3G80A

Nodamura virus protein b2, rna-binding domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
SCAYELIKSLPAKLEQLAQETQATIQTLMIADPNVNKDLRAFCEFLTVQHQRAYRATNSLLIKPRVAAALRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein B2
publication title Structure of the RNA-Binding Domain of Nodamura Virus Protein B2, a Suppressor of RNA Interference.
pubmed doi rcsb
source organism Nodamura virus
molecule tags Viral protein
total genus 28
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3g80A00
2AZ0A 3O9OA 3ZBHA 2KG7A 3GWKC 4I0XB 3FD9A 2VS0A 4LWSB 3TXQA 3FAVA 4ABMA 3GVMA 3Q4HA 2KG7B 1WA8A 3G80A 2AZ2A 2DE0X 2VRZA 3FAVB 4GZRB 3Q4HB 3TXSA 4I0XA 2B9ZA 1WA8B 4LWSA 3HR0A 3OGIB
chains in the Genus database with same CATH superfamily
3J80N 2PYJA 2CE4A 2MK3A 3A0BZ 4I55A 3K79A 1EFRG 1VQKV 1SQPH 1N33B 1WA8A 1HNWB 3JSNA 2VRZA 3JCUZ 3ML0A 3CHXA 1LR1A 3JAKA 1LNQA 4P9PA 5JWPA 2DWEC 4GKKB 2PI5A 2EINC 2DQ0A 1K5QA 5CMUA 3BRCA 1M56C 2ZINA 2GUZA 4X1KB 4D7TA 2YEVA 4G27B 5IY5B 5D5QA 4JI5O 3OUSA 4I0XA 3OEEG 4RUFA 2GTAA 3SPCA 1S72V 4LF9O 3ABMC 1YZBA 2AW9A 1NU1H 4LH6A 3OTOO 5LGTA 1R6NA 1MG1A 2QTSA 4LF4B 2WLKA 2V4DA 4H0LB 4DYLA 2CTRA 2N74A 3CRAA 5KX5A 4PHZA 4DV6O 4XDKA 1PKXA 4FLVA 3JSLA 5LOVA 4BIUA 1JQ0A 4O4JB 4W4KA 4PI0A 4CH3A 1YDXA 1VQ6V 1JVMA 4PA3A 3WG7B 4O4HA 1NT2B 5KUMA 1H8HG 1GH6A 4U7NA 2MW2B 4NYKA 4UCVA 1QBZA 3S3WA 1HW7A 3O65A 1AP6A 4LWSB 1XHZA 3B8NA 4GKJO 2F1MA 4GYCB 4JI5B 3CPWU 3G80A 1NTZH 2O57A 4I7ZB 4X62O 4LF9B 3T1CA 3SYOA 2Y4UA 4WFFA 3ETGA 4F6RA 4U3JB 4E2LA 3C3SA 4JYYA 3OTOB 2R72A 2IJIA 4X66O 2RCVA 2YUAA 1RSOB 3CEIA 3TK1A 5B3SC 4KUMA 5GTHZ 3DC6A 1ZX3A 1GTOA 2DWDC 4RO2A 1RPRA 4CC5A 2L35A 2FL4A 2QWRB 3R66A 3AG7A 4PDVA 4DV6B 2CAZC 1XMOO 5B1BC 1FFXA 3BAAA 5IYBO 3ABLB 1UJWB 1N32O 2OCHA 2N05A 5J9PC 2OWOA 4O4LB 5K1XA 2EIMC 1H2SB 2UUAO 2WLIA 4NVPA 4TSFG 2Q67A 1KP3A 2ARHA 3D8CA 4GZRB 4JPRA 2XT9A 1EM1A 1EZJA 4TWKA 4GKJB 3P3NA 3ZEDA 3RW0A 2F66C 1Q6HA 2PI4A 2YICA 1GMGA 3RYIA 2DMXA 5IYCO 4X62B 1WPXA 2N04A 4K8ZA 1Q86W 2P7TC 1I94O 1PNLA 3FFQA 1CPYA 1F23A 2HR3A 2X7RB 1NQTA 3A2FA 3AG1C 4H44B 3WB2A 1YTFD 2YIDA 4PDLA 4X66B 2M6YA 2FTKA 1GAXA 3UT5B 3RYHB 2QTOA 4UCOA 2Z5UA 2YC0A 2ADPA 4JAUA 1XMOB 4GCZA 4I55B 5BMVA 4JTAB 4CH4A 1N32B 3CD6V 2HVKC 5LXTA 4IYHA 4UV8A 3SYAA 2CTPA 2Q7HA 1IBKO 5CA1B 2ZD9A 3FD9A 2YSUB 1PNMA 3FKSG 4FFBA 5EBLC 1P49A 4C7UA 5F2VO 3E83A 1Q6IA 4JI4O 5IY5C 3L72H 4R8CA 3ZMVA 3CWBH 3EXAA 4ZI7A 2Q4PA 2IH3C 4DR1O 1BQZA 3VQWA 1Q82W 3T4ZA 3TXQA 2QEXV 2ITCC 1CXZB 4AILC 1H8EG 5KLVH 1I94B 2EULA 1YTFB 4G28B 2RMKB 2X0LA 4MVMA 1IVSA 1P7BA 5EIBD 2W6JG 1E1QG 1UFIA 5K1PA 2DW4A 2FYUH 4JAVA 1AILA 2HFEC 1Q90D 2UXXA 1AVMA 3H1LH 3LUTB 1Y4MA 2LW7A 1QR9A 2DQ3A 1PNKA 4BAYA 1VQNV 2P67A 3CRRA 2D2CB 5LOVB 1FXVA 4YJ2B 1EN6A 2QKAA 3TGUH 3HKDA 4KHPO 2JIZG 2DE0X 3LSQA 4XDLA 3WG7C 4A5UB 1IBKB 3RYFB 3CS5A 1IBMO 4O4HB 2EZOA 1EZVH 2RJZA 1JJ2U 1XEQA 1QLNA 3GVMA 3L75H 1FS0G 1GM9A 3L74H 5H6QA 1HWYA 4JI4B 1PL4A 3JAMN 2XAJA 2EJ7A 2IJJA 2CGNA 4DW0A 5IYDO 2EIJC 2UXCO 4DR1B 3K9AA 3ZRSA 2ZKOA 4UCSA 1L8DA 1L1FA 3L71H 2WLLB 1LUWA 1KB9F 1ZLZA 4NXNO 1M9NA 1Y67A 4FLXA 1K7DA 4FMTA 3ZHQA 4FZ0A 1Q7YW 1K5SA 3ZCCA 3UCSC 4EFEA 3HKCB 4X88A 4F4LA 4JI8O 1SZTA 1AR4A 4NKGB 4UCRA 2OYQA 4MVOA 4X1KA 1ZWIC 4U3FH 4FM2A 2Q0AA 4JI7O 5IJ0A 3JD1A 1VQ8V 1AP5A 2B1IA 2RN9A 4KHPB 1H2KA 3QVNA 5GW7A 4FFKA 2X6CA 2ZXWB 3RGBA 4D6TH 2Q69A 2WLIB 3OAAG 2F43G 4GT1A 1NR7A 3VQVA 2LP7A 2IM9A 3AG4C 1ENVA 5KHJA 1DF5A 4GX1A 5A9GA 2R70A 3G4SV 4GLXA 4D7SA 1U97A 3HPLC 1BE3H 1OJHA 4IHJA 1NBMG 2BCCH 2QR4A 3QTCA 1MNGA 1R6KA 3RYIB 2YS8A 2B9ZA 4J9YB 3LNNA 2UU9O 5BZBA 2P06A 3OMNB 1NKDA 4NXNB 4P9OA 2BOCC 3CRCA 5L3GA 1WAZA 3K9SA 1JOYA 4JI8B 4NTYA 1VQOV 3LNMB 5ITZA 1R3IC 2QSAA 4LWSA 4X64O 1RP3B 2LO1A 1FKAO 4UV9A 1XOUA 3STZC 4JI7B 3ASOB 5BMVB 5B1AB 1JX9A 3UM7A 4JI1O 1KUQA 1K4CC 1K8AW 2L6LA 2QWQB 3APOA 4I50A 5A2QN 3NR7A 2W0XA 2ATKC 4WFEA 3TCUA 1GN3A 1F4MA 4DR3O 4CS2A 1Z5VA 1RSOA 3WB1A 1XUQA 2PTMA 2CH7A 1AI6A 1G8MA 2VQEO 4UVCA 1THZA 1NTKH 4DW1A 2XUMA 4TV9B 4ZI7B 3CJHB 4RAIA 1OCRB 4UVAA 1VP7A 4DV1O 1R3JC 2PGGA 2ZDIA 3H1HH 5JH7B 2UU9B 5IT9N 5IE9A 5CB4A 3D3QA 4LF5B 4MW8A 4DUYO 3BFRA 3K06A 1I08A 1JCHA 4DV4O 1R3LC 3ETQA 3X2QB 4FPPA 1NTMH 1WN7A 2IJKA 2OIEA 4X64B 2HLDG 1FFTB 5CBHA 1TVKA 1GN6A 4NB5A 1JA8A 2WA4A 3JATA 3RBZA 2F23A 1J5EB 1I5YA 3E8FA 3FYEB 4JI1B 1T5EA 3QO8A 1TGOA 4GUNA 4J7JA 1VIBA 1KYOF 1L0NH 3SDLA 4DR3B 2XOKG 2CUGA 3ZMZA 1M90W 2JDIG 2WA3A 2VQEB 4JI3B 3O9OA 5CBFA 3K08A 4I9WA 4DV1B 1D5AA 2QA4V 3OT7A 3N2GB 4IT5A 3BABA 5EIBC 2ZQMA 5CA1A 1R1BA 1RM1C 5JVDB 4DUYB 4NXMO 1S5JA 2NNUA 4DV4B 2YI8A 2P22C 4XBFA 4J11A 4JTCB 2RQ6A 4YIOA 1KECA 5H2FZ 3E22B 4I9QA 5LYJA 2HG5C 5EYPA 2JGDA 4KXRA 2V7QG 5IJ0B 2P6JA 4MSWC 4DV0O 4MVUA 1PL0A 4EEQA 2KKWA 4X1IA 3R65A 2KB1A 1QHTA 3KG2A 2UXNA 3ASNB 1E79G 5LA6B 3W7UA 2YXLA 1COWG 3LDDA 3CCUV 4JASA 3OUFA 1V55B 1YITV 2DYRB 4AHCA 4B7EA 4WFGA 3CP1A 5D5PA 2QM7A 1KP2A 2JEUA 1GN2A 4IHJB 2Y69B 2IU0A 2PYLA 4YJ2A 3QF7A 4RQFA 4IL6Z 3SPGA 4JTDB 3RYFA 3ZHTA 4DR7O 4LR3A 1AR5A 1ORQC 4UCTA 4WCEV 2AXTZ 4BIZA 3ZRXA 2WLJA 4NXMB 1R3KC 2DOSA 5LP6A 5H5NA 4KP4A 4PA9A 3F5TA 3ZRWB 3WFVA 1W0KG 3T1HO 3DC5A 4I5SA 3ASOC 5ITZB 5B1AC 3ABKB 2OCCB 2XAFA 3G67A 4PDMA 5KMGB 4UVBA 2H94A 1YJWV 1ZL8A 5GONA 4DV0B 3CRQA 4FZ1A 3K03A 4K8XA 4IIJB 2WLLA 4LF7O 4I50B 2Q68A 3N27A 1XQ8A 2XNDG 4MTGA 2C2AA 2R9AA 1M4UA 1SETA 1VF6A 4ICGA 4B08A 1K34A 3K59A 1N0JA 1G6UA 3HKCA 2CH7B 1GM7A 4FLTA 1OCRC 1Q5OA 4BW5A 1BHBA 1WPBA 5JQGB 2LGQA 2BOBC 1S0VA 1CEZA 1N8RW 1V9PA 3OMAB 4JF3A 4WBNA 1IURA 4BWAA 4DR7B 5CB4B 4JZ2A 3AG2B 1I7FA 4CBCA 3BVOA 4JGSA 4MVQA 3BPZA 3X2QC 3CE2A 1N36O 5E1AC 4DR4O 1NVPD 1KKDA 1US6A 3SJCC 3T1HB 5DM6V 1JPXA 1K9MW 4CZZA 1AB3A 1QNMA 1XHXA 1EN4A 1TVKB 1GRJA 5JJEB 3DSQA 3BCCH 3JATB 4X9QA 3ZX6A 5L3FA 3OD4A 3K5NA 3CSXA 3SPHA 4LFBO 2FKXA 2DYSB 4LF7B 4UB6Z 4FJCC 4ASUG 1BHAA 3K57A 4MT8A 4X1YB 4O2BB 4JYAO 4L87A 2QGNA 3P3PA 3BA9A 3RYCB 1YCIA 4QPKA 1QLEB 1YEWA 1I5XA 2QKCA 3VOUA 5FNVB 4J9ZB 4LFAO 3F7YC 5L3CA 3CCJV 4TT3G 1SZXA 1Q6UA 2HEPA 2ZIOA 1XMQO 3K58A 1SQGA 2G38A 3LDEA 3FAVA 1F7YA 1N36B 1NVPB 4DR4B 1NZ6A 3LSSA 2JGUA 2H3OA 4ZKIA 4FM1A 3MAQA 1NR1A 2EBOA 4K0KO 4YIPA 3L73H 1KBHA 1SQXH 5LYJB 3JASB 1WB8A 2AHZA 4TV9A 5EYPB 2JGDB 3CJHA 5LHHA 3OTFA 3W7WA 1VEWA 1G1XB 1X59A 3ABTA 5JH7A 2LJ2A 3ASNC 4X1IB 4LFBB 1FXKA 1KQSU 3G6EV 4H37A 4FIPC 3M99B 1VQMV 4EB6A 4R7CA 2Q6AA 1VF7A 4JYAB 2BE3A 2BSKA 2Y69C 4J10A 4LF8O 1ZTEA 4LFAB 3CCQV 5KUKA 2Z0AA 4GX5A 3OMIB 2AZ2A 4WF9V 2CTWA 2LW1A 1XMQB 1Y66A 3CC2V 4MS2A 3UQ8A 5J2UA 4HNAA 4B7KA 1MABG 4PI2A 1NS1A 5LP6B 1BCCH 3SYPA 3ABKC 4FVMA 2OCCC 5E79Z 1FD9A 3U0ZA 5C93A 4K0KB 3MHHC 1YVWA 2IBZH 1QCEA 4AQYO 4PA4A 1ZL8B 4ZBMA 5GONB 1IXBA 4X65O 3OW2U 4FLWA 3K3WA 3N2GA 1CP9A 4J42A 1AJQA 3BA8A 5DEDA 3PJSK 3HKEB 5JVDA 4DV3O 3MD0A 4TV8A 4GX0A 4FLUA 1VQ9V 4P2ZA 4PDRA 3ZMUA 4UFZA 4F6EA 3VBBA 4UXNA 3SJAC 2Q9LA 3ABLC 1MSWD 3SYQA 3UO3A 4LF8B 3E22A 1TUBB 2ZDIC 4CS4A 4WBNB 3W7TA 1S5HC 5EC2C 3AG2C 2ZE5A 2Q73A 3VQYA 3OE7G 3G6BA 3IAYA 2WLNA 2YXHA 1MZEA 1K3EA 3SGIA 4RWUA 1H2MA 5LA6A 1PM9A 3K0DA 2XAHA 1ZUQA 1GM8A 2QE7G 1LUVA 3B4SA 3CCMV 4BW9A 2QM4A 2EIKB 4Z2WA 4G2KA 3ZMSA 1YF2A 4AQYB 2XASA 2YDEA 2W6IG 3BEHA 3Q4HB 4X65B 3P30A 2HJFC 4X89A 4DK1A 1AJPA 4HYOA 4GX2A 2YIBD 4KFMA 2GV9A 2XAGA 5C8YA 3ZHVA 4LF5O 1MSDA 4CC6A 4DV3B 1SKVA 5KHKA 3NXSA 3QNEA 1QLEC 2XTAA 4H33A 2KG7B 2R9IA 1Y74A 1Q8IA 5JCOA 4JI6O 3ZRVA 1B6QA 4J41A 3ZRWA 1S5LZ 3H9VA 1IBLO 1OHHG 1S3JA 1YSCA 2PF4E 3AEIA 2FMLA 1FYJA 3U10A 2Y0IA 1YHQV 3OFNG 2QKSA 5KMGA 2E76B 1TAEA 3F5WC 3H1JH 1J5EO 3FB8C 3APQA 2AHYA 1HNZO 1Q3EA 2RNBA 4IIJA 2BTOA 4PJ0Z 3FAVB 1YJNV 3SR2C 3CB2A 5KA5A 4LC1A 4DUZO 1BZKA 4PD4F 4I4TB 2ZR3A 1OV9A 2B5UA 4JI0O 2EJRA 3B40A 4ZIBA 1OZ0A 4PA7A 2R9RB 2WAMA 1YIJV 4LFCO 5JQGA 1F4NA 4JI3O 1SERA 3SJQC 3CXHF 4NTXA 5FLXN 1H38A 5EC1C 3P32A 1W0JG 1FXKB 3HKBB 4LCUC 1R73A 4EB6B 4MVSA 2UUBB 2WLMA 3JARA 3J81N 3I56V 4JI6B 1URFA 1Q81W 5TISZ 1AJNA 1IBLB 2BSKB 4AI8A 2ZT9B 3JD3A 1GN4A 1BS3A 1QVFU 1OCCB 3E35A 1XREA 2ILMA 1JFFB 5GTIZ 2P4VA 1P84F 3CMAV 1HNZB 1VARA 3GWKC 3ETEA 4B3TO 1K97A 1OCOB 4YJ3A 1TA8A 5FL7G 3OGCC 5LP6C 2ETNA 5J2UB 5AG2A 4HNAB 1D5NA 3W7XA 4DUZB 1E1RG 5CA3A 5KHIA 4DV7O 4X1YA 2HVJC 4O2BA 1K92A 3KCYA 4JI0B 3RYCA 4LF6O 1Y76B 3OGIB 3CXCU 1ROPA 5KHHA 1NJIW 4LFCB 1VQ4V 1B04A 5FNVA 2JEXA 3THOA 4FM0A 3ZS8C 4CH6A 3M7MX 1TUEB 3AG1B 2VWKA 3C90A 1VF6C 2A7WA 4X8AA 4B3RO 4TV8B 1G4YB 2A0LA 3L9DA 2ZCEA 1B3QA 4RUEA 1N34O 2ODMA 5KHGA 3LDCA 3OEHG 4J80A 1GO3F 4YXWG 4FK5C 1KD1W 3JASA 4W4LA 4K3AA 4ZHQB 4MVRA 2Q7GA 4LNUA 5B1NA 2ZXWC 1MMMA 1ZSPA 4B3TB 3E8GA 4TUYA 3IGAC 3FB6C 5IJ9B 2D3OW 3A0HZ 3JCZA 2OT5A 4QNHB 3SJBC 2LGWA 1DGSA 5EBMC 1QU7A 4DV7B 4DO2A 3DTUB 3RWRD 2WLHA 4DV2O 2EIKC 4O2AA 4LF6B 4WFBV 5B1OA 5EZYA 3SPJA 1XILA 2M7WA 1BGYH 3AK1A 5CA0A 2OIGA 2EX3A 1HP8A 2K1EA 4O4IA 3N2KB 4DR5O 1YJ9V 3GWOA 1XI1A 2ZE6A 3CC7V 5C8YB 1JMKC 4B3RB 2VWJA 1HDJA 2GHYA 3EFFK 3MHSC 1EBOA 2B1GA 1J95A 1Y74B 4N23A 2PY5A 3AG3B 3TETA 2E74B 3CCSV 1N34B 1PPJH 2OTLV 4BIOA 5LMNO 3OM3B 1FPOA 1W2BU 3CCLV 2HHHO 2A3QA 2OTJV 3U11A 1DK1A 1VQPV 1BSMA 4B3MO 1AROP 4FLZA 2A9HA 1O9HA 4MTFA 3HKEA 1XNRO 1W59A 3RFRA 2WWWA 1BQ0A 4DV2B 3T4DA 2V1DA 5CN0A 4OPAA 2ZR2A 2ZE8A 1FAFA 3STLC 3RVYA 2EIJB 1H2LA 1BL8A 5IDJA 2GSMB 1TUBA 4JAAA 2JJ2G 1FXKC 5EK0A 1WJZA 3FX7A 4DR2O 4DR5B 1D2DA 2A06H 1VQ5V 2UUCO 2F95B 5J2TA 2XAQA 4OGQB 2Q7EA 2X6BA 5KAFZ 1B06A 4JV5O 2JRIA 2HKOA 2JK5C 3JARB 3PN1A 3ZHSA 3M8AA 1SQBH 3ZMTA 4OPHA 4ZOLB 1OCCC 4N21A 3SYCA 2AZ0A 2LFSA 3J7AU 2NN4A 5LMNB 1NH2D 5CBGA 2ADQB 3EVKA 3H01A 3KCXA 4UB8Z 1M5IA 3I55V 1OCOC 2RDCA 3Q4HA 2KSDA 3BY6A 1K73W 2HHHB 3FYIB 1IXMA 1QVGU 3GB7C 5JJNB 1SESA 4YJ3B 4B3MB 1H2NA 1HR0O 2NR5A 4XDJA 3DXRB 3AK3A 4LH7A 1XNRB 5LMUO 3RN4A 2QM8A 4MVZA 4QJFB 3AG4B 3JYCA 2KG7A 1XL6A 3A8TA 2BTQB 1VQLV 3JALA 2FB5A 3IC7A 3IJ4A 3CX5F 4UUJC 3CRMA 1Y6XA 4KL1A 1H2GA 3ZHRA 2ZNJA 2QDOA 3TXSA 3E86A 4DR2B 1N4CA 1Q43A 3UKMA 4EFBA 2ZE7A 5H6RA 4MTOA 1V54B 2UUCB 4P30A 5LBQA 4Q20A 1KKCA 2EILB 4LBEC 4JV5B 1XL4A 2IH1C 4HAMA 2P90A 4CH5A 4DRXA 4I4TA 1WP8A 2DJVA 1U96A 4B3SO 1WNSA 2HJDA 2QWNB 4TQDA 1NH2B 1WA8B 2ZM6O 1AI7A 4MTXA 2GBOA 5KAIZ 3JD2A 2Y4TA 1SA0A 2UUAB 2IW5A 4LNUB 3JAKB 1JJOA 2HP8A 1SQFA 1I0HA 2YIBA 4HBNA 4TUYB 1OCZB 4DXWA 2IU3A 2YI9A 1SRYA 3HKBA 4RQEA 1HR0B 1S76D 3K5LA 2P5OA 2LQTA 3BHPA 3ZHUA 1V55C 5LMUB 2GUZB 4U7OA 2DYRC 1AI5A 2YEVB 5DECA 3CC4V 4O2AB 5BY1A 1F51A 4JYBA 1MZFA 5EZYB 5L3DA 4I0XB 4OXSA 5CA0B 1PP9H 1VF5B 5BXZA 1JFFA 3FB5C 3K5OA 4O4IB 1KU9A 2VQFO 3WU2Z 2EZPA 5B66Z 5JCOC 3AG3C 5IYZA 5B5EZ 5KX5B 2VS0A 4PV1B 1WLEA 5EBWC 1XDCA 4B3SB 2JJ1G 2JS3A 4UCUA 5JJJB 1Y76A 3ETDA 4IYIA 2ZM6B 1SQVH 5IWAO 4QGPA 3G71V 3ZN1A 1SC5B 3WB0A 5HFMA 3D36C 3KKYA 3ZBHA 3ZIAG 3D3IA 1IX9A 5FPRA 4YHHO 3T1YO 4X20A 3IC9A 3SPIA 1BMFG 3JAWA 3CCVV 4BR6A 2CGOA 2YXYA 1M57B 3EHBB 3ZJZA 3K04A 1ZAUA 2Q5ZA 5LGUA 2QWOB 2QJ1A 4FLYA 1NI8A 1RFYA 1HNXO 3AK2A 3T2MA 3QG5A 4ZHQA 4F6RB 3HB3B 2NLJC 1QR8A 2VQFB 1XBLA 2WPDG 1RM1B 5IJ9A 2AGAA 4LP8A 4TOIA 4YY3O 2Y48A 4R6ZA 5J2TB 5LL6Y 1BT8A 3K5MA 1FJGO 3UO2A 5L3BA 4DV5O 1FFXB 2EINB 5H9CA 1MA1A 1R6TA 1N0NA 2Q8VA 4QPJA 1M56B 1Z5WA 3E8HA 2X6AA 1WP7A 2K9PA 5IWAB 2F4VO 1SF9A 2DN9A 2H8PC 3CMEV 1IBMB 1KMIZ 3QO7A 2ZIMA 2DYSC 3DGEA 1YI2V 3HR0A 2Y0PA 3ABMB 3N2KA 3A0RA 2UXDO 4J7ZA 2JVDA 3T1YB 4YHHB 4NTWA 1AR1B 3OR7C 3JD0A 3JD4A 3E2EA 3FB7C 3LSUA 3CYOA 1O9GA 1VMGA 4NR1A 4MW3A 3RVZA 4PA6A 1S77D 2UUBO 2UXCB 3VQXA 1K4DC 1SS3A 3QO5A 2GTSA 4R50A 4O4JA 3JALB 4Z1MG 2XHBA 1HNXB 3TJTA 1PD3A 1V54C 3E89A 1DF4A 3ABUA 4JZGA 4TQFA 3ICXA 5LGNA 2JS5A 2EILC 1XNQO 5HFLA 4YY3B 4EKWA 4WFHA 3D36A 5LHGA 2E75B 1FJGB 1IDSA 4DV5B 4DRXB 1Z2GA 4Q6GA 2E5LO 2CK3G 1M93A 4JYCA 4OX9O 1KC8W 5LXTB 5BR8O 5LHIA 1DLBA 2F4VB 2ZNIA 3K0GA 2Z3YA 1QQCA 1GK9A 1OCZC 1PV0A 1M1KW 1SA0B 4U3JA 4FFBB 4JI2O 1X4TA 1MOFA 2UXDB 2UXBO 2F93B 2PZSA 3CCEV 1UPGA 2LFRA 4DR6O 4E4EA 3F7VC 1WB7A 1JR9A 1VQ7V 2P4KA 1SQQH 5B3SB 3MDSA 4ABMA 2PUSA 5FPOA 4H13B 4ZOLA 3IFXA 5B1BB 3RT3C 1N33O 4J7KA 1HNWO 1RPOA 4O4LA 1IZ3A 2GDSA 2E3CA 2CDYA 3B8MA 1P4RA 5DN6G 3L70H 3S3XA 4QIWF 3E8BA 2KQXA 3CCRV 2EIMB 1XNQB 3KZIZ 1A32A 2CTQA 4GKKO 2ITDC 1K33A 3OR6C 4IGGA 5IYZB 1YXBA 1P7GA 3DXRA 3H1KH 2WSSG 2Q0OC 3B09A 2E5LB 4OX9B 2BTQA 3HKDB 5BR8B 2IJHA 1AI4A 2W0FC 3I5DA 3C3TA 2QWPB 5L3EA 5KA6A 4PELA 1FXHA 4L8JA 2YIAA 4DK0A 4QE9A 3ZN0A 1EN5A 4CS3A 4JI2B 4Z1VA 1DTOA 1GKFA 2UXBB 4HZ3A 4DR6B 4X20B 3UT5A 4K35A 4LF4O 1L0LH 3RYHA 2A79B 1M57C 4WFAV 3B77A 3H1IH 3JAWB 3W7SA 4QE7A 3B2EE
chains in the Genus database with same CATH topology
2AZ0A 3O9OA 3ZBHA 2KG7A 3GWKC 4I0XB 3FD9A 2VS0A 4LWSB 3TXQA 3FAVA 4ABMA 3GVMA 3Q4HA 2KG7B 1WA8A 3G80A 2AZ2A 2DE0X 2VRZA 3FAVB 4GZRB 3Q4HB 3TXSA 4I0XA 2B9ZA 1WA8B 4LWSA 3HR0A 3OGIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ0 A;  3O9O A;  3ZBH A;  2KG7 A;  3GWK C;  4I0X B;  3FD9 A;  2VS0 A;  4LWS B;  3TXQ A;  3FAV A;  4ABM A;  3GVM A;  3Q4H A;  2KG7 B;  1WA8 A;  3G80 A;  2AZ2 A;  2DE0 X;  2VRZ A;  3FAV B;  4GZR B;  3Q4H B;  3TXS A;  4I0X A;  2B9Z A;  1WA8 B;  4LWS A;  3HR0 A;  3OGI B; 
#chains in the Genus database with same CATH topology
 3J80 N;  2PYJ A;  2CE4 A;  2MK3 A;  3A0B Z;  4I55 A;  3K79 A;  1EFR G;  1VQK V;  1SQP H;  1N33 B;  1WA8 A;  1HNW B;  3JSN A;  2VRZ A;  3JCU Z;  3ML0 A;  3CHX A;  1LR1 A;  3JAK A;  1LNQ A;  4P9P A;  5JWP A;  2DWE C;  4GKK B;  2PI5 A;  2EIN C;  2DQ0 A;  1K5Q A;  5CMU A;  3BRC A;  1M56 C;  2ZIN A;  2GUZ A;  4X1K B;  4D7T A;  2YEV A;  4G27 B;  5IY5 B;  5D5Q A;  4JI5 O;  3OUS A;  4I0X A;  3OEE G;  4RUF A;  2GTA A;  3SPC A;  1S72 V;  4LF9 O;  3ABM C;  1YZB A;  2AW9 A;  1NU1 H;  4LH6 A;  3OTO O;  5LGT A;  1R6N A;  1MG1 A;  2QTS A;  4LF4 B;  2WLK A;  2V4D A;  4H0L B;  4DYL A;  2CTR A;  2N74 A;  3CRA A;  5KX5 A;  4PHZ A;  4DV6 O;  4XDK A;  1PKX A;  4FLV A;  3JSL A;  5LOV A;  4BIU A;  1JQ0 A;  4O4J B;  4W4K A;  4PI0 A;  4CH3 A;  1YDX A;  1VQ6 V;  1JVM A;  4PA3 A;  3WG7 B;  4O4H A;  1NT2 B;  5KUM A;  1H8H G;  1GH6 A;  4U7N A;  2MW2 B;  4NYK A;  4UCV A;  1QBZ A;  3S3W A;  1HW7 A;  3O65 A;  1AP6 A;  4LWS B;  1XHZ A;  3B8N A;  4GKJ O;  2F1M A;  4GYC B;  4JI5 B;  3CPW U;  3G80 A;  1NTZ H;  2O57 A;  4I7Z B;  4X62 O;  4LF9 B;  3T1C A;  3SYO A;  2Y4U A;  4WFF A;  3ETG A;  4F6R A;  4U3J B;  4E2L A;  3C3S A;  4JYY A;  3OTO B;  2R72 A;  2IJI A;  4X66 O;  2RCV A;  2YUA A;  1RSO B;  3CEI A;  3TK1 A;  5B3S C;  4KUM A;  5GTH Z;  3DC6 A;  1ZX3 A;  1GTO A;  2DWD C;  4RO2 A;  1RPR A;  4CC5 A;  2L35 A;  2FL4 A;  2QWR B;  3R66 A;  3AG7 A;  4PDV A;  4DV6 B;  2CAZ C;  1XMO O;  5B1B C;  1FFX A;  3BAA A;  5IYB O;  3ABL B;  1UJW B;  1N32 O;  2OCH A;  2N05 A;  5J9P C;  2OWO A;  4O4L B;  5K1X A;  2EIM C;  1H2S B;  2UUA O;  2WLI A;  4NVP A;  4TSF G;  2Q67 A;  1KP3 A;  2ARH A;  3D8C A;  4GZR B;  4JPR A;  2XT9 A;  1EM1 A;  1EZJ A;  4TWK A;  4GKJ B;  3P3N A;  3ZED A;  3RW0 A;  2F66 C;  1Q6H A;  2PI4 A;  2YIC A;  1GMG A;  3RYI A;  2DMX A;  5IYC O;  4X62 B;  1WPX A;  2N04 A;  4K8Z A;  1Q86 W;  2P7T C;  1I94 O;  1PNL A;  3FFQ A;  1CPY A;  1F23 A;  2HR3 A;  2X7R B;  1NQT A;  3A2F A;  3AG1 C;  4H44 B;  3WB2 A;  1YTF D;  2YID A;  4PDL A;  4X66 B;  2M6Y A;  2FTK A;  1GAX A;  3UT5 B;  3RYH B;  2QTO A;  4UCO A;  2Z5U A;  2YC0 A;  2ADP A;  4JAU A;  1XMO B;  4GCZ A;  4I55 B;  5BMV A;  4JTA B;  4CH4 A;  1N32 B;  3CD6 V;  2HVK C;  5LXT A;  4IYH A;  4UV8 A;  3SYA A;  2CTP A;  2Q7H A;  1IBK O;  5CA1 B;  2ZD9 A;  3FD9 A;  2YSU B;  1PNM A;  3FKS G;  4FFB A;  5EBL C;  1P49 A;  4C7U A;  5F2V O;  3E83 A;  1Q6I A;  4JI4 O;  5IY5 C;  3L72 H;  4R8C A;  3ZMV A;  3CWB H;  3EXA A;  4ZI7 A;  2Q4P A;  2IH3 C;  4DR1 O;  1BQZ A;  3VQW A;  1Q82 W;  3T4Z A;  3TXQ A;  2QEX V;  2ITC C;  1CXZ B;  4AIL C;  1H8E G;  5KLV H;  1I94 B;  2EUL A;  1YTF B;  4G28 B;  2RMK B;  2X0L A;  4MVM A;  1IVS A;  1P7B A;  5EIB D;  2W6J G;  1E1Q G;  1UFI A;  5K1P A;  2DW4 A;  2FYU H;  4JAV A;  1AIL A;  2HFE C;  1Q90 D;  2UXX A;  1AVM A;  3H1L H;  3LUT B;  1Y4M A;  2LW7 A;  1QR9 A;  2DQ3 A;  1PNK A;  4BAY A;  1VQN V;  2P67 A;  3CRR A;  2D2C B;  5LOV B;  1FXV A;  4YJ2 B;  1EN6 A;  2QKA A;  3TGU H;  3HKD A;  4KHP O;  2JIZ G;  2DE0 X;  3LSQ A;  4XDL A;  3WG7 C;  4A5U B;  1IBK B;  3RYF B;  3CS5 A;  1IBM O;  4O4H B;  2EZO A;  1EZV H;  2RJZ A;  1JJ2 U;  1XEQ A;  1QLN A;  3GVM A;  3L75 H;  1FS0 G;  1GM9 A;  3L74 H;  5H6Q A;  1HWY A;  4JI4 B;  1PL4 A;  3JAM N;  2XAJ A;  2EJ7 A;  2IJJ A;  2CGN A;  4DW0 A;  5IYD O;  2EIJ C;  2UXC O;  4DR1 B;  3K9A A;  3ZRS A;  2ZKO A;  4UCS A;  1L8D A;  1L1F A;  3L71 H;  2WLL B;  1LUW A;  1KB9 F;  1ZLZ A;  4NXN O;  1M9N A;  1Y67 A;  4FLX A;  1K7D A;  4FMT A;  3ZHQ A;  4FZ0 A;  1Q7Y W;  1K5S A;  3ZCC A;  3UCS C;  4EFE A;  3HKC B;  4X88 A;  4F4L A;  4JI8 O;  1SZT A;  1AR4 A;  4NKG B;  4UCR A;  2OYQ A;  4MVO A;  4X1K A;  1ZWI C;  4U3F H;  4FM2 A;  2Q0A A;  4JI7 O;  5IJ0 A;  3JD1 A;  1VQ8 V;  1AP5 A;  2B1I A;  2RN9 A;  4KHP B;  1H2K A;  3QVN A;  5GW7 A;  4FFK A;  2X6C A;  2ZXW B;  3RGB A;  4D6T H;  2Q69 A;  2WLI B;  3OAA G;  2F43 G;  4GT1 A;  1NR7 A;  3VQV A;  2LP7 A;  2IM9 A;  3AG4 C;  1ENV A;  5KHJ A;  1DF5 A;  4GX1 A;  5A9G A;  2R70 A;  3G4S V;  4GLX A;  4D7S A;  1U97 A;  3HPL C;  1BE3 H;  1OJH A;  4IHJ A;  1NBM G;  2BCC H;  2QR4 A;  3QTC A;  1MNG A;  1R6K A;  3RYI B;  2YS8 A;  2B9Z A;  4J9Y B;  3LNN A;  2UU9 O;  5BZB A;  2P06 A;  3OMN B;  1NKD A;  4NXN B;  4P9O A;  2BOC C;  3CRC A;  5L3G A;  1WAZ A;  3K9S A;  1JOY A;  4JI8 B;  4NTY A;  1VQO V;  3LNM B;  5ITZ A;  1R3I C;  2QSA A;  4LWS A;  4X64 O;  1RP3 B;  2LO1 A;  1FKA O;  4UV9 A;  1XOU A;  3STZ C;  4JI7 B;  3ASO B;  5BMV B;  5B1A B;  1JX9 A;  3UM7 A;  4JI1 O;  1KUQ A;  1K4C C;  1K8A W;  2L6L A;  2QWQ B;  3APO A;  4I50 A;  5A2Q N;  3NR7 A;  2W0X A;  2ATK C;  4WFE A;  3TCU A;  1GN3 A;  1F4M A;  4DR3 O;  4CS2 A;  1Z5V A;  1RSO A;  3WB1 A;  1XUQ A;  2PTM A;  2CH7 A;  1AI6 A;  1G8M A;  2VQE O;  4UVC A;  1THZ A;  1NTK H;  4DW1 A;  2XUM A;  4TV9 B;  4ZI7 B;  3CJH B;  4RAI A;  1OCR B;  4UVA A;  1VP7 A;  4DV1 O;  1R3J C;  2PGG A;  2ZDI A;  3H1H H;  5JH7 B;  2UU9 B;  5IT9 N;  5IE9 A;  5CB4 A;  3D3Q A;  4LF5 B;  4MW8 A;  4DUY O;  3BFR A;  3K06 A;  1I08 A;  1JCH A;  4DV4 O;  1R3L C;  3ETQ A;  3X2Q B;  4FPP A;  1NTM H;  1WN7 A;  2IJK A;  2OIE A;  4X64 B;  2HLD G;  1FFT B;  5CBH A;  1TVK A;  1GN6 A;  4NB5 A;  1JA8 A;  2WA4 A;  3JAT A;  3RBZ A;  2F23 A;  1J5E B;  1I5Y A;  3E8F A;  3FYE B;  4JI1 B;  1T5E A;  3QO8 A;  1TGO A;  4GUN A;  4J7J A;  1VIB A;  1KYO F;  1L0N H;  3SDL A;  4DR3 B;  2XOK G;  2CUG A;  3ZMZ A;  1M90 W;  2JDI G;  2WA3 A;  2VQE B;  4JI3 B;  3O9O A;  5CBF A;  3K08 A;  4I9W A;  4DV1 B;  1D5A A;  2QA4 V;  3OT7 A;  3N2G B;  4IT5 A;  3BAB A;  5EIB C;  2ZQM A;  5CA1 A;  1R1B A;  1RM1 C;  5JVD B;  4DUY B;  4NXM O;  1S5J A;  2NNU A;  4DV4 B;  2YI8 A;  2P22 C;  4XBF A;  4J11 A;  4JTC B;  2RQ6 A;  4YIO A;  1KEC A;  5H2F Z;  3E22 B;  4I9Q A;  5LYJ A;  2HG5 C;  5EYP A;  2JGD A;  4KXR A;  2V7Q G;  5IJ0 B;  2P6J A;  4MSW C;  4DV0 O;  4MVU A;  1PL0 A;  4EEQ A;  2KKW A;  4X1I A;  3R65 A;  2KB1 A;  1QHT A;  3KG2 A;  2UXN A;  3ASN B;  1E79 G;  5LA6 B;  3W7U A;  2YXL A;  1COW G;  3LDD A;  3CCU V;  4JAS A;  3OUF A;  1V55 B;  1YIT V;  2DYR B;  4AHC A;  4B7E A;  4WFG A;  3CP1 A;  5D5P A;  2QM7 A;  1KP2 A;  2JEU A;  1GN2 A;  4IHJ B;  2Y69 B;  2IU0 A;  2PYL A;  4YJ2 A;  3QF7 A;  4RQF A;  4IL6 Z;  3SPG A;  4JTD B;  3RYF A;  3ZHT A;  4DR7 O;  4LR3 A;  1AR5 A;  1ORQ C;  4UCT A;  4WCE V;  2AXT Z;  4BIZ A;  3ZRX A;  2WLJ A;  4NXM B;  1R3K C;  2DOS A;  5LP6 A;  5H5N A;  4KP4 A;  4PA9 A;  3F5T A;  3ZRW B;  3WFV A;  1W0K G;  3T1H O;  3DC5 A;  4I5S A;  3ASO C;  5ITZ B;  5B1A C;  3ABK B;  2OCC B;  2XAF A;  3G67 A;  4PDM A;  5KMG B;  4UVB A;  2H94 A;  1YJW V;  1ZL8 A;  5GON A;  4DV0 B;  3CRQ A;  4FZ1 A;  3K03 A;  4K8X A;  4IIJ B;  2WLL A;  4LF7 O;  4I50 B;  2Q68 A;  3N27 A;  1XQ8 A;  2XND G;  4MTG A;  2C2A A;  2R9A A;  1M4U A;  1SET A;  1VF6 A;  4ICG A;  4B08 A;  1K34 A;  3K59 A;  1N0J A;  1G6U A;  3HKC A;  2CH7 B;  1GM7 A;  4FLT A;  1OCR C;  1Q5O A;  4BW5 A;  1BHB A;  1WPB A;  5JQG B;  2LGQ A;  2BOB C;  1S0V A;  1CEZ A;  1N8R W;  1V9P A;  3OMA B;  4JF3 A;  4WBN A;  1IUR A;  4BWA A;  4DR7 B;  5CB4 B;  4JZ2 A;  3AG2 B;  1I7F A;  4CBC A;  3BVO A;  4JGS A;  4MVQ A;  3BPZ A;  3X2Q C;  3CE2 A;  1N36 O;  5E1A C;  4DR4 O;  1NVP D;  1KKD A;  1US6 A;  3SJC C;  3T1H B;  5DM6 V;  1JPX A;  1K9M W;  4CZZ A;  1AB3 A;  1QNM A;  1XHX A;  1EN4 A;  1TVK B;  1GRJ A;  5JJE B;  3DSQ A;  3BCC H;  3JAT B;  4X9Q A;  3ZX6 A;  5L3F A;  3OD4 A;  3K5N A;  3CSX A;  3SPH A;  4LFB O;  2FKX A;  2DYS B;  4LF7 B;  4UB6 Z;  4FJC C;  4ASU G;  1BHA A;  3K57 A;  4MT8 A;  4X1Y B;  4O2B B;  4JYA O;  4L87 A;  2QGN A;  3P3P A;  3BA9 A;  3RYC B;  1YCI A;  4QPK A;  1QLE B;  1YEW A;  1I5X A;  2QKC A;  3VOU A;  5FNV B;  4J9Z B;  4LFA O;  3F7Y C;  5L3C A;  3CCJ V;  4TT3 G;  1SZX A;  1Q6U A;  2HEP A;  2ZIO A;  1XMQ O;  3K58 A;  1SQG A;  2G38 A;  3LDE A;  3FAV A;  1F7Y A;  1N36 B;  1NVP B;  4DR4 B;  1NZ6 A;  3LSS A;  2JGU A;  2H3O A;  4ZKI A;  4FM1 A;  3MAQ A;  1NR1 A;  2EBO A;  4K0K O;  4YIP A;  3L73 H;  1KBH A;  1SQX H;  5LYJ B;  3JAS B;  1WB8 A;  2AHZ A;  4TV9 A;  5EYP B;  2JGD B;  3CJH A;  5LHH A;  3OTF A;  3W7W A;  1VEW A;  1G1X B;  1X59 A;  3ABT A;  5JH7 A;  2LJ2 A;  3ASN C;  4X1I B;  4LFB B;  1FXK A;  1KQS U;  3G6E V;  4H37 A;  4FIP C;  3M99 B;  1VQM V;  4EB6 A;  4R7C A;  2Q6A A;  1VF7 A;  4JYA B;  2BE3 A;  2BSK A;  2Y69 C;  4J10 A;  4LF8 O;  1ZTE A;  4LFA B;  3CCQ V;  5KUK A;  2Z0A A;  4GX5 A;  3OMI B;  2AZ2 A;  4WF9 V;  2CTW A;  2LW1 A;  1XMQ B;  1Y66 A;  3CC2 V;  4MS2 A;  3UQ8 A;  5J2U A;  4HNA A;  4B7K A;  1MAB G;  4PI2 A;  1NS1 A;  5LP6 B;  1BCC H;  3SYP A;  3ABK C;  4FVM A;  2OCC C;  5E79 Z;  1FD9 A;  3U0Z A;  5C93 A;  4K0K B;  3MHH C;  1YVW A;  2IBZ H;  1QCE A;  4AQY O;  4PA4 A;  1ZL8 B;  4ZBM A;  5GON B;  1IXB A;  4X65 O;  3OW2 U;  4FLW A;  3K3W A;  3N2G A;  1CP9 A;  4J42 A;  1AJQ A;  3BA8 A;  5DED A;  3PJS K;  3HKE B;  5JVD A;  4DV3 O;  3MD0 A;  4TV8 A;  4GX0 A;  4FLU A;  1VQ9 V;  4P2Z A;  4PDR A;  3ZMU A;  4UFZ A;  4F6E A;  3VBB A;  4UXN A;  3SJA C;  2Q9L A;  3ABL C;  1MSW D;  3SYQ A;  3UO3 A;  4LF8 B;  3E22 A;  1TUB B;  2ZDI C;  4CS4 A;  4WBN B;  3W7T A;  1S5H C;  5EC2 C;  3AG2 C;  2ZE5 A;  2Q73 A;  3VQY A;  3OE7 G;  3G6B A;  3IAY A;  2WLN A;  2YXH A;  1MZE A;  1K3E A;  3SGI A;  4RWU A;  1H2M A;  5LA6 A;  1PM9 A;  3K0D A;  2XAH A;  1ZUQ A;  1GM8 A;  2QE7 G;  1LUV A;  3B4S A;  3CCM V;  4BW9 A;  2QM4 A;  2EIK B;  4Z2W A;  4G2K A;  3ZMS A;  1YF2 A;  4AQY B;  2XAS A;  2YDE A;  2W6I G;  3BEH A;  3Q4H B;  4X65 B;  3P30 A;  2HJF C;  4X89 A;  4DK1 A;  1AJP A;  4HYO A;  4GX2 A;  2YIB D;  4KFM A;  2GV9 A;  2XAG A;  5C8Y A;  3ZHV A;  4LF5 O;  1MSD A;  4CC6 A;  4DV3 B;  1SKV A;  5KHK A;  3NXS A;  3QNE A;  1QLE C;  2XTA A;  4H33 A;  2KG7 B;  2R9I A;  1Y74 A;  1Q8I A;  5JCO A;  4JI6 O;  3ZRV A;  1B6Q A;  4J41 A;  3ZRW A;  1S5L Z;  3H9V A;  1IBL O;  1OHH G;  1S3J A;  1YSC A;  2PF4 E;  3AEI A;  2FML A;  1FYJ A;  3U10 A;  2Y0I A;  1YHQ V;  3OFN G;  2QKS A;  5KMG A;  2E76 B;  1TAE A;  3F5W C;  3H1J H;  1J5E O;  3FB8 C;  3APQ A;  2AHY A;  1HNZ O;  1Q3E A;  2RNB A;  4IIJ A;  2BTO A;  4PJ0 Z;  3FAV B;  1YJN V;  3SR2 C;  3CB2 A;  5KA5 A;  4LC1 A;  4DUZ O;  1BZK A;  4PD4 F;  4I4T B;  2ZR3 A;  1OV9 A;  2B5U A;  4JI0 O;  2EJR A;  3B40 A;  4ZIB A;  1OZ0 A;  4PA7 A;  2R9R B;  2WAM A;  1YIJ V;  4LFC O;  5JQG A;  1F4N A;  4JI3 O;  1SER A;  3SJQ C;  3CXH F;  4NTX A;  5FLX N;  1H38 A;  5EC1 C;  3P32 A;  1W0J G;  1FXK B;  3HKB B;  4LCU C;  1R73 A;  4EB6 B;  4MVS A;  2UUB B;  2WLM A;  3JAR A;  3J81 N;  3I56 V;  4JI6 B;  1URF A;  1Q81 W;  5TIS Z;  1AJN A;  1IBL B;  2BSK B;  4AI8 A;  2ZT9 B;  3JD3 A;  1GN4 A;  1BS3 A;  1QVF U;  1OCC B;  3E35 A;  1XRE A;  2ILM A;  1JFF B;  5GTI Z;  2P4V A;  1P84 F;  3CMA V;  1HNZ B;  1VAR A;  3GWK C;  3ETE A;  4B3T O;  1K97 A;  1OCO B;  4YJ3 A;  1TA8 A;  5FL7 G;  3OGC C;  5LP6 C;  2ETN A;  5J2U B;  5AG2 A;  4HNA B;  1D5N A;  3W7X A;  4DUZ B;  1E1R G;  5CA3 A;  5KHI A;  4DV7 O;  4X1Y A;  2HVJ C;  4O2B A;  1K92 A;  3KCY A;  4JI0 B;  3RYC A;  4LF6 O;  1Y76 B;  3OGI B;  3CXC U;  1ROP A;  5KHH A;  1NJI W;  4LFC B;  1VQ4 V;  1B04 A;  5FNV A;  2JEX A;  3THO A;  4FM0 A;  3ZS8 C;  4CH6 A;  3M7M X;  1TUE B;  3AG1 B;  2VWK A;  3C90 A;  1VF6 C;  2A7W A;  4X8A A;  4B3R O;  4TV8 B;  1G4Y B;  2A0L A;  3L9D A;  2ZCE A;  1B3Q A;  4RUE A;  1N34 O;  2ODM A;  5KHG A;  3LDC A;  3OEH G;  4J80 A;  1GO3 F;  4YXW G;  4FK5 C;  1KD1 W;  3JAS A;  4W4L A;  4K3A A;  4ZHQ B;  4MVR A;  2Q7G A;  4LNU A;  5B1N A;  2ZXW C;  1MMM A;  1ZSP A;  4B3T B;  3E8G A;  4TUY A;  3IGA C;  3FB6 C;  5IJ9 B;  2D3O W;  3A0H Z;  3JCZ A;  2OT5 A;  4QNH B;  3SJB C;  2LGW A;  1DGS A;  5EBM C;  1QU7 A;  4DV7 B;  4DO2 A;  3DTU B;  3RWR D;  2WLH A;  4DV2 O;  2EIK C;  4O2A A;  4LF6 B;  4WFB V;  5B1O A;  5EZY A;  3SPJ A;  1XIL A;  2M7W A;  1BGY H;  3AK1 A;  5CA0 A;  2OIG A;  2EX3 A;  1HP8 A;  2K1E A;  4O4I A;  3N2K B;  4DR5 O;  1YJ9 V;  3GWO A;  1XI1 A;  2ZE6 A;  3CC7 V;  5C8Y B;  1JMK C;  4B3R B;  2VWJ A;  1HDJ A;  2GHY A;  3EFF K;  3MHS C;  1EBO A;  2B1G A;  1J95 A;  1Y74 B;  4N23 A;  2PY5 A;  3AG3 B;  3TET A;  2E74 B;  3CCS V;  1N34 B;  1PPJ H;  2OTL V;  4BIO A;  5LMN O;  3OM3 B;  1FPO A;  1W2B U;  3CCL V;  2HHH O;  2A3Q A;  2OTJ V;  3U11 A;  1DK1 A;  1VQP V;  1BSM A;  4B3M O;  1ARO P;  4FLZ A;  2A9H A;  1O9H A;  4MTF A;  3HKE A;  1XNR O;  1W59 A;  3RFR A;  2WWW A;  1BQ0 A;  4DV2 B;  3T4D A;  2V1D A;  5CN0 A;  4OPA A;  2ZR2 A;  2ZE8 A;  1FAF A;  3STL C;  3RVY A;  2EIJ B;  1H2L A;  1BL8 A;  5IDJ A;  2GSM B;  1TUB A;  4JAA A;  2JJ2 G;  1FXK C;  5EK0 A;  1WJZ A;  3FX7 A;  4DR2 O;  4DR5 B;  1D2D A;  2A06 H;  1VQ5 V;  2UUC O;  2F95 B;  5J2T A;  2XAQ A;  4OGQ B;  2Q7E A;  2X6B A;  5KAF Z;  1B06 A;  4JV5 O;  2JRI A;  2HKO A;  2JK5 C;  3JAR B;  3PN1 A;  3ZHS A;  3M8A A;  1SQB H;  3ZMT A;  4OPH A;  4ZOL B;  1OCC C;  4N21 A;  3SYC A;  2AZ0 A;  2LFS A;  3J7A U;  2NN4 A;  5LMN B;  1NH2 D;  5CBG A;  2ADQ B;  3EVK A;  3H01 A;  3KCX A;  4UB8 Z;  1M5I A;  3I55 V;  1OCO C;  2RDC A;  3Q4H A;  2KSD A;  3BY6 A;  1K73 W;  2HHH B;  3FYI B;  1IXM A;  1QVG U;  3GB7 C;  5JJN B;  1SES A;  4YJ3 B;  4B3M B;  1H2N A;  1HR0 O;  2NR5 A;  4XDJ A;  3DXR B;  3AK3 A;  4LH7 A;  1XNR B;  5LMU O;  3RN4 A;  2QM8 A;  4MVZ A;  4QJF B;  3AG4 B;  3JYC A;  2KG7 A;  1XL6 A;  3A8T A;  2BTQ B;  1VQL V;  3JAL A;  2FB5 A;  3IC7 A;  3IJ4 A;  3CX5 F;  4UUJ C;  3CRM A;  1Y6X A;  4KL1 A;  1H2G A;  3ZHR A;  2ZNJ A;  2QDO A;  3TXS A;  3E86 A;  4DR2 B;  1N4C A;  1Q43 A;  3UKM A;  4EFB A;  2ZE7 A;  5H6R A;  4MTO A;  1V54 B;  2UUC B;  4P30 A;  5LBQ A;  4Q20 A;  1KKC A;  2EIL B;  4LBE C;  4JV5 B;  1XL4 A;  2IH1 C;  4HAM A;  2P90 A;  4CH5 A;  4DRX A;  4I4T A;  1WP8 A;  2DJV A;  1U96 A;  4B3S O;  1WNS A;  2HJD A;  2QWN B;  4TQD A;  1NH2 B;  1WA8 B;  2ZM6 O;  1AI7 A;  4MTX A;  2GBO A;  5KAI Z;  3JD2 A;  2Y4T A;  1SA0 A;  2UUA B;  2IW5 A;  4LNU B;  3JAK B;  1JJO A;  2HP8 A;  1SQF A;  1I0H A;  2YIB A;  4HBN A;  4TUY B;  1OCZ B;  4DXW A;  2IU3 A;  2YI9 A;  1SRY A;  3HKB A;  4RQE A;  1HR0 B;  1S76 D;  3K5L A;  2P5O A;  2LQT A;  3BHP A;  3ZHU A;  1V55 C;  5LMU B;  2GUZ B;  4U7O A;  2DYR C;  1AI5 A;  2YEV B;  5DEC A;  3CC4 V;  4O2A B;  5BY1 A;  1F51 A;  4JYB A;  1MZF A;  5EZY B;  5L3D A;  4I0X B;  4OXS A;  5CA0 B;  1PP9 H;  1VF5 B;  5BXZ A;  1JFF A;  3FB5 C;  3K5O A;  4O4I B;  1KU9 A;  2VQF O;  3WU2 Z;  2EZP A;  5B66 Z;  5JCO C;  3AG3 C;  5IYZ A;  5B5E Z;  5KX5 B;  2VS0 A;  4PV1 B;  1WLE A;  5EBW C;  1XDC A;  4B3S B;  2JJ1 G;  2JS3 A;  4UCU A;  5JJJ B;  1Y76 A;  3ETD A;  4IYI A;  2ZM6 B;  1SQV H;  5IWA O;  4QGP A;  3G71 V;  3ZN1 A;  1SC5 B;  3WB0 A;  5HFM A;  3D36 C;  3KKY A;  3ZBH A;  3ZIA G;  3D3I A;  1IX9 A;  5FPR A;  4YHH O;  3T1Y O;  4X20 A;  3IC9 A;  3SPI A;  1BMF G;  3JAW A;  3CCV V;  4BR6 A;  2CGO A;  2YXY A;  1M57 B;  3EHB B;  3ZJZ A;  3K04 A;  1ZAU A;  2Q5Z A;  5LGU A;  2QWO B;  2QJ1 A;  4FLY A;  1NI8 A;  1RFY A;  1HNX O;  3AK2 A;  3T2M A;  3QG5 A;  4ZHQ A;  4F6R B;  3HB3 B;  2NLJ C;  1QR8 A;  2VQF B;  1XBL A;  2WPD G;  1RM1 B;  5IJ9 A;  2AGA A;  4LP8 A;  4TOI A;  4YY3 O;  2Y48 A;  4R6Z A;  5J2T B;  5LL6 Y;  1BT8 A;  3K5M A;  1FJG O;  3UO2 A;  5L3B A;  4DV5 O;  1FFX B;  2EIN B;  5H9C A;  1MA1 A;  1R6T A;  1N0N A;  2Q8V A;  4QPJ A;  1M56 B;  1Z5W A;  3E8H A;  2X6A A;  1WP7 A;  2K9P A;  5IWA B;  2F4V O;  1SF9 A;  2DN9 A;  2H8P C;  3CME V;  1IBM B;  1KMI Z;  3QO7 A;  2ZIM A;  2DYS C;  3DGE A;  1YI2 V;  3HR0 A;  2Y0P A;  3ABM B;  3N2K A;  3A0R A;  2UXD O;  4J7Z A;  2JVD A;  3T1Y B;  4YHH B;  4NTW A;  1AR1 B;  3OR7 C;  3JD0 A;  3JD4 A;  3E2E A;  3FB7 C;  3LSU A;  3CYO A;  1O9G A;  1VMG A;  4NR1 A;  4MW3 A;  3RVZ A;  4PA6 A;  1S77 D;  2UUB O;  2UXC B;  3VQX A;  1K4D C;  1SS3 A;  3QO5 A;  2GTS A;  4R50 A;  4O4J A;  3JAL B;  4Z1M G;  2XHB A;  1HNX B;  3TJT A;  1PD3 A;  1V54 C;  3E89 A;  1DF4 A;  3ABU A;  4JZG A;  4TQF A;  3ICX A;  5LGN A;  2JS5 A;  2EIL C;  1XNQ O;  5HFL A;  4YY3 B;  4EKW A;  4WFH A;  3D36 A;  5LHG A;  2E75 B;  1FJG B;  1IDS A;  4DV5 B;  4DRX B;  1Z2G A;  4Q6G A;  2E5L O;  2CK3 G;  1M93 A;  4JYC A;  4OX9 O;  1KC8 W;  5LXT B;  5BR8 O;  5LHI A;  1DLB A;  2F4V B;  2ZNI A;  3K0G A;  2Z3Y A;  1QQC A;  1GK9 A;  1OCZ C;  1PV0 A;  1M1K W;  1SA0 B;  4U3J A;  4FFB B;  4JI2 O;  1X4T A;  1MOF A;  2UXD B;  2UXB O;  2F93 B;  2PZS A;  3CCE V;  1UPG A;  2LFR A;  4DR6 O;  4E4E A;  3F7V C;  1WB7 A;  1JR9 A;  1VQ7 V;  2P4K A;  1SQQ H;  5B3S B;  3MDS A;  4ABM A;  2PUS A;  5FPO A;  4H13 B;  4ZOL A;  3IFX A;  5B1B B;  3RT3 C;  1N33 O;  4J7K A;  1HNW O;  1RPO A;  4O4L A;  1IZ3 A;  2GDS A;  2E3C A;  2CDY A;  3B8M A;  1P4R A;  5DN6 G;  3L70 H;  3S3X A;  4QIW F;  3E8B A;  2KQX A;  3CCR V;  2EIM B;  1XNQ B;  3KZI Z;  1A32 A;  2CTQ A;  4GKK O;  2ITD C;  1K33 A;  3OR6 C;  4IGG A;  5IYZ B;  1YXB A;  1P7G A;  3DXR A;  3H1K H;  2WSS G;  2Q0O C;  3B09 A;  2E5L B;  4OX9 B;  2BTQ A;  3HKD B;  5BR8 B;  2IJH A;  1AI4 A;  2W0F C;  3I5D A;  3C3T A;  2QWP B;  5L3E A;  5KA6 A;  4PEL A;  1FXH A;  4L8J A;  2YIA A;  4DK0 A;  4QE9 A;  3ZN0 A;  1EN5 A;  4CS3 A;  4JI2 B;  4Z1V A;  1DTO A;  1GKF A;  2UXB B;  4HZ3 A;  4DR6 B;  4X20 B;  3UT5 A;  4K35 A;  4LF4 O;  1L0L H;  3RYH A;  2A79 B;  1M57 C;  4WFA V;  3B77 A;  3H1I H;  3JAW B;  3W7S A;  4QE7 A;  3B2E E; 
#chains in the Genus database with same CATH homology
 2AZ0 A;  3O9O A;  3ZBH A;  2KG7 A;  3GWK C;  4I0X B;  3FD9 A;  2VS0 A;  4LWS B;  3TXQ A;  3FAV A;  4ABM A;  3GVM A;  3Q4H A;  2KG7 B;  1WA8 A;  3G80 A;  2AZ2 A;  2DE0 X;  2VRZ A;  3FAV B;  4GZR B;  3Q4H B;  3TXS A;  4I0X A;  2B9Z A;  1WA8 B;  4LWS A;  3HR0 A;  3OGI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...