3OUSA

Mthk channel pore t59a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIAAVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title Tuning the ion selectivity of tetrameric cation channels by changing the number of ion binding sites.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Membrane protein
total genus 30
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2010-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ousA00
3TETA 2ZXWC 4PA6A 4XDKA 4HYOA 2AHZA 4RAIA 3E8FA 3T1CA 5B3SC 4RUEA 4X89A 3K04A 4P9OA 2X6AA 3SPHA 2A9HA 3OUFA 3UM7A 2DYRC 3SPIA 3WG7C 2X6BA 4DXWA 3FB6C 4G28B 4KFMA 2IH3C 2WLLB 3IFXA 4PA7A 3AG4C 3SYCA 5B1AC 3SPJA 3K0GA 3OR7C 1R3KC 2IH1C 2R9RB 4MTGA 1R3JC 4RUFA 1R3IC 4G27B 3IGAC 4R7CA 3LUTB 3ZRSA 2WLIA 2WLMA 3SPGA 4MSWC 4MTFA 4MVZA 1P7BA 3AG3C 3OR6C 4WFFA 3RVZA 3RBZA 4PDRA 5KUKA 1J95A 3T2MA 1JVMA 3RVYA 4X88A 3BEHA 2AHYA 4JTDB 2ATKC 2HG5C 4PA4A 5CBGA 3E8GA 3AG1C 1KKDA 3E8BA 2QTOA 3F5WC 3SYQA 3UKMA 4QNHB 1S5HC 4R50A 3VOUA 4J9ZB 2WLKA 4PA9A 5J9PC 2Y69C 4PDLA 4UUJC 1K4DC 3JYCA 1XL6A 2HJFC 2A79B 4WFGA 4XDJA 5BZBA 1M57C 3SJQC 4MTOA 2DWDC 2EIMC 4MVQA 5EBLC 5IY5C 5EBMC 3X2QC 2ITCC 1LNQA 4MW3A 3SYOA 4QE7A 1QLEC 3LDCA 4HZ3A 3RW0A 4H37A 3ASOC 3ABLC 3F7VC 4P9PA 3KG2A 4MVRA 4TWKA 3ZJZA 3ASNC 4WFEA 3T4DA 3FB5C 4R8CA 2DYSC 3AG2C 4LCUC 4ZBMA 1K4CC 3TCUA 4LP8A 3FB8C 2BOCC 4MVUA 4MS2A 4PDVA 4LBEC 4EKWA 3ABMC 2WLIB 4X8AA 4GX0A 4WFHA 2ITDC 3SYPA 4CBCA 4MVOA 2A0LA 3K03A 4GX5A 4RO2A 3K08A 2KB1A 3PJSK 1BL8A 1ORQC 5EBWC 4PDMA 2OCCC 2Q67A 4XDLA 4MVSA 1G4YB 2HVKC 3T4ZA 4OXSA 2HFEC 4PA3A 3F7YC 4I9WA 2EILC 1ZWIC 2ZD9A 2WLHA 4QE9A 2W0FC 4P30A 5KUMA 5EK0A 3GB7C 3SYAA 3OGCC 4GX2A 2BOBC 2P7TC 2DWEC 3ABKC 3E8HA 3FB7C 3K06A 1V55C 2H8PC 1V54C 2EIKC 5CBHA 1OCRC 2YEVA 2QKSA 1R3LC 3OUSA 3HPLC 2WLJA 5B1BC 3LDEA 3E86A 2JK5C 2Q69A 4P2ZA 4JTAB 4H33A 1OCOC 1XL4A 4GX1A 5E1AC 4F4LA 5CBFA 3K0DA 1M56C 3SPCA 2WLNA 3EFFK 2Q6AA 4JTCB 2EINC 4R6ZA 4BW5A 3LDDA 1OCZC 5EC2C 2WLLA 3E83A 4J9YB 3LNMB 4MVMA 3STLC 2NLJC 2Q68A 5EC1C 1OCCC 2HVJC 2K1EA 2X6CA 3E89A 2EIJC 3STZC 3R65A 4MW8A
chains in the Genus database with same CATH superfamily
3NXSA 1COWG 3SPHA 2ADPA 1NQTA 3UM7A 2QGNA 2M7WA 3WB1A 3RFRA 1PL0A 2ADQB 1H2LA 2YI9A 3ZEDA 4CS3A 1VQ9V 1H8HG 1M57B 2LGWA 2UXNA 5IJ0A 1XHXA 3RBZA 4W4KA 2YSUB 2XAGA 3CRQA 3ABLB 4UV9A 3G71V 4DR4O 2DQ3A 3E8GA 1PP9H 1Y4MA 2WLKA 2P67A 5LMNO 3OAAG 1ZTEA 3KCYA 3ETQA 1AROP 1DLBA 4CH6A 4WFGA 2OCCB 4ZHQB 1KC8W 4DUZO 1SQGA 3D36C 1QLEC 3LDCA 2K9PA 3RW0A 1WP7A 2EIKB 4ZOLA 4JI4B 5KMGB 4LC1A 4Q20A 4E2LA 4D7SA 4WF9V 2CTPA 1XNRB 3BFRA 3UCSC 1QBZA 4MVOA 4ASUG 1KYOF 1VP7A 3B8NA 4GX5A 4GKKO 1AVMA 2CH7A 4DV1B 3WB2A 5GW7A 2UXBO 1GN6A 4NXNO 3SYAA 4O2AA 3FB7C 3K06A 3MAQA 1Y74A 1I7FA 5C8YA 2PZSA 4UCRA 3CS5A 1MZEA 3A0HZ 2HKOA 4YY3O 3DXRB 1LUVA 4J41A 1NU1H 1P49A 4NKGB 3OW2U 1XMOO 5BY1A 2Y4UA 2BE3A 2Q68A 2X6CA 4NXNB 4XDKA 1QVFU 5GONA 4NXMB 1MABG 3OTOB 2BTOA 4J42A 4JZ2A 5KHJA 1NTMH 4OX9B 2WLLB 2EBOA 1XMQB 5LGTA 1KQSU 2KG7A 1DF4A 1AI7A 2WLIA 2EIMB 1P7BA 3ETEA 4DV3O 2UXXA 2XUMA 3ZMSA 2VRZA 1EN4A 1KKDA 4QNHB 3H9VA 5HFLA 2CTWA 4LNUB 3AK2A 2Y69C 4FZ1A 4PDLA 1GN4A 3BVOA 1SF9A 5H9CA 5A9GA 4JI5O 4YHHO 3SJQC 4MVQA 3MD0A 4KHPO 5EBMC 3I55V 3SGIA 3KG2A 4QJFB 3RT3C 3FB5C 4UB6Z 4PV1B 4LP8A 4J7KA 1SA0A 4LBEC 2ZT9B 4EKWA 1Q8IA 4FFBB 1MMMA 4LWSB 4JI8B 5B1NA 1IBLB 2KB1A 4TUYB 4JI0O 5IJ9B 5HFMA 2W0XA 2E76B 1SETA 4ZI7B 4UFZA 4I9WA 4F4LA 2CAZC 1FXHA 4GX2A 1HNXB 1H2MA 4TV8A 1GTOA 2QKSA 2HR3A 2YEVA 3BAAA 4TOIA 1AI4A 3RYCB 4I50B 2NN4A 1EFRG 4X65O 3KCXA 1EN6A 3CXHF 3A0RA 3IAYA 1OCZC 1JA8A 1OV9A 1FXKB 2DOSA 3CYOA 2Q8VA 2RCVA 1VF7A 1K9MW 2ZIOA 3C90A 3JD3A 3OUFA 1KKCA 2VS0A 2DYRC 2RQ6A 1KMIZ 4LF9O 4B7KA 2MK3A 2QDOA 1IX9A 4RQFA 4U7OA 3CCVV 4JV5O 2NNUA 2UU9B 2Y48A 3IGAC 4JI6B 4YIPA 3AG7A 1RP3B 3FX7A 3N27A 1K7DA 1N34B 2EZOA 2IJKA 4DR5B 2IBZH 4GYCB 1WNSA 1J5EO 3AG1C 5EIBC 4B3SB 4JI3B 4BAYA 2WA4A 5LL6Y 4WBNB 2WWWA 4JPRA 5B5EZ 4LFBO 5BMVA 1RPOA 2Q0OC 1Q86W 4X20B 4K0KB 2OWOA 4H37A 5LGNA 1TUEB 3I56V 2M6YA 5CA1A 1SQXH 1TA8A 4O4HA 2VQFO 1VARA 1VF6C 1AILA 4F6RB 3K03A 3W7WA 3LSQA 1ORQC 1NVPD 3E22B 2ZXWB 3T4ZA 4LFAB 2B1IA 4RQEA 2W0FC 4P30A 5EK0A 2P22C 1I5XA 1ZL8B 4GCZA 4O2BA 4DV2B 1CXZB 3WG7B 5AG2A 5CBFA 1X4TA 3SPCA 4OPHA 4FLZA 2EINC 1TUBA 3NR7A 5B1OA 4LF5B 3AG3B 2HJDA 5JJJB 4PA6A 1GK9A 2ZDIC 2P5OA 1SZTA 1F23A 1K73W 2X6AA 4X1YA 1SERA 1YTFD 4QPJA 2LQTA 4JF3A 4BW9A 1IBKB 1H2GA 3LNNA 4UB8Z 5F2VO 3X2QB 4BIOA 5L3DA 3DC6A 4X88A 4I4TA 1HR0O 2E5LB 4DR7B 1HP8A 4N21A 4EEQA 3ZCCA 3SYQA 4LF7O 3ABMB 5IJ0B 4DR2O 2W6JG 3WFVA 3L71H 2UUBB 3ZN1A 4MTOA 2ITCC 4MW3A 2JVDA 1AP5A 1HR0B 5IYZA 4IYHA 3ABKB 3ZJZA 5EZYA 2ZNIA 3QO5A 2QWPB 2A3QA 4E4EA 2ZR2A 4PDVA 1BZKA 1FD9A 4CC5A 1GKFA 2A0LA 4RO2A 3HB3B 5A2QN 3RYHA 3OEEG 1DGSA 3L72H 1N36O 3HKEA 4XDLA 2EIJB 4ZOLB 3L70H 4FIPC 1JFFA 3QVNA 1OZ0A 4QE9A 1VQOV 5IYCO 3JD4A 1IURA 3E8HA 4GT1A 3ZMVA 4BWAA 3I5DA 1FFXA 2PGGA 2HP8A 5CBHA 4KUMA 5JH7A 4JI2B 3IC7A 1VQ7V 2B9ZA 4OPAA 4DR3O 4GX1A 5FL7G 4IGGA 1JJOA 5EC2C 1Q6HA 1YIJV 3L73H 4O2AB 1MG1A 1BSMA 5EC1C 1Y74B 4K8ZA 1XNQO 5C8YB 3CWBH 1NTKH 4X66O 1S72V 1SQFA 4WFAV 2PUSA 1YI2V 3QTCA 4EFBA 3D36A 1QR8A 1DK1A 1GO3F 3QF7A 2JRIA 3ZN0A 4LF6O 3ZMTA 2R9RB 4MTGA 5GONB 3A0BZ 4H13B 3B8MA 2IW5A 1N32B 2CDYA 4JZGA 3SPGA 1IBMB 3C3SA 5LHGA 1WN7A 3CJHA 4HNAA 3ZHTA 3ASOB 2E74B 4YIOA 3UO3A 1VQKV 2KG7B 3F5WC 1Y67A 1AB3A 2GHYA 2Z5UA 4DW0A 2ZM6O 2R9AA 3JALA 4FLVA 5DM6V 1W2BU 1XL6A 4H0LB 4DR6O 3CCLV 5JCOC 1LUWA 5IY5C 2JS3A 1AR1B 1VQ6V 1V54B 3L74H 3CC2V 2DYSC 3AG2C 4FLXA 1OCOB 4JI7B 1HNZO 1H2KA 3N2GA 3SYPA 1I94O 5KHKA 3PJSK 2GSMB 1Q81W 2RN9A 1KP3A 5CA0A 2LFSA 4DV4B 2QWQB 1HNWB 1P84F 1I5YA 2N04A 5J2UA 4PA3A 2UUAB 2FB5A 3CD6V 1K3EA 1SA0B 5B66Z 4JI1O 1V55C 2F23A 2ZIMA 1OCRC 4LFCO 2GTAA 3OUSA 1VQPV 5B1BC 1XI1A 4JTAB 1W59A 3CX5F 1MZFA 3K59A 2VQEB 1MSDA 3EFFK 4K3AA 4X64O 2A7WA 2LJ2A 5J2TA 3WB0A 1GM8A 1GAXA 3JAWA 4DUYO 4J9YB 1VQLV 3H1HH 4N23A 4TV8B 1PPJH 2YEVB 1NI8A 4FMTA 1NTZH 1FKAO 3OMIB 4NTWA 3BRCA 3QG5A 3BY6A 4FLUA 2UXDO 4G28B 5DEDA 1G1XB 2GV9A 2DE0X 3CMEV 4LH7A 1SQPH 4LF4B 2JGUA 4DV5B 4UVCA 4MTFA 3OTFA 4AILC 1NVPB 3ETDA 4I7ZB 5IWAB 1S76D 2HG5C 3CCQV 2CUGA 1XEQA 3VOUA 3HKDA 5IDJA 2JGDA 1AP6A 2UXCO 1ZX3A 5BZBA 3MHHC 1CEZA 4WFBV 4PELA 3K3WA 3BPZA 1SKVA 3F7VC 1M1KW 3SR2C 1YTFB 1S0VA 3TCUA 2AGAA 3RGBA 4NR1A 5BMVB 1TAEA 3TXSA 4DV7O 3ZS8C 1KUQA 5CA1B 5LA6B 4JAUA 2JS5A 5B3SB 4DR4B 1URFA 4O4HB 2BOBC 1YITV 4JAVA 2H8PC 1GN3A 1NBMG 3IJ4A 3CRMA 2WLJA 4UVBA 2EZPA 3W7SA 2JEUA 1XL4A 4H33A 5LMNB 3T1YO 4O4LA 1GM7A 3ZX6A 2JJ2G 1PL4A 4L87A 4IIJA 2ZINA 4CH4A 1U97A 2HEPA 3LNMB 3RYFA 4DUZB 4O2BB 3CMAV 3E8FA 1OJHA 2Y0PA 1M93A 4X89A 2HHHO 4GKJO 2X6BA 1TUBB 4DXWA 4LF8O 1Q3EA 1QQCA 3G6BA 5ITZA 1FFTB 4U3FH 2IH1C 2QJ1A 2X0LA 3CP1A 4RUFA 3HKCA 4EFEA 5LBQA 4GKKB 1KECA 4CS4A 4YXWG 1OHHG 2UXBB 1VF6A 2XOKG 5LP6A 3JCUZ 3U0ZA 3BEHA 5L3FA 3FAVA 3TGUH 1MA1A 3ZHUA 4YY3B 2ILMA 4IL6Z 3AK3A 1XMOB 4X62O 1K34A 2A79B 3Q4HA 1MNGA 2DWDC 4I4TB 1IZ3A 3D3IA 3L75H 4J7JA 3SJCC 2YXHA 2JEXA 3JARA 1UFIA 2ZDIA 5K1XA 2XT9A 1M56B 5FPOA 1WPXA 1B6QA 3CCSV 2ITDC 5KA6A 4B3TO 3K08A 5IYZB 1BL8A 3THOA 3QO8A 1OCCB 1UPGA 3GVMA 4MVSA 5EZYB 4DV3B 2OTJV 2EJRA 4D6TH 3OMNB 2EILC 3EHBB 1S77D 1JPXA 3P30A 5BR8O 1QLNA 1YF2A 1S5JA 1N33O 5E1AC 2WAMA 3B09A 5CMUA 3HKEB 3JCZA 5KX5B 1AJQA 1BT8A 4JI5B 4YHHB 4KHPB 3M7MX 2YICA 3OE7G 3E89A 1FFXB 4G2KA 5JH7B 1RM1C 1YZBA 4DV6O 1AR5A 3M99B 2GUZA 5H5NA 4UCUA 1KB9F 3ZHVA 5JWPA 1FAFA 5B1AC 3SPJA 2W6IG 3MHSC 1BE3H 3ABUA 3H1LH 1N4CA 4JI0B 3LUTB 3N2KA 2RJZA 4PDRA 1QLEB 1ZSPA 1JVMA 1L0LH 3AK1A 2BTQA 4PA4A 1Z5VA 2PF4E 1VEWA 2VWKA 1BMFG 4X65B 1VQMV 4PI0A 3J80N 2F93B 3OD4A 4O4JB 3CJHB 4HNAB 3JYCA 1YJWV 1N0NA 1LNQA 1Q6IA 2ZE5A 4P9PA 3D8CA 4RWUA 1QVGU 1RFYA 1BHBA 3JALB 4PI2A 2IJIA 4LF9B 3OT7A 5IT9N 4Z2WA 4JAAA 2AW9A 4JV5B 5CA3A 3FFQA 1K5SA 3LSSA 1O9GA 3RWRD 3B2EE 1JOYA 1S5LZ 3CCMV 3W7TA 4TSFG 2DN9A 3FYEB 4AI8A 1ZWIC 2FMLA 5KUMA 3ZMUA 1J5EB 3N2GB 3CCUV 1R3LC 2E75B 2QWNB 2QKAA 3ZIAG 1W0KG 1WLEA 3HR0A 3K0DA 1GN2A 5CA0B 2Q0AA 4ICGA 5J2UB 3E83A 5LP6C 4LFBB 4JYAO 4B7EA 2ZE6A 3BHPA 3K9SA 4HYOA 5KHHA 4I55A 5JCOA 5LHIA 2ETNA 1AJNA 2DW4A 3K79A 1DF5A 3W7UA 3IFXA 2VQFB 1WA8A 5JQGA 1YJ9V 2Y69B 3OR7C 1VF5B 1R3JC 3SJBC 3ZRSA 1N8RW 4MSWC 3UQ8A 2UUCO 4YJ3A 1VQ8V 2AHYA 4JTDB 2QEXV 2QM4A 2JDIG 3UKMA 5KHGA 3G4SV 1D5NA 5J9PC 4B3MO 1W0JG 1GRJA 4Z1MG 1H38A 1NR7A 1E1RG 1R1BA 2F43G 2DJVA 4QE7A 3K57A 1WJZA 4HZ3A 1TVKA 3HKDB 3S3XA 4TWKA 2PY5A 2LW7A 3ASNC 4WFEA 2JGDB 4X1KA 1NZ6A 4AQYO 1K4CC 3CEIA 1RSOA 1XDCA 2F66C 3CRCA 3P32A 4FFKA 4GX0A 1BS3A 1OCZB 2RNBA 3BCCH 4FJCC 4DW1A 2RDCA 4IHJA 1XBLA 4I0XA 1QCEA 4OXSA 2B1GA 4X1IA 2ZD9A 5CN0A 3SYCA 3CCEV 1L0NH 2L35A 3OGCC 4I9QA 2LP7A 2DYRB 1YVWA 2BCCH 1WB7A 1FJGO 4LF7B 1G8MA 5LYJA 1VIBA 4JTCB 5LXTA 4DR2B 1BQZA 5KA5A 4DV0O 1YDXA 3UO2A 2AZ2A 2H3OA 2Z3YA 4RAIA 2YS8A 4P9OA 1JJ2U 2A9HA 2C2AA 2QWOB 4O4LB 3OEHG 2DQ0A 3AG1B 1NR1A 4IIJB 5LGUA 3P3NA 3AG4B 2XAFA 1NKDA 2CH7B 2QWRB 4J11A 2GBOA 3CE2A 4FLTA 1N36B 1XREA 1YEWA 2Q7HA 3RVZA 1AI6A 5ITZB 2ATKC 4DR3B 1Z5WA 3EXAA 4ZKIA 3HKCB 3IC9A 4NVPA 1YCIA 2Q9LA 2GTSA 3RYIA 1PNMA 2F1MA 1SESA 2HJFC 4TQFA 5IE9A 1YSCA 2BSKA 4XBFA 4FM2A 1M57C 5EBLC 4FK5C 1L1FA 1XNQB 3MDSA 3FAVB 4U3JA 1FPOA 4X66B 5LMUO 3ABLC 1FXKA 2ZKOA 5D5PA 1FS0G 2XASA 4PHZA 1JR9A 4LCUC 5FNVA 4DYLA 4MS2A 4LF6B 3ICXA 2WLIB 1EZJA 2EINB 1SQBH 3BA9A 2XNDG 1V9PA 3F5TA 3GWKC 3APQA 2QE7G 5LHHA 2OCCC 1G4YB 3JARB 2WLHA 2DWEC 2VWJA 1Q6UA 2EIKC 5L3BA 1U96A 1EZVH 5JVDA 2EULA 3E86A 2ZM6B 3DC5A 4YJ2A 1NH2D 4EB6A 3OM3B 3K58A 4DR6B 4B3RO 2XHBA 2HLDG 2HVJC 1K5QA 4MW8A 5FPRA 1BCCH 2QKCA 1JCHA 4DR1O 3JD0A 5DECA 4GZRB 2D3OW 2IH3C 1HNZB 3CRAA 4X9QA 3VQVA 5C93A 1I94B 1QHTA 4PD4F 4JASA 2YUAA 2GUZB 2E3CA 3J81N 1IDSA 3RVYA 4JI1B 1ZLZA 4LFCB 3E35A 2WA3A 2RMKB 1PKXA 2WSSG 4ABMA 3N2KB 4X64B 3T1HO 5CB4A 4UCTA 1F4NA 3CB2A 4DUYB 1F7YA 3VQWA 2EIMC 2BTQB 2ZCEA 1M90W 1I0HA 4U7NA 2F4VO 3L9DA 5H6RA 1R6KA 2UXDB 3JSLA 4LH6A 1XHZA 1PV0A 1K92A 1XOUA 1GH6A 5GTIZ 2V1DA 4J80A 4KL1A 3S3WA 5H2FZ 2YIAA 3JATA 4CH5A 1JMKC 3K5NA 1WPBA 3UT5A 3JASA 1D2DA 1R6NA 3B4SA 4KP4A 3LDEA 2GDSA 3DGEA 1ZAUA 4R6ZA 4BW5A 1FYJA 2UXCB 2FTKA 2Y4TA 4MTXA 2K1EA 4UUJC 3JD2A 3ZHSA 3TETA 3B40A 2YI8A 3JAKA 3VBBA 4JI4O 2A06H 4TT3G 3ML0A 4UV8A 4UCVA 2KQXA 1XNRO 4DV7B 2O57A 2EX3A 4G27B 4I55B 1WB8A 5IY5B 3DTUB 4WFFA 1FXKC 1JQ0A 4DV1O 3CHXA 4HBNA 2LW1A 4Q6GA 4A5UB 1WA8B 5JQGB 3CPWU 2DYSB 5TISZ 3AG2B 2CK3G 3E8BA 2QTOA 3T1YB 4GUNA 1BHAA 3CCRV 1M9NA 2ZQMA 2KSDA 1IXMA 3G6EV 1QNMA 2QM7A 4XDJA 4MT8A 4YJ3B 4J10A 4JYCA 2FKXA 3ZHQA 4O4IA 4FZ0A 3TJTA 4X1YB 5KAIZ 1NT2B 4FLYA 1ENVA 2HHHB 3TK1A 4GKJB 4DK1A 1Y76A 2XAJA 1V55B 4NXMO 3OTOO 1OCRB 2JIZG 4LF8B 3OMAB 1EM1A 5B1BB 1WP8A 4OX9O 4ZIBA 3FB8C 2BOCC 4MVUA 1G6UA 1XMQO 4WFHA 1PNKA 2V4DA 1TVKB 5LOVA 2HVKC 3E2EA 2ZE8A 4X1KB 1RPRA 2HFEC 2ZNJA 4GLXA 3CCJV 1RSOB 3ABTA 3H01A 2Q69A 3OFNG 4K8XA 2Q6AA 4IHJB 4DRXA 5EIBD 2Q7EA 4I0XB 4X62B 3LDDA 2N74A 4X1IB 4DK0A 3STLC 3K5LA 3R65A 2OIEA 2ZXWC 5KAFZ 1X59A 3G67A 3W7XA 1DTOA 4CZZA 2ZR3A 2OTLV 5LYJB 5LXTB 3SPIA 3WG7C 3FB6C 3ETGA 4F6EA 3JAMN 2YIBA 1UJWB 3RYHB 1PD3A 4B3TB 3D3QA 1JFFB 1R3IC 4JI8O 2YXYA 4L8JA 1IBLO 2CGNA 3AG3C 3HKBA 1E1QG 4JYYA 5BXZA 2X7RB 5BR8B 4QGPA 1TGOA 2IU3A 5CBGA 5L3CA 1HNXO 5DN6G 1N33B 4I5SA 2P06A 4FLWA 4J9ZB 4PA9A 1NH2B 3ZRWA 3U10A 2ARHA 2D2CB 3SDLA 4CC6A 1SQQH 3X2QC 2PYLA 4UCOA 4DV6B 1VQNV 4TV9A 4FVMA 4JYBA 1S3JA 1YHQV 3RYIB 1ROPA 3DSQA 2BSKB 2XTAA 3ABMC 2CGOA 5EYPA 2PI4A 4U3JB 2H94A 2UU9O 5H6QA 4JI6O 1NJIW 1GM9A 3CSXA 2CTRA 3FD9A 3FYIB 3H1IH 5FNVB 1N34O 2YIBD 3ABKC 4DR5O 2XAHA 3KKYA 4B3SO 3H1JH 4JI3O 1P4RA 1PM9A 2Z0AA 1XILA 1THZA 2EIJC 2G38A 2AHZA 3BABA 5JVDB 1BQ0A 4RUEA 2N05A 4K0KO 2MW2B 4QPKA 3C3TA 3G80A 4YJ2B 4EB6B 1K8AW 2JJ1G 4HAMA 1Q90D 2P90A 4PA7A 4BIUA 2OT5A 3AG4C 3PN1A 2QTSA 3KZIZ 2P4VA 1XUQA 4MVZA 1XQ8A 4LFAO 1EBOA 1B04A 5LA6A 1E79G 4ZHQA 3R66A 1US6A 4DV2O 5KHIA 1K97A 5J2TB 2Y0IA 3JAWB 5KMGA 3JD1A 4H44B 4JYAB 1K4DC 2FL4A 2XAQA 4NB5A 2FYUH 4LF5O 2EILB 1MOFA 1D5AA 3ASOC 5CB4B 3K5MA 2CTQA 5L3GA 1SZXA 1ZUQA 2QR4A 3CC7V 4X8AA 1WAZA 2EJ7A 4CBCA 1Q7YW 1IBKO 5IYBO 3SJAC 2UUCB 1IXBA 1SQVH 4PDMA 1HDJA 3DXRA 3CXCU 2ZE7A 1RM1B 3M8AA 4K35A 1Q82W 1V54C 2E5LO 1BGYH 4DR7O 1Y6XA 4P2ZA 1VQ5V 2JK5C 4BR6A 1OCOC 5B1AB 4B3MB 2Q4PA 2Q5ZA 2YDEA 3JATB 2WLLA 1O9HA 1PNLA 3UT5B 1AI5A 1MSWD 3JASB 2UUBO 1CPYA 3ZRXA 1KU9A 4NTXA 3T1CA 2WPDG 3ZBHA 4AQYB 1B06A 5K1PA 4QIWF 2P6JA 1QU7A 4FPPA 1AJPA 5JJNB 2IJJA 3AEIA 2YXLA 1F51A 5E79Z 4LNUA 1M5IA 2WLMA 3JAKB 1N0JA 5GTHZ 1KP2A 2IJHA 1FJGB 4JI2O 4KXRA 1S5HC 3J7AU 2KKWA 3K9AA 2PTMA 3RYFB 4DV0B 3P3PA 2P4KA 1CP9A 1KD1W 4FFBA 4LWSA 4LR3A 5KX5A 3SYOA 4TUYA 4UCSA 4NYKA 5IJ9A 4BIZA 1SS3A 3T4DA 4ZI7A 3TXQA 4R8CA 4TQDA 2R9IA 2LGQA 3BA8A 1K33A 5D5QA 2QA4V 4FM1A 4PJ0Z 4O4IB 3LSUA 2Q7GA 4FM0A 1GMGA 3RYCA 4IYIA 4I50A 5LP6B 1VQ4V 1Y76B 2B5UA 2Q67A 1NS1A 1N32O 1IBMO 2LO1A 3T2MA 3QO7A 4JGSA 1HWYA 1L8DA 4J7ZA 2P7TC 2YC0A 4AHCA 1QR9A 3EVKA 3A8TA 1H2NA 3Q4HB 4C7UA 5LOVB 3VQYA 3ZHRA 1LR1A 2NLJC 4O4JA 1R6TA 3JSNA 1H2SB 2CE4A 3STZC 2R70A 5LMUB 3OGIB 2IU0A 5B3SC 3K04A 1JX9A 4DRXB 5IYDO 2OYQA 4Z1VA 3VQXA 4KFMA 4UVAA 3ZMZA 1B3QA 3CC4V 2ODMA 4JI7O 3K0GA 1H8EG 3RN4A 1R3KC 3WU2Z 4R7CA 1VMGA 1P7GA 3H1KH 4CH3A 2PYJA 4DV4O 3OR6C 1HW7A 1HNWO 5KUKA 1J95A 2UUAO 3K5OA 4WBNA 1YJNV 1A32A 3ASNB 1Q43A 4IT5A 4X20A 4R50A 2DMXA 4NTYA 2VQEO 1R73A 2IM9A 3HKBB 4B3RB 1F4MA 2L6LA 4F6RA 1EN5A 3ZRVA 4DO2A 1Y66A 4DR1B 1T5EA 5FLXN 4MVRA 3E22A 1I08A 3ZRWB 1Z2GA 4ZBMA 2YIDA 1ZL8A 5KLVH 1M4UA 1AR4A 3A2FA 4W4LA 1Q5OA 4TV9B 3FKSG 2AXTZ 4UXNA 4CS2A 1SC5B 5EBWC 4D7TA 1YXBA 4LF4O 5JJEB 4DV5O 3U11A 2R72A 3F7YC 3GWOA 2QSAA 3QNEA 3GB7C 1IVSA 5IWAO 2AZ0A 3APOA 5EYPB 3CRRA 3HPLC 3O9OA 2QM8A 1SRYA 2PI5A 3T1HB 5L3EA 1M56C 2NR5A 2WLNA 1FXVA 4OGQB 2F95B 2LFRA 2OCHA 2OIGA 3B77A 3O65A 4WCEV 1KBHA 4MVMA 2Q73A 2V7QG 1OCCC 4B08A 2F4VB
chains in the Genus database with same CATH topology
2ZXWC 4HYOA 3W7XA 3NXSA 1COWG 1DTOA 5LHIA 1S72V 4CZZA 3SPHA 2ZR3A 1AJNA 2DW4A 2OTLV 1NQTA 4WFAV 3UM7A 1YI2V 3SPIA 3WG7C 3D36A 2M7WA 1QR8A 1GO3F 3FB6C 3K79A 1DF5A 3ETGA 3W7UA 3IFXA 3ZN0A 1UJWB 1PL0A 1PD3A 3ZMTA 1YJ9V 2Y69B 3OR7C 2R9RB 4MTGA 1R3JC 1R3IC 3B8MA 1VQ9V 1H8HG 3ZRSA 2IW5A 1M57B 2UXNA 3SPGA 1N8RW 4MSWC 5LHGA 3AG3C 3RBZA 1E1QG 2YSUB 2XAGA 2X7RB 3ASOB 3ABLB 1VQ8V 4UV9A 3G71V 2AHYA 4JTDB 2QEXV 2IU3A 5L3CA 5CBGA 5DN6G 1VQKV 2DQ3A 3E8GA 2JDIG 4I5SA 3F5WC 3UKMA 1Y4MA 3G4SV 2GHYA 4J9ZB 2WLKA 2Z5UA 2P67A 4PA9A 5J9PC 3OAAG 1NH2B 1W0JG 3ZRWA 5DM6V 4Z1MG 1H38A 1W2BU 1AROP 1DLBA 1XL6A 1NR7A 1E1RG 4WFGA 3CCLV 2OCCB 5IY5C 1KC8W 3X2QC 1VQNV 2F43G 4QE7A 1QLEC 3LDCA 4HZ3A 4JYBA 1S3JA 3RW0A 1AR1B 1VQ6V 4TWKA 1V54B 2EIKB 1YHQV 3ASNC 4WFEA 3CC2V 4LC1A 4Q20A 4E2LA 2DYSC 3AG2C 1K4CC 1OCOB 1ROPA 4WF9V 3ABMC 3P32A 4GX0A 1QBZA 3SYPA 4MVOA 1OCZB 2PI4A 4ASUG 3B8NA 4GX5A 3PJSK 4FJCC 2GSMB 1Q81W 2H94A 5H6QA 1KP3A 2LFSA 5GW7A 1I5YA 1NJIW 1GM9A 1QCEA 4OXSA 2B1GA 3FYIB 4PA3A 2ZD9A 5CN0A 3SYCA 3SYAA 3CD6V 3CCEV 1K3EA 3OGCC 2LP7A 3FB7C 3K06A 3ABKC 1V55C 2DYRB 1OCRC 2XAHA 3OUSA 1VQPV 5B1BC 4JTAB 1G8MA 3EFFK 4JTCB 2HKOA 5KA5A 1GM8A 3OW2U 1P4RA 4J9YB 1VQLV 2Q68A 2X6CA 2EIJC 1THZA 2Z3YA 4N23A 2YEVB 4FMTA 4XDKA 1QVFU 2AHZA 4RAIA 3OMIB 4RUEA 4P9OA 1JJ2U 1MABG 2A9HA 2C2AA 4QPKA 3OEHG 2DQ0A 1K8AW 3AG1B 3BY6A 2JJ1G 4HAMA 1NR1A 4G28B 2P90A 5LGUA 2WLLB 4PA7A 2EBOA 4BIUA 2OT5A 3AG4C 3AG4B 5LGTA 2XAFA 1NKDA 1KQSU 3CMEV 1DF4A 1AI7A 2WLIA 2EIMB 4UVCA 4MTFA 1NVPB 4MVZA 1P7BA 3RVZA 3ETEA 3ETDA 1EBOA 2UXXA 1S76D 1AI6A 1E79G 2ATKC 2HG5C 3CCQV 3ZMSA 1K97A 1KKDA 4ZKIA 4QNHB 3VOUA 5HFLA 5IDJA 3JD1A 2Y69C 1PNMA 4PDLA 5H9CA 1K4DC 2XAQA 1SESA 2HJFC 1YSCA 4XBFA 5BZBA 3MHHC 1M57C 3SJQC 4MVQA 3MD0A 5EBLC 4FK5C 5EBMC 1L1FA 1CEZA 4WFBV 4PELA 2EILB 3I55V 3K3WA 1MOFA 3ASOC 3ABLC 3F7VC 1M1KW 3KG2A 1FXKA 4QJFB 1FS0G 2XASA 5L3GA 3FB5C 4LCUC 1YTFB 1S0VA 3TCUA 4LP8A 4MS2A 4LBEC 4EKWA 3CC7V 2WLIB 1EZJA 2EINB 4X8AA 4CBCA 2XNDG 5B1NA 2KB1A 1Q7YW 5IYBO 2QE7G 4PDMA 5LHHA 2OCCC 5HFMA 3CXCU 1SETA 1G4YB 4JAUA 1RM1B 4I9WA 4F4LA 2WLHA 5B3SB 1FXHA 4GX2A 2BOBC 1Q82W 2DWEC 1YITV 4JAVA 2H8PC 1V54C 2EIKC 5L3BA 1GTOA 1NBMG 2HR3A 2QKSA 2YEVA 2WLJA 4UVBA 2EZPA 4P2ZA 1AI4A 2JK5C 3E86A 3W7SA 1VQ5V 2JEUA 1OCOC 1XL4A 4H33A 1EFRG 5B1AB 1NH2D 1GM7A 2JJ2G 3OM3B 3A0RA 4L87A 1OCZC 2WLLA 1PNLA 3LNMB 2HLDG 1AI5A 1MSWD 2HVJC 1CPYA 1FXKB 1K5QA 4MW8A 3CMAV 3CYOA 3ZRXA 3E8FA 3T1CA 4X89A 1K9MW 1JCHA 3JD3A 3JD0A 2WPDG 3OUFA 2DYRC 2X6BA 4DXWA 2MK3A 2D3OW 2IH3C 4QIWF 2P6JA 4RQFA 4U7OA 3CCVV 4FPPA 1AJPA 5C93A 1FFTB 2IH1C 2X0LA 3CP1A 2NNUA 2IJJA 4RUFA 3AEIA 5LBQA 2Y48A 4JASA 1KECA 3IGAC 1F51A 4YXWG 1OHHG 2WLMA 2XOKG 1K7DA 2EZOA 2IJKA 3RVYA 1KP2A 3BEHA 2IJHA 3E35A 5L3FA 1PKXA 3AG1C 2WSSG 1S5HC 3K9AA 1F4NA 4BAYA 1K34A 2A79B 1CP9A 1KD1W 2WWWA 2DWDC 2EIMC 4JPRA 1M90W 1RPOA 3D3IA 1Q86W 3SYOA 4U7NA 4H37A 5LGNA 5H6RA 1TUEB 2JEXA 3I56V 4BIZA 1R6KA 3T4DA 4R8CA 2ZDIA 2R9IA 1K33A 1M56B 1WPXA 2QA4V 1B6QA 3CCSV 1K92A 2ITDC 5KA6A 1GMGA 3K03A 3W7WA 2V1DA 3K08A 1BL8A 3LSQA 1ORQC 1VQ4V 3QO8A 1OCCB 2B5UA 2Q67A 1NVPD 4MVSA 2OTJV 2EJRA 2ZXWB 3T4ZA 3T2MA 2B1IA 2EILC 3EHBB 3OMNB 3QO7A 4RQEA 2W0FC 4JGSA 4P30A 5EK0A 1HWYA 1S77D 1JPXA 1I5XA 3P30A 2P7TC 4GCZA 1R6NA 1QLNA 3WG7B 4KP4A 1QR9A 3LDEA 5E1AC 5CBFA 2WAMA 5CMUA 3SPCA 3DGEA 3JCZA 2EINC 4R6ZA 4BW5A 2FTKA 4MTXA 1AJQA 5B1OA 2NLJC 3OE7G 2K1EA 3E89A 4UUJC 3AG3B 3JD2A 3STZC 4G2KA 1RM1C 3TETA 4PA6A 1GK9A 2ZDIC 2IU0A 1SZTA 1F23A 5B3SC 3M99B 1K73W 3K04A 2X6AA 1SERA 1JX9A 5IYDO 3VBBA 1YTFD 4KFMA 4TT3G 3ML0A 4QPJA 4UVAA 3ZMZA 4UV8A 5B1AC 3SPJA 2W6IG 3CC4V 3MHSC 3K0GA 3ABUA 1H8EG 1R3KC 4JF3A 4G27B 4R7CA 1H2GA 3LUTB 5IY5B 3X2QB 3DTUB 3OR6C 1JQ0A 1FXKC 4WFFA 4PDRA 5L3DA 5KUKA 1QLEB 1J95A 1JVMA 4X88A 1YJNV 3ASNB 3CPWU 4PA4A 4N21A 2DYSB 3AG2B 2CK3G 3ZCCA 3E8BA 2QTOA 1BMFG 3SYQA 1BHAA 1VQMV 4R50A 3CCRV 1M9NA 3ABMB 2ZQMA 1R73A 1IXMA 3G6EV 3JYCA 1F4MA 1YJWV 2W6JG 2QM7A 4XDJA 4MT8A 3WFVA 3ZN1A 4JYCA 4MTOA 2ITCC 1LNQA 3ZRVA 4MW3A 1ENVA 4DO2A 3TK1A 1Y66A 4P9PA 2XAJA 3ABKB 4MVRA 3ZJZA 1V55B 1QVGU 1BHBA 1OCRB 2JIZG 2IJIA 3ZRWB 3QO5A 3OMAB 5B1BB 4ZBMA 3FB8C 2BOCC 2ZR2A 4MVUA 4PDVA 5CA3A 4WFHA 1GKFA 1PNKA 2A0LA 3FKSG 4UXNA 1K5SA 3HB3B 4RO2A 3OEEG 3LSSA 5EBWC 1JOYA 4XDLA 2EIJB 3CCMV 2HVKC 3W7TA 4FIPC 3FYEB 4TSFG 3E2EA 1OZ0A 1RPRA 2HFEC 3F7YC 4QE9A 1ZWIC 3GWOA 1VQOV 5KUMA 3QNEA 5IYCO 3GB7C 3JD4A 3CCJV 3E8HA 4GT1A 3ZMUA 3ZMVA 5CBHA 3ABTA 4KUMA 3CCUV 1R3LC 3HPLC 2QM8A 3IC7A 3H01A 1VQ7V 2Q69A 3ZIAG 3OFNG 1SRYA 1W0KG 4GX1A 2PI5A 1WLEA 5L3EA 3K0DA 1M56C 2WLNA 2Q6AA 5FL7G 1FXVA 2LFRA 3B77A 3LDDA 4WCEV 5EC2C 3E83A 1YIJV 1MG1A 4MVMA 3STLC 2V7QG 5EC1C 1OCCC 3R65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TET A;  2ZXW C;  4PA6 A;  4XDK A;  4HYO A;  2AHZ A;  4RAI A;  3E8F A;  3T1C A;  5B3S C;  4RUE A;  4X89 A;  3K04 A;  4P9O A;  2X6A A;  3SPH A;  2A9H A;  3OUF A;  3UM7 A;  2DYR C;  3SPI A;  3WG7 C;  2X6B A;  4DXW A;  3FB6 C;  4G28 B;  4KFM A;  2IH3 C;  2WLL B;  3IFX A;  4PA7 A;  3AG4 C;  3SYC A;  5B1A C;  3SPJ A;  3K0G A;  3OR7 C;  1R3K C;  2IH1 C;  2R9R B;  4MTG A;  1R3J C;  4RUF A;  1R3I C;  4G27 B;  3IGA C;  4R7C A;  3LUT B;  3ZRS A;  2WLI A;  2WLM A;  3SPG A;  4MSW C;  4MTF A;  4MVZ A;  1P7B A;  3AG3 C;  3OR6 C;  4WFF A;  3RVZ A;  3RBZ A;  4PDR A;  5KUK A;  1J95 A;  3T2M A;  1JVM A;  3RVY A;  4X88 A;  3BEH A;  2AHY A;  4JTD B;  2ATK C;  2HG5 C;  4PA4 A;  5CBG A;  3E8G A;  3AG1 C;  1KKD A;  3E8B A;  2QTO A;  3F5W C;  3SYQ A;  3UKM A;  4QNH B;  1S5H C;  4R50 A;  3VOU A;  4J9Z B;  2WLK A;  4PA9 A;  5J9P C;  2Y69 C;  4PDL A;  4UUJ C;  1K4D C;  3JYC A;  1XL6 A;  2HJF C;  2A79 B;  4WFG A;  4XDJ A;  5BZB A;  1M57 C;  3SJQ C;  4MTO A;  2DWD C;  2EIM C;  4MVQ A;  5EBL C;  5IY5 C;  5EBM C;  3X2Q C;  2ITC C;  1LNQ A;  4MW3 A;  3SYO A;  4QE7 A;  1QLE C;  3LDC A;  4HZ3 A;  3RW0 A;  4H37 A;  3ASO C;  3ABL C;  3F7V C;  4P9P A;  3KG2 A;  4MVR A;  4TWK A;  3ZJZ A;  3ASN C;  4WFE A;  3T4D A;  3FB5 C;  4R8C A;  2DYS C;  3AG2 C;  4LCU C;  4ZBM A;  1K4C C;  3TCU A;  4LP8 A;  3FB8 C;  2BOC C;  4MVU A;  4MS2 A;  4PDV A;  4LBE C;  4EKW A;  3ABM C;  2WLI B;  4X8A A;  4GX0 A;  4WFH A;  2ITD C;  3SYP A;  4CBC A;  4MVO A;  2A0L A;  3K03 A;  4GX5 A;  4RO2 A;  3K08 A;  2KB1 A;  3PJS K;  1BL8 A;  1ORQ C;  5EBW C;  4PDM A;  2OCC C;  2Q67 A;  4XDL A;  4MVS A;  1G4Y B;  2HVK C;  3T4Z A;  4OXS A;  2HFE C;  4PA3 A;  3F7Y C;  4I9W A;  2EIL C;  1ZWI C;  2ZD9 A;  2WLH A;  4QE9 A;  2W0F C;  4P30 A;  5KUM A;  5EK0 A;  3GB7 C;  3SYA A;  3OGC C;  4GX2 A;  2BOB C;  2P7T C;  2DWE C;  3ABK C;  3E8H A;  3FB7 C;  3K06 A;  1V55 C;  2H8P C;  1V54 C;  2EIK C;  5CBH A;  1OCR C;  2YEV A;  2QKS A;  1R3L C;  3OUS A;  3HPL C;  2WLJ A;  5B1B C;  3LDE A;  3E86 A;  2JK5 C;  2Q69 A;  4P2Z A;  4JTA B;  4H33 A;  1OCO C;  1XL4 A;  4GX1 A;  5E1A C;  4F4L A;  5CBF A;  3K0D A;  1M56 C;  3SPC A;  2WLN A;  3EFF K;  2Q6A A;  4JTC B;  2EIN C;  4R6Z A;  4BW5 A;  3LDD A;  1OCZ C;  5EC2 C;  2WLL A;  3E83 A;  4J9Y B;  3LNM B;  4MVM A;  3STL C;  2NLJ C;  2Q68 A;  5EC1 C;  1OCC C;  2HVJ C;  2K1E A;  2X6C A;  3E89 A;  2EIJ C;  3STZ C;  3R65 A;  4MW8 A; 
#chains in the Genus database with same CATH topology
 3NXS A;  1COW G;  3SPH A;  2ADP A;  1NQT A;  3UM7 A;  2QGN A;  2M7W A;  3WB1 A;  3RFR A;  1PL0 A;  2ADQ B;  1H2L A;  2YI9 A;  3ZED A;  4CS3 A;  1VQ9 V;  1H8H G;  1M57 B;  2LGW A;  2UXN A;  5IJ0 A;  1XHX A;  3RBZ A;  4W4K A;  2YSU B;  2XAG A;  3CRQ A;  3ABL B;  4UV9 A;  3G71 V;  4DR4 O;  2DQ3 A;  3E8G A;  1PP9 H;  1Y4M A;  2WLK A;  2P67 A;  5LMN O;  3OAA G;  1ZTE A;  3KCY A;  3ETQ A;  1ARO P;  1DLB A;  4CH6 A;  4WFG A;  2OCC B;  4ZHQ B;  1KC8 W;  4DUZ O;  1SQG A;  3D36 C;  1QLE C;  3LDC A;  2K9P A;  3RW0 A;  1WP7 A;  2EIK B;  4ZOL A;  4JI4 B;  5KMG B;  4LC1 A;  4Q20 A;  4E2L A;  4D7S A;  4WF9 V;  2CTP A;  1XNR B;  3BFR A;  3UCS C;  1QBZ A;  4MVO A;  4ASU G;  1KYO F;  1VP7 A;  3B8N A;  4GX5 A;  4GKK O;  1AVM A;  2CH7 A;  4DV1 B;  3WB2 A;  5GW7 A;  2UXB O;  1GN6 A;  4NXN O;  3SYA A;  4O2A A;  3FB7 C;  3K06 A;  3MAQ A;  1Y74 A;  1I7F A;  5C8Y A;  2PZS A;  4UCR A;  3CS5 A;  1MZE A;  3A0H Z;  2HKO A;  4YY3 O;  3DXR B;  1LUV A;  4J41 A;  1NU1 H;  1P49 A;  4NKG B;  3OW2 U;  1XMO O;  5BY1 A;  2Y4U A;  2BE3 A;  2Q68 A;  2X6C A;  4NXN B;  4XDK A;  1QVF U;  5GON A;  4NXM B;  1MAB G;  3OTO B;  2BTO A;  4J42 A;  4JZ2 A;  5KHJ A;  1NTM H;  4OX9 B;  2WLL B;  2EBO A;  1XMQ B;  5LGT A;  1KQS U;  2KG7 A;  1DF4 A;  1AI7 A;  2WLI A;  2EIM B;  1P7B A;  3ETE A;  4DV3 O;  2UXX A;  2XUM A;  3ZMS A;  2VRZ A;  1EN4 A;  1KKD A;  4QNH B;  3H9V A;  5HFL A;  2CTW A;  4LNU B;  3AK2 A;  2Y69 C;  4FZ1 A;  4PDL A;  1GN4 A;  3BVO A;  1SF9 A;  5H9C A;  5A9G A;  4JI5 O;  4YHH O;  3SJQ C;  4MVQ A;  3MD0 A;  4KHP O;  5EBM C;  3I55 V;  3SGI A;  3KG2 A;  4QJF B;  3RT3 C;  3FB5 C;  4UB6 Z;  4PV1 B;  4LP8 A;  4J7K A;  1SA0 A;  4LBE C;  2ZT9 B;  4EKW A;  1Q8I A;  4FFB B;  1MMM A;  4LWS B;  4JI8 B;  5B1N A;  1IBL B;  2KB1 A;  4TUY B;  4JI0 O;  5IJ9 B;  5HFM A;  2W0X A;  2E76 B;  1SET A;  4ZI7 B;  4UFZ A;  4I9W A;  4F4L A;  2CAZ C;  1FXH A;  4GX2 A;  1HNX B;  1H2M A;  4TV8 A;  1GTO A;  2QKS A;  2HR3 A;  2YEV A;  3BAA A;  4TOI A;  1AI4 A;  3RYC B;  4I50 B;  2NN4 A;  1EFR G;  4X65 O;  3KCX A;  1EN6 A;  3CXH F;  3A0R A;  3IAY A;  1OCZ C;  1JA8 A;  1OV9 A;  1FXK B;  2DOS A;  3CYO A;  2Q8V A;  2RCV A;  1VF7 A;  1K9M W;  2ZIO A;  3C90 A;  3JD3 A;  3OUF A;  1KKC A;  2VS0 A;  2DYR C;  2RQ6 A;  1KMI Z;  4LF9 O;  4B7K A;  2MK3 A;  2QDO A;  1IX9 A;  4RQF A;  4U7O A;  3CCV V;  4JV5 O;  2NNU A;  2UU9 B;  2Y48 A;  3IGA C;  4JI6 B;  4YIP A;  3AG7 A;  1RP3 B;  3FX7 A;  3N27 A;  1K7D A;  1N34 B;  2EZO A;  2IJK A;  4DR5 B;  2IBZ H;  4GYC B;  1WNS A;  1J5E O;  3AG1 C;  5EIB C;  4B3S B;  4JI3 B;  4BAY A;  2WA4 A;  5LL6 Y;  4WBN B;  2WWW A;  4JPR A;  5B5E Z;  4LFB O;  5BMV A;  1RPO A;  2Q0O C;  1Q86 W;  4X20 B;  4K0K B;  2OWO A;  4H37 A;  5LGN A;  1TUE B;  3I56 V;  2M6Y A;  5CA1 A;  1SQX H;  1TA8 A;  4O4H A;  2VQF O;  1VAR A;  1VF6 C;  1AIL A;  4F6R B;  3K03 A;  3W7W A;  3LSQ A;  1ORQ C;  1NVP D;  3E22 B;  2ZXW B;  3T4Z A;  4LFA B;  2B1I A;  4RQE A;  2W0F C;  4P30 A;  5EK0 A;  2P22 C;  1I5X A;  1ZL8 B;  4GCZ A;  4O2B A;  4DV2 B;  1CXZ B;  3WG7 B;  5AG2 A;  5CBF A;  1X4T A;  3SPC A;  4OPH A;  4FLZ A;  2EIN C;  1TUB A;  3NR7 A;  5B1O A;  4LF5 B;  3AG3 B;  2HJD A;  5JJJ B;  4PA6 A;  1GK9 A;  2ZDI C;  2P5O A;  1SZT A;  1F23 A;  1K73 W;  2X6A A;  4X1Y A;  1SER A;  1YTF D;  4QPJ A;  2LQT A;  4JF3 A;  4BW9 A;  1IBK B;  1H2G A;  3LNN A;  4UB8 Z;  5F2V O;  3X2Q B;  4BIO A;  5L3D A;  3DC6 A;  4X88 A;  4I4T A;  1HR0 O;  2E5L B;  4DR7 B;  1HP8 A;  4N21 A;  4EEQ A;  3ZCC A;  3SYQ A;  4LF7 O;  3ABM B;  5IJ0 B;  4DR2 O;  2W6J G;  3WFV A;  3L71 H;  2UUB B;  3ZN1 A;  4MTO A;  2ITC C;  4MW3 A;  2JVD A;  1AP5 A;  1HR0 B;  5IYZ A;  4IYH A;  3ABK B;  3ZJZ A;  5EZY A;  2ZNI A;  3QO5 A;  2QWP B;  2A3Q A;  4E4E A;  2ZR2 A;  4PDV A;  1BZK A;  1FD9 A;  4CC5 A;  1GKF A;  2A0L A;  4RO2 A;  3HB3 B;  5A2Q N;  3RYH A;  3OEE G;  1DGS A;  3L72 H;  1N36 O;  3HKE A;  4XDL A;  2EIJ B;  4ZOL B;  3L70 H;  4FIP C;  1JFF A;  3QVN A;  1OZ0 A;  4QE9 A;  1VQO V;  5IYC O;  3JD4 A;  1IUR A;  3E8H A;  4GT1 A;  3ZMV A;  4BWA A;  3I5D A;  1FFX A;  2PGG A;  2HP8 A;  5CBH A;  4KUM A;  5JH7 A;  4JI2 B;  3IC7 A;  1VQ7 V;  2B9Z A;  4OPA A;  4DR3 O;  4GX1 A;  5FL7 G;  4IGG A;  1JJO A;  5EC2 C;  1Q6H A;  1YIJ V;  3L73 H;  4O2A B;  1MG1 A;  1BSM A;  5EC1 C;  1Y74 B;  4K8Z A;  1XNQ O;  5C8Y B;  3CWB H;  1NTK H;  4X66 O;  1S72 V;  1SQF A;  4WFA V;  2PUS A;  1YI2 V;  3QTC A;  4EFB A;  3D36 A;  1QR8 A;  1DK1 A;  1GO3 F;  3QF7 A;  2JRI A;  3ZN0 A;  4LF6 O;  3ZMT A;  2R9R B;  4MTG A;  5GON B;  3A0B Z;  4H13 B;  3B8M A;  2IW5 A;  1N32 B;  2CDY A;  4JZG A;  3SPG A;  1IBM B;  3C3S A;  5LHG A;  1WN7 A;  3CJH A;  4HNA A;  3ZHT A;  3ASO B;  2E74 B;  4YIO A;  3UO3 A;  1VQK V;  2KG7 B;  3F5W C;  1Y67 A;  1AB3 A;  2GHY A;  2Z5U A;  4DW0 A;  2ZM6 O;  2R9A A;  3JAL A;  4FLV A;  5DM6 V;  1W2B U;  1XL6 A;  4H0L B;  4DR6 O;  3CCL V;  5JCO C;  1LUW A;  5IY5 C;  2JS3 A;  1AR1 B;  1VQ6 V;  1V54 B;  3L74 H;  3CC2 V;  2DYS C;  3AG2 C;  4FLX A;  1OCO B;  4JI7 B;  1HNZ O;  1H2K A;  3N2G A;  3SYP A;  1I94 O;  5KHK A;  3PJS K;  2GSM B;  1Q81 W;  2RN9 A;  1KP3 A;  5CA0 A;  2LFS A;  4DV4 B;  2QWQ B;  1HNW B;  1P84 F;  1I5Y A;  2N04 A;  5J2U A;  4PA3 A;  2UUA B;  2FB5 A;  3CD6 V;  1K3E A;  1SA0 B;  5B66 Z;  4JI1 O;  1V55 C;  2F23 A;  2ZIM A;  1OCR C;  4LFC O;  2GTA A;  3OUS A;  1VQP V;  5B1B C;  1XI1 A;  4JTA B;  1W59 A;  3CX5 F;  1MZF A;  3K59 A;  2VQE B;  1MSD A;  3EFF K;  4K3A A;  4X64 O;  2A7W A;  2LJ2 A;  5J2T A;  3WB0 A;  1GM8 A;  1GAX A;  3JAW A;  4DUY O;  4J9Y B;  1VQL V;  3H1H H;  4N23 A;  4TV8 B;  1PPJ H;  2YEV B;  1NI8 A;  4FMT A;  1NTZ H;  1FKA O;  3OMI B;  4NTW A;  3BRC A;  3QG5 A;  3BY6 A;  4FLU A;  2UXD O;  4G28 B;  5DED A;  1G1X B;  2GV9 A;  2DE0 X;  3CME V;  4LH7 A;  1SQP H;  4LF4 B;  2JGU A;  4DV5 B;  4UVC A;  4MTF A;  3OTF A;  4AIL C;  1NVP B;  3ETD A;  4I7Z B;  5IWA B;  1S76 D;  2HG5 C;  3CCQ V;  2CUG A;  1XEQ A;  3VOU A;  3HKD A;  5IDJ A;  2JGD A;  1AP6 A;  2UXC O;  1ZX3 A;  5BZB A;  3MHH C;  1CEZ A;  4WFB V;  4PEL A;  3K3W A;  3BPZ A;  1SKV A;  3F7V C;  1M1K W;  3SR2 C;  1YTF B;  1S0V A;  3TCU A;  2AGA A;  3RGB A;  4NR1 A;  5BMV B;  1TAE A;  3TXS A;  4DV7 O;  3ZS8 C;  1KUQ A;  5CA1 B;  5LA6 B;  4JAU A;  2JS5 A;  5B3S B;  4DR4 B;  1URF A;  4O4H B;  2BOB C;  1YIT V;  4JAV A;  2H8P C;  1GN3 A;  1NBM G;  3IJ4 A;  3CRM A;  2WLJ A;  4UVB A;  2EZP A;  3W7S A;  2JEU A;  1XL4 A;  4H33 A;  5LMN B;  3T1Y O;  4O4L A;  1GM7 A;  3ZX6 A;  2JJ2 G;  1PL4 A;  4L87 A;  4IIJ A;  2ZIN A;  4CH4 A;  1U97 A;  2HEP A;  3LNM B;  3RYF A;  4DUZ B;  4O2B B;  3CMA V;  3E8F A;  1OJH A;  2Y0P A;  1M93 A;  4X89 A;  2HHH O;  4GKJ O;  2X6B A;  1TUB B;  4DXW A;  4LF8 O;  1Q3E A;  1QQC A;  3G6B A;  5ITZ A;  1FFT B;  4U3F H;  2IH1 C;  2QJ1 A;  2X0L A;  3CP1 A;  4RUF A;  3HKC A;  4EFE A;  5LBQ A;  4GKK B;  1KEC A;  4CS4 A;  4YXW G;  1OHH G;  2UXB B;  1VF6 A;  2XOK G;  5LP6 A;  3JCU Z;  3U0Z A;  3BEH A;  5L3F A;  3FAV A;  3TGU H;  1MA1 A;  3ZHU A;  4YY3 B;  2ILM A;  4IL6 Z;  3AK3 A;  1XMO B;  4X62 O;  1K34 A;  2A79 B;  3Q4H A;  1MNG A;  2DWD C;  4I4T B;  1IZ3 A;  3D3I A;  3L75 H;  4J7J A;  3SJC C;  2YXH A;  2JEX A;  3JAR A;  1UFI A;  2ZDI A;  5K1X A;  2XT9 A;  1M56 B;  5FPO A;  1WPX A;  1B6Q A;  3CCS V;  2ITD C;  5KA6 A;  4B3T O;  3K08 A;  5IYZ B;  1BL8 A;  3THO A;  3QO8 A;  1OCC B;  1UPG A;  3GVM A;  4MVS A;  5EZY B;  4DV3 B;  2OTJ V;  2EJR A;  4D6T H;  3OMN B;  2EIL C;  3EHB B;  1S77 D;  1JPX A;  3P30 A;  5BR8 O;  1QLN A;  1YF2 A;  1S5J A;  1N33 O;  5E1A C;  2WAM A;  3B09 A;  5CMU A;  3HKE B;  3JCZ A;  5KX5 B;  1AJQ A;  1BT8 A;  4JI5 B;  4YHH B;  4KHP B;  3M7M X;  2YIC A;  3OE7 G;  3E89 A;  1FFX B;  4G2K A;  5JH7 B;  1RM1 C;  1YZB A;  4DV6 O;  1AR5 A;  3M99 B;  2GUZ A;  5H5N A;  4UCU A;  1KB9 F;  3ZHV A;  5JWP A;  1FAF A;  5B1A C;  3SPJ A;  2W6I G;  3MHS C;  1BE3 H;  3ABU A;  3H1L H;  1N4C A;  4JI0 B;  3LUT B;  3N2K A;  2RJZ A;  4PDR A;  1QLE B;  1ZSP A;  1JVM A;  1L0L H;  3AK1 A;  2BTQ A;  4PA4 A;  1Z5V A;  2PF4 E;  1VEW A;  2VWK A;  1BMF G;  4X65 B;  1VQM V;  4PI0 A;  3J80 N;  2F93 B;  3OD4 A;  4O4J B;  3CJH B;  4HNA B;  3JYC A;  1YJW V;  1N0N A;  1LNQ A;  1Q6I A;  2ZE5 A;  4P9P A;  3D8C A;  4RWU A;  1QVG U;  1RFY A;  1BHB A;  3JAL B;  4PI2 A;  2IJI A;  4LF9 B;  3OT7 A;  5IT9 N;  4Z2W A;  4JAA A;  2AW9 A;  4JV5 B;  5CA3 A;  3FFQ A;  1K5S A;  3LSS A;  1O9G A;  3RWR D;  3B2E E;  1JOY A;  1S5L Z;  3CCM V;  3W7T A;  4TSF G;  2DN9 A;  3FYE B;  4AI8 A;  1ZWI C;  2FML A;  5KUM A;  3ZMU A;  1J5E B;  3N2G B;  3CCU V;  1R3L C;  2E75 B;  2QWN B;  2QKA A;  3ZIA G;  1W0K G;  1WLE A;  3HR0 A;  3K0D A;  1GN2 A;  5CA0 B;  2Q0A A;  4ICG A;  5J2U B;  3E83 A;  5LP6 C;  4LFB B;  4JYA O;  4B7E A;  2ZE6 A;  3BHP A;  3K9S A;  4HYO A;  5KHH A;  4I55 A;  5JCO A;  5LHI A;  2ETN A;  1AJN A;  2DW4 A;  3K79 A;  1DF5 A;  3W7U A;  3IFX A;  2VQF B;  1WA8 A;  5JQG A;  1YJ9 V;  2Y69 B;  3OR7 C;  1VF5 B;  1R3J C;  3SJB C;  3ZRS A;  1N8R W;  4MSW C;  3UQ8 A;  2UUC O;  4YJ3 A;  1VQ8 V;  2AHY A;  4JTD B;  2QEX V;  2QM4 A;  2JDI G;  3UKM A;  5KHG A;  3G4S V;  1D5N A;  5J9P C;  4B3M O;  1W0J G;  1GRJ A;  4Z1M G;  1H38 A;  1NR7 A;  1E1R G;  1R1B A;  2F43 G;  2DJV A;  4QE7 A;  3K57 A;  1WJZ A;  4HZ3 A;  1TVK A;  3HKD B;  3S3X A;  4TWK A;  2PY5 A;  2LW7 A;  3ASN C;  4WFE A;  2JGD B;  4X1K A;  1NZ6 A;  4AQY O;  1K4C C;  3CEI A;  1RSO A;  1XDC A;  2F66 C;  3CRC A;  3P32 A;  4FFK A;  4GX0 A;  1BS3 A;  1OCZ B;  2RNB A;  3BCC H;  4FJC C;  4DW1 A;  2RDC A;  4IHJ A;  1XBL A;  4I0X A;  1QCE A;  4OXS A;  2B1G A;  4X1I A;  2ZD9 A;  5CN0 A;  3SYC A;  3CCE V;  1L0N H;  2L35 A;  3OGC C;  4I9Q A;  2LP7 A;  2DYR B;  1YVW A;  2BCC H;  1WB7 A;  1FJG O;  4LF7 B;  1G8M A;  5LYJ A;  1VIB A;  4JTC B;  5LXT A;  4DR2 B;  1BQZ A;  5KA5 A;  4DV0 O;  1YDX A;  3UO2 A;  2AZ2 A;  2H3O A;  2Z3Y A;  4RAI A;  2YS8 A;  4P9O A;  1JJ2 U;  2A9H A;  2C2A A;  2QWO B;  4O4L B;  3OEH G;  2DQ0 A;  3AG1 B;  1NR1 A;  4IIJ B;  5LGU A;  3P3N A;  3AG4 B;  2XAF A;  1NKD A;  2CH7 B;  2QWR B;  4J11 A;  2GBO A;  3CE2 A;  4FLT A;  1N36 B;  1XRE A;  1YEW A;  2Q7H A;  3RVZ A;  1AI6 A;  5ITZ B;  2ATK C;  4DR3 B;  1Z5W A;  3EXA A;  4ZKI A;  3HKC B;  3IC9 A;  4NVP A;  1YCI A;  2Q9L A;  2GTS A;  3RYI A;  1PNM A;  2F1M A;  1SES A;  2HJF C;  4TQF A;  5IE9 A;  1YSC A;  2BSK A;  4XBF A;  4FM2 A;  1M57 C;  5EBL C;  4FK5 C;  1L1F A;  1XNQ B;  3MDS A;  3FAV B;  4U3J A;  1FPO A;  4X66 B;  5LMU O;  3ABL C;  1FXK A;  2ZKO A;  5D5P A;  1FS0 G;  2XAS A;  4PHZ A;  1JR9 A;  4LCU C;  5FNV A;  4DYL A;  4MS2 A;  4LF6 B;  3ICX A;  2WLI B;  1EZJ A;  2EIN B;  1SQB H;  3BA9 A;  2XND G;  1V9P A;  3F5T A;  3GWK C;  3APQ A;  2QE7 G;  5LHH A;  2OCC C;  1G4Y B;  3JAR B;  2WLH A;  2DWE C;  2VWJ A;  1Q6U A;  2EIK C;  5L3B A;  1U96 A;  1EZV H;  5JVD A;  2EUL A;  3E86 A;  2ZM6 B;  3DC5 A;  4YJ2 A;  1NH2 D;  4EB6 A;  3OM3 B;  3K58 A;  4DR6 B;  4B3R O;  2XHB A;  2HLD G;  2HVJ C;  1K5Q A;  4MW8 A;  5FPR A;  1BCC H;  2QKC A;  1JCH A;  4DR1 O;  3JD0 A;  5DEC A;  4GZR B;  2D3O W;  2IH3 C;  1HNZ B;  3CRA A;  4X9Q A;  3VQV A;  5C93 A;  1I94 B;  1QHT A;  4PD4 F;  4JAS A;  2YUA A;  2GUZ B;  2E3C A;  3J81 N;  1IDS A;  3RVY A;  4JI1 B;  1ZLZ A;  4LFC B;  3E35 A;  2WA3 A;  2RMK B;  1PKX A;  2WSS G;  4ABM A;  3N2K B;  4X64 B;  3T1H O;  5CB4 A;  4UCT A;  1F4N A;  3CB2 A;  4DUY B;  1F7Y A;  3VQW A;  2EIM C;  2BTQ B;  2ZCE A;  1M90 W;  1I0H A;  4U7N A;  2F4V O;  3L9D A;  5H6R A;  1R6K A;  2UXD B;  3JSL A;  4LH6 A;  1XHZ A;  1PV0 A;  1K92 A;  1XOU A;  1GH6 A;  5GTI Z;  2V1D A;  4J80 A;  4KL1 A;  3S3W A;  5H2F Z;  2YIA A;  3JAT A;  4CH5 A;  1JMK C;  3K5N A;  1WPB A;  3UT5 A;  3JAS A;  1D2D A;  1R6N A;  3B4S A;  4KP4 A;  3LDE A;  2GDS A;  3DGE A;  1ZAU A;  4R6Z A;  4BW5 A;  1FYJ A;  2UXC B;  2FTK A;  2Y4T A;  4MTX A;  2K1E A;  4UUJ C;  3JD2 A;  3ZHS A;  3TET A;  3B40 A;  2YI8 A;  3JAK A;  3VBB A;  4JI4 O;  2A06 H;  4TT3 G;  3ML0 A;  4UV8 A;  4UCV A;  2KQX A;  1XNR O;  4DV7 B;  2O57 A;  2EX3 A;  4G27 B;  4I55 B;  1WB8 A;  5IY5 B;  3DTU B;  4WFF A;  1FXK C;  1JQ0 A;  4DV1 O;  3CHX A;  4HBN A;  2LW1 A;  4Q6G A;  4A5U B;  1WA8 B;  5JQG B;  3CPW U;  2DYS B;  5TIS Z;  3AG2 B;  2CK3 G;  3E8B A;  2QTO A;  3T1Y B;  4GUN A;  1BHA A;  3CCR V;  1M9N A;  2ZQM A;  2KSD A;  1IXM A;  3G6E V;  1QNM A;  2QM7 A;  4XDJ A;  4MT8 A;  4YJ3 B;  4J10 A;  4JYC A;  2FKX A;  3ZHQ A;  4O4I A;  4FZ0 A;  3TJT A;  4X1Y B;  5KAI Z;  1NT2 B;  4FLY A;  1ENV A;  2HHH B;  3TK1 A;  4GKJ B;  4DK1 A;  1Y76 A;  2XAJ A;  1V55 B;  4NXM O;  3OTO O;  1OCR B;  2JIZ G;  4LF8 B;  3OMA B;  1EM1 A;  5B1B B;  1WP8 A;  4OX9 O;  4ZIB A;  3FB8 C;  2BOC C;  4MVU A;  1G6U A;  1XMQ O;  4WFH A;  1PNK A;  2V4D A;  1TVK B;  5LOV A;  2HVK C;  3E2E A;  2ZE8 A;  4X1K B;  1RPR A;  2HFE C;  2ZNJ A;  4GLX A;  3CCJ V;  1RSO B;  3ABT A;  3H01 A;  2Q69 A;  3OFN G;  4K8X A;  2Q6A A;  4IHJ B;  4DRX A;  5EIB D;  2Q7E A;  4I0X B;  4X62 B;  3LDD A;  2N74 A;  4X1I B;  4DK0 A;  3STL C;  3K5L A;  3R65 A;  2OIE A;  2ZXW C;  5KAF Z;  1X59 A;  3G67 A;  3W7X A;  1DTO A;  4CZZ A;  2ZR3 A;  2OTL V;  5LYJ B;  5LXT B;  3SPI A;  3WG7 C;  3FB6 C;  3ETG A;  4F6E A;  3JAM N;  2YIB A;  1UJW B;  3RYH B;  1PD3 A;  4B3T B;  3D3Q A;  1JFF B;  1R3I C;  4JI8 O;  2YXY A;  4L8J A;  1IBL O;  2CGN A;  3AG3 C;  3HKB A;  1E1Q G;  4JYY A;  5BXZ A;  2X7R B;  5BR8 B;  4QGP A;  1TGO A;  2IU3 A;  5CBG A;  5L3C A;  1HNX O;  5DN6 G;  1N33 B;  4I5S A;  2P06 A;  4FLW A;  4J9Z B;  4PA9 A;  1NH2 B;  3ZRW A;  3U10 A;  2ARH A;  2D2C B;  3SDL A;  4CC6 A;  1SQQ H;  3X2Q C;  2PYL A;  4UCO A;  4DV6 B;  1VQN V;  4TV9 A;  4FVM A;  4JYB A;  1S3J A;  1YHQ V;  3RYI B;  1ROP A;  3DSQ A;  2BSK B;  2XTA A;  3ABM C;  2CGO A;  5EYP A;  2PI4 A;  4U3J B;  2H94 A;  2UU9 O;  5H6Q A;  4JI6 O;  1NJI W;  1GM9 A;  3CSX A;  2CTR A;  3FD9 A;  3FYI B;  3H1I H;  5FNV B;  1N34 O;  2YIB D;  3ABK C;  4DR5 O;  2XAH A;  3KKY A;  4B3S O;  3H1J H;  4JI3 O;  1P4R A;  1PM9 A;  2Z0A A;  1XIL A;  1THZ A;  2EIJ C;  2G38 A;  2AHZ A;  3BAB A;  5JVD B;  1BQ0 A;  4RUE A;  2N05 A;  4K0K O;  2MW2 B;  4QPK A;  3C3T A;  3G80 A;  4YJ2 B;  4EB6 B;  1K8A W;  2JJ1 G;  4HAM A;  1Q90 D;  2P90 A;  4PA7 A;  4BIU A;  2OT5 A;  3AG4 C;  3PN1 A;  2QTS A;  3KZI Z;  2P4V A;  1XUQ A;  4MVZ A;  1XQ8 A;  4LFA O;  1EBO A;  1B04 A;  5LA6 A;  1E79 G;  4ZHQ A;  3R66 A;  1US6 A;  4DV2 O;  5KHI A;  1K97 A;  5J2T B;  2Y0I A;  3JAW B;  5KMG A;  3JD1 A;  4H44 B;  4JYA B;  1K4D C;  2FL4 A;  2XAQ A;  4NB5 A;  2FYU H;  4LF5 O;  2EIL B;  1MOF A;  1D5A A;  3ASO C;  5CB4 B;  3K5M A;  2CTQ A;  5L3G A;  1SZX A;  1ZUQ A;  2QR4 A;  3CC7 V;  4X8A A;  1WAZ A;  2EJ7 A;  4CBC A;  1Q7Y W;  1IBK O;  5IYB O;  3SJA C;  2UUC B;  1IXB A;  1SQV H;  4PDM A;  1HDJ A;  3DXR A;  3CXC U;  2ZE7 A;  1RM1 B;  3M8A A;  4K35 A;  1Q82 W;  1V54 C;  2E5L O;  1BGY H;  4DR7 O;  1Y6X A;  4P2Z A;  1VQ5 V;  2JK5 C;  4BR6 A;  1OCO C;  5B1A B;  4B3M B;  2Q4P A;  2Q5Z A;  2YDE A;  3JAT B;  2WLL A;  1O9H A;  1PNL A;  3UT5 B;  1AI5 A;  1MSW D;  3JAS B;  2UUB O;  1CPY A;  3ZRX A;  1KU9 A;  4NTX A;  3T1C A;  2WPD G;  3ZBH A;  4AQY B;  1B06 A;  5K1P A;  4QIW F;  2P6J A;  1QU7 A;  4FPP A;  1AJP A;  5JJN B;  2IJJ A;  3AEI A;  2YXL A;  1F51 A;  5E79 Z;  4LNU A;  1M5I A;  2WLM A;  3JAK B;  1N0J A;  5GTH Z;  1KP2 A;  2IJH A;  1FJG B;  4JI2 O;  4KXR A;  1S5H C;  3J7A U;  2KKW A;  3K9A A;  2PTM A;  3RYF B;  4DV0 B;  3P3P A;  2P4K A;  1CP9 A;  1KD1 W;  4FFB A;  4LWS A;  4LR3 A;  5KX5 A;  3SYO A;  4TUY A;  4UCS A;  4NYK A;  5IJ9 A;  4BIZ A;  1SS3 A;  3T4D A;  4ZI7 A;  3TXQ A;  4R8C A;  4TQD A;  2R9I A;  2LGQ A;  3BA8 A;  1K33 A;  5D5Q A;  2QA4 V;  4FM1 A;  4PJ0 Z;  4O4I B;  3LSU A;  2Q7G A;  4FM0 A;  1GMG A;  3RYC A;  4IYI A;  4I50 A;  5LP6 B;  1VQ4 V;  1Y76 B;  2B5U A;  2Q67 A;  1NS1 A;  1N32 O;  1IBM O;  2LO1 A;  3T2M A;  3QO7 A;  4JGS A;  1HWY A;  1L8D A;  4J7Z A;  2P7T C;  2YC0 A;  4AHC A;  1QR9 A;  3EVK A;  3A8T A;  1H2N A;  3Q4H B;  4C7U A;  5LOV B;  3VQY A;  3ZHR A;  1LR1 A;  2NLJ C;  4O4J A;  1R6T A;  3JSN A;  1H2S B;  2CE4 A;  3STZ C;  2R70 A;  5LMU B;  3OGI B;  2IU0 A;  5B3S C;  3K04 A;  1JX9 A;  4DRX B;  5IYD O;  2OYQ A;  4Z1V A;  3VQX A;  4KFM A;  4UVA A;  3ZMZ A;  1B3Q A;  3CC4 V;  2ODM A;  4JI7 O;  3K0G A;  1H8E G;  3RN4 A;  1R3K C;  3WU2 Z;  4R7C A;  1VMG A;  1P7G A;  3H1K H;  4CH3 A;  2PYJ A;  4DV4 O;  3OR6 C;  1HW7 A;  1HNW O;  5KUK A;  1J95 A;  2UUA O;  3K5O A;  4WBN A;  1YJN V;  1A32 A;  3ASN B;  1Q43 A;  4IT5 A;  4X20 A;  4R50 A;  2DMX A;  4NTY A;  2VQE O;  1R73 A;  2IM9 A;  3HKB B;  4B3R B;  1F4M A;  2L6L A;  4F6R A;  1EN5 A;  3ZRV A;  4DO2 A;  1Y66 A;  4DR1 B;  1T5E A;  5FLX N;  4MVR A;  3E22 A;  1I08 A;  3ZRW B;  1Z2G A;  4ZBM A;  2YID A;  1ZL8 A;  5KLV H;  1M4U A;  1AR4 A;  3A2F A;  4W4L A;  1Q5O A;  4TV9 B;  3FKS G;  2AXT Z;  4UXN A;  4CS2 A;  1SC5 B;  5EBW C;  4D7T A;  1YXB A;  4LF4 O;  5JJE B;  4DV5 O;  3U11 A;  2R72 A;  3F7Y C;  3GWO A;  2QSA A;  3QNE A;  3GB7 C;  1IVS A;  5IWA O;  2AZ0 A;  3APO A;  5EYP B;  3CRR A;  3HPL C;  3O9O A;  2QM8 A;  1SRY A;  2PI5 A;  3T1H B;  5L3E A;  1M56 C;  2NR5 A;  2WLN A;  1FXV A;  4OGQ B;  2F95 B;  2LFR A;  2OCH A;  2OIG A;  3B77 A;  3O65 A;  4WCE V;  1KBH A;  4MVM A;  2Q73 A;  2V7Q G;  1OCC C;  4B08 A;  2F4V B; 
#chains in the Genus database with same CATH homology
 2ZXW C;  4HYO A;  3W7X A;  3NXS A;  1COW G;  1DTO A;  5LHI A;  1S72 V;  4CZZ A;  3SPH A;  2ZR3 A;  1AJN A;  2DW4 A;  2OTL V;  1NQT A;  4WFA V;  3UM7 A;  1YI2 V;  3SPI A;  3WG7 C;  3D36 A;  2M7W A;  1QR8 A;  1GO3 F;  3FB6 C;  3K79 A;  1DF5 A;  3ETG A;  3W7U A;  3IFX A;  3ZN0 A;  1UJW B;  1PL0 A;  1PD3 A;  3ZMT A;  1YJ9 V;  2Y69 B;  3OR7 C;  2R9R B;  4MTG A;  1R3J C;  1R3I C;  3B8M A;  1VQ9 V;  1H8H G;  3ZRS A;  2IW5 A;  1M57 B;  2UXN A;  3SPG A;  1N8R W;  4MSW C;  5LHG A;  3AG3 C;  3RBZ A;  1E1Q G;  2YSU B;  2XAG A;  2X7R B;  3ASO B;  3ABL B;  1VQ8 V;  4UV9 A;  3G71 V;  2AHY A;  4JTD B;  2QEX V;  2IU3 A;  5L3C A;  5CBG A;  5DN6 G;  1VQK V;  2DQ3 A;  3E8G A;  2JDI G;  4I5S A;  3F5W C;  3UKM A;  1Y4M A;  3G4S V;  2GHY A;  4J9Z B;  2WLK A;  2Z5U A;  2P67 A;  4PA9 A;  5J9P C;  3OAA G;  1NH2 B;  1W0J G;  3ZRW A;  5DM6 V;  4Z1M G;  1H38 A;  1W2B U;  1ARO P;  1DLB A;  1XL6 A;  1NR7 A;  1E1R G;  4WFG A;  3CCL V;  2OCC B;  5IY5 C;  1KC8 W;  3X2Q C;  1VQN V;  2F43 G;  4QE7 A;  1QLE C;  3LDC A;  4HZ3 A;  4JYB A;  1S3J A;  3RW0 A;  1AR1 B;  1VQ6 V;  4TWK A;  1V54 B;  2EIK B;  1YHQ V;  3ASN C;  4WFE A;  3CC2 V;  4LC1 A;  4Q20 A;  4E2L A;  2DYS C;  3AG2 C;  1K4C C;  1OCO B;  1ROP A;  4WF9 V;  3ABM C;  3P32 A;  4GX0 A;  1QBZ A;  3SYP A;  4MVO A;  1OCZ B;  2PI4 A;  4ASU G;  3B8N A;  4GX5 A;  3PJS K;  4FJC C;  2GSM B;  1Q81 W;  2H94 A;  5H6Q A;  1KP3 A;  2LFS A;  5GW7 A;  1I5Y A;  1NJI W;  1GM9 A;  1QCE A;  4OXS A;  2B1G A;  3FYI B;  4PA3 A;  2ZD9 A;  5CN0 A;  3SYC A;  3SYA A;  3CD6 V;  3CCE V;  1K3E A;  3OGC C;  2LP7 A;  3FB7 C;  3K06 A;  3ABK C;  1V55 C;  2DYR B;  1OCR C;  2XAH A;  3OUS A;  1VQP V;  5B1B C;  4JTA B;  1G8M A;  3EFF K;  4JTC B;  2HKO A;  5KA5 A;  1GM8 A;  3OW2 U;  1P4R A;  4J9Y B;  1VQL V;  2Q68 A;  2X6C A;  2EIJ C;  1THZ A;  2Z3Y A;  4N23 A;  2YEV B;  4FMT A;  4XDK A;  1QVF U;  2AHZ A;  4RAI A;  3OMI B;  4RUE A;  4P9O A;  1JJ2 U;  1MAB G;  2A9H A;  2C2A A;  4QPK A;  3OEH G;  2DQ0 A;  1K8A W;  3AG1 B;  3BY6 A;  2JJ1 G;  4HAM A;  1NR1 A;  4G28 B;  2P90 A;  5LGU A;  2WLL B;  4PA7 A;  2EBO A;  4BIU A;  2OT5 A;  3AG4 C;  3AG4 B;  5LGT A;  2XAF A;  1NKD A;  1KQS U;  3CME V;  1DF4 A;  1AI7 A;  2WLI A;  2EIM B;  4UVC A;  4MTF A;  1NVP B;  4MVZ A;  1P7B A;  3RVZ A;  3ETE A;  3ETD A;  1EBO A;  2UXX A;  1S76 D;  1AI6 A;  1E79 G;  2ATK C;  2HG5 C;  3CCQ V;  3ZMS A;  1K97 A;  1KKD A;  4ZKI A;  4QNH B;  3VOU A;  5HFL A;  5IDJ A;  3JD1 A;  2Y69 C;  1PNM A;  4PDL A;  5H9C A;  1K4D C;  2XAQ A;  1SES A;  2HJF C;  1YSC A;  4XBF A;  5BZB A;  3MHH C;  1M57 C;  3SJQ C;  4MVQ A;  3MD0 A;  5EBL C;  4FK5 C;  5EBM C;  1L1F A;  1CEZ A;  4WFB V;  4PEL A;  2EIL B;  3I55 V;  3K3W A;  1MOF A;  3ASO C;  3ABL C;  3F7V C;  1M1K W;  3KG2 A;  1FXK A;  4QJF B;  1FS0 G;  2XAS A;  5L3G A;  3FB5 C;  4LCU C;  1YTF B;  1S0V A;  3TCU A;  4LP8 A;  4MS2 A;  4LBE C;  4EKW A;  3CC7 V;  2WLI B;  1EZJ A;  2EIN B;  4X8A A;  4CBC A;  2XND G;  5B1N A;  2KB1 A;  1Q7Y W;  5IYB O;  2QE7 G;  4PDM A;  5LHH A;  2OCC C;  5HFM A;  3CXC U;  1SET A;  1G4Y B;  4JAU A;  1RM1 B;  4I9W A;  4F4L A;  2WLH A;  5B3S B;  1FXH A;  4GX2 A;  2BOB C;  1Q82 W;  2DWE C;  1YIT V;  4JAV A;  2H8P C;  1V54 C;  2EIK C;  5L3B A;  1GTO A;  1NBM G;  2HR3 A;  2QKS A;  2YEV A;  2WLJ A;  4UVB A;  2EZP A;  4P2Z A;  1AI4 A;  2JK5 C;  3E86 A;  3W7S A;  1VQ5 V;  2JEU A;  1OCO C;  1XL4 A;  4H33 A;  1EFR G;  5B1A B;  1NH2 D;  1GM7 A;  2JJ2 G;  3OM3 B;  3A0R A;  4L87 A;  1OCZ C;  2WLL A;  1PNL A;  3LNM B;  2HLD G;  1AI5 A;  1MSW D;  2HVJ C;  1CPY A;  1FXK B;  1K5Q A;  4MW8 A;  3CMA V;  3CYO A;  3ZRX A;  3E8F A;  3T1C A;  4X89 A;  1K9M W;  1JCH A;  3JD3 A;  3JD0 A;  2WPD G;  3OUF A;  2DYR C;  2X6B A;  4DXW A;  2MK3 A;  2D3O W;  2IH3 C;  4QIW F;  2P6J A;  4RQF A;  4U7O A;  3CCV V;  4FPP A;  1AJP A;  5C93 A;  1FFT B;  2IH1 C;  2X0L A;  3CP1 A;  2NNU A;  2IJJ A;  4RUF A;  3AEI A;  5LBQ A;  2Y48 A;  4JAS A;  1KEC A;  3IGA C;  1F51 A;  4YXW G;  1OHH G;  2WLM A;  2XOK G;  1K7D A;  2EZO A;  2IJK A;  3RVY A;  1KP2 A;  3BEH A;  2IJH A;  3E35 A;  5L3F A;  1PKX A;  3AG1 C;  2WSS G;  1S5H C;  3K9A A;  1F4N A;  4BAY A;  1K34 A;  2A79 B;  1CP9 A;  1KD1 W;  2WWW A;  2DWD C;  2EIM C;  4JPR A;  1M90 W;  1RPO A;  3D3I A;  1Q86 W;  3SYO A;  4U7N A;  4H37 A;  5LGN A;  5H6R A;  1TUE B;  2JEX A;  3I56 V;  4BIZ A;  1R6K A;  3T4D A;  4R8C A;  2ZDI A;  2R9I A;  1K33 A;  1M56 B;  1WPX A;  2QA4 V;  1B6Q A;  3CCS V;  1K92 A;  2ITD C;  5KA6 A;  1GMG A;  3K03 A;  3W7W A;  2V1D A;  3K08 A;  1BL8 A;  3LSQ A;  1ORQ C;  1VQ4 V;  3QO8 A;  1OCC B;  2B5U A;  2Q67 A;  1NVP D;  4MVS A;  2OTJ V;  2EJR A;  2ZXW B;  3T4Z A;  3T2M A;  2B1I A;  2EIL C;  3EHB B;  3OMN B;  3QO7 A;  4RQE A;  2W0F C;  4JGS A;  4P30 A;  5EK0 A;  1HWY A;  1S77 D;  1JPX A;  1I5X A;  3P30 A;  2P7T C;  4GCZ A;  1R6N A;  1QLN A;  3WG7 B;  4KP4 A;  1QR9 A;  3LDE A;  5E1A C;  5CBF A;  2WAM A;  5CMU A;  3SPC A;  3DGE A;  3JCZ A;  2EIN C;  4R6Z A;  4BW5 A;  2FTK A;  4MTX A;  1AJQ A;  5B1O A;  2NLJ C;  3OE7 G;  2K1E A;  3E89 A;  4UUJ C;  3AG3 B;  3JD2 A;  3STZ C;  4G2K A;  1RM1 C;  3TET A;  4PA6 A;  1GK9 A;  2ZDI C;  2IU0 A;  1SZT A;  1F23 A;  5B3S C;  3M99 B;  1K73 W;  3K04 A;  2X6A A;  1SER A;  1JX9 A;  5IYD O;  3VBB A;  1YTF D;  4KFM A;  4TT3 G;  3ML0 A;  4QPJ A;  4UVA A;  3ZMZ A;  4UV8 A;  5B1A C;  3SPJ A;  2W6I G;  3CC4 V;  3MHS C;  3K0G A;  3ABU A;  1H8E G;  1R3K C;  4JF3 A;  4G27 B;  4R7C A;  1H2G A;  3LUT B;  5IY5 B;  3X2Q B;  3DTU B;  3OR6 C;  1JQ0 A;  1FXK C;  4WFF A;  4PDR A;  5L3D A;  5KUK A;  1QLE B;  1J95 A;  1JVM A;  4X88 A;  1YJN V;  3ASN B;  3CPW U;  4PA4 A;  4N21 A;  2DYS B;  3AG2 B;  2CK3 G;  3ZCC A;  3E8B A;  2QTO A;  1BMF G;  3SYQ A;  1BHA A;  1VQM V;  4R50 A;  3CCR V;  1M9N A;  3ABM B;  2ZQM A;  1R73 A;  1IXM A;  3G6E V;  3JYC A;  1F4M A;  1YJW V;  2W6J G;  2QM7 A;  4XDJ A;  4MT8 A;  3WFV A;  3ZN1 A;  4JYC A;  4MTO A;  2ITC C;  1LNQ A;  3ZRV A;  4MW3 A;  1ENV A;  4DO2 A;  3TK1 A;  1Y66 A;  4P9P A;  2XAJ A;  3ABK B;  4MVR A;  3ZJZ A;  1V55 B;  1QVG U;  1BHB A;  1OCR B;  2JIZ G;  2IJI A;  3ZRW B;  3QO5 A;  3OMA B;  5B1B B;  4ZBM A;  3FB8 C;  2BOC C;  2ZR2 A;  4MVU A;  4PDV A;  5CA3 A;  4WFH A;  1GKF A;  1PNK A;  2A0L A;  3FKS G;  4UXN A;  1K5S A;  3HB3 B;  4RO2 A;  3OEE G;  3LSS A;  5EBW C;  1JOY A;  4XDL A;  2EIJ B;  3CCM V;  2HVK C;  3W7T A;  4FIP C;  3FYE B;  4TSF G;  3E2E A;  1OZ0 A;  1RPR A;  2HFE C;  3F7Y C;  4QE9 A;  1ZWI C;  3GWO A;  1VQO V;  5KUM A;  3QNE A;  5IYC O;  3GB7 C;  3JD4 A;  3CCJ V;  3E8H A;  4GT1 A;  3ZMU A;  3ZMV A;  5CBH A;  3ABT A;  4KUM A;  3CCU V;  1R3L C;  3HPL C;  2QM8 A;  3IC7 A;  3H01 A;  1VQ7 V;  2Q69 A;  3ZIA G;  3OFN G;  1SRY A;  1W0K G;  4GX1 A;  2PI5 A;  1WLE A;  5L3E A;  3K0D A;  1M56 C;  2WLN A;  2Q6A A;  5FL7 G;  1FXV A;  2LFR A;  3B77 A;  3LDD A;  4WCE V;  5EC2 C;  3E83 A;  1YIJ V;  1MG1 A;  4MVM A;  3STL C;  2V7Q G;  5EC1 C;  1OCC C;  3R65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...