3G80A

Nodamura virus protein b2, rna-binding domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
b'SCAYELIKSLPAKLEQLAQETQATIQTLMIADPNVNKDLRAFCEFLTVQHQRAYRATNSLLIKPRVAAALRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein B2
publication title Structure of the RNA-Binding Domain of Nodamura Virus Protein B2, a Suppressor of RNA Interference.
pubmed doi rcsb
source organism Nodamura virus
molecule tags Viral protein
total genus 28
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3g80A00
2AZ0A 4I0XA 3O9OA 4I0XB 2DE0X 3FAVB 3OGIB 2VS0A 3FAVA 4ABMA 4LWSA 3GVMA 4LWSB 1WA8A 1WA8B 3FD9A 2KG7B 2KG7A 4GZRB 2B9ZA 2AZ2A 3TXSA 2VRZA 3HR0A 3Q4HA 3Q4HB 3TXQA 3GWKC 3ZBHA 3G80A
chains in the Genus database with same CATH superfamily
4O4IB 2EINC 4LR3A 2OCHA 3ZRXA 4K0KB 3K5NA 4U3FH 2G38A 1VMGA 4TQFA 4JI5O 1SETA 2AHYA 2CE4A 2FTKA 2F23A 1NH2B 2QKCA 3N2GB 2EJRA 2PUSA 3JASA 2YC0A 5CA1B 5GONA 5LGNA 5JVDB 1FJGO 2PGGA 2QR4A 1FD9A 5BMVB 3DTUB 1HNXB 1SS3A 4GUNA 4LF6B 4XDLA 1TGOA 2DYRC 2RJZA 1GRJA 5KMGA 3ZMVA 1JJ2U 2UXDB 4WFEA 4IYHA 3T1HB 4PA6A 4JI2B 1G1XB 4B7KA 2YI9A 3AG4C 5IY5B 1V54B 4DR1B 2IBZH 1E1QG 1FXKB 1EM1A 5KA5A 2DE0X 1RP3B 2BTQB 1QNMA 4D7TA 3E8FA 3W7UA 3STLC 4J7ZA 1SA0B 4MSWC 1FS0G 4DV1B 1IBKO 4UCRA 4PI0A 1GMGA 4TOIA 5IYZA 4DR5B 5KUMA 5A2QN 3QG5A 4MVRA 2JS3A 3SPCA 5IT9N 3G67A 2EIJB 2A9HA 5DECA 1NKDA 4H0LB 3CCSV 2UXDO 5IYCO 5CA3A 3L73H 1XUQA 4ZI7B 3T1HO 3L72H 2K1EA 1G4YB 3JSNA 5L3CA 3FB8C 3RYCB 1GH6A 5L3DA 1HR0B 1WP7A 3D8CA 1KB9F 4YJ2A 3AG2C 3SJCC 4TV8B 2OIEA 3A2FA 1HNZO 3ZHSA 2V1DA 4YJ3B 2Q9LA 1Q3EA 1WAZA 2NN4A 2AHZA 3OTOB 5IDJA 1ZSPA 2E74B 3B4SA 2ZE5A 2M7WA 5J2UB 1FAFA 4JPRA 3R66A 2QJ1A 1H2KA 2P90A 2UXBO 4P30A 3X2QC 3CPWU 2Y0PA 3CEIA 1HR0O 4IIJA 1L0LH 5KUKA 2XOKG 4GKJO 4CH5A 2R9RB 5IJ9B 4P9PA 3CCJV 3L74H 4PA4A 1AR5A 3CJHB 2IJKA 5LHGA 1AJPA 1M5IA 2CGOA 1O9GA 1WB7A 1PL0A 3ZRWB 2ZR3A 3K03A 2A0LA 2ETNA 4X1YB 1SQFA 2JGDB 2Y4UA 1AJQA 4JASA 1R1BA 1PNMA 2QWPB 2YXYA 1BSMA 1ZX3A 3AK2A 4ICGA 4G27B 4JYAO 4OX9O 3OUFA 3G6BA 4F6RA 4YXWG 5J2TB 2UU9O 4DR3O 2RQ6A 1OCCC 2OT5A 2Z3YA 1MG1A 1FFXB 1MMMA 2HP8A 3N27A 4DUYO 2CGNA 3JCUZ 2BOBC 5FNVB 5FPRA 4MW3A 5BR8B 1YITV 1XQ8A 4O2AA 2H94A 1NI8A 3E8GA 1YJ9V 1SC5B 4IL6Z 3KZIZ 1XMOB 4MW8A 3L75H 4U7OA 1YI2V 2ADPA 4FIPC 3BAAA 1TUBA 3OUSA 4DR4O 2ZXWC 3J7AU 3FB6C 5KAFZ 3RYFA 3DC6A 5E79Z 4LC1A 3OR6C 1FXHA 3Q4HA 3D3IA 5JH7A 3DXRA 4RAIA 5D5PA 5GONB 2JEUA 2D2CB 3H1IH 1HNWO 5HFMA 3ABMB 2XASA 3BRCA 1K73W 2Q7EA 3CMAV 3RT3C 1S72V 1FFTB 2QGNA 1VQ4V 1N0NA 5KMGB 2DQ3A 2XAGA 5JJJB 3SYCA 2IJHA 5CB4B 1BCCH 4OXSA 5IYDO 2P06A 2QWNB 4J42A 4HYOA 2JEXA 1BHAA 1GN2A 2EIMB 4LFBO 3GWOA 4UCTA 4KL1A 4EKWA 1BS3A 1XDCA 2JIZG 1KP2A 3DGEA 2HLDG 3ABLC 1MZFA 3K57A 3H9VA 4FMTA 5C93A 1GTOA 2N04A 4RUFA 2HG5C 2WLLA 4UCVA 1JJOA 3BCCH 1RM1B 2BSKA 4JI1O 1SERA 1AB3A 1NQTA 4J11A 2XT9A 1JR9A 3QO5A 1FKAO 2QKSA 2MW2B 2OYQA 2PI5A 4WFBV 3CRCA 5C8YB 4DW1A 3WB2A 2CTPA 5ITZB 3LDDA 1R73A 4IHJA 3ZHTA 3BHPA 4UCSA 4FPPA 2QTSA 3ZHVA 1YF2A 1W0KG 2ZE6A 3IFXA 1M90W 1Q8IA 4DR7B 2H3OA 4IIJB 4BIOA 3K08A 1QQCA 3FX7A 2QKAA 1GM8A 4E2LA 2AGAA 5LMUB 3FFQA 4DV3B 3OGIB 3S3XA 3GVMA 4X65O 2VQFB 1VIBA 3TJTA 4JTCB 3RYIA 1AJNA 3BVOA 1Y74B 1UPGA 2Q7GA 1XOUA 4FLVA 2Q0AA 1K5QA 3E8BA 2YXLA 2FL4A 2XTAA 1Y6XA 2RNBA 1V55C 2B1GA 1XHZA 2UXCO 1BL8A 4F4LA 4DR7O 3FAVA 4PA3A 3CD6V 4TV9A 1SQBH 1VF6C 5D5QA 3J81N 2HKOA 4LBEC 4B3SB 2VQEB 5EYPA 4QJFB 1JX9A 3CRRA 1FPOA 3K0GA 1T5EA 2QWQB 3ZS8C 2LP7A 1NR7A 3K59A 3QVNA 4O4LB 2CH7A 3MHHC 2P4VA 3WB1A 1Y4MA 3A0HZ 3HKDA 3QNEA 4EEQA 1QHTA 2X6BA 3APOA 3H01A 3RYFB 3OM3B 2YS8A 5J9PC 3E35A 3HPLC 1N32B 3DXRB 2CTQA 3CC4V 2ZCEA 4JZGA 4J80A 2P7TC 2UXNA 2QM8A 5DM6V 4KFMA 3JAKB 1DF5A 3HKCA 1QU7A 1KUQA 2N74A 4LWSB 3I5DA 3CCRV 4LH7A 2AW9A 4X1KA 4O4HB 4X64O 1JA8A 3ABKB 4DK0A 2FB5A 4ZHQB 3PN1A 2DWDC 2HVKC 3UT5A 2M6YA 4FM1A 2DMXA 4E4EA 1QCEA 5KA6A 4FFBA 4HZ3A 2JDIG 3SYQA 3JAWA 4BIUA 5BY1A 3CRMA 1OCZC 3ICXA 3LDEA 1S5HC 3VBBA 2KQXA 4KHPB 1N33O 2EILB 1PL4A 1ZLZA 1RSOB 5DEDA 1NZ6A 4Z2WA 5A9GA 3ZN0A 4LF5O 4LFAB 3FB5C 3HB3B 4I7ZB 3ZMZA 3J80N 1PD3A 3TK1A 3TETA 4JGSA 2LFSA 3T1YO 2V7QG 5LMNB 5LXTA 3K0DA 3JALB 4DR2O 4WFGA 5B1BB 4NXNB 1QLEB 5H2FZ 4GT1A 5B3SC 5FLXN 3JD0A 4NYKA 5KHJA 4LFAO 4LNUA 2X7RB 2GDSA 4BR6A 4UFZA 4B3RB 1ZTEA 4LF7O 2VWKA 4B3MO 4H37A 3U0ZA 5H6RA 3RYIB 1COWG 3BY6A 3JARB 4HBNA 2HHHO 3WG7C 2Q7HA 4DRXA 4OGQB 4WFAV 1EFRG 2QTOA 1I94O 2UUAO 2F4VO 1YSCA 3FAVB 4PDMA 4WFHA 4O4JB 1I7FA 3OTFA 3ASNC 1I0HA 4YY3O 4CS2A 2EJ7A 2LJ2A 2AXTZ 1FJGB 1URFA 1L0NH 3R65A 3F7YC 4MT8A 1Z5WA 1D5NA 3ASOB 1KC8W 2YEVB 1P7BA 4GKKO 1K8AW 4JI8O 1H2NA 3HKDB 1SZXA 3ZRVA 2IH1C 3JSLA 2ZE8A 2DYSC 3K79A 1XL6A 2Y0IA 1H8EG 3JD1A 3JD3A 4PA7A 1GN4A 3CXCU 4BWAA 4PV1B 1MABG 1M57C 3B40A 1OCCB 3LSQA 3LSUA 5B1AB 1VF6A 5L3BA 2FKXA 4TT3G 4X88A 3T1CA 1BQ0A 4J7KA 1IBKB 1N34O 1SQVH 1PKXA 3EXAA 4DK1A 4A5UB 4FZ0A 1G8MA 1O9HA 2NLJC 4X1KB 3MD0A 4NXMO 1WP8A 2OTJV 1WB8A 5EBWC 3HKBA 1XMQB 3E22A 3ZBHA 3CS5A 3CC2V 3JATA 3ABTA 4U7NA 2ZXWB 4UVAA 3EHBB 4UUJC 3WU2Z 3RVYA 4JZ2A 2VWJA 1NVPD 3WB0A 1OJHA 4NR1A 3RYHB 1Z5VA 5EBMC 3UO3A 1HNZB 5KHHA 1K97A 3BEHA 4QE9A 1YJWV 3B2EE 3OEHG 3TGUH 1PNLA 1H2MA 1OCOB 3CE2A 1YVWA 1XMQO 1SRYA 2QDOA 2UXBB 4I50A 3E2EA 1JFFB 4DV2O 3THOA 1TVKA 2Y69B 5EC1C 2ZD9A 3CCVV 5EIBC 4GKJB 2WA3A 4CH4A 1QLNA 2P4KA 1IDSA 1GK9A 2W0FC 3W7SA 4I9QA 5LXTB 3VQYA 2Z5UA 4NB5A 4AILC 1WA8B 2Q67A 5IJ0A 1HW7A 3OMAB 1J5EO 5LA6B 1IBLO 2YIAA 1Y66A 1ORQC 5GW7A 5E1AC 2ZKOA 4JYAB 1NTMH 4L87A 4OX9B 3VQWA 2XAHA 2UU9B 4LNUB 4DR3B 3MHSC 4WF9V 3ETQA 3AK1A 1CEZA 3BFRA 4NTXA 4DUYB 2PYLA 2X0LA 4Z1VA 5CBGA 3T4DA 2XAQA 4TUYB 4YIPA 4UB8Z 4DUZB 4G28B 1VF5B 1YIJV 2ZE7A 1QBZA 5DN6G 3ZHRA 1AR1B 3OGCC 1W59A 1WPBA 1X4TA 4DR4B 5FPOA 4UCUA 5KLVH 3DSQA 2Q68A 4JI4O 3L9DA 1NR1A 3STZC 4LCUC 4FZ1A 3RGBA 1BMFG 1HNWB 3ZN1A 2WLKA 2ZDIC 4JI0B 4FLZA 1PM9A 2FYUH 4DUZO 1OCRC 1UJWB 3K9SA 3ETGA 1US6A 2Q4PA 2OIGA 2PZSA 1V55B 4H13B 1VEWA 3JASB 3P3PA 3ABUA 3CCQV 3GWKC 4H33A 3K5MA 3QO7A 1V9PA 3OE7G 4LF4O 4LFBB 4I0XA 1KKDA 3O9OA 1D5AA 5KAIZ 3JD2A 5IY5C 5CBFA 2FMLA 1V54C 1KECA 3UKMA 4FM0A 4JI0O 2F66C 1LNQA 4X20A 2VRZA 3D36C 3HKBB 2ATKC 4NKGB 3E22B 4JI1B 3E86A 2IJJA 3JATB 4GX0A 1G6UA 5JQGA 4DV5O 3CP1A 3AG3C 3H1JH 2Q73A 2JGUA 1KYOF 2WLIA 1JVMA 4CS4A 3S3WA 1WJZA 4MVQA 1RPOA 2DOSA 4FM2A 5IYZB 4D6TH 1ZWIC 1SKVA 3H1HH 4PI2A 1Q90D 2VS0A 1B3QA 3P32A 4HNAA 4I9WA 2EIKB 2BTOA 4U3JA 3RVZA 3SJBC 4YJ2B 5LL6Y 1VQLV 4B3TO 4GX1A 2OCCC 3SYAA 4YHHO 1WN7A 4X65B 3TCUA 3K3WA 2YSUB 2IW5A 4ZOLA 2IM9A 5K1PA 5LBQA 1EZJA 4LF8O 1U96A 3LUTB 3B09A 1OCZB 2AZ2A 4JYBA 3RW0A 5JJNB 1VQ9V 2OWOA 2LW7A 1X59A 3T2MA 2UXCB 1M56C 4Z1MG 3OFNG 4KUMA 1IBMB 5B5EZ 1PV0A 1LR1A 1EBOA 4LF9B 3QTCA 5K1XA 3OMNB 1K34A 1TA8A 4I55A 1K5SA 3BA8A 1NT2B 4FJCC 3AG1B 4AQYO 1H2LA 5CA0A 1OZ0A 4GX2A 1QVGU 5LYJA 2A3QA 1K33A 4QGPA 2HEPA 4N23A 4CH6A 3FKSG 1M93A 2Q8VA 1XI1A 3SPHA 2A79B 2ZNIA 4F6RB 3EFFK 1IBMO 1NTKH 4LF9O 3F5WC 4JYYA 3N2KA 4EFBA 4QNHB 3CB2A 4O2AB 5B1NA 5LHHA 4LFCO 1KMIZ 3L71H 4PA9A 1W2BU 4X64B 1TUEB 1W0JG 2XAJA 1TUBB 2GTSA 1K9MW 1THZA 2Q6AA 2EZOA 1A32A 2DQ0A 1UFIA 3Q4HB 2W0XA 4WBNA 5JH7B 1YDXA 5H6QA 3ASNB 4O4IA 5IYBO 2ZT9B 4UCOA 1VQ7V 3CRAA 2PI4A 4MVZA 2CUGA 1S5JA 4QPKA 3DC5A 2EZPA 4DV4O 2R9IA 2QSAA 4QPJA 2P22C 2ZDIA 2OTLV 1D2DA 3C3SA 2EINB 2EIMC 2UUBO 2JJ2G 1N33B 3W7TA 1XNRB 2DYSB 3SR2C 5JQGB 3CCMV 2GTAA 2K9PA 1XREA 2PTMA 1ZUQA 4LF5B 3M8AA 2WLIB 2Q0OC 4DXWA 1B6QA 2DW4A 1M57B 3RBZA 2B9ZA 4XDKA 2L6LA 3T1YB 2ARHA 1XEQA 4IT5A 4DR6O 3CXHF 2LFRA 4DR2B 3ZEDA 2DYRB 3NR7A 3U10A 4RO2A 2WLLB 2BSKB 5EIBD 3D36A 4RQEA 2Y4TA 4BIZA 4G2KA 1XNRO 4YIOA 4DV7O 1QR8A 4U3JB 3MDSA 3AG4B 4J9ZB 1AP5A 1P49A 2E5LO 5BXZA 1R6NA 1PP9H 4NTWA 3W7WA 1GO3F 1I08A 3UQ8A 2WWWA 2WSSG 1Q6IA 4ZI7A 4LF7B 4ZOLB 4UVBA 4B3MB 4IHJB 1XNQO 1LUVA 1N0JA 3UM7A 4BW9A 4UXNA 1SQGA 3C90A 2HHHB 3A8TA 3K58A 4O2BA 5IWAO 1CPYA 1R6KA 1I94B 2UUAB 1P7GA 4NTYA 4JI3O 2F4VB 1H8HG 1KD1W 3SPIA 4KP4A 1YTFD 4GX5A 4F6EA 1IZ3A 4FLYA 1AI7A 1DF4A 3JYCA 4YY3B 4EB6A 2F95B 4N21A 4X66O 3AG2B 4UV8A 4DV6O 3ZHUA 1MSDA 2KG7A 3K9AA 5J2UA 4XDJA 1S77D 5LYJB 1Q82W 4GKKB 1ZAUA 4JI8B 2NR5A 1ROPA 1NU1H 1LUWA 5LP6C 4JI6O 2HJFC 1L1FA 3KCXA 4I5SA 3OD4A 4DV0O 3PJSK 1GM9A 2HJDA 4TV9B 4FFKA 3X2QB 1Q81W 3RWRD 2W6JG 3ZRWA 2O57A 1NH2D 4X89A 1CXZB 4JV5O 3CWBH 4X1YA 1XBLA 5EYPB 3I56V 1HP8A 3N2KB 1F4NA 2F1MA 2LQTA 1VP7A 1N34B 1VF7A 3G80A 3CYOA 1Q43A 3A0BZ 1S76D 1N36O 4NXMB 2CH7B 2YDEA 1KU9A 2JK5C 2ZIOA 2WLJA 2LO1A 1RFYA 3W7XA 1M9NA 4PJ0Z 1F7YA 1H38A 1JQ0A 5FNVA 5TISZ 2ODMA 1HDJA 4WBNB 5H9CA 3P3NA 2ZM6O 2R70A 3QO8A 1Q86W 3ABKC 2JVDA 5LOVA 2WLHA 1Y67A 2EULA 3HKCB 2PF4E 1QVFU 3K5LA 4PDVA 2ITCC 1KP3A 4JTDB 1S5LZ 5L3EA 4WFFA 1FYJA 1QR9A 4CBCA 1R3KC 1BZKA 1OCRB 2B5UA 2PY5A 1YZBA 2EX3A 1XHXA 1U97A 3B8NA 3UT5B 1JPXA 4DV2B 5JCOC 2ITDC 1CP9A 1HWYA 4K0KO 3BA9A 2EILC 1YCIA 1M1KW 3CSXA 4FFBB 1VQ5V 3LSSA 5CB4A 2X6CA 5EC2C 3JAWB 4K35A 3SJQC 3RN4A 2WLNA 2LGQA 2X6AA 3OAAG 1J5EB 1IBLB 2XNDG 3GB7C 1B06A 1BGYH 2H8PC 3CHXA 4MVMA 5EK0A 3FD9A 1HNXO 4DW0A 2XHBA 1TAEA 3SPGA 4LF6O 3AG3B 5B1BC 4MVOA 1QLEC 1EN5A 1AROP 2RDCA 2CAZC 4AI8A 2R72A 2XAFA 4JI2O 3IJ4A 4PDRA 1NVPB 4DR1O 2CDYA 4QE7A 2YI8A 3AK3A 2MK3A 3ABLB 3OR7C 4O2BB 1F23A 1DGSA 1JMKC 1WPXA 4LP8A 5C8YA 5LHIA 3FB7C 3ZMSA 1Y76A 5EZYA 3ZCCA 4DV1O 3H1KH 5ITZA 4DR5O 4JI4B 4EB6B 2DN9A 4C7UA 1BHBA 1EN4A 4OPAA 2EBOA 2IU0A 4ABMA 3UO2A 4CC6A 2HFEC 4J10A 2OCCB 2KG7B 1JCHA 4W4KA 4X9QA 3UCSC 1K92A 2L35A 4PHZA 1EN6A 4JYCA 3SPJA 4CZZA 1SZTA 1XL4A 4DRXB 3IAYA 1DLBA 3IGAC 4JAUA 2YIBA 2RMKB 1I5YA 3ASOC 3ZHQA 2QWRB 4ZKIA 1M56B 4FK5C 1VQOV 2JS5A 3OTOO 1SQQH 3SYOA 4LF4B 1Y74A 2YICA 4K3AA 2ZNJA 4I4TA 5FL7G 4GLXA 4JI7B 1R3IC 1N8RW 4J9YB 5B1OA 3CMEV 5B1AC 3KCYA 3G71V 2JJ1G 3K04A 4NVPA 2ZIMA 5LP6A 1Q7YW 3CRQA 1PNKA 3HR0A 5CMUA 4DV5B 2RN9A 2BE3A 3BABA 4MTOA 4DO2A 3OMIB 2W6IG 1ZL8A 4O4LA 5LOVB 1IXBA 2KKWA 4RWUA 4UB6Z 2KSDA 4TQDA 2YUAA 1VQPV 4JI7O 4R7CA 1FXKC 4CC5A 3VOUA 3OT7A 5GTHZ 4X8AA 1S0VA 1Z2GA 4X1IA 3H1LH 2CTRA 4LH6A 1OV9A 5B66Z 1GKFA 4AHCA 5KHIA 3M99B 5BR8O 4PD4F 3JAKA 4IGGA 3OW2U 3B8MA 4LWSA 2EIJC 3CCLV 1XMOO 4B3TB 1MNGA 2IH3C 1AR4A 1GN6A 1YHQV 1OCOC 2WLMA 4FLWA 3CCEV 4O4HA 2E3CA 4ASUG 3EVKA 4YHHB 3CC7V 2Y48A 1SESA 3M7MX 4ZHQA 2E75B 3U11A 1VARA 2UUCB 2GUZA 3E83A 3LNNA 2Y69C 4LF8B 2DWEC 2GV9A 4JF3A 3HKEA 4XBFA 1K7DA 4UV9A 1R3JC 2ADQB 3B77A 4I50B 4MTFA 1TVKB 3VQVA 1MA1A 1NBMG 3TXSA 2BCCH 5L3GA 3CCUV 4ZBMA 2GHYA 5JCOA 4TWKA 1BT8A 2WAMA 4MTGA 3SGIA 4H44B 1VQNV 3BPZA 2YIBD 3C3TA 4AQYB 2UUCO 1VQ6V 1AP6A 1RSOA 3JD4A 4MTXA 1Q5OA 4Q6GA 5IJ0B 1YJNV 2GSMB 1J95A 5KX5A 3D3QA 4FLTA 1Y76B 5EZYB 2ZR2A 3RFRA 1AI5A 4R50A 1WNSA 5CBHA 4RQFA 4EFEA 4X62B 5CN0A 3JALA 2F43G 3QF7A 5EBLC 4LFCB 2C2AA 4MVUA 4PELA 5F2VO 3SYPA 1K4DC 2QM4A 1H2SB 1FXVA 4JAAA 5B3SB 2QA4V 4DYLA 2ILMA 4P9OA 4X62O 2XUMA 1Q6UA 1VQMV 1R3LC 3K06A 2IU3A 3JARA 4MVSA 3ZMUA 3MAQA 2R9AA 1VQ8V 4J41A 5JWPA 2HR3A 1WLEA 4PDLA 1IVSA 4I4TB 1F51A 1M4UA 3I55V 1GAXA 3ETEA 3ZX6A 4GCZA 3KG2A 3L70H 4BAYA 4DV4B 2WA4A 4O4JA 1GM7A 1GN3A 1N4CA 2P6JA 3WG7B 2UUBB 5IE9A 2V4DA 5LMUO 4DV3O 2LGWA 2NNUA 3ABMC 3A0RA 3ZIAG 5LP6B 4K8XA 1ENVA 2VQFO 5GTIZ 1RPRA 3CX5F 1B04A 3ETDA 5AG2A 2YEVA 3ZJZA 1ZL8B 2AZ0A 1L8DA 4I0XB 4WCEV 2GBOA 3G6EV 3AG7A 3JCZA 4GZRB 4DR6B 4X1IB 3N2GA 4X20B 3KKYA 1EZVH 3O65A 5CA1A 3T4ZA 4B3SO 4OPHA 2VQEO 1IX9A 4R6ZA 1DTOA 5JVDA 3AEIA 4DV7B 1JOYA 2N05A 3FYEB 1XILA 5BMVA 4TSFG 4IYIA 1DK1A 4RUEA 4CS3A 3F7VC 4BW5A 5BZBA 2E5LB 3LDCA 1S3JA 4FLXA 2QEXV 1F4MA 1Q6HA 1RM1C 3SJAC 5KHKA 2QM7A 2JRIA 1BQZA 5HFLA 1SQPH 2CTWA 3FYIB 2EIKC 4L8JA 2GUZB 1XNQB 4K8ZA 4R8CA 4B08A 3HKEB 1N32O 1FXKA 4MS2A 2A7WA 3WFVA 5IWAB 2BTQA 1MSWD 3RYHA 2UXXA 1MOFA 4HNAB 5KHGA 4FLUA 4JI3B 1SA0A 2P67A 2F93B 5L3FA 2E76B 4D7SA 1SF9A 1YEWA 2Z0AA 1KBHA 1E79G 1BE3H 3G4SV 3TXQA 4X66B 4J7JA 1IXMA 3IC9A 4DV6B 2Q5ZA 3SDLA 2ZQMA 2RCVA 2PYJA 3JAMN 3P30A 3RYCA 3E8HA 1JFFA 3K5OA 2QWOB 5LGTA 4JI6B 4FVMA 5KX5B 1YXBA 1R6TA 4TV8A 4CH3A 4DV0B 3AG1C 1AILA 2KB1A 4P2ZA 4YJ3A 1AVMA 2IJIA 1AI4A 4B7EA 4JV5B 1NS1A 1E1RG 4ZIBA 2HVJC 1WA8A 3OEEG 4KHPO 4I55B 4GYCB 3LNMB 5H5NA 5LA6A 2BOCC 1PPJH 1NJIW 5CA0B 2YIDA 1N36B 2Q69A 2P5OA 2QE7G 1VQKV 4JAVA 4KXRA 5IJ9A 4QIWF 1K3EA 3CJHA 2D3OW 4Q20A 2CK3G 1NTZH 5LMNO 2ZINA 1OHHG 5LGUA 2ZM6B 2LW1A 4HAMA 3APQA 2A06H 4TUYA 2JGDA 1K4CC 1IURA 2WPDG 4W4LA 4NXNO 3ML0A 1MZEA 1AI6A 1YTFB 4JI5B 3ZMTA 4JTAB 3VQXA 1I5XA 3F5TA 3E89A 5J2TA 1KQSU 4UVCA 1P4RA 2B1IA 1FFXA 3IC7A 1KKCA 1H2GA 3ZRSA 3NXSA 1P84F 4B3RO 5JJEB 2DJVA 2YXHA 1SQXH
chains in the Genus database with same CATH topology
2AZ0A 4I0XA 3O9OA 4I0XB 2DE0X 3FAVB 3OGIB 2VS0A 3FAVA 4ABMA 4LWSA 3GVMA 4LWSB 1WA8A 1WA8B 3FD9A 2KG7B 2KG7A 4GZRB 2B9ZA 2AZ2A 3TXSA 2VRZA 3HR0A 3Q4HA 3Q4HB 3TXQA 3GWKC 3ZBHA 3G80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ0 A;  4I0X A;  3O9O A;  4I0X B;  2DE0 X;  3FAV B;  3OGI B;  2VS0 A;  3FAV A;  4ABM A;  4LWS A;  3GVM A;  4LWS B;  1WA8 A;  1WA8 B;  3FD9 A;  2KG7 B;  2KG7 A;  4GZR B;  2B9Z A;  2AZ2 A;  3TXS A;  2VRZ A;  3HR0 A;  3Q4H A;  3Q4H B;  3TXQ A;  3GWK C;  3ZBH A;  3G80 A; 
#chains in the Genus database with same CATH topology
 4O4I B;  2EIN C;  4LR3 A;  2OCH A;  3ZRX A;  4K0K B;  3K5N A;  4U3F H;  2G38 A;  1VMG A;  4TQF A;  4JI5 O;  1SET A;  2AHY A;  2CE4 A;  2FTK A;  2F23 A;  1NH2 B;  2QKC A;  3N2G B;  2EJR A;  2PUS A;  3JAS A;  2YC0 A;  5CA1 B;  5GON A;  5LGN A;  5JVD B;  1FJG O;  2PGG A;  2QR4 A;  1FD9 A;  5BMV B;  3DTU B;  1HNX B;  1SS3 A;  4GUN A;  4LF6 B;  4XDL A;  1TGO A;  2DYR C;  2RJZ A;  1GRJ A;  5KMG A;  3ZMV A;  1JJ2 U;  2UXD B;  4WFE A;  4IYH A;  3T1H B;  4PA6 A;  4JI2 B;  1G1X B;  4B7K A;  2YI9 A;  3AG4 C;  5IY5 B;  1V54 B;  4DR1 B;  2IBZ H;  1E1Q G;  1FXK B;  1EM1 A;  5KA5 A;  2DE0 X;  1RP3 B;  2BTQ B;  1QNM A;  4D7T A;  3E8F A;  3W7U A;  3STL C;  4J7Z A;  1SA0 B;  4MSW C;  1FS0 G;  4DV1 B;  1IBK O;  4UCR A;  4PI0 A;  1GMG A;  4TOI A;  5IYZ A;  4DR5 B;  5KUM A;  5A2Q N;  3QG5 A;  4MVR A;  2JS3 A;  3SPC A;  5IT9 N;  3G67 A;  2EIJ B;  2A9H A;  5DEC A;  1NKD A;  4H0L B;  3CCS V;  2UXD O;  5IYC O;  5CA3 A;  3L73 H;  1XUQ A;  4ZI7 B;  3T1H O;  3L72 H;  2K1E A;  1G4Y B;  3JSN A;  5L3C A;  3FB8 C;  3RYC B;  1GH6 A;  5L3D A;  1HR0 B;  1WP7 A;  3D8C A;  1KB9 F;  4YJ2 A;  3AG2 C;  3SJC C;  4TV8 B;  2OIE A;  3A2F A;  1HNZ O;  3ZHS A;  2V1D A;  4YJ3 B;  2Q9L A;  1Q3E A;  1WAZ A;  2NN4 A;  2AHZ A;  3OTO B;  5IDJ A;  1ZSP A;  2E74 B;  3B4S A;  2ZE5 A;  2M7W A;  5J2U B;  1FAF A;  4JPR A;  3R66 A;  2QJ1 A;  1H2K A;  2P90 A;  2UXB O;  4P30 A;  3X2Q C;  3CPW U;  2Y0P A;  3CEI A;  1HR0 O;  4IIJ A;  1L0L H;  5KUK A;  2XOK G;  4GKJ O;  4CH5 A;  2R9R B;  5IJ9 B;  4P9P A;  3CCJ V;  3L74 H;  4PA4 A;  1AR5 A;  3CJH B;  2IJK A;  5LHG A;  1AJP A;  1M5I A;  2CGO A;  1O9G A;  1WB7 A;  1PL0 A;  3ZRW B;  2ZR3 A;  3K03 A;  2A0L A;  2ETN A;  4X1Y B;  1SQF A;  2JGD B;  2Y4U A;  1AJQ A;  4JAS A;  1R1B A;  1PNM A;  2QWP B;  2YXY A;  1BSM A;  1ZX3 A;  3AK2 A;  4ICG A;  4G27 B;  4JYA O;  4OX9 O;  3OUF A;  3G6B A;  4F6R A;  4YXW G;  5J2T B;  2UU9 O;  4DR3 O;  2RQ6 A;  1OCC C;  2OT5 A;  2Z3Y A;  1MG1 A;  1FFX B;  1MMM A;  2HP8 A;  3N27 A;  4DUY O;  2CGN A;  3JCU Z;  2BOB C;  5FNV B;  5FPR A;  4MW3 A;  5BR8 B;  1YIT V;  1XQ8 A;  4O2A A;  2H94 A;  1NI8 A;  3E8G A;  1YJ9 V;  1SC5 B;  4IL6 Z;  3KZI Z;  1XMO B;  4MW8 A;  3L75 H;  4U7O A;  1YI2 V;  2ADP A;  4FIP C;  3BAA A;  1TUB A;  3OUS A;  4DR4 O;  2ZXW C;  3J7A U;  3FB6 C;  5KAF Z;  3RYF A;  3DC6 A;  5E79 Z;  4LC1 A;  3OR6 C;  1FXH A;  3Q4H A;  3D3I A;  5JH7 A;  3DXR A;  4RAI A;  5D5P A;  5GON B;  2JEU A;  2D2C B;  3H1I H;  1HNW O;  5HFM A;  3ABM B;  2XAS A;  3BRC A;  1K73 W;  2Q7E A;  3CMA V;  3RT3 C;  1S72 V;  1FFT B;  2QGN A;  1VQ4 V;  1N0N A;  5KMG B;  2DQ3 A;  2XAG A;  5JJJ B;  3SYC A;  2IJH A;  5CB4 B;  1BCC H;  4OXS A;  5IYD O;  2P06 A;  2QWN B;  4J42 A;  4HYO A;  2JEX A;  1BHA A;  1GN2 A;  2EIM B;  4LFB O;  3GWO A;  4UCT A;  4KL1 A;  4EKW A;  1BS3 A;  1XDC A;  2JIZ G;  1KP2 A;  3DGE A;  2HLD G;  3ABL C;  1MZF A;  3K57 A;  3H9V A;  4FMT A;  5C93 A;  1GTO A;  2N04 A;  4RUF A;  2HG5 C;  2WLL A;  4UCV A;  1JJO A;  3BCC H;  1RM1 B;  2BSK A;  4JI1 O;  1SER A;  1AB3 A;  1NQT A;  4J11 A;  2XT9 A;  1JR9 A;  3QO5 A;  1FKA O;  2QKS A;  2MW2 B;  2OYQ A;  2PI5 A;  4WFB V;  3CRC A;  5C8Y B;  4DW1 A;  3WB2 A;  2CTP A;  5ITZ B;  3LDD A;  1R73 A;  4IHJ A;  3ZHT A;  3BHP A;  4UCS A;  4FPP A;  2QTS A;  3ZHV A;  1YF2 A;  1W0K G;  2ZE6 A;  3IFX A;  1M90 W;  1Q8I A;  4DR7 B;  2H3O A;  4IIJ B;  4BIO A;  3K08 A;  1QQC A;  3FX7 A;  2QKA A;  1GM8 A;  4E2L A;  2AGA A;  5LMU B;  3FFQ A;  4DV3 B;  3OGI B;  3S3X A;  3GVM A;  4X65 O;  2VQF B;  1VIB A;  3TJT A;  4JTC B;  3RYI A;  1AJN A;  3BVO A;  1Y74 B;  1UPG A;  2Q7G A;  1XOU A;  4FLV A;  2Q0A A;  1K5Q A;  3E8B A;  2YXL A;  2FL4 A;  2XTA A;  1Y6X A;  2RNB A;  1V55 C;  2B1G A;  1XHZ A;  2UXC O;  1BL8 A;  4F4L A;  4DR7 O;  3FAV A;  4PA3 A;  3CD6 V;  4TV9 A;  1SQB H;  1VF6 C;  5D5Q A;  3J81 N;  2HKO A;  4LBE C;  4B3S B;  2VQE B;  5EYP A;  4QJF B;  1JX9 A;  3CRR A;  1FPO A;  3K0G A;  1T5E A;  2QWQ B;  3ZS8 C;  2LP7 A;  1NR7 A;  3K59 A;  3QVN A;  4O4L B;  2CH7 A;  3MHH C;  2P4V A;  3WB1 A;  1Y4M A;  3A0H Z;  3HKD A;  3QNE A;  4EEQ A;  1QHT A;  2X6B A;  3APO A;  3H01 A;  3RYF B;  3OM3 B;  2YS8 A;  5J9P C;  3E35 A;  3HPL C;  1N32 B;  3DXR B;  2CTQ A;  3CC4 V;  2ZCE A;  4JZG A;  4J80 A;  2P7T C;  2UXN A;  2QM8 A;  5DM6 V;  4KFM A;  3JAK B;  1DF5 A;  3HKC A;  1QU7 A;  1KUQ A;  2N74 A;  4LWS B;  3I5D A;  3CCR V;  4LH7 A;  2AW9 A;  4X1K A;  4O4H B;  4X64 O;  1JA8 A;  3ABK B;  4DK0 A;  2FB5 A;  4ZHQ B;  3PN1 A;  2DWD C;  2HVK C;  3UT5 A;  2M6Y A;  4FM1 A;  2DMX A;  4E4E A;  1QCE A;  5KA6 A;  4FFB A;  4HZ3 A;  2JDI G;  3SYQ A;  3JAW A;  4BIU A;  5BY1 A;  3CRM A;  1OCZ C;  3ICX A;  3LDE A;  1S5H C;  3VBB A;  2KQX A;  4KHP B;  1N33 O;  2EIL B;  1PL4 A;  1ZLZ A;  1RSO B;  5DED A;  1NZ6 A;  4Z2W A;  5A9G A;  3ZN0 A;  4LF5 O;  4LFA B;  3FB5 C;  3HB3 B;  4I7Z B;  3ZMZ A;  3J80 N;  1PD3 A;  3TK1 A;  3TET A;  4JGS A;  2LFS A;  3T1Y O;  2V7Q G;  5LMN B;  5LXT A;  3K0D A;  3JAL B;  4DR2 O;  4WFG A;  5B1B B;  4NXN B;  1QLE B;  5H2F Z;  4GT1 A;  5B3S C;  5FLX N;  3JD0 A;  4NYK A;  5KHJ A;  4LFA O;  4LNU A;  2X7R B;  2GDS A;  4BR6 A;  4UFZ A;  4B3R B;  1ZTE A;  4LF7 O;  2VWK A;  4B3M O;  4H37 A;  3U0Z A;  5H6R A;  3RYI B;  1COW G;  3BY6 A;  3JAR B;  4HBN A;  2HHH O;  3WG7 C;  2Q7H A;  4DRX A;  4OGQ B;  4WFA V;  1EFR G;  2QTO A;  1I94 O;  2UUA O;  2F4V O;  1YSC A;  3FAV B;  4PDM A;  4WFH A;  4O4J B;  1I7F A;  3OTF A;  3ASN C;  1I0H A;  4YY3 O;  4CS2 A;  2EJ7 A;  2LJ2 A;  2AXT Z;  1FJG B;  1URF A;  1L0N H;  3R65 A;  3F7Y C;  4MT8 A;  1Z5W A;  1D5N A;  3ASO B;  1KC8 W;  2YEV B;  1P7B A;  4GKK O;  1K8A W;  4JI8 O;  1H2N A;  3HKD B;  1SZX A;  3ZRV A;  2IH1 C;  3JSL A;  2ZE8 A;  2DYS C;  3K79 A;  1XL6 A;  2Y0I A;  1H8E G;  3JD1 A;  3JD3 A;  4PA7 A;  1GN4 A;  3CXC U;  4BWA A;  4PV1 B;  1MAB G;  1M57 C;  3B40 A;  1OCC B;  3LSQ A;  3LSU A;  5B1A B;  1VF6 A;  5L3B A;  2FKX A;  4TT3 G;  4X88 A;  3T1C A;  1BQ0 A;  4J7K A;  1IBK B;  1N34 O;  1SQV H;  1PKX A;  3EXA A;  4DK1 A;  4A5U B;  4FZ0 A;  1G8M A;  1O9H A;  2NLJ C;  4X1K B;  3MD0 A;  4NXM O;  1WP8 A;  2OTJ V;  1WB8 A;  5EBW C;  3HKB A;  1XMQ B;  3E22 A;  3ZBH A;  3CS5 A;  3CC2 V;  3JAT A;  3ABT A;  4U7N A;  2ZXW B;  4UVA A;  3EHB B;  4UUJ C;  3WU2 Z;  3RVY A;  4JZ2 A;  2VWJ A;  1NVP D;  3WB0 A;  1OJH A;  4NR1 A;  3RYH B;  1Z5V A;  5EBM C;  3UO3 A;  1HNZ B;  5KHH A;  1K97 A;  3BEH A;  4QE9 A;  1YJW V;  3B2E E;  3OEH G;  3TGU H;  1PNL A;  1H2M A;  1OCO B;  3CE2 A;  1YVW A;  1XMQ O;  1SRY A;  2QDO A;  2UXB B;  4I50 A;  3E2E A;  1JFF B;  4DV2 O;  3THO A;  1TVK A;  2Y69 B;  5EC1 C;  2ZD9 A;  3CCV V;  5EIB C;  4GKJ B;  2WA3 A;  4CH4 A;  1QLN A;  2P4K A;  1IDS A;  1GK9 A;  2W0F C;  3W7S A;  4I9Q A;  5LXT B;  3VQY A;  2Z5U A;  4NB5 A;  4AIL C;  1WA8 B;  2Q67 A;  5IJ0 A;  1HW7 A;  3OMA B;  1J5E O;  5LA6 B;  1IBL O;  2YIA A;  1Y66 A;  1ORQ C;  5GW7 A;  5E1A C;  2ZKO A;  4JYA B;  1NTM H;  4L87 A;  4OX9 B;  3VQW A;  2XAH A;  2UU9 B;  4LNU B;  4DR3 B;  3MHS C;  4WF9 V;  3ETQ A;  3AK1 A;  1CEZ A;  3BFR A;  4NTX A;  4DUY B;  2PYL A;  2X0L A;  4Z1V A;  5CBG A;  3T4D A;  2XAQ A;  4TUY B;  4YIP A;  4UB8 Z;  4DUZ B;  4G28 B;  1VF5 B;  1YIJ V;  2ZE7 A;  1QBZ A;  5DN6 G;  3ZHR A;  1AR1 B;  3OGC C;  1W59 A;  1WPB A;  1X4T A;  4DR4 B;  5FPO A;  4UCU A;  5KLV H;  3DSQ A;  2Q68 A;  4JI4 O;  3L9D A;  1NR1 A;  3STZ C;  4LCU C;  4FZ1 A;  3RGB A;  1BMF G;  1HNW B;  3ZN1 A;  2WLK A;  2ZDI C;  4JI0 B;  4FLZ A;  1PM9 A;  2FYU H;  4DUZ O;  1OCR C;  1UJW B;  3K9S A;  3ETG A;  1US6 A;  2Q4P A;  2OIG A;  2PZS A;  1V55 B;  4H13 B;  1VEW A;  3JAS B;  3P3P A;  3ABU A;  3CCQ V;  3GWK C;  4H33 A;  3K5M A;  3QO7 A;  1V9P A;  3OE7 G;  4LF4 O;  4LFB B;  4I0X A;  1KKD A;  3O9O A;  1D5A A;  5KAI Z;  3JD2 A;  5IY5 C;  5CBF A;  2FML A;  1V54 C;  1KEC A;  3UKM A;  4FM0 A;  4JI0 O;  2F66 C;  1LNQ A;  4X20 A;  2VRZ A;  3D36 C;  3HKB B;  2ATK C;  4NKG B;  3E22 B;  4JI1 B;  3E86 A;  2IJJ A;  3JAT B;  4GX0 A;  1G6U A;  5JQG A;  4DV5 O;  3CP1 A;  3AG3 C;  3H1J H;  2Q73 A;  2JGU A;  1KYO F;  2WLI A;  1JVM A;  4CS4 A;  3S3W A;  1WJZ A;  4MVQ A;  1RPO A;  2DOS A;  4FM2 A;  5IYZ B;  4D6T H;  1ZWI C;  1SKV A;  3H1H H;  4PI2 A;  1Q90 D;  2VS0 A;  1B3Q A;  3P32 A;  4HNA A;  4I9W A;  2EIK B;  2BTO A;  4U3J A;  3RVZ A;  3SJB C;  4YJ2 B;  5LL6 Y;  1VQL V;  4B3T O;  4GX1 A;  2OCC C;  3SYA A;  4YHH O;  1WN7 A;  4X65 B;  3TCU A;  3K3W A;  2YSU B;  2IW5 A;  4ZOL A;  2IM9 A;  5K1P A;  5LBQ A;  1EZJ A;  4LF8 O;  1U96 A;  3LUT B;  3B09 A;  1OCZ B;  2AZ2 A;  4JYB A;  3RW0 A;  5JJN B;  1VQ9 V;  2OWO A;  2LW7 A;  1X59 A;  3T2M A;  2UXC B;  1M56 C;  4Z1M G;  3OFN G;  4KUM A;  1IBM B;  5B5E Z;  1PV0 A;  1LR1 A;  1EBO A;  4LF9 B;  3QTC A;  5K1X A;  3OMN B;  1K34 A;  1TA8 A;  4I55 A;  1K5S A;  3BA8 A;  1NT2 B;  4FJC C;  3AG1 B;  4AQY O;  1H2L A;  5CA0 A;  1OZ0 A;  4GX2 A;  1QVG U;  5LYJ A;  2A3Q A;  1K33 A;  4QGP A;  2HEP A;  4N23 A;  4CH6 A;  3FKS G;  1M93 A;  2Q8V A;  1XI1 A;  3SPH A;  2A79 B;  2ZNI A;  4F6R B;  3EFF K;  1IBM O;  1NTK H;  4LF9 O;  3F5W C;  4JYY A;  3N2K A;  4EFB A;  4QNH B;  3CB2 A;  4O2A B;  5B1N A;  5LHH A;  4LFC O;  1KMI Z;  3L71 H;  4PA9 A;  1W2B U;  4X64 B;  1TUE B;  1W0J G;  2XAJ A;  1TUB B;  2GTS A;  1K9M W;  1THZ A;  2Q6A A;  2EZO A;  1A32 A;  2DQ0 A;  1UFI A;  3Q4H B;  2W0X A;  4WBN A;  5JH7 B;  1YDX A;  5H6Q A;  3ASN B;  4O4I A;  5IYB O;  2ZT9 B;  4UCO A;  1VQ7 V;  3CRA A;  2PI4 A;  4MVZ A;  2CUG A;  1S5J A;  4QPK A;  3DC5 A;  2EZP A;  4DV4 O;  2R9I A;  2QSA A;  4QPJ A;  2P22 C;  2ZDI A;  2OTL V;  1D2D A;  3C3S A;  2EIN B;  2EIM C;  2UUB O;  2JJ2 G;  1N33 B;  3W7T A;  1XNR B;  2DYS B;  3SR2 C;  5JQG B;  3CCM V;  2GTA A;  2K9P A;  1XRE A;  2PTM A;  1ZUQ A;  4LF5 B;  3M8A A;  2WLI B;  2Q0O C;  4DXW A;  1B6Q A;  2DW4 A;  1M57 B;  3RBZ A;  2B9Z A;  4XDK A;  2L6L A;  3T1Y B;  2ARH A;  1XEQ A;  4IT5 A;  4DR6 O;  3CXH F;  2LFR A;  4DR2 B;  3ZED A;  2DYR B;  3NR7 A;  3U10 A;  4RO2 A;  2WLL B;  2BSK B;  5EIB D;  3D36 A;  4RQE A;  2Y4T A;  4BIZ A;  4G2K A;  1XNR O;  4YIO A;  4DV7 O;  1QR8 A;  4U3J B;  3MDS A;  3AG4 B;  4J9Z B;  1AP5 A;  1P49 A;  2E5L O;  5BXZ A;  1R6N A;  1PP9 H;  4NTW A;  3W7W A;  1GO3 F;  1I08 A;  3UQ8 A;  2WWW A;  2WSS G;  1Q6I A;  4ZI7 A;  4LF7 B;  4ZOL B;  4UVB A;  4B3M B;  4IHJ B;  1XNQ O;  1LUV A;  1N0J A;  3UM7 A;  4BW9 A;  4UXN A;  1SQG A;  3C90 A;  2HHH B;  3A8T A;  3K58 A;  4O2B A;  5IWA O;  1CPY A;  1R6K A;  1I94 B;  2UUA B;  1P7G A;  4NTY A;  4JI3 O;  2F4V B;  1H8H G;  1KD1 W;  3SPI A;  4KP4 A;  1YTF D;  4GX5 A;  4F6E A;  1IZ3 A;  4FLY A;  1AI7 A;  1DF4 A;  3JYC A;  4YY3 B;  4EB6 A;  2F95 B;  4N21 A;  4X66 O;  3AG2 B;  4UV8 A;  4DV6 O;  3ZHU A;  1MSD A;  2KG7 A;  3K9A A;  5J2U A;  4XDJ A;  1S77 D;  5LYJ B;  1Q82 W;  4GKK B;  1ZAU A;  4JI8 B;  2NR5 A;  1ROP A;  1NU1 H;  1LUW A;  5LP6 C;  4JI6 O;  2HJF C;  1L1F A;  3KCX A;  4I5S A;  3OD4 A;  4DV0 O;  3PJS K;  1GM9 A;  2HJD A;  4TV9 B;  4FFK A;  3X2Q B;  1Q81 W;  3RWR D;  2W6J G;  3ZRW A;  2O57 A;  1NH2 D;  4X89 A;  1CXZ B;  4JV5 O;  3CWB H;  4X1Y A;  1XBL A;  5EYP B;  3I56 V;  1HP8 A;  3N2K B;  1F4N A;  2F1M A;  2LQT A;  1VP7 A;  1N34 B;  1VF7 A;  3G80 A;  3CYO A;  1Q43 A;  3A0B Z;  1S76 D;  1N36 O;  4NXM B;  2CH7 B;  2YDE A;  1KU9 A;  2JK5 C;  2ZIO A;  2WLJ A;  2LO1 A;  1RFY A;  3W7X A;  1M9N A;  4PJ0 Z;  1F7Y A;  1H38 A;  1JQ0 A;  5FNV A;  5TIS Z;  2ODM A;  1HDJ A;  4WBN B;  5H9C A;  3P3N A;  2ZM6 O;  2R70 A;  3QO8 A;  1Q86 W;  3ABK C;  2JVD A;  5LOV A;  2WLH A;  1Y67 A;  2EUL A;  3HKC B;  2PF4 E;  1QVF U;  3K5L A;  4PDV A;  2ITC C;  1KP3 A;  4JTD B;  1S5L Z;  5L3E A;  4WFF A;  1FYJ A;  1QR9 A;  4CBC A;  1R3K C;  1BZK A;  1OCR B;  2B5U A;  2PY5 A;  1YZB A;  2EX3 A;  1XHX A;  1U97 A;  3B8N A;  3UT5 B;  1JPX A;  4DV2 B;  5JCO C;  2ITD C;  1CP9 A;  1HWY A;  4K0K O;  3BA9 A;  2EIL C;  1YCI A;  1M1K W;  3CSX A;  4FFB B;  1VQ5 V;  3LSS A;  5CB4 A;  2X6C A;  5EC2 C;  3JAW B;  4K35 A;  3SJQ C;  3RN4 A;  2WLN A;  2LGQ A;  2X6A A;  3OAA G;  1J5E B;  1IBL B;  2XND G;  3GB7 C;  1B06 A;  1BGY H;  2H8P C;  3CHX A;  4MVM A;  5EK0 A;  3FD9 A;  1HNX O;  4DW0 A;  2XHB A;  1TAE A;  3SPG A;  4LF6 O;  3AG3 B;  5B1B C;  4MVO A;  1QLE C;  1EN5 A;  1ARO P;  2RDC A;  2CAZ C;  4AI8 A;  2R72 A;  2XAF A;  4JI2 O;  3IJ4 A;  4PDR A;  1NVP B;  4DR1 O;  2CDY A;  4QE7 A;  2YI8 A;  3AK3 A;  2MK3 A;  3ABL B;  3OR7 C;  4O2B B;  1F23 A;  1DGS A;  1JMK C;  1WPX A;  4LP8 A;  5C8Y A;  5LHI A;  3FB7 C;  3ZMS A;  1Y76 A;  5EZY A;  3ZCC A;  4DV1 O;  3H1K H;  5ITZ A;  4DR5 O;  4JI4 B;  4EB6 B;  2DN9 A;  4C7U A;  1BHB A;  1EN4 A;  4OPA A;  2EBO A;  2IU0 A;  4ABM A;  3UO2 A;  4CC6 A;  2HFE C;  4J10 A;  2OCC B;  2KG7 B;  1JCH A;  4W4K A;  4X9Q A;  3UCS C;  1K92 A;  2L35 A;  4PHZ A;  1EN6 A;  4JYC A;  3SPJ A;  4CZZ A;  1SZT A;  1XL4 A;  4DRX B;  3IAY A;  1DLB A;  3IGA C;  4JAU A;  2YIB A;  2RMK B;  1I5Y A;  3ASO C;  3ZHQ A;  2QWR B;  4ZKI A;  1M56 B;  4FK5 C;  1VQO V;  2JS5 A;  3OTO O;  1SQQ H;  3SYO A;  4LF4 B;  1Y74 A;  2YIC A;  4K3A A;  2ZNJ A;  4I4T A;  5FL7 G;  4GLX A;  4JI7 B;  1R3I C;  1N8R W;  4J9Y B;  5B1O A;  3CME V;  5B1A C;  3KCY A;  3G71 V;  2JJ1 G;  3K04 A;  4NVP A;  2ZIM A;  5LP6 A;  1Q7Y W;  3CRQ A;  1PNK A;  3HR0 A;  5CMU A;  4DV5 B;  2RN9 A;  2BE3 A;  3BAB A;  4MTO A;  4DO2 A;  3OMI B;  2W6I G;  1ZL8 A;  4O4L A;  5LOV B;  1IXB A;  2KKW A;  4RWU A;  4UB6 Z;  2KSD A;  4TQD A;  2YUA A;  1VQP V;  4JI7 O;  4R7C A;  1FXK C;  4CC5 A;  3VOU A;  3OT7 A;  5GTH Z;  4X8A A;  1S0V A;  1Z2G A;  4X1I A;  3H1L H;  2CTR A;  4LH6 A;  1OV9 A;  5B66 Z;  1GKF A;  4AHC A;  5KHI A;  3M99 B;  5BR8 O;  4PD4 F;  3JAK A;  4IGG A;  3OW2 U;  3B8M A;  4LWS A;  2EIJ C;  3CCL V;  1XMO O;  4B3T B;  1MNG A;  2IH3 C;  1AR4 A;  1GN6 A;  1YHQ V;  1OCO C;  2WLM A;  4FLW A;  3CCE V;  4O4H A;  2E3C A;  4ASU G;  3EVK A;  4YHH B;  3CC7 V;  2Y48 A;  1SES A;  3M7M X;  4ZHQ A;  2E75 B;  3U11 A;  1VAR A;  2UUC B;  2GUZ A;  3E83 A;  3LNN A;  2Y69 C;  4LF8 B;  2DWE C;  2GV9 A;  4JF3 A;  3HKE A;  4XBF A;  1K7D A;  4UV9 A;  1R3J C;  2ADQ B;  3B77 A;  4I50 B;  4MTF A;  1TVK B;  3VQV A;  1MA1 A;  1NBM G;  3TXS A;  2BCC H;  5L3G A;  3CCU V;  4ZBM A;  2GHY A;  5JCO A;  4TWK A;  1BT8 A;  2WAM A;  4MTG A;  3SGI A;  4H44 B;  1VQN V;  3BPZ A;  2YIB D;  3C3T A;  4AQY B;  2UUC O;  1VQ6 V;  1AP6 A;  1RSO A;  3JD4 A;  4MTX A;  1Q5O A;  4Q6G A;  5IJ0 B;  1YJN V;  2GSM B;  1J95 A;  5KX5 A;  3D3Q A;  4FLT A;  1Y76 B;  5EZY B;  2ZR2 A;  3RFR A;  1AI5 A;  4R50 A;  1WNS A;  5CBH A;  4RQF A;  4EFE A;  4X62 B;  5CN0 A;  3JAL A;  2F43 G;  3QF7 A;  5EBL C;  4LFC B;  2C2A A;  4MVU A;  4PEL A;  5F2V O;  3SYP A;  1K4D C;  2QM4 A;  1H2S B;  1FXV A;  4JAA A;  5B3S B;  2QA4 V;  4DYL A;  2ILM A;  4P9O A;  4X62 O;  2XUM A;  1Q6U A;  1VQM V;  1R3L C;  3K06 A;  2IU3 A;  3JAR A;  4MVS A;  3ZMU A;  3MAQ A;  2R9A A;  1VQ8 V;  4J41 A;  5JWP A;  2HR3 A;  1WLE A;  4PDL A;  1IVS A;  4I4T B;  1F51 A;  1M4U A;  3I55 V;  1GAX A;  3ETE A;  3ZX6 A;  4GCZ A;  3KG2 A;  3L70 H;  4BAY A;  4DV4 B;  2WA4 A;  4O4J A;  1GM7 A;  1GN3 A;  1N4C A;  2P6J A;  3WG7 B;  2UUB B;  5IE9 A;  2V4D A;  5LMU O;  4DV3 O;  2LGW A;  2NNU A;  3ABM C;  3A0R A;  3ZIA G;  5LP6 B;  4K8X A;  1ENV A;  2VQF O;  5GTI Z;  1RPR A;  3CX5 F;  1B04 A;  3ETD A;  5AG2 A;  2YEV A;  3ZJZ A;  1ZL8 B;  2AZ0 A;  1L8D A;  4I0X B;  4WCE V;  2GBO A;  3G6E V;  3AG7 A;  3JCZ A;  4GZR B;  4DR6 B;  4X1I B;  3N2G A;  4X20 B;  3KKY A;  1EZV H;  3O65 A;  5CA1 A;  3T4Z A;  4B3S O;  4OPH A;  2VQE O;  1IX9 A;  4R6Z A;  1DTO A;  5JVD A;  3AEI A;  4DV7 B;  1JOY A;  2N05 A;  3FYE B;  1XIL A;  5BMV A;  4TSF G;  4IYI A;  1DK1 A;  4RUE A;  4CS3 A;  3F7V C;  4BW5 A;  5BZB A;  2E5L B;  3LDC A;  1S3J A;  4FLX A;  2QEX V;  1F4M A;  1Q6H A;  1RM1 C;  3SJA C;  5KHK A;  2QM7 A;  2JRI A;  1BQZ A;  5HFL A;  1SQP H;  2CTW A;  3FYI B;  2EIK C;  4L8J A;  2GUZ B;  1XNQ B;  4K8Z A;  4R8C A;  4B08 A;  3HKE B;  1N32 O;  1FXK A;  4MS2 A;  2A7W A;  3WFV A;  5IWA B;  2BTQ A;  1MSW D;  3RYH A;  2UXX A;  1MOF A;  4HNA B;  5KHG A;  4FLU A;  4JI3 B;  1SA0 A;  2P67 A;  2F93 B;  5L3F A;  2E76 B;  4D7S A;  1SF9 A;  1YEW A;  2Z0A A;  1KBH A;  1E79 G;  1BE3 H;  3G4S V;  3TXQ A;  4X66 B;  4J7J A;  1IXM A;  3IC9 A;  4DV6 B;  2Q5Z A;  3SDL A;  2ZQM A;  2RCV A;  2PYJ A;  3JAM N;  3P30 A;  3RYC A;  3E8H A;  1JFF A;  3K5O A;  2QWO B;  5LGT A;  4JI6 B;  4FVM A;  5KX5 B;  1YXB A;  1R6T A;  4TV8 A;  4CH3 A;  4DV0 B;  3AG1 C;  1AIL A;  2KB1 A;  4P2Z A;  4YJ3 A;  1AVM A;  2IJI A;  1AI4 A;  4B7E A;  4JV5 B;  1NS1 A;  1E1R G;  4ZIB A;  2HVJ C;  1WA8 A;  3OEE G;  4KHP O;  4I55 B;  4GYC B;  3LNM B;  5H5N A;  5LA6 A;  2BOC C;  1PPJ H;  1NJI W;  5CA0 B;  2YID A;  1N36 B;  2Q69 A;  2P5O A;  2QE7 G;  1VQK V;  4JAV A;  4KXR A;  5IJ9 A;  4QIW F;  1K3E A;  3CJH A;  2D3O W;  4Q20 A;  2CK3 G;  1NTZ H;  5LMN O;  2ZIN A;  1OHH G;  5LGU A;  2ZM6 B;  2LW1 A;  4HAM A;  3APQ A;  2A06 H;  4TUY A;  2JGD A;  1K4C C;  1IUR A;  2WPD G;  4W4L A;  4NXN O;  3ML0 A;  1MZE A;  1AI6 A;  1YTF B;  4JI5 B;  3ZMT A;  4JTA B;  3VQX A;  1I5X A;  3F5T A;  3E89 A;  5J2T A;  1KQS U;  4UVC A;  1P4R A;  2B1I A;  1FFX A;  3IC7 A;  1KKC A;  1H2G A;  3ZRS A;  3NXS A;  1P84 F;  4B3R O;  5JJE B;  2DJV A;  2YXH A;  1SQX H; 
#chains in the Genus database with same CATH homology
 2AZ0 A;  4I0X A;  3O9O A;  4I0X B;  2DE0 X;  3FAV B;  3OGI B;  2VS0 A;  3FAV A;  4ABM A;  4LWS A;  3GVM A;  4LWS B;  1WA8 A;  1WA8 B;  3FD9 A;  2KG7 B;  2KG7 A;  4GZR B;  2B9Z A;  2AZ2 A;  3TXS A;  2VRZ A;  3HR0 A;  3Q4H A;  3Q4H B;  3TXQ A;  3GWK C;  3ZBH A;  3G80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...