2CUGA

Solution structure of the j domain of the pseudo dnaj protein, mouse hypothetical mkiaa0962
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNYDHYGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mKIAA0962 protein
publication title Solution structure of the J domain of the pseudo DnaJ protein, mouse hypothetical mKIAA0962
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2cugA01
2DN9A 2GUZA 3UO3A 3APQA 1BQZA 4J7ZA 2CUGA 2Y4TA 1FPOA 2QSAA 2EJ7A 1WJZA 2LO1A 2YUAA 1N4CA 1BQ0A 4IT5A 2DMXA 3APOA 2CTWA 2LGWA 1FAFA 2M6YA 2QWNB 2N04A 2KQXA 2QWPB 2N05A 2OCHA 3UO2A 2GUZB 2QWOB 2QWQB 1NZ6A 1XBLA 2QWRB 2YS8A 3AG7A 2Y4UA 2CTQA 2L6LA 1IURA 3UCSC 2CTRA 4RWUA 2PF4E 4J80A 1GH6A 2CTPA 1HDJA 3BVOA
chains in the Genus database with same CATH superfamily
4B3RO 1R3KC 4J9ZB 2JS5A 3K0GA 3HPLC 1L8DA 5GTHZ 3CMAV 2QR4A 3JAKA 1FXHA 4PDRA 3JASA 1Y67A 2Q73A 1PNLA 4XDKA 1S77D 2N74A 3ETQA 1AI6A 4O4HB 5EZYB 2BOCC 4X62O 4J7ZA 2CGOA 2KKWA 5H6RA 5IWAO 4DXWA 2ZD9A 1BSMA 2P7TC 4QGPA 2F43G 3CCJV 3UQ8A 1XUQA 1K92A 5LBQA 2EJRA 3T4DA 4NB5A 3QVNA 3JD4A 4I4TB 1W59A 1Q6HA 3VQWA 2JRIA 1G4YB 4UVCA 3CCLV 4G2KA 1NH2D 3AG1C 1EM1A 3HR0A 2QGNA 3RWRD 4CZZA 3B40A 1K3EA 2P90A 4WBNA 4YIPA 1NTKH 1XMOO 1NQTA 2LJ2A 5JJNB 2UXNA 4JTDB 1AR5A 4BW9A 1TUEB 2IJHA 1N33B 4RAIA 1MMMA 3EFFK 3K0DA 5C8YB 1NVPB 5J2UB 3CC4V 3T1HO 5EYPA 3OE7G 3G67A 3LSUA 2ZXWB 4DV1B 3DC6A 1OV9A 1Y76A 5EBLC 4I0XA 2HVKC 5FL7G 2UXDB 1E79G 2V4DA 1OJHA 1XBLA 3CRMA 4WFFA 2EZOA 2IH3C 4X65O 2LW1A 1AJPA 2XAGA 1SQVH 1HNXO 4LFAB 3K79A 1SZTA 3A0BZ 4AILC 2P5OA 5LA6B 1BQZA 3AK1A 2BCCH 3JD2A 1Y74A 2XAFA 2PUSA 3OR7C 3CRRA 4DUZO 4X1IA 3ZRWB 1H38A 1VQ6V 3JATB 2Q4PA 3H1KH 3N2GB 3OM3B 2QEXV 1VF6C 5LMUO 1YF2A 3L71H 5IYZA 4TWKA 1PL4A 3AG3B 1UJWB 2VQFO 2ARHA 1L0NH 1XDCA 3BFRA 4O2BB 5B66Z 3RYFB 2UXCO 4PHZA 4RUFA 5L3BA 1GM9A 2QM8A 2D3OW 1Y6XA 1ZL8B 1I94O 3BHPA 2OIEA 3FFQA 3E86A 2H3OA 4K8XA 2HFEC 3JAWB 1ZLZA 1K33A 4HNAA 2F4VO 1GN3A 3G6BA 4MT8A 5JVDB 2IJJA 2CH7A 4EFEA 3CE2A 1N34B 1M90W 4UCVA 1XL6A 3L9DA 3NXSA 2UUCO 1Q5OA 2IJIA 2W0FC 3CSXA 4XDJA 5IE9A 5H9CA 3BVOA 1K7DA 3H1HH 2HHHO 4CS2A 3TGUH 1S0VA 1JQ0A 5LXTA 3A2FA 2YI9A 1H8EG 1WJZA 4PA9A 3T1YO 1VQLV 4XDLA 2RQ6A 2F93B 3SJAC 5JH7A 3JD1A 3ZMTA 4JYCA 1YXBA 5LP6B 3X2QC 3K5LA 4DV4B 5E1AC 5EIBC 2ZDIC 2XTAA 1NR7A 2GBOA 1XHZA 1J5EB 3BABA 2JVDA 1VARA 3CC2V 3LNNA 4P2ZA 2CTWA 3E8BA 4F6RA 5B3SB 2EIJB 3JARA 3IGAC 3OW2U 2MK3A 1S5JA 4LP8A 3ZN1A 1XHXA 2JGDB 5JQGA 5KAFZ 2IW5A 2AW9A 4LF4B 4RUEA 2AZ2A 2W6JG 4H13B 1XQ8A 4B3RB 3ZMVA 4TUYA 4Z2WA 4CC6A 4GT1A 1PV0A 4R6ZA 4KFMA 4JI5O 3SPCA 3CEIA 1BS3A 1DF5A 1WNSA 4UV8A 4GCZA 4FLZA 1TVKB 3AG3C 3WG7B 1GN6A 1YITV 3JASB 4FMTA 1KQSU 1Z2GA 1IBLO 2XHBA 4X62B 3SYPA 1YJ9V 2Q67A 5IWAB 1QR9A 2DJVA 4I50B 3ZRXA 3UT5B 2E5LO 1TGOA 1Q8IA 2F23A 4FIPC 1KECA 4UCRA 3SR2C 5LGNA 4UXNA 2VWJA 5CB4A 3ZBHA 1VF6A 2IU3A 1Q6UA 1TAEA 4FVMA 1QLEC 5JJEB 2BE3A 1XILA 2P67A 4MVQA 1QU7A 2LQTA 1KP2A 1OCOC 4JV5B 4AHCA 5KLVH 3LDCA 1T5EA 2OTJV 1CEZA 2X6CA 3PJSK 5KA6A 1XMOB 4G28B 1XOUA 4LF8O 3LSSA 1ZX3A 3ASNB 4JI0O 3KKYA 3T1HB 2XAQA 4LF9B 5IJ0A 4DW1A 4O4HA 5EZYA 2AHZA 3TETA 3AG7A 5EYPB 2Y4UA 1IXBA 4TT3G 1EN4A 3CMEV 2ZE6A 1KBHA 5LP6C 4W4LA 4I9WA 1V54B 4MVOA 5CMUA 1Y76B 4X65B 4DV5B 4I0XB 3FB7C 4N23A 1HNXB 2LGQA 4LF5O 2C2AA 2X6BA 3H1JH 1VQPV 2XASA 5CBGA 1H2GA 1YDXA 2Q5ZA 5B3SC 1PNKA 3N27A 4DUZB 2DYRC 4PA4A 1NZ6A 1URFA 4NTWA 3ABKB 1VQ5V 5J9PC 4X20B 4CC5A 2BTOA 2NN4A 2JEXA 3ASOC 3F7YC 2HP8A 2DN9A 2B9ZA 1EFRG 5L3GA 5LMUB 5DECA 1WB7A 3H1IH 2VQFB 4NTYA 3E8HA 1VQOV 1H2LA 2ZDIA 5J2UA 5IYZB 3RFRA 2MW2B 4HBNA 1IX9A 2UXCB 3GVMA 2GTAA 5IY5C 4JI2O 2IU0A 4KP4A 4ZI7B 1RP3B 4L8JA 3B8NA 5JWPA 1I94B 2UUBO 4OPAA 1QVFU 1QCEA 3D36A 4OX9O 4R8CA 4FM0A 3TJTA 2A9HA 4P9OA 1PKXA 4LNUA 1N32O 5LA6A 4J42A 2F4VB 1JVMA 1S5HC 4FK5C 1R6NA 3RYIB 1K4CC 3ML0A 3WU2Z 4O4JA 4KL1A 2UU9B 4LFBO 4I5SA 2ADQB 2HHHB 3ZMUA 3J81N 4DR2O 4K8ZA 2OYQA 3UKMA 5DN6G 5F2VO 3UM7A 3T4ZA 3ZHSA 2LFSA 1SERA 2Z0AA 5LXTB 5C93A 2EZPA 5DM6V 2L6LA 2ZR2A 3SPHA 4JI6B 1Q6IA 3CXCU 5JH7B 5FPRA 4X89A 1BE3H 4FLTA 4OXSA 1ZL8A 3E8FA 1FXKC 3ASNC 3DXRA 2LGWA 2PYLA 4PA3A 1YVWA 3E89A 1XNRO 1D5AA 1XMQB 2YXYA 2PI4A 3WB0A 2DW4A 1M5IA 5B1OA 5BZBA 2P22C 3AG1B 5IYCO 4A5UB 2QE7G 3TXQA 1GO3F 2ZIOA 4IIJB 1JJ2U 1WPBA 4NKGB 4U3JB 1XEQA 2QWOB 4CS4A 1BHAA 1AR1B 2ZE5A 5BXZA 2LFRA 3ABKC 1Q86W 4DV0O 2R9RB 4TUYB 4JI5B 5KUMA 2YIBD 3U0ZA 3P32A 4LF7O 5LP6A 3J7AU 2HG5C 1AVMA 1OZ0A 1THZA 2DYSC 3B4SA 2YSUB 3H9VA 1IBLB 2R70A 4MVMA 4EFBA 2OWOA 1M57C 3SJBC 3ETGA 3CYOA 3H1LH 3BEHA 2PF4E 1NS1A 4D7TA 4UFZA 2E5LB 2WLHA 5B1AB 5KAIZ 2FKXA 2Q7GA 5CA1A 3JD3A 2RDCA 4G27B 4BIZA 3CRAA 1M56C 2JGDA 1AI4A 3LUTB 1SRYA 2Q7HA 1YTFD 2RN9A 2HVJC 1B3QA 2JJ2G 1GN4A 2JJ1G 3AG2B 5CB4B 4AQYB 1ZSPA 2OTLV 4F4LA 3JALA 2PGGA 2KSDA 4FLVA 2ZINA 3JCZA 3CCSV 4JI8B 2R9IA 3I5DA 4B3SO 4LF8B 1FYJA 2Y0PA 3Q4HB 4LH6A 4JI0B 4DK1A 1TVKA 4K0KO 2B1IA 1KC8W 1SQQH 1AROP 1CP9A 4N21A 5IJ0B 4I50A 1HWYA 3UT5A 4X66B 4QIWF 4Z1VA 5KHGA 2M6YA 2A0LA 1Z5WA 4LF5B 5LMNO 3SYCA 3OT7A 3IC7A 3OGIB 1K5SA 5K1PA 1K5QA 3I56V 1BMFG 3BPZA 1HW7A 4Q6GA 4B3MO 2JS3A 1KD1W 1MOFA 5HFLA 3RGBA 4DR7O 1GK9A 1JJOA 1DGSA 1BT8A 2A7WA 4TQDA 2BOBC 2EULA 5IYBO 4JI4O 4MVUA 4UCTA 3P3PA 2K9PA 4JI1O 1FXKA 2UXBB 1WP7A 3X2QB 4NVPA 1GH6A 1SS3A 1WAZA 3OMNB 1Q7YW 3U10A 5E79Z 4ZBMA 1FFTB 3OEEG 3BRCA 4J10A 2EJ7A 3OTFA 3JCUZ 4LF6O 4X64O 4JZGA 2UUBB 3F5TA 2EINB 4DV2O 4OX9B 1YHQV 1N32B 2JIZG 2WLIA 3QO8A 5KHJA 2BSKB 3K9AA 3W7SA 2V7QG 5B1AC 4Z1MG 3G80A 4LNUB 3RYCA 5LOVB 3T1CA 1ORQC 2H8PC 4X20A 3DC5A 4LFBB 2M7WA 4YHHO 5BMVA 3CCMV 1CPYA 4JZ2A 4O4JB 2B5UA 4DR2B 4C7UA 4MVRA 4LC1A 1SQXH 2CTRA 4GX0A 3AG2C 1YCIA 1KMIZ 2PTMA 5H5NA 2XOKG 1AI5A 2QSAA 3R66A 4YJ2A 4GKJO 4LH7A 4ZI7A 4IHJB 4YJ3A 2O57A 1K9MW 4P30A 3BY6A 1KKCA 3OD4A 3JAMN 2BTQB 4XBFA 2QM4A 3DXRB 2AZ0A 1XNRB 3STZC 5L3CA 2ZT9B 4AI8A 3SPGA 2QKSA 2LO1A 3JD0A 3RYIA 1QLEB 2AXTZ 2WLJA 1OCOB 4W4KA 1R3LC 1IDSA 2ZM6O 3FD9A 3DSQA 3SJCC 1RM1C 3G4SV 2WPDG 4DV7O 2YICA 4UV9A 3L75H 1E1QG 4X88A 4DV0B 1B04A 2X6AA 2IJKA 1O9GA 4J11A 1HNWO 4BR6A 4GX1A 2ITDC 4ABMA 2A3QA 1N0JA 5LGTA 4JAAA 3CS5A 3B2EE 2OT5A 4GZRB 2KG7A 3MHHC 3ABLC 4NR1A 1AB3A 3C90A 4WFAV 1N4CA 4PA7A 2YIDA 4FM2A 3OEHG 3B09A 1BGYH 5CBHA 2DYRB 4JI3O 4YIOA 3ZRSA 2EINC 2CGNA 5CA1B 2UUAO 1IVSA 4R50A 4JGSA 3K5MA 4X9QA 1IBMB 3ASOB 4IIJA 3FB8C 4MW3A 2QTSA 1MABG 4U3JA 4JYAO 5D5QA 1G8MA 1Z5VA 1GMGA 4MTOA 4PI2A 5BY1A 3RN4A 1XNQO 2PYJA 3K03A 3JALB 5JJJB 1CXZB 1TUBB 4E2LA 4WFBV 1D2DA 4JYYA 3AG4C 5EBWC 5IY5B 3SDLA 1P4RA 4PDMA 1Y4MA 2EBOA 4E4EA 1YSCA 2Q8VA 4K0KB 1U96A 2JEUA 3SYAA 4X1YA 3STLC 2VQEO 2QDOA 2DMXA 3L72H 2E3CA 3FYIB 2WLNA 3ZHVA 1QLNA 1ZTEA 5KHHA 1F51A 4I55A 2XT9A 5LMNB 4IYIA 4B3MB 1Q82W 5CA3A 2Q69A 4DR7B 1VEWA 3IC9A 1BZKA 3SYOA 2AGAA 3CCEV 2QTOA 4GYCB 4J7KA 2GUZB 1N36O 4JI4B 2VRZA 1IURA 4DK0A 3WB2A 3Q4HA 4PI0A 4JI1B 1OHHG 1YZBA 4YY3O 1AP5A 1FJGO 5LHGA 1AJNA 1FXKB 4DO2A 1IBKO 4UB8Z 5EBMC 4K3AA 3ZMZA 2VS0A 4ICGA 4LF6B 4X64B 5HFMA 1F23A 1VQ8V 1G6UA 4DV2B 2GDSA 4JAVA 4FZ1A 2EIMC 2CDYA 1Y66A 2QKAA 3L74H 4WFGA 4ZHQA 1YIJV 1H8HG 3G71V 1GN2A 5KHIA 3WFVA 2WLIB 2QWPB 4JASA 2VWKA 3DTUB 3RYCB 2QWRB 4B3TO 3MDSA 2CTPA 5GTIZ 5BMVB 1I5YA 4F6EA 4O4IA 5KA5A 1NKDA 5DEDA 1V55C 1DTOA 4EB6B 4O2AA 2DYSB 2Z5UA 2WLLA 4GKJB 1NVPD 5J2TB 1XI1A 1M57B 1VQ9V 2E75B 3OMIB 4YJ2B 4RWUA 1E1RG 2QM7A 2DOSA 1J95A 1I0HA 4OGQB 4YJ3B 5IYDO 2CUGA 2K1EA 4YXWG 1M56B 4CH4A 4KHPO 4MS2A 1JFFB 3THOA 2WAMA 2BSKA 2N05A 1FD9A 2HR3A 5LOVA 3MHSC 4J41A 2DE0X 3OGCC 3D8CA 4FM1A 3LDDA 2HKOA 2UUCB 2P6JA 1I5XA 2F95B 4OPHA 4JPRA 4MTXA 3UO3A 3K59A 4QE7A 4DV7B 2UXDO 3K04A 2ODMA 5TISZ 2LW7A 2HJDA 1LUVA 1DK1A 1SQPH 3T1YB 3EHBB 1YEWA 2ADPA 2WLMA 1HNWB 1PD3A 4IHJA 3K58A 1MNGA 2YXLA 2GTSA 3K3WA 2B1GA 2BTQA 3HB3B 2FYUH 1DF4A 1JOYA 1KP3A 4MVSA 2KG7B 4RQEA 3M8AA 2OCCB 4ZOLA 3VQXA 3ABMC 3RVZA 1WPXA 3CD6V 4JI3B 3O9OA 3FYEB 3QTCA 2UUAB 3A0HZ 4DR6O 1NU1H 4JYAB 1V9PA 4JAUA 4K35A 2YEVB 2OCHA 1VQNV 1XNQB 1SETA 1H2NA 4QJFB 1JX9A 1B6QA 3J80N 3LSQA 3SJQC 5EK0A 4QE9A 4WCEV 1S76D 1NTMH 3K5NA 4FZ0A 4B08A 3AK2A 1YJNV 2D2CB 3CRQA 3APOA 3FKSG 1FAFA 4NXNO 4D7SA 2KQXA 2VQEB 2P06A 4X1YB 4DV3O 1JCHA 1PL0A 3ZCCA 4X8AA 2ZE8A 1P7BA 1HNZO 3JSNA 1K4DC 1ZWIC 1L0LH 4IL6Z 2ZNJA 4FPPA 3E22B 3QNEA 3FB6C 3EVKA 2YUAA 4MW8A 3HKCA 1K8AW 4I55B 2QKCA 4B7KA 1JR9A 3OTOO 1LR1A 3ZHUA 1N36B 1OCRC 3F5WC 2GSMB 2JK5C 4NXMO 2F1MA 1TUBA 1YI2V 1R3IC 2NNUA 4FFKA 2ZE7A 1KB9F 3QF7A 4PD4F 1W0JG 4PELA 1FXVA 2DQ0A 4B7EA 3MD0A 1GAXA 4YY3B 1FJGB 1IBKB 1SF9A 4GUNA 3ABUA 4PJ0Z 5FLXN 4GX5A 1SZXA 1M9NA 1FKAO 2X7RB 4LFCO 4BIUA 1BQ0A 2ZR3A 1QHTA 1TA8A 2CE4A 4JTCB 5LHIA 3CB2A 2EILB 5K1XA 4GKKO 4RO2A 2OCCC 3P3NA 3UCSC 1RM1B 4ZHQB 3JSLA 4RQFA 1P84F 1W0KG 3CP1A 1WLEA 4B3TB 5LGUA 1WA8A 1QBZA 2GUZA 3RVYA 5A2QN 3RYHB 3AK3A 4MSWC 1I08A 2Y0IA 4ASUG 1GM7A 3CJHA 3W7WA 1NJIW 1XL4A 3M7MX 2ZKOA 1FS0G 3QO5A 2Q9LA 2Y69B 4FFBA 4O4IB 1VIBA 1M1KW 1AJQA 1SKVA 2DWDC 3K08A 4H37A 3ZHRA 1HR0O 3BAAA 3N2KA 3ABLB 5ITZB 4O2AB 4JI2B 2WLLB 3W7XA 4FLXA 4JV5O 1SESA 1N0NA 1OCCC 1H2SB 3T2MA 2Q6AA 4BIOA 1OCZC 4TQFA 1BHBA 1WP8A 1IZ3A 4LWSB 4TOIA 4KHPB 1R6KA 4TV8A 4DRXA 4EEQA 1MA1A 3ICXA 4UCSA 2IM9A 1S5LZ 2EIKC 4ZIBA 1HDJA 3ZHTA 4JTAB 1VF7A 2DQ3A 4LF9O 1Q81W 3HKEA 4UB6Z 3L73H 3W7TA 3JYCA 5EC2C 3S3XA 2A79B 2OIGA 3AG4B 4U7OA 4DV5O 5KMGA 2RJZA 1SA0B 1PPJH 1S72V 2YI8A 4EB6A 3CPWU 4PDLA 2Q0OC 5J2TA 4DR5O 1SQFA 2XAJA 1F4NA 2WA4A 3C3SA 1WB8A 4DW0A 2R9AA 3OUFA 3TXSA 1KUQA 4PDVA 4CH3A 3QO7A 4JI7O 2CTQA 3KZIZ 1R1BA 3A8TA 1JFFA 3RT3C 1PM9A 1M93A 2RMKB 5CA0B 4ZOLB 2ITCC 3SYQA 5KHKA 4Q20A 1VQMV 4IT5A 3HKDB 1VQKV 1K34A 2N04A 4DR6B 1ENVA 2EILC 2CK3G 5LYJA 5KUKA 4FLUA 4LCUC 5AG2A 4J80A 3GB7C 4DR1O 2NLJC 1D5NA 5LL6Y 2FMLA 2WLKA 5JCOC 3RW0A 3G6EV 2FL4A 3B8MA 1W2BU 3ZHQA 1HP8A 4LF7B 2ETNA 2PZSA 3E2EA 1EBOA 2PI5A 4NXNB 2P4VA 4O4LB 3FAVA 1R73A 4U3FH 2Y69C 2UU9O 3TCUA 4JYBA 3ZJZA 5GONA 3OAAG 2HLDG 4DV3B 5CN0A 2XNDG 2EIMB 4DR3O 2Y48A 1HNZB 3ETDA 1VF5B 5B5EZ 1RSOA 1QVGU 2EX3A 2FB5A 1S3JA 1KU9A 4BW5A 3BCCH 1F7YA 4GX2A 4JI6O 4MVZA 5BR8O 5IJ9A 4H33A 5IT9N 3HKCB 3CHXA 2ZCEA 1R6TA 2YEVA 1UPGA 4H44B 3OTOB 1QR8A 4GLXA 3DGEA 3MAQA 2ZXWC 3ZMSA 4NXMB 1V55B 3CWBH 3OFNG 4UUJC 1XMQO 4X1KB 3CX5F 2RCVA 4B3SB 1K97A 2AHYA 3VOUA 1P7GA 3D36C 2WWWA 2JDIG 1XREA 1YTFB 5B1BB 1G1XB 3SPIA 1US6A 4TSFG 2V1DA 1ZUQA 2IH1C 4DV6O 1FFXA 1NI8A 2ZQMA 4LFCB 4EKWA 2A06H 5A9GA 5L3DA 5KX5A 3UO2A 2LP7A 2CAZC 1DLBA 3ZX6A 3E22A 2NR5A 5FNVA 4GKKB 1B06A 3ZIAG 3A0RA 3K57A 4BAYA 3LDEA 3JAKB 3IFXA 3OMAB 4CH5A 4DR4O 4TV9A 2Z3YA 1FPOA 4DUYO 5FPOA 2ILMA 4I9QA 1UFIA 1N8RW 2Q0AA 1NT2B 3RBZA 2QWNB 3CCQV 3M99B 3HKBA 3D3QA 2YDEA 1WA8B 3PN1A 1NTZH 2G38A 3CC7V 1X59A 3GWOA 3CJHB 5GW7A 5EC1C 1HR0B 4FFBB 3U11A 1KKDA 1RPOA 4UVAA 3N2KB 4AQYO 1RPRA 4FJCC 3CCRV 3ABMB 1NH2B 1MSDA 1SC5B 4WFEA 3KG2A 1A32A 1VQ7V 2Q68A 3I55V 4WBNB 4JI8O 1GM8A 1BCCH 1GKFA 4TV8B 3WB1A 4DRXB 1JA8A 1O9HA 1F4MA 3IJ4A 1K73W 1EZJA 4HYOA 3BA9A 5JCOA 1RFYA 3TK1A 3RYHA 1H2KA 3VQVA 2XAHA 3EXAA 3ABTA 4YHHB 3CXHF 4X66O 4CH6A 1AILA 3VQYA 3HKEB 2R72A 4UCOA 2YXHA 3E8GA 4FLYA 5LHHA 2F66C 5B1NA 4I4TA 2GHYA 3VBBA 3AEIA 4R7CA 2WA3A 2RNBA 5KMGB 3B77A 4DR5B 2EIJC 3K5OA 5ITZA 1U97A 3FX7A 3NR7A 5EIBD 4IYHA 3CRCA 1Y74B 1EZVH 4X1IB 2E74B 4J7JA 2QA4V 1Q90D 4JI7B 3H01A 4JF3A 1GTOA 4WFHA 4D6TH 4LWSA 5B1BC 4QNHB 2GV9A 3ZN0A 2ZNIA 2W0XA 4PV1B 3BA8A 1NR1A 4P9PA 2UXBO 5C8YA 1Q3EA 3ZRVA 4HAMA 2QWQB 1N33O 4CS3A 3F7VC 3LNMB 2E76B 2ZM6B 1NBMG 1EN5A 1OCRB 3L70H 1JPXA 5LYJB 1LUWA 3WG7C 2HJFC 3ZS8C 4DV1O 4DR1B 2QJ1A 4BWAA 3C3TA 4NTXA 1SA0A 1AR4A 2XUMA 4LFAO 4LR3A 2DWEC 2UXXA 3GWKC 4NYKA 2H94A 3E83A 4HNAB 3ZRWA 3JATA 1AI7A 1IXMA 2CH7B 3CCUV 4LBEC 1VP7A 3APQA 3E35A 1PP9H 4HZ3A 3N2GA 1I7FA 3ZEDA 2Y4TA 4CBCA 4QPJA 2JGUA 3FAVB 1SQBH 4WF9V 4DYLA 4H0LB 4DR3B 1AP6A 5GONB 5CA0A 3K06A 4O2BA 5CBFA 2KB1A 3RYFA 3OUSA 1RSOB 3HKDA 2ZIMA 1WN7A 1ZAUA 5BR8B 3D3IA 3FB5C 1BL8A 1M4UA 2YIAA 1JMKC 5IJ9B 5IDJA 3QG5A 2W6IG 5H6QA 1YJWV 4FLWA 1VMGA 4PA6A 2HEPA 3JAWA 3R65A 4L87A 3ETEA 5L3FA 1VQ4V 2FTKA 4UVBA 1QNMA 1MSWD 3OR6C 1X4TA 5D5PA 1KYOF 1LNQA 5JVDA 4KUMA 4F6RB 3JARB 1V54C 3SGIA 1OCCB 4O4LA 2WSSG 1Q43A 1N34O 1OCZB 5JQGB 4DV6B 5H2FZ 3KCXA 1H2MA 4QPKA 2P4KA 2EIKB 1FFXB 2ATKC 1L1FA 4KXRA 5L3EA 5KX5B 2YIBA 3CCVV 2L35A 5FNVB 1MZFA 3S3WA 3O65A 3SPJA 4U7NA 4DR4B 2YC0A 1PNMA 4DUYB 3K9SA 4UCUA 2YS8A 1QQCA 4TV9B 4DV4O 1GRJA 1MZEA 2Q7EA 1J5EO 4J9YB 1MG1A 1SQGA 4I7ZB 4X1KA 4ZKIA 1EN6A 1COWG 3HKBB 1P49A 4MTGA 3KCYA 4MTFA 4IGGA 1R3JC 3P30A 1IBMO 3IAYA 3W7UA 4LF4O 2IBZH 2X0LA 1ROPA 2PY5A
chains in the Genus database with same CATH topology
2DN9A 2GUZA 3UO3A 3APQA 1BQZA 4J7ZA 2CUGA 2Y4TA 1FPOA 2QSAA 2EJ7A 1WJZA 2LO1A 2YUAA 1N4CA 1BQ0A 4IT5A 2DMXA 3APOA 2CTWA 2LGWA 1FAFA 2M6YA 2QWNB 2N04A 2KQXA 2QWPB 2N05A 2OCHA 3UO2A 2GUZB 2QWOB 2QWQB 1NZ6A 1XBLA 2QWRB 2YS8A 3AG7A 2Y4UA 2CTQA 2L6LA 1IURA 3UCSC 2CTRA 4RWUA 2PF4E 4J80A 1GH6A 2CTPA 1HDJA 3BVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN9 A;  2GUZ A;  3UO3 A;  3APQ A;  1BQZ A;  4J7Z A;  2CUG A;  2Y4T A;  1FPO A;  2QSA A;  2EJ7 A;  1WJZ A;  2LO1 A;  2YUA A;  1N4C A;  1BQ0 A;  4IT5 A;  2DMX A;  3APO A;  2CTW A;  2LGW A;  1FAF A;  2M6Y A;  2QWN B;  2N04 A;  2KQX A;  2QWP B;  2N05 A;  2OCH A;  3UO2 A;  2GUZ B;  2QWO B;  2QWQ B;  1NZ6 A;  1XBL A;  2QWR B;  2YS8 A;  3AG7 A;  2Y4U A;  2CTQ A;  2L6L A;  1IUR A;  3UCS C;  2CTR A;  4RWU A;  2PF4 E;  4J80 A;  1GH6 A;  2CTP A;  1HDJ A;  3BVO A; 
#chains in the Genus database with same CATH topology
 4B3R O;  1R3K C;  4J9Z B;  2JS5 A;  3K0G A;  3HPL C;  1L8D A;  5GTH Z;  3CMA V;  2QR4 A;  3JAK A;  1FXH A;  4PDR A;  3JAS A;  1Y67 A;  2Q73 A;  1PNL A;  4XDK A;  1S77 D;  2N74 A;  3ETQ A;  1AI6 A;  4O4H B;  5EZY B;  2BOC C;  4X62 O;  4J7Z A;  2CGO A;  2KKW A;  5H6R A;  5IWA O;  4DXW A;  2ZD9 A;  1BSM A;  2P7T C;  4QGP A;  2F43 G;  3CCJ V;  3UQ8 A;  1XUQ A;  1K92 A;  5LBQ A;  2EJR A;  3T4D A;  4NB5 A;  3QVN A;  3JD4 A;  4I4T B;  1W59 A;  1Q6H A;  3VQW A;  2JRI A;  1G4Y B;  4UVC A;  3CCL V;  4G2K A;  1NH2 D;  3AG1 C;  1EM1 A;  3HR0 A;  2QGN A;  3RWR D;  4CZZ A;  3B40 A;  1K3E A;  2P90 A;  4WBN A;  4YIP A;  1NTK H;  1XMO O;  1NQT A;  2LJ2 A;  5JJN B;  2UXN A;  4JTD B;  1AR5 A;  4BW9 A;  1TUE B;  2IJH A;  1N33 B;  4RAI A;  1MMM A;  3EFF K;  3K0D A;  5C8Y B;  1NVP B;  5J2U B;  3CC4 V;  3T1H O;  5EYP A;  3OE7 G;  3G67 A;  3LSU A;  2ZXW B;  4DV1 B;  3DC6 A;  1OV9 A;  1Y76 A;  5EBL C;  4I0X A;  2HVK C;  5FL7 G;  2UXD B;  1E79 G;  2V4D A;  1OJH A;  1XBL A;  3CRM A;  4WFF A;  2EZO A;  2IH3 C;  4X65 O;  2LW1 A;  1AJP A;  2XAG A;  1SQV H;  1HNX O;  4LFA B;  3K79 A;  1SZT A;  3A0B Z;  4AIL C;  2P5O A;  5LA6 B;  1BQZ A;  3AK1 A;  2BCC H;  3JD2 A;  1Y74 A;  2XAF A;  2PUS A;  3OR7 C;  3CRR A;  4DUZ O;  4X1I A;  3ZRW B;  1H38 A;  1VQ6 V;  3JAT B;  2Q4P A;  3H1K H;  3N2G B;  3OM3 B;  2QEX V;  1VF6 C;  5LMU O;  1YF2 A;  3L71 H;  5IYZ A;  4TWK A;  1PL4 A;  3AG3 B;  1UJW B;  2VQF O;  2ARH A;  1L0N H;  1XDC A;  3BFR A;  4O2B B;  5B66 Z;  3RYF B;  2UXC O;  4PHZ A;  4RUF A;  5L3B A;  1GM9 A;  2QM8 A;  2D3O W;  1Y6X A;  1ZL8 B;  1I94 O;  3BHP A;  2OIE A;  3FFQ A;  3E86 A;  2H3O A;  4K8X A;  2HFE C;  3JAW B;  1ZLZ A;  1K33 A;  4HNA A;  2F4V O;  1GN3 A;  3G6B A;  4MT8 A;  5JVD B;  2IJJ A;  2CH7 A;  4EFE A;  3CE2 A;  1N34 B;  1M90 W;  4UCV A;  1XL6 A;  3L9D A;  3NXS A;  2UUC O;  1Q5O A;  2IJI A;  2W0F C;  3CSX A;  4XDJ A;  5IE9 A;  5H9C A;  3BVO A;  1K7D A;  3H1H H;  2HHH O;  4CS2 A;  3TGU H;  1S0V A;  1JQ0 A;  5LXT A;  3A2F A;  2YI9 A;  1H8E G;  1WJZ A;  4PA9 A;  3T1Y O;  1VQL V;  4XDL A;  2RQ6 A;  2F93 B;  3SJA C;  5JH7 A;  3JD1 A;  3ZMT A;  4JYC A;  1YXB A;  5LP6 B;  3X2Q C;  3K5L A;  4DV4 B;  5E1A C;  5EIB C;  2ZDI C;  2XTA A;  1NR7 A;  2GBO A;  1XHZ A;  1J5E B;  3BAB A;  2JVD A;  1VAR A;  3CC2 V;  3LNN A;  4P2Z A;  2CTW A;  3E8B A;  4F6R A;  5B3S B;  2EIJ B;  3JAR A;  3IGA C;  3OW2 U;  2MK3 A;  1S5J A;  4LP8 A;  3ZN1 A;  1XHX A;  2JGD B;  5JQG A;  5KAF Z;  2IW5 A;  2AW9 A;  4LF4 B;  4RUE A;  2AZ2 A;  2W6J G;  4H13 B;  1XQ8 A;  4B3R B;  3ZMV A;  4TUY A;  4Z2W A;  4CC6 A;  4GT1 A;  1PV0 A;  4R6Z A;  4KFM A;  4JI5 O;  3SPC A;  3CEI A;  1BS3 A;  1DF5 A;  1WNS A;  4UV8 A;  4GCZ A;  4FLZ A;  1TVK B;  3AG3 C;  3WG7 B;  1GN6 A;  1YIT V;  3JAS B;  4FMT A;  1KQS U;  1Z2G A;  1IBL O;  2XHB A;  4X62 B;  3SYP A;  1YJ9 V;  2Q67 A;  5IWA B;  1QR9 A;  2DJV A;  4I50 B;  3ZRX A;  3UT5 B;  2E5L O;  1TGO A;  1Q8I A;  2F23 A;  4FIP C;  1KEC A;  4UCR A;  3SR2 C;  5LGN A;  4UXN A;  2VWJ A;  5CB4 A;  3ZBH A;  1VF6 A;  2IU3 A;  1Q6U A;  1TAE A;  4FVM A;  1QLE C;  5JJE B;  2BE3 A;  1XIL A;  2P67 A;  4MVQ A;  1QU7 A;  2LQT A;  1KP2 A;  1OCO C;  4JV5 B;  4AHC A;  5KLV H;  3LDC A;  1T5E A;  2OTJ V;  1CEZ A;  2X6C A;  3PJS K;  5KA6 A;  1XMO B;  4G28 B;  1XOU A;  4LF8 O;  3LSS A;  1ZX3 A;  3ASN B;  4JI0 O;  3KKY A;  3T1H B;  2XAQ A;  4LF9 B;  5IJ0 A;  4DW1 A;  4O4H A;  5EZY A;  2AHZ A;  3TET A;  3AG7 A;  5EYP B;  2Y4U A;  1IXB A;  4TT3 G;  1EN4 A;  3CME V;  2ZE6 A;  1KBH A;  5LP6 C;  4W4L A;  4I9W A;  1V54 B;  4MVO A;  5CMU A;  1Y76 B;  4X65 B;  4DV5 B;  4I0X B;  3FB7 C;  4N23 A;  1HNX B;  2LGQ A;  4LF5 O;  2C2A A;  2X6B A;  3H1J H;  1VQP V;  2XAS A;  5CBG A;  1H2G A;  1YDX A;  2Q5Z A;  5B3S C;  1PNK A;  3N27 A;  4DUZ B;  2DYR C;  4PA4 A;  1NZ6 A;  1URF A;  4NTW A;  3ABK B;  1VQ5 V;  5J9P C;  4X20 B;  4CC5 A;  2BTO A;  2NN4 A;  2JEX A;  3ASO C;  3F7Y C;  2HP8 A;  2DN9 A;  2B9Z A;  1EFR G;  5L3G A;  5LMU B;  5DEC A;  1WB7 A;  3H1I H;  2VQF B;  4NTY A;  3E8H A;  1VQO V;  1H2L A;  2ZDI A;  5J2U A;  5IYZ B;  3RFR A;  2MW2 B;  4HBN A;  1IX9 A;  2UXC B;  3GVM A;  2GTA A;  5IY5 C;  4JI2 O;  2IU0 A;  4KP4 A;  4ZI7 B;  1RP3 B;  4L8J A;  3B8N A;  5JWP A;  1I94 B;  2UUB O;  4OPA A;  1QVF U;  1QCE A;  3D36 A;  4OX9 O;  4R8C A;  4FM0 A;  3TJT A;  2A9H A;  4P9O A;  1PKX A;  4LNU A;  1N32 O;  5LA6 A;  4J42 A;  2F4V B;  1JVM A;  1S5H C;  4FK5 C;  1R6N A;  3RYI B;  1K4C C;  3ML0 A;  3WU2 Z;  4O4J A;  4KL1 A;  2UU9 B;  4LFB O;  4I5S A;  2ADQ B;  2HHH B;  3ZMU A;  3J81 N;  4DR2 O;  4K8Z A;  2OYQ A;  3UKM A;  5DN6 G;  5F2V O;  3UM7 A;  3T4Z A;  3ZHS A;  2LFS A;  1SER A;  2Z0A A;  5LXT B;  5C93 A;  2EZP A;  5DM6 V;  2L6L A;  2ZR2 A;  3SPH A;  4JI6 B;  1Q6I A;  3CXC U;  5JH7 B;  5FPR A;  4X89 A;  1BE3 H;  4FLT A;  4OXS A;  1ZL8 A;  3E8F A;  1FXK C;  3ASN C;  3DXR A;  2LGW A;  2PYL A;  4PA3 A;  1YVW A;  3E89 A;  1XNR O;  1D5A A;  1XMQ B;  2YXY A;  2PI4 A;  3WB0 A;  2DW4 A;  1M5I A;  5B1O A;  5BZB A;  2P22 C;  3AG1 B;  5IYC O;  4A5U B;  2QE7 G;  3TXQ A;  1GO3 F;  2ZIO A;  4IIJ B;  1JJ2 U;  1WPB A;  4NKG B;  4U3J B;  1XEQ A;  2QWO B;  4CS4 A;  1BHA A;  1AR1 B;  2ZE5 A;  5BXZ A;  2LFR A;  3ABK C;  1Q86 W;  4DV0 O;  2R9R B;  4TUY B;  4JI5 B;  5KUM A;  2YIB D;  3U0Z A;  3P32 A;  4LF7 O;  5LP6 A;  3J7A U;  2HG5 C;  1AVM A;  1OZ0 A;  1THZ A;  2DYS C;  3B4S A;  2YSU B;  3H9V A;  1IBL B;  2R70 A;  4MVM A;  4EFB A;  2OWO A;  1M57 C;  3SJB C;  3ETG A;  3CYO A;  3H1L H;  3BEH A;  2PF4 E;  1NS1 A;  4D7T A;  4UFZ A;  2E5L B;  2WLH A;  5B1A B;  5KAI Z;  2FKX A;  2Q7G A;  5CA1 A;  3JD3 A;  2RDC A;  4G27 B;  4BIZ A;  3CRA A;  1M56 C;  2JGD A;  1AI4 A;  3LUT B;  1SRY A;  2Q7H A;  1YTF D;  2RN9 A;  2HVJ C;  1B3Q A;  2JJ2 G;  1GN4 A;  2JJ1 G;  3AG2 B;  5CB4 B;  4AQY B;  1ZSP A;  2OTL V;  4F4L A;  3JAL A;  2PGG A;  2KSD A;  4FLV A;  2ZIN A;  3JCZ A;  3CCS V;  4JI8 B;  2R9I A;  3I5D A;  4B3S O;  4LF8 B;  1FYJ A;  2Y0P A;  3Q4H B;  4LH6 A;  4JI0 B;  4DK1 A;  1TVK A;  4K0K O;  2B1I A;  1KC8 W;  1SQQ H;  1ARO P;  1CP9 A;  4N21 A;  5IJ0 B;  4I50 A;  1HWY A;  3UT5 A;  4X66 B;  4QIW F;  4Z1V A;  5KHG A;  2M6Y A;  2A0L A;  1Z5W A;  4LF5 B;  5LMN O;  3SYC A;  3OT7 A;  3IC7 A;  3OGI B;  1K5S A;  5K1P A;  1K5Q A;  3I56 V;  1BMF G;  3BPZ A;  1HW7 A;  4Q6G A;  4B3M O;  2JS3 A;  1KD1 W;  1MOF A;  5HFL A;  3RGB A;  4DR7 O;  1GK9 A;  1JJO A;  1DGS A;  1BT8 A;  2A7W A;  4TQD A;  2BOB C;  2EUL A;  5IYB O;  4JI4 O;  4MVU A;  4UCT A;  3P3P A;  2K9P A;  4JI1 O;  1FXK A;  2UXB B;  1WP7 A;  3X2Q B;  4NVP A;  1GH6 A;  1SS3 A;  1WAZ A;  3OMN B;  1Q7Y W;  3U10 A;  5E79 Z;  4ZBM A;  1FFT B;  3OEE G;  3BRC A;  4J10 A;  2EJ7 A;  3OTF A;  3JCU Z;  4LF6 O;  4X64 O;  4JZG A;  2UUB B;  3F5T A;  2EIN B;  4DV2 O;  4OX9 B;  1YHQ V;  1N32 B;  2JIZ G;  2WLI A;  3QO8 A;  5KHJ A;  2BSK B;  3K9A A;  3W7S A;  2V7Q G;  5B1A C;  4Z1M G;  3G80 A;  4LNU B;  3RYC A;  5LOV B;  3T1C A;  1ORQ C;  2H8P C;  4X20 A;  3DC5 A;  4LFB B;  2M7W A;  4YHH O;  5BMV A;  3CCM V;  1CPY A;  4JZ2 A;  4O4J B;  2B5U A;  4DR2 B;  4C7U A;  4MVR A;  4LC1 A;  1SQX H;  2CTR A;  4GX0 A;  3AG2 C;  1YCI A;  1KMI Z;  2PTM A;  5H5N A;  2XOK G;  1AI5 A;  2QSA A;  3R66 A;  4YJ2 A;  4GKJ O;  4LH7 A;  4ZI7 A;  4IHJ B;  4YJ3 A;  2O57 A;  1K9M W;  4P30 A;  3BY6 A;  1KKC A;  3OD4 A;  3JAM N;  2BTQ B;  4XBF A;  2QM4 A;  3DXR B;  2AZ0 A;  1XNR B;  3STZ C;  5L3C A;  2ZT9 B;  4AI8 A;  3SPG A;  2QKS A;  2LO1 A;  3JD0 A;  3RYI A;  1QLE B;  2AXT Z;  2WLJ A;  1OCO B;  4W4K A;  1R3L C;  1IDS A;  2ZM6 O;  3FD9 A;  3DSQ A;  3SJC C;  1RM1 C;  3G4S V;  2WPD G;  4DV7 O;  2YIC A;  4UV9 A;  3L75 H;  1E1Q G;  4X88 A;  4DV0 B;  1B04 A;  2X6A A;  2IJK A;  1O9G A;  4J11 A;  1HNW O;  4BR6 A;  4GX1 A;  2ITD C;  4ABM A;  2A3Q A;  1N0J A;  5LGT A;  4JAA A;  3CS5 A;  3B2E E;  2OT5 A;  4GZR B;  2KG7 A;  3MHH C;  3ABL C;  4NR1 A;  1AB3 A;  3C90 A;  4WFA V;  1N4C A;  4PA7 A;  2YID A;  4FM2 A;  3OEH G;  3B09 A;  1BGY H;  5CBH A;  2DYR B;  4JI3 O;  4YIO A;  3ZRS A;  2EIN C;  2CGN A;  5CA1 B;  2UUA O;  1IVS A;  4R50 A;  4JGS A;  3K5M A;  4X9Q A;  1IBM B;  3ASO B;  4IIJ A;  3FB8 C;  4MW3 A;  2QTS A;  1MAB G;  4U3J A;  4JYA O;  5D5Q A;  1G8M A;  1Z5V A;  1GMG A;  4MTO A;  4PI2 A;  5BY1 A;  3RN4 A;  1XNQ O;  2PYJ A;  3K03 A;  3JAL B;  5JJJ B;  1CXZ B;  1TUB B;  4E2L A;  4WFB V;  1D2D A;  4JYY A;  3AG4 C;  5EBW C;  5IY5 B;  3SDL A;  1P4R A;  4PDM A;  1Y4M A;  2EBO A;  4E4E A;  1YSC A;  2Q8V A;  4K0K B;  1U96 A;  2JEU A;  3SYA A;  4X1Y A;  3STL C;  2VQE O;  2QDO A;  2DMX A;  3L72 H;  2E3C A;  3FYI B;  2WLN A;  3ZHV A;  1QLN A;  1ZTE A;  5KHH A;  1F51 A;  4I55 A;  2XT9 A;  5LMN B;  4IYI A;  4B3M B;  1Q82 W;  5CA3 A;  2Q69 A;  4DR7 B;  1VEW A;  3IC9 A;  1BZK A;  3SYO A;  2AGA A;  3CCE V;  2QTO A;  4GYC B;  4J7K A;  2GUZ B;  1N36 O;  4JI4 B;  2VRZ A;  1IUR A;  4DK0 A;  3WB2 A;  3Q4H A;  4PI0 A;  4JI1 B;  1OHH G;  1YZB A;  4YY3 O;  1AP5 A;  1FJG O;  5LHG A;  1AJN A;  1FXK B;  4DO2 A;  1IBK O;  4UB8 Z;  5EBM C;  4K3A A;  3ZMZ A;  2VS0 A;  4ICG A;  4LF6 B;  4X64 B;  5HFM A;  1F23 A;  1VQ8 V;  1G6U A;  4DV2 B;  2GDS A;  4JAV A;  4FZ1 A;  2EIM C;  2CDY A;  1Y66 A;  2QKA A;  3L74 H;  4WFG A;  4ZHQ A;  1YIJ V;  1H8H G;  3G71 V;  1GN2 A;  5KHI A;  3WFV A;  2WLI B;  2QWP B;  4JAS A;  2VWK A;  3DTU B;  3RYC B;  2QWR B;  4B3T O;  3MDS A;  2CTP A;  5GTI Z;  5BMV B;  1I5Y A;  4F6E A;  4O4I A;  5KA5 A;  1NKD A;  5DED A;  1V55 C;  1DTO A;  4EB6 B;  4O2A A;  2DYS B;  2Z5U A;  2WLL A;  4GKJ B;  1NVP D;  5J2T B;  1XI1 A;  1M57 B;  1VQ9 V;  2E75 B;  3OMI B;  4YJ2 B;  4RWU A;  1E1R G;  2QM7 A;  2DOS A;  1J95 A;  1I0H A;  4OGQ B;  4YJ3 B;  5IYD O;  2CUG A;  2K1E A;  4YXW G;  1M56 B;  4CH4 A;  4KHP O;  4MS2 A;  1JFF B;  3THO A;  2WAM A;  2BSK A;  2N05 A;  1FD9 A;  2HR3 A;  5LOV A;  3MHS C;  4J41 A;  2DE0 X;  3OGC C;  3D8C A;  4FM1 A;  3LDD A;  2HKO A;  2UUC B;  2P6J A;  1I5X A;  2F95 B;  4OPH A;  4JPR A;  4MTX A;  3UO3 A;  3K59 A;  4QE7 A;  4DV7 B;  2UXD O;  3K04 A;  2ODM A;  5TIS Z;  2LW7 A;  2HJD A;  1LUV A;  1DK1 A;  1SQP H;  3T1Y B;  3EHB B;  1YEW A;  2ADP A;  2WLM A;  1HNW B;  1PD3 A;  4IHJ A;  3K58 A;  1MNG A;  2YXL A;  2GTS A;  3K3W A;  2B1G A;  2BTQ A;  3HB3 B;  2FYU H;  1DF4 A;  1JOY A;  1KP3 A;  4MVS A;  2KG7 B;  4RQE A;  3M8A A;  2OCC B;  4ZOL A;  3VQX A;  3ABM C;  3RVZ A;  1WPX A;  3CD6 V;  4JI3 B;  3O9O A;  3FYE B;  3QTC A;  2UUA B;  3A0H Z;  4DR6 O;  1NU1 H;  4JYA B;  1V9P A;  4JAU A;  4K35 A;  2YEV B;  2OCH A;  1VQN V;  1XNQ B;  1SET A;  1H2N A;  4QJF B;  1JX9 A;  1B6Q A;  3J80 N;  3LSQ A;  3SJQ C;  5EK0 A;  4QE9 A;  4WCE V;  1S76 D;  1NTM H;  3K5N A;  4FZ0 A;  4B08 A;  3AK2 A;  1YJN V;  2D2C B;  3CRQ A;  3APO A;  3FKS G;  1FAF A;  4NXN O;  4D7S A;  2KQX A;  2VQE B;  2P06 A;  4X1Y B;  4DV3 O;  1JCH A;  1PL0 A;  3ZCC A;  4X8A A;  2ZE8 A;  1P7B A;  1HNZ O;  3JSN A;  1K4D C;  1ZWI C;  1L0L H;  4IL6 Z;  2ZNJ A;  4FPP A;  3E22 B;  3QNE A;  3FB6 C;  3EVK A;  2YUA A;  4MW8 A;  3HKC A;  1K8A W;  4I55 B;  2QKC A;  4B7K A;  1JR9 A;  3OTO O;  1LR1 A;  3ZHU A;  1N36 B;  1OCR C;  3F5W C;  2GSM B;  2JK5 C;  4NXM O;  2F1M A;  1TUB A;  1YI2 V;  1R3I C;  2NNU A;  4FFK A;  2ZE7 A;  1KB9 F;  3QF7 A;  4PD4 F;  1W0J G;  4PEL A;  1FXV A;  2DQ0 A;  4B7E A;  3MD0 A;  1GAX A;  4YY3 B;  1FJG B;  1IBK B;  1SF9 A;  4GUN A;  3ABU A;  4PJ0 Z;  5FLX N;  4GX5 A;  1SZX A;  1M9N A;  1FKA O;  2X7R B;  4LFC O;  4BIU A;  1BQ0 A;  2ZR3 A;  1QHT A;  1TA8 A;  2CE4 A;  4JTC B;  5LHI A;  3CB2 A;  2EIL B;  5K1X A;  4GKK O;  4RO2 A;  2OCC C;  3P3N A;  3UCS C;  1RM1 B;  4ZHQ B;  3JSL A;  4RQF A;  1P84 F;  1W0K G;  3CP1 A;  1WLE A;  4B3T B;  5LGU A;  1WA8 A;  1QBZ A;  2GUZ A;  3RVY A;  5A2Q N;  3RYH B;  3AK3 A;  4MSW C;  1I08 A;  2Y0I A;  4ASU G;  1GM7 A;  3CJH A;  3W7W A;  1NJI W;  1XL4 A;  3M7M X;  2ZKO A;  1FS0 G;  3QO5 A;  2Q9L A;  2Y69 B;  4FFB A;  4O4I B;  1VIB A;  1M1K W;  1AJQ A;  1SKV A;  2DWD C;  3K08 A;  4H37 A;  3ZHR A;  1HR0 O;  3BAA A;  3N2K A;  3ABL B;  5ITZ B;  4O2A B;  4JI2 B;  2WLL B;  3W7X A;  4FLX A;  4JV5 O;  1SES A;  1N0N A;  1OCC C;  1H2S B;  3T2M A;  2Q6A A;  4BIO A;  1OCZ C;  4TQF A;  1BHB A;  1WP8 A;  1IZ3 A;  4LWS B;  4TOI A;  4KHP B;  1R6K A;  4TV8 A;  4DRX A;  4EEQ A;  1MA1 A;  3ICX A;  4UCS A;  2IM9 A;  1S5L Z;  2EIK C;  4ZIB A;  1HDJ A;  3ZHT A;  4JTA B;  1VF7 A;  2DQ3 A;  4LF9 O;  1Q81 W;  3HKE A;  4UB6 Z;  3L73 H;  3W7T A;  3JYC A;  5EC2 C;  3S3X A;  2A79 B;  2OIG A;  3AG4 B;  4U7O A;  4DV5 O;  5KMG A;  2RJZ A;  1SA0 B;  1PPJ H;  1S72 V;  2YI8 A;  4EB6 A;  3CPW U;  4PDL A;  2Q0O C;  5J2T A;  4DR5 O;  1SQF A;  2XAJ A;  1F4N A;  2WA4 A;  3C3S A;  1WB8 A;  4DW0 A;  2R9A A;  3OUF A;  3TXS A;  1KUQ A;  4PDV A;  4CH3 A;  3QO7 A;  4JI7 O;  2CTQ A;  3KZI Z;  1R1B A;  3A8T A;  1JFF A;  3RT3 C;  1PM9 A;  1M93 A;  2RMK B;  5CA0 B;  4ZOL B;  2ITC C;  3SYQ A;  5KHK A;  4Q20 A;  1VQM V;  4IT5 A;  3HKD B;  1VQK V;  1K34 A;  2N04 A;  4DR6 B;  1ENV A;  2EIL C;  2CK3 G;  5LYJ A;  5KUK A;  4FLU A;  4LCU C;  5AG2 A;  4J80 A;  3GB7 C;  4DR1 O;  2NLJ C;  1D5N A;  5LL6 Y;  2FML A;  2WLK A;  5JCO C;  3RW0 A;  3G6E V;  2FL4 A;  3B8M A;  1W2B U;  3ZHQ A;  1HP8 A;  4LF7 B;  2ETN A;  2PZS A;  3E2E A;  1EBO A;  2PI5 A;  4NXN B;  2P4V A;  4O4L B;  3FAV A;  1R73 A;  4U3F H;  2Y69 C;  2UU9 O;  3TCU A;  4JYB A;  3ZJZ A;  5GON A;  3OAA G;  2HLD G;  4DV3 B;  5CN0 A;  2XND G;  2EIM B;  4DR3 O;  2Y48 A;  1HNZ B;  3ETD A;  1VF5 B;  5B5E Z;  1RSO A;  1QVG U;  2EX3 A;  2FB5 A;  1S3J A;  1KU9 A;  4BW5 A;  3BCC H;  1F7Y A;  4GX2 A;  4JI6 O;  4MVZ A;  5BR8 O;  5IJ9 A;  4H33 A;  5IT9 N;  3HKC B;  3CHX A;  2ZCE A;  1R6T A;  2YEV A;  1UPG A;  4H44 B;  3OTO B;  1QR8 A;  4GLX A;  3DGE A;  3MAQ A;  2ZXW C;  3ZMS A;  4NXM B;  1V55 B;  3CWB H;  3OFN G;  4UUJ C;  1XMQ O;  4X1K B;  3CX5 F;  2RCV A;  4B3S B;  1K97 A;  2AHY A;  3VOU A;  1P7G A;  3D36 C;  2WWW A;  2JDI G;  1XRE A;  1YTF B;  5B1B B;  1G1X B;  3SPI A;  1US6 A;  4TSF G;  2V1D A;  1ZUQ A;  2IH1 C;  4DV6 O;  1FFX A;  1NI8 A;  2ZQM A;  4LFC B;  4EKW A;  2A06 H;  5A9G A;  5L3D A;  5KX5 A;  3UO2 A;  2LP7 A;  2CAZ C;  1DLB A;  3ZX6 A;  3E22 A;  2NR5 A;  5FNV A;  4GKK B;  1B06 A;  3ZIA G;  3A0R A;  3K57 A;  4BAY A;  3LDE A;  3JAK B;  3IFX A;  3OMA B;  4CH5 A;  4DR4 O;  4TV9 A;  2Z3Y A;  1FPO A;  4DUY O;  5FPO A;  2ILM A;  4I9Q A;  1UFI A;  1N8R W;  2Q0A A;  1NT2 B;  3RBZ A;  2QWN B;  3CCQ V;  3M99 B;  3HKB A;  3D3Q A;  2YDE A;  1WA8 B;  3PN1 A;  1NTZ H;  2G38 A;  3CC7 V;  1X59 A;  3GWO A;  3CJH B;  5GW7 A;  5EC1 C;  1HR0 B;  4FFB B;  3U11 A;  1KKD A;  1RPO A;  4UVA A;  3N2K B;  4AQY O;  1RPR A;  4FJC C;  3CCR V;  3ABM B;  1NH2 B;  1MSD A;  1SC5 B;  4WFE A;  3KG2 A;  1A32 A;  1VQ7 V;  2Q68 A;  3I55 V;  4WBN B;  4JI8 O;  1GM8 A;  1BCC H;  1GKF A;  4TV8 B;  3WB1 A;  4DRX B;  1JA8 A;  1O9H A;  1F4M A;  3IJ4 A;  1K73 W;  1EZJ A;  4HYO A;  3BA9 A;  5JCO A;  1RFY A;  3TK1 A;  3RYH A;  1H2K A;  3VQV A;  2XAH A;  3EXA A;  3ABT A;  4YHH B;  3CXH F;  4X66 O;  4CH6 A;  1AIL A;  3VQY A;  3HKE B;  2R72 A;  4UCO A;  2YXH A;  3E8G A;  4FLY A;  5LHH A;  2F66 C;  5B1N A;  4I4T A;  2GHY A;  3VBB A;  3AEI A;  4R7C A;  2WA3 A;  2RNB A;  5KMG B;  3B77 A;  4DR5 B;  2EIJ C;  3K5O A;  5ITZ A;  1U97 A;  3FX7 A;  3NR7 A;  5EIB D;  4IYH A;  3CRC A;  1Y74 B;  1EZV H;  4X1I B;  2E74 B;  4J7J A;  2QA4 V;  1Q90 D;  4JI7 B;  3H01 A;  4JF3 A;  1GTO A;  4WFH A;  4D6T H;  4LWS A;  5B1B C;  4QNH B;  2GV9 A;  3ZN0 A;  2ZNI A;  2W0X A;  4PV1 B;  3BA8 A;  1NR1 A;  4P9P A;  2UXB O;  5C8Y A;  1Q3E A;  3ZRV A;  4HAM A;  2QWQ B;  1N33 O;  4CS3 A;  3F7V C;  3LNM B;  2E76 B;  2ZM6 B;  1NBM G;  1EN5 A;  1OCR B;  3L70 H;  1JPX A;  5LYJ B;  1LUW A;  3WG7 C;  2HJF C;  3ZS8 C;  4DV1 O;  4DR1 B;  2QJ1 A;  4BWA A;  3C3T A;  4NTX A;  1SA0 A;  1AR4 A;  2XUM A;  4LFA O;  4LR3 A;  2DWE C;  2UXX A;  3GWK C;  4NYK A;  2H94 A;  3E83 A;  4HNA B;  3ZRW A;  3JAT A;  1AI7 A;  1IXM A;  2CH7 B;  3CCU V;  4LBE C;  1VP7 A;  3APQ A;  3E35 A;  1PP9 H;  4HZ3 A;  3N2G A;  1I7F A;  3ZED A;  2Y4T A;  4CBC A;  4QPJ A;  2JGU A;  3FAV B;  1SQB H;  4WF9 V;  4DYL A;  4H0L B;  4DR3 B;  1AP6 A;  5GON B;  5CA0 A;  3K06 A;  4O2B A;  5CBF A;  2KB1 A;  3RYF A;  3OUS A;  1RSO B;  3HKD A;  2ZIM A;  1WN7 A;  1ZAU A;  5BR8 B;  3D3I A;  3FB5 C;  1BL8 A;  1M4U A;  2YIA A;  1JMK C;  5IJ9 B;  5IDJ A;  3QG5 A;  2W6I G;  5H6Q A;  1YJW V;  4FLW A;  1VMG A;  4PA6 A;  2HEP A;  3JAW A;  3R65 A;  4L87 A;  3ETE A;  5L3F A;  1VQ4 V;  2FTK A;  4UVB A;  1QNM A;  1MSW D;  3OR6 C;  1X4T A;  5D5P A;  1KYO F;  1LNQ A;  5JVD A;  4KUM A;  4F6R B;  3JAR B;  1V54 C;  3SGI A;  1OCC B;  4O4L A;  2WSS G;  1Q43 A;  1N34 O;  1OCZ B;  5JQG B;  4DV6 B;  5H2F Z;  3KCX A;  1H2M A;  4QPK A;  2P4K A;  2EIK B;  1FFX B;  2ATK C;  1L1F A;  4KXR A;  5L3E A;  5KX5 B;  2YIB A;  3CCV V;  2L35 A;  5FNV B;  1MZF A;  3S3W A;  3O65 A;  3SPJ A;  4U7N A;  4DR4 B;  2YC0 A;  1PNM A;  4DUY B;  3K9S A;  4UCU A;  2YS8 A;  1QQC A;  4TV9 B;  4DV4 O;  1GRJ A;  1MZE A;  2Q7E A;  1J5E O;  4J9Y B;  1MG1 A;  1SQG A;  4I7Z B;  4X1K A;  4ZKI A;  1EN6 A;  1COW G;  3HKB B;  1P49 A;  4MTG A;  3KCY A;  4MTF A;  4IGG A;  1R3J C;  3P30 A;  1IBM O;  3IAY A;  3W7U A;  4LF4 O;  2IBZ H;  2X0L A;  1ROP A;  2PY5 A; 
#chains in the Genus database with same CATH homology
 2DN9 A;  2GUZ A;  3UO3 A;  3APQ A;  1BQZ A;  4J7Z A;  2CUG A;  2Y4T A;  1FPO A;  2QSA A;  2EJ7 A;  1WJZ A;  2LO1 A;  2YUA A;  1N4C A;  1BQ0 A;  4IT5 A;  2DMX A;  3APO A;  2CTW A;  2LGW A;  1FAF A;  2M6Y A;  2QWN B;  2N04 A;  2KQX A;  2QWP B;  2N05 A;  2OCH A;  3UO2 A;  2GUZ B;  2QWO B;  2QWQ B;  1NZ6 A;  1XBL A;  2QWR B;  2YS8 A;  3AG7 A;  2Y4U A;  2CTQ A;  2L6L A;  1IUR A;  3UCS C;  2CTR A;  4RWU A;  2PF4 E;  4J80 A;  1GH6 A;  2CTP A;  1HDJ A;  3BVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...