2P90A

The crystal structure of a protein of unknown function from corynebacterium glutamicum atcc 13032
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
269
Chain Sequence
DRMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Cgl1923
publication title The crystal structure of a protein of unknown function from Corynebacterium glutamicum ATCC 13032
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Structural genomics, unknown function
total genus 83
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2p90A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2p90A01
1YTFB 3W7UA 1NVPB 3IC7A 3VR0A 5GW7A 2WAMA 3W7WA 5CA3A 3GAAA 2HR3A 4HAMA 3W7TA 3W7SA 2P90A 4G4SP 3W7XA 1S3JA 3BY6A 1RM1C 1NH2B 3D3IA 3E35A 3MNFA 3WZ2A
chains in the Genus database with same CATH superfamily
4B7ZA 4HY3A 1MZVA 4OAOA 1PZHA 1WTAA 2D2VA 4GWGA 1HT3A 5CX4A 1V2HE 3MWFA 1CCWA 3VJLA 3ONVA 1RKXA 2Y2UA 1KZ4A 1RHQA 1IBRA 2BEUA 3U39A 3FDIA 1E6LA 3HDYA 2ILVA 3IPCA 3EEQA 5LXTF 2FDCA 4RH0A 1PGQA 4MB0A 3QOFA 2ERCA 2NLJC 3GVCA 3SC2B 1GTMA 2Y0IA 1W0KG 3CR3C 3HYLA 4I8DA 2DQZA 3GOHA 2AQHA 3DQPA 2FTKE 1B14A 4KH1A 4V0RA 3L8DA 3S2UA 2AN9A 3SXPA 3VQVA 3KG2A 5CFOA 4IF6A 3KR9A 5D01A 3EGVA 1YVUA 2HFKA 2WSSD 3BHIA 4MW7A 3LC2O 1WP8A 1JOYA 2V7BA 2HF2A 4GUNA 1LY1A 2VFAA 2B9EA 2RIPA 4BC1A 5K45A 1SCBA 2Y6VA 4ZVNA 3EEBA 4XCXA 3TE7A 1E89A 1A5ZA 5JG7A 1AZLA 2OV2A 3LK6A 3KTOA 2VC2B 4I0XB 3TSCA 1YJBA 1M1NB 2R6AA 4EGCB 1WXIA 1E7WA 2QXTA 3V1NA 4TKVB 5KNCH 3H2BA 1N8RW 5CLIA 4X6UA 4WFKA 1SERA 3TQCA 4LZJA 5JAPA 1Z25A 3BBPA 2QGNA 3NB0A 4TTVA 1E1QD 2ZRIA 3TDKA 5AR1A 1PSZA 1A5BB 5IDWA 2UUOA 4DMUB 2MTBA 3AEXA 4J75A 3AMVA 2Q2QA 1H65A 1M66A 3JARA 2B0CA 1YF2A 2EKQA 4J0GA 3LT2A 4HWKA 4CN9A 3KTAB 3ZW9A 4PLZA 4GBJA 4FNGA 1CQIA 2BUCA 4CKEA 1DQYA 1VMIA 1OCRB 3PFIA 3ZTWA 1RLUA 3LE8A 4AKSA 1RHKA 1EFVB 3EA0A 4CU2A 4FR5A 3TZQA 2Q7OE 2VH5R 1T1IA 1UCFA 2YZGA 2VR1A 2ZBQA 4XBFA 5LMNO 1CRLA 4FFRA 3DUFA 1XLWA 2ARHA 2Z09A 1E2HA 3Q8WA 3AU8A 3F2VA 4DCJA 1ZD1A 1Y80A 5AKIA 3IKMB 4JGBA 4X88A 4DV2B 4RDHA 4J0QA 4M22A 5KNDA 5EIXA 2JFNA 4TWBA 4TYQA 1LDEA 1TM2A 3K6SA 1QFZA 3PTZA 4H31A 1H94A 1QHNA 4HEJA 3CIFA 3B13B 3ZDYB 1OH8A 1SETA 3UJ6A 5BXZA 1P7GA 4YHHO 4DG9A 3OX4A 1KVSA 2B1IA 1WZUA 3MWDB 2Z08A 5A02A 2XQKA 1U7PA 5HZHA 1J1IA 1GH6A 1FMJA 1DO8A 3L7NA 1QVVA 4BJ5A 3WTBA 2GD1O 1GZ7A 2G80A 5HQTA 1XNHA 4KPYA 3B3QA 3I39X 4FILA 2HU5A 4UHEA 2WYOA 1DX9A 4DSOA 1BCRB 4XGKA 2BFWA 1KIFA 4NYJQ 2R6JA 4DZTA 1IZ9A 2WSSG 5HOQA 2ZJ1A 3W4JA 1KQGA 3ZBTA 4DNPA 2FZLA 5CH3A 5DCUA 3NHAA 1Z26A 4PFKA 1G6UA 3AUYA 5F33A 1QO0D 5TPWA 4ENTA 4ES6A 1T2NA 1XPJA 2Q2OA 1KYVA 4WFGA 2IYNA 2B94A 3TSAA 1OX6A 3P4YA 4DQLA 4HX2A 1I3KA 5AESA 3IEUA 1TTQB 1S5HC 3IC9A 1ZSVA 5MN5A 2PFGA 1AUXA 4JI4B 3GFRA 4UBIA 3IT3A 1JU4A 6LDHA 3SSMA 3DFMA 5AVJA 3ESBA 3D36C 4KW7A 1DWUA 4BGVA 1ZJWA 1UWCA 1CWUA 2RHHA 3VZSA 3TZBA 2X5KO 1BJRE 1EVEA 4MHSA 4FZRA 1EFRD 4QNNA 1NJ8A 1B93A 1E1QG 5ITVA 4K6GA 4YQEA 1TFUA 5DN6A 2YWEA 4OQQA 3EZFA 5B64A 4BRSA 3CRCA 4YQFA 3AF2A 1D09A 1TEZA 3CURA 4UTZA 4I1VA 3NBZC 1NNUA 1VSTA 4CG3A 5BYJA 3JSAA 4OHFA 5KZMB 3DC6A 4J7JA 2ZJ2A 3GP8A 4IV5A 3C3AA 4TKMA 3FUWA 2QN1A 4HFNA 1QG2A 1G41A 3DONA 3FOAA 4Z8XA 1KKCA 1OI4A 2YHBA 2OENG 4R8MA 4IUDS 3EZXA 1SCIA 2JGFA 5LGNA 2J6CA 1DC4A 1A7KA 4LX0A 4CV2A 4OHKA 4LZWA 2G3YA 1QFYA 3BEOA 5JYBA 4KXVA 2H4JA 2C2BA 4CM6A 1S8NA 5BSTA 4QULA 4OL9A 4EWLA 4XR4A 1NTRA 3WL7A 1HDXA 3P9RA 5CFZA 4ZIBA 4IINA 3PIIA 4I4TB 2BEJA 2AQKA 3UGQA 3NETA 4RQFA 2HNKA 2F8MA 1O94A 5JD6A 2DYRB 1GCIA 5BW8A 1XQWA 1H23A 2NZXA 2RMKA 3QKTA 4AZSA 3VR6D 2FEXA 1BE8A 1OY1A 3PPWA 2G70A 1YZKA 1HQDA 2ZWOA 3KU1A 8MHTA 2A1TS 2HVKC 4GOLD 1T8UA 1XMQO 2YXDA 2HMAA 3FFTA 1IPHA 3DVAB 4QQKA 5REQA 5J4HA 2W6JA 4G0UA 4IJKA 2FA9A 3U4GA 2HV9A 3MTQA 4X6LA 4OMDA 4NYIQ 1KRHA 1EAYA 3HLYA 2PSEA 5EHXA 1VG0B 1UIRA 5DHQA 1RM1B 2I8CA 4R05A 4HXEB 1N32B 3KEGA 2HLDD 4BY9E 2DB3A 3H2HA 2HIAA 2VUIB 3HXKA 5AKZA 5ES4B 2QNRA 4G5OA 5T3UA 1K5GA 1TKBA 2FN3A 4UW9A 5I4KA 5AXAA 3DGFC 3L7IA 1Q6YA 4EL0A 4PU0A 1EDBA 1BFKA 4FFPA 3SJQC 1K2VN 5L4NA 5M04A 5T64A 2IZ7A 2GXSA 3K94A 1HXHA 2HPHA 1I5OA 5BQ5A 3S2GA 3CLUD 4JCOA 2R1TB 4QO7A 1RAAA 3IHKA 1U3VA 4RV4A 5L7TA 5ISMA 3C1UA 1BXGB 3TX2A 4UPVA 1C0KA 1Q57A 1TYAE 3SMQA 2XECA 3PKIA 1EFRG 1EK2A 1Z2AA 1XHLA 4E30A 2CHEA 4FVMA 3WYEA 3SE0A 2OYSA 4E33A 4RQTA 2DOKA 3RO7A 4UV8A 4KIJA 2FOIA 3AEUB 1ACLA 4FS3A 3EGXA 1EQ2A 3ZN2A 2PGDA 4BE4A 2AKEA 3M34A 3NWJA 1MDBA 3HDQA 1EJ2A 4U63A 1SOUA 3OI7A 4TTAA 3OT5A 2O5RA 1Y1PA 3I4LA 2IXAA 2ZM5A 3S1SA 4OGGA 1AHPA 1ZLYA 2WHXA 4D9JA 3I1IA 1LGYA 3WWYA 4QRDA 1VXOA 5TPZD 1VKOA 3ZQUA 2EJTA 4FMTA 4XX0B 5HK8A 1E6CA 2P9FA 3T9FA 3HCOA 3P3NA 5KHOC 1RQGA 1GVHA 3UJDA 1XHEA 4ITVA 1RBZA 3HV0A 5E6SA 3ZK8A 3OJXA 3PC8A 1OV4A 2CWDA 2JJ2A 1AKEA 1FVHA 3T3IA 2JVDA 1UAAA 1VMDA 2Q9CA 3EGEA 3JD1A 1NUPA 4W9MC 4ZHSA 3E0XA 2JIDA 3D43A 1V8PA 2JGUA 2NO6A 3H2ZA 3SX2A 5A4MS 3E3AA 4KO1S 3G7UA 1GNTA 5FTJA 2H57A 3I32A 4C3ZA 1N6LA 3ZNNA 4OJYA 3SG0A 1JPUA 1XF1A 3WNVA 2E2WA 3K1TA 5ALIA 4LF6O 2CK3D 3N8HA 1OBOA 2O8DA 4D43A 4G8BA 4L9RA 4R1SA 1LBTA 1QONA 5ELLA 3G8YA 3JZDA 4NCHA 1NN1A 4NFSA 1AQ6A 2DWOA 4MI9A 2OTCA 4ZK2A 1IK4A 1VLZA 4JL6A 1CDOA 1RRFA 2HLDG 1H05A 4LF5B 1IHPA 4UNPA 5ALKA 1Y74B 2ZYTX 1BA3A 3D4LA 3GRZA 4E1AA 4MKRA 4TT3A 3OGIB 3S99A 3D8SA 1E0DA 1PWEA 1OCZC 4DYHA 1RI1A 2C59A 4C7OB 3WNBA 2Y1GA 4X60A 3P0RA 3DDCA 3GMIA 4AK9A 1RFGE 1O5TA 4CKWB 3CLKA 1X7WB 1FQKA 5EQFA 5CYFA 4EELA 1DJMA 3MUFA 1M67A 3UJPA 4ND4A 4BX8A 2B9ZA 5JJCA 4XLTA 1T9BA 3K8YA 4Q48A 1VPVA 1P7BA 2EFGA 5FBLB 3AR9A 4XX1A 4A5SA 1Y8CA 3BE8A 2Y1OA 4RZIA 4DA9A 3RFRA 1L9XA 4HL6A 3E9NA 1ODJA 4G86A 4RA9B 2JAHA 3GW8A 1VFNA 3WGQA 2NAFA 2QVYX 3IGFA 3AL3A 4ZHQF 4JN6B 1NNI1 1ULBA 4BIZA 4UBMA 1FX0B 1Z22A 2IW3A 1A50B 4HRAA 4C4OA 1N2JA 3DZGA 2AG1A 2A1UB 3QTCA 5LQSA 4QJBA 2VXYA 1U99A 1BH6A 3IQZA 1JYFA 1H2ZA 1E3QA 1HL3A 3U4DA 5LLSA 3C7AA 3ZKAA 1UJ2A 2PUBA 4AF6A 2OWOA 1MQAA 1EEHA 2QTAA 4B6PA 2UUAB 1P2BA 1P5HA 2FU5C 4F12A 1ONSA 3RSZA 1RWXA 1XTIA 4JI8B 5I7HA 1NM5A 2CTPA 3AUJB 1YS7A 3T4EA 4R8SA 1NJSA 1MA0A 3P2EA 4DMGA 1YKGA 3A0RB 2R7LA 1PL7A 2FMHA 3LT4A 3NP7A 1KWGA 2H3EA 5FX2A 1U2SA 2XYVA 1B16A 4MVQA 4B44A 4FE3A 5DE3A 4LBEC 3VTZA 2PZKA 4DV6B 3GUUA 5MDHA 1RYYA 1DCTA 4PG4A 1S5PA 4FC7A 4GMKA 3GH1A 4TVSA 3PX3A 1VBNA 1V71A 2O7RA 3EEOA 3LKBA 1TYZA 5K8IA 1CQWA 1T9HA 4L78A 2ZIVB 4EK9A 3PJSK 4JUCA 4R16A 3EHEA 3P8ZA 2I5PO 2OHIA 2YS6A 4Y30A 2CK3G 5CAEB 3VU0A 2ISQA 3GCXA 3FW1A 4HQFA 4NY1A 1Q20A 5EOVA 5EBLC 2CNDA 2XA1A 2WWHA 4MP8A 5GV7A 4KIUA 3MLBA 2ZKOA 1UPFA 3CF2A 5JMWA 4CTMA 1Q1AA 3R7WB 3NDJA 3PUXA 3A58B 1B2RA 1TC1A 5ILOA 2GCOA 3ABMC 8GPBA 3GHYA 1YVDA 1K9VF 3W9UA 1PDOA 4L4UA 1HMYA 4UBJA 2RHLA 2VWQA 3MJFA 4H9GA 4HPWA 1QUFA 3H97A 2CVPA 7ADHA 5CLHA 3JVEA 4YP7A 1BT8A 4PA9A 3F90A 2YBEA 3IVRA 4PC3A 1US8A 3PS9A 2OQRA 2EL7A 4M1KA 2D7JA 4G65A 1U1CA 1RWBA 2QLBA 1XF9A 1GAQA 5B37A 2BFOA 3DBRA 4JV5O 1QKKA 1EJ6A 5BYKA 3I9V1 2OVFA 3GBPA 4V2IA 3BRCA 2AJLI 3PVCA 3UFXA 2F1OA 2LBPA 4RIEA 2YUAA 1FYJA 1JFFB 1G3QA 1PNLA 1DINA 5DLEA 3VVCA 3CX5F 1E2LA 1GLGA 5LD2C 4BBPA 3AUUA 1PJAA 4DAEA 4QLAA 5HDBB 3IAFA 5CJPA 3U56A 5FPOA 4TN5A 2GBLA 4KI7A 4MKIA 4GE0A 3C3CA 2VDRB 4YP9A 4BP1A 2O2IA 4M0CA 2C97A 4QARA 2WLJA 2V5VA 1SGWA 5JV5A 4WFHA 1DLIA 4UCVA 1YR6A 2Z2ZA 2A9KA 3OQIB 4CGZA 3WLNA 3DGEC 1M56B 3LECA 1N3IA 3H8WA 4L4ZA 2B5WA 2ZIXA 3JQRA 1UOOA 1OF1A 3E3MA 1I6MA 4Y2XA 3RUFA 4WZAA 3PI6A 4HUQB 5ECWA 1QCYA 4N3BA 4BWGA 3LX8A 1UZMA 5TF0A 5K4GA 3UHPA 2B2CA 2G4VA 4AZ3A 4QFBA 3K9QO 1N2SA 2RQ6A 3ZXSA 4WNYA 1JE0A 3IDAA 2XXAB 3VQWA 1IOVA 3LWZA 3W8DA 4E0BA 4LJYA 4NAHA 1YXMA 2LUOA 2WE8A 4YJ2F 1YB1A 2PWPA 1OZ0A 5A3QA 1EWQA 5ERGB 4X1IB 1K5PA 4FU0A 5KVQA 1U8EA 3EK2A 4MPDA 2G06A 4J0HA 3B9PA 2ZKLA 1MH9A 2RGDA 4OLFA 4KZKA 3V7UA 3FPJA 1FVXA 2P2CA 2GF2A 3IERA 4MRNA 1NXXA 2ZCJA 3SZOA 1W2HA 1WLSA 4N76A 4FYIA 3DTTA 2ZPTX 1L5NA 4MVJM 1DAIA 1EM8B 1H8HG 4O4IA 1OXBB 4D9MA 5IS2A 4FNAA 3ULKA 4X94A 4INAA 5DLDA 1S0VA 3IVMA 5J4YA 2I2BA 2JLCA 2XGSA 4JD5A 4YRBA 4GBED 4Y2GA 3TLKA 4NONA 4MS1A 5DNCA 5I7AA 1C9MA 1FFGA 2C0PA 1YZTA 4ZALA 4F8JA 3A6LA 2ZSKA 5KSWB 4H4DA 2X15A 1FXSA 3VDMA 1QWSA 3RB8A 2A4MA 1BMFD 1HR0B 5IUNC 4P7GA 5J5CA 4C0AC 4ZGWA 1YJWV 5EQTA 3CWQA 3FWYA 2OG1A 2IHYA 1S1CA 1RWQA 4R2WA 5ALOA 2WF8A 4RUFA 3SF8A 3TR6A 3GZNA 1AA6A 2NOAA 5DP2A 2QTVA 2FPSA 3TW6A 1OBVA 4HDRA 1KMQA 5JSYA 3QE3A 2NWQA 3K70D 2R00C 2WUDA 1RQ2A 4KN8A 2RNBA 4ZQBA 5LZ5A 4TS1A 1HFKA 1I0HA 4RUKA 1PR3A 3K0AA 2BBSA 2VPTA 1XLTC 3ASOC 1EHCA 3MHSC 2X1LA 5BUSA 3PUVA 3SCZA 4PA7A 3TR5A 1EUDB 3CUWA 1EFPA 4YAJA 2DWDC 1SC4A 2IHBA 3BVOA 4ROSA 3L73H 3DVSX 4MTCA 1IBKB 2AEJA 1WJZA 2QMEA 3PD1A 1LPPA 2Q8VA 3KT6A 1D5CA 2JIRA 3EULA 1DRWA 4XJSA 3RSHA 1MIOA 1FY2A 5K0TA 2R8RA 1WDLA 5KLVH 1RPOA 1E9BA 2BR3A 3BDAA 2QBYA 4I9WA 2V3CC 2C1ZA 4LE1A 5B7NA 3P9SA 4UZFA 2GESA 1G5FA 1DTEA 3TD9A 2FMUA 4RLQA 3RANA 1E1YA 3BM5A 3SYMA 4MNTA 2HRRA 3BTVA 1ZH2A 3M5DA 5CT4A 1QS0A 2XE4A 1N2GA 4FT2A 2FRDC 2DHCA 4JOQA 3NOQA 1FFXA 2PYZA 2QTFA 2G72A 4FYYA 3BXFA 1T2UA 3G7NA 4EG7A 1RSOA 2HHLA 3AT1A 3KDSE 3OM9A 4G4GA 3KYCA 3I72A 2O1SA 3HA3A 2QTOA 4RH3A 4FHCA 1QZXA 3M6UA 1RVDA 1PEDA 3L49A 1V1RB 2MR6A 3PQ2A 4RTOA 4HXGA 4LA4A 2GVDC 3U13A 4PPNA 1TO2E 3H9UA 3R5HA 5B4TA 4F4LA 4RDCA 1K7SN 2PI5A 1T6XA 4O4JF 1Y9AA 2OFOA 2FK8A 1OJHA 4NU0A 5AUNB 2QKCA 2P4HX 1DOHA 3EAFA 3JQGB 1O1YA 3WRYA 3GMTA 2ZUFA 1XDCA 2A5LA 2EULA 3H1TA 4ZTBA 4BP8A 4JLJA 3DULA 1BMFG 1ZWIC 4BO0A 2ZM6B 5J2UF 2VUSA 5L3CA 3FYUC 2WJJA 3CC2V 2EZOA 4KRFA 2AXPA 2CB9A 3HL0A 5D6NA 1ML4A 4AY2A 1OAAA 1P0QA 2Q3CA 4NBLA 2C42A 3ZJ5A 1M83A 3RR2A 2JRIA 5GZ6A 1GCUA 5D84A 1W6RA 3A32A 4MMXB 1NQOA 3F96A 4RY8A 1C14A 3UKJA 1NBAA 2Z9BA 5BY2A 3MQ4A 1T9DA 3OZCA 4RCYA 5CRIA 4BJHB 2I55A 2H48A 3IP8A 3ZD7A 4LXYA 1R6NA 1UJNA 2DFDA 2HF8A 4MVXA 2DWPA 3V4OA 4TQFA 2FRXA 2FWRA 4UMDA 1WB8A 5B3AA 1AP6A 3FXAA 4E32A 1N8SA 1CB7A 3MF4A 1NF2A 3BICA 4R3NA 2DE0X 1ACMA 3OA2A 4FHGA 2E5LB 2P06A 5LU9A 1IK6A 4EYQA 5K99A 2OECA 1FK8A 2DGDA 1NFQA 2PIAA 5DSZA 3N28A 4H7KA 3FSJX 3BMNB 4FMBB 1VPEA 2GPBA 5A1TA 4LWQA 2BH2A 5FL7G 1OH5A 1QHYA 3GB9A 1R6DA 2JH3A 1L5HB 3B9QA 5FA8A 5SZIA 2VXCA 3E7PA 2G0NA 3S44A 2F8SA 3HR0A 1PFUA 1MFPA 4RD2A 3M5PA 5AM4A 1FMFA 4JP1A 3D6JA 1MJGM 2AUTA 4R6XA 5FPQA 1MORA 4F2DA 3QIVA 3LSUA 3KEMA 4V1CB 1N34O 1DOAA 2V7GA 1MB4A 5LNK1 4N48A 5A0VA 1WNSA 3GG9A 1XALA 1MABA 2PJDA 3Q72A 1H8EA 4WJKB 3L05A 4OXNA 2XTZA 2CJFA 5CB4F 4U3FH 4HAVA 2D0DA 4PFJA 2QL9A 2QLTA 2Z5GA 1J49A 2O4UX 2W43A 4F6EA 3H11B 1WJGA 2IFTA 2VKTA 3TCKA 2J3EA 5HFLA 3WU2Z 3Q3IA 2PPVA 4BNFA 4JL5A 1G7CA 3GZTB 1ZW6A 2D2IA 1DEAA 4ZQHA 2PFKA 3O8BA 4YQZA 2GN9A 5FAKA 3C8MA 1KZHA 3L7KA 5ALFA 2Y3IA 1ZI9A 2LPMA 4H7HA 1KVRA 2BFBB 1AZSC 1OU0A 2EYUA 3K3PA 4DGQA 1ZW1A 4E5UA 4KR2A 2QTHA 1MGOA 2AGAA 3V00A 2Q1WA 2AD5A 4DUGD 1QGED 2Y1XA 3HUFA 1Y4ZA 3JTEA 4NOKA 4DR5B 2OCGA 4MS4A 1XTBA 5AXCA 2R60A 3DP9A 3HADA 2QTNA 2MMGA 4ITUA 2ODMA 3PC6A 1Z0IA 3EVEA 3R7LA 4I66A 3OF2A 3E7XA 4I1SA 1AKQA 3TB6A 3ZY3A 3E8SA 1T1RA 5BRJA 1O3YA 2IYFA 3MMPA 5KTNA 4B6QA 3MCVA 1UPUA 4AXXA 3I1YA 3U09A 1R3DA 4ARSA 3EISA 4CQNA 2ZDHA 1WXQA 4JI2B 2A58A 1C2TA 3HBJA 4H16A 1WP4A 2PRZA 5CURA 5T6BA 2YDYA 4PTZA 3U37A 4PPFA 3T1CA 1CDDA 2KM1A 4PZYA 3HB9A 4LYHA 2YZMA 2R6DA 1V9LA 2Y1DA 4WZZA 2CDCA 4EO4A 3IL2A 2GQ0A 4I3GA 4C14A 4YPVA 1IBSA 4CUZA 2QZ4A 4UUAA 2NTVA 1W36D 5FUMA 4BKPA 1MOZA 2V45A 2RDCA 3L8HA 2WYHA 3A1FA 4UDYX 1H2AS 3STZC 5I5EA 1PHRA 2E5FA 4JVOA 3HYRA 3OPYI 1PUJA 2EBOA 4OY3A 4Y2JA 1X1BA 2GLTA 1BS2A 1SKAA 2OP1A 5IF9A 3CZPA 3ESXA 2LCIA 1YI1A 4G1CA 5A9RA 1N9GA 2WU3A 4P7BA 2EDAA 1FMCA 3FPCA 3SNKA 3R6GA 4KXWA 1CVRA 4DSNA 1H2BA 4Z4QA 3T0FA 3FOWA 2DR0A 2PS1A 1CUAA 4DLYA 2QE7A 4B3TB 4TOIA 4MUBA 3CKMA 3MERA 4ZREA 2Q41A 5FWNA 2OHJA 1J25A 1HOTA 1YK1A 5ALXA 3G5AA 1CY6A 3JW8A 3W8RA 3HXPA 1VE1A 3OLYA 1UPAA 3F7TA 1TGYA 2QLJA 4DIEA 2O19A 4GVXA 2G40A 2BFDA 2CZGA 4JA0A 2Z04A 4JL8A 3T1HO 1EBOA 3QA9A 3HM9A 3GLUA 2RK4A 3QO5A 1HV8A 3M83A 3PGXA 1XFAA 4BQEA 4Q03A 1MB2A 3EXHB 3R5KA 1KS9A 4FDAA 4FLWA 3I3OA 4PR3A 3SHVA 2JGIA 5EK0A 4LV5B 2JHFA 2ZB3A 1DAGA 4Q21A 4WAUA 5BSGA 1PFQA 3ZRWB 1Y9EA 1OH6A 3TI7A 4RK1A 5CK5A 4O4HB 4NULA 2O14A 5HOEA 1NQVA 5EP1A 5SY9A 4EY5A 3QUTA 2CTRA 2WD7B 1S6YA 2XR1A 3AJEA 2ZQMA 2ZSDA 4F9FA 2BUAA 4U7TB 2OYRA 1SBIA 4ARZB 4X64O 1V5WA 2XGJA 5KJEA 3WL3A 3F8TA 1W93A 4B4KA 5FI1B 5DWQA 2ZVPX 3PRHA 4WRRA 3W0LB 2YIVX 3IE0A 4C6RA 3I76A 4QUHA 4GOKA 5AVQA 3T1YB 2WBLC 1PNOA 2ODTX 4DLVA 4P4GA 1SNYA 1JXQA 2QTGA 2YJ4A 3MJEA 2UUBO 5K8TA 1A9OA 5D5QA 2Q3DA 4N7RA 1WNTA 2KS6A 3ADDA 2C5GA 3ZJZA 2HIMA 4GOOD 3KAKA 2VKQA 4QYWA 5EWJB 3UQ8A 5HPYB 2GS9A 1SBCA 1JB9A 1QZZA 2YXYA 2CYAA 4AUMA 1ML3A 3HDHA 2J0VA 4OJQA 4OFWA 4YCLA 1KOGA 2JDIA 2P4QA 3T4PA 2QZJA 4UULA 3BULA 2I6SA 1FSGA 4PZ0A 4WXMA 5SV2A 4DXHA 4JTCB 4JI6O 9ABPA 3OQVA 1IPEA 1CR4A 2VXOA 1R73A 4OKNA 2Q50A 4RF5A 1GTJ1 3SJCC 1K7CA 2QR2A 2MINA 3OHMA 4I36A 5FI0B 3LUJA 4Q93A 3GLRA 2BFCB 2AMVA 5KYUA 1GQFA 3R0ZA 1CIPA 4P86A 4OSOA 2WVJA 7REQA 4PCLA 4ENQA 4IJ5A 4IKOA 4J0IA 1EX9A 3CC8A 3NM5A 5IYDO 2NV2B 4QUJA 3K08A 2NACA 3E3NA 2PRYA 1X1SA 4CF7A 2JIZG 1TJPB 2XWBF 1IXKA 3F74A 5JS1A 4KHPB 4D7SA 4HUTA 2C0CA 1QLNA 4BQNA 5CM9C 1TMKA 2ZBUA 3FCUB 1WQ4A 5BWMA 5LM3A 4FM2A 4DCNA 1UJMA 9LDBA 1XCGB 4L51A 1SKVA 4P84A 4Q3NA 2R25B 4G1EB 4MUNA 3NW9A 1GFZA 1K8QA 1USUA 3A3PA 2QL6A 3ETQA 3RVKA 4K6CA 4RF4A 1G6OA 2VAXA 5CVEA 4ZC1A 3TCNA 1AR4A 1DMSA 1PL6A 1Y5RA 3COJA 5CW1A 3VV3A 2FWPA 1CUUA 2QP4A 5LL6P 4OSEA 2C7RA 4OUKX 4B6OA 1F48A 2FUKA 4HGYA 3LC1O 1IBLB 4QDXA 1TUGA 5KTKA 3EPLA 3A25A 1BWQA 4IDHA 4ENVA 3P94A 1ZI8A 3EXAA 3PDIA 2Q73A 5J2TF 4KE9A 2W8BB 3R0IA 1YTUA 5KQPA 1DQSA 2OESA 2VDUE 4DA6A 2G4LA 4Q19A 8ATCA 1CC1S 3O2JA 5DOZA 1KVUA 2VSXA 4YWJA 1YRWA 5GM2A 2OPBA 4UHBA 1QC5B 4Z7OB 5DBGA 1YZVA 3ZG6A 2CN1A 4JX8A 3ZQ4A 4Z0TA 4GDFA 5A05A 2A5DA 3T3EA 5A2GA 4MS3A 4A4DA 4M1SA 4BX3A 4QPDA 1SA0B 3PXDA 1ZEMA 3KKEA 3C3TA 4YUZA 4HI0E 4IGGA 1L6IA 5I51A 4PO3X 4AULA 2ZUWA 1G9TA 2JEOA 1G21B 3LHKA 5ECYA 4U7FA 4O2BB 1PJZA 1B26A 1QZUA 1M75A 2XVAA 2GOYA 4IJVA 1Q1EA 1NG1A 3RQSA 2QA5A 3REGA 1JLRA 2VDPB 3DAYA 4YASA 4J4TA 2OXCA 2JANA 4HSEA 2FN9A 1FXWA 2NGRA 1NR7A 1T0HB 2F43B 4UEOA 1YZFA 4ZVPA 3GRVA 3L4SO 5F2VO 2WT4A 1TZBA 3ORQA 4YXFA 1A82A 3JY6A 4AKGA 3LFUA 2NUAB 1X8JA 2HG5C 1Y81A 3VR3A 4LFAB 3NBXX 4WCVA 1V45E 4UJ5A 4RLFA 4OMCA 1Q43A 3WB9A 1DAEA 3Q98A 1JG2A 5KTSA 4MW0A 4C7MA 1SESA 1UMDA 3UOAB 1SXJE 3VR4H 3VU1A 1E0SA 1G66A 2O8EA 4B6SA 1ZD9A 4NHEA 1OT5A 5LXTA 3HQ4O 8AT1A 4XYLA 4BO9A 4EL5A 3ZNPA 1B0ZA 4YYEA 3KFVA 5CHYA 2X23A 3HJFA 1HTWA 1VF7A 2D7DA 3BTOA 3VSEA 3MUNA 1C50A 2QZPA 3L40A 2AIRA 3UHOA 5CFMA 4I1IA 4DJDC 4HX5A 1GRJA 4A8JC 2H5EA 5LLTA 2VSNA 1Y1LA 1KERA 1Z6QA 5KNDH 1MC1A 1C30B 3JQPA 3QNWA 3EFHA 4COKA 5DM4A 1HKUA 1OBHA 4PA6A 2D1FA 3AVUA 3AERB 4R8CA 1C4KA 1QOQB 2HCFA 2IGBA 4RSMA 5IYZB 2P6NA 3ZLTA 3N2GA 4G0OA 1P81A 3T3GA 5KAMA 1MZPA 4DKJA 4UQOA 4EFNA 1N3BA 2GX6A 1ZKDA 5TEWA 2FVYA 3LZCA 2OPHA 5JTUA 1BKSB 2AOVA 1I6WA 1A8IA 2O0MA 3E8HA 3TLCA 1FMTA 3MTEA 2Z1MA 3GGSA 3M1IA 6REQA 3OQPA 4CMJA 3K2EA 3SDSA 4FGZA 3DDUA 5T4FA 4K0KO 2C78A 2V6IA 1Y1TA 2WJAA 1VZ3A 4MCIA 2J5QA 2YOHA 3B1FA 2J8ZA 5H80A 3ER9A 1E2IA 2Z95A 1UBLS 3FY4A 1EZJA 2GKGA 5FWDA 3SMVA 3L5KA 5J63A 3TD6A 1T0UA 2WWTA 3VQXA 2UXNA 1OA0A 3RW0A 3W78A 4RZHA 2ZUEA 3FJYA 2BGKA 1CY7A 1JYSA 1R0RE 5FEUA 4L9SA 5TJHA 1CEQA 3FVWA 3GRPA 10MHA 3A6KA 4PNHA 3LYLA 2DPXA 5BSKA 3OOYA 4YRLA 4YMTA 3MTAA 1L7NA 4U7HA 3LO8A 1YJNV 3H0EA 3QSYA 1BQZA 2HA3A 3FVTA 4X0EA 3V2GA 5EEGA 4M36A 3H1EA 5AJUA 1QBGA 2PR2A 4MUFA 1E3DA 4GDMA 3CBGA 3LD9A 2NU8A 1R0XA 4UB8Z 3UK6A 2FPKA 4Z6KA 4HZUB 4LOLA 2NYVA 1AVMA 1D6NA 1IDOA 3E3OA 5IRCD 1FFEA 3WL5A 3ZE9A 4LP8A 4P3XA 3OTHA 3K1YA 4GR9A 4LXHA 4XSGA 4FDUA 1E6WA 2SCUA 1DB3A 2YY7A 2CV2A 4YRDA 3CNLA 2VPQA 1EXMA 4OIFA 3JS5A 2AYXA 3EH2A 2Q4PA 1X1DA 4YRSA 1U0SY 3N76A 3D3WB 4YMGA 4Y1FA 3AVYA 3KELA 2WKQA 1VJDA 4KKVA 4BNIA 1GU1A 3C3WA 4UD2A 4X7MA 2EJWA 2RSLA 5JS2A 4ZD6A 4F3RA 2BBOA 1ZVKA 1B76A 2EJRA 1DF4A 4NNOA 5ARCA 3X1XA 3LXMA 2PNJA 2W2XA 3TETA 5CXUA 4D9HA 3ZZUA 4GLBA 3RS9A 4Y18A 5EZSA 3IOMA 3EPJA 4YLEA 1S76D 3KHTA 1WPQA 2WWXA 4PGMA 3QNMA 5BQ3A 1AI6A 4FBGA 3DKRA 4BO3A 2QUAA 1SHUX 4KK3A 4L8VA 1VCHA 3OPMA 1GTG1 1L0BA 5J5AA 3EGWA 5A0TA 4HQ0A 3VNVA 1JHXA 3H16A 4E07A 1FJGB 5IDXA 4BXOA 2V1DA 3CZAA 3H8VA 2FE1A 2YY6A 1USVA 1N6RA 2IODA 3I4FA 1X86B 4LSZA 2OILA 4KMMA 3EWIA 4Q4JB 3P71T 5B1AC 1Z83A 3HCFA 3TPZA 1W59A 3TOVA 4EHIA 1YQGA 1EXVA 3NAGA 1ZNZA 1SH7A 4G5XA 4F4JA 3ZQJA 4BZQA 3OSZA 1KDVA 4ASUD 3DTYA 3BWCA 2QN7A 4PDVA 3MAQA 1F4MA 3EODA 2AEMA 3LDEA 3HCWA 3WGYA 4ZCPA 4UCWA 4ZODA 4AMGA 2JRCA 4V24A 2NT3A 4IKPA 5BWNA 5CEEA 4RV9A 3AL0C 4FMCB 2W6MA 2YHAA 4QASA 1I9CA 3WK7A 3UF0A 4UB6Z 2E89A 3W2TA 3TL2A 1N9ZA 2VAMA 2VZLA 2AKAB 2QK4A 1VLVA 3KUCA 5BR4A 3HCEA 4OOFA 1C1HA 5AKJA 3UTDA 2VDWA 2BPOA 4DK1A 4B5KA 5AG2A 2OBLA 5KUKA 1E3WB 2I80A 3OEHD 1BRMA 1SXJA 1CJMA 1GQYA 4O4LA 4WCEV 1C3LA 3D7NA 4X3OA 4OI1A 5JQGA 2ENWA 2O4CA 1MT3A 4JLSA 3SQOA 2DT5A 2Z2KA 2WYWA 4BKOA 5FOSA 4Z53A 3BQNB 2FL4A 1AUOA 2DW4A 1GUYA 1XMIA 3P3PA 4LSGA 4PNEA 4K35A 4BFUA 5C8YA 2V7TA 4YONB 1RP1A 5KWJA 3N59A 3DMYA 3LWBA 1JECA 4IXWA 3BQ9A 1YF3A 2PLAA 3OOEA 3N2KA 2BEUB 3F5FA 4KU4A 2K7FA 1PE0A 3G9UA 2CMFA 2IPOA 2QRVA 2WTNA 4NU6A 3WLRA 2ZAIA 4IDGA 3AEIA 4ME6A 3LXXA 3JQ8A 5JJEB 4C6HA 1P0MA 3ANSA 3A6HA 2DULA 2YJ3A 2GERA 1Q6HA 4GZ5A 3NHBA 2B4RO 3QEKA 2WP0A 2AJBA 3TLGA 1Q0RA 5IVPA 2FSUA 2X4DA 1FQWA 1KVQA 1TD1A 1US6A 2WU0A 2WJ4A 3OJWA 1RPRA 2JZNA 1SB9A 4KCGA 3MTBA 2OBXA 4Q82A 3KJGA 4ZI7F 1E5TA 1IC6A 3EZGA 5KHJA 1RTTA 5A2QN 5CFLA 4LPSA 3N6VA 1R50A 1OB5A 4R2KA 1BS3A 5EFZA 3SD7A 4MLCA 5KUTA 2OXIA 1IONA 4GICA 3S8EA 3W5UA 2QYTA 3ZD9A 1IZZA 1IZ7A 3SEZA 1M7BA 1SU8A 4L0QA 3LRXA 1GZ3A 4ASUG 1R3IC 4MULA 2RGRA 2WQ6A 2AHRA 5HYVA 2B83A 1D5NA 3SVLA 1LBEA 1TMGE 4ENSA 4RDIA 4LWZA 4ND6A 2QPLA 3CW8X 1NU1H 2YV5A 3LDFA 4FX2A 1FCJA 4P4NA 3AHEA 3LUGA 1NVBA 4DGSA 2JFQA 4W7HA 5DH9A 4G1VA 3OZ7A 4ZJZA 3VNRA 2CFIA 1XRRA 4XVQA 2F1IA 1W4LA 4WZAE 4ZANA 2C2GA 4QGBA 1M34E 4B76A 1E1RD 3JARB 4JEIA 4KXFB 3C3BA 4J94A 4DY6A 4BIMA 4G5SA 3WFVA 4JLMA 5KHKA 3OEHG 2PWBA 3NMUF 4S1TA 2C5EA 1EG7A 1CQIB 4HB4A 4CKEB 3HWWA 1KXZA 2RG7A 5KAPA 3P97A 4A8PA 3PHBE 3SJUA 2EDCA 3SJBC 1AZWA 4U6SA 4EI9A 1EFHA 3BH0A 4BBAA 1OGIA 3A1UA 4ZOLA 1EUQA 2K5UA 3IC7A 3DUFB 4R84A 4BN0A 3L7YA 3DHWC 2PYDA 5HF6A 2X6RA 1KEPA 3PWTA 3Q3JB 1OWPA 3DW1X 5A7GA 4Y6RA 3WJAA 3X43A 1ZCAA 2GETA 3K6SB 3VR4D 2A5YB 5HFAA 4R51A 1XVTA 2P6OA 2OGZA 4MVOA 5J4KA 1ULSA 4CG0A 3LPLA 2PWAA 3I53A 1CJCA 3VR2A 3ZVKA 5FWXA 3SS9X 3QA3E 1LS1A 1U8YA 4C88A 1X0XA 3R7AA 2QL7A 2IHJA 4BTVA 3FZYA 4YJ3F 2DJ5A 4B43A 3P96A 3UAWA 4BFWA 3CX7A 4E2FA 3NC1C 3PD7A 3IYLW 2OFXA 1EP2B 2FVXA 4CC5A 1B1CA 2Y1CA 3PHLA 4W82A 3HI4A 1R15A 3ZLVA 3GLIE 3AG3C 4ZT5A 3OFVA 4RQEA 4JLVA 2VATA 3G5LA 2DH5A 4UM8B 1OZAA 3ZEDA 3B89A 5EMLA 2NYUA 4Z9YA 1WXDA 4IIUA 1MG1A 1GVNB 1Q0TA 5IDJA 4C1BA 1TT7A 1R2QA 3U6BA 1BVUA 2CVQA 1ZIOA 2E76B 4RD3A 4ND7A 3C97A 4RE5A 1Z06A 2VXBA 3I83A 5K6RA 3TXAA 4S04A 4YS6A 3FFWA 4Q4DA 3PGA1 3QXHA 1UM9A 2PU5A 2IYAA 4LPKA 5TPWB 1VGRA 1XCJA 3QFRA 1T0JB 4LRXA 4NQZA 2Y0DA 2RAPA 5KNCD 4C4AA 4NBVA 2H3HA 3NT2A 1Z17A 3WZ2A 5IBCA 1YTFB 5IWAB 2GEBA 4ZI3A 3PDHA 2RGXA 3Q15C 2W2MA 4LYYA 2QX9A 1P61B 5AVYA 5DM60 2HP8A 2HWUA 1BG6A 1Q0HA 4BVJA 2NSYA 3ICVA 1G3IA 3KOWA 1GCAA 5DDIP 3N2ZB 5IY5C 4IZ6A 2Q3BA 3UTCA 5EP4A 3MINA 1MO6A 4CF6A 4XDGA 5FHRA 1F12A 2FGJA 3UV3A 2XTJA 4PZCA 1F4PA 3DCYA 2SHKA 3I09A 4LE0A 1KUQA 4JP8A 1YL7A 1YQUA 2PQMA 1S72V 5B58T 4PX3A 1LJLA 2XSZD 4GLJA 1FRQA 1E1RG 2OD2A 3KPWA 1I94B 1AGNA 4QEDA 1JR3A 2BSXA 4MGKR 4Q20A 3B3AA 5IBRA 2I2AA 1BS1A 3H5VA 1SQXH 1CRZA 3UMYA 2QJ1A 1K92A 4C5BA 1MIHA 1YASA 2FZEA 3FSGA 2AXQA 3T5MA 4DDUA 1R0WA 4KLNA 4KVGA 1Z16A 1CR6A 4GE3A 1O97C 2ECOA 3W7AA 3CW2A 4B8ZA 3Q1LA 4ED9A 4XEUA 1CT9A 2FX5A 4E4YA 5HKKD 5JHHB 3IJEB 1XCMA 3NAQA 5GONF 2ESRA 4PY2A 2XNDG 3V3KA 1QGAA 1NW3A 2PANA 1BCCH 3L7OA 1A5SB 2HF9A 5TLSA 2UVQA 4HQ6A 4V38A 3WRXA 3T5TA 1DQPA 4R54A 3ZS8A 1ENOA 3ANLA 2AYYA 3V4VB 3ZCPA 3OE7A 1LJ8A 2RMKB 4DDKA 5ENZA 4RHEA 1H8HD 1DAMA 2NZWA 3UCFA 1P0PA 2XUHA 2IOYA 2JGNA 1ZCZA 2WZQA 1YS6A 4UUOA 1FU4A 5DK4A 3BIXA 1U90A 2HHJA 1KIAA 2HTEA 2MSNA 3RT3C 3U1BA 1JP7A 1QE0A 5A7HA 1DO2A 2QD1A 3EF3A 5JQWA 5IEBA 5REQB 1PP9H 4H2DA 1OREA 4C2AA 4FPPA 5IAJA 2ZIWB 4OB6A 1VL2A 4RPGA 2AB0A 4CL2A 2VJAA 3AVTA 1RP7A 3R66A 4F9EA 2VNSA 4JXZA 3WQSB 1T34A 4S0XA 5JOQA 2CTQA 1ESDA 3KXDA 1J9GA 1PW5A 2VNAA 2QQGA 1FDSA 2L0XA 1P3DA 1MX3A 5BT8A 1FNBA 4L3WA 1ITZA 5JZVA 5ITZA 4G3XA 4RMHA 4RZQA 1L7PA 4DQKA 3THWA 2QRJA 1NRXA 4DLLA 4AQDA 3KZKA 4QOHA 1ISFA 4PXAA 4K7JA 4R1NA 3EG5A 1SVMA 3UHFA 2VQFO 1F0YA 4QUGA 2AUMA 1R7RA 421PA 1NC1A 2A3NA 2IV7A 3PEFA 5K0BA 2IBZH 1V48A 1ZVMA 4X6XA 4AILC 5F98A 1W0JA 3Q7SA 3L01A 2MIIA 4HFRA 1M3SA 2R85A 4M9UA 3CVVA 3NUQA 1XRSB 2Y93A 1OJ7A 3S2FA 4B32A 4E21A 3CXCU 1J09A 1U8UA 1BVHA 5ALYA 2QMUA 5BUQA 3CLVA 4E5MA 3SS7X 3ONFA 3CLHA 2H2HA 2QJTA 2JEXA 4PYNA 4YALA 1M34A 5AOBA 4M0LA 3HZRA 3EGXB 2XUGA 1NVXQ 4MVJI 1SC3A 3B3GA 5H83A 3R8CA 3GLSA 2H2DA 5DEOA 3HBMA 1B6RA 4QUBA 3BK1A 5LVAA 3FKJA 2QMOA 1RJEA 2O7SA 4X62B 2P8SA 3NEPX 1PWXA 2VPPA 1F6WA 3GFVA 3FDZA 3DFIA 3PGMA 1JEEA 4DPKA 2V03A 1IHUA 1URPA 5IT0A 2NO1A 1ATIA 5CEFA 4DCMA 5LQAA 1OFIA 3ZMVA 3HGTA 4PX5A 1U4OA 5I7VA 5F2KA 1KI2A 1JJ2U 3PQDA 1PBNA 1UKYA 2EP5A 5HWSA 3R3XA 3IV7A 3CG4A 4EF5A 2KB0A 3DW3X 3F4BA 5JNTA 3FG9A 2V3VA 1U0OC 4JMPA 2FUG6 3ESDA 2O7QA 3T7KA 3BEDA 3N6XA 4PLPA 3TLJA 4AL4A 1GNQA 3LHFA 3QE4A 4RWZA 3ZK7A 4NWIA 2JFGA 2XCUA 4AJ4A 1XGKA 3MPUA 1T36A 4C43A 1P45A 5HNKA 1NTMH 3BD9A 1TE2A 2CLLB 4MWCA 1JIKA 4W1RA 1ZWKA 2YV2A 5F4ZA 2O8DB 3GLIA 5IVHA 1KJIA 5A0FA 4RXUA 1OCCB 3PNLA 2ECQA 1XTJA 3NRCA 4JYZA 1FQOA 4COOA 5FADA 3MT9A 1GG5A 2FWAA 3Q3HA 4OGQB 4AMYA 4LAFA 1YC2A 3CNOA 4CTNA 4BO2A 1ORHA 3V8NA 3AK1A 3E35A 2CGEA 2EFDB 4MVZA 2PIDA 3AONB 4ZC8A 1SRRA 5K0EA 3CJHA 2DHEA 4BNWA 1QIFA 2J5XA 2Q0AA 5E1AC 5CN0A 1GHTA 5F2EA 5KOJA 3DCNA 1HLGA 3EQ7A 3T06B 1TB4A 4AO7A 1K27A 5C4MA 2WLHA 3T94A 4ICIA 4I5EA 3AG7A 2NXCA 1SZJG 5K8CA 3ICWA 3KDAA 3QPWA 2F62A 1NKTA 1E6UA 5FBZA 1MMMA 4G8DA 2AOXA 1EZVH 1NOJA 3OZIA 1JG4A 1PJCA 3R40A 3MJCA 2O2YA 2FMXA 3KCXA 3LX6A 4LYFA 1YQWA 4KN6A 1ZEJA 3Q7QA 4JQSA 3HNRA 4Y2HA 3AJDA 3T3DA 5FL7D 3FZNA 2GJ4A 4KVAA 4YY3O 2CKMA 4GR5A 3AG1B 5MGNA 3DPUA 1I01A 1M0TA 4N82A 2XMGA 3R76A 5IG2A 4GP7A 3MGAA 1F5SA 2GM3A 2JS3A 2WM9B 1L3CA 3WYAA 1UUFA 2ZI9A 4GBGA 3VPFA 1O89A 3NOOA 1KH3A 1T8YA 1SU4A 3L7CA 4EH1A 4Y9UA 3N1UA 2H9AA 2PL9A 1XZEA 4HVTA 2EILB 4NI5A 2JAXA 3MMXA 1HEIA 3EUAA 1FFAA 2ZJ3A 2XADA 3ZHTA 4H13B 5KOHA 1T26A 4KSYA 3UOWA 2VBIA 1RHMA 2B1GA 4BVLA 3U4HA 4KL8S 2I2WA 3GA0A 1VBKA 3NASA 1E4YA 1TPZA 4ZIRA 1ICEA 3WKBA 4Q01A 3FZEA 2R5WA 4E12A 3EDQA 3DZHA 1AR5A 4UBLA 1DC5A 4HDKA 1JJ7A 1ZIPA 2PD6A 3F3YA 2Y69C 2PBLA 3PHHA 3JV7A 5M7EA 3FB7C 2ZYWX 1Q16A 4J1TA 4HVCA 4NEHB 4JP2A 3TB4A 4KDRA 4ILKA 1GILA 4L07A 3FNEA 4MW8A 2QQFA 4MQBA 1ENZA 1PQWA 3UJAA 2BY4A 1P5RA 3BZWA 1BEZA 1B7GO 2G5CA 2OXTA 3WGZA 4PRZA 2AFRA 3RFCA 2Q7GA 2GCOB 3G02A 2BMWA 5EE0A 2XPCA 2H1SA 5BSEA 3HVHA 4MCJA 3Q10A 4QDKA 2GAAA 2YFKA 4QBTA 4Y6OA 2GZMA 5ENVA 3GP5A 4YAIA 1MEOA 5B3SC 4MI6A 4GZMA 4AQYB 4TVOA 4QE7A 1FPOA 2HJSA 3LAWA 4FK5C 1E1MA 3RRJA 1S7GA 3IODA 1US8B 5AK0A 1NBOA 1DP4A 3AVOA 3VYSB 3I2GA 3OM3B 2O8FA 2B37A 2LP7A 2I2XB 2OCLA 4HFJA 2OHFA 4C4XA 3UV6A 5LGTA 1GR1A 2D5IA 4CLOA 3DBRB 1QVAA 1Z6PA 3T5AA 5AVXA 2TS1A 4FI3C 3QEJA 1QAQA 4KTVE 5TX7A 3UA4A 5H2FZ 1S89A 3UFXB 4N9QA 4KQ1A 2WA3A 1BQ3A 4JR2A 4U7PB 2SKEA 2BDEA 4KO4S 5ER9A 3EPHA 4WQMA 2XA2A 2Q8QA 4GZLA 4YP1A 4K9DA 1DO0A 4PZ9A 1HM5A 4QUKA 4IV8A 5LHGA 4DIBA 1MUUA 1IEXA 4HEA6 3T0IA 4AICA 3ZV5A 4EPWA 4HADA 2ZJZA 3ZEIA 2VF5X 2A30A 5HM6A 4FC6A 5EPUA 4NG4A 5AQEA 3CXRA 1WHTA 1U3WA 1A4UA 5H6RA 3VC3A 1MC4A 1HTTA 4Y1RA 4II2A 3EIUA 3IPAA 4DA7A 2WVAA 2LFRA 3ZHQA 4M1EA 3ELYA 2ZIXB 2QD3A 3CF0A 4CFZA 1K5QA 4WVFA 2VT2A 4E6PA 2EARA 3F46A 4WZAB 1E63A 4GZ6A 1JIJA 1AHHA 4QXPA 4CCYA 2NQ2C 4JC0A 3RIXA 5HJ5A 4AZ3B 4NMXB 1EVIA 2FDRA 2QUBA 3QYAA 2ADMA 2JBHA 3H9CA 4K2HA 4EG8A 3AVWA 4L5CA 3HMQA 3H19A 1U1FA 4PLYA 1PGNA 2VWGA 4NYMR 4D5GA 3YASA 4X85A 3ZU4A 1CFZA 2VOJA 3BMCA 5CNIA 4CG1A 2Z4RA 3ZH2A 1YHQV 1C9JA 3FMVA 5CA1F 1GOTA 2FRVA 2ZVDA 1SXQA 2AR9A 3DOHA 3RIMA 1NI3A 1FNMA 1MN6A 4KOAA 1ECGA 4XTCS 3JR3A 1XZJA 1GN4A 5DT9A 1E61A 4CS4A 4R7TA 5HJ2A 1UWVA 3UH1A 3CZCA 2X3FA 3MIIA 1XZAA 3ZUGA 4ZO4A 2IV2X 1L6RA 1U0TA 4ZVLA 1D0SA 4XJTA 1JR4A 2IOFK 4FDVA 1CUZA 3IP7A 3QXJA 1MB0A 3ANTA 4NLLA 1LQ2A 2V9ZA 3D4IA 3EDRA 2XZDA 4C7JA 4IBOA 1WCIA 2Q3JA 3MTJA 5K0CA 5IM4F 3E9QA 1CYEA 4MS1B 3T41A 4RPCA 5E2IA 4BVEA 2FNAA 1G18A 4XB2A 4XRGA 4FFSA 2DM6A 2C07A 3D8HA 5C37A 4DRYA 5TQJA 1Y3FE 4I9GA 2XMCA 2VZEA 2EINC 2D1YA 1U2EA 2X1VA 1B3BA 4G67A 3I58A 1CF4A 5A9GA 3R65A 3KD3A 3RAJA 4I8IA 1KEVA 1NQXA 4Q1BA 1MTOA 4XQCA 3NR2A 3ZHSA 1U98A 3SF8B 1JG6A 2B1JA 4C6TA 3ENWA 3GZNB 2GWHA 2G6BA 4LXQA 4UE6A 4C3VA 4AZVA 1PSDA 3I5AA 2N1BA 2QP9X 2QTVB 4WJLA 2GBFA 3VV2A 4BQFA 4QWMA 2F48A 1PEKE 4HDRB 2C2XA 2IYQA 4MKFA 1I1QB 3R8XA 4QPKA 4GKJO 1N0IA 1NURA 2V54A 4D98A 4E15A 4GGPA 1TU3A 3LXRA 3WWZA 1FB5A 4AJ2A 5E0KB 5DX0A 2ETXA 4ZT4A 2IEBA 3HSKA 3K0AB 2DBVO 4A0RA 3PXUA 3VPXA 5AW4A 3BIOA 2CZCA 2N04A 2V4UA 1Z2GA 3JRWA 2EP8A 3T7RA 1EFPB 2C9YA 2WTUA 2HB6A 3INNA 4QU0A 4B3CA 4HLUC 3D6TB 1AXEA 5FPHA 1NIPA 4X8OA 1FFCA 5GQSA 1V55C 5GMOA 2JIZD 4KX3A 4QDUA 2FX3A 1V26A 4RD6A 4N7JA 3QKSA 3FA2A 1MIOB 1QK3A 3QVJA 4V0NA 2J07A 4YMLA 4X8MA 5BYAA 2C4KA 3NV9A 2GHYA 4PW0A 1J8YF 2QBYB 3FNRA 4NNPA 5ALMA 4FUTA 3ER8A 3B8NA 5ITWA 3VPBA 3KPJA 3IXLA 1KK0A 2HMUA 4X66B 4DLSA 1PNKA 1QS0B 2WIDA 4CMBA 3GFFA 3W1EA 2YHSA 1FA9A 3C85A 1KIMA 3FWZA 4DV5B 3ZDBA 4C29A 4MRMA 2QT1A 1FFXB 1C7EA 2L82A 4JNCA 4XIIA 1XNRB 4E13A 3UUFA 2BELA 4ENPA 2XD9A 1P9OA 1RSOB 3EIHA 1FQJA 3E1SA 1N0JA 3KYCB 1SZDA 2XVYA 4AS2A 1OGJA 5EI5A 4D4LA 4IDOA 1DBIA 1IHYA 3U4MA 3EDOA 4UDOA 2WDPA 5CMUA 4P93A 3C5VA 3BZBA 2WZCA 2BZSA 3W90A 4RV5A 2IV3A 1A2KC 5HRUA 2WA2A 2J85A 3WJ2A 4UFPA 3LKVA 2NTEA 5GJWC 2OT5A 4TTJA 3NPAA 4MW9A 2Q68A 4QAQA 2Q3FA 5FH9A 3FGZA 4WKOA 4G2NA 3LL4A 4A9AA 4BGIA 2AVNA 1ODIA 1NXWA 1NY5A 2BFPA 2IU3A 4UUNA 4Q1AA 5FBRB 1E1DA 4RF3A 4Q9LA 4HPXB 4MPTA 5IC6A 3RC7A 5M3BA 5FTKA 4XXHA 2LTAA 3KJXA 3T5PA 3SOZA 4EMBA 2CBGA 4N47A 2F59A 4M7PA 1NP6A 5DHTA 1V7PC 3G67A 1TVEA 1YFZA 4RYLA 3PUIA 3CT6A 4F04A 2CMKA 1ZPDA 2G36A 1WBDA 3UWDA 1GGFA 3OZSA 2ONKA 4IDAA 3T7DA 5TS3A 2X6BA 2F4NA 3T7TA 5CDUA 4CC6A 3K15A 5G4KA 4HKTA 5DISB 4A2PA 2CXPA 1I2BA 2F7SA 4AS1A 4L6IA 4MR9A 3INYA 4FDLA 2QUKA 2C92A 4QATA 4M83A 2W98A 2PPLA 3IE1A 4AKIA 2IIPA 2LZ0A 4BOYA 5DLQC 1X74A 2EX1A 3BA8A 2WY2D 3OFNA 1NYRA 2VHWA 3IE2A 3C14C 2Z8YA 1L2TA 2QG6A 2PN1A 4MV9A 3CNBA 1ZM2A 4AURA 1I5EA 3OP4A 2VH1A 4JP5A 2WF9A 3KSBC 2FWBA 2O2CA 4ZEVA 2PNFA 2D74A 2ITCC 3OH8A 2DQKA 5TIIA 5L3RA 3B5IA 2W6PA 1F8GA 1KZYC 3OETA 4KUMA 3AV0B 3RRXA 1GUDA 3BD6A 4IVRA 1FS5A 1NVGA 1LRJA 5CDFA 1MABB 2F1KA 2C1XA 1F06A 2VPIA 1XJ0A 2W8ZA 4C08A 1KDTA 1Z28A 2YVAA 5BP7A 3PWKA 1XWWA 2AX3A 1QYCA 4OU4A 3N58A 1K75A 1WNFA 3ZD6A 2YRWA 1U9CA 1Y1QA 3FTCA 1P3JA 4QOSA 3EGCA 1C1DA 2TMYA 2DWCA 3L06A 4F45A 4CRWB 1RYBA 4LCUC 3D4BA 3BWEA 2B2XA 1ZG3A 2FW6A 4DNOA 3OCUA 1F3LA 2XIQA 4HNQA 2CLFB 2GJ9A 3ILSA 5JO9A 2GN8A 5EWMA 1USIA 3UWKA 4TTQA 2ZI5A 4MS4B 1EXNA 5DO9A 2IHKA 4E5VA 1XJQA 4E94A 4OA8A 1GGNA 3AM4A 2AKYA 5KC9A 1IB0A 3VOBA 3B6MA 2YJ5A 4FIDA 1QTQA 3BPSA 3GJ7A 2CLHB 1WA5A 4W5RA 5LMUB 1U9IA 4IJUA 2AQ8A 3AHJA 4QOGA 1I0LA 2R79A 5I7WA 3M82A 4LF4B 2B30A 2P6RA 3ZU5A 5F78A 3OD4A 5EFOA 2P4UA 3GNLA 3H8JA 3G4SV 3N39C 4X7PA 2VBFA 2RHMA 3F6RA 3IEPA 1G3RA 2CDBA 4CBCA 1UR5A 1DF5A 4K6KA 2GNPA 4ZQIA 3SQNA 1QLEB 1NXPA 2H2WA 2E18A 2BZ1A 4AF8A 1Z68A 4KIFA 3PEEA 2PO7A 1XQ6A 1VTKA 3UA3A 3IESA 3SNHA 4HTFA 2AMJA 5AKHA 2GM4A 1YS4A 2HLHA 1RAIA 3SYKA 2HRCA 4E4TA 3LT5A 1J2RA 5JASA 2PT6A 3U11A 3RTGA 3IT1A 2H7YA 2V7EA 4RKFA 2DTEA 4LDZA 3CUYA 3LNCA 1H0SA 4DLTA 2QN8A 1R0LA 3RYIA 1N7HA 1FU8A 3TD2A 1U2GA 2H8KA 1M6EX 1RIIA 2WFMA 7MDHA 2WHPA 3W8FA 1EKXA 3TOSA 2NW6A 1F17A 3TPFA 2KQUA 5L3QA 2VUUA 1KK1A 4M0DA 1N9GB 1AU9A 2SKDA 3H99A 3GUHA 3DSRA 2Y71A 1PK7A 1SVSA 1KDYA 5FOQA 4HV4A 1ZHHA 4WK4B 4ZU3A 1QDEA 3ZOZA 4F1JA 4JB2A 4MAFA 1YR8A 1OW3B 4M98A 1G5IA 2X9NA 4DUYO 3OD1A 3SP1A 3ECAA 3Q9LA 3RWRD 1ORDA 4D2IA 2BF7A 4MIOA 3V9AA 2JG3A 1V1JA 2HL6A 4ARBA 2YIDA 4EEXA 3OCWA 2EKBA 1NFFA 1HDIA 4DCGA 1TVKA 4B7EA 3HEBA 3R0VA 3Q7TA 4ARIA 2Q1XA 3DT8A 3OO0A 1KBZA 1VGQA 4UD6A 2ZPUA 2RI1A 1WPBA 3CHYA 2JIOA 5AW7A 2BFDB 1C0IA 1RI5A 3N0RA 4JGGA 2C2HA 4KKXB 3X2QB 3L0SA 4DYLA 3P9KA 4HXFB 2WAOA 1AR1B 2O3RA 4WVLA 4DXWA 1ENVA 1UPTA 2OSBA 5MF6A 3LX4A 2CE7A 3ZLUA 4XIJA 5IC4A 2OMEA 3RS8A 5INTA 1NC3A 3AOEA 5KJCA 4B6RA 4MUYA 4HYOA 2ZIUB 5IZCA 3QKRA 1C7RA 3UWPA 2O1XA 3O74A 3WB1A 4K86A 4D3SA 3L7BA 4UZSA 5AMXA 4PPQA 4DR2O 3NHYA 4B46A 1HRKA 1DKUA 1E0AA 4PX9A 4ZU6X 4ZI2A 4ZAYA 1BGYH 2UXCB 2O7NA 4OYHA 4MUHA 2B8EA 1HE2A 1KQOA 1Y9DA 1EWYA 1I36A 2F66C 1EYZA 1M1YA 2OGUA 3MPOA 1YTLA 1I8TA 3ZJ4A 3EGOA 2OCYC 1DC8A 4LJ9A 3GO4A 1AQNA 4MDFA 2QN3A 2BKEA 5CH8A 1L5VA 2IX3A 3QX7A 2OKGA 2Q46A 2C8KA 4ETNA 2I65A 1MSWD 3GEDA 5GOZA 1QF7A 2CJXA 1OC4A 4PWYA 5GTDA 1NVVQ 4M46A 4DR1O 4OSPA 3Q7PA 2ITDC 1RRCA 5FD8A 5DLPA 2WJVA 4GI1A 6GPBA 5JAUA 4YRAA 3N70A 3RIHA 3UKMA 3GJYA 3T34A 2F43G 1B23P 4UBKA 1EK5A 2HK9A 4QO8A 4BQRA 3LUFA 1YSCA 4BE9A 2G25A 2R65A 3FMOB 1VP9A 3RV4A 1QGYA 2K7ZA 3EFOA 3OPVA 3F6CA 2CD9A 1G64A 3ZJVA 4QFDA 2NXWA 2WM3A 1DL5A 3V48A 1FXUA 3QV1A 1B00A 4MDYA 4N0MA 4LVNA 2AX4A 2QVCA 2MINB 1Z29A 3D8RA 3NBUA 1IY0A 1LVGA 4KH0A 1ES9A 3IBYA 5KYUB 1HYEA 4RSRA 2VZ8A 2IXFA 1R6BX 4P5EA 5FWYA 3DV0A 4HS4A 7REQB 1YQXA 4BLQA 4FSHA 2CXNA 1LUAA 3PKZA 5AJTA 1L8OA 1A9QA 3JQEA 3KSDO 2BRUC 3L93A 1IWBB 3K35A 4GMHA 3DXYA 1RYEA 3V7FA 4OI2A 1Y42X 3MBKA 4DBLC 4H1TA 1E9RA 3OEYA 4H35A 4NEQA 4O6VA 2HSDA 5HEKA 1JDBC 3I8XA 4YUYA 1EZ4A 2P40A 5K0ZA 4L4YA 5BSUA 1Q2UA 2SBTA 4INZA 3KZMA 4KLCA 3GK3A 3BEHA 3RKRA 4XFKA 4F5WA 1RBQA 3UK0A 4TXHA 3E18A 2UYYA 1YVPA 1EGHA 1XVLA 2NG1A 1YMQA 3QXSA 2G0TA 1BD3A 3MCZA 1GUZA 3OLXA 2BR4A 3MELA 2HH9A 4WN3A 5B6JA 5JD5A 4OPMA 4EA6A 4MUKA 2PT9A 3CZ9A 3D3JA 3BHNA 3PDIB 4G09A 3F1KA 2PZMA 5K5EA 2W42A 1VHLA 2HU2A 3LPMA 1GGJA 5C0OE 1GL9B 4FCWA 3WJ1A 4JI0O 3SICE 1CY8A 4KIWA 4L95C 1DKMA 3RVPA 4I5FA 3K0FA 3H0CA 4K6OA 3SAJA 4LSMA 1ZGGA 2ONCA 3CISA 2ZDIC 4I2NA 5JMOA 2IQ5A 3DVLA 5B1BB 4MS3B 2V9CA 4Z2WA 2XRMA 4FOSA 1KO1A 2DSNA 1I3CA 1XRJA 4RQAA 1FP4A 2I4TA 3EZ9A 1JR3E 3OPXA 1YJ5A 4V3BA 2CHGA 3WLEA 3UGJA 1PT5A 3AR4A 1K86A 1U9ZA 5KQSA 3FVVA 1EGMB 5L4LA 4HWOA 3T2MA 3NVMB 1MA3A 5EJAA 3UUEA 1Y33E 2Q1UA 3H86A 4MYTA 1BE3H 2WJIA 4KAAA 4B0OA 2DHRA 1GPWB 2C4MA 2OM6A 2F23A 4WMLA 2E4AA 2VUHB 4UHHA 3F6EX 1KEUA 1Z5OA 1V2GA 5JAHA 1O9GA 3UZUA 3BA6A 1NF3A 3RARA 4ACBA 1HFEL 2R72A 1UMDB 1ESEA 4TPKA 5A5EA 1JMKC 2LVBA 5T4BA 2O8EB 3HDVA 2C7GA 2VDVE 2IU6A 2H2GA 1F2DA 3NHLA 4JLAA 1L5LA 1AUQA 2PWYA 4TSFA 1Z0KA 3H84A 4DFDA 1X2EA 4TRNA 2BLLA 1Q7YW 2BN4A 3G6WA 4C3OB 4XGQA 1O6GA 2ZIZA 1IBMB 5BSRA 1PO7A 2NSDA 1C8KA 1TM5E 2VSYA 3ZWPA 1ZBQA 3N2IA 4KBGA 1VIVA 3IAM6 3RUDA 1XMSA 4V02A 3A1SA 1SUDA 4JJFA 3BIWA 3WADA 1NZDA 3ZHOA 1GKIA 5KTPA 1FE8A 4OBEA 4UTPA 2E74B 3FTNA 3W6UA 5DGCA 4JKIA 5DTEA 4R5HA 3MD0A 2WD8A 2A9JA 5JUWA 1GM7A 1JB1A 3N2GB 3ROFA 3RFXA 5AUQA 4FBLA 4ZOBA 1ZK1A 1QE3A 5FPPA 3WSTA 3W1WA 1SG0A 2YHIA 1C4XA 4EP1A 1RM3A 1C3OA 2QXUA 1W85A 3PX7A 2YINC 5G40A 3ONDA 3AFOA 5A71A 3E5RA 1YEWA 4QNMA 1XILA 3RS3A 4RD1A 3HJCA 4POOA 4N4AA 4N21A 6REQB 2FB9A 4XA8A 3TCXB 5C3UA 3ADOA 4BO8A 5C1OA 1NW8A 1NUHA 1IQ0A 3HWRA 2I6QA 5IWCA 2HCBA 1GO3F 4M0UA 4B75A 3BSYA 3TTSA 3C3KA 1VHWA 4JBWA 3PNSA 1NDQA 5BR8O 3WO1A 2WJYA 1MO4A 3Q4GA 3K1AA 1KY5A 1EG2A 4PC7A 4M38A 4TN1A 4B3XA 1W1IA 2LCQA 1H4QA 1O6BA 4AWXA 2ZCEA 4B1FA 2KW5A 4LRYA 1D04A 2ZYIA 5BORA 3FR8A 4YNBA 5E6UA 3DO8A 2A4KA 1Q7BA 2XQVA 1YB5A 4XAQA 2Y9MB 3DZ8A 1T5HX 2V5AA 1N7IA 5I5GA 2XNDD 3H2IA 4OYRA 3QVOA 2E85A 3FWPA 3LCVB 4LTNA 1Z73A 4LOIA 1ID1A 4B74A 2EZ9A 3KV1A 3OUFA 2WPDA 1AB3A 1Z0AA 4MX8A 3IEMA 4J6FA 3UO2A 5HFJA 5DBOA 4K88A 3GD5A 3QWFA 4NOLA 4GOMD 2Y4NA 2EKZA 4LMAA 5KYTA 3A6EA 4QGPA 1OZGA 1XYGA 4DXAA 3NGMA 4KDEA 1VHDA 2I29A 2WFLA 2NU8B 4L6CA 5CLQA 3Q0TA 1V11A 1YS9A 2OCDA 4I9QA 3OMNB 3I9KA 2XWQA 4EKYA 5GOTA 3BREA 5DEIA 2OORC 5LUAA 1OTHA 4J3NA 4BO1A 2OT3B 4YMIA 4KXXA 1FRFS 1POWA 1XOUA 2I1QA 2SCUB 3EVNA 5KNDD 3DT9A 4G01B 1OT3A 1JL3A 5HVNA 1D03A 2EIHA 5SY4A 2OKCA 1WUJS 1L0NH 4MJXA 4J76A 2JI9A 4TVBA 1XP5A 4ZHQA 1TRHA 2MSCB 3COSA 1GGMA 3RJ9A 4IJQA 4B40A 1H0KA 4IAOA 3PXXA 1T6YA 3X1KA 2PX5A 1BA2A 2EGHA 3O7MA 1YQEA 5SZJA 1P33A 3Q85A 3JD2A 4OREX 4CVNA 2CE2X 1C7ZA 5F2OA 4CF3A 4FQ5A 1P18A 2EW1A 3UIEA 1P7YA 5DNAA 3WAGA 3R3HA 1QP8A 4CIAA 2JLUA 4HJRA 2PF4E 2W83A 3GRYA 1UDAA 4LZNA 1YACA 4QGGA 3FYDA 4KQ2A 4JI1B 1RMQA 1KAHA 4MJ7A 3EDMA 2OV4A 1Z35A 5GADl 4BQPA 2YJ6A 4BXOB 2OBNA 4BCBA 3G59A 1XD8A 1P44A 4KO2S 4O08A 4QNHB 1R9MA 1FLDA 5HM8A 1ODKA 3I1FA 1JJVA 1H1TA 4LY9A 5ITSA 4CM8A 1RRGA 1J39A 2ZQYA 2COKA 3GFGA 1ZK0A 3VPCA 2R68A 1KS2A 2FPIA 3L7AA 1IZ3A 2O2JA 4E5SA 1B4DA 1QHXA 1NJ2A 1WOYA 2WNIA 4P08A 3W6PA 4R9VA 1J8VA 1QORA 3GRKA 3WICA 1BSVA 4MW6A 3QEOA 1HC7A 2ADOA 4R1TA 4BU1A 4KIGA 4GAEA 5DN6D 2IOFA 1HT2E 1G5RA 4IIVA 4JH0A 1YL5A 4MQ4A 4BMCA 3ZMTA 5A3RA 4RJLA 1KH1A 2DECA 3H3XA 3DUWA 3BAAA 2VJMA 3LHIA 3ILXA 5AM3A 4GH5A 3IT2A 3A9WA 5LBQA 5LP6F 2AFHA 1T13A 2BKUA 1EB8A 2FFRA 2PLFA 3H9GA 1NOKA 1Z82A 1IAQA 2M98A 2SKCA 2VDWB 1T2EA 3S27A 4JI3O 2LE0A 1ZU4A 1FAFA 3MW8A 4C04A 1CKEA 2NTJA 4WN9A 2Z58A 3K0CA 3NDRA 4A5UB 2PGXA 4M7RA 1SXJB 3B6EA 2VRZA 3VR5A 4KITB 3GVXA 5E1OA 1U94A 1UK9A 4O4LB 1SIOA 2FW7A 1E2EA 1ZK4A 4MKHA 3MJRA 1QLHA 4QRIA 5JQGB 1OKKA 3RLIA 1N5DA 1H5QA 1ZVJA 1QYDA 2FZWA 3WGGA 4WFBV 2C77A 2LKDA 3WC4A 4TMFA 2J4DA 1QGDA 2ALJA 5LIRA 3FFBA 4XCVA 2XQJA 1O94D 1KFBB 2HFJA 1N33B 5C8YB 3HK2A 1SKUA 2X1HA 2IDZA 3QYJA 3KAJA 4QHTA 4F97A 5FDFA 5JR3A 1IURA 2Z9DA 4OH1A 1KI3A 1UWKA 3UH0A 4KMSA 3B6ZA 1XQYA 3N2KB 3SSOA 4JA2A 5AI0A 3TSZA 3A4VA 4PTLA 3ZY2A 1DQZA 5B3JA 3S1AA 5EJFA 2QRVB 2XH8A 1DZIA 2ZT7A 1V6SA 3I5DA 1KDRA 2VHEA 1DBQA 3ZU6A 4ARUA 1NKVA 2CXUA 3ENZA 5CXQA 3JQ8B 3Q41A 3APQA 4P9PA 2EIKC 5AJHA 4G4JA 4R69A 4QGSA 3AR8A 3LF1A 2EZUA 4DV0B 5CPFA 1F7YA 2W9XA 2BONA 2BHSA 3N7UA 3TLGB 1U7OA 1WZIA 2NXNA 1E2KA 3RQIA 2FZ4A 1GV1A 4WSOA 2QI9C 3A9TA 3HJHA 5FV4A 1MHTA 5IKXA 4X71A 4I1YA 1FDVA 4JB8A 3DD5A 4FMDB 3WHLA 5DHAA 4BWAA 4MV7A 3HB0A 4RJIA 4H7PA 1PQYA 2I4NA 3GRRA 5EXEA 5BWLA 4PHFA 4HNTA 1SVNA 2KX7A 3JYCA 4TTPA 3GI1A 2FQWA 3PXAA 1ZL0A 5LQRA 4GUAA 1JHRA 1L3BA 1PI3A 3DDZX 4E51A 5CIQA 1G55A 4FHEA 1DPGA 4PHGA 3GT7A 3DEKA 4FZ0A 4UU1A 4A6EA 1HY3A 5HCIA 4EGFA 2RCNA 2Z5VA 4US0R 2RHOA 4HRXA 4YJ2A 5DN6G 2OAP1 2EBUA 5LA6F 4L73A 2YCBA 2PSJA 4QWWA 1NQTA 1OC2A 2FX2A 2XUIA 2Y0EA 3B2EE 3K0BA 2GLUA 3GB7C 1YCFA 4IL5A 1NKDA 3D2LA 3CLUC 3P27A 2PAFA 4B33A 3RJ5A 3P9CA 5IAEA 2ST1A 4EOGA 3P9ZA 3ABIA 4UAUA 5E6SB 2PKEA 2W37A 2LP4Y 4C78A 3LCRA 2QENA 4LV6A 3DEYX 2CD7A 2GRJA 1L1FA 1NJFA 1BE6A 3QY0A 1VOTA 1N4AA 4AJLA 3TIFA 4EKWA 1HNWB 3HJAA 3LLUA 3ZQKA 4M8IA 2DU8A 1JH8A 3LU1A 1UKEA 2JKVA 4R1LA 1VQ7V 1ADYA 5KJ6A 4A0QA 4ZOLB 5FOVA 3I56V 4BAYA 3C90A 1RM4A 1ZL8A 1J5EB 3WLLA 3UATA 4LF9B 1BH2A 3A3YA 2B61A 3IIIA 3CRAA 3ZR4B 1Y7HA 3HA2A 2HDOA 2JGRA 2JJ2D 4RVHA 2IU4A 3L9WA 4ID9A 1Z8NA 4B7XA 3P0EA 1K3EA 4PQRA 4HDCA 2KWIA 4RQBA 1G98A 5DYWA 1MF7A 5FWXB 1I32A 3E58A 2FFAA 3SYCA 3M3DA 5DSXA 5EN4A 3CS3A 1H9CA 1HNXO 4GMGA 1HW7A 5A4DA 1KZ1A 1E3TA 4KWCA 4QPJC 2IHTA 5ILQA 1ROPA 3MBIA 2JLRA 1N36B 3A27A 3U3DA 2QZZA 5E0OA 1WPGA 2CYCA 1YZ3A 1Q95A 4TT3D 2I8AA 3PUHA 4UCFA 2Y1FA 1MXHA 2O6LA 4ZO8A 3C2QA 3ZV3A 1FLVA 3KJFA 5C32A 1ODTC 3IKLA 3IAS1 4XVCA 3R0JA 3WOHA 2BTOA 1N4CA 2PZGA 3DB1A 4PC2A 2CNWA 2B34A 2YZ2A 4NESA 3QOWA 3AVVA 2OOSA 4GQBA 3EYWA 1UM9B 3VVMA 5JMTA 5FA6A 3ZEAA 1OI3A 3OIWA 4HGOA 2EC5A 3UOGA 5BSWA 4DG8A 2POQX 1QAOA 4HWGA 1L1RA 4K9OA 4LNAA 4WOPA 5ALEA 4JI7B 5KSPA 2QWRB 2GTHA 2MMCA 4FVTA 1I7SB 4R9SA 2DFPA 4UDNA 2BEVA 1K3UB 1NAHA 4CIXA 3BCSA 4RPHA 3UXHA 4LXUA 4CNBA 3EPRA 1C4WA 3C7CB 4NH4A 3MINB 1ULUA 3MJTA 4D82A 3I42A 1XEWY 1Y89A 5CITA 1DNPA 2AZ4A 3RADC 3OHPA 1B3QA 2DUMA 3RYFA 1IUPA 3ZE7A 4R2IA 3DWEX 2QP3A 3GJ6A 2YWHA 1JAIA 1EBBA 3I2IA 1XBLA 2ZR0A 2A92A 4RJJA 3TGPA 1WDTA 3EG9A 3KYDA 1OAKA 4XSVA 1GQOA 5B1OA 1QZ3A 3FX2A 3TTTA 4B3MO 4HS9A 2OB2A 4GI7A 3QBJA 1PFWA 3KIPA 1OFGA 1AKNA 4KFMA 3CCQV 1NUQA 4GSYA 4O4JA 3LQRA 5JCPA 4Q9KA 5DXJA 1Z5VA 9MHTA 1AURA 1KGSA 3H1HH 3ZVLA 3SVTA 1CE8A 3QI2A 5DTIA 4BNYA 3B7GA 2B8JA 2MSEB 2FUEA 2EAUA 1ZD5A 2WSBA 2JJ2G 1BL8A 4EPRA 5J2UA 2SICE 2R751 1DJPA 3T15A 1QVZA 1K8RA 4D74A 4INJA 1RMTA 4AJ9A 2V6FA 4IGIA 4C76A 2C2YA 4C20A 4BNJA 3GEBA 2JZCA 4AY5A 1ZMXA 4YMHA 5HGXA 2XDAA 1L5KA 3T9CA 2PS0A 2P5YA 1P4GA 4N40A 1INLA 4BUJA 4UHJA 3T99A 4DV4O 1SC6A 5C1IA 1YULA 1SUAA 3REOA 4FZ1A 5THQA 1EM6A 3U5ZB 4XWKA 3GP3A 3P9NA 1RJGA 3RRMA 4CR8A 3RFFA 1YGPA 2OV1A 4WLNA 4TT3G 2AZXA 2C3YA 3MAGA 3R5FA 4CTJA 2ZSAA 3W3AA 3IGAC 1K3FA 3M49A 2WB2A 1Y34E 3IUPA 1YR3A 2YNMA 4TMZA 1GPDG 2PA0A 2FN7A 1OSNA 1NI5A 5ALNA 2IK8A 4BNUA 2P69A 3U3JA 3O8CA 2ZWPA 5ITZB 4J03A 4Q9DA 3MS2A 4RC9A 2WV7A 4YJDA 5F5NA 3THWB 4TLMB 5HQ3A 2OZVA 2ZXWC 1RU3A 5BN4A 2AL7A 3RT1A 5D7NA 1AV6A 4BTLA 3T3OA 4PA3A 1UP4A 4U7WA 3GPDG 3AIIA 3KQYA 3DR5A 2HM7A 4TQGA 4BLOA 4MVJF 5COAA 3PE3A 3TGWA 5LMNB 3FH0A 4XI9A 2NN4A 2OAQ1 2GBPA 3GL9A 3ORSA 2HWYA 4UVAA 2HIHA 1P0FA 4L8GA 1EN6A 1XA3A 2VP0A 3CO5A 5CB4A 2LKCA 2O6HA 1MPTA 4PYRA 5TT1A 3B2EA 3E6AA 4GKKO 4GPBA 1POXA 3CUSA 3H7AA 3ASVA 2P2SA 3QMVA 2IYEA 4MI3A 4WD3A 4ZCSA 1LUVA 2ZZNA 3PQEA 1E2DA 3BWVA 1M57B 4TS9A 1M34B 3PQ8A 4QZVA 3FB6C 1T6ZA 4F8YA 4XUEA 4YHHB 2JLSA 1M4UA 1L3IA 5CG1A 3AI1A 3CCRV 2GYVA 5KDLA 5GIOE 4ZWNA 2X22A 1YHYA 1P8JA 4UVDA 3WKCA 1JQ5A 3R3ZA 4GIBA 3LK7A 5CDFE 3FDZB 5TMPA 2I91A 1M7GA 2YBDA 4ILEA 3EBOA 1H2GA 5DGIA 2OM2A 1QJCA 4TXJA 4YTEA 2H4HA 2QVLA 3EAQA 3HHPA 1LPMA 1S3JA 1SOAA 1Y6RA 4TTIA 5C53B 5ALVA 1EVKA 3L4JA 1JG7A 5EVJA 5FLKA 2ANCA 4ZV9A 1AKUA 2ID7A 5CCXA 1UPBA 1QCCA 4J7KA 5IJAA 4DW8A 4UPDA 4UXHA 3K5HA 1IN7A 1Y7TA 3BAFA 3UW3A 1XZQA 1QBZA 3WA7A 1SVUA 3D2BA 3WJ7A 4O4IB 3ORHA 3SDBA 1ZJ5A 1U81A 1JWAB 4DDVA 4KC0A 2YXLA 1YBMA 4Z1MA 2VS1A 1SFRA 4ER0A 3K57A 1T36B 1W4ZA 2QX7A 2WLKA 2C4UA 1SQPH 2HF7A 1FNCA 1ULZA 3AB3A 3OZBA 3LWDA 3GLIB 1BKYA 3ZIDA 1B74A 3IR6A 3OURA 4IR7A 1PS8A 1ZP6A 4AP6A 3L6EA 4PVCA 3OZTA 1ZONA 2O3TA 2A0LA 5E1MA 4WFAV 1NF9A 3CCEV 4MA4A 1SQBH 4WCFC 3KVYA 3IUNA 1CNMA 2VBGA 4GRIA 1I1NA 3B9RA 5DNVA 1GYRA 2IE8A 1V9PA 4BMVA 4HSGA 4WKNA 4F9TA 2PMBA 3DMPA 2ZT9B 2AZ2A 3OQJA 3CJHB 4PDRA 3ZWKA 2DBZA 4KQFA 3RGBA 5LDDC 3CNHA 1UKVY 2R6HA 4I7ZB 2X0NA 3SJAA 1QZTA 1AKMA 5KOJB 1KJWA 1IUNA 1VMAA 2PUJA 4R8RA 4TLCA 3ILHA 1PLJA 3P32A 1C7IA 1DXOA 1ZR2A 3GARA 5DHSA 2BLNA 4Y9DA 2QHXA 4KXYA 3U9SA 2OCKA 4JTAB 3WKDA 1ISMA 5FI3A 1WEKA 2H1IA 3MIZA 3KXLA 4YRJA 1KSHA 2X4GA 3TO5A 3VH2A 1IN4A 3RVZA 4LOAA 3FAVA 1P1BA 2Q6LA 2AC2A 3UB3A 1AGYA 1K6XA 1JXAA 3VO2A 4NMMA 4GZ3A 2WG2A 3KLMX 4ML3A 4NRDA 2BBTA 1YR7A 1JMVA 2OTLV 2QW8A 4CH5A 2AV6A 3LFTA 4FDMA 1M6YA 2EIJB 2C1EA 5LMZA 1SU6A 3D8TA 1NU6A 2B9VA 4OQLA 2WHEA 1ZICA 5EJ8A 1H69A 1RZRA 2C3OA 2J9RA 4IIBA 4WUTA 1CK4A 2PFSA 1IATA 3HXQA 1TDJA 2Z6AA 3A36A 3O3MB 1KE2A 4NXNO 3RN4A 5EBMC 1K5HA 1P29A 4JLWA 4RSGA 5AVSA 5AICA 1EZZA 1ZN8A 4YCAA 1E0KA 2BAGA 3OD5A 2JS5A 1O03A 3K70C 3L0ZA 5JAOA 1OU4A 4UTVA 1PVOA 5KOHB 4UXIA 1F6DA 1H9BA 3ZWAA 3DXFA 2HC9A 2VH2A 3RC8A 5DTRA 1NJ5A 4W9NA 4ZIRB 4BNGA 3RGWS 1LSJA 1R8XA 4LS3A 5BNWA 2IKSA 1JQLB 4D8UA 2JFXA 4HDKB 5D87A 4WNCA 3ELBA 2ZYUX 1QRUA 3BABA 3G13A 1DAOA 3VO9A 4O3MA 4K1XA 3BIJA 2HJVA 4D92A 5L3SA 1M76A 4ERXA 4DM3A 4J91A 5FOWA 3FLAA 4EKGA 3LGXA 3Q1KA 1U2DC 1CXZA 2WMYA 4HNRA 5LWHA 1BYIA 3ZZ1A 4J7XA 1IU9A 5I9MA 1OI2A 1TCVA 1Q44A 5DNUA 1KY4A 3RSGA 2I9KA 3SK0A 4Y9SA 5EC2C 4LF8O 4AWBA 2FEMA 4BMDA 1HUQA 3TCUA 3W5HA 2QMQA 1NJIW 3HE3A 5C93A 3E05A 4JQZA 4AJJA 2UZAA 3GGPA 4JXJA 2ATCA 3GRFA 4MVUA 3KQTA 3TTWA 1M1YE 3TXXA 3VHRA 2HZBA 1FEZA 2O7VA 1O08A 2WWFA 3VAZA 1J21A 4HRVA 1SWVA 3Q5EA 1LDYA 3M89A 5GAJA 1USWA 3C8DA 4GXTA 3WZLA 4HAXA 4WEQA 4LF7O 3FSEA 4BNMA 4KEAA 1L8DA 3VOUA 1OB2A 4ZCRA 2QKAA 3HGMA 2Z56A 4JT4A 2I3AA 2O8CA 2O8FB 1HYBA 4ZKDA 2HI0A 4Z9FA 4DSTA 1DG3A 4CLOB 1G7TA 1WXHA 2VTDA 4GPTA 3ODGA 3OZUA 3ODPA 3AG4C 4EYSA 5LZ9A 4C2UA 3D81A 3OA0A 1ZM9A 3C4VA 3AUTA 4XGRA 2W6IA 1R0YA 2LDBA 3TQIA 1CZKA 2YXNA 3O91A 4M87A 1QLJA 1X1QA 4I1PA 3UXEA 5TR9A 3H1GA 5T8KC 1MGPA 2IXTA 2HWWA 2JHPA 1TADA 4HYQA 2CTWA 3GMSA 4D3XA 2OD7A 5K6AC 3ZOKA 1UXHA 1YMVA 2JH8A 4KLRA 2A59A 2OVBA 4LF6B 2JJ1A 1ZH6A 1WG8A 1ZAUA 2P90A 2QNIA 5G3YA 5PGMA 2ZT5A 3FPKA 3ORRA 2WHQA 5BVHA 1CUHA 1WHTB 4N5LA 3MN1A 3ET4A 2VJYA 4Y1RB 4LHXA 4DMRA 2RJ3A 4G0NA 1E7YA 4WTOA 2HN9A 1LBHA 5GVSA 2ODNA 1NSTA 3BXEA 4UCUA 1YIAA 2X19A 1IZ8A 1PJ8A 4DJJA 3QFFA 2FJ0A 1FBTA 2BOCC 2G5TA 4XDZA 2DQ0A 4BKUA 5I47A 3L1IA 5J2TA 4JY7A 3D7MA 1RWMA 4CCYB 4GUDA 2Q8NA 5H02A 4TX1A 1AF7A 4NPCA 3NIBA 3WK4A 2WKWA 4GKBA 4WNIA 3L1KA 3F9RA 1OAOA 5B57C 1DRKA 3VM6A 3PRJA 3N2YA 2MSLA 4GYCB 1H8ED 3VPDA 4QBHA 3VGPA 5CCEA 3OFKA 3V4SA 3F5WC 3BMCB 1ZCBA 1MZEA 5BT9A 1QDLB 4YIKA 3LPAA 5LJIA 3F7MA 3BIFA 1QPGA 2C3PA 2BMAA 4NBNA 5HSGA 4D8TA 2RARA 2C99A 1GTOA <