2OTLV

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2otlV00
1W2BU 1VQ7V 1S72V 1QVFU 1Q82W 1YITV 1Q7YW 1KC8W 1M1KW 1K8AW 3CCQV 1VQ5V 3CD6V 4WFBV 1VQNV 1R73A 4WF9V 3CC7V 1N8RW 3CCJV 1VQ9V 1VQ6V 1YI2V 3CC2V 1Q81W 3CXCU 5DM6V 1Q86W 1VQMV 1VQLV 2OTLV 3G6EV 1YJ9V 4WCEV 2OTJV 3G71V 1YJWV 1YIJV 1YHQV 3OW2U 3CCVV 1VQOV 1YJNV 1VQPV 3CMEV 2QA4V 1K9MW 2QEXV 3CCSV 3CCEV 3CCMV 3I56V 1VQ8V 1KD1W 1JJ2U 1KQSU 1VQ4V 4WFAV 2D3OW 3CPWU 3CC4V 3CCRV 3CCLV 1K73W 1VQKV 3CMAV 3I55V 1M90W 1NJIW 3CCUV 1QVGU 3G4SV
chains in the Genus database with same CATH superfamily
5A9GA 2YI8A 1K8AW 3SDLA 1VQ5V 2JEXA 3HKEA 3A0HZ 4J10A 3K79A 4QE7A 3OW2U 1P4RA 5LP6B 1JFFB 3K9SA 1N33O 4FMTA 3K5MA 4DV5B 1LNQA 1FPOA 4Q6GA 2P22C 3B09A 1N0JA 4LC1A 3E8FA 2UXNA 5EC1C 3GB7C 1QR9A 3D36C 3RYHB 2EIKB 4ZI7A 4GX5A 4X20B 2Z3YA 2YUAA 2WPDG 3N27A 2QKSA 4YY3B 3T1YO 4JYCA 4R50A 3CRCA 4O4LB 3P3NA 5H9CA 3B8NA 1QCEA 1I5XA 1PV0A 4FVMA 3G4SV 2F43G 3D36A 3T1CA 2E76B 1L1FA 1S76D 5A2QN 3CC7V 1Q86W 3F7YC 3QTCA 2UUAO 1L0NH 4JI6B 2UXBO 4K3AA 3ZHVA 3FAVA 2VQEB 1WAZA 1VARA 1IX9A 4AI8A 3L73H 4ZHQB 1THZA 3QNEA 1AI6A 2CE4A 1SETA 3JALA 2WLHA 2UU9O 2QKAA 4OXSA 2PI5A 2A79B 2ZNJA 1MABG 2FL4A 4K35A 1Q5OA 1M93A 3L75H 4CS3A 4NYKA 2HJDA 5LXTB 2Q6AA 1QR8A 4B08A 3IAYA 1Q3EA 1NH2D 5EBWC 3WB0A 3GWKC 4CC6A 1CXZB 1GN2A 2HVJC 4TQFA 4UB6Z 3JD3A 1KC8W 3OD4A 1OCOB 4OX9B 4DUYB 2N05A 4CBCA 4F6EA 1TUEB 4RAIA 4GT1A 4LF7B 1P84F 2DYRC 1N36B 3RT3C 3U10A 5CBGA 1D5AA 1XHXA 2A06H 2LP7A 1L8DA 1Y67A 3A0BZ 3WB2A 1TA8A 2QWRB 5KHJA 1OCCC 4MW8A 2HR3A 1R3LC 1FFXA 4DXWA 1MSDA 3B77A 4DR7O 3CX5F 2EIJB 2BTQB 2QSAA 2AZ0A 5TISZ 1DF5A 3K0DA 3UO2A 1U97A 1Z2GA 4FIPC 4DYLA 2CAZC 2JIZG 3ABTA 4F4LA 2WLIA 3E86A 5KUKA 5IYZB 4X64O 3TXQA 2P67A 2XAJA 3CD6V 1TUBA 2PYJA 5KHGA 3FYIB 4J42A 4E4EA 3OT7A 4DW1A 5B1AC 3B4SA 3IC9A 2FMLA 5L3BA 4RUEA 1AI4A 4KHPO 4UV9A 2IU3A 1VP7A 4CS4A 1KBHA 2XAQA 1IBLB 2LQTA 4JYAB 3N2GA 4PDVA 2PI4A 2EIMB 4J7JA 5JWPA 3DGEA 3APQA 4DV3B 4NXMB 2YC0A 2DYSB 4CH6A 4X66O 1D5NA 2D3OW 3CRAA 2AGAA 4UVBA 2W6IG 1VF7A 5B1BB 1O9GA 4Q20A 3QO5A 3JCZA 1GM7A 3ZHRA 3ASOB 1BQ0A 3FKSG 1QU7A 1J5EB 2B1GA 1W0KG 3LUTB 3S3WA 2ZR2A 3OMIB 3J81N 5FLXN 5LYJB 3M8AA 5LOVA 2Q8VA 1MSWD 3SGIA 5IYCO 1XQ8A 1VEWA 3E22A 4G28B 3FAVB 5GW7A 1SA0A 2FB5A 3AEIA 5L3CA 3ZMSA 3JALB 4I9QA 3P30A 1MG1A 2UXDO 1ZWIC 3DC5A 2Y69B 2XTAA 1Y76B 2LW1A 2XOKG 3SYOA 1XNQO 2W0FC 5JJJB 1IDSA 3EVKA 1XNRB 4KL1A 1GKFA 2KSDA 4JPRA 2ZKOA 2UUBO 4JI5B 1QLEC 4H0LB 2KG7B 3VQYA 4MVOA 2DJVA 1LR1A 2G38A 5CA1A 2CK3G 4CH3A 5HFLA 1NH2B 1AROP 1SS3A 1Q6UA 2ADQB 5B1NA 3AG2C 4NTWA 1TVKA 4YXWG 1AR5A 3ABKC 5IE9A 2M6YA 1RM1B 4LFBB 3CHXA 3CP1A 1AR1B 1BZKA 1TAEA 1VQNV 1NT2B 5EYPA 3BPZA 1AJNA 1V54C 1F4NA 5K1PA 1F23A 2LGWA 2ADPA 3LSQA 3RYCA 1FFXB 5KHIA 2YI9A 2MK3A 3E35A 2ZM6B 3OMAB 3I55V 2DYRB 5IY5C 2JEUA 3CXHF 1SQFA 2YXYA 2EULA 2WLIB 3H1KH 3UO3A 1YJ9V 2K1EA 3RW0A 4H37A 3A2FA 1CPYA 2PGGA 1OCCB 2OCCC 3I5DA 4PJ0Z 4EEQA 3ZHTA 2YICA 2ZT9B 2EX3A 1Y74B 1JJ2U 1AVMA 4DV4B 2GHYA 2X6CA 4B3MO 3H01A 4J80A 2HLDG 5CBHA 1GTOA 1NKDA 2PYLA 1K3EA 4OPHA 4GZRB 3K57A 1N34O 2YIBD 4PA6A 2MW2B 2PZSA 2Q0OC 4ZIBA 4X65O 3F5WC 2F66C 1HNXB 2X7RB 2YIBA 2P90A 1Y66A 1F51A 4HZ3A 5LP6C 1WB8A 5HFMA 2YSUB 3KZIZ 4DUZO 1RSOA 5LGTA 1MZFA 4NTYA 1FAFA 2ZNIA 2EIKC 4XDJA 4I5SA 3T2MA 1K73W 2CUGA 4PI2A 3ZIAG 1OHHG 3SR2C 5LHHA 4HYOA 1JQ0A 5LP6A 2IH1C 3E22B 1GN6A 1EN6A 4P9PA 3TGUH 1YTFB 3OFNG 1Z5WA 2DQ3A 2DWDC 1JOYA 3W7XA 1IBMB 2QA4V 5KUMA 3CCMV 1GRJA 3VQVA 1I7FA 2LW7A 4X20A 2DQ0A 4FJCC 1BGYH 2DWEC 4MTOA 1FXVA 2YIAA 3WG7B 1S0VA 3STLC 4O4LA 4BWAA 4O2BA 3DSQA 4JI2O 2QWQB 3E8GA 2XNDG 5GTHZ 1AI5A 1SERA 4JAAA 3RWRD 1X59A 2B1IA 2GSMB 1NQTA 5IWAO 3JAMN 1U96A 5J9PC 3AK2A 3ZN1A 4BIOA 3LSSA 1UPGA 4GKJB 3KKYA 1VQ6V 1S5HC 2F95B 1H8HG 4DV7O 1MZEA 5EBMC 1Q90D 1M5IA 1EN4A 4ZHQA 4DV0B 1Y4MA 3FFQA 4MTXA 1JA8A 1LUWA 5LMNB 4DV2B 2A7WA 2JK5C 5KMGA 1PL4A 4MVZA 1GM9A 4BW9A 1OCOC 1IXMA 4TV8B 3AG2B 1PP9H 3RYCB 4JI8B 3SPJA 2Q68A 4X89A 4G27B 5LXTA 1P7BA 3ABKB 3SYAA 1K34A 2E3CA 1IVSA 2ZE7A 1BHAA 1R6TA 4JI1O 5IJ0B 2R72A 1KU9A 1K5QA 4ICGA 5AG2A 3ZCCA 4I0XA 3OTFA 2ZIOA 1T5EA 1US6A 1RFYA 1TGOA 1AILA 1YSCA 4LF5B 1Q7YW 5B3SB 3HKCA 2EIJC 2ITDC 2R9IA 1PNLA 3CJHB 3ZHSA 5D5QA 3OE7G 5IY5B 1Q43A 3VOUA 5LHGA 3ABMB 4JI3B 5CB4B 3K59A 2HKOA 2OCCB 3KCYA 2XUMA 1H2LA 3TCUA 1YCIA 2ILMA 1SQGA 4J9ZB 3AG1B 2BTQA 3BEHA 4P2ZA 4HAMA 1UFIA 1WJZA 3M7MX 3APOA 3PJSK 2Q7HA 4DK1A 1M57B 4AQYB 5FPRA 1NTMH 2F4VO 4U3FH 4K8ZA 5IYZA 3GWOA 1RSOB 2OT5A 4U3JA 4PHZA 1ZUQA 1J95A 3ETQA 4JI7O 4KP4A 1DGSA 2UXBB 2UXCB 4GYCB 1AR4A 2DYSC 2OTLV 4TOIA 4B7EA 1NTZH 2A0LA 4FFKA 5B1BC 4FLWA 1OV9A 1MOFA 3ASOC 5GTIZ 3I56V 1MNGA 2LFRA 1XILA 2UUCB 1F4MA 4J11A 2P7TC 3D3QA 1FXKB 2EILB 4O4IA 1IZ3A 1JJOA 3LDEA 3SYQA 4UVCA 5F2VO 3B8MA 1HNZO 1YEWA 4JV5B 1JR9A 4O2BB 4Z2WA 2HVKC 4DR5B 5LGNA 1DK1A 2QWPB 4DV6B 4A5UB 2LJ2A 1Z5VA 2Y69C 2OCHA 5LYJA 4B3RB 3EXAA 5LMUO 4X8AA 3OTOB 4JYYA 3JARB 4MS2A 2R9AA 1YHQV 2QWNB 1H2NA 1W59A 2JDIG 4DR1B 3LNNA 2A3QA 1FS0G 2CTQA 5KHKA 1E1RG 3BFRA 1FXHA 4XDLA 2ZD9A 4RQFA 4UCUA 1Y76A 5KMGB 1NR7A 1I94B 2IJKA 4B3SB 2B9ZA 1HNWB 5DM6V 2ZDIC 4OGQB 1PPJH 2CTPA 2LO1A 2GBOA 4K0KB 4NB5A 1N4CA 3UCSC 4O4JB 4UV8A 5E79Z 2NR5A 1RM1C 5H6RA 3QVNA 4FFBB 4EFBA 1EZJA 2KG7A 3BAAA 4DV5O 4X64B 4GX1A 1VQ7V 4LF9B 4I0XB 1H2MA 4LFCB 2L6LA 2ZDIA 4MVMA 4R8CA 4YY3O 3HKCB 3JASA 5LA6B 1SESA 4DO2A 3ZJZA 3ZRSA 3A0RA 4LFAB 3H1HH 4I9WA 3ZHUA 5L3GA 3K06A 4DR2B 1SZTA 4GKKB 2IH3C 1NZ6A 3B40A 2R9RB 2FYUH 1IBKB 1GN3A 2LGQA 4P9OA 3SJBC 4U7NA 4B3TB 1NBMG 1XDCA 4J7KA 4JI6O 1VQPV 4RUFA 5DEDA 4DR4B 1HR0O 4CS2A 2VQEO 1BS3A 4NKGB 4MTGA 4JYBA 1H2GA 4WBNB 3CCLV 3VBBA 4MVSA 4U3JB 1GM8A 4E2LA 3W7SA 3SYCA 2YIDA 5H2FZ 1ROPA 3T1HB 1Y74A 3CCVV 5JJEB 4YJ3B 3OUFA 2ZXWC 2EJRA 2H94A 1QQCA 3GVMA 4EB6B 1H38A 3G67A 1W2BU 5ITZB 2YDEA 1WN7A 1H8EG 2N74A 4OX9O 3K58A 4DUYO 1VQOV 4QPJA 3JSNA 1KECA 4O4IB 3CCEV 5EBLC 2OYQA 4LF7O 2YXHA 4LWSB 1N36O 1H2KA 1XL4A 5JQGB 3HPLC 1WPBA 5E1AC 1AI7A 2IU0A 4PDMA 4FLTA 4BIZA 1BCCH 3ZMVA 3CYOA 1GO3F 3K04A 5LGUA 3ZRXA 1YTFD 3OEEG 4IYHA 4X1KB 3CCSV 3ASNB 4H44B 4YHHO 1LUVA 1WPXA 4W4LA 3WG7C 3H9VA 1R3KC 2HFEC 3SPCA 4N21A 3BA9A 4NXNB 1CEZA 3J80N 4X62B 2KQXA 3TETA 1YXBA 2H8PC 3OUSA 4O4HA 5BR8B 4GUNA 2O57A 2Q7EA 1RPRA 3CRMA 4DRXB 3ZN0A 2W6JG 3L74H 2JVDA 4NTXA 3O9OA 2WA4A 3SYPA 4WFAV 1B3QA 2CH7B 2VQFB 5BMVB 4LP8A 4IGGA 3RN4A 2IJJA 4FLUA 1IBLO 3RFRA 4W4KA 4JYAO 1YIJV 4H13B 4JZGA 1R1BA 3SJAC 1PNKA 4RWUA 4NXMO 4PI0A 4I7ZB 4IYIA 3K5OA 3ABLB 1XMOB 2XAGA 5IYBO 3H1LH 3JASB 2P06A 1COWG 2ZE6A 4ZBMA 1O9HA 4UUJC 2E75B 2X6BA 1VQLV 1J5EO 4LF8B 5CA0B 2PF4E 5L3FA 2YXLA 3E8HA 5JVDA 4TV8A 2GDSA 4LF6B 3WB1A 4RO2A 1B06A 5B3SC 4DV1O 1Y6XA 5FPOA 2P6JA 3FB8C 4UFZA 2WLNA 1M4UA 1KKDA 3F5TA 5IJ0A 2RNBA 3ABMC 2H3OA 2Q5ZA 3ETEA 3K0GA 3RGBA 3MAQA 1D2DA 4L87A 2QDOA 1G6UA 2P4VA 4DK0A 3AG1C 1XNRO 3JATB 4TSFG 1NJIW 1GK9A 3L72H 2VWJA 2VWKA 3CJHA 3L9DA 1S72V 3K08A 1M57C 4JI5O 3KG2A 1XUQA 1YZBA 3ZS8C 5CB4A 1GN4A 3ZRWB 2Q9LA 4PD4F 2OWOA 1BE3H 1JMKC 1JVMA 2RCVA 1KQSU 3IGAC 1VQKV 1OCZC 5CA3A 2ZXWB 1JPXA 3ZBHA 4JI2B 1N32B 4LFBO 2ZE5A 1VQ9V 2ETNA 4ASUG 1K97A 5CN0A 3CRRA 2JS3A 4F6RA 2V4DA 3JSLA 3UT5B 4ZOLB 2AHYA 4OPAA 5IWAB 4JASA 4FPPA 1FXKC 2EILC 2EINC 4FM1A 3CWBH 4X1YA 2ZM6O 2EBOA 3H1JH 2JJ1G 1NR1A 3BABA 4NR1A 3O65A 3CCJV 3CXCU 3T4DA 3JAWA 4LH6A 2RDCA 2JGDB 4UCTA 3E83A 2K9PA 4JI0B 1KP2A 2M7WA 4O4HB 5CBFA 1FXKA 1OCRB 3JD1A 4WFGA 1SQXH 1NVPD 4DV4O 4TWKA 3DXRB 4WF9V 4JI1B 2HHHB 4GLXA 1P7GA 1I08A 3ZHQA 2QE7G 2CGNA 1NTKH 3BHPA 1FFTB 1WNSA 3DTUB 1FJGB 1E79G 3TJTA 4YJ2B 3Q4HB 4IT5A 1HNXO 2E5LB 1I5YA 2R70A 3JARA 3EFFK 3ETDA 5KX5A 4IIJB 2BE3A 1XOUA 2AHZA 4CZZA 1XMQB 1AP5A 1YJNV 4TUYB 1W0JG 3F7VC 3HB3B 4DR6B 1S3JA 1I0HA 1XI1A 1SQVH 1XREA 1SQQH 5B1OA 2Y0IA 1EFRG 2V1DA 4QIWF 4I50B 5JVDB 2Y0PA 3W7WA 4JAVA 4JAUA 2ZINA 2W0XA 3H1IH 3AG7A 3UM7A 2BOCC 4O4JA 1YDXA 1WB7A 4LF4B 4FFBA 2EJ7A 5EK0A 4BW5A 3IJ4A 1QNMA 2Q7GA 5J2TB 5IYDO 1IBMO 4PA4A 3LDCA 4JI7B 3JD4A 3EHBB 4C7UA 2YS8A 4FLVA 3QF7A 2L35A 2DOSA 1DTOA 2DMXA 4PA9A 2NN4A 3NR7A 3FD9A 2ATKC 3DC6A 5LA6A 4LR3A 2BCCH 2XAHA 1N33B 5JH7A 1PNMA 3WU2Z 4CC5A 4RQEA 3RYFB 3OMNB 4I4TA 3ZEDA 1SKVA 1G4YB 3JAKA 1ZX3A 3AK3A 1MA1A 3X2QB 1VF5B 3D3IA 1Q8IA 2QTOA 3QO8A 3HKBA 4HBNA 4IHJB 3T1YB 2GV9A 4GKJO 2JJ2G 4WBNA 4J9YB 5IDJA 4CH4A 4I55B 4DV0O 5B66Z 1EBOA 1VIBA 3THOA 2GTSA 1MMMA 4JTAB 3ICXA 4EKWA 4F6RB 5LMNO 4DV2O 1BSMA 3W7TA 2UUAB 1PL0A 4YJ3A 2F1MA 4MVRA 2VS0A 4LCUC 3FYEB 4X1YB 1OCZB 3G71V 2KKWA 1ZAUA 4JI4O 3ZX6A 2QGNA 3CMEV 4TV9B 4EB6A 1PKXA 3JAWB 5ITZA 1BT8A 3U0ZA 3CC4V 2UU9B 3N2KB 1N0NA 3ABUA 4D7TA 5GONB 3HKDA 3P3PA 5IJ9B 4LF5O 2EINB 5KA6A 5BZBA 4LWSA 1WA8A 3ASNC 2A9HA 1YJWV 1ZTEA 2RMKB 5JQGA 4UCOA 3RYIB 4JGSA 2DW4A 1KD1W 1R6NA 4JI3O 1VQ4V 1Q6HA 2IBZH 1NVPB 3CCUV 4QGPA 3QG5A 3RVYA 1KP3A 3MHHC 1Q82W 4DR3O 1K33A 2XT9A 4X1KA 5L3EA 4LBEC 4ABMA 3L71H 5KX5B 1BL8A 1ZLZA 3AG3C 2JS5A 5C8YA 3ZMZA 5J2UB 4AQYO 2ODMA 2XAFA 4DW0A 4UCRA 3JD0A 4AHCA 3STZC 3CMAV 2AXTZ 2BOBC 2GUZB 1E1QG 4GX2A 4DRXA 4UXNA 5FNVA 2C2AA 3MD0A 4DR7B 2UXCO 4WCEV 1FKAO 1HR0B 2CH7A 3ABLC 4FLXA 5BMVA 3CSXA 1K9MW 1YF2A 4LNUB 4Z1VA 4KUMA 5DECA 3D8CA 3OGIB 4CH5A 3T4ZA 2HEPA 2UUCO 1YITV 1KYOF 2FTKA 1Q6IA 1SC5B 1VMGA 3K5NA 3CC2V 4XDKA 4D7SA 3MDSA 2QEXV 3G80A 2KB1A 4JV5O 2IJIA 4KHPB 1WP7A 4WFEA 4GX0A 3CCRV 5JH7B 4FLYA 4FM0A 3BRCA 2QM7A 3NXSA 4U7OA 1S5JA 4DR5O 2Q73A 5CA0A 2N04A 1M1KW 4DV6O 1EZVH 3K9AA 5EZYB 3OM3B 4I4TB 1VQMV 3JAKB 4X1IA 1XHZA 4B3RO 1R6KA 2B5UA 3OEHG 2Q69A 3OTOO 3CS5A 4YIPA 4X66B 3HKBB 3OR6C 2F23A 3L70H 3A8TA 3IC7A 2ITCC 4NVPA 4DR1O 2GTAA 4BIUA 3OR7C 3AG4B 4LH7A 1DLBA 4YIOA 1SQBH 2BSKB 4WFBV 2JGUA 1HWYA 5LL6Y 1SRYA 1I94O 1HNWO 4B3SO 2Q0AA 3ZRVA 4ZKIA 1L0LH 3LDDA 3JATA 4X88A 4YHHB 2E74B 3FB7C 2QM8A 2RQ6A 5KA5A 4K0KO 3VQWA 5LHIA 1B04A 2QWOB 4IL6Z 2V7QG 1ORQC 5H5NA 3W7UA 1KKCA 1HW7A 1M90W 3LSUA 1OJHA 5L3DA 2XHBA 1SF9A 3ZRWA 3C90A 2UXDB 4LF9O 3G6BA 3J7AU 4LFCO 1SQPH 4MW3A 1NI8A 2XASA 1B6QA 1XNQB 3SJQC 3AK1A 3HKEB 2IW5A 3HKDB 2ARHA 1V55B 4UCSA 5KAFZ 1WA8B 2JRIA 2UUBB 4LFAO 4L8JA 2YEVA 4DR2O 4GKKO 3S3XA 1A32A 1K92A 3JD2A 5CMUA 2Z0AA 4O2AA 3UT5A 3C3SA 4ZOLA 1IBKO 3G6EV 4ZI7B 1EM1A 4B3TO 1OCRC 1IXBA 2NNUA 5IT9N 4DR4O 4JTDB 5C8YB 2DN9A 5KHHA 2LFSA 2JGDA 4R7CA 3CE2A 4FLZA 1M56C 1FD9A 1X4TA 3KCXA 2WLMA 2CTRA 4JF3A 2FKXA 3UKMA 4D6TH 3T1HO 3HR0A 2PTMA 5FNVB 4DV1B 3BY6A 1XEQA 3DXRA 3AG3B 3VQXA 3K5LA 2BTOA 1ENVA 3CRQA 5H6QA 4B7KA 2EZOA 4MT8A 1HDJA 2WA3A 2CTWA 1UJWB 4GCZA 4YJ2A 3Q4HA 4TT3G 3ML0A 4N23A 4HNAA 1IURA 3M99B 1G1XB 2QJ1A 4DV3O 4IIJA 4B3MB 3P32A 4G2KA 4EFEA 3SPIA 2PUSA 3OGCC 2WWWA 4TUYA 2WLLA 4PV1B 1N34B 2RJZA 1DF4A 4X65B 2QTSA 3JYCA 2P5OA 4J41A 4I50A 4X1IB 1VQ8V 4KXRA 3RVZA 4XBFA 1AJPA 4H33A 2OTJV 1ZL8A 1AB3A 2ZQMA 1NU1H 2IJHA 4NXNO 3CCQV 3JCUZ 4DUZB 5B5EZ 4X62O 5J2TA 2DE0X 4QPKA 2QR4A 2Y4UA 2WSSG 5BR8O 3RBZA 1G8MA 1GAXA 2CDYA 3ETGA 3CPWU 3X2QC 5BY1A 4QNHB 2VQFO 3QO7A 3ZMUA 2P4KA 1OZ0A 1AJQA 3U11A 3RYFA 1TUBB 4KFMA 2AZ2A 4WFHA 1KMIZ 3CEIA 5JCOC 5KAIZ 3UQ8A 2VRZA 1PD3A 4AILC 1KUQA 1URFA 2AW9A 2EZPA 4IHJA 4K8XA 1XMOO 2IM9A 4JTCB 2Y4TA 1XBLA 2WAMA 1F7YA 4WFFA 1YI2V 4I55A 1P49A 2YEVB 4LF8O 1BHBA 3N2GB 4O2AB 5JCOA 1WLEA 4MVQA 4LF6O 1GH6A 4FZ1A 3SPGA 2ZR3A 3LNMB 5B1AB 1R3JC 1QHTA 4DV7B 4FM2A 5JJNB 5FL7G 4TV9A 2Q67A 2X6AA 3K3WA 3FX7A 3N2KA 3FB6C 5GONA 5LOVB 5IJ9A 3IFXA 1QVGU 1JX9A 4PDLA 4FZ0A 1XL6A 1JFFA 1N8RW 3SPHA 4QJFB 4J7ZA 3RYIA 4UCVA 3BVOA 1BQZA 1SA0B 2D2CB 1AP6A 1BMFG 3BA8A 1PM9A 2ZIMA 4UB8Z 1M56B 3RYHA 3K03A 4BAYA 5EIBC 5EC2C 2CGOA 2OIGA 2ZE8A 3WFVA 4HNAB 1CP9A 5J2UA 1N32O 5BXZA 2WLJA 5EIBD 3ZMTA 2X0LA 2WLLB 3E8BA 2PY5A 2GUZA 5K1XA 5CA1B 4TQDA 4JZ2A 1KB9F 1TVKB 1QVFU 4MSWC 1R73A 1HP8A 1ZL8B 1QLEB 4LNUA 2RN9A 4R6ZA 2F4VB 5DN6G 1H2SB 3R65A 1S5LZ 5LBQA 1VF6C 1EN5A 1GMGA 5EYPB 4JI0O 2QKCA 1QBZA 1RP3B 4PA3A 4BR6A 1NS1A 2F93B 1QLNA 3TXSA 4P30A 2Z5UA 2HJFC 4FK5C 1K7DA 4JI4B 2Y48A 2HHHO 4Z1MG 1VF6A 1K5SA 3AG4C 1WP8A 1K4DC 3CB2A 1FJGO 1R3IC 1V54B 5EZYA 3BCCH 1M9NA 2E5LO 1ZSPA 1HNZB 3E2EA 3SJCC 4QE9A 1FYJA 1RPOA 2HP8A 4MVUA 5KLVH 2WLKA 1XMQO 2Q4PA 5D5PA 2ZCEA 2QM4A 2BSKA 2HG5C 1K4CC 4DR6O 4X9QA 1SZXA 4DR3B 5C93A 1V9PA 5LMUB 3PN1A 2NLJC 4JI8O 1S77D 1Q81W 1JCHA 1V55C 1YVWA 4PELA 3OAAG 3B2EE 4PDRA 4LF4O 4PA7A 4UVAA 3E89A 3FB5C 3C3TA 3R66A 3TK1A 2OIEA 3MHSC 2UXXA 4MTFA 2EIMC
chains in the Genus database with same CATH topology
1DLBA 2DWEC 4MTOA 1K8AW 1VQ5V 1FXVA 2JEXA 4WFBV 3WG7B 1S0VA 3STLC 4ZBMA 4UUJC 1HWYA 2X6BA 1VQLV 1SRYA 3E8GA 2XNDG 3ZRVA 1AI5A 3K79A 4QE7A 4ZKIA 1P4RA 5L3FA 3OW2U 3LDDA 4X88A 3E8HA 1SERA 3FB7C 2QM8A 5KA5A 4FMTA 1LNQA 4RO2A 5LHIA 5B3SC 2B1IA 2GSMB 1NQTA 2P6JA 2V7QG 4LC1A 3E8FA 1ORQC 2UXNA 5EC1C 3FB8C 3GB7C 3W7UA 1M90W 1QR9A 5L3DA 2WLNA 2EIKB 3ZRWA 5J9PC 1KKDA 4GX5A 3ZN1A 3LSSA 2Z3YA 2WPDG 1VQ6V 1S5HC 1H8HG 3ABMC 4MW3A 2QKSA 5EBMC 2XASA 1B6QA 3ETEA 3K0GA 3SJQC 4JYCA 4R50A 1Y4MA 2IW5A 4MTXA 4L87A 1V55B 5H9CA 3B8NA 1QCEA 2JK5C 4MVZA 1GM9A 1I5XA 3AG1C 1OCOC 4TSFG 1IXMA 1NJIW 3AG2B 1GK9A 3G4SV 2F43G 2YEVA 3D36A 3T1CA 3SPJA 2Q68A 1S72V 4X89A 1K92A 1L1FA 3K08A 1S76D 4G27B 3JD2A 1M57C 5CMUA 1P7BA 3ABKB 3SYAA 1K34A 3KG2A 3CC7V 1Q86W 3F7YC 3G6EV 1BHAA 3ZRWB 1OCRC 1K5QA 3ZCCA 1JVMA 2NNUA 1KQSU 3IGAC 4JTDB 1THZA 3QNEA 1AI6A 1VQKV 1SETA 1OCZC 2WLHA 5CA3A 1YSCA 2ZXWB 2LFSA 1Q7YW 4R7CA 5B3SB 1JPXA 4OXSA 2EIJC 2PI5A 2A79B 2ITDC 1MABG 2R9IA 1VQ9V 1M56C 4ASUG 1PNLA 1K97A 5CN0A 3OE7G 2WLMA 5IY5B 3VOUA 4JF3A 2Q6AA 3UKMA 1QR8A 5LHGA 3ABMB 1NH2D 2AHYA 5EBWC 4JASA 3BY6A 4FPPA 2HKOA 1FXKC 2HVJC 2EILC 2EINC 3AG3B 2OCCB 3TCUA 2EBOA 3JD3A 4J9ZB 2JJ1G 1KC8W 3AG1B 1NR1A 1OCOB 3BEHA 1ENVA 3CCJV 5H6QA 3CXCU 3T4DA 2EZOA 4P2ZA 4HAMA 4MT8A 1UJWB 4CBCA 4GCZA 3PJSK 3E83A 1M57B 1TUEB 4RAIA 4GT1A 4TT3G 3ML0A 2DYRC 4N23A 1KP2A 3M99B 5CBGA 3GWOA 2OT5A 2M7WA 3P32A 4G2KA 5CBFA 1FXKA 1OCRB 2LP7A 1J95A 3SPIA 3JD1A 4WFGA 3OGCC 1NVPD 2WWWA 4TWKA 4KP4A 1OCCC 2WLLA 4WF9V 4MW8A 2HR3A 1R3LC 1DF4A 2DYSC 2OTLV 4DXWA 3B77A 2EIJB 2A0LA 2QE7G 5B1BC 3JYCA 1FFTB 3DTUB 1MOFA 3ASOC 3I56V 1DF5A 1E79G 3K0DA 1VQ8V 2LFRA 3RVZA 4FIPC 4XBFA 2JIZG 1AJPA 3ABTA 4F4LA 2WLIA 4H33A 2OTJV 3E86A 5KUKA 1F4MA 1I5YA 2ZQMA 3EFFK 2IJHA 3ETDA 2P7TC 2P67A 2XAJA 3CCQV 3CD6V 1FXKB 2EILB 4QPKA 2AHZA 3LDEA 4CZZA 3SYQA 4UVCA 3B8MA 3FYIB 1YJNV 2WSSG 1W0JG 3RBZA 1G8MA 3F7VC 3HB3B 1S3JA 5B1AC 2HVKC 3ETGA 5L3BA 3CPWU 3X2QC 4RUEA 5B1OA 1AI4A 5LGNA 1EFRG 2V1DA 4QIWF 4UV9A 4QNHB 3QO7A 3ZMUA 2IU3A 3W7WA 4JAVA 4JAUA 1OZ0A 2Y69C 2XAQA 3UM7A 1AJQA 2BOCC 4PDVA 4X8AA 2PI4A 2EIMB 4MS2A 3DGEA 1YHQV 5EK0A 4BW5A 4KFMA 4WFHA 5IYDO 2DYSB 2JDIG 4PA4A 2D3OW 3LDCA 1FS0G 1PD3A 4UVBA 2W6IG 3JD4A 5B1BB 2EZPA 3EHBB 4Q20A 3QO5A 3JCZA 1GM7A 1E1RG 3ASOB 1FXHA 4JTCB 4XDLA 3FKSG 2ZD9A 4RQFA 1DTOA 1NR7A 2WAMA 2IJKA 4PA9A 4WFFA 2B1GA 1YI2V 5DM6V 1W0KG 2ATKC 2ZDIC 3LUTB 2YEVB 2XAHA 2ZR2A 3OMIB 1BHBA 1MSWD 1PNMA 4UV8A 5IYCO 1RM1C 5H6RA 4RQEA 1EZJA 1WLEA 4MVQA 3OMNB 4G28B 3SPGA 2ZR3A 1G4YB 4GX1A 5GW7A 3LNMB 5B1AB 1VQ7V 3X2QB 3D3IA 1R3JC 2QTOA 3QO8A 3AEIA 5FL7G 5L3CA 2ZDIA 4MVMA 3ZMSA 2Q67A 3P30A 1MG1A 1ZWIC 2X6AA 3K3WA 2Y69B 2JJ2G 2XOKG 4R8CA 3SYOA 4J9YB 5IDJA 2W0FC 1EBOA 1SESA 3FB6C 3ZJZA 4DO2A 3ZRSA 3A0RA 1GKFA 4JTAB 4I9WA 5L3GA 3K06A 4EKWA 1SZTA 3IFXA 4JPRA 2IH3C 1QVGU 1JX9A 1QLEC 4PDLA 2R9RB 3W7TA 1XL6A 1PL0A 1N8RW 3SPHA 4QJFB 4MVRA 4P9OA 4U7NA 4MVOA 4LCUC 3FYEB 1NBMG 1OCZB 3G71V 2CK3G 1BMFG 5HFLA 1NH2B 1AROP 1VQPV 4RUFA 5B1NA 3AG2C 3CMEV 1M56B 3K03A 1PKXA 4YXWG 4MTGA 4JYBA 1H2GA 3ABKC 3CC4V 4BAYA 3CCLV 3VBBA 4MVSA 5EC2C 3ABUA 3WFVA 1RM1B 1AR1B 3CP1A 1VQNV 1GM8A 4E2LA 3W7SA 1CP9A 2EINB 3SYCA 5KA6A 2WLJA 5BZBA 1ROPA 3ASNC 2A9HA 3OR7C 3ZMTA 1YJWV 3CCVV 1AJNA 1V54C 1F4NA 2X0LA 1F23A 2WLLB 3LSQA 3OUFA 4JGSA 3E8BA 2DW4A 2ZXWC 1KD1W 2EJRA 1R6NA 2MK3A 1VQ4V 2H94A 3E35A 1NVPB 3OMAB 3I55V 2DYRB 3CCUV 3RVYA 1H38A 1KP3A 3MHHC 1W2BU 1QVFU 5IY5C 1Q82W 2JEUA 4MSWC 1R73A 1H8EG 1K33A 2WLIB 5L3EA 4LBEC 1YJ9V 2K1EA 3RW0A 1QLEB 4R6ZA 4H37A 1CPYA 1VQOV 1OCCB 4QPJA 1BL8A 5DN6G 3R65A 1KECA 2OCCC 3AG3C 3ZMZA 5LBQA 3CCEV 5EBLC 1GMGA 2XAFA 1JJ2U 1QBZA 4PA3A 3JD0A 1XL4A 3STZC 2GHYA 2X6CA 3HPLC 3H01A 3CMAV 2BOBC 1QLNA 2HLDG 5E1AC 4P30A 1AI7A 2Z5UA 2IU0A 4PDMA 2HJFC 5CBHA 4BIZA 1E1QG 1GTOA 4GX2A 1NKDA 4FK5C 4UXNA 1K7DA 3ZMVA 1K3EA 2C2AA 3MD0A 3CYOA 4BIUA 2Y48A 4WCEV 4PA6A 1GO3F 3K04A 5LGUA 3F5WC 3ABLC 3ZRXA 1YTFD 3OEEG 4Z1MG 1K9MW 1K5SA 3AG4C 3CCSV 3ASNB 4KUMA 1K4DC 1R3IC 2X7RB 4MTFA 1V54B 1WPXA 3WG7C 1R3KC 2HFEC 2P90A 4N21A 3SPCA 1Y66A 1M9NA 3T4ZA 1CEZA 1F51A 4HZ3A 1YITV 3TETA 2FTKA 5HFMA 2YSUB 3CC2V 3E2EA 4XDKA 2H8PC 4QE9A 3OUSA 1RPOA 1RPRA 4MVUA 3ZN0A 2W6JG 5LGTA 2WLKA 2QEXV 2KB1A 2IJIA 3SYPA 2EIKC 4WFAV 2HG5C 4XDJA 1K4CC 4WFEA 4I5SA 4GX0A 3CCRV 3T2MA 1K73W 4LP8A 5C93A 4U7OA 2QM7A 3NXSA 3ZIAG 1OHHG 5LHHA 4HYOA 2NLJC 1JQ0A 1M1KW 2IH1C 3K9AA 3OM3B 1S77D 1Q81W 2IJJA 1JCHA 1V55C 4P9PA 1VQMV 1YTFB 3OFNG 2DQ3A 2DWDC 1R6KA 2B5UA 3OEHG 2Q69A 1YIJV 1JOYA 4PELA 3W7XA 3OAAG 4PDRA 4PA7A 4UVAA 2QA4V 5KUMA 3OR6C 1PNKA 3E89A 3CCMV 3FB5C 3IC7A 3ABLB 2ITCC 2XAGA 3TK1A 3MHSC 2UXXA 5IYBO 2DQ0A 4FJCC 2EIMC 3AG4B 1COWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B U;  1VQ7 V;  1S72 V;  1QVF U;  1Q82 W;  1YIT V;  1Q7Y W;  1KC8 W;  1M1K W;  1K8A W;  3CCQ V;  1VQ5 V;  3CD6 V;  4WFB V;  1VQN V;  1R73 A;  4WF9 V;  3CC7 V;  1N8R W;  3CCJ V;  1VQ9 V;  1VQ6 V;  1YI2 V;  3CC2 V;  1Q81 W;  3CXC U;  5DM6 V;  1Q86 W;  1VQM V;  1VQL V;  2OTL V;  3G6E V;  1YJ9 V;  4WCE V;  2OTJ V;  3G71 V;  1YJW V;  1YIJ V;  1YHQ V;  3OW2 U;  3CCV V;  1VQO V;  1YJN V;  1VQP V;  3CME V;  2QA4 V;  1K9M W;  2QEX V;  3CCS V;  3CCE V;  3CCM V;  3I56 V;  1VQ8 V;  1KD1 W;  1JJ2 U;  1KQS U;  1VQ4 V;  4WFA V;  2D3O W;  3CPW U;  3CC4 V;  3CCR V;  3CCL V;  1K73 W;  1VQK V;  3CMA V;  3I55 V;  1M90 W;  1NJI W;  3CCU V;  1QVG U;  3G4S V; 
#chains in the Genus database with same CATH topology
 5A9G A;  2YI8 A;  1K8A W;  3SDL A;  1VQ5 V;  2JEX A;  3HKE A;  3A0H Z;  4J10 A;  3K79 A;  4QE7 A;  3OW2 U;  1P4R A;  5LP6 B;  1JFF B;  3K9S A;  1N33 O;  4FMT A;  3K5M A;  4DV5 B;  1LNQ A;  1FPO A;  4Q6G A;  2P22 C;  3B09 A;  1N0J A;  4LC1 A;  3E8F A;  2UXN A;  5EC1 C;  3GB7 C;  1QR9 A;  3D36 C;  3RYH B;  2EIK B;  4ZI7 A;  4GX5 A;  4X20 B;  2Z3Y A;  2YUA A;  2WPD G;  3N27 A;  2QKS A;  4YY3 B;  3T1Y O;  4JYC A;  4R50 A;  3CRC A;  4O4L B;  3P3N A;  5H9C A;  3B8N A;  1QCE A;  1I5X A;  1PV0 A;  4FVM A;  3G4S V;  2F43 G;  3D36 A;  3T1C A;  2E76 B;  1L1F A;  1S76 D;  5A2Q N;  3CC7 V;  1Q86 W;  3F7Y C;  3QTC A;  2UUA O;  1L0N H;  4JI6 B;  2UXB O;  4K3A A;  3ZHV A;  3FAV A;  2VQE B;  1WAZ A;  1VAR A;  1IX9 A;  4AI8 A;  3L73 H;  4ZHQ B;  1THZ A;  3QNE A;  1AI6 A;  2CE4 A;  1SET A;  3JAL A;  2WLH A;  2UU9 O;  2QKA A;  4OXS A;  2PI5 A;  2A79 B;  2ZNJ A;  1MAB G;  2FL4 A;  4K35 A;  1Q5O A;  1M93 A;  3L75 H;  4CS3 A;  4NYK A;  2HJD A;  5LXT B;  2Q6A A;  1QR8 A;  4B08 A;  3IAY A;  1Q3E A;  1NH2 D;  5EBW C;  3WB0 A;  3GWK C;  4CC6 A;  1CXZ B;  1GN2 A;  2HVJ C;  4TQF A;  4UB6 Z;  3JD3 A;  1KC8 W;  3OD4 A;  1OCO B;  4OX9 B;  4DUY B;  2N05 A;  4CBC A;  4F6E A;  1TUE B;  4RAI A;  4GT1 A;  4LF7 B;  1P84 F;  2DYR C;  1N36 B;  3RT3 C;  3U10 A;  5CBG A;  1D5A A;  1XHX A;  2A06 H;  2LP7 A;  1L8D A;  1Y67 A;  3A0B Z;  3WB2 A;  1TA8 A;  2QWR B;  5KHJ A;  1OCC C;  4MW8 A;  2HR3 A;  1R3L C;  1FFX A;  4DXW A;  1MSD A;  3B77 A;  4DR7 O;  3CX5 F;  2EIJ B;  2BTQ B;  2QSA A;  2AZ0 A;  5TIS Z;  1DF5 A;  3K0D A;  3UO2 A;  1U97 A;  1Z2G A;  4FIP C;  4DYL A;  2CAZ C;  2JIZ G;  3ABT A;  4F4L A;  2WLI A;  3E86 A;  5KUK A;  5IYZ B;  4X64 O;  3TXQ A;  2P67 A;  2XAJ A;  3CD6 V;  1TUB A;  2PYJ A;  5KHG A;  3FYI B;  4J42 A;  4E4E A;  3OT7 A;  4DW1 A;  5B1A C;  3B4S A;  3IC9 A;  2FML A;  5L3B A;  4RUE A;  1AI4 A;  4KHP O;  4UV9 A;  2IU3 A;  1VP7 A;  4CS4 A;  1KBH A;  2XAQ A;  1IBL B;  2LQT A;  4JYA B;  3N2G A;  4PDV A;  2PI4 A;  2EIM B;  4J7J A;  5JWP A;  3DGE A;  3APQ A;  4DV3 B;  4NXM B;  2YC0 A;  2DYS B;  4CH6 A;  4X66 O;  1D5N A;  2D3O W;  3CRA A;  2AGA A;  4UVB A;  2W6I G;  1VF7 A;  5B1B B;  1O9G A;  4Q20 A;  3QO5 A;  3JCZ A;  1GM7 A;  3ZHR A;  3ASO B;  1BQ0 A;  3FKS G;  1QU7 A;  1J5E B;  2B1G A;  1W0K G;  3LUT B;  3S3W A;  2ZR2 A;  3OMI B;  3J81 N;  5FLX N;  5LYJ B;  3M8A A;  5LOV A;  2Q8V A;  1MSW D;  3SGI A;  5IYC O;  1XQ8 A;  1VEW A;  3E22 A;  4G28 B;  3FAV B;  5GW7 A;  1SA0 A;  2FB5 A;  3AEI A;  5L3C A;  3ZMS A;  3JAL B;  4I9Q A;  3P30 A;  1MG1 A;  2UXD O;  1ZWI C;  3DC5 A;  2Y69 B;  2XTA A;  1Y76 B;  2LW1 A;  2XOK G;  3SYO A;  1XNQ O;  2W0F C;  5JJJ B;  1IDS A;  3EVK A;  1XNR B;  4KL1 A;  1GKF A;  2KSD A;  4JPR A;  2ZKO A;  2UUB O;  4JI5 B;  1QLE C;  4H0L B;  2KG7 B;  3VQY A;  4MVO A;  2DJV A;  1LR1 A;  2G38 A;  5CA1 A;  2CK3 G;  4CH3 A;  5HFL A;  1NH2 B;  1ARO P;  1SS3 A;  1Q6U A;  2ADQ B;  5B1N A;  3AG2 C;  4NTW A;  1TVK A;  4YXW G;  1AR5 A;  3ABK C;  5IE9 A;  2M6Y A;  1RM1 B;  4LFB B;  3CHX A;  3CP1 A;  1AR1 B;  1BZK A;  1TAE A;  1VQN V;  1NT2 B;  5EYP A;  3BPZ A;  1AJN A;  1V54 C;  1F4N A;  5K1P A;  1F23 A;  2LGW A;  2ADP A;  3LSQ A;  3RYC A;  1FFX B;  5KHI A;  2YI9 A;  2MK3 A;  3E35 A;  2ZM6 B;  3OMA B;  3I55 V;  2DYR B;  5IY5 C;  2JEU A;  3CXH F;  1SQF A;  2YXY A;  2EUL A;  2WLI B;  3H1K H;  3UO3 A;  1YJ9 V;  2K1E A;  3RW0 A;  4H37 A;  3A2F A;  1CPY A;  2PGG A;  1OCC B;  2OCC C;  3I5D A;  4PJ0 Z;  4EEQ A;  3ZHT A;  2YIC A;  2ZT9 B;  2EX3 A;  1Y74 B;  1JJ2 U;  1AVM A;  4DV4 B;  2GHY A;  2X6C A;  4B3M O;  3H01 A;  4J80 A;  2HLD G;  5CBH A;  1GTO A;  1NKD A;  2PYL A;  1K3E A;  4OPH A;  4GZR B;  3K57 A;  1N34 O;  2YIB D;  4PA6 A;  2MW2 B;  2PZS A;  2Q0O C;  4ZIB A;  4X65 O;  3F5W C;  2F66 C;  1HNX B;  2X7R B;  2YIB A;  2P90 A;  1Y66 A;  1F51 A;  4HZ3 A;  5LP6 C;  1WB8 A;  5HFM A;  2YSU B;  3KZI Z;  4DUZ O;  1RSO A;  5LGT A;  1MZF A;  4NTY A;  1FAF A;  2ZNI A;  2EIK C;  4XDJ A;  4I5S A;  3T2M A;  1K73 W;  2CUG A;  4PI2 A;  3ZIA G;  1OHH G;  3SR2 C;  5LHH A;  4HYO A;  1JQ0 A;  5LP6 A;  2IH1 C;  3E22 B;  1GN6 A;  1EN6 A;  4P9P A;  3TGU H;  1YTF B;  3OFN G;  1Z5W A;  2DQ3 A;  2DWD C;  1JOY A;  3W7X A;  1IBM B;  2QA4 V;  5KUM A;  3CCM V;  1GRJ A;  3VQV A;  1I7F A;  2LW7 A;  4X20 A;  2DQ0 A;  4FJC C;  1BGY H;  2DWE C;  4MTO A;  1FXV A;  2YIA A;  3WG7 B;  1S0V A;  3STL C;  4O4L A;  4BWA A;  4O2B A;  3DSQ A;  4JI2 O;  2QWQ B;  3E8G A;  2XND G;  5GTH Z;  1AI5 A;  1SER A;  4JAA A;  3RWR D;  1X59 A;  2B1I A;  2GSM B;  1NQT A;  5IWA O;  3JAM N;  1U96 A;  5J9P C;  3AK2 A;  3ZN1 A;  4BIO A;  3LSS A;  1UPG A;  4GKJ B;  3KKY A;  1VQ6 V;  1S5H C;  2F95 B;  1H8H G;  4DV7 O;  1MZE A;  5EBM C;  1Q90 D;  1M5I A;  1EN4 A;  4ZHQ A;  4DV0 B;  1Y4M A;  3FFQ A;  4MTX A;  1JA8 A;  1LUW A;  5LMN B;  4DV2 B;  2A7W A;  2JK5 C;  5KMG A;  1PL4 A;  4MVZ A;  1GM9 A;  4BW9 A;  1OCO C;  1IXM A;  4TV8 B;  3AG2 B;  1PP9 H;  3RYC B;  4JI8 B;  3SPJ A;  2Q68 A;  4X89 A;  4G27 B;  5LXT A;  1P7B A;  3ABK B;  3SYA A;  1K34 A;  2E3C A;  1IVS A;  2ZE7 A;  1BHA A;  1R6T A;  4JI1 O;  5IJ0 B;  2R72 A;  1KU9 A;  1K5Q A;  4ICG A;  5AG2 A;  3ZCC A;  4I0X A;  3OTF A;  2ZIO A;  1T5E A;  1US6 A;  1RFY A;  1TGO A;  1AIL A;  1YSC A;  4LF5 B;  1Q7Y W;  5B3S B;  3HKC A;  2EIJ C;  2ITD C;  2R9I A;  1PNL A;  3CJH B;  3ZHS A;  5D5Q A;  3OE7 G;  5IY5 B;  1Q43 A;  3VOU A;  5LHG A;  3ABM B;  4JI3 B;  5CB4 B;  3K59 A;  2HKO A;  2OCC B;  3KCY A;  2XUM A;  1H2L A;  3TCU A;  1YCI A;  2ILM A;  1SQG A;  4J9Z B;  3AG1 B;  2BTQ A;  3BEH A;  4P2Z A;  4HAM A;  1UFI A;  1WJZ A;  3M7M X;  3APO A;  3PJS K;  2Q7H A;  4DK1 A;  1M57 B;  4AQY B;  5FPR A;  1NTM H;  2F4V O;  4U3F H;  4K8Z A;  5IYZ A;  3GWO A;  1RSO B;  2OT5 A;  4U3J A;  4PHZ A;  1ZUQ A;  1J95 A;  3ETQ A;  4JI7 O;  4KP4 A;  1DGS A;  2UXB B;  2UXC B;  4GYC B;  1AR4 A;  2DYS C;  2OTL V;  4TOI A;  4B7E A;  1NTZ H;  2A0L A;  4FFK A;  5B1B C;  4FLW A;  1OV9 A;  1MOF A;  3ASO C;  5GTI Z;  3I56 V;  1MNG A;  2LFR A;  1XIL A;  2UUC B;  1F4M A;  4J11 A;  2P7T C;  3D3Q A;  1FXK B;  2EIL B;  4O4I A;  1IZ3 A;  1JJO A;  3LDE A;  3SYQ A;  4UVC A;  5F2V O;  3B8M A;  1HNZ O;  1YEW A;  4JV5 B;  1JR9 A;  4O2B B;  4Z2W A;  2HVK C;  4DR5 B;  5LGN A;  1DK1 A;  2QWP B;  4DV6 B;  4A5U B;  2LJ2 A;  1Z5V A;  2Y69 C;  2OCH A;  5LYJ A;  4B3R B;  3EXA A;  5LMU O;  4X8A A;  3OTO B;  4JYY A;  3JAR B;  4MS2 A;  2R9A A;  1YHQ V;  2QWN B;  1H2N A;  1W59 A;  2JDI G;  4DR1 B;  3LNN A;  2A3Q A;  1FS0 G;  2CTQ A;  5KHK A;  1E1R G;  3BFR A;  1FXH A;  4XDL A;  2ZD9 A;  4RQF A;  4UCU A;  1Y76 A;  5KMG B;  1NR7 A;  1I94 B;  2IJK A;  4B3S B;  2B9Z A;  1HNW B;  5DM6 V;  2ZDI C;  4OGQ B;  1PPJ H;  2CTP A;  2LO1 A;  2GBO A;  4K0K B;  4NB5 A;  1N4C A;  3UCS C;  4O4J B;  4UV8 A;  5E79 Z;  2NR5 A;  1RM1 C;  5H6R A;  3QVN A;  4FFB B;  4EFB A;  1EZJ A;  2KG7 A;  3BAA A;  4DV5 O;  4X64 B;  4GX1 A;  1VQ7 V;  4LF9 B;  4I0X B;  1H2M A;  4LFC B;  2L6L A;  2ZDI A;  4MVM A;  4R8C A;  4YY3 O;  3HKC B;  3JAS A;  5LA6 B;  1SES A;  4DO2 A;  3ZJZ A;  3ZRS A;  3A0R A;  4LFA B;  3H1H H;  4I9W A;  3ZHU A;  5L3G A;  3K06 A;  4DR2 B;  1SZT A;  4GKK B;  2IH3 C;  1NZ6 A;  3B40 A;  2R9R B;  2FYU H;  1IBK B;  1GN3 A;  2LGQ A;  4P9O A;  3SJB C;  4U7N A;  4B3T B;  1NBM G;  1XDC A;  4J7K A;  4JI6 O;  1VQP V;  4RUF A;  5DED A;  4DR4 B;  1HR0 O;  4CS2 A;  2VQE O;  1BS3 A;  4NKG B;  4MTG A;  4JYB A;  1H2G A;  4WBN B;  3CCL V;  3VBB A;  4MVS A;  4U3J B;  1GM8 A;  4E2L A;  3W7S A;  3SYC A;  2YID A;  5H2F Z;  1ROP A;  3T1H B;  1Y74 A;  3CCV V;  5JJE B;  4YJ3 B;  3OUF A;  2ZXW C;  2EJR A;  2H94 A;  1QQC A;  3GVM A;  4EB6 B;  1H38 A;  3G67 A;  1W2B U;  5ITZ B;  2YDE A;  1WN7 A;  1H8E G;  2N74 A;  4OX9 O;  3K58 A;  4DUY O;  1VQO V;  4QPJ A;  3JSN A;  1KEC A;  4O4I B;  3CCE V;  5EBL C;  2OYQ A;  4LF7 O;  2YXH A;  4LWS B;  1N36 O;  1H2K A;  1XL4 A;  5JQG B;  3HPL C;  1WPB A;  5E1A C;  1AI7 A;  2IU0 A;  4PDM A;  4FLT A;  4BIZ A;  1BCC H;  3ZMV A;  3CYO A;  1GO3 F;  3K04 A;  5LGU A;  3ZRX A;  1YTF D;  3OEE G;  4IYH A;  4X1K B;  3CCS V;  3ASN B;  4H44 B;  4YHH O;  1LUV A;  1WPX A;  4W4L A;  3WG7 C;  3H9V A;  1R3K C;  2HFE C;  3SPC A;  4N21 A;  3BA9 A;  4NXN B;  1CEZ A;  3J80 N;  4X62 B;  2KQX A;  3TET A;  1YXB A;  2H8P C;  3OUS A;  4O4H A;  5BR8 B;  4GUN A;  2O57 A;  2Q7E A;  1RPR A;  3CRM A;  4DRX B;  3ZN0 A;  2W6J G;  3L74 H;  2JVD A;  4NTX A;  3O9O A;  2WA4 A;  3SYP A;  4WFA V;  1B3Q A;  2CH7 B;  2VQF B;  5BMV B;  4LP8 A;  4IGG A;  3RN4 A;  2IJJ A;  4FLU A;  1IBL O;  3RFR A;  4W4K A;  4JYA O;  1YIJ V;  4H13 B;  4JZG A;  1R1B A;  3SJA C;  1PNK A;  4RWU A;  4NXM O;  4PI0 A;  4I7Z B;  4IYI A;  3K5O A;  3ABL B;  1XMO B;  2XAG A;  5IYB O;  3H1L H;  3JAS B;  2P06 A;  1COW G;  2ZE6 A;  4ZBM A;  1O9H A;  4UUJ C;  2E75 B;  2X6B A;  1VQL V;  1J5E O;  4LF8 B;  5CA0 B;  2PF4 E;  5L3F A;  2YXL A;  3E8H A;  5JVD A;  4TV8 A;  2GDS A;  4LF6 B;  3WB1 A;  4RO2 A;  1B06 A;  5B3S C;  4DV1 O;  1Y6X A;  5FPO A;  2P6J A;  3FB8 C;  4UFZ A;  2WLN A;  1M4U A;  1KKD A;  3F5T A;  5IJ0 A;  2RNB A;  3ABM C;  2H3O A;  2Q5Z A;  3ETE A;  3K0G A;  3RGB A;  3MAQ A;  1D2D A;  4L87 A;  2QDO A;  1G6U A;  2P4V A;  4DK0 A;  3AG1 C;  1XNR O;  3JAT B;  4TSF G;  1NJI W;  1GK9 A;  3L72 H;  2VWJ A;  2VWK A;  3CJH A;  3L9D A;  1S72 V;  3K08 A;  1M57 C;  4JI5 O;  3KG2 A;  1XUQ A;  1YZB A;  3ZS8 C;  5CB4 A;  1GN4 A;  3ZRW B;  2Q9L A;  4PD4 F;  2OWO A;  1BE3 H;  1JMK C;  1JVM A;  2RCV A;  1KQS U;  3IGA C;  1VQK V;  1OCZ C;  5CA3 A;  2ZXW B;  1JPX A;  3ZBH A;  4JI2 B;  1N32 B;  4LFB O;  2ZE5 A;  1VQ9 V;  2ETN A;  4ASU G;  1K97 A;  5CN0 A;  3CRR A;  2JS3 A;  4F6R A;  2V4D A;  3JSL A;  3UT5 B;  4ZOL B;  2AHY A;  4OPA A;  5IWA B;  4JAS A;  4FPP A;  1FXK C;  2EIL C;  2EIN C;  4FM1 A;  3CWB H;  4X1Y A;  2ZM6 O;  2EBO A;  3H1J H;  2JJ1 G;  1NR1 A;  3BAB A;  4NR1 A;  3O65 A;  3CCJ V;  3CXC U;  3T4D A;  3JAW A;  4LH6 A;  2RDC A;  2JGD B;  4UCT A;  3E83 A;  2K9P A;  4JI0 B;  1KP2 A;  2M7W A;  4O4H B;  5CBF A;  1FXK A;  1OCR B;  3JD1 A;  4WFG A;  1SQX H;  1NVP D;  4DV4 O;  4TWK A;  3DXR B;  4WF9 V;  4JI1 B;  2HHH B;  4GLX A;  1P7G A;  1I08 A;  3ZHQ A;  2QE7 G;  2CGN A;  1NTK H;  3BHP A;  1FFT B;  1WNS A;  3DTU B;  1FJG B;  1E79 G;  3TJT A;  4YJ2 B;  3Q4H B;  4IT5 A;  1HNX O;  2E5L B;  1I5Y A;  2R70 A;  3JAR A;  3EFF K;  3ETD A;  5KX5 A;  4IIJ B;  2BE3 A;  1XOU A;  2AHZ A;  4CZZ A;  1XMQ B;  1AP5 A;  1YJN V;  4TUY B;  1W0J G;  3F7V C;  3HB3 B;  4DR6 B;  1S3J A;  1I0H A;  1XI1 A;  1SQV H;  1XRE A;  1SQQ H;  5B1O A;  2Y0I A;  1EFR G;  2V1D A;  4QIW F;  4I50 B;  5JVD B;  2Y0P A;  3W7W A;  4JAV A;  4JAU A;  2ZIN A;  2W0X A;  3H1I H;  3AG7 A;  3UM7 A;  2BOC C;  4O4J A;  1YDX A;  1WB7 A;  4LF4 B;  4FFB A;  2EJ7 A;  5EK0 A;  4BW5 A;  3IJ4 A;  1QNM A;  2Q7G A;  5J2T B;  5IYD O;  1IBM O;  4PA4 A;  3LDC A;  4JI7 B;  3JD4 A;  3EHB B;  4C7U A;  2YS8 A;  4FLV A;  3QF7 A;  2L35 A;  2DOS A;  1DTO A;  2DMX A;  4PA9 A;  2NN4 A;  3NR7 A;  3FD9 A;  2ATK C;  3DC6 A;  5LA6 A;  4LR3 A;  2BCC H;  2XAH A;  1N33 B;  5JH7 A;  1PNM A;  3WU2 Z;  4CC5 A;  4RQE A;  3RYF B;  3OMN B;  4I4T A;  3ZED A;  1SKV A;  1G4Y B;  3JAK A;  1ZX3 A;  3AK3 A;  1MA1 A;  3X2Q B;  1VF5 B;  3D3I A;  1Q8I A;  2QTO A;  3QO8 A;  3HKB A;  4HBN A;  4IHJ B;  3T1Y B;  2GV9 A;  4GKJ O;  2JJ2 G;  4WBN A;  4J9Y B;  5IDJ A;  4CH4 A;  4I55 B;  4DV0 O;  5B66 Z;  1EBO A;  1VIB A;  3THO A;  2GTS A;  1MMM A;  4JTA B;  3ICX A;  4EKW A;  4F6R B;  5LMN O;  4DV2 O;  1BSM A;  3W7T A;  2UUA B;  1PL0 A;  4YJ3 A;  2F1M A;  4MVR A;  2VS0 A;  4LCU C;  3FYE B;  4X1Y B;  1OCZ B;  3G71 V;  2KKW A;  1ZAU A;  4JI4 O;  3ZX6 A;  2QGN A;  3CME V;  4TV9 B;  4EB6 A;  1PKX A;  3JAW B;  5ITZ A;  1BT8 A;  3U0Z A;  3CC4 V;  2UU9 B;  3N2K B;  1N0N A;  3ABU A;  4D7T A;  5GON B;  3HKD A;  3P3P A;  5IJ9 B;  4LF5 O;  2EIN B;  5KA6 A;  5BZB A;  4LWS A;  1WA8 A;  3ASN C;  2A9H A;  1YJW V;  1ZTE A;  2RMK B;  5JQG A;  4UCO A;  3RYI B;  4JGS A;  2DW4 A;  1KD1 W;  1R6N A;  4JI3 O;  1VQ4 V;  1Q6H A;  2IBZ H;  1NVP B;  3CCU V;  4QGP A;  3QG5 A;  3RVY A;  1KP3 A;  3MHH C;  1Q82 W;  4DR3 O;  1K33 A;  2XT9 A;  4X1K A;  5L3E A;  4LBE C;  4ABM A;  3L71 H;  5KX5 B;  1BL8 A;  1ZLZ A;  3AG3 C;  2JS5 A;  5C8Y A;  3ZMZ A;  5J2U B;  4AQY O;  2ODM A;  2XAF A;  4DW0 A;  4UCR A;  3JD0 A;  4AHC A;  3STZ C;  3CMA V;  2AXT Z;  2BOB C;  2GUZ B;  1E1Q G;  4GX2 A;  4DRX A;  4UXN A;  5FNV A;  2C2A A;  3MD0 A;  4DR7 B;  2UXC O;  4WCE V;  1FKA O;  1HR0 B;  2CH7 A;  3ABL C;  4FLX A;  5BMV A;  3CSX A;  1K9M W;  1YF2 A;  4LNU B;  4Z1V A;  4KUM A;  5DEC A;  3D8C A;  3OGI B;  4CH5 A;  3T4Z A;  2HEP A;  2UUC O;  1YIT V;  1KYO F;  2FTK A;  1Q6I A;  1SC5 B;  1VMG A;  3K5N A;  3CC2 V;  4XDK A;  4D7S A;  3MDS A;  2QEX V;  3G80 A;  2KB1 A;  4JV5 O;  2IJI A;  4KHP B;  1WP7 A;  4WFE A;  4GX0 A;  3CCR V;  5JH7 B;  4FLY A;  4FM0 A;  3BRC A;  2QM7 A;  3NXS A;  4U7O A;  1S5J A;  4DR5 O;  2Q73 A;  5CA0 A;  2N04 A;  1M1K W;  4DV6 O;  1EZV H;  3K9A A;  5EZY B;  3OM3 B;  4I4T B;  1VQM V;  3JAK B;  4X1I A;  1XHZ A;  4B3R O;  1R6K A;  2B5U A;  3OEH G;  2Q69 A;  3OTO O;  3CS5 A;  4YIP A;  4X66 B;  3HKB B;  3OR6 C;  2F23 A;  3L70 H;  3A8T A;  3IC7 A;  2ITC C;  4NVP A;  4DR1 O;  2GTA A;  4BIU A;  3OR7 C;  3AG4 B;  4LH7 A;  1DLB A;  4YIO A;  1SQB H;  2BSK B;  4WFB V;  2JGU A;  1HWY A;  5LL6 Y;  1SRY A;  1I94 O;  1HNW O;  4B3S O;  2Q0A A;  3ZRV A;  4ZKI A;  1L0L H;  3LDD A;  3JAT A;  4X88 A;  4YHH B;  2E74 B;  3FB7 C;  2QM8 A;  2RQ6 A;  5KA5 A;  4K0K O;  3VQW A;  5LHI A;  1B04 A;  2QWO B;  4IL6 Z;  2V7Q G;  1ORQ C;  5H5N A;  3W7U A;  1KKC A;  1HW7 A;  1M90 W;  3LSU A;  1OJH A;  5L3D A;  2XHB A;  1SF9 A;  3ZRW A;  3C90 A;  2UXD B;  4LF9 O;  3G6B A;  3J7A U;  4LFC O;  1SQP H;  4MW3 A;  1NI8 A;  2XAS A;  1B6Q A;  1XNQ B;  3SJQ C;  3AK1 A;  3HKE B;  2IW5 A;  3HKD B;  2ARH A;  1V55 B;  4UCS A;  5KAF Z;  1WA8 B;  2JRI A;  2UUB B;  4LFA O;  4L8J A;  2YEV A;  4DR2 O;  4GKK O;  3S3X A;  1A32 A;  1K92 A;  3JD2 A;  5CMU A;  2Z0A A;  4O2A A;  3UT5 A;  3C3S A;  4ZOL A;  1IBK O;  3G6E V;  4ZI7 B;  1EM1 A;  4B3T O;  1OCR C;  1IXB A;  2NNU A;  5IT9 N;  4DR4 O;  4JTD B;  5C8Y B;  2DN9 A;  5KHH A;  2LFS A;  2JGD A;  4R7C A;  3CE2 A;  4FLZ A;  1M56 C;  1FD9 A;  1X4T A;  3KCX A;  2WLM A;  2CTR A;  4JF3 A;  2FKX A;  3UKM A;  4D6T H;  3T1H O;  3HR0 A;  2PTM A;  5FNV B;  4DV1 B;  3BY6 A;  1XEQ A;  3DXR A;  3AG3 B;  3VQX A;  3K5L A;  2BTO A;  1ENV A;  3CRQ A;  5H6Q A;  4B7K A;  2EZO A;  4MT8 A;  1HDJ A;  2WA3 A;  2CTW A;  1UJW B;  4GCZ A;  4YJ2 A;  3Q4H A;  4TT3 G;  3ML0 A;  4N23 A;  4HNA A;  1IUR A;  3M99 B;  1G1X B;  2QJ1 A;  4DV3 O;  4IIJ A;  4B3M B;  3P32 A;  4G2K A;  4EFE A;  3SPI A;  2PUS A;  3OGC C;  2WWW A;  4TUY A;  2WLL A;  4PV1 B;  1N34 B;  2RJZ A;  1DF4 A;  4X65 B;  2QTS A;  3JYC A;  2P5O A;  4J41 A;  4I50 A;  4X1I B;  1VQ8 V;  4KXR A;  3RVZ A;  4XBF A;  1AJP A;  4H33 A;  2OTJ V;  1ZL8 A;  1AB3 A;  2ZQM A;  1NU1 H;  2IJH A;  4NXN O;  3CCQ V;  3JCU Z;  4DUZ B;  5B5E Z;  4X62 O;  5J2T A;  2DE0 X;  4QPK A;  2QR4 A;  2Y4U A;  2WSS G;  5BR8 O;  3RBZ A;  1G8M A;  1GAX A;  2CDY A;  3ETG A;  3CPW U;  3X2Q C;  5BY1 A;  4QNH B;  2VQF O;  3QO7 A;  3ZMU A;  2P4K A;  1OZ0 A;  1AJQ A;  3U11 A;  3RYF A;  1TUB B;  4KFM A;  2AZ2 A;  4WFH A;  1KMI Z;  3CEI A;  5JCO C;  5KAI Z;  3UQ8 A;  2VRZ A;  1PD3 A;  4AIL C;  1KUQ A;  1URF A;  2AW9 A;  2EZP A;  4IHJ A;  4K8X A;  1XMO O;  2IM9 A;  4JTC B;  2Y4T A;  1XBL A;  2WAM A;  1F7Y A;  4WFF A;  1YI2 V;  4I55 A;  1P49 A;  2YEV B;  4LF8 O;  1BHB A;  3N2G B;  4O2A B;  5JCO A;  1WLE A;  4MVQ A;  4LF6 O;  1GH6 A;  4FZ1 A;  3SPG A;  2ZR3 A;  3LNM B;  5B1A B;  1R3J C;  1QHT A;  4DV7 B;  4FM2 A;  5JJN B;  5FL7 G;  4TV9 A;  2Q67 A;  2X6A A;  3K3W A;  3FX7 A;  3N2K A;  3FB6 C;  5GON A;  5LOV B;  5IJ9 A;  3IFX A;  1QVG U;  1JX9 A;  4PDL A;  4FZ0 A;  1XL6 A;  1JFF A;  1N8R W;  3SPH A;  4QJF B;  4J7Z A;  3RYI A;  4UCV A;  3BVO A;  1BQZ A;  1SA0 B;  2D2C B;  1AP6 A;  1BMF G;  3BA8 A;  1PM9 A;  2ZIM A;  4UB8 Z;  1M56 B;  3RYH A;  3K03 A;  4BAY A;  5EIB C;  5EC2 C;  2CGO A;  2OIG A;  2ZE8 A;  3WFV A;  4HNA B;  1CP9 A;  5J2U A;  1N32 O;  5BXZ A;  2WLJ A;  5EIB D;  3ZMT A;  2X0L A;  2WLL B;  3E8B A;  2PY5 A;  2GUZ A;  5K1X A;  5CA1 B;  4TQD A;  4JZ2 A;  1KB9 F;  1TVK B;  1QVF U;  4MSW C;  1R73 A;  1HP8 A;  1ZL8 B;  1QLE B;  4LNU A;  2RN9 A;  4R6Z A;  2F4V B;  5DN6 G;  1H2S B;  3R65 A;  1S5L Z;  5LBQ A;  1VF6 C;  1EN5 A;  1GMG A;  5EYP B;  4JI0 O;  2QKC A;  1QBZ A;  1RP3 B;  4PA3 A;  4BR6 A;  1NS1 A;  2F93 B;  1QLN A;  3TXS A;  4P30 A;  2Z5U A;  2HJF C;  4FK5 C;  1K7D A;  4JI4 B;  2Y48 A;  2HHH O;  4Z1M G;  1VF6 A;  1K5S A;  3AG4 C;  1WP8 A;  1K4D C;  3CB2 A;  1FJG O;  1R3I C;  1V54 B;  5EZY A;  3BCC H;  1M9N A;  2E5L O;  1ZSP A;  1HNZ B;  3E2E A;  3SJC C;  4QE9 A;  1FYJ A;  1RPO A;  2HP8 A;  4MVU A;  5KLV H;  2WLK A;  1XMQ O;  2Q4P A;  5D5P A;  2ZCE A;  2QM4 A;  2BSK A;  2HG5 C;  1K4C C;  4DR6 O;  4X9Q A;  1SZX A;  4DR3 B;  5C93 A;  1V9P A;  5LMU B;  3PN1 A;  2NLJ C;  4JI8 O;  1S77 D;  1Q81 W;  1JCH A;  1V55 C;  1YVW A;  4PEL A;  3OAA G;  3B2E E;  4PDR A;  4LF4 O;  4PA7 A;  4UVA A;  3E89 A;  3FB5 C;  3C3T A;  3R66 A;  3TK1 A;  2OIE A;  3MHS C;  2UXX A;  4MTF A;  2EIM C; 
#chains in the Genus database with same CATH homology
 1DLB A;  2DWE C;  4MTO A;  1K8A W;  1VQ5 V;  1FXV A;  2JEX A;  4WFB V;  3WG7 B;  1S0V A;  3STL C;  4ZBM A;  4UUJ C;  1HWY A;  2X6B A;  1VQL V;  1SRY A;  3E8G A;  2XND G;  3ZRV A;  1AI5 A;  3K79 A;  4QE7 A;  4ZKI A;  1P4R A;  5L3F A;  3OW2 U;  3LDD A;  4X88 A;  3E8H A;  1SER A;  3FB7 C;  2QM8 A;  5KA5 A;  4FMT A;  1LNQ A;  4RO2 A;  5LHI A;  5B3S C;  2B1I A;  2GSM B;  1NQT A;  2P6J A;  2V7Q G;  4LC1 A;  3E8F A;  1ORQ C;  2UXN A;  5EC1 C;  3FB8 C;  3GB7 C;  3W7U A;  1M90 W;  1QR9 A;  5L3D A;  2WLN A;  2EIK B;  3ZRW A;  5J9P C;  1KKD A;  4GX5 A;  3ZN1 A;  3LSS A;  2Z3Y A;  2WPD G;  1VQ6 V;  1S5H C;  1H8H G;  3ABM C;  4MW3 A;  2QKS A;  5EBM C;  2XAS A;  1B6Q A;  3ETE A;  3K0G A;  3SJQ C;  4JYC A;  4R50 A;  1Y4M A;  2IW5 A;  4MTX A;  4L87 A;  1V55 B;  5H9C A;  3B8N A;  1QCE A;  2JK5 C;  4MVZ A;  1GM9 A;  1I5X A;  3AG1 C;  1OCO C;  4TSF G;  1IXM A;  1NJI W;  3AG2 B;  1GK9 A;  3G4S V;  2F43 G;  2YEV A;  3D36 A;  3T1C A;  3SPJ A;  2Q68 A;  1S72 V;  4X89 A;  1K92 A;  1L1F A;  3K08 A;  1S76 D;  4G27 B;  3JD2 A;  1M57 C;  5CMU A;  1P7B A;  3ABK B;  3SYA A;  1K34 A;  3KG2 A;  3CC7 V;  1Q86 W;  3F7Y C;  3G6E V;  1BHA A;  3ZRW B;  1OCR C;  1K5Q A;  3ZCC A;  1JVM A;  2NNU A;  1KQS U;  3IGA C;  4JTD B;  1THZ A;  3QNE A;  1AI6 A;  1VQK V;  1SET A;  1OCZ C;  2WLH A;  5CA3 A;  1YSC A;  2ZXW B;  2LFS A;  1Q7Y W;  4R7C A;  5B3S B;  1JPX A;  4OXS A;  2EIJ C;  2PI5 A;  2A79 B;  2ITD C;  1MAB G;  2R9I A;  1VQ9 V;  1M56 C;  4ASU G;  1PNL A;  1K97 A;  5CN0 A;  3OE7 G;  2WLM A;  5IY5 B;  3VOU A;  4JF3 A;  2Q6A A;  3UKM A;  1QR8 A;  5LHG A;  3ABM B;  1NH2 D;  2AHY A;  5EBW C;  4JAS A;  3BY6 A;  4FPP A;  2HKO A;  1FXK C;  2HVJ C;  2EIL C;  2EIN C;  3AG3 B;  2OCC B;  3TCU A;  2EBO A;  3JD3 A;  4J9Z B;  2JJ1 G;  1KC8 W;  3AG1 B;  1NR1 A;  1OCO B;  3BEH A;  1ENV A;  3CCJ V;  5H6Q A;  3CXC U;  3T4D A;  2EZO A;  4P2Z A;  4HAM A;  4MT8 A;  1UJW B;  4CBC A;  4GCZ A;  3PJS K;  3E83 A;  1M57 B;  1TUE B;  4RAI A;  4GT1 A;  4TT3 G;  3ML0 A;  2DYR C;  4N23 A;  1KP2 A;  3M99 B;  5CBG A;  3GWO A;  2OT5 A;  2M7W A;  3P32 A;  4G2K A;  5CBF A;  1FXK A;  1OCR B;  2LP7 A;  1J95 A;  3SPI A;  3JD1 A;  4WFG A;  3OGC C;  1NVP D;  2WWW A;  4TWK A;  4KP4 A;  1OCC C;  2WLL A;  4WF9 V;  4MW8 A;  2HR3 A;  1R3L C;  1DF4 A;  2DYS C;  2OTL V;  4DXW A;  3B77 A;  2EIJ B;  2A0L A;  2QE7 G;  5B1B C;  3JYC A;  1FFT B;  3DTU B;  1MOF A;  3ASO C;  3I56 V;  1DF5 A;  1E79 G;  3K0D A;  1VQ8 V;  2LFR A;  3RVZ A;  4FIP C;  4XBF A;  2JIZ G;  1AJP A;  3ABT A;  4F4L A;  2WLI A;  4H33 A;  2OTJ V;  3E86 A;  5KUK A;  1F4M A;  1I5Y A;  2ZQM A;  3EFF K;  2IJH A;  3ETD A;  2P7T C;  2P67 A;  2XAJ A;  3CCQ V;  3CD6 V;  1FXK B;  2EIL B;  4QPK A;  2AHZ A;  3LDE A;  4CZZ A;  3SYQ A;  4UVC A;  3B8M A;  3FYI B;  1YJN V;  2WSS G;  1W0J G;  3RBZ A;  1G8M A;  3F7V C;  3HB3 B;  1S3J A;  5B1A C;  2HVK C;  3ETG A;  5L3B A;  3CPW U;  3X2Q C;  4RUE A;  5B1O A;  1AI4 A;  5LGN A;  1EFR G;  2V1D A;  4QIW F;  4UV9 A;  4QNH B;  3QO7 A;  3ZMU A;  2IU3 A;  3W7W A;  4JAV A;  4JAU A;  1OZ0 A;  2Y69 C;  2XAQ A;  3UM7 A;  1AJQ A;  2BOC C;  4PDV A;  4X8A A;  2PI4 A;  2EIM B;  4MS2 A;  3DGE A;  1YHQ V;  5EK0 A;  4BW5 A;  4KFM A;  4WFH A;  5IYD O;  2DYS B;  2JDI G;  4PA4 A;  2D3O W;  3LDC A;  1FS0 G;  1PD3 A;  4UVB A;  2W6I G;  3JD4 A;  5B1B B;  2EZP A;  3EHB B;  4Q20 A;  3QO5 A;  3JCZ A;  1GM7 A;  1E1R G;  3ASO B;  1FXH A;  4JTC B;  4XDL A;  3FKS G;  2ZD9 A;  4RQF A;  1DTO A;  1NR7 A;  2WAM A;  2IJK A;  4PA9 A;  4WFF A;  2B1G A;  1YI2 V;  5DM6 V;  1W0K G;  2ATK C;  2ZDI C;  3LUT B;  2YEV B;  2XAH A;  2ZR2 A;  3OMI B;  1BHB A;  1MSW D;  1PNM A;  4UV8 A;  5IYC O;  1RM1 C;  5H6R A;  4RQE A;  1EZJ A;  1WLE A;  4MVQ A;  3OMN B;  4G28 B;  3SPG A;  2ZR3 A;  1G4Y B;  4GX1 A;  5GW7 A;  3LNM B;  5B1A B;  1VQ7 V;  3X2Q B;  3D3I A;  1R3J C;  2QTO A;  3QO8 A;  3AEI A;  5FL7 G;  5L3C A;  2ZDI A;  4MVM A;  3ZMS A;  2Q67 A;  3P30 A;  1MG1 A;  1ZWI C;  2X6A A;  3K3W A;  2Y69 B;  2JJ2 G;  2XOK G;  4R8C A;  3SYO A;  4J9Y B;  5IDJ A;  2W0F C;  1EBO A;  1SES A;  3FB6 C;  3ZJZ A;  4DO2 A;  3ZRS A;  3A0R A;  1GKF A;  4JTA B;  4I9W A;  5L3G A;  3K06 A;  4EKW A;  1SZT A;  3IFX A;  4JPR A;  2IH3 C;  1QVG U;  1JX9 A;  1QLE C;  4PDL A;  2R9R B;  3W7T A;  1XL6 A;  1PL0 A;  1N8R W;  3SPH A;  4QJF B;  4MVR A;  4P9O A;  4U7N A;  4MVO A;  4LCU C;  3FYE B;  1NBM G;  1OCZ B;  3G71 V;  2CK3 G;  1BMF G;  5HFL A;  1NH2 B;  1ARO P;  1VQP V;  4RUF A;  5B1N A;  3AG2 C;  3CME V;  1M56 B;  3K03 A;  1PKX A;  4YXW G;  4MTG A;  4JYB A;  1H2G A;  3ABK C;  3CC4 V;  4BAY A;  3CCL V;  3VBB A;  4MVS A;  5EC2 C;  3ABU A;  3WFV A;  1RM1 B;  1AR1 B;  3CP1 A;  1VQN V;  1GM8 A;  4E2L A;  3W7S A;  1CP9 A;  2EIN B;  3SYC A;  5KA6 A;  2WLJ A;  5BZB A;  1ROP A;  3ASN C;  2A9H A;  3OR7 C;  3ZMT A;  1YJW V;  3CCV V;  1AJN A;  1V54 C;  1F4N A;  2X0L A;  1F23 A;  2WLL B;  3LSQ A;  3OUF A;  4JGS A;  3E8B A;  2DW4 A;  2ZXW C;  1KD1 W;  2EJR A;  1R6N A;  2MK3 A;  1VQ4 V;  2H94 A;  3E35 A;  1NVP B;  3OMA B;  3I55 V;  2DYR B;  3CCU V;  3RVY A;  1H38 A;  1KP3 A;  3MHH C;  1W2B U;  1QVF U;  5IY5 C;  1Q82 W;  2JEU A;  4MSW C;  1R73 A;  1H8E G;  1K33 A;  2WLI B;  5L3E A;  4LBE C;  1YJ9 V;  2K1E A;  3RW0 A;  1QLE B;  4R6Z A;  4H37 A;  1CPY A;  1VQO V;  1OCC B;  4QPJ A;  1BL8 A;  5DN6 G;  3R65 A;  1KEC A;  2OCC C;  3AG3 C;  3ZMZ A;  5LBQ A;  3CCE V;  5EBL C;  1GMG A;  2XAF A;  1JJ2 U;  1QBZ A;  4PA3 A;  3JD0 A;  1XL4 A;  3STZ C;  2GHY A;  2X6C A;  3HPL C;  3H01 A;  3CMA V;  2BOB C;  1QLN A;  2HLD G;  5E1A C;  4P30 A;  1AI7 A;  2Z5U A;  2IU0 A;  4PDM A;  2HJF C;  5CBH A;  4BIZ A;  1E1Q G;  1GTO A;  4GX2 A;  1NKD A;  4FK5 C;  4UXN A;  1K7D A;  3ZMV A;  1K3E A;  2C2A A;  3MD0 A;  3CYO A;  4BIU A;  2Y48 A;  4WCE V;  4PA6 A;  1GO3 F;  3K04 A;  5LGU A;  3F5W C;  3ABL C;  3ZRX A;  1YTF D;  3OEE G;  4Z1M G;  1K9M W;  1K5S A;  3AG4 C;  3CCS V;  3ASN B;  4KUM A;  1K4D C;  1R3I C;  2X7R B;  4MTF A;  1V54 B;  1WPX A;  3WG7 C;  1R3K C;  2HFE C;  2P90 A;  4N21 A;  3SPC A;  1Y66 A;  1M9N A;  3T4Z A;  1CEZ A;  1F51 A;  4HZ3 A;  1YIT V;  3TET A;  2FTK A;  5HFM A;  2YSU B;  3CC2 V;  3E2E A;  4XDK A;  2H8P C;  4QE9 A;  3OUS A;  1RPO A;  1RPR A;  4MVU A;  3ZN0 A;  2W6J G;  5LGT A;  2WLK A;  2QEX V;  2KB1 A;  2IJI A;  3SYP A;  2EIK C;  4WFA V;  2HG5 C;  4XDJ A;  1K4C C;  4WFE A;  4I5S A;  4GX0 A;  3CCR V;  3T2M A;  1K73 W;  4LP8 A;  5C93 A;  4U7O A;  2QM7 A;  3NXS A;  3ZIA G;  1OHH G;  5LHH A;  4HYO A;  2NLJ C;  1JQ0 A;  1M1K W;  2IH1 C;  3K9A A;  3OM3 B;  1S77 D;  1Q81 W;  2IJJ A;  1JCH A;  1V55 C;  4P9P A;  1VQM V;  1YTF B;  3OFN G;  2DQ3 A;  2DWD C;  1R6K A;  2B5U A;  3OEH G;  2Q69 A;  1YIJ V;  1JOY A;  4PEL A;  3W7X A;  3OAA G;  4PDR A;  4PA7 A;  4UVA A;  2QA4 V;  5KUM A;  3OR6 C;  1PNK A;  3E89 A;  3CCM V;  3FB5 C;  3IC7 A;  3ABL B;  2ITC C;  2XAG A;  3TK1 A;  3MHS C;  2UXX A;  5IYB O;  2DQ0 A;  4FJC C;  2EIM C;  3AG4 B;  1COW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...