2OTLV

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2otlV00
1N8RW 5DM6V 1VQ5V 3CCJV 1W2BU 2QEXV 1Q86W 2QA4V 1QVFU 1VQLV 1KC8W 1YI2V 1VQ4V 3CCEV 1VQ7V 1YHQV 4WFAV 1YITV 1YJWV 3G4SV 3G71V 4WCEV 1Q82W 1M1KW 1KQSU 1VQ6V 3I55V 1VQNV 1R73A 2D3OW 1Q81W 1K73W 3CCLV 3CCVV 3G6EV 1VQKV 1JJ2U 3CMAV 3CC4V 3CC7V 1VQOV 3CCSV 1YJ9V 1VQ8V 1KD1W 1Q7YW 3CCRV 1VQ9V 4WFBV 3CXCU 3CMEV 1K8AW 2OTLV 3CC2V 2OTJV 1S72V 1YIJV 1QVGU 4WF9V 3CCUV 1YJNV 1K9MW 1M90W 1VQMV 1VQPV 3CPWU 3CCQV 3CD6V 3OW2U 3I56V 1NJIW 3CCMV
chains in the Genus database with same CATH superfamily
5H2FZ 2CTPA 2FMLA 1F23A 2ZINA 3ZMTA 5K1PA 1K5SA 1KKCA 1YJWV 1TUEB 4LF4O 3ABLB 1WP8A 2RQ6A 4MVUA 4DV7O 3E8HA 3L71H 1I94O 2WWWA 1SQXH 1XILA 5LOVA 4LFCB 2UXCB 4CS4A 2EILC 1N36O 2QTOA 1KB9F 1VP7A 3OGIB 3RBZA 1I08A 2JDIG 3E8FA 1OCRC 4O4LB 4PA3A 1JCHA 3AG7A 1G8MA 2P4KA 3LUTB 4CH5A 1TGOA 4E2LA 2KG7A 4FFBB 1IXMA 1FFTB 3BEHA 3BHPA 5KHGA 3AK3A 4MVOA 2LFSA 5GONA 4DK1A 4X89A 2QJ1A 4B7EA 1GTOA 1B3QA 4CH4A 3RYHB 2B1IA 2P67A 4TV8A 4WFEA 2CTRA 1THZA 1JFFB 3UKMA 4CH3A 1SQGA 1HNXO 4J42A 4U7NA 5A9GA 4B3MB 3B8NA 1J5EO 4LNUA 3DGEA 1FJGO 4Q6GA 2W6JG 5IWAO 2ZM6B 1S5HC 2C2AA 3E2EA 5B1BB 2ZIOA 3HB3B 3CS5A 1B06A 4FZ1A 1YI2V 2UUCO 4MTXA 3ZEDA 4JI3O 5JJNB 1XHXA 4GX2A 2JVDA 4LP8A 4FLWA 4DXWA 5D5QA 1WN7A 1K9MW 3HKBB 3E83A 3JSLA 2Q69A 1L8DA 5EZYA 2ZDIC 5CN0A 4KHPB 3W7SA 2MK3A 5EIBD 2Q7HA 1EN5A 5L3EA 5LMNO 2UUBO 1TA8A 2JGUA 2ZNJA 2JK5C 3FD9A 3J7AU 4ABMA 5KX5B 4MSWC 2ETNA 4ZBMA 1KU9A 4DR7O 2R9RB 2EIJC 1V55C 4LC1A 1PPJH 1GN3A 1WPBA 1BQ0A 4UV9A 5C93A 2KB1A 5CBGA 4X62B 4UB8Z 1CEZA 2CDYA 1IBLB 2EIJB 1BS3A 2QR4A 1KBHA 2L35A 1P4RA 4O2BA 2Q7EA 1JQ0A 4AILC 3BA8A 2GTAA 3Q4HB 5IYCO 2QA4V 3VBBA 1UPGA 4TUYA 4DR1B 1DF5A 3ASOB 2HEPA 4DR5O 1BL8A 3OTOB 4J10A 5KA6A 3HKDB 4LFBO 3ZX6A 2QM7A 1E1QG 4I55B 4NXNB 2OCCB 4K0KO 1W0JG 1Q6HA 1XMOB 2Q9LA 3CCMV 2F1MA 5DM6V 3K5MA 4R6ZA 4U3FH 3RWRD 3HKCA 5JH7B 4A5UB 3B8MA 2LJ2A 4UCRA 1KQSU 1MZEA 1QHTA 3BVOA 4J41A 5FPRA 2EINB 3CCSV 3ZN0A 2QKAA 4YY3B 1YF2A 4JI8B 3AG4B 1XMQB 2R9AA 1Y66A 2D2CB 1VF5B 2B1GA 5LHIA 2N74A 4NTWA 3ETGA 2ZCEA 3JASB 1K3EA 4OXSA 1S3JA 5LMUB 1K5QA 4ZOLB 2P6JA 3EHBB 3APQA 5LHHA 3OUSA 4TWKA 4HYOA 4GKJO 3HKDA 1QVGU 2ZE5A 4NXNO 1Q6IA 1K7DA 2P90A 4B08A 1RPRA 1H2MA 3N2KA 4LBEC 3P3NA 2ZKOA 3SPHA 2IU0A 4BW5A 1HWYA 4QPJA 5CA3A 4DV6B 3T1YB 1EN4A 3G6EV 2DYSB 5J2UA 2XAJA 1KECA 4X1IA 4JYYA 1YVWA 4CC5A 4LF9O 2EILB 1Q86W 4X65B 2IW5A 4MTOA 3AEIA 4DV4B 3L75H 2HFEC 3CCLV 3U10A 1IBMO 4JI7O 3A0BZ 3P3PA 1OCZB 1N36B 4YHHB 1N34B 5LGUA 5IYZB 1BZKA 1TUBA 5LMNB 3ZHVA 5IJ0B 4F4LA 3TETA 4FIPC 2BOCC 2X7RB 1YHQV 3AG2B 4GZRB 4WBNA 1ZAUA 3H01A 4UVAA 2CGOA 5BY1A 4K3AA 5B1NA 1YJ9V 5FL7G 3AG1C 4GX1A 4DK0A 4H0LB 4AQYO 5IJ9B 3IC7A 4E4EA 2YIAA 2LQTA 1EZVH 1JR9A 3AG2C 3OFNG 1GKFA 3RYHA 2LGWA 1OHHG 4IHJA 1M9NA 4H33A 4K8XA 3WG7B 1PL4A 1NVPB 3BRCA 3UT5B 1K4DC 1XMQO 3DC6A 1OCZC 3ETEA 1ZUQA 2QM8A 1G1XB 2EJ7A 4D7TA 3RYCB 1K97A 1SQBH 4G27B 1P7GA 3JATB 3OMAB 4FLTA 4PI2A 1AI4A 3BA9A 4DV1O 3A0RA 1I0HA 3A0HZ 3CHXA 1NH2B 1B04A 2V1DA 1TVKA 4DUZB 2CH7A 3F7VC 4HNAB 5LL6Y 2ZXWB 4X88A 3Q4HA 1SQQH 5IY5C 4AQYB 4UCVA 3ZHRA 5HFLA 3K03A 3SYOA 2E75B 4O4HB 1VQ7V 2KG7B 3E86A 4JAVA 4JYCA 1Q3EA 4KP4A 4X1KB 4UB6Z 2IJIA 4UVBA 1NT2B 4KFMA 5AG2A 4MS2A 1IDSA 4U3JB 5JJEB 4LH7A 4PD4F 4ASUG 1Z5WA 1XNQO 2Q7GA 2Q67A 2QWPB 1G6UA 4MVRA 4DR1O 3TCUA 4PA7A 1V9PA 2EINC 1AR4A 2HKOA 5B3SC 4X20A 1VF6C 1NR7A 4O4JB 1XNRB 2M6YA 3IJ4A 4X62O 2PI5A 3JATA 3ZCCA 1VQ6V 4MT8A 4FVMA 4LF6B 3EFFK 3B4SA 1MG1A 2VQEO 4XDLA 3IC9A 3S3XA 1KD1W 1ENVA 3MHSC 4CZZA 4X1YB 4B7KA 3OT7A 2A7WA 2UXNA 2Q73A 3J81N 1JJOA 2KKWA 4PA9A 4D6TH 1PL0A 1I5YA 2UUAB 2JGDA 2UXXA 4FM2A 4G28B 4ZI7B 4IHJB 1ZWIC 1QU7A 2ZDIA 2YUAA 1S77D 4LH6A 2BSKB 3SDLA 2EZPA 2YI9A 3OW2U 3ETDA 2Y4TA 3K5OA 2GV9A 4I0XB 5IJ9A 4LF5B 1FFXA 3TXQA 3IAYA 1FXKA 4DV2B 2HVKC 2XAFA 4IIJA 3M8AA 2DWEC 3ZIAG 4KHPO 1NH2D 1XDCA 3TGUH 3SGIA 3OE7G 4BR6A 2BTQB 2QWNB 3UQ8A 1HNWB 3IFXA 5D5PA 5KX5A 1QNMA 5IWAB 4JV5B 5B66Z 2E5LB 2GUZB 1NKDA 3FB6C 5LOVB 4D7SA 1YITV 3CP1A 4WCEV 1XREA 3MD0A 1ZTEA 2Y48A 4P30A 2F4VO 3QVNA 2N05A 3ZRWA 5KMGA 3ZMSA 1SQPH 4UXNA 1VQ9V 2ZQMA 2OIEA 5EC2C 1HNWO 3SJQC 2ILMA 2Q68A 4DR3O 1RPOA 2ZR3A 2WAMA 3OR7C 1QR8A 1S5LZ 2QSAA 3A8TA 1AROP 1OCOC 3SJAC 1YCIA 3K79A 2PF4E 4OPHA 3ABUA 1I5XA 1IBKB 2YDEA 4X64O 3SR2C 2AGAA 4QNHB 5HFMA 4FLYA 1Q90D 4PDVA 2M7WA 3CRCA 1SQVH 2IJKA 5LP6C 3L9DA 4LNUB 4DR4B 1SS3A 2CE4A 4ZIBA 2HHHB 3JALB 3RFRA 3D3QA 1N33O 4LF7O 3VQXA 2OTLV 1WA8A 1QCEA 2OCCC 3DSQA 1VQMV 2AZ2A 2E3CA 2XTAA 3TXSA 4JYAO 1FXKC 1Y76B 2PZSA 1PKXA 3JCZA 4JYBA 3QTCA 1RSOA 1IVSA 3RGBA 4DV4O 4DR4O 5KA5A 4JI6O 1EBOA 4PELA 3JALA 3W7WA 1QQCA 4GKJB 2JJ2G 1QLEB 3OTFA 2LGQA 3AG4C 1I7FA 1GK9A 1GN4A 5CBHA 2UUBB 1IBKO 2F23A 1H2SB 4I55A 4J9ZB 4N23A 3BFRA 4X20B 2Y69B 3K06A 4HZ3A 3T1YO 2QWRB 1FD9A 3ZHQA 2YC0A 5KAIZ 2QWOB 3ETQA 3OGCC 5EYPB 1N32B 1AP6A 1BHBA 2ADQB 5ITZA 1DGSA 2UXDO 1X59A 5KLVH 1JX9A 4NTYA 1P49A 5E1AC 3JSNA 1F51A 2PGGA 5DECA 2Q4PA 2UUCB 1WJZA 4JI5B 4WFGA 4J7JA 2JEUA 1ZL8A 3ZMVA 5IT9N 4O4HA 3K3WA 2YIBA 1J95A 1E1RG 2E76B 3K04A 1MA1A 3OTOO 3JASA 4JI4O 3FKSG 1U96A 3I55V 2FL4A 2AZ0A 3QNEA 3D36C 4YIOA 3FYEB 4RQFA 2WLJA 4ZHQA 3CYOA 4GT1A 4DUYB 3RT3C 3ABTA 4GX5A 4LF8B 4J9YB 4TOIA 1BMFG 1MOFA 2H94A 1VQNV 2X6BA 5IJ0A 3W7TA 2QKCA 2R72A 2Q0OC 5B3SB 4PHZA 2K1EA 1Y4MA 1OCCC 3OR6C 2RCVA 2HR3A 3HKEB 1H38A 5EBWC 2EULA 5GW7A 1RFYA 2HG5C 4DV7B 1XEQA 3FYIB 4RQEA 4LF6O 2EZOA 1NBMG 2IBZH 1MSWD 3THOA 1OCOB 4JF3A 3WB1A 1SA0A 3L70H 3R66A 3ABMC 1AI7A 1D5NA 4NXMO 1SESA 3LDCA 4DR7B 3WG7C 4QE7A 3DC5A 3I56V 3JYCA 3W7XA 4OX9B 4YHHO 5K1XA 5IYBO 2YEVB 1AI6A 1HNZO 4XDKA 5E79Z 2EIMC 2WLLB 3RYFA 1OZ0A 4O4IA 2PUSA 3RVZA 4FPPA 2A0LA 1K34A 1QR9A 3CC4V 5GTIZ 4HBNA 1EFRG 4LF8O 1HP8A 3GWOA 3CCQV 5LP6B 3K9SA 2UU9B 1LNQA 3CXHF 1AJNA 2GTSA 4F6RA 3K9AA 4FLVA 2ZR2A 3CJHB 4TV9B 3JD0A 3QO5A 2F95B 2W6IG 4DRXA 2WA3A 3OMNB 3QO7A 5EIBC 4NXMB 1BGYH 5CA0B 3SPCA 2KSDA 4DR5B 1VQLV 2CH7B 4R7CA 4JTDB 3JARA 5FNVB 2O57A 3LNMB 4TQDA 3CCVV 3GB7C 1JPXA 4UCSA 1ZLZA 3KCXA 3FAVA 2YXLA 4AHCA 1FS0G 1VQPV 3ZRSA 2IH1C 2XT9A 4JI6B 4P2ZA 1B6QA 2JJ1G 5LHGA 4DV0O 1JJ2U 1HNZB 1N4CA 1VQ8V 3CRMA 1WLEA 5J2UB 2OTJV 3BPZA 5GTHZ 4B3SO 3T4DA 2IM9A 4LFCO 2B9ZA 3H1LH 4BIUA 1W2BU 1I94B 2P4VA 2WLNA 3ZHTA 1SERA 2ADPA 1UJWB 1TVKB 3NR7A 2EIKB 2OWOA 3HR0A 4U3JA 4JI4B 4DR3B 4C7UA 1WAZA 5H6QA 5LGNA 1RP3B 2Y0PA 5JJJB 3CJHA 3ZRVA 5KHKA 1HR0B 1GM9A 2EBOA 3BY6A 1SZXA 4OGQB 4PA6A 3OM3B 3OMIB 1FKAO 3CC2V 4PDLA 1M90W 4X64B 4B3SB 2QEXV 4PI0A 1AI5A 4X1KA 1PD3A 4X66O 3H1HH 4MTGA 4DR6O 4DR2B 1H2KA 1M1KW 3K0DA 3N2GB 2RN9A 3C3SA 5BMVB 4DO2A 1EM1A 3TK1A 4HNAA 3UT5A 5CA1A 1YXBA 3UO3A 2IJJA 3B2EE 1WA8B 2YEVA 3SPGA 3WB2A 1XI1A 4I4TB 1O9HA 2NNUA 1N0NA 1NI8A 4DYLA 1ZSPA 2LW7A 3KKYA 2X6AA 2VQFB 3S3WA 1PNKA 3JAMN 4MVZA 1R6NA 4QPKA 4EFEA 3QF7A 2Y0IA 2JGDB 2Z5UA 3HKEA 5C8YA 2N04A 4Z1MG 1GM8A 1MNGA 1G4YB 4JV5O 2Q8VA 1KKDA 1NTMH 1YJNV 1GN6A 1AJQA 2JS5A 3N2KB 3FFQA 1NJIW 4MTFA 5LYJB 3LSQA 4DV3B 5CBFA 1OJHA 5JCOC 2XHBA 3T1HO 2F66C 5KUMA 1VQKV 4X9QA 3CSXA 2JRIA 3WB0A 1SZTA 4JI1B 5B5EZ 1L0LH 4J80A 4JZ2A 4CS2A 2PY5A 2UXDB 1XL6A 1S76D 4YY3O 4FM0A 1P7BA 5CA1B 2V7QG 4RWUA 1M57B 3ZHUA 5L3BA 1JA8A 2ZNIA 1KUQA 4JTCB 4JI0B 4I5SA 4W4KA 5KHIA 5BR8B 2YI8A 5LYJA 2YICA 3C90A 2GUZA 3L72H 1L0NH 3NXSA 4J7ZA 2JEXA 4EKWA 1AR5A 4YJ3A 3JD2A 3H1JH 3R65A 3ABMB 5L3GA 1L1FA 2QKSA 4JI7B 3RN4A 5H5NA 2BTQA 2ZT9B 2P7TC 1Z5VA 3SYQA 1P84F 2DMXA 2XOKG 3VQWA 4EB6B 1VMGA 1K73W 1DK1A 3U11A 3W7UA 1PV0A 4ICGA 1FXKB 1ROPA 5B1AB 4WFBV 4EEQA 2QGNA 3QO8A 2EX3A 1YTFB 1M57C 3GWKC 5ITZB 1AVMA 3JAWA 5JQGB 3T1CA 1K92A 1KP2A 2GSMB 5BXZA 3ZJZA 1PNLA 1M93A 4QE9A 1GM7A 4TSFG 3G71V 5A2QN 2KQXA 5EBLC 2BTOA 4GYCB 4RAIA 4FFKA 3BAAA 4IGGA 3FB5C 3G6BA 1Y6XA 1N8RW 4DV1B 1WP7A 2WLHA 3JARB 5FNVA 1FXHA 3WFVA 2GDSA 2WLIA 4QJFB 2H8PC 2LW1A 3RVYA 4FLUA 4B3TO 3CMAV 2DYRC 2BOBC 3CC7V 5B1OA 2YXHA 4K0KB 2WSSG 1IURA 4J11A 3SYAA 3N2GA 2JS3A 5L3DA 2E74B 4FJCC 3K59A 2DYRB 2EJRA 3PN1A 1N0JA 4Q20A 4DRXB 1NQTA 1GMGA 4WBNB 2NR5A 1BQZA 2DW4A 2QTSA 2XUMA 1XMOO 1DLBA 3T4ZA 2PI4A 3UO2A 4LWSA 4EFBA 1T5EA 4LFAO 2A3QA 1BE3H 1XUQA 4TUYB 3RYFB 4KUMA 1GH6A 1HNXB 1NU1H 1MZFA 2CTWA 4CH6A 4ZKIA 2W0FC 5KHHA 3K58A 2P5OA 1JFFA 1JVMA 3H1IH 1Q7YW 4IYIA 4PV1B 3ZN1A 1Y67A 1M56B 4PA4A 3CWBH 4F6EA 3ZRXA 4I4TA 3H9VA 5JVDA 4JTAB 2NLJC 4B3RB 3P32A 5CB4B 3N27A 3CRAA 5KUKA 5IDJA 1EZJA 1YIJV 1KYOF 4J7KA 2H3OA 4UCUA 4RO2A 2WLLA 3CCJV 4I9QA 2A9HA 3APOA 2OT5A 1VQ4V 3JCUZ 3AG3B 4JI0O 4O2AA 2ODMA 4JZGA 1XHZA 2IH3C 4LFAB 1AILA 4MW3A 2HJDA 1AP5A 1YZBA 2OCHA 3VOUA 1NZ6A 3CCRV 3B09A 3P30A 1M4UA 1J5EB 1OV9A 3OD4A 5H9CA 2MW2B 5BZBA 4CC6A 1QVFU 2OYQA 2VQFO 5B1AC 1IBMB 4MVMA 3FX7A 4O2AB 3CRRA 3RYIB 2RMKB 3E89A 4FFBA 4YIPA 5IYDO 5IYZA 3JD3A 3M7MX 2WLKA 2ZIMA 3I5DA 2DWDC 4OPAA 3E35A 4O4IB 3EVKA 1MSDA 3A2FA 4B3MO 3STLC 4TT3G 3FAVB 4TV8B 2GBOA 3EXAA 4R50A 4XDJA 5LXTB 4X66B 4ZHQB 1BCCH 1IX9A 3M99B 2WA4A 1NVPD 1XBLA 1R1BA 3B77A 2LFRA 1OCRB 3BCCH 1SA0B 3CCUV 3OEHG 2PTMA 3K08A 1VARA 2W0XA 4I50A 3L73H 4I9WA 2VWKA 4K8ZA 1YSCA 5GONB 2Y69C 4I7ZB 3SJCC 4WFAV 1XNRO 4JASA 3MDSA 4JAUA 3E8GA 4GKKB 4JI2B 1PP9H 1Z2GA 4LF5O 1VEWA 2HLDG 4WFHA 4QGPA 4JAAA 1N33B 4BW9A 4IIJB 1D2DA 1GN2A 5LGTA 1D5AA 1FFXB 3ASNB 4WFFA 4KL1A 4RUEA 1DTOA 2L6LA 1Q82W 3O65A 2EIKC 1Q43A 4I50B 1EN6A 1W59A 4H13B 2Q0AA 4KXRA 1Q5OA 4QIWF 2X0LA 2XAHA 4FLZA 3MAQA 3LDEA 4BIOA 3LSUA 1IBLO 3LDDA 4W4LA 1R3IC 2WLIB 2CGNA 2ATKC 2VQEB 1VF6A 3LSSA 5LXTA 2A06H 4DV5O 1HW7A 1AJPA 3RYCA 4GLXA 4F6RB 4UUJC 2HVJC 1NTKH 3AK1A 1KMIZ 2IJHA 1CPYA 2VWJA 4JPRA 2XAGA 4AI8A 1SKVA 2V4DA 5C8YB 5LA6A 1VF7A 1GRJA 3FB8C 3SPIA 4G2KA 3E22A 5JCOA 1NS1A 5CA0A 2YIBD 1M56C 4YJ2A 5KMGB 2FYUH 5JWPA 3AK2A 1S0VA 4EB6A 1PNMA 2F4VB 5H6RA 1E79G 2CAZC 1H2NA 3AG1B 3TJTA 1KP3A 1BSMA 3O9OA 1URFA 2F43G 1US6A 2R70A 3HPLC 4BWAA 4MW8A 1SETA 4GCZA 2F93B 3J80N 2E5LO 2P06A 2YSUB 1H2LA 2QDOA 1S72V 2HJFC 4O4LA 3CD6V 1RSOB 3JAKA 1F4NA 1FPOA 1IZ3A 3RYIA 3KG2A 2PYLA 2YS8A 3OAAG 5JVDB 1R3LC 5LMUO 2QWQB 3AG3C 3F5TA 4IYHA 4DV2O 1QLEC 1BHAA 2UXCO 2YXYA 1RM1C 1LUWA 1K33A 4ZI7A 2FB5A 4DW0A 1AR1B 4NTXA 1YTFD 4YJ2B 2VRZA 5J2TA 3JAKB 4X65O 5FLXN 2WPDG 4N21A 4LF9B 1NR1A 2VS0A 3D3IA 1S5JA 5B1BC 3ABKC 4WF9V 2Z3YA 5DEDA 2FTKA 1GAXA 3ZHSA 4DV0B 3BABA 3WU2Z 2Q5ZA 4NVPA 5IE9A 2WLMA 2ZE8A 2ZE6A 4P9OA 2EIMB 2PYJA 3OEEG 1R3KC 3ABKB 4JYAB 2BE3A 2DQ0A 5EBMC 4UCOA 4JI2O 1Q6UA 1LR1A 1M5IA 2LO1A 4DW1A 1SC5B 4O4JA 4NKGB 4FLXA 4JI3B 3T1HB 4JGSA 4DV6O 1HR0O 4NR1A 2K9PA 3G80A 4RUFA 4B3RO 1VIBA 1H2GA 1U97A 1IXBA 1SRYA 2ARHA 4H37A 4JI8O 4FMTA 2HP8A 2ITCC 1COWG 1LUVA 1FJGB 4Z1VA 2D3OW 5EK0A 2G38A 1ZL8B 5L3CA 1DF4A 5LP6A 2NN4A 1KC8W 1NTZH 3ZMUA 2ZE7A 3UCSC 1YDXA 4L8JA 5BR8O 3X2QC 2B5UA 3IGAC 2Z0AA 2RNBA 4O2BB 4LR3A 1Q8IA 3MHHC 2X6CA 1GO3F 5LA6B 3PJSK 4H44B 4DUZO 4NB5A 1Y74B 1V54C 4B3TB 2ITDC 2AHYA 1CXZB 1WPXA 4UV8A 2RJZA 4JI5O 3CCEV 4DR6B 2AHZA 1FXVA 2JIZG 3CE2A 1UFIA 3CMEV 3L74H 1QLNA 3CPWU 2ZM6O 2DYSC 1PM9A 4PDMA 3JD4A 4LCUC 2QM4A 4YXWG 4MVSA 1WB8A 1Y76A 2HHHO 1RM1B 1SF9A 4YJ3B 5KAFZ 5TISZ 3JAWB 5JQGA 3F7YC 2ZD9A 1N34O 5J2TB 2XASA 1HDJA 1K8AW 2DOSA 2UU9O 1TAEA 1V54B 4Z2WA 1X4TA 3B40A 4IL6Z 1BT8A 4UFZA 5JH7A 4FM1A 1XOUA 1W0KG 3CRQA 2UUAO 3G4SV 1FYJA 1JOYA 4TV9A 3CEIA 1TUBB 1F7YA 2DJVA 3E8BA 4UVCA 3H1KH 3SYPA 3SYCA 5FPOA 1R3JC 3CB2A 5CB4A 1XL4A 2GHYA 4FK5C 4X1YA 1WB7A 2IU3A 4MVQA 3KCYA 2R9IA 1FAFA 5EZYB 1ORQC 3ML0A 3LNNA 1MABG 5DN6G 3VQVA 3VQYA 3HKBA 3KZIZ 1A32A 4U7OA 5KHJA 3K5NA 3CXCU 1R6KA 4UCTA 4P9PA 4I0XA 4CBCA 3RW0A 4X8AA 1CP9A 4PDRA 4K35A 5IY5B 2BSKA 3ZRWB 4FZ0A 5EYPA 3E22B 3F5WC 1XNQB 2XNDG 3QG5A 4L87A 1OCCB 2CUGA 3T2MA 2OIGA 3UM7A 2RDCA 3CX5F 2UXBB 4GUNA 2UXBO 2P22C 3JD1A 3OUFA 5EC1C 2AW9A 2CK3G 2CTQA 4JI1O 1SQFA 3FB7C 4HAMA 3K5LA 2Y4UA 1R73A 1R6TA 2FKXA 1H8HG 2DN9A 5CMUA 4OX9O 1VQOV 4ZOLA 4X1IB 3DTUB 4DV3O 3GVMA 4DV5B 4LFBB 1VQ5V 3U0ZA 1N32O 3STZC 5LBQA 4LF4B 1F4MA 4TQFA 1XQ8A 5F2VO 2AXTZ 3K0GA 1H8EG 2XAQA 3HKCB 3D8CA 3DXRA 2QE7G 1Q81W 4LWSB 1V55B 1JMKC 1K4CC 2BCCH 3ASNC 1ZX3A 2YIDA 3D36A 2DE0X 3SJBC 3ZS8C 4IT5A 3C3TA 4LF7B 3G67A 4PJ0Z 4BAYA 4XBFA 3ZBHA 4BIZA 3K57A 1MMMA 4R8CA 3X2QB 2DQ3A 1WNSA 1Y74A 3DXRB 2A79B 2LP7A 4DR2O 4DUYO 1QBZA 3ASOC 3ICXA 1AB3A 4GX0A 2ZXWC 1O9GA 4CS3A 3ZMZA 4NYKA 3SPJA 5L3FA 2Q6AA 5BMVA 4GKKO 3ABLC 5J9PC 1YEWA
chains in the Genus database with same CATH topology
4BIUA 3LDDA 1W2BU 1F23A 3ZMTA 1R3IC 2WLNA 1K5SA 1SERA 2WLIB 2ATKC 1UJWB 2PI5A 2EIKB 1YJWV 1TUEB 3ZCCA 1VQ6V 4MT8A 5H6QA 5LGNA 3ABLB 3LSSA 3ZRVA 3EFFK 1MG1A 4XDLA 4MVUA 1GM9A 1KD1W 3E8HA 2EBOA 1ENVA 3BY6A 2WWWA 3MHSC 4PA6A 1AJPA 3OM3B 3OMIB 3CC2V 4CZZA 4PDLA 1M90W 2EILC 4UUJC 2UXNA 2HVJC 2QTOA 3RBZA 2IJHA 1CPYA 2JDIG 3E8FA 2QEXV 1AI5A 1PD3A 1OCRC 4PA3A 1JCHA 4JPRA 2XAGA 4PA9A 4MTGA 1G8MA 3LUTB 1PL0A 1I5YA 1M1KW 3K0DA 4E2LA 2UXXA 4DO2A 3TK1A 1IXMA 1FFTB 3BEHA 3FB8C 4G28B 4MVOA 4G2KA 2LFSA 2IJJA 3SPIA 1ZWIC 4X89A 2YEVA 2ZDIA 3SPGA 1S77D 1M56C 1GTOA 2EZPA 3OW2U 2NNUA 3ETDA 2B1IA 2P67A 1S0VA 1PNMA 4WFEA 1FXKA 5H6RA 1E79G 2X6AA 1PNKA 3AG1B 1THZA 2HVKC 2XAFA 1KP3A 1R6NA 4MVZA 4QPKA 2F43G 3UKMA 2DWEC 3ZIAG 3HPLC 1NH2D 2Z5UA 4U7NA 4MW8A 3B8NA 1SETA 3OE7G 4GCZA 4Z1MG 1GM8A 3DGEA 1G4YB 1KKDA 2W6JG 2YSUB 1S72V 1S5HC 3IFXA 1YJNV 2HJFC 1AJQA 2C2AA 3CD6V 5B1BB 3E2EA 1NJIW 3HB3B 4MTFA 1F4NA 3LSQA 3KG2A 1NKDA 3FB6C 3OAAG 5CBFA 1YI2V 4MTXA 1YITV 3CP1A 4WCEV 3MD0A 1R3LC 2Y48A 3AG3C 5KUMA 4P30A 1VQKV 1QLEC 4LP8A 4GX2A 3ZRWA 1BHAA 1SZTA 3ZMSA 4UXNA 4DXWA 1VQ9V 2ZQMA 1RM1C 1K9MW 5EC2C 3E83A 1K33A 1XL6A 1S76D 1P7BA 2V7QG 1AR1B 1M57B 3SJQC 2Q68A 1YTFD 5L3BA 1RPOA 2Q69A 2ZR3A 2WAMA 3OR7C 1QR8A 2ZDIC 4JTCB 4I5SA 5CN0A 3W7SA 2MK3A 1AROP 1OCOC 2WPDG 3NXSA 2JEXA 3K79A 4EKWA 5L3EA 3ABUA 4N21A 3JD2A 1I5XA 1NR1A 3D3IA 3R65A 3ABMB 5B1BC 5HFMA 2JK5C 4QNHB 3ABKC 4WF9V 2Z3YA 5L3GA 2FTKA 4PDVA 2M7WA 4MSWC 2IJKA 4ZBMA 1L1FA 2QKSA 2R9RB 2EIJC 2P7TC 3SYQA 1V55C 4LC1A 2XOKG 2WLMA 4UV9A 1K73W 5C93A 2KB1A 5CBGA 3W7UA 4P9OA 1CEZA 1FXKB 1ROPA 2EIMB 5B1AB 3OEEG 1R3KC 3ABKB 2EIJB 4WFBV 2OTLV 1QCEA 2DQ0A 5EBMC 1P4RA 2OCCC 3QO8A 1VQMV 1JQ0A 1YTFB 1M57C 3T1CA 1K92A 5IYCO 1KP2A 2GSMB 3VBBA 2QA4V 1FXKC 3ZJZA 4JGSA 1DF5A 3ASOB 1PKXA 1PNLA 3JCZA 4QE9A 1GM7A 4JYBA 4TSFG 4RUFA 3G71V 1BL8A 5EBLC 1H2GA 5KA6A 5KA5A 1SRYA 1EBOA 4PELA 2QM7A 4H37A 3W7WA 1E1QG 4RAIA 4FMTA 2OCCB 2ITCC 1COWG 1W0JG 2JJ2G 1QLEB 3FB5C 2D3OW 3AG4C 5EK0A 3CCMV 1N8RW 5DM6V 1GK9A 4R6ZA 5CBHA 5L3CA 1DF4A 2WLHA 4J9ZB 3WFVA 1KC8W 1FXHA 4N23A 3B8MA 2WLIA 4QJFB 2H8PC 3ZMUA 3RVYA 2Y69B 1KQSU 3K06A 4HZ3A 3X2QC 3CMAV 2B5UA 2DYRC 2BOBC 3IGAC 2EINB 3CC7V 5B1OA 3OGCC 3CCSV 3ZN0A 2WSSG 1BHBA 3MHHC 2X6CA 1GO3F 3AG4B 3PJSK 3SYAA 1Y66A 5L3DA 2B1GA 1JX9A 5LHIA 1V54C 4FJCC 3ETGA 2ITDC 2DYRB 2AHYA 5E1AC 1K3EA 4OXSA 1WPXA 2EJRA 4UV8A 1S3JA 3CCEV 1F51A 2AHZA 1FXVA 4Q20A 1K5QA 2JIZG 2P6JA 1NQTA 1GMGA 3EHBB 4WFGA 5LHHA 2DW4A 3OUSA 4TWKA 4HYOA 1DLBA 3T4ZA 2PI4A 2JEUA 3CMEV 1QVGU 1QLNA 3ZMVA 3CPWU 1K7DA 2P90A 2DYSC 1RPRA 4PDMA 3JD4A 4LCUC 3K3WA 4YXWG 4MVSA 1J95A 1E1RG 3K04A 4KUMA 1RM1B 4LBEC 3SPHA 2IU0A 3FKSG 4BW5A 1HWYA 4QPJA 5CA3A 4ZKIA 3I55V 2W0FC 3F7YC 2ZD9A 3G6EV 2DYSB 2XAJA 1KECA 1JVMA 3QNEA 1Q7YW 2XASA 1K8AW 3ZN1A 3FYEB 4RQFA 2WLJA 1V54B 1M56B 3CYOA 4PA4A 4GT1A 2EILB 3ABTA 4GX5A 3ZRXA 4J9YB 1Q86W 1BMFG 2IW5A 4MTOA 1MOFA 3AEIA 4JTAB 2H94A 1W0KG 3G4SV 1JOYA 1VQNV 2X6BA 3W7TA 2NLJC 2HFEC 3CCLV 3P32A 5B3SB 5KUKA 2K1EA 3E8BA 4UVCA 1Y4MA 1OCCC 1OCZB 3OR6C 3SYPA 5IDJA 3SYCA 1EZJA 1YIJV 1R3JC 2HR3A 1H38A 5LGUA 4RO2A 2WLLA 5EBWC 5GW7A 3CCJV 1XL4A 2HG5C 2GHYA 4F4LA 2A9HA 3FYIB 4RQEA 3TETA 4FK5C 2OT5A 2IU3A 1VQ4V 2EZOA 4FIPC 4MVQA 2BOCC 1NBMG 2R9IA 2X7RB 3AG3B 1YHQV 1MSWD 1OCOB 1ORQC 3AG2B 3ML0A 4JF3A 2IH3C 1MABG 3H01A 4UVAA 4MW3A 5DN6G 3ABMC 5B1NA 1AI7A 3VOUA 1YJ9V 4GX1A 3AG1C 5FL7G 4U7OA 1SESA 3CCRV 3IC7A 3LDCA 3CXCU 1R6KA 3P30A 3WG7C 4QE7A 4P9PA 3I56V 3JYCA 3W7XA 3AG2C 4CBCA 3RW0A 4X8AA 1CP9A 1GKFA 3OFNG 4PDRA 5H9CA 5IYBO 5IY5B 2YEVB 5BZBA 1AI6A 1QVFU 1OHHG 3ZRWB 4XDKA 1M9NA 2EIMC 5B1AC 2WLLB 1OZ0A 4MVMA 3F5WC 4H33A 3WG7B 3E89A 1NVPB 1K4DC 2XNDG 3RVZA 2A0LA 1K34A 4FPPA 4L87A 3JD3A 1QR9A 1OCZC 1OCCB 5IYDO 3CC4V 2WLKA 3ETEA 2QM8A 3T2MA 3UM7A 1EFRG 2DWDC 1K97A 3GWOA 3E35A 3CCQV 3JD1A 1LNQA 3OUFA 3STLC 4G27B 5EC1C 1AJNA 4TT3G 2CK3G 3K9AA 3FB7C 4HAMA 3OMAB 2ZR2A 4R50A 4XDJA 1AI4A 3JD0A 3QO5A 1R73A 3M99B 3A0RA 1H8HG 1NVPD 5CMUA 2W6IG 1VQOV 3B77A 3OMNB 1NH2B 2V1DA 3QO7A 3DTUB 2LFRA 1OCRB 3F7VC 2ZXWB 4X88A 3CCUV 3OEHG 5IY5C 3K08A 1VQ5V 5HFLA 3K03A 3STZC 3SYOA 3SPCA 5LBQA 1F4MA 4I9WA 1VQLV 1YSCA 4R7CA 2Y69C 4JTDB 3K0GA 1VQ7V 1H8EG 4WFAV 2XAQA 3E86A 4JAVA 2QE7G 1Q81W 4JASA 4JYCA 4JAUA 3LNMB 3CCVV 1V55B 1K4CC 3GB7C 3E8GA 3ASNC 4KP4A 1JPXA 3D36A 2HLDG 4WFHA 4UVBA 2IJIA 4KFMA 4MS2A 1FS0G 1VQPV 3ZRSA 2IH1C 5LGTA 4ASUG 4P2ZA 4XBFA 4BIZA 4BAYA 1B6QA 3ASNB 4WFFA 2JJ1G 4R8CA 1DTOA 4RUEA 3X2QB 2DQ3A 1Q82W 5LHGA 2EIKC 2Q67A 4MVRA 2A79B 2LP7A 1JJ2U 3TCUA 1QBZA 3ASOC 4PA7A 1VQ8V 4GX0A 2ZXWC 1WLEA 3ZMZA 4QIWF 2EINC 2HKOA 2X0LA 3SPJA 2XAHA 5L3FA 2OTJV 2Q6AA 3LDEA 3ABLC 3T4DA 5J9PC 5B3SC 1NR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R W;  5DM6 V;  1VQ5 V;  3CCJ V;  1W2B U;  2QEX V;  1Q86 W;  2QA4 V;  1QVF U;  1VQL V;  1KC8 W;  1YI2 V;  1VQ4 V;  3CCE V;  1VQ7 V;  1YHQ V;  4WFA V;  1YIT V;  1YJW V;  3G4S V;  3G71 V;  4WCE V;  1Q82 W;  1M1K W;  1KQS U;  1VQ6 V;  3I55 V;  1VQN V;  1R73 A;  2D3O W;  1Q81 W;  1K73 W;  3CCL V;  3CCV V;  3G6E V;  1VQK V;  1JJ2 U;  3CMA V;  3CC4 V;  3CC7 V;  1VQO V;  3CCS V;  1YJ9 V;  1VQ8 V;  1KD1 W;  1Q7Y W;  3CCR V;  1VQ9 V;  4WFB V;  3CXC U;  3CME V;  1K8A W;  2OTL V;  3CC2 V;  2OTJ V;  1S72 V;  1YIJ V;  1QVG U;  4WF9 V;  3CCU V;  1YJN V;  1K9M W;  1M90 W;  1VQM V;  1VQP V;  3CPW U;  3CCQ V;  3CD6 V;  3OW2 U;  3I56 V;  1NJI W;  3CCM V; 
#chains in the Genus database with same CATH topology
 5H2F Z;  2CTP A;  2FML A;  1F23 A;  2ZIN A;  3ZMT A;  5K1P A;  1K5S A;  1KKC A;  1YJW V;  1TUE B;  4LF4 O;  3ABL B;  1WP8 A;  2RQ6 A;  4MVU A;  4DV7 O;  3E8H A;  3L71 H;  1I94 O;  2WWW A;  1SQX H;  1XIL A;  5LOV A;  4LFC B;  2UXC B;  4CS4 A;  2EIL C;  1N36 O;  2QTO A;  1KB9 F;  1VP7 A;  3OGI B;  3RBZ A;  1I08 A;  2JDI G;  3E8F A;  1OCR C;  4O4L B;  4PA3 A;  1JCH A;  3AG7 A;  1G8M A;  2P4K A;  3LUT B;  4CH5 A;  1TGO A;  4E2L A;  2KG7 A;  4FFB B;  1IXM A;  1FFT B;  3BEH A;  3BHP A;  5KHG A;  3AK3 A;  4MVO A;  2LFS A;  5GON A;  4DK1 A;  4X89 A;  2QJ1 A;  4B7E A;  1GTO A;  1B3Q A;  4CH4 A;  3RYH B;  2B1I A;  2P67 A;  4TV8 A;  4WFE A;  2CTR A;  1THZ A;  1JFF B;  3UKM A;  4CH3 A;  1SQG A;  1HNX O;  4J42 A;  4U7N A;  5A9G A;  4B3M B;  3B8N A;  1J5E O;  4LNU A;  3DGE A;  1FJG O;  4Q6G A;  2W6J G;  5IWA O;  2ZM6 B;  1S5H C;  2C2A A;  3E2E A;  5B1B B;  2ZIO A;  3HB3 B;  3CS5 A;  1B06 A;  4FZ1 A;  1YI2 V;  2UUC O;  4MTX A;  3ZED A;  4JI3 O;  5JJN B;  1XHX A;  4GX2 A;  2JVD A;  4LP8 A;  4FLW A;  4DXW A;  5D5Q A;  1WN7 A;  1K9M W;  3HKB B;  3E83 A;  3JSL A;  2Q69 A;  1L8D A;  5EZY A;  2ZDI C;  5CN0 A;  4KHP B;  3W7S A;  2MK3 A;  5EIB D;  2Q7H A;  1EN5 A;  5L3E A;  5LMN O;  2UUB O;  1TA8 A;  2JGU A;  2ZNJ A;  2JK5 C;  3FD9 A;  3J7A U;  4ABM A;  5KX5 B;  4MSW C;  2ETN A;  4ZBM A;  1KU9 A;  4DR7 O;  2R9R B;  2EIJ C;  1V55 C;  4LC1 A;  1PPJ H;  1GN3 A;  1WPB A;  1BQ0 A;  4UV9 A;  5C93 A;  2KB1 A;  5CBG A;  4X62 B;  4UB8 Z;  1CEZ A;  2CDY A;  1IBL B;  2EIJ B;  1BS3 A;  2QR4 A;  1KBH A;  2L35 A;  1P4R A;  4O2B A;  2Q7E A;  1JQ0 A;  4AIL C;  3BA8 A;  2GTA A;  3Q4H B;  5IYC O;  2QA4 V;  3VBB A;  1UPG A;  4TUY A;  4DR1 B;  1DF5 A;  3ASO B;  2HEP A;  4DR5 O;  1BL8 A;  3OTO B;  4J10 A;  5KA6 A;  3HKD B;  4LFB O;  3ZX6 A;  2QM7 A;  1E1Q G;  4I55 B;  4NXN B;  2OCC B;  4K0K O;  1W0J G;  1Q6H A;  1XMO B;  2Q9L A;  3CCM V;  2F1M A;  5DM6 V;  3K5M A;  4R6Z A;  4U3F H;  3RWR D;  3HKC A;  5JH7 B;  4A5U B;  3B8M A;  2LJ2 A;  4UCR A;  1KQS U;  1MZE A;  1QHT A;  3BVO A;  4J41 A;  5FPR A;  2EIN B;  3CCS V;  3ZN0 A;  2QKA A;  4YY3 B;  1YF2 A;  4JI8 B;  3AG4 B;  1XMQ B;  2R9A A;  1Y66 A;  2D2C B;  1VF5 B;  2B1G A;  5LHI A;  2N74 A;  4NTW A;  3ETG A;  2ZCE A;  3JAS B;  1K3E A;  4OXS A;  1S3J A;  5LMU B;  1K5Q A;  4ZOL B;  2P6J A;  3EHB B;  3APQ A;  5LHH A;  3OUS A;  4TWK A;  4HYO A;  4GKJ O;  3HKD A;  1QVG U;  2ZE5 A;  4NXN O;  1Q6I A;  1K7D A;  2P90 A;  4B08 A;  1RPR A;  1H2M A;  3N2K A;  4LBE C;  3P3N A;  2ZKO A;  3SPH A;  2IU0 A;  4BW5 A;  1HWY A;  4QPJ A;  5CA3 A;  4DV6 B;  3T1Y B;  1EN4 A;  3G6E V;  2DYS B;  5J2U A;  2XAJ A;  1KEC A;  4X1I A;  4JYY A;  1YVW A;  4CC5 A;  4LF9 O;  2EIL B;  1Q86 W;  4X65 B;  2IW5 A;  4MTO A;  3AEI A;  4DV4 B;  3L75 H;  2HFE C;  3CCL V;  3U10 A;  1IBM O;  4JI7 O;  3A0B Z;  3P3P A;  1OCZ B;  1N36 B;  4YHH B;  1N34 B;  5LGU A;  5IYZ B;  1BZK A;  1TUB A;  5LMN B;  3ZHV A;  5IJ0 B;  4F4L A;  3TET A;  4FIP C;  2BOC C;  2X7R B;  1YHQ V;  3AG2 B;  4GZR B;  4WBN A;  1ZAU A;  3H01 A;  4UVA A;  2CGO A;  5BY1 A;  4K3A A;  5B1N A;  1YJ9 V;  5FL7 G;  3AG1 C;  4GX1 A;  4DK0 A;  4H0L B;  4AQY O;  5IJ9 B;  3IC7 A;  4E4E A;  2YIA A;  2LQT A;  1EZV H;  1JR9 A;  3AG2 C;  3OFN G;  1GKF A;  3RYH A;  2LGW A;  1OHH G;  4IHJ A;  1M9N A;  4H33 A;  4K8X A;  3WG7 B;  1PL4 A;  1NVP B;  3BRC A;  3UT5 B;  1K4D C;  1XMQ O;  3DC6 A;  1OCZ C;  3ETE A;  1ZUQ A;  2QM8 A;  1G1X B;  2EJ7 A;  4D7T A;  3RYC B;  1K97 A;  1SQB H;  4G27 B;  1P7G A;  3JAT B;  3OMA B;  4FLT A;  4PI2 A;  1AI4 A;  3BA9 A;  4DV1 O;  3A0R A;  1I0H A;  3A0H Z;  3CHX A;  1NH2 B;  1B04 A;  2V1D A;  1TVK A;  4DUZ B;  2CH7 A;  3F7V C;  4HNA B;  5LL6 Y;  2ZXW B;  4X88 A;  3Q4H A;  1SQQ H;  5IY5 C;  4AQY B;  4UCV A;  3ZHR A;  5HFL A;  3K03 A;  3SYO A;  2E75 B;  4O4H B;  1VQ7 V;  2KG7 B;  3E86 A;  4JAV A;  4JYC A;  1Q3E A;  4KP4 A;  4X1K B;  4UB6 Z;  2IJI A;  4UVB A;  1NT2 B;  4KFM A;  5AG2 A;  4MS2 A;  1IDS A;  4U3J B;  5JJE B;  4LH7 A;  4PD4 F;  4ASU G;  1Z5W A;  1XNQ O;  2Q7G A;  2Q67 A;  2QWP B;  1G6U A;  4MVR A;  4DR1 O;  3TCU A;  4PA7 A;  1V9P A;  2EIN C;  1AR4 A;  2HKO A;  5B3S C;  4X20 A;  1VF6 C;  1NR7 A;  4O4J B;  1XNR B;  2M6Y A;  3IJ4 A;  4X62 O;  2PI5 A;  3JAT A;  3ZCC A;  1VQ6 V;  4MT8 A;  4FVM A;  4LF6 B;  3EFF K;  3B4S A;  1MG1 A;  2VQE O;  4XDL A;  3IC9 A;  3S3X A;  1KD1 W;  1ENV A;  3MHS C;  4CZZ A;  4X1Y B;  4B7K A;  3OT7 A;  2A7W A;  2UXN A;  2Q73 A;  3J81 N;  1JJO A;  2KKW A;  4PA9 A;  4D6T H;  1PL0 A;  1I5Y A;  2UUA B;  2JGD A;  2UXX A;  4FM2 A;  4G28 B;  4ZI7 B;  4IHJ B;  1ZWI C;  1QU7 A;  2ZDI A;  2YUA A;  1S77 D;  4LH6 A;  2BSK B;  3SDL A;  2EZP A;  2YI9 A;  3OW2 U;  3ETD A;  2Y4T A;  3K5O A;  2GV9 A;  4I0X B;  5IJ9 A;  4LF5 B;  1FFX A;  3TXQ A;  3IAY A;  1FXK A;  4DV2 B;  2HVK C;  2XAF A;  4IIJ A;  3M8A A;  2DWE C;  3ZIA G;  4KHP O;  1NH2 D;  1XDC A;  3TGU H;  3SGI A;  3OE7 G;  4BR6 A;  2BTQ B;  2QWN B;  3UQ8 A;  1HNW B;  3IFX A;  5D5P A;  5KX5 A;  1QNM A;  5IWA B;  4JV5 B;  5B66 Z;  2E5L B;  2GUZ B;  1NKD A;  3FB6 C;  5LOV B;  4D7S A;  1YIT V;  3CP1 A;  4WCE V;  1XRE A;  3MD0 A;  1ZTE A;  2Y48 A;  4P30 A;  2F4V O;  3QVN A;  2N05 A;  3ZRW A;  5KMG A;  3ZMS A;  1SQP H;  4UXN A;  1VQ9 V;  2ZQM A;  2OIE A;  5EC2 C;  1HNW O;  3SJQ C;  2ILM A;  2Q68 A;  4DR3 O;  1RPO A;  2ZR3 A;  2WAM A;  3OR7 C;  1QR8 A;  1S5L Z;  2QSA A;  3A8T A;  1ARO P;  1OCO C;  3SJA C;  1YCI A;  3K79 A;  2PF4 E;  4OPH A;  3ABU A;  1I5X A;  1IBK B;  2YDE A;  4X64 O;  3SR2 C;  2AGA A;  4QNH B;  5HFM A;  4FLY A;  1Q90 D;  4PDV A;  2M7W A;  3CRC A;  1SQV H;  2IJK A;  5LP6 C;  3L9D A;  4LNU B;  4DR4 B;  1SS3 A;  2CE4 A;  4ZIB A;  2HHH B;  3JAL B;  3RFR A;  3D3Q A;  1N33 O;  4LF7 O;  3VQX A;  2OTL V;  1WA8 A;  1QCE A;  2OCC C;  3DSQ A;  1VQM V;  2AZ2 A;  2E3C A;  2XTA A;  3TXS A;  4JYA O;  1FXK C;  1Y76 B;  2PZS A;  1PKX A;  3JCZ A;  4JYB A;  3QTC A;  1RSO A;  1IVS A;  3RGB A;  4DV4 O;  4DR4 O;  5KA5 A;  4JI6 O;  1EBO A;  4PEL A;  3JAL A;  3W7W A;  1QQC A;  4GKJ B;  2JJ2 G;  1QLE B;  3OTF A;  2LGQ A;  3AG4 C;  1I7F A;  1GK9 A;  1GN4 A;  5CBH A;  2UUB B;  1IBK O;  2F23 A;  1H2S B;  4I55 A;  4J9Z B;  4N23 A;  3BFR A;  4X20 B;  2Y69 B;  3K06 A;  4HZ3 A;  3T1Y O;  2QWR B;  1FD9 A;  3ZHQ A;  2YC0 A;  5KAI Z;  2QWO B;  3ETQ A;  3OGC C;  5EYP B;  1N32 B;  1AP6 A;  1BHB A;  2ADQ B;  5ITZ A;  1DGS A;  2UXD O;  1X59 A;  5KLV H;  1JX9 A;  4NTY A;  1P49 A;  5E1A C;  3JSN A;  1F51 A;  2PGG A;  5DEC A;  2Q4P A;  2UUC B;  1WJZ A;  4JI5 B;  4WFG A;  4J7J A;  2JEU A;  1ZL8 A;  3ZMV A;  5IT9 N;  4O4H A;  3K3W A;  2YIB A;  1J95 A;  1E1R G;  2E76 B;  3K04 A;  1MA1 A;  3OTO O;  3JAS A;  4JI4 O;  3FKS G;  1U96 A;  3I55 V;  2FL4 A;  2AZ0 A;  3QNE A;  3D36 C;  4YIO A;  3FYE B;  4RQF A;  2WLJ A;  4ZHQ A;  3CYO A;  4GT1 A;  4DUY B;  3RT3 C;  3ABT A;  4GX5 A;  4LF8 B;  4J9Y B;  4TOI A;  1BMF G;  1MOF A;  2H94 A;  1VQN V;  2X6B A;  5IJ0 A;  3W7T A;  2QKC A;  2R72 A;  2Q0O C;  5B3S B;  4PHZ A;  2K1E A;  1Y4M A;  1OCC C;  3OR6 C;  2RCV A;  2HR3 A;  3HKE B;  1H38 A;  5EBW C;  2EUL A;  5GW7 A;  1RFY A;  2HG5 C;  4DV7 B;  1XEQ A;  3FYI B;  4RQE A;  4LF6 O;  2EZO A;  1NBM G;  2IBZ H;  1MSW D;  3THO A;  1OCO B;  4JF3 A;  3WB1 A;  1SA0 A;  3L70 H;  3R66 A;  3ABM C;  1AI7 A;  1D5N A;  4NXM O;  1SES A;  3LDC A;  4DR7 B;  3WG7 C;  4QE7 A;  3DC5 A;  3I56 V;  3JYC A;  3W7X A;  4OX9 B;  4YHH O;  5K1X A;  5IYB O;  2YEV B;  1AI6 A;  1HNZ O;  4XDK A;  5E79 Z;  2EIM C;  2WLL B;  3RYF A;  1OZ0 A;  4O4I A;  2PUS A;  3RVZ A;  4FPP A;  2A0L A;  1K34 A;  1QR9 A;  3CC4 V;  5GTI Z;  4HBN A;  1EFR G;  4LF8 O;  1HP8 A;  3GWO A;  3CCQ V;  5LP6 B;  3K9S A;  2UU9 B;  1LNQ A;  3CXH F;  1AJN A;  2GTS A;  4F6R A;  3K9A A;  4FLV A;  2ZR2 A;  3CJH B;  4TV9 B;  3JD0 A;  3QO5 A;  2F95 B;  2W6I G;  4DRX A;  2WA3 A;  3OMN B;  3QO7 A;  5EIB C;  4NXM B;  1BGY H;  5CA0 B;  3SPC A;  2KSD A;  4DR5 B;  1VQL V;  2CH7 B;  4R7C A;  4JTD B;  3JAR A;  5FNV B;  2O57 A;  3LNM B;  4TQD A;  3CCV V;  3GB7 C;  1JPX A;  4UCS A;  1ZLZ A;  3KCX A;  3FAV A;  2YXL A;  4AHC A;  1FS0 G;  1VQP V;  3ZRS A;  2IH1 C;  2XT9 A;  4JI6 B;  4P2Z A;  1B6Q A;  2JJ1 G;  5LHG A;  4DV0 O;  1JJ2 U;  1HNZ B;  1N4C A;  1VQ8 V;  3CRM A;  1WLE A;  5J2U B;  2OTJ V;  3BPZ A;  5GTH Z;  4B3S O;  3T4D A;  2IM9 A;  4LFC O;  2B9Z A;  3H1L H;  4BIU A;  1W2B U;  1I94 B;  2P4V A;  2WLN A;  3ZHT A;  1SER A;  2ADP A;  1UJW B;  1TVK B;  3NR7 A;  2EIK B;  2OWO A;  3HR0 A;  4U3J A;  4JI4 B;  4DR3 B;  4C7U A;  1WAZ A;  5H6Q A;  5LGN A;  1RP3 B;  2Y0P A;  5JJJ B;  3CJH A;  3ZRV A;  5KHK A;  1HR0 B;  1GM9 A;  2EBO A;  3BY6 A;  1SZX A;  4OGQ B;  4PA6 A;  3OM3 B;  3OMI B;  1FKA O;  3CC2 V;  4PDL A;  1M90 W;  4X64 B;  4B3S B;  2QEX V;  4PI0 A;  1AI5 A;  4X1K A;  1PD3 A;  4X66 O;  3H1H H;  4MTG A;  4DR6 O;  4DR2 B;  1H2K A;  1M1K W;  3K0D A;  3N2G B;  2RN9 A;  3C3S A;  5BMV B;  4DO2 A;  1EM1 A;  3TK1 A;  4HNA A;  3UT5 A;  5CA1 A;  1YXB A;  3UO3 A;  2IJJ A;  3B2E E;  1WA8 B;  2YEV A;  3SPG A;  3WB2 A;  1XI1 A;  4I4T B;  1O9H A;  2NNU A;  1N0N A;  1NI8 A;  4DYL A;  1ZSP A;  2LW7 A;  3KKY A;  2X6A A;  2VQF B;  3S3W A;  1PNK A;  3JAM N;  4MVZ A;  1R6N A;  4QPK A;  4EFE A;  3QF7 A;  2Y0I A;  2JGD B;  2Z5U A;  3HKE A;  5C8Y A;  2N04 A;  4Z1M G;  1GM8 A;  1MNG A;  1G4Y B;  4JV5 O;  2Q8V A;  1KKD A;  1NTM H;  1YJN V;  1GN6 A;  1AJQ A;  2JS5 A;  3N2K B;  3FFQ A;  1NJI W;  4MTF A;  5LYJ B;  3LSQ A;  4DV3 B;  5CBF A;  1OJH A;  5JCO C;  2XHB A;  3T1H O;  2F66 C;  5KUM A;  1VQK V;  4X9Q A;  3CSX A;  2JRI A;  3WB0 A;  1SZT A;  4JI1 B;  5B5E Z;  1L0L H;  4J80 A;  4JZ2 A;  4CS2 A;  2PY5 A;  2UXD B;  1XL6 A;  1S76 D;  4YY3 O;  4FM0 A;  1P7B A;  5CA1 B;  2V7Q G;  4RWU A;  1M57 B;  3ZHU A;  5L3B A;  1JA8 A;  2ZNI A;  1KUQ A;  4JTC B;  4JI0 B;  4I5S A;  4W4K A;  5KHI A;  5BR8 B;  2YI8 A;  5LYJ A;  2YIC A;  3C90 A;  2GUZ A;  3L72 H;  1L0N H;  3NXS A;  4J7Z A;  2JEX A;  4EKW A;  1AR5 A;  4YJ3 A;  3JD2 A;  3H1J H;  3R65 A;  3ABM B;  5L3G A;  1L1F A;  2QKS A;  4JI7 B;  3RN4 A;  5H5N A;  2BTQ A;  2ZT9 B;  2P7T C;  1Z5V A;  3SYQ A;  1P84 F;  2DMX A;  2XOK G;  3VQW A;  4EB6 B;  1VMG A;  1K73 W;  1DK1 A;  3U11 A;  3W7U A;  1PV0 A;  4ICG A;  1FXK B;  1ROP A;  5B1A B;  4WFB V;  4EEQ A;  2QGN A;  3QO8 A;  2EX3 A;  1YTF B;  1M57 C;  3GWK C;  5ITZ B;  1AVM A;  3JAW A;  5JQG B;  3T1C A;  1K92 A;  1KP2 A;  2GSM B;  5BXZ A;  3ZJZ A;  1PNL A;  1M93 A;  4QE9 A;  1GM7 A;  4TSF G;  3G71 V;  5A2Q N;  2KQX A;  5EBL C;  2BTO A;  4GYC B;  4RAI A;  4FFK A;  3BAA A;  4IGG A;  3FB5 C;  3G6B A;  1Y6X A;  1N8R W;  4DV1 B;  1WP7 A;  2WLH A;  3JAR B;  5FNV A;  1FXH A;  3WFV A;  2GDS A;  2WLI A;  4QJF B;  2H8P C;  2LW1 A;  3RVY A;  4FLU A;  4B3T O;  3CMA V;  2DYR C;  2BOB C;  3CC7 V;  5B1O A;  2YXH A;  4K0K B;  2WSS G;  1IUR A;  4J11 A;  3SYA A;  3N2G A;  2JS3 A;  5L3D A;  2E74 B;  4FJC C;  3K59 A;  2DYR B;  2EJR A;  3PN1 A;  1N0J A;  4Q20 A;  4DRX B;  1NQT A;  1GMG A;  4WBN B;  2NR5 A;  1BQZ A;  2DW4 A;  2QTS A;  2XUM A;  1XMO O;  1DLB A;  3T4Z A;  2PI4 A;  3UO2 A;  4LWS A;  4EFB A;  1T5E A;  4LFA O;  2A3Q A;  1BE3 H;  1XUQ A;  4TUY B;  3RYF B;  4KUM A;  1GH6 A;  1HNX B;  1NU1 H;  1MZF A;  2CTW A;  4CH6 A;  4ZKI A;  2W0F C;  5KHH A;  3K58 A;  2P5O A;  1JFF A;  1JVM A;  3H1I H;  1Q7Y W;  4IYI A;  4PV1 B;  3ZN1 A;  1Y67 A;  1M56 B;  4PA4 A;  3CWB H;  4F6E A;  3ZRX A;  4I4T A;  3H9V A;  5JVD A;  4JTA B;  2NLJ C;  4B3R B;  3P32 A;  5CB4 B;  3N27 A;  3CRA A;  5KUK A;  5IDJ A;  1EZJ A;  1YIJ V;  1KYO F;  4J7K A;  2H3O A;  4UCU A;  4RO2 A;  2WLL A;  3CCJ V;  4I9Q A;  2A9H A;  3APO A;  2OT5 A;  1VQ4 V;  3JCU Z;  3AG3 B;  4JI0 O;  4O2A A;  2ODM A;  4JZG A;  1XHZ A;  2IH3 C;  4LFA B;  1AIL A;  4MW3 A;  2HJD A;  1AP5 A;  1YZB A;  2OCH A;  3VOU A;  1NZ6 A;  3CCR V;  3B09 A;  3P30 A;  1M4U A;  1J5E B;  1OV9 A;  3OD4 A;  5H9C A;  2MW2 B;  5BZB A;  4CC6 A;  1QVF U;  2OYQ A;  2VQF O;  5B1A C;  1IBM B;  4MVM A;  3FX7 A;  4O2A B;  3CRR A;  3RYI B;  2RMK B;  3E89 A;  4FFB A;  4YIP A;  5IYD O;  5IYZ A;  3JD3 A;  3M7M X;  2WLK A;  2ZIM A;  3I5D A;  2DWD C;  4OPA A;  3E35 A;  4O4I B;  3EVK A;  1MSD A;  3A2F A;  4B3M O;  3STL C;  4TT3 G;  3FAV B;  4TV8 B;  2GBO A;  3EXA A;  4R50 A;  4XDJ A;  5LXT B;  4X66 B;  4ZHQ B;  1BCC H;  1IX9 A;  3M99 B;  2WA4 A;  1NVP D;  1XBL A;  1R1B A;  3B77 A;  2LFR A;  1OCR B;  3BCC H;  1SA0 B;  3CCU V;  3OEH G;  2PTM A;  3K08 A;  1VAR A;  2W0X A;  4I50 A;  3L73 H;  4I9W A;  2VWK A;  4K8Z A;  1YSC A;  5GON B;  2Y69 C;  4I7Z B;  3SJC C;  4WFA V;  1XNR O;  4JAS A;  3MDS A;  4JAU A;  3E8G A;  4GKK B;  4JI2 B;  1PP9 H;  1Z2G A;  4LF5 O;  1VEW A;  2HLD G;  4WFH A;  4QGP A;  4JAA A;  1N33 B;  4BW9 A;  4IIJ B;  1D2D A;  1GN2 A;  5LGT A;  1D5A A;  1FFX B;  3ASN B;  4WFF A;  4KL1 A;  4RUE A;  1DTO A;  2L6L A;  1Q82 W;  3O65 A;  2EIK C;  1Q43 A;  4I50 B;  1EN6 A;  1W59 A;  4H13 B;  2Q0A A;  4KXR A;  1Q5O A;  4QIW F;  2X0L A;  2XAH A;  4FLZ A;  3MAQ A;  3LDE A;  4BIO A;  3LSU A;  1IBL O;  3LDD A;  4W4L A;  1R3I C;  2WLI B;  2CGN A;  2ATK C;  2VQE B;  1VF6 A;  3LSS A;  5LXT A;  2A06 H;  4DV5 O;  1HW7 A;  1AJP A;  3RYC A;  4GLX A;  4F6R B;  4UUJ C;  2HVJ C;  1NTK H;  3AK1 A;  1KMI Z;  2IJH A;  1CPY A;  2VWJ A;  4JPR A;  2XAG A;  4AI8 A;  1SKV A;  2V4D A;  5C8Y B;  5LA6 A;  1VF7 A;  1GRJ A;  3FB8 C;  3SPI A;  4G2K A;  3E22 A;  5JCO A;  1NS1 A;  5CA0 A;  2YIB D;  1M56 C;  4YJ2 A;  5KMG B;  2FYU H;  5JWP A;  3AK2 A;  1S0V A;  4EB6 A;  1PNM A;  2F4V B;  5H6R A;  1E79 G;  2CAZ C;  1H2N A;  3AG1 B;  3TJT A;  1KP3 A;  1BSM A;  3O9O A;  1URF A;  2F43 G;  1US6 A;  2R70 A;  3HPL C;  4BWA A;  4MW8 A;  1SET A;  4GCZ A;  2F93 B;  3J80 N;  2E5L O;  2P06 A;  2YSU B;  1H2L A;  2QDO A;  1S72 V;  2HJF C;  4O4L A;  3CD6 V;  1RSO B;  3JAK A;  1F4N A;  1FPO A;  1IZ3 A;  3RYI A;  3KG2 A;  2PYL A;  2YS8 A;  3OAA G;  5JVD B;  1R3L C;  5LMU O;  2QWQ B;  3AG3 C;  3F5T A;  4IYH A;  4DV2 O;  1QLE C;  1BHA A;  2UXC O;  2YXY A;  1RM1 C;  1LUW A;  1K33 A;  4ZI7 A;  2FB5 A;  4DW0 A;  1AR1 B;  4NTX A;  1YTF D;  4YJ2 B;  2VRZ A;  5J2T A;  3JAK B;  4X65 O;  5FLX N;  2WPD G;  4N21 A;  4LF9 B;  1NR1 A;  2VS0 A;  3D3I A;  1S5J A;  5B1B C;  3ABK C;  4WF9 V;  2Z3Y A;  5DED A;  2FTK A;  1GAX A;  3ZHS A;  4DV0 B;  3BAB A;  3WU2 Z;  2Q5Z A;  4NVP A;  5IE9 A;  2WLM A;  2ZE8 A;  2ZE6 A;  4P9O A;  2EIM B;  2PYJ A;  3OEE G;  1R3K C;  3ABK B;  4JYA B;  2BE3 A;  2DQ0 A;  5EBM C;  4UCO A;  4JI2 O;  1Q6U A;  1LR1 A;  1M5I A;  2LO1 A;  4DW1 A;  1SC5 B;  4O4J A;  4NKG B;  4FLX A;  4JI3 B;  3T1H B;  4JGS A;  4DV6 O;  1HR0 O;  4NR1 A;  2K9P A;  3G80 A;  4RUF A;  4B3R O;  1VIB A;  1H2G A;  1U97 A;  1IXB A;  1SRY A;  2ARH A;  4H37 A;  4JI8 O;  4FMT A;  2HP8 A;  2ITC C;  1COW G;  1LUV A;  1FJG B;  4Z1V A;  2D3O W;  5EK0 A;  2G38 A;  1ZL8 B;  5L3C A;  1DF4 A;  5LP6 A;  2NN4 A;  1KC8 W;  1NTZ H;  3ZMU A;  2ZE7 A;  3UCS C;  1YDX A;  4L8J A;  5BR8 O;  3X2Q C;  2B5U A;  3IGA C;  2Z0A A;  2RNB A;  4O2B B;  4LR3 A;  1Q8I A;  3MHH C;  2X6C A;  1GO3 F;  5LA6 B;  3PJS K;  4H44 B;  4DUZ O;  4NB5 A;  1Y74 B;  1V54 C;  4B3T B;  2ITD C;  2AHY A;  1CXZ B;  1WPX A;  4UV8 A;  2RJZ A;  4JI5 O;  3CCE V;  4DR6 B;  2AHZ A;  1FXV A;  2JIZ G;  3CE2 A;  1UFI A;  3CME V;  3L74 H;  1QLN A;  3CPW U;  2ZM6 O;  2DYS C;  1PM9 A;  4PDM A;  3JD4 A;  4LCU C;  2QM4 A;  4YXW G;  4MVS A;  1WB8 A;  1Y76 A;  2HHH O;  1RM1 B;  1SF9 A;  4YJ3 B;  5KAF Z;  5TIS Z;  3JAW B;  5JQG A;  3F7Y C;  2ZD9 A;  1N34 O;  5J2T B;  2XAS A;  1HDJ A;  1K8A W;  2DOS A;  2UU9 O;  1TAE A;  1V54 B;  4Z2W A;  1X4T A;  3B40 A;  4IL6 Z;  1BT8 A;  4UFZ A;  5JH7 A;  4FM1 A;  1XOU A;  1W0K G;  3CRQ A;  2UUA O;  3G4S V;  1FYJ A;  1JOY A;  4TV9 A;  3CEI A;  1TUB B;  1F7Y A;  2DJV A;  3E8B A;  4UVC A;  3H1K H;  3SYP A;  3SYC A;  5FPO A;  1R3J C;  3CB2 A;  5CB4 A;  1XL4 A;  2GHY A;  4FK5 C;  4X1Y A;  1WB7 A;  2IU3 A;  4MVQ A;  3KCY A;  2R9I A;  1FAF A;  5EZY B;  1ORQ C;  3ML0 A;  3LNN A;  1MAB G;  5DN6 G;  3VQV A;  3VQY A;  3HKB A;  3KZI Z;  1A32 A;  4U7O A;  5KHJ A;  3K5N A;  3CXC U;  1R6K A;  4UCT A;  4P9P A;  4I0X A;  4CBC A;  3RW0 A;  4X8A A;  1CP9 A;  4PDR A;  4K35 A;  5IY5 B;  2BSK A;  3ZRW B;  4FZ0 A;  5EYP A;  3E22 B;  3F5W C;  1XNQ B;  2XND G;  3QG5 A;  4L87 A;  1OCC B;  2CUG A;  3T2M A;  2OIG A;  3UM7 A;  2RDC A;  3CX5 F;  2UXB B;  4GUN A;  2UXB O;  2P22 C;  3JD1 A;  3OUF A;  5EC1 C;  2AW9 A;  2CK3 G;  2CTQ A;  4JI1 O;  1SQF A;  3FB7 C;  4HAM A;  3K5L A;  2Y4U A;  1R73 A;  1R6T A;  2FKX A;  1H8H G;  2DN9 A;  5CMU A;  4OX9 O;  1VQO V;  4ZOL A;  4X1I B;  3DTU B;  4DV3 O;  3GVM A;  4DV5 B;  4LFB B;  1VQ5 V;  3U0Z A;  1N32 O;  3STZ C;  5LBQ A;  4LF4 B;  1F4M A;  4TQF A;  1XQ8 A;  5F2V O;  2AXT Z;  3K0G A;  1H8E G;  2XAQ A;  3HKC B;  3D8C A;  3DXR A;  2QE7 G;  1Q81 W;  4LWS B;  1V55 B;  1JMK C;  1K4C C;  2BCC H;  3ASN C;  1ZX3 A;  2YID A;  3D36 A;  2DE0 X;  3SJB C;  3ZS8 C;  4IT5 A;  3C3T A;  4LF7 B;  3G67 A;  4PJ0 Z;  4BAY A;  4XBF A;  3ZBH A;  4BIZ A;  3K57 A;  1MMM A;  4R8C A;  3X2Q B;  2DQ3 A;  1WNS A;  1Y74 A;  3DXR B;  2A79 B;  2LP7 A;  4DR2 O;  4DUY O;  1QBZ A;  3ASO C;  3ICX A;  1AB3 A;  4GX0 A;  2ZXW C;  1O9G A;  4CS3 A;  3ZMZ A;  4NYK A;  3SPJ A;  5L3F A;  2Q6A A;  5BMV A;  4GKK O;  3ABL C;  5J9P C;  1YEW A; 
#chains in the Genus database with same CATH homology
 4BIU A;  3LDD A;  1W2B U;  1F23 A;  3ZMT A;  1R3I C;  2WLN A;  1K5S A;  1SER A;  2WLI B;  2ATK C;  1UJW B;  2PI5 A;  2EIK B;  1YJW V;  1TUE B;  3ZCC A;  1VQ6 V;  4MT8 A;  5H6Q A;  5LGN A;  3ABL B;  3LSS A;  3ZRV A;  3EFF K;  1MG1 A;  4XDL A;  4MVU A;  1GM9 A;  1KD1 W;  3E8H A;  2EBO A;  1ENV A;  3BY6 A;  2WWW A;  3MHS C;  4PA6 A;  1AJP A;  3OM3 B;  3OMI B;  3CC2 V;  4CZZ A;  4PDL A;  1M90 W;  2EIL C;  4UUJ C;  2UXN A;  2HVJ C;  2QTO A;  3RBZ A;  2IJH A;  1CPY A;  2JDI G;  3E8F A;  2QEX V;  1AI5 A;  1PD3 A;  1OCR C;  4PA3 A;  1JCH A;  4JPR A;  2XAG A;  4PA9 A;  4MTG A;  1G8M A;  3LUT B;  1PL0 A;  1I5Y A;  1M1K W;  3K0D A;  4E2L A;  2UXX A;  4DO2 A;  3TK1 A;  1IXM A;  1FFT B;  3BEH A;  3FB8 C;  4G28 B;  4MVO A;  4G2K A;  2LFS A;  2IJJ A;  3SPI A;  1ZWI C;  4X89 A;  2YEV A;  2ZDI A;  3SPG A;  1S77 D;  1M56 C;  1GTO A;  2EZP A;  3OW2 U;  2NNU A;  3ETD A;  2B1I A;  2P67 A;  1S0V A;  1PNM A;  4WFE A;  1FXK A;  5H6R A;  1E79 G;  2X6A A;  1PNK A;  3AG1 B;  1THZ A;  2HVK C;  2XAF A;  1KP3 A;  1R6N A;  4MVZ A;  4QPK A;  2F43 G;  3UKM A;  2DWE C;  3ZIA G;  3HPL C;  1NH2 D;  2Z5U A;  4U7N A;  4MW8 A;  3B8N A;  1SET A;  3OE7 G;  4GCZ A;  4Z1M G;  1GM8 A;  3DGE A;  1G4Y B;  1KKD A;  2W6J G;  2YSU B;  1S72 V;  1S5H C;  3IFX A;  1YJN V;  2HJF C;  1AJQ A;  2C2A A;  3CD6 V;  5B1B B;  3E2E A;  1NJI W;  3HB3 B;  4MTF A;  1F4N A;  3LSQ A;  3KG2 A;  1NKD A;  3FB6 C;  3OAA G;  5CBF A;  1YI2 V;  4MTX A;  1YIT V;  3CP1 A;  4WCE V;  3MD0 A;  1R3L C;  2Y48 A;  3AG3 C;  5KUM A;  4P30 A;  1VQK V;  1QLE C;  4LP8 A;  4GX2 A;  3ZRW A;  1BHA A;  1SZT A;  3ZMS A;  4UXN A;  4DXW A;  1VQ9 V;  2ZQM A;  1RM1 C;  1K9M W;  5EC2 C;  3E83 A;  1K33 A;  1XL6 A;  1S76 D;  1P7B A;  2V7Q G;  1AR1 B;  1M57 B;  3SJQ C;  2Q68 A;  1YTF D;  5L3B A;  1RPO A;  2Q69 A;  2ZR3 A;  2WAM A;  3OR7 C;  1QR8 A;  2ZDI C;  4JTC B;  4I5S A;  5CN0 A;  3W7S A;  2MK3 A;  1ARO P;  1OCO C;  2WPD G;  3NXS A;  2JEX A;  3K79 A;  4EKW A;  5L3E A;  3ABU A;  4N21 A;  3JD2 A;  1I5X A;  1NR1 A;  3D3I A;  3R65 A;  3ABM B;  5B1B C;  5HFM A;  2JK5 C;  4QNH B;  3ABK C;  4WF9 V;  2Z3Y A;  5L3G A;  2FTK A;  4PDV A;  2M7W A;  4MSW C;  2IJK A;  4ZBM A;  1L1F A;  2QKS A;  2R9R B;  2EIJ C;  2P7T C;  3SYQ A;  1V55 C;  4LC1 A;  2XOK G;  2WLM A;  4UV9 A;  1K73 W;  5C93 A;  2KB1 A;  5CBG A;  3W7U A;  4P9O A;  1CEZ A;  1FXK B;  1ROP A;  2EIM B;  5B1A B;  3OEE G;  1R3K C;  3ABK B;  2EIJ B;  4WFB V;  2OTL V;  1QCE A;  2DQ0 A;  5EBM C;  1P4R A;  2OCC C;  3QO8 A;  1VQM V;  1JQ0 A;  1YTF B;  1M57 C;  3T1C A;  1K92 A;  5IYC O;  1KP2 A;  2GSM B;  3VBB A;  2QA4 V;  1FXK C;  3ZJZ A;  4JGS A;  1DF5 A;  3ASO B;  1PKX A;  1PNL A;  3JCZ A;  4QE9 A;  1GM7 A;  4JYB A;  4TSF G;  4RUF A;  3G71 V;  1BL8 A;  5EBL C;  1H2G A;  5KA6 A;  5KA5 A;  1SRY A;  1EBO A;  4PEL A;  2QM7 A;  4H37 A;  3W7W A;  1E1Q G;  4RAI A;  4FMT A;  2OCC B;  2ITC C;  1COW G;  1W0J G;  2JJ2 G;  1QLE B;  3FB5 C;  2D3O W;  3AG4 C;  5EK0 A;  3CCM V;  1N8R W;  5DM6 V;  1GK9 A;  4R6Z A;  5CBH A;  5L3C A;  1DF4 A;  2WLH A;  4J9Z B;  3WFV A;  1KC8 W;  1FXH A;  4N23 A;  3B8M A;  2WLI A;  4QJF B;  2H8P C;  3ZMU A;  3RVY A;  2Y69 B;  1KQS U;  3K06 A;  4HZ3 A;  3X2Q C;  3CMA V;  2B5U A;  2DYR C;  2BOB C;  3IGA C;  2EIN B;  3CC7 V;  5B1O A;  3OGC C;  3CCS V;  3ZN0 A;  2WSS G;  1BHB A;  3MHH C;  2X6C A;  1GO3 F;  3AG4 B;  3PJS K;  3SYA A;  1Y66 A;  5L3D A;  2B1G A;  1JX9 A;  5LHI A;  1V54 C;  4FJC C;  3ETG A;  2ITD C;  2DYR B;  2AHY A;  5E1A C;  1K3E A;  4OXS A;  1WPX A;  2EJR A;  4UV8 A;  1S3J A;  3CCE V;  1F51 A;  2AHZ A;  1FXV A;  4Q20 A;  1K5Q A;  2JIZ G;  2P6J A;  1NQT A;  1GMG A;  3EHB B;  4WFG A;  5LHH A;  2DW4 A;  3OUS A;  4TWK A;  4HYO A;  1DLB A;  3T4Z A;  2PI4 A;  2JEU A;  3CME V;  1QVG U;  1QLN A;  3ZMV A;  3CPW U;  1K7D A;  2P90 A;  2DYS C;  1RPR A;  4PDM A;  3JD4 A;  4LCU C;  3K3W A;  4YXW G;  4MVS A;  1J95 A;  1E1R G;  3K04 A;  4KUM A;  1RM1 B;  4LBE C;  3SPH A;  2IU0 A;  3FKS G;  4BW5 A;  1HWY A;  4QPJ A;  5CA3 A;  4ZKI A;  3I55 V;  2W0F C;  3F7Y C;  2ZD9 A;  3G6E V;  2DYS B;  2XAJ A;  1KEC A;  1JVM A;  3QNE A;  1Q7Y W;  2XAS A;  1K8A W;  3ZN1 A;  3FYE B;  4RQF A;  2WLJ A;  1V54 B;  1M56 B;  3CYO A;  4PA4 A;  4GT1 A;  2EIL B;  3ABT A;  4GX5 A;  3ZRX A;  4J9Y B;  1Q86 W;  1BMF G;  2IW5 A;  4MTO A;  1MOF A;  3AEI A;  4JTA B;  2H94 A;  1W0K G;  3G4S V;  1JOY A;  1VQN V;  2X6B A;  3W7T A;  2NLJ C;  2HFE C;  3CCL V;  3P32 A;  5B3S B;  5KUK A;  2K1E A;  3E8B A;  4UVC A;  1Y4M A;  1OCC C;  1OCZ B;  3OR6 C;  3SYP A;  5IDJ A;  3SYC A;  1EZJ A;  1YIJ V;  1R3J C;  2HR3 A;  1H38 A;  5LGU A;  4RO2 A;  2WLL A;  5EBW C;  5GW7 A;  3CCJ V;  1XL4 A;  2HG5 C;  2GHY A;  4F4L A;  2A9H A;  3FYI B;  4RQE A;  3TET A;  4FK5 C;  2OT5 A;  2IU3 A;  1VQ4 V;  2EZO A;  4FIP C;  4MVQ A;  2BOC C;  1NBM G;  2R9I A;  2X7R B;  3AG3 B;  1YHQ V;  1MSW D;  1OCO B;  1ORQ C;  3AG2 B;  3ML0 A;  4JF3 A;  2IH3 C;  1MAB G;  3H01 A;  4UVA A;  4MW3 A;  5DN6 G;  3ABM C;  5B1N A;  1AI7 A;  3VOU A;  1YJ9 V;  4GX1 A;  3AG1 C;  5FL7 G;  4U7O A;  1SES A;  3CCR V;  3IC7 A;  3LDC A;  3CXC U;  1R6K A;  3P30 A;  3WG7 C;  4QE7 A;  4P9P A;  3I56 V;  3JYC A;  3W7X A;  3AG2 C;  4CBC A;  3RW0 A;  4X8A A;  1CP9 A;  1GKF A;  3OFN G;  4PDR A;  5H9C A;  5IYB O;  5IY5 B;  2YEV B;  5BZB A;  1AI6 A;  1QVF U;  1OHH G;  3ZRW B;  4XDK A;  1M9N A;  2EIM C;  5B1A C;  2WLL B;  1OZ0 A;  4MVM A;  3F5W C;  4H33 A;  3WG7 B;  3E89 A;  1NVP B;  1K4D C;  2XND G;  3RVZ A;  2A0L A;  1K34 A;  4FPP A;  4L87 A;  3JD3 A;  1QR9 A;  1OCZ C;  1OCC B;  5IYD O;  3CC4 V;  2WLK A;  3ETE A;  2QM8 A;  3T2M A;  3UM7 A;  1EFR G;  2DWD C;  1K97 A;  3GWO A;  3E35 A;  3CCQ V;  3JD1 A;  1LNQ A;  3OUF A;  3STL C;  4G27 B;  5EC1 C;  1AJN A;  4TT3 G;  2CK3 G;  3K9A A;  3FB7 C;  4HAM A;  3OMA B;  2ZR2 A;  4R50 A;  4XDJ A;  1AI4 A;  3JD0 A;  3QO5 A;  1R73 A;  3M99 B;  3A0R A;  1H8H G;  1NVP D;  5CMU A;  2W6I G;  1VQO V;  3B77 A;  3OMN B;  1NH2 B;  2V1D A;  3QO7 A;  3DTU B;  2LFR A;  1OCR B;  3F7V C;  2ZXW B;  4X88 A;  3CCU V;  3OEH G;  5IY5 C;  3K08 A;  1VQ5 V;  5HFL A;  3K03 A;  3STZ C;  3SYO A;  3SPC A;  5LBQ A;  1F4M A;  4I9W A;  1VQL V;  1YSC A;  4R7C A;  2Y69 C;  4JTD B;  3K0G A;  1VQ7 V;  1H8E G;  4WFA V;  2XAQ A;  3E86 A;  4JAV A;  2QE7 G;  1Q81 W;  4JAS A;  4JYC A;  4JAU A;  3LNM B;  3CCV V;  1V55 B;  1K4C C;  3GB7 C;  3E8G A;  3ASN C;  4KP4 A;  1JPX A;  3D36 A;  2HLD G;  4WFH A;  4UVB A;  2IJI A;  4KFM A;  4MS2 A;  1FS0 G;  1VQP V;  3ZRS A;  2IH1 C;  5LGT A;  4ASU G;  4P2Z A;  4XBF A;  4BIZ A;  4BAY A;  1B6Q A;  3ASN B;  4WFF A;  2JJ1 G;  4R8C A;  1DTO A;  4RUE A;  3X2Q B;  2DQ3 A;  1Q82 W;  5LHG A;  2EIK C;  2Q67 A;  4MVR A;  2A79 B;  2LP7 A;  1JJ2 U;  3TCU A;  1QBZ A;  3ASO C;  4PA7 A;  1VQ8 V;  4GX0 A;  2ZXW C;  1WLE A;  3ZMZ A;  4QIW F;  2EIN C;  2HKO A;  2X0L A;  3SPJ A;  2XAH A;  5L3F A;  2OTJ V;  2Q6A A;  3LDE A;  3ABL C;  3T4D A;  5J9P C;  5B3S C;  1NR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...