3OUSA

Mthk channel pore t59a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIAAVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Calcium-gated potassium channel mthK
publication title Tuning the ion selectivity of tetrameric cation channels by changing the number of ion binding sites.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 30
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2010-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ousA00
4XDLA 3SPHA 2ZXWC 3E8BA 3FB6C 3E86A 2EIKC 4XDKA 3K08A 1V55C 4P9OA 2BOCC 2DWDC 3OR7C 3WG7C 4MTOA 4P9PA 5CBFA 4PA9A 3TETA 4MSWC 2H8PC 2JK5C 1M56C 2KB1A 3SYOA 1QLEC 4H37A 4R50A 3HPLC 4G27B 4RAIA 2WLJA 2ITCC 2ITDC 3SPCA 3LDCA 3LUTB 3RBZA 4MVZA 4JTCB 3SPJA 1ZWIC 3SPGA 1OCCC 1R3IC 2AHZA 3E89A 3FB8C 2WLLA 2EIJC 4GX2A 4J9ZB 4MVQA 4RUEA 2AHYA 3RVZA 1K4DC 3LDEA 3ZRSA 3X2QC 3T2MA 3LDDA 3F5WC 4F4LA 1V54C 4H33A 5E1AC 1LNQA 3SJQC 3SYQA 4PDRA 4R8CA 2QKSA 2HG5C 3UKMA 1G4YB 3IFXA 1R3JC 2DWEC 4MTGA 3OUSA 4PA4A 1K4CC 5B1AC 4WFEA 2EILC 3SPIA 3T1CA 2WLHA 4PA6A 4QE9A 2X6AA 4EKWA 4DXWA 3F7YC 3ABKC 4MW3A 4G28B 4RO2A 1ORQC 3EFFK 3LNMB 4HYOA 1R3KC 2EINC 2HVKC 4I9WA 1OCZC 4MVMA 3K03A 4X8AA 4R6ZA 3JYCA 2Q6AA 2WLLB 3OGCC 5KUMA 3FB5C 4MTFA 5CBHA 3E83A 4LBEC 4P30A 4UUJC 4X88A 2IH3C 4PDVA 5B1BC 3AG3C 3T4DA 3VOUA 2ATKC 3SYCA 4XDJA 1KKDA 2WLNA 3GB7C 3ABLC 3BEHA 4MVSA 2W0FC 2OCCC 4MW8A 4PDLA 4PA7A 1R3LC 2EIMC 2WLMA 3SYAA 4X89A 2WLIA 5EC2C 3TCUA 1OCOC 3K04A 2A9HA 2QTOA 2X6CA 3ABMC 3ASOC 2P7TC 3IGAC 2BOBC 4TWKA 2NLJC 4MVRA 2WLIB 4WFGA 1JVMA 2R9RB 4QNHB 4LP8A 2WLKA 2A0LA 1BL8A 3F7VC 2Q67A 3K06A 3R65A 4PA3A 4ZBMA 4MVUA 4RUFA 4J9YB 2Q69A 4CBCA 4MS2A 4MVOA 4LCUC 1P7BA 3E8GA 4OXSA 5EBLC 4WFHA 2HFEC 5EBWC 5IY5C 3ASNC 3E8FA 1OCRC 5KUKA 4GX1A 2X6BA 2Y69C 3K0DA 1J95A 4P2ZA 3STZC 3OUFA 3SYPA 2A79B 5EC1C 2YEVA 2HVJC 4JTAB 3E8HA 3AG2C 1M57C 5J9PC 3T4ZA 3UM7A 5EK0A 2DYSC 3AG1C 3OR6C 4PDMA 3RVYA 5B3SC 3KG2A 3ZJZA 2K1EA 4QE7A 3RW0A 2HJFC 3FB7C 4KFMA 1S5HC 4GX0A 5BZBA 2ZD9A 1XL6A 3AG4C 3PJSK 5EBMC 2IH1C 2Q68A 4R7CA 4BW5A 4JTDB 5CBGA 2DYRC 1XL4A 4GX5A 3STLC 3K0GA 4WFFA 4HZ3A
chains in the Genus database with same CATH superfamily
3P3PA 3T1YO 1VQPV 1N34B 4P9OA 3K59A 2H8PC 4B3TO 1IBMO 1R73A 5B1BB 3T1HB 3CCRV 2VRZA 3RBZA 2XNDG 1R3IC 5CB4B 5KHGA 3L70H 3G4SV 2FKXA 3JASB 1FS0G 1AP5A 1FXKC 2WSSG 3OE7G 3X2QC 1PL0A 3O9OA 2IU3A 3AK3A 3WB0A 3B8NA 1THZA 2ADQB 1Q3EA 3CCLV 4DK1A 3CE2A 1OCRB 3CJHB 2Y69B 1B6QA 3L73H 2UXCB 5KMGA 1BMFG 2AGAA 4NB5A 4A5UB 1QR8A 1RFYA 2DYSB 2E5LO 5LYJA 2BCCH 4I50B 5GONA 4DW0A 3CCMV 4X20A 2RMKB 1K73W 1YSCA 4FVMA 4DV5O 2DMXA 1ZTEA 3M7MX 4B08A 2YIDA 2QWPB 4UVAA 3WB2A 4J80A 3RYFA 1RSOA 5EZYB 5IWAO 1OV9A 1ZL8A 4RQEA 1V9PA 2BOBC 4FIPC 3BFRA 3RYIA 1L8DA 4N23A 2WWWA 5L3BA 2RQ6A 4MVUA 2PGGA 2E75B 1LR1A 1QLNA 4EB6B 3AG2C 4LFAB 2DOSA 3AK1A 5H2FZ 3RVYA 1SA0B 1ZLZA 1JX9A 5BZBA 5IYZB 1H2NA 4LFBO 5EYPB 2CH7B 4XDLA 1D2DA 4DRXA 2EZOA 1VMGA 4PA9A 3FAVA 1B06A 2KB1A 4DR5O 4B3MO 1YXBA 1SQGA 4LF6O 2OCCB 3G6BA 4DV1O 2EIJC 2F23A 1KQSU 4RUEA 3ZX6A 2QR4A 4GUNA 1QVGU 5LMUB 2P22C 4GZRB 3MD0A 1MABG 2XASA 2BTQB 1BHBA 3K9AA 5D5QA 4R8CA 3S3WA 1TUBA 1KB9F 4RWUA 1MZFA 5IY5B 1JA8A 4PA4A 2KG7A 1AJNA 4UVCA 1VQKV 3F7YC 1WB7A 4DUZO 1ORQC 1XOUA 3CD6V 2HVKC 4LR3A 1HNZB 5BMVB 4FZ0A 1FXVA 2GBOA 4TT3G 1KYOF 3BAAA 4LBEC 4ABMA 5JVDA 1YHQV 4GKJO 1S72V 4NXMB 2UXDO 3JD2A 5KHKA 5EIBD 1BQZA 5CMUA 4JI7O 3SYAA 3VQXA 3TCUA 1Z2GA 3CPWU 5KMGB 1N33O 1IBKB 2R9RB 5LYJB 3C90A 5GONB 4JAVA 3W7SA 4JAUA 3E8GA 2E74B 2HFEC 1KECA 4DV4B 1Y4MA 3CCSV 1V55B 4FLZA 4DR4B 2ZQMA 2E76B 3GVMA 2GTAA 4JV5O 1NQTA 4CS3A 2IH1C 5JJNB 3CCQV 1RSOB 1S5JA 1ZL8B 2XAFA 3B09A 5FNVA 3RYIB 4B3SO 1WB8A 3BA9A 2VS0A 3MHSC 4DK0A 2GSMB 3LDCA 1ZWIC 4QPJA 5J2TA 1JOYA 1HWYA 2JGUA 1YJNV 3O65A 1H2LA 3JD0A 3E22B 1L0NH 1H2KA 2DWEC 2UU9O 4DRXB 3CC7V 3S3XA 2XT9A 3FAVB 1FJGO 2BTOA 1Q81W 4RO2A 2ETNA 5LL6Y 4IHJB 4I0XB 3CRRA 3OGCC 1AI5A 5CBHA 1CPYA 2Y48A 4JGSA 5D5PA 1J5EO 4X88A 4DR2B 4TSFG 1F51A 4LNUA 3WG7B 1TUBB 2HJDA 4ICGA 3BEHA 4PDLA 2AXTZ 2V1DA 2KG7B 2E5LB 1BZKA 4FJCC 3H9VA 4BIOA 2UUAB 2EX3A 2VWKA 1PV0A 3JAWA 2M6YA 2WLKA 2IJHA 4DO2A 2R72A 4F6EA 4MS2A 2Z5UA 3HKEA 5LGNA 5JVDB 4DV0O 2X6BA 3CS5A 4QPKA 5A9GA 4DV5B 4FM1A 2XHBA 2XAJA 4QGPA 2R9AA 4PDMA 2ZIMA 1WN7A 2ZDIA 1L0LH 1XMOO 1HNWB 4X1YA 4TV9A 4PI2A 1KMIZ 3K08A 4MTOA 4YJ2B 1SZTA 3MAQA 1N34O 1UJWB 2VQFB 3OMNB 5B66Z 3Q4HA 2VQEB 1VIBA 4U3JB 3SPCA 1AI6A 3T1HO 1NKDA 5L3DA 1NH2B 4BWAA 2Q8VA 4ZIBA 4LFBB 1OCZB 3FFQA 4H13B 5TISZ 5L3CA 1OJHA 3SYQA 2IJKA 4DW1A 3H1JH 5ITZA 2YUAA 3JD4A 4EEQA 3SPIA 2YIAA 3BVOA 1EM1A 5HFMA 4LF6B 1E1RG 2RDCA 4DV1B 2UXCO 4NR1A 3EFFK 3AG1B 3OFNG 4R6ZA 3ASOB 4L87A 1L1FA 4PV1B 1GN6A 2WAMA 5IYCO 4AQYO 1YJ9V 3GB7C 5LXTA 4JI6B 1M56B 3LNNA 3JARA 1GM8A 3W7XA 1AI7A 4Q6GA 3K04A 4MTXA 5JCOA 2WLIB 4LC1A 1JVMA 2JRIA 4UCVA 4JYAB 1VQNV 2UXDB 2LQTA 3H1LH 4GX1A 2ZM6B 2JGDA 5IYDO 3BHPA 2LGQA 2QWRB 3OR6C 4LFAO 5B3SC 4GX0A 4FM0A 1SKVA 2D2CB 1E79G 2ZCEA 3SPHA 2DE0X 1VARA 1V55C 4P9PA 2CAZC 4KUMA 3HKEB 2ITDC 1JJOA 4FLXA 3E89A 3ZHUA 4KP4A 5H9CA 3ZS8C 2UXXA 1QBZA 2LFRA 5LMUO 3B40A 1LUWA 1AILA 1R6KA 4B3SB 2HG5C 5FPRA 3ZRWB 2PI5A 2X6AA 3AEIA 3HKDB 4G28B 3Q4HB 2KQXA 2X0LA 4H44B 3APQA 4LH6A 3K57A 3ZN1A 5KUMA 1HNZO 1BGYH 3JSLA 5LOVA 5KHIA 1TUEB 4NXMO 3T4DA 1IVSA 5J2UA 3A8TA 3KCXA 3ZMUA 1SQQH 3MDSA 2QSAA 5ITZB 2EIMC 1G6UA 3J80N 1GH6A 3CP1A 3PN1A 2FYUH 5CA1B 1ENVA 5KHHA 3K06A 1IBKO 4JI2B 2B1GA 2EJ7A 1EN6A 2JEXA 1I08A 2D3OW 1N4CA 1OZ0A 2RJZA 4DV4O 3W7TA 1YJWV 2EILB 4DR4O 1RP3B 5IYZA 5LXTB 3RW0A 2HJFC 3JARB 2HLDG 3BY6A 5CA0A 1ROPA 3VQVA 4NKGB 3OMAB 2Z0AA 3FB6C 5C8YB 4I7ZB 4DV3B 3ZHTA 4DV6O 4LF4O 2PZSA 4O2AA 1R6NA 3ZBHA 2EBOA 2JGDB 3ABLB 2QA4V 1SQBH 3LDEA 1Q6UA 4YIOA 3QO7A 3LSQA 1W0KG 4O4HA 3F5WC 1LNQA 3CCJV 4DR6O 4FK5C 3D36A 5BMVA 1H8EG 2XUMA 2IJJA 1OCZC 2B9ZA 3RT3C 4J7KA 3JYCA 1YTFD 3FD9A 4JAAA 1PD3A 4BW9A 3SJBC 3EXAA 3AG3C 4DR2O 1QU7A 3G71V 3CWBH 3K5LA 5B5EZ 1MG1A 1WP8A 4JYBA 5L3EA 3CCUV 3I55V 3ABMC 3ASOC 1TGOA 3TXSA 3ZCCA 4WFGA 2UUAO 1MSWD 4Z2WA 4LFCB 3KCYA 4RUFA 4J9YB 4BIZA 3ABUA 4JI1B 4AQYB 5LOVB 1WJZA 2A79B 4L8JA 5LA6A 1AR1B 4D6TH 1S3JA 3TJTA 5J2UB 1JR9A 3ZJZA 2F43G 4PD4F 1S76D 3GWKC 2UXBB 2VWJA 4I4TA 1HNWO 1N32O 4J7ZA 3E8BA 1WP7A 5CBFA 2HP8A 1JCHA 4MSWC 1FAFA 3SYOA 3OGIB 2VQFO 4O2BA 4WBNA 3OEEG 2VQEO 4JTCB 1NTZH 4MVQA 4K0KO 4NXNB 4ZI7B 3OTOB 2ZE6A 2ZE8A 3T2MA 1ZUQA 3E22A 3BRCA 2R70A 5CA0B 1EN5A 1YCIA 4FLYA 1KBHA 3A2FA 1G4YB 1R3JC 4PELA 2NR5A 5IDJA 1QVFU 2RCVA 3SJAC 2YXHA 3HR0A 4JI8B 3RN4A 1NTKH 4IHJA 4I0XA 1XQ8A 2OTLV 4NVPA 1EZVH 4O2AB 3JATB 1R3KC 2YXLA 2ZDIC 1IZ3A 2YI9A 4MTFA 2ZR3A 1XEQA 1FFTB 2QE7G 2UUBB 3F5TA 4O4HB 4B3RO 2EIKB 1SZXA 1M1KW 2B1IA 2BSKA 4TV8B 1SQVH 5KHJA 4TUYB 1KKCA 4DYLA 2GDSA 4JI6O 1Y76A 2LW7A 5E79Z 1VQ8V 4CZZA 5EC2C 2BE3A 2QTSA 1U96A 1PP9H 1OCOC 2DJVA 3A0HZ 1K33A 3WFVA 2A0LA 1BL8A 1YITV 4MVOA 1PL4A 4JYAO 4UB6Z 2YIBD 3OUFA 1XNRB 2ZM6O 1M57C 4FM2A 4JI4B 5FL7G 2Y0PA 2ZE5A 3UQ8A 5JJJB 4UCRA 3ABKB 2A06H 3FB7C 4KFMA 1ZAUA 3ETDA 3IAYA 3K5NA 3BA8A 5GTIZ 5JQGB 4BW5A 3RWRD 2N05A 1ZSPA 3QO8A 4HZ3A 2PUSA 4YJ2A 2WPDG 1B3QA 3OR7C 4U3JA 4B7KA 1GM7A 2OT5A 1YF2A 4H37A 2NNUA 2B5UA 4FFKA 1RM1B 1TVKA 1UPGA 1Y6XA 4CH5A 3G6EV 1CP9A 1OCCC 5LA6B 3SR2C 1WPXA 5CN0A 5JCOC 2AZ2A 3OT7A 3LDDA 3JCUZ 4I4TB 2IBZH 4H33A 5DN6G 2UUCO 1BQ0A 4DV6B 4LF4B 4CH4A 3HKCA 1WLEA 2PI4A 4UCSA 1K3EA 4O2BB 4WBNB 3QVNA 3ZMSA 1XNQO 2LW1A 4X8AA 1CEZA 3N2KA 2Q7HA 4CS2A 3K3WA 5H6QA 2LJ2A 4IT5A 4DR6B 4CC5A 2P4KA 1VQ6V 1GN4A 5B1BC 1WPBA 2GTSA 1K34A 3ETQA 3OTFA 1MNGA 2FL4A 3JCZA 1I7FA 2WLMA 4K3AA 2WLIA 1XUQA 1AI4A 2X6CA 1NTMH 1CXZB 1IDSA 1GKFA 3B4SA 1YVWA 2LP7A 3DC5A 3D3IA 3LSUA 1K7DA 1V54B 4JI2O 3ZRVA 2LFSA 1OCRC 3KKYA 3SDLA 4F6RA 3FX7A 2Y69C 3K0DA 2C2AA 4TOIA 1K5SA 1M93A 3ZHQA 5J9PC 1QLEB 4X65O 2BSKB 3JAKB 2DYSC 2LO1A 1YEWA 1VQ4V 1F4MA 4YHHB 1TAEA 4FFBA 1Y76B 2YS8A 5BXZA 1XHZA 1NT2B 5LGUA 3U0ZA 4XDKA 1I5YA 1EN4A 3FYIB 4Z1VA 4DV3O 5LHHA 3HPLC 2WLJA 5EIBC 3SPJA 4MVZA 1D5AA 2WLLA 2YSUB 3H1KH 4J9ZB 2N74A 1MMMA 1M5IA 1JJ2U 4Z1MG 2OIEA 1N32B 4E2LA 2GUZA 3OEHG 3ZRWA 5HFLA 4YY3O 1W0JG 4PDRA 1DF5A 1PPJH 1Q5OA 1K97A 3UKMA 3JALA 1WAZA 2F1MA 2F95B 3HKDA 4QE9A 3DSQA 4BAYA 4ZOLA 4ZHQB 1VQ5V 5L3FA 3CCVV 1FXHA 1XMQB 4K0KB 1TVKB 3CSXA 4LF9O 1Q7YW 3AG4B 1F23A 3E35A 4K35A 4U3FH 1VQ9V 3E83A 5H6RA 4P30A 1I94O 4O4JA 2P6JA 3OM3B 2OTJV 1AB3A 3SYCA 1K8AW 1NU1H 2ADPA 2OCCC 4FZ1A 3CYOA 4G2KA 3HKCB 1AJQA 4X89A 1VEWA 2LGWA 4JI3O 1MZEA 5CA1A 3ZEDA 4K8XA 3M8AA 1Q8IA 2N04A 1Y67A 1M4UA 3J7AU 3X2QB 3P32A 4LFCO 3N2KB 4JZGA 4B3RB 2P06A 5IY5C 3WB1A 4FLTA 3A0RA 1SC5B 3UM7A 3SYPA 4UB8Z 2YEVA 4JI1O 3E8HA 4WFBV 4BR6A 1PKXA 1PNKA 5B1NA 3U11A 1YIJV 5EK0A 1NVPD 4OPAA 3W7UA 1Y74A 2HKOA 3DGEA 2UXBO 4R7CA 3J81N 4NTYA 1HR0O 5C8YA 1NR1A 3GWOA 3ZMVA 2BOCC 3L74H 3TETA 4J10A 2JK5C 1XBLA 3CRMA 4X62B 3CB2A 2PTMA 4F6RB 3ML0A 5B1AB 5LP6A 1M9NA 4LF7B 4I5SA 1R1BA 1XDCA 1DGSA 2CGNA 2JS5A 2QWOB 2Y0IA 3K9SA 4UV9A 3ZRSA 1X4TA 4NXNO 1SERA 3OTOO 4FFBB 3JSNA 4O4IA 3SJQC 3W7WA 2DN9A 2GV9A 1FD9A 3IFXA 1RM1C 4PJ0Z 1VF6A 4DXWA 4JI8O 3AG2B 4LF5B 1E1QG 3DTUB 1K5QA 3ABTA 2XAHA 2Q0OC 3L9DA 1DTOA 2WLLB 4HAMA 1FFXA 1N0NA 2UUCB 2PYLA 2UUBO 5IE9A 4OX9B 2GUZB 1GMGA 1IX9A 3ASNB 4MVSA 3JALB 3TXQA 1NR7A 4DR1B 2Y4UA 3APOA 1XNQB 4GYCB 1F4NA 4ZOLB 1MSDA 2IM9A 1IURA 2EIJB 2CUGA 1S0VA 2JEUA 1GM9A 4DUYO 2DQ3A 2ODMA 1YTFB 2DYRB 4CBCA 4OXSA 2W6IG 2ZKOA 1GAXA 3I5DA 2NN4A 1XI1A 3ZIAG 4D7TA 1VF5B 2E3CA 2YIBA 4O4JB 3VQWA 5LGTA 1IXBA 3QNEA 4GCZA 1XNRO 2F4VO 3K79A 3I56V 4HBNA 5LMNO 4FLVA 4JI4O 1B04A 1O9GA 4U7OA 1VQOV 4WFFA 4QJFB 1SQPH 3CC2V 3E86A 1QR9A 2QM8A 3WG7C 1FKAO 2G38A 1U97A 3QO5A 4D7SA 1QLEC 4X65B 1KU9A 2F66C 3FB8C 2YEVB 4UCTA 4ZI7A 1N0JA 1BHAA 2AHYA 3UCSC 1K4DC 5IJ9B 4LF8B 1A32A 3H1HH 1Y74B 3SGIA 1WNSA 4CH6A 2IJIA 3A0BZ 3UO3A 2ZE7A 1EZJA 3JATA 3R66A 3ZMZA 1TA8A 3VBBA 4EFBA 4I9WA 2QWQB 4BIUA 5LP6B 3FB5C 3H1IH 5BR8B 4YY3B 2H94A 2WA3A 4TV8A 3CCEV 3K58A 1MOFA 4TUYA 4UVBA 1NI8A 3CMEV 5BY1A 2QKAA 4J42A 2YICA 4O4IB 4TQFA 4MW8A 1COWG 1NZ6A 4JI0B 1R3LC 3JD1A 3QTCA 5B1OA 3ZMTA 1S77D 4LF9B 1OHHG 2P7TC 1NS1A 4TWKA 2Q7EA 3F7VC 4DR3B 2ZT9B 1I94B 1HP8A 2CGOA 3P30A 1P7BA 2RNBA 2ZXWB 1FFXB 3JD3A 3RGBA 1JFFB 4KL1A 2Q9LA 3K5MA 3AG1C 1DLBA 4JI3B 3WU2Z 5H5NA 2K1EA 5JQGA 1N36B 4JPRA 4X1KA 1QNMA 4YHHO 3IJ4A 1H2MA 2P67A 3B77A 2EZPA 4NYKA 2MW2B 1M56C 3U10A 4R50A 1IXMA 4WCEV 1PM9A 2ZNIA 3LUTB 3DXRA 3P3NA 4X66O 1AROP 5LBQA 1HR0B 2DW4A 2FMLA 3NR7A 4TQDA 2CE4A 4FMTA 1JQ0A 2PYJA 3RYCB 5B1AC 3T1CA 3UT5A 5KA5A 1KP2A 2YXYA 3RFRA 2UXNA 1S5LZ 2FB5A 2JIZG 3K03A 1XMQO 2AW9A 2FTKA 4DR7B 5IJ0A 4KHPB 4FPPA 2IH3C 1K9MW 1ZX3A 1GO3F 5IYBO 3BCCH 2QWNB 3FYEB 2NLJC 4NTWA 4O4LA 1SRYA 2YDEA 5EBLC 5EBWC 4LCUC 1QHTA 2IW5A 4WFHA 2HHHO 3ASNC 3E8FA 4CC6A 1WA8A 3CRAA 3JAKA 2R9IA 3T4ZA 5DEDA 4YJ3B 1RPRA 4HNAA 3L72H 3E2EA 1P49A 2ZINA 1URFA 1P7GA 2DYRC 4GX5A 4DUYB 2MK3A 5GTHZ 1SS3A 2W6JG 1HNXB 4RAIA 4G27B 3ETEA 2ITCC 4UXNA 2F4VB 4X62O 2KSDA 5LMNB 3IC7A 3RYHA 2PF4E 4LF7O 1MA1A 3CXHF 2QEXV 2Q4PA 2JJ1G 4X1KB 5L3GA 4W4LA 2X7RB 3D3QA 3TGUH 4EFEA 2PY5A 3MHHC 3OUSA 2M7WA 4WFEA 2EILC 4ZHQA 1P84F 2HR3A 1BSMA 1H2GA 4EKWA 2F93B 2RN9A 4MW3A 3ZHVA 3ZHRA 4DV2B 2WA4A 1Y66A 3LNMB 4LF5O 5B3SB 3DXRB 4LH7A 5K1XA 4OGQB 2Q0AA 4PDVA 4X20B 4J41A 4OX9O 4XDJA 5JH7A 3ABLC 1Q6IA 2XOKG 3QG5A 4YXWG 4JYCA 1KC8W 4KXRA 4X64B 1FPOA 2OYQA 5C93A 3UT5B 4DR1O 2JVDA 1FXKA 5LP6C 1K92A 3RYFB 4QNHB 4GLXA 1FYJA 4PA3A 1H8HG 1Q90D 1BE3H 1SQFA 4K8ZA 5KX5A 3G80A 5IJ0B 1Q86W 4P2ZA 3B2EE 2HVJC 2XAQA 4JI5B 1YI2V 1HW7A 1VF6C 4X1IA 4GKKB 2EJRA 1S5HC 4UCOA 4OPHA 4J11A 4PHZA 4UV8A 4ASUG 3BABA 2V4DA 5CBGA 4LWSA 3T1YB 5JWPA 1IBLO 1HDJA 2ZXWC 4B3TB 1Q6HA 1IBMB 4O4LB 1JMKC 1BT8A 1M90W 1GK9A 4XBFA 4IYIA 1WA8B 4H0LB 2L6LA 4CH3A 4DV7O 2ZR2A 2O57A 2EIMB 2QGNA 5KAIZ 5A2QN 1NVPB 2EINB 5K1PA 4HNAB 4LF8O 3VQYA 4F4LA 1SF9A 1VQLV 1Q43A 4UFZA 1AJPA 1W2BU 3BPZA 4I9QA 1K4CC 1P4RA 5CA3A 2WLHA 4Q20A 1H2SB 3L71H 4X66B 3DC6A 2W0XA 3CRQA 3RYHB 2Q6AA 1KUQA 5AG2A 5KAFZ 1BS3A 2OCHA 4YIPA 5BR8O 5GW7A 3CXCU 2ATKC 2Y4TA 1AR5A 4QIWF 2WLNA 3EVKA 2W0FC 2ILMA 4PA7A 1XHXA 4JI0O 5IWAB 4C7UA 2CTPA 2QTOA 1DF4A 2ARHA 4MVRA 2P4VA 3N2GA 3KZIZ 3UO2A 3QF7A 1VP7A 4DR3O 2QM7A 5KUKA 2XAGA 3STZC 2CDYA 3CEIA 5EC1C 2QKCA 4WF9V 2KKWA 4I55A 4IIJA 1VQMV 1PNLA 5JH7B 4QE7A 1AVMA 1LUVA 3AK2A 3PJSK 1N36O 2L35A 3JAMN 1FXKB 2EIKC 3TK1A 4PI0A 2HHHB 2A7WA 4DR5B 2QJ1A 2CTQA 2XTAA 4CS4A 4B3MB 4E4EA 2CTRA 5FNVB 2ZIOA 2YI8A 3AG3B 1F7YA 2JDIG 1AP6A 1RPOA 5KX5B 2GHYA 2V7QG 1EFRG 3D36C 1G8MA 3ETGA 2AHZA 5IJ9A 3ICXA 4IGGA 3HKBA 4GX2A 3RVZA 1SETA 1Z5WA 5J2TB 4X1IB 3ABMB 5E1AC 1DK1A 1Z5VA 5JJEB 4LWSB 3CMAV 2QKSA 4UCUA 4MTGA 1QCEA 1T5EA 1W59A 2JS3A 1AR4A 4GT1A 4DUZB 1PNMA 3CHXA 3ABKC 4JASA 2Z3YA 1X59A 3SJCC 4IL6Z 4JZ2A 4U7NA 4GKJB 1SESA 4WFAV 2JJ2G 2Q73A 4DR7O 2OWOA 4KHPO 3VOUA 1GRJA 1VF7A 3OD4A 4IYHA 1KKDA 4FLWA 4LNUB 4JI7B 1I0HA 4AHCA 2YC0A 3B8MA 3CC4V 2Q5ZA 2A3QA 1N33B 3H01A 4RQFA 1UFIA 1G1XB 1BCCH 3ZHSA 1US6A 2IU0A 5KA6A 3ZN0A 2Q67A 4ZBMA 3R65A 3JAWB 2Q69A 4MT8A 3D8CA 1J95A 1JFFA 5CB4A 1NH2D 4JTAB 3JASA 3OMIB 2Q7GA 1GTOA 1YZBA 4JV5B 4JF3A 5KLVH 4W4KA 1QQCA 2ZD9A 1XL6A 4X9QA 2Q68A 2QDOA 1XL4A 3STLC 5DM6V 2EULA 1GN2A 3CJHA 4X1YB 4B7EA 4TV9B 2DWDC 3N2GB 3K5OA 1HNXO 4I50A 2ZNJA 3SPGA 3AG7A 3C3SA 4I55B 4IIJB 5FPOA 5F2VO 1OCOB 1KP3A 1IBLB 3G67A 1V54C 1R6TA 1XILA 4ZKIA 4N21A 2P5OA 3N27A 2K9PA 2UU9B 3RYCA 2AZ0A 1N8RW 3FKSG 1FJGB 4PA6A 5EZYA 4DV7B 3L75H 1GN3A 1M57B 2DQ0A 1Q82W 4HYOA 2EINC 4DV2O 2CTWA 4MVMA 3M99B 3HKBB 3THOA 1J5EB 1EBOA 3CRCA 1O9HA 2H3OA 4UUJC 4NTXA 4J7JA 3EHBB 4EB6A 1NJIW 3LSSA 5DECA 1SA0A 3CX5F 1JPXA 4X64O 1YDXA 5EYPA 2CH7A 1D5NA 2QM4A 1OCCB 1XREA 2A9HA 3IGAC 2OIGA 1H38A 5FLXN 4LP8A 4AILC 1NBMG 4JYYA 1SQXH 2CK3G 5LHGA 4DV0B 4FLUA 2P90A 3IC9A 1VQ7V 4YJ3A 5LHIA 1KD1W 5IT9N 1I5XA 3NXSA 3OAAG 4JI5O 3C3TA 3KG2A 2HEPA 1XMOB 3ZRXA 3AG4C 3OW2U 2BTQA 4GKKO 5EBMC 3HB3B 4JTDB 4AI8A 3K0GA
chains in the Genus database with same CATH topology
5LGUA 3SPHA 2MK3A 4XDKA 1I5YA 1VQPV 1V55C 4P9OA 4P9PA 2H8PC 2W6JG 3FYIB 1R73A 4KUMA 5LHHA 3HPLC 4G27B 3ETEA 4RAIA 2WLJA 5B1BB 3CCRV 2ITCC 2ITDC 4UXNA 3RBZA 3SPJA 4MVZA 2XNDG 1R3IC 3E89A 3IC7A 2WLLA 2YSUB 3G4SV 4KP4A 4J9ZB 5H9CA 1FS0G 1FXKC 2WSSG 3OE7G 1JJ2U 2UXXA 3X2QC 1QBZA 4Z1MG 2LFRA 4E2LA 3OEHG 2QEXV 1PL0A 3ZRWA 2JJ1G 5L3GA 5HFLA 1R6KA 2IU3A 1W0JG 4PDRA 1DF5A 2X7RB 3B8NA 1THZA 2HG5C 1K97A 3UKMA 3ZRWB 3CCLV 3MHHC 3OUSA 1OCRB 2M7WA 4WFEA 2EILC 2PI5A 2Y69B 2HR3A 4QE9A 1B6QA 2X6AA 4BAYA 1H2GA 4EKWA 1BMFG 3AEIA 4MW3A 4G28B 1QR8A 1VQ5V 5L3FA 3CCVV 1FXHA 1Y66A 2DYSB 3LNMB 5B3SB 2X0LA 1Q7YW 3ZN1A 3CCMV 3AG4B 1F23A 3E35A 5KUMA 1VQ9V 3E83A 5H6RA 4P30A 1TUEB 1K73W 4PDVA 1YSCA 2P6JA 3OM3B 3T4DA 2OTJV 3SYCA 4XDJA 3ZMUA 1K8AW 3ABLC 2XOKG 2OCCC 4YXWG 4JYCA 1KC8W 3CYOA 4UVAA 4G2KA 2EIMC 1AJQA 4X89A 5C93A 1FXKA 1K92A 4RQEA 3CP1A 2BOBC 4FIPC 4QNHB 1ENVA 3K06A 3P32A 2WWWA 1H8HG 4N23A 4PA3A 3X2QB 4MVUA 5L3BA 2B1GA 2JEXA 5IY5C 3A0RA 2D3OW 1Q86W 3UM7A 1OZ0A 4P2ZA 3SYPA 1QLNA 2YEVA 2HVJC 3E8HA 4WFBV 1PKXA 1PNKA 2XAQA 3AG2C 5B1NA 3W7TA 1YI2V 1YJWV 1YIJV 2EILB 5EK0A 3RVYA 1NVPD 3W7UA 3RW0A 2HKOA 2HJFC 1JX9A 2EJRA 1S5HC 3DGEA 5BZBA 2HLDG 3BY6A 4ASUG 4R7CA 4UV8A 5CBGA 1ROPA 4XDLA 3OMAB 2ZXWC 3FB6C 2EZOA 1NR1A 3GWOA 3ZMVA 2BOCC 4PA9A 3TETA 2JK5C 2KB1A 1M90W 1GK9A 4XBFA 1R6NA 2EBOA 3ABLB 3ML0A 5B1AB 2OCCB 2ZR2A 2QA4V 1M9NA 2EIJC 2EIMB 1KQSU 4RUEA 4I5SA 1QVGU 3LDEA 1NVPB 4UV9A 3QO7A 3ZRSA 2EINB 1SERA 3LSQA 1W0KG 3MD0A 3F5WC 4F4LA 1MABG 2XASA 1BHBA 1LNQA 3K9AA 1VQLV 3SJQC 3W7WA 4R8CA 3CCJV 1AJPA 1W2BU 3IFXA 1RM1C 5IY5B 4FK5C 4PA4A 1K4CC 1AJNA 1P4RA 3D36A 2WLHA 5CA3A 4Q20A 4UVCA 4DXWA 3F7YC 1VQKV 3AG2B 1E1QG 3DTUB 1H8EG 1ORQC 3CD6V 1K5QA 2HVKC 2IJJA 3ABTA 1OCZC 2XAHA 3JYCA 1YTFD 1DTOA 2Q6AA 2WLLB 1FXVA 4TT3G 1PD3A 4HAMA 4LBEC 1YHQV 1S72V 5GW7A 3CXCU 3AG3C 2ATKC 1GMGA 4QIWF 2WLNA 3JD2A 3ASNB 4MVSA 3G71V 2W0FC 1NR7A 1MG1A 4JYBA 4PA7A 5L3EA 5CMUA 3SYAA 3CCUV 3TCUA 1F4NA 3CPWU 3I55V 2QTOA 1DF4A 3ABMC 2EIJB 3ASOC 3ZCCA 4WFGA 1S0VA 4MVRA 1MSWD 2R9RB 2JEUA 1GM9A 4JAVA 2DQ3A 4RUFA 3W7SA 4J9YB 2DYRB 4CBCA 1YTFB 4JAUA 4OXSA 2W6IG 3ABUA 3E8GA 2QM7A 4BIZA 2HFEC 1KECA 3ZIAG 5KUKA 1Y4MA 2XAGA 3CCSV 3STZC 1V55B 2A79B 5EC1C 5LGTA 4WF9V 3QNEA 4GCZA 2ZQMA 1AR1B 1S3JA 3K79A 3I56V 1VQMV 1PNLA 3ZJZA 2F43G 4QE7A 1S76D 1NQTA 3PJSK 4U7OA 2IH1C 3CCQV 1VQOV 1FXKB 4WFFA 4QJFB 3CC2V 3E8BA 2XAFA 3E86A 1QR9A 2EIKC 3TK1A 2QM8A 5CBFA 3WG7C 1JCHA 4MSWC 3QO5A 3MHSC 3SYOA 1QLEC 3AG3B 2JDIG 1RPOA 2GHYA 2V7QG 1EFRG 2GSMB 3LDCA 3OEEG 1G8MA 4JTCB 1ZWIC 3ETGA 2AHZA 3FB8C 2YEVB 4QPJA 1BHAA 4GX2A 4MVQA 1JOYA 2AHYA 1HWYA 3RVZA 1K4DC 1SETA 1YJNV 3ABMB 3T2MA 5E1AC 3JD0A 3CMAV 2QKSA 2IJIA 1G4YB 1R3JC 2DWEC 4PELA 4MTGA 5IDJA 1QVFU 3CC7V 1QCEA 1EZJA 4GT1A 1PNMA 3ZMZA 3ABKC 4JASA 2OTLV 2Z3YA 1Q81W 4RO2A 1R3KC 3VBBA 4I9WA 2ZDIC 4BIUA 3OGCC 1AI5A 3FB5C 4U7NA 4MTFA 5CBHA 1SESA 2ZR3A 4WFAV 1FFTB 1CPYA 2JJ2G 2Y48A 4JGSA 2H94A 2QE7G 4X88A 3CCEV 1MOFA 4TSFG 4UVBA 1F51A 2EIKB 3CMEV 3VOUA 1M1KW 2B1IA 3WG7B 1KKDA 3BEHA 4MW8A 4PDLA 1COWG 1R3LC 3B8MA 3JD1A 2V1DA 3CC4V 5B1OA 3ZMTA 1VQ8V 4CZZA 5EC2C 4FJCC 1S77D 3H01A 4RQFA 1OCOC 1OHHG 2P7TC 4TWKA 2IU0A 1K33A 5KA6A 3WFVA 2WLKA 2A0LA 1BL8A 2IJHA 2Q67A 3F7VC 3R65A 4ZBMA 3ZN0A 4DO2A 1YITV 2Q69A 4MS2A 3P30A 4MVOA 1P7BA 2Z5UA 4MT8A 5LGNA 2ZXWB 3JD3A 2X6BA 4QPKA 1J95A 3OUFA 1NH2D 4JTAB 2XAJA 1M57C 3OMIB 1GTOA 3AG1C 4PDMA 5FL7G 4JF3A 1DLBA 2K1EA 3ABKB 3FB7C 2ZDIA 4KFMA 2ZD9A 3ETDA 1XL6A 4JPRA 4BW5A 2Q68A 1XL4A 3STLC 5DM6V 2P67A 3B77A 2EZPA 3QO8A 4HZ3A 2WPDG 3K08A 2DWDC 3OR7C 4MTOA 1SZTA 1GM7A 2OT5A 1M56C 1UJWB 3OMNB 4H37A 2NNUA 4R50A 1IXMA 2B5UA 4WCEV 1RM1B 3SPCA 1AI6A 3LUTB 1NKDA 3G6EV 1CP9A 5L3DA 3SPGA 1OCCC 1NH2B 1AROP 5LBQA 1WPXA 1OCOB 5CN0A 2DW4A 1KP3A 1OCZB 3LDDA 1V54C 4H33A 5L3CA 4ZKIA 4N21A 3SYQA 2IJKA 4FMTA 5DN6G 1JQ0A 1N8RW 3FKSG 3JD4A 5B1AC 3T1CA 3SPIA 1WLEA 4PA6A 5KA5A 2PI4A 1KP2A 5HFMA 1E1RG 1M57B 2UXNA 2DQ0A 1Q82W 1K3EA 3EFFK 4HYOA 3AG1B 2EINC 3ZMSA 3OFNG 2JIZG 4MVMA 3K03A 3M99B 4X8AA 1CEZA 4R6ZA 3K3WA 2FTKA 5H6QA 1EBOA 3ASOB 4L87A 1L1FA 4FPPA 4UUJC 2IH3C 1VQ6V 3EHBB 1K9MW 2WAMA 5B1BC 1NJIW 3LSSA 5IYCO 1K34A 1GO3F 1YJ9V 3GB7C 5IYBO 1M56B 1JPXA 1GM8A 3JCZA 3W7XA 2WLMA 1AI7A 2WLIA 1OCCB 3FYEB 1AI4A 3K04A 4MTXA 2A9HA 2X6CA 3IGAC 1H38A 2NLJC 2WLIB 4LC1A 1GKFA 1JVMA 4LP8A 2LP7A 1NBMG 1SRYA 3D3IA 1VQNV 2CK3G 5EBLC 1K7DA 4LCUC 1V54B 5EBWC 2IW5A 5LHGA 4WFHA 2P90A 3ZRVA 3ASNC 2LFSA 1OCRC 3E8FA 1VQ7V 4GX1A 2Y69C 3K0DA 2C2AA 5IYDO 5LHIA 1K5SA 1KD1W 2R9IA 5J9PC 3T4ZA 1I5XA 1QLEB 3NXSA 2DYSC 3OAAG 3OR6C 5B3SC 3KG2A 1RPRA 1VQ4V 1F4MA 3ZRXA 4GX0A 3AG4C 3E2EA 3OW2U 5EBMC 1E79G 3HB3B 4JTDB 2DYRC 4GX5A 3K0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDL A;  3SPH A;  2ZXW C;  3E8B A;  3FB6 C;  3E86 A;  2EIK C;  4XDK A;  3K08 A;  1V55 C;  4P9O A;  2BOC C;  2DWD C;  3OR7 C;  3WG7 C;  4MTO A;  4P9P A;  5CBF A;  4PA9 A;  3TET A;  4MSW C;  2H8P C;  2JK5 C;  1M56 C;  2KB1 A;  3SYO A;  1QLE C;  4H37 A;  4R50 A;  3HPL C;  4G27 B;  4RAI A;  2WLJ A;  2ITC C;  2ITD C;  3SPC A;  3LDC A;  3LUT B;  3RBZ A;  4MVZ A;  4JTC B;  3SPJ A;  1ZWI C;  3SPG A;  1OCC C;  1R3I C;  2AHZ A;  3E89 A;  3FB8 C;  2WLL A;  2EIJ C;  4GX2 A;  4J9Z B;  4MVQ A;  4RUE A;  2AHY A;  3RVZ A;  1K4D C;  3LDE A;  3ZRS A;  3X2Q C;  3T2M A;  3LDD A;  3F5W C;  4F4L A;  1V54 C;  4H33 A;  5E1A C;  1LNQ A;  3SJQ C;  3SYQ A;  4PDR A;  4R8C A;  2QKS A;  2HG5 C;  3UKM A;  1G4Y B;  3IFX A;  1R3J C;  2DWE C;  4MTG A;  3OUS A;  4PA4 A;  1K4C C;  5B1A C;  4WFE A;  2EIL C;  3SPI A;  3T1C A;  2WLH A;  4PA6 A;  4QE9 A;  2X6A A;  4EKW A;  4DXW A;  3F7Y C;  3ABK C;  4MW3 A;  4G28 B;  4RO2 A;  1ORQ C;  3EFF K;  3LNM B;  4HYO A;  1R3K C;  2EIN C;  2HVK C;  4I9W A;  1OCZ C;  4MVM A;  3K03 A;  4X8A A;  4R6Z A;  3JYC A;  2Q6A A;  2WLL B;  3OGC C;  5KUM A;  3FB5 C;  4MTF A;  5CBH A;  3E83 A;  4LBE C;  4P30 A;  4UUJ C;  4X88 A;  2IH3 C;  4PDV A;  5B1B C;  3AG3 C;  3T4D A;  3VOU A;  2ATK C;  3SYC A;  4XDJ A;  1KKD A;  2WLN A;  3GB7 C;  3ABL C;  3BEH A;  4MVS A;  2W0F C;  2OCC C;  4MW8 A;  4PDL A;  4PA7 A;  1R3L C;  2EIM C;  2WLM A;  3SYA A;  4X89 A;  2WLI A;  5EC2 C;  3TCU A;  1OCO C;  3K04 A;  2A9H A;  2QTO A;  2X6C A;  3ABM C;  3ASO C;  2P7T C;  3IGA C;  2BOB C;  4TWK A;  2NLJ C;  4MVR A;  2WLI B;  4WFG A;  1JVM A;  2R9R B;  4QNH B;  4LP8 A;  2WLK A;  2A0L A;  1BL8 A;  3F7V C;  2Q67 A;  3K06 A;  3R65 A;  4PA3 A;  4ZBM A;  4MVU A;  4RUF A;  4J9Y B;  2Q69 A;  4CBC A;  4MS2 A;  4MVO A;  4LCU C;  1P7B A;  3E8G A;  4OXS A;  5EBL C;  4WFH A;  2HFE C;  5EBW C;  5IY5 C;  3ASN C;  3E8F A;  1OCR C;  5KUK A;  4GX1 A;  2X6B A;  2Y69 C;  3K0D A;  1J95 A;  4P2Z A;  3STZ C;  3OUF A;  3SYP A;  2A79 B;  5EC1 C;  2YEV A;  2HVJ C;  4JTA B;  3E8H A;  3AG2 C;  1M57 C;  5J9P C;  3T4Z A;  3UM7 A;  5EK0 A;  2DYS C;  3AG1 C;  3OR6 C;  4PDM A;  3RVY A;  5B3S C;  3KG2 A;  3ZJZ A;  2K1E A;  4QE7 A;  3RW0 A;  2HJF C;  3FB7 C;  4KFM A;  1S5H C;  4GX0 A;  5BZB A;  2ZD9 A;  1XL6 A;  3AG4 C;  3PJS K;  5EBM C;  2IH1 C;  2Q68 A;  4R7C A;  4BW5 A;  4JTD B;  5CBG A;  2DYR C;  1XL4 A;  4GX5 A;  3STL C;  3K0G A;  4WFF A;  4HZ3 A; 
#chains in the Genus database with same CATH topology
 3P3P A;  3T1Y O;  1VQP V;  1N34 B;  4P9O A;  3K59 A;  2H8P C;  4B3T O;  1IBM O;  1R73 A;  5B1B B;  3T1H B;  3CCR V;  2VRZ A;  3RBZ A;  2XND G;  1R3I C;  5CB4 B;  5KHG A;  3L70 H;  3G4S V;  2FKX A;  3JAS B;  1FS0 G;  1AP5 A;  1FXK C;  2WSS G;  3OE7 G;  3X2Q C;  1PL0 A;  3O9O A;  2IU3 A;  3AK3 A;  3WB0 A;  3B8N A;  1THZ A;  2ADQ B;  1Q3E A;  3CCL V;  4DK1 A;  3CE2 A;  1OCR B;  3CJH B;  2Y69 B;  1B6Q A;  3L73 H;  2UXC B;  5KMG A;  1BMF G;  2AGA A;  4NB5 A;  4A5U B;  1QR8 A;  1RFY A;  2DYS B;  2E5L O;  5LYJ A;  2BCC H;  4I50 B;  5GON A;  4DW0 A;  3CCM V;  4X20 A;  2RMK B;  1K73 W;  1YSC A;  4FVM A;  4DV5 O;  2DMX A;  1ZTE A;  3M7M X;  4B08 A;  2YID A;  2QWP B;  4UVA A;  3WB2 A;  4J80 A;  3RYF A;  1RSO A;  5EZY B;  5IWA O;  1OV9 A;  1ZL8 A;  4RQE A;  1V9P A;  2BOB C;  4FIP C;  3BFR A;  3RYI A;  1L8D A;  4N23 A;  2WWW A;  5L3B A;  2RQ6 A;  4MVU A;  2PGG A;  2E75 B;  1LR1 A;  1QLN A;  4EB6 B;  3AG2 C;  4LFA B;  2DOS A;  3AK1 A;  5H2F Z;  3RVY A;  1SA0 B;  1ZLZ A;  1JX9 A;  5BZB A;  5IYZ B;  1H2N A;  4LFB O;  5EYP B;  2CH7 B;  4XDL A;  1D2D A;  4DRX A;  2EZO A;  1VMG A;  4PA9 A;  3FAV A;  1B06 A;  2KB1 A;  4DR5 O;  4B3M O;  1YXB A;  1SQG A;  4LF6 O;  2OCC B;  3G6B A;  4DV1 O;  2EIJ C;  2F23 A;  1KQS U;  4RUE A;  3ZX6 A;  2QR4 A;  4GUN A;  1QVG U;  5LMU B;  2P22 C;  4GZR B;  3MD0 A;  1MAB G;  2XAS A;  2BTQ B;  1BHB A;  3K9A A;  5D5Q A;  4R8C A;  3S3W A;  1TUB A;  1KB9 F;  4RWU A;  1MZF A;  5IY5 B;  1JA8 A;  4PA4 A;  2KG7 A;  1AJN A;  4UVC A;  1VQK V;  3F7Y C;  1WB7 A;  4DUZ O;  1ORQ C;  1XOU A;  3CD6 V;  2HVK C;  4LR3 A;  1HNZ B;  5BMV B;  4FZ0 A;  1FXV A;  2GBO A;  4TT3 G;  1KYO F;  3BAA A;  4LBE C;  4ABM A;  5JVD A;  1YHQ V;  4GKJ O;  1S72 V;  4NXM B;  2UXD O;  3JD2 A;  5KHK A;  5EIB D;  1BQZ A;  5CMU A;  4JI7 O;  3SYA A;  3VQX A;  3TCU A;  1Z2G A;  3CPW U;  5KMG B;  1N33 O;  1IBK B;  2R9R B;  5LYJ B;  3C90 A;  5GON B;  4JAV A;  3W7S A;  4JAU A;  3E8G A;  2E74 B;  2HFE C;  1KEC A;  4DV4 B;  1Y4M A;  3CCS V;  1V55 B;  4FLZ A;  4DR4 B;  2ZQM A;  2E76 B;  3GVM A;  2GTA A;  4JV5 O;  1NQT A;  4CS3 A;  2IH1 C;  5JJN B;  3CCQ V;  1RSO B;  1S5J A;  1ZL8 B;  2XAF A;  3B09 A;  5FNV A;  3RYI B;  4B3S O;  1WB8 A;  3BA9 A;  2VS0 A;  3MHS C;  4DK0 A;  2GSM B;  3LDC A;  1ZWI C;  4QPJ A;  5J2T A;  1JOY A;  1HWY A;  2JGU A;  1YJN V;  3O65 A;  1H2L A;  3JD0 A;  3E22 B;  1L0N H;  1H2K A;  2DWE C;  2UU9 O;  4DRX B;  3CC7 V;  3S3X A;  2XT9 A;  3FAV B;  1FJG O;  2BTO A;  1Q81 W;  4RO2 A;  2ETN A;  5LL6 Y;  4IHJ B;  4I0X B;  3CRR A;  3OGC C;  1AI5 A;  5CBH A;  1CPY A;  2Y48 A;  4JGS A;  5D5P A;  1J5E O;  4X88 A;  4DR2 B;  4TSF G;  1F51 A;  4LNU A;  3WG7 B;  1TUB B;  2HJD A;  4ICG A;  3BEH A;  4PDL A;  2AXT Z;  2V1D A;  2KG7 B;  2E5L B;  1BZK A;  4FJC C;  3H9V A;  4BIO A;  2UUA B;  2EX3 A;  2VWK A;  1PV0 A;  3JAW A;  2M6Y A;  2WLK A;  2IJH A;  4DO2 A;  2R72 A;  4F6E A;  4MS2 A;  2Z5U A;  3HKE A;  5LGN A;  5JVD B;  4DV0 O;  2X6B A;  3CS5 A;  4QPK A;  5A9G A;  4DV5 B;  4FM1 A;  2XHB A;  2XAJ A;  4QGP A;  2R9A A;  4PDM A;  2ZIM A;  1WN7 A;  2ZDI A;  1L0L H;  1XMO O;  1HNW B;  4X1Y A;  4TV9 A;  4PI2 A;  1KMI Z;  3K08 A;  4MTO A;  4YJ2 B;  1SZT A;  3MAQ A;  1N34 O;  1UJW B;  2VQF B;  3OMN B;  5B66 Z;  3Q4H A;  2VQE B;  1VIB A;  4U3J B;  3SPC A;  1AI6 A;  3T1H O;  1NKD A;  5L3D A;  1NH2 B;  4BWA A;  2Q8V A;  4ZIB A;  4LFB B;  1OCZ B;  3FFQ A;  4H13 B;  5TIS Z;  5L3C A;  1OJH A;  3SYQ A;  2IJK A;  4DW1 A;  3H1J H;  5ITZ A;  2YUA A;  3JD4 A;  4EEQ A;  3SPI A;  2YIA A;  3BVO A;  1EM1 A;  5HFM A;  4LF6 B;  1E1R G;  2RDC A;  4DV1 B;  2UXC O;  4NR1 A;  3EFF K;  3AG1 B;  3OFN G;  4R6Z A;  3ASO B;  4L87 A;  1L1F A;  4PV1 B;  1GN6 A;  2WAM A;  5IYC O;  4AQY O;  1YJ9 V;  3GB7 C;  5LXT A;  4JI6 B;  1M56 B;  3LNN A;  3JAR A;  1GM8 A;  3W7X A;  1AI7 A;  4Q6G A;  3K04 A;  4MTX A;  5JCO A;  2WLI B;  4LC1 A;  1JVM A;  2JRI A;  4UCV A;  4JYA B;  1VQN V;  2UXD B;  2LQT A;  3H1L H;  4GX1 A;  2ZM6 B;  2JGD A;  5IYD O;  3BHP A;  2LGQ A;  2QWR B;  3OR6 C;  4LFA O;  5B3S C;  4GX0 A;  4FM0 A;  1SKV A;  2D2C B;  1E79 G;  2ZCE A;  3SPH A;  2DE0 X;  1VAR A;  1V55 C;  4P9P A;  2CAZ C;  4KUM A;  3HKE B;  2ITD C;  1JJO A;  4FLX A;  3E89 A;  3ZHU A;  4KP4 A;  5H9C A;  3ZS8 C;  2UXX A;  1QBZ A;  2LFR A;  5LMU O;  3B40 A;  1LUW A;  1AIL A;  1R6K A;  4B3S B;  2HG5 C;  5FPR A;  3ZRW B;  2PI5 A;  2X6A A;  3AEI A;  3HKD B;  4G28 B;  3Q4H B;  2KQX A;  2X0L A;  4H44 B;  3APQ A;  4LH6 A;  3K57 A;  3ZN1 A;  5KUM A;  1HNZ O;  1BGY H;  3JSL A;  5LOV A;  5KHI A;  1TUE B;  4NXM O;  3T4D A;  1IVS A;  5J2U A;  3A8T A;  3KCX A;  3ZMU A;  1SQQ H;  3MDS A;  2QSA A;  5ITZ B;  2EIM C;  1G6U A;  3J80 N;  1GH6 A;  3CP1 A;  3PN1 A;  2FYU H;  5CA1 B;  1ENV A;  5KHH A;  3K06 A;  1IBK O;  4JI2 B;  2B1G A;  2EJ7 A;  1EN6 A;  2JEX A;  1I08 A;  2D3O W;  1N4C A;  1OZ0 A;  2RJZ A;  4DV4 O;  3W7T A;  1YJW V;  2EIL B;  4DR4 O;  1RP3 B;  5IYZ A;  5LXT B;  3RW0 A;  2HJF C;  3JAR B;  2HLD G;  3BY6 A;  5CA0 A;  1ROP A;  3VQV A;  4NKG B;  3OMA B;  2Z0A A;  3FB6 C;  5C8Y B;  4I7Z B;  4DV3 B;  3ZHT A;  4DV6 O;  4LF4 O;  2PZS A;  4O2A A;  1R6N A;  3ZBH A;  2EBO A;  2JGD B;  3ABL B;  2QA4 V;  1SQB H;  3LDE A;  1Q6U A;  4YIO A;  3QO7 A;  3LSQ A;  1W0K G;  4O4H A;  3F5W C;  1LNQ A;  3CCJ V;  4DR6 O;  4FK5 C;  3D36 A;  5BMV A;  1H8E G;  2XUM A;  2IJJ A;  1OCZ C;  2B9Z A;  3RT3 C;  4J7K A;  3JYC A;  1YTF D;  3FD9 A;  4JAA A;  1PD3 A;  4BW9 A;  3SJB C;  3EXA A;  3AG3 C;  4DR2 O;  1QU7 A;  3G71 V;  3CWB H;  3K5L A;  5B5E Z;  1MG1 A;  1WP8 A;  4JYB A;  5L3E A;  3CCU V;  3I55 V;  3ABM C;  3ASO C;  1TGO A;  3TXS A;  3ZCC A;  4WFG A;  2UUA O;  1MSW D;  4Z2W A;  4LFC B;  3KCY A;  4RUF A;  4J9Y B;  4BIZ A;  3ABU A;  4JI1 B;  4AQY B;  5LOV B;  1WJZ A;  2A79 B;  4L8J A;  5LA6 A;  1AR1 B;  4D6T H;  1S3J A;  3TJT A;  5J2U B;  1JR9 A;  3ZJZ A;  2F43 G;  4PD4 F;  1S76 D;  3GWK C;  2UXB B;  2VWJ A;  4I4T A;  1HNW O;  1N32 O;  4J7Z A;  3E8B A;  1WP7 A;  5CBF A;  2HP8 A;  1JCH A;  4MSW C;  1FAF A;  3SYO A;  3OGI B;  2VQF O;  4O2B A;  4WBN A;  3OEE G;  2VQE O;  4JTC B;  1NTZ H;  4MVQ A;  4K0K O;  4NXN B;  4ZI7 B;  3OTO B;  2ZE6 A;  2ZE8 A;  3T2M A;  1ZUQ A;  3E22 A;  3BRC A;  2R70 A;  5CA0 B;  1EN5 A;  1YCI A;  4FLY A;  1KBH A;  3A2F A;  1G4Y B;  1R3J C;  4PEL A;  2NR5 A;  5IDJ A;  1QVF U;  2RCV A;  3SJA C;  2YXH A;  3HR0 A;  4JI8 B;  3RN4 A;  1NTK H;  4IHJ A;  4I0X A;  1XQ8 A;  2OTL V;  4NVP A;  1EZV H;  4O2A B;  3JAT B;  1R3K C;  2YXL A;  2ZDI C;  1IZ3 A;  2YI9 A;  4MTF A;  2ZR3 A;  1XEQ A;  1FFT B;  2QE7 G;  2UUB B;  3F5T A;  4O4H B;  4B3R O;  2EIK B;  1SZX A;  1M1K W;  2B1I A;  2BSK A;  4TV8 B;  1SQV H;  5KHJ A;  4TUY B;  1KKC A;  4DYL A;  2GDS A;  4JI6 O;  1Y76 A;  2LW7 A;  5E79 Z;  1VQ8 V;  4CZZ A;  5EC2 C;  2BE3 A;  2QTS A;  1U96 A;  1PP9 H;  1OCO C;  2DJV A;  3A0H Z;  1K33 A;  3WFV A;  2A0L A;  1BL8 A;  1YIT V;  4MVO A;  1PL4 A;  4JYA O;  4UB6 Z;  2YIB D;  3OUF A;  1XNR B;  2ZM6 O;  1M57 C;  4FM2 A;  4JI4 B;  5FL7 G;  2Y0P A;  2ZE5 A;  3UQ8 A;  5JJJ B;  4UCR A;  3ABK B;  2A06 H;  3FB7 C;  4KFM A;  1ZAU A;  3ETD A;  3IAY A;  3K5N A;  3BA8 A;  5GTI Z;  5JQG B;  4BW5 A;  3RWR D;  2N05 A;  1ZSP A;  3QO8 A;  4HZ3 A;  2PUS A;  4YJ2 A;  2WPD G;  1B3Q A;  3OR7 C;  4U3J A;  4B7K A;  1GM7 A;  2OT5 A;  1YF2 A;  4H37 A;  2NNU A;  2B5U A;  4FFK A;  1RM1 B;  1TVK A;  1UPG A;  1Y6X A;  4CH5 A;  3G6E V;  1CP9 A;  1OCC C;  5LA6 B;  3SR2 C;  1WPX A;  5CN0 A;  5JCO C;  2AZ2 A;  3OT7 A;  3LDD A;  3JCU Z;  4I4T B;  2IBZ H;  4H33 A;  5DN6 G;  2UUC O;  1BQ0 A;  4DV6 B;  4LF4 B;  4CH4 A;  3HKC A;  1WLE A;  2PI4 A;  4UCS A;  1K3E A;  4O2B B;  4WBN B;  3QVN A;  3ZMS A;  1XNQ O;  2LW1 A;  4X8A A;  1CEZ A;  3N2K A;  2Q7H A;  4CS2 A;  3K3W A;  5H6Q A;  2LJ2 A;  4IT5 A;  4DR6 B;  4CC5 A;  2P4K A;  1VQ6 V;  1GN4 A;  5B1B C;  1WPB A;  2GTS A;  1K34 A;  3ETQ A;  3OTF A;  1MNG A;  2FL4 A;  3JCZ A;  1I7F A;  2WLM A;  4K3A A;  2WLI A;  1XUQ A;  1AI4 A;  2X6C A;  1NTM H;  1CXZ B;  1IDS A;  1GKF A;  3B4S A;  1YVW A;  2LP7 A;  3DC5 A;  3D3I A;  3LSU A;  1K7D A;  1V54 B;  4JI2 O;  3ZRV A;  2LFS A;  1OCR C;  3KKY A;  3SDL A;  4F6R A;  3FX7 A;  2Y69 C;  3K0D A;  2C2A A;  4TOI A;  1K5S A;  1M93 A;  3ZHQ A;  5J9P C;  1QLE B;  4X65 O;  2BSK B;  3JAK B;  2DYS C;  2LO1 A;  1YEW A;  1VQ4 V;  1F4M A;  4YHH B;  1TAE A;  4FFB A;  1Y76 B;  2YS8 A;  5BXZ A;  1XHZ A;  1NT2 B;  5LGU A;  3U0Z A;  4XDK A;  1I5Y A;  1EN4 A;  3FYI B;  4Z1V A;  4DV3 O;  5LHH A;  3HPL C;  2WLJ A;  5EIB C;  3SPJ A;  4MVZ A;  1D5A A;  2WLL A;  2YSU B;  3H1K H;  4J9Z B;  2N74 A;  1MMM A;  1M5I A;  1JJ2 U;  4Z1M G;  2OIE A;  1N32 B;  4E2L A;  2GUZ A;  3OEH G;  3ZRW A;  5HFL A;  4YY3 O;  1W0J G;  4PDR A;  1DF5 A;  1PPJ H;  1Q5O A;  1K97 A;  3UKM A;  3JAL A;  1WAZ A;  2F1M A;  2F95 B;  3HKD A;  4QE9 A;  3DSQ A;  4BAY A;  4ZOL A;  4ZHQ B;  1VQ5 V;  5L3F A;  3CCV V;  1FXH A;  1XMQ B;  4K0K B;  1TVK B;  3CSX A;  4LF9 O;  1Q7Y W;  3AG4 B;  1F23 A;  3E35 A;  4K35 A;  4U3F H;  1VQ9 V;  3E83 A;  5H6R A;  4P30 A;  1I94 O;  4O4J A;  2P6J A;  3OM3 B;  2OTJ V;  1AB3 A;  3SYC A;  1K8A W;  1NU1 H;  2ADP A;  2OCC C;  4FZ1 A;  3CYO A;  4G2K A;  3HKC B;  1AJQ A;  4X89 A;  1VEW A;  2LGW A;  4JI3 O;  1MZE A;  5CA1 A;  3ZED A;  4K8X A;  3M8A A;  1Q8I A;  2N04 A;  1Y67 A;  1M4U A;  3J7A U;  3X2Q B;  3P32 A;  4LFC O;  3N2K B;  4JZG A;  4B3R B;  2P06 A;  5IY5 C;  3WB1 A;  4FLT A;  3A0R A;  1SC5 B;  3UM7 A;  3SYP A;  4UB8 Z;  2YEV A;  4JI1 O;  3E8H A;  4WFB V;  4BR6 A;  1PKX A;  1PNK A;  5B1N A;  3U11 A;  1YIJ V;  5EK0 A;  1NVP D;  4OPA A;  3W7U A;  1Y74 A;  2HKO A;  3DGE A;  2UXB O;  4R7C A;  3J81 N;  4NTY A;  1HR0 O;  5C8Y A;  1NR1 A;  3GWO A;  3ZMV A;  2BOC C;  3L74 H;  3TET A;  4J10 A;  2JK5 C;  1XBL A;  3CRM A;  4X62 B;  3CB2 A;  2PTM A;  4F6R B;  3ML0 A;  5B1A B;  5LP6 A;  1M9N A;  4LF7 B;  4I5S A;  1R1B A;  1XDC A;  1DGS A;  2CGN A;  2JS5 A;  2QWO B;  2Y0I A;  3K9S A;  4UV9 A;  3ZRS A;  1X4T A;  4NXN O;  1SER A;  3OTO O;  4FFB B;  3JSN A;  4O4I A;  3SJQ C;  3W7W A;  2DN9 A;  2GV9 A;  1FD9 A;  3IFX A;  1RM1 C;  4PJ0 Z;  1VF6 A;  4DXW A;  4JI8 O;  3AG2 B;  4LF5 B;  1E1Q G;  3DTU B;  1K5Q A;  3ABT A;  2XAH A;  2Q0O C;  3L9D A;  1DTO A;  2WLL B;  4HAM A;  1FFX A;  1N0N A;  2UUC B;  2PYL A;  2UUB O;  5IE9 A;  4OX9 B;  2GUZ B;  1GMG A;  1IX9 A;  3ASN B;  4MVS A;  3JAL B;  3TXQ A;  1NR7 A;  4DR1 B;  2Y4U A;  3APO A;  1XNQ B;  4GYC B;  1F4N A;  4ZOL B;  1MSD A;  2IM9 A;  1IUR A;  2EIJ B;  2CUG A;  1S0V A;  2JEU A;  1GM9 A;  4DUY O;  2DQ3 A;  2ODM A;  1YTF B;  2DYR B;  4CBC A;  4OXS A;  2W6I G;  2ZKO A;  1GAX A;  3I5D A;  2NN4 A;  1XI1 A;  3ZIA G;  4D7T A;  1VF5 B;  2E3C A;  2YIB A;  4O4J B;  3VQW A;  5LGT A;  1IXB A;  3QNE A;  4GCZ A;  1XNR O;  2F4V O;  3K79 A;  3I56 V;  4HBN A;  5LMN O;  4FLV A;  4JI4 O;  1B04 A;  1O9G A;  4U7O A;  1VQO V;  4WFF A;  4QJF B;  1SQP H;  3CC2 V;  3E86 A;  1QR9 A;  2QM8 A;  3WG7 C;  1FKA O;  2G38 A;  1U97 A;  3QO5 A;  4D7S A;  1QLE C;  4X65 B;  1KU9 A;  2F66 C;  3FB8 C;  2YEV B;  4UCT A;  4ZI7 A;  1N0J A;  1BHA A;  2AHY A;  3UCS C;  1K4D C;  5IJ9 B;  4LF8 B;  1A32 A;  3H1H H;  1Y74 B;  3SGI A;  1WNS A;  4CH6 A;  2IJI A;  3A0B Z;  3UO3 A;  2ZE7 A;  1EZJ A;  3JAT A;  3R66 A;  3ZMZ A;  1TA8 A;  3VBB A;  4EFB A;  4I9W A;  2QWQ B;  4BIU A;  5LP6 B;  3FB5 C;  3H1I H;  5BR8 B;  4YY3 B;  2H94 A;  2WA3 A;  4TV8 A;  3CCE V;  3K58 A;  1MOF A;  4TUY A;  4UVB A;  1NI8 A;  3CME V;  5BY1 A;  2QKA A;  4J42 A;  2YIC A;  4O4I B;  4TQF A;  4MW8 A;  1COW G;  1NZ6 A;  4JI0 B;  1R3L C;  3JD1 A;  3QTC A;  5B1O A;  3ZMT A;  1S77 D;  4LF9 B;  1OHH G;  2P7T C;  1NS1 A;  4TWK A;  2Q7E A;  3F7V C;  4DR3 B;  2ZT9 B;  1I94 B;  1HP8 A;  2CGO A;  3P30 A;  1P7B A;  2RNB A;  2ZXW B;  1FFX B;  3JD3 A;  3RGB A;  1JFF B;  4KL1 A;  2Q9L A;  3K5M A;  3AG1 C;  1DLB A;  4JI3 B;  3WU2 Z;  5H5N A;  2K1E A;  5JQG A;  1N36 B;  4JPR A;  4X1K A;  1QNM A;  4YHH O;  3IJ4 A;  1H2M A;  2P67 A;  3B77 A;  2EZP A;  4NYK A;  2MW2 B;  1M56 C;  3U10 A;  4R50 A;  1IXM A;  4WCE V;  1PM9 A;  2ZNI A;  3LUT B;  3DXR A;  3P3N A;  4X66 O;  1ARO P;  5LBQ A;  1HR0 B;  2DW4 A;  2FML A;  3NR7 A;  4TQD A;  2CE4 A;  4FMT A;  1JQ0 A;  2PYJ A;  3RYC B;  5B1A C;  3T1C A;  3UT5 A;  5KA5 A;  1KP2 A;  2YXY A;  3RFR A;  2UXN A;  1S5L Z;  2FB5 A;  2JIZ G;  3K03 A;  1XMQ O;  2AW9 A;  2FTK A;  4DR7 B;  5IJ0 A;  4KHP B;  4FPP A;  2IH3 C;  1K9M W;  1ZX3 A;  1GO3 F;  5IYB O;  3BCC H;  2QWN B;  3FYE B;  2NLJ C;  4NTW A;  4O4L A;  1SRY A;  2YDE A;  5EBL C;  5EBW C;  4LCU C;  1QHT A;  2IW5 A;  4WFH A;  2HHH O;  3ASN C;  3E8F A;  4CC6 A;  1WA8 A;  3CRA A;  3JAK A;  2R9I A;  3T4Z A;  5DED A;  4YJ3 B;  1RPR A;  4HNA A;  3L72 H;  3E2E A;  1P49 A;  2ZIN A;  1URF A;  1P7G A;  2DYR C;  4GX5 A;  4DUY B;  2MK3 A;  5GTH Z;  1SS3 A;  2W6J G;  1HNX B;  4RAI A;  4G27 B;  3ETE A;  2ITC C;  4UXN A;  2F4V B;  4X62 O;  2KSD A;  5LMN B;  3IC7 A;  3RYH A;  2PF4 E;  4LF7 O;  1MA1 A;  3CXH F;  2QEX V;  2Q4P A;  2JJ1 G;  4X1K B;  5L3G A;  4W4L A;  2X7R B;  3D3Q A;  3TGU H;  4EFE A;  2PY5 A;  3MHH C;  3OUS A;  2M7W A;  4WFE A;  2EIL C;  4ZHQ A;  1P84 F;  2HR3 A;  1BSM A;  1H2G A;  4EKW A;  2F93 B;  2RN9 A;  4MW3 A;  3ZHV A;  3ZHR A;  4DV2 B;  2WA4 A;  1Y66 A;  3LNM B;  4LF5 O;  5B3S B;  3DXR B;  4LH7 A;  5K1X A;  4OGQ B;  2Q0A A;  4PDV A;  4X20 B;  4J41 A;  4OX9 O;  4XDJ A;  5JH7 A;  3ABL C;  1Q6I A;  2XOK G;  3QG5 A;  4YXW G;  4JYC A;  1KC8 W;  4KXR A;  4X64 B;  1FPO A;  2OYQ A;  5C93 A;  3UT5 B;  4DR1 O;  2JVD A;  1FXK A;  5LP6 C;  1K92 A;  3RYF B;  4QNH B;  4GLX A;  1FYJ A;  4PA3 A;  1H8H G;  1Q90 D;  1BE3 H;  1SQF A;  4K8Z A;  5KX5 A;  3G80 A;  5IJ0 B;  1Q86 W;  4P2Z A;  3B2E E;  2HVJ C;  2XAQ A;  4JI5 B;  1YI2 V;  1HW7 A;  1VF6 C;  4X1I A;  4GKK B;  2EJR A;  1S5H C;  4UCO A;  4OPH A;  4J11 A;  4PHZ A;  4UV8 A;  4ASU G;  3BAB A;  2V4D A;  5CBG A;  4LWS A;  3T1Y B;  5JWP A;  1IBL O;  1HDJ A;  2ZXW C;  4B3T B;  1Q6H A;  1IBM B;  4O4L B;  1JMK C;  1BT8 A;  1M90 W;  1GK9 A;  4XBF A;  4IYI A;  1WA8 B;  4H0L B;  2L6L A;  4CH3 A;  4DV7 O;  2ZR2 A;  2O57 A;  2EIM B;  2QGN A;  5KAI Z;  5A2Q N;  1NVP B;  2EIN B;  5K1P A;  4HNA B;  4LF8 O;  3VQY A;  4F4L A;  1SF9 A;  1VQL V;  1Q43 A;  4UFZ A;  1AJP A;  1W2B U;  3BPZ A;  4I9Q A;  1K4C C;  1P4R A;  5CA3 A;  2WLH A;  4Q20 A;  1H2S B;  3L71 H;  4X66 B;  3DC6 A;  2W0X A;  3CRQ A;  3RYH B;  2Q6A A;  1KUQ A;  5AG2 A;  5KAF Z;  1BS3 A;  2OCH A;  4YIP A;  5BR8 O;  5GW7 A;  3CXC U;  2ATK C;  2Y4T A;  1AR5 A;  4QIW F;  2WLN A;  3EVK A;  2W0F C;  2ILM A;  4PA7 A;  1XHX A;  4JI0 O;  5IWA B;  4C7U A;  2CTP A;  2QTO A;  1DF4 A;  2ARH A;  4MVR A;  2P4V A;  3N2G A;  3KZI Z;  3UO2 A;  3QF7 A;  1VP7 A;  4DR3 O;  2QM7 A;  5KUK A;  2XAG A;  3STZ C;  2CDY A;  3CEI A;  5EC1 C;  2QKC A;  4WF9 V;  2KKW A;  4I55 A;  4IIJ A;  1VQM V;  1PNL A;  5JH7 B;  4QE7 A;  1AVM A;  1LUV A;  3AK2 A;  3PJS K;  1N36 O;  2L35 A;  3JAM N;  1FXK B;  2EIK C;  3TK1 A;  4PI0 A;  2HHH B;  2A7W A;  4DR5 B;  2QJ1 A;  2CTQ A;  2XTA A;  4CS4 A;  4B3M B;  4E4E A;  2CTR A;  5FNV B;  2ZIO A;  2YI8 A;  3AG3 B;  1F7Y A;  2JDI G;  1AP6 A;  1RPO A;  5KX5 B;  2GHY A;  2V7Q G;  1EFR G;  3D36 C;  1G8M A;  3ETG A;  2AHZ A;  5IJ9 A;  3ICX A;  4IGG A;  3HKB A;  4GX2 A;  3RVZ A;  1SET A;  1Z5W A;  5J2T B;  4X1I B;  3ABM B;  5E1A C;  1DK1 A;  1Z5V A;  5JJE B;  4LWS B;  3CMA V;  2QKS A;  4UCU A;  4MTG A;  1QCE A;  1T5E A;  1W59 A;  2JS3 A;  1AR4 A;  4GT1 A;  4DUZ B;  1PNM A;  3CHX A;  3ABK C;  4JAS A;  2Z3Y A;  1X59 A;  3SJC C;  4IL6 Z;  4JZ2 A;  4U7N A;  4GKJ B;  1SES A;  4WFA V;  2JJ2 G;  2Q73 A;  4DR7 O;  2OWO A;  4KHP O;  3VOU A;  1GRJ A;  1VF7 A;  3OD4 A;  4IYH A;  1KKD A;  4FLW A;  4LNU B;  4JI7 B;  1I0H A;  4AHC A;  2YC0 A;  3B8M A;  3CC4 V;  2Q5Z A;  2A3Q A;  1N33 B;  3H01 A;  4RQF A;  1UFI A;  1G1X B;  1BCC H;  3ZHS A;  1US6 A;  2IU0 A;  5KA6 A;  3ZN0 A;  2Q67 A;  4ZBM A;  3R65 A;  3JAW B;  2Q69 A;  4MT8 A;  3D8C A;  1J95 A;  1JFF A;  5CB4 A;  1NH2 D;  4JTA B;  3JAS A;  3OMI B;  2Q7G A;  1GTO A;  1YZB A;  4JV5 B;  4JF3 A;  5KLV H;  4W4K A;  1QQC A;  2ZD9 A;  1XL6 A;  4X9Q A;  2Q68 A;  2QDO A;  1XL4 A;  3STL C;  5DM6 V;  2EUL A;  1GN2 A;  3CJH A;  4X1Y B;  4B7E A;  4TV9 B;  2DWD C;  3N2G B;  3K5O A;  1HNX O;  4I50 A;  2ZNJ A;  3SPG A;  3AG7 A;  3C3S A;  4I55 B;  4IIJ B;  5FPO A;  5F2V O;  1OCO B;  1KP3 A;  1IBL B;  3G67 A;  1V54 C;  1R6T A;  1XIL A;  4ZKI A;  4N21 A;  2P5O A;  3N27 A;  2K9P A;  2UU9 B;  3RYC A;  2AZ0 A;  1N8R W;  3FKS G;  1FJG B;  4PA6 A;  5EZY A;  4DV7 B;  3L75 H;  1GN3 A;  1M57 B;  2DQ0 A;  1Q82 W;  4HYO A;  2EIN C;  4DV2 O;  2CTW A;  4MVM A;  3M99 B;  3HKB B;  3THO A;  1J5E B;  1EBO A;  3CRC A;  1O9H A;  2H3O A;  4UUJ C;  4NTX A;  4J7J A;  3EHB B;  4EB6 A;  1NJI W;  3LSS A;  5DEC A;  1SA0 A;  3CX5 F;  1JPX A;  4X64 O;  1YDX A;  5EYP A;  2CH7 A;  1D5N A;  2QM4 A;  1OCC B;  1XRE A;  2A9H A;  3IGA C;  2OIG A;  1H38 A;  5FLX N;  4LP8 A;  4AIL C;  1NBM G;  4JYY A;  1SQX H;  2CK3 G;  5LHG A;  4DV0 B;  4FLU A;  2P90 A;  3IC9 A;  1VQ7 V;  4YJ3 A;  5LHI A;  1KD1 W;  5IT9 N;  1I5X A;  3NXS A;  3OAA G;  4JI5 O;  3C3T A;  3KG2 A;  2HEP A;  1XMO B;  3ZRX A;  3AG4 C;  3OW2 U;  2BTQ A;  4GKK O;  5EBM C;  3HB3 B;  4JTD B;  4AI8 A;  3K0G A; 
#chains in the Genus database with same CATH homology
 5LGU A;  3SPH A;  2MK3 A;  4XDK A;  1I5Y A;  1VQP V;  1V55 C;  4P9O A;  4P9P A;  2H8P C;  2W6J G;  3FYI B;  1R73 A;  4KUM A;  5LHH A;  3HPL C;  4G27 B;  3ETE A;  4RAI A;  2WLJ A;  5B1B B;  3CCR V;  2ITC C;  2ITD C;  4UXN A;  3RBZ A;  3SPJ A;  4MVZ A;  2XND G;  1R3I C;  3E89 A;  3IC7 A;  2WLL A;  2YSU B;  3G4S V;  4KP4 A;  4J9Z B;  5H9C A;  1FS0 G;  1FXK C;  2WSS G;  3OE7 G;  1JJ2 U;  2UXX A;  3X2Q C;  1QBZ A;  4Z1M G;  2LFR A;  4E2L A;  3OEH G;  2QEX V;  1PL0 A;  3ZRW A;  2JJ1 G;  5L3G A;  5HFL A;  1R6K A;  2IU3 A;  1W0J G;  4PDR A;  1DF5 A;  2X7R B;  3B8N A;  1THZ A;  2HG5 C;  1K97 A;  3UKM A;  3ZRW B;  3CCL V;  3MHH C;  3OUS A;  1OCR B;  2M7W A;  4WFE A;  2EIL C;  2PI5 A;  2Y69 B;  2HR3 A;  4QE9 A;  1B6Q A;  2X6A A;  4BAY A;  1H2G A;  4EKW A;  1BMF G;  3AEI A;  4MW3 A;  4G28 B;  1QR8 A;  1VQ5 V;  5L3F A;  3CCV V;  1FXH A;  1Y66 A;  2DYS B;  3LNM B;  5B3S B;  2X0L A;  1Q7Y W;  3ZN1 A;  3CCM V;  3AG4 B;  1F23 A;  3E35 A;  5KUM A;  1VQ9 V;  3E83 A;  5H6R A;  4P30 A;  1TUE B;  1K73 W;  4PDV A;  1YSC A;  2P6J A;  3OM3 B;  3T4D A;  2OTJ V;  3SYC A;  4XDJ A;  3ZMU A;  1K8A W;  3ABL C;  2XOK G;  2OCC C;  4YXW G;  4JYC A;  1KC8 W;  3CYO A;  4UVA A;  4G2K A;  2EIM C;  1AJQ A;  4X89 A;  5C93 A;  1FXK A;  1K92 A;  4RQE A;  3CP1 A;  2BOB C;  4FIP C;  4QNH B;  1ENV A;  3K06 A;  3P32 A;  2WWW A;  1H8H G;  4N23 A;  4PA3 A;  3X2Q B;  4MVU A;  5L3B A;  2B1G A;  2JEX A;  5IY5 C;  3A0R A;  2D3O W;  1Q86 W;  3UM7 A;  1OZ0 A;  4P2Z A;  3SYP A;  1QLN A;  2YEV A;  2HVJ C;  3E8H A;  4WFB V;  1PKX A;  1PNK A;  2XAQ A;  3AG2 C;  5B1N A;  3W7T A;  1YI2 V;  1YJW V;  1YIJ V;  2EIL B;  5EK0 A;  3RVY A;  1NVP D;  3W7U A;  3RW0 A;  2HKO A;  2HJF C;  1JX9 A;  2EJR A;  1S5H C;  3DGE A;  5BZB A;  2HLD G;  3BY6 A;  4ASU G;  4R7C A;  4UV8 A;  5CBG A;  1ROP A;  4XDL A;  3OMA B;  2ZXW C;  3FB6 C;  2EZO A;  1NR1 A;  3GWO A;  3ZMV A;  2BOC C;  4PA9 A;  3TET A;  2JK5 C;  2KB1 A;  1M90 W;  1GK9 A;  4XBF A;  1R6N A;  2EBO A;  3ABL B;  3ML0 A;  5B1A B;  2OCC B;  2ZR2 A;  2QA4 V;  1M9N A;  2EIJ C;  2EIM B;  1KQS U;  4RUE A;  4I5S A;  1QVG U;  3LDE A;  1NVP B;  4UV9 A;  3QO7 A;  3ZRS A;  2EIN B;  1SER A;  3LSQ A;  1W0K G;  3MD0 A;  3F5W C;  4F4L A;  1MAB G;  2XAS A;  1BHB A;  1LNQ A;  3K9A A;  1VQL V;  3SJQ C;  3W7W A;  4R8C A;  3CCJ V;  1AJP A;  1W2B U;  3IFX A;  1RM1 C;  5IY5 B;  4FK5 C;  4PA4 A;  1K4C C;  1AJN A;  1P4R A;  3D36 A;  2WLH A;  5CA3 A;  4Q20 A;  4UVC A;  4DXW A;  3F7Y C;  1VQK V;  3AG2 B;  1E1Q G;  3DTU B;  1H8E G;  1ORQ C;  3CD6 V;  1K5Q A;  2HVK C;  2IJJ A;  3ABT A;  1OCZ C;  2XAH A;  3JYC A;  1YTF D;  1DTO A;  2Q6A A;  2WLL B;  1FXV A;  4TT3 G;  1PD3 A;  4HAM A;  4LBE C;  1YHQ V;  1S72 V;  5GW7 A;  3CXC U;  3AG3 C;  2ATK C;  1GMG A;  4QIW F;  2WLN A;  3JD2 A;  3ASN B;  4MVS A;  3G71 V;  2W0F C;  1NR7 A;  1MG1 A;  4JYB A;  4PA7 A;  5L3E A;  5CMU A;  3SYA A;  3CCU V;  3TCU A;  1F4N A;  3CPW U;  3I55 V;  2QTO A;  1DF4 A;  3ABM C;  2EIJ B;  3ASO C;  3ZCC A;  4WFG A;  1S0V A;  4MVR A;  1MSW D;  2R9R B;  2JEU A;  1GM9 A;  4JAV A;  2DQ3 A;  4RUF A;  3W7S A;  4J9Y B;  2DYR B;  4CBC A;  1YTF B;  4JAU A;  4OXS A;  2W6I G;  3ABU A;  3E8G A;  2QM7 A;  4BIZ A;  2HFE C;  1KEC A;  3ZIA G;  5KUK A;  1Y4M A;  2XAG A;  3CCS V;  3STZ C;  1V55 B;  2A79 B;  5EC1 C;  5LGT A;  4WF9 V;  3QNE A;  4GCZ A;  2ZQM A;  1AR1 B;  1S3J A;  3K79 A;  3I56 V;  1VQM V;  1PNL A;  3ZJZ A;  2F43 G;  4QE7 A;  1S76 D;  1NQT A;  3PJS K;  4U7O A;  2IH1 C;  3CCQ V;  1VQO V;  1FXK B;  4WFF A;  4QJF B;  3CC2 V;  3E8B A;  2XAF A;  3E86 A;  1QR9 A;  2EIK C;  3TK1 A;  2QM8 A;  5CBF A;  3WG7 C;  1JCH A;  4MSW C;  3QO5 A;  3MHS C;  3SYO A;  1QLE C;  3AG3 B;  2JDI G;  1RPO A;  2GHY A;  2V7Q G;  1EFR G;  2GSM B;  3LDC A;  3OEE G;  1G8M A;  4JTC B;  1ZWI C;  3ETG A;  2AHZ A;  3FB8 C;  2YEV B;  4QPJ A;  1BHA A;  4GX2 A;  4MVQ A;  1JOY A;  2AHY A;  1HWY A;  3RVZ A;  1K4D C;  1SET A;  1YJN V;  3ABM B;  3T2M A;  5E1A C;  3JD0 A;  3CMA V;  2QKS A;  2IJI A;  1G4Y B;  1R3J C;  2DWE C;  4PEL A;  4MTG A;  5IDJ A;  1QVF U;  3CC7 V;  1QCE A;  1EZJ A;  4GT1 A;  1PNM A;  3ZMZ A;  3ABK C;  4JAS A;  2OTL V;  2Z3Y A;  1Q81 W;  4RO2 A;  1R3K C;  3VBB A;  4I9W A;  2ZDI C;  4BIU A;  3OGC C;  1AI5 A;  3FB5 C;  4U7N A;  4MTF A;  5CBH A;  1SES A;  2ZR3 A;  4WFA V;  1FFT B;  1CPY A;  2JJ2 G;  2Y48 A;  4JGS A;  2H94 A;  2QE7 G;  4X88 A;  3CCE V;  1MOF A;  4TSF G;  4UVB A;  1F51 A;  2EIK B;  3CME V;  3VOU A;  1M1K W;  2B1I A;  3WG7 B;  1KKD A;  3BEH A;  4MW8 A;  4PDL A;  1COW G;  1R3L C;  3B8M A;  3JD1 A;  2V1D A;  3CC4 V;  5B1O A;  3ZMT A;  1VQ8 V;  4CZZ A;  5EC2 C;  4FJC C;  1S77 D;  3H01 A;  4RQF A;  1OCO C;  1OHH G;  2P7T C;  4TWK A;  2IU0 A;  1K33 A;  5KA6 A;  3WFV A;  2WLK A;  2A0L A;  1BL8 A;  2IJH A;  2Q67 A;  3F7V C;  3R65 A;  4ZBM A;  3ZN0 A;  4DO2 A;  1YIT V;  2Q69 A;  4MS2 A;  3P30 A;  4MVO A;  1P7B A;  2Z5U A;  4MT8 A;  5LGN A;  2ZXW B;  3JD3 A;  2X6B A;  4QPK A;  1J95 A;  3OUF A;  1NH2 D;  4JTA B;  2XAJ A;  1M57 C;  3OMI B;  1GTO A;  3AG1 C;  4PDM A;  5FL7 G;  4JF3 A;  1DLB A;  2K1E A;  3ABK B;  3FB7 C;  2ZDI A;  4KFM A;  2ZD9 A;  3ETD A;  1XL6 A;  4JPR A;  4BW5 A;  2Q68 A;  1XL4 A;  3STL C;  5DM6 V;  2P67 A;  3B77 A;  2EZP A;  3QO8 A;  4HZ3 A;  2WPD G;  3K08 A;  2DWD C;  3OR7 C;  4MTO A;  1SZT A;  1GM7 A;  2OT5 A;  1M56 C;  1UJW B;  3OMN B;  4H37 A;  2NNU A;  4R50 A;  1IXM A;  2B5U A;  4WCE V;  1RM1 B;  3SPC A;  1AI6 A;  3LUT B;  1NKD A;  3G6E V;  1CP9 A;  5L3D A;  3SPG A;  1OCC C;  1NH2 B;  1ARO P;  5LBQ A;  1WPX A;  1OCO B;  5CN0 A;  2DW4 A;  1KP3 A;  1OCZ B;  3LDD A;  1V54 C;  4H33 A;  5L3C A;  4ZKI A;  4N21 A;  3SYQ A;  2IJK A;  4FMT A;  5DN6 G;  1JQ0 A;  1N8R W;  3FKS G;  3JD4 A;  5B1A C;  3T1C A;  3SPI A;  1WLE A;  4PA6 A;  5KA5 A;  2PI4 A;  1KP2 A;  5HFM A;  1E1R G;  1M57 B;  2UXN A;  2DQ0 A;  1Q82 W;  1K3E A;  3EFF K;  4HYO A;  3AG1 B;  2EIN C;  3ZMS A;  3OFN G;  2JIZ G;  4MVM A;  3K03 A;  3M99 B;  4X8A A;  1CEZ A;  4R6Z A;  3K3W A;  2FTK A;  5H6Q A;  1EBO A;  3ASO B;  4L87 A;  1L1F A;  4FPP A;  4UUJ C;  2IH3 C;  1VQ6 V;  3EHB B;  1K9M W;  2WAM A;  5B1B C;  1NJI W;  3LSS A;  5IYC O;  1K34 A;  1GO3 F;  1YJ9 V;  3GB7 C;  5IYB O;  1M56 B;  1JPX A;  1GM8 A;  3JCZ A;  3W7X A;  2WLM A;  1AI7 A;  2WLI A;  1OCC B;  3FYE B;  1AI4 A;  3K04 A;  4MTX A;  2A9H A;  2X6C A;  3IGA C;  1H38 A;  2NLJ C;  2WLI B;  4LC1 A;  1GKF A;  1JVM A;  4LP8 A;  2LP7 A;  1NBM G;  1SRY A;  3D3I A;  1VQN V;  2CK3 G;  5EBL C;  1K7D A;  4LCU C;  1V54 B;  5EBW C;  2IW5 A;  5LHG A;  4WFH A;  2P90 A;  3ZRV A;  3ASN C;  2LFS A;  1OCR C;  3E8F A;  1VQ7 V;  4GX1 A;  2Y69 C;  3K0D A;  2C2A A;  5IYD O;  5LHI A;  1K5S A;  1KD1 W;  2R9I A;  5J9P C;  3T4Z A;  1I5X A;  1QLE B;  3NXS A;  2DYS C;  3OAA G;  3OR6 C;  5B3S C;  3KG2 A;  1RPR A;  1VQ4 V;  1F4M A;  3ZRX A;  4GX0 A;  3AG4 C;  3E2E A;  3OW2 U;  5EBM C;  1E79 G;  3HB3 B;  4JTD B;  2DYR C;  4GX5 A;  3K0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...