2P90A

The crystal structure of a protein of unknown function from corynebacterium glutamicum atcc 13032
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
269
Chain Sequence
DRMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a protein of unknown function from Corynebacterium glutamicum ATCC 13032
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Cgl1923
total genus 83
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p90A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2p90A01
3W7UA 1NH2B 1YTFB 1S3JA 4HAMA 3W7XA 5GW7A 3IC7A 3W7WA 1NVPB 3MNFA 2P90A 2WAMA 5CA3A 3VR0A 4G4SP 2HR3A 3E35A 3BY6A 3WZ2A 1RM1C 3W7TA 3D3IA 3W7SA 3GAAA
chains in the Genus database with same CATH superfamily
4LI0A 5C7IO 1VQ8V 1SVNA 3O3MB 1OROA 4NLLA 3FLMA 4BRWA 1RIFA 1T0PA 1XEWX 5AG2A 1EESA 3SX2A 2GF2A 1PZMA 5L3BA 1YFKA 2F8MA 5EIOA 1X70A 4D0SA 1GNRA 1US8B 2PX8A 1MRZA 4R41A 1AUVA 4EL5A 5JO9A 3WV5A 1ZESA 2R48A 3T4UA 4QRHA 4D98A 4H4DA 3OPNA 4N6GA 3N2KA 1M1YA 3ST7A 1WCIB 3HC7A 1JTVA 4IILA 4J0HA 5KCMA 3V7UA 4M3NA 1LA2A 1KEEB 1F51A 2P3SA 3JVEA 5A5GA 5JH7F 3GEDA 2OGUA 4J91A 5DNEA 4XSGA 1M34E 2QBYB 4F4HA 1E1RG 3L4KA 3U4HA 4C29A 5TQ0A 2B94A 5H3LA 3LFHA 1SQBH 1U7WA 3MIZA 5JBIA 2C3UA 4PAGA 5CDUA 3AHIA 1QHFA 2NX2A 3WRXC 1V8PA 3SYPA 1KIMA 1C2YA 1CY2A 4AWAA 2BH2A 4YJFA 4F56A 3ELWA 2OKCA 3H2IA 1PNMA 2GPSA 2OPHA 3VMMA 3QXSA 4QBHA 4B4VA 4XRGA 4QOFA 1ESDA 4TTQA 4WFQA 1K9MW 5EIXA 3FVTA 1URFA 1GRRA 3L6UA 1J2YA 1MTOA 2ZBVA 2HVKC 1DBRA 4I55A 1K08A 4IT5A 3BFVA 4NATA 4UTPA 3R0ZA 2X0KA 2XSZA 1JDZA 2YNMA 1OILA 1NKTA 1Z2DA 4J7AA 3E53A 2IL1A 4P38A 4QU0A 1F51E 1HORA 4ZT5A 1EQUA 4ACBA 3UV3A 1ZL2A 3K9BA 4PZ9A 4U5XA 1O57A 3EY4A 1TQ4A 2ZRBA 5BSTA 2BJHA 1JT2A 1M1YE 4R9NA 1X77A 1KJ8A 3E5MA 4KWHA 4OH1A 1P3Y1 1SQ0A 1W44A 2WA4A 3CO5A 3L4BA 1O95C 4HB0A 4JLPA 1R1DA 2J45A 3L7BA 4N5LA 4YCDA 4DTCA 2A1TS 3HKBB 3IUYA 4ZCQA 3WYAA 3W3AH 1M1UA 3QLUC 4Q7MB 1W85B 3IAEA 1ZI9A 2C98A 3DO8A 4XVCA 1G16A 3G5AA 5ED0A 2DOSA 3DTVB 3T0IA 3KU1A 4RGVA 1P4HA 1TTQB 4FSDA 2PXXA 1KGDA 3RB8A 4RTPA 2RNBA 4FFBA 2JFYA 2QRJA 1FYWA 2D7JA 2ODWA 4KAXA 2HL6A 4INAA 2O8BB 1ENPA 5KWVA 4I9FA 1KORA 1XB2A 5EN4A 2CLFB 3H2ZA 3VNVA 3CCEV 4CN9A 4HQRA 3AEYA 3CLRC 1F6WA 2RCNA 4JI6B 3K4QA 2GPBA 3SXJA 4B9EA 1Q1GA 2OLKA 4DR6O 3GNTA 4WPGA 2UYCA 1ZX3A 4J11A 4YP6A 5JBQA 2CVQA 4EZIA 1X94A 2QGFA 5AVKA 4CMIB 3L1VA 1ZD1A 1EXNA 3E9MA 2DYRB 5JATA 2QYSA 4EOGA 6NULA 2O4CA 2QP4A 4F2PA 1A7AA 1K5DA 1X1CA 4D96A 3STTA 4WJZA 4B1FA 4GFDA 4HL6A 1KAMA 4XX0A 4MTGA 4PQGA 2VBGA 1THZA 1P81A 2QPLA 2YOHA 4FEGA 2WF9A 3RNLA 1VM6A 5L3ZA 4B8YA 3T54A 1HWYA 1XC7A 2QG6A 4ECAA 2QTVB 3W8NA 3PEWA 3IEIA 4M1KA 2YRFA 2CYCA 3QHPA 4HWSA 4WOKA 3WWYA 1GZ7A 2ZBEA 2O8FB 3R65A 2C0CA 5D3MB 4YR7A 1UEIA 3SPCA 5CM2Z 4QSMA 1ZICA 4RENA 3KOUA 3M6VA 2OV4A 2V74B 2J0EA 4CL0A 1G8FA 3IAAA 4EEXA 1HQDA 1MU0A 4TPKA 3WLIA 4CRWB 2A06H 1XU9A 4YCBA 2O48X 5E9JA 5ALMA 1OC4A 1QSGA 4WADA 2EYQA 3DT9A 2W8BA 4ZT2A 4R9SA 2QW1A 3LRXA 4J3NA 3BTUA 4X44A 2H1CA 3PLAE 1AHPA 1O6ZA 4C1BA 4RHTA 1DEAA 5KOHA 2IYEA 5JFGA 1TM7E 4UFZA 1EFAA 2I91A 4YDRA 1XHFA 3SX0A 3JU3A 5TT1A 3UJ3X 4KXQA 2AOTB 5IX8A 1JV2B 3OM3B 1H9CA 2JEUA 1QKKA 4X84A 5GOTA 3ZVNA 4DPMA 4EA8A 4CDGA 1JCHA 2B9ZA 4TV9A 1OPXA 4F9GA 2NUTB 1P2BA 1A9PA 5B3AA 3OZSA 5TGTA 5I5GA 3GWOA 4EEZA 5LJLA 3NBQA 4X7RA 2GYWA 4ACAA 1T36B 1HL3A 4ON9A 1EX1A 2F1OA 4AO8A 4H4CA 3MWKA 1F8FA 3LDGA 1LRJA 2WHYA 4QC2A 1ONOA 1TB4A 4DYDA 4MQLA 3KB6A 3MTGA 1WSAA 3AJ8A 3W78A 4L4SA 4DJDC 2AHYA 3DE7X 5EWJA 3QXXA 2GF9A 3KEFA 2X41A 2EIJC 1DTWA 3BHJA 5AVUA 4DY6A 3R0VA 4UPDA 1H3EA 3ZDXB 1PVVA 1MGPA 3ZCQA 2JEZA 5HFMA 4PI0A 3MHSC 4MEJA 2EC5A 2GEFA 3SYAA 5EIAA 421PA 2XR1A 3ZD9A 1YJ5A 3PLRA 1TC2A 4V2UA 2ES4A 4AS2A 5CEFA 5D5PA 2EV9A 4G67A 3VR4D 3IKLA 1VLVA 3OCWA 3F3YA 2Y6UA 3X2FA 2X6CA 1CDEA 2NWQA 3FDJA 3CD6V 1EINA 1PT7A 1EFPA 3O75A 2C9YA 1EXMA 3UGKA 5L3SA 1QDEA 4RKWA 4M53A 5BQXA 2QD4A 1WUJS 2ZM6O 1YE8A 2QTFA 5EIBD 1D1QA 4TQAA 4E5MA 1XD2A 4IWYA 1TU0A 1U81A 1KIAA 4M83A 3JQQA 3OECA 2P78A 1ZRMA 1QFSA 1X2BA 5I9MA 2X6AA 4EQZA 1FS6A 3DDWA 3GVCA 3SKVA 5JNTA 1K34A 2JCSA 4HX5A 1MPTA 2VXBA 1NR7A 3GD5A 5CGZA 3G0DA 3SZGA 3ZKWB 4BKPA 4KTVE 4F96A 1PEYA 2JIZA 4OQXA 1GITA 4BCBA 4MI6A 4CH5A 4GI1A 3RRZA 4DA9A 4LYHA 5BV1A 3RSZA 4ZKDA 5JS8A 2WA1A 2IK8A 3KAPA 1P45A 1KUQA 4A15A 4ARZB 4P9PA 3FM9A 3O7MA 2E82A 2H7CA 4M9UA 4XPZA 5DTJA 5IH3A 5DW0A 1PFWA 4Z4FA 1IZ3A 1CXZB 1IHUA 2ZE6A 1FCJA 2EKLA 2ECPA 3A1TA 4Y1RB 4LFAO 3ZE9A 5JV5A 4G81A 1SCIA 2J6CA 1G98A 3D64A 3ZVKA 1HY3A 4I2NA 4JT2A 5B1DA 4OIFA 3VPGA 1Y63A 4K35A 3I4CA 3HR8A 1SRRA 3QENA 2I2DA 2YHSA 3E5NA 4ZWNA 1UBEA 1H93A 4ZVLA 4BQNA 2CDCA 1ZFNA 4DL9A 2ZIXB 1WY5A 4MVOA 2GRUA 1G8AA 2CE2X 2EKZA 3ZDQA 5KU1A 4KI7A 4L50A 4J0JA 3RS0A 4TQDA 3NNSA 1QHGA 3OE1A 3CWZA 5BV2P 4UBMA 1FOEB 2H63A 5KAIZ 2R6HA 1F7YA 3VU3A 1KAGA 3MJVA 1DAEA 1VHQA 4CMJA 3A3KA 1DFGA 4IXMA 1KJYA 1PR9A 4WKPA 1E96A 3D3JA 4KLCA 3KQUA 4KI0A 6GPBA 2SBTA 1WNSA 2TMKA 5BMVA 2ZBUA 1VG8A 3V4VB 2PUEA 2O19A 1THTA 3DVAB 2IH4A 4CUJA 3B09A 4JC4A 1ULSA 2BTQA 3KQWA 2I2AA 4HGNA 1A5BB 3KR9A 4FB4A 1OYVA 1AKRA 5GP1A 4B76A 3VHXA 1TKCA 3KLPX 2R00C 4Q24A 2FMHA 4KR0A 2PDAA 4TQ9A 4AHCA 1KKUA 3CV3A 4CV1A 2XAFA 4D8VA 3U09A 4EF5A 1SXJE 3I4FA 2R1VB 4DSOA 3DOHA 4Y0VA 1COWD 3BWBA 2PJDA 3BIOA 1LRLA 3CLTC 3L8YA 3CS5A 3B9RA 3M9WA 1V95A 3A58B 3U44B 2PX3A 3ABMC 1OKKD 4HAOA 2X7HA 4RZ2A 4E88A 4WNAB 3OP1A 4DV7B 2R84A 1S2GA 2BDEA 3STWA 5DHQA 4BC0A 4DXDA 3HDVA 3WK8A 2G76A 4PCLA 3PWTA 1T3HA 3EC1A 2DT8A 4HEA6 5H6RA 4D7SA 1NATA 1ADJA 1WZCA 2OHHA 1I6KA 1X7ZB 3IQDB 4FN5A 1DAKA 2G9NA 1LDBA 3WGLA 4EGQA 3KS9A 3NAZA 2A1UB 2V6GA 1Z39A 1WMEA 3NVAA 3BA6A 4IRUB 5ILGA 1EGMB 4WLVA 2Q5LA 5CUQA 5EJ8A 3LSSA 4PCAA 1WU7A 3SLKA 1WTCA 3V9PA 1ZDMA 5FPQA 1IVNA 4P54A 4XDHA 3JASA 4GYCB 1O94D 2FUKA 3RU3A 1LZLA 1VQ9V 3W6PA 4W5WA 4CI9A 1FP4B 1L4GA 1NW8A 3A3YA 1ZMXA 3MWYW 4J2OA 2Z2XA 4HDAA 1U97A 2NTNA 4DUYO 3EEBA 4MVJH 5KSWB 2HX1A 2LVBA 3FYSA 5FA6A 4ZC1A 3WIEA 4KGDA 4ABTA 1QOQB 4NCHA 4UEWA 1VYUA 3RSGA 3ZU2A 4EPXA 5KOYA 2XQJA 2NM0A 5NULA 5B1YA 1RKUA 4L8LA 3T5CA 5LYJB 1EUYA 3O93A 1Z5VA 2FPLA 1H69A 2IJHA 1RU3A 2DY1A 2YFYA 4X3PA 4MV9A 1KJWA 1M0WA 4MWOA 3TX6A 4BZQA 4EW1A 3I0ZA 4K9DA 1G5RA 5F51A 4Z2YA 2HA5A 4MW8A 1Z5OA 4CM9D 2XEDA 1G4YB 1Z3IX 2F9LA 1HOTA 3H9CA 3QFRA 4POAA 3SEQA 5CJJA 5DEDA 2XMZA 3RUHA 1NGSA 4OFWA 1SCNE 5IVPA 5CT4A 3U7QA 5GJWC 5DM70 3PDIB 3A0RA 1B8VA 3AZPA 4IUBS 2PUBA 2FWNA 1YI2V 1IK6A 3N3AC 3K20A 3T7RA 4M8KA 1YS9A 1MC1A 3C0KA 4FFOA 4YRTA 5CVVA 1IQUA 4O1MA 4JJGA 1M57B 1J2JA 2V4DA 5I48A 1P5RA 2A6PA 4LOHA 4I1IA 1BXZA 4DG9A 5KYXB 3WA7A 1QTQA 4G86A 4HNQA 2WTBA 2GXQA 3I04A 2RK3A 1GZ5A 3UMSA 3LCRA 4XH9B 1BGVA 1TVKB 1W0KG 1MRSA 3K5OA 1QX4A 2C9ZA 1Y9JA 2WF7A 3M7IA 4W63A 4C4RA 4Z4GA 2WTAA 1RJEA 3UJ9A 5HQTA 4O33A 3PFIA 4TMTA 4JL6A 5F1KA 3RJZA 5K8IA 4FJ1A 1Q11A 2A57A 2E9SA 3TZEA 4JXZA 1DRUA 5KJEA 3GEGA 4AJJA 1DX6A 1I0HA 1TMOA 4I1OA 3W0LB 4UTVA 1WSDA 3G2IA 3CWCA 1FLNA 1DO2A 5D3ZA 4Q1AA 3VKGA 1QQ7A 2IYNA 1XDCA 3GYGA 2ADFA 3PGA1 1BRMA 1QWSA 5BUCA 3DWGA 4LFCO 1MJHA 1Z83A 2W6JD 3DOCA 3VJKA 3W8FA 4AXXA 3O83A 3TNJA 1P7BA 3MB5A 2FSHA 3X2QB 2ZANA 1PF7E 3FBGA 4FW8A 2H1SA 1M33A 3FR8A 4HAZA 4QYXA 1EM8B 4JIGA 3EE6A 2IS4A 2ZRPA 4S35A 1R0XA 3L05A 5D5QA 5CRIA 3KSBC 2O14A 1XTTA 3ACDA 1EGQA 3IUMA 4LH6A 3HN7A 2AF4C 4HDRA 2F64A 4UU0A 3T38A 4C5BA 4NZYA 4EJSC 4AL4A 1YBVA 4TRNA 5B4TA 3CXHF 1JEJA 3JZAA 3F78A 1VFPA 2CF6A 2R9VA 2VA8A 1ESCA 4MUNA 3BMNB 3G2LA 1DAMA 1SUDA 2R6CA 3H1TA 1NI3A 1N6RA 3JQ7A 4CQMB 1YHZA 4X91A 5I5EA 1VF7A 2YY6A 3DEKA 3O94A 1NKVA 3S0JA 3ZNOA 3L7LA 5JNWA 3RM3A 2AJLI 5ERYA 1PRYA 4TTAA 1RM1C 3FIJA 2APJA 3Q6MA 4KLRA 1QIJA 2A9VA 4ZFNA 1PG2A 1JW9B 3GLGA 4MDFA 3DBLA 1TEVA 5D7BA 3F5FA 2I80A 3CSDA 2Y1DA 2DE0X 4D6TH 1KFEB 3IFXA 5IULC 3G5TA 3SQOA 3KB2A 1YR3A 1IXRC 2X8WA 1SHZA 1AK2A 1CUBA 3HBNA 2WU0A 3NCHA 4MYRA 4YAIA 1CUGA 3ZEDA 2Y27A 2VA9A 3VXKA 5F9FA 1XMOB 4MTCA 4TKUB 1KMIZ 3TTSA 4BV9A 4EHFA 1JKFA 1OE0A 1N7IA 2OAGA 2IJJA 2GWRA 1R3LC 3ICCA 2A2ZA 3EB9A 4D7AA 2JGFA 5EZYF 2J7PD 3TW4A 2B8EA 4QJBA 2F95B 5COAA 4URHA 5AW5A 2B5UA 3S2IA 3OTIA 2BTEA 2XGJA 3CVJA 2XUGA 1GPBA 3D7RA 2PH5A 3NB0A 1J07A 4DBZA 3CPHA 2KE5A 3F6RA 1Q83A 3WGTA 3D7MA 1KQ3A 2Q46A 3HCOA 3EVEA 3DE2X 4GH5A 3SJCA 2H94A 3WLEA 4BJ5A 1EP2B 2VKTA 2H1OA 4NCAA 4FK5C 5IJ9A 3N5KA 3LT0A 2YWDA 3ZY2A 1ENZA 2PFSA 3AR3A 4CKEB 4L51A 5KVCA 1GNSA 1M9NA 1T3ZA 1J95A 4NF2A 3C8UA 1ZVVA 1YU6A 3TOCA 2VJMA 4UVEA 1GNQA 1R5OA 1NU6A 2JI6A 3BG5A 3K0AA 1CC1S 5BXYA 5K03A 3VC1A 4YCAA 3T0FA 5JAOA 2W2VA 4KREA 2JG3A 2HLNA 3LCUA 4ZALA 3HI6A 4DV6B 3ZGZA 3BGVA 1UDRA 3VPSA 3FNQA 4WDQA 4CMIA 3K5PA 1FP1D 2IOQA 3WYGA 4ZCRA 1F3LA 4P3NA 5TVKA 4BMNA 1HI9A 1CRLA 4ZO7A 5THXA 5KTRA 5KO2A 3WLMA 3WE7A 1SQ5A 3IPRA 3QJ5A 3SY8A 3NTUA 3VKHA 2OQIA 5DI3B 3VDMA 3ZS8A 2VF5X 4RSHA 3MJSA 1Q50A 2E55A 4RKQA 1NH2B 5FHRA 3ZHQA 3AOEC 4FZ1A 3Q2IA 3U2QA 4JI7O 1YE3A 2X0LA 3OJWA 2O1XA 5FB3A 2PA3A 1ZR4A 2IEGA 1ACLA 4J10A 4EYSA 3RKSA 3QEOA 3SYKA 2OVFA 3JX9A 4YRGA 1CJMA 1H5QA 3L93A 4MB0A 2O3TA 5J2UB 5SV2A 5J5CA 1U0FA 1UFIA 1J9ZA 3F8TA 1WKCA 2BR5A 3UK0A 1P0MA 2YIDA 4AY4A 2V58A 2XB4A 3DDCA 4AKHA 1IXYA 2Q3EA 3EVCA 2P1RA 3LPDA 1J22A 3ORFA 3OX1A 4Y6RA 4JI0B 3VNAA 4B79A 4S1OA 5C80A 4TQUS 5LBTA 4MVQA 4NYJR 4KFMA 1B2LA 1MH1A 1OLOA 3D4BA 4JI6O 3MW8A 3IOCA 1LFDB 3UANA 4Q20A 3ZHCA 2CGOA 3DD1A 4Z9AA 4BY9E 1BCCH 4XUDA 3SZMA 1GGFA 1QK3A 2VUHB 3IAM1 3IBSA 3P9IA 5K4AA 1JLSA 2GT1A 4MVZA 1LSJA 4DUZB 1LLQA 1XZKA 2JJ2D 4IOMA 4XQCA 5JC8A 4IS2A 4OK5A 1EWTA 3LSTA 2XT0A 2RB5A 4TLEA 5CYFA 6LDHA 5K5EA 2HEIA 1T5DX 2GKGA 1S77D 5JECA 5KC8A 2PLAA 3TQIA 2XCSB 3VOBA 1TJ3A 5IY5C 2Y9MB 1VPVA 1IZ9A 4UZSA 7REQB 2RN9A 3GB9A 1E62A 1XEXA 2QK4A 5LBQA 1VCOA 3EZFA 1TD9A 3M4JA 4JWTA 3UCSC 4R4JA 4HZUA 3ESRA 1JEDA 1RW4A 5F5LA 1AV6A 3N0RA 1UJ6A 1U31A 1GYPA 3P0IA 4HRAA 3OR7C 2PH1A 4QQKA 4ZYLA 5H3HA 2VF7A 3S8YA 3UMMA 3DXXA 5IE9A 5LHGA 4X85A 1RLMA 4PE5B 1YH3A 3NORA 3RLIA 2M6YA 2ZQMA 2NPIA 3ZCXA 3EF1A 1B8PA 4MHSA 1MABG 4LJ5A 1IVSA 2WJ3A 5CTAA 1NBIA 4C4TA 3NHUA 3AG1B 2MWMA 2QN9A 4GM0A 5K2MA 3SG0A 1DC4A 4UCUA 2NUPA 1P17A 4O0LA 3WGNA 2CGEA 3GBPA 3JAWA 1GHTA 2WKWA 1W5EA 1X38A 2JAOA 5EXTA 2BTOA 2ZSDA 4IDCA 3GDGA 4YBRA 3TCNA 4X9QA 4ZDKA 1DIBA 4IXNA 3S1LA 4WMLA 4AQ7A 4HQNA 2DHEA 1VIYA 5THQA 3U3KA 2GCOB 2WUWE 4KWCA 4BLVA 2OV2A 4LX0A 1SG9A 1KAOA 2ZIOA 1RQGA 3U1BA 3NHRA 4RAIA 3LGXA 4MNTA 1OCRC 5H5NA 3GT4A 3HRHA 2H0QA 4WT7A 4X54A 4PF1A 3RYCB 3B6JA 3ZCUA 3GLGB 5DTMA 3NDBB 1G59A 4EUKA 1TYDE 2H54A 1PNVA 3V8EA 3MDSA 3O65A 2Q5QA 3DT6A 3OKAA 1R9JA 3HA7A 2Q4PA 3IT0A 4GICA 4H17A 2D62A 3V8BA 5I7HA 4MICA 5FUYA 5SZKB 1T2NA 5DVZA 3RFFA 4UNIA 5B7NA 3ZJVA 1YVUA 2P30A 3B3FA 4CS4A 3PCRB 1VIVA 3I52A 2I78A 2GCNA 5IT5A 3FAVA 1XWFA 1Q5PA 2R2AA 4M89A 2PYLA 2WQ7A 2E4YA 2UUPA 3E9QA 2JLBA 4LC9A 2UYOA 5FA5A 3TW6A 2FMXA 1C9DB 3Q7EA 1PUJA 1JH9A 5E4FA 3C90A 1XXHA 1V16A 1S02A 2NSLA 2YZMA 3O2SB 3AF5A 1Z2NX 4C3ZA 3DCNA 3L02A 4FFSA 1SUWA 2QAIA 3G8CA 1REQA 3TFWA 4MYHA 4S1VA 5LP6B 4WY2A 3S7TA 1M6YA 2AHRA 3BWYA 5E2IA 5CFRA 3IPCA 3EPLA 4F1KA 4UREA 4W1SA 1LJUA 1NUTA 4CTJA 3A6PC 2O8BA 3DGFC 4FONA 1V39A 4Z7QB 1GRCA 1UWCA 1L0LH 5F1PA 1V4BA 5AUOB 3CISA 1Z8NA 2QRKA 4Y18A 3KUKA 1GNVA 3OJOA 4P4SA 3RIEA 5AM1A 1QFYA 2ZT8A 4KKXB 3D3EA 4J41A 1T5BA 1GCGA 1JGTA 2ADOA 4AWXA 4J0EA 4X1YA 1DAPA 2WQ6A 4HAXA 3FCUB 4YR9A 5E7IA 2X8BA 3O0DA 2DFNA 3V8VA 4NECA 2O1WA 1E66A 1Z4IA 4PAQA 1B04A 5CR9A 3JRNA 1H42A 4R7GA 4TL6A 5EAIA 2Y4TA 2EZTA 3SDSA 4LG1A 3ZU3A 3X0DA 2HA3A 3OVMA 4GMGA 2FFRA 3ICEA 4DDVA 2CFSA 4RUEA 4O4HB 5K3SA 2PKXA 2GGSA 1IM5A 2WWFA 4P3KA 4JFAA 1AG9A 3HB9A 3JPYA 4FGWA 4JI0O 2R9AA 4IDGA 1L4HA 4TMVA 4AX8A 1NL3A 1KOJA 4HZUB 4K86A 1I7PA 4NBTA 1Q5OA 4MVJP 2HFJA 4TWBA 5BORA 3AXSA 3NPAA 2BSAA 2IP2A 4IJQA 3R9IA 5K0FA 1EJBA 1DHTA 4BZZA 4EI9A 2DJ5A 1C4WA 3KWFA 1PHPA 1GYRA 3EJWA 3NLLA 5DM60 2NSHA 1CF4A 1YMQA 4KVZA 5J4VA 3H1KH 4ZN6A 1JG2A 2QZSA 1GKUB 1XPUA 3OIDA 1UIRA 2J3LA 3NHJA 2H65A 3LA8A 4G2TA 3S28A 1PJSA 4EELA 5JZMA 3C3TA 5EC8A 3K0FA 2Q1TA 4LY6A 4QO8A 4F7WA 4FYXA 5K0ZA 1G1XB 1XZIA 2Z4RA 4ASUA 2WM9B 1EUCA 4J9YB 3PIRA 4PNHA 3WLFA 3SK0A 4V1CI 2QYOA 2CLSA 4FYMA 4OAQA 3LQ4A 3WKDA 3QWAA 2C5LA 2JNWA 4E03A 2CFOA 3I9KA 1JQJC 1U8CB 4F3NA 3JSXA 2QTBA 3EQ2A 4NZZA 1VP3A 4QJFB 1N9GA 2GVDC 1B6QA 5F73A 1P1KA 3NOOA 4I4LA 3ADCA 5FBRB 4LF9O 3FYTA 3VNRA 4DCTA 2OZEA 4K8XA 1NVVQ 4M7OA 4PO3X 2K5UA 4RIIA 1GWNA 4O4JF 1KF0A 4GC9A 4A92A 1LX7A 1TT5B 2A35A 2JA2A 4FHDA 4H0LB 4JF3A 3LL4A 1QP8A 2EIJB 4YLYA 1US8A 3ETCA 4OBEA 3BQ9A 4QO7A 1GA6A 1CUYA 1EP9A 1HQCA 3BDIA 3GGPA 4R3WA 1Z75A 4NS1A 1Q0TA 1K5HA 3OHPA 3NIDB 2WWRA 3CWBH 1IOWA 1AIPA 2AQ8A 3OPYA 2R8ZA 3NATA 4N5HX 5FQOA 2FKAA 1OREA 2Y1WA 3KHKA 4V0OA 2YW2A 1UP7A 1AKQA 4DJTA 3CCMV 4KWIA 3ABZA 2HA7A 3FFWA 3MJFA 4DUZO 1T24A 1X7XA 2DHDA 4UQOA 2QWXA 5GZ6A 3WGGA 2F9MA 1UDCA 3K06A 2F8TA 1X0XA 2VLIA 1NBAA 4R6ZA 1WMDA 2BGNA 4PYMA 1YA4A 5KYUA 3WGHA 1IDSA 1MQAA 2QJ1A 4E2YA 2GA9A 4CN8A 5AVXA 2XB8A 8ADHA 3H7IA 4G89A 2OVBA 2X76A 1GN8A 3NHYA 4L5YA 4PYLA 4R8KA 1YA8A 2XZDA 3PRHA 2GCGA 4XR4A 2DFTA 2W4QA 3E2EA 2VQ3A 3FW1A 4R05A 1PJ3A 2Y1LA 3EAFA 2O8EB 1X7HA 3EQ6A 3EZ7A 4IYIA 1GUDA 2JARA 4CIYA 1Z13A 2PV7A 4G25A 3BDVA 4WBNB 3HR4A 2HP8A 4BQEA 2Q9CA 1NVWQ 1YZKA 1YIDA 2PRYA 4Q7QA 4Z2AA 3N27A 1KYYA 2MJLA 5HF9A 1EI9A 2QXTA 3IFSA 4Q1DA 2B1QA 4BX8A 2IPLA 4DMUB 5KTSA 3WFJA 1WW2A 1AA6A 1YOVA 3EUFA 5U4XA 4B3MO 4R7TA 5BOSA 1CNEA 3B6ZA 1JE1A 3K9HA 3V7WA 2HKIA 3A6FA 3K6KA 3RANA 5EPOA 2OV6A 3ER9A 1B0PA 1R4ZA 1TC1A 1O89A 1VLHA 1ZNWA 1GUZA 2NU6B 3CNNA 3GL9A 4ILKA 4P81A 1TLTA 4TMZA 4W5TA 4IG9A 1H65A 2B3DA 1DKQA 5KYYA 1OWLA 2HEGA 4A5SA 1H2KA 2W2KA 4L8JA 3ICPA 2AZ2A 3KUXA 5DI9A 5DEIA 3H9JA 5AO9A 5B5SA 2QAGB 1T9KA 3FOWA 1XOUA 2WFAA 1N3LA 4A82A 3MJ4A 2DYSC 3WMRA 1KK0A 3HDQA 1JVSA 2DN9A 1ZH0A 3G89A 3GLIA 4L75A 1DIRA 1FJHA 4OPAA 4ZI7F 4EG1A 3VYUB 4YUWA 4TV8A 3TBHA 1OKKA 1YFZA 1JKJA 4BDTA 1MX5A 2PX6A 3V2HA 2OFOA 1LDNA 4I1VA 4F5ZA 4AUNA 3Q9SA 3C3JA 4L3OA 3BXFA 3MB8A 1JSXA 2R62A 4EMSA 2H16A 1Z34A 2KSDA 2AG0A 4YS6A 1EP1B 4CLEA 2JF0A 2IWHA 1R3JC 2XSZD 1YTFB 1YRQA 1LC0A 2OO5C 4A0RA 1MOZA 3ZBUA 1MJGM 4BKMA 5KNBD 4E46A 5KMGA 1QVAA 2XCOA 4RYLA 3R6TA 3KRTA 4E7OA 3MWLA 4G1CA 5CW2A 1DI0A 2BSKA 1LTKA 1PYDA 1XOIA 1N2JA 4K9MA 4G65A 4QVKA 4YJGA 4Z0TA 1G2PA 1XKQA 1Y9DA 2BCJQ 1LW7A 1MC4A 3R0JA 5F7JA 3VTZA 4IUDS 4AY3A 4XWOA 5C8XA 1MF7A 4CMBA 3F5QA 2RGRA 2FPIA 1XFAA 5DGIA 1DZIA 2HMSA 4PLHA 1IXBA 1PL8A 1JR3A 1Z74A 4L5AA 5F2OA 4C4XA 1I0IA 4XDGA 5TIIA 1EK1A 3IALA 1LV7A 5H9WA 1RJ9B 5K7SA 3H18A 1LQTA 2PD6A 3WBBA 4DR1B 1O95A 1H1DA 1S8OA 4K6KA 3NX4A 3NGMA 5C51B 3ZBPA 1N2HA 2BZGA 1KKDA 3HY6A 5FI5A 3ASZA 5IAEA 2IY9A 3V1UA 4DR5B 1ISPA 2I2XB 2XUMA 4MR8A 4P34A 4E2XA 2IJIA 3DM9B 3N76A 1GM7A 1XZEA 1R5NA 2WMYA 1VG1A 3RFXA 2C9BA 2I9KA 3QG5A 1X74A 2MSDB 2A0YA 3S44A 3GEPA 3N7TA 5HZMA 3A3NA 3CEAA 3Q15C 4M9CA 2BKUA 3GLSA 4R8MA 1DHRA 1IEVA 3KX2A 1UQUA 1N6PA 3DQPA 4HGRA 3T5MA 4BPBA 1DUIA 2V9ZA 4K87A 1CR6A 1EA5A 1LEHA 1FFSA 3F2VA 2JK1A 4C89A 4MYTA 4QTYA 3UV7A 1PJ4A 3R40A 2GN0A 4KIUA 4I99A 2D2VA 1P72A 4CH3A 1JU3A 4RXMA 4G23A 4FMDB 2JIZG 1CY1A 2HGZA 2ZCEA 3AUFA 3EXIA 5IYZF 3RTBA 3WBKA 3HUEA 2OHXA 3I09A 2KBFA 4H35A 3ZRXA 1S0VA 3C8ZA 3FGPA 1MO6A 3CSSA 1JR9A 3O82A 5JHGB 2YKGA 5F1YA 4BLSA 1GGMA 2GETA 1M6NA 3EPPA 3HBMA 3RIYA 3U39A 4YYEA 3PNKA 4Q3NA 4DMFA 2C3PA 3Q7TA 4J0CA 1GV0A 3TOZA 3GIDA 2ZI7A 4FEAA 1P80A 2HWUA 1N4AA 2QTHA 4GMHA 2E6UX 1IZ0A 3SHFA 1H2HA 2H00A 3OTQA 3P9QA 1QGZA 1W6RA 3DZBA 3FVWA 2ATXA 2ZBGA 4Q4HA 5CNJA 3SD7A 1ZM4A 1ZUD1 4FYYA 3U3MA 3ZWKA 3PDIA 3UPDA 3R5KA 1K4DC 5JH7B 1EFRA 2LCFA 3FUWA 4OKSA 2B3TA 2R8EA 3NC0C 4L78A 3JQEA 1XTSA 1DJQA 4NV0A 3KVVA 1QORA 3NC1C 4MW5A 1ISRA 4PVDA 5LXTA 1JTEA 2BCCH 3JQDA 1VXOA 3P2YA 4B45A 5IYZB 2QTNA 3KZKA 1YRLA 2X8LA 5IXJA 2XXBA 1N3BA 3MS4A 4UOQA 2P69A 2E4AA 4XI9A 2QX9A 3EMKA 2CUGA 3JQRA 4Q6WA 1FVFA 4DY4A 1W76A 2OCIA 3UWPA 2P41A 2YJ6A 1G41A 2COEA 5ICEA 1GUFA 3IMEA 5JQWA 2C4HA 2C29D 5TMPA 3A1UA 5FX2A 2IYWA 1KZHA 1SQQH 3AWIA 1CQJB 4ETMA 1E1LA 1G5TA 4XLZA 1W36D 2CTPA 1NVUQ 1MNGA 1Q1NA 2GN4A 5AM0A 2EF0A 2R6JA 3C24A 2HRRA 3CW8X 4KK4A 3KQTA 1P0IA 4QWMA 2LGWA 2HK8A 1S5LZ 4DV0B 3H8VA 2OO7A 4I1SA 1NRXA 4M36A 5LR6A 3LH5A 3OFND 2R1VA 1A2BA 4MW7A 1TO2E 4LWOA 3NYIA 3RUCA 1KWGA 3GLIB 1SQXH 1HV8A 4OHOA 4QASA 2VSNA 3ULKA 2AB0A 3BF7A 2O7QA 4Y2TA 5BWLA 3IUJA 2QU8A 2YICA 2QSAA 5F3DA 1NLZA 2I2FA 5DNCA 2VCYA 5KSYA 4TV9F 1CLUA 4BRZA 5ESRA 5EGSA 2QN8A 2E21A 2G0AA 1K7DA 1U3FA 2WWVD 4FW9A 4DEYA 1P91A 1U3DA 4HQ0A 1FMFA 4H6VA 5DV9A 4YREA 5PGMA 3WQQA 1UZLA 3FLEA 3IQXA 4ZT4A 1GUAA 4BP3A 1T15A 1XZDA 3ZRSA 5FO0A 3P2EA 4NENB 4DYHA 1AVTA 3EGIA 1VYVA 1RFGE 1C1HA 4RH3A 4RJ2A 3I0MA 5JYBA 3EX7C 1VSBA 4M54A 2SCUB 3ND8A 3I9FA 4QT4A 4OQMA 1G19A 4OD0A 2BTQB 2WD9A 2XNCA 3A26A 4IFBA 4A5OA 3E6AA 4B81A 1XG5A 1XILA 1P3DA 2A4KA 1G0NA 4U7HA 3VH1A 1M83A 3B12A 5EUBA 1HOXA 3RC2A 3TLBA 4YRKA 1FSGA 3UMCA 1H2SB 2JA1A 2R7LA 3P94A 4JP2A 3OESA 5CXXA 5AKYA 3A6DA 2YHAA 1AKEA 3ITKA 3WGQA 3WWZA 4AECA 4QRIA 1UKBA 3EHBB 3UXMA 1BQ4A 3QV2A 5B2EA 4PA4A 2I33A 3IMFA 3WU2Z 2GZDA 1TI7A 4JB0A 3PFKA 2GN6A 3P2OA 3Q3VA 2ZIUB 4X90A 5GJVC 2XCQA 4IMRA 3RARA 4UTZA 2P65A 4RF2A 4YCNA 1XVUA 1PJCA 4NBSA 4R9UC 5IS2A 4LKRA 1QG4A 1S8NA 3QP9A 1RYFA 4AF6A 1CZHA 2PSFA 2DSTA 4ILEA 1QK4A 2VSQA 1E3LA 4KVFA 3GVHA 4FLFA 1UK8A 4PFJA 3F7TA 2W2KB 1CG6A 3DHNA 1XRLA 3N5CA 2ENUA 2XMPA 3CCQV 3NBZC 4HNRA 2HSJA 4WZAB 3E4CA 2R96A 2VS1A 3K9LA 4JLOA 2AV6A 1J9EA 4QXRA 3W90A 1D2NA 2NGRA 4BWVA 4TLAA 3LWZA 3OQ6A 1DBSA 1E2DA 3PKJA 5I4BA 4PLWA 4CM8A 2GFIA 1ZUNA 4C21A 1GCAA 4NFLA 1A5AB 1OJLA 3LY9A 2N74A 1PQ4A 1UQRA 3ONVA 4NULA 2PRZA 1I2CA 3K1JA 2OHIA 1LCIA 1H9AA 3EA4A 3HHEA 5DHUA 1I3NA 1RZRA 3P9PA 4DQVA 1PFUA 4Q1VA 3Q7QA 4RDHA 4RGQA 5DYWA 1RTKA 1RS0A 4R0MA 1ECPA 1UOOA 3RIGA 1YSCA 3AQIA 3UW3A 3SS9X 5G1PA 2O07A 4L4XA 2VS0A 4YDHB 3OC0A 3GH1A 4O4JB 2C2OA 3ZE0B 3RRJA 4DA4A 2G09A 1U3GA 2FSUA 3F1LA 2I2CA 5MGNA 1ID8A 3LECA 4GX1A 1Z3CA 2VZ0A 3F3SA 1ATZA 2XUZA 2FEAA 3ZJTA 4FHGA 4DLSA 4D5GA 5AI6A 4MIKA 3QBTA 1NBMD 2VZLA 3TSZA 4MVSA 3VA7A 1KAQA 3M8AA 4LE2A 4RLHA 3FNEA 2EJRA 2C2BA 5KUTA 4MW0A 2HTEA 3H99A 4S2UA 4XQGA 2XUPA 1Q44A 4OGLA 1N5KA 1BDJA 1FFGA 2ZTMA 3MFYA 1KI9A 4BWAA 1W94A 2IVFA 5H82A 2EXXA 5MN4A 3IHTA 4GPIB 4ZCIA 2OR3A 2WAMA 4TZKA 2A9HA 3S2SA 2YBDA 1KPHA 1U9IC 4H2DA 2VVTA 3EG9A 2RHJA 4M99A 1DC7A 2EZ9A 1V1MB 4HDNA 3HSKA 4Q15A 4B43A 1WMSA 2W2PA 3WA6A 4ETIA 1NF9A 4UPVA 4XAQA 4BO6A 2PY5A 4O4HF 2RFLA 4W4LA 5CHYA 5CH3A 2AW3A 1KI1A 2ZJOA 1SVUA 3FWYA 1QHSA 5B4VA 1GN4A 1AK9A 2WKRA 2WWHA 4O25A 3FETA 4IH4A 5EKXA 3KT0A 2Z0AA 3Q7RA 5B7QA 3CXUA 2AWOA 3KKYA 3G9ZA 4TVKA 1MO5A 5BN4B 4UBKA 4BJHB 5C5CA 1VCNA 3WGKA 2P22C 2JVKA 4HDKB 4HNAA 4PXSA 1W9HA 2HIGA 3BGDA 1SOUA 4IIHA 2WP8J 4TV8F 2GN1A 4JBWA 1SHTX 1YRYE 2DUUA 3A4TA 1RC0A 1YKGA 2PXAA 1VF6C 2WIAA 4OXYA 4CEHA 4GHWA 5FPHA 3LHSA 4MWZA 3EBOA 4N49A 4YJ3F 5GONF 3TBKA 5IAKA 4QYWA 2CXHA 3ETHA 3ASOC 2JFQA 3BWMA 1L5ZA 4PTLA 4AZ3B 4TM7A 1DF4A 3HYCA 1H94A 5G2OA 1A8IA 4M37A 1V8ZA 2YQZA 1DX4A 3INTA 3C3KA 4FOPA 3V32A 3DOOA 1AR1B 3IAS6 3J81N 2JGIA 4YFYA 4P22A 3A36A 3ENKA 1JIXA 3DLAA 3I28A 3VRHA 2XE6A 1QB7A 4JUFA 3JAKA 1JMYA 3N39C 4MWDA 2JLZA 1QV7A 1SD1A 2DWPA 2BFBB 2EWMA 3HO6A 3WLOA 1UPTA 4PW0A 1QLEB 3EXEB 3CNHA 1E3WB 3MCWA 3HM2A 3OQ1A 3OCUA 1OCCB 2Z1MA 5E4JA 4CLDA 5K8JB 2OYCA 1PT5A 1QU3A 3A2LA 4Y1FA 1P6UA 5CJPA 1K6MA 2JFXA 4FLEA 3BE4A 2QM4A 3GOQA 3MERA 1XHZA 4FE4A 3OIUA 1QUFA 1DFIA 3K0BA 3PF8A 2EILC 2DR0A 3EXHC 5DBGA 4CUZA 1TM4E 5LWHA 1CERA 3DCYA 4ZOEA 2JJ8A 5FPYA 1YRBA 1I14A 2BGIA 1RZVA 4HAMA 4MYSA 2IV2X 5JQGA 3SIWA 1M6WA 5A9TA 4YCMA 2UXXA 2FMLA 1H6AA 1HG1A 2Q3JA 4JQZA 4EUNA 2DWEC 2AEJA 1CKEA 2NXWA 2GM5A 3NKLA 2VH5R 4BNTA 5G3ZA 5IKXA 3QMMA 1VL8A 2PGGA 4MUXA 3HGQA 1MAWA 3WDLA 2Z1DA 1ZLYA 1U2DC 4LW8A 2C84A 4GLLA 4LNUB 3O03A 4Z8XA 2X2EA 3VSBA 4JOQA 4BV2A 2H3HA 2NV0A 1EX7A 2ZSUA 2ZSKA 3PPVA 3QI7A 2BYTA 3T3GA 4JSTA 3JWPA 1FP6A 4CC5A 1X7DA 1L4FA 1DF5A 2HFKA 3B5JA 1JA8A 3VC2A 1T9ZA 1XCLA 1RYYA 1JRLA 4ETWA 1DCTA 1W5TA 1RFYA 3CT6A 3UTCA 5J23A 5B2FA 4DZTA 4J1SA 5GTHZ 1NJ5A 5I7VA 4A8PA 2FAXA 4BFSA 2D3TA 3TSYA 4EKDA 3I55V 3N74A 4JL5A 3M6AA 1YF3A 4PEVA 2HVJC 1P4GA 1MCZA 1QYCA 4NJMA 4WFIA 2XOKD 1PS0A 3D7SA 1JHPA 2QAJA 5LA6F 4ATNA 3OFVA 1M2HA 4B71A 1RSOB 1PGJA 2WV9A 2Y68A 3KXIA 5LPNA 3ZQ6A 2WLSA 3ZTTA 1I2MA 3JQPA 3WC4A 2P1ZA 5I7RA 2PCLA 1Q7BA 4MW6A 1CEQA 1CY8A 1D7AA 2YVQA 3OUUA 4PY2A 1WCV1 4HAYA 1WUTA 2P9ZA 2PIDA 3HYRA 4HPWA 1RPNA 2Q5EA 3QX9A 2G5GX 5DH9A 5KYNA 1JF8A 4UU7A 1PSZA 1T8PA 1G3RA 1DT3A 4FM2A 3ENQA 1CVRA 2C07A 3G68A 3NWOA 4Q3OA 3VOTA 4JI1B 3ZK8A 4B8WA 3ZIAA 5IC4A 1L5RA 2OV3A 4MKIA 3A6HA 2VDJA 1IPEA 4RC9A 4W1RA 4EKGA 2ZZMA 2WU1A 2ZWIA 3ZZMA 2AL7A 4A0FA 1RXSA 2FI1A 1V54C 4IJ6A 5ETJA 4AVYA 3SC3A 4P0PB 2V0GA 2ZXWC 3CH5A 2PWPA 1IN4A 3OZUA 2WE7A 4M1ZA 1A1VA 2CSXA 4JLNA 4ND7A 4XM2A 5D3QA 1D5NA 1ADYA 1DV1A 2ZYVX 3HCAA 3HG7A 4NZMA 4PHTA 2WA2A 5D1HA 3QKRB 3LDUA 4Q7KA 1NJ8A 4MKFA 5I9TA 2WZCA 1DKOA 1LNSA 1SVIA 3D4IA 3OZRA 5G0WA 1YZVA 3HB4X 1LS1A 5BUQA 3LNMB 1TK3A 2NQTA 1R0SA 5CYOA 5FUBA 3RJMA 1MQ8B 1DS6A 3OOEA 4RZUA 3G13A 5DXFA 4WBNA 3NRJA 5EP4A 1QP4A 1QRSA 1YI0A 1QHHB 3GXBA 3GVXA 4OQNA 1GZ3A 4N5NA 2EOAA 4G5YA 3LD9A 1KRXA 1E1NA 4Y2PA 3SZOA 4BMPB 3SPJA 3HKEB 1UJBA 2QENA 1PHRA 4RELA 4KLNA 2HNKA 2ZJ6A 1QTRA 2IGBA 1OWOA 4NBWA 1JB1A 4LVCA 4MWTA 3RU9A 1R4MA 4H7IA 3WYFA 1JKMA 3PNMA 2AYXA 1SD2A 2GZ3A 2H2IA 3STZC 4E4EA 2E2WA 3C7CB 1Z15A 3D31A 1U1EA 3PQCA 3A05A 4C6RA 3WLHA 5HOQA 4PC3A 1PIWA 2E3JA 2AJCA 1XCJA 2OZPA 3JQAB 4Q7EA 4DM7A 3KTAA 3ZCRA 3UXHA 3IUQA 2QPOA 5SYAA 2GCOA 1GTOA 4Y2VA 2NYRA 3L7IA 4WV3A 4XFKA 1GD1O 1JDTA 4YRZA 1ZITA 3QO8A 1RWVA 2A0XA 2HBRA 1KZ4A 1MG0A 2Q1XA 3IILA 3L7CA 1G42A 4G1MB 4EY8A 1DINA 3I9MA 3T52A 1BXGB 1R3IC 1OMOA 2AC2A 3CKKA 5B3JA 4DLKA 3RVDA 1UC8A 4FFDA 1Z6GA 2VSYA 2O2YA 3ICVA 5G0UA 2MR6A 2P4KA 1PUXA 3E0XA 3TMAA 4XYMA 3B8HA 2F43B 1ABEA 2CJXA 3BD6A 4GRIA 3CBGA 3ZVRA 2FH5B 1RP3B 1P8JA 3GARA 3RUFA 1PNQA 1QYDA 1WXIA 1F5NA 3PDWA 3WRXA 1QV6A 3ZN2A 1E3MA 2BHSA 3WGOA 2UZAA 4CR8A 3O8CA 2XCRB 1D03A 4HEQA 2UUBB 1OI4A 5HJ2A 3ZY6A 3QXJA 3BA1A 4OF4A 1S1MA 2X15A 3PHCA 3KFVA 2A30A 2ZT9B 3DHYA 4I50A 4RACA 4MUJA 1IN6A 2OPBA 1PK7A 4QQRA 4MTFA 5E6UB 2XQVA 3KTDA 1JE0A 4PC1A 3F6PA 5EJMA 1JQKA 4O3FA 4KXFB 3BB1A 1K7EB 3I56V 2PSDA 4XE5A 1NOJA 3SE7A 3CXRA 4H27A 5AK5A 4ALKA 3LY7A 2BFDB 2QL6A 2Z8YA 2FPGA 4KQHA 1P29A 3LUFA 4IOLA 1JHQA 4RXUA 4D8YA 2P27A 4IUYA 5HBRA 3ZU4A 4ICGA 2PRSA 2GCEA 3HCRA 2EJCA 5EC2C 1UZUA 3NBAA 4LFBO 4V03A 1X7YA 3CZ4A 3NDPA 2ASEA 3P4UA 2KLBA 2OENG 5J4LA 5GAJA 4Z9FA 3R3ZA 4JGGA 4CF4A 1EFTA 2B2NA 3DEYX 3MJEA 1F20A 2EYUA 4B4UA 3N2YA 5T4BA 3C4VA 4CBVA 2GDJA 3GNLA 2M6LA 1W88B 1E69A 3VPDA 1HZZA 2MSNA 1EQAA 1PJRA 1Y1QA 3FFTA 3LUHA 4ISCA 1NXVA 2X4LA 1HKHA 4WW0A 5AKEA 2N3ZA 5IAOA 2E5LB 4TLDA 3WAKA 5IF9A 3W9BA 5LSAA 5HFLA 4MRAA 3K3WA 1OH5A 1YZ3A 3E35A 2ZR7A 3ENZA 3WSTA 3PD0A 4D25A 2QDKA 1HC7A 1ZTEA 2DULA 2XYRA 3DR5A 3I9NA 3D3NA 3F6CA 3KKEA 3PNQA 3QVSA 5J2TF 4DLTA 2A7XA 1WQ3A 3L3BA 3NUQA 1YUMA 1P2DA 3P96A 5T4FA 1T10A 3NR7A 3CRW1 4EJMA 1BH6A 1VIAA 2ZB3A 2FPWA 1ZXBA 4JAVC 4RM2A 3D2AA 3FDZB 1CQIA 1I5EA 5ADUS 4QULA 1PBTA 1NQOA 1PLKA 3IUEA 4OMCA 5LDDC 4W5OA 3QM1A 1HDEA 3OQIA 5JT1A 3H9BA 1URPA 1Z2GA 4N8EA 2HWKA 1P5HA 1L8AA 4ZV9A 2HV9A 1JG7A 4LK2A 5C8ZA 2JJMA 2GBOA 1DEHA 1FE8A 1WVIA 2F90A 3DZJA 1SWVA 1YR2A 4AJKA 4O0MA 1OX6A 2AC7A 1UBKS 1XQ8A 3O3CA 2J3IA 1OLUB 1XMVA 1XZLA 2BE9A 4UHBA 2P9BA 8MHTA 4HWKA 3L06A 1PL6A 1I9GA 3DPUA 3O4VA 3WKEA 1R6AA 3SYQA 1B41A 1O6BA 1JP7A 4OB8A 3WAGA 4J2HA 1A27A 4GPZA 4GX5A 4R1UA 2J31A 5T5QA 4BLPA 4OXXA 4WCFB 4FIPC 1FYJA 4AJEA 4URVR 1IJEA 5B1EA 5IABA 1A7KA 1GQRA 3Q8WA 3ROMA 1T5EA 4HSEA 3PX2A 1T4BA 3VDRA 3VVCA 3ZJ5A 1FBTA 5FWXB 4ZOLA 4DN6A 1FDUA 3F5DA 2CWWA 3FDFA 2Y92A 1QVFU 5CIWA 2CUNA 4LCJA 3HDHA 2VSFA 1YQUA 4R1TA 3NOVA 1S5HC 1CRZA 2QGNA 1PFQA 1YXMA 2CK3D 2HLHA 4GKKB 1U2TA 2OSVA 3MK31 1VBFA 4WF9V 2AUNA 4YWJA 5FEUA 1MX1A 3B7PA 5C81A 3SHVA 3VYWA 5DBIA 4OKIA 5TRTA 4DABA 1E0KA 2X3UA 1X13A 4HDSA 4MARA 2HK7A 2XKAA 3WB1A 2DFLA 4P4LA 5ICGA 4FLMA 2RI1A 3I32A 3KPVA 3MUEA 1Z37A 3RE1A 2L42A 4XVHA 3GC6A 4AMBA 1R6UA 3WB9A 5BWCA 2C59A 1OCZC 3GUUA 4WESA 3P0FA 2I4TA 4E94A 5CDSA 1XLWA 3MHTA 2VJAA 4JAUA 4FDMA 3OTOB 2CL5A 5AK4A 1UDXA 2CLDX 2B61A 2XNDA 1G63A 3BM5A 3V1KA 4BMDA 1ZRHA 2YWJA 3NR2A 1VJGA 4IQ0A 3DUFA 2A14A 1QO0D 2XZTA 2Z09A 4PX2A 1K5PA 4IWXA 3TR5A 3TZBA 1JR3D 2QRNA 4BGVA 1KFCB 4FHZA 4TRMA 1AQNA 3OWXA 1E4OA 2QL5A 5BQ3A 1TAHA 1NQVA 5AESA 4XIIA 2NVUA 2QTGA 1NAHA 2RKOA 3DBVO 1Q82W 1P62B 3K9CA 3PC8A 4IV5A 4RD2A 3WNQA 1EVKA 2FW9A 3CZPA 4N7BA 1LTQA 4FZRA 1KZGB 3BYZA 3USES 3WLPA 3CX6A 1Z63A 2RHOA 2ZPTX 3LGSA 3MBKA 4IW3B 5AKJA 1AO0A 5C0OE 3NFRA 5GY7A 2JH8A 1SU6A 1VSTA 2GD2A 3ABIA 1VE6A 5HQ3A 3HADA 4HDMA 3IC7A 5BW6B 1G6Q1 3TOVA 5FNVA 1N1EA 2E49A 1FPOA 3JASB 1XA3A 2RCVA 2UVPA 1TPYA 3IA7A 3RRBA 2H1VA 1TUBB 5KTOA 2LR0A 3CZ9A 4NV1A 1DARA 1MW9X 1U0BB 4OU4A 4XGQA 3PFNA 3C7TA 2WSSD 1PJQA 5FAXA 5C8DA 1N32B 2PJZA 5GTIZ 1RXUA 3AR2A 1C4OA 2ZI9A 3DJFA 3L7DA 4GQAA 4KWEA 4QUDA 5HA5A 3TUIC 3ZHOA 4HLNA 5DECA 5FUQA 5CNKA 4ZK2A 1B0AA 1O0SA 1Q1ZA 1ZHHA 2FX5A 3R74A 3AEUA 1NZDA 2X2FA 4Y6GB 3ZJYA 3RK0A 2JLAA 3ZWXA 3CJHA 1IHDA 2YFKA 1F60A 1RAFA 3B1FA 1L9KA 1S2LA 2GEKA 3WK4A 3HUFA 1UJWB 3LF2A 2GD6A 1IHXA 2ODTX 2YWXA 2CTQA 3VQYA 4I3FA 2DH6A 1G17A 2QTRA 4L3VA 5T3YA 3TZLA 3PTAA 3K5MA 1ADFA 1Z08A 2QMZA 2REQB 4Y6SA 1XRJA 5TV2A 5BN3A 3AVUA 4IIFA 3FX2A 4HYQA 5A1JA 2XOEA 1ZKDA 4K1XA 1JPVA 2W58A 5GQSA 2VNKA 5E6SB 3L40A 2VT3A 1E9FA 3MUNA 3OOYA 2OFPA 4P6VF 3IRVA 3OGCC 3IXMA 4RV9A 1N4DA 1J0DA 4FYWA 2CJYA 1P39A 2VSOA 4TOIA 2CHGA 2IYRA 3C39A 3SM9A 3TXAA 2WZQA 3OCCA 3N8GA 1JYFA 1U9YA 2XHZA 1U8FO 3NRCA 4MPRA 5U4QA 1R0RE 3VM6A 3WICA 2ZITA 3C6BA 4GI7A 2OCCC 3ZGLA 3BZWA 1FXUA 3V55A 1DEOA 2IUSA 2VWKA 1AZTA 3R7DA 1UADA 5KYGA 1FJGO 4QPNA 3CRRA 2BBOA 4LP8A 1NVDA 2BGUA 2C5FA 2J59A 3LUCA 4LQ4A 3CURA 4LBYA 3K72B 2XEXA 3AF3A 5BXQC 3ED1A 2ZI3A 1GRQA 4BVFA 5HS4A 4EJFA 5JAMA 3QVUA 5KS2A 3PNLA 3SR0A 1XTVA 2R72A 2I4OA 2V3WA 4NU0A 4NY1A 4DCGA 4EATA 4ER6A 2JCBA 4K5QA 4DRXB 4N39A 1NVEA 4LMAA 4ARVA 5JJLA 1FRFS 1QRTA 3DOEA 4HB2A 4IDNA 3U17A 2EKQA 1L5FA 3ROQA 5CYPA 1XZNA 3DNMA 5EHGA 4N40A 2FTKA 2XODA 3C6YA 3LG2A 3R7FA 4G0UA 4GKKO 1A8QA 1N0IA 2E6KA 2OEPA 2QUZA 2OZKA 3NEPX 4WIAA 2I2WA 4W5HA 5CPFA 4RWZA 4UC0A 4Q37A 1S3GA 4ANFA 4RTQA 2NSJA 4C7OA 4ZCSA 1CY0A 4WOPA 2R8BA 1RI1A 1NI4A 3D3QA 2DQZA 3DMRA 4HQKA 3WLJA 4AN1A 2D1TA 3I8SA 4JLJA 5A02A 1EEXB 1CXZA 2IYYA 4CMKA 1M74A 4FGKA 2LKCA 4ZAZA 4OJNA 4QUAA 4AUMA 5COQA 4N8DA 1TCUA 1USIA 4XW2A 1I5XA 1ZY2A 3BFXA 2ZDGA 1A9RA 4B2IA 3CZRA 1MA0A 4ZIRA 3TK1A 4U9UA 1RWWA 4RHUA 4Z1MG 1WEKA 3TXSA 3FSGA 1ZN2A 3COVA 4V0RA 3O9OA 5HDQA 3RUPA 5FTJA 4EW2A 4LF4B 5HPYB 1P1FA 2J5KA 4LWPA 4DJEC 3KQQA 2XUIA 4DVJA 4Y9UA 2J3MA 4GR5A 2H2AA 3D0QA 1TZCA 1A88A 2GLTA 4XGNA 2R11A 4AJ4A 4MIYA 1XNGA 4P3YA 4ARCA 4QE7A 1QFJA 3PA6A 4P3XA 1YFJA 2XYHA 1TQHA 3IHLA 1IN7A 3CUYA 4DSTA 4PC2A 2G5PA 3OBBA 3ZXIA 4AZVA 1RJ9A 3WXBA 4OA5A 5LGUA 3FB1A 1JBEA 3WG7B 1YQTA 1XRPA 5AHRA 4BEJA 1Z7EA 5JJIA 4DVGA 1SY7A 3EQZA 4KH1A 1G5QA 2GEJA 3TVDA 4PU0A 3FMGA 4RETA 2GILA 4M1WA 2XKKA 3N2NA 1RXVA 2HPZA 5U9CA 2OILA 3UA4A 1LPAB 1XTRA 3M5CA 5IFKA 3IPAA 1J2RA 2YIBD 3G2KA 2CMHA 3U5ZB 4BNUA 3E7FA 3MC1A 2H2GA 1BMTA 3O31A 1E4YA 5EZSA 3S8EA 1FUEA 4OMUA 4CL3A 3OMWA 5FL7G 1NYQA 2PX2A 1TW2A 2R8XA 1R50A 1KR5A 4FYPA 4ME6A 3TXQA 1UJ5A 3C97A 4NK5A 5BYBA 3T0GA 5EJ4A 5TLSA 1IBKB 1BDBA 1GLGA 1SFRA 1T26A 4MVCA 4XWYA 3OT7A 3ABQB 4GR4A 4PBRA 1NVBA 4DANA 1GVNB 1MQ9A 1XZMA 2JCVA 1N25A 2WWGA 1NVXQ 3I2GA 4I5EA 4M1SA 3BA9A 1ZWKA 1QH1B 2IPMA 4RIEA 4BMYA 4UPEA 5BZBA 1QC5B 4TLCA 5GGYA 3HYLA 3NS7A 8LDHA 2GPJA 1KY3A 2J87A 3ES9A 3IKJA 3ELDA 3TTTA 6PFKA 4IO0A 4C9BA 5HK9A 4B09A 4EI8A 2HQSA 5JDCA 1OT3A 4YY3B 2IZ5A 1T0HB 3H9EO 4L27A 5K09A 2X1VA 2KQUA 1FFXB 3AXTA 3PJGA 2Y0IA 1T2CA 1JMKC 2QG4A 1F2VA 3OEEG 4HADA 4LSMA 4O5OA 2PGXA 2FUG6 4L07A 5AXDA 3K0AB 4KLZA 1N3IA 1EDDA 1YRWA 2WF8A 3PD7A 4WLNA 1NYTA 2P35A 3OEED 2ODQA 4D7TA 2G83A 1GNPA 1N0VC 4KPFC 3D1LA 1GL7A 4JODA 4OGKA 1ZAKA 4BFUA 1X19A 1F14A 1FL9A 2BZ0A 2GD1O 2G25A 3HHPA 1ADGA 4JENA 5CDYA 3C98A 3S81A 3HTXA 2ZRHA 3UJDA 2WPDD 2EILB 1XMQB 1SB9A 2P4SA 3D6TB 3EA0A 3WGZA 4TROA 4DHEA 5ES4B 3DBHA 2YBEA 2JIQA 2GYVA 3GWGA 1JAHA 5CT5A 5IJAA 3BJRA 1PZXA 3VNBA 3T2MA 4DO2A 1TNDA 2CTRA 4MROA 3TSWA 2Z58A 4D9CA 1DO0A 4HKTA 4BNYA 2FU5C 1K3TA 1V41E 2H1FA 3A6GA 16PKA 1MP0A 3PP8A 1L4NA 3K09C 4NU5A 1MIOB 3K94A 1HSZA 4ODIA 3T61A 1TJ5A 3SHQA 2AJTA 2VK2A 4RQBA 4Z54A 2XASA 4YECA 1OLXA 1TYZA 3LKBA 4XTCS 1KPGA 2IU4A 1A50B 2VQFO 2BZSA 3U7EB 4PHZA 2JGKA 3CLKA 2AXPA 2XY4A 3G5MA 3P20A 1RPJA 3HFGA 4JXXA 1FTNA 3BFRA 2FPPB 2I0FA 5AKKA 1ZD3A 1EX6A 1KVRA 2VEDA 1R3KC 3KLMX 1KO5A 3B3AA 3K6SB 4KQGA 4F5YA 3WGIA 3DFZA 1STOA 3A06A 2OOKA 3HXKA 4KKVA 4KQWA 5K3CA 5TQ0B 4W5NA 3O1JC 3IQIX 5KX5A 5I4KA 2UXBO 1GG9A 4Y1EA 3ZK9A 5IT9N 1KEEA 1GDTA 1AJNA 1Q0ZA 2HY7A 3BD7A 3GMIA 3HS3A 4WXPA 5H68A 4M0MA 4YAWA 2QM0A 3E9YA 3QKIA 3S5JA 3HZRA 4AY6A 1PDOA 4UVGA 4CTMA 5JZSA 2G9RA 5A6SA 5B12A 2BEVB 1C9YA 1PLJA 1EZ1A 1O94C 5AT1A 1AHNA 2ZNIA 3AR8A 1F5SA 2EBUA 3B78A 3NVDA 1SO8A 5KWIA 2W0XA 3PIDA 3IB3A 2FK7A 4L4RA 3GLHA 2Y4UA 3OCZA 3V1TC 3E7DA 1FVHA 4K6OA 3KPJA 3L75H 3R7WB 5AR1A 3DLCA 3FYDA 4I50F 3AG4B 13PKA 1BG6A 3NTQA 2PT7A 1YK1A 1M56B 5ANRB 3W7UA 3GJTA 1NHWA 2WSIA 4GBJA 2PS3A 4MVJF 5KKNB 1L3BA 2BM9A 1SWWA 4EABA 3HVKA 5CG2A 3T1YB 2DSNA 5JJKA 5DBOA 1LPOA 1N6LA 4ZRDA 4CT4B 1AUOA 2CNLA 2WB4A 2WTEA 4R0VA 5A71A 3NVMB 4B08A 2CXPA 1MKYA 1AN9A 2TMDA 2ZWVA 3HKEA 3B85A 4LYGA 4I9WA 2UU9O 2PNFA 3KELA 1IY1A 1ELOA 2AXEA 3DW3X 4U9HS 4BFXA 4F5WA 4EFBA 4UZFA 1OHHD 1RQ7A 3JWGA 1FFHA 3K2EA 2NOAA 3H01A 5IY5B 3L72H 1FYVA 1P0QA 4JXKA 4RTNA 1V9CA 1KHHA 2M6RA 3ICWA 3JVVA 4QDJA 4O5AA 2ERXA 1V5IA 3SXPA 3TO5A 1NQWA 4NP6A 1E2EA 1ZNYA 4DM4A 1CZNA 1X3SA 3OO1A 3OZIA 5CMUA 4UCSA 3S55A 3CCBA 4D4KA 3HWSA 2OBFA 1VHJA 4FWBA 4P36A 3LDCA 3ZN1A 4FMCF 4UXJA 5DBEX 3UHOA 3KEMA 3ZNNA 5EBWC 2EFHB 4MTLA 2VJLA 2YUTA 1CT9A 2PQ0A 4QFCA 2R47A 5EP1A 1BHSA 1FZQA 1P0FA 2F2TA 2FEKA 5TE9A 3EPHA 4LGCA 2H51A 1USWA 1G7CA 3SVLA 1C8VB 3RAJA 1G8GA 4XB1A 2OWEA 3O4FA 2OCAA 4Q3KA 2E76B 3V8MA 2Q9LA 4E4TA 4ZO4A 5I9LA 4JR2A 2QMUA 2AZ4A 2VDOB 5MN5A 1R0CA 3GEEA 1N33O 4IX1A 1H23A 1PYGA 2DTXA 3H86A 5IJ9B 4NBUA 3ADPA 3BL5A 3FXAA 3FKSD 1BSVA 1JIQA 1VRVA 1Z0ZA 2IF2A 3ZWPA 1QCYA 1SRQA 3QMPA 4OPMA 1GZSA 2QAGC 4DC9A 5KQPA 1Y98A 2P9GA 2OC4A 3J80N 1VMKA 2Q9BA 4D3SA 2OKGA 4JASB 2P2YA 4KQ6A 5BT9A 1QGYA 2C7GA 3RS7A 4CTNA 1G9TA 1CQWA 2HEPA 4DV0O 1XTBA 4H31A 2PKEA 1U8ZA 2ATIA 1U1CA 1JXAA 1QH0A 1X87A 2P4HX 2R97A 1QB8A 3RHSA 4I1PA 3ASUA 4MP3A 2QZPA 3LT5A 3H2KA 3VQWA 1WOMA 4U2KA 3O7WA 1BH2A 2O7SA 5T4EA 4AJ2A 3LKZA 3ADDA 5IANA 4TKVB 3QWIA 1ZOOA 3LCVB 2WLHA 2N1BA 3OF2A 1E1DA 3Q2KA 1D1TA 3ZD6A 3S2ZA 4G0WA 4UCWA 4EUFA 5KSZA 4TMWA 1KVQA 2DXIA 2Z4TA 3EFOB 4C0XA 1CP3A 4RTLA 4RTOA 2WSSG 4UAVA 4O4IB 1KQOA 2CBGA 3OFKA 2K2WA 1R88A 1M93A 3HNPA 1CRWG 1ZA2A 3MAJA 3IP6A 4WINA 5T3UA 4E2LA 2NZWA 1PM9A 2KM1A 4EUSA 1WA5A 3PV0A 2WE8A 1N0JA 4AZ0A 4TV9B 3OZCA 3H5VA 1GGHA 3CVXA 2ZJ2A 3HN6A 1JHVA 2GEDA 3BSWA 2XMGA 4HY3A 1E7YA 2IH2A 3RYIA 3CRCA 1P9LA 1K8AW 2E4VA 6ABPA 2H5JA 3L41A 1MABA 2DPXA 1PGNA 4BR6A 3HPLC 2XTJA 1U9JA 2RK4A 2G5TA 1PO7A 2FR0A 5EZ5A 3TTUA 1V7QA 1KP9A 3FPEA 5CFQA 3CNBA 4ZU6X 2BHNA 3WGJA 2RH9B 5K8UA 4CNBA 1MX9A 4LZJA 3DHEA 4PX3A 4EAAA 1GZUA 1ZVQA 1FS5A 3L82B 1V26A 1Y42X 2VI5A 4AO7A 4BLOA 5HRCA 2G3YA 2ITDC 2OAQ1 1L4UA 3OSUA 5L9AA 3JD3A 3HUTA 4TUYB 1N1MA 5GJBA 5BY1A 3WKAA 2VAMA 3K32A 1FNDA 1GQ2A 5JPIA 1YB4A 3DM5A 5JNLA 2BR4A 4GVLA 1H2GA 1RPTA 2PEYA 1L5VA 4ICIA 4JROA 5D3KA 4UFNA 4EH1A 2XMSA 3T5GA 2G4LA 4NKRA 3ET5A 4QTTB 3G5LA 3PD1A 3IEKA 3Q0TA 4K9OA 4NX2A 2O7RA 3FGOA 1DG3A 3V8QA 3PICA 2PZSA 5K20A 3DWEX 4F8EA 2DVMA 4PONA 1FXWA 1BN7A 1JJFA 1X2EA 3R75A 3C8MA 3CF2A 3F7OA 2F3RA 2V3CC 4UJ5A 1UMCA 4N3AA 1FZTA 3B9PA 2VTBA 1ZGHA 1GN3A 1EUDA 1HNNA 2PM8A 3BMQB 4HR7A 4M21A 4MRVA 1RC1A 5K3FA 2NVUB 4A26A 4CCWA 4FKZA 3KJHA 2OBNA 5C37A 4RMIA 3ZI4A 3RC3A 5CYGA 1DIHA 4A23A 1JPNA 1FDVA 4FK8A 3RREA 1TF7A 2FUNB 4BQPA 2IHNA 1FMJA 3OFSA 1U4NA 2I8AA 2FSSA 3E8HA 2WBLC 1NC3A 3KQVA 2QN2A 3NOXA 4N7JA 5F5NA 1NSYA 1VC2A 3KG2A 3APQA 1J8QA 3CNQS 1TECE 2DUMA 2HDWA 2PX0A 4JZ2A 2B8NA 4YP0A 5T4HA 1HRKA 3PX7A 3H97A 5D2CA 1E7WA 1Q7CA 4B3HA 3BKXA 2FZKA 3NP9A 1XLTC 5CVEA 5DWDA 2F55A 1NJFA 2BGTA 1I5OA 5K0NA 1EDZA 3E81A 3EMBA 4G1EB 1EFVB 4RWEA 3QW2A 1TQ6A 2FE1A 2RG1A 2RGUA 2G80A 4AYTA 3UK1A 1X8JA 1OB5A 5E6RB 4N0DA 2JGMA 1YR8A 4D81A 4FM1A 2X3FA 1BTOA 2X7XA 4MDEA 4ZCPA 1J4AA 2WRZA 3NANA 2VYFA 4PZZA 2R66A 4FDAA 2H31A 4YXWA 4EGSA 3EBLA 1S76D 3MM4A 1H2XA 1JAYA 2XXAA 2RC5A 4KAFA 1TLLA 2BISA 2GZMA 5ECGC 4AJLA 1H9BA 1PD1A 3CEMA 3WFZA 4MVXA 3CRQA 1KSFX 1LLFA 4AF7A 1OASA 3IPXA 4ZEWA 4C0LA 1QLWA 2GEBA 5ES3A 1IOZA 1NMQA 2BGKA 3Q0IA 3FTFA 2O3JA 3CUEF 3WI7A 2R00A 3L8CA 3DFKA 1P5JA 1UDWA 3I6BA 2H11A 2F8SA 3ZG6A 5CB4A 1OCZB 4FZ0A 3QHQA 2UXDB 3DYIA 2JJ1G 4WUVA 4MJ3A 5E4TA 3GEIA 2P7IA 4US0R 4H59A 1NHGA 3PVCA 3UHPA 4Q6GA 2SICE 2HWWA 1O5OA 4KIWA 4CIBA 2PH3A 2R8RA 2P6OA 3VAZA 2FF7A 3OHMA 3X1JA 4A2WA 2D4AA 1Q0UA 3KFXA 4F4IA 10MHA 3U44A 1A76A 3FPLA 5FADA 2Y2VA 2W98A 1U4OA 2EQBA 2ZIGA 4TN5A 3KJQA 2WYVA 4Z86A 4KE8A 4ALNA 4WK6A 3W8EA 1JKJB 2EX0A 3IR5A 2WR8A 4JJZA 4ZHQB 4B3SB 1XEWY 2J5BA 4LISA 3I34X 4N3NA 3ZWQA 4CIAA 4EK9A 3QPWA 4ESOA 4TWAA 7MHTA 1JYSA 1PLLA 3UFXA 1DQRA 3C3MA 5SY4A 1TDJA 4WXEA 4Q3DA 4KPYA 1T6BY 2ZSJA 2BEUA 2RH8A 3VHQA 5KHLB 1PJ8A 1J49A 2QD2A 1UKAA 1HYQA 2K7ZA 3Q12A 4YTEA 3Q72A 5FBQB 3PQFA 4D9NA 1N5RA 3OR6C 3KKKA 3PR1A 3PNPA 3FMOB 4RJLA 4PG5A 1MSWD 2I8LA 1Q17A 3G2HA 4G07A 4ZMBA 2ZJ0A 3UMRA 3AL0C 4YAJA 1Q2XA 2B98A 2Z2IA 3KXKA 2NW6A 2FR8A 2IW5A 1T1GA 2EKDA 2NUBA 3FZQA 3GCGA 2JRIA 1ZZEA 2HQRA 3FUXA 3HPRA 4IIYA 3UICA 5LIPA 2JAQA 3ZWVA 3AG4C 4X7PA 1NY5A 3GB7C 2ZT6A 1KERA 1JLHA 2OP0A 4OSEA 1S2NA 5J5VA 1D0SA 4FR0A 4U1RA 3A4LA 4R8VA 5EJAA 3F46A 3RF6A 5JEDA 3SR2C 1R27A 4K6CA 2VDLB 3D7LA 1NNUA 4H18A 4ZO6A 2XF8A 3KR0A 2FPGB 3DZIA 4DCPA 3MGCA 3EW9A 4L6CA 2PMKA 1LLDA 1ZMOA 1FEZA 1X7GA 2EHDA 2FWRA 2YZGA 1GPMA 4HYTA 2B0CA 4MRMA 2H4FA 1I08A 4DV4O 1HMPA 1Z8FA 2XADA 4HI0E 1ONPA 1RYZA 4Q3LA 3SYMA 3ZW8A 2IP1A 3BCHA 4JI5B 2NZ2A 4PDMA 2QT9A 1EVJA 3GGGA 1EWVA 5IBCA 4ZU3A 3N8KA 4GYJA 1HNZB 3TIXB 3GGCA 5A3QA 1ZCZA 2JLXA 3TKYA 1O58A 4CZZA 1XTJA 4RJIA 3P32A 3IHKA 1PG5A 4DYLA 3ZBQA 2IYZA 4IJWA 5REQA 4UXNA 3HWWA 5IJZA 1D6NA 3USCS 4G4SO 1AQLA 9LDTA 1QS0B 2IYAA 1AHHA 3V33A 4U2DA 4JYZA 1TMYA 1YBHA 2BWJA 1PD3A 1VJ5A 2WJJA 1DAGA 4EENA 3BWEA 4PS0A 1NQXA 3G1TA 3NONA 3QVXA 1B8OA 3QBJA 4PV7A 4I46A 1H8HA 4UUAA 3EAQA 5KDLA 2WVAA 5MN6A 1SOVA 1COWA 2NNLD 2MOKA 2P79A 3DE1X 4MIOA 4Z6KA 5HW0A 4Y98A 4MKHA 3IGAC 1UBRS 2XUKA 3F1KA 3EDRA 1MC8A 2WHXA 1N7GA 4G4GA 2DPHA 2CJPA 1S5PA 1KMHB 2P2LA 3EUEA 4RQTA 1SKQA 1RBQA 5LUBA 5JSHA 1JEYB 4BIMA 3MFQA 3OZDA 2PKWA 4LGVA 1J0XO 2LIPA 2Q2NA 1CQJA 4Z0HO 4EF6A 2Q5ZA 4KP4A 1HT0A 1QM5A 2WJYA 2A7WA 2LIVA 1F17A 1R9MA 3EWAA 4EB0A 4GM4A 2FVYA 1NV9A 1BXKA 2PMDA 4INZA 3WZLA 1SOMA 2BHRA 3L6CA 1OFIA 2I6TA 2IZ6A 3QPVA 4HH4A 4OP2A 3URMA 4BLTA 4CNQA 5KYKA 1DDIA 3A0BZ 2YJTD 3PK0A 3IT2A 1KDTA 2RH5A 1P7WA 5HGJA 4MVWA 3BN3A 1SRYA 1Q14A 2YOFA 2X6RA 4DV1B 1QLNA 5BURA 1I4OA 1V2HE 2C8VA 3EVFA 2IC5A 2QJRA 1RHQA 4OU5A 2C2GA 3LT4A 1Q0PA 2PBLA 3NASA 3MWJA 4OXNA 3QBEA 1A9SA 1BS9A 4WN9A 4ZPJA 3JZIA 4YCJA 4M0DA 5GV8A 1Y6XA 1ZVKA 1W7AA 3NJ8A 3U49A 4UXIA 2J09A 4F2GA 4DLLA 4JT9A 5F4ZA 2YWCA 4D3ZA 2AG8A 3HYSA 4BKUA 1XTIA 3QFFA 4UHFA 5IC6A 1M72A 3CEIA 3E1SA 1MR3F 2NUAA 5FWYB 4ZDIA 2XUAA 4UDXX 3RFVA 2O57A 1HSOA 4XVQA 1LKZA 1NULA 2IOFA 3GGOA 2Q3HA 5CAEA 4J1QA 2Z3VA 4WXMA 1L0BA 4HAUA 1JJIA 3SBEA 2FKXA 1F0KA 1I0LA 5KPJA 2FZWA 2CXXA 1SHLA 3CVUA 4ZOLF 3ZMSA 3L8DA 1FU4A 1GR0A 3CF6R 3J81A 1VGRA 3APOA 1Y6FA 2GOYA 2AOUB 2GTPA 2QN6A 3K5WA 3LW7A 4GMDA 1IN1A 4JI4O 1Q7YW 2B83A 1IFXA 1DFHA 1FYEA 2EGUA 4P5PA 3IC9A 4TSKA 1O03A 2H8PC 2C4KA 3VI3B 2WNHA 4Q4HB 5LL6Y 1Z6TA 4UEKA 1GGKA 1WZEA 5CA0F 2C9CA 4NR1A 1MB2A 4N21A 3G6BA 1PNOA 1YCIA 3A2FA 4WFEA 2E89A 2FUEA 2SHKA 1QHXA 3ZDDA 1V9PA 1YCFA 1OI2A 1Z68A 2LV8A 3WBJA 2XA2A 1QGUB 2J4FA 3OW2U 4L0QA 4TGLA 2ZCVA 3LYUA 3I6IA 3KZIZ 1UDBA 2DBVO 4TT3A 5ALNA 2R5FA 4ZOLB 1P2FA 5DB4A 4YIOA 3OQIB 2WHEA 3QU7A 3DBHB 2Q0AA 5SYMA 2JCYA 1K8YB 2IEZA 5A04A 1SC5B 3CB2A 4GMKA 3M1IA 2OORA 3DUWA 2AFRA 1VE9A 3P2JA 4HH0A 1TYBE 3V4LA 4GWGA 1E3EA 4HN4B 1ECFA 1FUKA 3DLBA 2W6OA 1Z26A 3JYHA 4DW1A 3WYCA 1YQDA 3GJXC 3UMFA 2IYOA 5BSUA 4TYNA 1I94B 5AJYA 4H33A 2Y66A 5JMTA 2QEQA 5JVDB 1HLDA 1ULBA 2FPRA 3AJDA 4OHFA 4YIHA 2SECE 2E87A 2W0MA 5KHGA 3C14C 4PDLA 1ILWA 3CLVA 4IGEA 5CB8A 4QRDA 5ITSA 4PLVA 4PRKA 2GBIA 4M9XA 2VDNB 3RI3A 2VOJA 2NTEA 5ISMA 1GEEA 3HABA 4LV8B 2IPXA 3SJZA 5BSMA 1ZJ4A 3H2GA 1VLLA 4IM7A 4AJIA 4BGUA 3PYXA 1Z5ZA 1P1BA 3UJ6A 2MYPA 5ALFA 4CMAA 4MQEB 5IG2A 2JZCA 1ND5A 1Y81A 2AVDA 2RB4A 2IPAB 2F48A 4MLZA 4TKZA 3RBVA 3VGJA 1L5QA 1N2CB 2C3YA 2CL0X 3MUFA 5C31A 1BDHA 1JPXA 3P2IA 4F3KA 5CU7A 5EE9A 3ENNA 1SKYE 3FNBA 4CYMA 4IIVA 1YS2X 3AIMA 3FPJA 1SZDA 5DXJA 1PQYA 2O2XA 4D3FA 2EEPA 4ND6A 4YDQA 1K68A 1KU6A 3G8DA 1PCXA 4P80A 4BFYA 3B6KA 4EVIA 3JVUA 3SYNA 2R1TB 1VRWA 3M83A 3TAXA 4L8WB 2A5YB 4E3ZA 4I08A 4JKOA 5L3FA 4Z1OA 1LQUA 3DKRA 1QANA 5JPCA 2IHZA 3QEJA 5B1BB 4MVJA 5E3IA 1GPYA 4IIGA 3L01A 1Z5WA 3EK2A 3N2GB 4N23A 4X20B 3LC1O 3NHPA 2GHYA 2IXDA 4G6ZA 5AKGA 5JAZA 4YROA 3OQJA 3T1CA 4O4LA 1A95A 1SIUA 1Z88A 2WKQA 1PWYE 2XPCA 4M38A 4WACA 8OHMA 2PXCA 1B3BA 3IQGX 4M8IA 3PL5A 3FTNA 5EKTA 5AFSA 3THWA 2AUMA 3I1IA 3OG9A 4YEDA 1E79D 5HX7A 1DC5A 3GX1A 2JIZD 2FPMA 2D8MA 4DW0A 1N6HA 1UPUA 1O87A 2FWJA 4MGZR 4ZQHA 3SI7A 2ILVA 3UAYA 4KO8A 3KVYA 1L5OA 1TO1E 3PR3A 2IOHA 4CLRB 2YHIB 5CP8A 3BICA 3MCTA 3OLVA 4FYIA 5LBIA 3RBZA 2FWMX 3I01M 3LK7A 4J07A 3RG2A 2P3LA 3P4XA 2BLNA 5JOQA 1NKSA 3EIHA 4NYKA 4XLLA 3ESZA 4A3SA 5JCZA 2CUZA 5KCZA 1XUQA 3NC4A 2D1FA 1DXHA 4LDJA 4A03A 4RHCA 4JI8B 5TC4A 2K7FA 2ZAMA 4GX2A 1Z6QA 2D5CA 3ZN0A 1JHAA 4QUEA 3WRYA 1E6EA 4ZEMA 2JFGA 5JDCC 2Z08A 3P30A 3F9CA 4BNIA 4M9SA 1U7TA 1Z0AA 2OE2A 3L8FA 4KO1S 2X4DA 1P7YA 3I2JA 4QQ8A 3SOZA 3FJ1A 5E38A 4G0OA 3UMGA 3NDJA 1PK9A 4CKXA 3RYHB 1A4UA 5AICA 2HOQA 4ND1A 4DLRA 4ZI7B 2CLMB 2PI5A 4IDFA 1QBZA 2YV5A 4MGYR 3KHTA 3LGAA 1XRQA 3U0BA 3GWZA 4IFEA 1HE3A 3HU3A 5AXBA 1GT6A 3ZEAA 2DQYA 2PPLA 1Q3EA 2XJ9A 3G0IA 3AKCA 2DWUA 3FJYA 1IEQA 1OH7A 2ACVA 1QG2A 1LW6E 2XOKG 4IHJA 4QJ5A 3SBDA 2ZUCA 3HSYA 5DOVA 1AI4A 2HAEA 2LUOA 4MYUA 4A1FA 1L7DA 3RGWS 2UVDA 3MTAA 4XQ0A 1FW8A 3PWSA 4N4AA 4UDNA 1EVEA 3QYPA 4KN6A 1Z5NA 1MG5A 2YR0A 2DQ3A 1U65A 5MF6A 1M0EA 1QLHA 2E4ZA 1TIKA 4AY2A 5HCUA 2P9CA 1LQ2A 1WB6A 3K92A 3P97A 4A4DA 1MC5A 3BJZA 4MQ4A 4UTRA 2VO1A 3EPRA 5CCEA 4AULA 5EQDA 1TA0A 1U94A 2BEKA 1N1DA 3WMXA 2YFHA 1AX9A 2ZFUA 3KT8A 3NJRA 1Z5GA 1KBOA 2VJDA 4IXTA 1W52X 4M9QA 4RO0A 3E8GA 5HGXA 2GO7A 5SZHB 4DBLC 5A0VA 5HR5A 1KEKA 1SQFA 5EUQB 5BNIA 1C8LA 2HRDA 1AGRA 3CKMA 2QLFA 4BNKA 1GO3F 4ZVPA 4LJKA 1QZUA 2VUTA 3ZWOA 1RYEA 3MSXA 3EH1A 4JX8A 4QQNA 3ZIUA 4ALMA 4DCJA 1U63A 4KQFA 1JQ5A 3IV7A 3SHTA 2IP4A 1BHJA 3CYFA 3FPSA 1J39A 1EVLA 1YJCA 2XMBA 3NM5A 3PF9A 4G4IA 3GPCA 4M55A 5A4DA 3F9RA 1ZCBA 3CE6A 3I64A 4D4GA 3MNFA 4BVGA 4D9JA 3AVTA 2AEEA 2R751 4HOYA 4H6XA 1NTKH 3T7JA 2C2MA 1KSGA 4XA8A 5HE9A 3RADC 1QCCA 1YIJV 4PTYA 4EVSA 3QFSA 3RBXA 4IDAA 2WI8A 4AJ1A 2V6MA 4JJ7A 4YJDA 4AUKA 4AF8A 5JJNB 2A0KA 1EGVB 2YSUB 3IUSA 3V6LA 2XDYA 5DYIA 4O2LA 1XN1A 1SULA 1EE1A 3OQPA 2ZM6B 1PEAA 2XVAA 1JZSA 3CJTA 4P98A 5DHAA 1EUCB 4L2IA 4K9PA 1CFZA 3L8MA 1LFAA 4F7DA 1NPYA 1Q0LA 4Z4CA 2AR7A 3OZEA 5KIAA 5GPBA 3T1TA 2YCLA 1KPIA 2V8BA 4FZVA 4XDYA 5T7BA 4JDPA 5D87A 2PS1A 1GGNA 2JAPA 2RCYA 4P4UA 4JH0A 4TSFG 1IDN1 2P06A 1A04A 2IIBA 2BFAA 3GRYA 5M3BA 5AM2A 4UUJC 2VP5A 4NYIQ 3KQHA 2ZE7A 2L6LA 1PJZA 1KQPA 3W7BA 3T3OA 1XNHA 1NUAA 4LH7A 4JYPA 1UK7A 2FR8C 1YXBA 2VYNA 1WHTB 3CA8A 5CBGA 3P0EA 3CQ9A 3QA9A 1SB8A 1XDGA 4NAUA 3E3NA 3JYOA 4IF4A 4J75A 4CR6A 9ABPA 1JZQA 3OIGA 1F2UA 5EJEA 1T5LA 1TGYA 3TGLA 2W8BB 2ONJA 4UOEA 1EP3B 3TSAA 5KJ1A 1C9JA 4FCWA 4YV2A 5JWOA 1X3LA 3R8XA 4XBFA 1L6IA 1UMCB 3IOYA 4JLSA 1CIJA 1A8UA 4UMDA 1UBCA 1TJPB 3FMVA 2X9VA 3TIGA 1NQTA 4EKEA 5MGBA 2GASA 2VDMB 1N7JA 4KU4A 4FB5A 2Q7EA 1XHXA 2TSYB 2XVZA 2VP6A 2IIQA 3C3BA 3K31A 3MS2A 1W85A 1VMGA 3B5IA 3H04A 1JZTA 4MAFA 5K1XA 4FFMA 3GQVA 2NO9A 2VWGA 4PD4F 5G4KB 1XPRA 4K0KO 1GSIA 3AYXB 4I4CA 3BEHA 2FQYA 2O8NA 2Q0QA 3D5TA 1J1UA 4FFBB 4NCXA 4F86A 1DKMA 1SGWA 3TKLA 2QKCA 3T4PA 3F5MA 2RAVA 4QBKA 1JL3A 2RD2A 1I33A 1FK8A 2L82A 2ZDQA 3A04A 2AN3A 4AAYA 5KQGA 2CNNA 1SBNE 3AP1A 3KYJB 3BIJA 4RHEA 2ABWA 2R87A 1L3IA 4YMTA 1B15A 2LP7A 3ZK7A 3E84A 4XWTA 2YVLA 4OL9A 4L16A 4WJLA 4UNQA 2K6GA 4DQDA 2QJWA 3PXGA 5KA6A 4AIRA 1TPZA 2Z5UA 2BP7B 2Z3YA 3EXEA 2SKCA 3L7KA 1P3JA 1QGOA 2HU8A 3WLLA 1TYAE 3EEFA 3DE5X 3DP9A 4NFHA 4EQ6B 3O8OA 5JD5A 4W8HA 1CE8B 4MGKR 3QWFA 3L79A 1Q7EA 3AL2A 4Q3CA 3HGMA 3THOA 2JJ1A 4RU1A 1Y9EA 1VZ2A 4F8JA 2O8DA 4Q7JB 1ZXXA 2WWTA 3JVDA 4W9RA 4FFVA 1KR2A 3V1YA 2RSLA 2PWYA 1D6JA 1HE1C 3IEXA 4ISBA 3RU7A