2CUGA

Solution structure of the j domain of the pseudo dnaj protein, mouse hypothetical mkiaa0962
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNYDHYGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mKIAA0962 protein
publication title Solution structure of the J domain of the pseudo DnaJ protein, mouse hypothetical mKIAA0962
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2cugA01
2Y4TA 1BQZA 4RWUA 2LGWA 3APQA 2PF4E 2KQXA 2L6LA 1XBLA 1BQ0A 3UO2A 3BVOA 2QWOB 2QSAA 3APOA 1IURA 1N4CA 2YUAA 2DMXA 1FPOA 1NZ6A 2QWNB 2M6YA 2OCHA 2CUGA 4J80A 3AG7A 3UCSC 2EJ7A 2DN9A 2N05A 2QWPB 2CTRA 2YS8A 4J7ZA 2CTQA 2CTWA 4IT5A 3UO3A 2LO1A 1HDJA 1FAFA 2GUZB 1GH6A 1WJZA 2GUZA 2N04A 2QWQB 2QWRB 2Y4UA 2CTPA
chains in the Genus database with same CATH superfamily
3T4ZA 2OTLV 3ABMC 1BL8A 4MW8A 4LFBB 4MTOA 2B1GA 3APOA 5JJEB 2GV9A 4LBEC 2WLMA 3JSNA 3T4DA 1M90W 4DV6B 1SERA 3OM3B 1NKDA 1AI7A 3WU2Z 5LHHA 2QJ1A 2QTSA 3OUFA 5C8YB 4F4LA 1JMKC 3JCUZ 3K59A 2WLKA 4N23A 1XNQO 4PA3A 2FYUH 2QTOA 1WLEA 3R66A 2L6LA 1K97A 1L0LH 2P7TC 1KP2A 3ZRSA 3I55V 3HKDA 4HZ3A 2Z0AA 2F23A 4CH3A 2RDCA 1SQXH 5LOVB 2P67A 2F4VB 1KC8W 3OFNG 4X89A 2FMLA 2IH1C 3ZX6A 4DUZB 2H94A 4OPHA 1WB7A 1FKAO 4JI0B 5DEDA 2N04A 3SGIA 4ABMA 4ZI7A 2ZXWC 2JRIA 4I5SA 5H9CA 4I0XB 3APQA 2JGUA 3RW0A 5L3GA 3VQXA 4OXSA 4DV5B 1RP3B 2XAHA 1S76D 3JASA 2BOBC 4HAMA 3CJHA 3RFRA 4B08A 4FLUA 2QR4A 4O2BB 3STLC 4KFMA 3E8BA 1V54B 2ZNJA 1J5EB 1H38A 1JA8A 3K0DA 1NH2B 5LP6A 5CBGA 3AG1B 4NXNB 1TVKA 4FM1A 3T1HO 4HNAA 2QWPB 1F51A 3CYOA 2H3OA 4KUMA 1JJOA 2Z3YA 5LXTA 2JEXA 2NR5A 2OIGA 4NXMO 5IYCO 4JYAO 5EIBD 3QVNA 1WPBA 4WFEA 3AK3A 1NR7A 1TUEB 4YJ2A 3AK2A 1N33O 4IIJB 4K8XA 1QR9A 5LHIA 5CA3A 1GTOA 1AJQA 5KAIZ 3JSLA 4DR6O 2RNBA 1SQPH 4PELA 2DW4A 1YITV 2ZE7A 1QBZA 1JFFA 3FB6C 2YEVB 4YHHB 1KKDA 5IJ9A 1AB3A 1XI1A 2A06H 2RJZA 2YS8A 4NR1A 3B09A 5IDJA 3O65A 3CRCA 1JPXA 4X20B 2EJRA 2XAGA 2XAJA 4P9PA 1K33A 1IZ3A 1IDSA 2P6JA 3JAMN 4UCOA 2IJKA 2WA3A 4JTCB 5EYPB 1EN5A 5EC2C 3Q4HB 1VF7A 4J7ZA 5LMUO 4FLZA 3LDDA 4LF6O 2XAQA 3KZIZ 4OX9B 2VRZA 2KKWA 5IJ0B 1FFXB 2HR3A 4CC5A 3T1CA 4MW3A 1K4CC 1T5EA 2DWEC 2W6IG 5B1NA 1ZTEA 4LFAB 1R6TA 2A7WA 5EZYA 2FTKA 2IJIA 1GH6A 1HW7A 2AXTZ 2ZNIA 1DTOA 4CH6A 4BIOA 3G4SV 3G6EV 1V54C 4DR1O 3CJHB 5AG2A 4R7CA 2MW2B 1YJNV 4CS3A 2Q7GA 1GO3F 4PJ0Z 3SYPA 4BWAA 3AG1C 4RWUA 1IXMA 2EIKB 1XMOO 3CRMA 4MT8A 4ZOLA 3SJAC 5KA6A 4CH4A 4GKKO 2RMKB 3WFVA 5IYBO 2IM9A 2UUAO 4LC1A 1KU9A 3VOUA 2UXBB 4MVZA 4FLVA 3AG3B 1VF5B 1YEWA 4DV6O 2GHYA 3RN4A 5J2TA 3TXQA 3P32A 4J42A 3CHXA 4UB6Z 4Z2WA 3E86A 3ABTA 1M57C 2OIEA 3AEIA 2OCHA 4GX2A 2CAZC 5A2QN 2EJ7A 4JTDB 2A79B 3N2GB 3OMIB 4NTYA 4DV3B 2ZR3A 5IY5B 4U7NA 1US6A 1Q43A 1G1XB 1AR1B 3K5NA 2A3QA 3M7MX 1VP7A 2YI8A 2IU3A 4Q6GA 2Q0OC 3DTUB 5BR8O 3ETDA 4DV1B 4WFGA 4JI0O 2ZCEA 1P49A 1WAZA 5IYZA 5IJ9B 3HKBA 2QKSA 1QLNA 4DXWA 4X1KB 4G2KA 3FB8C 1NBMG 2JEUA 3ZHQA 4DV5O 1XMQB 3E8GA 4UB8Z 2EIMB 1YHQV 4B3MB 2ILMA 2R9IA 1URFA 2R72A 3RVYA 4X65B 4FPPA 2JIZG 2Q9LA 3GVMA 4JI1B 2Q69A 3UO3A 1YJWV 1VQ9V 4BW9A 1ZLZA 4X1IA 1XILA 1L8DA 5LBQA 2IH3C 3JYCA 4NXNO 4JI7O 4I9WA 1Q90D 2UXXA 4A5UB 5J9PC 4GT1A 4DW1A 2LQTA 5J2UB 3ZN0A 2JVDA 3H01A 1S3JA 4IYIA 1L1FA 1JCHA 3W7SA 2LO1A 1K8AW 2RN9A 1IBKB 1THZA 2E3CA 1B06A 5JCOC 3E8HA 1EZVH 2HG5C 4I50A 2QM7A 4I55A 2UUBB 3JD2A 4JI4B 1D5AA 1NVPD 4X66O 1ZUQA 4UCVA 1I7FA 3BEHA 3CCQV 2EIKC 5FL7G 2GTAA 4J7JA 2BE3A 2OT5A 3ASNB 2FL4A 1QU7A 4F6EA 2KSDA 3E8FA 1YTFB 1CXZB 3JATA 1BT8A 5KMGA 3E89A 4YHHO 4FFKA 3IGAC 2UXDB 1M9NA 3AG3C 5B3SB 1SETA 2EBOA 1Y76B 2YXHA 4GKJO 1MG1A 4MVRA 4PA6A 3CCVV 4WBNA 4BW5A 1KYOF 2CTQA 4Z1MG 1Y74B 2OYQA 3F5WC 2OTJV 2A9HA 4B7KA 1R6NA 2ZM6B 3K03A 4AQYO 1Y66A 3MHSC 1QQCA 2WLIA 3JALB 4UUJC 5IY5C 3P30A 1S5LZ 4RO2A 4O4JA 1VMGA 4W4KA 5BXZA 1YF2A 3CRQA 2AZ2A 1GMGA 3CRRA 4IHJA 4O4LB 4JI3B 1YIJV 3GB7C 3LNNA 3C90A 1GAXA 2WA4A 5KUKA 3L72H 4FLXA 4LFCB 4D7TA 2P4VA 3K5MA 3EHBB 5JH7A 1LR1A 1AJNA 2DJVA 5CA0B 2OCCB 4LF4B 5GTHZ 2QM4A 3S3WA 4YY3B 1G8MA 1HWYA 2WLJA 4GX5A 3BRCA 1YI2V 2WLNA 1Q82W 3QO7A 1D5NA 3D36A 4JASA 2QWQB 3K9AA 4NTWA 3ETEA 3IAYA 4PA7A 4JYBA 2PI4A 1VQNV 3CSXA 5CA1A 2EZOA 4JI6O 3FX7A 1NTMH 1GRJA 4KP4A 4LF5O 3H9VA 4DRXB 4KHPB 1WB8A 3EVKA 4MTXA 4CZZA 1QCEA 2JJ2G 3IC9A 1BHAA 2EULA 4JAVA 2CH7A 4RQEA 4DV0O 2ITCC 4U3JB 3RVZA 1K9MW 5FNVB 4DR7B 3K04A 2X7RB 2XTAA 2JGDA 3CXCU 1KKCA 5LYJB 2X6CA 3QTCA 4EB6A 3W7TA 2CTWA 2LP7A 1E1RG 4TV9B 3CRAA 3QO8A 4OGQB 3A8TA 4JI5B 4WF9V 1E1QG 1QVFU 3BABA 4JAAA 3UQ8A 3ASNC 3ZCCA 4DV3O 1R6KA 2YXLA 1FXKB 1YDXA 1M4UA 2HEPA 1OJHA 3BY6A 1XDCA 4CS4A 5B3SC 1P7BA 4DO2A 2Q7EA 3OTOB 2QWRB 1G6UA 1K5SA 2IBZH 5KMGB 1XHXA 2AGAA 4PHZA 1DLBA 1V55C 4TV8B 1K3EA 1GKFA 3ZHRA 4JGSA 1VQLV 1S5HC 1VEWA 2Y48A 1XMQO 1Z5WA 4LWSA 1DF4A 4DV7B 3RYFB 1JVMA 2B5UA 1R3LC 4WCEV 2ZDIA 3ZRWA 4BIUA 2QKCA 4MVSA 1IBMB 4X65O 2WLIB 4F6RB 4GZRB 1VQPV 1PP9H 3OEHG 2ITDC 4O4JB 1JR9A 1NTKH 2QDOA 2L35A 1DGSA 2KB1A 3K08A 1HP8A 4JI8O 2OCCC 2Q68A 5B1AB 1KB9F 4DR5B 1VF6C 1FS0G 4XDKA 3HKCB 4P9OA 1I08A 4X1YA 1OCRB 1SQBH 1SS3A 4LF7B 3SJQC 1NT2B 1F7YA 1YSCA 1IURA 1Q6HA 2HP8A 4NB5A 5LA6A 4WFHA 1IBKO 3B40A 5L3CA 1BS3A 4HYOA 1UJWB 1FJGB 3DXRA 4IT5A 3QNEA 2UUBO 1EZJA 3EFFK 1FAFA 5KUMA 1KECA 4UV8A 3B2EE 4RAIA 1KP3A 3HKEB 4UFZA 4BIZA 3ETGA 2LFSA 3OUSA 1SZXA 3CCJV 3UO2A 3RYCA 4YJ3A 5HFLA 4U3FH 4TUYA 4X64B 1OV9A 3ZN1A 1CEZA 4MVOA 4UVAA 3CMEV 1MSWD 1M5IA 2Q67A 3RT3C 1F4MA 1AI4A 3ABKB 4X8AA 1VQKV 2Y4TA 3BFRA 3N2KA 4JI2B 3CP1A 2ZR2A 2KQXA 1VQ8V 5JQGB 1S72V 5TISZ 2WPDG 4JV5B 4J10A 4J80A 3JARA 5KHKA 1R3JC 1RSOA 1FXVA 1SQQH 1VQMV 3SPCA 1F4NA 1O9HA 1FXKC 3KKYA 4PV1B 2UU9B 2VQFO 5CB4A 2Q4PA 3AG2B 4PDLA 3RGBA 2PUSA 1BCCH 4WFFA 3SYCA 1RM1B 4ZHQA 4DR3O 1Q5OA 3FKSG 3M8AA 4JYCA 4EKWA 4K8ZA 5ITZB 3IC7A 1KMIZ 4J7KA 3ZBHA 4FLWA 4J11A 3PN1A 4JPRA 4TQFA 5JWPA 3SR2C 4AHCA 1K4DC 1SA0B 2Y0IA 4LCUC 4L87A 4YY3O 1Q86W 5JVDA 3CCLV 2DMXA 4X9QA 2IJHA 1FXHA 1NTZH 3CCMV 2IU0A 3G71V 2Y69B 4CS2A 4XBFA 3DGEA 3JAKA 3UT5A 4DR4B 2V1DA 1AP5A 3OT7A 1K92A 4LR3A 3E22A 4GUNA 3STZC 4DV2B 5B1AC 1SC5B 4ZBMA 3OE7G 2YI9A 4H13B 3HKDB 1Q3EA 1WP8A 2QGNA 4B3SO 4X88A 2YSUB 1OCRC 5IYDO 1ZL8A 4PD4F 4DYLA 1XHZA 3C3SA 1TUBA 3HB3B 4ZI7B 2LGWA 2E5LO 1I94B 2D3OW 3THOA 2DOSA 1SZTA 3JASB 5LA6B 1N0JA 4XDLA 4JI5O 2CE4A 4MVUA 2GTSA 3UCSC 5LGNA 5L3DA 2X6AA 3J7AU 4L8JA 2VQEO 1SKVA 1K7DA 1VARA 2QKAA 1TGOA 3CC4V 1WPXA 2GDSA 4TSFG 4YIOA 1P84F 1WA8A 3EXAA 1PV0A 2PY5A 1BSMA 3ABKC 5KHJA 2KG7A 3JD3A 5LP6B 1FPOA 1N32O 1ZAUA 1H8EG 1TVKB 5L3EA 4HNAB 1KQSU 3TGUH 1AILA 4C7UA 4RUEA 4R8CA 4LFBO 3NXSA 5LXTB 4Q20A 3CXHF 3JAWA 4LF8B 4O2AA 3UM7A 2K9PA 1QHTA 2Z5UA 4ZIBA 4MVMA 5KHHA 2PGGA 2F95B 5EBWC 1W59A 2Q7HA 4I7ZB 1COWG 3SYQA 5DN6G 2M6YA 2AZ0A 4LF9B 3AG2C 4X62B 4YJ2B 4Z1VA 3RYIA 1SQVH 2DYRB 1RM1C 1PNMA 1XOUA 4GYCB 4TQDA 1OZ0A 3OR6C 2NN4A 2F4VO 3E83A 5LHGA 4DUYB 4ICGA 4UVBA 4DUZO 1AI5A 2DQ0A 1JFFB 1XL6A 4DR5O 5BMVA 5B1OA 3SYAA 3VQYA 1XNRB 1YXBA 3WB0A 2XHBA 3DC5A 1H2NA 2R9AA 2Y69C 3L70H 3ZS8C 1FJGO 2E75B 1NH2D 3O9OA 2EZPA 5EBMC 3B8MA 5B5EZ 3WB1A 2N05A 1IXBA 2A0LA 3LSUA 4GLXA 1J5EO 4EFEA 1ZX3A 3P3PA 3SDLA 4RUFA 1RPOA 4X64O 5CBHA 5KAFZ 1MMMA 2JS5A 2XAFA 1XNQB 3K06A 2XUMA 2WLHA 4G27B 3CCSV 1S77D 4PI2A 4JI2O 1WNSA 3ZMVA 5EZYB 2FKXA 4QPJA 5DECA 1D2DA 1ROPA 2LJ2A 2LW7A 1CPYA 2P06A 1TUBB 3X2QB 4O4IA 3E35A 4J41A 4LNUA 1H2LA 5LL6Y 2K1EA 4WFAV 1Q8IA 3JD0A 3GWKC 4UCUA 1Q6UA 2IJJA 5E1AC 2UU9O 2XT9A 1L0NH 1UPGA 4FIPC 3QO5A 1Y67A 3FAVA 3MHHC 2V7QG 5LP6C 2HJFC 3CCUV 3CCEV 4ZOLB 2QEXV 1I5YA 2C2AA 3CC7V 2KG7B 2ATKC 3AK1A 3OGCC 4NKGB 1AROP 2Q0AA 1IBLB 3T1HB 3H1LH 3CWBH 1SESA 3L9DA 4PDMA 1OCOB 2DYRC 5J2TB 2QWOB 2ZT9B 3W7WA 1RFYA 4JYAB 1BE3H 4GX0A 1YVWA 1XUQA 4OX9O 3RYIB 3F5TA 4KL1A 5C8YA 2EIJB 2V4DA 3BCCH 1H8HG 4FZ0A 3JD4A 3SYOA 5KA5A 1N33B 1EN6A 3PJSK 4FM0A 1PPJH 4DR6B 5IE9A 4LFAO 2VWJA 4XDJA 1KBHA 5A9GA 5LOVA 3FB5C 4NYKA 5IYZB 5B1BB 4UXNA 2PZSA 3CCRV 2DN9A 3HKBB 3ZMZA 2EIMC 2YICA 4B3TB 2EILB 3BPZA 2EINB 2ODMA 4I0XA 1VQOV 4NVPA 2BSKA 3OR7C 2LGQA 4QGPA 5KHIA 1E79G 2UXNA 3H1KH 4MVQA 1VQ6V 4DR2B 1PNKA 5EBLC 3QG5A 4X1IB 1WJZA 3S3XA 1R73A 1VQ7V 2O57A 1M56B 2ZE6A 3T1YB 4LF6B 2F43G 3ZHTA 1Y6XA 2UXBO 5IT9N 2BTOA 3X2QC 1N4CA 1HNWB 2UXCB 2YIBD 3K0GA 5K1PA 1LUVA 3W7UA 3A0HZ 1QVGU 1ZWIC 4I50B 3F7VC 3SPIA 4I55B 1R3KC 3LNMB 4FFBA 3ZHVA 3ABLB 2P4KA 2EX3A 4JZ2A 4IIJA 1BMFG 4FLYA 4DK0A 2ZQMA 3WG7B 4DUYO 3FAVB 3NR7A 3J80N 4BR6A 5CBFA 4PA4A 4DV1O 3JATB 3L74H 1PL0A 3K57A 2VS0A 5KLVH 4J9ZB 3ZHUA 1FFTB 2W0XA 3HR0A 3KG2A 1XMOB 1X59A 1XNRO 2YIDA 4AI8A 3JCZA 4D6TH 1OCOC 1AJPA 2ETNA 3P3NA 3L75H 4WBNB 4X20A 5E79Z 4MTFA 4QE9A 1QLEB 4LP8A 5FLXN 4RQFA 2UUAB 4B3MO 4H0LB 1HNXB 2EIJC 3BA8A 4PI0A 4JI1O 1AR5A 2Y0PA 5EYPA 3Q4HA 4IHJB 5EIBC 1JX9A 1N34B 5JJJB 5H6QA 2GUZA 5B1BC 3J81N 2GBOA 3SJCC 5IJ0A 2P5OA 1FFXA 1MA1A 5JH7B 2UUCB 4K0KB 5KX5A 4UVCA 4P30A 3MAQA 2JK5C 2QSAA 3H1HH 1KD1W 2G38A 2EILC 1EN4A 3RWRD 3CB2A 2EINC 5GONA 4FJCC 5BR8B 3T2MA 4R6ZA 1F23A 3CEIA 2D2CB 1MNGA 5LMNB 1YTFD 1K5QA 1NR1A 4JI4O 1GN2A 2F66C 3IJ4A 2BSKB 5CA1B 4N21A 1TA8A 4EEQA 2E74B 5IWAB 5JCOA 1M56C 2N74A 4I4TA 2CH7B 5L3BA 3L73H 2CGNA 1YCIA 2UXDO 2XASA 1VQ5V 3E2EA 3D3IA 1XREA 1OCCB 3ZMUA 5LGUA 1OCZB 2E76B 1AI6A 2DE0X 3ZRVA 2AW9A 2JGDB 4UCTA 1W0JG 1IBLO 3SPJA 5JJNB 2PYLA 4JI7B 4QPKA 1HR0B 3B8NA 3M99B 3KCXA 2ZM6O 4EB6B 4JZGA 3ABLC 2OWOA 4YXWG 1XQ8A 2PI5A 2DQ3A 3TXSA 4YIPA 1BHBA 1KUQA 3G80A 2WSSG 3WG7C 4FFBB 4JI3O 3FYIB 1CP9A 2IW5A 3CMAV 3CPWU 4BAYA 4PDVA 2P22C 1GN6A 4LFCO 4X66B 3N2GA 2YIBA 4B3RB 3H1IH 1N36B 4TWKA 4P2ZA 1M57B 1IVSA 3VQVA 4LF4O 4K35A 2QE7G 2PF4E 1QLEC 1EFRG 2M7WA 3W7XA 1YJ9V 4B3TO 1NVPB 1AVMA 1WN7A 1B04A 3DSQA 1HNZB 3A0BZ 1PD3A 2Q6AA 4X1KA 4LWSB 4GKJB 1P4RA 1BGYH 4EFBA 1S0VA 1PM9A 3ZRWB 4KHPO 1Z5VA 1NU1H 2ZE8A 4DR2O 2CDYA 3ZMTA 1X4TA 3ZHSA 1P7GA 4AQYB 3JD1A 5D5QA 1U96A 4WFBV 2W6JG 1GK9A 4QNHB 3UKMA 1JOYA 3T1YO 1N0NA 3FB7C 4DR7O 1PL4A 1NI8A 2GUZB 3VQWA 2JS3A 1HNWO 5KX5B 4IYHA 4X1YB 2UXCO 4AILC 2NLJC 4MS2A 3D36C 1H2GA 2ZE5A 1Q81W 2WLLA 2JDIG 3LDEA 5GONB 5J2UA 1O9GA 5LGTA 1OHHG 3DXRB 3K3WA 4NTXA 2HFEC 3U11A 3BA9A 3B77A 1M1KW 1LUWA 2DYSB 3FYEB 3RBZA 1G4YB 2BCCH 1ZSPA 2R70A 1M93A 4H37A 3RYCB 4YJ3B 1TAEA 1R1BA 3KCYA 1XEQA 4TUYB 3SPGA 4JI6B 3OTOO 3H1JH 4FM2A 1OCCC 4I4TB 4LF5B 4DV4B 1OCZC 2HJDA 1K73W 5H5NA 2FB5A 3D3QA 1Y4MA 2CTPA 4QE7A 3TCUA 1WP7A 3N2KB 4DV0B 2CK3G 5BY1A 3ASOB 1GM8A 2Q73A 2LFRA 3CC2V 1Y76A 4DV7O 3CD6V 2ZIOA 1EM1A 3ZIAG 1EBOA 2BTQA 3OD4A 3L71H 3JARB 1HNXO 1IBMO 1RSOB 2HHHB 1Y74A 3OAAG 5D5PA 3TK1A 1MABG 4H33A 1NZ6A 1BQZA 3LSQA 1I5XA 5CB4B 3JALA 4PDRA 3G67A 1ENVA 1N34O 3A2FA 4ZHQB 1K34A 1SRYA 1A32A 2YXYA 5B66Z 2CUGA 4O4LA 4OPAA 3QF7A 4K0KO 2UUCO 1HDJA 2Q5ZA 1GN4A 2X6BA 1B6QA 2Y4UA 4IGGA 4LF7O 2LW1A 4UV9A 1JJ2U 4O4HA 3FFQA 2AHYA 4K3AA 1XBLA 5CA0A 1AR4A 3VBBA 5JVDB 1VF6A 5LMNO 2YUAA 2ZDIC 4JF3A 4QIWF 3D8CA 5H2FZ 1XL4A 3K79A 4CBCA 5EK0A 3K5OA 4DK1A 2X0LA 3JAKB 4FLTA 3ETQA 3UT5B 2ZKOA 3K58A 3G6BA 3ABUA 5IWAO 4GX1A 3E22B 3ML0A 3ICXA 4DRXA 3AG4B 5CMUA 1Z2GA 3CX5F 3OMAB 4CH5A 3I5DA 1VQ4V 4GCZA 2NNUA 2Q8VA 5EC1C 2ADQB 1ZL8B 1Q6IA 4JAUA 1H2KA 1SF9A 4U3JA 2XOKG 4JV5O 4JI8B 5FNVA 1H2MA 3I56V 1HR0O 3BVOA 1GM9A 3HPLC 1QNMA 4JTAB 2GSMB 2WLLB 4E4EA 2DYSC 5LYJA 1QR8A 3GWOA 1NS1A 5DM6V 2HKOA 1MZFA 3CS5A 3R65A 1GM7A 4TV9A 1LNQA 2MK3A 1VIBA 5GW7A 1UFIA 2YDEA 4J9YB 5L3FA 4H44B 1WA8B 3N27A 2P90A 1S5JA 4B3RO 1FXKA 1W2BU 2HLDG 1N36O 2QWNB 4ASUG 3LUTB 2R9RB 5K1XA 3ASOC 3TETA 2RQ6A 3RYHA 4I9QA 2AHZA 3JAWB 2F1MA 2WWWA 4O2AB 2PTMA 4FK5C 1Q7YW 2F93B 3B4SA 1HNZO 3OMNB 4TV8A 1W0KG 4IL6Z 2XNDG 4W4LA 4NXMB 4DR4O 3MDSA 2BTQB 4UCRA 1V9PA 3ABMB 4FZ1A 4DV2O 1V55B 3RYFA 3TJTA 1B3QA 3OW2U 4UCSA 1IX9A 2QA4V 3OTFA 1MSDA 4F6RA 2YIAA 3A0RA 1DK1A 2JJ1G 2VQFB 3ZMSA 4TT3G 3IFXA 2YC0A 3BAAA 5BMVB 5KHGA 1ORQC 4DR3B 2HVJC 3ZRXA 4R50A 1JQ0A 1I94O 2PYJA 1PNLA 3ZJZA 3HKCA 1SQFA 2ARHA 4O4HB 5CN0A 3F7YC 1J95A 4DW0A 4E2LA 3SPHA 5F2VO 1MZEA 3DC6A 5BZBA 1MOFA 4FVMA 2ZXWB 4FMTA 1GN3A 3U10A 3OEEG 5C93A 3AG4C 4O2BA 2ZIMA 5FPRA 3BHPA 2H8PC 4KXRA 3HKEA 1FD9A 1R3IC 2QM8A 1RPRA 1NJIW 2W0FC 4B7EA 5LMUB 2ZD9A 2HVKC 2WAMA 4DV4O 1H2SB 1U97A 4HBNA 2B1IA 3U0ZA 2BOCC 5FPOA 3LDCA 3SJBC 4LF8O 4MTGA 1AP6A 4CC6A 4TOIA 1BZKA 4B3SB 1DF5A 3ZEDA 2ADPA 4JYYA 2DWDC 4O4IB 2CGOA 3CE2A 4LNUB 5JQGA 1BQ0A 4LF9O 4X62O 1N8RW 2RCVA 5H6RA 4LH6A 2HHHO 2E5LB 1YZBA 2ZINA 3LSSA 5GTIZ 4MSWC 1I0HA 3C3TA 1NQTA 3K9SA 3FD9A 4G28B 4DR1B 4U7OA 3WB2A 2VQEB 3MD0A 4PA9A 5HFMA 4QJFB 3OGIB 2YEVA 3K5LA 2VWKA 5ITZA 3AG7A 1FYJA 2CTRA 4D7SA 2B9ZA 1SQGA 4ZKIA 4GKKB 1N32B 3RYHB 4LH7A 1SA0A 1PKXA
chains in the Genus database with same CATH topology
2Y4TA 1BQZA 4RWUA 2LGWA 3APQA 2PF4E 2KQXA 2L6LA 1XBLA 1BQ0A 3UO2A 3BVOA 2QWOB 2QSAA 3APOA 1IURA 1N4CA 2YUAA 2DMXA 1FPOA 1NZ6A 2QWNB 2M6YA 2OCHA 2CUGA 4J80A 3AG7A 3UCSC 2EJ7A 2DN9A 2N05A 2QWPB 2CTRA 2YS8A 4J7ZA 2CTQA 2CTWA 4IT5A 3UO3A 2LO1A 1HDJA 1FAFA 2GUZB 1GH6A 1WJZA 2GUZA 2N04A 2QWQB 2QWRB 2Y4UA 2CTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4T A;  1BQZ A;  4RWU A;  2LGW A;  3APQ A;  2PF4 E;  2KQX A;  2L6L A;  1XBL A;  1BQ0 A;  3UO2 A;  3BVO A;  2QWO B;  2QSA A;  3APO A;  1IUR A;  1N4C A;  2YUA A;  2DMX A;  1FPO A;  1NZ6 A;  2QWN B;  2M6Y A;  2OCH A;  2CUG A;  4J80 A;  3AG7 A;  3UCS C;  2EJ7 A;  2DN9 A;  2N05 A;  2QWP B;  2CTR A;  2YS8 A;  4J7Z A;  2CTQ A;  2CTW A;  4IT5 A;  3UO3 A;  2LO1 A;  1HDJ A;  1FAF A;  2GUZ B;  1GH6 A;  1WJZ A;  2GUZ A;  2N04 A;  2QWQ B;  2QWR B;  2Y4U A;  2CTP A; 
#chains in the Genus database with same CATH topology
 3T4Z A;  2OTL V;  3ABM C;  1BL8 A;  4MW8 A;  4LFB B;  4MTO A;  2B1G A;  3APO A;  5JJE B;  2GV9 A;  4LBE C;  2WLM A;  3JSN A;  3T4D A;  1M90 W;  4DV6 B;  1SER A;  3OM3 B;  1NKD A;  1AI7 A;  3WU2 Z;  5LHH A;  2QJ1 A;  2QTS A;  3OUF A;  5C8Y B;  4F4L A;  1JMK C;  3JCU Z;  3K59 A;  2WLK A;  4N23 A;  1XNQ O;  4PA3 A;  2FYU H;  2QTO A;  1WLE A;  3R66 A;  2L6L A;  1K97 A;  1L0L H;  2P7T C;  1KP2 A;  3ZRS A;  3I55 V;  3HKD A;  4HZ3 A;  2Z0A A;  2F23 A;  4CH3 A;  2RDC A;  1SQX H;  5LOV B;  2P67 A;  2F4V B;  1KC8 W;  3OFN G;  4X89 A;  2FML A;  2IH1 C;  3ZX6 A;  4DUZ B;  2H94 A;  4OPH A;  1WB7 A;  1FKA O;  4JI0 B;  5DED A;  2N04 A;  3SGI A;  4ABM A;  4ZI7 A;  2ZXW C;  2JRI A;  4I5S A;  5H9C A;  4I0X B;  3APQ A;  2JGU A;  3RW0 A;  5L3G A;  3VQX A;  4OXS A;  4DV5 B;  1RP3 B;  2XAH A;  1S76 D;  3JAS A;  2BOB C;  4HAM A;  3CJH A;  3RFR A;  4B08 A;  4FLU A;  2QR4 A;  4O2B B;  3STL C;  4KFM A;  3E8B A;  1V54 B;  2ZNJ A;  1J5E B;  1H38 A;  1JA8 A;  3K0D A;  1NH2 B;  5LP6 A;  5CBG A;  3AG1 B;  4NXN B;  1TVK A;  4FM1 A;  3T1H O;  4HNA A;  2QWP B;  1F51 A;  3CYO A;  2H3O A;  4KUM A;  1JJO A;  2Z3Y A;  5LXT A;  2JEX A;  2NR5 A;  2OIG A;  4NXM O;  5IYC O;  4JYA O;  5EIB D;  3QVN A;  1WPB A;  4WFE A;  3AK3 A;  1NR7 A;  1TUE B;  4YJ2 A;  3AK2 A;  1N33 O;  4IIJ B;  4K8X A;  1QR9 A;  5LHI A;  5CA3 A;  1GTO A;  1AJQ A;  5KAI Z;  3JSL A;  4DR6 O;  2RNB A;  1SQP H;  4PEL A;  2DW4 A;  1YIT V;  2ZE7 A;  1QBZ A;  1JFF A;  3FB6 C;  2YEV B;  4YHH B;  1KKD A;  5IJ9 A;  1AB3 A;  1XI1 A;  2A06 H;  2RJZ A;  2YS8 A;  4NR1 A;  3B09 A;  5IDJ A;  3O65 A;  3CRC A;  1JPX A;  4X20 B;  2EJR A;  2XAG A;  2XAJ A;  4P9P A;  1K33 A;  1IZ3 A;  1IDS A;  2P6J A;  3JAM N;  4UCO A;  2IJK A;  2WA3 A;  4JTC B;  5EYP B;  1EN5 A;  5EC2 C;  3Q4H B;  1VF7 A;  4J7Z A;  5LMU O;  4FLZ A;  3LDD A;  4LF6 O;  2XAQ A;  3KZI Z;  4OX9 B;  2VRZ A;  2KKW A;  5IJ0 B;  1FFX B;  2HR3 A;  4CC5 A;  3T1C A;  4MW3 A;  1K4C C;  1T5E A;  2DWE C;  2W6I G;  5B1N A;  1ZTE A;  4LFA B;  1R6T A;  2A7W A;  5EZY A;  2FTK A;  2IJI A;  1GH6 A;  1HW7 A;  2AXT Z;  2ZNI A;  1DTO A;  4CH6 A;  4BIO A;  3G4S V;  3G6E V;  1V54 C;  4DR1 O;  3CJH B;  5AG2 A;  4R7C A;  2MW2 B;  1YJN V;  4CS3 A;  2Q7G A;  1GO3 F;  4PJ0 Z;  3SYP A;  4BWA A;  3AG1 C;  4RWU A;  1IXM A;  2EIK B;  1XMO O;  3CRM A;  4MT8 A;  4ZOL A;  3SJA C;  5KA6 A;  4CH4 A;  4GKK O;  2RMK B;  3WFV A;  5IYB O;  2IM9 A;  2UUA O;  4LC1 A;  1KU9 A;  3VOU A;  2UXB B;  4MVZ A;  4FLV A;  3AG3 B;  1VF5 B;  1YEW A;  4DV6 O;  2GHY A;  3RN4 A;  5J2T A;  3TXQ A;  3P32 A;  4J42 A;  3CHX A;  4UB6 Z;  4Z2W A;  3E86 A;  3ABT A;  1M57 C;  2OIE A;  3AEI A;  2OCH A;  4GX2 A;  2CAZ C;  5A2Q N;  2EJ7 A;  4JTD B;  2A79 B;  3N2G B;  3OMI B;  4NTY A;  4DV3 B;  2ZR3 A;  5IY5 B;  4U7N A;  1US6 A;  1Q43 A;  1G1X B;  1AR1 B;  3K5N A;  2A3Q A;  3M7M X;  1VP7 A;  2YI8 A;  2IU3 A;  4Q6G A;  2Q0O C;  3DTU B;  5BR8 O;  3ETD A;  4DV1 B;  4WFG A;  4JI0 O;  2ZCE A;  1P49 A;  1WAZ A;  5IYZ A;  5IJ9 B;  3HKB A;  2QKS A;  1QLN A;  4DXW A;  4X1K B;  4G2K A;  3FB8 C;  1NBM G;  2JEU A;  3ZHQ A;  4DV5 O;  1XMQ B;  3E8G A;  4UB8 Z;  2EIM B;  1YHQ V;  4B3M B;  2ILM A;  2R9I A;  1URF A;  2R72 A;  3RVY A;  4X65 B;  4FPP A;  2JIZ G;  2Q9L A;  3GVM A;  4JI1 B;  2Q69 A;  3UO3 A;  1YJW V;  1VQ9 V;  4BW9 A;  1ZLZ A;  4X1I A;  1XIL A;  1L8D A;  5LBQ A;  2IH3 C;  3JYC A;  4NXN O;  4JI7 O;  4I9W A;  1Q90 D;  2UXX A;  4A5U B;  5J9P C;  4GT1 A;  4DW1 A;  2LQT A;  5J2U B;  3ZN0 A;  2JVD A;  3H01 A;  1S3J A;  4IYI A;  1L1F A;  1JCH A;  3W7S A;  2LO1 A;  1K8A W;  2RN9 A;  1IBK B;  1THZ A;  2E3C A;  1B06 A;  5JCO C;  3E8H A;  1EZV H;  2HG5 C;  4I50 A;  2QM7 A;  4I55 A;  2UUB B;  3JD2 A;  4JI4 B;  1D5A A;  1NVP D;  4X66 O;  1ZUQ A;  4UCV A;  1I7F A;  3BEH A;  3CCQ V;  2EIK C;  5FL7 G;  2GTA A;  4J7J A;  2BE3 A;  2OT5 A;  3ASN B;  2FL4 A;  1QU7 A;  4F6E A;  2KSD A;  3E8F A;  1YTF B;  1CXZ B;  3JAT A;  1BT8 A;  5KMG A;  3E89 A;  4YHH O;  4FFK A;  3IGA C;  2UXD B;  1M9N A;  3AG3 C;  5B3S B;  1SET A;  2EBO A;  1Y76 B;  2YXH A;  4GKJ O;  1MG1 A;  4MVR A;  4PA6 A;  3CCV V;  4WBN A;  4BW5 A;  1KYO F;  2CTQ A;  4Z1M G;  1Y74 B;  2OYQ A;  3F5W C;  2OTJ V;  2A9H A;  4B7K A;  1R6N A;  2ZM6 B;  3K03 A;  4AQY O;  1Y66 A;  3MHS C;  1QQC A;  2WLI A;  3JAL B;  4UUJ C;  5IY5 C;  3P30 A;  1S5L Z;  4RO2 A;  4O4J A;  1VMG A;  4W4K A;  5BXZ A;  1YF2 A;  3CRQ A;  2AZ2 A;  1GMG A;  3CRR A;  4IHJ A;  4O4L B;  4JI3 B;  1YIJ V;  3GB7 C;  3LNN A;  3C90 A;  1GAX A;  2WA4 A;  5KUK A;  3L72 H;  4FLX A;  4LFC B;  4D7T A;  2P4V A;  3K5M A;  3EHB B;  5JH7 A;  1LR1 A;  1AJN A;  2DJV A;  5CA0 B;  2OCC B;  4LF4 B;  5GTH Z;  2QM4 A;  3S3W A;  4YY3 B;  1G8M A;  1HWY A;  2WLJ A;  4GX5 A;  3BRC A;  1YI2 V;  2WLN A;  1Q82 W;  3QO7 A;  1D5N A;  3D36 A;  4JAS A;  2QWQ B;  3K9A A;  4NTW A;  3ETE A;  3IAY A;  4PA7 A;  4JYB A;  2PI4 A;  1VQN V;  3CSX A;  5CA1 A;  2EZO A;  4JI6 O;  3FX7 A;  1NTM H;  1GRJ A;  4KP4 A;  4LF5 O;  3H9V A;  4DRX B;  4KHP B;  1WB8 A;  3EVK A;  4MTX A;  4CZZ A;  1QCE A;  2JJ2 G;  3IC9 A;  1BHA A;  2EUL A;  4JAV A;  2CH7 A;  4RQE A;  4DV0 O;  2ITC C;  4U3J B;  3RVZ A;  1K9M W;  5FNV B;  4DR7 B;  3K04 A;  2X7R B;  2XTA A;  2JGD A;  3CXC U;  1KKC A;  5LYJ B;  2X6C A;  3QTC A;  4EB6 A;  3W7T A;  2CTW A;  2LP7 A;  1E1R G;  4TV9 B;  3CRA A;  3QO8 A;  4OGQ B;  3A8T A;  4JI5 B;  4WF9 V;  1E1Q G;  1QVF U;  3BAB A;  4JAA A;  3UQ8 A;  3ASN C;  3ZCC A;  4DV3 O;  1R6K A;  2YXL A;  1FXK B;  1YDX A;  1M4U A;  2HEP A;  1OJH A;  3BY6 A;  1XDC A;  4CS4 A;  5B3S C;  1P7B A;  4DO2 A;  2Q7E A;  3OTO B;  2QWR B;  1G6U A;  1K5S A;  2IBZ H;  5KMG B;  1XHX A;  2AGA A;  4PHZ A;  1DLB A;  1V55 C;  4TV8 B;  1K3E A;  1GKF A;  3ZHR A;  4JGS A;  1VQL V;  1S5H C;  1VEW A;  2Y48 A;  1XMQ O;  1Z5W A;  4LWS A;  1DF4 A;  4DV7 B;  3RYF B;  1JVM A;  2B5U A;  1R3L C;  4WCE V;  2ZDI A;  3ZRW A;  4BIU A;  2QKC A;  4MVS A;  1IBM B;  4X65 O;  2WLI B;  4F6R B;  4GZR B;  1VQP V;  1PP9 H;  3OEH G;  2ITD C;  4O4J B;  1JR9 A;  1NTK H;  2QDO A;  2L35 A;  1DGS A;  2KB1 A;  3K08 A;  1HP8 A;  4JI8 O;  2OCC C;  2Q68 A;  5B1A B;  1KB9 F;  4DR5 B;  1VF6 C;  1FS0 G;  4XDK A;  3HKC B;  4P9O A;  1I08 A;  4X1Y A;  1OCR B;  1SQB H;  1SS3 A;  4LF7 B;  3SJQ C;  1NT2 B;  1F7Y A;  1YSC A;  1IUR A;  1Q6H A;  2HP8 A;  4NB5 A;  5LA6 A;  4WFH A;  1IBK O;  3B40 A;  5L3C A;  1BS3 A;  4HYO A;  1UJW B;  1FJG B;  3DXR A;  4IT5 A;  3QNE A;  2UUB O;  1EZJ A;  3EFF K;  1FAF A;  5KUM A;  1KEC A;  4UV8 A;  3B2E E;  4RAI A;  1KP3 A;  3HKE B;  4UFZ A;  4BIZ A;  3ETG A;  2LFS A;  3OUS A;  1SZX A;  3CCJ V;  3UO2 A;  3RYC A;  4YJ3 A;  5HFL A;  4U3F H;  4TUY A;  4X64 B;  1OV9 A;  3ZN1 A;  1CEZ A;  4MVO A;  4UVA A;  3CME V;  1MSW D;  1M5I A;  2Q67 A;  3RT3 C;  1F4M A;  1AI4 A;  3ABK B;  4X8A A;  1VQK V;  2Y4T A;  3BFR A;  3N2K A;  4JI2 B;  3CP1 A;  2ZR2 A;  2KQX A;  1VQ8 V;  5JQG B;  1S72 V;  5TIS Z;  2WPD G;  4JV5 B;  4J10 A;  4J80 A;  3JAR A;  5KHK A;  1R3J C;  1RSO A;  1FXV A;  1SQQ H;  1VQM V;  3SPC A;  1F4N A;  1O9H A;  1FXK C;  3KKY A;  4PV1 B;  2UU9 B;  2VQF O;  5CB4 A;  2Q4P A;  3AG2 B;  4PDL A;  3RGB A;  2PUS A;  1BCC H;  4WFF A;  3SYC A;  1RM1 B;  4ZHQ A;  4DR3 O;  1Q5O A;  3FKS G;  3M8A A;  4JYC A;  4EKW A;  4K8Z A;  5ITZ B;  3IC7 A;  1KMI Z;  4J7K A;  3ZBH A;  4FLW A;  4J11 A;  3PN1 A;  4JPR A;  4TQF A;  5JWP A;  3SR2 C;  4AHC A;  1K4D C;  1SA0 B;  2Y0I A;  4LCU C;  4L87 A;  4YY3 O;  1Q86 W;  5JVD A;  3CCL V;  2DMX A;  4X9Q A;  2IJH A;  1FXH A;  1NTZ H;  3CCM V;  2IU0 A;  3G71 V;  2Y69 B;  4CS2 A;  4XBF A;  3DGE A;  3JAK A;  3UT5 A;  4DR4 B;  2V1D A;  1AP5 A;  3OT7 A;  1K92 A;  4LR3 A;  3E22 A;  4GUN A;  3STZ C;  4DV2 B;  5B1A C;  1SC5 B;  4ZBM A;  3OE7 G;  2YI9 A;  4H13 B;  3HKD B;  1Q3E A;  1WP8 A;  2QGN A;  4B3S O;  4X88 A;  2YSU B;  1OCR C;  5IYD O;  1ZL8 A;  4PD4 F;  4DYL A;  1XHZ A;  3C3S A;  1TUB A;  3HB3 B;  4ZI7 B;  2LGW A;  2E5L O;  1I94 B;  2D3O W;  3THO A;  2DOS A;  1SZT A;  3JAS B;  5LA6 B;  1N0J A;  4XDL A;  4JI5 O;  2CE4 A;  4MVU A;  2GTS A;  3UCS C;  5LGN A;  5L3D A;  2X6A A;  3J7A U;  4L8J A;  2VQE O;  1SKV A;  1K7D A;  1VAR A;  2QKA A;  1TGO A;  3CC4 V;  1WPX A;  2GDS A;  4TSF G;  4YIO A;  1P84 F;  1WA8 A;  3EXA A;  1PV0 A;  2PY5 A;  1BSM A;  3ABK C;  5KHJ A;  2KG7 A;  3JD3 A;  5LP6 B;  1FPO A;  1N32 O;  1ZAU A;  1H8E G;  1TVK B;  5L3E A;  4HNA B;  1KQS U;  3TGU H;  1AIL A;  4C7U A;  4RUE A;  4R8C A;  4LFB O;  3NXS A;  5LXT B;  4Q20 A;  3CXH F;  3JAW A;  4LF8 B;  4O2A A;  3UM7 A;  2K9P A;  1QHT A;  2Z5U A;  4ZIB A;  4MVM A;  5KHH A;  2PGG A;  2F95 B;  5EBW C;  1W59 A;  2Q7H A;  4I7Z B;  1COW G;  3SYQ A;  5DN6 G;  2M6Y A;  2AZ0 A;  4LF9 B;  3AG2 C;  4X62 B;  4YJ2 B;  4Z1V A;  3RYI A;  1SQV H;  2DYR B;  1RM1 C;  1PNM A;  1XOU A;  4GYC B;  4TQD A;  1OZ0 A;  3OR6 C;  2NN4 A;  2F4V O;  3E83 A;  5LHG A;  4DUY B;  4ICG A;  4UVB A;  4DUZ O;  1AI5 A;  2DQ0 A;  1JFF B;  1XL6 A;  4DR5 O;  5BMV A;  5B1O A;  3SYA A;  3VQY A;  1XNR B;  1YXB A;  3WB0 A;  2XHB A;  3DC5 A;  1H2N A;  2R9A A;  2Y69 C;  3L70 H;  3ZS8 C;  1FJG O;  2E75 B;  1NH2 D;  3O9O A;  2EZP A;  5EBM C;  3B8M A;  5B5E Z;  3WB1 A;  2N05 A;  1IXB A;  2A0L A;  3LSU A;  4GLX A;  1J5E O;  4EFE A;  1ZX3 A;  3P3P A;  3SDL A;  4RUF A;  1RPO A;  4X64 O;  5CBH A;  5KAF Z;  1MMM A;  2JS5 A;  2XAF A;  1XNQ B;  3K06 A;  2XUM A;  2WLH A;  4G27 B;  3CCS V;  1S77 D;  4PI2 A;  4JI2 O;  1WNS A;  3ZMV A;  5EZY B;  2FKX A;  4QPJ A;  5DEC A;  1D2D A;  1ROP A;  2LJ2 A;  2LW7 A;  1CPY A;  2P06 A;  1TUB B;  3X2Q B;  4O4I A;  3E35 A;  4J41 A;  4LNU A;  1H2L A;  5LL6 Y;  2K1E A;  4WFA V;  1Q8I A;  3JD0 A;  3GWK C;  4UCU A;  1Q6U A;  2IJJ A;  5E1A C;  2UU9 O;  2XT9 A;  1L0N H;  1UPG A;  4FIP C;  3QO5 A;  1Y67 A;  3FAV A;  3MHH C;  2V7Q G;  5LP6 C;  2HJF C;  3CCU V;  3CCE V;  4ZOL B;  2QEX V;  1I5Y A;  2C2A A;  3CC7 V;  2KG7 B;  2ATK C;  3AK1 A;  3OGC C;  4NKG B;  1ARO P;  2Q0A A;  1IBL B;  3T1H B;  3H1L H;  3CWB H;  1SES A;  3L9D A;  4PDM A;  1OCO B;  2DYR C;  5J2T B;  2QWO B;  2ZT9 B;  3W7W A;  1RFY A;  4JYA B;  1BE3 H;  4GX0 A;  1YVW A;  1XUQ A;  4OX9 O;  3RYI B;  3F5T A;  4KL1 A;  5C8Y A;  2EIJ B;  2V4D A;  3BCC H;  1H8H G;  4FZ0 A;  3JD4 A;  3SYO A;  5KA5 A;  1N33 B;  1EN6 A;  3PJS K;  4FM0 A;  1PPJ H;  4DR6 B;  5IE9 A;  4LFA O;  2VWJ A;  4XDJ A;  1KBH A;  5A9G A;  5LOV A;  3FB5 C;  4NYK A;  5IYZ B;  5B1B B;  4UXN A;  2PZS A;  3CCR V;  2DN9 A;  3HKB B;  3ZMZ A;  2EIM C;  2YIC A;  4B3T B;  2EIL B;  3BPZ A;  2EIN B;  2ODM A;  4I0X A;  1VQO V;  4NVP A;  2BSK A;  3OR7 C;  2LGQ A;  4QGP A;  5KHI A;  1E79 G;  2UXN A;  3H1K H;  4MVQ A;  1VQ6 V;  4DR2 B;  1PNK A;  5EBL C;  3QG5 A;  4X1I B;  1WJZ A;  3S3X A;  1R73 A;  1VQ7 V;  2O57 A;  1M56 B;  2ZE6 A;  3T1Y B;  4LF6 B;  2F43 G;  3ZHT A;  1Y6X A;  2UXB O;  5IT9 N;  2BTO A;  3X2Q C;  1N4C A;  1HNW B;  2UXC B;  2YIB D;  3K0G A;  5K1P A;  1LUV A;  3W7U A;  3A0H Z;  1QVG U;  1ZWI C;  4I50 B;  3F7V C;  3SPI A;  4I55 B;  1R3K C;  3LNM B;  4FFB A;  3ZHV A;  3ABL B;  2P4K A;  2EX3 A;  4JZ2 A;  4IIJ A;  1BMF G;  4FLY A;  4DK0 A;  2ZQM A;  3WG7 B;  4DUY O;  3FAV B;  3NR7 A;  3J80 N;  4BR6 A;  5CBF A;  4PA4 A;  4DV1 O;  3JAT B;  3L74 H;  1PL0 A;  3K57 A;  2VS0 A;  5KLV H;  4J9Z B;  3ZHU A;  1FFT B;  2W0X A;  3HR0 A;  3KG2 A;  1XMO B;  1X59 A;  1XNR O;  2YID A;  4AI8 A;  3JCZ A;  4D6T H;  1OCO C;  1AJP A;  2ETN A;  3P3N A;  3L75 H;  4WBN B;  4X20 A;  5E79 Z;  4MTF A;  4QE9 A;  1QLE B;  4LP8 A;  5FLX N;  4RQF A;  2UUA B;  4B3M O;  4H0L B;  1HNX B;  2EIJ C;  3BA8 A;  4PI0 A;  4JI1 O;  1AR5 A;  2Y0P A;  5EYP A;  3Q4H A;  4IHJ B;  5EIB C;  1JX9 A;  1N34 B;  5JJJ B;  5H6Q A;  2GUZ A;  5B1B C;  3J81 N;  2GBO A;  3SJC C;  5IJ0 A;  2P5O A;  1FFX A;  1MA1 A;  5JH7 B;  2UUC B;  4K0K B;  5KX5 A;  4UVC A;  4P30 A;  3MAQ A;  2JK5 C;  2QSA A;  3H1H H;  1KD1 W;  2G38 A;  2EIL C;  1EN4 A;  3RWR D;  3CB2 A;  2EIN C;  5GON A;  4FJC C;  5BR8 B;  3T2M A;  4R6Z A;  1F23 A;  3CEI A;  2D2C B;  1MNG A;  5LMN B;  1YTF D;  1K5Q A;  1NR1 A;  4JI4 O;  1GN2 A;  2F66 C;  3IJ4 A;  2BSK B;  5CA1 B;  4N21 A;  1TA8 A;  4EEQ A;  2E74 B;  5IWA B;  5JCO A;  1M56 C;  2N74 A;  4I4T A;  2CH7 B;  5L3B A;  3L73 H;  2CGN A;  1YCI A;  2UXD O;  2XAS A;  1VQ5 V;  3E2E A;  3D3I A;  1XRE A;  1OCC B;  3ZMU A;  5LGU A;  1OCZ B;  2E76 B;  1AI6 A;  2DE0 X;  3ZRV A;  2AW9 A;  2JGD B;  4UCT A;  1W0J G;  1IBL O;  3SPJ A;  5JJN B;  2PYL A;  4JI7 B;  4QPK A;  1HR0 B;  3B8N A;  3M99 B;  3KCX A;  2ZM6 O;  4EB6 B;  4JZG A;  3ABL C;  2OWO A;  4YXW G;  1XQ8 A;  2PI5 A;  2DQ3 A;  3TXS A;  4YIP A;  1BHB A;  1KUQ A;  3G80 A;  2WSS G;  3WG7 C;  4FFB B;  4JI3 O;  3FYI B;  1CP9 A;  2IW5 A;  3CMA V;  3CPW U;  4BAY A;  4PDV A;  2P22 C;  1GN6 A;  4LFC O;  4X66 B;  3N2G A;  2YIB A;  4B3R B;  3H1I H;  1N36 B;  4TWK A;  4P2Z A;  1M57 B;  1IVS A;  3VQV A;  4LF4 O;  4K35 A;  2QE7 G;  2PF4 E;  1QLE C;  1EFR G;  2M7W A;  3W7X A;  1YJ9 V;  4B3T O;  1NVP B;  1AVM A;  1WN7 A;  1B04 A;  3DSQ A;  1HNZ B;  3A0B Z;  1PD3 A;  2Q6A A;  4X1K A;  4LWS B;  4GKJ B;  1P4R A;  1BGY H;  4EFB A;  1S0V A;  1PM9 A;  3ZRW B;  4KHP O;  1Z5V A;  1NU1 H;  2ZE8 A;  4DR2 O;  2CDY A;  3ZMT A;  1X4T A;  3ZHS A;  1P7G A;  4AQY B;  3JD1 A;  5D5Q A;  1U96 A;  4WFB V;  2W6J G;  1GK9 A;  4QNH B;  3UKM A;  1JOY A;  3T1Y O;  1N0N A;  3FB7 C;  4DR7 O;  1PL4 A;  1NI8 A;  2GUZ B;  3VQW A;  2JS3 A;  1HNW O;  5KX5 B;  4IYH A;  4X1Y B;  2UXC O;  4AIL C;  2NLJ C;  4MS2 A;  3D36 C;  1H2G A;  2ZE5 A;  1Q81 W;  2WLL A;  2JDI G;  3LDE A;  5GON B;  5J2U A;  1O9G A;  5LGT A;  1OHH G;  3DXR B;  3K3W A;  4NTX A;  2HFE C;  3U11 A;  3BA9 A;  3B77 A;  1M1K W;  1LUW A;  2DYS B;  3FYE B;  3RBZ A;  1G4Y B;  2BCC H;  1ZSP A;  2R70 A;  1M93 A;  4H37 A;  3RYC B;  4YJ3 B;  1TAE A;  1R1B A;  3KCY A;  1XEQ A;  4TUY B;  3SPG A;  4JI6 B;  3OTO O;  3H1J H;  4FM2 A;  1OCC C;  4I4T B;  4LF5 B;  4DV4 B;  1OCZ C;  2HJD A;  1K73 W;  5H5N A;  2FB5 A;  3D3Q A;  1Y4M A;  2CTP A;  4QE7 A;  3TCU A;  1WP7 A;  3N2K B;  4DV0 B;  2CK3 G;  5BY1 A;  3ASO B;  1GM8 A;  2Q73 A;  2LFR A;  3CC2 V;  1Y76 A;  4DV7 O;  3CD6 V;  2ZIO A;  1EM1 A;  3ZIA G;  1EBO A;  2BTQ A;  3OD4 A;  3L71 H;  3JAR B;  1HNX O;  1IBM O;  1RSO B;  2HHH B;  1Y74 A;  3OAA G;  5D5P A;  3TK1 A;  1MAB G;  4H33 A;  1NZ6 A;  1BQZ A;  3LSQ A;  1I5X A;  5CB4 B;  3JAL A;  4PDR A;  3G67 A;  1ENV A;  1N34 O;  3A2F A;  4ZHQ B;  1K34 A;  1SRY A;  1A32 A;  2YXY A;  5B66 Z;  2CUG A;  4O4L A;  4OPA A;  3QF7 A;  4K0K O;  2UUC O;  1HDJ A;  2Q5Z A;  1GN4 A;  2X6B A;  1B6Q A;  2Y4U A;  4IGG A;  4LF7 O;  2LW1 A;  4UV9 A;  1JJ2 U;  4O4H A;  3FFQ A;  2AHY A;  4K3A A;  1XBL A;  5CA0 A;  1AR4 A;  3VBB A;  5JVD B;  1VF6 A;  5LMN O;  2YUA A;  2ZDI C;  4JF3 A;  4QIW F;  3D8C A;  5H2F Z;  1XL4 A;  3K79 A;  4CBC A;  5EK0 A;  3K5O A;  4DK1 A;  2X0L A;  3JAK B;  4FLT A;  3ETQ A;  3UT5 B;  2ZKO A;  3K58 A;  3G6B A;  3ABU A;  5IWA O;  4GX1 A;  3E22 B;  3ML0 A;  3ICX A;  4DRX A;  3AG4 B;  5CMU A;  1Z2G A;  3CX5 F;  3OMA B;  4CH5 A;  3I5D A;  1VQ4 V;  4GCZ A;  2NNU A;  2Q8V A;  5EC1 C;  2ADQ B;  1ZL8 B;  1Q6I A;  4JAU A;  1H2K A;  1SF9 A;  4U3J A;  2XOK G;  4JV5 O;  4JI8 B;  5FNV A;  1H2M A;  3I56 V;  1HR0 O;  3BVO A;  1GM9 A;  3HPL C;  1QNM A;  4JTA B;  2GSM B;  2WLL B;  4E4E A;  2DYS C;  5LYJ A;  1QR8 A;  3GWO A;  1NS1 A;  5DM6 V;  2HKO A;  1MZF A;  3CS5 A;  3R65 A;  1GM7 A;  4TV9 A;  1LNQ A;  2MK3 A;  1VIB A;  5GW7 A;  1UFI A;  2YDE A;  4J9Y B;  5L3F A;  4H44 B;  1WA8 B;  3N27 A;  2P90 A;  1S5J A;  4B3R O;  1FXK A;  1W2B U;  2HLD G;  1N36 O;  2QWN B;  4ASU G;  3LUT B;  2R9R B;  5K1X A;  3ASO C;  3TET A;  2RQ6 A;  3RYH A;  4I9Q A;  2AHZ A;  3JAW B;  2F1M A;  2WWW A;  4O2A B;  2PTM A;  4FK5 C;  1Q7Y W;  2F93 B;  3B4S A;  1HNZ O;  3OMN B;  4TV8 A;  1W0K G;  4IL6 Z;  2XND G;  4W4L A;  4NXM B;  4DR4 O;  3MDS A;  2BTQ B;  4UCR A;  1V9P A;  3ABM B;  4FZ1 A;  4DV2 O;  1V55 B;  3RYF A;  3TJT A;  1B3Q A;  3OW2 U;  4UCS A;  1IX9 A;  2QA4 V;  3OTF A;  1MSD A;  4F6R A;  2YIA A;  3A0R A;  1DK1 A;  2JJ1 G;  2VQF B;  3ZMS A;  4TT3 G;  3IFX A;  2YC0 A;  3BAA A;  5BMV B;  5KHG A;  1ORQ C;  4DR3 B;  2HVJ C;  3ZRX A;  4R50 A;  1JQ0 A;  1I94 O;  2PYJ A;  1PNL A;  3ZJZ A;  3HKC A;  1SQF A;  2ARH A;  4O4H B;  5CN0 A;  3F7Y C;  1J95 A;  4DW0 A;  4E2L A;  3SPH A;  5F2V O;  1MZE A;  3DC6 A;  5BZB A;  1MOF A;  4FVM A;  2ZXW B;  4FMT A;  1GN3 A;  3U10 A;  3OEE G;  5C93 A;  3AG4 C;  4O2B A;  2ZIM A;  5FPR A;  3BHP A;  2H8P C;  4KXR A;  3HKE A;  1FD9 A;  1R3I C;  2QM8 A;  1RPR A;  1NJI W;  2W0F C;  4B7E A;  5LMU B;  2ZD9 A;  2HVK C;  2WAM A;  4DV4 O;  1H2S B;  1U97 A;  4HBN A;  2B1I A;  3U0Z A;  2BOC C;  5FPO A;  3LDC A;  3SJB C;  4LF8 O;  4MTG A;  1AP6 A;  4CC6 A;  4TOI A;  1BZK A;  4B3S B;  1DF5 A;  3ZED A;  2ADP A;  4JYY A;  2DWD C;  4O4I B;  2CGO A;  3CE2 A;  4LNU B;  5JQG A;  1BQ0 A;  4LF9 O;  4X62 O;  1N8R W;  2RCV A;  5H6R A;  4LH6 A;  2HHH O;  2E5L B;  1YZB A;  2ZIN A;  3LSS A;  5GTI Z;  4MSW C;  1I0H A;  3C3T A;  1NQT A;  3K9S A;  3FD9 A;  4G28 B;  4DR1 B;  4U7O A;  3WB2 A;  2VQE B;  3MD0 A;  4PA9 A;  5HFM A;  4QJF B;  3OGI B;  2YEV A;  3K5L A;  2VWK A;  5ITZ A;  3AG7 A;  1FYJ A;  2CTR A;  4D7S A;  2B9Z A;  1SQG A;  4ZKI A;  4GKK B;  1N32 B;  3RYH B;  4LH7 A;  1SA0 A;  1PKX A; 
#chains in the Genus database with same CATH homology
 2Y4T A;  1BQZ A;  4RWU A;  2LGW A;  3APQ A;  2PF4 E;  2KQX A;  2L6L A;  1XBL A;  1BQ0 A;  3UO2 A;  3BVO A;  2QWO B;  2QSA A;  3APO A;  1IUR A;  1N4C A;  2YUA A;  2DMX A;  1FPO A;  1NZ6 A;  2QWN B;  2M6Y A;  2OCH A;  2CUG A;  4J80 A;  3AG7 A;  3UCS C;  2EJ7 A;  2DN9 A;  2N05 A;  2QWP B;  2CTR A;  2YS8 A;  4J7Z A;  2CTQ A;  2CTW A;  4IT5 A;  3UO3 A;  2LO1 A;  1HDJ A;  1FAF A;  2GUZ B;  1GH6 A;  1WJZ A;  2GUZ A;  2N04 A;  2QWQ B;  2QWR B;  2Y4U A;  2CTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...