2OTLV

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2otlV00
3CCJV 1QVFU 1M1KW 1YJWV 1QVGU 2OTLV 1VQMV 1YITV 3CCSV 1YIJV 1JJ2U 3CD6V 3CMEV 1VQ7V 3I55V 1YJ9V 2D3OW 1NJIW 1VQ8V 3G71V 1VQ9V 1VQNV 1K9MW 3CCRV 3CPWU 1S72V 3CCVV 1W2BU 1Q86W 3I56V 1VQ6V 3G6EV 1KQSU 1VQ4V 3CCUV 3CC2V 4WCEV 3CCMV 3CCQV 1Q81W 3G4SV 2QEXV 1YHQV 3CCLV 1YI2V 3CC4V 2QA4V 3CCEV 1Q82W 1N8RW 3CC7V 1M90W 5DM6V 3CMAV 1Q7YW 1VQOV 1VQKV 1VQPV 1VQLV 2OTJV 1KD1W 3OW2U 1YJNV 4WF9V 1R73A 4WFBV 1KC8W 1VQ5V 3CXCU 1K8AW 1K73W 4WFAV
chains in the Genus database with same CATH superfamily
4JI1O 1TVKB 5TISZ 4EFEA 2B9ZA 2XAFA 3N2KA 1M5IA 2PYJA 1R3JC 4KL1A 1SESA 2CH7B 5B3SC 1I5XA 4DV3B 1NQTA 4UB8Z 3SPJA 4WFAV 1K4CC 1PD3A 3BRCA 3BABA 4MTGA 1AB3A 1J95A 3FB7C 4I0XB 4MVRA 1A32A 5JQGA 5IYCO 1IURA 4JI1B 3SPHA 4PA9A 5CBGA 1SETA 3CRRA 1KKCA 5CMUA 1MNGA 1HDJA 5CBFA 3CB2A 3STZC 1N0JA 1KUQA 2EINC 1H8EG 3U11A 3ZN0A 2YXYA 4MVOA 4MVZA 5LYJB 1HNZO 5K1XA 5JCOC 5C8YB 3D3QA 1YTFD 3SYQA 5BMVB 1L1FA 1XQ8A 4JYBA 5KHHA 1SQGA 2EJRA 5EIBD 3Q4HB 1MMMA 4GLXA 4I50A 2JEXA 4DV4O 3KCYA 2LW7A 1PNKA 5CN0A 2YEVA 4MS2A 4RO2A 1VP7A 5A9GA 4GX5A 3N2GB 1NU1H 4DR4O 2WLJA 3SPIA 2G38A 4L8JA 5GONA 2DQ3A 5ITZB 2ZE6A 5LHHA 3H1KH 2V4DA 3JD1A 1HNZB 4HAMA 3CCVV 1JR9A 4FFBA 2EIJC 3FKSG 5KX5A 4PA4A 5LP6C 3QNEA 3O9OA 1KKDA 3AK2A 4AQYO 2IJHA 3CEIA 4MSWC 4DV4B 1R3IC 3K5MA 3L9DA 4ZKIA 3G6BA 1TUEB 4DR4B 4YIOA 4FLWA 1F4MA 3LNMB 2QKCA 1Q86W 1AJNA 3B4SA 2ADQB 1EM1A 1FXKA 4K0KO 2Q7HA 1KC8W 3CE2A 5EIBC 4D7TA 2AHZA 2QWRB 3ETDA 4AQYB 2Q69A 4ZOLB 5JVDB 1PNMA 2EILC 1DTOA 4GKKO 5EBWC 2X6CA 3CWBH 1J5EO 4JI0O 3F7VC 2A3QA 4JI4O 2K9PA 3D36A 4WFHA 2CK3G 3HKCA 2W6IG 2BSKB 4O4HB 1NVPB 4OX9O 1RPRA 2R70A 3RYCB 2Q68A 1RFYA 2JGDA 2CUGA 1M4UA 2AHYA 4K0KB 3VOUA 3RFRA 4PDRA 2BTQA 3UO2A 2BOBC 2ZD9A 3G71V 1XBLA 3L75H 1VEWA 3CP1A 1RM1B 2B5UA 1D2DA 2QM8A 3LDDA 4JI7O 1KECA 4FLVA 4GKKB 2YIBA 2DN9A 5KLVH 2FL4A 1J5EB 4HNAB 4JI0B 4LF6O 2Y0PA 4O2AB 5B1NA 2WLIB 4TV9A 5IJ9A 4QE7A 4JI4B 1QHTA 2OTLV 4OX9B 2HP8A 1VARA 4UVAA 1SQFA 2CGNA 3DSQA 5C93A 4P9OA 1Y76A 2Q7EA 2OCCB 1XL6A 1BS3A 1I5YA 3RYFA 3H1HH 4JYAO 2QSAA 2XHBA 2HJDA 1EN5A 1K4DC 5EC2C 4K8XA 4JAVA 4WF9V 3E8HA 1WPBA 5LA6A 4JI7B 5J2UB 3B8MA 2LGWA 4X1IB 4LF6B 2LO1A 1W0JG 3ABKB 2RMKB 3BY6A 4DW0A 1YDXA 3CRAA 4A5UB 2HHHO 1ZL8B 1GH6A 4DR7O 4BW9A 1FD9A 5D5QA 4JYAB 1IXMA 1TVKA 1SF9A 1GN2A 5LOVB 3ABTA 3DTUB 1M1KW 3K0GA 5DECA 4DUYB 1WB7A 4X20B 1JFFB 2O57A 2LW1A 3CMEV 2D3OW 2DE0X 4P9PA 1K9MW 3N27A 2IJJA 2KSDA 1VQ4V 2LFSA 2CH7A 1ROPA 3NXSA 5DEDA 4FLXA 1YSCA 4F6RB 2QWNB 4NTYA 2HHHB 2BE3A 1L8DA 1Y66A 4YIPA 1Y4MA 4I0XA 4ZI7B 2QGNA 4DR7B 3SYCA 3THOA 3ZJZA 4DV2O 4GKJO 3M7MX 2Y4TA 5L3DA 1HR0O 1TGOA 4WCEV 1KYOF 3JAKB 4X66O 3PN1A 1V54C 3OAAG 5LYJA 5C8YA 3B8NA 4B7EA 1G6UA 3AG3C 2Y69C 3FB5C 5BMVA 1M57B 2QKAA 3JALB 1O9HA 4I7ZB 1K34A 1NZ6A 1YITV 3Q4HA 4DO2A 1YIJV 1VQ7V 2JRIA 4JI6O 5CA0B 4DV2B 4P2ZA 3VQXA 3IC7A 4LF4O 3ASNC 2KB1A 3K03A 4PA3A 5IJ0B 2E5LO 1HR0B 2ZR2A 3FYEB 4UV9A 5ITZA 3E86A 4X88A 1GO3F 4TQFA 1JPXA 1ENVA 4D7SA 2WLNA 3FB8C 1L0NH 1OCCB 4IT5A 3DXRB 5JJJB 4JYYA 1PPJH 2UXDO 3ZRVA 4UVBA 4LF4B 3ABLB 2GSMB 2ZNJA 4JV5O 2ETNA 4Z2WA 2E75B 4FZ1A 2DYSC 4MW3A 3H9VA 1H2KA 1GK9A 3F7YC 2E5LB 2IH1C 5E79Z 2XASA 3PJSK 4PA7A 2QR4A 5FPOA 3QTCA 1OCRB 3AG2C 4D6TH 5L3EA 3MDSA 2A06H 2UUBO 1IDSA 1ZWIC 2YDEA 4I55B 4W4KA 4PDMA 1LUVA 1BHAA 3K9AA 4ZOLA 1K97A 3M99B 1AR4A 5JVDA 4U7OA 1PL0A 1D5NA 1V9PA 3UKMA 5IYDO 2EIMB 4O2BB 5LHIA 4KHPO 2HKOA 2OCHA 1N32O 4JV5B 4UUJC 1P49A 3VQWA 2F23A 1D5AA 4IYIA 2BSKA 4O4HA 2CTPA 4QIWF 3ICXA 2HVKC 1YF2A 2UUBB 3RYCA 5IT9N 3K5NA 4I9QA 2EIKB 1SQQH 5J9PC 3JAMN 3RN4A 1V55B 4OPAA 3VBBA 1YZBA 1OCOB 2QKSA 4O4LB 3ZHTA 3CCRV 2ZNIA 3K08A 4KHPB 1SA0B 1N32B 3LUTB 3SGIA 1BSMA 4HNAA 2QE7G 4O2AA 2F43G 2WLIA 1XI1A 1MG1A 3VQVA 2E76B 2YI8A 3ZMTA 2P6JA 2ADPA 1QLEB 1XUQA 4GYCB 3ML0A 4I5SA 1L0LH 1AR1B 1K3EA 5L3GA 2KKWA 3W7UA 2PY5A 2R9IA 3D3IA 2ZIMA 1GM7A 3E83A 5J2UA 2ARHA 4DR1O 4X1IA 1BGYH 4XBFA 2ZDIC 3OD4A 4U3FH 2CE4A 4XDJA 1NR1A 4BWAA 4R7CA 1DF5A 1VQ8V 3OR6C 1ZL8A 1TUBB 2EJ7A 2QEXV 3CC4V 4JTAB 4PHZA 5LOVA 3TGUH 1GN4A 2E74B 1BMFG 2UUCO 4QPJA 4X20A 1JFFA 1PNLA 3MHHC 1QVFU 2ZR3A 2P5OA 2JK5C 4DR1B 3VQYA 3QO8A 4MTOA 2PGGA 4LF5O 4IGGA 2YXHA 1EFRG 1S5LZ 1FFTB 3BA8A 2UXXA 4LF9O 4F6RA 3L71H 4ZI7A 4JAAA 1F4NA 3AG4C 2ATKC 1E79G 2UUCB 2ITCC 3CSXA 5J2TB 3X2QC 3JAKA 1WB8A 4WFFA 5KHJA 3CCQV 2XAGA 3OMAB 2NLJC 3G67A 4LF5B 3CMAV 3R65A 4GT1A 4FM0A 3JALA 4AILC 4LF9B 2LFRA 1XHXA 5EYPB 1XOUA 5EBLC 5CA0A 5KHIA 4FLTA 3OE7G 5GTIZ 5IJ0A 5L3CA 4TUYB 3CCLV 4E4EA 1Q82W 1THZA 5H6QA 2ZIOA 4IIJB 5KA6A 4DXWA 2W0XA 4JF3A 3C90A 4F6EA 2FYUH 2OIEA 1H8HG 3DXRA 1IXBA 1AP6A 1F51A 1PV0A 2IBZH 2Y4UA 1P4RA 2ZQMA 1WP7A 1G8MA 3HPLC 3HKBB 2GTAA 3RYHB 3OW2U 2GHYA 1B06A 4RQFA 2NN4A 3OEEG 2UU9O 2IU0A 2B1GA 1M56C 3WB1A 2ILMA 4I55A 2X0LA 1UPGA 1SZTA 4DV6O 4OXSA 1KD1W 3ZHSA 1Q5OA 5IY5B 4O2BA 5GTHZ 5A2QN 4JPRA 4MTFA 3CCSV 4UCOA 1JJ2U 5B1BC 2P4VA 2UU9B 1NJIW 3ZHQA 2NNUA 4UB6Z 2ZXWC 3CC2V 5DM6V 2CTWA 4CC6A 1RPOA 1KU9A 3IJ4A 1SS3A 4DV6B 1T5EA 3AG1B 4O4LA 1Z5VA 3W7TA 3K5OA 4IHJB 1SA0A 5FPRA 1VF7A 1NH2B 1Q6UA 3KCXA 3ABMB 1FPOA 1ZSPA 4UCUA 2YIBD 3ZHVA 5KAIZ 4BR6A 4NR1A 4TQDA 1OCZC 4H44B 2QM7A 2QTSA 3RBZA 2PI5A 1Y67A 2JGUA 1FXKC 3HKDB 3JCZA 1AR5A 2Z5UA 2GTSA 1O9GA 3L74H 3JYCA 2AXTZ 1N8RW 1WAZA 1VQOV 2N05A 2N74A 2YI9A 4GUNA 4CS2A 5D5PA 4FM2A 3JAWB 5B1AB 3UT5B 2DW4A 1JQ0A 2Q7GA 2P90A 2WLHA 2DMXA 3APQA 1DLBA 1TUBA 4U7NA 1SZXA 2QWPB 1BHBA 1URFA 2HVJC 4MVQA 3ZEDA 3D36C 5JH7B 1E1RG 3LSSA 4H37A 5H2FZ 4MVMA 2CAZC 3JD2A 3RGBA 2A79B 4B3RO 4FIPC 1KMIZ 1XREA 3K04A 4J11A 3SJQC 3T4DA 2JIZG 3RVZA 3ZCCA 1K92A 3W7XA 4ICGA 4QE9A 3LDCA 1MOFA 2DOSA 1EZJA 2QA4V 1JX9A 2DYRB 3WB2A 1VQKV 4DYLA 1AI5A 3ETGA 3ZMZA 5L3BA 2RCVA 1GKFA 4X1KB 1FAFA 4LNUB 3P3PA 4Q6GA 1XMQB 3FB6C 2M7WA 5J2TA 4B3RB 1NT2B 1BE3H 3ZRWB 2VRZA 1N36O 1AILA 2CTRA 5LXTB 2F4VO 4DR3O 5JWPA 2FKXA 1E1QG 3OUSA 2UXNA 2ZE7A 5EYPA 3HKEB 1GN3A 4DUYO 4QNHB 3WG7C 4DW1A 1YXBA 1YJWV 1US6A 5IYZB 4H0LB 4UCRA 3P32A 2WLKA 4TUYA 3OFNG 2H94A 4JZ2A 1VQ6V 2PI4A 1AVMA 2F93B 4IIJA 4Q20A 1KP2A 1N36B 2EBOA 2F4VB 3ZX6A 4DR3B 4ZIBA 2E3CA 5F2VO 2XUMA 4NTXA 2IJKA 1S76D 3LSUA 4PI0A 1MA1A 3HKBA 1PKXA 1SERA 1FS0G 3E8FA 2LP7A 4X64O 3T1YO 1XDCA 2RQ6A 2XNDG 1R73A 4PDVA 1BCCH 1I94O 1DK1A 2JJ1G 1QVGU 4DK0A 4FPPA 5KAFZ 4LWSB 3S3WA 4J80A 1HW7A 2VQFO 1R6KA 2ZINA 3JD3A 1LUWA 4YJ2B 2OIGA 1IZ3A 1Q81W 4J9YB 2F1MA 3K06A 1AI4A 1N0NA 2YS8A 1Z5WA 4I4TB 2FMLA 1R3LC 4X64B 2GUZB 3T1YB 3TJTA 5B1OA 1I94B 3AG7A 4H13B 3M8AA 4CS3A 1XILA 3S3XA 2AZ0A 3ZMVA 1S3JA 2F66C 2VQFB 3N2GA 3T1HO 5H6RA 1QNMA 1NVPD 3RT3C 2QWOB 1XEQA 1CXZB 4IHJA 2M6YA 4Z1MG 3OUFA 3BFRA 3K3WA 3ZMSA 3G4SV 2LJ2A 3TK1A 3ABUA 5JJEB 3ZRXA 5BZBA 4AHCA 1SQPH 4OPHA 3T1HB 4YHHO 1FXHA 4DRXB 4DR6O 4N23A 3HKDA 4X1YB 1WA8B 2MW2B 3CRMA 3EFFK 1QLNA 4JYCA 1VF6A 4Z1VA 3AEIA 1Q7YW 1AJPA 3JAWA 3UT5A 3ZHUA 1GN6A 1K8AW 4NTWA 4HYOA 3E89A 5B3SB 3NR7A 4KUMA 1MSDA 3WU2Z 5JH7A 1OZ0A 3JSLA 2P4KA 4CH6A 4DK1A 1WNSA 5CA3A 4YHHB 2DWDC 2Q9LA 4DR6B 1KB9F 1H2LA 4I9WA 4PI2A 5LHGA 3UQ8A 1K7DA 1RM1C 1FKAO 2CTQA 2HG5C 2UUAO 1GM8A 2EINB 4CH5A 2PZSA 3I56V 3G6EV 1KQSU 3CCMV 3WB0A 5E1AC 4X1KA 2P22C 4B3MO 4LNUA 4JAUA 1P7GA 3RYIB 4JGSA 2OCCC 4MT8A 1AP5A 3UO3A 3ZRWA 1M9NA 2WAMA 5BXZA 4ZHQB 5LXTA 3FX7A 1MABG 1IVSA 1NR7A 2VS0A 1ZAUA 1LR1A 2UUAB 1Y74B 3HKEA 4J9ZB 1QU7A 2W6JG 5KX5B 1M93A 2R9RB 1AI7A 1BZKA 2WA3A 4TT3G 4WFEA 5IYZA 2Z0AA 2IW5A 3B2EE 3GWOA 2EIJB 5LP6B 4B3MB 4X89A 2PUSA 1S77D 2IU3A 1JVMA 4NXMO 4LF8O 4JZGA 1Z2GA 4FZ0A 1XHZA 5K1PA 4EEQA 2EULA 2EX3A 3E8BA 1G1XB 3SPCA 1QBZA 3BVOA 1MZEA 3H1LH 1QR8A 1KP3A 2L35A 2DJVA 2Z3YA 4JI2O 3OM3B 4UCSA 3K59A 4GZRB 1YTFB 3TXSA 1UFIA 1WP8A 3CCUV 4NXMB 4LF8B 5LGTA 2EILB 3DC5A 5LGUA 4TSFG 3W7WA 1RSOB 1PM9A 3OT7A 2W0FC 1H2GA 4LWSA 4IYHA 3BHPA 3JCUZ 1N34O 4YJ2A 2OT5A 3CD6V 3RWRD 2BTQB 2LGQA 3JASB 3U10A 2ZE8A 4JI2B 5FL7G 4LFBO 2QDOA 1M57C 3J80N 4I4TA 3TETA 3T2MA 2GUZA 3D8CA 1U97A 1KBHA 1EN4A 3CXCU 3T4ZA 3FAVB 2CDYA 4ASUG 4HBNA 2VWKA 5KMGB 1NI8A 2WLMA 1W0KG 1N34B 1YI2V 1Y6XA 3SYAA 4DV1O 1VMGA 1XMOO 4LFBB 2XAHA 4GCZA 3CJHB 1OJHA 1SKVA 2GV9A 4PD4F 2QWQB 4YY3O 1F7YA 4X8AA 3MAQA 1PP9H 4UCVA 1OCCC 1S0VA 5LA6B 1H2SB 2X7RB 5IE9A 2R9AA 2DQ0A 2WWWA 3ABLC 3CPWU 3JARB 4J41A 4UVCA 3O65A 1YHQV 1NTZH 3BPZA 4BIUA 3B40A 1G4YB 3OGIB 1EN6A 1OCRC 2ITDC 1B3QA 4DRXA 3DC6A 1UJWB 4J7JA 2JDIG 3RVYA 3T1CA 4DV1B 4X1YA 1WA8A 4G27B 4WFGA 2H8PC 4FM1A 1XMOB 3QO7A 4ZBMA 3CX5F 1BL8A 1IBLO 1B04A 4YY3B 4MVSA 4GX1A 3E22B 4RWUA 4BIOA 3G80A 4W4LA 4PV1B 2EIMC 2YXLA 1EZVH 2IJIA 1Q3EA 1DGSA 4YJ3B 3KG2A 4YXWG 4O4IB 4PELA 3UM7A 4H33A 4K8ZA 2JS3A 2X6AA 4GX2A 5FNVB 2EIKC 4FLYA 4NKGB 3ZS8C 1IBLB 4CC5A 1V55C 2YIDA 4XDKA 1Q6HA 1VQPV 4J7KA 2B1IA 1H2NA 1OCOC 4WFBV 1R6TA 3MHSC 3E8GA 2MK3A 1V54B 4NVPA 1VF5B 1AJQA 4B3TO 4EB6B 2QM4A 5JCOA 3AG3B 2Y69B 1HNXO 5IWAO 1QLEC 3K57A 3C3TA 3RYIA 4BW5A 3MD0A 2OTJV 3WFVA 4NXNO 1YJNV 1QCEA 2F95B 3ASNB 4JTCB 4ZHQA 4R6ZA 4DUZO 2Y48A 2VWJA 1CEZA 2V1DA 2GBOA 1Y74A 1GM9A 1LNQA 4UFZA 4DV0O 4U3JB 2AGAA 4B3TB 1YEWA 3KKYA 3SJBC 3CC7V 1HNXB 5LP6A 4N21A 1I0HA 5IWAB 3GVMA 1CPYA 2Q67A 1P7BA 4FMTA 1IBMO 2EZPA 4NXNB 1NKDA 3TCUA 4CBCA 1VQ9V 1Q90D 3LDEA 3B77A 4GX0A 3RW0A 2DYSB 4DUZB 1VIBA 3QG5A 2JVDA 4E2LA 3CCEV 4B3SO 3AG2B 1FXVA 2PYLA 4DV0B 1F23A 1ZLZA 3F5TA 1XMQO 5LBQA 4R8CA 1X59A 3IFXA 4WBNB 4FLZA 4DR2O 2FB5A 5IDJA 2RJZA 3ZN1A 1Q8IA 3CHXA 3OMNB 1IBMB 1W59A 1AROP 1W2BU 1RSOA 3HB3B 3K0DA 2XOKG 5IYBO 1YCIA 4KXRA 1TAEA 1GRJA 3JATB 4LBEC 3L72H 5B5EZ 4X65O 1K73W 4B3SB 3ETEA 2WLLB 4O4JB 3JASA 3ASOC 3JSNA 4LFCO 3SJCC 1JOYA 4K3AA 5BY1A 4DR2B 1Q6IA 1R3KC 4DV5O 3OGCC 3LNNA 3GWKC 1XNRO 4LCUC 1HNWO 1R6NA 3FAVA 1Q43A 2IM9A 5EZYB 3KZIZ 3IGAC 3OEHG 5EK0A 3SPGA 1ORQC 2LQTA 4QGPA 3K5LA 2EZOA 3K9SA 5KMGA 4X65B 1SQXH 3K58A 4AI8A 2AZ2A 4RUEA 1S5HC 4LFCB 4KP4A 1JCHA 3BCCH 1K33A 4MTXA 2Q0AA 2HEPA 5CA1B 4DV5B 3CJHA 3CS5A 3JD0A 2RNBA 1K5QA 3A8TA 1N33O 2P7TC 2IH3C 3H1JH 1XNRB 2BCCH 1HNWB 4TV8B 3JARA 1FFXB 3HR0A 1H2MA 4LP8A 3FFQA 1OHHG 1NH2D 2YSUB 3OTFA 3RYHA 5LGNA 5DN6G 1MSWD 4FFKA 2YC0A 1JMKC 4NYKA 1VQ5V 1WJZA 4F4LA 1COWG 2HFEC 3E2EA 4NB5A 4PDLA 3CRCA 1P84F 3J7AU 4FLUA 3E22A 1S5JA 1N33B 1QQCA 2ZM6O 2XAQA 5IY5C 3IAYA 3W7SA 1NTMH 4JI8O 1FJGO 1NBMG 4TOIA 5CB4B 3SJAC 4YJ3A 2L6LA 2PF4E 1VQLV 3TXQA 1DF4A 4O4IA 4CS4A 2YUAA 5EBMC 1OV9A 1H38A 5FNVA 2YIAA 2XT9A 2A0LA 1JA8A 2OWOA 3CRQA 2Q6AA 4RQEA 1GTOA 3AG4B 4KFMA 3I5DA 1PL4A 4PA6A 2ZM6B 5KUMA 3AG1C 2RDCA 2ZT9B 3X2QB 4P30A 4JI8B 2Y0IA 4RUFA 4EB6A 1FJGB 3A0BZ 2KG7B 4FVMA 3ABMC 3FYIB 3IC9A 2OYQA 4GKJB 4B7KA 2D2CB 4LF7O 2VQEO 2A9HA 2UXBO 1U96A 4J10A 3EHBB 3EVKA 2JEUA 2Q73A 2BOCC 2ZKOA 4G2KA 2V7QG 4X66B 3R66A 3A2FA 5BR8O 1BQ0A 4U3JA 4DR5O 5KUKA 1VF6C 1K5SA 2Q8VA 4QPKA 5B1AC 3QVNA 2PTMA 4JI6B 3N2KB 1YVWA 5HFLA 4LF7B 2DWEC 2VQEB 2UXBB 1BQZA 4CH3A 1MZFA 5KHGA 4JTDB 2UXCO 1I08A 1ZTEA 1VQMV 5LMUO 2WSSG 2R72A 2ZCEA 2ZE5A 3OTOO 5BR8B 2WPDG 2Q5ZA 3JD4A 2HR3A 2KQXA 3EXAA 5JQGB 4DR5B 1M56B 1WLEA 4BAYA 4WBNA 3P30A 2QTOA 3CXHF 1AI6A 3BEHA 1B6QA 2UXDB 1RP3B 4G28B 3OMIB 2DYRC 2JJ2G 4JI5O 1SQBH 2UXCB 4X9QA 3L70H 1FYJA 4C7UA 5LMUB 3JATA 3BAAA 3ZHRA 3OTOB 3SYPA 5B1BB 3ZMUA 1SQVH 2K1EA 4I50B 2WLLA 4QJFB 4O4JA 1BT8A 2ZXWB 2YEVB 4CH4A 3CCJV 4EFBA 1CP9A 1JJOA 3APOA 1WPXA 4UV8A 4UXNA 5GONB 1R1BA 3L73H 3B09A 2GDSA 3U0ZA 4FFBB 4JI5B 5EZYA 5FLXN 1WN7A 4JI3O 3ABKC 1GMGA 3GB7C 2RN9A 2Q4PA 3AK1A 4PJ0Z 2NR5A 3I55V 2BTOA 1S72V 4TWKA 3QF7A 5CA1A 5B66Z 1OCZB 3J81N 4RAIA 1SC5B 2A7WA 3STLC 2Q0OC 3ZIAG 1IBKO 1FXKB 3A0HZ 4TV8A 5AG2A 4MW8A 1EBOA 4JI3B 5LMNO 1FFXA 2CGOA 3UCSC 1ZUQA 2ZDIA 1HP8A 4FK5C 4XDLA 2HJFC 1ZX3A 5KHKA 2XTAA 3SDLA 1M90W 4EKWA 3DGEA 3AK3A 2HLDG 3HKCB 3K79A 3A0RA 3E35A 5KA5A 1IBKB 4J7ZA 3SR2C 2JGDB 3FD9A 3C3SA 1YJ9V 3LSQA 1VQNV 1HWYA 2ODMA 5LMNB 1XNQO 3H1IH 5CB4A 3ZRSA 2H3OA 5L3FA 4X62O 3SYOA 4B08A 1SRYA 4LR3A 4LFAO 5EC1C 2N04A 3F5WC 4UCTA 1TA8A 4TV9B 1NS1A 5IJ9B 4DV7O 4HZ3A 1N4CA 4JASA 3QO5A 4IL6Z 4MVUA 4OGQB 3ASOB 2JS5A 1Y76B 3H01A 4LC1A 5HFMA 3RYFB 5JJNB 1XNQB 4J42A 4K35A 2KG7A 1X4TA 2YICA 4LH6A 4X62B 5H5NA 5LL6Y 3ZBHA 2P67A 1GAXA 4LH7A 2C2AA 4BIZA 2XAJA 4LFAB 1QR9A 3WG7B 2WA4A 1I7FA 4L87A 1NTKH 5GW7A 1IX9A 4CZZA 4DV7B 4ABMA 4DV3O 2AW9A 4FJCC 3OR7C 5H9CA 2QJ1A 5CBHA 3ETQA 2X6BA 1XL4A 4R50A 3CYOA 2FTKA 3BA9A 3P3NA 2P06A
chains in the Genus database with same CATH topology
3IFXA 1QLEB 5IDJA 3ZN1A 3ML0A 4I5SA 5B1OA 3OMNB 1AR1B 2XAFA 1K3EA 1AROP 1W2BU 5L3GA 3W7UA 3ZMVA 1S3JA 2R9IA 3HB3B 3K0DA 3D3IA 2XOKG 1R3JC 5IYBO 1GM7A 1SESA 3E83A 5B3SC 5H6RA 4LBEC 1NVPD 1I5XA 1K73W 1NQTA 3ETEA 3SPJA 4WFAV 1K4CC 1PD3A 4XBFA 2ZDIC 2WLLB 4MTGA 4XDJA 3ASOC 4Z1MG 1J95A 1NR1A 3FB7C 4MVRA 4R7CA 1DF5A 1JOYA 1VQ8V 3OUFA 5IYCO 1R3KC 3K3WA 3OR6C 3SPHA 3OGCC 4PA9A 1SETA 3ZMSA 5CBGA 2QEXV 3G4SV 3TK1A 3CC4V 3ABUA 5CMUA 4JTAB 5CBFA 3ZRXA 3STZC 5BZBA 4LCUC 1BMFG 1R6NA 2EINC 1H8EG 4QPJA 3ZN0A 4MVOA 1PNLA 3MHHC 4MVZA 3OEHG 3IGAC 5EK0A 1QVFU 3SPGA 1ORQC 2ZR3A 2JK5C 1FXHA 1YTFD 3SYQA 4N23A 3QO8A 4MTOA 2EZOA 1L1FA 4JYBA 2EJRA 1EFRG 1FFTB 4RUEA 1S5HC 2UXXA 1JCHA 3EFFK 1K33A 4KP4A 1QLNA 2JEXA 4MTXA 4JYCA 1PNKA 3AEIA 2YEVA 4MS2A 1AJPA 5CN0A 1Q7YW 4RO2A 3JD0A 4GX5A 1K5QA 1K8AW 2WLJA 2P7TC 3SPIA 1F4NA 2IH3C 4HYOA 3AG4C 3E89A 2ATKC 2DQ3A 1E79G 5B3SB 5LHHA 4KUMA 2ITCC 1OZ0A 3JD1A 3X2QC 4HAMA 4WFFA 4LP8A 3CCVV 5CA3A 2DWDC 2EIJC 1OHHG 3FKSG 3CCQV 2YSUB 1NH2D 2XAGA 4PA4A 3OMAB 2NLJC 5LGNA 3QNEA 5DN6G 3CMAV 1KKDA 1MSWD 3R65A 4GT1A 2IJHA 1VQ5V 4I9WA 4MSWC 4F4LA 2LFRA 1COWG 1R3IC 2HFEC 5EBLC 5LHGA 3E2EA 4ZKIA 4PDLA 1K7DA 1RM1C 2HG5C 1TUEB 1GM8A 2EINB 3OE7G 1F4MA 3LNMB 2XAQA 5IY5C 3I56V 1Q86W 3G6EV 1KQSU 1AJNA 5L3CA 3CCMV 3W7SA 3CCLV 5E1AC 1Q82W 1FXKA 1THZA 1NBMG 5H6QA 5KA6A 4DXWA 1VQLV 4JAUA 4JF3A 1DF4A 5EBMC 1KC8W 4JGSA 2OCCC 4MT8A 2AHZA 1H38A 3ETDA 3ZRWA 2Q69A 1M9NA 2WAMA 1PNMA 2EILC 2A0LA 1H8HG 1MABG 2Q6AA 4RQEA 1DTOA 1GTOA 5EBWC 1F51A 1NR7A 2X6CA 1P4RA 2ZQMA 3AG4B 4KFMA 1G8MA 3F7VC 3HPLC 4J9ZB 4PA6A 2W6JG 5KUMA 3AG1C 3D36A 4WFHA 2CK3G 2W6IG 2R9RB 1AI7A 3X2QB 3OW2U 2GHYA 4TT3G 4WFEA 1NVPB 2IW5A 4RQFA 1RPRA 2EIJB 3GWOA 3OEEG 4P30A 2IU0A 4RUFA 2Q68A 2B1GA 4X89A 1S77D 2AHYA 2IU3A 1M56C 1JVMA 3VOUA 3ABMC 4PDRA 2BOBC 3FYIB 2ZD9A 3G71V 2A9HA 2X0LA 3CP1A 1RM1B 2B5UA 2QM8A 3LDDA 3E8BA 3EHBB 2JEUA 1SZTA 1KECA 2BOCC 4OXSA 3SPCA 1QBZA 1KD1W 4G2KA 5IY5B 2V7QG 5B1NA 2WLIB 1QR8A 4QE7A 1KP3A 4JPRA 4MTFA 2Z3YA 2OTLV 3OM3B 3CCSV 1YTFB 1JJ2U 5B1BC 4UVAA 5C93A 1NJIW 4P9OA 5KUKA 2OCCB 1XL6A 2NNUA 1I5YA 1K5SA 3CCUV 2ZXWC 3CC2V 4QPKA 5B1AC 5LGTA 2EILB 5HFLA 5DM6V 5LGUA 1K4DC 1RPOA 4TSFG 2DWEC 5EC2C 4JAVA 3W7WA 4WF9V 3E8HA 2W0FC 1H2GA 4JTDB 3B8MA 3AG1B 3W7TA 1VQMV 2WSSG 1W0JG 3ABKB 2OT5A 3CD6V 3BY6A 2WPDG 3JD4A 5FL7G 2HR3A 1NH2B 1M56B 1M57C 3ABMB 1WLEA 4BAYA 3TETA 3P30A 2QTOA 3T2MA 1IXMA 1AI6A 3CXCU 3BEHA 1B6QA 3ABTA 3DTUB 3T4ZA 1M1KW 3K0GA 4ASUG 1OCZC 4G28B 3OMIB 2DYRC 2QM7A 3RBZA 3CMEV 2D3OW 2PI5A 2JJ2G 4P9PA 1K9MW 2IJJA 1FXKC 1VQ4V 2LFSA 3JCZA 2WLMA 1W0KG 1ROPA 2Z5UA 1YI2V 3NXSA 3JYCA 3SYAA 1N8RW 3SYPA 5B1BB 3ZMUA 2K1EA 1VQOV 1YSCA 2WLLA 4QJFB 2XAHA 2ZXWB 4GCZA 2YEVB 1Y66A 5B1AB 3CCJV 1Y4MA 4X8AA 2DW4A 1JQ0A 1OCCC 1S0VA 2P90A 3SYCA 3ZJZA 1CP9A 2WLHA 1DLBA 2X7RB 4U7NA 1WPXA 4UV8A 4UXNA 2DQ0A 2WWWA 3ABLC 3CPWU 1BHBA 2HVJC 5L3DA 4MVQA 4WCEV 4UVCA 1YHQV 4BIUA 1E1RG 1G4YB 3LSSA 1V54C 4H37A 4MVMA 1OCRC 3OAAG 2ITDC 3JD2A 2A79B 4FIPC 3ABKC 1UJWB 3B8NA 1GMGA 3AG3C 2Y69C 3GB7C 2JDIG 3RVYA 3FB5C 3T1CA 1M57B 4G27B 4WFGA 2H8PC 3K04A 1K34A 3QO7A 4ZBMA 1YITV 3SJQC 3T4DA 1BL8A 4DO2A 2JIZG 3RVZA 1YIJV 1VQ7V 3ZCCA 3I55V 1K92A 4MVSA 4GX1A 1S72V 3W7XA 4QE9A 4TWKA 4P2ZA 3IC7A 3LDCA 1MOFA 3ASNC 1EZJA 2QA4V 2KB1A 1OCZB 3K03A 2EIMC 4RAIA 1JX9A 2DYRB 4PA3A 3STLC 1VQKV 2IJIA 1AI5A 2ZR2A 3ETGA 3ZIAG 3ZMZA 5L3BA 3FYEB 1FXKB 1GKFA 4UV9A 3E86A 3KG2A 4YXWG 4X88A 4MW8A 4PELA 3UM7A 1EBOA 3FB6C 4H33A 2M7WA 1GO3F 2ZDIA 4FK5C 3ZRWB 1JPXA 2X6AA 4GX2A 1ENVA 2WLNA 2EIKC 3FB8C 1OCCB 4XDLA 2HJFC 1V55C 4XDKA 1E1QG 1M90W 3OUSA 2UXNA 4EKWA 3ZRVA 3DGEA 1VQPV 4UVBA 2B1IA 3ABLB 2GSMB 1OCOC 4QNHB 4WFBV 3WG7C 2HLDG 3MHSC 3E8GA 2DYSC 4MW3A 1GK9A 2MK3A 3F7YC 1YJWV 2IH1C 1V54B 2XASA 3K79A 3PJSK 4PA7A 3A0RA 3E35A 5KA5A 1AJQA 1OCRB 3AG2C 3P32A 5L3EA 2WLKA 1YJ9V 3LSQA 3OFNG 1VQNV 3AG3B 2H94A 2Y69B 1HWYA 1VQ6V 2PI4A 3ZRSA 1ZWIC 5L3FA 4Q20A 1KP2A 1QLEC 2EBOA 4BW5A 4PDMA 3SYOA 3MD0A 2OTJV 1BHAA 3K9AA 3WFVA 1YJNV 1SRYA 1QCEA 1K97A 3ASNB 3M99B 4JTCB 5EC1C 4U7OA 1PL0A 4R6ZA 3UKMA 5IYDO 2EIMB 3F5WC 2IJKA 5LHIA 2HKOA 2Y48A 1S76D 4HZ3A 1CEZA 2V1DA 4JASA 3QO5A 1GM9A 4UUJC 4MVUA 1LNQA 1PKXA 3ASOB 1SERA 3H01A 4QIWF 1FS0G 3E8FA 4LC1A 5HFMA 3CC7V 2HVKC 2LP7A 4N21A 2XNDG 1R73A 4PDVA 2EIKB 5J9PC 1CPYA 2Q67A 1P7BA 4FMTA 2JJ1G 1V55B 1QVGU 2EZPA 4FPPA 3VBBA 2P67A 2C2AA 4BIZA 1NKDA 2XAJA 3TCUA 1OCOB 2QKSA 1QR9A 3WG7B 4CBCA 1VQ9V 3LDEA 3CCRV 3B77A 3K08A 4GX0A 2DYSB 4L87A 1R6KA 3JD3A 3RW0A 5GW7A 3LUTB 4CZZA 1Q81W 4J9YB 4E2LA 3K06A 1AI4A 4FJCC 3CCEV 3OR7C 3AG2B 2QE7G 1FXVA 2F43G 2WLIA 5H9CA 5CBHA 1MG1A 1F23A 2X6BA 1XL4A 3ZMTA 4R50A 3CYOA 2FTKA 5LBQA 4R8CA 2P6JA 1R3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ V;  1QVF U;  1M1K W;  1YJW V;  1QVG U;  2OTL V;  1VQM V;  1YIT V;  3CCS V;  1YIJ V;  1JJ2 U;  3CD6 V;  3CME V;  1VQ7 V;  3I55 V;  1YJ9 V;  2D3O W;  1NJI W;  1VQ8 V;  3G71 V;  1VQ9 V;  1VQN V;  1K9M W;  3CCR V;  3CPW U;  1S72 V;  3CCV V;  1W2B U;  1Q86 W;  3I56 V;  1VQ6 V;  3G6E V;  1KQS U;  1VQ4 V;  3CCU V;  3CC2 V;  4WCE V;  3CCM V;  3CCQ V;  1Q81 W;  3G4S V;  2QEX V;  1YHQ V;  3CCL V;  1YI2 V;  3CC4 V;  2QA4 V;  3CCE V;  1Q82 W;  1N8R W;  3CC7 V;  1M90 W;  5DM6 V;  3CMA V;  1Q7Y W;  1VQO V;  1VQK V;  1VQP V;  1VQL V;  2OTJ V;  1KD1 W;  3OW2 U;  1YJN V;  4WF9 V;  1R73 A;  4WFB V;  1KC8 W;  1VQ5 V;  3CXC U;  1K8A W;  1K73 W;  4WFA V; 
#chains in the Genus database with same CATH topology
 4JI1 O;  1TVK B;  5TIS Z;  4EFE A;  2B9Z A;  2XAF A;  3N2K A;  1M5I A;  2PYJ A;  1R3J C;  4KL1 A;  1SES A;  2CH7 B;  5B3S C;  1I5X A;  4DV3 B;  1NQT A;  4UB8 Z;  3SPJ A;  4WFA V;  1K4C C;  1PD3 A;  3BRC A;  3BAB A;  4MTG A;  1AB3 A;  1J95 A;  3FB7 C;  4I0X B;  4MVR A;  1A32 A;  5JQG A;  5IYC O;  1IUR A;  4JI1 B;  3SPH A;  4PA9 A;  5CBG A;  1SET A;  3CRR A;  1KKC A;  5CMU A;  1MNG A;  1HDJ A;  5CBF A;  3CB2 A;  3STZ C;  1N0J A;  1KUQ A;  2EIN C;  1H8E G;  3U11 A;  3ZN0 A;  2YXY A;  4MVO A;  4MVZ A;  5LYJ B;  1HNZ O;  5K1X A;  5JCO C;  5C8Y B;  3D3Q A;  1YTF D;  3SYQ A;  5BMV B;  1L1F A;  1XQ8 A;  4JYB A;  5KHH A;  1SQG A;  2EJR A;  5EIB D;  3Q4H B;  1MMM A;  4GLX A;  4I50 A;  2JEX A;  4DV4 O;  3KCY A;  2LW7 A;  1PNK A;  5CN0 A;  2YEV A;  4MS2 A;  4RO2 A;  1VP7 A;  5A9G A;  4GX5 A;  3N2G B;  1NU1 H;  4DR4 O;  2WLJ A;  3SPI A;  2G38 A;  4L8J A;  5GON A;  2DQ3 A;  5ITZ B;  2ZE6 A;  5LHH A;  3H1K H;  2V4D A;  3JD1 A;  1HNZ B;  4HAM A;  3CCV V;  1JR9 A;  4FFB A;  2EIJ C;  3FKS G;  5KX5 A;  4PA4 A;  5LP6 C;  3QNE A;  3O9O A;  1KKD A;  3AK2 A;  4AQY O;  2IJH A;  3CEI A;  4MSW C;  4DV4 B;  1R3I C;  3K5M A;  3L9D A;  4ZKI A;  3G6B A;  1TUE B;  4DR4 B;  4YIO A;  4FLW A;  1F4M A;  3LNM B;  2QKC A;  1Q86 W;  1AJN A;  3B4S A;  2ADQ B;  1EM1 A;  1FXK A;  4K0K O;  2Q7H A;  1KC8 W;  3CE2 A;  5EIB C;  4D7T A;  2AHZ A;  2QWR B;  3ETD A;  4AQY B;  2Q69 A;  4ZOL B;  5JVD B;  1PNM A;  2EIL C;  1DTO A;  4GKK O;  5EBW C;  2X6C A;  3CWB H;  1J5E O;  4JI0 O;  3F7V C;  2A3Q A;  4JI4 O;  2K9P A;  3D36 A;  4WFH A;  2CK3 G;  3HKC A;  2W6I G;  2BSK B;  4O4H B;  1NVP B;  4OX9 O;  1RPR A;  2R70 A;  3RYC B;  2Q68 A;  1RFY A;  2JGD A;  2CUG A;  1M4U A;  2AHY A;  4K0K B;  3VOU A;  3RFR A;  4PDR A;  2BTQ A;  3UO2 A;  2BOB C;  2ZD9 A;  3G71 V;  1XBL A;  3L75 H;  1VEW A;  3CP1 A;  1RM1 B;  2B5U A;  1D2D A;  2QM8 A;  3LDD A;  4JI7 O;  1KEC A;  4FLV A;  4GKK B;  2YIB A;  2DN9 A;  5KLV H;  2FL4 A;  1J5E B;  4HNA B;  4JI0 B;  4LF6 O;  2Y0P A;  4O2A B;  5B1N A;  2WLI B;  4TV9 A;  5IJ9 A;  4QE7 A;  4JI4 B;  1QHT A;  2OTL V;  4OX9 B;  2HP8 A;  1VAR A;  4UVA A;  1SQF A;  2CGN A;  3DSQ A;  5C93 A;  4P9O A;  1Y76 A;  2Q7E A;  2OCC B;  1XL6 A;  1BS3 A;  1I5Y A;  3RYF A;  3H1H H;  4JYA O;  2QSA A;  2XHB A;  2HJD A;  1EN5 A;  1K4D C;  5EC2 C;  4K8X A;  4JAV A;  4WF9 V;  3E8H A;  1WPB A;  5LA6 A;  4JI7 B;  5J2U B;  3B8M A;  2LGW A;  4X1I B;  4LF6 B;  2LO1 A;  1W0J G;  3ABK B;  2RMK B;  3BY6 A;  4DW0 A;  1YDX A;  3CRA A;  4A5U B;  2HHH O;  1ZL8 B;  1GH6 A;  4DR7 O;  4BW9 A;  1FD9 A;  5D5Q A;  4JYA B;  1IXM A;  1TVK A;  1SF9 A;  1GN2 A;  5LOV B;  3ABT A;  3DTU B;  1M1K W;  3K0G A;  5DEC A;  4DUY B;  1WB7 A;  4X20 B;  1JFF B;  2O57 A;  2LW1 A;  3CME V;  2D3O W;  2DE0 X;  4P9P A;  1K9M W;  3N27 A;  2IJJ A;  2KSD A;  1VQ4 V;  2LFS A;  2CH7 A;  1ROP A;  3NXS A;  5DED A;  4FLX A;  1YSC A;  4F6R B;  2QWN B;  4NTY A;  2HHH B;  2BE3 A;  1L8D A;  1Y66 A;  4YIP A;  1Y4M A;  4I0X A;  4ZI7 B;  2QGN A;  4DR7 B;  3SYC A;  3THO A;  3ZJZ A;  4DV2 O;  4GKJ O;  3M7M X;  2Y4T A;  5L3D A;  1HR0 O;  1TGO A;  4WCE V;  1KYO F;  3JAK B;  4X66 O;  3PN1 A;  1V54 C;  3OAA G;  5LYJ A;  5C8Y A;  3B8N A;  4B7E A;  1G6U A;  3AG3 C;  2Y69 C;  3FB5 C;  5BMV A;  1M57 B;  2QKA A;  3JAL B;  1O9H A;  4I7Z B;  1K34 A;  1NZ6 A;  1YIT V;  3Q4H A;  4DO2 A;  1YIJ V;  1VQ7 V;  2JRI A;  4JI6 O;  5CA0 B;  4DV2 B;  4P2Z A;  3VQX A;  3IC7 A;  4LF4 O;  3ASN C;  2KB1 A;  3K03 A;  4PA3 A;  5IJ0 B;  2E5L O;  1HR0 B;  2ZR2 A;  3FYE B;  4UV9 A;  5ITZ A;  3E86 A;  4X88 A;  1GO3 F;  4TQF A;  1JPX A;  1ENV A;  4D7S A;  2WLN A;  3FB8 C;  1L0N H;  1OCC B;  4IT5 A;  3DXR B;  5JJJ B;  4JYY A;  1PPJ H;  2UXD O;  3ZRV A;  4UVB A;  4LF4 B;  3ABL B;  2GSM B;  2ZNJ A;  4JV5 O;  2ETN A;  4Z2W A;  2E75 B;  4FZ1 A;  2DYS C;  4MW3 A;  3H9V A;  1H2K A;  1GK9 A;  3F7Y C;  2E5L B;  2IH1 C;  5E79 Z;  2XAS A;  3PJS K;  4PA7 A;  2QR4 A;  5FPO A;  3QTC A;  1OCR B;  3AG2 C;  4D6T H;  5L3E A;  3MDS A;  2A06 H;  2UUB O;  1IDS A;  1ZWI C;  2YDE A;  4I55 B;  4W4K A;  4PDM A;  1LUV A;  1BHA A;  3K9A A;  4ZOL A;  1K97 A;  3M99 B;  1AR4 A;  5JVD A;  4U7O A;  1PL0 A;  1D5N A;  1V9P A;  3UKM A;  5IYD O;  2EIM B;  4O2B B;  5LHI A;  4KHP O;  2HKO A;  2OCH A;  1N32 O;  4JV5 B;  4UUJ C;  1P49 A;  3VQW A;  2F23 A;  1D5A A;  4IYI A;  2BSK A;  4O4H A;  2CTP A;  4QIW F;  3ICX A;  2HVK C;  1YF2 A;  2UUB B;  3RYC A;  5IT9 N;  3K5N A;  4I9Q A;  2EIK B;  1SQQ H;  5J9P C;  3JAM N;  3RN4 A;  1V55 B;  4OPA A;  3VBB A;  1YZB A;  1OCO B;  2QKS A;  4O4L B;  3ZHT A;  3CCR V;  2ZNI A;  3K08 A;  4KHP B;  1SA0 B;  1N32 B;  3LUT B;  3SGI A;  1BSM A;  4HNA A;  2QE7 G;  4O2A A;  2F43 G;  2WLI A;  1XI1 A;  1MG1 A;  3VQV A;  2E76 B;  2YI8 A;  3ZMT A;  2P6J A;  2ADP A;  1QLE B;  1XUQ A;  4GYC B;  3ML0 A;  4I5S A;  1L0L H;  1AR1 B;  1K3E A;  5L3G A;  2KKW A;  3W7U A;  2PY5 A;  2R9I A;  3D3I A;  2ZIM A;  1GM7 A;  3E83 A;  5J2U A;  2ARH A;  4DR1 O;  4X1I A;  1BGY H;  4XBF A;  2ZDI C;  3OD4 A;  4U3F H;  2CE4 A;  4XDJ A;  1NR1 A;  4BWA A;  4R7C A;  1DF5 A;  1VQ8 V;  3OR6 C;  1ZL8 A;  1TUB B;  2EJ7 A;  2QEX V;  3CC4 V;  4JTA B;  4PHZ A;  5LOV A;  3TGU H;  1GN4 A;  2E74 B;  1BMF G;  2UUC O;  4QPJ A;  4X20 A;  1JFF A;  1PNL A;  3MHH C;  1QVF U;  2ZR3 A;  2P5O A;  2JK5 C;  4DR1 B;  3VQY A;  3QO8 A;  4MTO A;  2PGG A;  4LF5 O;  4IGG A;  2YXH A;  1EFR G;  1S5L Z;  1FFT B;  3BA8 A;  2UXX A;  4LF9 O;  4F6R A;  3L71 H;  4ZI7 A;  4JAA A;  1F4N A;  3AG4 C;  2ATK C;  1E79 G;  2UUC B;  2ITC C;  3CSX A;  5J2T B;  3X2Q C;  3JAK A;  1WB8 A;  4WFF A;  5KHJ A;  3CCQ V;  2XAG A;  3OMA B;  2NLJ C;  3G67 A;  4LF5 B;  3CMA V;  3R65 A;  4GT1 A;  4FM0 A;  3JAL A;  4AIL C;  4LF9 B;  2LFR A;  1XHX A;  5EYP B;  1XOU A;  5EBL C;  5CA0 A;  5KHI A;  4FLT A;  3OE7 G;  5GTI Z;  5IJ0 A;  5L3C A;  4TUY B;  3CCL V;  4E4E A;  1Q82 W;  1THZ A;  5H6Q A;  2ZIO A;  4IIJ B;  5KA6 A;  4DXW A;  2W0X A;  4JF3 A;  3C90 A;  4F6E A;  2FYU H;  2OIE A;  1H8H G;  3DXR A;  1IXB A;  1AP6 A;  1F51 A;  1PV0 A;  2IBZ H;  2Y4U A;  1P4R A;  2ZQM A;  1WP7 A;  1G8M A;  3HPL C;  3HKB B;  2GTA A;  3RYH B;  3OW2 U;  2GHY A;  1B06 A;  4RQF A;  2NN4 A;  3OEE G;  2UU9 O;  2IU0 A;  2B1G A;  1M56 C;  3WB1 A;  2ILM A;  4I55 A;  2X0L A;  1UPG A;  1SZT A;  4DV6 O;  4OXS A;  1KD1 W;  3ZHS A;  1Q5O A;  5IY5 B;  4O2B A;  5GTH Z;  5A2Q N;  4JPR A;  4MTF A;  3CCS V;  4UCO A;  1JJ2 U;  5B1B C;  2P4V A;  2UU9 B;  1NJI W;  3ZHQ A;  2NNU A;  4UB6 Z;  2ZXW C;  3CC2 V;  5DM6 V;  2CTW A;  4CC6 A;  1RPO A;  1KU9 A;  3IJ4 A;  1SS3 A;  4DV6 B;  1T5E A;  3AG1 B;  4O4L A;  1Z5V A;  3W7T A;  3K5O A;  4IHJ B;  1SA0 A;  5FPR A;  1VF7 A;  1NH2 B;  1Q6U A;  3KCX A;  3ABM B;  1FPO A;  1ZSP A;  4UCU A;  2YIB D;  3ZHV A;  5KAI Z;  4BR6 A;  4NR1 A;  4TQD A;  1OCZ C;  4H44 B;  2QM7 A;  2QTS A;  3RBZ A;  2PI5 A;  1Y67 A;  2JGU A;  1FXK C;  3HKD B;  3JCZ A;  1AR5 A;  2Z5U A;  2GTS A;  1O9G A;  3L74 H;  3JYC A;  2AXT Z;  1N8R W;  1WAZ A;  1VQO V;  2N05 A;  2N74 A;  2YI9 A;  4GUN A;  4CS2 A;  5D5P A;  4FM2 A;  3JAW B;  5B1A B;  3UT5 B;  2DW4 A;  1JQ0 A;  2Q7G A;  2P90 A;  2WLH A;  2DMX A;  3APQ A;  1DLB A;  1TUB A;  4U7N A;  1SZX A;  2QWP B;  1BHB A;  1URF A;  2HVJ C;  4MVQ A;  3ZED A;  3D36 C;  5JH7 B;  1E1R G;  3LSS A;  4H37 A;  5H2F Z;  4MVM A;  2CAZ C;  3JD2 A;  3RGB A;  2A79 B;  4B3R O;  4FIP C;  1KMI Z;  1XRE A;  3K04 A;  4J11 A;  3SJQ C;  3T4D A;  2JIZ G;  3RVZ A;  3ZCC A;  1K92 A;  3W7X A;  4ICG A;  4QE9 A;  3LDC A;  1MOF A;  2DOS A;  1EZJ A;  2QA4 V;  1JX9 A;  2DYR B;  3WB2 A;  1VQK V;  4DYL A;  1AI5 A;  3ETG A;  3ZMZ A;  5L3B A;  2RCV A;  1GKF A;  4X1K B;  1FAF A;  4LNU B;  3P3P A;  4Q6G A;  1XMQ B;  3FB6 C;  2M7W A;  5J2T A;  4B3R B;  1NT2 B;  1BE3 H;  3ZRW B;  2VRZ A;  1N36 O;  1AIL A;  2CTR A;  5LXT B;  2F4V O;  4DR3 O;  5JWP A;  2FKX A;  1E1Q G;  3OUS A;  2UXN A;  2ZE7 A;  5EYP A;  3HKE B;  1GN3 A;  4DUY O;  4QNH B;  3WG7 C;  4DW1 A;  1YXB A;  1YJW V;  1US6 A;  5IYZ B;  4H0L B;  4UCR A;  3P32 A;  2WLK A;  4TUY A;  3OFN G;  2H94 A;  4JZ2 A;  1VQ6 V;  2PI4 A;  1AVM A;  2F93 B;  4IIJ A;  4Q20 A;  1KP2 A;  1N36 B;  2EBO A;  2F4V B;  3ZX6 A;  4DR3 B;  4ZIB A;  2E3C A;  5F2V O;  2XUM A;  4NTX A;  2IJK A;  1S76 D;  3LSU A;  4PI0 A;  1MA1 A;  3HKB A;  1PKX A;  1SER A;  1FS0 G;  3E8F A;  2LP7 A;  4X64 O;  3T1Y O;  1XDC A;  2RQ6 A;  2XND G;  1R73 A;  4PDV A;  1BCC H;  1I94 O;  1DK1 A;  2JJ1 G;  1QVG U;  4DK0 A;  4FPP A;  5KAF Z;  4LWS B;  3S3W A;  4J80 A;  1HW7 A;  2VQF O;  1R6K A;  2ZIN A;  3JD3 A;  1LUW A;  4YJ2 B;  2OIG A;  1IZ3 A;  1Q81 W;  4J9Y B;  2F1M A;  3K06 A;  1AI4 A;  1N0N A;  2YS8 A;  1Z5W A;  4I4T B;  2FML A;  1R3L C;  4X64 B;  2GUZ B;  3T1Y B;  3TJT A;  5B1O A;  1I94 B;  3AG7 A;  4H13 B;  3M8A A;  4CS3 A;  1XIL A;  3S3X A;  2AZ0 A;  3ZMV A;  1S3J A;  2F66 C;  2VQF B;  3N2G A;  3T1H O;  5H6R A;  1QNM A;  1NVP D;  3RT3 C;  2QWO B;  1XEQ A;  1CXZ B;  4IHJ A;  2M6Y A;  4Z1M G;  3OUF A;  3BFR A;  3K3W A;  3ZMS A;  3G4S V;  2LJ2 A;  3TK1 A;  3ABU A;  5JJE B;  3ZRX A;  5BZB A;  4AHC A;  1SQP H;  4OPH A;  3T1H B;  4YHH O;  1FXH A;  4DRX B;  4DR6 O;  4N23 A;  3HKD A;  4X1Y B;  1WA8 B;  2MW2 B;  3CRM A;  3EFF K;  1QLN A;  4JYC A;  1VF6 A;  4Z1V A;  3AEI A;  1Q7Y W;  1AJP A;  3JAW A;  3UT5 A;  3ZHU A;  1GN6 A;  1K8A W;  4NTW A;  4HYO A;  3E89 A;  5B3S B;  3NR7 A;  4KUM A;  1MSD A;  3WU2 Z;  5JH7 A;  1OZ0 A;  3JSL A;  2P4K A;  4CH6 A;  4DK1 A;  1WNS A;  5CA3 A;  4YHH B;  2DWD C;  2Q9L A;  4DR6 B;  1KB9 F;  1H2L A;  4I9W A;  4PI2 A;  5LHG A;  3UQ8 A;  1K7D A;  1RM1 C;  1FKA O;  2CTQ A;  2HG5 C;  2UUA O;  1GM8 A;  2EIN B;  4CH5 A;  2PZS A;  3I56 V;  3G6E V;  1KQS U;  3CCM V;  3WB0 A;  5E1A C;  4X1K A;  2P22 C;  4B3M O;  4LNU A;  4JAU A;  1P7G A;  3RYI B;  4JGS A;  2OCC C;  4MT8 A;  1AP5 A;  3UO3 A;  3ZRW A;  1M9N A;  2WAM A;  5BXZ A;  4ZHQ B;  5LXT A;  3FX7 A;  1MAB G;  1IVS A;  1NR7 A;  2VS0 A;  1ZAU A;  1LR1 A;  2UUA B;  1Y74 B;  3HKE A;  4J9Z B;  1QU7 A;  2W6J G;  5KX5 B;  1M93 A;  2R9R B;  1AI7 A;  1BZK A;  2WA3 A;  4TT3 G;  4WFE A;  5IYZ A;  2Z0A A;  2IW5 A;  3B2E E;  3GWO A;  2EIJ B;  5LP6 B;  4B3M B;  4X89 A;  2PUS A;  1S77 D;  2IU3 A;  1JVM A;  4NXM O;  4LF8 O;  4JZG A;  1Z2G A;  4FZ0 A;  1XHZ A;  5K1P A;  4EEQ A;  2EUL A;  2EX3 A;  3E8B A;  1G1X B;  3SPC A;  1QBZ A;  3BVO A;  1MZE A;  3H1L H;  1QR8 A;  1KP3 A;  2L35 A;  2DJV A;  2Z3Y A;  4JI2 O;  3OM3 B;  4UCS A;  3K59 A;  4GZR B;  1YTF B;  3TXS A;  1UFI A;  1WP8 A;  3CCU V;  4NXM B;  4LF8 B;  5LGT A;  2EIL B;  3DC5 A;  5LGU A;  4TSF G;  3W7W A;  1RSO B;  1PM9 A;  3OT7 A;  2W0F C;  1H2G A;  4LWS A;  4IYH A;  3BHP A;  3JCU Z;  1N34 O;  4YJ2 A;  2OT5 A;  3CD6 V;  3RWR D;  2BTQ B;  2LGQ A;  3JAS B;  3U10 A;  2ZE8 A;  4JI2 B;  5FL7 G;  4LFB O;  2QDO A;  1M57 C;  3J80 N;  4I4T A;  3TET A;  3T2M A;  2GUZ A;  3D8C A;  1U97 A;  1KBH A;  1EN4 A;  3CXC U;  3T4Z A;  3FAV B;  2CDY A;  4ASU G;  4HBN A;  2VWK A;  5KMG B;  1NI8 A;  2WLM A;  1W0K G;  1N34 B;  1YI2 V;  1Y6X A;  3SYA A;  4DV1 O;  1VMG A;  1XMO O;  4LFB B;  2XAH A;  4GCZ A;  3CJH B;  1OJH A;  1SKV A;  2GV9 A;  4PD4 F;  2QWQ B;  4YY3 O;  1F7Y A;  4X8A A;  3MAQ A;  1PP9 H;  4UCV A;  1OCC C;  1S0V A;  5LA6 B;  1H2S B;  2X7R B;  5IE9 A;  2R9A A;  2DQ0 A;  2WWW A;  3ABL C;  3CPW U;  3JAR B;  4J41 A;  4UVC A;  3O65 A;  1YHQ V;  1NTZ H;  3BPZ A;  4BIU A;  3B40 A;  1G4Y B;  3OGI B;  1EN6 A;  1OCR C;  2ITD C;  1B3Q A;  4DRX A;  3DC6 A;  1UJW B;  4J7J A;  2JDI G;  3RVY A;  3T1C A;  4DV1 B;  4X1Y A;  1WA8 A;  4G27 B;  4WFG A;  2H8P C;  4FM1 A;  1XMO B;  3QO7 A;  4ZBM A;  3CX5 F;  1BL8 A;  1IBL O;  1B04 A;  4YY3 B;  4MVS A;  4GX1 A;  3E22 B;  4RWU A;  4BIO A;  3G80 A;  4W4L A;  4PV1 B;  2EIM C;  2YXL A;  1EZV H;  2IJI A;  1Q3E A;  1DGS A;  4YJ3 B;  3KG2 A;  4YXW G;  4O4I B;  4PEL A;  3UM7 A;  4H33 A;  4K8Z A;  2JS3 A;  2X6A A;  4GX2 A;  5FNV B;  2EIK C;  4FLY A;  4NKG B;  3ZS8 C;  1IBL B;  4CC5 A;  1V55 C;  2YID A;  4XDK A;  1Q6H A;  1VQP V;  4J7K A;  2B1I A;  1H2N A;  1OCO C;  4WFB V;  1R6T A;  3MHS C;  3E8G A;  2MK3 A;  1V54 B;  4NVP A;  1VF5 B;  1AJQ A;  4B3T O;  4EB6 B;  2QM4 A;  5JCO A;  3AG3 B;  2Y69 B;  1HNX O;  5IWA O;  1QLE C;  3K57 A;  3C3T A;  3RYI A;  4BW5 A;  3MD0 A;  2OTJ V;  3WFV A;  4NXN O;  1YJN V;  1QCE A;  2F95 B;  3ASN B;  4JTC B;  4ZHQ A;  4R6Z A;  4DUZ O;  2Y48 A;  2VWJ A;  1CEZ A;  2V1D A;  2GBO A;  1Y74 A;  1GM9 A;  1LNQ A;  4UFZ A;  4DV0 O;  4U3J B;  2AGA A;  4B3T B;  1YEW A;  3KKY A;  3SJB C;  3CC7 V;  1HNX B;  5LP6 A;  4N21 A;  1I0H A;  5IWA B;  3GVM A;  1CPY A;  2Q67 A;  1P7B A;  4FMT A;  1IBM O;  2EZP A;  4NXN B;  1NKD A;  3TCU A;  4CBC A;  1VQ9 V;  1Q90 D;  3LDE A;  3B77 A;  4GX0 A;  3RW0 A;  2DYS B;  4DUZ B;  1VIB A;  3QG5 A;  2JVD A;  4E2L A;  3CCE V;  4B3S O;  3AG2 B;  1FXV A;  2PYL A;  4DV0 B;  1F23 A;  1ZLZ A;  3F5T A;  1XMQ O;  5LBQ A;  4R8C A;  1X59 A;  3IFX A;  4WBN B;  4FLZ A;  4DR2 O;  2FB5 A;  5IDJ A;  2RJZ A;  3ZN1 A;  1Q8I A;  3CHX A;  3OMN B;  1IBM B;  1W59 A;  1ARO P;  1W2B U;  1RSO A;  3HB3 B;  3K0D A;  2XOK G;  5IYB O;  1YCI A;  4KXR A;  1TAE A;  1GRJ A;  3JAT B;  4LBE C;  3L72 H;  5B5E Z;  4X65 O;  1K73 W;  4B3S B;  3ETE A;  2WLL B;  4O4J B;  3JAS A;  3ASO C;  3JSN A;  4LFC O;  3SJC C;  1JOY A;  4K3A A;  5BY1 A;  4DR2 B;  1Q6I A;  1R3K C;  4DV5 O;  3OGC C;  3LNN A;  3GWK C;  1XNR O;  4LCU C;  1HNW O;  1R6N A;  3FAV A;  1Q43 A;  2IM9 A;  5EZY B;  3KZI Z;  3IGA C;  3OEH G;  5EK0 A;  3SPG A;  1ORQ C;  2LQT A;  4QGP A;  3K5L A;  2EZO A;  3K9S A;  5KMG A;  4X65 B;  1SQX H;  3K58 A;  4AI8 A;  2AZ2 A;  4RUE A;  1S5H C;  4LFC B;  4KP4 A;  1JCH A;  3BCC H;  1K33 A;  4MTX A;  2Q0A A;  2HEP A;  5CA1 B;  4DV5 B;  3CJH A;  3CS5 A;  3JD0 A;  2RNB A;  1K5Q A;  3A8T A;  1N33 O;  2P7T C;  2IH3 C;  3H1J H;  1XNR B;  2BCC H;  1HNW B;  4TV8 B;  3JAR A;  1FFX B;  3HR0 A;  1H2M A;  4LP8 A;  3FFQ A;  1OHH G;  1NH2 D;  2YSU B;  3OTF A;  3RYH A;  5LGN A;  5DN6 G;  1MSW D;  4FFK A;  2YC0 A;  1JMK C;  4NYK A;  1VQ5 V;  1WJZ A;  4F4L A;  1COW G;  2HFE C;  3E2E A;  4NB5 A;  4PDL A;  3CRC A;  1P84 F;  3J7A U;  4FLU A;  3E22 A;  1S5J A;  1N33 B;  1QQC A;  2ZM6 O;  2XAQ A;  5IY5 C;  3IAY A;  3W7S A;  1NTM H;  4JI8 O;  1FJG O;  1NBM G;  4TOI A;  5CB4 B;  3SJA C;  4YJ3 A;  2L6L A;  2PF4 E;  1VQL V;  3TXQ A;  1DF4 A;  4O4I A;  4CS4 A;  2YUA A;  5EBM C;  1OV9 A;  1H38 A;  5FNV A;  2YIA A;  2XT9 A;  2A0L A;  1JA8 A;  2OWO A;  3CRQ A;  2Q6A A;  4RQE A;  1GTO A;  3AG4 B;  4KFM A;  3I5D A;  1PL4 A;  4PA6 A;  2ZM6 B;  5KUM A;  3AG1 C;  2RDC A;  2ZT9 B;  3X2Q B;  4P30 A;  4JI8 B;  2Y0I A;  4RUF A;  4EB6 A;  1FJG B;  3A0B Z;  2KG7 B;  4FVM A;  3ABM C;  3FYI B;  3IC9 A;  2OYQ A;  4GKJ B;  4B7K A;  2D2C B;  4LF7 O;  2VQE O;  2A9H A;  2UXB O;  1U96 A;  4J10 A;  3EHB B;  3EVK A;  2JEU A;  2Q73 A;  2BOC C;  2ZKO A;  4G2K A;  2V7Q G;  4X66 B;  3R66 A;  3A2F A;  5BR8 O;  1BQ0 A;  4U3J A;  4DR5 O;  5KUK A;  1VF6 C;  1K5S A;  2Q8V A;  4QPK A;  5B1A C;  3QVN A;  2PTM A;  4JI6 B;  3N2K B;  1YVW A;  5HFL A;  4LF7 B;  2DWE C;  2VQE B;  2UXB B;  1BQZ A;  4CH3 A;  1MZF A;  5KHG A;  4JTD B;  2UXC O;  1I08 A;  1ZTE A;  1VQM V;  5LMU O;  2WSS G;  2R72 A;  2ZCE A;  2ZE5 A;  3OTO O;  5BR8 B;  2WPD G;  2Q5Z A;  3JD4 A;  2HR3 A;  2KQX A;  3EXA A;  5JQG B;  4DR5 B;  1M56 B;  1WLE A;  4BAY A;  4WBN A;  3P30 A;  2QTO A;  3CXH F;  1AI6 A;  3BEH A;  1B6Q A;  2UXD B;  1RP3 B;  4G28 B;  3OMI B;  2DYR C;  2JJ2 G;  4JI5 O;  1SQB H;  2UXC B;  4X9Q A;  3L70 H;  1FYJ A;  4C7U A;  5LMU B;  3JAT A;  3BAA A;  3ZHR A;  3OTO B;  3SYP A;  5B1B B;  3ZMU A;  1SQV H;  2K1E A;  4I50 B;  2WLL A;  4QJF B;  4O4J A;  1BT8 A;  2ZXW B;  2YEV B;  4CH4 A;  3CCJ V;  4EFB A;  1CP9 A;  1JJO A;  3APO A;  1WPX A;  4UV8 A;  4UXN A;  5GON B;  1R1B A;  3L73 H;  3B09 A;  2GDS A;  3U0Z A;  4FFB B;  4JI5 B;  5EZY A;  5FLX N;  1WN7 A;  4JI3 O;  3ABK C;  1GMG A;  3GB7 C;  2RN9 A;  2Q4P A;  3AK1 A;  4PJ0 Z;  2NR5 A;  3I55 V;  2BTO A;  1S72 V;  4TWK A;  3QF7 A;  5CA1 A;  5B66 Z;  1OCZ B;  3J81 N;  4RAI A;  1SC5 B;  2A7W A;  3STL C;  2Q0O C;  3ZIA G;  1IBK O;  1FXK B;  3A0H Z;  4TV8 A;  5AG2 A;  4MW8 A;  1EBO A;  4JI3 B;  5LMN O;  1FFX A;  2CGO A;  3UCS C;  1ZUQ A;  2ZDI A;  1HP8 A;  4FK5 C;  4XDL A;  2HJF C;  1ZX3 A;  5KHK A;  2XTA A;  3SDL A;  1M90 W;  4EKW A;  3DGE A;  3AK3 A;  2HLD G;  3HKC B;  3K79 A;  3A0R A;  3E35 A;  5KA5 A;  1IBK B;  4J7Z A;  3SR2 C;  2JGD B;  3FD9 A;  3C3S A;  1YJ9 V;  3LSQ A;  1VQN V;  1HWY A;  2ODM A;  5LMN B;  1XNQ O;  3H1I H;  5CB4 A;  3ZRS A;  2H3O A;  5L3F A;  4X62 O;  3SYO A;  4B08 A;  1SRY A;  4LR3 A;  4LFA O;  5EC1 C;  2N04 A;  3F5W C;  4UCT A;  1TA8 A;  4TV9 B;  1NS1 A;  5IJ9 B;  4DV7 O;  4HZ3 A;  1N4C A;  4JAS A;  3QO5 A;  4IL6 Z;  4MVU A;  4OGQ B;  3ASO B;  2JS5 A;  1Y76 B;  3H01 A;  4LC1 A;  5HFM A;  3RYF B;  5JJN B;  1XNQ B;  4J42 A;  4K35 A;  2KG7 A;  1X4T A;  2YIC A;  4LH6 A;  4X62 B;  5H5N A;  5LL6 Y;  3ZBH A;  2P67 A;  1GAX A;  4LH7 A;  2C2A A;  4BIZ A;  2XAJ A;  4LFA B;  1QR9 A;  3WG7 B;  2WA4 A;  1I7F A;  4L87 A;  1NTK H;  5GW7 A;  1IX9 A;  4CZZ A;  4DV7 B;  4ABM A;  4DV3 O;  2AW9 A;  4FJC C;  3OR7 C;  5H9C A;  2QJ1 A;  5CBH A;  3ETQ A;  2X6B A;  1XL4 A;  4R50 A;  3CYO A;  2FTK A;  3BA9 A;  3P3N A;  2P06 A; 
#chains in the Genus database with same CATH homology
 3IFX A;  1QLE B;  5IDJ A;  3ZN1 A;  3ML0 A;  4I5S A;  5B1O A;  3OMN B;  1AR1 B;  2XAF A;  1K3E A;  1ARO P;  1W2B U;  5L3G A;  3W7U A;  3ZMV A;  1S3J A;  2R9I A;  3HB3 B;  3K0D A;  3D3I A;  2XOK G;  1R3J C;  5IYB O;  1GM7 A;  1SES A;  3E83 A;  5B3S C;  5H6R A;  4LBE C;  1NVP D;  1I5X A;  1K73 W;  1NQT A;  3ETE A;  3SPJ A;  4WFA V;  1K4C C;  1PD3 A;  4XBF A;  2ZDI C;  2WLL B;  4MTG A;  4XDJ A;  3ASO C;  4Z1M G;  1J95 A;  1NR1 A;  3FB7 C;  4MVR A;  4R7C A;  1DF5 A;  1JOY A;  1VQ8 V;  3OUF A;  5IYC O;  1R3K C;  3K3W A;  3OR6 C;  3SPH A;  3OGC C;  4PA9 A;  1SET A;  3ZMS A;  5CBG A;  2QEX V;  3G4S V;  3TK1 A;  3CC4 V;  3ABU A;  5CMU A;  4JTA B;  5CBF A;  3ZRX A;  3STZ C;  5BZB A;  4LCU C;  1BMF G;  1R6N A;  2EIN C;  1H8E G;  4QPJ A;  3ZN0 A;  4MVO A;  1PNL A;  3MHH C;  4MVZ A;  3OEH G;  3IGA C;  5EK0 A;  1QVF U;  3SPG A;  1ORQ C;  2ZR3 A;  2JK5 C;  1FXH A;  1YTF D;  3SYQ A;  4N23 A;  3QO8 A;  4MTO A;  2EZO A;  1L1F A;  4JYB A;  2EJR A;  1EFR G;  1FFT B;  4RUE A;  1S5H C;  2UXX A;  1JCH A;  3EFF K;  1K33 A;  4KP4 A;  1QLN A;  2JEX A;  4MTX A;  4JYC A;  1PNK A;  3AEI A;  2YEV A;  4MS2 A;  1AJP A;  5CN0 A;  1Q7Y W;  4RO2 A;  3JD0 A;  4GX5 A;  1K5Q A;  1K8A W;  2WLJ A;  2P7T C;  3SPI A;  1F4N A;  2IH3 C;  4HYO A;  3AG4 C;  3E89 A;  2ATK C;  2DQ3 A;  1E79 G;  5B3S B;  5LHH A;  4KUM A;  2ITC C;  1OZ0 A;  3JD1 A;  3X2Q C;  4HAM A;  4WFF A;  4LP8 A;  3CCV V;  5CA3 A;  2DWD C;  2EIJ C;  1OHH G;  3FKS G;  3CCQ V;  2YSU B;  1NH2 D;  2XAG A;  4PA4 A;  3OMA B;  2NLJ C;  5LGN A;  3QNE A;  5DN6 G;  3CMA V;  1KKD A;  1MSW D;  3R65 A;  4GT1 A;  2IJH A;  1VQ5 V;  4I9W A;  4MSW C;  4F4L A;  2LFR A;  1COW G;  1R3I C;  2HFE C;  5EBL C;  5LHG A;  3E2E A;  4ZKI A;  4PDL A;  1K7D A;  1RM1 C;  2HG5 C;  1TUE B;  1GM8 A;  2EIN B;  3OE7 G;  1F4M A;  3LNM B;  2XAQ A;  5IY5 C;  3I56 V;  1Q86 W;  3G6E V;  1KQS U;  1AJN A;  5L3C A;  3CCM V;  3W7S A;  3CCL V;  5E1A C;  1Q82 W;  1FXK A;  1THZ A;  1NBM G;  5H6Q A;  5KA6 A;  4DXW A;  1VQL V;  4JAU A;  4JF3 A;  1DF4 A;  5EBM C;  1KC8 W;  4JGS A;  2OCC C;  4MT8 A;  2AHZ A;  1H38 A;  3ETD A;  3ZRW A;  2Q69 A;  1M9N A;  2WAM A;  1PNM A;  2EIL C;  2A0L A;  1H8H G;  1MAB G;  2Q6A A;  4RQE A;  1DTO A;  1GTO A;  5EBW C;  1F51 A;  1NR7 A;  2X6C A;  1P4R A;  2ZQM A;  3AG4 B;  4KFM A;  1G8M A;  3F7V C;  3HPL C;  4J9Z B;  4PA6 A;  2W6J G;  5KUM A;  3AG1 C;  3D36 A;  4WFH A;  2CK3 G;  2W6I G;  2R9R B;  1AI7 A;  3X2Q B;  3OW2 U;  2GHY A;  4TT3 G;  4WFE A;  1NVP B;  2IW5 A;  4RQF A;  1RPR A;  2EIJ B;  3GWO A;  3OEE G;  4P30 A;  2IU0 A;  4RUF A;  2Q68 A;  2B1G A;  4X89 A;  1S77 D;  2AHY A;  2IU3 A;  1M56 C;  1JVM A;  3VOU A;  3ABM C;  4PDR A;  2BOB C;  3FYI B;  2ZD9 A;  3G71 V;  2A9H A;  2X0L A;  3CP1 A;  1RM1 B;  2B5U A;  2QM8 A;  3LDD A;  3E8B A;  3EHB B;  2JEU A;  1SZT A;  1KEC A;  2BOC C;  4OXS A;  3SPC A;  1QBZ A;  1KD1 W;  4G2K A;  5IY5 B;  2V7Q G;  5B1N A;  2WLI B;  1QR8 A;  4QE7 A;  1KP3 A;  4JPR A;  4MTF A;  2Z3Y A;  2OTL V;  3OM3 B;  3CCS V;  1YTF B;  1JJ2 U;  5B1B C;  4UVA A;  5C93 A;  1NJI W;  4P9O A;  5KUK A;  2OCC B;  1XL6 A;  2NNU A;  1I5Y A;  1K5S A;  3CCU V;  2ZXW C;  3CC2 V;  4QPK A;  5B1A C;  5LGT A;  2EIL B;  5HFL A;  5DM6 V;  5LGU A;  1K4D C;  1RPO A;  4TSF G;  2DWE C;  5EC2 C;  4JAV A;  3W7W A;  4WF9 V;  3E8H A;  2W0F C;  1H2G A;  4JTD B;  3B8M A;  3AG1 B;  3W7T A;  1VQM V;  2WSS G;  1W0J G;  3ABK B;  2OT5 A;  3CD6 V;  3BY6 A;  2WPD G;  3JD4 A;  5FL7 G;  2HR3 A;  1NH2 B;  1M56 B;  1M57 C;  3ABM B;  1WLE A;  4BAY A;  3TET A;  3P30 A;  2QTO A;  3T2M A;  1IXM A;  1AI6 A;  3CXC U;  3BEH A;  1B6Q A;  3ABT A;  3DTU B;  3T4Z A;  1M1K W;  3K0G A;  4ASU G;  1OCZ C;  4G28 B;  3OMI B;  2DYR C;  2QM7 A;  3RBZ A;  3CME V;  2D3O W;  2PI5 A;  2JJ2 G;  4P9P A;  1K9M W;  2IJJ A;  1FXK C;  1VQ4 V;  2LFS A;  3JCZ A;  2WLM A;  1W0K G;  1ROP A;  2Z5U A;  1YI2 V;  3NXS A;  3JYC A;  3SYA A;  1N8R W;  3SYP A;  5B1B B;  3ZMU A;  2K1E A;  1VQO V;  1YSC A;  2WLL A;  4QJF B;  2XAH A;  2ZXW B;  4GCZ A;  2YEV B;  1Y66 A;  5B1A B;  3CCJ V;  1Y4M A;  4X8A A;  2DW4 A;  1JQ0 A;  1OCC C;  1S0V A;  2P90 A;  3SYC A;  3ZJZ A;  1CP9 A;  2WLH A;  1DLB A;  2X7R B;  4U7N A;  1WPX A;  4UV8 A;  4UXN A;  2DQ0 A;  2WWW A;  3ABL C;  3CPW U;  1BHB A;  2HVJ C;  5L3D A;  4MVQ A;  4WCE V;  4UVC A;  1YHQ V;  4BIU A;  1E1R G;  1G4Y B;  3LSS A;  1V54 C;  4H37 A;  4MVM A;  1OCR C;  3OAA G;  2ITD C;  3JD2 A;  2A79 B;  4FIP C;  3ABK C;  1UJW B;  3B8N A;  1GMG A;  3AG3 C;  2Y69 C;  3GB7 C;  2JDI G;  3RVY A;  3FB5 C;  3T1C A;  1M57 B;  4G27 B;  4WFG A;  2H8P C;  3K04 A;  1K34 A;  3QO7 A;  4ZBM A;  1YIT V;  3SJQ C;  3T4D A;  1BL8 A;  4DO2 A;  2JIZ G;  3RVZ A;  1YIJ V;  1VQ7 V;  3ZCC A;  3I55 V;  1K92 A;  4MVS A;  4GX1 A;  1S72 V;  3W7X A;  4QE9 A;  4TWK A;  4P2Z A;  3IC7 A;  3LDC A;  1MOF A;  3ASN C;  1EZJ A;  2QA4 V;  2KB1 A;  1OCZ B;  3K03 A;  2EIM C;  4RAI A;  1JX9 A;  2DYR B;  4PA3 A;  3STL C;  1VQK V;  2IJI A;  1AI5 A;  2ZR2 A;  3ETG A;  3ZIA G;  3ZMZ A;  5L3B A;  3FYE B;  1FXK B;  1GKF A;  4UV9 A;  3E86 A;  3KG2 A;  4YXW G;  4X88 A;  4MW8 A;  4PEL A;  3UM7 A;  1EBO A;  3FB6 C;  4H33 A;  2M7W A;  1GO3 F;  2ZDI A;  4FK5 C;  3ZRW B;  1JPX A;  2X6A A;  4GX2 A;  1ENV A;  2WLN A;  2EIK C;  3FB8 C;  1OCC B;  4XDL A;  2HJF C;  1V55 C;  4XDK A;  1E1Q G;  1M90 W;  3OUS A;  2UXN A;  4EKW A;  3ZRV A;  3DGE A;  1VQP V;  4UVB A;  2B1I A;  3ABL B;  2GSM B;  1OCO C;  4QNH B;  4WFB V;  3WG7 C;  2HLD G;  3MHS C;  3E8G A;  2DYS C;  4MW3 A;  1GK9 A;  2MK3 A;  3F7Y C;  1YJW V;  2IH1 C;  1V54 B;  2XAS A;  3K79 A;  3PJS K;  4PA7 A;  3A0R A;  3E35 A;  5KA5 A;  1AJQ A;  1OCR B;  3AG2 C;  3P32 A;  5L3E A;  2WLK A;  1YJ9 V;  3LSQ A;  3OFN G;  1VQN V;  3AG3 B;  2H94 A;  2Y69 B;  1HWY A;  1VQ6 V;  2PI4 A;  3ZRS A;  1ZWI C;  5L3F A;  4Q20 A;  1KP2 A;  1QLE C;  2EBO A;  4BW5 A;  4PDM A;  3SYO A;  3MD0 A;  2OTJ V;  1BHA A;  3K9A A;  3WFV A;  1YJN V;  1SRY A;  1QCE A;  1K97 A;  3ASN B;  3M99 B;  4JTC B;  5EC1 C;  4U7O A;  1PL0 A;  4R6Z A;  3UKM A;  5IYD O;  2EIM B;  3F5W C;  2IJK A;  5LHI A;  2HKO A;  2Y48 A;  1S76 D;  4HZ3 A;  1CEZ A;  2V1D A;  4JAS A;  3QO5 A;  1GM9 A;  4UUJ C;  4MVU A;  1LNQ A;  1PKX A;  3ASO B;  1SER A;  3H01 A;  4QIW F;  1FS0 G;  3E8F A;  4LC1 A;  5HFM A;  3CC7 V;  2HVK C;  2LP7 A;  4N21 A;  2XND G;  1R73 A;  4PDV A;  2EIK B;  5J9P C;  1CPY A;  2Q67 A;  1P7B A;  4FMT A;  2JJ1 G;  1V55 B;  1QVG U;  2EZP A;  4FPP A;  3VBB A;  2P67 A;  2C2A A;  4BIZ A;  1NKD A;  2XAJ A;  3TCU A;  1OCO B;  2QKS A;  1QR9 A;  3WG7 B;  4CBC A;  1VQ9 V;  3LDE A;  3CCR V;  3B77 A;  3K08 A;  4GX0 A;  2DYS B;  4L87 A;  1R6K A;  3JD3 A;  3RW0 A;  5GW7 A;  3LUT B;  4CZZ A;  1Q81 W;  4J9Y B;  4E2L A;  3K06 A;  1AI4 A;  4FJC C;  3CCE V;  3OR7 C;  3AG2 B;  2QE7 G;  1FXV A;  2F43 G;  2WLI A;  5H9C A;  5CBH A;  1MG1 A;  1F23 A;  2X6B A;  1XL4 A;  3ZMT A;  4R50 A;  3CYO A;  2FTK A;  5LBQ A;  4R8C A;  2P6J A;  1R3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...