2CUGA

Solution structure of the j domain of the pseudo dnaj protein, mouse hypothetical mkiaa0962
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
GSSGSSGILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNYDHYGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mKIAA0962 protein
publication title Solution structure of the J domain of the pseudo DnaJ protein, mouse hypothetical mKIAA0962
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2cugA01
4IT5A 4J7ZA 4RWUA 1HDJA 2EJ7A 2CUGA 1IURA 2DMXA 2YS8A 2LGWA 2QWNB 3BVOA 3AG7A 2QWQB 2CTRA 2OCHA 2N05A 2Y4UA 2LO1A 4J80A 2QWRB 1XBLA 1BQZA 2QWOB 1FAFA 1WJZA 3UCSC 2KQXA 2QSAA 1N4CA 3APQA 3UO2A 2CTWA 2YUAA 2CTPA 3APOA 3UO3A 2Y4TA 1FPOA 2CTQA 2GUZA 1NZ6A 2PF4E 2M6YA 2QWPB 2L6LA 2N04A 1GH6A 1BQ0A 2GUZB 2DN9A
chains in the Genus database with same CATH superfamily
4LNUA 1Y74B 3Q4HA 3LSSA 1IVSA 3CD6V 1V54C 3L75H 1WN7A 4MT8A 1KU9A 2JK5C 2NLJC 3GWKC 5KHIA 3HKDA 2WPDG 4BR6A 2HR3A 2VS0A 3N27A 3ETQA 4WF9V 4J7ZA 1VF6A 1XEQA 1I94B 1S5LZ 3J7AU 5EZYB 3QNEA 2VQEO 1ZUQA 3SYCA 5KHJA 1AR5A 4QJFB 5CBHA 1BS3A 3T1HO 2A9HA 4H0LB 5B5EZ 2ZE5A 4DUYO 1MMMA 4DUZB 2W6IG 3K59A 4Z1MG 1QBZA 1MSDA 2VQFO 1XL6A 4IYIA 1OCCC 2GBOA 4J9YB 2OTJV 3OEHG 1WP7A 1YITV 4DV2B 3A2FA 3RYHB 3CCJV 3ZHSA 1NR7A 3TK1A 1JA8A 5HFLA 4I9WA 3B8MA 1TGOA 1V55C 5CA0A 2ZE8A 1NVPB 1VQ6V 3VQVA 1AJPA 1YTFD 1R6KA 5L3EA 5GONB 5KAIZ 4FLWA 4FLTA 1YJ9V 3OUSA 3AG2B 3H1KH 3BVOA 2ZNJA 4TV9B 2HJDA 3AG3C 2ILMA 5LL6Y 4P2ZA 1RPRA 1OV9A 1WNSA 2FTKA 3ASNB 4DR3B 2H94A 5K1XA 1IBKO 1K4CC 3JASA 4LFCB 5CA1B 5IJ0B 2PYLA 1B06A 1R1BA 2X6AA 3ZHRA 5BZBA 3JYCA 1ZWIC 3STZC 4WBNA 5LA6A 4FJCC 1K4DC 4YXWG 4NTYA 4JZ2A 1S0VA 4DXWA 5B3SC 1DTOA 2DE0X 5L3DA 2WLKA 4X88A 2UXBO 3RBZA 2MW2B 1YXBA 3K5MA 3RT3C 4FFBB 5LP6B 1M93A 4JYYA 1ZL8A 4JYAO 4O4JB 2ZKOA 2HVKC 3OGIB 1SA0B 2YICA 4D6TH 1EBOA 2HHHB 4GUNA 2ARHA 4BWAA 1G1XB 1VP7A 1YEWA 1BHBA 4E4EA 1FXHA 3OR7C 1YVWA 2HVJC 4JTDB 2UUBO 1XDCA 3JSLA 2BSKA 4J11A 1JVMA 2PF4E 4WFHA 4GX0A 4ZKIA 5EK0A 3IC7A 1O9HA 1S3JA 1ENVA 1FS0G 1R3KC 1H2MA 2ADPA 1KKCA 1R3IC 5BXZA 3H1IH 1SF9A 3RN4A 3FB7C 2ZQMA 1K73W 3ABTA 1Z2GA 2NR5A 1QVFU 3SJBC 2A06H 3TCUA 3BABA 3E22B 2X6BA 1BMFG 4X65B 1SQGA 1K5QA 1I94O 4GKJO 4JV5B 1BT8A 1G6UA 3K57A 3BHPA 1PL0A 4QNHB 1US6A 2NN4A 4NXNO 4O2BB 3ABLB 2CTPA 2AZ0A 4CZZA 4FM2A 3OE7G 5D5PA 4CH5A 1RM1B 3CMAV 1JR9A 1PM9A 2CGOA 1BCCH 3G67A 3K0DA 4DV2O 1Q6IA 4ZIBA 4LWSB 5JH7A 1MG1A 2IU3A 2CTRA 3ZRSA 1YCIA 5IYZB 1GN6A 4FMTA 3X2QB 4I4TA 4FLYA 5C93A 4B3RB 1AJQA 4FPPA 1IXBA 1GM8A 3BA8A 5EC2C 3E35A 1ROPA 1OZ0A 3UT5B 2FB5A 2IBZH 4DR1B 1SS3A 1F51A 1V9PA 1BQZA 1R6NA 5K1PA 3ASOB 4WFAV 2UXCB 3FB5C 1QLNA 3ZRWA 1AI5A 4I0XB 4U3JB 3EFFK 4FZ0A 4DR3O 2IM9A 2JJ2G 5KHKA 3LSQA 1P4RA 1BQ0A 3P3PA 4IT5A 3JARB 5EBWC 4J41A 2P22C 2ZCEA 1NH2D 2Y0IA 3N2GB 4PJ0Z 1RSOA 1IBMB 3AG1C 2D3OW 4DO2A 3ZCCA 1S76D 2DYRB 2OWOA 3FFQA 1NS1A 2GV9A 5IT9N 4J7KA 1IBLO 1VF7A 4NYKA 1UJWB 2WLMA 1VEWA 2GUZB 2ZXWB 3HKBB 3CS5A 2ZINA 1TUEB 4GLXA 1U97A 5KUKA 3DXRA 2P6JA 2HHHO 4YIOA 3AG2C 4GT1A 2XHBA 5EYPA 2B1IA 1JJ2U 1J95A 5JWPA 3ASNC 2Z3YA 2C2AA 3U10A 3HKCA 5CA3A 2V1DA 4RAIA 1OHHG 4DV0O 2XUMA 2DMXA 3THOA 3QO8A 2JRIA 4L8JA 1DF5A 4GX5A 1WPBA 3G6EV 5KX5B 1KECA 1W0KG 4QE7A 3W7WA 2E75B 3JALB 1F4NA 2B5UA 1VQPV 4B08A 3C90A 5JVDA 2Q7EA 4PV1B 5LP6C 4X65O 3B2EE 2R9AA 1JQ0A 3T4DA 4JV5O 3HPLC 5JQGA 2KB1A 5J2TA 3MHHC 2X0LA 2YSUB 3IJ4A 1Q90D 3L71H 3ABUA 1FJGB 1NU1H 1EN4A 3H9VA 4JF3A 1Z5VA 3RYCA 1CEZA 2P06A 5CB4B 1S5JA 3HKEB 4PDMA 1HNWB 3A0RA 2FKXA 2UUCB 1ZSPA 4N21A 4PA4A 2Y69B 4F4LA 2F95B 4WFGA 1F7YA 2YS8A 4EFBA 2PY5A 3ZX6A 1SZTA 5IE9A 3CP1A 1PKXA 5DEDA 4CH4A 4P30A 1KQSU 2LFRA 5BR8B 4B3RO 1KMIZ 4DV7B 4I55B 2Q68A 2DQ3A 4NXMB 4J7JA 2Q67A 2IU0A 5HFMA 2Q0OC 1E79G 1H2GA 2WA4A 1XI1A 1XILA 1UFIA 4G28B 4DR1O 4IHJA 5CBGA 3F5WC 4DR7B 4GKKB 4JI4B 5GTHZ 5IDJA 3W7SA 5JJEB 2UXCO 2Y4TA 3QO7A 3ABLC 3AK2A 2BCCH 3OM3B 1FFXA 1RM1C 4E2LA 4O4LB 1YIJV 1CXZB 1YTFB 1TUBA 1VQ8V 3RFRA 1FXKB 3OEEG 4BAYA 4D7SA 1WP8A 1IBMO 5KLVH 2QSAA 1JFFA 3X2QC 2Q4PA 5ITZA 4DRXA 4LBEC 4PHZA 1MSWD 4O4HA 1QHTA 1KUQA 2DN9A 2CK3G 5KHHA 4DV6O 1YSCA 2P67A 5GW7A 3CXCU 2EIMB 2LGWA 1Y67A 4MVQA 1I5YA 2QWNB 5B1AC 4RQEA 2PZSA 4ZI7B 3OR6C 4CH3A 3KG2A 3EHBB 4MVOA 4ZBMA 1Q6HA 1M57B 2A0LA 4MVMA 4QE9A 4CC5A 4KUMA 4O2AB 5LMNB 3CYOA 3VQWA 3RYIA 5EIBD 4LNUB 1NT2B 1HP8A 2DJVA 1PD3A 2V4DA 1GMGA 4K35A 3JCUZ 4J80A 4LFBO 2XT9A 1VQOV 3SR2C 2G38A 5AG2A 4K8XA 3LDEA 3R66A 2HFEC 1GTOA 4J42A 3AEIA 3B4SA 1IBKB 2DYRC 3CRRA 2M7WA 1WAZA 3HKDB 3JATA 3UQ8A 1SQFA 3BPZA 2OIEA 4NB5A 2YEVA 1ZLZA 5KMGA 2QWRB 1GN2A 1N32B 4X20B 3LDDA 1FJGO 3ZMUA 3N2KA 4CS2A 1HNWO 2RMKB 1TVKA 1QLEB 4H37A 4WCEV 1QR9A 4TUYA 2UUCO 1H2NA 2IW5A 3JAWA 2KKWA 5C8YA 5EBMC 2Q9LA 2IJJA 2BTOA 5CA0B 1MABG 1N0NA 1PL4A 4NVPA 3TXQA 3BCCH 4UVAA 4B3SB 4FM0A 4L87A 5BR8O 1B04A 4DV7O 1GKFA 3A0HZ 3K79A 1XHZA 4UCVA 2WA3A 4CS3A 4HZ3A 4UCUA 4NXMO 2CGNA 3WB0A 3RW0A 2Q8VA 3W7TA 4P9OA 1SERA 4JAVA 1XHXA 3E8GA 1Y76B 3SYOA 2P4KA 4I50A 4DR4B 3CCUV 1F4MA 4DR7O 4GKKO 2HJFC 3E83A 4JI4O 1R6TA 4D7TA 5JJNB 2Y48A 1IDSA 3OTFA 2QTOA 5LGUA 2RDCA 4GKJB 5L3CA 3WG7B 2Y69C 2ETNA 3OMIB 4MTXA 2QM7A 1SETA 4NXNB 5A9GA 3K04A 3UO2A 4X1YA 3RVZA 1EFRG 1FPOA 4MTGA 2IJKA 5J9PC 1THZA 4UUJC 3ZJZA 2RNBA 3ETEA 5EBLC 1BGYH 1B3QA 1P7GA 1Q3EA 2EJ7A 2QR4A 1XOUA 4W4LA 4CBCA 5B1BC 1GRJA 1AP6A 1XNRB 3E8BA 3SPJA 2UXDB 2FL4A 2AHYA 1EN6A 4JI3B 1E1RG 3APOA 4Z1VA 3SPGA 1NH2B 2YIBA 1XL4A 1U96A 4NTXA 2BSKB 3GB7C 3ABMB 3M99B 4DW1A 4YJ2A 5LMNO 2DWDC 3E8HA 3OD4A 2HEPA 5KAFZ 4ZOLB 4DR2B 4RO2A 3CC4V 3AG7A 3B09A 4B3MB 1FD9A 3T2MA 1AROP 4LF5B 3CB2A 2L35A 5LOVA 1EM1A 1FXKC 4JYCA 3SPHA 3G4SV 2YI9A 4JI5B 5LGNA 1GO3F 3K9SA 2ZNIA 1QR8A 2P90A 2EBOA 2RN9A 3SPIA 3BAAA 3L72H 2E74B 1COWG 3CJHB 3H1JH 3K5NA 2EIMC 4MW8A 1NTZH 1N32O 4X64B 2NNUA 2OTLV 2Q73A 3FYIB 1IBLB 1RFYA 1M57C 2ZDIC 1E1QG 1Y66A 5EZYA 2HLDG 2DOSA 2QKCA 4FLZA 2OYQA 4H33A 4O4IB 2H8PC 1SKVA 1W2BU 1B6QA 4IYHA 3SYAA 1L8DA 5JH7B 1QVGU 2OCCB 4I4TB 2K9PA 2JGUA 4H13B 4UXNA 4B3SO 2AHZA 2R72A 2HG5C 4MVSA 3RYHA 2AXTZ 4QPKA 4DV0B 3TXSA 1SC5B 4X89A 4R6ZA 2QWQB 4KHPB 1K34A 3WU2Z 3D8CA 4QGPA 4NTWA 3JAKB 2BOBC 4DR4O 3D36C 4RUFA 4X1IA 3AK3A 3ZRWB 5IJ9B 2Y0PA 4WFEA 1N33B 4JYBA 3CCEV 1QLEC 2CE4A 4JI1B 4TV9A 2EINB 4UCOA 2LW1A 5FLXN 1Q81W 1NQTA 2UXNA 2YIBD 4PD4F 4FFKA 3K08A 4IGGA 4U7OA 5H2FZ 4U7NA 1TA8A 1MZEA 3IAYA 1IX9A 4X1KB 4EB6A 5IYDO 2A79B 3U11A 4BIZA 5JJJB 2ODMA 1GM9A 2QM8A 4UCTA 1LUVA 2Y4UA 2W0XA 3DXRB 1XNRO 1FXVA 2GDSA 4YHHB 2UXDO 3K06A 3UCSC 2JS5A 4JAAA 1WPXA 4JI3O 4PDVA 3GWOA 2IJIA 4O4JA 1SA0A 2VRZA 4FLUA 4JZGA 1NBMG 2QA4V 1HR0B 4X8AA 3G80A 4H44B 3HKCB 1Q43A 1MZFA 2GTAA 3CCVV 1S5HC 4DR2O 4WFBV 3WG7C 1R3LC 4B3MO 4K0KB 1F23A 4LF5O 1XNQO 3ZN0A 5DECA 3IGAC 4GZRB 1FYJA 4MVRA 4KXRA 5L3GA 3ZHTA 1K5SA 3FKSG 3KCYA 3TETA 1YDXA 3CSXA 2YC0A 1OCRB 4JI5O 3OGCC 1MOFA 3VQXA 1CPYA 1JPXA 1P84F 2Q7HA 3AK1A 3LNNA 1XQ8A 2Q0AA 2XTAA 2KG7A 4X64O 2QKAA 4JTAB 2EZOA 2JGDA 3STLC 3E22A 5LHIA 2WLNA 2B1GA 4DV6B 4MSWC 4JI6B 4Z2WA 3OTOB 4O2BA 1K33A 4DV5B 2QWOB 1T5EA 1M56B 4LCUC 4JAUA 4WFFA 4JTCB 3CC2V 4DK1A 1BZKA 5IYZA 2DQ0A 1Q86W 2F43G 4LFBB 1SZXA 2WWWA 4KHPO 1D5AA 2LP7A 3APQA 1NR1A 1PNLA 4MW3A 2O57A 3R65A 4LC1A 1PV0A 2WSSG 3UT5A 2JVDA 1N8RW 2JDIG 1JOYA 4ABMA 1M5IA 1FFXB 2QKSA 2PTMA 1N33O 1UPGA 5CBFA 3CRCA 4HYOA 2XAGA 3FB8C 4JI1O 1TUBB 1YJWV 1XUQA 3OW2U 3RYFA 2CAZC 3B8NA 3OUFA 2W6JG 3JSNA 3AG4B 1JFFB 4PDRA 2XAHA 5ITZB 4DRXB 1XMQB 2M6YA 2ZD9A 3KCXA 4HNAA 4NKGB 4F6RA 4O4HB 3SGIA 2ITCC 1NI8A 2P4VA 3BA9A 1FKAO 5J2UA 3FX7A 3ETGA 3FD9A 1M4UA 3ZIAG 4TV8B 1XBLA 1L0LH 4FZ1A 4YHHO 4KP4A 4AI8A 4AHCA 2QM4A 2YXYA 2PI4A 1M9NA 1K9MW 3B40A 2GUZA 1VQMV 4XDLA 1GAXA 4PA9A 4G2KA 2V7QG 2JEUA 1WA8B 1NTMH 1NTKH 2ZIMA 3RYIB 1G8MA 3C3TA 1HR0O 5LYJB 1LUWA 2EINC 1SQBH 5B1OA 3JD1A 1LR1A 2AW9A 3RWRD 3ZBHA 1OCCB 4K0KO 4UVBA 4ZHQA 4OPHA 1Q6UA 4LH6A 4JI0B 2YXHA 3PJSK 5JCOA 3SJCC 1YJNV 3JATB 1DF4A 1VQNV 3A8TA 5KX5A 2YEVB 3O9OA 3GVMA 3BFRA 1KP3A 3JALA 3JD3A 2AGAA 5KMGB 2B9ZA 3UO3A 2CH7A 3TJTA 5LHHA 1KKDA 3S3WA 4B3TO 3N2KB 2YIAA 1KB9F 2ZIOA 1TVKB 1L0NH 3FB6C 3ABKB 1A32A 2E5LB 4JI6O 3JAWB 4LH7A 3OTOO 3E89A 3SPCA 3QG5A 2QDOA 5KUMA 1P7BA 2WLLB 3QTCA 5C8YB 2DW4A 3MD0A 4DV5O 2BOCC 3JD2A 3QF7A 2F4VB 1WLEA 3MHSC 1WB8A 2YI8A 3ASOC 1HNXO 1N34B 3VQYA 2EILB 1HNZB 2EIKB 3DC6A 4FM1A 1R73A 4PDLA 3ZEDA 1GK9A 3ZMTA 1K3EA 1TAEA 3Q4HB 5LHGA 4X66B 1YHQV 2DWEC 1CP9A 1Q7YW 4W4KA 4OXSA 5EIBC 4I50B 2CTQA 2HP8A 3O65A 5DM6V 4NR1A 4TT3G 1PPJH 1S72V 4PELA 3WB1A 2ZXWC 2XAQA 4LF9B 2GTSA 1X59A 3NXSA 4MTFA 3FAVA 4BIUA 3ZHVA 4CS4A 4HBNA 4MTOA 1M56C 4R8CA 1XMQO 3EXAA 4RWUA 1FXKA 4GCZA 3SJAC 4CH6A 2UUAB 1XREA 1JJOA 1AILA 3I56V 2UXXA 4TOIA 3HR0A 1Q82W 2YXLA 3L70H 1OCOB 4OGQB 4R50A 2DYSB 5IWAO 2F66C 4LP8A 1AI7A 1GN3A 3G71V 1NZ6A 2FMLA 4TWKA 3T4ZA 5CN0A 4YJ2B 3CE2A 2Q7GA 4ICGA 4ZI7A 2GSMB 5BMVA 1AB3A 1N36B 5E1AC 1H2SB 2Q69A 2YDEA 1BE3H 3D3IA 3C3SA 4LF8O 2WLIA 1EZJA 5LOVB 3J80N 3M7MX 4EKWA 2EZPA 5FNVA 3CWBH 1QNMA 2BTQA 1I08A 2LFSA 3ICXA 2PYJA 2L6LA 4JI0O 5H6QA 3JASB 4PI0A 4Q20A 1K7DA 1KC8W 1XMOB 2IH1C 2RQ6A 4WBNB 1Y4MA 3F5TA 3F7YC 5LA6B 1M90W 3NR7A 4CC6A 4XDJA 3CPWU 1BHAA 1G4YB 5GTIZ 1PNKA 5A2QN 2XOKG 1PNMA 1GH6A 1ORQC 1AI6A 1KYOF 1Q5OA 1ZL8B 4JASA 1OCZB 4MVZA 4AQYB 3VOUA 2E5LO 2OCHA 4BW9A 3D36A 4X20A 5LMUB 1ZTEA 4GX2A 4YJ3A 1EN5A 3JAMN 1YI2V 3CX5F 3DC5A 1AVMA 3TGUH 2F4VO 5LXTA 2EX3A 4B7EA 3CRQA 1N34O 1HW7A 3KZIZ 4DR5B 1SRYA 3FYEB 1VIBA 4UB6Z 4F6EA 1W59A 4IIJA 1HNZO 1VARA 3AG1B 2X6CA 2PGGA 1VQ7V 3ZN1A 1XNQB 3K58A 4X66O 3CCMV 4FLXA 4FVMA 4X1IB 1Y74A 2YIDA 4PA7A 4JI8B 3L74H 1AR1B 3K03A 4RQFA 1NKDA 3ABKC 1K97A 1Y76A 4JI2O 4LF9O 1QCEA 3D3QA 5IYCO 3QVNA 2P7TC 5IY5B 1IZ3A 1WB7A 3L73H 1PP9H 4EB6B 2EILC 2IH3C 2A7WA 4PA3A 4OPAA 5KA6A 2F23A 2EIKC 1P49A 2VWKA 2UUAO 4LFAB 4PA6A 3CCQV 1AP5A 3ZMZA 4UB8Z 4DK0A 1M1KW 2FYUH 3IFXA 5KA5A 3MDSA 2WLJA 3ML0A 4MVUA 1VQ9V 1I5XA 1N36O 4OX9B 1VF6C 4IL6Z 1S77D 2XNDG 1JMKC 1VQ5V 5D5QA 3CHXA 4RUEA 5GONA 4MS2A 1DLBA 4QIWF 1H2LA 4DR6B 4U3FH 4ZOLA 3H1HH 3ZHUA 4TSFG 1XMOO 4K3AA 3LNMB 5L3BA 3U0ZA 4YIPA 4LF7B 2K1EA 2WAMA 1RSOB 4KL1A 3JD4A 1QU7A 2KG7B 1I7FA 2EULA 1OCOC 3ETDA 2DYSC 2JGDB 5CA1A 5IJ0A 4LR3A 3CMEV 1DGSA 4JI7B 5H6RA 3K3WA 2RCVA 1AI4A 5LGTA 3CJHA 3OT7A 4AQYO 1J5EB 2E3CA 5EC1C 3JD0A 1W0JG 2H3OA 4UCSA 5LMUO 4DUZO 5EYPB 4FFBA 5LP6A 3OFNG 2XASA 1GN4A 2N04A 4O4IA 2ZM6B 3H01A 2LJ2A 4DR5O 3ZS8C 3BRCA 2JEXA 2VWJA 5BY1A 2E76B 1VQKV 2PUSA 2F93B 2OIGA 3I55V 3ZRVA 1H8HG 3LUTB 4PI2A 2YUAA 1MA1A 5L3FA 3SJQC 1VQ4V 3T1YB 4LF4B 5H5NA 5B1AB 2IJHA 5JVDB 3K5OA 2R9RB 1IURA 4JI8O 2QTSA 1SQPH 2XAFA 1YZBA 4C7UA 3P30A 1OCZC 3IC9A 3L9DA 2LW7A 1I0HA 3RYFB 3JAKA 5JQGB 5J2TB 3S3XA 4UVCA 4GX1A 1K92A 5IJ9A 3ZMVA 4DV3B 3UKMA 5F2VO 3RGBA 2W0FC 1YF2A 4B3TB 3SYPA 3RYCB 3M8AA 3W7XA 4HNAB 4F6RB 4LFCO 5DN6G 2CDYA 4J10A 1NVPD 3ABMC 1N0JA 1ZX3A 5J2UB 2HKOA 1FAFA 2EJRA 1O9GA 4LFAO 3H1LH 1SQXH 5B66Z 3CCSV 1HNXB 5KHGA 3OMAB 4X1KA 3P32A 4LF6B 1KD1W 3CCLV 4LWSA 2QGNA 3JCZA 3A0BZ 3J81N 2X7RB 3DTUB 2WLHA 5E79Z 4OX9O 3OMNB 3G6BA 1VF5B 1N4CA 3LDCA 4IHJB 1Y6XA 4X62B 4ZHQB 1AR4A 1GM7A 4UFZA 5IY5C 4DR6O 2EIJB 2Z5UA 1KP2A 1WJZA 3CCRV 2AZ2A 4I0XA 4U3JA 4LF7O 4I9QA 2OCCC 5H9CA 5LBQA 2CH7B 1LNQA 1R3JC 4TQDA 1EZVH 3K9AA 3JARA 2F1MA 1RP3B 2JIZG 4I7ZB 3E86A 1V54B 4G27B 4JI7O 4N23A 5IYBO 4FIPC 2UU9B 1SESA 1SQVH 3WB2A 3N2GA 3VBBA 2R9IA 3B77A 1J5EO 4DV1B 1ZAUA 5IWAB 3CRMA 4UCRA 1H38A 1SQQH 1H8EG 1FFTB 4JGSA 4AILC 3P3NA 4YY3B 3HKBA 2ZR2A 5B1NA 2JS3A 3EVKA 4FLVA 1Z5WA 2P5OA 1JX9A 2ZM6O 2Q6AA 4J9ZB 2D2CB 3CRAA 3F7VC 5CMUA 2ITDC 1NJIW 4LF8B 3E2EA 4DW0A 3OAAG 3KKYA 4GYCB 5FPRA 4DV4B 4UV9A 2JJ1G 2QWPB 5B1BB 3ZRXA 3T1YO 4LF4O 3E8FA 1D5NA 2MK3A 1V55B 1OJHA 1HWYA 1DK1A 1VMGA 3FAVB 4A5UB 4DV3O 5TISZ 2ZE7A 4BW5A 1URFA 4UV8A 1HDJA 3DGEA 2VQEB 2CUGA 4TUYB 4FK5C 3AG3B 3T1HB 1RPOA 4DUYB 2ZR3A 2VQFB 5CB4A 1MNGA 3HKEA 3T1CA 2ADQB 3QO5A 1L1FA 4EFEA 4JPRA 4HAMA 4DYLA 4LF6O 3LSUA 2OT5A 2XAJA 5FL7G 3K5LA 4QPJA 4TV8A 5B3SB 1OCRC 5FPOA 5BMVB 4K8ZA 1JCHA 2QJ1A 2Z0AA 2PI5A 3CC7V 4I5SA 4I55A 3DSQA 2LQTA 2WLIB 1KBHA 2A3QA 2N74A 1WA8A 3PN1A 5FNVB 4X62O 2BTQB 4XDKA 4ASUG 2RJZA 5LYJA 3K0GA 3SDLA 3W7UA 3CEIA 1QQCA 2N05A 3ZMSA 3BEHA 4JI2B 3I5DA 2QE7G 1D2DA 3UM7A 2Q5ZA 3BY6A 4Q6GA 4X1YB 2GHYA 4O4LA 4X9QA 1X4TA 4EEQA 2BE3A 2ATKC 1BSMA 2UU9O 1K8AW 2UXBB 4B7KA 1H2KA 2ZE6A 4DV1O 3SYQA 2CTWA 1BL8A 4YJ3B 4JYAB 1IXMA 5LXTB 4YY3O 1VQLV 3MAQA 2WLLA 4IIJB 3WFVA 2R70A 4XBFA 5JCOC 4KFMA 2LO1A 4TQFA 1AJNA 2KSDA 2EIJC 2ZT9B 2UUBB 2KQXA 2ZDIA 4BIOA 3CXHF 1Q8IA 2QEXV 4P9PA 4O2AA 3ZHQA 3HB3B 2LGQA 4DV4O 4R7CA 3AG4C 3RVYA
chains in the Genus database with same CATH topology
4IT5A 4J7ZA 4RWUA 1HDJA 2EJ7A 2CUGA 1IURA 2DMXA 2YS8A 2LGWA 2QWNB 3BVOA 3AG7A 2QWQB 2CTRA 2OCHA 2N05A 2Y4UA 2LO1A 4J80A 2QWRB 1XBLA 1BQZA 2QWOB 1FAFA 1WJZA 3UCSC 2KQXA 2QSAA 1N4CA 3APQA 3UO2A 2CTWA 2YUAA 2CTPA 3APOA 3UO3A 2Y4TA 1FPOA 2CTQA 2GUZA 1NZ6A 2PF4E 2M6YA 2QWPB 2L6LA 2N04A 1GH6A 1BQ0A 2GUZB 2DN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT5 A;  4J7Z A;  4RWU A;  1HDJ A;  2EJ7 A;  2CUG A;  1IUR A;  2DMX A;  2YS8 A;  2LGW A;  2QWN B;  3BVO A;  3AG7 A;  2QWQ B;  2CTR A;  2OCH A;  2N05 A;  2Y4U A;  2LO1 A;  4J80 A;  2QWR B;  1XBL A;  1BQZ A;  2QWO B;  1FAF A;  1WJZ A;  3UCS C;  2KQX A;  2QSA A;  1N4C A;  3APQ A;  3UO2 A;  2CTW A;  2YUA A;  2CTP A;  3APO A;  3UO3 A;  2Y4T A;  1FPO A;  2CTQ A;  2GUZ A;  1NZ6 A;  2PF4 E;  2M6Y A;  2QWP B;  2L6L A;  2N04 A;  1GH6 A;  1BQ0 A;  2GUZ B;  2DN9 A; 
#chains in the Genus database with same CATH topology
 4LNU A;  1Y74 B;  3Q4H A;  3LSS A;  1IVS A;  3CD6 V;  1V54 C;  3L75 H;  1WN7 A;  4MT8 A;  1KU9 A;  2JK5 C;  2NLJ C;  3GWK C;  5KHI A;  3HKD A;  2WPD G;  4BR6 A;  2HR3 A;  2VS0 A;  3N27 A;  3ETQ A;  4WF9 V;  4J7Z A;  1VF6 A;  1XEQ A;  1I94 B;  1S5L Z;  3J7A U;  5EZY B;  3QNE A;  2VQE O;  1ZUQ A;  3SYC A;  5KHJ A;  1AR5 A;  4QJF B;  5CBH A;  1BS3 A;  3T1H O;  2A9H A;  4H0L B;  5B5E Z;  2ZE5 A;  4DUY O;  1MMM A;  4DUZ B;  2W6I G;  3K59 A;  4Z1M G;  1QBZ A;  1MSD A;  2VQF O;  1XL6 A;  4IYI A;  1OCC C;  2GBO A;  4J9Y B;  2OTJ V;  3OEH G;  1WP7 A;  1YIT V;  4DV2 B;  3A2F A;  3RYH B;  3CCJ V;  3ZHS A;  1NR7 A;  3TK1 A;  1JA8 A;  5HFL A;  4I9W A;  3B8M A;  1TGO A;  1V55 C;  5CA0 A;  2ZE8 A;  1NVP B;  1VQ6 V;  3VQV A;  1AJP A;  1YTF D;  1R6K A;  5L3E A;  5GON B;  5KAI Z;  4FLW A;  4FLT A;  1YJ9 V;  3OUS A;  3AG2 B;  3H1K H;  3BVO A;  2ZNJ A;  4TV9 B;  2HJD A;  3AG3 C;  2ILM A;  5LL6 Y;  4P2Z A;  1RPR A;  1OV9 A;  1WNS A;  2FTK A;  3ASN B;  4DR3 B;  2H94 A;  5K1X A;  1IBK O;  1K4C C;  3JAS A;  4LFC B;  5CA1 B;  5IJ0 B;  2PYL A;  1B06 A;  1R1B A;  2X6A A;  3ZHR A;  5BZB A;  3JYC A;  1ZWI C;  3STZ C;  4WBN A;  5LA6 A;  4FJC C;  1K4D C;  4YXW G;  4NTY A;  4JZ2 A;  1S0V A;  4DXW A;  5B3S C;  1DTO A;  2DE0 X;  5L3D A;  2WLK A;  4X88 A;  2UXB O;  3RBZ A;  2MW2 B;  1YXB A;  3K5M A;  3RT3 C;  4FFB B;  5LP6 B;  1M93 A;  4JYY A;  1ZL8 A;  4JYA O;  4O4J B;  2ZKO A;  2HVK C;  3OGI B;  1SA0 B;  2YIC A;  4D6T H;  1EBO A;  2HHH B;  4GUN A;  2ARH A;  4BWA A;  1G1X B;  1VP7 A;  1YEW A;  1BHB A;  4E4E A;  1FXH A;  3OR7 C;  1YVW A;  2HVJ C;  4JTD B;  2UUB O;  1XDC A;  3JSL A;  2BSK A;  4J11 A;  1JVM A;  2PF4 E;  4WFH A;  4GX0 A;  4ZKI A;  5EK0 A;  3IC7 A;  1O9H A;  1S3J A;  1ENV A;  1FS0 G;  1R3K C;  1H2M A;  2ADP A;  1KKC A;  1R3I C;  5BXZ A;  3H1I H;  1SF9 A;  3RN4 A;  3FB7 C;  2ZQM A;  1K73 W;  3ABT A;  1Z2G A;  2NR5 A;  1QVF U;  3SJB C;  2A06 H;  3TCU A;  3BAB A;  3E22 B;  2X6B A;  1BMF G;  4X65 B;  1SQG A;  1K5Q A;  1I94 O;  4GKJ O;  4JV5 B;  1BT8 A;  1G6U A;  3K57 A;  3BHP A;  1PL0 A;  4QNH B;  1US6 A;  2NN4 A;  4NXN O;  4O2B B;  3ABL B;  2CTP A;  2AZ0 A;  4CZZ A;  4FM2 A;  3OE7 G;  5D5P A;  4CH5 A;  1RM1 B;  3CMA V;  1JR9 A;  1PM9 A;  2CGO A;  1BCC H;  3G67 A;  3K0D A;  4DV2 O;  1Q6I A;  4ZIB A;  4LWS B;  5JH7 A;  1MG1 A;  2IU3 A;  2CTR A;  3ZRS A;  1YCI A;  5IYZ B;  1GN6 A;  4FMT A;  3X2Q B;  4I4T A;  4FLY A;  5C93 A;  4B3R B;  1AJQ A;  4FPP A;  1IXB A;  1GM8 A;  3BA8 A;  5EC2 C;  3E35 A;  1ROP A;  1OZ0 A;  3UT5 B;  2FB5 A;  2IBZ H;  4DR1 B;  1SS3 A;  1F51 A;  1V9P A;  1BQZ A;  1R6N A;  5K1P A;  3ASO B;  4WFA V;  2UXC B;  3FB5 C;  1QLN A;  3ZRW A;  1AI5 A;  4I0X B;  4U3J B;  3EFF K;  4FZ0 A;  4DR3 O;  2IM9 A;  2JJ2 G;  5KHK A;  3LSQ A;  1P4R A;  1BQ0 A;  3P3P A;  4IT5 A;  3JAR B;  5EBW C;  4J41 A;  2P22 C;  2ZCE A;  1NH2 D;  2Y0I A;  3N2G B;  4PJ0 Z;  1RSO A;  1IBM B;  3AG1 C;  2D3O W;  4DO2 A;  3ZCC A;  1S76 D;  2DYR B;  2OWO A;  3FFQ A;  1NS1 A;  2GV9 A;  5IT9 N;  4J7K A;  1IBL O;  1VF7 A;  4NYK A;  1UJW B;  2WLM A;  1VEW A;  2GUZ B;  2ZXW B;  3HKB B;  3CS5 A;  2ZIN A;  1TUE B;  4GLX A;  1U97 A;  5KUK A;  3DXR A;  2P6J A;  2HHH O;  4YIO A;  3AG2 C;  4GT1 A;  2XHB A;  5EYP A;  2B1I A;  1JJ2 U;  1J95 A;  5JWP A;  3ASN C;  2Z3Y A;  2C2A A;  3U10 A;  3HKC A;  5CA3 A;  2V1D A;  4RAI A;  1OHH G;  4DV0 O;  2XUM A;  2DMX A;  3THO A;  3QO8 A;  2JRI A;  4L8J A;  1DF5 A;  4GX5 A;  1WPB A;  3G6E V;  5KX5 B;  1KEC A;  1W0K G;  4QE7 A;  3W7W A;  2E75 B;  3JAL B;  1F4N A;  2B5U A;  1VQP V;  4B08 A;  3C90 A;  5JVD A;  2Q7E A;  4PV1 B;  5LP6 C;  4X65 O;  3B2E E;  2R9A A;  1JQ0 A;  3T4D A;  4JV5 O;  3HPL C;  5JQG A;  2KB1 A;  5J2T A;  3MHH C;  2X0L A;  2YSU B;  3IJ4 A;  1Q90 D;  3L71 H;  3ABU A;  1FJG B;  1NU1 H;  1EN4 A;  3H9V A;  4JF3 A;  1Z5V A;  3RYC A;  1CEZ A;  2P06 A;  5CB4 B;  1S5J A;  3HKE B;  4PDM A;  1HNW B;  3A0R A;  2FKX A;  2UUC B;  1ZSP A;  4N21 A;  4PA4 A;  2Y69 B;  4F4L A;  2F95 B;  4WFG A;  1F7Y A;  2YS8 A;  4EFB A;  2PY5 A;  3ZX6 A;  1SZT A;  5IE9 A;  3CP1 A;  1PKX A;  5DED A;  4CH4 A;  4P30 A;  1KQS U;  2LFR A;  5BR8 B;  4B3R O;  1KMI Z;  4DV7 B;  4I55 B;  2Q68 A;  2DQ3 A;  4NXM B;  4J7J A;  2Q67 A;  2IU0 A;  5HFM A;  2Q0O C;  1E79 G;  1H2G A;  2WA4 A;  1XI1 A;  1XIL A;  1UFI A;  4G28 B;  4DR1 O;  4IHJ A;  5CBG A;  3F5W C;  4DR7 B;  4GKK B;  4JI4 B;  5GTH Z;  5IDJ A;  3W7S A;  5JJE B;  2UXC O;  2Y4T A;  3QO7 A;  3ABL C;  3AK2 A;  2BCC H;  3OM3 B;  1FFX A;  1RM1 C;  4E2L A;  4O4L B;  1YIJ V;  1CXZ B;  1YTF B;  1TUB A;  1VQ8 V;  3RFR A;  1FXK B;  3OEE G;  4BAY A;  4D7S A;  1WP8 A;  1IBM O;  5KLV H;  2QSA A;  1JFF A;  3X2Q C;  2Q4P A;  5ITZ A;  4DRX A;  4LBE C;  4PHZ A;  1MSW D;  4O4H A;  1QHT A;  1KUQ A;  2DN9 A;  2CK3 G;  5KHH A;  4DV6 O;  1YSC A;  2P67 A;  5GW7 A;  3CXC U;  2EIM B;  2LGW A;  1Y67 A;  4MVQ A;  1I5Y A;  2QWN B;  5B1A C;  4RQE A;  2PZS A;  4ZI7 B;  3OR6 C;  4CH3 A;  3KG2 A;  3EHB B;  4MVO A;  4ZBM A;  1Q6H A;  1M57 B;  2A0L A;  4MVM A;  4QE9 A;  4CC5 A;  4KUM A;  4O2A B;  5LMN B;  3CYO A;  3VQW A;  3RYI A;  5EIB D;  4LNU B;  1NT2 B;  1HP8 A;  2DJV A;  1PD3 A;  2V4D A;  1GMG A;  4K35 A;  3JCU Z;  4J80 A;  4LFB O;  2XT9 A;  1VQO V;  3SR2 C;  2G38 A;  5AG2 A;  4K8X A;  3LDE A;  3R66 A;  2HFE C;  1GTO A;  4J42 A;  3AEI A;  3B4S A;  1IBK B;  2DYR C;  3CRR A;  2M7W A;  1WAZ A;  3HKD B;  3JAT A;  3UQ8 A;  1SQF A;  3BPZ A;  2OIE A;  4NB5 A;  2YEV A;  1ZLZ A;  5KMG A;  2QWR B;  1GN2 A;  1N32 B;  4X20 B;  3LDD A;  1FJG O;  3ZMU A;  3N2K A;  4CS2 A;  1HNW O;  2RMK B;  1TVK A;  1QLE B;  4H37 A;  4WCE V;  1QR9 A;  4TUY A;  2UUC O;  1H2N A;  2IW5 A;  3JAW A;  2KKW A;  5C8Y A;  5EBM C;  2Q9L A;  2IJJ A;  2BTO A;  5CA0 B;  1MAB G;  1N0N A;  1PL4 A;  4NVP A;  3TXQ A;  3BCC H;  4UVA A;  4B3S B;  4FM0 A;  4L87 A;  5BR8 O;  1B04 A;  4DV7 O;  1GKF A;  3A0H Z;  3K79 A;  1XHZ A;  4UCV A;  2WA3 A;  4CS3 A;  4HZ3 A;  4UCU A;  4NXM O;  2CGN A;  3WB0 A;  3RW0 A;  2Q8V A;  3W7T A;  4P9O A;  1SER A;  4JAV A;  1XHX A;  3E8G A;  1Y76 B;  3SYO A;  2P4K A;  4I50 A;  4DR4 B;  3CCU V;  1F4M A;  4DR7 O;  4GKK O;  2HJF C;  3E83 A;  4JI4 O;  1R6T A;  4D7T A;  5JJN B;  2Y48 A;  1IDS A;  3OTF A;  2QTO A;  5LGU A;  2RDC A;  4GKJ B;  5L3C A;  3WG7 B;  2Y69 C;  2ETN A;  3OMI B;  4MTX A;  2QM7 A;  1SET A;  4NXN B;  5A9G A;  3K04 A;  3UO2 A;  4X1Y A;  3RVZ A;  1EFR G;  1FPO A;  4MTG A;  2IJK A;  5J9P C;  1THZ A;  4UUJ C;  3ZJZ A;  2RNB A;  3ETE A;  5EBL C;  1BGY H;  1B3Q A;  1P7G A;  1Q3E A;  2EJ7 A;  2QR4 A;  1XOU A;  4W4L A;  4CBC A;  5B1B C;  1GRJ A;  1AP6 A;  1XNR B;  3E8B A;  3SPJ A;  2UXD B;  2FL4 A;  2AHY A;  1EN6 A;  4JI3 B;  1E1R G;  3APO A;  4Z1V A;  3SPG A;  1NH2 B;  2YIB A;  1XL4 A;  1U96 A;  4NTX A;  2BSK B;  3GB7 C;  3ABM B;  3M99 B;  4DW1 A;  4YJ2 A;  5LMN O;  2DWD C;  3E8H A;  3OD4 A;  2HEP A;  5KAF Z;  4ZOL B;  4DR2 B;  4RO2 A;  3CC4 V;  3AG7 A;  3B09 A;  4B3M B;  1FD9 A;  3T2M A;  1ARO P;  4LF5 B;  3CB2 A;  2L35 A;  5LOV A;  1EM1 A;  1FXK C;  4JYC A;  3SPH A;  3G4S V;  2YI9 A;  4JI5 B;  5LGN A;  1GO3 F;  3K9S A;  2ZNI A;  1QR8 A;  2P90 A;  2EBO A;  2RN9 A;  3SPI A;  3BAA A;  3L72 H;  2E74 B;  1COW G;  3CJH B;  3H1J H;  3K5N A;  2EIM C;  4MW8 A;  1NTZ H;  1N32 O;  4X64 B;  2NNU A;  2OTL V;  2Q73 A;  3FYI B;  1IBL B;  1RFY A;  1M57 C;  2ZDI C;  1E1Q G;  1Y66 A;  5EZY A;  2HLD G;  2DOS A;  2QKC A;  4FLZ A;  2OYQ A;  4H33 A;  4O4I B;  2H8P C;  1SKV A;  1W2B U;  1B6Q A;  4IYH A;  3SYA A;  1L8D A;  5JH7 B;  1QVG U;  2OCC B;  4I4T B;  2K9P A;  2JGU A;  4H13 B;  4UXN A;  4B3S O;  2AHZ A;  2R72 A;  2HG5 C;  4MVS A;  3RYH A;  2AXT Z;  4QPK A;  4DV0 B;  3TXS A;  1SC5 B;  4X89 A;  4R6Z A;  2QWQ B;  4KHP B;  1K34 A;  3WU2 Z;  3D8C A;  4QGP A;  4NTW A;  3JAK B;  2BOB C;  4DR4 O;  3D36 C;  4RUF A;  4X1I A;  3AK3 A;  3ZRW B;  5IJ9 B;  2Y0P A;  4WFE A;  1N33 B;  4JYB A;  3CCE V;  1QLE C;  2CE4 A;  4JI1 B;  4TV9 A;  2EIN B;  4UCO A;  2LW1 A;  5FLX N;  1Q81 W;  1NQT A;  2UXN A;  2YIB D;  4PD4 F;  4FFK A;  3K08 A;  4IGG A;  4U7O A;  5H2F Z;  4U7N A;  1TA8 A;  1MZE A;  3IAY A;  1IX9 A;  4X1K B;  4EB6 A;  5IYD O;  2A79 B;  3U11 A;  4BIZ A;  5JJJ B;  2ODM A;  1GM9 A;  2QM8 A;  4UCT A;  1LUV A;  2Y4U A;  2W0X A;  3DXR B;  1XNR O;  1FXV A;  2GDS A;  4YHH B;  2UXD O;  3K06 A;  3UCS C;  2JS5 A;  4JAA A;  1WPX A;  4JI3 O;  4PDV A;  3GWO A;  2IJI A;  4O4J A;  1SA0 A;  2VRZ A;  4FLU A;  4JZG A;  1NBM G;  2QA4 V;  1HR0 B;  4X8A A;  3G80 A;  4H44 B;  3HKC B;  1Q43 A;  1MZF A;  2GTA A;  3CCV V;  1S5H C;  4DR2 O;  4WFB V;  3WG7 C;  1R3L C;  4B3M O;  4K0K B;  1F23 A;  4LF5 O;  1XNQ O;  3ZN0 A;  5DEC A;  3IGA C;  4GZR B;  1FYJ A;  4MVR A;  4KXR A;  5L3G A;  3ZHT A;  1K5S A;  3FKS G;  3KCY A;  3TET A;  1YDX A;  3CSX A;  2YC0 A;  1OCR B;  4JI5 O;  3OGC C;  1MOF A;  3VQX A;  1CPY A;  1JPX A;  1P84 F;  2Q7H A;  3AK1 A;  3LNN A;  1XQ8 A;  2Q0A A;  2XTA A;  2KG7 A;  4X64 O;  2QKA A;  4JTA B;  2EZO A;  2JGD A;  3STL C;  3E22 A;  5LHI A;  2WLN A;  2B1G A;  4DV6 B;  4MSW C;  4JI6 B;  4Z2W A;  3OTO B;  4O2B A;  1K33 A;  4DV5 B;  2QWO B;  1T5E A;  1M56 B;  4LCU C;  4JAU A;  4WFF A;  4JTC B;  3CC2 V;  4DK1 A;  1BZK A;  5IYZ A;  2DQ0 A;  1Q86 W;  2F43 G;  4LFB B;  1SZX A;  2WWW A;  4KHP O;  1D5A A;  2LP7 A;  3APQ A;  1NR1 A;  1PNL A;  4MW3 A;  2O57 A;  3R65 A;  4LC1 A;  1PV0 A;  2WSS G;  3UT5 A;  2JVD A;  1N8R W;  2JDI G;  1JOY A;  4ABM A;  1M5I A;  1FFX B;  2QKS A;  2PTM A;  1N33 O;  1UPG A;  5CBF A;  3CRC A;  4HYO A;  2XAG A;  3FB8 C;  4JI1 O;  1TUB B;  1YJW V;  1XUQ A;  3OW2 U;  3RYF A;  2CAZ C;  3B8N A;  3OUF A;  2W6J G;  3JSN A;  3AG4 B;  1JFF B;  4PDR A;  2XAH A;  5ITZ B;  4DRX B;  1XMQ B;  2M6Y A;  2ZD9 A;  3KCX A;  4HNA A;  4NKG B;  4F6R A;  4O4H B;  3SGI A;  2ITC C;  1NI8 A;  2P4V A;  3BA9 A;  1FKA O;  5J2U A;  3FX7 A;  3ETG A;  3FD9 A;  1M4U A;  3ZIA G;  4TV8 B;  1XBL A;  1L0L H;  4FZ1 A;  4YHH O;  4KP4 A;  4AI8 A;  4AHC A;  2QM4 A;  2YXY A;  2PI4 A;  1M9N A;  1K9M W;  3B40 A;  2GUZ A;  1VQM V;  4XDL A;  1GAX A;  4PA9 A;  4G2K A;  2V7Q G;  2JEU A;  1WA8 B;  1NTM H;  1NTK H;  2ZIM A;  3RYI B;  1G8M A;  3C3T A;  1HR0 O;  5LYJ B;  1LUW A;  2EIN C;  1SQB H;  5B1O A;  3JD1 A;  1LR1 A;  2AW9 A;  3RWR D;  3ZBH A;  1OCC B;  4K0K O;  4UVB A;  4ZHQ A;  4OPH A;  1Q6U A;  4LH6 A;  4JI0 B;  2YXH A;  3PJS K;  5JCO A;  3SJC C;  1YJN V;  3JAT B;  1DF4 A;  1VQN V;  3A8T A;  5KX5 A;  2YEV B;  3O9O A;  3GVM A;  3BFR A;  1KP3 A;  3JAL A;  3JD3 A;  2AGA A;  5KMG B;  2B9Z A;  3UO3 A;  2CH7 A;  3TJT A;  5LHH A;  1KKD A;  3S3W A;  4B3T O;  3N2K B;  2YIA A;  1KB9 F;  2ZIO A;  1TVK B;  1L0N H;  3FB6 C;  3ABK B;  1A32 A;  2E5L B;  4JI6 O;  3JAW B;  4LH7 A;  3OTO O;  3E89 A;  3SPC A;  3QG5 A;  2QDO A;  5KUM A;  1P7B A;  2WLL B;  3QTC A;  5C8Y B;  2DW4 A;  3MD0 A;  4DV5 O;  2BOC C;  3JD2 A;  3QF7 A;  2F4V B;  1WLE A;  3MHS C;  1WB8 A;  2YI8 A;  3ASO C;  1HNX O;  1N34 B;  3VQY A;  2EIL B;  1HNZ B;  2EIK B;  3DC6 A;  4FM1 A;  1R73 A;  4PDL A;  3ZED A;  1GK9 A;  3ZMT A;  1K3E A;  1TAE A;  3Q4H B;  5LHG A;  4X66 B;  1YHQ V;  2DWE C;  1CP9 A;  1Q7Y W;  4W4K A;  4OXS A;  5EIB C;  4I50 B;  2CTQ A;  2HP8 A;  3O65 A;  5DM6 V;  4NR1 A;  4TT3 G;  1PPJ H;  1S72 V;  4PEL A;  3WB1 A;  2ZXW C;  2XAQ A;  4LF9 B;  2GTS A;  1X59 A;  3NXS A;  4MTF A;  3FAV A;  4BIU A;  3ZHV A;  4CS4 A;  4HBN A;  4MTO A;  1M56 C;  4R8C A;  1XMQ O;  3EXA A;  4RWU A;  1FXK A;  4GCZ A;  3SJA C;  4CH6 A;  2UUA B;  1XRE A;  1JJO A;  1AIL A;  3I56 V;  2UXX A;  4TOI A;  3HR0 A;  1Q82 W;  2YXL A;  3L70 H;  1OCO B;  4OGQ B;  4R50 A;  2DYS B;  5IWA O;  2F66 C;  4LP8 A;  1AI7 A;  1GN3 A;  3G71 V;  1NZ6 A;  2FML A;  4TWK A;  3T4Z A;  5CN0 A;  4YJ2 B;  3CE2 A;  2Q7G A;  4ICG A;  4ZI7 A;  2GSM B;  5BMV A;  1AB3 A;  1N36 B;  5E1A C;  1H2S B;  2Q69 A;  2YDE A;  1BE3 H;  3D3I A;  3C3S A;  4LF8 O;  2WLI A;  1EZJ A;  5LOV B;  3J80 N;  3M7M X;  4EKW A;  2EZP A;  5FNV A;  3CWB H;  1QNM A;  2BTQ A;  1I08 A;  2LFS A;  3ICX A;  2PYJ A;  2L6L A;  4JI0 O;  5H6Q A;  3JAS B;  4PI0 A;  4Q20 A;  1K7D A;  1KC8 W;  1XMO B;  2IH1 C;  2RQ6 A;  4WBN B;  1Y4M A;  3F5T A;  3F7Y C;  5LA6 B;  1M90 W;  3NR7 A;  4CC6 A;  4XDJ A;  3CPW U;  1BHA A;  1G4Y B;  5GTI Z;  1PNK A;  5A2Q N;  2XOK G;  1PNM A;  1GH6 A;  1ORQ C;  1AI6 A;  1KYO F;  1Q5O A;  1ZL8 B;  4JAS A;  1OCZ B;  4MVZ A;  4AQY B;  3VOU A;  2E5L O;  2OCH A;  4BW9 A;  3D36 A;  4X20 A;  5LMU B;  1ZTE A;  4GX2 A;  4YJ3 A;  1EN5 A;  3JAM N;  1YI2 V;  3CX5 F;  3DC5 A;  1AVM A;  3TGU H;  2F4V O;  5LXT A;  2EX3 A;  4B7E A;  3CRQ A;  1N34 O;  1HW7 A;  3KZI Z;  4DR5 B;  1SRY A;  3FYE B;  1VIB A;  4UB6 Z;  4F6E A;  1W59 A;  4IIJ A;  1HNZ O;  1VAR A;  3AG1 B;  2X6C A;  2PGG A;  1VQ7 V;  3ZN1 A;  1XNQ B;  3K58 A;  4X66 O;  3CCM V;  4FLX A;  4FVM A;  4X1I B;  1Y74 A;  2YID A;  4PA7 A;  4JI8 B;  3L74 H;  1AR1 B;  3K03 A;  4RQF A;  1NKD A;  3ABK C;  1K97 A;  1Y76 A;  4JI2 O;  4LF9 O;  1QCE A;  3D3Q A;  5IYC O;  3QVN A;  2P7T C;  5IY5 B;  1IZ3 A;  1WB7 A;  3L73 H;  1PP9 H;  4EB6 B;  2EIL C;  2IH3 C;  2A7W A;  4PA3 A;  4OPA A;  5KA6 A;  2F23 A;  2EIK C;  1P49 A;  2VWK A;  2UUA O;  4LFA B;  4PA6 A;  3CCQ V;  1AP5 A;  3ZMZ A;  4UB8 Z;  4DK0 A;  1M1K W;  2FYU H;  3IFX A;  5KA5 A;  3MDS A;  2WLJ A;  3ML0 A;  4MVU A;  1VQ9 V;  1I5X A;  1N36 O;  4OX9 B;  1VF6 C;  4IL6 Z;  1S77 D;  2XND G;  1JMK C;  1VQ5 V;  5D5Q A;  3CHX A;  4RUE A;  5GON A;  4MS2 A;  1DLB A;  4QIW F;  1H2L A;  4DR6 B;  4U3F H;  4ZOL A;  3H1H H;  3ZHU A;  4TSF G;  1XMO O;  4K3A A;  3LNM B;  5L3B A;  3U0Z A;  4YIP A;  4LF7 B;  2K1E A;  2WAM A;  1RSO B;  4KL1 A;  3JD4 A;  1QU7 A;  2KG7 B;  1I7F A;  2EUL A;  1OCO C;  3ETD A;  2DYS C;  2JGD B;  5CA1 A;  5IJ0 A;  4LR3 A;  3CME V;  1DGS A;  4JI7 B;  5H6R A;  3K3W A;  2RCV A;  1AI4 A;  5LGT A;  3CJH A;  3OT7 A;  4AQY O;  1J5E B;  2E3C A;  5EC1 C;  3JD0 A;  1W0J G;  2H3O A;  4UCS A;  5LMU O;  4DUZ O;  5EYP B;  4FFB A;  5LP6 A;  3OFN G;  2XAS A;  1GN4 A;  2N04 A;  4O4I A;  2ZM6 B;  3H01 A;  2LJ2 A;  4DR5 O;  3ZS8 C;  3BRC A;  2JEX A;  2VWJ A;  5BY1 A;  2E76 B;  1VQK V;  2PUS A;  2F93 B;  2OIG A;  3I55 V;  3ZRV A;  1H8H G;  3LUT B;  4PI2 A;  2YUA A;  1MA1 A;  5L3F A;  3SJQ C;  1VQ4 V;  3T1Y B;  4LF4 B;  5H5N A;  5B1A B;  2IJH A;  5JVD B;  3K5O A;  2R9R B;  1IUR A;  4JI8 O;  2QTS A;  1SQP H;  2XAF A;  1YZB A;  4C7U A;  3P30 A;  1OCZ C;  3IC9 A;  3L9D A;  2LW7 A;  1I0H A;  3RYF B;  3JAK A;  5JQG B;  5J2T B;  3S3X A;  4UVC A;  4GX1 A;  1K92 A;  5IJ9 A;  3ZMV A;  4DV3 B;  3UKM A;  5F2V O;  3RGB A;  2W0F C;  1YF2 A;  4B3T B;  3SYP A;  3RYC B;  3M8A A;  3W7X A;  4HNA B;  4F6R B;  4LFC O;  5DN6 G;  2CDY A;  4J10 A;  1NVP D;  3ABM C;  1N0J A;  1ZX3 A;  5J2U B;  2HKO A;  1FAF A;  2EJR A;  1O9G A;  4LFA O;  3H1L H;  1SQX H;  5B66 Z;  3CCS V;  1HNX B;  5KHG A;  3OMA B;  4X1K A;  3P32 A;  4LF6 B;  1KD1 W;  3CCL V;  4LWS A;  2QGN A;  3JCZ A;  3A0B Z;  3J81 N;  2X7R B;  3DTU B;  2WLH A;  5E79 Z;  4OX9 O;  3OMN B;  3G6B A;  1VF5 B;  1N4C A;  3LDC A;  4IHJ B;  1Y6X A;  4X62 B;  4ZHQ B;  1AR4 A;  1GM7 A;  4UFZ A;  5IY5 C;  4DR6 O;  2EIJ B;  2Z5U A;  1KP2 A;  1WJZ A;  3CCR V;  2AZ2 A;  4I0X A;  4U3J A;  4LF7 O;  4I9Q A;  2OCC C;  5H9C A;  5LBQ A;  2CH7 B;  1LNQ A;  1R3J C;  4TQD A;  1EZV H;  3K9A A;  3JAR A;  2F1M A;  1RP3 B;  2JIZ G;  4I7Z B;  3E86 A;  1V54 B;  4G27 B;  4JI7 O;  4N23 A;  5IYB O;  4FIP C;  2UU9 B;  1SES A;  1SQV H;  3WB2 A;  3N2G A;  3VBB A;  2R9I A;  3B77 A;  1J5E O;  4DV1 B;  1ZAU A;  5IWA B;  3CRM A;  4UCR A;  1H38 A;  1SQQ H;  1H8E G;  1FFT B;  4JGS A;  4AIL C;  3P3N A;  4YY3 B;  3HKB A;  2ZR2 A;  5B1N A;  2JS3 A;  3EVK A;  4FLV A;  1Z5W A;  2P5O A;  1JX9 A;  2ZM6 O;  2Q6A A;  4J9Z B;  2D2C B;  3CRA A;  3F7V C;  5CMU A;  2ITD C;  1NJI W;  4LF8 B;  3E2E A;  4DW0 A;  3OAA G;  3KKY A;  4GYC B;  5FPR A;  4DV4 B;  4UV9 A;  2JJ1 G;  2QWP B;  5B1B B;  3ZRX A;  3T1Y O;  4LF4 O;  3E8F A;  1D5N A;  2MK3 A;  1V55 B;  1OJH A;  1HWY A;  1DK1 A;  1VMG A;  3FAV B;  4A5U B;  4DV3 O;  5TIS Z;  2ZE7 A;  4BW5 A;  1URF A;  4UV8 A;  1HDJ A;  3DGE A;  2VQE B;  2CUG A;  4TUY B;  4FK5 C;  3AG3 B;  3T1H B;  1RPO A;  4DUY B;  2ZR3 A;  2VQF B;  5CB4 A;  1MNG A;  3HKE A;  3T1C A;  2ADQ B;  3QO5 A;  1L1F A;  4EFE A;  4JPR A;  4HAM A;  4DYL A;  4LF6 O;  3LSU A;  2OT5 A;  2XAJ A;  5FL7 G;  3K5L A;  4QPJ A;  4TV8 A;  5B3S B;  1OCR C;  5FPO A;  5BMV B;  4K8Z A;  1JCH A;  2QJ1 A;  2Z0A A;  2PI5 A;  3CC7 V;  4I5S A;  4I55 A;  3DSQ A;  2LQT A;  2WLI B;  1KBH A;  2A3Q A;  2N74 A;  1WA8 A;  3PN1 A;  5FNV B;  4X62 O;  2BTQ B;  4XDK A;  4ASU G;  2RJZ A;  5LYJ A;  3K0G A;  3SDL A;  3W7U A;  3CEI A;  1QQC A;  2N05 A;  3ZMS A;  3BEH A;  4JI2 B;  3I5D A;  2QE7 G;  1D2D A;  3UM7 A;  2Q5Z A;  3BY6 A;  4Q6G A;  4X1Y B;  2GHY A;  4O4L A;  4X9Q A;  1X4T A;  4EEQ A;  2BE3 A;  2ATK C;  1BSM A;  2UU9 O;  1K8A W;  2UXB B;  4B7K A;  1H2K A;  2ZE6 A;  4DV1 O;  3SYQ A;  2CTW A;  1BL8 A;  4YJ3 B;  4JYA B;  1IXM A;  5LXT B;  4YY3 O;  1VQL V;  3MAQ A;  2WLL A;  4IIJ B;  3WFV A;  2R70 A;  4XBF A;  5JCO C;  4KFM A;  2LO1 A;  4TQF A;  1AJN A;  2KSD A;  2EIJ C;  2ZT9 B;  2UUB B;  2KQX A;  2ZDI A;  4BIO A;  3CXH F;  1Q8I A;  2QEX V;  4P9P A;  4O2A A;  3ZHQ A;  3HB3 B;  2LGQ A;  4DV4 O;  4R7C A;  3AG4 C;  3RVY A; 
#chains in the Genus database with same CATH homology
 4IT5 A;  4J7Z A;  4RWU A;  1HDJ A;  2EJ7 A;  2CUG A;  1IUR A;  2DMX A;  2YS8 A;  2LGW A;  2QWN B;  3BVO A;  3AG7 A;  2QWQ B;  2CTR A;  2OCH A;  2N05 A;  2Y4U A;  2LO1 A;  4J80 A;  2QWR B;  1XBL A;  1BQZ A;  2QWO B;  1FAF A;  1WJZ A;  3UCS C;  2KQX A;  2QSA A;  1N4C A;  3APQ A;  3UO2 A;  2CTW A;  2YUA A;  2CTP A;  3APO A;  3UO3 A;  2Y4T A;  1FPO A;  2CTQ A;  2GUZ A;  1NZ6 A;  2PF4 E;  2M6Y A;  2QWP B;  2L6L A;  2N04 A;  1GH6 A;  1BQ0 A;  2GUZ B;  2DN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...