The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
83
|
sequence length |
269
|
structure length |
269
|
Chain Sequence |
DRMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The crystal structure of a protein of unknown function from Corynebacterium glutamicum ATCC 13032
rcsb |
| source organism |
Corynebacterium glutamicum atcc 13032
|
| molecule tags |
Structural genomics, unknown function
|
| molecule keywords |
Hypothetical protein Cgl1923
|
| total genus |
83
|
| structure length |
269
|
| sequence length |
269
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2007-03-23 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09754 | PAC2 | PAC2 family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix Hairpins | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
