2P90A

The crystal structure of a protein of unknown function from corynebacterium glutamicum atcc 13032
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
269
Chain Sequence
b'DRMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Cgl1923
publication title The crystal structure of a protein of unknown function from Corynebacterium glutamicum ATCC 13032
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Structural genomics, unknown function
total genus 83
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p90A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2p90A01
3BY6A 1RM1C 3W7SA 3WZ2A 3W7XA 3D3IA 3W7WA 2HR3A 3IC7A 3E35A 1S3JA 3VR0A 1NH2B 4HAMA 2P90A 1NVPB 3MNFA 4G4SP 5CA3A 3GAAA 1YTFB 2WAMA 3W7UA 5GW7A 3W7TA
chains in the Genus database with same CATH superfamily
1CUYA 2II6A 2O7QA 4CWAA 1X19A 2ZUEA 2Y4UA 4DA8A 3QLVA 1NN3A 3C3CA 4YJFA 4EH1A 4DV0B 3STWA 1IDOA 5HILA 3DV0B 3MAAC 3UAVA 1T9ZA 1QLHA 3O3MB 4JD5A 3IAXA 3P2EA 3AF2A 1KI7A 2EJWA 3SEQA 2WUWE 3I9V6 2HJVA 1D5WA 2COKA 3HVIA 1OV4A 3VR5D 1X7XA 2QRLA 2GASA 5AH0A 5EE3A 3SS9X 2ATKC 4R1MA 1RQ7A 1BMFD 5HS4A 5JI2E 3DC6A 2OPHA 2GBOA 1JDVA 3N6XA 2J5KA 4LXXA 3IAFA 4WCDA 3DVLA 2JVDA 3T3EA 4RZ2A 1KEEA 2WILA 3G02A 2ZSFA 3S2UA 3HMKA 1CZOA 1F2UB 4IZHA 2R6JA 3L93A 2GM4A 4MVJP 5DLEA 2ZKLA 6NULA 4Y1RA 4DJFC 2X2PA 4UHFA 3RS3A 3SNHA 1K4DC 2EINB 5SZKB 5KVAA 1TMOA 3MTBA 4MQFB 4GLXA 3COYA 3JATA 4OUKX 4ADSG 3E15A 3ZXUB 2NT3A 1U0GA 4CVNA 2IBSA 4L8VA 1SVSA 3H18A 2NU7B 1XRPA 1G5RA 2ZSHA 4JJ8A 2QZPA 1GG8A 2XB8A 3IMKA 3FLAA 1A0OA 1U1DA 1O03A 3ONWA 4QPJA 4JT9A 2AA3A 4CCSA 1URPA 5CURA 3E18A 1BCRB 1F5SA 3COWA 3DO6A 2YCLA 3ZV5A 2EQ5A 3HRHA 2IBZH 5C8YB 2V9ZA 3B6IA 1UJMA 1IQPA 5EZ5A 3IQHX 4MB2A 3VTKA 1W4ZA 3TW4A 1LU9A 5H3LA 1KA9H 1TK9A 4JHXA 3QEOA 3CCMV 3DXFA 4KFUA 5IHPA 1SG6A 2VDJA 4TSFD 5H7XA 2QRVB 2WQZA 2YJ5A 3W7SA 2RBEA 4WUVA 5CFQA 1C7RA 3S44A 1OCEA 4AG3A 3KR0A 1SBTA 4E4EA 3TS1A 3WQHA 2XT6A 1PR6A 5J2UA 1UZAA 2AWNA 4E94A 4QVGA 5FBZA 4TMVA 4DEXA 4BQFA 1GNSA 1UDXA 1H0SA 1SK9A 4HXFB 2ZI9A 2HR3A 1Q1NA 1LD3A 3KQWA 2K2QB 4BMDA 1SAYA 4G0OA 2OPBA 4IDHA 1U4SA 3RIEA 2DU8A 3D6FA 2Y0BA 4UEOA 1LQUA 4RK4A 3CS5A 1XCGB 2Y68A 2ZJYA 5CLHA 4V3CA 4RHCA 1VCMA 2CJXA 4KE8A 4HUTA 4J29A 1TYBE 2J7KA 1M2VA 3ZGOA 4J7KA 2F6RA 1QYIA 4YYEA 2YQ4A 3ZHXA 2PGOA 4CG3A 2GZAA 3M49A 4ALJA 1ZZGA 1VSQA 4Z9FA 4TMTA 2NO6A 4MTLA 2FMKA 1QHHB 3A26A 3G5AA 1GSIA 5HMMA 1U2PA 1LSSA 2HWYA 3FNGA 4FYPA 4KWIA 2ADMA 4N54A 2BFEB 4L2IA 5FCDA 5DULA 3JRXA 5JECA 4QSMA 2F1MA 2AEEA 4KK3A 3VKHA 3A2NA 1W4LA 3IA2A 4O08A 3HNRA 2PJRA 2CTWA 3CNBA 1ZMXA 1F38A 1P17A 1M57C 3NAZA 3O95A 3JVEA 2EFHB 3I9OA 1H4QA 1YK1A 3M6MD 4CT4B 2DKNA 2H07A 1ODTC 3ADOA 3RVLA 2W0FC 2YRFA 2CXXA 4JYAB 1S5LZ 1V16B 1X9GA 1GFZA 4OHKA 4ENTA 1PJAA 2FHSA 3AJ9A 4BO1A 4MDHA 3FHOA 2C92A 3TSCA 5IAEA 2D1RA 3A1DA 3KKLA 3OLXA 1KYIA 2W8BA 3L43A 1GL6A 3Q0TA 4NYIQ 3HP7A 1GSAA 1MW9X 3TOSA 2FX3A 2V7UA 4RELA 3EF3A 1G8YA 1X1QA 3TXAA 3D54D 3J7AC 3NWPA 5DTIA 4XR4A 1LV8A 1ZD4A 1NATA 1VHTA 1BHBA 1SU8A 5IX8A 1BO6A 4ZAFA 4HT3B 3EX7C 1P5RA 4PLTA 3HUDA 3IJEB 1O6ZA 3GDWA 3LP8A 1N0NA 1MAHA 3QVGB 4MR8B 2SKDA 4RE6A 1NZJA 3BIWA 5GONF 2WJ3A 2NUAB 2XGJA 1WS6A 2KWIA 3G9XA 4C0JA 2CB9A 2K2WA 2Z6AA 1A77A 3AIIA 4QTTB 3GGGA 3CE2A 3DW1X 1SCUB 1SCDA 4H7JA 2IPAB 5LMUB 2OO3A 1JT2A 2X8LA 3KQSA 2I33A 3LC7O 1XKLA 1BHJA 5CK5A 4D9HA 3JAWB 4M9UA 4R8RA 1FFAA 1IPFA 3M4XA 1RE0A 2PD4A 1KETA 5HIAA 1RYFA 1LDYA 4GEGA 5H82A 2B4RO 3OOJA 4K9MA 4Q6BA 4F4FA 4ENVA 2PGNA 1OCOC 5KX5F 3MQFA 1N9GA 1XOIA 3BXFA 4MS4B 4XCXA 4X66O 4BO9A 4U7HA 4R3NA 4I50B 4OXIA 2A5YB 1XVLA 4W9MC 3QLUA 1D5NA 2WJVA 1RWNA 5LMNB 3FMOB 2PXXA 3PZBA 1IH8A 1S76D 1KBZA 2HUPA 3UC5A 5CGZA 3OZEA 3WBJA 4BNUA 2Z3YA 1EA5A 4NBRA 4JP3A 5JJCA 1IEXA 2IS1A 4DMLA 2DPLA 4QTUB 3NJ8A 1WXGA 1NIPA 3ORRA 3ZTTA 2YZ2A 4HI0E 3TIFA 4YAEA 2H0QA 1FSZA 4S2EA 3CV3A 2WWFA 4MQ5A 3M4JA 3CWCA 4K86A 5JAHA 1Q3EA 3W8NA 3NAMA 3WHKA 1V4VA 3H4VA 4BQSA 2G1PA 4C3UA 2I9PA 3QWIA 4ATNA 1HLPA 4RKYA 2Z5GA 1Q0ZA 2CZGA 1P18A 2GYWA 1FQWA 2O3RA 1FYFA 3ZDDA 1R2QA 3DAHA 2PUHA 4TXMA 4L4ZA 1WXXA 2WV9A 3X1WA 2I6TA 4JL6A 4EG3A 5D8DA 3G2NA 2O07A 2FN8A 4IT5A 3KCNA 3GBPA 4MKIA 1NMEA 5BSEA 1CJVC 3HSKA 3ZMSA 2VLBA 2XASA 4CQJA 2CEKA 1P0CA 3H2IA 1JXQA 2VXYA 3B2EE 4EY7A 2EIJC 4M4SA 3CYOA 2QE7A 5EKDA 5KYWA 3RO7A 2ZSBA 2JGUA 1Z22A 2JZNA 2WSSA 2PKYX 3PFGA 4JV5O 3JATB 3QG5A 5F52A 1ORTA 1W35A 3WYDA 4KQEA 5TMEA 5CIQA 2ZROA 4XDGA 3NXSA 1NVDA 1P5FA 3TH5A 1WJZA 4BWFB 5TQ0B 3KHKA 5AXAA 2QNBA 3ITEA 1JIQA 3TG2A 2BTQA 4L0DA 2MTBA 1POXA 4FI3C 4W5OA 4NOMA 4KP4A 2YKGA 4Z1VA 5AP9A 4FLXA 2IEAA 2P9GA 3QEMB 4LN1A 4F46A 2AKYA 5DGIA 4MW9A 1R10A 1N4CA 4UDXX 4NU0A 4UHEA 5HBRA 2HJWA 5KU1A 2JHFA 4KUMA 4XPIB 1I4WA 3EZ2A 1D5AA 4Z4CA 1YS6A 1ZESA 3LY7A 3DCNA 4TWRA 4BNIA 1ISJA 3TNYA 2B1GA 4D97A 1RU3A 3DCYA 3ROXA 2FRVA 1P2UA 4TSKA 5JS1A 2G88A 4IDFA 1W88B 3C3JA 1XDZA 3KC2A 4G37A 1NNLA 4K05A 1T43A 1U6KA 5J2UB 2RHLA 2NN4A 1WNFA 5T7BA 3CB2A 4YJ3B 2BHRA 2C8VA 3CT6A 3E4CA 1DC3A 5GOZA 1KO4A 3KJQA 4RENA 2WHRA 1UDRA 3NDJA 5FA8A 3H75A 4EFMA 4R51A 2AMJA 4LTNA 3IPXA 1BMFG 3AR9A 4S1OA 3B9BA 2ZCEA 1ORIA 3VBCA 1LCIA 3ML1A 3NYIA 4UVBA 3ZZ1A 2VP0A 3T95A 4DMMA 3SJBA 2DJ5A 1G4HA 5I4KA 3QELB 2JB9A 4RTKA 2HA3A 4US0R 5CFLA 4PM4A 3B20A 3PGLA 1UT6A 2WUVA 3TGPA 2HU7A 1E1KA 5ABPA 4B5KA 3WNZA 3GGJA 1X8KA 2J3LA 2AKEA 1X0VA 1JV2B 3UUGA 5EP2A 4E31A 1JVNA 2A0WA 1BMQA 5BUZA 1S9DA 1PWZA 3KELA 3UB3A 1UOEA 2YXLA 1J9ZA 1XU9A 3D5QA 1Y6GA 4FFMA 5DXFA 5JCPA 2QORA 4TRMA 5E4FA 2NVUA 3VHXB 4PA9A 4TLAA 4JBHA 4UATA 1M6VB 4QJBA 3LA8A 4J0QA 2ECPA 5JOQA 2YVUA 2N05A 1H0KA 1QHIA 2WD7A 1IJKA 3H5AA 2NYUA 2AK3A 3K73O 3LC0A 4C2AA 2I5PO 1Q2UA 2ZBRA 4UHCA 1P45A 1DJOA 2V4DA 1FVFA 3BK2A 1XREA 2Y69B 1J70A 4IY1A 2VR1A 1Z73A 4YAOA 4P5PA 3L7BA 3L7OA 4G5OA 4DA9A 5CVVA 3TZ6A 3R3VA 1AKVA 4PAWA 5B3JC 4G24A 1VIMA 4AN0A 1JQKA 4TSFG 1EVJA 3HB1A 4ZI7F 3VTZA 4ZICA 4RD4A 1U3FA 4F4IA 4MRAA 2W0XA 5CLGA 4MV6A 4PTYA 4YNBA 2WF9A 1A9SA 5CVCA 3ZCCA 4WXYB 3KUCA 2E87A 3ITKA 2W4MA 5JS8A 3HADA 5BYKA 1R1BA 3QVKA 4ZAXA 3QENA 2GAIA 1X42A 3NRBA 3AG4B 1MRSA 1XZHA 4YUVA 4RJJA 2JKVA 4TWBA 2WTBA 4LXTA 3SX4A 1BC5A 2P9JA 5BWMA 2WU4A 2WUFA 4M6WA 1PT8A 5JFGA 3WHPA 2C99A 4K9DA 3M9LA 2QI9F 1P4RA 3FZGA 1B6RA 2C04A 3NTUA 1JLMA 2H48A 1PNVA 1MO5A 2QTVB 5B66Z 1H2MA 4KQGA 2NLJC 3QOXA 2C84A 4CEHA 4J7CA 3EGWA 1JOYA 5AVVA 3NYRA 3P0RA 1T5IA 2QPAA 3QLJA 3VZSA 1P8AA 3GCWA 3AU9A 3SPXA 5LXTF 1ND5A 4CLHA 4L5IA 1N5DA 3ND9A 3SPJA 1BXGB 1O8CA 2FWBA 3BWEA 2IXTA 3GWZA 2G08A 4ZEVA 3IUYA 1KK0A 1XIVA 5E1MA 4PG6A 1XYYA 1ZUNB 4BQEA 1YI0A 1ONSA 4F4CA 5THXA 1QG0A 5AI5A 1YRHA 1U11A 1PEYA 1PK7A 4ARAA 3JQ9A 2VAXA 2O8BB 4WMLA 3SX2A 1TTQB 3VO8A 1QGED 2RI1A 1L7OA 4B3GA 4NAHA 4DCPA 5AW9A 1TL7C 1HNXB 1JEQA 1CWUA 5BMVA 3IEUA 5TLSA 4WJLA 1YB1A 2BEWA 1SUBA 1OWMA 4EK9A 4Q1FA 3IV9A 1T9CA 3HZZA 2ZXFA 4DQXA 1SXJB 3QO8A 2GD6A 2UZIR 1T25A 4BBZA 3INRA 1PYDA 2H59A 2QLNA 4D2IA 3M6XA 1E1LA 3SK0A 4X6UA 4RF3A 1F8UA 1B41A 3EEBA 4TOIA 5B1AC 3K0EA 2YXPX 1FMCA 1FNSA 1JNXX 3PKZA 2XMGA 3TDNA 4HEA6 1DTOA 4D6PA 2WSIA 4B3SB 2O2EA 3VU3A 2IX9A 2WU0A 3FOFC 3BMNA 1PKXA 1QYRA 1PPJH 5AR1A 2E4AA 1WBBA 3PXAA 3H3XA 4G27B 3AM5A 3FFXA 2OAEA 1ONOA 4RZQA 1T9AA 5AHRA 3OF5A 1I4OA 3GEMA 4YY3O 3OMIB 2C4VA 3P5SA 1S2NA 1GR1A 3W9SA 3KQPA 1O95C 1P33A 4IVRA 5GADl 5IH7A 1K4KA 3V2GA 4Z7JA 4MVJH 4KRFA 4FIPC 1XEWX 3GARA 3QPCA 4DS3A 1A4XA 1FSPA 1T6BY 4UCOA 4OVKA 2OWOA 4DLVA 3IEXA 3S7ZA 4X71A 4B7EA 3T7SA 2BTQB 5EEHA 5EQFA 4BMNA 3LCVB 1IN1A 1ML3A 3MWDB 1C1DA 4W6QA 5H16A 5DSZA 4PE5B 4D96A 2ETXA 3G88A 2PRZA 1YS7A 3SE0A 1SQ0A 1SZDA 5HYVA 1U7UA 1R6XA 4RMGA 5TY0A 4NXMB 1K4YA 5DW3A 2B9VA 1JNYA 5LMZA 2XT0A 4YRMA 4M7RA 3T1HB 1MFZA 3JR3A 3ZCQA 5BNZA 3U56A 4E09A 3V4LA 4RULA 1IN4A 3QPVA 4UUAA 1ULZA 1CQPA 1EM1A 1T1SA 3EBOA 4NAVA 1XDBA 4EY8A 1ZGBA 4FTWA 1C30B 1XL4A 4ITUA 4Y18A 3GJ6A 4R3UC 1NNI1 4CFSA 2IDJA 2JFOA 4W9RA 1NI3A 4JITA 3E3OA 3N2ZB 1VLHA 1NE2A 1C9KA 4JGGA 2X2FA 4EZBA 5IDJA 1FA9A 1SXQA 1BMTA 1KI6B 4QYIB 2RHBA 1J7JA 1VP7A 1EN6A 1M57B 5CXXA 1ZI6A 4O4JF 5JW6A 2C0PA 2N3ZA 2H1OA 4Q12A 3OFJA 1PW7A 3RRZA 5LUAA 3JQGA 4J4HA 4OSPA 1MDFA 2VEOA 4AQYO 1R8YA 3O21A 2UUCB 1YVRA 4LC9A 2GEBA 4L3VA 4LYDA 2KLBA 3C3TA 3QUSA 3ABKC 2JJQA 2VIIA 3EWIA 5DNYB 1ZMBA 1YBHA 3FHTA 4EPYA 1MZPA 2CFCA 4J7ZA 4BNMA 1L7DA 2W6JD 3AK3A 6Q21A 3YASA 2IS6A 1Z12A 3O38A 5C8XA 4UCUA 3R4VA 3KJFA 2LRHA 5CFRA 2VUUA 4HAWA 1E1RD 3VTAA 3I8OA 4I2NA 1PJLA 1X9HA 3HBNA 3MD9A 3DE2X 3KTAB 2Q9AA 2WJZB 2ICAA 4O6VA 1F51A 3LQRA 1NX6A 4MSUA 1KY3A 4KDFA 3GVXA 3W0LB 2DH5A 2B8NA 3K79A 2XZOA 4GR5A 4YXWA 4KR9A 3M3PA 3NEYA 3T9DA 3W3AA 4D3ZA 1T5OA 2VSXA 5C51B 5HF5A 3ZS9A 1AKNA 4KC0A 1PS8A 2JFQA 1EM8A 5KHHA 5CJ2A 4F2GA 5A0TA 2OQ2A 1CDZA 4RXMA 2VNSA 1WOYA 2Q5LA 5A9SA 2ZRHA 2C2MA 4M6WB 3TTVA 3CJQA 2EWWA 3SQLA 3NI2A 1F6BA 1M0SA 3RW0A 3KKYA 1KJNA 3U44B 3QMMA 1Z6YA 5B2FA 3B40A 3E22B 1K7EB 1I6WA 5JV5A 1WXFA 4RZIA 2O3SA 2EARA 3PL5A 1GG2A 1UMBB 4V2UA 3COPA 4B2YA 5L3SA 4YRDA 2V3VA 5ECYA 3JZMA 1KK1A 1XZGA 1MF7A 2AQIA 5C9ZA 2GAJA 3D5TA 2GTPA 4ZXFA 2FEOA 4Z9BA 3RS7A 5LQKA 3FGZA 3SQDA 2INGX 1P91A 1QWSA 4HNRA 1P0IA 1WXIA 3CJTA 3UMVA 4MP8A 421PA 2RHDA 3DDUA 4JB2A 3RBXA 1GGMA 1C8KA 1OV9A 4HXGA 1V5FA 4HSGA 4NC9A 3ADKA 1HYQA 2G06A 5EVJA 2BL4A 3ZD8A 2GBIA 1UXHA 4AZSA 1Q50A 1JR3D 3FLBA 5BN1A 2IOYA 4BW9A 4G1UC 5LP1A 1D4AA 3F5QA 2GGSA 3HBMA 4ZK2A 1XD9A 2JA1A 5L9AA 3I53A 4F93B 4A16A 3T1TA 1DLJA 2X6AA 2X9NA 4LQ4A 4TMXA 2AG1A 4AULA 1ZEMA 1N6IA 1FDUA 5TX7A 4LYAA 5AW2A 3FZEA 4FLWA 4S05A 1G59A 5BMVB 1XTQA 2QMYA 2VDNB 3JYCA 2BEWB 3VZRA 1AK9A 1WL8A 3HL0A 2VUTA 1DTWB 2ZRMA 4MRMA 2UV8A 3LDDA 3VR4D 5EBMC 2AMYA 1D2MA 1Z18A 4BBJA 1Q1BA 3EPJA 4H0CA 4D26A 3OQIA 1W0CA 1ZU5A 3ER9A 1NMZA 4FZJA 4CS3A 1DTSA 2CDBA 3PNOA 3KQUA 2G5PA 5EMMA 5AHKA 1L5NA 4NOLA 5KINB 3IPCA 3SYAA 3JWGA 4FVTA 4TRJA 3LPLA 2I8LA 3WXMA 2BW0A 4CRWB 5K3AA 1CFZA 2VNHA 1SQFA 3MHPA 3IDZA 2EIHA 5I8ZA 1NVUQ 1Y4DE 1XX6A 1MV8A 4ARVA 3MTGA 3HCBA 1JR4A 1JJBA 4RA9A 3ETEA 4V0SA 3F78A 3UBMA 5U4QA 1E2FA 1PI3A 3GUZA 2PLAA 4K9QA 2VS0A 4QUKA 2Y3IA 1HOXA 3BTVA 4JNKA 4DV4B 1XAHA 2KLHA 3NVKI 5I7AA 3GA0A 1BCSB 3WY9A 4X85A 4TKVB 3L1UA 3M1YA 4TMKA 2C3OA 4K81B 3K9NA 1GPKA 4F9FA 5HZGA 2OR3A 5BSRA 4ZOLB 3C48A 3CX6A 4E7OA 1KF0A 1C1DB 3ZY3A 2WSYB 2O3JA 1NWHA 4V38A 1GRQA 1R3UA 2NO5A 5TIIA 5DNCA 2KS6A 1NFFA 1KEZA 1KSFX 3ACCA 4J91A 3MBKA 2QOEA 2W2KB 1BL8A 4E30A 5LQSA 3K71B 4MSWC 2VAVA 2R8EA 4NPAA 2HIHA 2EV9A 5DBHX 1GWNA 3HE3A 4TWJA 4LF5B 4LGYA 5T6BA 5DMHA 1MA0A 3GCGA 1BT8A 1KWKA 4R5MA 4XM2A 1OLXA 4EUSA 1XF1A 1L0LH 1FP7A 1M1XB 3O7MA 3KPYA 1YB2A 3NT2A 3S70A 4JELA 4POOA 1L9XA 1Z4LA 1S0UA 2QLJA 4O4LA 2W8ZA 2PZBA 3E61A 4DADA 5JC8A 3H1KH 4R6XA 3LDCA 3MS7A 4IWXA 1O95D 2YHBA 2Q6IA 2CKMA 2DTXA 4BU1A 2QG6A 1N5OX 2M98A 2O0LA 4N01A 2PH7A 5LBIA 3U1VA 2I7DA 3BL5A 3HH8A 1W19A 2QXYA 3B3FA 2CV1A 2HH9A 3AI3A 2JI4A 4FGWA 1LPBB 4JLMA 1C5KA 4RSRA 3H1GA 2IYAA 3F7TA 3NWEA 1DFIA 3R09A 4ND3A 1BGXT 2ZIVB 2BZSA 4P0QB 3MWEB 3QPBA 3ZXSA 1QCYA 3D8UA 1UC8A 3NHYA 1FS4A 5AFSA 1M34B 5I3CA 2YH2A 1CQJB 3WZLA 2QT1A 3FCCA 4E2ZA 3TNFA 3THWA 1J2YA 3WLJA 4ARIA 4HNUA 1WUHS 1KDTA 1EE9A 4BQOA 3LD9A 4DLNA 4OGFA 1EHIA 2YICA 4KQJA 1Q2XA 4GOND 4C0WA 3UGTA 2X4IA 3H99A 3FVQA 5D85A 3IKLA 1E96A 3LKZA 1C1XB 2MHCA 4ZRDA 2C4MA 5A9TA 1Z5UA 1JQ5A 1VMAA 3UMSA 2DUNA 4P22A 1G6Q1 1SKVA 4P5EA 3K8YA 3K9BA 4K03A 2HZ7A 3CPJB 2D4AA 4POAA 3OE5A 4FW9A 3AFOA 2WICA 2EXXA 1LK7A 3QWBA 3HDQA 2O5CA 3ELDA 1GUBA 3EZXA 4U6NA 2QF7A 2FL4A 4JLOA 2WOOA 3E9MA 1GUYA 1N0IA 3X1XA 2OBBA 1F4LA 4HWSA 3VISA 4QVKA 4ZAYA 3O8LA 1TUBA 3IEMA 2XTZA 1EUCA 2C0CA 1AV7A 5HTKA 3VGPA 5LQDA 5B3SC 1MHTA 2BUAA 4Y6LA 3ZVKA 1N3YA 4DZZA 4M0MA 3W2GA 2PTGA 2OFWA 3QP9A 1W5EA 1U5BB 1LPSA 3JQRA 3FTEA 2ZJAA 2GN0A 3RC8A 1XHFA 3Q12A 1RBZA 1UM9A 2XB4A 5CNMA 2V96A 5L3SB 1TQ8A 1KL7A 3LUFA 4WIAA 1Y81A 3DMGA 2UXCB 1G8MA 2AK2A 3M2PA 2HPVA 5CX1A 1OI7A 1DTEA 3LRTA 3LECA 3JYNA 5I8WA 4TYQA 3ZJ4A 1XBLA 1E8DA 1Q0PA 3DV0A 1FXVA 4MWOA 2W6JG 1CR4A 3GQBA 1WU7A 2BSQA 3CD6V 1QNLA 3LG2A 4C7MA 2ZIMA 1X1SA 1F12A 3VPXA 2PL3A 1YC2A 3ZUPA 4QQ8A 1E1RG 5EL0A 4FZ0A 4MQEA 2F3SA 4W6ZA 2RK3A 5K0LA 2GCIA 3VVCA 1XDUA 3JVUA 4ZQHA 4I9NA 1XHZA 4EF6A 4D43A 4OY3A 4A0GA 4AO7A 2O4CA 2AXTZ 3I6IA 1F2UA 5L6MB 1YXBA 5KJFA 5DSXA 2VA9A 2G17A 4G1CA 3OUTA 4RGQA 1NYQA 1XD2B 2NT4A 4CUZA 4MQFA 1NF3A 5KYTA 3GV0A 4J4TA 2V7WA 2R79A 3B8MA 4MRMB 5FOSA 5A4MS 2NU7A 5AW1A 1YT5A 3JQFC 4QO7A 2PR2A 3WG7B 3O92A 1DKMA 3M9WA 3OZIA 1OLOA 1YVDA 2NAPA 2YWRA 2GK7A 3KLBA 5K0SA 3C74A 3IMFA 4GX2A 4WV3A 2JAHA 2PWAA 1JDBC 2R751 2Y92A 3P1JA 1PZFA 1WNSA 4DBVO 1RAGA 1DEOA 1Q57A 3DC7A 1BCRA 3WA6A 2TMYA 5C8YA 3WIDA 5DBOA 3ELWA 4NAUA 1I33A 2C3UA 1Z2GA 3EEOA 4Y9RA 4XDKA 2PO7A 4GI2A 2PT6A 1I14A 3L7IA 1H2BA 5CH8A 4OHVA 2QRVA 3IA7A 5HFNA 4RA9B 3R6GA 4R98A 4ZOBA 3ERCA 4MYRA 3WDKA 2Q2OA 4GIBA 4ICIA 1SRYA 4C20A 3S27A 3ADDA 5CW1A 4KHPO 2JW5A 4FILA 4AN4A 3FNEA 4Y2TA 3H97A 2C2OA 1NVVR 5C3UA 4D3SA 5A4AA 2G67A 4JASB 4PC3A 5B1DA 4ZO4A 3TTYA 1KP3A 4X7MA 5C4GB 4RIHA 2ZCUA 4FM1A 3O93A 1L7PA 4KBFA 1ZCAA 5J4YA 3PICA 4L9AA 1MEEA 4HS4A 3PC8C 4OGLA 1U94A 1TZJA 3IUNA 3QVVA 5IVDA 4RIEA 3N8NA 3A25A 4DJ5X 3UJDA 2CHVA 2VF8A 2KI5A 2J0EA 2JLQA 4XEHA 1Z5GA 4QOIA 1DCTA 1PFYA 1E0KA 4IJMA 1F1JA 1QHHA 2AZXA 4B3JA 2H4WA 4H7IA 2WLHA 3GLTA 2XYHA 1PAUA 1PQWA 2BFEA 4DUZB 2ZKOA 2L35A 4GMFA 1WTAA 1UC5B 5ENVA 2WFZA 4D9IA 4RGVA 1UADA 2JARA 1SBZA 1YK0A 1UK6A 4DSTA 2ZJZA 3H8SA 1QO7A 3H5NA 1FXKA 4AURA 1YL5A 4UXHA 2Y1CA 1G8GA 2D7DA 3KPUA 1QRSA 3B6JA 4ROSA 1WO8A 3K94A 3KJZA 1YR3A 4K0RA 1LBSA 2Z09A 2B5OA 5A02A 4O4LB 2HRCA 4IRUB 3I9V1 2QRZA 4DGQA 1JWBB 2ZQ5A 2QTCA 5M2QA 2PGLA 1V16A 3DUWA 4EAQA 1PV4A 4II2A 2Q4TA 1HFEL 4ZTBA 1ATIA 4LYFA 1QCCA 1R0CA 3NTVA 3HYLA 1ZJ5A 4HYTA 5IT5A 2CUNA 4NQZA 1AF4A 3OM3B 3FWZA 3C6BA 3BWVA 2RJOA 2QTMA 2ZR9A 2CMHA 3VR5A 3WICA 2CFRA 1SC6A 1HLGA 4GCZA 4G97A 2XGMA 2NVBA 1QZXA 2A9PA 2G8LA 1W29A 4O63O 2REXB 1MBZA 2XCLA 3HJCA 5FTMA 1K88A 3JQEA 2X6QA 1NUPA 2FW9A 1T3SA 2M1ZA 3VV2A 3GIDA 4XD7D 3LFTA 1VMGA 1U31A 5DI9A 1NJSA 1Z39A 5EERA 3EVDA 2A94A 4HQFA 3UWMA 4YI3A 1DRUA 1PIWA 1I36A 3HBLA 2B4TO 2R85A 2W83A 2BP7A 3THWB 1VL8A 3J81A 3EARA 3QVGA 3H4IA 4MR8A 3UKJA 2AXEA 2NUAA 2CLFB 2HWXA 1CUGA 1QAMA 4NBWA 1VMKA 1KVQA 3FMVA 4L22A 3G8BA 4QFMA 1Y76A 3DDZX 4NG5A 3B7PA 5IXJA 4B34A 4UUPA 2FW6A 1HZZA 1CW2B 1SCUA 1RXSA 5LGTA 3T0GA 3AC0A 1T0BA 1TCAA 3JAWA 3PRKE 2HRQA 1YQUA 1X7DA 1BSVA 2QP3A 4QYSA 4G2KA 2G77B 3I0MA 2IHBA 3WMEA 1M4UA 2HIAA 2JEUA 1ISIA 4KMOA 1AHHA 3Q5DA 4D7SA 5DV9A 1QTNA 1I4TD 3EY9A 4MS4A 2WG2A 5IKXA 1IBLO 3TQFA 1H23A 1QLNA 2VJDA 4TSFA 3O65A 3QF4A 3FGNA 3LU1A 1TUBB 3O5AA 5EIFA 4EVIA 5EUCA 4ZYWA 4BASA 3G2QA 3IXMA 3OD4A 5IULC 1DQZA 1H85A 4DIFA 3B1WA 1R6AA 3DMYA 3VNUA 3D2AA 3LFUA 5J5CA 5LC1A 3GXOA 3TVTA 2WIKA 2YIAA 3HWSA 4IGKA 2IFTA 5I6DA 4NCKA 1JCHA 4MNTA 1ORHA 2E85A 1ZR4A 5HHTA 2E18A 2YUIA 5CX1B 3SR4A 3PI6A 5H02A 4MRSA 4J0HA 2Q1SA 4E14A 1O9GA 5IC5A 3PQ2A 1J42A 3GQBB 2WWYA 4PZYA 3VQXA 4DR1B 3L1HA 4BIOA 5KVSA 4CV0A 1T9GS 3PBKA 1VB3A 3H5WA 1YA6A 4B4DA 2V74B 5HCUA 1IY0A 4MQEB 3UWOA 2ZB2A 3FPEA 4YCDA 2Q5ZA 2XUQA 1W47A 2GA8A 3NALA 4OYYA 4DANA 3H9GA 2HW8A 4WK0B 2WU1A 2QUZA 4G4SO 2VJMB 1YZFA 2C9CA 1CNFA 3NG1A 3TX6A 1NUTA 4IS2A 4L4XA 4X63A 4FPXA 3WFZA 1CY4A 3VZBA 3H9BA 4BLUA 3ZIAG 5EP4A 4MWTA 1SPBS 2IEGA 4C7UA 2QTRA 4FGUA 4D82A 3H2SA 1UQRA 3D59A 3D6NB 4NP6A 4AMYA 1CUFA 2JGDB 5K0NA 2BFFA 1DIOB 5KHKA 4WA8A 1G9XA 4HAZA 3OETA 5H5JA 5TQ0A 3O2QB 4OXNA 3WLPA 3IV6A 2R66A 2YRWA 4ALMA 4CN9A 5A3QA 1VLQA 5HOEA 1Q5OA 2CNDA 2F7SA 1FFYA 4HYQA 1Q83A 2QKAA 3QEMA 3JZFA 3OD5A 4PRZA 2XZPA 2BMEA 1VG8A 2EYQA 2Z57A 5KQPA 3G71V 2OCDA 2YWJA 3L02A 4DC9A 2XRYA 5I9SA 4MWBA 3EA0A 5ERGB 3PJFA 4ZJUA 4XPIA 2CUTA 1UBRS 5HM6A 3E9ZA 4EVSA 1ACJA 2OXRA 2WF7A 1GN3A 3BEHA 3KBOA 4DLAA 1V45E 3I9KA 2JLUA 3GN1A 3T12A 2XRFA 3FX2A 2V6FA 3N8HA 4ZVUA 4QDUA 4FE7A 4GOMD 4KVFA 1W88A 2HJHA 4IV5A 2YZKA 2VAWA 2RH4A 4LZOA 4DXWA 4M22A 4OHWA 2AG5A 3FKSD 1GM5A 2AG6A 1OH6A 4YJ3A 1D8AA 6AT1A 3NJRA 2VNKA 1D03A 4B44A 5TGTA 3ROGA 4IJWA 4KAAA 2Z2KA 2Z1NA 1M0EA 5L3CA 4YRJA 1QH0A 4ALNA 1HUQA 3CHYA 4QU9A 1DCKA 4M1WA 1UWLA 3VR2D 2Q4EA 4JY7A 4MRPA 5CNIA 1J8VA 1S0VA 4F8EA 3QELA 4HFMA 4PN7A 1RLMA 3V1MA 1RJ9A 4Y2PA 3MFQA 2EOAA 2JEXA 3F9IA 1QLEB 4UB6Z 1RHQA 1RCUA 3I8SA 4W7HA 2AXQA 3MJDA 3IEPA 1XK7A 3A1VA 3NUQA 4R9VA 3MFYA 4UNRA 3HYRA 1CRWG 5EOVA 4WY8A 2PH3A 3CSXA 4CT5A 1VSBA 2XADA 4YJKA 1QPGA 1OBOA 3X1DA 2NAFA 3OE7D 1EVLA 3VHXA 1H1DA 3HDHA 4EVRA 3FIJA 2Y1LA 2BGWA 1M6VA 3TM4A 3ZWCA 1FXKB 3TZKA 1P6QA 3L5OA 1BE0A 2POCA 4LF9O 2Q1TA 3B12A 1HYEA 3RVJA 2DBRA 4ZP1A 1B4DA 3W9YA 4DQKA 4A6XA 1V2GA 1YAHA 4EI8A 1Z2CA 1P73A 2VJNA 1JA8A 2ISQA 3NQ41 4UOEA 1ZHHA 5TV2A 1D8TA 3GDGA 1Z8FA 4GKJO 4HFRA 2Z4TA 1V26A 5GINE 1I5XA 4F7WA 4OAPA 3L8CA 3ZIDA 2E4XA 1LRLA 4JUAA 3OX3A 3T2MA 2V1XA 1FLNA 1USVA 4AS3A 1WKCA 4EJMA 1Q0HA 4F5DA 1ABFA 3CZRA 2I7TA 3SYKA 3WWZA 1KFBB 2NWQA 1I32A 2XQVA 5DGCA 1B3QA 2DQYA 4L73A 3RC1A 3BA6A 4HQ0A 2FX2A 4OB7A 5KNBD 1AMUA 1JIVA 1PJTA 2A9HA 2CTRA 3WLIA 4EF5A 2ZIUB 2GTAA 4TQ9A 1GU1A 4ZIBA 5ALWA 2FZKA 3VV3A 3EWAA 2JAOA 4ZDKA 5BT9A 2BP7B 1S72V 1NBOA 3WGTA 3LZCA 4GWKA 1I4LD 1A9OA 4YRGA 4GDFA 4XX1A 1QR6A 2V7XA 1SIWA 4FZRA 2CXUA 3MUFA 3THXB 4TL6A 4MLDA 2QTVA 4J8PA 2IEYA 4Q7LA 2OKCA 3GCXA 1SOWA 1Y76B 4I36A 3MCUA 4YMGA 2OCKA 1PR1A 1G8AA 5FD8A 5HWSA 4CHGA 2NPIA 3FAZA 4LYHA 4UXNA 4GECA 3VPFA 5E1BA 1X87A 3U3RA 1BXGA 3BULA 1SQGA 2ASVA 3FZYA 3LH5A 4C87A 1OCRC 1XVIA 1GTL1 2X9LA 3O9MA 3N3AC 3IAUA 1ZTEA 4YS6A 3AQIA 1XNQO 2IH2A 2BM1A 2Z5LA 4PPQA 1SEPA 3FPCA 5KBYA 1A4IA 3CSSA 1ZUNA 1N92A 2BTOA 4X1YB 4GXRA 3QF4B 3SN6A 4E4TA 3SQNA 2IUYA 4IUYA 1Q7RA 3ENVA 5JRZA 3VR1A 4IOJA 1H9BA 4JJ4A 2O8BA 2JGEA 1R1DA 1Z4JA 3TIGA 2X40A 1YITV 2WC1A 1P4SA 1QDUA 4ENUA 2EGUA 1B73A 1RI3A 3OEEA 1T8SA 4EKDA 2X13A 2W58A 3WKAA 5DBGA 5CTAA 1P9RA 4OU4A 4UUOA 4ZA2A 4WZ6A 1VQ6V 4JB8A 1XMQO 1GG9A 1ZSNA 4DA0A 2W4IA 4PAQA 1J09A 1SXJA 3C6QA 2F64A 1O7JA 5FQOA 5I9MA 5JMOA 3IYLW 4R8MA 3U4IA 3WQRA 4L9SA 3LSTA 1NQ5A 4F3NA 3ITNA 1DLIA 3MQ4A 2QJFA 2ZVPX 4C5CA 3N2EA 5EI5A 4BQRA 4JUCA 2OG1A 4OK5A 4XJVA 4DY4A 1R5BA 3ODGA 1QP7A 1O8BA 1PN3A 4AUEA 4JGSA 2GDZA 3M6IA 5J4VA 1JDBB 4S24A 5ICEA 1QBKC 3UMMA 5AKJA 2XCUA 3OIDA 4RPKA 4HLCA 4CLDA 5D5HA 3MJVA 2ZXWB 3RVOA 1PDVA 1PJ4A 3MCTA 1RRKA 1M6WA 1EXDA 1XRJA 2QTAA 4FLEA 2CE4A 3AHEA 1VHDA 1FD9A 4E08A 4AZTA 1RXCA 4Q1AA 3VR3D 3ZWQA 2BDUA 3SJUA 1OXTA 1V1RB 3S8EA 3F1KA 2BFFB 1Y3FE 4D8WA 5LCXA 1KAQA 3IVGA 3FBGA 2N47A 4ZJPA 1EINA 1QF7A 3U26A 3AM3A 1VXRA 4D42A 2IW3A 4U7DA 1LPMA 1PD3A 2Z2ZA 2IYEA 4KJXA 3ANYB 4NFHA 4IIHA 5DFAA 1XZCA 8ABPA 3MWDA 3I34X 3C1UA 2OIEA 4MVCA 4M1TA 3AONB 3S0JA 2PUDA 1G63A 3B78A 4EA6A 1E5LA 1THZA 3UTDA 5DNEA 4BE9A 3HA3A 1LI5A 1BN7A 2PL5A 1UBKS 1DT5A 4Q3EA 1N0UA 3KQNA 3AFNA 1PSWA 2YL2A 4MAMA 3FE2A 4FIZA 4K8RB 1FDRA 3F6BX 3IBYA 2YHUA 2EULA 2DC1A 2DBZA 2XYPA 3MD0A 3Q40A 4GR9A 1A5AB 4RYDA 4Y2SA 1RMTA 2P8JA 1X80B 3ZY4A 1C30A 1KS2A 2VATA 4TXJA 5CT9A 3SDLA 4FLTA 1L4KA 3U5ZB 1MOSA 4J80A 3IS3A 2P9QA 3V4VB 2VG8A 3AR5A 4C4YA 3PFFA 3ZLUA 1KI6A 1BDBA 4BV9A 4QYIA 1N1DA 5DNDA 4PLVA 4ZJYA 4QRHA 2PUJA 4P0TA 1RJ9B 5TARA 4RQEA 3BD7A 1UZNA 1TYDE 1JN0A 1XDCA 5KQLA 5CPFA 2E89A 3SKXA 3TW6A 4Q82A 4B76A 3P4YA 5JH7F 2M1XA 4URWR 3TBFA 4LOKA 2ZSAA 3ZBTA 3RYIA 4FBGA 3VR0A 4IDOA 2IDKA 4LRYA 1RNLA 4YWHA 3BXEA 3CUKA 1YZLA 1AR5A 1U5CA 3BRCA 2OTLV 1J95A 1GL7A 3PIDA 4G36A 2QV0A 2FK8A 4ABMA 1VBNA 1VPLA 4NLLA 1J00A 5HF6A 3LLVA 4N0EA 3HM9A 2HGSA 5KHGA 1I2DA 3Q87B 4HEA1 2AFVA 3WLAA 1FXUA 2QSJA 1KC1A 2PLRA 3KTAA 3L7AA 3R44A 3I55V 5DX1A 2PQ6A 3SXJA 4O5AA 2WIBA 3PCXA 5F73A 2QTBA 4YLYA 1VCHA 3FKSG 2ZIWB 4RQFA 3QO7A 3PDCA 1JDUA 1U63A 4RXTA 3OKFA 3OF3A 3AK2A 4GL4A 3MTEA 1Y1QA 2X19A 5ES3A 3BTSA 3IP3A 1VL0A 4JYCA 2I6XA 4N4AA 2Z8XA 3O8NA 2YJTD 4G9GA 5C53B 3L0PA 1EMDA 1GZUA 4EJ2A 1L2TA 5DHSA 4MVJM 3UUWA 3U44A 3DFFA 1FJ2A 2FNAA 4ZRMA 3E22A 2X5OA 4AKIA 2WPDD 3FVWA 4AIRA 4FCWA 1YE5A 3LLCA 2XWJI 1UMBA 3VSAA 3DULA 1ANKA 4M1SA 1YXMA 3ZWDA 4EW3A 2Z2YA 1PDWA 2JANA 2B20A 3OE7G 4ZVQA 1JFLA 2WR8A 4GC5A 4MULA 2DBQA 2AF3C 3M6FA 5J9FA 3Q3IA 1E4EA 3H1PA 4H15A 4YMTA 3MPUA 2PSFA 2C7VA 2QE6A 1J25A 2XKBA 1CZNA 1E3LA 3ETCA 4Q19A 2I7XA 3RHSA 3ASZA 1DO8A 2NTJA 621PA 3BAZA 3MW8A 4RZUA 2WHQA 3WJ1A 1MU0A 1JZQA 5CA1A 4DR7O 1GPDG 1LQ2A 2H00A 1YRQA 2FFJA 4YMHA 4HVLA 1TAHA 4F1JA 3DQQA 3P2JA 1J7KA 2JAQA 4MICA 5AXBA 5F5NA 1JAYA 1XZEA 2BHLA 4CJXA 1PNKA 2GEDA 2WJAA 1IEWA 4C06A 2FTKE 3DPUA 2DG2A 2ZTHA 4IG4A 1OTHA 2F3PA 4MPPA 1LBEA 4KO8A 3EZYA 1ODJA 3MT0A 5TNXA 2H11A 4KN5A 3U13A 1YVUA 2DPXA 1CULC 1A8UA 4JR0A 3SF0A 3WFJA 4BLWA 1DTWA 3TOVA 4GX0A 1LNQA 1I2CA 2P2DA 3IDSA 4LHSA 2VYND 2QPLA 2F3RA 4P5DA 1SESA 5KVVA 4WCEV 2EX1A 3RE1A 3AEQA 3HI4A 4UU8A 3K9LA 5K0BA 4CG2A 4RVFA 4AW9A 3V7NA 1QHYA 2P1ZA 2HADA 5GOTA 5JSZB 3FUXA 5IBRA 2GS9A 1VI2A 3IUQA 2ZSUA 3EDMA 2OB2A 4YQZA 2XMRA 4NEGA 3TECE 1XQXA 2WWXA 2QGFA 3VNSA 4B6RA 1W2WB 2AWOA 1HMYA 3ZDAA 2W6JA 4GP7A 4CL8A 3QEBZ 4E5PA 3VPAA 4NMWA 4EYSA 2VRNA 4AXXA 3V3KA 2UUOA 1GPMA 3O75A 2OWDA 4JX8A 5DHUA 3WB9A 4OYRA 4IYHA 1C3VA 3LLMA 5F7OA 4DC1A 3B1ZA 3SM9A 1RM5A 3G1TA 1DJPA 3D0QA 3SJ7A 1C9YA 5KAIZ 3C90A 4MLCA 2FOLA 3QW4B 4V24A 4FDLA 1BCSA 2UZ1B 1MG5A 5KTOA 1NZ6A 3B2QA 1CIVA 2Y93A 2GXUA 2XNCA 4TKVA 1TAEA 1NLMA 4FFSA 4B45A 1DELA 2GBLA 2B69A 1TF2A 3BG5A 1KEUA 2L18A 1U1GA 2IA5A 4ZOLA 4RCYA 3MT7A 4MVRA 5H4HA 3WYFA 1BJRE 2VOJA 1DC6A 2HBRA 1V95A 3L6CA 1F3OA 4F7DA 2AQ8A 3OZ7A 2GB4A 4OUDA 4X8AA 3RSQA 3U7QB 1OD6A 4N7JA 1Y4ZA 2OKGA 1GO3F 1P39A 3R7WB 1MJHA 2W2KA 4HNVA 3ML0A 1H5UA 3HN7A 2EJTA 1NYTA 3PGKA 5FB3A 4DA6A 3DDCA 3E5RA 4MS1B 2W9XA 2DWOA 3TJZA 5AJYA 4MITA 5TISZ 4XCVA 3PEWA 4DV5O 1U8TA 3OURA 3W6PA 1CU1A 2HA6A 4LX0A 2QZ9A 5JAQA 5JYEA 2BGIA 5NLLA 5F1PA 3MDSA 3AKZA 3VBEA 5LWQA 3VKGA 2RD2A 5LLSA 4BJHB 1QV7A 1Q90D 3E82A 2J7PD 2VHQA 2Y0DA 4D9CA 1E7YA 3HLKA 1HDZA 2I3AA 1YBMA 4I1OA 3ABTA 1EFRD 2GEFA 2I1QA 5IXSA 4W1PA 3SAJA 1NBAA 4ARZA 1X6VA 1OB5A 4IM7A 3OTIA 2MR5A 2BI7A 3F1LA 3MC1A 1QE5A 1EGVB 1N2IA 1MJGM 3QYAA 1WXEA 1BD3A 2EEZA 2OQVA 4I5FA 5A2QA 1DEHA 2WTNA 1ZK2A 1SETA 1MA3A 5K2MA 1R4NB 2QBYB 5AM0A 3DZHA 2C88A 4WCVA 5KPDA 3RVSA 4WL0A 5AI0A 3RYIB 1JA9A 3OQHA 3MWEA 1ZJ4A 2X1MA 3OZFA 3AKEA 4EKEA 2YFYA 1G66A 3RU2A 4YUZA 4RV9A 5K99A 1M34A 2HPHA 3SF8B 1CQJA 3RC2A 1U8FO 2B35A 1USWA 1GU7A 5EIOA 3K2QA 1WUTA 4LE2A 3PUWA 1T29A 1Q44A 2Q5CA 3OCZA 3VR4A 3OCWA 4EKIA 3RYHA 5CT8A 1C1XA 5KNLA 4AWBA 4JEMA 3WGVA 1OX5A 4NU5A 3LX5A 1T5HX 4FFNA 4YBZA 1QO9A 4MDEA 1KXZA 1RHMA 1GFIA 2FN7A 3IT1A 4QELA 1P7VA 4RY0A 2XZLA 3L70H 2PMDA 2W6CX 1EYZA 3C3MA 3GEDA 4NZZA 4A10A 4LS3A 3C8ZA 4BCCA 3AF3A 3E3NA 1BWPA 5DI3A 1IN6A 3EXHC 4LFCO 2I2CA 3RK4A 3TZQA 2OP1A 2QTNA 1Z0JA 4V0OA 2C97A 4H1WA 1TTTA 1E5TA 2VQDA 1JHYA 3KIPA 2PD6A 4ZDWA 2CVPA 4LTMA 1BIFA 1IPHA 3MBOA 5ALYA 4CF3A 3IUEA 1OCOB 5CM9C 4OXXA 5CFNA 1YTFD 4KR0A 3RVZA 3QM1A 5JNSA 2E75B 1VKNA 2A3NA 3OEYA 1QRDA 3RTEA 4QHSA 4QIWF 2WLKA 1U5BA 3B82A 3J80N 5I7OA 1N9KA 3RW9A 4HDMB 1AGRA 2R7AA 4BO7A 2QQ0A 3E3AA 3IB3A 2H5EA 4G0MA 3I5XA 3IUJA 4IOLA 2I6UA 5H83A 3EFHA 4JI1O 4TQGA 3HB4X 4B9AA 4PQRA 5JY1A 2GZDA 2XPCA 3H9UA 1NTOA 1II9A 1K75A 4F12A 4JYZA 1E4EB 1GVNB 3G8CA 3T7EA 4HAVA 1UK7A 3GXBA 1RPOA 2DR2A 1M0TA 1P3Y1 3ZDCA 1YE3A 4CKZA 3AHHA 3OTOO 1KJWA 4MWZA 2NSLA 1TEZA 2CVZA 3CPHA 3KNZA 5CA1B 2HJ9A 1EK6A 1QH8A 4DJTA 2QMEA 2X5NA 3F6PA 5CHEA 1FYVA 4IIJF 4BQQA 1IOWA 3FNHA 3BWCA 4A6EA 2Q7EA 1M75A 2WSBA 1TPYA 4XLLA 4OLFA 5EXXA 4EW6A 1FRNA 2RAVA 1JBQA 3UXHA 3OFVA 4K0KO 1V7PC 3WGIA 3HACA 4RKEA 3H1IH 5A1JA 2ZCJA 1NLUA 1XD2A 1YS2X 1PGJA 5B2ZA 3TTWA 1KJIA 4EECA 3CY6A 2ODPA 2EIJB 3U3JA 1DZ3A 5F12A 3CMCO 4N8EA 2GESA 1JU4A 3NDPA 3LZ6A 3AEQB 4ZI3A 1QCDA 1E61A 3K70C 1RC8A 1K5HA 1RC1A 4FOPA 4MS2A 3CR7A 2YI8A 4JN6B 1B8UA 5A9GA 3T0IA 3UZUA 5E0OA 4E70A 3BILA 4PIMA 3ASNC 1P2TA 2H1RA 3BH7A 3LWZA 4I1RA 1WTCA 1Z0AA 4KOEC 4OD0A 5JLJA 2IGBA 1V0JA 3DLTA 4BO0A 2HFJA 3T4EA 3NWOA 5KOHB 1B23P 4MPRA 1THMA 3Q4HB 1C3OB 4JT8A 5JSFA 2WF6A 1PD1A 4FZ5A 2QMQA 4I4TB 1NBHA 2IIPA 1K34A 2W6ZA 5HA5A 4GRDA 4TTRA 1E3DA 2IGTA 2O14A 1SKQA 2IUUA 1GN6A 1WEKA 3LDEA 2VWJA 4QOSA 4JASA 3CUUA 2COEA 3HPLC 1Y7HA 1C3JA 3SZ3A 3D7KA 4NNJA 3PEUA 3QNMA 3SQXA 4OMUA 3ZIAA 4L4SA 4TWKA 4B3MO 1HT2E 2ZBQA 4TQFA 2WVAA 4OUDB 3WBKA 3FSJX 1M54A 3RS4A 3HZRA 2Q49A 4XXHA 5K1XA 1EK5A 1MQAA 2BLLA 4CM1A 4BY9E 4PX5A 3H16A 5FNZA 3I1IA 3DV2A 3R9IA 4M83A 1BKYA 5E6SB 2N0SA 4YRLA 1M3SA 2X6TA 3SIWA 3K4QA 2J6HA 1TMKA 1XDWA 1NFRA 4JB3A 3FKJA 5JS6A 1GUDA 1X1DA 5FUQA 3PFCA 3V1UA 4E2WA 1AY0A 3C39A 2FR0A 4A2PA 3AR3A 1GZHB 3H9EO 1TLLA 3KJIA 3V9PA 2YX1A 2DUMA 2JH8A 2WIDA 5I45A 2DT8A 3T7DA 4DK0A 3KQLA 3F49S 2XCQA 2CJWA 3LX4A 5TPZA 2XMZA 2AUNA 1BXRB 1YDMA 3PF8A 3VKWA 3LDHA 2QUHA 1WIWA 1VGVA 2PRSA 1L8LA 5SV2A 1LC0A 5KTKA 3KLMX 4ARZB 5ESXA 4HNQA 2P2NA 2WIJA 1ZH8A 4JJKA 2B2NA 3GJSA 5KWVA 3T9AA 4U3JA 5JHGB 1GRVA 2ZRBA 4RAQA 1EDOA 3M99B 4M1MA 1BHO1 1R8JA 4K87A 2R7MA 1SUEA 2J3IA 3QXCA 1ZXXA 3SJCC 3EISA 4KBGA 3MGCA 1QU7A 3D8TA 5I7UA 1YFKA 3G6KA 4WBNB 3GP5A 5FEMA 3X3HA 2ZDHA 1GILA 4FGSA 1NJ8A 2VDRB 2HSDA 1B15A 4X3CA 3K3WA 4HLDA 2XMQA 4UMFA 4AT1A 1U8UA 5B4UA 3F6CA 4WFBV 1QHNA 3B6KA 5CEJA 3NT5A 2QWPB 1D0SA 1VGRA 3JVIA 5K2OA 3OI7A 2C3PA 1KYXA 5BURA 2XBLA 2QYSA 4NKRA 4N21A 3CURA 2P9ZA 1YNOA 3RYHB 4BNNA 4BMYA 1UK8A 4EVQA 1LVGA 5TR9A 4MK4A 4NEQA 2DR3A 2JG3A 3EVFA 1DIBA 1G6HA 5JAZA 1WN7A 5BN5B 5GIOE 2ZNJA 4IXNA 4H9GA 2OM6A 2RCNA 5DI3B 1TQ6A 1PG5A 4IXWA 3T34A 4CZ2A 2CL0X 1VPWA 2R25B 2NSJA 2AC7A 3RIGA 2GN9A 3UYLA 1U8XX 3LQYA 1GAQA 4ZYYA 4EDHA 1R7RA 9LDTA 3REFA 3I12A 1EZZA 3PXCX 3NEPX 3ST7A 3V8RA 2ASEA 3QPDA 2ZWIA 1FQJA 4ZYZA 2BFMA 2VJQA 3EIUA 2CFIA 3U3XA 4YJHB 1KH1A 5HFAA 3TMAA 3VQYA 3GNQA 3QY0A 3G80A 1JLLB 1Y5NA 1MMFB 2RGEA 2WAMA 4XZ3A 1I2MA 3IX7A 2XE6A 3C7TA 1XTJA 1Z6PA 1OFTA 3NHPA 2BFPA 1KUQA 4LBVA 4A0SA 2Q0QA 2O1WA 1VARA 2GEUA 5A5FA 1UF9A 9GPBA 3GCDA 2B92A 5KQSA 4J9YB 1OAAA 2KB1A 5CM8B 4N8DA 1Y3BE 3PV0A 2AC4A 5A4DA 1I4DD 5M3BA 2X4LA 4MWEA 4QYXA 2ROQA 1VKOA 2EBUA 1E69A 3H2JA 3WYNA 4D0NA 3TAHA 1M8FA 4MVZA 1QH8B 5B1AB 1WB5A 3GRAA 1FP4B 2H4ZA 1Y9JA 4OTZA 2VJMA 3W3ZB 5JS7A 2IVFA 2XDQB 2ZI3A 2IEIA 1XVAA 5JEEA 5IM4F 1XAGA 4JAVA 4U9IS 1N0HA 2F2TA 3E2PA 4ZWNA 1IXRC 3X44A 4LP8A 2FW1A 3IAS6 1RWOA 1NVEA 4U7GA 2W2PA 3HHEA 4AMBA 1Y33E 2CVHA 2JGDA 1R6TA 5BN3B 5JCOC 3LKDA 3U31A 1FNCA 2YVLA 2Q3MA 3ZK9A 1E9AA 4GVXA 3VGJA 4AG6A 1UP4A 4JIGA 4U2EA 2VRBA 4IXTA 1XLTC 3N6RA 2JJYA 2VDPB 3OUZA 2J4DA 1NKSA 4UASA 2Q2WA 1CEXA 3A3OA 2WIFA 4G8BA 1Q6ZA 2WZDA 4FNMA 1TIPA 3LYUA 1N7GA 2GHTA 4BNJA 3TXXA 4DLTA 3NNSA 4QG7A 2R2GA 1LPOA 2OXIA 1EBUA 3BF7A 1UZLA 2BGKA 2KBFA 4XD7A 4BP3A 1FLAA 1GYPA 4CL2A 3ETGA 3G9TA 3G68A 5EKUA 2GSWA 2GYYA 1VE9A 4QUJA 2CL6X 2OHJA 3LM8A 2DY1A 4EGSA 2TRSB 3BUSA 3LSQA 1C0IA 3K04A 4FYIA 1EP3B 2GEJA 3WGHA 1EESA 4HC4A 4OKIA 3PFWO 1RRFA 1EFHA 1R6DA 3M70A 3MMNA 1ADGA 5J40A 4JI0B 3U7GA 1CY1A 1SCQA 1WABA 2Q7XA 2HU8A 3NLLA 2XIJA 3F5SA 4PLZA 4WLFA 1V96A 3Q0IA 1Z16A 3PEVA 4FJ2A 4W7SA 4MX8A 1ZW1A 2J8ZA 4IH1A 3R7FA 4H7FA 4CMEA 4PNPA 4AZ3B 2EFDB 4F6CA 5JAUA 1TX4B 3T52A 1AP6A 2HJRA 1BU8A 2LBPA 1FTYA 2JGKA 2QPTA 4GE0A 2D5CA 4N0MA 2LKDA 3E8GA 3UFBA 4LWSB 4QDTA 4RLHA 2P1RA 4KQ2A 3SQMA 1R16A 1SA0B 4RYLA 4TLCA 2JGAA 3K70D 5CB0A 1U9JA 4BRZA 3U4HA 2E4VA 1J8FA 4PELA 3KFLA 2Y2VA 1H2ZA 4L27A 1U9IC 3ABKB 1C0LA 4A82A 2JASA 3ZCRA 3DZJA 4X65B 1WCWA 4PY2A 1M7GA 3BEDA 2CJWB 2IV2X 4FR5A 1EGAA 4JTCB 5FBWB 3BORA 4R41A 1QGYA 5H0IA 1QH9A 4MTXA 1WDWB 5EHQA 3ABMC 4OP2A 3U0BA 1WG8A 1R6VA 5K7SA 4EGJA 3LCUA 1AR1B 1NN0A 5ALVA 1V8FA 4U3JB 4DREA 4LDAA 2AMVA 1ZBQA 4J1TC 2F48A 3WMWA 1XJQA 1Z4IA 3DEFA 2B5WA 5DX0A 1TCVA 1BMFA 4UCWA 3G6WA 3QI2A 3HN2A 3WWOA 4OOFA 4QT0A 4YFVA 2HA7A 2VPTA 2HUNA 4PZUA 5JPIA 1WB4A 3SBXA 3I6YA 1QV6A 2Y2UA 3LPMA 4PPNA 2R6CA 2RARA 2AZMA 1E9DA 1V8DA 4E7PA 3QJGA 1QSGA 2BF4A 3EXHB 4MPDA 3WNQA 5BV2P 5F9HA 3RANA 4BGDA 1FNNA 2J3KA 2C77A 1NVVQ 2GAAA 3STVA 2QRNA 4AM8A 5HCIA 3THXA 3ZS8C 1Z33A 4DWVA 1ZJWA 1BXKA 1QIIA 5KJCA 4OQEA 1DXYA 5DKFA 3D7RA 5CDFA 3H7AA 2IH3C 3AXTA 1BS9A 4LTDA 4JOQA 4HBNA 5HK8A 5GZ1A 3E9QA 3WL4A 3G1WA 5EJ4A 1VBFA 1Z4OA 5CFMA 3APQA 4MDYA 3D6TB 5JBIA 4FKBA 5B53A 4DZRA 3KB6A 3HZHA 5D84A 4DDHA 4QXQA 4PEVA 5F1KA 3Q9UA 4I3GA 1U8EA 1QHXA 1PQPA 3OMLA 3AXSA 4FLUA 3IXQA 5B3AA 3BVPA 4X1YA 1G17A 4ES6A 3LUHA 2E4UA 4HYEA 5HJ2A 1WLSA 4RH3A 1HFKA 2HJGA 1K98A 2P9YA 4G4SP 1B74A 1M5IA 2WKRA 1N2CB 1GUFA 1W30A 4IH9A 2C3MA 2F4NA 3I30X 3NKVA 3L9WA 2NO9A 2DWEC 3CRVA 3N05A 1J39A 4RMJA 3HCNA 1OH7A 1N8SA 4P54A 5H3CA 1PT7A 1RI1A 2IIBA 3PTZA 5FLXA 1MA1A 2HI0A 3GVHA 4V0RA 3DE4X 8AT1A 4R2IA 3WGYA 2Q0OC 4LMAA 1MX5A 2AUTA 2ZZKA 3EDOA 2QI9C 4ZZ1A 1QPZA 4WTOA 4GBED 1NW8A 3QMVA 1DUIA 2O1SA 3GJ3A 2FWRA 3ESCA 3EDCA 4GU5A 2YV4A 4UDOA 2ZBUA 5IXYA 3TWOA 3AYXB 2BKLA 5CLLA 4D6YA 3TLYA 4UFOA 1I7FA 2CTQA 4P3PA 5HP4A 1YJNV 1DADA 2VPYA 2WE7A 2PT5A 3EMVA 1WDLA 4JA2A 5ALKA 3OU2A 3K9AA 2FVYA 1CUCA 2R8YA 5B7GA 2CDCA 5KHAA 2E6KA 2GNPA 4UZSA 1IN7A 4GUAA 4NF2A 1F23A 2CLMB 3S1LA 1Z6AA 4IOKA 1H2XA 1Z6ZA 1V1RA 3PDHA 3LYAA 2BSAA 1M2KA 3KQKA 4EG7A 2FEMA 1P4GA 2AB0A 4P3OA 3ZVRA 4YLGA 3CVYA 3GLIA 2OHXA 1AUOA 4KXLA 2RHRA 2IY9A 1Q1GA 2C29D 1A4UA 1M1YB 2IITA 2FPMA 2PLFA 2P77A 2I22A 3AQ4A 4IZ6A 2P90A 4DCUA 2OHOA 1PRYA 4I19A 4XEUA 2XX3A 1HYGA 4OHMA 4FZ1A 4K8ZA 5DXJA 2HREA 4W1QA 3PC8A 3ZDQA 1OI3A 4I5EA 2B37A 3EGIA 3ORHA 2QZSA 1YQDA 2J9FB 3NONA 1Q7YW 2AD5A 3H9VA 1N0JA 4BNXA 1M2WA 1VA5A 3AR7A 1DC5A 1BROA 1UC9A 3JQQA 5CLJA 3B8EA 3U0VA 1QOZA 2PUTA 3BSWA 2QW0X 4HFNA 4CS4A 3NNNA 5DF1A 2ZBFA 3DYIA 1X80A 4PTZA 1CQWA 3DVAA 2G71A 3JD3A 3KFVA 1STOA 3FMIA 5CG2A 1LKZA 1QTRA 1IIRA 1RI4A 4P86A 2G5TA 3A27A 5JJIA 2F1KA 4EA7A 3BKXA 3CUSA 2XUJA 3KJXA 3R6DA 4QBFA 3B48A 5WRFA 1QM5A 4ZCRA 5D3MB 3OG9A 4BNVA 3TAUA 4PO1A 1M8PA 1V43A 2DFNA 3N2LA 3T5GA 4KQ6A 5A4KA 1XZJA 2JBWA 3NTRA 4LY6A 4DLSA 2QQFA 1XF9A 4Z0NA 4RV5A 3ZQUA 4QYMA 1BWSA 4XM0A 2BKAA 3AF6A 2X3YA 2BPOA 4FHFA 3GW8A 2PM8A 5A0VA 1VQ4V 3P30A 3RVPA 2G9UA 3K1JA 4K9PA 2P65A 3O83A 4LY3A 2GCEA 4PQFA 1DDOA 5AVSA 3FTQA 4EFNA 1KC8W 3PK0A 4HP8A 1KSHA 1Z29A 5F3RA 2O3TA 1Y4UA 5IKOA 5LZ2A 4P36A 3J81N 2D1FA 3KOUA 3CEJA 1XXHB 2G3YA 5AW5A 1L1QA 2YY5A 1Z83A 1LLQA 4LZPA 2C4WA 2B94A 2C2BA 2IYRA 1KR5A 4LXHA 3DFZA 2FETA 4FCCA 1E3TA 2IQ5A 4FMCF 4F2PA 1P3DA 3I5DA 3Q2KA 4K9SA 4MTFA 4DIKA 4ECEA 4UUNA 4PICA 2B83A 1R4ZA 5K1ZA 4CKWB 2FMXA 4BGVA 1YIOA 1KPGA 3CFYA 5EZYF 3TDMA 3ICOA 1TGVA 3HJHA 4BYMA 1I01A 4UNNA 5T4HA 1IJFA 2X86A 4C6RA 5A6VA 1V7CA 1T5EA 3VAZA 4PW0A 1RRVA 4LSGA 3O3OB 5CH5A 1DRJA 4YC7A 2X6RA 1H6DA 1FAFA 2CCKA 2Y9PB 3HFSA 1L4EA 3R5TA 1G8KA 1EWQA 3S7TA 2HG5C 1HT0A 4RESA 1CTQA 4ITVA 2X76A 1KBHA 1W6UA 2O8VA 4TSRA 3DL7A 1K0UA 5B3SB 4RM2A 3BYZA 1ZNZA 4H7DA 1JPXA 1YZHA 3GL9A 4PYRA 3L92A 4WNAB 5C3MA 2LW7A 3VA7A 1G16A 4URHA 4NH0A 1Y9AA 5KNCH 1COZA 2Q45A 2BIFA 1YQTA 4MLZA 4TXHA 3SJZA 4RBNA 5KEIA 1DAGA 1E2UA 1EU1A 1WUYA 3HZOA 3BGVA 3L0IB 4DV3O 3CSUA 4BEWA 1YS4A 3RVRA 1F4NA 2VQEO 1MLDA 1MNAA 4GR4A 4C7VA 5GONB 1GTOA 2FPUA 1D5CA 5BQXA 1WVIA 2V3CC 1B3BA 4MUHA 2IU6A 3BMOB 1L1RA 3PHGA 4CIBA 4KNYA 4MAFA 3RKRA 4G0XA 2PFSA 4BAGA 4NE2A 4DCGA 3HO6A 2R8BA 3DAPA 2ZLBA 3THYA 3KZ1E 1FP6A 3KWMA 1SZXA 3O73A 4BNFA 1Q14A 3SG0A 4RIIA 4Y2HA 3SDSA 1YZVA 4MVUA 2WU3A 4F3KA 1Z0FA 2BBTA 3VHQA 5JCZA 1KYOF 1VQOV 3KUXA 1XAIA 2Q2NA 3NRCA 2QB5A 4JQYA 4OX9O 2P6UA 3HWX1 1FUKA 1UKBA 2E82A 1ZHOA 2FPGB 4AZ0B 4BE4A 2RH8A 3KKKA 1A32A 1NUQA 4E5YA 4IQ4A 1HR0O 4TYYA 4MWDA 5JSZA 1NSTA 3G49A 4JTDB 5ITSA 4JVOA 4TX1A 2BN4A 1CQZA 2QM8A 3NAQA 2BLNA 2XBMA 4ZVSA 2XZTA 5BNIA 3LIIA 4M49A 4TGLA 1T4CB 5F2VO 1KZ1A 1O4WA 3AVQA 3MHTA 5IDYA 2ZPUA 3UK0A 4B3BA 1M2NA 1DEKA 3HP4A 5DYNA 3RRJA 4YHHB 1Z7GA 1W93A 2RGCA 4YBRA 1FMTA 4PAGA 4M8LA 3ESRA 3EGVA 4QRDA 3DV9A 1HSZA 2QAJA 1E5DA 4IKEA 2UZ1A 2VJPA 3BD8A 2I4RA 5EIEA 1K5QA 4LWQA 3GLIB 4OYLA 2V7QD 1A72A 3RUEA 4N1AA 1U8YA 2BGNA 1A95A 3KKPA 1KHHA 4LJKA 1B8VA 2HDOA 4E5DA 3I09A 2O8FA 1N7HA 3VKVA 1GM9A 2EP8A 5E4YA 1JQJC 3U7QA 3L07A 3KZKA 5DNVA 3UUFA 2YJ4A 2CHGA 4ZAWA 1TF7A 3ZX4A 4H7HA 3R7WA 4EG0A 3LT4A 4K28A 2H4JA 5F3DA 3EWSA 2F4VO 2I3GA 1UQTA 1NF2A 5BMOA 1KYYA 1BQ3A 3L9XA 2ZYTX 5JJBA 2ATXA 5BSTA 3BB4A 4MS1A 5C4MA 2QTWB 2PO5A 5IZ4A 2GUZB 1YGPA 4UBIA 4KQ1A 3BIFA 5CA3A 1A76A 1GZSA 1DKQA 3JTEA 3H8JA 1F7UA 1E9VA 3GLQA 4A5UB 2Q8VA 3DVAB 2HQRA 4OQDA 2RKBA 2C2ZA 2QEQA 2LW1A 4OL9A 1GNRA 2CGOA 3WJ7A 4REOA 1TIKA 3VR6D 4DV2B 4ED9A 4M0CA 3KE9A 1KKMA 1IIBA 2WWTA 4URXR 3FVTA 1NH2D 5HIIA 3DKVA 2JBHA 5F7ZA 1XQYA 1UBTS 2XDWA 4REQB 1NJGA 1YF2A 3ABMB 5FOQA 5FJIA 1UP6A 1G7TA 1IDN1 1NZFA 16PKA 4R2HA 2PGJA 3QKRA 2XHEA 2YJ6A 4XYBA 4QHYA 1R4NA 2QBYA 2BMJA 3JW8A 5A4IS 5IANA 4JI7O 1I94O 3DWEX 4JLSA 4BLPA 2PMFA 1U04A 2AJBA 1OT5A 3NH9A 1H6AA 4J0EA 1NVGA 4KZPA 5KYXA 4H4DA 4GXQA 2HMWA 1ZIPA 4O4HF 3RARA 3WMRA 3GDHA 5CVEA 1IHXA 1KRXA 2PRJA 1E79D 3SEFA 4B6FA 3P45A 1ULAA 3IPAA 3SF8A 3TMYA 1NQTA 1S9HA 3NO4A 3OGCC 2MYNA 5FIUA 3CVXA 3E1SA 5E1OA 1K3EA 1Z2NX 2PLWA 1K2WA 2O1XA 5CEEA 3GRPA 1ADBA 4NABA 1ZVVA 2PVCA 8GPBA 4HG2A 2C4UA 2VPZA 4NYKA 4FDAA 3RJMA 3LVRE 3JYOA 4L07A 1P29A 1KGSA 3ESBA 2GN4A 1VPEA 5ED0A 1QIHA 3N76A 3PPWA 4ZMRA 3EXG1 3KPVA 3ON5A 3JCUZ 2JLSA 1GM7A 3OFND 3SJQC 5IABA 1RXIA 5JLAA 3RTBA 2HRBA 3GWOA 1XR3A 4DF3A 3DOEA 4G8DA 5AJZA 4JI8O 1ZSPA 4INAA 4A8PA 4I1SA 5T41A 4H1HA 1EZ4A 3GFPA 3HXKA 3UHPA 4B3IA 4WW0A 1VJTA 1G3QA 1QVVA 4RTPA 3PWZA 1MXHA 2X5JO 1A7JA 4YRNA 5DGXA 2Q7GA 4MQLA 1RJEA 3K1TA 4LXGA 3H1EA 3RRBA 3ULKA 1GZ3A 4X5OA 4WESA 3QGMA 2ZUUA 1PS0A 1ZDMA 3OZUA 1H65A 1NU6A 1T4MA 4HDMA 4C7JA 2C9OA 3CRQA 1VMDA 3KTOA 4UCVA 5KI6A 3ZNPA 1L5MA 3FD9A 2WD9A 2AZTA 1DMSA 3KEGA 5ES4B 4Q03A 3QU5A 4HNSA 2OUIA 1JKIA 1PG2A 4HPXB 2HA2A 3VQTA 4EYOA 4QDJA 4YCJA 1DJLA 3V2UA 2QMHA 2LNDA 3T7JA 3EFFK 3WVNA 2R84A 1M2FA 2BFNA 2ZDIC 2FZ5A 1IUOA 4WZAE 1LGYA 1TLFA 1A2QA 1DJQA 1O08A 4GXTA 5AI9A 3D8BA 5DJ5A 1TGYA 2A7XA 2ZUDA 1IJBA 2CGNA 1JB9A 3HYNA 1HE8B 5CA0F 3WLKX 3C5EA 2IDMA 2V03A 3KB8A 2R9VA 1JHQA 2DERA 3F71A 2HF7A 2VTKA 4PBSA 1H2HA 2ZATA 1TEHA 4Q3CA 5J59A 3I6ZA 1AS0A 2PI4A 4M8NE 1R3LC 3KQHA 4CXMA 4F71A 4UEWA 4LA4A 4F21A 4JSYA 1E20A 2A88A 4EUEA 2HEIA 3JWEA 4KQMA 4IHQA 3THYB 4RJ2A 3ND8A 3HNOA 4XFDA 1D1QA 4RAOA 4W7IA 4YDHB 2FEPA 2TS1A 4QXOA 5JC1A 1NH2B 4UCXA 1VJ0A 2ZTVA 4PV1B 3PX3A 4KX3A 3EBPA 1K5PA 4KOAA 3QBJA 4RQUA 1EP1B 3UJCA 1K7XB 4H08A 4FINA 2AYZA 1R88A 2E74B 4NXNB 1VKRA 3PFKA 1KJ8A 3FH0A 4KN8A 1Y1PA 1MT0A 4UCSA 4H17A 1ISMA 5JQWA 3Q3EA 2DWUA 4RF4A 5BWBA 4CKCB 5EN4A 5ICMA 3ZQ4A 4PRKA 1Q0LA 3TSOA 1P1RA 2OAQ1 2J08A 4CF6A 2GH1A 4Q9AA 2ECFA 4GT1A 5KOHA 7ABPA 1J2RA 3GGSA 1YS1X 2PRYA 4J9UE 2YJZA 3JU3A 3L01A 3Q4HA 3WRYC 2RJZA 4TV9A 5G2OA 1C3OA 4ZYLA 4GPD1 4BJ6A 1L9KA 2KKWA 1BS2A 3QRWA 4GEKA 4AJ4A 1UANA 4Q9HA 4XSVA 4I4TA 1CJCA 1E1RA 3OLZA 4RVOA 1Y48E 4JIMA 3WLMA 5HKBA 1FNDA 2Y1EA 3V8PA 1ODKA 4PHGA 1LA2A 4RMNA 2VZ8A 3DM5A 4YHBA 4N48A 3OPYB 3TJRA 2IC5A 3G0CA 4FM0A 3EHBB 4EAAA 4DR5O 2O8FB 5KOIA 3GC6A 2EZ4A 3E7WA 3WGUA 2BCJQ 4MV3A 3G0OA 4NY1A 2YWGA 1QYVA 2UUAO 4GZMA 1EM6A 3RIHA 1ZC4A 4AKEA 5IRCD 4O33A 1U3DA 4CEIB 1H9CA 3QE4A 2QK4A 4GM0A 5E6SA 3GEBA 2EQBA 3DKPA 3FD8A 2ORED 5HJEA 1ADFA 3DMFA 5I51A 3FCEA 3CQ9A 3BXPA 3LQFA 1GOTA 4GQBA 5THQA 1U7PA 1T8WA 1EXVA 1WDTA 4IDGA 2HP8A 2P4UA 3U39A 4JSRA 4OFBA 3RNLA 5IT9A 3PFHA 3UV6A 3O4HA 3T06B 3O3NB 5HF9A 3PN1A 4O2AA 3O47A 1NDHA 1PU2A 1BXRA 4OEHA 4MB6A 4AKGA 4DIOA 4H4EA 4H6VA 4QGSA 2Z6QA 4B33A 4DR2O 3ZYZA 3HJNA 3K7EA 3IO5A 1NLZA 1QK4A 4CLXA 2JK5C 3AJRA 4CM4B 2QL7A 1T1EA 1IWPB 4YRCA 2Q41A 1HOTA 4GWLA 4AP5A 3QKRB 1P7GA 1JSZA 2O23A 2V0NA 4IAOA 3K03A 5B3JA 1JR3A 2EP7A 2FRXA 1MOQA 1MV5A 4JBGA 4OU5A 4P3YA 4WBNA 4YPVA 5EJ7A 3AZPA 2H0RA 4HWGA 1ZNYA 2VA8A 5KYXB 3KTDA 1UZUA 4JB0A 2G1JA 5C18A 3RROA 5JPCA 3NASA 1IURA 2B78A 5ICSA 1WBDA 2XJ4A 4RDIA 2D54A 1AXRA 5HR5A 1CRLA 2J67A 4H1TA 3DZCA 1MC1A 4MA5A 4MZXA 1UODA 3EMKA 3R40A 2PUAA 4FYYA 3ZE6A 4Q9NA 5BR4A 3GPIA 5FWDA 2HCTA 1KU9A 4LJ9A 4ZVMA 4HY3A 1AUVA 2CEAA 1NV8A 1PS9A 4W5JA 1T3GA 2O06A 3E0XA 5AM4A 1XMVA 1OJLA 3T8YA 2WQ7A 2J3DA 4B83A 1TJ3A 2XITA 1PLJA 4BWVA 3BMCA 3R5JA 1K27A 3U7HB 3CCCA 5JMWA 2WIGA 2ZUVA 2DQ3A 1GP2A 2P2YA 1H2AS 1BZYA 5FAKA 4H6WA 1KQ3A 1MRZA 5BN5A 3G0GA 2ISCA 1ZPDA 3W9BA 2YW2A 4U9UA 3EYWA 3VDRA 3PCRB 3QHPA 4WZZA 2GN6A 3D1VA 1LLFA 2FPLA 1OGYA 3G0IA 1RAHA 1W2HA 1OCRB 1KKCA 5KUTA 1VMIA 5A7HA 1A82A 1QG6A 1QTQA 3GDOA 4YJHA 4AY4A 3QKWA 4KREA 1XG5A 1US8B 2B99A 4WESB 1JLLA 1Z74A 3OHPA 3GYBA 3PGVA 3STUA 3N7TA 1IZ0A 5AKLA 2UU9B 3H7IA 3VSDA 4TL7A 3GUHA 1R73A 1JLSA 2RB4A 3IE1A 3MK31 3Q8KA 3PYLA 5LZ8A 1U2DC 5DHRA 2Q8PA 3QKTA 3RQIA 3HB7A 3ONNA 4N3NA 1JHOA 5JNUA 5FV4A 1X7GA 4PO3X 5FOTA 4KIGA 1PL4A 3IUBA 1E79G 4KE7A 4GMGA 2I8CA 4MUEA 4QJFB 3B8HA 1AKTA 1Q92A 1L7NA 1Y8QA 1Z13A 1E2PA 1YGYA 4NOJA 3D02A 1A1SA 4XRGA 2FXIA 2BM0A 1E2QA 4ER7A 1FP4A 2FSVC 1M5TA 1Y34E 3K0DA 1ZCZA 2XDQA 1FE8A 3CMAV 4XWTA 2AFIE 3FNRA 5FNVF 1TVCA 4PA6A 4U7JA 2EEPA 1CP2A 2YV2A 5A03A 4KL8S 1JVBA 3OC6A 1I3LA 3OFNG 3FUUA 1H8HD 1M74A 4DA7A 4MRNA 4YRZA 3MJ4A 4E4YA 2JD0A 1EUZA 3WKEA 3N75A 1S7CA 1JI3A 5BN3A 2Z3WA 3IO3A 3IL2A 1O95A 3K5WA 5TEWA 2IU3A 5H9WA 2FZVA 3R7DA 4CIAA 3RHTA 3G7UA 1U0BB 2QRKA 5F4BA 3RGWS 1A97A 1O0BA 4RKWA 4DV6O 2XNJA 1L4BA 2HBYA 2O7VA 3TIVA 2WIAA 2P2ZA 2HDWA 2PSDA 2B82A 2WPDG 4DFDA 2H7YA 4GL2A 4WINA 1ZGAA 1KIMA 2DGDA 5CIWA 1QUEA 3CGGA 3P96A 2ZWAA 2PLNA 1M8GA 2OAP1 4WX2B 4LF8O 1A96A 4R8CA 4K6KA 3WKDA 4Q9IA 3E81A 4TV9B 1T8YA 2D8MA 3JCZA 5EC1C 3ENWA 1SK8A 1MH9A 3NGMA 4G5HA 3CJRA 3DT6A 3RRYA 5KNDD 1EB8A 3MJHA 3LHSA 2X9QA 5G3YA 3ZHVA 1NJ5A 4XGNA 3G8AA 4BW5A 3K35A 1DE0A 5JXJA 3D3EA 2A9KA 4Y0AA 5LZ4A 1P3JA 3FCOA 3WXBA 3F7NA 1A71A 1KAEA 3I9MA 1TMYA 2WM2A 3MXTA 3RF7A 1QJ4A 2P9EA 3W77A 4KTTE 3ZLVA 3L05A 1MQ8B 1MAUA 1XJ0A 3SYRA 1Q95A 3L0OA 2EJVA 4O25A 4BX2A 2WWIA 2P41A 4AZ3A 3TQRA 1IATA 6ADHA 2VOEA 4KSBA 3QXSA 4QYTA 3CR3C 4GPZA 1U02A 1DRKA 4QGFA 4R6ZA 5B1BC 2G6BA 3TVDA 4DBLE 3TJTA 1MC5A 1S3SA 2OB1A 2B1QA 1U9CA 2OV3A 4LWSA 2ADQB 2BFBB 2QXUA 1SA0A 3BZBA 1YTFB 4E11A 1F0PA 1ELOA 3C3BA 3W5VA 2EAUA 1O96B 1U2TA 3PE4A 3S3XA 3D7SA 1U65A 3MPOA 3ZJVA 3AM1A 1QFZA 3I2GA 1Z45A 1JEAA 5C93A 5GPBA 4QODA 3DS8A 4KFRA 2P6OA 4KQHA 2H65A 2OZEA 1MX1A 2WB4A 3JWIA 2JLVA 5EKSA 1QNFA 4DHEA 5B64A 4O2AB 4ZQIA 2X0RA 4ZVKA 1IUNA 4A2QA 2O05A 1WE2A 5IYZF 1BOOA 3QUTA 4R2JA 4G2NA 1FBTA 5IDWA 3N2IA 4UJ5A 3SOZA 4BZWA 4F2HA 4TTQA 4YR9A 4Y7DA 3BJEA 5LQJA 1R8XA 4WXEA 1D04A 4YUWA 1QCEA 3II6X 1H69A 4C7BA 2EZTA 3QVTA 1LW6E 4PQYA 5FQNA 1AZTA 4MVJF 3DONA 2XWSA 1VIBA 4X1IB 8ADHA 3RAPR 2BJVA 3U0ZA 2BT4A 5DP2A 1U0NA 1ZMOA 3M6WA 4I8IA 1Z15A 5KWIA 1KQNA 3QE2A 3IAS1 5JO9A 1AF7A 3ZCSA 1JFTA 3AFMA 4FUTA 2NP7A 1U28C 2J0UB 2G0TA 3FPAA 4MW5A 3ES9A 3AI1A 3EQ9A 3EXHA 4CODB 4U2CA 1XCBA 4KACA 4BOYA 1KU6A 3I45A 3ECCA 2VJLA 4NR0A 1ZM2A 2NO1A 1PX0A 3HU2A 1Y5MA 4IL5A 3VNBA 2VTBB 1OFUX 2Q5OA 4KUGA 4RVDA 2FSSA 4RUKA 1XQ1A 3FVVA 3QTCA 2O57A 2PX3A 1KYWA 4LCUC 2P6PA 5AXDA 1YULA 4IKOA 4UV9A 2GNOA 5K6RA 3BMCB 1XTPA 3HU3A 1J33A 4K2AA 4XW2A 3UCSC 1WMAA 4AFNA 1F2DA 1JMKC 5FI3A 5IVPA 4Y2QA 1J2TA 1TT5B 2RB5A 2VT6A 1UBUS 1H8ED 1HV8A 3NDIA 2L82A 2ORIA 3CZAA 1PVVA 2L6LA 7YASA 4UBMA 3C16C 1Z6GA 5CCEA 1EEHA 3KL2A 3MA0A 3FYEB 2AZ4A 2PKCA 3OCUA 3WLHA 5I47A 1YUNA 4B7ZA 1G4YB 1OZAA 1ESZA 4BNYA 1OCCC 2J33A 3IILA 1VHJA 2OFOA 1EFRG 3ASOC 2MOKA 3U3KA 2AR7A 1YCGA 4J9VA 1PTJC 2X15A 4QFCA 2XUKA 4AJHA 1EGQA 4MV5A 4XB6B 4OQQA 4UUQA 4QFBA 1D2EA 2R44A 2YMMA 1WXHA 2NV2B 1E6WA 4Y2RA 4MQBA 4BO6A 4UHDA 1E2JA 1N2CA 2BUCA 1GZ4A 1ZOSA 1Q81W 1TUEB 1VSVA 2ZE8A 5BP7A 1H42A 4RPLA 1VGQA 3H1BA 3V80A 2ZRCA 4CM9D 4JUDX 3WL8A 5HX7A 3QU7A 5K3DA 1KEPA 2X23A 5FRDA 2ZTMA 4ZT7A 3V97A 1PV1A 2SKCA 1DC4A 1I51A 3QWHA 3CZPA 2H9YA 3CCSV 2Z8YM 3IC5A 2E5FA 1G5QA 4F8YA 5GAJA 4ZGWA 1MP0A 3CIFA 1M67A 1YR8A 4GDMA 2WM3A 1S8FA 3B6EA 1RMQA 1Z82A 1ZRHA 4X8MA 2R5NA 1Y8QB 3P26A 1Q6YA 3CXHF 1GKFA 1SPXA 1YJ9V 1VJCA 3R7LA 4INOA 1YI2V 4TN1A 2GPBA 3KDSE 2MSKA 4JUIA 1J8YF 2HXGA 1JYEA 5E7QA 4U5XA 5ESWA 1H2WA 3I04A 4XI9A 2QDKA 4YV1A 1E1MA 3UJ6A 4D7TA 4W8OA 4HDAA 5EA2A 1IVNA 1I13A 4L78A 1MNQA 3A1UA 4TRNA 1WHTA 3GJTA 3OOEA 4P3KA 2RJ3A 4G3XA 1ZZEA 1MSWD 3W34A 2FLVA 4TQAA 4LVUA 1VOTA 1Q0TA 3AF4A 3H19A 2OOSA 1NVFA 3OH8A 1Y80A 3M89A 4KLCA 1Y1KE 4Y7CA 1W85B 4IGEA 4WAUA 4JAUA 4LBWA 3P0JA 1J8MF 4II3A 1M1YA 3IBCA 3ICXA 2R7KA 3GRZA 4B32A 5KYUB 3PQ4A 2D3WA 5G0UA 2I4TA 2ID8A 2L69A 3SPIA 4HTFB 4L4RA 5E6RB 4I4NA 3OU7A 4HZGA 1U3UA 1ONNA 2P9TA 5SZJA 1U0FA 2J9FA 3OZTA 3L7CA 3L6RA 3OHSX 5BW4A 2HHAA 2A6PA 4J16C 3RD5A 3DBRB 5MDHA 5MGBA 3KQTA 2OC9A 1RLJA 5HTOA 1QR8A 2HHCA 2B3DA 1WBJB 5AK3A 4QM7A 2Z56A 4TTVA 1D2NA 4WKBA 4JI3O 3WOVA 5CX4A 4UTXA 4YP6A 1EG7A 2HAEA 1P0MA 1XTVA 4S12A 2ZZNA 3T38A 3IB6A 1QQTA 3WR5A 2ZJ8A 5HZKA 4DLZA 3GJYA 1XN4A 2IV7A 2R87A 3EG5A 3ENZA 3TIXB 4EI2A 5LJLA 1XEFA 1CUHA 5HGJA 4MJXA 4NFLA 5D3MA 4K3AA 1OI4A 1YQGA 4FSXA 4K6CA 5EE0A 2OGWA 3IHWA 4FFDA 1WW3A 3DSQA 2RGDA 3TI7A 3VHLB 3PDJA 1MT3A 2AI2A 1UKAA 1H8HG 1WEHA 3A2FA 2Q3EA 4EFKA 2ZM6B 4UEJA 5IC4A 3SMQA 3EPHA 2BJHA 2N1MA 1XTIA 4HR7A 3QKIA 3U7EB 4IINA 3SJCA 1Q1EA 1ZKDA 2ECQA 4BQPA 1H2NA 4QNNA 5T67A 1TF5A 1G0NA 3LXUX 2ZK7A 1VIDA 3LOUA 4ALLA 4JC0A 1XXHA 2IPLA 3EFOB 4M0EA 2C96A 4DSUA 2F59A 3M81A 2JS5A 3STYA 5CK4A 2IOHA 1P7WA</