2CUGA

Solution structure of the j domain of the pseudo dnaj protein, mouse hypothetical mkiaa0962
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
GSSGSSGILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNYDHYGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords mKIAA0962 protein
publication title Solution structure of the J domain of the pseudo DnaJ protein, mouse hypothetical mKIAA0962
rcsb
source organism Mus musculus
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2cugA01
1N4CA 2QWRB 1IURA 3APOA 2YS8A 2CTPA 2CUGA 1XBLA 2YUAA 1WJZA 2Y4TA 1GH6A 3UCSC 3BVOA 2PF4E 2CTRA 2QWNB 3AG7A 1FAFA 2LO1A 2DMXA 2N04A 3APQA 4RWUA 2KQXA 2N05A 2CTQA 2QSAA 2M6YA 1NZ6A 2LGWA 2Y4UA 2QWOB 3UO2A 2DN9A 4J7ZA 2EJ7A 3UO3A 1FPOA 2CTWA 2L6LA 2QWQB 1BQ0A 2GUZA 2OCHA 1BQZA 1HDJA 4J80A 2GUZB 4IT5A 2QWPB
chains in the Genus database with same CATH superfamily
1OJHA 2QKCA 1LNQA 4JAAA 1EM1A 3RN4A 4TQFA 2E75B 4J9YB 2XAGA 2P4VA 1QVGU 1NBMG 2NR5A 3CCSV 1G8MA 4PA7A 2R70A 4DV6B 5KHKA 5JVDA 3NXSA 1N0JA 4I55A 3SPGA 3H1HH 3CCLV 1XMOO 1M56C 4RO2A 4C7UA 1PL4A 4LFBB 4FFKA 2PI5A 1XNQB 2OYQA 4Q20A 2KKWA 1GN6A 5IT9N 3CP1A 1KB9F 5KHGA 4K8XA 2VWKA 2JIZG 2F95B 4NTWA 1I5YA 2WLNA 1AI5A 1BT8A 1MMMA 4OX9O 5L3FA 1QR8A 1FD9A 3Q4HA 3K9AA 4P2ZA 4NTXA 3CCVV 5IY5C 5IWAB 1PNLA 2ZNIA 2ZR2A 2OTLV 3CMEV 1H2GA 2UXBO 1NTKH 3IGAC 4DV0B 2OTJV 4NXNB 4GZRB 3JD3A 3S3WA 1HNXO 2RN9A 5LOVA 3AK2A 4B3SO 3HKBB 4LNUA 4UV9A 1B3QA 4WFBV 4IYIA 2Q6AA 5BR8O 1M9NA 4UB6Z 3CRAA 5JJEB 2JGDB 2QE7G 3G80A 3RW0A 4PA6A 4FLVA 1FJGO 2NLJC 4X9QA 4JI6O 1FAFA 1ZAUA 4EKWA 5BMVA 2GDSA 3ZMTA 1E79G 3G6EV 2E5LB 1NR1A 1IBKO 2X0LA 1RM1B 3QO5A 2GUZB 3EFFK 3ZHQA 3D3QA 3OT7A 2N74A 3JARB 5ITZA 2IJKA 4GKKO 1TUBB 3FYIB 3SPJA 3T1HO 3MAQA 4MTOA 4X8AA 1RFYA 1WNSA 3SGIA 4LFCB 1I5XA 3ETQA 4GLXA 4JYAB 4B3RO 1S5JA 4JI3B 1SQFA 1IBMB 2GUZA 4J80A 4HYOA 4J7KA 3HR0A 3RYIA 3HB3B 5LMNO 5EK0A 3DXRB 1TUBA 3H01A 4HZ3A 1VQ8V 4XDKA 4FM0A 3CD6V 3UM7A 1ZL8B 4DR4B 1YHQV 5EIBD 1SETA 4IHJB 2EIKB 3QG5A 4WF9V 2ADQB 1THZA 2PYJA 1RM1C 3ICXA 4PELA 3OR6C 2A79B 2JS5A 1IDSA 2LW7A 3DC6A 3FD9A 5EBWC 4DR7O 4FK5C 1R6KA 4LF4B 3VBBA 2YC0A 2QGNA 2Z5UA 4O2BB 3SJQC 4F6EA 1KUQA 1NH2D 4PI2A 5CBHA 4J7ZA 2ZNJA 4I4TA 5IDJA 4W4KA 1JFFB 1S3JA 1YJNV 3FYEB 1BMFG 4YY3B 1MZFA 4AQYB 1SESA 4PA3A 1KBHA 4JTDB 1ZUQA 4FLYA 1KD1W 2LFRA 3BVOA 3K57A 1J5EO 2EIKC 3BFRA 4JV5O 3CSXA 3FFQA 5B1AC 1JFFA 4I50A 3RGBA 3ABKB 3GWKC 2XHBA 1N33B 2DYRC 2YUAA 4JZ2A 4DUYB 4BIZA 1KYOF 3AG7A 3RT3C 2ZM6B 2WLMA 1XNRB 4RAIA 2N05A 4IIJA 1BGYH 4YJ2B 3MHHC 3SPHA 3CCJV 1S5HC 4LF6B 1NQTA 4L87A 1XOUA 1FXVA 3JASB 4EB6A 3CB2A 4LFAO 1GRJA 2AGAA 3B8NA 5BXZA 4K0KB 4FFBB 1XL6A 4YJ2A 2UUCB 2UXXA 4BW5A 3IFXA 1PKXA 1NU1H 1FXKB 2KG7B 5CA0B 1PNKA 2ITCC 3ABKC 3AG1B 3JASA 1H2LA 2OIGA 2XAQA 1GKFA 4AI8A 4N23A 1S72V 1VQ5V 3BAAA 3ZRWB 4X65O 1AI6A 4UXNA 4OXSA 4IL6Z 1FFXB 1KC8W 3ZCCA 3G6BA 3ZRXA 1YIJV 3DGEA 4UUJC 4DR1O 5E1AC 2CTWA 4Z1MG 2VRZA 2UXDO 4O4JB 1W2BU 3F7VC 4LFBO 3ZRWA 4WFGA 5J2TA 4G27B 2OIEA 1SQXH 3JSLA 1NT2B 2Q7HA 1FFXA 5JQGA 1ZWIC 3DTUB 4DYLA 1FXKC 2Y4UA 3A2FA 5H9CA 3AG1C 4MVOA 4A5UB 4JI2O 5IWAO 1I94B 1S76D 3CCUV 2IBZH 3OR7C 1QHTA 4DR3O 2O57A 1N32B 3E2EA 1JVMA 5F2VO 1OCCC 4B7KA 4YHHB 1GM9A 2YXLA 4PHZA 3SYAA 2P67A 4Q6GA 4DR5B 1N36O 4I9WA 3OTOB 3OD4A 3OGIB 4FLWA 1WP8A 4X1YB 1VQ9V 1TGOA 3H1IH 4JYYA 1IBLO 4LF7O 1VQ7V 2D2CB 4WFEA 3T4ZA 2Q7GA 2X7RB 3W7TA 1G4YB 1K8AW 4JI7B 2Q69A 4HNAB 4FZ1A 2VWJA 2CUGA 1Q5OA 1RSOB 1NR7A 2RMKB 1AR1B 4DR2B 2AW9A 2P06A 3VQYA 5CA1B 3H1LH 5CBGA 2NN4A 1S5LZ 2WLIB 1I08A 3M7MX 2QR4A 3SJBC 5EYPB 2A7WA 1F51A 3JATB 1Q86W 1FFTB 2BTQA 5B5EZ 5LXTB 4EFEA 4GX0A 3OMIB 3E22B 1RSOA 4MVMA 3ZMUA 2QKSA 4TWKA 5CA1A 1PL0A 2QEXV 4DR4O 2YIBD 4DRXB 2Q73A 4UCSA 1U96A 1FS0G 3JATA 2DWEC 5C93A 1QQCA 4JI1O 1P84F 3BPZA 5LA6B 3E22A 1DK1A 3CRMA 5L3GA 4U3FH 4LF5B 5FL7G 2UUBB 5K1XA 1IZ3A 3CC2V 2F93B 4LF4O 5KLVH 3CCQV 4QGPA 4LF9O 1FYJA 5LHGA 3B77A 1K33A 5D5PA 2WA3A 1YDXA 1B06A 2EULA 3TETA 5LA6A 3ZHUA 4JTAB 1M57B 4BW9A 1YEWA 1UFIA 2Y4TA 4DV3B 3ZN0A 4AQYO 3KZIZ 5LGNA 1GO3F 4I5SA 1ORQC 2ZIOA 4JI5B 1V54B 3D36A 5J2UB 2YEVB 1K7DA 3B09A 4CBCA 4DV5B 4RQEA 3BA8A 3RYHA 5IYZB 3GVMA 1FPOA 2HLDG 1IVSA 1VQLV 4P30A 3LDDA 1HW7A 3RWRD 2YS8A 2Q7EA 2IH1C 1BZKA 2B5UA 1EZJA 3CMAV 3CWBH 2IU0A 3K5OA 2ZM6O 3D36C 5J2UA 2CE4A 2HVKC 2QM4A 3CYOA 3JAKA 5IYZA 4LF8B 1L0NH 1NTMH 1GK9A 1OCOB 1M57C 2ZD9A 4MT8A 4PJ0Z 2Q8VA 3ASNB 1EN4A 1D5AA 1DF4A 1OHHG 1BS3A 1JOYA 4BWAA 1V54C 1HNZB 2YIAA 4UCOA 3STLC 1YZBA 3BRCA 2R72A 5KUMA 3E8BA 1XMQB 4GYCB 1MNGA 3CC4V 3ZIAG 4CH6A 5L3DA 4O4IB 5LP6A 4DR6O 3RYCB 3A8TA 3CCEV 4ZOLB 2HG5C 1N34O 5H6RA 5GW7A 1XREA 1WA8A 1QLEB 3FB5C 1NZ6A 4RUFA 3RFRA 4JZGA 4J41A 3PJSK 3UO3A 4LCUC 1Q7YW 1BQ0A 4YJ3B 4X20B 2UXNA 1W0JG 2R9AA 3CX5F 4WBNB 3ABLB 4O4IA 5LP6C 5LMUO 5C8YB 3WB0A 1XBLA 1Y4MA 1NKDA 2DQ0A 2RNBA 3U10A 2A0LA 3SYPA 4CH4A 5EC1C 1G1XB 1VQNV 1Z2GA 1Y6XA 2HP8A 2KQXA 3NR7A 3ABUA 4FVMA 5CMUA 4X62B 4TSFG 4B3TB 2PTMA 4DV7O 5E79Z 3KCYA 3K0DA 4H33A 3QO7A 1NJIW 2PI4A 1Q3EA 5FPOA 4KHPO 1OV9A 1FXHA 3ABTA 1I94O 2QDOA 1QLEC 3IJ4A 1ROPA 3E35A 2VS0A 2ZE7A 4JYBA 2XASA 1D2DA 3WB1A 2KSDA 2ADPA 5LHIA 3E86A 4TQDA 1IX9A 3OTOO 1CPYA 3W7XA 4FM1A 4MVSA 2PYLA 5A9GA 1H2MA 4RUEA 3K3WA 1L8DA 2V7QG 2IM9A 3F5TA 3ABMB 2F1MA 2QKAA 4JI7O 3HKDB 4FMTA 3LDCA 1YI2V 1GM8A 2XAJA 1K73W 1PD3A 3SPCA 3B40A 2DJVA 1BHBA 3TGUH 2X6CA 2K1EA 3FX7A 5EC2C 3UO2A 4RQFA 3PN1A 3T1CA 5FNVB 3HKBA 2L6LA 3BA9A 2JGDA 1TAEA 2QWRB 3HKDA 2EILB 2IU3A 4U3JB 2JVDA 4E2LA 3N2GB 5CA3A 3MHSC 3K5LA 2Q68A 2ZE8A 4R7CA 3L71H 3ZX6A 1YCIA 1R3JC 4DO2A 2QJ1A 2CTQA 3L72H 3ABMC 5GONB 1ENVA 4DUZB 1HDJA 4U3JA 3OAAG 4ASUG 1AJQA 1Z5WA 5IJ9B 2CTPA 3O65A 3JARA 3N2GA 4PV1B 1DF5A 2W0XA 4R8CA 3OE7G 3OMNB 4WFFA 3ZHRA 3D3IA 3K79A 4PDVA 1CEZA 5B1OA 1JJ2U 1YF2A 4EFBA 1T5EA 2Q0OC 4WFAV 1BE3H 2EILC 3QVNA 1VQMV 3E8HA 4QE7A 4U7NA 1QBZA 1Y76B 2BOCC 3A0BZ 4UCVA 4X66B 3DXRA 3P32A 1ZL8A 2ARHA 2GSMB 2PF4E 4HAMA 3CRQA 5LHHA 5HFLA 2UXCB 4IHJA 4CS2A 2Y69B 4GKJO 4LR3A 3I56V 4QE9A 3CRRA 1HR0B 1K5QA 1ZLZA 2YDEA 2C2AA 4PDMA 3N2KB 3P3PA 4DV1B 4JI4B 3JAWB 4E4EA 1V55B 1VQPV 4UB8Z 1XHZA 4CS4A 4B3MB 2WSSG 3P30A 4O2BA 1HNWO 2JEXA 3ZMVA 2XUMA 4I0XB 1H2KA 1AVMA 5KA5A 1WN7A 2Y48A 1VP7A 3G4SV 4J9ZB 3IC7A 3M8AA 3APOA 3K08A 1PNMA 4JYCA 4CC6A 4B7EA 3WG7B 4GX1A 3K04A 1W59A 3APQA 4BR6A 2ZCEA 4DV2B 1YSCA 1AROP 2Q5ZA 2HHHO 1A32A 1DTOA 4JI8B 2DW4A 1EN5A 1YJWV 1V55C 1SQBH 2CDYA 4MVRA 2WPDG 4PA9A 4KL1A 3L70H 4ZKIA 1JA8A 2VQEB 3OGCC 2BE3A 4JAVA 2Q9LA 4LC1A 5BY1A 3OFNG 3EHBB 4X64B 3WG7C 2UU9B 3K0GA 4MVUA 1F7YA 3ETEA 1B04A 2PGGA 3TXSA 2Q0AA 4TV9B 5HFMA 4NVPA 2B1IA 1VMGA 1R3IC 4FFBA 4BIUA 2UUAB 2KG7A 1FXKA 2GTAA 1F4MA 5CA0A 4DV6O 3H9VA 3O9OA 1FKAO 5KHIA 4LWSB 3ZRSA 3SJAC 1XNQO 2FL4A 1R1BA 4OGQB 3VQXA 3T1YB 4NXMB 2BSKB 1O9HA 4N21A 4FLTA 2E76B 3RYFB 2W0FC 1J95A 2ZE5A 4JASA 1GN4A 4O4HB 4AILC 1TVKB 2JJ2G 1N4CA 4O4JA 3ZS8C 3JSNA 2ITDC 3BHPA 1H8HG 4QPKA 5KHJA 3SYCA 1Q6HA 3JALB 5KMGB 1AILA 2DWDC 1BCCH 1SKVA 4DV0O 2LO1A 1JQ0A 2H3OA 3RYFA 4NXNO 5CBFA 2DE0X 1XMOB 3SPIA 2DN9A 1VEWA 5LBQA 3CCMV 3L75H 1TVKA 1YTFD 2ZT9B 4ZHQB 2F4VB 1KMIZ 1HWYA 3FB7C 4AHCA 3JALA 5KMGA 5L3BA 3CS5A 4OX9B 1NVPD 3ZEDA 1M5IA 1WLEA 1LUWA 2P7TC 3B4SA 2JRIA 4UCUA 2E5LO 1IXBA 3FAVB 2UXBB 4I9QA 1OZ0A 4FJCC 1JMKC 2EBOA 3CHXA 1AP5A 4ZHQA 1Z5VA 4X1YA 2P90A 4KFMA 3OEEG 3WB2A 3AK3A 1P7GA 3AG2B 1HNXB 3I5DA 3UKMA 2DYSB 1VARA 3C3TA 4B3SB 3LSQA 2OWOA 1Q90D 1QU7A 5BR8B 3MD0A 3A0HZ 4LFCO 3KCXA 4HNAA 1FJGB 5JJJB 4JYAO 2EX3A 3OUSA 2FMLA 4JI3O 3CC7V 1IBMO 3SJCC 2LJ2A 1MG1A 1K5SA 2AHYA 2Z3YA 5IYBO 5LGUA 1K97A 4FLXA 1N0NA 4FLUA 1WAZA 5L3CA 1IBKB 1Y74B 3EXAA 2WLIA 3ZBHA 1P49A 1JPXA 5EYPA 5B66Z 3OW2U 5IE9A 1VF6C 4NB5A 4IT5A 5LXTA 4GKKB 1X59A 3AG2C 4H13B 3T1HB 4TUYB 3VOUA 2HFEC 5LYJB 2DYSC 4PDRA 4NYKA 2D3OW 4DV4B 4B3RB 2QSAA 4DRXA 5IYDO 1VF5B 2LGQA 5KX5B 2YIDA 5KUKA 4X1IB 1BQZA 5LMNB 4NTYA 2EINB 1XL4A 3WFVA 4TV8B 1QLNA 4J10A 4QNHB 3UCSC 2IH3C 4YY3O 2VQFB 1UPGA 3UT5B 3TXQA 3K5MA 3U0ZA 4KUMA 1RP3B 2F43G 3K59A 3J81N 3ASOB 3BABA 1KQSU 2OCHA 1R3KC 4DR7B 4MW3A 1N33O 4OPAA 2P5OA 2XT9A 4DUYO 4TT3G 2A9HA 3ZHTA 2CK3G 4R6ZA 3CXHF 3G67A 3AG3B 2YEVA 3CPWU 1XNRO 1PPJH 2KB1A 3GB7C 4UVCA 2RQ6A 2QWQB 1DLBA 2EINC 2E74B 3BCCH 3HKCB 4LF6O 2K9PA 1J5EB 3P3NA 4JV5B 2QWNB 4ZI7B 5KA6A 4L8JA 2EIJB 1KECA 1Y67A 1SZXA 3C3SA 3CEIA 3I55V 3ZMSA 4MVZA 2ZE6A 2BOBC 3ASOC 4K0KO 2VQEO 4XDJA 2UUCO 1P4RA 4LBEC 4YIOA 3HKCA 4ZBMA 2WLLB 2ETNA 2GV9A 5L3EA 1N8RW 4XBFA 4ZI7A 5D5QA 3AG3C 1URFA 1Q81W 4UCRA 3HKEB 1OCOC 1AR4A 2EZPA 1E1RG 2AZ0A 3ASNC 1R3LC 4LFAB 1M56B 4DK1A 4D7SA 1K3EA 1GTOA 3RYCA 2JK5C 4ZOLA 4OPHA 4YIPA 2EIJC 4UVAA 3T1YO 2A3QA 1TUEB 1H2SB 1PM9A 1AP6A 4I55B 4WCEV 4YJ3A 4X20A 1SERA 2HJDA 5IY5B 4WBNA 5EBLC 1V9PA 4R50A 2YICA 4MSWC 4PA4A 5C8YA 3SYOA 2DQ3A 4NR1A 4X65B 3FB6C 3KKYA 4JI0B 1K4CC 3CJHB 4JF3A 2EJRA 3JD0A 2IJIA 1QCEA 1CXZB 4LH7A 4DR1B 3LSUA 2V4DA 2H94A 1XQ8A 2YXYA 4FLZA 1N32O 3Q4HB 5FPRA 1K9MW 3E8FA 3J80N 5DEDA 2UXDB 1CP9A 3ABLC 3CRCA 1WPBA 1PV0A 4YHHO 3EVKA 3CJHA 4DR5O 2F4VO 2P6JA 1EBOA 5JJNB 2ZIMA 4MVQA 1OCRB 2RJZA 5LOVB 4B08A 4JI2B 2W6JG 1WPXA 3OUFA 3RBZA 2ZR3A 4LNUB 1VQ6V 4HBNA 1R6TA 3GWOA 5FLXN 4DR3B 5AG2A 3W7WA 5EBMC 4Z1VA 4F6RB 1NH2B 5A2QN 2WLHA 3QNEA 1L1FA 5BMVB 1AI4A 2IJHA 4DR2O 3LUTB 2LGWA 4CH5A 1ZSPA 1N36B 1DGSA 5EIBC 2PZSA 4LH6A 2HKOA 1IBLB 5ITZB 4F6RA 1AR5A 5JWPA 1Q43A 2YXHA 4LF7B 1KKDA 1GAXA 1OCRC 2ODMA 1EZVH 3L9DA 2ATKC 1KKCA 2GTSA 3K06A 3QF7A 3WU2Z 2Y0PA 4UFZA 5FNVA 2GBOA 1E1QG 1F4NA 2XAHA 4UCTA 1QNMA 1K4DC 2B9ZA 2H8PC 3C90A 3RYIB 4FM2A 2MK3A 2X6BA 2ZINA 3CE2A 3J7AU 1M90W 4LF5O 1S0VA 2UUBO 3RVZA 3SDLA 4DV4O 5GONA 2JGUA 2X6AA 3QTCA 3S3XA 4W4LA 1MOFA 5IJ9A 1Y66A 3ML0A 3STZC 4X89A 3K5NA 2VQFO 4DV3O 2WAMA 5IJ0B 3ZHVA 4H37A 4JI1B 4DW1A 2HEPA 4JI5O 3VQVA 4H0LB 4I4TB 5B1AB 4DV5O 1I0HA 2RCVA 4MS2A 4MTFA 3ETDA 1Y76A 1M4UA 2YSUB 1WB8A 2DYRB 4FIPC 3BY6A 4G28B 5CB4B 2QA4V 1KU9A 3L73H 5KAFZ 4MW8A 4LF9B 5IJ0A 2HVJC 1YXBA 3SYQA 3T4DA 1SQQH 1SQGA 1O9GA 2MW2B 4PD4F 4ZIBA 4I50B 1S77D 4D6TH 3ZHSA 4LF8O 5B3SB 3N2KA 4JTCB 3JAWA 2L35A 3R66A 5CB4A 4JAUA 3AEIA 2Y69C 2IW5A 1H38A 4FPPA 1COWG 4IIJB 3DSQA 1BHAA 2ZXWB 4I0XA 2Y0IA 1HNZO 3JAMN 4F4LA 1MA1A 1GN3A 5H6QA 4U7OA 1P7BA 1VQOV 3AK1A 4J11A 3L74H 4EB6B 3THOA 1XMQO 1B6QA 1SF9A 2FB5A 2PUSA 3LSSA 2CTRA 4J7JA 4JGSA 2R9IA 3B8MA 1GN2A 1YTFB 4FZ0A 2QM7A 1QVFU 4LP8A 3F5WC 4WFHA 5B3SC 2XNDG 4PI0A 1LR1A 4KXRA 1L0LH 3VQWA 1TA8A 4GX5A 1IXMA 1NVPB 1SZTA 3BEHA 4GT1A 2LP7A 2EZOA 1YJ9V 3K9SA 2ZXWC 2N04A 4TOIA 1Q6UA 3OTFA 1US6A 2ILMA 2ZQMA 5CN0A 5JH7B 4QJFB 3TK1A 1AI7A 1X4TA 3E83A 4X62O 4B3TO 4JPRA 1MZEA 4DW0A 4DR6B 1N34B 4YXWG 4X1KB 2DOSA 2FYUH 3W7SA 5J2TB 3JCUZ 4JI0O 4TV9A 3OMAB 4EEQA 5JQGB 5EZYB 2G38A 5JH7A 3W7UA 4O2AB 4DXWA 4MTGA 2EJ7A 4NKGB 1OCCB 2A06H 5LMUB 4DK0A 5IYCO 5TISZ 3E89A 1SQPH 1XI1A 5K1PA 2F23A 4LWSA 4X1KA 2LFSA 5J9PC 1Q8IA 3KG2A 1D5NA 4UV8A 1F23A 2BSKA 1SQVH 4MTXA 5EZYA 2IJJA 1BL8A 2GHYA 2AHZA 5LL6Y 4DV7B 3FKSG 1UJWB 1MABG 2AXTZ 4O2AA 2V1DA 2JEUA 4CZZA 3G71V 2QM8A 4O4HA 1XEQA 4KHPB 1LUVA 2FKXA 2QWPB 1RPRA 3LNMB 2YIBA 1K34A 1GH6A 1Q6IA 1I7FA 1M93A 1XHXA 2BCCH 2P22C 4UVBA 1XUQA 1YITV 3QO8A 4P9OA 1W0KG 2RDCA 5B1BB 4X88A 5DM6V 4D7TA 3UQ8A 3D8CA 2JJ1G 3TJTA 1ZX3A 1R6NA 1RPOA 3FAVA 5B1NA 2BTQB 3A0RA 3JD1A 4DUZO 1VF6A 1IURA 4G2KA 3ZJZA 5KHHA 1WJZA 4JI6B 1KP2A 5KAIZ 3H1JH 4XDLA 1NI8A 3H1KH 1NS1A 3K03A 2QWOB 3K58A 1SRYA 4CS3A 3ZMZA 1R73A 2WWWA 2WLKA 4IGGA 1NTZH 1VQ4V 4J42A 2BTOA 3LDEA 1EN6A 4P9PA 3CCRV 2QTOA 4KP4A 1G6UA 5B1BC 4X66O 1QR9A 2XTAA 3B2EE 3E8GA 2JS3A 1HP8A 1Y74A 5H5NA 2UXCO 1JCHA 1VQKV 2WLJA 5GTHZ 1JR9A 1OCZB 1U97A 3ZRVA 2E3CA 3HPLC 1ZTEA 2DMXA 5H2FZ 3X2QB 1SC5B 4GCZA 1GM7A 1HR0O 2XOKG 3MDSA 4TUYA 3N27A 2AZ2A 5LYJA 1VF7A 3IAYA 4DV1O 4JI4O 4RWUA 2M6YA 5JCOA 2HR3A 2P4KA 2EIMB 1YVWA 5KX5A 4CH3A 4B3MO 1WP7A 3RYHB 4X1IA 1VIBA 5GTIZ 2QTSA 4BAYA 1PP9H 3IC9A 3U11A 4TV8A 3M99B 1M1KW 4PDLA 2W6IG 2Q67A 4GKJB 3UT5A 3JD4A 1JJOA 4GUNA 3AG4B 3OEHG 3OM3B 2FTKA 5JCOC 4K8ZA 5DECA 1OCZC 4QIWF 3CXCU 4O4LB 3ETGA 3JAKB 3RVYA 1AJNA 3X2QC 1XILA 4DV2O 1GMGA 3JD2A 1H8EG 1H2NA 2R9RB 3TCUA 1JX9A 2OCCB 3ZN1A 2YI9A 2CGNA 3JYCA 4JI8O 2B1GA 4ABMA 3SR2C 1HNWB 2YI8A 4H44B 1AB3A 2EIMC 2LW1A 5DN6G 2XAFA 4IYHA 4I7ZB 1K92A 4O4LA 2LQTA 2Q4PA 5LGTA 5LP6B 3R65A 2WA4A 4GX2A 3DC5A 4K35A 1KP3A 3AG4C 3FB8C 4Z2WA 4X64O 2UU9O 4BIOA 4QPJA 2CH7B 3JCZA 1WA8B 2JDIG 2F66C 4CC5A 2HHHB 2HJFC 1AJPA 4K3AA 1SA0B 2OT5A 2UUAO 2ZDIA 1EFRG 4ICGA 1MSDA 2OCCC 1Q82W 2WLLA 2CGOA 1MSWD 3T2MA 2ZKOA 2NNUA 2CH7A 5BZBA 1BSMA 1WB7A 2CAZC 2M7WA 4NXMO 2PY5A 1SA0A 3HKEA 3LNNA 5JVDB 2ZDIC 2Z0AA 1XDCA 1SS3A 3F7YC
chains in the Genus database with same CATH topology
1N4CA 2QWRB 1IURA 3APOA 2YS8A 2CTPA 2CUGA 1XBLA 2YUAA 1WJZA 2Y4TA 1GH6A 3UCSC 3BVOA 2PF4E 2CTRA 2QWNB 3AG7A 1FAFA 2LO1A 2DMXA 2N04A 3APQA 4RWUA 2KQXA 2N05A 2CTQA 2QSAA 2M6YA 1NZ6A 2LGWA 2Y4UA 2QWOB 3UO2A 2DN9A 4J7ZA 2EJ7A 3UO3A 1FPOA 2CTWA 2L6LA 2QWQB 1BQ0A 2GUZA 2OCHA 1BQZA 1HDJA 4J80A 2GUZB 4IT5A 2QWPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4C A;  2QWR B;  1IUR A;  3APO A;  2YS8 A;  2CTP A;  2CUG A;  1XBL A;  2YUA A;  1WJZ A;  2Y4T A;  1GH6 A;  3UCS C;  3BVO A;  2PF4 E;  2CTR A;  2QWN B;  3AG7 A;  1FAF A;  2LO1 A;  2DMX A;  2N04 A;  3APQ A;  4RWU A;  2KQX A;  2N05 A;  2CTQ A;  2QSA A;  2M6Y A;  1NZ6 A;  2LGW A;  2Y4U A;  2QWO B;  3UO2 A;  2DN9 A;  4J7Z A;  2EJ7 A;  3UO3 A;  1FPO A;  2CTW A;  2L6L A;  2QWQ B;  1BQ0 A;  2GUZ A;  2OCH A;  1BQZ A;  1HDJ A;  4J80 A;  2GUZ B;  4IT5 A;  2QWP B; 
#chains in the Genus database with same CATH topology
 1OJH A;  2QKC A;  1LNQ A;  4JAA A;  1EM1 A;  3RN4 A;  4TQF A;  2E75 B;  4J9Y B;  2XAG A;  2P4V A;  1QVG U;  1NBM G;  2NR5 A;  3CCS V;  1G8M A;  4PA7 A;  2R70 A;  4DV6 B;  5KHK A;  5JVD A;  3NXS A;  1N0J A;  4I55 A;  3SPG A;  3H1H H;  3CCL V;  1XMO O;  1M56 C;  4RO2 A;  4C7U A;  1PL4 A;  4LFB B;  4FFK A;  2PI5 A;  1XNQ B;  2OYQ A;  4Q20 A;  2KKW A;  1GN6 A;  5IT9 N;  3CP1 A;  1KB9 F;  5KHG A;  4K8X A;  2VWK A;  2JIZ G;  2F95 B;  4NTW A;  1I5Y A;  2WLN A;  1AI5 A;  1BT8 A;  1MMM A;  4OX9 O;  5L3F A;  1QR8 A;  1FD9 A;  3Q4H A;  3K9A A;  4P2Z A;  4NTX A;  3CCV V;  5IY5 C;  5IWA B;  1PNL A;  2ZNI A;  2ZR2 A;  2OTL V;  3CME V;  1H2G A;  2UXB O;  1NTK H;  3IGA C;  4DV0 B;  2OTJ V;  4NXN B;  4GZR B;  3JD3 A;  3S3W A;  1HNX O;  2RN9 A;  5LOV A;  3AK2 A;  4B3S O;  3HKB B;  4LNU A;  4UV9 A;  1B3Q A;  4WFB V;  4IYI A;  2Q6A A;  5BR8 O;  1M9N A;  4UB6 Z;  3CRA A;  5JJE B;  2JGD B;  2QE7 G;  3G80 A;  3RW0 A;  4PA6 A;  4FLV A;  1FJG O;  2NLJ C;  4X9Q A;  4JI6 O;  1FAF A;  1ZAU A;  4EKW A;  5BMV A;  2GDS A;  3ZMT A;  1E79 G;  3G6E V;  2E5L B;  1NR1 A;  1IBK O;  2X0L A;  1RM1 B;  3QO5 A;  2GUZ B;  3EFF K;  3ZHQ A;  3D3Q A;  3OT7 A;  2N74 A;  3JAR B;  5ITZ A;  2IJK A;  4GKK O;  1TUB B;  3FYI B;  3SPJ A;  3T1H O;  3MAQ A;  4MTO A;  4X8A A;  1RFY A;  1WNS A;  3SGI A;  4LFC B;  1I5X A;  3ETQ A;  4GLX A;  4JYA B;  4B3R O;  1S5J A;  4JI3 B;  1SQF A;  1IBM B;  2GUZ A;  4J80 A;  4HYO A;  4J7K A;  3HR0 A;  3RYI A;  3HB3 B;  5LMN O;  5EK0 A;  3DXR B;  1TUB A;  3H01 A;  4HZ3 A;  1VQ8 V;  4XDK A;  4FM0 A;  3CD6 V;  3UM7 A;  1ZL8 B;  4DR4 B;  1YHQ V;  5EIB D;  1SET A;  4IHJ B;  2EIK B;  3QG5 A;  4WF9 V;  2ADQ B;  1THZ A;  2PYJ A;  1RM1 C;  3ICX A;  4PEL A;  3OR6 C;  2A79 B;  2JS5 A;  1IDS A;  2LW7 A;  3DC6 A;  3FD9 A;  5EBW C;  4DR7 O;  4FK5 C;  1R6K A;  4LF4 B;  3VBB A;  2YC0 A;  2QGN A;  2Z5U A;  4O2B B;  3SJQ C;  4F6E A;  1KUQ A;  1NH2 D;  4PI2 A;  5CBH A;  4J7Z A;  2ZNJ A;  4I4T A;  5IDJ A;  4W4K A;  1JFF B;  1S3J A;  1YJN V;  3FYE B;  1BMF G;  4YY3 B;  1MZF A;  4AQY B;  1SES A;  4PA3 A;  1KBH A;  4JTD B;  1ZUQ A;  4FLY A;  1KD1 W;  2LFR A;  3BVO A;  3K57 A;  1J5E O;  2EIK C;  3BFR A;  4JV5 O;  3CSX A;  3FFQ A;  5B1A C;  1JFF A;  4I50 A;  3RGB A;  3ABK B;  3GWK C;  2XHB A;  1N33 B;  2DYR C;  2YUA A;  4JZ2 A;  4DUY B;  4BIZ A;  1KYO F;  3AG7 A;  3RT3 C;  2ZM6 B;  2WLM A;  1XNR B;  4RAI A;  2N05 A;  4IIJ A;  1BGY H;  4YJ2 B;  3MHH C;  3SPH A;  3CCJ V;  1S5H C;  4LF6 B;  1NQT A;  4L87 A;  1XOU A;  1FXV A;  3JAS B;  4EB6 A;  3CB2 A;  4LFA O;  1GRJ A;  2AGA A;  3B8N A;  5BXZ A;  4K0K B;  4FFB B;  1XL6 A;  4YJ2 A;  2UUC B;  2UXX A;  4BW5 A;  3IFX A;  1PKX A;  1NU1 H;  1FXK B;  2KG7 B;  5CA0 B;  1PNK A;  2ITC C;  3ABK C;  3AG1 B;  3JAS A;  1H2L A;  2OIG A;  2XAQ A;  1GKF A;  4AI8 A;  4N23 A;  1S72 V;  1VQ5 V;  3BAA A;  3ZRW B;  4X65 O;  1AI6 A;  4UXN A;  4OXS A;  4IL6 Z;  1FFX B;  1KC8 W;  3ZCC A;  3G6B A;  3ZRX A;  1YIJ V;  3DGE A;  4UUJ C;  4DR1 O;  5E1A C;  2CTW A;  4Z1M G;  2VRZ A;  2UXD O;  4O4J B;  1W2B U;  3F7V C;  4LFB O;  3ZRW A;  4WFG A;  5J2T A;  4G27 B;  2OIE A;  1SQX H;  3JSL A;  1NT2 B;  2Q7H A;  1FFX A;  5JQG A;  1ZWI C;  3DTU B;  4DYL A;  1FXK C;  2Y4U A;  3A2F A;  5H9C A;  3AG1 C;  4MVO A;  4A5U B;  4JI2 O;  5IWA O;  1I94 B;  1S76 D;  3CCU V;  2IBZ H;  3OR7 C;  1QHT A;  4DR3 O;  2O57 A;  1N32 B;  3E2E A;  1JVM A;  5F2V O;  1OCC C;  4B7K A;  4YHH B;  1GM9 A;  2YXL A;  4PHZ A;  3SYA A;  2P67 A;  4Q6G A;  4DR5 B;  1N36 O;  4I9W A;  3OTO B;  3OD4 A;  3OGI B;  4FLW A;  1WP8 A;  4X1Y B;  1VQ9 V;  1TGO A;  3H1I H;  4JYY A;  1IBL O;  4LF7 O;  1VQ7 V;  2D2C B;  4WFE A;  3T4Z A;  2Q7G A;  2X7R B;  3W7T A;  1G4Y B;  1K8A W;  4JI7 B;  2Q69 A;  4HNA B;  4FZ1 A;  2VWJ A;  2CUG A;  1Q5O A;  1RSO B;  1NR7 A;  2RMK B;  1AR1 B;  4DR2 B;  2AW9 A;  2P06 A;  3VQY A;  5CA1 B;  3H1L H;  5CBG A;  2NN4 A;  1S5L Z;  2WLI B;  1I08 A;  3M7M X;  2QR4 A;  3SJB C;  5EYP B;  2A7W A;  1F51 A;  3JAT B;  1Q86 W;  1FFT B;  2BTQ A;  5B5E Z;  5LXT B;  4EFE A;  4GX0 A;  3OMI B;  3E22 B;  1RSO A;  4MVM A;  3ZMU A;  2QKS A;  4TWK A;  5CA1 A;  1PL0 A;  2QEX V;  4DR4 O;  2YIB D;  4DRX B;  2Q73 A;  4UCS A;  1U96 A;  1FS0 G;  3JAT A;  2DWE C;  5C93 A;  1QQC A;  4JI1 O;  1P84 F;  3BPZ A;  5LA6 B;  3E22 A;  1DK1 A;  3CRM A;  5L3G A;  4U3F H;  4LF5 B;  5FL7 G;  2UUB B;  5K1X A;  1IZ3 A;  3CC2 V;  2F93 B;  4LF4 O;  5KLV H;  3CCQ V;  4QGP A;  4LF9 O;  1FYJ A;  5LHG A;  3B77 A;  1K33 A;  5D5P A;  2WA3 A;  1YDX A;  1B06 A;  2EUL A;  3TET A;  5LA6 A;  3ZHU A;  4JTA B;  1M57 B;  4BW9 A;  1YEW A;  1UFI A;  2Y4T A;  4DV3 B;  3ZN0 A;  4AQY O;  3KZI Z;  5LGN A;  1GO3 F;  4I5S A;  1ORQ C;  2ZIO A;  4JI5 B;  1V54 B;  3D36 A;  5J2U B;  2YEV B;  1K7D A;  3B09 A;  4CBC A;  4DV5 B;  4RQE A;  3BA8 A;  3RYH A;  5IYZ B;  3GVM A;  1FPO A;  2HLD G;  1IVS A;  1VQL V;  4P30 A;  3LDD A;  1HW7 A;  3RWR D;  2YS8 A;  2Q7E A;  2IH1 C;  1BZK A;  2B5U A;  1EZJ A;  3CMA V;  3CWB H;  2IU0 A;  3K5O A;  2ZM6 O;  3D36 C;  5J2U A;  2CE4 A;  2HVK C;  2QM4 A;  3CYO A;  3JAK A;  5IYZ A;  4LF8 B;  1L0N H;  1NTM H;  1GK9 A;  1OCO B;  1M57 C;  2ZD9 A;  4MT8 A;  4PJ0 Z;  2Q8V A;  3ASN B;  1EN4 A;  1D5A A;  1DF4 A;  1OHH G;  1BS3 A;  1JOY A;  4BWA A;  1V54 C;  1HNZ B;  2YIA A;  4UCO A;  3STL C;  1YZB A;  3BRC A;  2R72 A;  5KUM A;  3E8B A;  1XMQ B;  4GYC B;  1MNG A;  3CC4 V;  3ZIA G;  4CH6 A;  5L3D A;  4O4I B;  5LP6 A;  4DR6 O;  3RYC B;  3A8T A;  3CCE V;  4ZOL B;  2HG5 C;  1N34 O;  5H6R A;  5GW7 A;  1XRE A;  1WA8 A;  1QLE B;  3FB5 C;  1NZ6 A;  4RUF A;  3RFR A;  4JZG A;  4J41 A;  3PJS K;  3UO3 A;  4LCU C;  1Q7Y W;  1BQ0 A;  4YJ3 B;  4X20 B;  2UXN A;  1W0J G;  2R9A A;  3CX5 F;  4WBN B;  3ABL B;  4O4I A;  5LP6 C;  5LMU O;  5C8Y B;  3WB0 A;  1XBL A;  1Y4M A;  1NKD A;  2DQ0 A;  2RNB A;  3U10 A;  2A0L A;  3SYP A;  4CH4 A;  5EC1 C;  1G1X B;  1VQN V;  1Z2G A;  1Y6X A;  2HP8 A;  2KQX A;  3NR7 A;  3ABU A;  4FVM A;  5CMU A;  4X62 B;  4TSF G;  4B3T B;  2PTM A;  4DV7 O;  5E79 Z;  3KCY A;  3K0D A;  4H33 A;  3QO7 A;  1NJI W;  2PI4 A;  1Q3E A;  5FPO A;  4KHP O;  1OV9 A;  1FXH A;  3ABT A;  1I94 O;  2QDO A;  1QLE C;  3IJ4 A;  1ROP A;  3E35 A;  2VS0 A;  2ZE7 A;  4JYB A;  2XAS A;  1D2D A;  3WB1 A;  2KSD A;  2ADP A;  5LHI A;  3E86 A;  4TQD A;  1IX9 A;  3OTO O;  1CPY A;  3W7X A;  4FM1 A;  4MVS A;  2PYL A;  5A9G A;  1H2M A;  4RUE A;  3K3W A;  1L8D A;  2V7Q G;  2IM9 A;  3F5T A;  3ABM B;  2F1M A;  2QKA A;  4JI7 O;  3HKD B;  4FMT A;  3LDC A;  1YI2 V;  1GM8 A;  2XAJ A;  1K73 W;  1PD3 A;  3SPC A;  3B40 A;  2DJV A;  1BHB A;  3TGU H;  2X6C A;  2K1E A;  3FX7 A;  5EC2 C;  3UO2 A;  4RQF A;  3PN1 A;  3T1C A;  5FNV B;  3HKB A;  2L6L A;  3BA9 A;  2JGD A;  1TAE A;  2QWR B;  3HKD A;  2EIL B;  2IU3 A;  4U3J B;  2JVD A;  4E2L A;  3N2G B;  5CA3 A;  3MHS C;  3K5L A;  2Q68 A;  2ZE8 A;  4R7C A;  3L71 H;  3ZX6 A;  1YCI A;  1R3J C;  4DO2 A;  2QJ1 A;  2CTQ A;  3L72 H;  3ABM C;  5GON B;  1ENV A;  4DUZ B;  1HDJ A;  4U3J A;  3OAA G;  4ASU G;  1AJQ A;  1Z5W A;  5IJ9 B;  2CTP A;  3O65 A;  3JAR A;  3N2G A;  4PV1 B;  1DF5 A;  2W0X A;  4R8C A;  3OE7 G;  3OMN B;  4WFF A;  3ZHR A;  3D3I A;  3K79 A;  4PDV A;  1CEZ A;  5B1O A;  1JJ2 U;  1YF2 A;  4EFB A;  1T5E A;  2Q0O C;  4WFA V;  1BE3 H;  2EIL C;  3QVN A;  1VQM V;  3E8H A;  4QE7 A;  4U7N A;  1QBZ A;  1Y76 B;  2BOC C;  3A0B Z;  4UCV A;  4X66 B;  3DXR A;  3P32 A;  1ZL8 A;  2ARH A;  2GSM B;  2PF4 E;  4HAM A;  3CRQ A;  5LHH A;  5HFL A;  2UXC B;  4IHJ A;  4CS2 A;  2Y69 B;  4GKJ O;  4LR3 A;  3I56 V;  4QE9 A;  3CRR A;  1HR0 B;  1K5Q A;  1ZLZ A;  2YDE A;  2C2A A;  4PDM A;  3N2K B;  3P3P A;  4DV1 B;  4JI4 B;  3JAW B;  4E4E A;  1V55 B;  1VQP V;  4UB8 Z;  1XHZ A;  4CS4 A;  4B3M B;  2WSS G;  3P30 A;  4O2B A;  1HNW O;  2JEX A;  3ZMV A;  2XUM A;  4I0X B;  1H2K A;  1AVM A;  5KA5 A;  1WN7 A;  2Y48 A;  1VP7 A;  3G4S V;  4J9Z B;  3IC7 A;  3M8A A;  3APO A;  3K08 A;  1PNM A;  4JYC A;  4CC6 A;  4B7E A;  3WG7 B;  4GX1 A;  3K04 A;  1W59 A;  3APQ A;  4BR6 A;  2ZCE A;  4DV2 B;  1YSC A;  1ARO P;  2Q5Z A;  2HHH O;  1A32 A;  1DTO A;  4JI8 B;  2DW4 A;  1EN5 A;  1YJW V;  1V55 C;  1SQB H;  2CDY A;  4MVR A;  2WPD G;  4PA9 A;  4KL1 A;  3L70 H;  4ZKI A;  1JA8 A;  2VQE B;  3OGC C;  2BE3 A;  4JAV A;  2Q9L A;  4LC1 A;  5BY1 A;  3OFN G;  3EHB B;  4X64 B;  3WG7 C;  2UU9 B;  3K0G A;  4MVU A;  1F7Y A;  3ETE A;  1B04 A;  2PGG A;  3TXS A;  2Q0A A;  4TV9 B;  5HFM A;  4NVP A;  2B1I A;  1VMG A;  1R3I C;  4FFB A;  4BIU A;  2UUA B;  2KG7 A;  1FXK A;  2GTA A;  1F4M A;  5CA0 A;  4DV6 O;  3H9V A;  3O9O A;  1FKA O;  5KHI A;  4LWS B;  3ZRS A;  3SJA C;  1XNQ O;  2FL4 A;  1R1B A;  4OGQ B;  3VQX A;  3T1Y B;  4NXM B;  2BSK B;  1O9H A;  4N21 A;  4FLT A;  2E76 B;  3RYF B;  2W0F C;  1J95 A;  2ZE5 A;  4JAS A;  1GN4 A;  4O4H B;  4AIL C;  1TVK B;  2JJ2 G;  1N4C A;  4O4J A;  3ZS8 C;  3JSN A;  2ITD C;  3BHP A;  1H8H G;  4QPK A;  5KHJ A;  3SYC A;  1Q6H A;  3JAL B;  5KMG B;  1AIL A;  2DWD C;  1BCC H;  1SKV A;  4DV0 O;  2LO1 A;  1JQ0 A;  2H3O A;  3RYF A;  4NXN O;  5CBF A;  2DE0 X;  1XMO B;  3SPI A;  2DN9 A;  1VEW A;  5LBQ A;  3CCM V;  3L75 H;  1TVK A;  1YTF D;  2ZT9 B;  4ZHQ B;  2F4V B;  1KMI Z;  1HWY A;  3FB7 C;  4AHC A;  3JAL A;  5KMG A;  5L3B A;  3CS5 A;  4OX9 B;  1NVP D;  3ZED A;  1M5I A;  1WLE A;  1LUW A;  2P7T C;  3B4S A;  2JRI A;  4UCU A;  2E5L O;  1IXB A;  3FAV B;  2UXB B;  4I9Q A;  1OZ0 A;  4FJC C;  1JMK C;  2EBO A;  3CHX A;  1AP5 A;  4ZHQ A;  1Z5V A;  4X1Y A;  2P90 A;  4KFM A;  3OEE G;  3WB2 A;  3AK3 A;  1P7G A;  3AG2 B;  1HNX B;  3I5D A;  3UKM A;  2DYS B;  1VAR A;  3C3T A;  4B3S B;  3LSQ A;  2OWO A;  1Q90 D;  1QU7 A;  5BR8 B;  3MD0 A;  3A0H Z;  4LFC O;  3KCX A;  4HNA A;  1FJG B;  5JJJ B;  4JYA O;  2EX3 A;  3OUS A;  2FML A;  4JI3 O;  3CC7 V;  1IBM O;  3SJC C;  2LJ2 A;  1MG1 A;  1K5S A;  2AHY A;  2Z3Y A;  5IYB O;  5LGU A;  1K97 A;  4FLX A;  1N0N A;  4FLU A;  1WAZ A;  5L3C A;  1IBK B;  1Y74 B;  3EXA A;  2WLI A;  3ZBH A;  1P49 A;  1JPX A;  5EYP A;  5B66 Z;  3OW2 U;  5IE9 A;  1VF6 C;  4NB5 A;  4IT5 A;  5LXT A;  4GKK B;  1X59 A;  3AG2 C;  4H13 B;  3T1H B;  4TUY B;  3VOU A;  2HFE C;  5LYJ B;  2DYS C;  4PDR A;  4NYK A;  2D3O W;  4DV4 B;  4B3R B;  2QSA A;  4DRX A;  5IYD O;  1VF5 B;  2LGQ A;  5KX5 B;  2YID A;  5KUK A;  4X1I B;  1BQZ A;  5LMN B;  4NTY A;  2EIN B;  1XL4 A;  3WFV A;  4TV8 B;  1QLN A;  4J10 A;  4QNH B;  3UCS C;  2IH3 C;  4YY3 O;  2VQF B;  1UPG A;  3UT5 B;  3TXQ A;  3K5M A;  3U0Z A;  4KUM A;  1RP3 B;  2F43 G;  3K59 A;  3J81 N;  3ASO B;  3BAB A;  1KQS U;  2OCH A;  1R3K C;  4DR7 B;  4MW3 A;  1N33 O;  4OPA A;  2P5O A;  2XT9 A;  4DUY O;  4TT3 G;  2A9H A;  3ZHT A;  2CK3 G;  4R6Z A;  3CXH F;  3G67 A;  3AG3 B;  2YEV A;  3CPW U;  1XNR O;  1PPJ H;  2KB1 A;  3GB7 C;  4UVC A;  2RQ6 A;  2QWQ B;  1DLB A;  2EIN C;  2E74 B;  3BCC H;  3HKC B;  4LF6 O;  2K9P A;  1J5E B;  3P3N A;  4JV5 B;  2QWN B;  4ZI7 B;  5KA6 A;  4L8J A;  2EIJ B;  1KEC A;  1Y67 A;  1SZX A;  3C3S A;  3CEI A;  3I55 V;  3ZMS A;  4MVZ A;  2ZE6 A;  2BOB C;  3ASO C;  4K0K O;  2VQE O;  4XDJ A;  2UUC O;  1P4R A;  4LBE C;  4YIO A;  3HKC A;  4ZBM A;  2WLL B;  2ETN A;  2GV9 A;  5L3E A;  1N8R W;  4XBF A;  4ZI7 A;  5D5Q A;  3AG3 C;  1URF A;  1Q81 W;  4UCR A;  3HKE B;  1OCO C;  1AR4 A;  2EZP A;  1E1R G;  2AZ0 A;  3ASN C;  1R3L C;  4LFA B;  1M56 B;  4DK1 A;  4D7S A;  1K3E A;  1GTO A;  3RYC A;  2JK5 C;  4ZOL A;  4OPH A;  4YIP A;  2EIJ C;  4UVA A;  3T1Y O;  2A3Q A;  1TUE B;  1H2S B;  1PM9 A;  1AP6 A;  4I55 B;  4WCE V;  4YJ3 A;  4X20 A;  1SER A;  2HJD A;  5IY5 B;  4WBN A;  5EBL C;  1V9P A;  4R50 A;  2YIC A;  4MSW C;  4PA4 A;  5C8Y A;  3SYO A;  2DQ3 A;  4NR1 A;  4X65 B;  3FB6 C;  3KKY A;  4JI0 B;  1K4C C;  3CJH B;  4JF3 A;  2EJR A;  3JD0 A;  2IJI A;  1QCE A;  1CXZ B;  4LH7 A;  4DR1 B;  3LSU A;  2V4D A;  2H94 A;  1XQ8 A;  2YXY A;  4FLZ A;  1N32 O;  3Q4H B;  5FPR A;  1K9M W;  3E8F A;  3J80 N;  5DED A;  2UXD B;  1CP9 A;  3ABL C;  3CRC A;  1WPB A;  1PV0 A;  4YHH O;  3EVK A;  3CJH A;  4DR5 O;  2F4V O;  2P6J A;  1EBO A;  5JJN B;  2ZIM A;  4MVQ A;  1OCR B;  2RJZ A;  5LOV B;  4B08 A;  4JI2 B;  2W6J G;  1WPX A;  3OUF A;  3RBZ A;  2ZR3 A;  4LNU B;  1VQ6 V;  4HBN A;  1R6T A;  3GWO A;  5FLX N;  4DR3 B;  5AG2 A;  3W7W A;  5EBM C;  4Z1V A;  4F6R B;  1NH2 B;  5A2Q N;  2WLH A;  3QNE A;  1L1F A;  5BMV B;  1AI4 A;  2IJH A;  4DR2 O;  3LUT B;  2LGW A;  4CH5 A;  1ZSP A;  1N36 B;  1DGS A;  5EIB C;  2PZS A;  4LH6 A;  2HKO A;  1IBL B;  5ITZ B;  4F6R A;  1AR5 A;  5JWP A;  1Q43 A;  2YXH A;  4LF7 B;  1KKD A;  1GAX A;  1OCR C;  2ODM A;  1EZV H;  3L9D A;  2ATK C;  1KKC A;  2GTS A;  3K06 A;  3QF7 A;  3WU2 Z;  2Y0P A;  4UFZ A;  5FNV A;  2GBO A;  1E1Q G;  1F4N A;  2XAH A;  4UCT A;  1QNM A;  1K4D C;  2B9Z A;  2H8P C;  3C90 A;  3RYI B;  4FM2 A;  2MK3 A;  2X6B A;  2ZIN A;  3CE2 A;  3J7A U;  1M90 W;  4LF5 O;  1S0V A;  2UUB O;  3RVZ A;  3SDL A;  4DV4 O;  5GON A;  2JGU A;  2X6A A;  3QTC A;  3S3X A;  4W4L A;  1MOF A;  5IJ9 A;  1Y66 A;  3ML0 A;  3STZ C;  4X89 A;  3K5N A;  2VQF O;  4DV3 O;  2WAM A;  5IJ0 B;  3ZHV A;  4H37 A;  4JI1 B;  4DW1 A;  2HEP A;  4JI5 O;  3VQV A;  4H0L B;  4I4T B;  5B1A B;  4DV5 O;  1I0H A;  2RCV A;  4MS2 A;  4MTF A;  3ETD A;  1Y76 A;  1M4U A;  2YSU B;  1WB8 A;  2DYR B;  4FIP C;  3BY6 A;  4G28 B;  5CB4 B;  2QA4 V;  1KU9 A;  3L73 H;  5KAF Z;  4MW8 A;  4LF9 B;  5IJ0 A;  2HVJ C;  1YXB A;  3SYQ A;  3T4D A;  1SQQ H;  1SQG A;  1O9G A;  2MW2 B;  4PD4 F;  4ZIB A;  4I50 B;  1S77 D;  4D6T H;  3ZHS A;  4LF8 O;  5B3S B;  3N2K A;  4JTC B;  3JAW A;  2L35 A;  3R66 A;  5CB4 A;  4JAU A;  3AEI A;  2Y69 C;  2IW5 A;  1H38 A;  4FPP A;  1COW G;  4IIJ B;  3DSQ A;  1BHA A;  2ZXW B;  4I0X A;  2Y0I A;  1HNZ O;  3JAM N;  4F4L A;  1MA1 A;  1GN3 A;  5H6Q A;  4U7O A;  1P7B A;  1VQO V;  3AK1 A;  4J11 A;  3L74 H;  4EB6 B;  3THO A;  1XMQ O;  1B6Q A;  1SF9 A;  2FB5 A;  2PUS A;  3LSS A;  2CTR A;  4J7J A;  4JGS A;  2R9I A;  3B8M A;  1GN2 A;  1YTF B;  4FZ0 A;  2QM7 A;  1QVF U;  4LP8 A;  3F5W C;  4WFH A;  5B3S C;  2XND G;  4PI0 A;  1LR1 A;  4KXR A;  1L0L H;  3VQW A;  1TA8 A;  4GX5 A;  1IXM A;  1NVP B;  1SZT A;  3BEH A;  4GT1 A;  2LP7 A;  2EZO A;  1YJ9 V;  3K9S A;  2ZXW C;  2N04 A;  4TOI A;  1Q6U A;  3OTF A;  1US6 A;  2ILM A;  2ZQM A;  5CN0 A;  5JH7 B;  4QJF B;  3TK1 A;  1AI7 A;  1X4T A;  3E83 A;  4X62 O;  4B3T O;  4JPR A;  1MZE A;  4DW0 A;  4DR6 B;  1N34 B;  4YXW G;  4X1K B;  2DOS A;  2FYU H;  3W7S A;  5J2T B;  3JCU Z;  4JI0 O;  4TV9 A;  3OMA B;  4EEQ A;  5JQG B;  5EZY B;  2G38 A;  5JH7 A;  3W7U A;  4O2A B;  4DXW A;  4MTG A;  2EJ7 A;  4NKG B;  1OCC B;  2A06 H;  5LMU B;  4DK0 A;  5IYC O;  5TIS Z;  3E89 A;  1SQP H;  1XI1 A;  5K1P A;  2F23 A;  4LWS A;  4X1K A;  2LFS A;  5J9P C;  1Q8I A;  3KG2 A;  1D5N A;  4UV8 A;  1F23 A;  2BSK A;  1SQV H;  4MTX A;  5EZY A;  2IJJ A;  1BL8 A;  2GHY A;  2AHZ A;  5LL6 Y;  4DV7 B;  3FKS G;  1UJW B;  1MAB G;  2AXT Z;  4O2A A;  2V1D A;  2JEU A;  4CZZ A;  3G71 V;  2QM8 A;  4O4H A;  1XEQ A;  4KHP B;  1LUV A;  2FKX A;  2QWP B;  1RPR A;  3LNM B;  2YIB A;  1K34 A;  1GH6 A;  1Q6I A;  1I7F A;  1M93 A;  1XHX A;  2BCC H;  2P22 C;  4UVB A;  1XUQ A;  1YIT V;  3QO8 A;  4P9O A;  1W0K G;  2RDC A;  5B1B B;  4X88 A;  5DM6 V;  4D7T A;  3UQ8 A;  3D8C A;  2JJ1 G;  3TJT A;  1ZX3 A;  1R6N A;  1RPO A;  3FAV A;  5B1N A;  2BTQ B;  3A0R A;  3JD1 A;  4DUZ O;  1VF6 A;  1IUR A;  4G2K A;  3ZJZ A;  5KHH A;  1WJZ A;  4JI6 B;  1KP2 A;  5KAI Z;  3H1J H;  4XDL A;  1NI8 A;  3H1K H;  1NS1 A;  3K03 A;  2QWO B;  3K58 A;  1SRY A;  4CS3 A;  3ZMZ A;  1R73 A;  2WWW A;  2WLK A;  4IGG A;  1NTZ H;  1VQ4 V;  4J42 A;  2BTO A;  3LDE A;  1EN6 A;  4P9P A;  3CCR V;  2QTO A;  4KP4 A;  1G6U A;  5B1B C;  4X66 O;  1QR9 A;  2XTA A;  3B2E E;  3E8G A;  2JS3 A;  1HP8 A;  1Y74 A;  5H5N A;  2UXC O;  1JCH A;  1VQK V;  2WLJ A;  5GTH Z;  1JR9 A;  1OCZ B;  1U97 A;  3ZRV A;  2E3C A;  3HPL C;  1ZTE A;  2DMX A;  5H2F Z;  3X2Q B;  1SC5 B;  4GCZ A;  1GM7 A;  1HR0 O;  2XOK G;  3MDS A;  4TUY A;  3N27 A;  2AZ2 A;  5LYJ A;  1VF7 A;  3IAY A;  4DV1 O;  4JI4 O;  4RWU A;  2M6Y A;  5JCO A;  2HR3 A;  2P4K A;  2EIM B;  1YVW A;  5KX5 A;  4CH3 A;  4B3M O;  1WP7 A;  3RYH B;  4X1I A;  1VIB A;  5GTI Z;  2QTS A;  4BAY A;  1PP9 H;  3IC9 A;  3U11 A;  4TV8 A;  3M99 B;  1M1K W;  4PDL A;  2W6I G;  2Q67 A;  4GKJ B;  3UT5 A;  3JD4 A;  1JJO A;  4GUN A;  3AG4 B;  3OEH G;  3OM3 B;  2FTK A;  5JCO C;  4K8Z A;  5DEC A;  1OCZ C;  4QIW F;  3CXC U;  4O4L B;  3ETG A;  3JAK B;  3RVY A;  1AJN A;  3X2Q C;  1XIL A;  4DV2 O;  1GMG A;  3JD2 A;  1H8E G;  1H2N A;  2R9R B;  3TCU A;  1JX9 A;  2OCC B;  3ZN1 A;  2YI9 A;  2CGN A;  3JYC A;  4JI8 O;  2B1G A;  4ABM A;  3SR2 C;  1HNW B;  2YI8 A;  4H44 B;  1AB3 A;  2EIM C;  2LW1 A;  5DN6 G;  2XAF A;  4IYH A;  4I7Z B;  1K92 A;  4O4L A;  2LQT A;  2Q4P A;  5LGT A;  5LP6 B;  3R65 A;  2WA4 A;  4GX2 A;  3DC5 A;  4K35 A;  1KP3 A;  3AG4 C;  3FB8 C;  4Z2W A;  4X64 O;  2UU9 O;  4BIO A;  4QPJ A;  2CH7 B;  3JCZ A;  1WA8 B;  2JDI G;  2F66 C;  4CC5 A;  2HHH B;  2HJF C;  1AJP A;  4K3A A;  1SA0 B;  2OT5 A;  2UUA O;  2ZDI A;  1EFR G;  4ICG A;  1MSD A;  2OCC C;  1Q82 W;  2WLL A;  2CGO A;  1MSW D;  3T2M A;  2ZKO A;  2NNU A;  2CH7 A;  5BZB A;  1BSM A;  1WB7 A;  2CAZ C;  2M7W A;  4NXM O;  2PY5 A;  1SA0 A;  3HKE A;  3LNN A;  5JVD B;  2ZDI C;  2Z0A A;  1XDC A;  1SS3 A;  3F7Y C; 
#chains in the Genus database with same CATH homology
 1N4C A;  2QWR B;  1IUR A;  3APO A;  2YS8 A;  2CTP A;  2CUG A;  1XBL A;  2YUA A;  1WJZ A;  2Y4T A;  1GH6 A;  3UCS C;  3BVO A;  2PF4 E;  2CTR A;  2QWN B;  3AG7 A;  1FAF A;  2LO1 A;  2DMX A;  2N04 A;  3APQ A;  4RWU A;  2KQX A;  2N05 A;  2CTQ A;  2QSA A;  2M6Y A;  1NZ6 A;  2LGW A;  2Y4U A;  2QWO B;  3UO2 A;  2DN9 A;  4J7Z A;  2EJ7 A;  3UO3 A;  1FPO A;  2CTW A;  2L6L A;  2QWQ B;  1BQ0 A;  2GUZ A;  2OCH A;  1BQZ A;  1HDJ A;  4J80 A;  2GUZ B;  4IT5 A;  2QWP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...