2OTLV

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2otlV00
2D3OW 1M1KW 5DM6V 4WFAV 2QA4V 1M90W 1R73A 3CC2V 3CCEV 1QVGU 3CCVV 1VQ8V 1VQ4V 1QVFU 3G4SV 1YHQV 3G6EV 1K8AW 1W2BU 3CD6V 1VQMV 2OTLV 1VQNV 3CCQV 3CCSV 2QEXV 2OTJV 3I55V 1K9MW 1S72V 1YJWV 1YJ9V 3CMAV 3CPWU 1VQ7V 1VQKV 1YI2V 1KC8W 1VQ9V 1VQOV 1NJIW 3OW2U 1VQLV 1YJNV 1YIJV 3CC4V 1K73W 3G71V 3CXCU 1N8RW 1VQPV 3CCJV 1Q7YW 3I56V 4WF9V 3CCUV 3CCRV 1Q82W 1VQ5V 3CMEV 4WFBV 4WCEV 1KD1W 1VQ6V 1KQSU 1Q81W 1JJ2U 1Q86W 3CCLV 1YITV 3CC7V 3CCMV
chains in the Genus database with same CATH superfamily
1G8MA 2DYSC 4DV7B 4U3JA 4U7OA 4KP4A 1N32B 1S3JA 3OUFA 1X4TA 2KSDA 3FX7A 1IXBA 3AG3B 4KFMA 4P9PA 5EIBC 1XMOB 3A8TA 1ZWIC 5GW7A 4IYHA 1L0NH 2UXDB 1KKCA 3OR6C 3SYPA 3OM3B 3DGEA 2KG7A 3ZIAG 2Q4PA 3K3WA 1M4UA 5JH7B 1DK1A 3CCEV 4G2KA 3BRCA 2L6LA 1L8DA 3N2GB 2QJ1A 4GCZA 2XT9A 4LF5O 1XNRB 2FMLA 3UT5B 2YC0A 4NTWA 4YY3O 4OX9O 1QU7A 2HVJC 1Q43A 3CRAA 3M7MX 3L70H 1H2KA 2DE0X 1OCOC 2DYRC 4OXSA 2XAJA 2KG7B 4JI6B 4JYBA 3RVZA 1Q5OA 4UV9A 1EN5A 4J9ZB 2JVDA 3CMEV 3EHBB 2N04A 4JI1O 3K5MA 3IC9A 1PNMA 5JWPA 5DN6G 1K8AW 4UCOA 2QKSA 2OYQA 1DLBA 3TK1A 4FZ1A 4PA3A 4PHZA 5ITZA 3CMAV 4J41A 4UCUA 3RN4A 3CSXA 4HZ3A 3U10A 4WFFA 3T1YO 1E1QG 4QE9A 1YTFD 1NVPD 3IC7A 3UO2A 2Q0AA 2UUBB 2YEVA 4MW8A 4DV0B 1Q3EA 1HWYA 1BL8A 1M9NA 1NVPB 3CCSV 1OZ0A 2Y0PA 3O9OA 2JGDA 1FXKC 4X62O 3OW2U 3RBZA 3M99B 1GN4A 4X88A 3WU2Z 4Z2WA 2A7WA 4RUFA 1AJQA 4G27B 5KHHA 4R8CA 5ITZB 1W59A 4LF4O 1PNLA 1PNKA 1IBMB 2Q5ZA 2ZM6O 4JI3O 1XILA 2X0LA 4DK1A 1K73W 2N05A 3EXAA 4DV3B 2R9AA 2YSUB 4JI8O 4I0XA 2A3QA 2YEVB 4LCUC 4ASUG 3SPCA 2GTAA 4DV7O 1M90W 5B1NA 5LP6B 2AHYA 3B2EE 1N32O 1NR1A 2QEXV 1FYJA 2OCCC 3B8NA 1WB8A 3E8BA 1ZL8A 1VQLV 3F5TA 1XMOO 1FS0G 5D5PA 1Q7YW 2UXDO 5LXTA 4Z1MG 3A2FA 3KCYA 2OT5A 3TCUA 1P7GA 1MZEA 4LBEC 2DW4A 1YEWA 1SQXH 3H1HH 1W0KG 2RCVA 1Y4MA 4DW0A 2JJ1G 5JJEB 2BOCC 4I0XB 4F4LA 2P90A 1PP9H 4N21A 1XNRO 2EIMB 1BQ0A 1P49A 1R6TA 2ETNA 2ZCEA 1IZ3A 3CP1A 3CCRV 4CS2A 5KX5A 5IYZA 3G80A 2IU0A 4LFCB 4DR7B 3HKEA 1E1RG 4F6RA 3OUSA 4MVMA 2OTLV 4JYYA 1SF9A 3ZHQA 5LXTB 2GDSA 3K57A 4PDRA 3CHXA 2Q7EA 4JI6O 1R3JC 2VRZA 5DEDA 3AK2A 2VS0A 3ABLB 4EKWA 4H44B 1URFA 1XL6A 1GTOA 2E3CA 3CC2V 1VF5B 4FJCC 4JPRA 4CC6A 1N0JA 5IE9A 4DR3B 3ZEDA 1MSDA 1VARA 5KX5B 4J7KA 4MT8A 3SPHA 5IYZB 4DV2B 4Z1VA 1MABG 2FYUH 5FNVA 2GHYA 4PA4A 4B3TB 2ZXWC 4MS2A 3HKEB 4F6RB 3QVNA 1VQ5V 3L73H 1TAEA 1JJ2U 2XAGA 4PDLA 4DV1B 2UUBO 4GUNA 4OGQB 3SJAC 4DV0O 2Y4TA 1B06A 1KECA 2JRIA 3OR7C 3ABMB 4UUJC 4KHPB 1Q6UA 3VBBA 1JA8A 5H6QA 3OGIB 5BXZA 2XASA 2JJ2G 3I56V 1PM9A 2QR4A 5IYBO 1BSMA 4O2AA 1WP8A 3BCCH 5B1AC 1OCZC 3L9DA 2IJKA 5DM6V 1SZTA 2A79B 4DRXA 2HJFC 3H9VA 1RM1B 5JJNB 5FNVB 1IBMO 5CMUA 3SPJA 1CXZB 1V55B 3UQ8A 4UCTA 5GONA 5FPRA 5KMGA 3QO5A 5LGTA 1FXHA 4DV3O 1TGOA 1NS1A 3VQVA 3K0DA 4JTDB 4J10A 4DO2A 2XUMA 1XQ8A 3K0GA 1N0NA 4X1KA 3LDEA 3T1HB 1R3IC 2EIJB 3MD0A 2CTWA 1BE3H 1K5SA 5CA1A 3JD4A 1YI2V 5H6RA 4O2AB 1ZUQA 1W0JG 1U97A 2JEXA 2GBOA 2R70A 4LFAB 4DRXB 4DYLA 3J80N 2F43G 4W4LA 1H2MA 4D7TA 1SERA 5GONB 5KMGB 1QCEA 3TETA 2E76B 1T5EA 4YIOA 3G4SV 3ICXA 3KCXA 4NVPA 4PV1B 2R9RB 4CH4A 1EZVH 3BAAA 1TUEB 2EIKC 2HEPA 3ZHTA 3L71H 2EZOA 1B3QA 4X1KB 2K9PA 3K5NA 2ZE6A 2ARHA 2YI9A 3CC7V 4LFCO 3RYFA 4DR7O 5CA1B 4Q20A 4LC1A 3CXHF 5L3CA 3CRQA 1K33A 4H0LB 2ILMA 2Z3YA 4O4JA 4GX2A 3D36C 4GLXA 2UXCB 1M56B 2AHZA 4LH7A 1G6UA 1AI7A 3J7AU 3CX5F 1YDXA 2WA4A 1R6KA 3HKDA 4DK0A 1FKAO 1FD9A 4EEQA 2QM7A 3WB2A 3K5OA 1S76D 1AJPA 4LP8A 2HKOA 4DV2O 2A0LA 5IYCO 2ZDIA 4B3TO 3FB7C 3RYFB 3JYCA 2E5LB 5B5EZ 1DTOA 1AB3A 5LOVB 4CBCA 1YJWV 4O4JB 4DV1O 2RN9A 1K92A 1AJNA 4RQFA 3A0RA 4ZHQB 2XOKG 2W0FC 4KHPO 4TOIA 5KHJA 4PA7A 3JCZA 3C90A 4WF9V 2XAFA 1KB9F 3HKDB 1XEQA 4UCRA 4TV9B 4TUYA 4PDMA 2PY5A 4PA6A 1F4NA 2KQXA 5KAFZ 3WB0A 1S0VA 3AG3C 2YUAA 4JI4B 4R7CA 4RQEA 2HR3A 2MW2B 2PZSA 5JJJB 1JR9A 1EFRG 4CC5A 3OE7G 3JSNA 1Q90D 4K3AA 4J9YB 4AQYB 1VQ8V 1R1BA 2JIZG 3JARA 3OFNG 3E8GA 3T1HO 4WBNB 3RW0A 1M57B 4FLZA 4I9WA 4JTAB 2WLJA 4FM1A 1VQKV 5KA5A 4O2BA 4TUYB 1VQPV 5J2UA 1I5XA 4LFAO 1TUBA 1NI8A 1K4DC 1NT2B 1ZLZA 4LF7B 5E1AC 4KUMA 2CE4A 1NR7A 2B5UA 2Q9LA 3ZCCA 5L3EA 1Y66A 2WSSG 1VQNV 3BY6A 5IY5C 1J5EB 5CA3A 1TA8A 3CJHB 4UCSA 4IL6Z 4I50A 3GB7C 3JARB 1GAXA 2W6IG 2X6AA 4UXNA 4XDLA 1I08A 2GTSA 3H01A 3RWRD 5CBHA 1AROP 4O2BB 4RAIA 2YXYA 2F4VB 5J2UB 3ABKB 3ZN1A 1TUBB 2W6JG 3A0BZ 1O9HA 3ZRXA 1P4RA 5KHKA 2UXCO 3Q4HA 1A32A 2QWOB 1K97A 4BWAA 1HNWB 1XI1A 1N36B 2ZIOA 1XUQA 4FIPC 4DR1B 3B40A 1GKFA 2HG5C 3G6EV 1W2BU 4I50B 1MNGA 5C8YB 2EULA 3I55V 2ZQMA 2IJIA 3CPWU 4TSFG 3N2KA 3TXSA 5K1XA 2ZR3A 1Q6IA 1I5YA 3CYOA 4JTCB 2E5LO 1SQQH 1Y6XA 4FM0A 4BIOA 1AVMA 5B1OA 2QKAA 1R3KC 2P22C 3NR7A 1EN4A 3MHHC 2ODMA 4WFEA 3ZMZA 3Q4HB 4BAYA 4QNHB 4YIPA 1NKDA 1B6QA 3X2QB 1OHHG 3ASNB 3WB1A 1TVKB 3QF7A 1SQPH 3CWBH 4KXRA 1IURA 1HP8A 3RYCA 1N33B 4U3JB 1SESA 2LFRA 1VQ9V 2Y69B 1JPXA 2RDCA 3QTCA 5LP6C 3F5WC 3N2KB 5TISZ 1OV9A 1CEZA 3RYIA 2HLDG 4K8ZA 4JI4O 1AILA 2ITDC 2LFSA 3ZX6A 3E22A 4LF8B 3BEHA 1UJWB 1G4YB 3K5LA 2QGNA 3JD1A 3OEHG 4AQYO 1QVGU 1VF7A 4HBNA 3IAYA 4UVCA 1GO3F 1P7BA 2Q69A 3KZIZ 3RYCB 1Z5VA 2WLMA 5IJ9A 5LMNB 4H13B 1YJ9V 2EIMC 2NR5A 3F7YC 5L3DA 4X64O 5B3SC 3RYHA 2KB1A 2IM9A 2LO1A 4WFHA 1AI6A 4JF3A 3RYIB 4LF7O 1R73A 5LHGA 1THZA 3QO7A 1J5EO 1YTFB 2ZE5A 3E22B 3LSUA 4DW1A 3C3SA 3HKCA 3BPZA 4ZIBA 2AW9A 4DXWA 3ETEA 2AZ0A 3OD4A 1CP9A 3FB8C 4NYKA 2GSMB 1COWG 5IJ9B 4J11A 1QLEC 1R3LC 3ZRWA 1SC5B 1HDJA 4R6ZA 2Q67A 2RMKB 2F4VO 4P9OA 3RYHB 1R6NA 2H8PC 2K1EA 1IDSA 1U96A 4PA9A 2Q0OC 2Y0IA 1EM1A 1HNZB 1FXVA 3AG1B 3D3QA 1HNWO 1N36O 1H8EG 2WPDG 4DR4B 5L3GA 2IH1C 5IT9N 4WFAV 4DR1O 1I0HA 5GTIZ 1GM7A 3HKCB 2JGDB 1JMKC 4K0KB 1FFTB 2X6CA 1M5IA 1F23A 4UVBA 4KL1A 2R9IA 4IHJA 1GN3A 3AG7A 2PUSA 3MAQA 1BT8A 4QPJA 4P30A 3ZRWB 3G67A 2P5OA 2GUZA 4B7KA 4ZBMA 4MVQA 1J95A 2YIAA 4JAVA 2FB5A 1RM1C 2ADQB 5KHIA 2LP7A 1V55C 1H2NA 4FK5C 2W0XA 1OCRB 1XMQB 5B1BB 1SZXA 5LA6A 3LNNA 4J80A 1K7DA 1N33O 1FFXA 4WCEV 1YF2A 1FXKA 4XDKA 4CH3A 1M1KW 4IHJB 4LF9B 4PI0A 1MZFA 1NTZH 1ZL8B 5LGUA 2V1DA 3TJTA 1DF4A 2PTMA 2ZINA 2GUZB 2OCHA 4ZI7A 2V7QG 3OGCC 4TT3G 3T4ZA 2B9ZA 5L3FA 1QR8A 4LF8O 4MVSA 5JCOA 1FPOA 3BVOA 3I5DA 2CK3G 1WB7A 5LMNO 1QNMA 2Q7GA 3VOUA 2ZNIA 1UFIA 4X1YA 4BW5A 2UXBO 4NR1A 4B3SB 2JDIG 5KAIZ 4ZI7B 1ZSPA 1WA8A 3SPGA 2WLLA 4DUYB 1D5AA 1RPRA 4TWKA 1MG1A 1EBOA 3E8HA 1M56C 3JATA 1MOFA 4E4EA 2Q68A 3KKYA 4H37A 4QGPA 2UXNA 1S5LZ 1SQFA 5LHHA 4FLVA 4LF6B 4O4HA 1NU1H 5J9PC 3MHSC 2P67A 3PJSK 3T2MA 5HFLA 2XHBA 4X1YB 3THOA 1D5NA 4JI0B 1HNXB 1HNZO 2CAZC 2Q7HA 3E83A 4GX0A 2ZT9B 3EVKA 5JVDA 3ZS8C 1SQGA 2F95B 5KA6A 1WA8B 4DR4O 2WLLB 4IGGA 2R72A 1Q82W 2MK3A 4LR3A 1JCHA 3CRCA 2PYJA 4K0KO 3JATB 2WLHA 4I55A 5BMVA 1WP7A 2UU9B 1KC8W 3FB6C 4JV5B 2GV9A 2LGWA 1NJIW 1AI4A 2HJDA 4L8JA 4O4HB 1N8RW 1GN2A 3P30A 2JEUA 2ZE7A 1BMFG 4L87A 4U3FH 4LNUA 2Y4UA 4AHCA 5BR8O 3ZMSA 5F2VO 1UPGA 4XBFA 3OTFA 3JD3A 2RQ6A 5JVDB 3SGIA 1XMQO 1BS3A 5LYJA 1VMGA 1F51A 2HHHB 4I9QA 2B1GA 4FFBA 5A9GA 3FFQA 3BA9A 1GMGA 2DQ0A 5FPOA 4I55B 1HR0B 3FYIB 3R66A 3CCVV 4LF9O 1BQZA 3K04A 2X6BA 1M57C 1S72V 1WN7A 1G1XB 4LNUB 1AR4A 1E79G 1YJNV 3P3NA 1WAZA 2UUCO 3G71V 3K9SA 4EFBA 2CDYA 5EC2C 3UO3A 2WLNA 2YXHA 3ZJZA 3CCLV 5BY1A 2D3OW 3E8FA 4MVUA 4FFBB 4C7UA 4GX5A 2XTAA 4NKGB 4YJ2A 1OJHA 1Y74A 2F1MA 2YS8A 3OMIB 4B7EA 4B3SO 5LHIA 1NTKH 5KUMA 5EZYA 1IBLO 4CS3A 4Q6GA 4EFEA 1AP5A 3K79A 4HYOA 4DUYO 1K9MW 5EYPA 3BHPA 1YCIA 3CE2A 4DV6B 1MA1A 3AG4B 5AG2A 4JZGA 2PI4A 1Q86W 2EINB 4LF6O 2NN4A 2QWPB 4HAMA 3HKBA 5LGNA 4YXWG 2JK5C 4YJ2B 4NXNO 1Y74B 3S3XA 1OCCB 3UKMA 2VQFO 4JI0O 3ZRVA 1HNXO 1K34A 3AG2B 4D6TH 3WFVA 3OTOB 3FB5C 1YZBA 4TQFA 2AXTZ 1SA0A 4GKJB 3ZMVA 4LFBB 3ZN0A 4NXMB 5EYPB 1I7FA 4IIJA 4AI8A 1VP7A 4PJ0Z 3VQXA 2RNBA 4MW3A 4X9QA 2BTQA 4I7ZB 3X2QC 2UU9O 1Q8IA 5K1PA 3ASNC 4JV5O 2P6JA 4X64B 2F93B 1XREA 3HKBB 4I5SA 3JD2A 1VF6A 1JX9A 1RSOA 4JYCA 1US6A 3LDCA 5BZBA 3N27A 1JVMA 1L0LH 1KMIZ 3SYAA 2KKWA 4O4IA 1SA0B 4CS4A 3ABTA 1RFYA 2N74A 4FLWA 4F6EA 1GM9A 2HVKC 2ZNJA 2P06A 2HHHO 4FLYA 1QBZA 4B3MB 4IIJB 4JASA 3SJCC 4CH5A 3JAKA 2QSAA 1HR0O 1V54B 2CGOA 4EB6A 3ZBHA 4X65B 5EK0A 2PGGA 3MDSA 4J42A 1FAFA 1SKVA 2EILB 1WPBA 4W4KA 4BIZA 5H5NA 5EBWC 1IBKB 1VQ7V 1RSOB 4XDJA 2QWNB 1H8HG 1K3EA 3W7UA 1K5QA 4CH6A 4DUZB 3CC4V 1NH2D 4K35A 5CB4A 3LNMB 3WG7B 4JYAB 3RFRA 1NH2B 3SPIA 4O4IB 2G38A 2ZR2A 1AP6A 1YVWA 2ADPA 3M8AA 1P84F 4DR6B 4J7ZA 1VQMV 1S5JA 5JH7A 4MTFA 3DTUB 1FJGO 3JAKB 5H2FZ 5IWAB 4QPKA 3P3PA 1SS3A 2QDOA 4X8AA 4EB6B 2FTKA 2BSKA 3QG5A 1LUWA 1PL0A 3CCMV 4UV8A 4DV5B 4MTXA 1VQ4V 4RO2A 1YHQV 3UCSC 2LJ2A 1PPJH 2LW7A 5CB4B 2Q73A 3B8MA 4DV6O 2IBZH 2YIDA 2OIGA 3AG1C 2VWJA 4AILC 2BOBC 2FKXA 3L75H 2AGAA 3JD0A 2V4DA 3JCUZ 2NLJC 3S3WA 2OWOA 2E74B 3T1CA 4JI2O 2LQTA 3VQWA 4YHHB 1F7YA 3ASOB 2BSKB 3OTOO 4JI5B 3R65A 2IJJA 4GKJO 1SQBH 4LFBO 1Q81W 2A9HA 4NXMO 2H3OA 4NTXA 2IW5A 4OPHA 1YXBA 5IY5B 3FD9A 1OCRC 5B1BC 3HB3B 4FFKA 1JJOA 5EC1C 3SDLA 4HNAA 2ZE8A 3ML0A 2UXBB 4RWUA 1RPOA 2P4VA 4I4TA 2Z0AA 3K59A 3ETDA 1ZAUA 1AI5A 3H1IH 1M93A 4B3MO 1NBMG 4PI2A 3RVYA 3ABLC 2PYLA 1IX9A 3DC6A 4X65O 2DYSB 3IJ4A 3K06A 1QVFU 1V9PA 3U11A 5EIBD 2AZ2A 2YXLA 5CN0A 1ROPA 4HNAB 1IBKO 5LP6A 4DUZO 4BIUA 4X89A 1KP2A 4U7NA 3K03A 3F7VC 4JYAO 3J81N 4FMTA 4I4TB 2ZKOA 3APQA 4X1IA 4GZRB 2FL4A 1ENVA 3KG2A 4DR6O 3E89A 3P32A 4X66O 3SYQA 5IWAO 3K08A 3NXSA 4FLXA 5JCOC 5LMUO 5FL7G 3ABMC 3LSSA 3SYCA 3STZC 2XAQA 4DV5O 5KUKA 4BW9A 1H38A 1AR5A 5BR8B 1QLNA 1GM8A 4DR2B 3ZMTA 3CD6V 4NTYA 1XDCA 3G6BA 4MVOA 5KHGA 2BE3A 1OCOB 4UB8Z 1EZJA 2DYRB 5CBGA 4ZKIA 2CTRA 2YI8A 4X1IB 1PV0A 3RT3C 3B4SA 4FZ0A 1XL4A 2LGQA 3L72H 2ZIMA 1BGYH 4UFZA 3D8CA 2IU3A 1F4MA 5L3BA 4QE7A 3EFFK 2EBOA 3D3IA 3CRRA 4YHHO 2OTJV 2EIJC 4ZOLA 3JAMN 1WJZA 4B3RB 2CTQA 3H1JH 1HW7A 3HPLC 4N23A 1QR9A 2P7TC 5B3SB 3ZHSA 4JI5O 4GT1A 2UUCB 4K8XA 4JAAA 4O4LA 3SJQC 5IDJA 2EZPA 4PD4F 3ABUA 1KBHA 2Q8VA 4UCVA 1I94B 3GVMA 3C3TA 5LA6B 5CA0A 2P4KA 4OPAA 1ZTEA 5E79Z 3B09A 2DMXA 4FPPA 2Q6AA 5GTHZ 1B04A 1FFXB 3VQYA 1RP3B 2M6YA 2QWQB 5FLXN 1FXKB 3CRMA 1QHTA 4H33A 3DSQA 4FLUA 2CH7A 4ZOLB 1BHBA 3B77A 3ZHRA 1QLEB 1X59A 2BCCH 5CBFA 1IBLB 1PL4A 1SQVH 2JS5A 4O4LB 2RJZA 1PKXA 3W7TA 5H9CA 4R50A 3BFRA 2UUAB 1MMMA 5DECA 1KD1W 3ZRSA 5CA0B 4MVZA 1YITV 1CPYA 2PI5A 2C2AA 2H94A 2JGUA 5IJ0A 2A06H 3PN1A 3K58A 1Y67A 4ABMA 4NXNB 1QQCA 2EJ7A 2VQFB 2OCCB 4P2ZA 2CH7B 1YIJV 1KP3A 1KU9A 4RUEA 1O9GA 1IVSA 1WNSA 3QNEA 1WLEA 4QIWF 2Y48A 4X20A 3STLC 2VQEB 1BHAA 2HFEC 2WA3A 1N4CA 3W7SA 2EX3A 4QJFB 2L35A 5C93A 2DOSA 1K4CC 4GKKB 3AG4C 2NNUA 2XAHA 5IJ0B 3DC5A 4JI7B 1XOUA 2CTPA 2EINC 2DWEC 5EBLC 1MSWD 2PF4E 3APOA 1YSCA 3GWKC 3AK1A 4DV4B 2D2CB 3ZMUA 1JFFA 4DR2O 3LSQA 2ZDIC 5EBMC 3RGBA 1OCCC 3T4DA 1GK9A 2QE7G 3AG2C 4X20B 2JS3A 3L74H 2HP8A 3CXCU 5LBQA 1VIBA 1ZX3A 2YIBA 3LDDA 2XNDG 3E35A 5BMVB 3DXRA 3TXQA 1VEWA 2QKCA 4FM2A 4JGSA 3FAVA 5HFMA 1ORQC 1GRJA 3TGUH 1LNQA 4JAUA 1DGSA 4B3RO 3HR0A 1N34B 4MTGA 5B66Z 1XBLA 2ZXWB 1JFFB 2ZD9A 4ICGA 4GYCB 4DR5B 3O65A 2YIBD 2UXXA 5LYJB 4NB5A 1XNQB 1I94O 3UM7A 2Z5UA 1XHZA 4LH6A 5LOVA 2DQ3A 4JZ2A 1BZKA 3CEIA 1FJGB 4BR6A 5KLVH 1KKDA 4FLTA 4UB6Z 3DXRB 4ZHQA 3CCJV 2IH3C 1VQ6V 3FAVB 1V54C 2WLIA 3FKSG 5B1AB 4WFGA 1OCZB 2QA4V 4DR3O 3JALA 2EILC 1H2SB 4TV9A 3ABKC 3OT7A 3AEIA 1NTMH 1DF5A 3FYEB 1VF6C 3SYOA 1EN6A 3IFXA 2OIEA 2ITCC 1S5HC 2UUAO 3WG7C 1KQSU 5JQGA 1Z5WA 3H1KH 3OAAG 1BCCH 2M7WA 3ETQA 3OEEG 1Y76A 2QWRB 4JI2B 2DJVA 2E75B 3JASA 3ZHVA 4G28B 2WLIB 4LF5B 5A2QN 4YJ3A 4WBNA 2X7RB 5EZYB 2DWDC 3JALB 3CCUV 3SJBC 1AR1B 3K9AA 1KUQA 4MTOA 4YY3B 3D36A 2VQEO 4OX9B 4E2LA 4MVRA 2WLKA 5IYDO 1Z2GA 4GX1A 4CZZA 2F66C 3H1LH 5D5QA 1Q6HA 2WAMA 2BTOA 4TV8A 1JQ0A 4GKKO 3JSLA 2EIKB 2YICA 5JQGB 1KYOF 4LWSA 1PD3A 2YDEA 4JI7O 4UVAA 3CJHA 1GN6A 3OMNB 3LUTB 3ZHUA 1Y76B 4JI1B 2Y69C 2ATKC 3CS5A 4D7SA 4DV4O 3JAWA 3JASB 3E86A 2EJRA 4YJ3B 2B1IA 3ASOC 4MSWC 1XHXA 1JOYA 3W7XA 3QO8A 3E2EA 2QM4A 4PELA 5J2TA 3T1YB 3OMAB 4A5UB 1D2DA 3SR2C 1S77D 5LL6Y 1GH6A 2BTQB 4TV8B 1WPXA 2QTSA 3BABA 1H2GA 3AK3A 2F23A 1IXMA 1SRYA 3GWOA 4LWSB 3CCQV 3CB2A 4B08A 1NZ6A 2VWKA 4IT5A 1N34O 1NQTA 4X62B 2QTOA 5C8YA 3JAWB 1LR1A 4FVMA 4WFBV 2CUGA 4PDVA 2QM8A 4DR5O 4IYIA 2LW1A 4J7JA 1XNQO 4LF4B 4X66B 2IJHA 5J2TB 2ZM6B 4JI3B 4TQDA 3W7WA 1VQOV 3IGAC 3ETGA 2WWWA 5LMUB 3U0ZA 1LUVA 3N2GA 3BA8A 3A0HZ 2O57A 4JI8B 1TVKA 1SETA 2DN9A 1L1FA 2CGNA 3UT5A 1H2LA
chains in the Genus database with same CATH topology
1G8MA 2DYSC 1ENVA 3KG2A 5J9PC 3MHSC 2P67A 1K92A 1AJNA 3E89A 3P32A 4U7OA 3PJSK 4RQFA 4KP4A 1S3JA 3OUFA 5HFLA 3T2MA 3A0RA 3SYQA 2XOKG 3K08A 3NXSA 4KFMA 3AG3B 2W0FC 4P9PA 5FL7G 3ABMC 3E83A 4PA7A 3LSSA 4GX0A 1ZWIC 3JCZA 5GW7A 3SYCA 4WF9V 3STZC 2XAFA 3SYPA 3OR6C 5KA6A 3OM3B 3DGEA 3ZIAG 2XAQA 2WLLB 3K3WA 1Q82W 2MK3A 5KUKA 1H38A 4PDMA 3CCEV 4G2KA 1JCHA 1QLNA 1GM8A 4PA6A 3ZMTA 2WLHA 3CD6V 1F4NA 4MVOA 1OCOB 1EZJA 2DYRB 4GCZA 1S0VA 3AG3C 5CBGA 4ZKIA 1KC8W 3FB6C 1NJIW 4R7CA 4RQEA 2HR3A 1AI4A 1N8RW 1XL4A 2JEUA 3P30A 1BMFG 4L87A 1EFRG 3OE7G 2HVJC 2IU3A 1F4MA 5L3BA 3ZMSA 4QE7A 4J9YB 3EFFK 2EBOA 1VQ8V 2JIZG 4XBFA 3OFNG 3D3IA 3E8GA 3JD3A 1OCOC 2DYRC 3RW0A 2OTJV 1M57B 2EIJC 4I9WA 4JTAB 4OXSA 2WLJA 2XAJA 1VQKV 5KA5A 3HPLC 4N23A 1F51A 1QR9A 2P7TC 5B3SB 2B1GA 4GT1A 4JYBA 1VQPV 1I5XA 3RVZA 4UV9A 1GMGA 1K4DC 4J9ZB 3CMEV 3EHBB 3SJQC 5IDJA 2DQ0A 2EZPA 5E1AC 4KUMA 3ABUA 3FYIB 1NR7A 2B5UA 3ZCCA 1PNMA 3CCVV 5DN6G 1K8AW 3K04A 5L3EA 2X6BA 1Y66A 2QKSA 2WSSG 1VQNV 1DLBA 1M57C 3BY6A 3TK1A 5IY5C 4PA3A 1S72V 5CA3A 3CMAV 4FPPA 2Q6AA 1E79G 1YJNV 1FXKB 3G71V 3GB7C 4HZ3A 4WFFA 4H33A 5EC2C 2WLNA 1E1QG 2W6IG 2X6AA 4UXNA 4QE9A 3ZJZA 1NVPD 3CCLV 1YTFD 3IC7A 4XDLA 2D3OW 1BHBA 3B77A 3E8FA 1QLEB 5CBFA 3H01A 2YEVA 4MVUA 4MW8A 5CBHA 1AROP 4RAIA 1HWYA 1BL8A 1M9NA 1NVPB 3CCSV 1OZ0A 3ABKB 3ZN1A 4GX5A 1PKXA 2W6JG 3ZRXA 1P4RA 1FXKC 3OW2U 3W7TA 5H9CA 3RBZA 1K97A 3M99B 4R50A 4X88A 3OMIB 5LHIA 1KD1W 3ZRSA 5KUMA 4MVZA 4RUFA 1AJQA 1YITV 1CPYA 4G27B 2PI5A 2C2AA 4FIPC 2H94A 4R8CA 1GKFA 1PNLA 2HG5C 1PNKA 3G6EV 1W2BU 3K79A 4HYOA 3I55V 1K9MW 2ZQMA 2IJIA 3CPWU 4TSFG 2X0LA 2OCCB 4P2ZA 3AG4B 1YIJV 1K73W 1KP3A 2ZR3A 4RUEA 1I5YA 3CYOA 4JTCB 2YSUB 3QNEA 1WLEA 2YEVB 4LCUC 4ASUG 4QIWF 2PI4A 5B1OA 3SPCA 2Y48A 2EINB 1Q86W 1R3KC 3STLC 1BHAA 2HFEC 1M90W 4HAMA 3MHHC 5B1NA 5LGNA 2AHYA 4WFEA 4YXWG 2JK5C 3W7SA 3ZMZA 1NR1A 4BAYA 4QNHB 3UKMA 1OCCB 2QEXV 1NKDA 4QJFB 1B6QA 5C93A 3X2QB 3ZRVA 1K4CC 2OCCC 1OHHG 3ASNB 3AG4C 3B8NA 1K34A 3E8BA 3AG2B 1VQLV 3WFVA 2NNUA 2XAHA 3FB5C 1FS0G 1Q7YW 4Z1MG 2OT5A 1SESA 3TCUA 3ZMVA 2EINC 2DWEC 4LBEC 5EBLC 1MSWD 2LFRA 1VQ9V 2DW4A 3ZN0A 2Y69B 1YSCA 1JPXA 3ZMUA 3F5WC 1W0KG 1CEZA 1Y4MA 3LSQA 2ZDIC 2HLDG 4MW3A 5EBMC 1OCCC 3T4DA 1GK9A 2JJ1G 2QE7G 3X2QC 2BOCC 4F4LA 2P90A 3ASNC 4N21A 2EIMB 3AG2C 2ITDC 2LFSA 2P6JA 3CXCU 5LBQA 3LDDA 2XNDG 3CP1A 3BEHA 4I5SA 1UJWB 1G4YB 3CCRV 3JD2A 1JX9A 4JYCA 3E35A 3JD1A 3OEHG 3LDCA 5BZBA 2IU0A 1JVMA 1QVGU 1E1RG 3OUSA 4JGSA 4MVMA 1GO3F 1P7BA 2Q69A 1ORQC 4UVCA 3SYAA 5HFMA 2OTLV 1LNQA 4JAUA 2WLMA 3ABTA 1YJ9V 4PDRA 2EIMC 1GM9A 2HVKC 3F7YC 5L3DA 4MTGA 5B3SC 1QBZA 1R3JC 2KB1A 4JASA 4WFHA 1AI6A 2ZXWB 4JF3A 3ABLB 2ZD9A 4EKWA 1V54B 1XL6A 1GTOA 3CC2V 1R73A 2UXXA 5LHGA 4FJCC 1THZA 4JPRA 5EK0A 3UM7A 2Z5UA 2EILB 3QO7A 1YTFB 2DQ3A 4BIZA 5EBWC 1VQ7V 4MT8A 4XDJA 3W7UA 1H8HG 1K3EA 3SPHA 1K5QA 1KKDA 3CC4V 1MABG 4DXWA 1NH2D 2GHYA 4PA4A 2ZXWC 3CCJV 4MS2A 3ETEA 3LNMB 2IH3C 3WG7B 1CP9A 1VQ5V 1VQ6V 1V54C 3FB8C 2WLIA 1JJ2U 1NH2B 3FKSG 3SPIA 2GSMB 5B1AB 2XAGA 4WFGA 1COWG 1OCZB 2ZR2A 4PDLA 2QA4V 1QLEC 1R3LC 3ZRWA 4R6ZA 2EILC 2Q67A 4P9OA 1VQMV 1KECA 1R6NA 4MTFA 3DTUB 3OR7C 2H8PC 3ABKC 3AEIA 4QPKA 2K1EA 1DF5A 3FYEB 3SYOA 4PA9A 3ABMB 4UUJC 3VBBA 4X8AA 1FXVA 3AG1B 3IFXA 5H6QA 2ITCC 2XASA 1S5HC 2JJ2G 2FTKA 3I56V 3WG7C 5IYBO 1H8EG 2WPDG 1PL0A 1KQSU 5B1AC 5L3GA 1OCZC 2IH1C 3CCMV 2IJKA 4UV8A 5DM6V 4MTXA 4WFAV 1SZTA 1GM7A 2A79B 1VQ4V 4RO2A 2HJFC 3OAAG 1RM1B 1YHQV 1FFTB 2M7WA 2X6CA 3OEEG 5CMUA 3SPJA 1F23A 4UVBA 1V55B 2R9IA 3B8MA 4G28B 2WLIB 3AG1C 3QO5A 2X7RB 4QPJA 5LGTA 4P30A 1FXHA 2DWDC 3ZRWB 3CCUV 2BOBC 1AR1B 3K9AA 3K0DA 4MTOA 3D36A 3JD0A 4ZBMA 4MVQA 4E2LA 4JTDB 1J95A 4MVRA 4DO2A 2WLKA 4JAVA 5IYDO 2NLJC 4GX1A 3K0GA 4CZZA 1RM1C 3T1CA 3LDEA 2LP7A 1V55C 1R3IC 2WAMA 2EIJB 3MD0A 4FK5C 1OCRB 3ASOB 5B1BB 1K5SA 1JQ0A 3JD4A 1YI2V 5H6RA 1W0JG 2EIKB 1K7DA 2JEXA 1PD3A 3R65A 2IJJA 4UVAA 4WCEV 2F43G 3OMNB 1FXKA 1Q81W 3LUTB 2A9HA 4XDKA 2Y69C 1M1KW 2ATKC 1SERA 1QCEA 3TETA 3E86A 2EJRA 3G4SV 2IW5A 5LGUA 2B1IA 2V1DA 2R9RB 5IY5B 1OCRC 3ASOC 1DF4A 5B1BC 4MSWC 1JOYA 1TUEB 2EIKC 3HB3B 5EC1C 2V7QG 3QO8A 3W7XA 3OGCC 4TT3G 3T4ZA 3E2EA 5L3FA 1QR8A 2EZOA 4PELA 4MVSA 3OMAB 3ML0A 1S77D 3CC7V 1WPXA 4Q20A 1RPOA 4LC1A 1H2GA 5L3CA 1K33A 2CK3G 1IXMA 1SRYA 3GWOA 3CCQV 2Z3YA 3ETDA 4GX2A 1AI5A 1NQTA 3VOUA 1M56B 2QTOA 1NBMG 2AHZA 1AI7A 4BW5A 3RVYA 3ABLC 4WFBV 4PDVA 2QM8A 2DYSB 3K06A 2JDIG 1QVFU 1R6KA 2QM7A 3SPGA 2WLLA 5CN0A 1ROPA 2IJHA 1S76D 1AJPA 4LP8A 2HKOA 1RPRA 4TWKA 2A0LA 3W7WA 1VQOV 1MG1A 1EBOA 3E8HA 3ETGA 1M56C 2WWWA 1MOFA 3IGAC 4BIUA 2ZDIA 5IYCO 4X89A 1KP2A 3FB7C 4U7NA 3K03A 3F7VC 2Q68A 3JYCA 4FMTA 4H37A 2UXNA 1SETA 1DTOA 1L1FA 5LHHA 4CBCA 1YJWV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3O W;  1M1K W;  5DM6 V;  4WFA V;  2QA4 V;  1M90 W;  1R73 A;  3CC2 V;  3CCE V;  1QVG U;  3CCV V;  1VQ8 V;  1VQ4 V;  1QVF U;  3G4S V;  1YHQ V;  3G6E V;  1K8A W;  1W2B U;  3CD6 V;  1VQM V;  2OTL V;  1VQN V;  3CCQ V;  3CCS V;  2QEX V;  2OTJ V;  3I55 V;  1K9M W;  1S72 V;  1YJW V;  1YJ9 V;  3CMA V;  3CPW U;  1VQ7 V;  1VQK V;  1YI2 V;  1KC8 W;  1VQ9 V;  1VQO V;  1NJI W;  3OW2 U;  1VQL V;  1YJN V;  1YIJ V;  3CC4 V;  1K73 W;  3G71 V;  3CXC U;  1N8R W;  1VQP V;  3CCJ V;  1Q7Y W;  3I56 V;  4WF9 V;  3CCU V;  3CCR V;  1Q82 W;  1VQ5 V;  3CME V;  4WFB V;  4WCE V;  1KD1 W;  1VQ6 V;  1KQS U;  1Q81 W;  1JJ2 U;  1Q86 W;  3CCL V;  1YIT V;  3CC7 V;  3CCM V; 
#chains in the Genus database with same CATH topology
 1G8M A;  2DYS C;  4DV7 B;  4U3J A;  4U7O A;  4KP4 A;  1N32 B;  1S3J A;  3OUF A;  1X4T A;  2KSD A;  3FX7 A;  1IXB A;  3AG3 B;  4KFM A;  4P9P A;  5EIB C;  1XMO B;  3A8T A;  1ZWI C;  5GW7 A;  4IYH A;  1L0N H;  2UXD B;  1KKC A;  3OR6 C;  3SYP A;  3OM3 B;  3DGE A;  2KG7 A;  3ZIA G;  2Q4P A;  3K3W A;  1M4U A;  5JH7 B;  1DK1 A;  3CCE V;  4G2K A;  3BRC A;  2L6L A;  1L8D A;  3N2G B;  2QJ1 A;  4GCZ A;  2XT9 A;  4LF5 O;  1XNR B;  2FML A;  3UT5 B;  2YC0 A;  4NTW A;  4YY3 O;  4OX9 O;  1QU7 A;  2HVJ C;  1Q43 A;  3CRA A;  3M7M X;  3L70 H;  1H2K A;  2DE0 X;  1OCO C;  2DYR C;  4OXS A;  2XAJ A;  2KG7 B;  4JI6 B;  4JYB A;  3RVZ A;  1Q5O A;  4UV9 A;  1EN5 A;  4J9Z B;  2JVD A;  3CME V;  3EHB B;  2N04 A;  4JI1 O;  3K5M A;  3IC9 A;  1PNM A;  5JWP A;  5DN6 G;  1K8A W;  4UCO A;  2QKS A;  2OYQ A;  1DLB A;  3TK1 A;  4FZ1 A;  4PA3 A;  4PHZ A;  5ITZ A;  3CMA V;  4J41 A;  4UCU A;  3RN4 A;  3CSX A;  4HZ3 A;  3U10 A;  4WFF A;  3T1Y O;  1E1Q G;  4QE9 A;  1YTF D;  1NVP D;  3IC7 A;  3UO2 A;  2Q0A A;  2UUB B;  2YEV A;  4MW8 A;  4DV0 B;  1Q3E A;  1HWY A;  1BL8 A;  1M9N A;  1NVP B;  3CCS V;  1OZ0 A;  2Y0P A;  3O9O A;  2JGD A;  1FXK C;  4X62 O;  3OW2 U;  3RBZ A;  3M99 B;  1GN4 A;  4X88 A;  3WU2 Z;  4Z2W A;  2A7W A;  4RUF A;  1AJQ A;  4G27 B;  5KHH A;  4R8C A;  5ITZ B;  1W59 A;  4LF4 O;  1PNL A;  1PNK A;  1IBM B;  2Q5Z A;  2ZM6 O;  4JI3 O;  1XIL A;  2X0L A;  4DK1 A;  1K73 W;  2N05 A;  3EXA A;  4DV3 B;  2R9A A;  2YSU B;  4JI8 O;  4I0X A;  2A3Q A;  2YEV B;  4LCU C;  4ASU G;  3SPC A;  2GTA A;  4DV7 O;  1M90 W;  5B1N A;  5LP6 B;  2AHY A;  3B2E E;  1N32 O;  1NR1 A;  2QEX V;  1FYJ A;  2OCC C;  3B8N A;  1WB8 A;  3E8B A;  1ZL8 A;  1VQL V;  3F5T A;  1XMO O;  1FS0 G;  5D5P A;  1Q7Y W;  2UXD O;  5LXT A;  4Z1M G;  3A2F A;  3KCY A;  2OT5 A;  3TCU A;  1P7G A;  1MZE A;  4LBE C;  2DW4 A;  1YEW A;  1SQX H;  3H1H H;  1W0K G;  2RCV A;  1Y4M A;  4DW0 A;  2JJ1 G;  5JJE B;  2BOC C;  4I0X B;  4F4L A;  2P90 A;  1PP9 H;  4N21 A;  1XNR O;  2EIM B;  1BQ0 A;  1P49 A;  1R6T A;  2ETN A;  2ZCE A;  1IZ3 A;  3CP1 A;  3CCR V;  4CS2 A;  5KX5 A;  5IYZ A;  3G80 A;  2IU0 A;  4LFC B;  4DR7 B;  3HKE A;  1E1R G;  4F6R A;  3OUS A;  4MVM A;  2OTL V;  4JYY A;  1SF9 A;  3ZHQ A;  5LXT B;  2GDS A;  3K57 A;  4PDR A;  3CHX A;  2Q7E A;  4JI6 O;  1R3J C;  2VRZ A;  5DED A;  3AK2 A;  2VS0 A;  3ABL B;  4EKW A;  4H44 B;  1URF A;  1XL6 A;  1GTO A;  2E3C A;  3CC2 V;  1VF5 B;  4FJC C;  4JPR A;  4CC6 A;  1N0J A;  5IE9 A;  4DR3 B;  3ZED A;  1MSD A;  1VAR A;  5KX5 B;  4J7K A;  4MT8 A;  3SPH A;  5IYZ B;  4DV2 B;  4Z1V A;  1MAB G;  2FYU H;  5FNV A;  2GHY A;  4PA4 A;  4B3T B;  2ZXW C;  4MS2 A;  3HKE B;  4F6R B;  3QVN A;  1VQ5 V;  3L73 H;  1TAE A;  1JJ2 U;  2XAG A;  4PDL A;  4DV1 B;  2UUB O;  4GUN A;  4OGQ B;  3SJA C;  4DV0 O;  2Y4T A;  1B06 A;  1KEC A;  2JRI A;  3OR7 C;  3ABM B;  4UUJ C;  4KHP B;  1Q6U A;  3VBB A;  1JA8 A;  5H6Q A;  3OGI B;  5BXZ A;  2XAS A;  2JJ2 G;  3I56 V;  1PM9 A;  2QR4 A;  5IYB O;  1BSM A;  4O2A A;  1WP8 A;  3BCC H;  5B1A C;  1OCZ C;  3L9D A;  2IJK A;  5DM6 V;  1SZT A;  2A79 B;  4DRX A;  2HJF C;  3H9V A;  1RM1 B;  5JJN B;  5FNV B;  1IBM O;  5CMU A;  3SPJ A;  1CXZ B;  1V55 B;  3UQ8 A;  4UCT A;  5GON A;  5FPR A;  5KMG A;  3QO5 A;  5LGT A;  1FXH A;  4DV3 O;  1TGO A;  1NS1 A;  3VQV A;  3K0D A;  4JTD B;  4J10 A;  4DO2 A;  2XUM A;  1XQ8 A;  3K0G A;  1N0N A;  4X1K A;  3LDE A;  3T1H B;  1R3I C;  2EIJ B;  3MD0 A;  2CTW A;  1BE3 H;  1K5S A;  5CA1 A;  3JD4 A;  1YI2 V;  5H6R A;  4O2A B;  1ZUQ A;  1W0J G;  1U97 A;  2JEX A;  2GBO A;  2R70 A;  4LFA B;  4DRX B;  4DYL A;  3J80 N;  2F43 G;  4W4L A;  1H2M A;  4D7T A;  1SER A;  5GON B;  5KMG B;  1QCE A;  3TET A;  2E76 B;  1T5E A;  4YIO A;  3G4S V;  3ICX A;  3KCX A;  4NVP A;  4PV1 B;  2R9R B;  4CH4 A;  1EZV H;  3BAA A;  1TUE B;  2EIK C;  2HEP A;  3ZHT A;  3L71 H;  2EZO A;  1B3Q A;  4X1K B;  2K9P A;  3K5N A;  2ZE6 A;  2ARH A;  2YI9 A;  3CC7 V;  4LFC O;  3RYF A;  4DR7 O;  5CA1 B;  4Q20 A;  4LC1 A;  3CXH F;  5L3C A;  3CRQ A;  1K33 A;  4H0L B;  2ILM A;  2Z3Y A;  4O4J A;  4GX2 A;  3D36 C;  4GLX A;  2UXC B;  1M56 B;  2AHZ A;  4LH7 A;  1G6U A;  1AI7 A;  3J7A U;  3CX5 F;  1YDX A;  2WA4 A;  1R6K A;  3HKD A;  4DK0 A;  1FKA O;  1FD9 A;  4EEQ A;  2QM7 A;  3WB2 A;  3K5O A;  1S76 D;  1AJP A;  4LP8 A;  2HKO A;  4DV2 O;  2A0L A;  5IYC O;  2ZDI A;  4B3T O;  3FB7 C;  3RYF B;  3JYC A;  2E5L B;  5B5E Z;  1DTO A;  1AB3 A;  5LOV B;  4CBC A;  1YJW V;  4O4J B;  4DV1 O;  2RN9 A;  1K92 A;  1AJN A;  4RQF A;  3A0R A;  4ZHQ B;  2XOK G;  2W0F C;  4KHP O;  4TOI A;  5KHJ A;  4PA7 A;  3JCZ A;  3C90 A;  4WF9 V;  2XAF A;  1KB9 F;  3HKD B;  1XEQ A;  4UCR A;  4TV9 B;  4TUY A;  4PDM A;  2PY5 A;  4PA6 A;  1F4N A;  2KQX A;  5KAF Z;  3WB0 A;  1S0V A;  3AG3 C;  2YUA A;  4JI4 B;  4R7C A;  4RQE A;  2HR3 A;  2MW2 B;  2PZS A;  5JJJ B;  1JR9 A;  1EFR G;  4CC5 A;  3OE7 G;  3JSN A;  1Q90 D;  4K3A A;  4J9Y B;  4AQY B;  1VQ8 V;  1R1B A;  2JIZ G;  3JAR A;  3OFN G;  3E8G A;  3T1H O;  4WBN B;  3RW0 A;  1M57 B;  4FLZ A;  4I9W A;  4JTA B;  2WLJ A;  4FM1 A;  1VQK V;  5KA5 A;  4O2B A;  4TUY B;  1VQP V;  5J2U A;  1I5X A;  4LFA O;  1TUB A;  1NI8 A;  1K4D C;  1NT2 B;  1ZLZ A;  4LF7 B;  5E1A C;  4KUM A;  2CE4 A;  1NR7 A;  2B5U A;  2Q9L A;  3ZCC A;  5L3E A;  1Y66 A;  2WSS G;  1VQN V;  3BY6 A;  5IY5 C;  1J5E B;  5CA3 A;  1TA8 A;  3CJH B;  4UCS A;  4IL6 Z;  4I50 A;  3GB7 C;  3JAR B;  1GAX A;  2W6I G;  2X6A A;  4UXN A;  4XDL A;  1I08 A;  2GTS A;  3H01 A;  3RWR D;  5CBH A;  1ARO P;  4O2B B;  4RAI A;  2YXY A;  2F4V B;  5J2U B;  3ABK B;  3ZN1 A;  1TUB B;  2W6J G;  3A0B Z;  1O9H A;  3ZRX A;  1P4R A;  5KHK A;  2UXC O;  3Q4H A;  1A32 A;  2QWO B;  1K97 A;  4BWA A;  1HNW B;  1XI1 A;  1N36 B;  2ZIO A;  1XUQ A;  4FIP C;  4DR1 B;  3B40 A;  1GKF A;  2HG5 C;  3G6E V;  1W2B U;  4I50 B;  1MNG A;  5C8Y B;  2EUL A;  3I55 V;  2ZQM A;  2IJI A;  3CPW U;  4TSF G;  3N2K A;  3TXS A;  5K1X A;  2ZR3 A;  1Q6I A;  1I5Y A;  3CYO A;  4JTC B;  2E5L O;  1SQQ H;  1Y6X A;  4FM0 A;  4BIO A;  1AVM A;  5B1O A;  2QKA A;  1R3K C;  2P22 C;  3NR7 A;  1EN4 A;  3MHH C;  2ODM A;  4WFE A;  3ZMZ A;  3Q4H B;  4BAY A;  4QNH B;  4YIP A;  1NKD A;  1B6Q A;  3X2Q B;  1OHH G;  3ASN B;  3WB1 A;  1TVK B;  3QF7 A;  1SQP H;  3CWB H;  4KXR A;  1IUR A;  1HP8 A;  3RYC A;  1N33 B;  4U3J B;  1SES A;  2LFR A;  1VQ9 V;  2Y69 B;  1JPX A;  2RDC A;  3QTC A;  5LP6 C;  3F5W C;  3N2K B;  5TIS Z;  1OV9 A;  1CEZ A;  3RYI A;  2HLD G;  4K8Z A;  4JI4 O;  1AIL A;  2ITD C;  2LFS A;  3ZX6 A;  3E22 A;  4LF8 B;  3BEH A;  1UJW B;  1G4Y B;  3K5L A;  2QGN A;  3JD1 A;  3OEH G;  4AQY O;  1QVG U;  1VF7 A;  4HBN A;  3IAY A;  4UVC A;  1GO3 F;  1P7B A;  2Q69 A;  3KZI Z;  3RYC B;  1Z5V A;  2WLM A;  5IJ9 A;  5LMN B;  4H13 B;  1YJ9 V;  2EIM C;  2NR5 A;  3F7Y C;  5L3D A;  4X64 O;  5B3S C;  3RYH A;  2KB1 A;  2IM9 A;  2LO1 A;  4WFH A;  1AI6 A;  4JF3 A;  3RYI B;  4LF7 O;  1R73 A;  5LHG A;  1THZ A;  3QO7 A;  1J5E O;  1YTF B;  2ZE5 A;  3E22 B;  3LSU A;  4DW1 A;  3C3S A;  3HKC A;  3BPZ A;  4ZIB A;  2AW9 A;  4DXW A;  3ETE A;  2AZ0 A;  3OD4 A;  1CP9 A;  3FB8 C;  4NYK A;  2GSM B;  1COW G;  5IJ9 B;  4J11 A;  1QLE C;  1R3L C;  3ZRW A;  1SC5 B;  1HDJ A;  4R6Z A;  2Q67 A;  2RMK B;  2F4V O;  4P9O A;  3RYH B;  1R6N A;  2H8P C;  2K1E A;  1IDS A;  1U96 A;  4PA9 A;  2Q0O C;  2Y0I A;  1EM1 A;  1HNZ B;  1FXV A;  3AG1 B;  3D3Q A;  1HNW O;  1N36 O;  1H8E G;  2WPD G;  4DR4 B;  5L3G A;  2IH1 C;  5IT9 N;  4WFA V;  4DR1 O;  1I0H A;  5GTI Z;  1GM7 A;  3HKC B;  2JGD B;  1JMK C;  4K0K B;  1FFT B;  2X6C A;  1M5I A;  1F23 A;  4UVB A;  4KL1 A;  2R9I A;  4IHJ A;  1GN3 A;  3AG7 A;  2PUS A;  3MAQ A;  1BT8 A;  4QPJ A;  4P30 A;  3ZRW B;  3G67 A;  2P5O A;  2GUZ A;  4B7K A;  4ZBM A;  4MVQ A;  1J95 A;  2YIA A;  4JAV A;  2FB5 A;  1RM1 C;  2ADQ B;  5KHI A;  2LP7 A;  1V55 C;  1H2N A;  4FK5 C;  2W0X A;  1OCR B;  1XMQ B;  5B1B B;  1SZX A;  5LA6 A;  3LNN A;  4J80 A;  1K7D A;  1N33 O;  1FFX A;  4WCE V;  1YF2 A;  1FXK A;  4XDK A;  4CH3 A;  1M1K W;  4IHJ B;  4LF9 B;  4PI0 A;  1MZF A;  1NTZ H;  1ZL8 B;  5LGU A;  2V1D A;  3TJT A;  1DF4 A;  2PTM A;  2ZIN A;  2GUZ B;  2OCH A;  4ZI7 A;  2V7Q G;  3OGC C;  4TT3 G;  3T4Z A;  2B9Z A;  5L3F A;  1QR8 A;  4LF8 O;  4MVS A;  5JCO A;  1FPO A;  3BVO A;  3I5D A;  2CK3 G;  1WB7 A;  5LMN O;  1QNM A;  2Q7G A;  3VOU A;  2ZNI A;  1UFI A;  4X1Y A;  4BW5 A;  2UXB O;  4NR1 A;  4B3S B;  2JDI G;  5KAI Z;  4ZI7 B;  1ZSP A;  1WA8 A;  3SPG A;  2WLL A;  4DUY B;  1D5A A;  1RPR A;  4TWK A;  1MG1 A;  1EBO A;  3E8H A;  1M56 C;  3JAT A;  1MOF A;  4E4E A;  2Q68 A;  3KKY A;  4H37 A;  4QGP A;  2UXN A;  1S5L Z;  1SQF A;  5LHH A;  4FLV A;  4LF6 B;  4O4H A;  1NU1 H;  5J9P C;  3MHS C;  2P67 A;  3PJS K;  3T2M A;  5HFL A;  2XHB A;  4X1Y B;  3THO A;  1D5N A;  4JI0 B;  1HNX B;  1HNZ O;  2CAZ C;  2Q7H A;  3E83 A;  4GX0 A;  2ZT9 B;  3EVK A;  5JVD A;  3ZS8 C;  1SQG A;  2F95 B;  5KA6 A;  1WA8 B;  4DR4 O;  2WLL B;  4IGG A;  2R72 A;  1Q82 W;  2MK3 A;  4LR3 A;  1JCH A;  3CRC A;  2PYJ A;  4K0K O;  3JAT B;  2WLH A;  4I55 A;  5BMV A;  1WP7 A;  2UU9 B;  1KC8 W;  3FB6 C;  4JV5 B;  2GV9 A;  2LGW A;  1NJI W;  1AI4 A;  2HJD A;  4L8J A;  4O4H B;  1N8R W;  1GN2 A;  3P30 A;  2JEU A;  2ZE7 A;  1BMF G;  4L87 A;  4U3F H;  4LNU A;  2Y4U A;  4AHC A;  5BR8 O;  3ZMS A;  5F2V O;  1UPG A;  4XBF A;  3OTF A;  3JD3 A;  2RQ6 A;  5JVD B;  3SGI A;  1XMQ O;  1BS3 A;  5LYJ A;  1VMG A;  1F51 A;  2HHH B;  4I9Q A;  2B1G A;  4FFB A;  5A9G A;  3FFQ A;  3BA9 A;  1GMG A;  2DQ0 A;  5FPO A;  4I55 B;  1HR0 B;  3FYI B;  3R66 A;  3CCV V;  4LF9 O;  1BQZ A;  3K04 A;  2X6B A;  1M57 C;  1S72 V;  1WN7 A;  1G1X B;  4LNU B;  1AR4 A;  1E79 G;  1YJN V;  3P3N A;  1WAZ A;  2UUC O;  3G71 V;  3K9S A;  4EFB A;  2CDY A;  5EC2 C;  3UO3 A;  2WLN A;  2YXH A;  3ZJZ A;  3CCL V;  5BY1 A;  2D3O W;  3E8F A;  4MVU A;  4FFB B;  4C7U A;  4GX5 A;  2XTA A;  4NKG B;  4YJ2 A;  1OJH A;  1Y74 A;  2F1M A;  2YS8 A;  3OMI B;  4B7E A;  4B3S O;  5LHI A;  1NTK H;  5KUM A;  5EZY A;  1IBL O;  4CS3 A;  4Q6G A;  4EFE A;  1AP5 A;  3K79 A;  4HYO A;  4DUY O;  1K9M W;  5EYP A;  3BHP A;  1YCI A;  3CE2 A;  4DV6 B;  1MA1 A;  3AG4 B;  5AG2 A;  4JZG A;  2PI4 A;  1Q86 W;  2EIN B;  4LF6 O;  2NN4 A;  2QWP B;  4HAM A;  3HKB A;  5LGN A;  4YXW G;  2JK5 C;  4YJ2 B;  4NXN O;  1Y74 B;  3S3X A;  1OCC B;  3UKM A;  2VQF O;  4JI0 O;  3ZRV A;  1HNX O;  1K34 A;  3AG2 B;  4D6T H;  3WFV A;  3OTO B;  3FB5 C;  1YZB A;  4TQF A;  2AXT Z;  1SA0 A;  4GKJ B;  3ZMV A;  4LFB B;  3ZN0 A;  4NXM B;  5EYP B;  1I7F A;  4IIJ A;  4AI8 A;  1VP7 A;  4PJ0 Z;  3VQX A;  2RNB A;  4MW3 A;  4X9Q A;  2BTQ A;  4I7Z B;  3X2Q C;  2UU9 O;  1Q8I A;  5K1P A;  3ASN C;  4JV5 O;  2P6J A;  4X64 B;  2F93 B;  1XRE A;  3HKB B;  4I5S A;  3JD2 A;  1VF6 A;  1JX9 A;  1RSO A;  4JYC A;  1US6 A;  3LDC A;  5BZB A;  3N27 A;  1JVM A;  1L0L H;  1KMI Z;  3SYA A;  2KKW A;  4O4I A;  1SA0 B;  4CS4 A;  3ABT A;  1RFY A;  2N74 A;  4FLW A;  4F6E A;  1GM9 A;  2HVK C;  2ZNJ A;  2P06 A;  2HHH O;  4FLY A;  1QBZ A;  4B3M B;  4IIJ B;  4JAS A;  3SJC C;  4CH5 A;  3JAK A;  2QSA A;  1HR0 O;  1V54 B;  2CGO A;  4EB6 A;  3ZBH A;  4X65 B;  5EK0 A;  2PGG A;  3MDS A;  4J42 A;  1FAF A;  1SKV A;  2EIL B;  1WPB A;  4W4K A;  4BIZ A;  5H5N A;  5EBW C;  1IBK B;  1VQ7 V;  1RSO B;  4XDJ A;  2QWN B;  1H8H G;  1K3E A;  3W7U A;  1K5Q A;  4CH6 A;  4DUZ B;  3CC4 V;  1NH2 D;  4K35 A;  5CB4 A;  3LNM B;  3WG7 B;  4JYA B;  3RFR A;  1NH2 B;  3SPI A;  4O4I B;  2G38 A;  2ZR2 A;  1AP6 A;  1YVW A;  2ADP A;  3M8A A;  1P84 F;  4DR6 B;  4J7Z A;  1VQM V;  1S5J A;  5JH7 A;  4MTF A;  3DTU B;  1FJG O;  3JAK B;  5H2F Z;  5IWA B;  4QPK A;  3P3P A;  1SS3 A;  2QDO A;  4X8A A;  4EB6 B;  2FTK A;  2BSK A;  3QG5 A;  1LUW A;  1PL0 A;  3CCM V;  4UV8 A;  4DV5 B;  4MTX A;  1VQ4 V;  4RO2 A;  1YHQ V;  3UCS C;  2LJ2 A;  1PPJ H;  2LW7 A;  5CB4 B;  2Q73 A;  3B8M A;  4DV6 O;  2IBZ H;  2YID A;  2OIG A;  3AG1 C;  2VWJ A;  4AIL C;  2BOB C;  2FKX A;  3L75 H;  2AGA A;  3JD0 A;  2V4D A;  3JCU Z;  2NLJ C;  3S3W A;  2OWO A;  2E74 B;  3T1C A;  4JI2 O;  2LQT A;  3VQW A;  4YHH B;  1F7Y A;  3ASO B;  2BSK B;  3OTO O;  4JI5 B;  3R65 A;  2IJJ A;  4GKJ O;  1SQB H;  4LFB O;  1Q81 W;  2A9H A;  4NXM O;  2H3O A;  4NTX A;  2IW5 A;  4OPH A;  1YXB A;  5IY5 B;  3FD9 A;  1OCR C;  5B1B C;  3HB3 B;  4FFK A;  1JJO A;  5EC1 C;  3SDL A;  4HNA A;  2ZE8 A;  3ML0 A;  2UXB B;  4RWU A;  1RPO A;  2P4V A;  4I4T A;  2Z0A A;  3K59 A;  3ETD A;  1ZAU A;  1AI5 A;  3H1I H;  1M93 A;  4B3M O;  1NBM G;  4PI2 A;  3RVY A;  3ABL C;  2PYL A;  1IX9 A;  3DC6 A;  4X65 O;  2DYS B;  3IJ4 A;  3K06 A;  1QVF U;  1V9P A;  3U11 A;  5EIB D;  2AZ2 A;  2YXL A;  5CN0 A;  1ROP A;  4HNA B;  1IBK O;  5LP6 A;  4DUZ O;  4BIU A;  4X89 A;  1KP2 A;  4U7N A;  3K03 A;  3F7V C;  4JYA O;  3J81 N;  4FMT A;  4I4T B;  2ZKO A;  3APQ A;  4X1I A;  4GZR B;  2FL4 A;  1ENV A;  3KG2 A;  4DR6 O;  3E89 A;  3P32 A;  4X66 O;  3SYQ A;  5IWA O;  3K08 A;  3NXS A;  4FLX A;  5JCO C;  5LMU O;  5FL7 G;  3ABM C;  3LSS A;  3SYC A;  3STZ C;  2XAQ A;  4DV5 O;  5KUK A;  4BW9 A;  1H38 A;  1AR5 A;  5BR8 B;  1QLN A;  1GM8 A;  4DR2 B;  3ZMT A;  3CD6 V;  4NTY A;  1XDC A;  3G6B A;  4MVO A;  5KHG A;  2BE3 A;  1OCO B;  4UB8 Z;  1EZJ A;  2DYR B;  5CBG A;  4ZKI A;  2CTR A;  2YI8 A;  4X1I B;  1PV0 A;  3RT3 C;  3B4S A;  4FZ0 A;  1XL4 A;  2LGQ A;  3L72 H;  2ZIM A;  1BGY H;  4UFZ A;  3D8C A;  2IU3 A;  1F4M A;  5L3B A;  4QE7 A;  3EFF K;  2EBO A;  3D3I A;  3CRR A;  4YHH O;  2OTJ V;  2EIJ C;  4ZOL A;  3JAM N;  1WJZ A;  4B3R B;  2CTQ A;  3H1J H;  1HW7 A;  3HPL C;  4N23 A;  1QR9 A;  2P7T C;  5B3S B;  3ZHS A;  4JI5 O;  4GT1 A;  2UUC B;  4K8X A;  4JAA A;  4O4L A;  3SJQ C;  5IDJ A;  2EZP A;  4PD4 F;  3ABU A;  1KBH A;  2Q8V A;  4UCV A;  1I94 B;  3GVM A;  3C3T A;  5LA6 B;  5CA0 A;  2P4K A;  4OPA A;  1ZTE A;  5E79 Z;  3B09 A;  2DMX A;  4FPP A;  2Q6A A;  5GTH Z;  1B04 A;  1FFX B;  3VQY A;  1RP3 B;  2M6Y A;  2QWQ B;  5FLX N;  1FXK B;  3CRM A;  1QHT A;  4H33 A;  3DSQ A;  4FLU A;  2CH7 A;  4ZOL B;  1BHB A;  3B77 A;  3ZHR A;  1QLE B;  1X59 A;  2BCC H;  5CBF A;  1IBL B;  1PL4 A;  1SQV H;  2JS5 A;  4O4L B;  2RJZ A;  1PKX A;  3W7T A;  5H9C A;  4R50 A;  3BFR A;  2UUA B;  1MMM A;  5DEC A;  1KD1 W;  3ZRS A;  5CA0 B;  4MVZ A;  1YIT V;  1CPY A;  2PI5 A;  2C2A A;  2H94 A;  2JGU A;  5IJ0 A;  2A06 H;  3PN1 A;  3K58 A;  1Y67 A;  4ABM A;  4NXN B;  1QQC A;  2EJ7 A;  2VQF B;  2OCC B;  4P2Z A;  2CH7 B;  1YIJ V;  1KP3 A;  1KU9 A;  4RUE A;  1O9G A;  1IVS A;  1WNS A;  3QNE A;  1WLE A;  4QIW F;  2Y48 A;  4X20 A;  3STL C;  2VQE B;  1BHA A;  2HFE C;  2WA3 A;  1N4C A;  3W7S A;  2EX3 A;  4QJF B;  2L35 A;  5C93 A;  2DOS A;  1K4C C;  4GKK B;  3AG4 C;  2NNU A;  2XAH A;  5IJ0 B;  3DC5 A;  4JI7 B;  1XOU A;  2CTP A;  2EIN C;  2DWE C;  5EBL C;  1MSW D;  2PF4 E;  3APO A;  1YSC A;  3GWK C;  3AK1 A;  4DV4 B;  2D2C B;  3ZMU A;  1JFF A;  4DR2 O;  3LSQ A;  2ZDI C;  5EBM C;  3RGB A;  1OCC C;  3T4D A;  1GK9 A;  2QE7 G;  3AG2 C;  4X20 B;  2JS3 A;  3L74 H;  2HP8 A;  3CXC U;  5LBQ A;  1VIB A;  1ZX3 A;  2YIB A;  3LDD A;  2XND G;  3E35 A;  5BMV B;  3DXR A;  3TXQ A;  1VEW A;  2QKC A;  4FM2 A;  4JGS A;  3FAV A;  5HFM A;  1ORQ C;  1GRJ A;  3TGU H;  1LNQ A;  4JAU A;  1DGS A;  4B3R O;  3HR0 A;  1N34 B;  4MTG A;  5B66 Z;  1XBL A;  2ZXW B;  1JFF B;  2ZD9 A;  4ICG A;  4GYC B;  4DR5 B;  3O65 A;  2YIB D;  2UXX A;  5LYJ B;  4NB5 A;  1XNQ B;  1I94 O;  3UM7 A;  2Z5U A;  1XHZ A;  4LH6 A;  5LOV A;  2DQ3 A;  4JZ2 A;  1BZK A;  3CEI A;  1FJG B;  4BR6 A;  5KLV H;  1KKD A;  4FLT A;  4UB6 Z;  3DXR B;  4ZHQ A;  3CCJ V;  2IH3 C;  1VQ6 V;  3FAV B;  1V54 C;  2WLI A;  3FKS G;  5B1A B;  4WFG A;  1OCZ B;  2QA4 V;  4DR3 O;  3JAL A;  2EIL C;  1H2S B;  4TV9 A;  3ABK C;  3OT7 A;  3AEI A;  1NTM H;  1DF5 A;  3FYE B;  1VF6 C;  3SYO A;  1EN6 A;  3IFX A;  2OIE A;  2ITC C;  1S5H C;  2UUA O;  3WG7 C;  1KQS U;  5JQG A;  1Z5W A;  3H1K H;  3OAA G;  1BCC H;  2M7W A;  3ETQ A;  3OEE G;  1Y76 A;  2QWR B;  4JI2 B;  2DJV A;  2E75 B;  3JAS A;  3ZHV A;  4G28 B;  2WLI B;  4LF5 B;  5A2Q N;  4YJ3 A;  4WBN A;  2X7R B;  5EZY B;  2DWD C;  3JAL B;  3CCU V;  3SJB C;  1AR1 B;  3K9A A;  1KUQ A;  4MTO A;  4YY3 B;  3D36 A;  2VQE O;  4OX9 B;  4E2L A;  4MVR A;  2WLK A;  5IYD O;  1Z2G A;  4GX1 A;  4CZZ A;  2F66 C;  3H1L H;  5D5Q A;  1Q6H A;  2WAM A;  2BTO A;  4TV8 A;  1JQ0 A;  4GKK O;  3JSL A;  2EIK B;  2YIC A;  5JQG B;  1KYO F;  4LWS A;  1PD3 A;  2YDE A;  4JI7 O;  4UVA A;  3CJH A;  1GN6 A;  3OMN B;  3LUT B;  3ZHU A;  1Y76 B;  4JI1 B;  2Y69 C;  2ATK C;  3CS5 A;  4D7S A;  4DV4 O;  3JAW A;  3JAS B;  3E86 A;  2EJR A;  4YJ3 B;  2B1I A;  3ASO C;  4MSW C;  1XHX A;  1JOY A;  3W7X A;  3QO8 A;  3E2E A;  2QM4 A;  4PEL A;  5J2T A;  3T1Y B;  3OMA B;  4A5U B;  1D2D A;  3SR2 C;  1S77 D;  5LL6 Y;  1GH6 A;  2BTQ B;  4TV8 B;  1WPX A;  2QTS A;  3BAB A;  1H2G A;  3AK3 A;  2F23 A;  1IXM A;  1SRY A;  3GWO A;  4LWS B;  3CCQ V;  3CB2 A;  4B08 A;  1NZ6 A;  2VWK A;  4IT5 A;  1N34 O;  1NQT A;  4X62 B;  2QTO A;  5C8Y A;  3JAW B;  1LR1 A;  4FVM A;  4WFB V;  2CUG A;  4PDV A;  2QM8 A;  4DR5 O;  4IYI A;  2LW1 A;  4J7J A;  1XNQ O;  4LF4 B;  4X66 B;  2IJH A;  5J2T B;  2ZM6 B;  4JI3 B;  4TQD A;  3W7W A;  1VQO V;  3IGA C;  3ETG A;  2WWW A;  5LMU B;  3U0Z A;  1LUV A;  3N2G A;  3BA8 A;  3A0H Z;  2O57 A;  4JI8 B;  1TVK A;  1SET A;  2DN9 A;  1L1F A;  2CGN A;  3UT5 A;  1H2L A; 
#chains in the Genus database with same CATH homology
 1G8M A;  2DYS C;  1ENV A;  3KG2 A;  5J9P C;  3MHS C;  2P67 A;  1K92 A;  1AJN A;  3E89 A;  3P32 A;  4U7O A;  3PJS K;  4RQF A;  4KP4 A;  1S3J A;  3OUF A;  5HFL A;  3T2M A;  3A0R A;  3SYQ A;  2XOK G;  3K08 A;  3NXS A;  4KFM A;  3AG3 B;  2W0F C;  4P9P A;  5FL7 G;  3ABM C;  3E83 A;  4PA7 A;  3LSS A;  4GX0 A;  1ZWI C;  3JCZ A;  5GW7 A;  3SYC A;  4WF9 V;  3STZ C;  2XAF A;  3SYP A;  3OR6 C;  5KA6 A;  3OM3 B;  3DGE A;  3ZIA G;  2XAQ A;  2WLL B;  3K3W A;  1Q82 W;  2MK3 A;  5KUK A;  1H38 A;  4PDM A;  3CCE V;  4G2K A;  1JCH A;  1QLN A;  1GM8 A;  4PA6 A;  3ZMT A;  2WLH A;  3CD6 V;  1F4N A;  4MVO A;  1OCO B;  1EZJ A;  2DYR B;  4GCZ A;  1S0V A;  3AG3 C;  5CBG A;  4ZKI A;  1KC8 W;  3FB6 C;  1NJI W;  4R7C A;  4RQE A;  2HR3 A;  1AI4 A;  1N8R W;  1XL4 A;  2JEU A;  3P30 A;  1BMF G;  4L87 A;  1EFR G;  3OE7 G;  2HVJ C;  2IU3 A;  1F4M A;  5L3B A;  3ZMS A;  4QE7 A;  4J9Y B;  3EFF K;  2EBO A;  1VQ8 V;  2JIZ G;  4XBF A;  3OFN G;  3D3I A;  3E8G A;  3JD3 A;  1OCO C;  2DYR C;  3RW0 A;  2OTJ V;  1M57 B;  2EIJ C;  4I9W A;  4JTA B;  4OXS A;  2WLJ A;  2XAJ A;  1VQK V;  5KA5 A;  3HPL C;  4N23 A;  1F51 A;  1QR9 A;  2P7T C;  5B3S B;  2B1G A;  4GT1 A;  4JYB A;  1VQP V;  1I5X A;  3RVZ A;  4UV9 A;  1GMG A;  1K4D C;  4J9Z B;  3CME V;  3EHB B;  3SJQ C;  5IDJ A;  2DQ0 A;  2EZP A;  5E1A C;  4KUM A;  3ABU A;  3FYI B;  1NR7 A;  2B5U A;  3ZCC A;  1PNM A;  3CCV V;  5DN6 G;  1K8A W;  3K04 A;  5L3E A;  2X6B A;  1Y66 A;  2QKS A;  2WSS G;  1VQN V;  1DLB A;  1M57 C;  3BY6 A;  3TK1 A;  5IY5 C;  4PA3 A;  1S72 V;  5CA3 A;  3CMA V;  4FPP A;  2Q6A A;  1E79 G;  1YJN V;  1FXK B;  3G71 V;  3GB7 C;  4HZ3 A;  4WFF A;  4H33 A;  5EC2 C;  2WLN A;  1E1Q G;  2W6I G;  2X6A A;  4UXN A;  4QE9 A;  3ZJZ A;  1NVP D;  3CCL V;  1YTF D;  3IC7 A;  4XDL A;  2D3O W;  1BHB A;  3B77 A;  3E8F A;  1QLE B;  5CBF A;  3H01 A;  2YEV A;  4MVU A;  4MW8 A;  5CBH A;  1ARO P;  4RAI A;  1HWY A;  1BL8 A;  1M9N A;  1NVP B;  3CCS V;  1OZ0 A;  3ABK B;  3ZN1 A;  4GX5 A;  1PKX A;  2W6J G;  3ZRX A;  1P4R A;  1FXK C;  3OW2 U;  3W7T A;  5H9C A;  3RBZ A;  1K97 A;  3M99 B;  4R50 A;  4X88 A;  3OMI B;  5LHI A;  1KD1 W;  3ZRS A;  5KUM A;  4MVZ A;  4RUF A;  1AJQ A;  1YIT V;  1CPY A;  4G27 B;  2PI5 A;  2C2A A;  4FIP C;  2H94 A;  4R8C A;  1GKF A;  1PNL A;  2HG5 C;  1PNK A;  3G6E V;  1W2B U;  3K79 A;  4HYO A;  3I55 V;  1K9M W;  2ZQM A;  2IJI A;  3CPW U;  4TSF G;  2X0L A;  2OCC B;  4P2Z A;  3AG4 B;  1YIJ V;  1K73 W;  1KP3 A;  2ZR3 A;  4RUE A;  1I5Y A;  3CYO A;  4JTC B;  2YSU B;  3QNE A;  1WLE A;  2YEV B;  4LCU C;  4ASU G;  4QIW F;  2PI4 A;  5B1O A;  3SPC A;  2Y48 A;  2EIN B;  1Q86 W;  1R3K C;  3STL C;  1BHA A;  2HFE C;  1M90 W;  4HAM A;  3MHH C;  5B1N A;  5LGN A;  2AHY A;  4WFE A;  4YXW G;  2JK5 C;  3W7S A;  3ZMZ A;  1NR1 A;  4BAY A;  4QNH B;  3UKM A;  1OCC B;  2QEX V;  1NKD A;  4QJF B;  1B6Q A;  5C93 A;  3X2Q B;  3ZRV A;  1K4C C;  2OCC C;  1OHH G;  3ASN B;  3AG4 C;  3B8N A;  1K34 A;  3E8B A;  3AG2 B;  1VQL V;  3WFV A;  2NNU A;  2XAH A;  3FB5 C;  1FS0 G;  1Q7Y W;  4Z1M G;  2OT5 A;  1SES A;  3TCU A;  3ZMV A;  2EIN C;  2DWE C;  4LBE C;  5EBL C;  1MSW D;  2LFR A;  1VQ9 V;  2DW4 A;  3ZN0 A;  2Y69 B;  1YSC A;  1JPX A;  3ZMU A;  3F5W C;  1W0K G;  1CEZ A;  1Y4M A;  3LSQ A;  2ZDI C;  2HLD G;  4MW3 A;  5EBM C;  1OCC C;  3T4D A;  1GK9 A;  2JJ1 G;  2QE7 G;  3X2Q C;  2BOC C;  4F4L A;  2P90 A;  3ASN C;  4N21 A;  2EIM B;  3AG2 C;  2ITD C;  2LFS A;  2P6J A;  3CXC U;  5LBQ A;  3LDD A;  2XND G;  3CP1 A;  3BEH A;  4I5S A;  1UJW B;  1G4Y B;  3CCR V;  3JD2 A;  1JX9 A;  4JYC A;  3E35 A;  3JD1 A;  3OEH G;  3LDC A;  5BZB A;  2IU0 A;  1JVM A;  1QVG U;  1E1R G;  3OUS A;  4JGS A;  4MVM A;  1GO3 F;  1P7B A;  2Q69 A;  1ORQ C;  4UVC A;  3SYA A;  5HFM A;  2OTL V;  1LNQ A;  4JAU A;  2WLM A;  3ABT A;  1YJ9 V;  4PDR A;  2EIM C;  1GM9 A;  2HVK C;  3F7Y C;  5L3D A;  4MTG A;  5B3S C;  1QBZ A;  1R3J C;  2KB1 A;  4JAS A;  4WFH A;  1AI6 A;  2ZXW B;  4JF3 A;  3ABL B;  2ZD9 A;  4EKW A;  1V54 B;  1XL6 A;  1GTO A;  3CC2 V;  1R73 A;  2UXX A;  5LHG A;  4FJC C;  1THZ A;  4JPR A;  5EK0 A;  3UM7 A;  2Z5U A;  2EIL B;  3QO7 A;  1YTF B;  2DQ3 A;  4BIZ A;  5EBW C;  1VQ7 V;  4MT8 A;  4XDJ A;  3W7U A;  1H8H G;  1K3E A;  3SPH A;  1K5Q A;  1KKD A;  3CC4 V;  1MAB G;  4DXW A;  1NH2 D;  2GHY A;  4PA4 A;  2ZXW C;  3CCJ V;  4MS2 A;  3ETE A;  3LNM B;  2IH3 C;  3WG7 B;  1CP9 A;  1VQ5 V;  1VQ6 V;  1V54 C;  3FB8 C;  2WLI A;  1JJ2 U;  1NH2 B;  3FKS G;  3SPI A;  2GSM B;  5B1A B;  2XAG A;  4WFG A;  1COW G;  1OCZ B;  2ZR2 A;  4PDL A;  2QA4 V;  1QLE C;  1R3L C;  3ZRW A;  4R6Z A;  2EIL C;  2Q67 A;  4P9O A;  1VQM V;  1KEC A;  1R6N A;  4MTF A;  3DTU B;  3OR7 C;  2H8P C;  3ABK C;  3AEI A;  4QPK A;  2K1E A;  1DF5 A;  3FYE B;  3SYO A;  4PA9 A;  3ABM B;  4UUJ C;  3VBB A;  4X8A A;  1FXV A;  3AG1 B;  3IFX A;  5H6Q A;  2ITC C;  2XAS A;  1S5H C;  2JJ2 G;  2FTK A;  3I56 V;  3WG7 C;  5IYB O;  1H8E G;  2WPD G;  1PL0 A;  1KQS U;  5B1A C;  5L3G A;  1OCZ C;  2IH1 C;  3CCM V;  2IJK A;  4UV8 A;  5DM6 V;  4MTX A;  4WFA V;  1SZT A;  1GM7 A;  2A79 B;  1VQ4 V;  4RO2 A;  2HJF C;  3OAA G;  1RM1 B;  1YHQ V;  1FFT B;  2M7W A;  2X6C A;  3OEE G;  5CMU A;  3SPJ A;  1F23 A;  4UVB A;  1V55 B;  2R9I A;  3B8M A;  4G28 B;  2WLI B;  3AG1 C;  3QO5 A;  2X7R B;  4QPJ A;  5LGT A;  4P30 A;  1FXH A;  2DWD C;  3ZRW B;  3CCU V;  2BOB C;  1AR1 B;  3K9A A;  3K0D A;  4MTO A;  3D36 A;  3JD0 A;  4ZBM A;  4MVQ A;  4E2L A;  4JTD B;  1J95 A;  4MVR A;  4DO2 A;  2WLK A;  4JAV A;  5IYD O;  2NLJ C;  4GX1 A;  3K0G A;  4CZZ A;  1RM1 C;  3T1C A;  3LDE A;  2LP7 A;  1V55 C;  1R3I C;  2WAM A;  2EIJ B;  3MD0 A;  4FK5 C;  1OCR B;  3ASO B;  5B1B B;  1K5S A;  1JQ0 A;  3JD4 A;  1YI2 V;  5H6R A;  1W0J G;  2EIK B;  1K7D A;  2JEX A;  1PD3 A;  3R65 A;  2IJJ A;  4UVA A;  4WCE V;  2F43 G;  3OMN B;  1FXK A;  1Q81 W;  3LUT B;  2A9H A;  4XDK A;  2Y69 C;  1M1K W;  2ATK C;  1SER A;  1QCE A;  3TET A;  3E86 A;  2EJR A;  3G4S V;  2IW5 A;  5LGU A;  2B1I A;  2V1D A;  2R9R B;  5IY5 B;  1OCR C;  3ASO C;  1DF4 A;  5B1B C;  4MSW C;  1JOY A;  1TUE B;  2EIK C;  3HB3 B;  5EC1 C;  2V7Q G;  3QO8 A;  3W7X A;  3OGC C;  4TT3 G;  3T4Z A;  3E2E A;  5L3F A;  1QR8 A;  2EZO A;  4PEL A;  4MVS A;  3OMA B;  3ML0 A;  1S77 D;  3CC7 V;  1WPX A;  4Q20 A;  1RPO A;  4LC1 A;  1H2G A;  5L3C A;  1K33 A;  2CK3 G;  1IXM A;  1SRY A;  3GWO A;  3CCQ V;  2Z3Y A;  3ETD A;  4GX2 A;  1AI5 A;  1NQT A;  3VOU A;  1M56 B;  2QTO A;  1NBM G;  2AHZ A;  1AI7 A;  4BW5 A;  3RVY A;  3ABL C;  4WFB V;  4PDV A;  2QM8 A;  2DYS B;  3K06 A;  2JDI G;  1QVF U;  1R6K A;  2QM7 A;  3SPG A;  2WLL A;  5CN0 A;  1ROP A;  2IJH A;  1S76 D;  1AJP A;  4LP8 A;  2HKO A;  1RPR A;  4TWK A;  2A0L A;  3W7W A;  1VQO V;  1MG1 A;  1EBO A;  3E8H A;  3ETG A;  1M56 C;  2WWW A;  1MOF A;  3IGA C;  4BIU A;  2ZDI A;  5IYC O;  4X89 A;  1KP2 A;  3FB7 C;  4U7N A;  3K03 A;  3F7V C;  2Q68 A;  3JYC A;  4FMT A;  4H37 A;  2UXN A;  1SET A;  1DTO A;  1L1F A;  5LHH A;  4CBC A;  1YJW V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...