3G80A

Nodamura virus protein b2, rna-binding domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
SCAYELIKSLPAKLEQLAQETQATIQTLMIADPNVNKDLRAFCEFLTVQHQRAYRATNSLLIKPRVAAALRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Protein B2
publication title Structure of the RNA-Binding Domain of Nodamura Virus Protein B2, a Suppressor of RNA Interference.
pubmed doi rcsb
source organism Nodamura virus
total genus 28
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3g80A00
2KG7B 2DE0X 2KG7A 3ZBHA 2AZ2A 3GVMA 2B9ZA 3GWKC 3O9OA 3Q4HB 3Q4HA 3HR0A 1WA8B 4LWSB 3TXQA 1WA8A 4LWSA 3OGIB 3FD9A 4GZRB 3G80A 4I0XB 2VRZA 3FAVB 4I0XA 2AZ0A 3FAVA 2VS0A 3TXSA 4ABMA
chains in the Genus database with same CATH superfamily
5EBLC 3JAMN 5C93A 1N36O 5IYZA 3L73H 1VF5B 3RVZA 2LQTA 4DV5O 2H94A 3Q4HA 5D5QA 4X1YB 3RW0A 4AQYO 1DF4A 4OPAA 2Z0AA 1IBKO 1QLEC 4CBCA 3I55V 1K97A 2CAZC 5H5NA 3C3SA 1VQ4V 2LJ2A 2FTKA 3JD1A 2PY5A 3AEIA 2ZDIC 5BR8B 4LF5O 3K5MA 1I5YA 2EJRA 3C90A 4YJ3B 1PNKA 5CBFA 3ZHTA 4JASA 3JD4A 3K03A 1Q43A 1PKXA 2QKCA 4OPHA 5EZYA 2P7TC 1WJZA 1M9NA 4BR6A 4FFBA 4FMTA 4JI7O 4J9YB 2Y4TA 2YIBA 3CXCU 1RM1C 1VQMV 1HNZO 1MOFA 4GT1A 4Z1VA 2Y0IA 5H6QA 4IHJB 3VQVA 4DYLA 4F6EA 4H37A 1K4CC 3ASOB 3CJHA 5LMNO 4I9QA 5KA5A 1AP6A 1FXVA 3SDLA 1FFTB 1Q6HA 2ZNJA 5L3FA 4X9QA 4WBNB 4LFCO 3O65A 2ZT9B 2ILMA 3E83A 2P5OA 2QKAA 2PUSA 3CRMA 3ABLB 3IC7A 4MVMA 3MAQA 3FB7C 5KHJA 5GONA 4QJFB 2OCCC 2FB5A 3CCSV 5J2TA 2N04A 3HKDB 2X6CA 1M56C 4MTOA 5JQGA 1KP3A 4R6ZA 4J7JA 1AI4A 1SQXH 3ABMC 1KB9F 2IJIA 2QEXV 1P7BA 5IJ0A 4TWKA 4DR5B 3TK1A 4GKJB 1FS0G 2IBZH 5DM6V 3JD3A 1PL4A 3JAWB 5BZBA 2PI4A 4DUZB 3JALB 4AILC 3JCZA 3APOA 2ZM6B 1GRJA 3ZS8C 1OCCB 1FXKA 5KHHA 3DSQA 4JYBA 4LNUA 4CZZA 4NXNO 3DXRB 4UUJC 3I5DA 3W7XA 2XTAA 3N2KA 1HWYA 1CEZA 3T1HO 2YIAA 2GBOA 4UCOA 1MSDA 1TVKB 3E89A 3VBBA 2WLKA 2KG7B 4E2LA 4N21A 1Y74B 3KCXA 3SPGA 5B1NA 5FLXN 2QWRB 4DV7B 1XI1A 4LF6O 3SPHA 1KD1W 2LGQA 4LFAO 4P30A 3J7AU 2IJJA 1H2MA 5FNVB 5A2QN 4MT8A 1KMIZ 3AG3B 3JD2A 4UVAA 1QHTA 3JD0A 1ZTEA 1K4DC 3ABTA 4B3SB 4DV3O 4YXWG 1Y4MA 1K34A 2FMLA 4FZ1A 3SYPA 3PN1A 3ZRWA 1OJHA 4PD4F 5L3EA 4LCUC 2HJDA 3JAKB 2UXDB 1JMKC 2WA4A 2HG5C 2IH1C 1Q86W 3SR2C 3RYFB 1N8RW 3BFRA 2Q8VA 2YSUB 4IGGA 4YHHB 1IX9A 3GWKC 4H44B 4K35A 1J5EO 4EFEA 4R7CA 4B7KA 4JYAO 5BMVA 2OIGA 3OW2U 3MHHC 3WU2Z 4JI2O 4HBNA 4IL6Z 2CH7B 5LMUO 1QLNA 1V54C 1NTZH 3SJQC 5CA1B 4NYKA 2PZSA 2BSKA 5CA0B 3KKYA 4LF8O 5CBHA 4LWSB 4RUEA 4JI6B 1R73A 1LUWA 1WNSA 1DLBA 1PL0A 1RSOA 4NR1A 2ZE8A 4ZI7A 2JGDB 3CHXA 3TXSA 2UXBO 4KFMA 4JV5O 3E22A 2A79B 5KAIZ 1G1XB 3ZMVA 2Q4PA 1SQGA 4U7OA 1HNWB 2QWOB 2GTAA 1KUQA 1AJPA 3AG1C 3H1IH 1IBLO 3CC2V 2QWPB 3RN4A 1PM9A 2DYRB 1B3QA 2NN4A 2V1DA 5DEDA 1XUQA 4W4KA 1K5SA 3K5LA 3B8MA 3MHSC 2Q9LA 3T2MA 2WLNA 4QGPA 3H1HH 3OGCC 4CC5A 3BHPA 2E74B 2CTWA 4X89A 3JSNA 1N32O 1IXBA 1GM8A 1NU1H 2IJHA 4I0XA 5IT9N 3W7TA 4DRXB 4Q20A 4TUYB 5KLVH 2GUZB 4JAVA 4X65B 1SQVH 5EBWC 2XAQA 4X62O 1NS1A 5GTHZ 4DR7O 1M4UA 1AP5A 1LUVA 4DV0O 4DV4O 4OX9O 3S3WA 4CH6A 3EVKA 1M57C 3RBZA 2EJ7A 2FYUH 4O4LB 2RJZA 2UUBB 3IC9A 1OCRB 1H2NA 3G71V 2L35A 2YXHA 4BW9A 4I4TA 4EB6B 4PI2A 2P67A 3UCSC 1SQQH 3JARB 1NKDA 3E8BA 5B1OA 2F43G 4I55A 4FLUA 2EIMC 2EINB 2GV9A 2C2AA 1S5LZ 2QM4A 4B3MB 3EXAA 3TGUH 5IJ9B 5EIBC 2HHHB 5KHGA 2K9PA 1XHXA 3FYIB 3L74H 2WWWA 4I50B 2UXCB 4YJ2B 2Q67A 3OTOO 4CH5A 1Q5OA 4PELA 4LF4B 2B1IA 1OCOB 2XUMA 1EBOA 1E1RG 5AG2A 4NXMB 5IY5B 1HNXO 4LF9O 1PV0A 3K57A 2K1EA 5B1AC 1MMMA 3N2GB 4TV8B 1OHHG 1IBMB 4K0KO 3RGBA 4WFAV 4LFBB 1Q8IA 2A06H 2VQEO 1JOYA 4JTDB 4ZOLB 2ATKC 1LNQA 3QVNA 5LP6B 3ABUA 4HYOA 3ZHVA 3P3NA 1Y76A 3JASA 4B3RB 1GKFA 1B04A 4MSWC 1VQ5V 5JCOC 4JGSA 1JA8A 1PNMA 2DWEC 4JI3O 1RP3B 4I9WA 5EC2C 4MS2A 4CS3A 1YEWA 2M6YA 1FFXA 3R65A 4JI5O 1XMOO 3HKEA 1S0VA 1JCHA 4O2AB 2O57A 5LA6B 3ETDA 2WLIB 4DUYB 4BIOA 5D5PA 3AG4C 3RYHA 2PI5A 5CN0A 2GSMB 5B1BC 5E79Z 4CH4A 1J95A 4J80A 2CGOA 1RPRA 3CC4V 3AK1A 1WPXA 1KP2A 3HB3B 2BTQB 4TQDA 3WG7C 2WA3A 1M93A 2ZXWC 2OTLV 4DV2O 2HP8A 3B2EE 4DR6B 3UO2A 4GKKB 4G28B 4FLZA 3ASNC 1BT8A 4DV5B 3ABKC 3E35A 2YUAA 2R9RB 1Y66A 5H6RA 4ZBMA 1UFIA 2V7QG 4GCZA 5B3SB 4DR1B 3CCRV 1VQ8V 2YI9A 2ITCC 2W6JG 2QM7A 3CC7V 3AG7A 4JTCB 3L72H 1WP8A 3HKCA 1XNRO 3G67A 3NR7A 1YJ9V 1MABG 1FAFA 2ZNIA 3FAVA 3CCVV 4LF5B 3HKBA 1QQCA 4JF3A 4C7UA 1E1QG 1SQBH 1R6TA 2Y69B 1Z5VA 3TJTA 2XOKG 3BA9A 3IJ4A 5KX5B 1FXKC 1VIBA 3BPZA 2QDOA 4X20A 1JFFB 4DR2O 1WA8A 3VOUA 2YIDA 3U11A 2HVJC 4LBEC 1GM7A 4B08A 5LHGA 2RCVA 3HPLC 2UXNA 4H13B 4U3JB 4ICGA 2UU9O 1NTMH 2QSAA 4UCVA 3T1YO 1W59A 2YEVA 4TV9B 4U7NA 3RYIA 3FFQA 2XASA 2W0FC 3TCUA 4H0LB 4O2BB 5CA3A 4X66B 4ZHQA 5LMNB 3OR6C 4JI8B 2DQ0A 5J2TB 4QIWF 2UXXA 4LFCB 3CCLV 3ZBHA 3GVMA 4IT5A 2YI8A 4GX0A 1SQPH 1XNQO 2XAFA 1N33O 4PDRA 3DC6A 4O4JB 5JCOA 2DYSB 4YIPA 3ABLC 2D2CB 5FL7G 4O4HA 4WCEV 3QNEA 1EN6A 1JVMA 3B40A 3OEHG 1AROP 2DMXA 3H01A 3W7WA 1BZKA 2F1MA 2WLMA 3ZHRA 1SZTA 4U3FH 2IJKA 4TOIA 1UPGA 1Z2GA 5A9GA 4YY3B 4DR4O 1H8HG 3ZMUA 2PYLA 1N4CA 4P2ZA 5CB4A 2JVDA 4UCUA 4P9PA 4YIOA 1MNGA 3ZMSA 2QA4V 2Z3YA 5K1XA 3OFNG 2DN9A 3ZN0A 1XBLA 1H2GA 3UT5A 4FLWA 4X1IA 1YSCA 2JEXA 1K7DA 4D7TA 2LP7A 1G6UA 5JH7A 1K3EA 5KMGB 1GH6A 3ZJZA 2A9HA 1SESA 3B77A 3DGEA 3OMNB 2NR5A 5JWPA 3RYCB 2EZOA 4X1YA 1L1FA 3A0HZ 1KYOF 2QTSA 4HNAB 3RT3C 2QTOA 1LR1A 3QTCA 4UFZA 1XMQO 2H3OA 4MVZA 3S3XA 4DR3B 5BY1A 2F4VB 1QVGU 2X6BA 5B5EZ 4BIUA 2P90A 4MW8A 1IDSA 1I94B 2BOCC 3UO3A 3L9DA 3DC5A 4YJ3A 4MVRA 2W0XA 4G2KA 4NTXA 1AR4A 1QNMA 1SETA 2CTRA 2V4DA 5J2UB 4B3TB 2Q68A 1NQTA 1U97A 2AHYA 1GM9A 3OD4A 1GN3A 1H2KA 4WFHA 4WF9V 4ASUG 4Z2WA 1ZAUA 1GAXA 3WB1A 2DWDC 1P7GA 3B09A 3STZC 1D2DA 3M7MX 2N05A 4LF7B 3STLC 4PDLA 1Q90D 5IYBO 3LNMB 1FPOA 4IHJA 1SERA 4UCSA 1RPOA 1M56B 5JJEB 1BL8A 1Y6XA 1FD9A 3X2QB 4WBNA 1M1KW 1VF6C 2BE3A 1OCZB 2AGAA 1EZJA 1CXZB 4JI1B 4CS4A 3R66A 5CMUA 1NVPB 1AB3A 5EYPB 2HJFC 4WFEA 2NNUA 4DR5O 1WAZA 1SF9A 4PA6A 1YDXA 3ZRXA 3ZN1A 3U10A 3HKDA 3F5WC 1N0NA 1D5NA 3CD6V 4CS2A 2ZM6O 3OMAB 1V9PA 4F6RB 1V55B 1P84F 3OE7G 2EIJC 3FB5C 1F23A 1MA1A 4X1KB 4JZ2A 1NVPD 2LO1A 2DYRC 3NXSA 3CCMV 3JAWA 3THOA 1I08A 3JALA 5LYJB 2WSSG 4GX1A 4J11A 4IYIA 2XAHA 4DK1A 4N23A 4XDLA 2AXTZ 4GX5A 1YCIA 3DXRA 2B5UA 4DV7O 1ZL8B 3FD9A 1NH2B 3IFXA 3G80A 4DO2A 4D7SA 1TVKA 3F7VC 3FKSG 2A0LA 4X62B 2KG7A 2Q7GA 2Q0AA 4DR7B 1Y74A 1O9GA 5JVDB 1P49A 3L71H 3J80N 4DV0B 1YF2A 1GN2A 4J41A 1URFA 4DW0A 2CDYA 1BQZA 1SQFA 2FL4A 1K9MW 3CB2A 5IWAB 4B3SO 2VQFB 3CMEV 2Y0PA 1B6QA 3SPCA 4RQEA 1TUBB 1NH2D 5FNVA 2UXDO 2EZPA 1OCRC 2ZQMA 4NTYA 3KG2A 4YHHO 2KKWA 3GWOA 2UUAB 1W0KG 1I7FA 1ZUQA 4GZRB 1JJOA 3JAKA 3ICXA 2JJ1G 2EILB 2EINC 3RYFA 1T5EA 3N27A 5IYDO 4DV6O 1ZSPA 1THZA 5H9CA 1Q3EA 3CXHF 3CRCA 2X6AA 3UM7A 2OWOA 1KKDA 1FJGO 2OCHA 1X4TA 4FM2A 1WB8A 5H2FZ 2P4KA 1AI7A 4UB8Z 1EZVH 3SPJA 2CH7A 1OCOC 2GTSA 4IIJB 2QR4A 5CA1A 3LDDA 2KSDA 3O9OA 5CA0A 1AILA 1VF6A 2EULA 5B66Z 1EM1A 1R6KA 4LWSA 2VQEB 2D3OW 1QBZA 4JI0B 1HNWO 1K33A 1S72V 4JI4B 3ZEDA 2JGDA 5IYCO 3JATB 5L3GA 5LP6C 1ORQC 2YDEA 1GMGA 1AI5A 1AJQA 1ENVA 2GHYA 3E86A 2YXYA 5C8YB 1Q7YW 2P4VA 5ITZB 1S5HC 1WPBA 3H1KH 4Z1MG 3F7YC 5LXTB 2DQ3A 4PV1B 2UUCB 2VRZA 3A0BZ 2RDCA 1HR0O 1N34B 4O4IB 5L3DA 1A32A 2WLLB 3F5TA 2AHZA 4X65O 2ZCEA 2JEUA 3APQA 4I5SA 2CTPA 4QNHB 2CUGA 3ZHQA 2Q5ZA 2LGWA 3G6EV 1W0JG 1NJIW 4MVQA 2Z5UA 1G8MA 4NKGB 1JPXA 3K5OA 1M57B 4DRXA 4TUYA 2GUZA 4LP8A 1O9HA 1XREA 2YC0A 5JJNB 5HFLA 1TGOA 4BW5A 2CGNA 1I5XA 2UUBO 4PJ0Z 5LOVB 1R3JC 4MVUA 3K58A 2XT9A 3CMAV 3BCCH 4PDVA 1JQ0A 3CS5A 1ZWIC 5KUKA 4ABMA 1Q82W 4O4LA 4UVBA 1YVWA 1F4MA 1WN7A 1SRYA 3ZIAG 4K8XA 1XOUA 3TXQA 4X64B 3D36C 1BHBA 4EB6A 4B3MO 3SYOA 2HHHO 2E5LB 1VQKV 1QR9A 3JCUZ 4J9ZB 5EBMC 3JARA 3CCQV 4NTWA 4FM1A 1DK1A 1R6NA 1DF5A 4QPJA 4FLVA 1VQLV 2UXCO 5IYZB 2MK3A 2XHBA 4DV1B 4LF4O 4I7ZB 2Y69C 4HAMA 2CK3G 1WP7A 5IJ9A 3EFFK 1IZ3A 3Q4HB 4JAAA 5B1AB 1IURA 1YTFB 1PD3A 3AK2A 4Q6GA 4KP4A 5HFMA 4A5UB 4I50A 1TAEA 5BXZA 1MZEA 1N36B 3CE2A 4OXSA 2NLJC 4YJ2A 2LW7A 1BS3A 1H8EG 3OUSA 4LFBO 4BWAA 1RFYA 3AG2B 4NB5A 2CTQA 4AQYB 2LFSA 4TT3G 4PI0A 3FX7A 2XNDG 2L6LA 1XQ8A 3BRCA 2Q7EA 1IBKB 1IXMA 3K0GA 4GUNA 4XDKA 5KA6A 4KXRA 4B3RO 5LHIA 3N2GA 4TV8A 4J10A 3LDEA 2RMKB 3L75H 4FK5C 4WFFA 5EZYB 3K59A 3CCJV 2EX3A 4FZ0A 2HKOA 1SS3A 2BOBC 3WFVA 2OTJV 1H38A 4FFBB 4ZOLA 5LP6A 2JS5A 3H1JH 1K5QA 3AG4B 2FKXA 2DYSC 4JI7B 4FLXA 1P4RA 4EFBA 4DUYO 2IH3C 3CJHB 1OZ0A 3P32A 3CRQA 3H1LH 2Y4UA 1HNZB 2A7WA 2ZR3A 3B4SA 1XDCA 2WAMA 1EFRG 3ZX6A 2YIBD 1CPYA 3BVOA 4RO2A 3SJBC 3BY6A 4O2AA 2QWNB 3UQ8A 5LA6A 4GLXA 4PA3A 1D5AA 1COWG 2WLIA 3CP1A 1NTKH 5GONB 4GKKO 1XILA 1PPJH 2EIKB 4MW3A 2ODMA 4AHCA 1Q6IA 1SZXA 3ASOC 4WFBV 4KHPO 4UCTA 1SA0A 5JQGB 2BTQA 1MG1A 2ZE5A 4X8AA 4RQFA 4IYHA 1AJNA 2E76B 1HDJA 3A0RA 4XDJA 5IJ0B 3OMIB 2JRIA 4DR1O 3CRRA 1FKAO 1W2BU 1JJ2U 4FIPC 3T4ZA 2QM8A 1KKCA 5E1AC 4JAUA 4FLYA 1R1BA 1CP9A 2EBOA 1AVMA 1HP8A 3CYOA 2X0LA 1FXKB 2OT5A 3BA8A 4UXNA 1GO3F 4LNUB 1EN5A 4AI8A 1BGYH 1XMQB 3D36A 3QG5A 2ETNA 3VQWA 3N2KB 1NZ6A 1YHQV 1UJWB 1M5IA 3B8NA 2AZ0A 2VS0A 2KB1A 2RQ6A 1S77D 1GTOA 4NXNB 3OR7C 4UCRA 3CWBH 1G4YB 2JIZG 1XHZA 3GB7C 1OCCC 5KX5A 3T1HB 1JFFA 1WB7A 3OEEG 1IVSA 2ADPA 1QLEB 1YJWV 2XAJA 4CC6A 4X66O 1PNLA 4UB6Z 4U3JA 4JI8O 4LF6B 2P06A 3TETA 4LFAB 4TV9A 4PA9A 3D3QA 3ZRWB 4G27B 1U96A 3ETQA 4BAYA 4O2BA 2IU3A 2CE4A 1YIJV 2ADQB 1AI6A 5BR8O 2IM9A 3A2FA 5GW7A 3W7UA 2YICA 3KCYA 2JDIG 4X88A 1NT2B 4DV3B 4UVCA 4F4LA 1S76D 1RM1B 3AG3C 3X2QC 3CCEV 1GK9A 4R50A 1OCZC 2W6IG 3A8TA 4O4JA 1NR1A 5BMVB 4E4EA 4BIZA 3CSXA 4FFKA 2F23A 1HW7A 1YITV 4YY3O 2DE0X 4FLTA 5LL6Y 3ETGA 1US6A 3T1CA 2AW9A 2BSKB 5KHIA 3ZHUA 1J5EB 2DOSA 4JYCA 2HR3A 3ZHSA 3LUTB 1SKVA 4JYAB 5LGTA 1NR7A 1VQ6V 3FB8C 5KUMA 4JI2B 1V55C 3EHBB 1RSOB 5LMUB 1Z5WA 4LH6A 4ZI7B 2OCCB 1YJNV 2R9IA 5JJJB 4LF8B 3ETEA 3E22B 3M8AA 3CEIA 3ZRVA 3C3TA 2Q6AA 1VARA 2Y48A 3ABMB 4QPKA 3ZCCA 2UXBB 1K8AW 2QE7G 1Q6UA 1VEWA 3E8HA 1QVFU 4JV5B 2KQXA 3I56V 1ROPA 2ZIOA 2BCCH 2AZ2A 4GKJO 3CPWU 4H33A 4PA4A 5KMGA 2ZDIA 4DUZO 2P22C 1IBLB 4DR3O 2F4VO 3T4DA 4TQFA 1QR8A 1QCEA 3SGIA 3KZIZ 3RYCA 2BTOA 4DXWA 4HNAA 3ZMTA 4L8JA 1I94O 2QGNA 4I0XB 4RUFA 3OTFA 4UV9A 1VP7A 4LH7A 1FYJA 3FB6C 3K08A 4B3TO 3MDSA 3MD0A 4ZKIA 1XL4A 1N32B 5FPOA 1R3KC 3HR0A 3PJSK 1B06A 4J7KA 1VMGA 2YXLA 5IDJA 1OV9A 3RWRD 4FPPA 4DV6B 5J2UA 4LF7O 2EILC 1JX9A 1YI2V 3JYCA 3CCUV 1FJGB 1VQ7V 1L8DA 2JGUA 4FM0A 4MVOA 4I4TB 3OUFA 2X7RB 4DV4B 2F95B 5L3CA 4OX9B 3W7SA 1S5JA 4J42A 3JSLA 1X59A 4JI1O 2ZINA 4I55B 4KL1A 2R9AA 2HEPA 3G4SV 2Q73A 1TUEB 1QU7A 3K9AA 2ARHA 1H2SB 2IU0A 3J81N 2E75B 1DTOA 2JK5C 2EIJB 2PGGA 3BEHA 4UV8A 5EYPA 3RFRA 3IAYA 1V54B 1PP9H 3D8CA 1F4NA 2ZIMA 4LR3A 5LGNA 1K92A 1KU9A 5J9PC 5K1PA 2R72A 3FYEB 2QJ1A 1Q81W 4D6TH 3K3WA 1M90W 3OTOB 2DW4A 4F6RA 1HR0B 1GN6A 3BABA 2QWQB 2M7WA 3LSSA 4JI6O 1HNXB 4X1KA 4HZ3A 4LF9B 4DW1A 3K9SA 2R70A 1VQNV 4PDMA 5LYJA 1Y76B 2WLJA 3JASB 5IY5C 3WB2A 3OM3B 4K0KB 3QO7A 3SYQA 5EC1C 3AG1B 3QO8A 2LW1A 1ZL8A 4J7ZA 3K0DA 1VF7A 5IWAO 4GX2A 4K3AA 3K04A 2VQFO 2ZD9A 4QE7A 1N0JA 1FFXB 3M99B 1MZFA 1R3IC 5JVDA 3HKEB 2HVKC 1XL6A 2F66C 4JPRA 4JI3B 5GTIZ 3LSUA 3U0ZA 1NI8A 2H8PC 3RYHB 4PHZA 1WLEA 2UUAO 4LC1A 1BSMA 1TUBA 1ZX3A 4PA7A 4JI5B 2E3CA 1XMOB 5KHKA 1XEQA 4KUMA 5TISZ 1VQ9V 3CX5F 4RAIA 1VQOV 2RN9A 4MTFA 2IW5A 3K5NA 4R8CA 1BHAA 3LDCA 3L70H 2A3QA 4ZIBA 1KECA 1BE3H 4B7EA 4MTXA 2ITDC 2PTMA 1NBMG 5FPRA 3SYCA 4DV2B 1YZBA 1KQSU 1KBHA 2ZKOA 3VQYA 3CRAA 3E8GA 2Q69A 2Q0OC 5F2VO 1BQ0A 3G6BA 2XAGA 1VQPV 3ZRSA 3E8FA 2WLHA 2HLDG 1TA8A 5CBGA 1F51A 3HKCB 4FVMA 1BMFG 3UKMA 3RVYA 3FAVB 2EIMB 5LBQA 3HKBB 3ML0A 4JI0O 5EK0A 4IIJA 4JI4O 3AG2C 2PYJA 4X20B 5B3SC 1WA8B 4MTGA 1XNRB 3OGIB 1ZLZA 4L87A 4QE9A 4P9OA 2WPDG 2GDSA 2PF4E 5LHHA 4DR2B 2UUCO 3JATA 2YEVB 2B1GA 4JZGA 2G38A 3RYIB 3LSQA 1S3JA 3LNNA 1N34O 4DK0A 2JS3A 5C8YA 4NXMO 5EIBD 5ITZA 5IE9A 4ZHQB 4TSFG 2ZE6A 1L0NH 3QO5A 2JJ2G 3OT7A 5DN6G 2UU9B 5LXTA 1JR9A 1EN4A 2ZR2A 3T1YB 3IGAC 1H2LA 5KAFZ 1IBMO 1SA0B 3E2EA 2DJVA 4O4IA 3P30A 2WLLA 3SYAA 3AK3A 3BAAA 3SJAC 2YS8A 3VQXA 1DGSA 4WFGA 1KC8W 1E79G 1F7YA 3QF7A 2VWKA 4O4HB 4KHPB 1YTFD 3P3PA 1FXHA 3DTUB 2EIKC 2LFRA 3K79A 1XNQB 1N33B 3SJCC 2B9ZA 4EKWA 2QKSA 2OIEA 3OAAG 4OGQB 3K06A 5L3BA 1YXBA 1GN4A 5LOVA 4FJCC 1K73W 2ZE7A 4X64O 2Q7HA 2P6JA 5B1BB 4NVPA 2N74A 5LGUA 4GYCB 2E5LO 3SPIA 1MSWD 4CH3A 1BCCH 5DECA 5CB4B 1SC5B 3WG7B 4JYYA 2ZXWB 4MVSA 2RNBA 2F93B 1I0HA 4RWUA 4XBFA 2MW2B 1R3LC 3D3IA 4DV1O 4JTAB 1AR1B 4DR4B 1Y67A 2VWJA 3H9VA 2HFEC 4EEQA 3UT5B 1L0LH 4X1IB 3ASNB 2OYQA 3WB0A 1AR5A 4DR6O 4K8ZA 3ZMZA 4W4LA 3ABKB 5JH7B
chains in the Genus database with same CATH topology
2KG7B 2DE0X 2KG7A 3ZBHA 2AZ2A 3GVMA 2B9ZA 3GWKC 3O9OA 3Q4HB 3Q4HA 3HR0A 1WA8B 4LWSB 3TXQA 1WA8A 4LWSA 3OGIB 3FD9A 4GZRB 3G80A 4I0XB 2VRZA 3FAVB 4I0XA 2AZ0A 3FAVA 2VS0A 3TXSA 4ABMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG7 B;  2DE0 X;  2KG7 A;  3ZBH A;  2AZ2 A;  3GVM A;  2B9Z A;  3GWK C;  3O9O A;  3Q4H B;  3Q4H A;  3HR0 A;  1WA8 B;  4LWS B;  3TXQ A;  1WA8 A;  4LWS A;  3OGI B;  3FD9 A;  4GZR B;  3G80 A;  4I0X B;  2VRZ A;  3FAV B;  4I0X A;  2AZ0 A;  3FAV A;  2VS0 A;  3TXS A;  4ABM A; 
#chains in the Genus database with same CATH topology
 5EBL C;  3JAM N;  5C93 A;  1N36 O;  5IYZ A;  3L73 H;  1VF5 B;  3RVZ A;  2LQT A;  4DV5 O;  2H94 A;  3Q4H A;  5D5Q A;  4X1Y B;  3RW0 A;  4AQY O;  1DF4 A;  4OPA A;  2Z0A A;  1IBK O;  1QLE C;  4CBC A;  3I55 V;  1K97 A;  2CAZ C;  5H5N A;  3C3S A;  1VQ4 V;  2LJ2 A;  2FTK A;  3JD1 A;  2PY5 A;  3AEI A;  2ZDI C;  5BR8 B;  4LF5 O;  3K5M A;  1I5Y A;  2EJR A;  3C90 A;  4YJ3 B;  1PNK A;  5CBF A;  3ZHT A;  4JAS A;  3JD4 A;  3K03 A;  1Q43 A;  1PKX A;  2QKC A;  4OPH A;  5EZY A;  2P7T C;  1WJZ A;  1M9N A;  4BR6 A;  4FFB A;  4FMT A;  4JI7 O;  4J9Y B;  2Y4T A;  2YIB A;  3CXC U;  1RM1 C;  1VQM V;  1HNZ O;  1MOF A;  4GT1 A;  4Z1V A;  2Y0I A;  5H6Q A;  4IHJ B;  3VQV A;  4DYL A;  4F6E A;  4H37 A;  1K4C C;  3ASO B;  3CJH A;  5LMN O;  4I9Q A;  5KA5 A;  1AP6 A;  1FXV A;  3SDL A;  1FFT B;  1Q6H A;  2ZNJ A;  5L3F A;  4X9Q A;  4WBN B;  4LFC O;  3O65 A;  2ZT9 B;  2ILM A;  3E83 A;  2P5O A;  2QKA A;  2PUS A;  3CRM A;  3ABL B;  3IC7 A;  4MVM A;  3MAQ A;  3FB7 C;  5KHJ A;  5GON A;  4QJF B;  2OCC C;  2FB5 A;  3CCS V;  5J2T A;  2N04 A;  3HKD B;  2X6C A;  1M56 C;  4MTO A;  5JQG A;  1KP3 A;  4R6Z A;  4J7J A;  1AI4 A;  1SQX H;  3ABM C;  1KB9 F;  2IJI A;  2QEX V;  1P7B A;  5IJ0 A;  4TWK A;  4DR5 B;  3TK1 A;  4GKJ B;  1FS0 G;  2IBZ H;  5DM6 V;  3JD3 A;  1PL4 A;  3JAW B;  5BZB A;  2PI4 A;  4DUZ B;  3JAL B;  4AIL C;  3JCZ A;  3APO A;  2ZM6 B;  1GRJ A;  3ZS8 C;  1OCC B;  1FXK A;  5KHH A;  3DSQ A;  4JYB A;  4LNU A;  4CZZ A;  4NXN O;  3DXR B;  4UUJ C;  3I5D A;  3W7X A;  2XTA A;  3N2K A;  1HWY A;  1CEZ A;  3T1H O;  2YIA A;  2GBO A;  4UCO A;  1MSD A;  1TVK B;  3E89 A;  3VBB A;  2WLK A;  2KG7 B;  4E2L A;  4N21 A;  1Y74 B;  3KCX A;  3SPG A;  5B1N A;  5FLX N;  2QWR B;  4DV7 B;  1XI1 A;  4LF6 O;  3SPH A;  1KD1 W;  2LGQ A;  4LFA O;  4P30 A;  3J7A U;  2IJJ A;  1H2M A;  5FNV B;  5A2Q N;  4MT8 A;  1KMI Z;  3AG3 B;  3JD2 A;  4UVA A;  1QHT A;  3JD0 A;  1ZTE A;  1K4D C;  3ABT A;  4B3S B;  4DV3 O;  4YXW G;  1Y4M A;  1K34 A;  2FML A;  4FZ1 A;  3SYP A;  3PN1 A;  3ZRW A;  1OJH A;  4PD4 F;  5L3E A;  4LCU C;  2HJD A;  3JAK B;  2UXD B;  1JMK C;  2WA4 A;  2HG5 C;  2IH1 C;  1Q86 W;  3SR2 C;  3RYF B;  1N8R W;  3BFR A;  2Q8V A;  2YSU B;  4IGG A;  4YHH B;  1IX9 A;  3GWK C;  4H44 B;  4K35 A;  1J5E O;  4EFE A;  4R7C A;  4B7K A;  4JYA O;  5BMV A;  2OIG A;  3OW2 U;  3MHH C;  3WU2 Z;  4JI2 O;  4HBN A;  4IL6 Z;  2CH7 B;  5LMU O;  1QLN A;  1V54 C;  1NTZ H;  3SJQ C;  5CA1 B;  4NYK A;  2PZS A;  2BSK A;  5CA0 B;  3KKY A;  4LF8 O;  5CBH A;  4LWS B;  4RUE A;  4JI6 B;  1R73 A;  1LUW A;  1WNS A;  1DLB A;  1PL0 A;  1RSO A;  4NR1 A;  2ZE8 A;  4ZI7 A;  2JGD B;  3CHX A;  3TXS A;  2UXB O;  4KFM A;  4JV5 O;  3E22 A;  2A79 B;  5KAI Z;  1G1X B;  3ZMV A;  2Q4P A;  1SQG A;  4U7O A;  1HNW B;  2QWO B;  2GTA A;  1KUQ A;  1AJP A;  3AG1 C;  3H1I H;  1IBL O;  3CC2 V;  2QWP B;  3RN4 A;  1PM9 A;  2DYR B;  1B3Q A;  2NN4 A;  2V1D A;  5DED A;  1XUQ A;  4W4K A;  1K5S A;  3K5L A;  3B8M A;  3MHS C;  2Q9L A;  3T2M A;  2WLN A;  4QGP A;  3H1H H;  3OGC C;  4CC5 A;  3BHP A;  2E74 B;  2CTW A;  4X89 A;  3JSN A;  1N32 O;  1IXB A;  1GM8 A;  1NU1 H;  2IJH A;  4I0X A;  5IT9 N;  3W7T A;  4DRX B;  4Q20 A;  4TUY B;  5KLV H;  2GUZ B;  4JAV A;  4X65 B;  1SQV H;  5EBW C;  2XAQ A;  4X62 O;  1NS1 A;  5GTH Z;  4DR7 O;  1M4U A;  1AP5 A;  1LUV A;  4DV0 O;  4DV4 O;  4OX9 O;  3S3W A;  4CH6 A;  3EVK A;  1M57 C;  3RBZ A;  2EJ7 A;  2FYU H;  4O4L B;  2RJZ A;  2UUB B;  3IC9 A;  1OCR B;  1H2N A;  3G71 V;  2L35 A;  2YXH A;  4BW9 A;  4I4T A;  4EB6 B;  4PI2 A;  2P67 A;  3UCS C;  1SQQ H;  3JAR B;  1NKD A;  3E8B A;  5B1O A;  2F43 G;  4I55 A;  4FLU A;  2EIM C;  2EIN B;  2GV9 A;  2C2A A;  1S5L Z;  2QM4 A;  4B3M B;  3EXA A;  3TGU H;  5IJ9 B;  5EIB C;  2HHH B;  5KHG A;  2K9P A;  1XHX A;  3FYI B;  3L74 H;  2WWW A;  4I50 B;  2UXC B;  4YJ2 B;  2Q67 A;  3OTO O;  4CH5 A;  1Q5O A;  4PEL A;  4LF4 B;  2B1I A;  1OCO B;  2XUM A;  1EBO A;  1E1R G;  5AG2 A;  4NXM B;  5IY5 B;  1HNX O;  4LF9 O;  1PV0 A;  3K57 A;  2K1E A;  5B1A C;  1MMM A;  3N2G B;  4TV8 B;  1OHH G;  1IBM B;  4K0K O;  3RGB A;  4WFA V;  4LFB B;  1Q8I A;  2A06 H;  2VQE O;  1JOY A;  4JTD B;  4ZOL B;  2ATK C;  1LNQ A;  3QVN A;  5LP6 B;  3ABU A;  4HYO A;  3ZHV A;  3P3N A;  1Y76 A;  3JAS A;  4B3R B;  1GKF A;  1B04 A;  4MSW C;  1VQ5 V;  5JCO C;  4JGS A;  1JA8 A;  1PNM A;  2DWE C;  4JI3 O;  1RP3 B;  4I9W A;  5EC2 C;  4MS2 A;  4CS3 A;  1YEW A;  2M6Y A;  1FFX A;  3R65 A;  4JI5 O;  1XMO O;  3HKE A;  1S0V A;  1JCH A;  4O2A B;  2O57 A;  5LA6 B;  3ETD A;  2WLI B;  4DUY B;  4BIO A;  5D5P A;  3AG4 C;  3RYH A;  2PI5 A;  5CN0 A;  2GSM B;  5B1B C;  5E79 Z;  4CH4 A;  1J95 A;  4J80 A;  2CGO A;  1RPR A;  3CC4 V;  3AK1 A;  1WPX A;  1KP2 A;  3HB3 B;  2BTQ B;  4TQD A;  3WG7 C;  2WA3 A;  1M93 A;  2ZXW C;  2OTL V;  4DV2 O;  2HP8 A;  3B2E E;  4DR6 B;  3UO2 A;  4GKK B;  4G28 B;  4FLZ A;  3ASN C;  1BT8 A;  4DV5 B;  3ABK C;  3E35 A;  2YUA A;  2R9R B;  1Y66 A;  5H6R A;  4ZBM A;  1UFI A;  2V7Q G;  4GCZ A;  5B3S B;  4DR1 B;  3CCR V;  1VQ8 V;  2YI9 A;  2ITC C;  2W6J G;  2QM7 A;  3CC7 V;  3AG7 A;  4JTC B;  3L72 H;  1WP8 A;  3HKC A;  1XNR O;  3G67 A;  3NR7 A;  1YJ9 V;  1MAB G;  1FAF A;  2ZNI A;  3FAV A;  3CCV V;  4LF5 B;  3HKB A;  1QQC A;  4JF3 A;  4C7U A;  1E1Q G;  1SQB H;  1R6T A;  2Y69 B;  1Z5V A;  3TJT A;  2XOK G;  3BA9 A;  3IJ4 A;  5KX5 B;  1FXK C;  1VIB A;  3BPZ A;  2QDO A;  4X20 A;  1JFF B;  4DR2 O;  1WA8 A;  3VOU A;  2YID A;  3U11 A;  2HVJ C;  4LBE C;  1GM7 A;  4B08 A;  5LHG A;  2RCV A;  3HPL C;  2UXN A;  4H13 B;  4U3J B;  4ICG A;  2UU9 O;  1NTM H;  2QSA A;  4UCV A;  3T1Y O;  1W59 A;  2YEV A;  4TV9 B;  4U7N A;  3RYI A;  3FFQ A;  2XAS A;  2W0F C;  3TCU A;  4H0L B;  4O2B B;  5CA3 A;  4X66 B;  4ZHQ A;  5LMN B;  3OR6 C;  4JI8 B;  2DQ0 A;  5J2T B;  4QIW F;  2UXX A;  4LFC B;  3CCL V;  3ZBH A;  3GVM A;  4IT5 A;  2YI8 A;  4GX0 A;  1SQP H;  1XNQ O;  2XAF A;  1N33 O;  4PDR A;  3DC6 A;  4O4J B;  5JCO A;  2DYS B;  4YIP A;  3ABL C;  2D2C B;  5FL7 G;  4O4H A;  4WCE V;  3QNE A;  1EN6 A;  1JVM A;  3B40 A;  3OEH G;  1ARO P;  2DMX A;  3H01 A;  3W7W A;  1BZK A;  2F1M A;  2WLM A;  3ZHR A;  1SZT A;  4U3F H;  2IJK A;  4TOI A;  1UPG A;  1Z2G A;  5A9G A;  4YY3 B;  4DR4 O;  1H8H G;  3ZMU A;  2PYL A;  1N4C A;  4P2Z A;  5CB4 A;  2JVD A;  4UCU A;  4P9P A;  4YIO A;  1MNG A;  3ZMS A;  2QA4 V;  2Z3Y A;  5K1X A;  3OFN G;  2DN9 A;  3ZN0 A;  1XBL A;  1H2G A;  3UT5 A;  4FLW A;  4X1I A;  1YSC A;  2JEX A;  1K7D A;  4D7T A;  2LP7 A;  1G6U A;  5JH7 A;  1K3E A;  5KMG B;  1GH6 A;  3ZJZ A;  2A9H A;  1SES A;  3B77 A;  3DGE A;  3OMN B;  2NR5 A;  5JWP A;  3RYC B;  2EZO A;  4X1Y A;  1L1F A;  3A0H Z;  1KYO F;  2QTS A;  4HNA B;  3RT3 C;  2QTO A;  1LR1 A;  3QTC A;  4UFZ A;  1XMQ O;  2H3O A;  4MVZ A;  3S3X A;  4DR3 B;  5BY1 A;  2F4V B;  1QVG U;  2X6B A;  5B5E Z;  4BIU A;  2P90 A;  4MW8 A;  1IDS A;  1I94 B;  2BOC C;  3UO3 A;  3L9D A;  3DC5 A;  4YJ3 A;  4MVR A;  2W0X A;  4G2K A;  4NTX A;  1AR4 A;  1QNM A;  1SET A;  2CTR A;  2V4D A;  5J2U B;  4B3T B;  2Q68 A;  1NQT A;  1U97 A;  2AHY A;  1GM9 A;  3OD4 A;  1GN3 A;  1H2K A;  4WFH A;  4WF9 V;  4ASU G;  4Z2W A;  1ZAU A;  1GAX A;  3WB1 A;  2DWD C;  1P7G A;  3B09 A;  3STZ C;  1D2D A;  3M7M X;  2N05 A;  4LF7 B;  3STL C;  4PDL A;  1Q90 D;  5IYB O;  3LNM B;  1FPO A;  4IHJ A;  1SER A;  4UCS A;  1RPO A;  1M56 B;  5JJE B;  1BL8 A;  1Y6X A;  1FD9 A;  3X2Q B;  4WBN A;  1M1K W;  1VF6 C;  2BE3 A;  1OCZ B;  2AGA A;  1EZJ A;  1CXZ B;  4JI1 B;  4CS4 A;  3R66 A;  5CMU A;  1NVP B;  1AB3 A;  5EYP B;  2HJF C;  4WFE A;  2NNU A;  4DR5 O;  1WAZ A;  1SF9 A;  4PA6 A;  1YDX A;  3ZRX A;  3ZN1 A;  3U10 A;  3HKD A;  3F5W C;  1N0N A;  1D5N A;  3CD6 V;  4CS2 A;  2ZM6 O;  3OMA B;  1V9P A;  4F6R B;  1V55 B;  1P84 F;  3OE7 G;  2EIJ C;  3FB5 C;  1F23 A;  1MA1 A;  4X1K B;  4JZ2 A;  1NVP D;  2LO1 A;  2DYR C;  3NXS A;  3CCM V;  3JAW A;  3THO A;  1I08 A;  3JAL A;  5LYJ B;  2WSS G;  4GX1 A;  4J11 A;  4IYI A;  2XAH A;  4DK1 A;  4N23 A;  4XDL A;  2AXT Z;  4GX5 A;  1YCI A;  3DXR A;  2B5U A;  4DV7 O;  1ZL8 B;  3FD9 A;  1NH2 B;  3IFX A;  3G80 A;  4DO2 A;  4D7S A;  1TVK A;  3F7V C;  3FKS G;  2A0L A;  4X62 B;  2KG7 A;  2Q7G A;  2Q0A A;  4DR7 B;  1Y74 A;  1O9G A;  5JVD B;  1P49 A;  3L71 H;  3J80 N;  4DV0 B;  1YF2 A;  1GN2 A;  4J41 A;  1URF A;  4DW0 A;  2CDY A;  1BQZ A;  1SQF A;  2FL4 A;  1K9M W;  3CB2 A;  5IWA B;  4B3S O;  2VQF B;  3CME V;  2Y0P A;  1B6Q A;  3SPC A;  4RQE A;  1TUB B;  1NH2 D;  5FNV A;  2UXD O;  2EZP A;  1OCR C;  2ZQM A;  4NTY A;  3KG2 A;  4YHH O;  2KKW A;  3GWO A;  2UUA B;  1W0K G;  1I7F A;  1ZUQ A;  4GZR B;  1JJO A;  3JAK A;  3ICX A;  2JJ1 G;  2EIL B;  2EIN C;  3RYF A;  1T5E A;  3N27 A;  5IYD O;  4DV6 O;  1ZSP A;  1THZ A;  5H9C A;  1Q3E A;  3CXH F;  3CRC A;  2X6A A;  3UM7 A;  2OWO A;  1KKD A;  1FJG O;  2OCH A;  1X4T A;  4FM2 A;  1WB8 A;  5H2F Z;  2P4K A;  1AI7 A;  4UB8 Z;  1EZV H;  3SPJ A;  2CH7 A;  1OCO C;  2GTS A;  4IIJ B;  2QR4 A;  5CA1 A;  3LDD A;  2KSD A;  3O9O A;  5CA0 A;  1AIL A;  1VF6 A;  2EUL A;  5B66 Z;  1EM1 A;  1R6K A;  4LWS A;  2VQE B;  2D3O W;  1QBZ A;  4JI0 B;  1HNW O;  1K33 A;  1S72 V;  4JI4 B;  3ZED A;  2JGD A;  5IYC O;  3JAT B;  5L3G A;  5LP6 C;  1ORQ C;  2YDE A;  1GMG A;  1AI5 A;  1AJQ A;  1ENV A;  2GHY A;  3E86 A;  2YXY A;  5C8Y B;  1Q7Y W;  2P4V A;  5ITZ B;  1S5H C;  1WPB A;  3H1K H;  4Z1M G;  3F7Y C;  5LXT B;  2DQ3 A;  4PV1 B;  2UUC B;  2VRZ A;  3A0B Z;  2RDC A;  1HR0 O;  1N34 B;  4O4I B;  5L3D A;  1A32 A;  2WLL B;  3F5T A;  2AHZ A;  4X65 O;  2ZCE A;  2JEU A;  3APQ A;  4I5S A;  2CTP A;  4QNH B;  2CUG A;  3ZHQ A;  2Q5Z A;  2LGW A;  3G6E V;  1W0J G;  1NJI W;  4MVQ A;  2Z5U A;  1G8M A;  4NKG B;  1JPX A;  3K5O A;  1M57 B;  4DRX A;  4TUY A;  2GUZ A;  4LP8 A;  1O9H A;  1XRE A;  2YC0 A;  5JJN B;  5HFL A;  1TGO A;  4BW5 A;  2CGN A;  1I5X A;  2UUB O;  4PJ0 Z;  5LOV B;  1R3J C;  4MVU A;  3K58 A;  2XT9 A;  3CMA V;  3BCC H;  4PDV A;  1JQ0 A;  3CS5 A;  1ZWI C;  5KUK A;  4ABM A;  1Q82 W;  4O4L A;  4UVB A;  1YVW A;  1F4M A;  1WN7 A;  1SRY A;  3ZIA G;  4K8X A;  1XOU A;  3TXQ A;  4X64 B;  3D36 C;  1BHB A;  4EB6 A;  4B3M O;  3SYO A;  2HHH O;  2E5L B;  1VQK V;  1QR9 A;  3JCU Z;  4J9Z B;  5EBM C;  3JAR A;  3CCQ V;  4NTW A;  4FM1 A;  1DK1 A;  1R6N A;  1DF5 A;  4QPJ A;  4FLV A;  1VQL V;  2UXC O;  5IYZ B;  2MK3 A;  2XHB A;  4DV1 B;  4LF4 O;  4I7Z B;  2Y69 C;  4HAM A;  2CK3 G;  1WP7 A;  5IJ9 A;  3EFF K;  1IZ3 A;  3Q4H B;  4JAA A;  5B1A B;  1IUR A;  1YTF B;  1PD3 A;  3AK2 A;  4Q6G A;  4KP4 A;  5HFM A;  4A5U B;  4I50 A;  1TAE A;  5BXZ A;  1MZE A;  1N36 B;  3CE2 A;  4OXS A;  2NLJ C;  4YJ2 A;  2LW7 A;  1BS3 A;  1H8E G;  3OUS A;  4LFB O;  4BWA A;  1RFY A;  3AG2 B;  4NB5 A;  2CTQ A;  4AQY B;  2LFS A;  4TT3 G;  4PI0 A;  3FX7 A;  2XND G;  2L6L A;  1XQ8 A;  3BRC A;  2Q7E A;  1IBK B;  1IXM A;  3K0G A;  4GUN A;  4XDK A;  5KA6 A;  4KXR A;  4B3R O;  5LHI A;  3N2G A;  4TV8 A;  4J10 A;  3LDE A;  2RMK B;  3L75 H;  4FK5 C;  4WFF A;  5EZY B;  3K59 A;  3CCJ V;  2EX3 A;  4FZ0 A;  2HKO A;  1SS3 A;  2BOB C;  3WFV A;  2OTJ V;  1H38 A;  4FFB B;  4ZOL A;  5LP6 A;  2JS5 A;  3H1J H;  1K5Q A;  3AG4 B;  2FKX A;  2DYS C;  4JI7 B;  4FLX A;  1P4R A;  4EFB A;  4DUY O;  2IH3 C;  3CJH B;  1OZ0 A;  3P32 A;  3CRQ A;  3H1L H;  2Y4U A;  1HNZ B;  2A7W A;  2ZR3 A;  3B4S A;  1XDC A;  2WAM A;  1EFR G;  3ZX6 A;  2YIB D;  1CPY A;  3BVO A;  4RO2 A;  3SJB C;  3BY6 A;  4O2A A;  2QWN B;  3UQ8 A;  5LA6 A;  4GLX A;  4PA3 A;  1D5A A;  1COW G;  2WLI A;  3CP1 A;  1NTK H;  5GON B;  4GKK O;  1XIL A;  1PPJ H;  2EIK B;  4MW3 A;  2ODM A;  4AHC A;  1Q6I A;  1SZX A;  3ASO C;  4WFB V;  4KHP O;  4UCT A;  1SA0 A;  5JQG B;  2BTQ A;  1MG1 A;  2ZE5 A;  4X8A A;  4RQF A;  4IYH A;  1AJN A;  2E76 B;  1HDJ A;  3A0R A;  4XDJ A;  5IJ0 B;  3OMI B;  2JRI A;  4DR1 O;  3CRR A;  1FKA O;  1W2B U;  1JJ2 U;  4FIP C;  3T4Z A;  2QM8 A;  1KKC A;  5E1A C;  4JAU A;  4FLY A;  1R1B A;  1CP9 A;  2EBO A;  1AVM A;  1HP8 A;  3CYO A;  2X0L A;  1FXK B;  2OT5 A;  3BA8 A;  4UXN A;  1GO3 F;  4LNU B;  1EN5 A;  4AI8 A;  1BGY H;  1XMQ B;  3D36 A;  3QG5 A;  2ETN A;  3VQW A;  3N2K B;  1NZ6 A;  1YHQ V;  1UJW B;  1M5I A;  3B8N A;  2AZ0 A;  2VS0 A;  2KB1 A;  2RQ6 A;  1S77 D;  1GTO A;  4NXN B;  3OR7 C;  4UCR A;  3CWB H;  1G4Y B;  2JIZ G;  1XHZ A;  3GB7 C;  1OCC C;  5KX5 A;  3T1H B;  1JFF A;  1WB7 A;  3OEE G;  1IVS A;  2ADP A;  1QLE B;  1YJW V;  2XAJ A;  4CC6 A;  4X66 O;  1PNL A;  4UB6 Z;  4U3J A;  4JI8 O;  4LF6 B;  2P06 A;  3TET A;  4LFA B;  4TV9 A;  4PA9 A;  3D3Q A;  3ZRW B;  4G27 B;  1U96 A;  3ETQ A;  4BAY A;  4O2B A;  2IU3 A;  2CE4 A;  1YIJ V;  2ADQ B;  1AI6 A;  5BR8 O;  2IM9 A;  3A2F A;  5GW7 A;  3W7U A;  2YIC A;  3KCY A;  2JDI G;  4X88 A;  1NT2 B;  4DV3 B;  4UVC A;  4F4L A;  1S76 D;  1RM1 B;  3AG3 C;  3X2Q C;  3CCE V;  1GK9 A;  4R50 A;  1OCZ C;  2W6I G;  3A8T A;  4O4J A;  1NR1 A;  5BMV B;  4E4E A;  4BIZ A;  3CSX A;  4FFK A;  2F23 A;  1HW7 A;  1YIT V;  4YY3 O;  2DE0 X;  4FLT A;  5LL6 Y;  3ETG A;  1US6 A;  3T1C A;  2AW9 A;  2BSK B;  5KHI A;  3ZHU A;  1J5E B;  2DOS A;  4JYC A;  2HR3 A;  3ZHS A;  3LUT B;  1SKV A;  4JYA B;  5LGT A;  1NR7 A;  1VQ6 V;  3FB8 C;  5KUM A;  4JI2 B;  1V55 C;  3EHB B;  1RSO B;  5LMU B;  1Z5W A;  4LH6 A;  4ZI7 B;  2OCC B;  1YJN V;  2R9I A;  5JJJ B;  4LF8 B;  3ETE A;  3E22 B;  3M8A A;  3CEI A;  3ZRV A;  3C3T A;  2Q6A A;  1VAR A;  2Y48 A;  3ABM B;  4QPK A;  3ZCC A;  2UXB B;  1K8A W;  2QE7 G;  1Q6U A;  1VEW A;  3E8H A;  1QVF U;  4JV5 B;  2KQX A;  3I56 V;  1ROP A;  2ZIO A;  2BCC H;  2AZ2 A;  4GKJ O;  3CPW U;  4H33 A;  4PA4 A;  5KMG A;  2ZDI A;  4DUZ O;  2P22 C;  1IBL B;  4DR3 O;  2F4V O;  3T4D A;  4TQF A;  1QR8 A;  1QCE A;  3SGI A;  3KZI Z;  3RYC A;  2BTO A;  4DXW A;  4HNA A;  3ZMT A;  4L8J A;  1I94 O;  2QGN A;  4I0X B;  4RUF A;  3OTF A;  4UV9 A;  1VP7 A;  4LH7 A;  1FYJ A;  3FB6 C;  3K08 A;  4B3T O;  3MDS A;  3MD0 A;  4ZKI A;  1XL4 A;  1N32 B;  5FPO A;  1R3K C;  3HR0 A;  3PJS K;  1B06 A;  4J7K A;  1VMG A;  2YXL A;  5IDJ A;  1OV9 A;  3RWR D;  4FPP A;  4DV6 B;  5J2U A;  4LF7 O;  2EIL C;  1JX9 A;  1YI2 V;  3JYC A;  3CCU V;  1FJG B;  1VQ7 V;  1L8D A;  2JGU A;  4FM0 A;  4MVO A;  4I4T B;  3OUF A;  2X7R B;  4DV4 B;  2F95 B;  5L3C A;  4OX9 B;  3W7S A;  1S5J A;  4J42 A;  3JSL A;  1X59 A;  4JI1 O;  2ZIN A;  4I55 B;  4KL1 A;  2R9A A;  2HEP A;  3G4S V;  2Q73 A;  1TUE B;  1QU7 A;  3K9A A;  2ARH A;  1H2S B;  2IU0 A;  3J81 N;  2E75 B;  1DTO A;  2JK5 C;  2EIJ B;  2PGG A;  3BEH A;  4UV8 A;  5EYP A;  3RFR A;  3IAY A;  1V54 B;  1PP9 H;  3D8C A;  1F4N A;  2ZIM A;  4LR3 A;  5LGN A;  1K92 A;  1KU9 A;  5J9P C;  5K1P A;  2R72 A;  3FYE B;  2QJ1 A;  1Q81 W;  4D6T H;  3K3W A;  1M90 W;  3OTO B;  2DW4 A;  4F6R A;  1HR0 B;  1GN6 A;  3BAB A;  2QWQ B;  2M7W A;  3LSS A;  4JI6 O;  1HNX B;  4X1K A;  4HZ3 A;  4LF9 B;  4DW1 A;  3K9S A;  2R70 A;  1VQN V;  4PDM A;  5LYJ A;  1Y76 B;  2WLJ A;  3JAS B;  5IY5 C;  3WB2 A;  3OM3 B;  4K0K B;  3QO7 A;  3SYQ A;  5EC1 C;  3AG1 B;  3QO8 A;  2LW1 A;  1ZL8 A;  4J7Z A;  3K0D A;  1VF7 A;  5IWA O;  4GX2 A;  4K3A A;  3K04 A;  2VQF O;  2ZD9 A;  4QE7 A;  1N0J A;  1FFX B;  3M99 B;  1MZF A;  1R3I C;  5JVD A;  3HKE B;  2HVK C;  1XL6 A;  2F66 C;  4JPR A;  4JI3 B;  5GTI Z;  3LSU A;  3U0Z A;  1NI8 A;  2H8P C;  3RYH B;  4PHZ A;  1WLE A;  2UUA O;  4LC1 A;  1BSM A;  1TUB A;  1ZX3 A;  4PA7 A;  4JI5 B;  2E3C A;  1XMO B;  5KHK A;  1XEQ A;  4KUM A;  5TIS Z;  1VQ9 V;  3CX5 F;  4RAI A;  1VQO V;  2RN9 A;  4MTF A;  2IW5 A;  3K5N A;  4R8C A;  1BHA A;  3LDC A;  3L70 H;  2A3Q A;  4ZIB A;  1KEC A;  1BE3 H;  4B7E A;  4MTX A;  2ITD C;  2PTM A;  1NBM G;  5FPR A;  3SYC A;  4DV2 B;  1YZB A;  1KQS U;  1KBH A;  2ZKO A;  3VQY A;  3CRA A;  3E8G A;  2Q69 A;  2Q0O C;  5F2V O;  1BQ0 A;  3G6B A;  2XAG A;  1VQP V;  3ZRS A;  3E8F A;  2WLH A;  2HLD G;  1TA8 A;  5CBG A;  1F51 A;  3HKC B;  4FVM A;  1BMF G;  3UKM A;  3RVY A;  3FAV B;  2EIM B;  5LBQ A;  3HKB B;  3ML0 A;  4JI0 O;  5EK0 A;  4IIJ A;  4JI4 O;  3AG2 C;  2PYJ A;  4X20 B;  5B3S C;  1WA8 B;  4MTG A;  1XNR B;  3OGI B;  1ZLZ A;  4L87 A;  4QE9 A;  4P9O A;  2WPD G;  2GDS A;  2PF4 E;  5LHH A;  4DR2 B;  2UUC O;  3JAT A;  2YEV B;  2B1G A;  4JZG A;  2G38 A;  3RYI B;  3LSQ A;  1S3J A;  3LNN A;  1N34 O;  4DK0 A;  2JS3 A;  5C8Y A;  4NXM O;  5EIB D;  5ITZ A;  5IE9 A;  4ZHQ B;  4TSF G;  2ZE6 A;  1L0N H;  3QO5 A;  2JJ2 G;  3OT7 A;  5DN6 G;  2UU9 B;  5LXT A;  1JR9 A;  1EN4 A;  2ZR2 A;  3T1Y B;  3IGA C;  1H2L A;  5KAF Z;  1IBM O;  1SA0 B;  3E2E A;  2DJV A;  4O4I A;  3P30 A;  2WLL A;  3SYA A;  3AK3 A;  3BAA A;  3SJA C;  2YS8 A;  3VQX A;  1DGS A;  4WFG A;  1KC8 W;  1E79 G;  1F7Y A;  3QF7 A;  2VWK A;  4O4H B;  4KHP B;  1YTF D;  3P3P A;  1FXH A;  3DTU B;  2EIK C;  2LFR A;  3K79 A;  1XNQ B;  1N33 B;  3SJC C;  2B9Z A;  4EKW A;  2QKS A;  2OIE A;  3OAA G;  4OGQ B;  3K06 A;  5L3B A;  1YXB A;  1GN4 A;  5LOV A;  4FJC C;  1K73 W;  2ZE7 A;  4X64 O;  2Q7H A;  2P6J A;  5B1B B;  4NVP A;  2N74 A;  5LGU A;  4GYC B;  2E5L O;  3SPI A;  1MSW D;  4CH3 A;  1BCC H;  5DEC A;  5CB4 B;  1SC5 B;  3WG7 B;  4JYY A;  2ZXW B;  4MVS A;  2RNB A;  2F93 B;  1I0H A;  4RWU A;  4XBF A;  2MW2 B;  1R3L C;  3D3I A;  4DV1 O;  4JTA B;  1AR1 B;  4DR4 B;  1Y67 A;  2VWJ A;  3H9V A;  2HFE C;  4EEQ A;  3UT5 B;  1L0L H;  4X1I B;  3ASN B;  2OYQ A;  3WB0 A;  1AR5 A;  4DR6 O;  4K8Z A;  3ZMZ A;  4W4L A;  3ABK B;  5JH7 B; 
#chains in the Genus database with same CATH homology
 2KG7 B;  2DE0 X;  2KG7 A;  3ZBH A;  2AZ2 A;  3GVM A;  2B9Z A;  3GWK C;  3O9O A;  3Q4H B;  3Q4H A;  3HR0 A;  1WA8 B;  4LWS B;  3TXQ A;  1WA8 A;  4LWS A;  3OGI B;  3FD9 A;  4GZR B;  3G80 A;  4I0X B;  2VRZ A;  3FAV B;  4I0X A;  2AZ0 A;  3FAV A;  2VS0 A;  3TXS A;  4ABM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...