2CUGA

Solution structure of the j domain of the pseudo dnaj protein, mouse hypothetical mkiaa0962
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
GSSGSSGILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNYDHYGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the J domain of the pseudo DnaJ protein, mouse hypothetical mKIAA0962
rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords mKIAA0962 protein
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2cugA01
2DN9A 3UO2A 2Y4TA 4IT5A 2LGWA 3APOA 2M6YA 1HDJA 4RWUA 1IURA 2QWRB 2CTRA 2QSAA 2DMXA 1NZ6A 2L6LA 2YS8A 2N05A 3BVOA 2CTWA 1FAFA 2CTQA 2N04A 2Y4UA 2GUZB 2PF4E 2EJ7A 2QWQB 2QWNB 3UCSC 1BQZA 3AG7A 3APQA 4J80A 2QWOB 4J7ZA 2YUAA 1N4CA 1XBLA 2CUGA 2QWPB 3UO3A 1GH6A 1FPOA 2GUZA 2LO1A 2CTPA 2OCHA 1BQ0A 1WJZA 2KQXA
chains in the Genus database with same CATH superfamily
1HW7A 4OPHA 3JD2A 5FNVA 2XAGA 4QPKA 4YHHO 4MSWC 4YJ2A 4DUZO 1R1BA 2P06A 3KG2A 3W7UA 5CBGA 4KFMA 1Z5WA 3KCYA 4IHJA 3UCSC 3UT5A 1OCZC 3FB7C 3BFRA 3RYHB 1NBMG 5AG2A 2DN9A 4JYBA 1SA0B 3ASOB 1TGOA 2E75B 1HNZB 4K8XA 2WLLB 5ITZA 1R3JC 2A3QA 2QM8A 2P90A 1K34A 3MHHC 1HNXO 4B3MB 3S3XA 1XL4A 1ZUQA 1AJQA 2JVDA 5EC1C 4TQDA 3G67A 3VQYA 2ADQB 1N8RW 4PHZA 1W2BU 2ZR3A 4RAIA 5DM6V 2QEXV 1R6NA 1M4UA 2CDYA 1M56B 1VQ7V 3CP1A 4I9WA 3VOUA 4NXNO 1KP2A 3JCUZ 4D7SA 3CRAA 1WN7A 3SJAC 5LXTA 2JJ2G 2HHHO 2HG5C 2QM7A 3HKEB 2A06H 3GWKC 4ZHQA 3H1LH 5J2UB 2DYRB 2HJDA 1K4CC 2CK3G 3OUFA 1GO3F 4X8AA 4O4LB 2PYJA 5L3BA 2CE4A 4KL1A 4LFBO 3L70H 4PDLA 3LDDA 3JAWB 3B77A 3BAAA 1JMKC 3RGBA 3DC6A 3K9AA 4Z1MG 1M93A 4JTAB 4DV1B 2P67A 1KU9A 4FLWA 1GN6A 1SETA 2CTWA 4X65B 5B1AC 2QJ1A 2WA4A 1OCRB 1MABG 2ETNA 3EFFK 1E1QG 3M7MX 1W0KG 2YIBA 4X64B 3UM7A 5J2UA 3JD0A 2JGDA 5FPOA 4JF3A 3OGIB 1WB7A 4FM1A 3SYQA 1EFRG 1FFTB 4TV9A 2ZIMA 1TVKA 4NXMB 2UXDB 2X6AA 2Y0IA 1SERA 1NTZH 1B3QA 2LFRA 4IL6Z 1AR1B 2EZPA 1J5EO 1V55B 4WBNB 4G28B 4HNAB 5KA6A 1CXZB 4PA4A 4LFBB 4I9QA 5CBHA 2XAHA 2Z0AA 3O65A 2ZXWB 5IY5B 3AG4C 2QWRB 3OD4A 1HP8A 1V55C 2A9HA 2YIBD 2E3CA 3QNEA 3ABKC 2ITCC 4I50A 4O2AA 2IJIA 2JJ1G 1OCCC 4H0LB 5B5EZ 3JCZA 1NR1A 5CA0B 4W4KA 3JALA 2FYUH 3SYPA 3CE2A 3CB2A 5EIBD 3ZHQA 1XDCA 4LF7O 4H44B 3A2FA 4FLZA 2EJRA 3W7SA 5KX5B 1BQZA 4J80A 4BR6A 1K33A 2BE3A 5LP6C 1GMGA 1JOYA 2Q5ZA 1QVFU 2ZE7A 4CC5A 4F6EA 2JIZG 2A0LA 2HFEC 2D3OW 5C8YB 2ITDC 3HKCA 1MG1A 1K3EA 3CCQV 4JI4B 2CTPA 1QU7A 3E35A 4UB6Z 5A9GA 1MZEA 4J10A 4JI3O 1NJIW 4B3RB 5L3DA 2R9AA 2XT9A 4UXNA 3K04A 2OWOA 1VQLV 1YEWA 3CJHA 3CCSV 1XNQO 1EZVH 2HVKC 3E86A 2LW1A 1Q43A 4QNHB 3JASA 2Q9LA 3SPJA 5EYPA 2WAMA 1VQ6V 4O2BA 3RYCA 1B06A 2IH3C 1IVSA 1VF6A 4DR2O 1B04A 1ZAUA 5B1BC 4MT8A 1ZL8B 4X62B 1AI4A 1NTKH 3ZCCA 2VQFB 1KMIZ 2EBOA 1SQGA 4W4LA 2OIGA 3LNNA 2N74A 3SYAA 1KB9F 4JZGA 5IYCO 2P22C 5LGTA 4DV3O 1NH2D 4TT3G 5KHKA 1S76D 4UCRA 4DXWA 1QLEB 3ASOC 3T1CA 3H1JH 5DEDA 2MK3A 4XDJA 2YXLA 3T4DA 4K3AA 5EK0A 1VQMV 3K58A 3R66A 2ZKOA 3BA8A 4J11A 4KHPB 4MVSA 2OCHA 3CCLV 2IU3A 3B8NA 2Q67A 5CA1A 2BTOA 1BE3H 4L87A 1NR7A 4DV6O 3ZHSA 3G71V 2GTAA 1N33B 1FXVA 1XI1A 3CC4V 4RUFA 1M57C 3L71H 1XBLA 3HB3B 1W59A 3E89A 3STZC 1GN2A 4CH3A 3ZRWA 2QTOA 4CZZA 2UXBO 1VQNV 2M6YA 3T2MA 1LR1A 2V4DA 4UCSA 3AG2C 1N32B 5FNVB 3ZJZA 4AILC 4A5UB 3BVOA 5IYDO 4HBNA 3JALB 1I5XA 3L73H 1SRYA 2QDOA 4MW8A 3F5TA 4GKKB 3GWOA 1SESA 2ZXWC 4TUYA 1YJNV 2JEXA 2AZ2A 4JI5B 4BIUA 3FAVB 3IFXA 1FKAO 4LCUC 3F7YC 1UFIA 1VQ8V 4LF8B 4Z2WA 1NKDA 3SDLA 4K8ZA 4KXRA 1AJNA 1GRJA 1XL6A 4PDMA 1QCEA 1MMMA 1Q6UA 3OM3B 1GN4A 3DTUB 5IJ0A 2ADPA 4JI3B 1HNZO 2QM4A 2WA3A 1OV9A 2CUGA 3UO3A 1JPXA 1I94O 1XUQA 1FPOA 2JS3A 4FM0A 1LUVA 2ILMA 4IGGA 3ZRSA 5LGUA 1XMQO 3ZS8C 4X20A 1FXKA 1BZKA 2HJFC 2N04A 4I0XA 4J9YB 4DR3B 3CCUV 3QO8A 2ZT9B 5GW7A 4FK5C 1WA8A 1AP5A 1URFA 2WLJA 3A0RA 4GLXA 2P4VA 4F6RA 3JARB 4DV2O 4H13B 4TV8A 2PYLA 5EYPB 1K8AW 4PA7A 4RUEA 2JRIA 4OGQB 3CRQA 1DF5A 4MVRA 1JJ2U 3CHXA 4JYAO 1PNMA 5B1OA 3RYHA 1GAXA 3CYOA 5KUKA 1ZSPA 1AJPA 1SA0A 1T5EA 1H2MA 4KP4A 1PL0A 3ABLC 1FD9A 1SQQH 2PI4A 2EILB 1XMOO 4C7UA 1KKDA 5DECA 2R9IA 1HR0B 3OR6C 4XDLA 4I55A 2BSKB 2F93B 4UV9A 3WG7C 4FIPC 2Q4PA 2ZINA 5IYBO 4GZRB 4LNUB 1ZTEA 3CRCA 4FZ0A 4EFBA 2CTRA 2GTSA 3RWRD 4DV2B 2G38A 3E8BA 2F1MA 4L8JA 3TXQA 2Z5UA 3LSQA 4JYCA 2A7WA 2ZDIC 5LXTB 1JFFB 1TUBA 5IWAO 2UXDO 1F51A 5LMUB 1NU1H 4UUJC 2DYSB 4PA6A 3BHPA 1V54C 1QLEC 5EBMC 4R8CA 2HHHB 4LNUA 2Y4UA 4WBNA 1THZA 2PUSA 3CXHF 3H1IH 1AB3A 1GM7A 1DGSA 2IU0A 5JVDB 2LW7A 5KAIZ 2VWJA 3ZHVA 3P3NA 5JWPA 5IJ9A 1ZWIC 2PGGA 1MZFA 4CS2A 2RNBA 1KUQA 4I4TA 3SJCC 2BCCH 4JV5B 3WB0A 4I5SA 1KD1W 4JZ2A 1SC5B 5KMGB 4JYYA 4JI1B 5JQGB 3DXRA 4DW1A 4N21A 4LF6O 3D3IA 2H8PC 2UUCO 2HLDG 4DW0A 1Q82W 3JSLA 2EIJC 2HEPA 3F5WC 4E2LA 3DGEA 5K1XA 4NXMO 1COWG 5LA6B 2HKOA 4IHJB 4LH6A 5D5QA 1R73A 1R3LC 1IBLB 2Y48A 3ETQA 3H1KH 1Q6IA 2YIDA 1DLBA 1M57B 4X1KB 2VQEO 2XTAA 4DRXA 5ITZB 5KHGA 3ZIAG 4HZ3A 3K0GA 5LOVB 3ZMSA 2PI5A 3JAKB 2CGOA 4JI8O 3LDCA 3CC7V 2VQEB 2QWOB 5IYZA 3SPHA 2P7TC 2XNDG 2YDEA 2K9PA 1TAEA 2BTQB 4P30A 4GX5A 1U96A 1P84F 2ZCEA 2DWDC 2YI9A 3QTCA 3H9VA 3CCMV 4YHHB 4DR5B 4DR4O 1LUWA 2QWQB 2KG7A 4NYKA 4DR1B 2Q73A 4X1KA 2XAQA 2NLJC 2ZM6O 3K03A 3FB8C 3ZMUA 3JD4A 3A0BZ 1JQ0A 2PTMA 3VQXA 1GK9A 5H5NA 5BZBA 1TA8A 1BSMA 3MD0A 4X62O 3J7AU 4RQEA 2BSKA 3ETGA 4RQFA 4JV5O 3BA9A 2NNUA 1K97A 2CTQA 4MTFA 2UU9B 5KHHA 5B66Z 4MVUA 3OTOB 1VP7A 3CWBH 1V9PA 1GTOA 5JJNB 4BAYA 1YTFB 2RMKB 1PV0A 3T4ZA 1TUBB 1X4TA 2P5OA 3OFNG 5LGNA 4DV5O 2LQTA 3J80N 1I94B 1BS3A 4LFCB 3IGAC 3M99B 5BY1A 5IY5C 2RN9A 4WFBV 1XMQB 4XDKA 1YITV 1FFXA 1JJOA 4ZI7A 1PM9A 4DYLA 4ZOLB 4J7KA 3FB6C 1AI5A 2V1DA 1YVWA 4QIWF 3K57A 2AZ0A 1Y6XA 4U7OA 2XAJA 3WB2A 3LUTB 5BXZA 1RPRA 2ODMA 1XHZA 1AROP 2DJVA 5IE9A 3N2KB 3JD3A 1S5JA 4GX1A 3W7XA 4Q20A 4FJCC 2YC0A 3THOA 2UXXA 1OCZB 4LF5O 4JAVA 1WP8A 1VQOV 3T1YO 3MDSA 4LF4O 4IYHA 1Q90D 3DXRB 4HYOA 4NVPA 4PA9A 3E22B 1IBKB 1L0LH 4DV5B 1VQ5V 4MVMA 3I5DA 3K5OA 2JK5C 2Q0AA 4EB6A 2UUBO 4FMTA 4U7NA 4PDRA 3MHSC 2X6BA 4JASA 5BMVB 3WG7B 2B5UA 4OPAA 4X89A 4PI0A 1VMGA 1QQCA 1EBOA 1XHXA 2EZOA 2RDCA 3ABUA 1WLEA 3BRCA 5LL6Y 1ENVA 4JI0O 3K9SA 3I55V 4QGPA 4B08A 4X66B 3UO2A 3BCCH 4CS3A 1VIBA 3FX7A 3EHBB 5EC2C 1IXBA 4DR5O 4GX2A 2BOBC 5B1AB 3F7VC 4FFBB 1GN3A 1P7GA 3HR0A 1AILA 1XMOB 5CB4B 1YZBA 1YIJV 2F23A 3D36C 1RSOB 4FLUA 2DW4A 4X66O 4GT1A 1MA1A 2QKCA 3JARA 5JCOA 3CX5F 2RQ6A 2ZE5A 1Y74B 5EBWC 2UUCB 3RW0A 2V7QG 2OYQA 5LYJB 1D5NA 4B7EA 1FJGO 3ML0A 4QPJA 4O4JA 4JI7B 2HP8A 3J81N 2E5LB 3U10A 1YJWV 4PV1B 1I0HA 4K0KB 3X2QB 1AR5A 1IBLO 1OHHG 3B09A 4DR6O 1VQ9V 1XREA 3WU2Z 3GVMA 4E4EA 1YXBA 4B3RO 3N2GA 3OMNB 1D2DA 1ZL8A 4LFAB 4WCEV 1N32O 4X1YA 1AI7A 1IBKO 3D8CA 3T1HO 1SZTA 2CH7B 1NQTA 1N0JA 4GKJO 1XNRO 4JI4O 2ZE6A 5L3GA 3CCRV 4TV8B 3L74H 4O4LA 1N33O 1BHBA 4B3TO 4EFEA 4B3SO 3G80A 5GONB 4LF9O 2ZE8A 4MTXA 3K0DA 5LHIA 2L6LA 1Y67A 2LFSA 1U97A 3AG1B 2E74B 1BT8A 5LMUO 1Y76B 2WLIB 4J42A 4AI8A 2YIAA 2ARHA 1SQVH 2D2CB 3ZBHA 3RN4A 2QWPB 1SS3A 1W0JG 2LP7A 4P2ZA 5CA1B 2JGDB 2X7RB 1MSDA 3HKBB 5GTIZ 1J5EB 1KQSU 3D3QA 3SJBC 4ICGA 3HKEA 1AI6A 1IX9A 5JH7A 3NR7A 5A2QN 3ABTA 5GONA 1M5IA 5IDJA 3N27A 1HWYA 4ABMA 4DV7B 4TQFA 5CBFA 5CN0A 3JATA 1K4DC 2XUMA 4LWSA 4HNAA 2EX3A 1R3IC 2MW2B 3RYFA 1HNWO 5LHHA 5BMVA 1L1FA 1RM1C 1IBMB 2GUZB 1VEWA 4J9ZB 3K06A 5HFLA 1GM8A 2OCCC 5LA6A 4J7ZA 1AVMA 3A8TA 4JTCB 3TCUA 1BQ0A 1NTMH 2LGQA 4O2AB 4J7JA 1H8HG 2DMXA 3HKDB 5J2TB 4DV4B 5BR8B 2F95B 3PJSK 3AG3B 2OCCB 3OTFA 2ZNJA 2QTSA 4FFBA 2GUZA 1VQ4V 4P9OA 3VQWA 3K08A 4P9PA 1QHTA 1BGYH 2B1GA 3JAMN 3TK1A 1NVPD 1XEQA 4X20B 3LNMB 3ABMC 4I7ZB 1FXKB 1PNLA 1WB8A 1WPBA 1G6UA 4BIZA 4JTDB 5KMGA 2DQ3A 4RO2A 1I5YA 4OX9B 3CSXA 2KG7B 3CEIA 3AEIA 2Q6AA 3M8AA 4FLXA 1BHAA 4UCTA 1GKFA 2GHYA 2O57A 3CRRA 1Z5VA 5H9CA 5H6RA 5F2VO 1K92A 4D6TH 2LGWA 2NN4A 1NI8A 5J9PC 1Q5OA 4LF8O 3LDEA 5FPRA 1OZ0A 5C93A 3RVZA 5JCOC 2ZR2A 3QG5A 4GKJB 1OCOC 2JEUA 1L0NH 1AR4A 2KQXA 3JD1A 1P4RA 2B9ZA 4DV0O 4DUZB 2IBZH 4G27B 5IWAB 1J95A 5B1NA 5CA3A 2PF4E 4JI2O 3OTOO 2YXHA 5KHJA 3L72H 4I55B 2OTLV 2WPDG 1Q6HA 4JI5O 1FJGB 1NT2B 2R70A 2F4VO 5C8YA 4F4LA 1HNXB 4IIJA 4TWKA 4ZOLA 1O9GA 3JAWA 3LSUA 4R7CA 3CCJV 3BABA 3UKMA 1B6QA 2E76B 3OR7C 2F66C 4UVCA 1M9NA 4GX0A 2UXBB 2Y69B 4BW9A 2GDSA 1FFXB 3BEHA 3CD6V 4ZBMA 2QKSA 1H2GA 1Y66A 4IT5A 1NVPB 1P49A 4DV3B 1G4YB 2WLKA 1F23A 3FFQA 2XHBA 1SF9A 4X64O 4TV9B 2FKXA 4DV1O 2P4KA 2ATKC 1F4NA 3QO5A 3RYIA 4DV6B 2QWNB 3RYFB 1BCCH 4YXWG 1N4CA 1H2SB 1RPOA 3STLC 2DOSA 4O4HA 3FD9A 5IJ9B 3RBZA 1Q7YW 4MS2A 3ETDA 1DK1A 1NS1A 1E1RG 1HNWB 5LMNB 4DR3O 1EN4A 1PP9H 5KUMA 2OT5A 3C3SA 4BWAA 2WWWA 2ZQMA 3HKDA 4XBFA 1S5LZ 1N0NA 1WJZA 4DV0B 1ZLZA 1VF7A 1WNSA 2GSMB 2IJJA 2ZDIA 3K59A 1YDXA 4AQYB 2Q69A 2Q0OC 2WSSG 2PY5A 4FLVA 4JI1O 3CRMA 1F7YA 3L75H 4GYCB 3PN1A 2WLMA 3N2KA 1KYOF 2YSUB 3E8FA 1MNGA 2UXCB 4YY3B 5IJ0B 4JI7O 4CH4A 4NR1A 5KHIA 3MAQA 3SYCA 1OJHA 1FAFA 2DE0X 4U3FH 4YY3O 3H01A 2EULA 3IAYA 4U3JA 3CMEV 3BY6A 4LH7A 3JAKA 3IJ4A 2UXCO 3UT5B 1JX9A 1CEZA 1ZX3A 2H3OA 1I08A 1EN6A 4ZIBA 5KA5A 4TUYB 4WFGA 3TETA 1Y74A 2H94A 1HDJA 4DK1A 1BMFG 3HKCB 1V54B 2X6CA 1UPGA 3ZN1A 1I7FA 5L3EA 4YIOA 1F4MA 1RM1B 2FMLA 3SYOA 5L3CA 2EILC 3K79A 4Q6GA 2CH7A 4UCUA 2A79B 3EXAA 4DR6B 2LO1A 1PPJH 3CJHB 1S72V 1CPYA 3P3PA 1IZ3A 1O9HA 3N2GB 3JYCA 4TOIA 4O2BB 3RYCB 4QE9A 1YJ9V 3JSNA 3RVYA 1MSWD 3AK3A 3ZRXA 1FYJA 4N23A 4NKGB 1L8DA 2NR5A 3AG3C 4I0XB 5FL7G 1GH6A 1M1KW 3ZMZA 4Z1VA 3ZEDA 1WA8B 3WB1A 3G4SV 1XQ8A 2JDIG 2JGUA 5B1BB 2HR3A 4JYAB 1H2LA 4O4JB 5GTHZ 3VBBA 2WLIA 2Y0PA 3ZRWB 2VRZA 3KZIZ 3ICXA 1MOFA 3P32A 4PD4F 4X65O 4DO2A 5LP6B 2DQ0A 1US6A 3HKBA 3G6EV 5EZYA 2ZNIA 3CCVV 4UCOA 3LSSA 3KKYA 5JJJB 2Y69C 4LF9B 5JH7B 3ZHRA 3FAVA 3ZRVA 3L9DA 2FL4A 2KKWA 1N34O 4MVOA 1SZXA 4PDVA 5EBLC 1Q3EA 1M90W 4NTWA 4UFZA 1SQPH 2YEVA 4GKKO 1YTFD 4YJ3A 3RT3C 4KUMA 1K5SA 3FKSG 3CPWU 4LC1A 5LHGA 4UCVA 2VQFO 5E79Z 1Y76A 5LP6A 1EZJA 1S77D 2YICA 2EINB 5E1AC 2BOCC 3ZMTA 2X0LA 1EN5A 1RFYA 4I4TB 1VF5B 5KLVH 5LBQA 3CCEV 1QLNA 2L35A 1LNQA 4NB5A 2UU9O 1SQFA 3B2EE 1JFFA 5LMNO 1AP6A 2AW9A 2AGAA 3OEHG 3K3WA 2KSDA 3OE7G 1YI2V 5B3SB 4EEQA 1YF2A 1A32A 2EINC 4JGSA 1NH2B 3JATB 4FZ1A 2ZM6B 4PELA 4DR1O 4LF7B 4U3JB 3WFVA 1XNRB 4OXSA 4ASUG 4O4IA 2GV9A 4JAUA 3U0ZA 1FS0G 2QGNA 2QSAA 1NZ6A 4LFCO 4WFHA 3OUSA 3X2QC 2ZIOA 1BL8A 1QR9A 3Q4HB 1VF6C 3ZN0A 1RSOA 2EIKB 2FB5A 1IDSA 4LP8A 2C2AA 2ZD9A 4K0KO 2IM9A 5LOVA 3A0HZ 1KBHA 2HVJC 4UVBA 5JQGA 3AG2B 2B1IA 1ROPA 4YJ2B 1X59A 2W0FC 3RFRA 1OCRC 2LJ2A 4F6RB 4O4IB 2K1EA 4UVAA 2AXTZ 3D36A 3EVKA 3AG7A 3Q4HA 5D5PA 2QKAA 4BW5A 4JI2B 2RJZA 4NTYA 1R6KA 2Q8VA 1HR0O 4UV8A 1H8EG 4DV7O 3DC5A 2OTJV 2UUBB 4WFFA 1Q8IA 4MTOA 5H2FZ 4K35A 4HAMA 3ASNC 3OMIB 1PD3A 4DRXB 5JJEB 3OW2U 2QR4A 4IIJB 2UXNA 3QO7A 4X1IB 3APOA 4R6ZA 1TVKB 2XAFA 3ABLB 1WP7A 1VQKV 1KECA 5JVDA 5DN6G 3CS5A 3K5NA 4MTGA 5KAFZ 1SQBH 3FYEB 4GCZA 1DF4A 2IJKA 4X9QA 4WFEA 3O9OA 5CMUA 3FB5C 5EZYB 3W7TA 4DK0A 4JI6O 3H1HH 3QF7A 2IH1C 2Y4TA 1Q86W 1H38A 4H37A 2YI8A 3SJQC 1DTOA 4CH5A 3SGIA 2AHZA 1JA8A 3SPCA 2UUAO 5K1PA 1IXMA 4PJ0Z 4AQYO 1QVGU 2YEVB 3TGUH 3OEEG 4X1IA 3T1HB 4NXNB 3AK2A 5H6QA 3S3WA 3T1YB 4PA3A 1K73W 4LF4B 1JVMA 1R3KC 3APQA 4LFAO 2M7WA 1G8MA 4LF5B 3ZHTA 4CC6A 4FLYA 2EIMB 4LWSB 5CA0A 4R50A 1PL4A 5BR8O 3GB7C 4MVZA 2OIEA 4DV4O 2IJHA 1GM9A 4OX9O 2Q68A 2E5LO 1Q81W 2XASA 4B3MO 4B3SB 1EM1A 3BPZA 4G2KA 1FXKC 4JPRA 2RCVA 1PNKA 1S3JA 2EIMC 4DR4B 4EB6B 1IBMO 1KKCA 1XILA 2YS8A 3UQ8A 4YIPA 4LR3A 5IYZB 3VQVA 2PZSA 4J41A 2UUAB 4I50B 1Z2GA 2Q7EA 1VQPV 3IC7A 4NTXA 2CAZC 2QA4V 1YCIA 2VS0A 2W0XA 3SR2C 2DYSC 4O4HB 4JI8B 3E2EA 4QE7A 2WLHA 3E83A 1WPXA 4FM2A 3CXCU 1P7BA 1K9MW 1OCOB 1R6TA 4DR2B 4DUYO 4KHPO 5FLXN 4FLTA 1H2KA 3C90A 4FFKA 3OGCC 5CB4A 3TXSA 2R9RB 2EIJB 1KC8W 5HFMA 3U11A 1IURA 4TSFG 2AHYA 3QVNA 2WLNA 4FPPA 3K5MA 2DYRC 2DWEC 4LBEC 5EIBC 3CC2V 5KX5A 4MVQA 2BTQA 2W6IG 4LF6B 1VARA 2WLLA 3R65A 1E79G 1UJWB 5B3SC 4FVMA 3I56V 1S5HC 3FYIB 2IW5A 1WAZA 3ASNB 1TUEB 2QE7G 4RWUA 3K5LA 3C3TA 4UB8Z 2R72A 4JAAA 4ZKIA 5TISZ 3B4SA 1QR8A 4DR7O 3ZHUA 4ZI7B 2P6JA 1K7DA 1XOUA 3AG1C 2Z3YA 1XNQB 4X1YB 4WFAV 3AK1A 4IYIA 1M56C 5IT9N 3ZMVA 4PI2A 1SQXH 2JS5A 1G1XB 4B3TB 1JCHA 4CBCA 2Q7GA 1RP3B 3JASB 4ZHQB 3SPIA 1KP3A 2CGNA 5LYJA 4WF9V 1S0VA 4CS4A 3E22A 4H33A 3ETEA 1SKVA 4JI6B 1OCCB 1Y4MA 3AG4B 1QNMA 2YXYA 3IC9A 3CMAV 3KCXA 3OMAB 1YHQV 1H2NA 4DR7B 1QBZA 3SPGA 3RYIB 1D5AA 3ABKB 2GBOA 4MW3A 4CH6A 1CP9A 4B7KA 3W7WA 3B40A 3NXSA 2Q7HA 1PKXA 4X88A 4D7TA 4EKWA 2KB1A 3TJTA 1N36O 3G6BA 3B8MA 2EIKC 3HPLC 3P30A 3OT7A 3E8GA 1N36B 2F43G 3ZX6A 1N34B 1ORQC 4QJFB 4JI0B 2N05A 5L3FA 2W6JG 2XOKG 1FXHA 3DSQA 4DUYB 2VWKA 2F4VB 2EJ7A 3ABMB 3OAAG 2FTKA 1YSCA 2YUAA 5J2TA 4AHCA 1K5QA 3E8HA 4GUNA 4YJ3B 1JR9A 4BIOA
chains in the Genus database with same CATH topology
2DN9A 3UO2A 2Y4TA 4IT5A 2LGWA 3APOA 2M6YA 1HDJA 4RWUA 1IURA 2QWRB 2CTRA 2QSAA 2DMXA 1NZ6A 2L6LA 2YS8A 2N05A 3BVOA 2CTWA 1FAFA 2CTQA 2N04A 2Y4UA 2GUZB 2PF4E 2EJ7A 2QWQB 2QWNB 3UCSC 1BQZA 3AG7A 3APQA 4J80A 2QWOB 4J7ZA 2YUAA 1N4CA 1XBLA 2CUGA 2QWPB 3UO3A 1GH6A 1FPOA 2GUZA 2LO1A 2CTPA 2OCHA 1BQ0A 1WJZA 2KQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN9 A;  3UO2 A;  2Y4T A;  4IT5 A;  2LGW A;  3APO A;  2M6Y A;  1HDJ A;  4RWU A;  1IUR A;  2QWR B;  2CTR A;  2QSA A;  2DMX A;  1NZ6 A;  2L6L A;  2YS8 A;  2N05 A;  3BVO A;  2CTW A;  1FAF A;  2CTQ A;  2N04 A;  2Y4U A;  2GUZ B;  2PF4 E;  2EJ7 A;  2QWQ B;  2QWN B;  3UCS C;  1BQZ A;  3AG7 A;  3APQ A;  4J80 A;  2QWO B;  4J7Z A;  2YUA A;  1N4C A;  1XBL A;  2CUG A;  2QWP B;  3UO3 A;  1GH6 A;  1FPO A;  2GUZ A;  2LO1 A;  2CTP A;  2OCH A;  1BQ0 A;  1WJZ A;  2KQX A; 
#chains in the Genus database with same CATH topology
 1HW7 A;  4OPH A;  3JD2 A;  5FNV A;  2XAG A;  4QPK A;  4YHH O;  4MSW C;  4YJ2 A;  4DUZ O;  1R1B A;  2P06 A;  3KG2 A;  3W7U A;  5CBG A;  4KFM A;  1Z5W A;  3KCY A;  4IHJ A;  3UCS C;  3UT5 A;  1OCZ C;  3FB7 C;  3BFR A;  3RYH B;  1NBM G;  5AG2 A;  2DN9 A;  4JYB A;  1SA0 B;  3ASO B;  1TGO A;  2E75 B;  1HNZ B;  4K8X A;  2WLL B;  5ITZ A;  1R3J C;  2A3Q A;  2QM8 A;  2P90 A;  1K34 A;  3MHH C;  1HNX O;  4B3M B;  3S3X A;  1XL4 A;  1ZUQ A;  1AJQ A;  2JVD A;  5EC1 C;  4TQD A;  3G67 A;  3VQY A;  2ADQ B;  1N8R W;  4PHZ A;  1W2B U;  2ZR3 A;  4RAI A;  5DM6 V;  2QEX V;  1R6N A;  1M4U A;  2CDY A;  1M56 B;  1VQ7 V;  3CP1 A;  4I9W A;  3VOU A;  4NXN O;  1KP2 A;  3JCU Z;  4D7S A;  3CRA A;  1WN7 A;  3SJA C;  5LXT A;  2JJ2 G;  2HHH O;  2HG5 C;  2QM7 A;  3HKE B;  2A06 H;  3GWK C;  4ZHQ A;  3H1L H;  5J2U B;  2DYR B;  2HJD A;  1K4C C;  2CK3 G;  3OUF A;  1GO3 F;  4X8A A;  4O4L B;  2PYJ A;  5L3B A;  2CE4 A;  4KL1 A;  4LFB O;  3L70 H;  4PDL A;  3LDD A;  3JAW B;  3B77 A;  3BAA A;  1JMK C;  3RGB A;  3DC6 A;  3K9A A;  4Z1M G;  1M93 A;  4JTA B;  4DV1 B;  2P67 A;  1KU9 A;  4FLW A;  1GN6 A;  1SET A;  2CTW A;  4X65 B;  5B1A C;  2QJ1 A;  2WA4 A;  1OCR B;  1MAB G;  2ETN A;  3EFF K;  1E1Q G;  3M7M X;  1W0K G;  2YIB A;  4X64 B;  3UM7 A;  5J2U A;  3JD0 A;  2JGD A;  5FPO A;  4JF3 A;  3OGI B;  1WB7 A;  4FM1 A;  3SYQ A;  1EFR G;  1FFT B;  4TV9 A;  2ZIM A;  1TVK A;  4NXM B;  2UXD B;  2X6A A;  2Y0I A;  1SER A;  1NTZ H;  1B3Q A;  2LFR A;  4IL6 Z;  1AR1 B;  2EZP A;  1J5E O;  1V55 B;  4WBN B;  4G28 B;  4HNA B;  5KA6 A;  1CXZ B;  4PA4 A;  4LFB B;  4I9Q A;  5CBH A;  2XAH A;  2Z0A A;  3O65 A;  2ZXW B;  5IY5 B;  3AG4 C;  2QWR B;  3OD4 A;  1HP8 A;  1V55 C;  2A9H A;  2YIB D;  2E3C A;  3QNE A;  3ABK C;  2ITC C;  4I50 A;  4O2A A;  2IJI A;  2JJ1 G;  1OCC C;  4H0L B;  5B5E Z;  3JCZ A;  1NR1 A;  5CA0 B;  4W4K A;  3JAL A;  2FYU H;  3SYP A;  3CE2 A;  3CB2 A;  5EIB D;  3ZHQ A;  1XDC A;  4LF7 O;  4H44 B;  3A2F A;  4FLZ A;  2EJR A;  3W7S A;  5KX5 B;  1BQZ A;  4J80 A;  4BR6 A;  1K33 A;  2BE3 A;  5LP6 C;  1GMG A;  1JOY A;  2Q5Z A;  1QVF U;  2ZE7 A;  4CC5 A;  4F6E A;  2JIZ G;  2A0L A;  2HFE C;  2D3O W;  5C8Y B;  2ITD C;  3HKC A;  1MG1 A;  1K3E A;  3CCQ V;  4JI4 B;  2CTP A;  1QU7 A;  3E35 A;  4UB6 Z;  5A9G A;  1MZE A;  4J10 A;  4JI3 O;  1NJI W;  4B3R B;  5L3D A;  2R9A A;  2XT9 A;  4UXN A;  3K04 A;  2OWO A;  1VQL V;  1YEW A;  3CJH A;  3CCS V;  1XNQ O;  1EZV H;  2HVK C;  3E86 A;  2LW1 A;  1Q43 A;  4QNH B;  3JAS A;  2Q9L A;  3SPJ A;  5EYP A;  2WAM A;  1VQ6 V;  4O2B A;  3RYC A;  1B06 A;  2IH3 C;  1IVS A;  1VF6 A;  4DR2 O;  1B04 A;  1ZAU A;  5B1B C;  4MT8 A;  1ZL8 B;  4X62 B;  1AI4 A;  1NTK H;  3ZCC A;  2VQF B;  1KMI Z;  2EBO A;  1SQG A;  4W4L A;  2OIG A;  3LNN A;  2N74 A;  3SYA A;  1KB9 F;  4JZG A;  5IYC O;  2P22 C;  5LGT A;  4DV3 O;  1NH2 D;  4TT3 G;  5KHK A;  1S76 D;  4UCR A;  4DXW A;  1QLE B;  3ASO C;  3T1C A;  3H1J H;  5DED A;  2MK3 A;  4XDJ A;  2YXL A;  3T4D A;  4K3A A;  5EK0 A;  1VQM V;  3K58 A;  3R66 A;  2ZKO A;  3BA8 A;  4J11 A;  4KHP B;  4MVS A;  2OCH A;  3CCL V;  2IU3 A;  3B8N A;  2Q67 A;  5CA1 A;  2BTO A;  1BE3 H;  4L87 A;  1NR7 A;  4DV6 O;  3ZHS A;  3G71 V;  2GTA A;  1N33 B;  1FXV A;  1XI1 A;  3CC4 V;  4RUF A;  1M57 C;  3L71 H;  1XBL A;  3HB3 B;  1W59 A;  3E89 A;  3STZ C;  1GN2 A;  4CH3 A;  3ZRW A;  2QTO A;  4CZZ A;  2UXB O;  1VQN V;  2M6Y A;  3T2M A;  1LR1 A;  2V4D A;  4UCS A;  3AG2 C;  1N32 B;  5FNV B;  3ZJZ A;  4AIL C;  4A5U B;  3BVO A;  5IYD O;  4HBN A;  3JAL B;  1I5X A;  3L73 H;  1SRY A;  2QDO A;  4MW8 A;  3F5T A;  4GKK B;  3GWO A;  1SES A;  2ZXW C;  4TUY A;  1YJN V;  2JEX A;  2AZ2 A;  4JI5 B;  4BIU A;  3FAV B;  3IFX A;  1FKA O;  4LCU C;  3F7Y C;  1UFI A;  1VQ8 V;  4LF8 B;  4Z2W A;  1NKD A;  3SDL A;  4K8Z A;  4KXR A;  1AJN A;  1GRJ A;  1XL6 A;  4PDM A;  1QCE A;  1MMM A;  1Q6U A;  3OM3 B;  1GN4 A;  3DTU B;  5IJ0 A;  2ADP A;  4JI3 B;  1HNZ O;  2QM4 A;  2WA3 A;  1OV9 A;  2CUG A;  3UO3 A;  1JPX A;  1I94 O;  1XUQ A;  1FPO A;  2JS3 A;  4FM0 A;  1LUV A;  2ILM A;  4IGG A;  3ZRS A;  5LGU A;  1XMQ O;  3ZS8 C;  4X20 A;  1FXK A;  1BZK A;  2HJF C;  2N04 A;  4I0X A;  4J9Y B;  4DR3 B;  3CCU V;  3QO8 A;  2ZT9 B;  5GW7 A;  4FK5 C;  1WA8 A;  1AP5 A;  1URF A;  2WLJ A;  3A0R A;  4GLX A;  2P4V A;  4F6R A;  3JAR B;  4DV2 O;  4H13 B;  4TV8 A;  2PYL A;  5EYP B;  1K8A W;  4PA7 A;  4RUE A;  2JRI A;  4OGQ B;  3CRQ A;  1DF5 A;  4MVR A;  1JJ2 U;  3CHX A;  4JYA O;  1PNM A;  5B1O A;  3RYH A;  1GAX A;  3CYO A;  5KUK A;  1ZSP A;  1AJP A;  1SA0 A;  1T5E A;  1H2M A;  4KP4 A;  1PL0 A;  3ABL C;  1FD9 A;  1SQQ H;  2PI4 A;  2EIL B;  1XMO O;  4C7U A;  1KKD A;  5DEC A;  2R9I A;  1HR0 B;  3OR6 C;  4XDL A;  4I55 A;  2BSK B;  2F93 B;  4UV9 A;  3WG7 C;  4FIP C;  2Q4P A;  2ZIN A;  5IYB O;  4GZR B;  4LNU B;  1ZTE A;  3CRC A;  4FZ0 A;  4EFB A;  2CTR A;  2GTS A;  3RWR D;  4DV2 B;  2G38 A;  3E8B A;  2F1M A;  4L8J A;  3TXQ A;  2Z5U A;  3LSQ A;  4JYC A;  2A7W A;  2ZDI C;  5LXT B;  1JFF B;  1TUB A;  5IWA O;  2UXD O;  1F51 A;  5LMU B;  1NU1 H;  4UUJ C;  2DYS B;  4PA6 A;  3BHP A;  1V54 C;  1QLE C;  5EBM C;  4R8C A;  2HHH B;  4LNU A;  2Y4U A;  4WBN A;  1THZ A;  2PUS A;  3CXH F;  3H1I H;  1AB3 A;  1GM7 A;  1DGS A;  2IU0 A;  5JVD B;  2LW7 A;  5KAI Z;  2VWJ A;  3ZHV A;  3P3N A;  5JWP A;  5IJ9 A;  1ZWI C;  2PGG A;  1MZF A;  4CS2 A;  2RNB A;  1KUQ A;  4I4T A;  3SJC C;  2BCC H;  4JV5 B;  3WB0 A;  4I5S A;  1KD1 W;  4JZ2 A;  1SC5 B;  5KMG B;  4JYY A;  4JI1 B;  5JQG B;  3DXR A;  4DW1 A;  4N21 A;  4LF6 O;  3D3I A;  2H8P C;  2UUC O;  2HLD G;  4DW0 A;  1Q82 W;  3JSL A;  2EIJ C;  2HEP A;  3F5W C;  4E2L A;  3DGE A;  5K1X A;  4NXM O;  1COW G;  5LA6 B;  2HKO A;  4IHJ B;  4LH6 A;  5D5Q A;  1R73 A;  1R3L C;  1IBL B;  2Y48 A;  3ETQ A;  3H1K H;  1Q6I A;  2YID A;  1DLB A;  1M57 B;  4X1K B;  2VQE O;  2XTA A;  4DRX A;  5ITZ B;  5KHG A;  3ZIA G;  4HZ3 A;  3K0G A;  5LOV B;  3ZMS A;  2PI5 A;  3JAK B;  2CGO A;  4JI8 O;  3LDC A;  3CC7 V;  2VQE B;  2QWO B;  5IYZ A;  3SPH A;  2P7T C;  2XND G;  2YDE A;  2K9P A;  1TAE A;  2BTQ B;  4P30 A;  4GX5 A;  1U96 A;  1P84 F;  2ZCE A;  2DWD C;  2YI9 A;  3QTC A;  3H9V A;  3CCM V;  4YHH B;  4DR5 B;  4DR4 O;  1LUW A;  2QWQ B;  2KG7 A;  4NYK A;  4DR1 B;  2Q73 A;  4X1K A;  2XAQ A;  2NLJ C;  2ZM6 O;  3K03 A;  3FB8 C;  3ZMU A;  3JD4 A;  3A0B Z;  1JQ0 A;  2PTM A;  3VQX A;  1GK9 A;  5H5N A;  5BZB A;  1TA8 A;  1BSM A;  3MD0 A;  4X62 O;  3J7A U;  4RQE A;  2BSK A;  3ETG A;  4RQF A;  4JV5 O;  3BA9 A;  2NNU A;  1K97 A;  2CTQ A;  4MTF A;  2UU9 B;  5KHH A;  5B66 Z;  4MVU A;  3OTO B;  1VP7 A;  3CWB H;  1V9P A;  1GTO A;  5JJN B;  4BAY A;  1YTF B;  2RMK B;  1PV0 A;  3T4Z A;  1TUB B;  1X4T A;  2P5O A;  3OFN G;  5LGN A;  4DV5 O;  2LQT A;  3J80 N;  1I94 B;  1BS3 A;  4LFC B;  3IGA C;  3M99 B;  5BY1 A;  5IY5 C;  2RN9 A;  4WFB V;  1XMQ B;  4XDK A;  1YIT V;  1FFX A;  1JJO A;  4ZI7 A;  1PM9 A;  4DYL A;  4ZOL B;  4J7K A;  3FB6 C;  1AI5 A;  2V1D A;  1YVW A;  4QIW F;  3K57 A;  2AZ0 A;  1Y6X A;  4U7O A;  2XAJ A;  3WB2 A;  3LUT B;  5BXZ A;  1RPR A;  2ODM A;  1XHZ A;  1ARO P;  2DJV A;  5IE9 A;  3N2K B;  3JD3 A;  1S5J A;  4GX1 A;  3W7X A;  4Q20 A;  4FJC C;  2YC0 A;  3THO A;  2UXX A;  1OCZ B;  4LF5 O;  4JAV A;  1WP8 A;  1VQO V;  3T1Y O;  3MDS A;  4LF4 O;  4IYH A;  1Q90 D;  3DXR B;  4HYO A;  4NVP A;  4PA9 A;  3E22 B;  1IBK B;  1L0L H;  4DV5 B;  1VQ5 V;  4MVM A;  3I5D A;  3K5O A;  2JK5 C;  2Q0A A;  4EB6 A;  2UUB O;  4FMT A;  4U7N A;  4PDR A;  3MHS C;  2X6B A;  4JAS A;  5BMV B;  3WG7 B;  2B5U A;  4OPA A;  4X89 A;  4PI0 A;  1VMG A;  1QQC A;  1EBO A;  1XHX A;  2EZO A;  2RDC A;  3ABU A;  1WLE A;  3BRC A;  5LL6 Y;  1ENV A;  4JI0 O;  3K9S A;  3I55 V;  4QGP A;  4B08 A;  4X66 B;  3UO2 A;  3BCC H;  4CS3 A;  1VIB A;  3FX7 A;  3EHB B;  5EC2 C;  1IXB A;  4DR5 O;  4GX2 A;  2BOB C;  5B1A B;  3F7V C;  4FFB B;  1GN3 A;  1P7G A;  3HR0 A;  1AIL A;  1XMO B;  5CB4 B;  1YZB A;  1YIJ V;  2F23 A;  3D36 C;  1RSO B;  4FLU A;  2DW4 A;  4X66 O;  4GT1 A;  1MA1 A;  2QKC A;  3JAR A;  5JCO A;  3CX5 F;  2RQ6 A;  2ZE5 A;  1Y74 B;  5EBW C;  2UUC B;  3RW0 A;  2V7Q G;  2OYQ A;  5LYJ B;  1D5N A;  4B7E A;  1FJG O;  3ML0 A;  4QPJ A;  4O4J A;  4JI7 B;  2HP8 A;  3J81 N;  2E5L B;  3U10 A;  1YJW V;  4PV1 B;  1I0H A;  4K0K B;  3X2Q B;  1AR5 A;  1IBL O;  1OHH G;  3B09 A;  4DR6 O;  1VQ9 V;  1XRE A;  3WU2 Z;  3GVM A;  4E4E A;  1YXB A;  4B3R O;  3N2G A;  3OMN B;  1D2D A;  1ZL8 A;  4LFA B;  4WCE V;  1N32 O;  4X1Y A;  1AI7 A;  1IBK O;  3D8C A;  3T1H O;  1SZT A;  2CH7 B;  1NQT A;  1N0J A;  4GKJ O;  1XNR O;  4JI4 O;  2ZE6 A;  5L3G A;  3CCR V;  4TV8 B;  3L74 H;  4O4L A;  1N33 O;  1BHB A;  4B3T O;  4EFE A;  4B3S O;  3G80 A;  5GON B;  4LF9 O;  2ZE8 A;  4MTX A;  3K0D A;  5LHI A;  2L6L A;  1Y67 A;  2LFS A;  1U97 A;  3AG1 B;  2E74 B;  1BT8 A;  5LMU O;  1Y76 B;  2WLI B;  4J42 A;  4AI8 A;  2YIA A;  2ARH A;  1SQV H;  2D2C B;  3ZBH A;  3RN4 A;  2QWP B;  1SS3 A;  1W0J G;  2LP7 A;  4P2Z A;  5CA1 B;  2JGD B;  2X7R B;  1MSD A;  3HKB B;  5GTI Z;  1J5E B;  1KQS U;  3D3Q A;  3SJB C;  4ICG A;  3HKE A;  1AI6 A;  1IX9 A;  5JH7 A;  3NR7 A;  5A2Q N;  3ABT A;  5GON A;  1M5I A;  5IDJ A;  3N27 A;  1HWY A;  4ABM A;  4DV7 B;  4TQF A;  5CBF A;  5CN0 A;  3JAT A;  1K4D C;  2XUM A;  4LWS A;  4HNA A;  2EX3 A;  1R3I C;  2MW2 B;  3RYF A;  1HNW O;  5LHH A;  5BMV A;  1L1F A;  1RM1 C;  1IBM B;  2GUZ B;  1VEW A;  4J9Z B;  3K06 A;  5HFL A;  1GM8 A;  2OCC C;  5LA6 A;  4J7Z A;  1AVM A;  3A8T A;  4JTC B;  3TCU A;  1BQ0 A;  1NTM H;  2LGQ A;  4O2A B;  4J7J A;  1H8H G;  2DMX A;  3HKD B;  5J2T B;  4DV4 B;  5BR8 B;  2F95 B;  3PJS K;  3AG3 B;  2OCC B;  3OTF A;  2ZNJ A;  2QTS A;  4FFB A;  2GUZ A;  1VQ4 V;  4P9O A;  3VQW A;  3K08 A;  4P9P A;  1QHT A;  1BGY H;  2B1G A;  3JAM N;  3TK1 A;  1NVP D;  1XEQ A;  4X20 B;  3LNM B;  3ABM C;  4I7Z B;  1FXK B;  1PNL A;  1WB8 A;  1WPB A;  1G6U A;  4BIZ A;  4JTD B;  5KMG A;  2DQ3 A;  4RO2 A;  1I5Y A;  4OX9 B;  3CSX A;  2KG7 B;  3CEI A;  3AEI A;  2Q6A A;  3M8A A;  4FLX A;  1BHA A;  4UCT A;  1GKF A;  2GHY A;  2O57 A;  3CRR A;  1Z5V A;  5H9C A;  5H6R A;  5F2V O;  1K92 A;  4D6T H;  2LGW A;  2NN4 A;  1NI8 A;  5J9P C;  1Q5O A;  4LF8 O;  3LDE A;  5FPR A;  1OZ0 A;  5C93 A;  3RVZ A;  5JCO C;  2ZR2 A;  3QG5 A;  4GKJ B;  1OCO C;  2JEU A;  1L0N H;  1AR4 A;  2KQX A;  3JD1 A;  1P4R A;  2B9Z A;  4DV0 O;  4DUZ B;  2IBZ H;  4G27 B;  5IWA B;  1J95 A;  5B1N A;  5CA3 A;  2PF4 E;  4JI2 O;  3OTO O;  2YXH A;  5KHJ A;  3L72 H;  4I55 B;  2OTL V;  2WPD G;  1Q6H A;  4JI5 O;  1FJG B;  1NT2 B;  2R70 A;  2F4V O;  5C8Y A;  4F4L A;  1HNX B;  4IIJ A;  4TWK A;  4ZOL A;  1O9G A;  3JAW A;  3LSU A;  4R7C A;  3CCJ V;  3BAB A;  3UKM A;  1B6Q A;  2E76 B;  3OR7 C;  2F66 C;  4UVC A;  1M9N A;  4GX0 A;  2UXB B;  2Y69 B;  4BW9 A;  2GDS A;  1FFX B;  3BEH A;  3CD6 V;  4ZBM A;  2QKS A;  1H2G A;  1Y66 A;  4IT5 A;  1NVP B;  1P49 A;  4DV3 B;  1G4Y B;  2WLK A;  1F23 A;  3FFQ A;  2XHB A;  1SF9 A;  4X64 O;  4TV9 B;  2FKX A;  4DV1 O;  2P4K A;  2ATK C;  1F4N A;  3QO5 A;  3RYI A;  4DV6 B;  2QWN B;  3RYF B;  1BCC H;  4YXW G;  1N4C A;  1H2S B;  1RPO A;  3STL C;  2DOS A;  4O4H A;  3FD9 A;  5IJ9 B;  3RBZ A;  1Q7Y W;  4MS2 A;  3ETD A;  1DK1 A;  1NS1 A;  1E1R G;  1HNW B;  5LMN B;  4DR3 O;  1EN4 A;  1PP9 H;  5KUM A;  2OT5 A;  3C3S A;  4BWA A;  2WWW A;  2ZQM A;  3HKD A;  4XBF A;  1S5L Z;  1N0N A;  1WJZ A;  4DV0 B;  1ZLZ A;  1VF7 A;  1WNS A;  2GSM B;  2IJJ A;  2ZDI A;  3K59 A;  1YDX A;  4AQY B;  2Q69 A;  2Q0O C;  2WSS G;  2PY5 A;  4FLV A;  4JI1 O;  3CRM A;  1F7Y A;  3L75 H;  4GYC B;  3PN1 A;  2WLM A;  3N2K A;  1KYO F;  2YSU B;  3E8F A;  1MNG A;  2UXC B;  4YY3 B;  5IJ0 B;  4JI7 O;  4CH4 A;  4NR1 A;  5KHI A;  3MAQ A;  3SYC A;  1OJH A;  1FAF A;  2DE0 X;  4U3F H;  4YY3 O;  3H01 A;  2EUL A;  3IAY A;  4U3J A;  3CME V;  3BY6 A;  4LH7 A;  3JAK A;  3IJ4 A;  2UXC O;  3UT5 B;  1JX9 A;  1CEZ A;  1ZX3 A;  2H3O A;  1I08 A;  1EN6 A;  4ZIB A;  5KA5 A;  4TUY B;  4WFG A;  3TET A;  1Y74 A;  2H94 A;  1HDJ A;  4DK1 A;  1BMF G;  3HKC B;  1V54 B;  2X6C A;  1UPG A;  3ZN1 A;  1I7F A;  5L3E A;  4YIO A;  1F4M A;  1RM1 B;  2FML A;  3SYO A;  5L3C A;  2EIL C;  3K79 A;  4Q6G A;  2CH7 A;  4UCU A;  2A79 B;  3EXA A;  4DR6 B;  2LO1 A;  1PPJ H;  3CJH B;  1S72 V;  1CPY A;  3P3P A;  1IZ3 A;  1O9H A;  3N2G B;  3JYC A;  4TOI A;  4O2B B;  3RYC B;  4QE9 A;  1YJ9 V;  3JSN A;  3RVY A;  1MSW D;  3AK3 A;  3ZRX A;  1FYJ A;  4N23 A;  4NKG B;  1L8D A;  2NR5 A;  3AG3 C;  4I0X B;  5FL7 G;  1GH6 A;  1M1K W;  3ZMZ A;  4Z1V A;  3ZED A;  1WA8 B;  3WB1 A;  3G4S V;  1XQ8 A;  2JDI G;  2JGU A;  5B1B B;  2HR3 A;  4JYA B;  1H2L A;  4O4J B;  5GTH Z;  3VBB A;  2WLI A;  2Y0P A;  3ZRW B;  2VRZ A;  3KZI Z;  3ICX A;  1MOF A;  3P32 A;  4PD4 F;  4X65 O;  4DO2 A;  5LP6 B;  2DQ0 A;  1US6 A;  3HKB A;  3G6E V;  5EZY A;  2ZNI A;  3CCV V;  4UCO A;  3LSS A;  3KKY A;  5JJJ B;  2Y69 C;  4LF9 B;  5JH7 B;  3ZHR A;  3FAV A;  3ZRV A;  3L9D A;  2FL4 A;  2KKW A;  1N34 O;  4MVO A;  1SZX A;  4PDV A;  5EBL C;  1Q3E A;  1M90 W;  4NTW A;  4UFZ A;  1SQP H;  2YEV A;  4GKK O;  1YTF D;  4YJ3 A;  3RT3 C;  4KUM A;  1K5S A;  3FKS G;  3CPW U;  4LC1 A;  5LHG A;  4UCV A;  2VQF O;  5E79 Z;  1Y76 A;  5LP6 A;  1EZJ A;  1S77 D;  2YIC A;  2EIN B;  5E1A C;  2BOC C;  3ZMT A;  2X0L A;  1EN5 A;  1RFY A;  4I4T B;  1VF5 B;  5KLV H;  5LBQ A;  3CCE V;  1QLN A;  2L35 A;  1LNQ A;  4NB5 A;  2UU9 O;  1SQF A;  3B2E E;  1JFF A;  5LMN O;  1AP6 A;  2AW9 A;  2AGA A;  3OEH G;  3K3W A;  2KSD A;  3OE7 G;  1YI2 V;  5B3S B;  4EEQ A;  1YF2 A;  1A32 A;  2EIN C;  4JGS A;  1NH2 B;  3JAT B;  4FZ1 A;  2ZM6 B;  4PEL A;  4DR1 O;  4LF7 B;  4U3J B;  3WFV A;  1XNR B;  4OXS A;  4ASU G;  4O4I A;  2GV9 A;  4JAU A;  3U0Z A;  1FS0 G;  2QGN A;  2QSA A;  1NZ6 A;  4LFC O;  4WFH A;  3OUS A;  3X2Q C;  2ZIO A;  1BL8 A;  1QR9 A;  3Q4H B;  1VF6 C;  3ZN0 A;  1RSO A;  2EIK B;  2FB5 A;  1IDS A;  4LP8 A;  2C2A A;  2ZD9 A;  4K0K O;  2IM9 A;  5LOV A;  3A0H Z;  1KBH A;  2HVJ C;  4UVB A;  5JQG A;  3AG2 B;  2B1I A;  1ROP A;  4YJ2 B;  1X59 A;  2W0F C;  3RFR A;  1OCR C;  2LJ2 A;  4F6R B;  4O4I B;  2K1E A;  4UVA A;  2AXT Z;  3D36 A;  3EVK A;  3AG7 A;  3Q4H A;  5D5P A;  2QKA A;  4BW5 A;  4JI2 B;  2RJZ A;  4NTY A;  1R6K A;  2Q8V A;  1HR0 O;  4UV8 A;  1H8E G;  4DV7 O;  3DC5 A;  2OTJ V;  2UUB B;  4WFF A;  1Q8I A;  4MTO A;  5H2F Z;  4K35 A;  4HAM A;  3ASN C;  3OMI B;  1PD3 A;  4DRX B;  5JJE B;  3OW2 U;  2QR4 A;  4IIJ B;  2UXN A;  3QO7 A;  4X1I B;  3APO A;  4R6Z A;  1TVK B;  2XAF A;  3ABL B;  1WP7 A;  1VQK V;  1KEC A;  5JVD A;  5DN6 G;  3CS5 A;  3K5N A;  4MTG A;  5KAF Z;  1SQB H;  3FYE B;  4GCZ A;  1DF4 A;  2IJK A;  4X9Q A;  4WFE A;  3O9O A;  5CMU A;  3FB5 C;  5EZY B;  3W7T A;  4DK0 A;  4JI6 O;  3H1H H;  3QF7 A;  2IH1 C;  2Y4T A;  1Q86 W;  1H38 A;  4H37 A;  2YI8 A;  3SJQ C;  1DTO A;  4CH5 A;  3SGI A;  2AHZ A;  1JA8 A;  3SPC A;  2UUA O;  5K1P A;  1IXM A;  4PJ0 Z;  4AQY O;  1QVG U;  2YEV B;  3TGU H;  3OEE G;  4X1I A;  3T1H B;  4NXN B;  3AK2 A;  5H6Q A;  3S3W A;  3T1Y B;  4PA3 A;  1K73 W;  4LF4 B;  1JVM A;  1R3K C;  3APQ A;  4LFA O;  2M7W A;  1G8M A;  4LF5 B;  3ZHT A;  4CC6 A;  4FLY A;  2EIM B;  4LWS B;  5CA0 A;  4R50 A;  1PL4 A;  5BR8 O;  3GB7 C;  4MVZ A;  2OIE A;  4DV4 O;  2IJH A;  1GM9 A;  4OX9 O;  2Q68 A;  2E5L O;  1Q81 W;  2XAS A;  4B3M O;  4B3S B;  1EM1 A;  3BPZ A;  4G2K A;  1FXK C;  4JPR A;  2RCV A;  1PNK A;  1S3J A;  2EIM C;  4DR4 B;  4EB6 B;  1IBM O;  1KKC A;  1XIL A;  2YS8 A;  3UQ8 A;  4YIP A;  4LR3 A;  5IYZ B;  3VQV A;  2PZS A;  4J41 A;  2UUA B;  4I50 B;  1Z2G A;  2Q7E A;  1VQP V;  3IC7 A;  4NTX A;  2CAZ C;  2QA4 V;  1YCI A;  2VS0 A;  2W0X A;  3SR2 C;  2DYS C;  4O4H B;  4JI8 B;  3E2E A;  4QE7 A;  2WLH A;  3E83 A;  1WPX A;  4FM2 A;  3CXC U;  1P7B A;  1K9M W;  1OCO B;  1R6T A;  4DR2 B;  4DUY O;  4KHP O;  5FLX N;  4FLT A;  1H2K A;  3C90 A;  4FFK A;  3OGC C;  5CB4 A;  3TXS A;  2R9R B;  2EIJ B;  1KC8 W;  5HFM A;  3U11 A;  1IUR A;  4TSF G;  2AHY A;  3QVN A;  2WLN A;  4FPP A;  3K5M A;  2DYR C;  2DWE C;  4LBE C;  5EIB C;  3CC2 V;  5KX5 A;  4MVQ A;  2BTQ A;  2W6I G;  4LF6 B;  1VAR A;  2WLL A;  3R65 A;  1E79 G;  1UJW B;  5B3S C;  4FVM A;  3I56 V;  1S5H C;  3FYI B;  2IW5 A;  1WAZ A;  3ASN B;  1TUE B;  2QE7 G;  4RWU A;  3K5L A;  3C3T A;  4UB8 Z;  2R72 A;  4JAA A;  4ZKI A;  5TIS Z;  3B4S A;  1QR8 A;  4DR7 O;  3ZHU A;  4ZI7 B;  2P6J A;  1K7D A;  1XOU A;  3AG1 C;  2Z3Y A;  1XNQ B;  4X1Y B;  4WFA V;  3AK1 A;  4IYI A;  1M56 C;  5IT9 N;  3ZMV A;  4PI2 A;  1SQX H;  2JS5 A;  1G1X B;  4B3T B;  1JCH A;  4CBC A;  2Q7G A;  1RP3 B;  3JAS B;  4ZHQ B;  3SPI A;  1KP3 A;  2CGN A;  5LYJ A;  4WF9 V;  1S0V A;  4CS4 A;  3E22 A;  4H33 A;  3ETE A;  1SKV A;  4JI6 B;  1OCC B;  1Y4M A;  3AG4 B;  1QNM A;  2YXY A;  3IC9 A;  3CMA V;  3KCX A;  3OMA B;  1YHQ V;  1H2N A;  4DR7 B;  1QBZ A;  3SPG A;  3RYI B;  1D5A A;  3ABK B;  2GBO A;  4MW3 A;  4CH6 A;  1CP9 A;  4B7K A;  3W7W A;  3B40 A;  3NXS A;  2Q7H A;  1PKX A;  4X88 A;  4D7T A;  4EKW A;  2KB1 A;  3TJT A;  1N36 O;  3G6B A;  3B8M A;  2EIK C;  3HPL C;  3P30 A;  3OT7 A;  3E8G A;  1N36 B;  2F43 G;  3ZX6 A;  1N34 B;  1ORQ C;  4QJF B;  4JI0 B;  2N05 A;  5L3F A;  2W6J G;  2XOK G;  1FXH A;  3DSQ A;  4DUY B;  2VWK A;  2F4V B;  2EJ7 A;  3ABM B;  3OAA G;  2FTK A;  1YSC A;  2YUA A;  5J2T A;  4AHC A;  1K5Q A;  3E8H A;  4GUN A;  4YJ3 B;  1JR9 A;  4BIO A; 
#chains in the Genus database with same CATH homology
 2DN9 A;  3UO2 A;  2Y4T A;  4IT5 A;  2LGW A;  3APO A;  2M6Y A;  1HDJ A;  4RWU A;  1IUR A;  2QWR B;  2CTR A;  2QSA A;  2DMX A;  1NZ6 A;  2L6L A;  2YS8 A;  2N05 A;  3BVO A;  2CTW A;  1FAF A;  2CTQ A;  2N04 A;  2Y4U A;  2GUZ B;  2PF4 E;  2EJ7 A;  2QWQ B;  2QWN B;  3UCS C;  1BQZ A;  3AG7 A;  3APQ A;  4J80 A;  2QWO B;  4J7Z A;  2YUA A;  1N4C A;  1XBL A;  2CUG A;  2QWP B;  3UO3 A;  1GH6 A;  1FPO A;  2GUZ A;  2LO1 A;  2CTP A;  2OCH A;  1BQ0 A;  1WJZ A;  2KQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...