2P90A

The crystal structure of a protein of unknown function from corynebacterium glutamicum atcc 13032
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
269
Chain Sequence
DRMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Cgl1923
publication title The crystal structure of a protein of unknown function from Corynebacterium glutamicum ATCC 13032
rcsb
source organism Corynebacterium glutamicum atcc 13032
total genus 83
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p90A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2p90A01
3D3IA 4HAMA 5GW7A 3W7UA 2WAMA 3VR0A 2P90A 3W7SA 1NVPB 5CA3A 1S3JA 3W7TA 3MNFA 3WZ2A 4G4SP 3IC7A 3E35A 3W7XA 1NH2B 3BY6A 2HR3A 3W7WA 1YTFB 3GAAA 1RM1C
chains in the Genus database with same CATH superfamily
1M9NA 1X7XB 2BR3A 4M88A 4JI1O 1ZMXA 5CYOA 1BXGA 3B5JA 1NDQA 3CUTA 1YL6A 3R3HA 2J6HA 3IEKA 1UBLS 4PHZA 4LFBO 3G1TA 1UWVA 1R37A 3FYTA 5CX1B 3CJHA 1UC5B 1Z6AA 4UHBA 2BLLA 3QMVA 2NAPA 4R2HA 2X3FA 2R6DA 4LBWA 1Y8QB 1EXWA 1R18A 2C0CA 1NLUA 4NZPA 3AVYA 2Z0AA 2HNKA 1XPUA 3I72A 3EF3A 5AK3A 4IXDA 4KWEA 3AHDA 3W1EA 4YMSA 5IW8A 4Z9FA 4MWTA 3MWJA 1VE6A 3GMIA 2GCOA 4B3XA 4I9WA 4RHTA 2PGDA 5JWHA 3JASB 2EX0A 3KB8A 4ID3A 4A26A 4HUQB 4NXMB 4K0RA 2JIZD 5D7BA 1G21E 1UPAA 4DXWA 1JLLA 1WNFA 3OOJA 3AU9A 1WAZA 1E4EB 1CETA 3ZWYA 2IYPA 3EWAA 2LQTA 1HF3A 4DZZA 5KYYA 3R0VA 3UUGA 3IB3A 3FMOB 5CA0F 4RD3A 3GD7A 3QEMB 1GMGA 3RTGA 1DC4A 2HXSA 2BL4A 3PNQA 1ZGZA 3N59A 4JZ2A 5CMUA 2RGXA 3NVMB 1E79A 3D0OA 3IVGA 2FN4A 1GXSA 2VHYA 3FYUA 4D3XA 3F6RA 2IV3A 4D0GA 5G02A 2ZRHA 4LXHA 2FB5A 1MABG 4YV1A 4IXWA 3TUIC 3EC2A 4QSMA 3GMSA 4JQCA 3NEAA 2I1LA 4J7JA 1BCSB 2W42A 1GGFA 2EEPA 4RZQA 2VP0A 1NIPA 2GPSA 4R9UC 2BFMA 1MW9X 3MCUA 2QJWA 4PO1A 1G20E 1QXSA 2QVYX 4F0JA 4WX2B 1H5NA 4Q37A 1QHHA 5C8ZA 2PGXA 3Q3GE 2P9CA 2YFYA 4GOLD 4B35A 2QR2A 1VL2A 3ZJZA 1BVYF 5JNTA 5KQRA 4AUNA 1MO4A 1PQYA 2WLIA 1MAWA 4E5DA 4YGXB 1DKPA 4LHVA 3BZWA 4G9GA 4ATNA 2XMSA 5TGDA 1I0IA 3N0TA 4X97A 5ESDA 2J8ZA 1NYLA 4OU5A 3TOVA 3LVFO 4MVOA 4DLPA 3KS9A 2BFFA 4GI7A 3K30A 1M0WA 2ZI5A 3F2IA 2V7QD 4QAQA 3TLMA 2PM8A 1IU9A 5LHHA 2C4KA 5LQUA 1VBKA 3VKVA 1MR3F 4BO4A 1G8KA 3BJMA 4DWVA 1FRNA 4TVKA 4JKIA 1BJTA 3OQPA 2B82A 1YFKA 4ASUG 4M1WA 3M6VA 4DPKA 4Q9JA 1XUQA 3ADKA 1ZK4A 1KNXA 1J9ZA 2BOBC 2ZJOA 4MV6A 2D4AA 1FYEA 3FPBA 4FYXA 4LRUA 3RW0A 2PWYA 4UJ5A 1MIHA 4BAGA 5DBFA 1FXKB 2O3QA 3O4RA 1YR9A 3P71T 4B71A 4MCHA 3BWMA 3FCSB 5AXBA 4N47A 3FTEA 3ZY3A 2YY6A 2OGTA 3AJEA 3L6BA 3MINA 4RY9A 5B7NA 2FRVA 3P0FA 2H8GA 1B8VA 2X22A 2OWEA 1R5NA 1LBQA 2VRNA 3ZXSA 1GT91 5CGQB 2JRLA 4Q02A 2P4UA 3TJTA 1NHWA 2DBVO 1D1QA 2I1VB 3B7GA 1Y1QA 4XSVA 2Q9UA 2HV8A 2MINB 1PJLA 4R40A 4JK3A 2YI9A 5E7IA 4MW8A 2XH8A 2F4NA 1TM5E 4GI1A 3TAXA 3UJAA 5EAIA 4JQYA 5EIBD 4M9RA 2Q2VA 3LECA 3FOWA 1QFJA 3AKCA 2ZYRA 4CV3A 1Q11A 3MIZA 2HK6A 2VZEA 1P1JA 2APJA 4PCAA 5H68A 4KO1S 1SR8A 1UAYA 1GD1O 2OD9A 3VISA 3M1LA 3UMBA 3HADA 2KM1A 3ZU3A 4J3FA 3STXA 3GFFA 5FTKA 2AN5A 3CUWA 3C3KA 3QELB 4R31A 1KEEA 3M89A 4BLPA 2BD0A 5B1NA 3GGDA 3UH0A 3DZBA 2RGYA 2GGSA 1H0SA 1S6YA 4GOXA 3KSMA 1ZH2A 3IVRA 2N05A 3NG1A 2CNLA 2AGVA 5L3GA 4OQQA 2HSZA 3MJEA 5IAKA 5GTIZ 1CNEA 4R2XA 3AB8A 1KHTA 3LQRA 5BN4A 3U09A 2OB1A 4C6SA 1Y5NA 5J4HA 3CT4A 2WUEA 2J6IA 1L6RA 3HE3A 3OU7A 2VJPA 4RDXA 1DPGA 4QYTA 3D7NA 2DMXA 2QXYA 2DUMA 4PG4A 4BTEA 1RFYA 4QASA 2HBRA 2YBEA 3DR3A 3QIVA 4MDFA 2K1EA 4D96A 3TLEA 4GE3A 4ZDJA 3U6KA 2JGAA 2BE7A 1NOIA 3NH9A 1NNUA 3B3AA 1OVGA 1QTIA 3PIDA 1SU8A 1MJHA 3CF2A 4MV5A 1IN7A 3QVOA 3V4OA 4H7PA 4DC1A 4AU1A 4Y0AA 2DBZA 821PA 5FWDA 4KXMA 2QG4A 1R0KA 3ZN0A 5KQLA 1XNJA 1LQTA 3P94A 2JFOA 1U3WA 3HCDA 4YREA 3BJEA 4UUPA 2QLNA 3AMVA 3USCS 2JAXA 4Y6QA 2J3HA 3PCRB 1RLOA 3BEHA 1RPZA 4Y67A 3LE8A 1GGKA 5D3ZA 3KDSE 4WZAA 4GBED 5CTAA 1QFZA 1N3LA 3QV1A 1TF7A 3CKYA 4DANA 2JB9A 2BW0A 4QUJA 1ZI8A 2VYFA 2FZVA 3GCGA 3EB9A 1KQ3A 4PYJA 2VWGA 1QZZA 3E7DA 2AVDA 1FP7A 1MPTA 3HXOA 2RBGA 2M1XA 3PXEA 5AIBA 1B14A 4ZDIA 4R9NA 5ILOA 5DMXA 4UARA 2EJCA 3A0RA 3I9NA 1MENA 1H2MA 5FPRA 4Q93A 4G41A 4M7RA 3FWPA 1J70A 3KAQA 1F0NA 4JC8A 3ZH9B 4QYXA 1TC1A 1QGUB 1CS0A 3BCHA 2PYZA 1JYFA 4Q47A 3EF1A 3GMTA 4R9RA 1PJCA 3JQ6A 1II9A 4OYRA 5BO5A 1E7SA 3Q41A 3QLEA 4MB2A 1TPZA 1CY2A 1ZUIA 3MRVA 3BQ9A 1MB0A 1RP1A 1Z6PA 3PN1A 2DTDA 3H1FA 1MJGM 1PLJA 1YF2A 1YR8A 4BFLA 1BDHA 1X1QA 4BMCA 4LXYA 4JOSA 3WRYA 4D7TA 4ZZIA 5EJ7A 4GGOA 4ZKEA 5CBFA 1FFYA 5DM0A 4JU8A 3Q2IA 1Q5OA 4S0ZA 2SKCA 1AUPA 2WINI 2J33A 3EXHB 1QRSA 4I7EA 1EPUA 1D6NA 2Y05A 3ISJA 2WWWA 1ZBDA 3D3WA 1G3UA 3RQIA 5FL7G 5FA6A 5ADWA 5F78A 2G0AA 2P2LA 3K6RA 1Z6YA 1EB9A 1FXWF 2HO4A 4LMAA 4FLYA 4BRWA 2I1QA 3HN6A 4GX2A 3G5UA 2O8CA 2O7NA 2ES4A 3QO5A 3L0OA 3SSNA 4R51A 3IP7A 2F4VO 2CXUA 1QP7A 3H8WA 1FFDA 2O50A 1KEVA 2O59A 2V8OA 1SUFA 3ZE9A 3ID6C 3PEVA 1I4LD 1N1MA 3RRJA 3RWMB 1GNLA 3D36C 1NNSA 1QLJA 5I8ZA 3KDPA 4UAGA 2G9VA 1U9YA 4CPDA 3OTWA 3GJZA 1N9GA 5FBHA 4UCFA 5KHOC 5DO9A 3UXMA 2YXLA 3VQTA 4BN5A 3D5QA 1YMUA 4FM9A 3MCTA 3ED1A 4TV9F 1UDAA 1NBWB 5CFOA 1MX1A 2X8LA 1XNHA 2RHOA 1HQCA 1CUHA 1AIPA 2VT3A 1KFBB 2D3WA 4MPJA 1R9NA 3VZQA 5D1HA 4C6TA 1MX3A 2LBPA 3ROZA 5JAZA 3CTMA 1Z4NA 3I62A 2ZSAA 1MVLA 2LCQA 3WRXA 1J97A 2GCNA 4ND5A 1AI6A 1J25A 2GSWA 5I7OA 1QOPB 1UP6A 1NNI1 1A8UA 3MD0A 3JYQA 5LWQA 2QP4A 1VHWA 4TMKA 1RTTA 2XUAA 4DG5A 2XEDA 4I4LA 1A5AB 4MGIR 4AKTA 3FAZA 4N82A 3L9WA 4ZO9A 1NTMH 1I94B 1IOWA 3EEOA 3NTUA 2QLBA 1YRYE 3NBFA 3VPBA 4AVYA 3C43A 3K15A 4HI0E 3N2GB 1GU1A 4JAAA 4ZPXA 1I2MA 1AROP 2YYYA 4IF4A 3E9DA 2WTNA 2F1HA 5IANA 4J1QA 1XUOA 1PDVA 4Q3BA 1YZGA 1XC7A 5LQRA 2HCTA 4HDAA 3EXIA 1YQGA 2X6BA 2ORWA 2WJ3A 3DE2X 3A0UA 4YP6A 1O89A 1E1RD 1HNZB 3O7MA 1NVEA 3RYTC 2ZSDA 4W99A 1O4VA 2UUPA 2XTJA 1P18A 4FMPA 2ST1A 3KEGA 3UWOA 4MYDA 5KLVH 1JIVA 3KHUA 3JQ9C 5E4YA 2HJ9A 5FOVA 2BCGY 1SZTA 4RAIA 2IDJA 2OESA 4MS1A 4BYGA 5TSDA 3R23A 1N5OX 2WKPA 4KWCA 4RC9A 4A7PA 1FCJA 4JVNA 4AO6A 2SECE 1OBCA 4JSRA 2FPKA 3MBKA 3A27A 3BQMB 2UVPB 2CCKA 1NFRA 4E31A 3SBOA 1MOQA 2Z3ZA 1GZ5A 5EMHA 1DQRA 4Q9IA 3OG9A 3IS3A 4F93B 3DHEA 1USUA 2C2XA 3T52A 2ZT9B 3KQYA 1PUXA 3K0FA 2AJTA 2VHCA 4MVJP 2C7QA 1W29A 1PJBA 4UPDA 3ZU4A 1C2TA 1TYDE 3WOHA 2FEMA 1NBME 3HZOA 4FT4A 3DAPA 1OLSA 1A5TA 1GR0A 1R5BA 3HR8A 4BVKA 3F5MA 5GONF 3AFNA 3IA7A 5KJ1A 4K6OA 3INNA 4EPWA 1E1DA 4JA2A 3UW3A 4BEBA 4WDRA 2CV0A 4XPZA 4FFMA 4AY4A 2JCYA 1QHTA 3FBWA 2R8RA 1S8OA 4OQFA 3VR2A 1PJ3A 5DP1A 2EDAA 4BNKA 3KKEA 5TQVA 3K70C 1VGRA 4F84A 4BE4A 1KH1A 4DW0A 1I4DD 2PZBA 1IJBA 5IEBA 2K5UA 2UAGA 3DDOA 3F3MA 4UCOA 3P3NA 1CUVA 1T9KA 4CC5A 2V6FA 5JS1A 1XP8A 2NZUG 2H3HA 5L3SB 1NPYA 1YGPA 1J0AA 2JAPA 1POXA 3OCYA 4O4LF 1NT4A 2VG8A 2ZRMA 1W581 2VHEA 3QLUA 1BSMA 1KHHA 5KTPA 2FA9A 1SA0A 2JRIA 3EEFA 4RUEA 3JD3A 4JV5O 2QD5A 2FX3A 4X1YA 1T9GR 2VPZA 4GM0A 2RC6A 1I14A 1PEAA 1ZA2A 1GCIA 5U1PA 1NTZH 4TL6A 4NNJA 4YH1A 4UBKA 3OQ1A 1UJ2A 5AVZA 2HWYA 1SKUA 4HO1X 1YRAA 1JE0A 1VYHA 3DEKA 4C5CA 3WIOA 3OT5A 1LNQA 1C3OB 5F2KA 3OURA 5A04A 2B2XA 3T7AA 1EKXA 1TQ4A 4OQ4A 1FW8A 1AMOA 1Z73A 3IURA 3U4CA 5FPPA 5AI4A 2VPQA 1XVLA 2JFNA 1ODKA 1I6KA 1TUBA 2FTKE 4WFFA 5FT9A 3A1NA 4MW7A 1QHYA 3UNXA 3I04M 5IAOA 3EFBA 1TYCA 3G79A 3FOEC 1B23P 5KVAA 2N42A 3LX4A 3I9V1 5DIZA 1PNMA 4IINA 1Q19A 1RJFA 1QCDA 3A3OA 5LMNB 1GPBA 4ZKDA 1XCMA 2PT9A 3FYEB 1Z5ZA 1UDWA 4EYKA 3W2IA 2JFHA 3KQNA 2NZ2A 3WGHA 3N8NA 1P33A 3WSWA 1YQUA 2GEKA 2XMQA 1ODTC 4KC0A 4R2MA 4PA6A 4JBYA 4KQ9A 3PV0A 2Q3CA 2CL6X 4YDRA 1T2CA 5ECGC 2ZWAA 2C97A 5KYNA 2IXGA 3W78A 2HX1A 2DY0A 4H7KA 1DFHA 3B6IA 3DTTA 2D6FA 5ALFA 4OGFA 3RV4A 2ZS7A 1ZUD1 4W1PA 2W6JA 2Z56A 3PLAE 3EVTA 2COEA 4F04A 5SY4A 4JEMA 2HO5A 2DERA 4DB4A 3W90A 4XR4A 4WXRA 3JSXA 1R16A 3PHLA 5C0OE 4K03A 1QH9A 2HLHA 4H7HA 4F3RA 3G23A 2C4VA 2OZLA 4IS2A 2UXCB 1RM3A 4ALIA 4CLOB 2J08A 3E5MA 1A71A 4PPFA 3I1YA 1N2CA 1TZ2A 2ODTX 2H52A 1RPOA 5DGCA 1IHPA 4LF6O 3SC6A 5IYZB 1BNCA 1WOYA 4NRDA 2AZ2A 1U0NA 1R27A 1ZCBA 1VPEA 3OT1A 5AVUA 4RXUA 1T36A 3K57A 4TV9A 1GKFA 1XRRA 3MWGA 4CM1A 5B1AC 2A35A 4RHCA 3LUKA 5BMOA 5PGMA 3FNGA 1E9VA 1W0KA 2Y0DA 3WFIA 2C5HA 3ZVMA 1YS4A 3DTUB 1XMQB 1ST2A 3C14C 3JYPA 4R9SA 4RETA 5ED4A 4Q3KA 2A0LA 2YJGA 2Y0CA 3K5LA 1KR2A 2GQ0A 5CM9C 3IHTA 1EEHA 2KE5A 2DHQA 3GI1A 5I9SA 3TKLA 3HP7A 3PQDA 5LB4A 2F1JA 5MDHA 1H2YA 4IQ0A 3O4GA 1HFJA 3JQBA 4HTFB 4MMYB 1ULSA 1V4BA 5AJVB 3VNQA 3PC4A 4IWXA 1UZAA 4HDMA 5G41A 1WP7A 1U6IA 1JDPA 2DP4E 4UVBA 1D2MA 1HLPA 4UFPA 5H8WA 2OYRA 1P4AA 5IJ0A 3R7SA 2R8BA 1HDOA 2QD1A 2RI0A 4Z4HA 3K9AA 2RJNA 2IOYA 4M1YA 3UICA 2I7TA 4ER0A 2PUCA 4BFWA 3IEUA 4LF4O 2CMKA 4J7XA 2JFXA 1I7LA 3SX4A 1RS0A 4NBRA 2BI7A 1S7CA 1RSZA 3GLIE 3KEQA 4ZV9A 3FLMA 3JYHA 1XZKA 3SYCA 1RI1A 4D6YA 4KPYA 2M6LA 3RVLA 1VJTA 1LPAB 1YTUA 4ZYYA 5IWAB 3SHOA 4RDHA 4DR2B 2Q5CA 1NR1A 2XA1A 2GUZA 2ZP1A 1PWEA 4C01A 1A9TA 1BKYA 1OYWA 4MI3A 3FTNA 2O3TA 1WPXA 1L5SA 5FEUA 1JA8A 3EVDA 1WA5A 1A2QA 4D81A 3CE6A 2Q4DA 3IILA 1UBMS 1Q86W 5AT1A 3KQOA 4P0TA 1R64A 2FF7A 4G2NA 1L4UA 4F1JA 2PR7A 2F8MA 3ADDA 3PCTA 5ALGA 3AVVA 4E08A 1ZZEA 3D64A 2Z83A 2G80A 1GN8A 1A7UA 1E0DA 1PZMA 2ZSIA 1XEAA 3T3MB 2BOCC 1TU0A 1RAHA 1ZP6A 3K05A 4BCCA 1GGHA 2ZSFA 1PT9A 2GEJA 5HHTA 3LY7A 1RRCA 1WUYA 1V96A 1SVKA 2Y1KA 2IK8A 1X0VA 4ZT7A 2C2HA 5AVXA 2A94A 2I29A 1LD3A 1TF2A 3D2AA 2PYIA 3RT3C 1I08A 3A1WA 1Z15A 1T34A 4S1NA 2VT2A 5DU2A 2HLPA 3GDFA 3RJ9A 3Q8WA 4EPTA 3K08A 1TRHA 2WJZB 5C3UA 2OBFA 3NHSA 2BONA 5GONA 2A06H 4XFKA 4C7XA 3DLPX 4AW9A 4QPKA 4N03A 3KO8A 3I3OA 2OTJV 3PICA 2DXIA 1GA4A 1RYBA 3NBZC 1AO0A 1UBKS 2DQSA 3K09C 5B66Z 1V3UA 5P8WA 1RI5A 1Y3DE 2QM8A 2CKDA 2R00A 4OXIA 4KBGA 2AZTA 1Z7GA 4D8YA 3MSCA 1VE5A 1SU7A 3H5TA 3RTAA 3JD1A 1IHDA 4LE1A 3GLFB 5ADHA 2ODMA 1OFIA 5D1NA 3I9JA 3G8AA 2P0YA 4QRHA 4BNNA 2VQSA 4WCFA 2HVJC 1YI8A 2GZRA 2EFGA 5CLLA 4IIVA 5C5CA 5D6OA 2C61A 2ROQA 1A8IA 1KK2A 1ZI9A 2GSDA 3DLAA 4BNFA 4KQMA 1C29B 1YVUA 1ZXBA 1XJQA 3P5SA 2WWVD 1O77A 4UASA 4O4LA 4ITUA 1HC7A 2KG7B 3D6VA 1OMOA 3BXEA 1V9SA 5JCJD 1P2DA 1Z75A 4Y9DA 4I3HA 4ZA2A 4E3ZA 2RJOA 4CKXA 2P7IA 4U7JA 1U3VA 3OTOB 4LXTA 3EGEA 1XJCA 4JROA 1JSLA 1EE9A 1P73A 4V0QA 4LV6A 5EWLB 2CLCX 1QYVA 5BSUA 4P9OA 1UJ5A 3RVKA 4TKLA 1EP1B 3P3PA 1KEWA 4EJ0A 2JIQA 1EK5A 1RM1C 5LQCA 2GESA 3WIBA 3O65A 1O95C 3WKBA 5EHGA 4ALJA 2ODEA 1BDJA 3C98A 3HVRA 3EFOB 1ORTA 3ZLVA 3RVZA 2XTNA 1OCCC 4X95A 2QKYA 3DMFA 4BIOA 4LTMA 3RYFB 1EXNA 3GDOA 5FRDA 2PBZA 1SWWA 3L0ZA 4G0UA 1Q0PA 4RZ2A 1B04A 1CRPA 3T4XA 2TMGA 3TSZA 2QVCA 4P08A 4JGBA 1JNXX 2I4IA 3ZYCA 2Z6AA 3UV6A 5EXDA 2V6IA 3K1JA 1ID8A 1C5KA 3SFZA 2A1UA 1Z68A 4AS2A 1VL0A 4Q3LA 3U80A 2W2LA 1Z3IX 3AHJA 5FUWA 4K6FA 3A2LA 4F2HA 4FU0A 3FUUA 1SRYA 4UDXX 3Q8LA 1JPJA 5L3QA 3F1LA 4LYJA 1XYGA 3LDAA 4P80A 3IJEB 1JILA 1VMIA 3I1FA 3B82A 3C3SA 2IE0A 4AZ3A 2MYNA 2HWWA 2QN6A 4M1KA 3VZCA 1CUEA 4FNOA 2HLDG 2C92A 1UFIA 2HP8A 1ZI6A 5BMVB 3MTJA 3ZTWA 3JTMA 3ZCQA 4U6SA 3I01M 5C35A 3L8YA 2JLSA 4YJFB 5DYGA 5C9ZA 5CT6A 1U0RA 2WF6A 5TGZA 2IYAA 1ONOA 1H2RS 4TM8A 4JYZA 4EVIA 2FQXA 3M70A 4M0LA 4IX1A 2AKAB 4EKWA 1Y9EA 1PFVA 3A1UA 3N2NA 5BN1A 4BECA 2Z04A 2RFLA 5CURA 4Y18A 2OTCA 4D9NA 4CKWA 1IM5A 2AHYA 2AW3A 4B76A 1BQ0A 1JQKA 4LJKA 4L78A 3P8ZA 4X8MA 2YWJA 2P8SA 3PD0A 2W2VA 4WFBV 5FA5A 3ZE7A 1UJNA 1HZZC 2H17A 5AVWA 3LUGA 5KB3A 3UK0A 4I5GA 4YMVA 2VBGA 4NP6A 3ILYA 1YDWA 4DNQA 4PG6A 1SBNE 2A78A 1CJCA 4PC2A 3HUTA 2E4AA 3HTXA 2QMHA 3SIWA 1W59A 4Z4QA 5F3WB 3AG6A 4OHYA 1FFXB 3ZCRA 5HG0A 3KPJA 4BAYA 4UQPA 5GMOA 4CV1A 2FUEA 4KH0A 2VKQA 1ZM7A 4L4YA 1KBHA 3TG2A 3RC3A 2BSAA 2EATA 1E4OA 3O93A 1RRKA 2XUIA 4ANFA 3QVUA 1JVMA 2BAGA 4RA6B 6Q21A 1EVYA 5FTJA 2CV1A 4JX9A 3GVPA 3EEQA 4IDDA 2ZB2A 4X1KA 4DRZA 1KSHA 2DPHA 1J22A 2PS9A 1BE6A 4Z3DA 5T4BA 1NMXA 1RM5A 4HGYA 3OWXA 1PP4A 1XILA 2AX3A 1ZNYA 4KXLA 3TVTA 3D8SA 5HA5A 3ROFA 4JNKA 2P65A 3ASOC 2QYTA 3VR4D 5DYNA 4XJTA 2IYNA 2H51A 3CB4A 4JXZA 2XGGA 4LF7O 4WKGA 4IXNA 4J1NA 4NFSA 2GT1A 2XMZA 3FR8A 5F23A 4CC6A 4B44A 1LDGA 1VLLA 2JGDB 1HLFA 5JJ5A 5ILGA 4IILA 1SHKA 3H75A 3QMPA 4FKMA 3WMGA 1M1YA 1QGAA 3QTBA 3PNPA 4XPIB 5DHQA 3KR9A 3TLZA 2EILC 1KOFA 1GZVA 3IAS6 3ER9A 5AK5A 1W8IA 3PHIA 1U0LA 1WHSB 2X1HA 5I7RA 3K5HA 4TRMA 1OPRA 2IOQA 3RG8A 4MWOA 4JCOA 4FD2A 3I6MA 2C04A 3D2LA 5G0VA 1YI2V 4WE3A 2Z9CA 3CZCA 3O8DA 2WMOB 2Z2IA 4CQLB 1G6HA 4K9SA 2ZSJA 3BHNA 2RIPA 4Q9KA 4GMKA 4RPLA 5FNVB 1V11B 3K2QA 2QTBA 5CLGA 5CH3A 3WE7A 2ZBVA 2GZDA 3Q11A 1XLVA 2GNPA 2WKSA 3GUYA 4L73A 2CYAA 2IDKA 3K58A 3I9KA 2VQDA 5AIAA 4C06A 3D1JA 1JVNA 4ZVKA 1TM7E 5AUPB 5CVTA 5DTMA 3L7JA 2HMVA 4OHRA 1ZUNB 4L9WA 1N6IA 4X8LA 4X66B 4AXXA 4CN8A 2NV2B 4XXHA 4PV7A 2EARA 3OZBA 3VAAA 1FNCA 4IFIA 2RIRA 5BPHA 1KYYA 1XTUA 1OE0A 2HHJA 3QO8A 3KHKA 1Z35A 3MDSA 3P0EA 4QDXA 4COOA 4JF3A 5KHJA 4CF5A 3CZPA 1HH4A 1PZHA 5IDYA 2BKVA 1KDOA 2FN3A 3CXHF 2HU2A 1JQLB 4G0OA 4NXNO 1DZIA 4Y6LA 2VS1A 1RRPA 2W70A 1UBJS 4AZVA 4B4UA 1W9HA 3U48A 1J8VA 3E0QA 3STYA 2AUMA 1YBHA 3V1LA 1BX3A 1U28C 2OBXA 3GEHA 1GLVA 3AEKA 1ULHA 3ZGYA 3WK8A 4TN5A 5AJWA 1U99A 3IOYA 3E9YA 2Y9MB 1YR3A 3NVDA 2W2KB 4I4CA 3M8KA 4RYLA 5B4UA 2HEIA 1XMSA 1KWGA 1KQGA 1N0HA 3GC6A 1CQIA 2Y93A 2QSZA 3VVCA 4BIMA 1UXGA 1PKXA 3QY9A 2YFKA 1HNXB 4D02A 2PXAA 3FYSA 3D4IA 3WG7B 1V47A 3O3OB 1NVBA 1GP2A 2PZFA 1SQFA 4ADSG 4RDCA 2CMDA 5DNYB 3TNJA 3W9YA 5KX5A 1XZHA 1YBVA 5EFZA 1DBPA 2Y3IA 5DTEA 1Z29A 1C7ZA 5CJJA 3TZEA 3NMUF 4EG4A 4RTMA 1H8HG 4PDMA 1XZPA 3OTFA 4F8JA 2WDPA 1JKXA 2PY5A 3NP7A 1JX9A 3IBTA 4LJYA 1VKRA 4HRVA 3BGWA 4M38A 4YJHB 1KKUA 1VF5B 3T9AA 3KKOA 4IWNA 2QN3A 3ZCPA 5JOQA 2EF1A 1THTA 5HIAA 3RVJA 2DMRA 5K0EA 4TUYB 3STLC 2GO1A 2WQZA 1OYOA 1BL8A 3LL7A 1YAJA 4JXJA 3K9QO 1NL3A 2A5FA 1TA0A 2D2XA 4GP7A 1XDUA 4RGBA 3KYDA 4XFDA 2QM0A 3UCSC 1EBUA 2IUSA 4E32A 2D54A 2A9OA 2ZXWC 4UVHA 5A1TA 1WXIA 2HRCA 4KFTA 3GNQA 3ULKA 4II2A 1Y6XA 1H2FA 4U2BA 4Q3NA 2WSYB 4XYEA 4NV0A 2A7XA 1JDVA 5HZKA 3N2KA 3CCFA 4FFPA 4PZCA 2YIMA 2ZYGA 3EJ6A 2VNSA 5K0NA 2X5JO 3IP6A 3OPYB 5FAKA 1U1EA 3EHDA 1E5XA 1MOZA 4QIHA 3B9PA 1A4XA 3HKBA 1WJGA 1RADA 2FPPA 1D5AA 5K1PA 1G59A 3E81A 2QW0X 1AK2A 3FCEA 4KVAA 1K7XB 1GWNA 5CDUA 1TFUA 3NAQA 4UVAA 3QEKA 2PUTA 4C0WA 2BH9A 4L5IA 4DZRA 1UQRA 4MGEA 5AJYA 4XDLA 3DONA 2WKQA 5B7QA 2YVLA 1XELA 3HBLA 3GUZA 2H2DA 4B3BA 3EIOA 2UUBO 2Q0SA 4U2CA 1IHUA 1VLJA 4UPVA 1T15A 2QROA 3SR3A 4M8KA 1APBA 4L0CA 2OEPA 2ID8A 2XAAA 4LBEC 3CCUV 4M9SA 4R2WA 3ZGOA 4BVLA 2GJAA 3CINA 3W9UA 5HM6A 3DOHA 1Z0UA 4PDLA 2X1VA 1DEAA 4IGEA 5LQAA 3KQTA 3PUYA 5THXA 3T5GA 5BORA 4GRAA 1LDNA 4X9XA 3S5UA 3LHSA 1EE1A 2ZPUA 3PX7A 3OEYA 1X1DA 5BQPA 4EO9A 1FS4A 3TIIA 4BTVA 1E20A 3BREA 1W8DA 5WRFA 1HRDA 1X7YA 3UGQA 4YAIA 2LCFA 4ZHSA 2R6ZA 1IRXA 1HE8B 1AQJA 4UC0A 1XXHA 4UZEA 1N2ZA 2ZR0A 2WLNA 5B4TA 3EAGA 4DDMA 1U7TA 3SC2B 2OCKA 4UUMA 4L85A 5IJAA 2BEWB 4ZOLB 1H69A 3BOSA 3GK3A 2V74B 3WLJA 2XKAA 4WK4B 4QU9A 4EAAA 2LO1A 5DWQA 3L06A 3ICPA 3EIWA 3I73A 3U44A 3LLVA 3BL6A 2A0UA 4L5YA 5KS2A 2OWOA 4I50B 2TRSB 2YYAA 5BY1A 2NM0A 2WM9B 1SVSA 4FR5A 3RE1A 3CH5A 4PI0A 4HNSA 2P22C 2FYUH 5ALPA 4MHSA 3WGTA 4Y30A 3B1ZA 5K03A 3JAKB 3BSYA 2RAFA 4YP1A 5HUHA 4JI8O 2VF4X 4P7BA 1XQWA 4HNQA 3LBIA 4EG3A 3WQQA 1RWVA 2Q4TA 1RP3B 2MR6A 1JXQA 1EN4A 2FPXA 3VHXA 1SQ6A 5FPHA 3ICVA 3AETA 3FUWA 3A4NA 1XA0A 2C7GA 1HT1E 3JQAB 1WD5A 3CVVA 4UBNA 5CT5A 1COZA 2E21A 1OWOA 4IJ5A 4ZU1X 1IXYA 4Q00A 1XD2A 4CKEA 4FCWA 5IVKA 3MA0A 2I6SA 2Q4PA 1M0EA 2PS1A 1KZ9A 1JXOA 1E2IA 5IC6A 1O54A 2HUNA 2QHXA 4CCAA 3RUEA 1NWHA 3UO2A 3WDSA 3TS1A 3IBGA 3FB1A 2PX0A 1OROA 3FCXA 1M2OA 1TCCA 1ZSPA 2GBFA 3LPCA 1H3EA 4B74A 3ZVLA 2HA0A 3F3SA 1R4MB 2NO4A 2X5XA 5JDIA 5CVDA 5KJFA 1U97A 3CRAA 4OU4A 1C7FA 2EIMC 2B4RO 2LFRA 5DKFA 1PYDA 1C7EA 4FS3A 2Q7OE 3L7NA 4EUKA 2WE8A 1A5ZA 4BNTA 2X8WA 5FUXA 1TAQA 2DFNA 1EVQA 2O57A 4AUKA 2P4VA 1PGNA 1RCFA 1NW3A 4U3JB 2DWDC 3I55V 3CMMA 3DAFA 2CLEB 1W5SA 2HBYA 2Q5QA 2IZ7A 3NWPA 2H57A 2YJ3A 4RUFA 1MVNA 1SUDA 7MHTA 2PY6A 2QP9X 3QEJA 4ZVOA 1NJIW 4A36A 2NXEA 2Q50A 2HFEC 5CB4B 4WNAB 3GN1A 3WLMA 1I1HA 3VPDA 1X7WA 2CLLB 1FMLA 2OM6A 2E85A 2O3RA 1SU4A 4V0ME 3SSAA 1Q6YA 3EXEA 2QTWB 3FCUB 3GUUA 4JS0A 1KVTA 1H23A 3PI7A 4Z9AA 1PFYA 2NU7A 3H86A 1DBWA 1KFKB 4KYVA 3L73H 1WUJS 3MCZA 3TEMA 1SXJA 2RHRA 2I4LA 4M0CA 3RFCA 1CUCA 4G5YA 2AZ0A 1YQWA 2C5AA 3L6DA 3O1LA 4KMSA 2ZG6A 3LQYA 4IG4A 3PR1A 2I2DA 2WA3A 3HB3B 2OXTA 3H97A 4JBWA 4XVHA 3Q98A 2XNHA 4YJ3B 2AFIB 4X85A 2FOIA 2EIHA 2VJBA 3KQQA 1I7NA 3WGVA 3ND5A 2PRKA 1A4IA 1CUGA 3A0HZ 4BJ5A 3K9HA 3TCXB 4X7BA 5E0KB 3DDZX 4CF4A 4M99A 1SQQH 2Z4SA 2QQGA 3BWCA 1MXHA 5IT4A 5HP4A 1DRKA 2EIXA 1HP8A 2VSNA 1HTWA 3S44A 5K6RA 2X0EA 4W7HA 1P9NA 4LE0A 2DAPA 1PLKA 7ABPA 2Q41A 3NATA 1MA1A 1WXEA 2A9PA 4N6GA 5HIJA 2P5OA 1XTVA 1HFKA 1KRWA 1LBSA 3WL6A 3E7XA 3OUUA 1Z5WA 4ACAA 4KR2A 4ZI7F 1VLQA 4R3UC 4HN2A 1ADFA 2ECFA 1DEOA 3INYA 3SNKA 2X58A 3OKAA 4PI2A 2WUWE 2ZYSA 4EY3A 5HK9A 5B6IA 3HZHA 2R6FA 2IOFK 3CC7V 3AU8A 1VLVA 5CBGA 3QUBA 2OD7A 3WMWA 2R4UA 1L5RA 3QHQA 2JH8A 3JSLA 3I9OA 1T5BA 2IU6A 4EEXA 1PQUA 3BGIA 2DRIA 4J9YB 3TE6A 1I3LA 2Q9AA 3QMMA 5FFFA 4KQ1A 4MSUA 3BHJA 2GM5A 3TRIA 4LV5B 1XNQO 1S8FA 3HP1A 3AESA 2AN9A 3VR3A 5B3AA 3OJCA 1H1LA 2WFLB 5H82A 1U7WA 4UKDA 3AI3A 1TTHA 4DABA 3DL2A 5I9NA 4AI8A 2HRDA 4YACA 4CIWA 3VU0A 3L7MA 4B73A 2GEDA 3O74A 3R5XA 1KMHB 1K8AW 4L02A 3CEHA 1UZLA 1UXKA 4INAA 1EXMA 3ANTA 3OCUA 4HGRA 1T3HA 1QS0B 3TVDA 3BRWD 2RC5A 3DOOA 2FEXA 5LA6F 5I7VA 4FILA 3OJEA 5IBCA 4HBZA 3JARB 1W85A 5TE9A 4R7TA 2QSUA 3IQHX 3KLNA 2EL9A 1N7GA 2WWYA 4QUAA 3GLHA 5EZYF 3GQVA 3S0JA 3TDKA 2DBRA 4H1UA 2V59A 1T5HX 1N1EA 3GCXA 1YC2A 3ABZA 2X5NA 4KQ6A 3F3KA 4MIYA 2JBAA 4U7TB 3W04A 3ENWA 4KSYA 5K0BA 3GGSA 4DL9A 3K9FC 2V7UA 3HVIA 2ENUA 2P78A 4P82A 5AKEA 4TLCA 1K9SA 3E35A 4JQOA 1EJ6A 4MKIA 3G7UA 1BA3A 2J7KA 2XMBA 1W1IA 1VJ1A 1QQCA 1M3SA 3HGMA 1G7SA 1T6BY 3B09A 1JU9A 1FFEA 1WCIB 3GRZA 1ZCFA 4ZOQI 4F9EA 4LDRA 4U8HA 3RRMA 3DC5A 1AI5A 2VH1A 4LKRA 1U63A 2CUKA 5EESA 1RRFA 3TQQA 3DP7A 3HB9A 1OJ7A 2JAHA 4FCTA 5BV1A 4WCVA 1DWQA 3DBHB 1XQXA 1LH0A 2P2NA 4IO1A 2EKPA 2WSBA 3R2JA 2Q6LA 3M6IA 1CDDA 1LVUA 4JVSB 2O8DA 3HXKA 5H70A 4PLTA 1I2BA 1EFVA 1W5BA 4UFNA 4P7JA 4BASA 1JAIA 1CF9A 1DWUA 4BDTA 4B79A 3Q9LA 1H05A 3UUWA 1OBHA 5J43A 1W36D 4QJFB 1H4VB 2XCIA 3RRYA 4LFAO 3PTZA 2IHKA 1BYIA 4MDEA 4KMRA 5KKNB 3GVMA 3JVVA 1E0KA 3UBMA 2UZ4A 5BW6B 4P31A 2HNBA 4U7PB 3OOYA 4WERA 3DF9A 3SLGA 2G76A 4UDOA 1BRTA 4G2KA 2GA8A 4OPAA 4OUDA 5EJ9A 2HRQA 4UOQA 4UPEA 3TK1A 4ZZ0A 2TMKA 3HEAA 2GEBA 3IL2A 4NAHA 1KR5A 1DJPA 3PHHA 3AFIA 2MJLA 1XWFA 1UWLA 2J0VA 3P9NA 5KSPA 1Z5VA 3E3MA 4H33A 3L8EA 3F71A 5AI5A 3VC1A 3KZNA 1JYSA 5HF8A 4QPNA 4WUVA 4P58A 1G2QA 2XLCA 3E61A 3ZN1A 1P0CA 2HQSA 3ZVKA 1NR5A 3M4ZA 1U9IA 4DIUA 5DWDA 4CBCA 3VI4B 3G2PA 1TVEA 1L5HA 1L3BA 2CUTA 5G4LA 4Q1EA 3RFUA 3GA5A 3ITKA 5JWOA 1UC4B 3LBAA 4MVJD 1GGVA 2CLKB 4HLUC 2BM0A 3NV9A 4LBVA 4RZ3A 3T1CA 1TAUA 3C87A 4N3NA 3G6EV 4YA6A 3EUEA 3OIYA 1QIEA 4UNRA 5J1SB 3SS8A 4MA4A 3Q7PA 4PPNA 3LNMB 3U7EB 3L18A 1JG7A 4RK1A 3LPLA 4GG1A 1Z22A 3TD9A 3NAGA 2Q6KA 4I8IA 3QXHA 1UC9A 1SELA 2EULA 3I34X 3ASUA 1I0HA 3NNNA 4YWJA 1BXZA 1LS1A 3PZRA 4BP9A 3THYB 3OWOA 1J20A 4XLTA 1DJOA 3D6NB 1YZTA 1YB1A 1Q7BA 3C6KA 2A86A 4MUFA 1N8NA 1RAAA 1JT2A 3V55A 4NL4H 3AM5A 3ABLB 2XGMA 2GPBA 1G0NA 2DE0X 3RS5A 1Y66A 1R0SA 2XSZA 1E6WA 5FQOA 4BRZA 1KJ9A 3O26A 2C20A 5IH7A 3CPEA 3ENQA 4FZJA 5H1YA 1S1MA 5JBNA 3DUWA 3STUA 3HZZA 2JGJA 3BD6A 1HR0O 1U4SA 4OAOA 1XU4A 4EFLA 4E5YA 4BEWA 4CQJA 3LP6A 2XUDA 3BB1A 3WZ2A 4MRMB 4R6WA 2GPNA 5C5DA 3P52A 1R6XA 1DAHA 4ZI7A 2PSHA 1G6UA 5A6VA 4BXOA 3FVWA 1P2TA 2YHAA 2GRJA 3HVUA 3JD2A 1RP7A 2FPGA 4BUCA 3IUEA 3HDJA 4IDGA 1A5SB 4WL0A 1OH5A 3EVZA 4IHJB 4QOFA 3WBBA 1BH6A 3ZKWA 3SPHA 3K16A 5FI3A 4CEHB 4HAMA 3B6EA 3MBIA 3CZQA 3NC0C 4JGGA 1Q2UA 2IXAA 3OMIB 2YDXA 1YVDA 2ZDIC 1AY0A 4WA8A 5GVSA 4C30A 4IZIA 2O5VA 2ZRBA 2WRZA 4XWWA 2WWHA 1JR3D 4DYVA 2WJ4A 5DI3A 2C7OA 1V2GA 4IKPA 1P6UA 3PE4A 1A8HA 4AY5A 3ZRWB 2PXXA 4AL4A 1IOZA 4RIGA 5JWPA 5KHHA 5G53C 3TCKA 3ABUA 1FU8A 1U90A 4RJJA 2JS3A 4S24A 3ROGA 2QNIA 1DKRA 4E09A 5C1PA 2IYVA 2WILA 2H29A 3L6RA 1U8YA 1HEYA 1ADGA 3H5NA 3WIDA 3E7WA 3T1HO 5JTUA 5IE9A 2P8JA 5C80A 1GNPA 3IR5A 4UFZA 5DEDA 5G3YA 3N39C 3L7KA 2CFTA 1NJSA 3IUPA 2A14A 5A3QA 1Y4UA 4FYKA 4A6DA 1IN6A 3IIKA 3GVIA 3QU5A 1UEJA 5DT9A 2AG1A 5LA6A 4NK5A 1D4OA 3GEPA 1R4NA 5DM2A 1BD4A 3CVWA 1IN8A 4LK2A 4P9PA 3P0HA 3THXA 2CH7B 3O9MA 5EZYA 4MRNA 1GPLA 3K5OA 5FOUA 4Y2PA 4HDOB 4ZT3A 4KRYA 3D6JA 1TJPB 1KDPA 4RGQA 4CI0B 1U1GA 4EPXA 1RQNA 2VYQA 2N47A 3BRQA 2JFZA 4CCWA 4HGOA 4G5XA 3HXTA 3CCBA 4NTZA 2J3LA 3SSMA 3GJYA 4LKOA 3AKDA 4M8SA 4KZKA 2QTFA 1AQIA 3BWVA 1UBSB 5KVQA 1HNWB 4PLCA 2HD4A 2VZ0A 4U00A 2NW6A 5ALQA 3AI1A 3BG5A 2ZVJA 4LRYA 5AKYA 3JQAD 3QW2A 1A9XA 4I1YA 4E1VA 4ZYWA 3VAYA 1JA9A 3SS7X 3NLLA 2HJWA 4KL1A 1VZ2A 3QUSA 3DC7A 2CLDX 3RJMA 1Q83A 2C78A 1E1QA 2ECQA 1ML3A 5KCZA 3H2JA 3DG9A 2C7PA 2ZTUA 1RPTA 1AXGA 4LHZA 2NU6B 1KVRA 4PRZA 1XAIA 1OCOC 4OHMA 3AK1A 1OXSC 1WXHA 4EA7A 5IMSA 2XUFA 3K1AB 4KQGA 4RCYA 1P7GA 3T1OA 1EN5A 1NQ5A 3DL7A 2QL6A 2BGNA 2ORVA 3R5JA 5DXJA 1NMSA 3F96A 4R8KA 5AI9A 4UUBA 4RY0A 4HK4A 3ZD7A 3KVOA 1XMIA 3K7EA 2WSIA 4QDJA 5DBGA 5EMKA 1TYBE 1GTJ1 4H7IA 4LOHA 3NYWA 4NY1A 1Z25A 3C4JA 3DKRA 2C57A 1CEYA 1OXXK 4WQMA 2GFHA 4IW3B 4C5BA 2HA3A 3RBVA 1Z88A 5ELLA 1IBMB 5ERGB 1CP2A 3SQOA 4J75A 5FO0A 3NYIA 4YAKA 1QV6A 4FJ0A 1KJZA 3LQ2A 3SY8A 3E70C 3UKMA 3RAFC 4ZEXA 1ISFA 2HMYB 2Q4RA 4BNZA 5JSZB 4O2RA 3UJDA 3KXPA 5BW5A 4ZALA 2CHQA 1X3SA 3FAVB 1W76A 2FLWA 2ZRGA 2ZATA 2ZULA 4OYLA 3LOUA 1MQSA 4GZMA 1XMOB 3S5JA 3TTVA 2OCYC 1GKLA 1YJ8A 1T4CB 2Q3LA 4EFBA 4N4AA 1FJGO 2Q4OA 2EZ4A 3L05A 3O4IA 1BA2A 2I7CA 4XJVA 1ST3A 4LRQA 1G1MA 1OD6A 4WN3A 2K87A 4WECA 2ARHA 1SOWA 3UFXA 1OYVA 4CH4A 3OCZA 5GJVC 2ECKA 4MSWC 2RK3A 4IMJB 3ZJUA 2OIEA 3ILSA 4D6XA 3FUCA 4ITVA 4QGFA 1VE9A 5JYCA 3WWEA 4JOQA 1Z2EA 3CVUA 3FHOA 3QI2A 3R5TA 3IAFA 4B7ZA 2X0IA 5GZ6A 4AS3A 2YMLA 3CONA 4FOLA 5JH7F 2FUCA 4BMVA 3V8NA 3HDHA 1JSRA 1K4YA 3ZXYA 4CHGA 5JJCA 4X41A 4BJHB 4R1NA 1G38A 1JHUA 1R3UA 1RZ3A 5TVGA 2FMXA 1J2JA 3E2IA 1NXSA 2BGRA 1F8GA 4DVGA 2Z6QA 1UKAA 2DFPA 1I0LA 4ASUD 3KYIB 2XY4A 5ELMA 3FLBA 5A7GA 3TXSA 2O3JA 3PHJA 4G1UC 4BUJA 4B4DA 3KZ1E 3KC2A 1Y0BA 1Y3HA 5DK4A 2I65A 3DMDA 4RKQA 5B3JA 2J3KA 3VV3A 1XQVA 4DLLA 3FGZA 1S9DA 4H27A 1EX9A 4XCQA 1OH8A 1DF5A 1YO6A 2FRXA 4DIEA 4Q9AA 2RJZA 1W35A 1QDLB 4C4RA 4W6ZA 2VDOB 1BGYH 1UWKA 1MAVA 3SHQA 1T9DA 1RI2A 4DMKA 2R96A 1WEKA 2C9DA 2FG6C 3E9ZA 4GLLA 4DA9A 2OP0A 3IBFA 2B7BA 3IEVA 2FP4A 4I1SA 1HETA 1CKEA 4WUTA 2XVAA 4RGVA 3IAUA 4F8EA 3WLRA 3OA0A 4KFRA 3V4ZA 5LKRA 4HJRA 1M2VB 3KKYA 4IJWA 3H9VA 1XHEA 3KJFA 2DU8A 4ND8B 3WY9A 5EXSA 1QF9A 3PBKA 1U2RA 4DR7O 2MSCB 1NM5C 1DAEA 3STVA 2IV2X 1J1ZA 4YAUA 3O4JA 2X13A 1NSYA 2R7KA 4FGKA 3M49A 4I4TB 1LA2A 1RXCA 3OU2A 3W9BA 3ZJ4A 1AKRA 3FDJA 2VPPA 5JCOC 3PGLA 5F9FA 5FTNA 5BYBA 5L4SA 1ETUA 1OTXA 1SZPA 2IHJA 1QX4A 3N86A 4RPIA 3ESDA 3V33A 2E89A 1V3QE 5TXGA 4KGVA 3EZ9A 2J67A 3NRJA 1V35A 4TXMA 4DV7O 4K8OA 4QFCA 1GITA 1A97A 2G8NA 5EYPA 2I91A 4KH1A 1LBTA 5KOYA 4NEQA 1NWCA 3PVSA 3WGJA 2OFWA 4FHFA 1ECFA 4ZD6A 1ZA1A 2AOUA 2PAFA 1XRPA 1JFRA 2MSKA 2LW7A 3W3AD 2H92A 4C89A 2GASA 5BVHA 5JISA 3FNEA 5CNKA 5H7XA 3TLJA 3UM7A 1PT5A 1Y80A 1KYVA 2C0QA 4K6HA 1RKVA 4PZAA 2B21A 3FYCA 1G63A 1Z5GA 1H2XA 2QUKA 4ED9A 1ZKDA 3Q6IA 4DUGD 4Y2SA 1T6YA 2PG3A 3BMNB 4YCMA 3LCJA 3WGNA 1JHRA 1EUZA 4X1IB 4FM2A 1WE2A 3GZNA 3ZWXA 3KJHA 3O4HA 1K5HA 5COBA 1A7AA 4XCVA 4RZHA 1QP0A 3NDJA 2VK2A 4JI2B 2YINC 2A1IA 1R6KA 3OQVA 1Z7BA 1G3IA 1NVDA 1AQNA 2ZYDA 1N2XA 3GPLA 2J31A 1V71A 1MJFA 3G59A 3DT8A 3QW4B 3JALA 4CYMA 4J0KA 3TZHA 2D5CA 3ZCUA 4BHTA 2GM9A 4XE5A 5DCLA 1XL6A 3N76A 2HHCA 2ZR3A 2HHHO 4NMWA 1SXIA 3DDWA 5DNEA 5FHRA 4TXLA 5DSXA 4WGFA 3W5HA 3DT6A 1R66A 3KXIA 2JS5A 2I66A 1KI9A 1KOLA 4CN9A 2CB0A 3HFRA 1U7DA 1XDCA 4R8CA 5ENDA 4ZICA 1VIYA 2J32A 1VPDA 4Y6GB 4FYIA 5AHKA 2I3GA 4PANA 1ISRA 2SKEA 2UDPA 3GYBA 1I2CA 4NZZA 4YC7A 5A6SB 3DCYA 1OCEA 3U3OA 1H4QA 1JPNA 2QTRA 1RYEA 3I2YX 1NI5A 3FZQA 3MYRA 2ZJ2A 3K0AB 1OY1A 2B78A 2VK1A 4KR3A 2BFNA 3RLIA 2PYDA 4ZHQF 1RM4A 4HBGA 3K04A 1PBTA 5EKSA 4MUJA 4X65B 3S7ZA 2YIBD 2UYQA 4ARBA 5J2TB 3PC8C 4W4KA 1QM5A 3BIJA 1AKQA 1YHNA 5HZHA 4DUYB 2BJHA 3UMVA 2J4DA 1U3GA 4LTNA 4DCGA 4EG6A 1VMDA 5B1AB 1V8BA 2CEAA 1WSWA 5FL7D 4MUYA 3CISA 1H8EA 4TT3G 3F7VC 1GNTA 4RE5A 1DP4A 4YO7A 1K6IA 3WGYA 4G0YA 3PP8A 4KV7A 4X93A 1AQ6A 4PZEA 3H3JA 5KX5F 4TWIA 2WHPA 2IUEA 1DJMA 1NP3A 2AXQA 3OZVA 5KNCH 4ZCSA 3KL4A 2CUGA 1L4HA 4NCJA 2UXDB 2ZK7A 2PJDA 3MJ4A 4B2YA 1JVBA 2A2ZA 4QBGB 4WWHA 1OZ0A 3V6LA 5IVPA 5IMBA 4LYHA 2R86A 3BEDA 3AFOA 5IY5C 3I56V 1GTZA 3NBXX 4WAUA 4ER5A 3QOWA 4CMJA 4LY3A 4RQAA 1LEHA 3GARA 4TTJA 3N1UA 4HB4A 3Q1LA 3ONDA 4I55B 1O94A 1C9YA 4LHYA 1NP7A 5BSMA 2VRZA 4L5AA 1WRBA 1XLWA 3LG2A 4QYIB 2ZWOA 3NUGA 1AZLA 5J9FA 3T5BA 2XOKG 2VCYA 1KMMA 2QI9C 1WB8A 3BTOA 1OQAA 3EXFA 3B3GA 4KUGA 2AR7A 3T41A 3TXAA 1T2EA 1I7QB 1VB3A 1PTJC 5JH7A 8MHTA 2FZWA 5CDYA 1PJ8A 3W2HA 5FBVB 3JZMA 2FWNA 4YRSA 4AURA 2ZRDA 4EHLA 1IB6A 2GJ9A 2AYYA 2FQYA 1E66A 2H7VA 1Y48E 2IZ6A 3IR6A 1JHMA 3M83A 2ZBEA 4NPHA 3ZE1B 2VAVA 4PQFA 4B3TB 1BHJA 3UC5A 4EFDA 1HGXA 4PICA 4TKVB 2CV2A 3F9CA 4EBFA 4EUNA 1MNGA 2CXHA 3INTA 4YXWA 1FF9A 1NKTA 1JP7A 2ZUBA 3T9CA 3ZI0A 5B2ZA 4AO8A 1TJNA 3HJBA 1YDGA 1QC5B 5E9AA 4ZIRB 4OGLA 1UJMA 3TZCA 4LFCO 5CK5A 2VUHB 2BI4A 4XB6B 2GPTA 2X0DA 3RFTA 1V54C 1KAGA 2AI2A 2PMKA 3HN7A 4HPJB 2G1KA 4UCUA 1YGYA 1PL0A 4FLUA 2BUAA 4OFZA 4RD4A 2BE9A 2QVZX 1JNYA 4DV5O 4O33A 1M7BA 4DV4O 3A6GA 1C4KA 4UUAA 3R77A 1IVYA 1S5LZ 4GXQA 1MAUA 1KK3A 4REQA 4R1UA 4BU1A 2HCJB 5H59A 3VA7A 1BOFA 3SQNA 1P75A 3ORYA 1GKKA 2P6NA 4KDRA 4D9BA 4V3CA 1DEHA 2GMWA 4A8JA 1AVTA 1HURA 1USWA 1BIFA 4GEKA 3RIHA 3MWKA 3CX8A 1WPBA 3LY5A 4Z3OA 2YW9A 1AKNA 1A76A 1UIRA 4S1WA 5FNZA 1K9VF 4ZJPA 1LVHA 2F43G 1K3UB 4R4JA 4D0RA 3N7TA 2Y1CA 1VP7A 4D25A 2JJ2A 1Q44A 4YRCA 2VJMA 3FZYA 2C8JA 3DMNA 3QLVC 1YDHA 4MOWA 1EVKA 1RW4A 2ZRLA 3CHYA 3QBEA 4AO7A 2XTMA 4FDTA 2IUFA 2MSLA 2Q4EA 3KETA 4AJ4A 1CZHA 3IQGX 5EQDA 1JWBB 1V3VA 2XQVA 2KBEA 5AW0A 3KKPA 4FX5A 3EZFA 2D0DA 4ARZA 4DG8A 1O6BA 2VAWA 3C5WP 4C0SA 4N3AA 1Z62A 1MKYA 4KAXA 4HEA1 2CE2X 4ABMA 1Y33E 2D2FA 2FSPA 2DKFA 3HU5A 4FR2A 4KKVA 1PWHA 3AP1A 2Q6OA 1OCCB 2CLSA 2G82A 1G2OA 3BIOA 4E14A 1XEQA 4CDRA 2G1JA 2EJRA 1SG0A 1NJ1A 3QVGB 1NASA 5TQJA 1M93A 4N5LA 2P6MA 3P2JA 3OF2A 4MI9A 4YRDA 1IUKA 2VP6A 2EJUA 4IHKA 1R0BA 4M1MA 3UCEA 4K9QA 2WT9A 2PTMA 5AP9A 3AJDA 2PA3A 3BBPA 2CHVA 1PTKA 4CMEA 3IT1A 1EJ2A 1R0WA 2NVBA 1EG2A 4IIYA 2BGGA 3IDFA 3O90A 3RC7A 1Z33A 4OKIA 4W5RA 4KR9A 3F6CA 5CDFA 3CIFA 1RXIA 3I0ZA 3JQ7A 4GMGA 1CJSA 4PFKA 4O6VA 3OSZA 4P8RA 1E6LA 4CEIA 1PR2A 4R05A 2Q07A 3MJDA 4XYLA 2W22A 2EP7A 2IEZA 3C3CA 3B9QA 2X2EA 2DHDA 4ZHQA 2UUCB 2OUKA 2JLYA 2XYGA 2Q7GA 2PUJA 1GUAA 3VBEA 2YS6A 3A6ZA 1ZGBA 4NBWA 4P22A 1N2CE 4YYZA 4JEHA 2H5EA 5J63A 4MAMA 3NS7A 2H2IA 3IUQA 3LDEA 5COQA 3UGTA 3SCZA 2YX1A 2X2FA 4K28A 4A0RA 1D2EA 2RBKA 3WXBA 4L76A 4Z4FA 2I8LA 4WZ6A 2X77A 2QM3A 4OYHA 2QMZA 2GPJA 4XX0B 2OIGA 1ADYA 4EG5A 2B3TA 2RGNC 3LDGA 2IZ1A 4NJEB 1DT3A 2FN9A 2D2IA 3MOIA 4EEKA 4G6ZA 1VL1A 1I5EA 5DP2A 3ZV3A 3CZ5A 4QULA 1ZQ1A 2O6LA 4QOJA 2RKBA 4KP7A 4BIUA 4EW6A 5I8WA 1MOFA 3CZMA 2R97A 4XOIA 4HS4A 1USKA 4JQSA 1M1NA 3LF2A 1U11A 1SUPA 3LA8A 5KSYA 4N12A 3BK1A 3CRW1 1CIVA 3UN1A 4U4AA 2VNHA 1DADA 1XVIA 1ZAKA 1UFKA 3EYWA 3IKVA 5JO9A 1M8PA 2BZGA 1H3FA 1ZUWA 1WX1A 1N36O 1J5EO 1RZUA 3SMQA 3V4FA 3SPXA 4LJ7A 5E6RB 3FKSG 1RJWA 2XRFA 3TDNA 5H02A 4OYYA 1GRCA 3A2NA 1GYRA 1NOJA 5IF3A 2R44A 3ASOB 2AEFA 3PHCA 2CE7A 4ZO4A 3G9UA 4N5NA 1H2KA 2NACA 1KJJA 3FPCA 1T10A 1WTAA 1VARA 5GM1A 4RZUA 4ZYZA 2P4KA 1PQ4A 3GR6A 1ICIA 2QD3A 4FWBA 5KMGB 1F9AA 3FHCB 3GD5A 3KQMA 3D3IA 4QFDA 1Q7YW 1WOMA 1T1IA 2V7WA 3O8QA 4F60A 9ABPA 3WJ2A 3M5WA 4CKBB 4FVMA 1EJ0A 3I9MA 3B36A 4D99A 1DTWB 1P9RA 2YV2A 1VIVA 5G1NA 1TLLA 5FTWA 4YQZA 2OENG 1D7OA 2CNBA 4IDEA 3MJCA 1DIGA 4M0PA 4BV2A 5K4HA 4DHWA 3TYXA 1P61B 2EBWA 4MXDA 4WD3A 3O1HB 4LEIA 1FRQA 1ZK1A 1DCKA 1EFKA 5EXXA 3LPNA 1NW5A 2Z2JA 2OKCA 4LSGA 2C4NA 5REQB 4Q12A 3T54A 1ZD4A 3Q72A 3ZRVA 3HSKA 1Z8DA 4ZQEA 2GUWA 2H9IA 5C81A 1QYIA 2TSYB 3L7YA 2A0YA 2ZE6A 4LXXA 1K4MA 2LNDA 1E9FA 2OCAA 5AM1A 2W2NA 2P90A 5FF9A 1YAHA 2JCGA 2UUAB 3BULA 4C7JA 1YJQA 2AD5A 2X5OA 3TNFA 6AT1A 4L3WA 4ZRDA 3UM9A 3FWKA 4BNDB 2ZITA 2QRGA 3LU1A 3THRA 1C1XB 5HQJA 4NOJA 4Y1RA 1L4GA 3ZIAG 1PGQA 3KWJA 4H7EA 2V6JA 2RE8A 3HJFA 4G1VA 2JRCA 3KNZA 1NBOA 2NV0A 4X6UA 4BV3A 1CRQA 3KL2A 3VGJA 4YHHB 3D1VA 2R1VB 1X70A 1GN3A 4F3NA 1N2JA 1SWVA 2GEVA 1WKVA 4Z53A 2RK4A 4BMNA 2NUTB 1V1JA 3PL5A 3IQDB 1SO8A 3ZNPA 3RFXA 1QUFA 4AMVA 4PBSA 4NHEA 1QTNA 1X8LA 1Y3FE 1VQ7V 3ABRB 1JFFB 5BR8B 3WDMA 1T5TA 1H2LA 1DF4A 2QTTA 2NV6A 1XQYA 1KC8W 3LC7O 3FB7C 3E27A 3TW0A 4UCTA 2FWBA 2YV4A 2WUFA 2ZAOA 3FTFA 1AMUA 1NS1A 4NMXB 1BVHA 1N34O 2G71A 1O9HA 3OE7A 4LQ4A 3WLEA 3KT3A 1O96B 2CDYA 2IPAB 1F6BA 5FUBA 2YVAA 4W1RA 3WYEA 1YASA 5FLEX 3WLIA 3AEIA 3R9XB 1J8FA 4OAPA 4IH4A 1HE3A 4YIHA 3E22A 1NN0A 1MBZA 4RH1A 3K92A 1DRVA 2VSFA 3KSAC 3QBJA 4QGGA 2JGNA 1WMFA 2OGWA 2BSKA 1NKVA 1X1CA 3HBJA 3O0DA 4QUGA 4CZZA 2B30A 2BP7B 3TL2A 1I3OA 4MS4A 2J0UB 3CPWU 2Q5EA 2P4SA 1MO5A 1JPXA 3A31A 2P4QA 4X00A 4DK1A 4FLFA 1JX6A 2ZIMA 4D9KA 4QBKA 3ISTA 4RSGA 1VI5A 3LFHA 4X7RA 4EGAA 2QY9A 1TFRA 1B1CA 2IPXA 1FNSA 1SXPA 4N5MA 2NU8A 1MABB 2IH1C 1VEWA 2VYVD 5IEJA 1VHDA 3VSAA 2IYTA 5KAPA 2R3SA 1QLEB 2YUAA 1XFAA 1JB9A 2W8BB 1J56A 4ENVA 3VNUA 2HN9A 4R41A 3EEIA 5HYVA 1UMKA 1PZFA 3LQQA 5I9MA 3GEDA 1J00A 3R24A 1XBLA 1E1YA 3DNFA 2GZHA 1B06A 2B5WA 1D2DA 1NQVA 4L6IA 4M54A 3RK1A 1ZMOA 1IBSA 4LRSB 4NNOA 3ICEA 3HDYA 3UYLA 4JR0A 3AG1B 2IJGX 3PSAA 4LXIA 2EX4A 4IUDS 3C6BA 1F51E 1BVRA 3QOYA 4JP5A 5FUVA 3ER6A 3V9PA 3ICXA 2AIRA 1M6VA 4B3IA 2R9VA 1SKQA 3SIXA 1N33B 1DG3A 3E05A 2DULA 2JL1A 3NI2A 3OIDA 4TYQA 4MCIA 4YRMA 2XX3A 4UM8B 1BKSB 3JRNA 3F5WC 5KIAA 3DE4X 3DVAB 3VVLA 3RWRD 2Q1YA 1NNLA 1YZ3A 3TBFA 5ICSA 3PD7A 2W43A 2RGGA 4ENPA 4ERNA 4GOOD 1KAOA 4KN9S 4K86A 3I5XA 4GGMX 2R66A 4N54A 1FVXA 4OQNA 2DBQA 2I2WA 2Z2XA 4C4ZA 4FOPA 4A92A 5LGUA 1VRWA 5L3CA 1Z0JA 2HYIC 5JCXA 2I78A 4EHJA 3ICQB 1W2GA 3R3WA 4NQZA 1RE0A 2UU9O 2R87A 2CGEA 3PRKE 2B7LA 4D8VA 4UNPA 3QNWA 4HR7A 2CHUA 5EE3A 2OT5A 2A5JA 5FORA 5ALEA 4BJ6A 2AUTA 4LGYA 2PO5A 4WBNA 1VHJA 5MGBA 2DKNA 1N2HA 2QWNB 1TQ2A 2H8PC 2PUEA 5BWBA 2B1JA 1V1RB 5KYUB 3KE9A 3HDTA 3PYLA 3VHLB 1VKZA 4H31A 1WPQA 4XUGB 3INRA 3HKCA 2JW5A 3GT0A 5B55A 4UMVA 5T8KC 4X3CA 3KAJA 2NR5A 3JZDA 4JJZA 2AL7A 1BW9A 4H44B 2ZNIA 1KP9A 1Q92A 2WNSA 1ZJ6A 3WL7A 2WABA 1Z6TA 2JD2A 5ENZA 4CG1A 1JAYA 1JHVA 1C30B 1LWNA 3U19A 3PI6A 3II6X 2Z95A 1YJWV 5KPJA 3O82A 3NALA 3KYCA 4TWRA 3EGXB 2O2CA 1J9EA 1Y7LA 1A32A 4LPSA 4RD6A 5BNIA 521PA 2GAOA 4AK9A 2JIZA 3WLOA 2QDKA 4EA9A 4PA3A 3SZGA 1NVUQ 1YB4A 3VQYA 5F33A 5C32A 1GTOA 4FVTA 2A59A 2FSVC 1RNLA 4BMOB 5JG7A 2A0KA 4U9UA 3SPIA 3KT0A 3NTLA 1U0EA 3HCOA 5GZ3A 1VRCA 2IKSA 1IWOA 5I9IA 1WLEA 4RACA 5CMLA 3H6HA 3WL3A 1X0XA 4JX8A 5EC8A 2XBMA 1R50A 4M3NA 5TS2A 3U7GA 3Q7QA 2ZRCA 4C1BA 5ALJA 6YASA 3J81N 2RMKB 4W5OA 2B3DA 2GCPA 2PZAA 3FPGA 1Z0AA 4DCPA 3QGMA 2YH2A 3OZRA 4K9OA 1ZOSA 3NKVA 3AUTA 4U9IS 5HK8A 3B1KA 3FSRA 1II0A 1X9HA 3NEYA 1XG5A 1YR2A 4KJXA 5DGIA 2VDUE 3PDIB 1G4HA 3EFHA 1ORRA 2J6CA 4HXYA 4WV3A 1GNQA 3GRVA 3U4QB 4ENSA 3HCFA 4RKWA 1KMNA 4B5KA 2I7XA 2HZ7A 4J49A 1E8MA 3ZVRA 1QRUA 1ZGHA 2RH4A 3AOGA 1ZNWA 2QUJA 3N75A 3G6KA 4YJ2F 2IS1A 3RREA 3BXZA 1KE1A 5A9GA 1M5RA 4GYJA 3GLRA 3PPVA 3OHPA 5GAJA 3FXAA 1DKUA 3F78A 4ZTBA 4JR2A 2V7QA 3WICA 4WF9V 5TMPA 4HAXA 4AQDA 4FK8A 2W58A 4LX0A 2WJWA 1KDTA 5FR2A 1YZLA 3SPGA 3SYNA 3DWGA 1EGQA 3JQDA 1OX4B 3P2IA 3OEHD 3CJQA 3VH2A 4IXMA 4IV8A 4H17A 3VKUA 2DH5A 1M72A 3MOSA 1XN1A 5MF6A 4P30A 3K0BA 4RVNA 1AA6A 3PPWA 5A5VA 4U39A 3FF4A 4TROA 5J2UB 2VQFO 5KDOA 1SD1A 5MGNA 3K03A 5CFLA 3W5AA 2PA0A 2I99A 3HRHA 3U4MA 1ZJ4A 4CTNA 1UINA 3BMOA 1TVKA 1EG7A 4I5EA 1T3TA 4ZK2A 3F74A 1VF6A 2YV1A 1AGYA 5GVRA 2YY5A 2IRWA 3FHJA 1US8B 3FY4A 1PGPA 2QAGC 1U2ZA 3DV0B 1NUQA 4IL5A 3B2EE 4QGBA 1G4YB 2GHRA 2XVMA 3DOUA 5K8JB 4ZOAA 1V5EA 4MA0A 1GGMA 2ZBPA 4KFSA 2EKZA 4HVLA 3SXJA 1KU9A 2RHLA 3OQIA 4CIXA 5BNTA 3P96A 4ZIBA 4AKHA 4BO2A 3A3KA 2ZWMA 1OIWA 3FNHA 5IBQA 3O92A 5TMEA 4B45A 3O83A 5CB8A 1BGXT 3PL1A 4E13A 1ZEJA 4Q4HA 1BAPA 1TIPA 5DE3A 4QTZA 5DISB 2JDID 4S12A 2FUKA 4ER7A 1R73A 3DFZA 5B12A 1P6XA 1B8NA 2GVDC 4DLVA 2J07A 4NOMA 1J42A 3ACDA 1RWMA 1EX6A 3FD8A 4U5QA 3QTLA 5EKUA 3V4RA 4QJIA 1V3TA 3R0XA 3NB0A 2Z09A 1YI1A 3GBVA 5IX8A 3P0IA 1TTPB 1W88B 4WZBA 2LFSA 3AB7A 3F4LA 3OY7A 2F17A 2I9PA 2JGLA 4BWVA 2F1IA 4J0EA 1OAOC 1U2GA 1Z9BA 3R6WA 5BR7A 2PQ6A 4M2LA 2V58A 4ZCMA 1RFGE 3EY4A 4G5FA 1ZO8A 3KCXA 4D4HA 4POAA 1VQPV 1UMCB 4NYJR 4IIFA 1O7JA 3ETNA 5EQTA 3Q2OA 1U1DA 3H05A 5J4LA 3UKDA 4XQGA 1XTIA 1WU8A 1RLIA 3CW9A 2JHCA 1IATA 4QOHA 3KFXA 4OJKA 5ALDA 3I32A 2NSHA 4DRXA 2ZUVA 4P3XA 4RZIA 3J81A 1K68A 2NUAA 1OFGA 3BILA 5L4LA 4A6EA 1YR6A 1NF8A 4Y9TA 1ID1A 4N0DA 1LQUA 1I13A 4ZQCB 1NUTA 3IOMA 3UJPA 4Z4GA 2UKDA 2VDMB 1YL5A 4URZR 1YA4A 4QM7A 1Z4JA 4I14A 4HD8A 4YI5A 2P69A 1W2BU 4MUEA 3PDUA 5A9SB 4KACA 3WHIA 1COWD 3ST7A 3COYA 1U2EA 4QVIA 2MR5A 4W63A 2QVGA 2Y67A 2IZ5A 5T4FA 1R7RA 2IZOA 3G0IA 1XRQA 2QZPA 2CW5A 3IAM1 5A5FA 4JCCA 1YJBA 1V95A 1L4BA 1E7MA 3UQ8A 4U7WA 3DKPA 4INOA 3D3EA 4GLBA 4CKYA 4P36A 4BL5A 4BLQA 3L8GA 4D79A 1Q0QA 3CU5A 3TGWA 3PF8A 3FTCA 2PSDA 2MYTA 5KNDA 3O2SB 2Y4OA 3AY3A 5ESRA 2BGWA 2LKCA 3U60B 1V7CA 2X2PA 4NCAA 1UK9A 4FC7A 1SKYE 2C8KA 4FW9A 3PT5A 4PYNA 3Q9NA 13PKA 4X89A 4CLEA 2R1ZA 1VG9B 1S2DA 1MC4A 3BSFA 2R79A 1ONPA 4QDKA 4Y2QA 2JEXA 3QKSB 1X1EA 4HWKA 4Y6SA 1R00A 1KI6B 2QTSA 2Y8EA 2VRBA 2CNWD 5LBUA 1MO2A 3T1YO 3BB4A 1H22A 1ZZGA 3FMGA 4D1YA 3KZXA 5CFMA 4DQ0A 2FR1A 3KXKA 4O02B 4UM9B 4JXXA 4UB8Z 1WDWB 2AMVA 1MXFA 1VG8A 1L7XA 3O2QB 4Q1BA 5D2CA 4QARA 3BWYA 3KD3A 1Z0FA 1TUEA 2XDWA 2P2DA 3LX6A 5I7EA 4P53A 3C24A 2ZXFA 2BDUA 4X45A 4MLCA 3M34A 2ZKIA 1XQ1A 2WYOA 3ELWA 3GJTA 2FFJA 2A8YA 1AD2A 2D8AA 5IT0A 5AOCA 1ROPA 3KB6A 1LCIA 1DNPA 1W1UA 1NVGA 3PENA 3LVQE 4P4GA 4CH3A 1WCYA 3ZZMA 2A67A 1E99A 2NVOA 4LCJA 5JUWA 2VLBA 4NFYA 4UREA 2UVQA 3OLXA 4HUJA 4V2UA 1FYVA 4HAIA 4HJXA 4JDPA 4Q4DA 3TQCA 3QVKA 3A4LA 4C7OA 3Q3CA 1BXRA 3AEUB 1PK7A 2ZR9A 4YJ2A 2PQMA 3LTEA 3IH5A 2WF9A 3V4VB 1Y76A 1E5LA 4AWXA 1CS4C 2AYZA 1U2DA 2YQ5A 5EERA 2DB3A 5IDJA 4FFNA 4A3SA 1YA6A 5TGTA 2EZ9A 1DC3A 5CYFA 1B6SA 2XZDA 4EIWA 2I1WA 3WTCA 3DZIA 3HPLC 3EEBA 2OCBA 1YJAA 4EX7A 2IH2A 1NY5A 5D86A 5TQ0A 3TQTA 3T1QA 4EHBA 4RCZA 1AB5A 4IHAA 2W2QA 4B2LA 5A71A 4DCTA 3EW9A 3ZYZA 5JQGA 1Y6ZA 1S2NA 3ND7A 5BW4A 4N5IX 2GCGA 4OSPA 4FFVA 2JJYA 1SXJE 3AK2A 4FYMA 3BMXA 4UZSA 3H19A 2PCJA 4FLEA 5DBOA 4JTDB 1SIBE 3TQHA 3L8DA 1ISGA 4D9MA 1QLHA 5AVOA 5B2FA 4Q05A 1R3LC 3SGIA 3RS8A 2BJVA 3L5OA 4UXNA 2DR3A 2HPHA 1T3GA 1POWA 4X6LA 1ZHOA 1D07A 1KZ1A 1VFNA 1DWOA 3ZQJA 3RIMA 1FYJA 4CL0A 2A9JA 1G8PA 3ROEA 3W2TA 3PNSA 1B0UA 2GVZC 3WAJA 3E0XA 1P72A 4M86A 2WIJA 2Q7DA 4X6XA 4EJMA 3UG7A 1NW4A 2R7AA 1Z0SA 4UHKA 1KO1A 1CP3A 3D02A 1KI7A 3E9RA 1DXQA 1DBIA 2O2EA 2ZE5A 1QHXA 3MS7A 2QL7A 2FWPA 3VTKA 1VL5A 3T1TA 4NR0A 2RQ6A 3FNIA 2O0KA 1I3KA 1XCJA 2DQZA 1DV1A 4OQZA 4TQ9A 2PRZA 2BMFA 4JUDX 4J7CA 3QF7A 4UNNA 4BX2A 4L7QA 2C83A 5BNWA 1XDGA 3P9IA 3JZIA 4IQ4A 2F3UA 3CVYA 2OVBA 3ILVA 3MGAA 2C2ZA 4Y2JA 2ZB8A 4WRRA 4JI1B 2WKRA 1DJNA 1HA3A 2XR1A 2WD7A 3NGXA 2WJHA 4C29A 4LFBB 3NKLA 2K2QB 1V8PA 1E0AA 1NF2A 4TRRA 3DH0A 2HWKA 2PFGA 1Y9DA 3RGBA 1XEXB 1H2EA 3B8NA 2Q5LA 2VOJA 4M98A 4XUCA 1ZSNA 2QK4A 2V98A 2XT0A 5FV7A 2WHQA 2QRVB 5CK4A 2RHGB 4RD2A 3H11A 4G65A 2QW8A 3U31A 4WJKB 1U2SA 3EXG2 3KE8A 1PO7A 4TKZA 2AD1A 1O6GA 1MG5A 4E6EA 3UATA 3AEXA 1FXVA 3A4MA 3ER8A 5CVUA 3TAUA 2AHRA 3CN9A 4DV1B 1Y8QA 3PWKA 2O5RA 2G28A 2IZ0A 1WB7A 3O3MB 1ECGA 3OC6A 1QQ7A 6ADHA 2NX2A 3K32A 2DF8A 5M3BA 2G72A 3LLUA 2NN4A 2CVFA 4PLWA 1DKOA 2ZJBA 4YPFA 4RLSA 4KR7A 3ABQB 3ZZ0A 2ZR2A 5AOBA 1DMRA 3IJRA 3T38A 4HUQA 5LUBA 3OO1A 1JR2A 3K70B 4F71A 1WV1A 2HLNA 4MEJA 4AAYA 2BTQA 2WMYA 3G5TA 2QRUA 2YHBA 2NTEA 1JR6A 1UBNA 3NHYA 4I5DA 4YRTA 3V7UA 2V9CA 3ZNQA 2HYDA 5HUJA 3ABOB 1IULA 1P2FA 3IKLA 3QEMA 4B2PA 4XDYA 3ESAA 3D7LA 1EHYA 2GBPA 2CJWB 2A9RA 3KP1A 4QYMA 1NX9A 3EYAA 1LRKA 3WQBA 4QGPA 4HNVA 1K9MW 3KJNA 2WTAA 3H8VA 2G70A 1GGEA 2JI9A 1M75A 2JG3A 4WZAE 1CLUA 1QDEA 3AVQA 3F8SA 4JT9A 1QG0A 4GSKA 2F9LA 4C0LA 2OAGA 3B6ZA 5IUNC 3DTYA 3A4IA 2BSQA 2AWNA 3NT2A 1ZH6A 3MMPA 1KOJA 1YZFA 4L08A 4OVKA 3U3KA 4M9UA 4I9NA 4EY5A 1INLA 1D7AA 3OMLA 3HYLA 1PNKA 5DXAA 1I3CA 2C59A 3BWEA 4BW5A 2ZREA 3DGEA 3LGAA 3G0GA 3DLHA 2QM4A 2CXQA 1XRNA 3PTAA 3EDMA 3DEFA 2QAJA 5FL3A 4F1KA 3IJ5A 2FFBA 5C5EA 3M8AA 3QF4B 2Q1TA 1DB3A 3IE2A 4QEZA 4ZN6A 3O8BA 3BA6A 3P0JA 2ZIVB 3A6HA 2P9TA 2YVUA 5KVSA 4EFNA 1JBQA 1DTSA 1YQEA 1PJAA 4HF7A 2YZNA 1X13A 3WJ7A 4BW9A 4KNVA 4AJKA 4FB5A 3HU3A 1UMBA 3QKTA 2G8LA 1OYYA 2EG9A 1Z63A 2QT1A 2YEVA 3K94A 1PWXA 3TBHA 2E1RA 4XUEA 3MWEB 1S2MA 4C76A 1OXBB 2C5EA 1IUOA 2JFBA 2D1YA 2MU1A 1BQZA 1J0XO 2ZJ3A 1PP9H 4CV0A 3RROA 1G60A 1QWSA 3CYFA 3WWDA 3ZGZA 4AZWA 3N8GA 3M6WA 3TKYA 4Z7QB 1QANA 5H6RA 3MPOA 5AR1A 1U0BB 1DUSA 2MT9A 1XAHA 4IT5A 4KYIB 1QE0A 4KMMA 4MWGA 3R8CA 2PHZA 4JIGA 3E8GA 2AF4C 3OCXA 3V2HA 2O7RA 4Z1MG 3HY6A 2ADMA 4KQKA 3B77A 4LF5O 4BO8A 1CE8B 2EVWX 1G4UR 3HDQA 4YONB 4DMLA 2O05A 2VUSA 3E1GA 4ZU6X 1B0PA 4OHBA 3BIFA 3UWPA 2VJCA 2ZSEA 4TS9A 2Y0IA 2WLJA 2CK3G 1Q0ZA 3DR5A 1L5NA 4L1KA 4MHTA 1E94E 2VXOA 3AW9A 1HO3A 1R6AA 3SPCA 5DHSA 3PEYA 5IH3A 4GR5A 4MGYR 3R65A 4OLFA 1ZHHA 1HMPA 3IAHA 3VUEA 2NIPA 1P7WA 4K9PA 3C3YA 1KY5A 2PIAA 4AICA 5CLFA 1KVUA 4R81A 1I51A 2JAOA 3UPDA 3PKIA 4ABYA 4DV2O 2UYCA 3CIOA 3WQHA 2EQ5A 4FMDF 4JI3B 2BR5A 5CVVA 3I9V6 3HWRA 4HSGA 4WLUA 1VE1A 5JAQA 1U96A 3PT9A 1KO7A 4IDNA 2L82A 1LSUA 3KT8A 1ZC4A 3ROXA 3N0XA 3E9NA 4R1PA 5GIPE 2VIIA 4NBNA 1A1SA 1C0IA 4B6OA 3BJIC 3OD4A 2IVZA 4DLAA 2FB9A 4ME6A 3L7AA 4FSHA 1BN6A 4MYHA 1V8FA 3APOA 1EFTA 1RWXA 4C14A 1Q90D 2CJXA 4U2DA 1TKRA 3KJGA 3T95A 3FFWA 4LYEA 2M6RA 1FTGA 3MHHC 4H59A 2Z5FA 3NBAA 1QKJA 2P7HA 2AFHA 2EF0A 1UXOA 2PT7A 1EQ2A 1RZVA 4WN9B 5AKXA 1BE0A 2H06A 2V54A 4YRKA 1VIMA 1HOTA 4KIWA 2ZPTX 1JEYB 3WMXA 4NENA 4BGIA 3REOA 2EG5A 4P0PB 3BJZA 2NZWA 3AF6A 1VYTA 1TOAA 2O8FB 5I9LA 4DR4O 3KDAA 4AS1A 4DLYA 4RL6A 1PG0A 1P1CA 1T0JB 4X0EA 1KDZA 1RC1A 2B4KA 2P6PA 3F98A 1EBOA 2LTAA 1W2WB 5BR4A 2MWMA 1ESEA 3OE4A 2QUZA 4QUEA 1N4CA 3JW8A 4MUHA 5JJEB 3AIIA 2WSSG 4BFXA 4Z7OB 4LISA 4MQFB 3E84A 3EULA 1ENPA 1F2TB 1XJ5A 4C2BA 4XTRA 3GDGA 4NAVA 4ETIA 1EFRG 1G8JA 1C9KA 4LGCA 3IQFA 4QJBA 2IUTA 4JGIA 2ADOA 1V1MB 4UNQA 4UCSA 3OAAG 4RHFA 1TGYA 4M89A 5JCJA 1XI2A 4TMZA 1E6KA 5AUQA 1QGUA 3OIWA 3EQ8A 4R8RA 5E4JA 4XH9B 5IFLA 4LJSA 1NULA 1SBYA 4EHKA 4DM3A 4YK7A 3ABKC 3PKZA 3GCZA 4PA4A 4AX8A 2V6GA 3A1SA 1OXVA 2FRDC 4RQBA 3H1TA 4IEEA 4J1TA 4A0SA 2L6LA 5C8DA 5JAOA 2AQKA 2XGOA 2AMLA 3W77A 3ICOA 5FYDA 1OXTA 4F4DA 1NW8A 3BL5A 2AOVA 2HY7A 1L5YA 3E9QA 1YL7A 2ETXA 1C8LA 4ZRNA 3AGPA 3NR2A 3CRVA 2QXUA 3PHBE 3DTVB 4CTJA 3T3HA 3DMYA 4PVCA 2QTMA 4DIDA 3LZDA 2F95B 4HZUA 4RJIA 2F43B 2E4VA 3M9WA 3A4VA 4UM9D 1K4CC 1KMIZ 2CTWA 3O3CA 2V65A 1PL4A 1ZOIA 3MF4A 4I5SA 4IIXA 4PLZA 3EFFK 2V0GA 3I4CA 4LR3A 2B9VA 3L3BA 3Q0TA 4JITA 1G42A 1ULUA 1Y8RA 3PC7A 3IEPA 2ZIFA 3D6HA 3BMCB 5K0SA 2EFEB 1EWKA 4C5AA 4JYAO 2FPIB 4DHEA 4Y2XA 5C8YB 2NU9A 5IJWA 5DTJA 3BF8A 4F92B 3ACBA 5FWYB 2I76A 4MVWA 3TSCA 5H5JA 3TCUA 1RM1B 2VUTA 3GUCA 1P8JA 4DMFA 4ZGBA 3KSBC 4OQLA 4JVOA 1EWVA 1T9ZA 2YXEA 2BGLA 3BXXA 4CLDA 5KKCA 3SWWA 4N8EA 5LD2C 1UBRS 4XDKA 5EBMC 3GPIA 4U6QA 5AKHA 5KZMB 2B36A 1A2BA 1M76A 4ZC1A 4DSUA 3UJ9A 3BRCA 5E4FA 2BGKA 4JLMA 4ZO7A 1C0PA 3WHKA 1ZGAA 4E4EA 3O2NA 1Q20A 4D0LB 5ITVA 1NW6A 4KB5A 5D8DA 1KVSA 3EIXA 4ZQIA 1FNNA 4DR6O 1KJIA 4R5HA 5L45A 1IZYA 2W6MA 4PQRA 4EY8A 1LSJA 1TJ5A 4BIZA 3X2SA 3MB5A 4IGFA 3IAAA 4LJLA 3CF0A 4AQ7A 2XRMA 4DV3O 4QRDA 1G3QA 4ZJYA 2CE4A 1B2RA 3A1FA 4AN1A 1TA4A 1ZD8A 5YASA 1VC2A 4GRIA 4R50A 4UCQA 4W8GA 2PR2A 4KFCA 1LW6E 2JVJA 1VGQA 3GFTA 3LC0A 5TDHA 1IMJA 3ZQUA 1WG8A 2BGUA 5CHYA 4MI6A 4NDAA 1SQXH 3WGQA 2VF5X 3YASA 3DPUA 4D8TA 3JQ8B 3QM1A 1VYUA 2HK8A 4BVEA 1B43A 1D5NA 3FN4A 3QPAA 3DAGA 3OBBA 4HX2A 2VXCA 1GCOA 1M83A 5K8IA 1KA9H 1OCZC 1ZUHA 4GMDA 1IONA 3IYLW 2W0SA 3DWEX 5KOHB 1AK9A 1C80A 3CS5A 4LDJA 4JAUA 2GKGA 1P5ZB 4TTIA 4TQUS 3RBAA 1DWPA 4E7OA 2YL2A 4H9GA 3UQZA 3JD4A 5FIUA 1J5XA 4HWSA 1VECA 3ZMZA 3UJ8A 4Z9BA 4IOKA 1D1SA 4M7PA 3D5EA 1PYOA 3NHFA 1FDIA 4YRZA 2NTVA 4LGMA 1C1DA 1WUIS 2BM1A 3AXTA 4C22A 3PNVA 4EMSA 2BF4A 4H77A 4DTCA 4I8DA 4BMPB 1R6DA 1EUYA 3R6DA 1JU3A 2YW2A 4FGZA 4GXNA 3TLAA 1MN6A 3AHGA 4C6RA 1P4SA 3LCVB 1IHYA 3TI7A 2A1TR 3K9WA 4AMZA 2I2FA 1R15A 4CM6A 1EMDA 3I92A 1TCAA 3HO1A 5DNUA 1FU4A 4TGLA 3T4ZA 3MT9A 1MH1A 4AZ0B 5THKA 2PXCA 5B1HA 3C3PA 2HF2A 3VR6D 1Z5OA 3CYOA 1L7RA 3EBPA 1QRDA 4C0BA 1SEVA 4ODIA 1KPIA 1OILA 3AEYA 4TLEA 5GPBA 1JQAA 2DC1A 2BFCB 5L3FA 3AUSA 1Y3AA 4US1R 1WB9A 4GI2A 2WJPA 3W8NA 3HCBA 5IJZA 3G7NA 1WHTB 4X5OA 4DDHA 1JSXA 4PDRA 2PUBA 4YR9A 4GKKO 5SYAA 4MRVA 2R5FA 1P4GA 4GLOA 4JV5B 5K9ZA 1JDJA 1UBGA 2B9ZA 4WBNF 5L3ZA 4GLXA 4MV8A 2DWEC 4JLNA 4JMPA 2H1IA 5JZVA 4ROSA 1BZYA 1IAVA 2GLUA 3ZDBA 5FYQA 3IUYA 4BX9A 3ZDEA 4DSAA 2XIQA 4O4JB 2VDRB 2TMYA 2B34A 5D5QA 1JEOA 2AMJA 3K59A 2NZ8A 4Q3OA 3PX3A 3OT4A 2YDEA 4YMIA 2V9PA 4Y1EA 3DBIA 3TLGB 1EQAA 3X43A 1PJTA 2EJVA 2B0JA 3LBFA 8AT1A 5AWFC 3OZWA 1V9PA 2EILB 4PTLA 2JLZA