEA 1V9PA 4ZOLB 3P3NA 2IU3A 4DV6B 3CP1A 2QWRB 1QU7A 4X62O 3QVNA 2MK3A 3CMAV 3CRMA 2JGDA 3LSQA 3FX7A 1S5LZ 2EINB 4BIUA 4X88A 2DJVA 3AG2C 4OX9B 4DUZB 1KKDA 2HP8A 1K4CC 1XUQA 2DOSA 4O4IA 4LNUA 1ZSPA 2Q0AA 4UCTA 2UUAO 4O4LA 2XHBA 4ZIBA 2Q6AA 1IBMO 3CJHA 1NBMG 4I55A 1IXBA 3T1CA 2ZR3A 3BEHA 3QNEA 4B3TO 4MVQA 4PA6A 2EIKB 4JAVA 2UXBO 1NS1A 1K97A 1PNKA 3BVOA 1I0HA 2QKCA 3JSLA 4J7KA 2DMXA 3MD0A 1QNMA 2B1IA 1H2SB 1V54C 2ZE5A 2YEVA 1PPJH 3E22B 2H94A 1Q86W 3CCLV 1OCZB 2JGDB 5KMGA 1KMIZ 3FAVB 2CUGA 4H0LB 1Q6UA 1Y76B 5JJEB 4IHJB 4DRXA 3CCRV 5KHIA 1Q5OA 2FKXA 4K0KO 2CTPA 1KBHA 3VQWA 3HB3B 1Q81W 4DR2O 1JVMA 2Q67A 3RYIA 3T4DA 4TOIA 1KECA 4PA4A 5BXZA 2H8PC 4WCEV 1DF4A 5BR8B 3SJQC 1MNGA 2QWQB 1RPOA 2YI8A 4TQDA 4TUYA 3X2QB 4NXMB 1H2GA 3RT3C 1JJ2U 4B7EA 3OEEG 2B9ZA 5EBMC 5CBFA 1Q7YW 2P67A 5EC1C 3CCVV 1VQ7V 2ATKC 2YEVB 1KC8W 3G67A 4BIOA 2QE7G 3W7SA 1SZXA 5HFMA 5GONB 2BTQB 1O9HA 1F7YA 2ZM6B 1SF9A 3CEIA 4MTXA 4FLXA 3T1YB 1QCEA 1HW7A 4KL1A 3RGBA 1GO3F 4ZKIA 3JCZA 1XNRB 4OGQB 2ZD9A 4TV8A 3SPGA 5GW7A 3RYIB 1XMQO 1QR9A 2KKWA 5IJ9B 4DV5B 1H8HG 3JD4A 2BCCH 2XAFA 2VQEB 3JYCA 2GDSA 1RSOA 3D8CA 2IJKA 1E79G 3LDDA 4GCZA 1WLEA 3QTCA 3ZRXA 3JD0A 3VQXA 1CXZB 4PA7A 2ETNA 2P5OA 2XNDG 4HBNA 4LF5O 4DV4B 3LDEA 3LUTB 1RM1B 4JAAA 2CE4A 4LFCB 4B3SB 2CTRA 1GN4A 4ASUG 5JQGB 2Y69C 2E5LO 1BSMA 4LF7B 5CMUA 4CS4A 3N27A 1N36O 4I4TA 4X62B 1SZTA 1FFXA 1H2LA 1K92A 1BCCH 1FJGO 1KP2A 4I7ZB 5FL7G 3SGIA 3ZIAG 4DO2A 3D3QA 5J9PC 1D5NA 5KUKA 1JX9A 3ZN0A 4KHPO 5LHIA 2UUAB 5C8YA 4TV8B 1NH2B 1SQPH 3B09A 4QGPA 4U7NA 3RW0A 2UXDO 2QDOA 2B5UA 1H2KA 3AK3A 3UT5A 3DTUB 4QE7A 1AROP 4B3TB 4UXNA 5LA6A 2YXLA 3IAYA 3WB2A 4XDKA 4X8AA 2JRIA 3BCCH 4JV5O 4E4EA 2UXBB 1WJZA 1F23A 5FPRA 1JFFA 4B08A 1VQ9V 5H6RA 2IJJA 1ZL8B 2PY5A 3VBBA 3H9VA 3H1IH 2KG7A 4J9ZB 5B1AB 1EZJA 4GUNA 3ABKB 1L0NH 2XAJA 4I4TB 1IBLO 1AI6A 3AG4B 4B7KA 5CBHA 4DR6B 3J7AU 3QO7A 4Z2WA 4FLZA 1DK1A 2V7QG 4UVCA 1O9GA 2DYSC 1D5AA 3IFXA 3WG7B 3JATB 1WA8A 3K03A 4UVAA 3NXSA 1VQ4V 3W7UA 1BE3H 3ICXA 4K0KB 1JOYA 1VP7A 3ZS8C 4DR2B 1GTOA 4MTFA 4J7JA 4YIPA 1ZAUA 1K3EA 3ZRWA 1TAEA 1GMGA 3H1HH 1EZVH 1XL6A 2QTSA 3CWBH 3UT5B 2HKOA 2IJIA 2ZDIA 3BA9A 4JASA 1IURA 2LP7A 4TV9B 1KP3A 3R66A 1GK9A 1H38A 2OCHA 3ASOB 3RYHB 4HYOA 1T5EA 2PZSA 1NI8A 2VWJA 4FFBA 5LMUO 4QIWF 4RUEA 4EB6B 1QVGU 1SRYA 2HG5C 4J9YB 3WU2Z 4BW5A 3AG7A 2QWNB 3OGCC 5J2TA 4QJFB 2PYJA 1G1XB 1JCHA 5EC2C 3OUFA 4FLYA 1AVMA 2DYRC 1FPOA 1YZBA 2DQ3A 3BFRA 2XASA 2C2AA 1F4NA 2ZNJA 3P30A 4ZBMA 4PI2A 1SQXH 2F43G 2AZ2A 2GTAA 4DW1A 2OCCC 3SDLA 3G6EV 2PYLA 1XMQB 2FB5A 5DM6V 1AJNA 2Q7HA 2JEUA 3GWKC 1VQ8V 4JI8O 5EYPA 5LOVA 1GN3A 2DN9A 4JYAO 1N33O 1M57B 4J11A 4MTGA 4FPPA 2PI5A 1Q8IA 3KCXA 3JAMN 1HP8A 2JVDA 2RNBA 2ZR2A 2VS0A 4LF5B 2WA3A 5ITZB 3GB7C 5IDJA 2UXXA 1NTZH 1NQTA 4O2BB 4CBCA 5B1BC 2E5LB 3ZHQA 1NVPB 4MS2A 1N36B 3OR6C 3OTOO 2YXYA 3LNNA 4GX2A 4FZ0A 1YJ9V 2N74A 3CXHF 4D7SA 3JASA 5FNVA 2IJHA 1P7BA 1MSWD 2NR5A 1N32O 5K1PA 4CS3A 3ETDA 4PJ0Z 1CP9A 4WFFA 3THOA 5KUMA 2R70A 4NR1A 5E79Z 5KA6A 4KHPB 3EFFK 3F5TA 3CHXA 3F7VC 4X65B 1DTOA 3W7WA 4EKWA 3N2GA 1HNWO 1YF2A 4ZHQA 5B3SC 5JCOC 2CTQA 3LSSA 1R3IC 4K3AA 5BMVA 1BZKA 4LP8A 4J41A 5L3BA 2IM9A 4PDMA 2WLHA 4BAYA 4LF9O 3KCYA 1SC5B 2HR3A 2N05A 4K35A 5LXTB 2EILC 3AK1A 1XQ8A 2ITCC 4Q20A 4I50A 1HDJA 1WP7A 1VARA 2W6IG 4R7CA 1K8AW 4BWAA 2RDCA 2ZIOA 1S3JA 2R9IA 4AI8A 5GTIZ 3D3IA 5JCOA 3SJBC 1IBLB 2CAZC 3CC4V 1YVWA 1YTFB 1BGYH 2DQ0A 3RYFA 3ABLC 3CRCA 3E8HA 3B40A 2JDIG 3Q4HA 4QNHB 4D6TH 3JASB 4QPKA 5FNVB 2GTSA 3B77A 3C3SA 3QG5A 4P9PA 3UQ8A 2HFEC 4DV1O 2Z3YA 3ABTA 1WPXA 5IY5C 4LH6A 1PNLA 4NKGB 4WFGA 4GT1A 2A06H 4X1YA 4UVBA 1BS3A 1IZ3A 2LFRA 3H1JH 2AZ0A 5K1XA 5IYDO 4C7UA 3FD9A 3UCSC 2F95B 4CH4A 4NB5A 4BR6A 1IXMA 1SA0A 2IU0A 4Q6GA 3RYCB 4UV8A 3A0BZ 2YSUB 3G80A 2F93B 2JEXA 4P2ZA 1P49A 5EK0A 1PP9H 4ZI7A 2NN4A 2ZIMA 3ML0A 1I94O 3K3WA 1OCRB 3QO8A 1TUEB 1JMKC 1EN4A 3L75H 3K0GA 3HPLC 1TGOA 3K9SA 1J5EO 4XBFA 5LHHA 5B1OA 2EIJB 3C3TA 5KAIZ 1R3KC 1P84F 4RWUA 2BTOA 2A7WA 3JAWA 3UKMA 3CC2V 4I9QA 3T4ZA 1OCCB 3HR0A 1MOFA 1R3LC 2ZXWB 1XILA 2WLLB 1E1QG 2BE3A 4CH3A 2UXCO 4TT3G 5IYBO 1NH2D 4P9OA 4X66O 2O57A 2PI4A 4NTWA 3DSQA 3K9AA 2P06A 3L72H 4J10A 4JI8B 1FXKC 1N33B 4LC1A 1Z2GA 4PD4F 1NT2B 1VMGA 5KAFZ 4MVZA 4YJ2A 5A2QN 4UCRA 4YHHO 3ZBHA 1N8RW 4LCUC 1VF7A 4D7TA 1FXVA 3E89A 3TGUH 4BW9A 3U10A 3BHPA 1I5XA 5LGTA 3OTOB 4ICGA 4J7ZA 1FXKA 4NTYA 2R72A 2CGNA 2K1EA 3AG3B 2GV9A 2F1MA 3ZHSA 3R65A 4O4IB 4LNUB 1VQOV 2UUBO 1Q6HA 4DR3O 5CBGA 2ZKOA 4O4LB 4RO2A 3RBZA 4GKJB 3CJHB 1N32B 1E1RG 4I55B 1IX9A 2PF4E 4LFAO 2V4DA 1MMMA 3FKSG 3H1LH
chains in the Genus database with same CATH topology
1URFA 1RFYA 1US6A 1UPGA 2Q0OC 1CXZB 2HJDA 2RMKB 4IGGA 4NKGB 4DYLA 4NB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URF A;  1RFY A;  1US6 A;  1UPG A;  2Q0O C;  1CXZ B;  2HJD A;  2RMK B;  4IGG A;  4NKG B;  4DYL A;  4NB5 A; 
#chains in the Genus database with same CATH topology
 2B1G A;  1YIJ V;  1HNW B;  3T1H B;  1M1K W;  4X1I A;  5L3D A;  3ZMS A;  1N34 O;  3AG2 B;  1EN5 A;  2YID A;  2P6J A;  1COW G;  2PGG A;  4Z1M G;  4LF9 B;  4J80 A;  3CXC U;  1VF5 B;  4YJ2 B;  4W4K A;  1GN6 A;  1VQP V;  1PL4 A;  5EBW C;  5LP6 C;  4KXR A;  4OPA A;  4PHZ A;  3L73 H;  4RQE A;  1YHQ V;  4PDR A;  2YXH A;  2OIG A;  1WN7 A;  5KMG B;  4GX5 A;  1IBK O;  2P4V A;  4DRX B;  3SYP A;  3CC7 V;  4HNA A;  3MAQ A;  3OMI B;  4X64 B;  5AG2 A;  1R6N A;  2AW9 A;  4PDL A;  1OZ0 A;  1M4U A;  2AGA A;  1S72 V;  2CK3 G;  1V54 B;  1CPY A;  4DV1 B;  5LP6 A;  1FS0 G;  4AIL C;  1EM1 A;  1Q82 W;  3H01 A;  1S5J A;  4B3M O;  2N04 A;  4TUY B;  3JD2 A;  4YJ3 A;  4DW0 A;  5B1A C;  1XOU A;  1XHZ A;  2HEP A;  5KX5 A;  2X6C A;  1VIB A;  2Y0I A;  1WB8 A;  1XL4 A;  5KHJ A;  4L87 A;  4X9Q A;  1AI4 A;  4O4H A;  1OJH A;  4DUY O;  1KYO F;  1XI1 A;  2XT9 A;  1I94 B;  5EZY A;  4GKK O;  3U11 A;  1QLE C;  2LFS A;  1XHX A;  1GH6 A;  1LNQ A;  1JR9 A;  1J5E B;  2QJ1 A;  1DGS A;  1NVP D;  2WLM A;  1G8M A;  4JGS A;  4NXN O;  1W2B U;  1R6K A;  3CS5 A;  5BZB A;  1SES A;  3ABU A;  4F6R A;  2YUA A;  2E76 B;  4AHC A;  2ARH A;  5CA3 A;  2ZE6 A;  3SPC A;  3FB7 C;  4UB6 Z;  4UFZ A;  1IBM B;  5LL6 Y;  1W59 A;  3AG1 C;  2RN9 A;  3OR7 C;  5JH7 A;  3K5O A;  5H6Q A;  3L74 H;  1NJI W;  1RSO B;  1ZUQ A;  3M7M X;  1IDS A;  1QVF U;  4X66 B;  1WAZ A;  1DF5 A;  3K04 A;  2CH7 A;  2L6L A;  2Q5Z A;  2QWO B;  4H33 A;  2LW7 A;  4GX0 A;  1XMO O;  2BOC C;  4YY3 O;  3OAA G;  2W0F C;  5EIB D;  3HKC A;  3ZHT A;  4O4H B;  1Q6I A;  4IYI A;  4UV9 A;  2OIE A;  4YHH B;  2E74 B;  1OCO C;  4DR4 O;  1LR1 A;  1PL0 A;  5EZY B;  4JI4 O;  1K7D A;  4IGG A;  1V55 B;  1Z5W A;  5KLV H;  3DC5 A;  4DK1 A;  1BHA A;  2QA4 V;  1FFX B;  4JI5 O;  3AEI A;  4JZ2 A;  4CC6 A;  4PDV A;  1KD1 W;  4DV3 O;  5CB4 A;  4H13 B;  2HVJ C;  3RFR A;  1LUW A;  3JD3 A;  1YCI A;  4LFB O;  2UUB B;  2Y69 B;  3O9O A;  1M93 A;  3ZMZ A;  1FKA O;  3OGI B;  5C8Y B;  1BQ0 A;  1I7F A;  1JA8 A;  5JH7 B;  4DV7 O;  4LFA B;  2Q68 A;  3WB0 A;  1YIT V;  2Q73 A;  2WSS G;  3WB1 A;  5LA6 B;  4YIO A;  1QR8 A;  4EEQ A;  2R9A A;  1Z5V A;  2GUZ A;  3E83 A;  5KHK A;  1N34 B;  4ABM A;  1JFF B;  4O4J A;  1TUB A;  5L3C A;  3STL C;  3CCM V;  3RVY A;  4U3J A;  2V1D A;  2KG7 B;  3ZRS A;  3K08 A;  3W7T A;  3K5N A;  2LJ2 A;  3M8A A;  1NKD A;  4FLT A;  1M56 C;  1AP5 A;  5FPO A;  1Q90 D;  5IWA O;  1X4T A;  4LH7 A;  3TK1 A;  1TVK A;  2NLJ C;  5C93 A;  1IBK B;  4IL6 Z;  1WA8 B;  5CB4 B;  2GBO A;  2QWP B;  4I0X A;  3B4S A;  1BQZ A;  4QPJ A;  2E75 B;  2ITD C;  1GM9 A;  4DR5 O;  2QEX V;  3ZRW B;  2WLN A;  1YEW A;  2Y4U A;  1RP3 B;  1VQ5 V;  4JI3 O;  5JWP A;  1M5I A;  2QKS A;  4MVM A;  4B3M B;  3CSX A;  3JAK A;  4TQF A;  4JI7 O;  2DYS B;  4BIZ A;  3P3P A;  4DV0 O;  1PV0 A;  1ZTE A;  2EIM C;  2YC0 A;  1D2D A;  3P32 A;  4GLX A;  2KQX A;  4FFB B;  1EN6 A;  4JYC A;  2XAQ A;  2QGN A;  2OTL V;  4X1K A;  2JJ2 G;  1NZ6 A;  1KKC A;  3EVK A;  4DUY B;  1VEW A;  5J2T B;  2Q8V A;  3HKE A;  4GKK B;  4F4L A;  2QTO A;  2Q0O C;  2WLJ A;  3J81 N;  1KUQ A;  3DC6 A;  2X7R B;  1OHH G;  2ZCE A;  4JF3 A;  4R6Z A;  4FLW A;  1FJG B;  3TET A;  4NXN B;  4PA3 A;  3LNM B;  3SPI A;  4NVP A;  1EFR G;  1X59 A;  1YDX A;  3FFQ A;  1JPX A;  2BSK A;  2X6A A;  1SQB H;  4LF8 O;  1TA8 A;  4FJC C;  1J95 A;  3HKB A;  2YI9 A;  3E8B A;  5IJ0 A;  3E8F A;  2UXD B;  3STZ C;  2IW5 A;  1P7G A;  3TCU A;  2AXT Z;  1AB3 A;  2DWE C;  5KA5 A;  2DYR B;  5EYP B;  5LOV B;  1JJO A;  3ABM C;  3FB8 C;  3BPZ A;  4EFE A;  4JAU A;  2RCV A;  4JV5 B;  5H2F Z;  3F7Y C;  1BMF G;  4GX1 A;  4N23 A;  3CPW U;  1A32 A;  2UU9 O;  3OMN B;  1XMO B;  3DXR A;  4YY3 B;  4LBE C;  3RVZ A;  4FVM A;  4FFK A;  1BHB A;  2EIN C;  1HNX O;  4X1K B;  1XRE A;  2OCC B;  1GM8 A;  1WP8 A;  5KHG A;  4DR4 B;  2GHY A;  2QKA A;  1ROP A;  3TXS A;  4JI4 B;  3ZX6 A;  4FM0 A;  3E35 A;  4UCO A;  3RWR D;  1S77 D;  1Y74 A;  1GM7 A;  4MVR A;  3D36 C;  1AI7 A;  2YIC A;  3ZMT A;  4QE9 A;  2WPD G;  4DV3 B;  3K5L A;  2ZE7 A;  3SR2 C;  3CX5 F;  2XTA A;  4LFB B;  2EIK C;  1YJW V;  5B1B B;  2G38 A;  4IIJ A;  4K8X A;  4UCU A;  4RQF A;  5IJ0 B;  3T1Y O;  3ASN B;  4PV1 B;  1R3J C;  3GVM A;  3N2G B;  3BA8 A;  4DV7 B;  4ZHQ B;  2ZQM A;  3VOU A;  5BMV B;  3ETG A;  3A2F A;  3D36 A;  3K57 A;  1PM9 A;  3BRC A;  4UUJ C;  3K58 A;  2EX3 A;  3OW2 U;  3QF7 A;  4MVO A;  3DXR B;  1OCZ C;  4I50 B;  3NR7 A;  5LMU B;  4B3R O;  1U97 A;  1UJW B;  1XNQ O;  2NNU A;  4DV4 O;  5JJN B;  5IWA B;  2Z0A A;  3ETQ A;  3ZJZ A;  3RYF B;  3KZI Z;  3H1K H;  4U3F H;  1THZ A;  3Q4H B;  1F4M A;  1B3Q A;  2YIA A;  2L35 A;  3FYI B;  3E22 A;  4JI6 O;  2EIL B;  2LW1 A;  2CGO A;  1IVS A;  1SQG A;  5FLX N;  1GAX A;  3M99 B;  3KG2 A;  3FAV A;  3CYO A;  2YIB D;  2OT5 A;  1U96 A;  2W6J G;  2PUS A;  4WFA V;  4X1Y B;  1Y76 A;  4JI1 O;  4IHJ A;  3X2Q C;  2UXN A;  4IIJ B;  2JGU A;  2LGQ A;  4DR5 B;  5IT9 N;  4CH6 A;  4JI3 B;  1LUV A;  5B5E Z;  1SA0 B;  5A9G A;  3ABL B;  4JYY A;  4TWK A;  5LHG A;  2EJ7 A;  4JYA B;  4JI7 B;  1QBZ A;  1KQS U;  1MA1 A;  2LQT A;  4DV0 B;  3OTF A;  2DE0 X;  3K06 A;  1FYJ A;  1I5Y A;  4LF4 O;  5IY5 B;  1AR1 B;  1VF6 C;  4ZI7 B;  1RPR A;  3K5M A;  3MDS A;  1M9N A;  4PA9 A;  5DED A;  1Y6X A;  4G28 B;  1GKF A;  1SQV H;  3JD1 A;  5LGN A;  1CEZ A;  2E3C A;  1YSC A;  3UO3 A;  2ILM A;  1H2N A;  4JI0 O;  4PI0 A;  2CDY A;  3JAW B;  4KFM A;  1GRJ A;  1YJN V;  2IBZ H;  5L3G A;  4G2K A;  1VF6 A;  3CCU V;  4DR6 O;  2XUM A;  3IC9 A;  2JIZ G;  1XBL A;  1K33 A;  1VQK V;  3K0D A;  1K73 W;  2F66 C;  1W0J G;  1FXH A;  1GN2 A;  1N4C A;  5GON A;  4LF8 B;  2BTQ A;  1Y4M A;  1HNZ O;  5H9C A;  1H2M A;  2AHZ A;  1SQF A;  2AHY A;  4DYL A;  2F4V O;  1RM1 C;  1VQ6 V;  3APO A;  2RMK B;  4DK0 A;  4HAM A;  1KU9 A;  5IJ9 A;  4R8C A;  2Q7E A;  1MZE A;  2UU9 B;  4XDJ A;  3OE7 G;  2BOB C;  4AQY O;  4RUF A;  1QHT A;  2HJD A;  3QO5 A;  4FIP C;  1HNX B;  1WB7 A;  4EFB A;  4DR1 O;  4DR7 O;  5JVD A;  4FMT A;  3C90 A;  3BAB A;  1FXK B;  3S3W A;  1P4R A;  5JQG A;  1AR4 A;  4NYK A;  1FAF A;  5L3F A;  1VQL V;  1US6 A;  4LWS A;  4MW8 A;  4CZZ A;  3FYE B;  4R50 A;  2HLD G;  3K59 A;  3OMA B;  2WLK A;  2JS5 A;  2OYQ A;  2IH1 C;  4I9W A;  2ADQ B;  3CE2 A;  3ETE A;  3IC7 A;  2DWD C;  4O2A A;  3BAA A;  1HR0 O;  2YIB A;  4X1I B;  4A5U B;  1ENV A;  3TXQ A;  3CME V;  1M90 W;  2A3Q A;  4OXS A;  1ZWI C;  3ABK C;  1BL8 A;  1PD3 A;  2W0X A;  3ZRV A;  3FB6 C;  4FZ1 A;  3CCS V;  2A79 B;  4E2L A;  3BY6 A;  3AG4 C;  1V55 C;  5L3E A;  4LF6 O;  2EZP A;  1SET A;  2D3O W;  5KHH A;  4B3R B;  3ZHU A;  1K4D C;  4NTX A;  3WG7 C;  5J2U A;  1B6Q A;  1ZL8 A;  5JVD B;  3I55 V;  1XNQ B;  1UPG A;  5B66 Z;  2EBO A;  3CCQ V;  3SPH A;  3KKY A;  1NR7 A;  2R9R B;  2LO1 A;  4JTD B;  3LSU A;  4HNA B;  3SJC C;  1K34 A;  1QQC A;  4LWS B;  2VQF O;  5DEC A;  2FML A;  4JI6 B;  1SKV A;  1NTK H;  2Q7G A;  3A8T A;  4DV2 O;  4RAI A;  1G4Y B;  3EXA A;  5LP6 B;  2K9P A;  1G6U A;  3TJT A;  4PEL A;  4JI2 O;  4JI1 B;  2WLI A;  1KB9 F;  3JAT A;  2UXC B;  2Y4T A;  4O2A B;  4F6E A;  3ASO C;  4FLU A;  3K79 A;  4IYH A;  1L1F A;  3T2M A;  3OFN G;  1MZF A;  1WNS A;  2QM4 A;  4YJ3 B;  3UM7 A;  5LBQ A;  1W0K G;  1WPB A;  1AJP A;  3O65 A;  3OD4 A;  5KX5 B;  3N2K A;  4X65 O;  2D2C B;  2M6Y A;  1B06 A;  5TIS Z;  4OPH A;  2EUL A;  4UCS A;  2UUC O;  4LF4 B;  4WFB V;  4JTA B;  4TV9 A;  1MG1 A;  4MW3 A;  3JAL A;  3RYH A;  3SYC A;  1NU1 H;  5J2U B;  2WAM A;  1K5Q A;  2P22 C;  4U7O A;  3JSN A;  2ZE8 A;  3E8G A;  4EB6 A;  1YTF D;  4JTC B;  4MTO A;  4YXW G;  4JI0 B;  3LDC A;  4H44 B;  4MSW C;  4F6R B;  3J80 N;  3SYO A;  2QSA A;  4DR3 B;  4G27 B;  5E1A C;  4FM1 A;  2ZDI C;  1R73 A;  1QLE B;  2OTJ V;  5CA1 A;  2HHH O;  3VQV A;  5F2V O;  2DW4 A;  1M57 C;  2WLI B;  1HNZ B;  3OM3 B;  4J42 A;  4UCV A;  3ZHV A;  1N0J A;  3ZED A;  3OEH G;  3PN1 A;  1NTM H;  3HKD A;  1L8D A;  3WFV A;  2CH7 B;  2ODM A;  2F4V B;  1URF A;  2ADP A;  4DXW A;  1R1B A;  3N2K B;  3U0Z A;  3SJA C;  1YI2 V;  3CRR A;  3HKC B;  1QLN A;  3G71 V;  3PJS K;  4WFE A;  3I56 V;  4HZ3 A;  4I5S A;  1AR5 A;  1L0L H;  5HFL A;  3MHH C;  2WA4 A;  3AG1 B;  4AQY B;  5IYC O;  1XEQ A;  3UO2 A;  3B8N A;  3JAL B;  5LMN O;  1DLB A;  1BT8 A;  3F5W C;  4DR1 B;  4DR7 B;  3APQ A;  4WBN A;  3IJ4 A;  1UFI A;  4DV6 O;  5ITZ A;  1XDC A;  1AIL A;  4O2B A;  2FYU H;  1NR1 A;  5LGU A;  3MHS C;  4CS2 A;  5D5P A;  2EJR A;  3L71 H;  1H8E G;  1OCO B;  1YXB A;  3SPJ A;  4X89 A;  3E86 A;  2JK5 C;  2VRZ A;  4JYB A;  2HVK C;  4OX9 O;  4H37 A;  1Q43 A;  5CA1 B;  4DUZ O;  1Q3E A;  2FTK A;  3CRA A;  4MT8 A;  1MAB G;  5EIB C;  3ZCC A;  5GTH Z;  1HR0 B;  4WF9 V;  2PTM A;  3HKD B;  3ZMV A;  2A9H A;  2GUZ B;  2Y48 A;  2M7W A;  2WWW A;  4O4J B;  1TUB B;  1R6T A;  3S3X A;  1S5H C;  4U3J B;  3ZMU A;  4KUM A;  5D5Q A;  2KSD A;  5LYJ A;  4GYC B;  3CCE V;  2Z5U A;  3GWO A;  3JAR A;  5DN6 G;  4GZR B;  4MVS A;  1B04 A;  2A0L A;  4LF6 B;  2QR4 A;  2P7T C;  1HWY A;  2Q9L A;  2HJF C;  2KB1 A;  4CH5 A;  4MVU A;  5LXT A;  1JQ0 A;  3G4S V;  1AI5 A;  1AJQ A;  4WBN B;  1TVK B;  5JJJ B;  3CD6 V;  5IYZ A;  3CB2 A;  2X0L A;  4KP4 A;  5CA0 A;  4I0X B;  2VQF B;  3AK2 A;  3ASN C;  4Z1V A;  2RJZ A;  4DV2 B;  3W7X A;  3VQY A;  1AP6 A;  1M56 B;  2P4K A;  1Y66 A;  1PKX A;  2Y0P A;  1FFT B;  3CRQ A;  4JPR A;  3ZHR A;  1I08 A;  4JI2 B;  3G6B A;  1K9M W;  1S0V A;  1RFY A;  3RN4 A;  3OT7 A;  3E2E A;  3JAK B;  4GKJ O;  3B8M A;  1MSD A;  3SYA A;  1SQQ H;  2ZIN A;  4FM2 A;  3I5D A;  5BR8 O;  1OCR C;  3OUS A;  4W4L A;  2JS3 A;  2FL4 A;  1ZX3 A;  2XAG A;  2CTW A;  2MW2 B;  5CN0 A;  5EBL C;  3T1H O;  4NXM O;  5LYJ B;  2Q69 A;  2UUC B;  1K5S A;  2EIJ C;  3JAR B;  1PNM A;  4X20 A;  4P30 A;  3RYC A;  2ZT9 B;  4JZG A;  3HKE B;  4XDL A;  2H3O A;  3B2E E;  3FB5 C;  2JJ1 G;  1OCC C;  4JI5 B;  5B1N A;  2RQ6 A;  3L9D A;  4ZOL A;  2EIM B;  2ZXW C;  4TSF G;  4WFH A;  1VQM V;  1F51 A;  5IYZ B;  1FD9 A;  2ZNI A;  5IE9 A;  4IT5 A;  3CCJ V;  5CA0 B;  3ZN1 A;  2BSK B;  2XOK G;  4FLV A;  2OWO A;  2ZM6 O;  3HKB B;  3L70 H;  4CC5 A;  3A0R A;  1Y67 A;  2Q4P A;  3JCU Z;  4X64 O;  2YDE A;  2XAH A;  2HHH B;  2GSM B;  3EHB B;  2EZO A;  1S76 D;  1VQN V;  4K8Z A;  3SYQ A;  1XNR O;  2X6B A;  4FK5 C;  2IH3 C;  2WLL A;  4DV5 O;  1OV9 A;  2P90 A;  5BY1 A;  4N21 A;  2LGW A;  2VQE O;  1SER A;  1ORQ C;  4L8J A;  2YS8 A;  1EBO A;  1ZLZ A;  5H5N A;  4LR3 A;  4UB8 Z;  2F23 A;  4X20 B;  2QM7 A;  3A0H Z;  3AG3 C;  5B3S B;  2QM8 A;  5LMN B;  3ABM B;  4B3S O;  4LFC O;  1N0N A;  1Y74 B;  1SS3 A;  3IGA C;  4LF7 O;  2VWK A;  3DGE A;  1V9P A;  4ZOL B;  3P3N A;  2IU3 A;  4DV6 B;  3CP1 A;  2QWR B;  1QU7 A;  4X62 O;  3QVN A;  2MK3 A;  3CMA V;  3CRM A;  2JGD A;  3LSQ A;  3FX7 A;  1S5L Z;  2EIN B;  4BIU A;  4X88 A;  2DJV A;  3AG2 C;  4OX9 B;  4DUZ B;  1KKD A;  2HP8 A;  1K4C C;  1XUQ A;  2DOS A;  4O4I A;  4LNU A;  1ZSP A;  2Q0A A;  4UCT A;  2UUA O;  4O4L A;  2XHB A;  4ZIB A;  2Q6A A;  1IBM O;  3CJH A;  1NBM G;  4I55 A;  1IXB A;  3T1C A;  2ZR3 A;  3BEH A;  3QNE A;  4B3T O;  4MVQ A;  4PA6 A;  2EIK B;  4JAV A;  2UXB O;  1NS1 A;  1K97 A;  1PNK A;  3BVO A;  1I0H A;  2QKC A;  3JSL A;  4J7K A;  2DMX A;  3MD0 A;  1QNM A;  2B1I A;  1H2S B;  1V54 C;  2ZE5 A;  2YEV A;  1PPJ H;  3E22 B;  2H94 A;  1Q86 W;  3CCL V;  1OCZ B;  2JGD B;  5KMG A;  1KMI Z;  3FAV B;  2CUG A;  4H0L B;  1Q6U A;  1Y76 B;  5JJE B;  4IHJ B;  4DRX A;  3CCR V;  5KHI A;  1Q5O A;  2FKX A;  4K0K O;  2CTP A;  1KBH A;  3VQW A;  3HB3 B;  1Q81 W;  4DR2 O;  1JVM A;  2Q67 A;  3RYI A;  3T4D A;  4TOI A;  1KEC A;  4PA4 A;  5BXZ A;  2H8P C;  4WCE V;  1DF4 A;  5BR8 B;  3SJQ C;  1MNG A;  2QWQ B;  1RPO A;  2YI8 A;  4TQD A;  4TUY A;  3X2Q B;  4NXM B;  1H2G A;  3RT3 C;  1JJ2 U;  4B7E A;  3OEE G;  2B9Z A;  5EBM C;  5CBF A;  1Q7Y W;  2P67 A;  5EC1 C;  3CCV V;  1VQ7 V;  2ATK C;  2YEV B;  1KC8 W;  3G67 A;  4BIO A;  2QE7 G;  3W7S A;  1SZX A;  5HFM A;  5GON B;  2BTQ B;  1O9H A;  1F7Y A;  2ZM6 B;  1SF9 A;  3CEI A;  4MTX A;  4FLX A;  3T1Y B;  1QCE A;  1HW7 A;  4KL1 A;  3RGB A;  1GO3 F;  4ZKI A;  3JCZ A;  1XNR B;  4OGQ B;  2ZD9 A;  4TV8 A;  3SPG A;  5GW7 A;  3RYI B;  1XMQ O;  1QR9 A;  2KKW A;  5IJ9 B;  4DV5 B;  1H8H G;  3JD4 A;  2BCC H;  2XAF A;  2VQE B;  3JYC A;  2GDS A;  1RSO A;  3D8C A;  2IJK A;  1E79 G;  3LDD A;  4GCZ A;  1WLE A;  3QTC A;  3ZRX A;  3JD0 A;  3VQX A;  1CXZ B;  4PA7 A;  2ETN A;  2P5O A;  2XND G;  4HBN A;  4LF5 O;  4DV4 B;  3LDE A;  3LUT B;  1RM1 B;  4JAA A;  2CE4 A;  4LFC B;  4B3S B;  2CTR A;  1GN4 A;  4ASU G;  5JQG B;  2Y69 C;  2E5L O;  1BSM A;  4LF7 B;  5CMU A;  4CS4 A;  3N27 A;  1N36 O;  4I4T A;  4X62 B;  1SZT A;  1FFX A;  1H2L A;  1K92 A;  1BCC H;  1FJG O;  1KP2 A;  4I7Z B;  5FL7 G;  3SGI A;  3ZIA G;  4DO2 A;  3D3Q A;  5J9P C;  1D5N A;  5KUK A;  1JX9 A;  3ZN0 A;  4KHP O;  5LHI A;  2UUA B;  5C8Y A;  4TV8 B;  1NH2 B;  1SQP H;  3B09 A;  4QGP A;  4U7N A;  3RW0 A;  2UXD O;  2QDO A;  2B5U A;  1H2K A;  3AK3 A;  3UT5 A;  3DTU B;  4QE7 A;  1ARO P;  4B3T B;  4UXN A;  5LA6 A;  2YXL A;  3IAY A;  3WB2 A;  4XDK A;  4X8A A;  2JRI A;  3BCC H;  4JV5 O;  4E4E A;  2UXB B;  1WJZ A;  1F23 A;  5FPR A;  1JFF A;  4B08 A;  1VQ9 V;  5H6R A;  2IJJ A;  1ZL8 B;  2PY5 A;  3VBB A;  3H9V A;  3H1I H;  2KG7 A;  4J9Z B;  5B1A B;  1EZJ A;  4GUN A;  3ABK B;  1L0N H;  2XAJ A;  4I4T B;  1IBL O;  1AI6 A;  3AG4 B;  4B7K A;  5CBH A;  4DR6 B;  3J7A U;  3QO7 A;  4Z2W A;  4FLZ A;  1DK1 A;  2V7Q G;  4UVC A;  1O9G A;  2DYS C;  1D5A A;  3IFX A;  3WG7 B;  3JAT B;  1WA8 A;  3K03 A;  4UVA A;  3NXS A;  1VQ4 V;  3W7U A;  1BE3 H;  3ICX A;  4K0K B;  1JOY A;  1VP7 A;  3ZS8 C;  4DR2 B;  1GTO A;  4MTF A;  4J7J A;  4YIP A;  1ZAU A;  1K3E A;  3ZRW A;  1TAE A;  1GMG A;  3H1H H;  1EZV H;  1XL6 A;  2QTS A;  3CWB H;  3UT5 B;  2HKO A;  2IJI A;  2ZDI A;  3BA9 A;  4JAS A;  1IUR A;  2LP7 A;  4TV9 B;  1KP3 A;  3R66 A;  1GK9 A;  1H38 A;  2OCH A;  3ASO B;  3RYH B;  4HYO A;  1T5E A;  2PZS A;  1NI8 A;  2VWJ A;  4FFB A;  5LMU O;  4QIW F;  4RUE A;  4EB6 B;  1QVG U;  1SRY A;  2HG5 C;  4J9Y B;  3WU2 Z;  4BW5 A;  3AG7 A;  2QWN B;  3OGC C;  5J2T A;  4QJF B;  2PYJ A;  1G1X B;  1JCH A;  5EC2 C;  3OUF A;  4FLY A;  1AVM A;  2DYR C;  1FPO A;  1YZB A;  2DQ3 A;  3BFR A;  2XAS A;  2C2A A;  1F4N A;  2ZNJ A;  3P30 A;  4ZBM A;  4PI2 A;  1SQX H;  2F43 G;  2AZ2 A;  2GTA A;  4DW1 A;  2OCC C;  3SDL A;  3G6E V;  2PYL A;  1XMQ B;  2FB5 A;  5DM6 V;  1AJN A;  2Q7H A;  2JEU A;  3GWK C;  1VQ8 V;  4JI8 O;  5EYP A;  5LOV A;  1GN3 A;  2DN9 A;  4JYA O;  1N33 O;  1M57 B;  4J11 A;  4MTG A;  4FPP A;  2PI5 A;  1Q8I A;  3KCX A;  3JAM N;  1HP8 A;  2JVD A;  2RNB A;  2ZR2 A;  2VS0 A;  4LF5 B;  2WA3 A;  5ITZ B;  3GB7 C;  5IDJ A;  2UXX A;  1NTZ H;  1NQT A;  4O2B B;  4CBC A;  5B1B C;  2E5L B;  3ZHQ A;  1NVP B;  4MS2 A;  1N36 B;  3OR6 C;  3OTO O;  2YXY A;  3LNN A;  4GX2 A;  4FZ0 A;  1YJ9 V;  2N74 A;  3CXH F;  4D7S A;  3JAS A;  5FNV A;  2IJH A;  1P7B A;  1MSW D;  2NR5 A;  1N32 O;  5K1P A;  4CS3 A;  3ETD A;  4PJ0 Z;  1CP9 A;  4WFF A;  3THO A;  5KUM A;  2R70 A;  4NR1 A;  5E79 Z;  5KA6 A;  4KHP B;  3EFF K;  3F5T A;  3CHX A;  3F7V C;  4X65 B;  1DTO A;  3W7W A;  4EKW A;  3N2G A;  1HNW O;  1YF2 A;  4ZHQ A;  5B3S C;  5JCO C;  2CTQ A;  3LSS A;  1R3I C;  4K3A A;  5BMV A;  1BZK A;  4LP8 A;  4J41 A;  5L3B A;  2IM9 A;  4PDM A;  2WLH A;  4BAY A;  4LF9 O;  3KCY A;  1SC5 B;  2HR3 A;  2N05 A;  4K35 A;  5LXT B;  2EIL C;  3AK1 A;  1XQ8 A;  2ITC C;  4Q20 A;  4I50 A;  1HDJ A;  1WP7 A;  1VAR A;  2W6I G;  4R7C A;  1K8A W;  4BWA A;  2RDC A;  2ZIO A;  1S3J A;  2R9I A;  4AI8 A;  5GTI Z;  3D3I A;  5JCO A;  3SJB C;  1IBL B;  2CAZ C;  3CC4 V;  1YVW A;  1YTF B;  1BGY H;  2DQ0 A;  3RYF A;  3ABL C;  3CRC A;  3E8H A;  3B40 A;  2JDI G;  3Q4H A;  4QNH B;  4D6T H;  3JAS B;  4QPK A;  5FNV B;  2GTS A;  3B77 A;  3C3S A;  3QG5 A;  4P9P A;  3UQ8 A;  2HFE C;  4DV1 O;  2Z3Y A;  3ABT A;  1WPX A;  5IY5 C;  4LH6 A;  1PNL A;  4NKG B;  4WFG A;  4GT1 A;  2A06 H;  4X1Y A;  4UVB A;  1BS3 A;  1IZ3 A;  2LFR A;  3H1J H;  2AZ0 A;  5K1X A;  5IYD O;  4C7U A;  3FD9 A;  3UCS C;  2F95 B;  4CH4 A;  4NB5 A;  4BR6 A;  1IXM A;  1SA0 A;  2IU0 A;  4Q6G A;  3RYC B;  4UV8 A;  3A0B Z;  2YSU B;  3G80 A;  2F93 B;  2JEX A;  4P2Z A;  1P49 A;  5EK0 A;  1PP9 H;  4ZI7 A;  2NN4 A;  2ZIM A;  3ML0 A;  1I94 O;  3K3W A;  1OCR B;  3QO8 A;  1TUE B;  1JMK C;  1EN4 A;  3L75 H;  3K0G A;  3HPL C;  1TGO A;  3K9S A;  1J5E O;  4XBF A;  5LHH A;  5B1O A;  2EIJ B;  3C3T A;  5KAI Z;  1R3K C;  1P84 F;  4RWU A;  2BTO A;  2A7W A;  3JAW A;  3UKM A;  3CC2 V;  4I9Q A;  3T4Z A;  1OCC B;  3HR0 A;  1MOF A;  1R3L C;  2ZXW B;  1XIL A;  2WLL B;  1E1Q G;  2BE3 A;  4CH3 A;  2UXC O;  4TT3 G;  5IYB O;  1NH2 D;  4P9O A;  4X66 O;  2O57 A;  2PI4 A;  4NTW A;  3DSQ A;  3K9A A;  2P06 A;  3L72 H;  4J10 A;  4JI8 B;  1FXK C;  1N33 B;  4LC1 A;  1Z2G A;  4PD4 F;  1NT2 B;  1VMG A;  5KAF Z;  4MVZ A;  4YJ2 A;  5A2Q N;  4UCR A;  4YHH O;  3ZBH A;  1N8R W;  4LCU C;  1VF7 A;  4D7T A;  1FXV A;  3E89 A;  3TGU H;  4BW9 A;  3U10 A;  3BHP A;  1I5X A;  5LGT A;  3OTO B;  4ICG A;  4J7Z A;  1FXK A;  4NTY A;  2R72 A;  2CGN A;  2K1E A;  3AG3 B;  2GV9 A;  2F1M A;  3ZHS A;  3R65 A;  4O4I B;  4LNU B;  1VQO V;  2UUB O;  1Q6H A;  4DR3 O;  5CBG A;  2ZKO A;  4O4L B;  4RO2 A;  3RBZ A;  4GKJ B;  3CJH B;  1N32 B;  1E1R G;  4I55 B;  1IX9 A;  2PF4 E;  4LFA O;  2V4D A;  1MMM A;  3FKS G;  3H1L H; 
#chains in the Genus database with same CATH homology
 1URF A;  1RFY A;  1US6 A;  1UPG A;  2Q0O C;  1CXZ B;  2HJD A;  2RMK B;  4IGG A;  4NKG B;  4DYL A;  4NB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...