4QE9A

Open mthk pore structure soaked in 10 mm ba2+/100 mm k+
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
83
structure length
83
Chain Sequence
b'VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel MthK
publication title Ionic interactions of Ba2+ blockades in the MthK K+ channel
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transport protein
total genus 31
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qe9A00
5EBWC 4GX0A 3LNMB 4MVSA 4PA6A 4ZBMA 3ASOC 3VOUA 3OUSA 3K0DA 2WLIA 3K08A 5CBGA 2EIKC 3PJSK 2Q69A 2IH3C 2Q68A 4I9WA 1K4CC 4PDLA 2HJFC 4MS2A 3E8GA 1OCOC 4MSWC 4QNHB 3STZC 2A9HA 5B1BC 2DWDC 2H8PC 2QKSA 3OR6C 1P7BA 4KFMA 3E8HA 3F7YC 3SJQC 1JVMA 2IH1C 1S5HC 2WLNA 3K03A 2KB1A 4OXSA 4PDMA 2HVKC 4X88A 1V54C 4R7CA 4XDKA 1R3KC 4PA7A 4MVZA 3RBZA 1OCZC 1J95A 2AHYA 3K06A 2A79B 3OUFA 4H33A 5E1AC 1OCRC 4RAIA 3STLC 3FB8C 2ITCC 4H37A 2X6AA 3ASNC 2WLJA 3K0GA 3OGCC 3IFXA 4J9YB 4JTDB 4MW8A 2A0LA 4MTGA 4PA3A 4R8CA 5EBMC 3RW0A 2EINC 3UM7A 2JK5C 4TWKA 4RUEA 3LUTB 1QLEC 3SPJA 3SYQA 2P7TC 4HZ3A 3WG7C 2ZXWC 3AG2C 1K4DC 2EIMC 4PDVA 3E89A 3SYCA 3LDDA 2BOCC 4WFFA 3T4DA 4XDLA 3ZJZA 4EKWA 2WLLB 3SPIA 4GX2A 2DWEC 4X89A 3SYOA 3SPCA 4MVQA 2Q67A 4MVOA 4WFGA 4MVUA 3SPGA 3K04A 4R50A 2WLLA 4HYOA 4R6ZA 2DYRC 4MTOA 3E86A 3E8BA 1ZWIC 4WFEA 1ORQC 4DXWA 3LDCA 2YEVA 3T1CA 3FB6C 3HPLC 4P2ZA 4MVMA 5EC1C 3ABLC 1R3JC 3EFFK 1R3LC 3IGAC 3SYPA 4PA4A 4G27B 4LBEC 3SYAA 2ITDC 3BEHA 4MVRA 1R3IC 2EIJC 3AG1C 4RO2A 4BW5A 5CBFA 4GX5A 4WFHA 5EC2C 4JTCB 5KUKA 2QTOA 4X8AA 3UKMA 3E8FA 4P9PA 4J9ZB 4RUFA 1BL8A 2X6BA 5B3SC 5BZBA 3T2MA 3F5WC 1KKDA 2WLHA 2OCCC 4PA9A 3KG2A 1LNQA 3ABMC 2WLIB 3JYCA 5EBLC 3FB7C 2Y69C 1M56C 2ATKC 2NLJC 3TETA 2EILC 3LDEA 5EK0A 5J9PC 5KUMA 4XDJA 2R9RB 2WLMA 2Q6AA 2ZD9A 4CBCA 1G4YB 2HFEC 3R65A 3T4ZA 4MTFA 2W0FC 3X2QC 3SPHA 2BOBC 2X6CA 1M57C 3OR7C 4GX1A 4PDRA 4P30A 1XL6A 3GB7C 4JTAB 3AG4C 3RVYA 4F4LA 5CBHA 3FB5C 3AG3C 4QE7A 3TCUA 4UUJC 2HG5C 3F7VC 1XL4A 1OCCC 3E83A 2AHZA 3RVZA 1V55C 5IY5C 4P9OA 4MW3A 2WLKA 2HVJC 3ABKC 4G28B 3ZRSA 5B1AC 4LCUC 2K1EA 2DYSC 4QE9A 4LP8A
chains in the Genus database with same CATH superfamily
1OCRB 3ASOC 1XMOO 5BMVB 3AEIA 4I55A 2Q69A 1HNZO 1EBOA 4NXMB 1K4CC 1VIBA 1WB7A 1N34O 4K3AA 2HEPA 3JSNA 5L3EA 2L35A 4CC6A 4XDKA 3CCSV 2Z5UA 3O9OA 2QWOB 4TSFG 2LO1A 3IC9A 2DYRB 3ML0A 5EBMC 4K35A 3HKDA 1AP5A 1NU1H 3LSSA 2UUAB 1NI8A 2YIBA 5KA5A 4GKKB 1FFXB 4FM0A 3D3IA 4Q20A 3KZIZ 2WLLB 5IYCO 4TUYB 3SYOA 4WFGA 1K34A 5LP6C 2Y69B 4TV9B 4D6TH 3E86A 3MD0A 3E8BA 5IYZB 1OZ0A 4FIPC 5EC1C 3UQ8A 1R3JC 2BTOA 3T1HB 2XHBA 2OWOA 3L71H 4FM1A 5EC2C 1BE3H 5CMUA 5JQGB 4GUNA 5D5QA 4FFKA 3P3PA 2HR3A 3N2KB 1FFXA 1J5EB 2OCCC 2CH7B 4QJFB 3HKBB 2GBOA 1XREA 5LA6B 4TUYA 2ATKC 3S3WA 3LDEA 4NTWA 4UV9A 4LF7O 1JR9A 5IYZA 2YXYA 3CYOA 3GB7C 3CS5A 4OX9O 2Q7HA 2YIAA 4LF6B 2LW7A 2Q0OC 5JQGA 3CCMV 2HHHO 2W6IG 4FMTA 2UU9O 2CH7A 5EYPB 3HKBA 5LA6A 1QVFU 2CTWA 2CGOA 2R9IA 2EIKC 1HNXB 3CCLV 2JS3A 4DV5B 1IBMB 1VQ5V 4PDLA 1B6QA 4KHPO 1BCCH 1FXKB 3E8HA 2ZNIA 1E1RG 1KD1W 1VP7A 4B3MO 4R7CA 4BWAA 4FLWA 3ABMB 1QQCA 1U96A 4EB6B 2ZE7A 1AI4A 2GV9A 1WPXA 4WFBV 4X65B 4PA3A 1TUBA 3OTOO 5LOVB 5EYPA 3IC7A 3RYHB 1YI2V 2EIJB 5DM6V 5FNVB 2HP8A 2BOCC 5GW7A 1T5EA 1WP7A 1MZEA 3ZN1A 5A9GA 2JS5A 3Q4HA 4YIOA 1YDXA 4W4LA 1M56B 4JI1B 2JIZG 5E79Z 1I94B 1NT2B 1FJGB 4J7KA 1KBHA 1XHXA 1VQNV 4G27B 5LOVA 4RO2A 3BA8A 3AG1C 5LGNA 3VBBA 3JATB 2AZ0A 4O4JB 1ZUQA 4B3TB 2YICA 2JEUA 5FNVA 3TJTA 1Y76B 3IAYA 4UVAA 2WLHA 3K59A 3OE7G 1YVWA 1VF6A 4WCEV 4DV2B 3CCEV 3NXSA 2Q6AA 1SESA 2ZR2A 1SQVH 3E22A 3QVNA 3E2EA 4JI2B 4JI4B 3OEEG 1DTOA 3A2FA 2QM4A 4DV1B 1PL4A 1EN4A 4G2KA 4JZ2A 3CCQV 2DYSC 1Y76A 3TXQA 4O2AB 4DK0A 1Q90D 3P3NA 5ITZA 1XDCA 4DR5B 2W0XA 4X9QA 4JAVA 4MSWC 2HJFC 4MS2A 1S3JA 4QNHB 1NQTA 3ZN0A 4O4LB 5EIBC 5JVDB 2OIGA 3M8AA 2Y0IA 1XHZA 4X88A 4TOIA 3I56V 3L73H 2AHYA 2A79B 3STLC 1LUWA 3ASNC 1AVMA 1XQ8A 1UFIA 3KCYA 5H2FZ 2QWPB 2F93B 1Q8IA 4O2AA 1H2GA 4DR7O 1SF9A 3B77A 1PNLA 1M5IA 3OEHG 2P67A 1YXBA 4JYCA 4O4LA 5B3SB 5JVDA 4U3JA 2ZKOA 2EJRA 4TV8B 1M93A 3RYIA 1B04A 1FS0G 2AZ2A 5TISZ 4R6ZA 1PP9H 1NS1A 2AW9A 1EZJA 4J41A 2OCHA 3CRRA 2XAFA 2ZNJA 2A3QA 4TT3G 3SYPA 4BW5A 3AG4B 5KUKA 1IURA 1YJWV 4DR6O 3UKMA 1Y74B 1W0KG 1FKAO 3E8FA 1RSOB 2ZCEA 3JASA 3ABKB 1R1BA 1O9GA 2WLIB 5EBLC 2UXBB 1K5QA 2ZD9A 4CBCA 1SS3A 2Q5ZA 2Q8VA 3RVYA 3NR7A 3W7SA 4WFAV 1GN4A 2XNDG 3RVZA 5IY5C 4XBFA 2EX3A 1Y74A 3CCUV 4GLXA 1RSOA 4UV8A 1SA0B 5IJ0B 1HNWB 1BT8A 3UCSC 2WLIA 4CS4A 3PJSK 4DR3O 1SQBH 2F4VB 4JYAB 1SQQH 1OCOC 3STZC 2PZSA 2E76B 4LFCB 1Q43A 4NTYA 5EZYB 1RPOA 2IH1C 2C2AA 2QDOA 4B3RO 3JAWB 3FD9A 4ASUG 5LMUB 2PYJA 3WB1A 2RJZA 4LFAB 3IFXA 2IW5A 4O4IA 3ETQA 1SA0A 5IJ0A 4CS3A 3RN4A 3SPJA 5IWAO 1JQ0A 1AI7A 4PV1B 1XNRO 4DV3B 4PDVA 3SJBC 3K9AA 3AK1A 2F95B 1QHTA 4N21A 4J10A 4MTXA 4NXNB 4LF9B 2D2CB 2N74A 5EZYA 3ABTA 4X66B 3JAWA 4JV5O 1Z2GA 3JAMN 3H9VA 1M57B 1XEQA 4MVRA 4X62O 3AG3B 3J7AU 5CA0A 4FLYA 1CPYA 2O57A 2JVDA 4NKGB 1S76D 3AK2A 4IYHA 2UXCO 1YCIA 4UB8Z 4DUZB 5L3FA 1R6NA 3JD2A 1SKVA 3QNEA 1AR4A 1W59A 3EHBB 3OMNB 4DO2A 1D5NA 4K0KO 2ETNA 1BQ0A 3BA9A 2LGWA 4DYLA 4UVBA 3ZMUA 4Z1MG 4Z2WA 4JYBA 4N23A 1SERA 1Y6XA 2LFSA 1DK1A 2N04A 4B08A 2E75B 1B3QA 4FZ0A 3EVKA 3G6EV 2OTJV 1S72V 2HLDG 2ZXWB 5JJEB 1SZTA 1SZXA 4LF8B 1S5HC 3HKEB 3THOA 4BIZA 1AROP 4UCUA 2VWKA 1J95A 3OUFA 2Q7EA 4CS2A 2WLJA 3OGCC 4MW8A 4JI6B 4DXWA 4JTDB 4LWSB 1RM1C 3L9DA 2EINC 4DR2B 3K58A 2OTLV 4PI2A 2UUAO 4YJ3A 4BIUA 5C8YB 2EIMC 3B40A 4NB5A 1H2KA 1Q6IA 4WFFA 1FD9A 2G38A 3VQWA 4X89A 4ZHQB 2KG7B 3HKEA 4I4TB 3N2GB 1GMGA 3HPLC 2ZM6O 1Q86W 2DOSA 3ABLC 1ENVA 4LWSA 2QA4V 4GT1A 3G71V 1K3EA 5CBFA 4LH7A 1K7DA 2QTOA 3N27A 1S5JA 1VQ6V 1V55B 2P6JA 3CCRV 3CCVV 2UUBB 3ZX6A 4DV7O 2M7WA 2KQXA 1JOYA 2Y4TA 1IVSA 2KG7A 4I4TA 4AILC 3N2GA 1ROPA 4DW0A 1S77D 2QWNB 4JTAB 4DV4B 1FYJA 3HB3B 4JASA 1XL4A 3EXAA 2QJ1A 3H1KH 3U0ZA 3ICXA 2HJDA 3DSQA 4JI0O 1MNGA 1V54B 5B1AC 5D5PA 4JAAA 3VQXA 1OCZB 4LP8A 4I55B 4ZBMA 1ZL8A 3ETGA 3HKCB 4DW1A 2B9ZA 1XMQB 2BTQB 5HFLA 4RQEA 1HNXO 3K3WA 3B8NA 4DV5O 1IBMO 4MT8A 1US6A 2H8PC 4H44B 1WJZA 5FLXN 4AQYO 1PNMA 1N8RW 4PDMA 1THZA 4FM2A 2GTSA 2V4DA 3ZHUA 3PN1A 3HKDB 3FAVA 2Y4UA 1SQXH 2KKWA 1IBKB 1AI5A 3ZMTA 3QO7A 4TWKA 1ZLZA 1ZTEA 3HKCA 3H1JH 3WG7C 2BTQA 5B5EZ 1K4DC 4I0XA 2K9PA 3CMAV 4XDLA 1Q3EA 3SPIA 2DWEC 3K04A 1R6KA 1I5XA 4A5UB 1P84F 1KUQA 4WFEA 4PJ0Z 4JI1O 3RWRD 4X1KB 5IDJA 3T1CA 5H5NA 4UCRA 3K5NA 1Y67A 1FJGO 4LFBO 3M99B 1VEWA 3OT7A 4JTCB 2DMXA 1KC8W 1BL8A 1R73A 4FLVA 3MHSC 5JWPA 4DV0B 3JYCA 3FB7C 3I55V 2RMKB 4JI8O 2WSSG 4MTFA 1JJOA 2IJHA 4X1KA 1K97A 4NR1A 1VARA 2IM9A 2E74B 5GTHZ 1WNSA 1H2NA 5DEDA 1GH6A 4J80A 4DV1O 3T1YB 1M9NA 5EBWC 4GX0A 1X59A 3K0DA 2E5LB 2W6JG 2YIBD 4DR5O 2NR5A 2JGDB 2PGGA 3DXRB 2VQEB 2IBZH 1P7BA 1F51A 3F7YC 3C3SA 2CDYA 3FYEB 2BE3A 3CMEV 1VQKV 1TUBB 2ITCC 1RP3B 3K0GA 1BGYH 3BRCA 2XAHA 5DECA 2CTQA 4F6RA 2F23A 4HZ3A 1MABG 3AG2C 1YIJV 3I5DA 1Y4MA 3LDDA 2JGDA 3IJ4A 3DXRA 3ZJZA 3Q4HB 1RPRA 2BCCH 3SPGA 3WB2A 1KP2A 3ETDA 3ZCCA 3CSXA 2AGAA 1Z5VA 4Q6GA 3OAAG 1R3LC 1MSWD 2LP7A 1VQ9V 2JDIG 3SYAA 2QSAA 1XNQB 4GX5A 1JA8A 1SETA 1SC5B 4RUFA 4P9PA 2A06H 1YJNV 4D7TA 1IXMA 5KLVH 3JD3A 4X20A 1XMOB 1F7YA 2B1GA 2EILC 1JMKC 4O2BB 5EK0A 2UXBO 2IJIA 3E22B 1N34B 1EN6A 4DR1B 1N32O 2HG5C 2MK3A 3E83A 4O4HB 5BXZA 3WFVA 4DV6O 1SQPH 3E35A 2WLKA 1KYOF 4FJCC 2RNBA 4QE9A 5ITZB 1HNWO 2PUSA 3QO8A 4O2BA 2WA3A 4JI7B 4JYAO 2YXLA 5LHIA 1NR7A 4LC1A 4J7JA 1NH2B 2GUZA 2V7QG 3SR2C 1EN5A 2KB1A 2L6LA 4O4HA 5LMNO 2ZE5A 2EBOA 1H2SB 1OCRC 3CD6V 2D3OW 3A8TA 5KHIA 4RUEA 5LGUA 3C90A 2F1MA 1EZVH 2VWJA 4DV3O 3CRAA 4U3JB 1VF7A 3RYIB 4I5SA 4WBNA 4JI5B 5LYJA 1A32A 1WPBA 3HR0A 4MVQA 3ZMSA 4X64O 4MVUA 4UCVA 2RQ6A 2QGNA 2DYRC 1DGSA 4X66O 2GSMB 3P32A 1AI6A 2FKXA 3LDCA 2UXDO 4B3SO 2PI4A 2YI8A 5KA6A 5B1BB 1R3IC 4GKJB 4X8AA 3JASB 1OCCB 1U97A 4IGGA 3K79A 2YS8A 1H8EG 4PA9A 1IBLB 1LNQA 1N33O 2Y69C 4DUYB 3A0RA 1SQFA 3CEIA 2WLMA 4NYKA 5JJNB 1AJNA 2Q7GA 4LF4O 4ZIBA 3AK3A 4QE7A 1NH2D 4UUJC 3DGEA 2B5UA 1EFRG 1KP3A 2CUGA 5CA3A 3L70H 1GRJA 4YHHO 1G8MA 1VQMV 2HVJC 1BHBA 4PELA 3OD4A 2NN4A 1TA8A 5L3GA 1QCEA 2UUCO 4RQFA 3RYCB 2CAZC 4QGPA 3ETEA 4NVPA 3W7WA 4WF9V 1QLEB 4I9WA 1YZBA 5IE9A 3QF7A 1GAXA 4FPPA 4FVMA 3CRQA 4DR4B 4PA7A 1PPJH 3RBZA 4O4IB 1YEWA 3W7XA 5IT9N 4D7SA 4UFZA 2A0LA 4TQFA 4JI6O 1DF4A 2OIEA 3CJHB 3TGUH 3RYCA 1FFTB 4DR2O 4CH6A 5LXTA 1QNMA 2EZOA 1FXKC 1IZ3A 3T4DA 3LSUA 3BAAA 3SPCA 4JI3B 4R50A 1HP8A 3G4SV 1M4UA 2QR4A 1ZWIC 2QEXV 3X2QB 3EFFK 4LBEC 3ZHRA 1BMFG 3BEHA 2EIJC 5CA0B 2H3OA 3CJHA 1N0NA 2XT9A 3M7MX 2GHYA 2X6BA 3CE2A 5BZBA 1WN7A 1VF6C 4UCSA 5DN6G 5KHGA 4LF5B 5B66Z 5KX5B 1TVKB 5C93A 1M56C 3U11A 3H1LH 1GN2A 1WA8A 1X4TA 3ASOB 1JCHA 1N36B 5BY1A 3P30A 3OR7C 3CB2A 1XL6A 1MMMA 3WG7B 5CA1B 3FB5C 1HW7A 1MA1A 5HFMA 2XOKG 3ZRSA 2YUAA 3CX5F 3VOUA 3RT3C 5KX5A 1TVKA 3OM3B 4HAMA 3FFQA 4GYCB 2YXHA 5JCOC 1IXBA 4BR6A 4BW9A 2Q4PA 4HNAA 2A9HA 3K5OA 2JGUA 5CA1A 2WLNA 2VRZA 1PL0A 1UPGA 5JJJB 3C3TA 5LP6B 4FLZA 2R72A 1HR0O 5IJ9B 1BZKA 1D2DA 3K5LA 4YJ3B 1OV9A 4DR6B 4NXMO 4JZGA 3B8MA 1E1QG 5CN0A 3CCJV 4NTXA 3FKSG 3BFRA 4X1YB 1GN3A 3ZBHA 1JX9A 2OCCB 1F4MA 2P22C 3ZHQA 5H6RA 5LP6A 4B7EA 3QO5A 4BAYA 4MVMA 5JH7A 1F23A 5IJ9A 1S0VA 4PA4A 5LHGA 1IX9A 4J11A 5J2UB 3OMAB 3OTFA 3APQA 2CGNA 3A0BZ 5B3SC 4GKKO 1AJQA 2VS0A 4L87A 4X1YA 5H9CA 4DR3B 4RWUA 2OYQA 4E2LA 2IU0A 5BR8B 2HFEC 3T4ZA 1AILA 2EIKB 2W0FC 3R66A 4IIJB 3AG4C 5H6QA 5CBHA 1TUEB 3T1HO 3D8CA 1MG1A 5J2TB 4B3RB 3QG5A 4JGSA 5J2UA 3CXHF 1HDJA 3ABKC 3ZHVA 4G28B 4LCUC 1ZL8B 1KB9F 2LGQA 1J5EO 3FX7A 3LNMB 4PA6A 2GDSA 1URFA 3MDSA 3O65A 1S5LZ 2H94A 5CBGA 2IH3C 2DQ3A 1TAEA 1XNRB 4IIJA 1Q5OA 5J2TA 3FAVB 4LF6O 5E1AC 1VQ4V 1MOFA 1CEZA 3ZMZA 4X62B 3SYQA 2P7TC 4I0XB 5K1PA 5B1OA 4ZKIA 3AG1B 1DLBA 2P90A 2UXCB 1NR1A 1PV0A 2XAQA 4JAUA 4EKWA 4GX2A 2JEXA 2X7RB 3D3QA 3UO2A 3SDLA 1K9MW 1PNKA 1RFYA 4X65O 4P2ZA 3IGAC 4PI0A 4K0KB 3ZRWB 1JFFB 2BSKB 3KCXA 1OJHA 4OPAA 4E4EA 3KG2A 1GN6A 3BCCH 4DRXB 2DYSB 1GM9A 4PHZA 3ZMVA 1P7GA 2WPDG 2B1IA 3F5TA 1VQLV 2HKOA 1SQGA 3APOA 3LNNA 3SPHA 1XUQA 3TXSA 2X6CA 4GX1A 1M57C 1I94O 2VQFB 3AG3C 3GVMA 3JD0A 3TCUA 4DR1O 1H2MA 3ZRWA 1P49A 4B3TO 4IHJB 1JFFA 2BSKA 3RGBA 1WAZA 4J42A 3BPZA 3CHXA 3OUSA 3ASNB 4DRXA 4DV2O 5BMVA 2MW2B 4AI8A 3J81N 2ZE8A 3K57A 4JI7O 2DJVA 4CZZA 2QKSA 1WB8A 2IJJA 1O9HA 4JI2O 4EFBA 4UCTA 1DF5A 4OXSA 4JI4O 2HVKC 1R3KC 1NBMG 2RDCA 3L74H 3CPWU 4YY3B 1SRYA 4IHJA 4MTGA 1VQ8V 2ZM6B 2CTPA 1JPXA 3RW0A 4F6RB 4R8CA 1KU9A 3G6BA 5F2VO 1VMGA 4CH4A 1VF5B 1KECA 4IT5A 4LNUB 2X0LA 2ZXWC 1VQPV 2FMLA 4JI5O 2WLLA 4DV7B 2ADQB 2AXTZ 1WP8A 1R6TA 2QM7A 5GONB 1ORQC 4TV9A 1L0NH 1H38A 5EIBD 3WB0A 4FZ1A 1G6UA 3OW2U 3ZEDA 4LNUA 4GKJO 2JJ1G 5IYDO 3BHPA 4JI0B 5IY5B 4X20B 4TQDA 3N2KA 1IBLO 3LSQA 3B4SA 4DUYO 1JJ2U 2PI5A 4QIWF 1GKFA 2LJ2A 2BOBC 3BABA 5GONA 4P30A 1KKCA 2ZDIC 5KAFZ 1OCOB 1BSMA 2FYUH 4AQYB 2LFRA 4CH3A 3DC5A 2ZINA 1V55C 3G80A 1ZSPA 2YC0A 4MW3A 3CXCU 5FL7G 2XUMA 2XTAA 2ILMA 3L72H 1B06A 3DTUB 1HNZB 3BVOA 4FK5C 3CRCA 1NJIW 3D36C 2LQTA 2ZE6A 3S3XA 4W4KA 1D5AA 5L3BA 1I5YA 3JARB 2GUZB 4UB6Z 1EM1A 3SJQC 1XILA 1FXKA 1GK9A 5AG2A 1NTKH 3UT5B 3ABUA 2QWQB 3K03A 1V54C 2M6YA 4DR4O 2ZQMA 1OCZC 2P4KA 4H33A 3FB8C 4EB6A 1GTOA 1K92A 3UM7A 3LUTB 4LFBB 1NKDA 1CP9A 5KHHA 2F4VO 1OHHG 1K5SA 3CC4V 2A7WA 3RYHA 4EEQA 4WBNB 3QTCA 5LYJB 5IYBO 4LFCO 3JARA 2Q67A 2PTMA 2YSUB 4MVOA 1H2LA 4JI3O 3UT5A 2CK3G 4KL1A 4JI8B 4I9QA 1BQZA 2N05A 5LMUO 2QM8A 2FTKA 2YDEA 4LFAO 3JCUZ 2UXNA 4PD4F 3B09A 5KAIZ 1YTFB 3CC2V 1XI1A 2YIDA 1Z5WA 3JATA 2XASA 4O4JA 1LR1A 4BIOA 4NXNO 5LBQA 4LF9O 4LF5O 1QVGU 3JALB 3WU2Z 4LF7B 2WAMA 2GTAA 2ZIMA 4L8JA 3R65A 1N36O 2ARHA 4KUMA 3JD4A 4PDRA 1AR5A 4OX9B 5JCOA 2Y0PA 2XAJA 2HHHB 4P9OA 4IL6Z 1K8AW 2UU9B 4DUZO 1QU7A 4MVSA 4GZRB 4OGQB 2DQ0A 3K08A 1MZFA 1QR8A 1RM1B 2EINB 2QE7G 3JALA 4GCZA 3ZRVA 4KHPB 1YHQV 1BS3A 4ZOLB 2DWDC 2EIMB 3U10A 3OR6C 4B3MB 2OT5A 5KHJA 4YIPA 4FLTA 3SJCC 1AR1B 1GM8A 3OTOB 1M90W 3W7UA 2CTRA 2RN9A 5LXTB 3CWBH 3ABLB 4U7OA 1YTFD 1L1FA 3K5MA 2WA4A 3SYCA 4FFBB 3VQVA 4ZOLA 1I7FA 4AHCA 1FXHA 3K9SA 3H1HH 4LF8O 2DE0X 1QLNA 2QKCA 4ABMA 4TV8A 1PKXA 4MTOA 5CB4B 4LR3A 2Z3YA 4F6EA 4X1IB 2V1DA 1N32B 5LHHA 2ITDC 4WFHA 5LGTA 4DV6B 3CP1A 4H13B 1QR9A 4UVCA 1COWG 4J9ZB 2FB5A 1NVPB 3T2MA 1YSCA 3F5WC 4CH5A 1Q82W 2ADPA 4FFBA 5L3CA 2IJKA 5B1AB 3ABMC 1WA8B 2EJ7A 3ZHSA 2NLJC 3TETA 4JF3A 4Z1VA 5KUMA 2Q9LA 2R9RB 2KSDA 5BR8O 4KP4A 3MHHC 5CB4A 2PY5A 2QKAA 4F4LA 3TK1A 1FPOA 5A2QN 4X1IA 3SJAC 1NZ6A 2AHZA 3OMIB 3GWKC 4EFEA 2NNUA 4I7ZB 5LMNB 4B7KA 3SGIA 4K8XA 4HBNA 1LUVA 1AB3A 2UUBO 5LL6Y 1FAFA 1M1KW 1YF2A 4HNAB 1XOUA 1NTZH 3BY6A 4ICGA 3JAKB 3E8GA 3RYFB 3MAQA 2LW1A 4DV4O 3A0HZ 4FLUA 4KFMA 4X64B 2WWWA 2E3CA 2Z0AA 1N4CA 4MVZA 1GM7A 5FPOA 2UXDB 1I08A 1Q7YW 2X6AA 4B3SB 1K33A 2Y48A 2JK5C 2ZT9B 4H0LB 3H1IH 1XMQO 4DR7B 4U7NA 1IDSA 1N0JA 2QWRB 4JYYA 1H8HG 3OFNG 1NVPD 3JAKA 4UCOA 3UO3A 3RYFA 2XAGA 1N33B 2DW4A 1FXVA 2Q73A 5K1XA 2ZR3A 2P4VA 4YJ2B 5JH7B 4IYIA 2PYLA 4LF4B 3J80N 3B2EE 1IBKO 5FPRA 2R9AA 2RCVA 1KQSU 4YHHB 2YI9A 3W7TA 2Q0AA 1AJPA 3ZIAG 1E79G 3JSLA 2FL4A 2ODMA 2UUCB 3DC6A 5J9PC 4XDJA 2QTSA 4YJ2A 5B1BC 1V9PA 2JJ2G 4FLXA 3L75H 2R70A 2VQFO 2F66C 2IU3A 3F7VC 1OCCC 3JD1A 1I0HA 2CE4A 3AG7A 3CRMA 3RFRA 5GTIZ 1KMIZ 2DN9A 2K1EA 4DV0O 1F4NA 1MSDA 1L0LH 1QBZA 1VQOV 1NTMH 1ZX3A 2Q68A 1Y66A 4C7UA 1K73W 3H01A 5KHKA 1YITV 3AG2B 3CC7V 1JVMA 4J7ZA 5B1NA 2UXXA 3ZRXA 3K06A 4YY3O 2YEVB 4RAIA 3T1YO 4H37A 4J9YB 1CXZB 1W2BU 1YJ9V 1GO3F 2E5LO 1QLEC 5IWAB 4JPRA 4I50B 4K8ZA 4DK1A 3KKYA 5L3DA 2EZPA 4YXWG 1VQ7V 3VQYA 3E89A 2F43G 2P5OA 5C8YA 2VQEO 1Q6HA 5KMGB 4HYOA 3ZS8C 4ZHQA 4JV5B 2EILB 4QPKA 1Q81W 1XBLA 2JRIA 1HWYA 4KXRA 3OGIB 1ZAUA 2YEVA 3FB6C 4QPJA 3FYIB 1BHAA 1PD3A 4I50A 1W0JG 2EULA 2ZDIA 4ZI7B 2P06A 4OPHA 4CC5A 1KKDA 1L8DA 4U3FH 1WLEA 1TGOA 3G67A 1UJWB 5KMGA 4LH6A 1G4YB 1AP6A 1P4RA 3X2QC 1Q6UA 2PF4E 3ZHTA 2ZIOA 4UXNA 3D36A 1PM9A 1XNQO 3GWOA 4ZI7A 1G1XB 3JCZA 1HR0B
chains in the Genus database with same CATH topology
2LFSA 1OCRB 1QCEA 3ASOC 5L3GA 4RQFA 3DTUB 3AEIA 3ETEA 3W7WA 2Q69A 4FK5C 4WF9V 1EBOA 1NJIW 1QLEB 4I9WA 1K4CC 3G6EV 2OTJV 1S72V 2HLDG 2ZXWB 5L3BA 1I5YA 1SZTA 4FPPA 3SJQC 1FXKA 5L3EA 1GK9A 1S5HC 3ABUA 4XDKA 3K03A 4BIZA 1V54C 3CCSV 2Z5UA 4PA7A 1AROP 4TSFG 2ZQMA 3RBZA 1OCZC 1J95A 3OUFA 4H33A 2DYRB 3ML0A 3W7XA 3FB8C 2WLJA 3OGCC 4MW8A 5EBMC 4DXWA 4JTDB 1GTOA 2A0LA 1RM1C 1K92A 2EINC 3UM7A 3LUTB 2OTLV 1DF4A 1NKDA 3LSSA 1CP9A 1FFTB 1OHHG 1K5SA 2EZOA 3CC4V 1FXKC 4BIUA 2EIMC 5KA5A 4WFFA 5IYBO 3D3IA 3T4DA 4Q20A 2WLLB 5IYCO 4X89A 3SYOA 3SPCA 2Q67A 2YSUB 4MVOA 4WFGA 1K34A 4R50A 3G4SV 2CK3G 2Y69B 3E86A 3MD0A 3E8BA 1ZWIC 1OZ0A 1GMGA 2QEXV 2QM8A 2FTKA 4FIPC 3HPLC 2UXNA 1Q86W 5EC1C 3X2QB 3ABLC 1R3JC 3EFFK 1ENVA 4LBEC 1BMFG 3BEHA 4GT1A 1K3EA 3G71V 2EIJC 5CBFA 2QA4V 5EC2C 1YTFB 5CMUA 3CC2V 1K7DA 2QTOA 1VQ6V 1V55B 2GHYA 2X6BA 2XASA 2P6JA 2HR3A 3CCRV 5BZBA 3CCVV 5DN6G 2OCCC 4QJFB 5LBQA 5C93A 1M56C 2ATKC 1QVGU 2M7WA 3LDEA 1JOYA 3ASOB 1JCHA 2WAMA 4UV9A 3R65A 1ROPA 4KUMA 3P30A 1S77D 3JD4A 3CYOA 3OR7C 4PDRA 1XL6A 3GB7C 4JTAB 3WG7B 3FB5C 3HB3B 4JASA 1XL4A 2XAJA 5HFMA 4P9OA 2XOKG 3CCMV 3ZRSA 1V54B 5B1AC 2W6IG 1K8AW 4FMTA 1OCZB 4LP8A 4MVSA 4ZBMA 3VOUA 3ETGA 2DQ0A 3K08A 1QVFU 2R9IA 1QR8A 1RM1B 2EIKC 2EINB 2QE7G 3CCLV 3OM3B 4HAMA 4GCZA 5HFLA 4RQEA 3ZRVA 3K3WA 3B8NA 1YHQV 4PDLA 1B6QA 4MT8A 1VQ5V 2A9HA 1FXKB 2DWDC 2EIMB 2H8PC 3OR6C 3E8HA 1PNMA 1E1RG 1N8RW 2OT5A 2WLNA 1KD1W 4PDMA 1THZA 4R7CA 3ABMB 1PL0A 1AR1B 1AI4A 1GM8A 1WPXA 4WFBV 1M90W 4PA3A 3W7UA 1AI5A 3ZMTA 3QO7A 4TWKA 3IC7A 3ABLB 4U7OA 1YI2V 1YTFD 3WG7C 1L1FA 2EIJB 5DM6V 1K4DC 3SYCA 3B8MA 3CMAV 2BOCC 1E1QG 4XDLA 5GW7A 5CN0A 3CCJV 1FXHA 3FKSG 3SPIA 2DWEC 1QLNA 3ZN1A 1JX9A 2OCCB 3K04A 1F4MA 1R6KA 1I5XA 1PKXA 4MTOA 1M56B 5H6RA 4WFEA 2JIZG 3QO5A 5IDJA 2Z3YA 3T1CA 4BAYA 4MVMA 2V1DA 1F23A 1S0VA 1VQNV 4PA4A 5LHGA 4G27B 5LHHA 2ITDC 4RO2A 3M99B 3AG1C 5LGNA 3VBBA 4WFHA 5LGTA 4JTCB 3OMAB 3CP1A 1KC8W 1QR9A 4UVCA 1COWG 4J9ZB 1BL8A 2JEUA 1R73A 5B3SC 1NVPB 3T2MA 1YSCA 3F5WC 1Q82W 3MHSC 4UVAA 2WLHA 1AJQA 5L3CA 2IJKA 5B1AB 3ABMC 3JYCA 3FB7C 3OE7G 4L87A 2NLJC 3I55V 3TETA 4JF3A 5H9CA 4WCEV 3CCEV 5KUMA 4E2LA 2R9RB 3NXSA 2Q6AA 2WSSG 2IU0A 2HFEC 3T4ZA 2EIKB 4MTFA 1SESA 2W0FC 3MHHC 4KP4A 2ZR2A 2IJHA 1K97A 3AG4C 5H6QA 4F4LA 5CBHA 3TK1A 1TUEB 3E2EA 1MG1A 2AHZA 3OMIB 3OEEG 1DTOA 4JGSA 2NNUA 3ABKC 4G28B 4LCUC 4G2KA 3CCQV 2DYSC 1M9NA 5EBWC 4GX0A 3LNMB 4PA6A 3K0DA 2H94A 5CBGA 1M1KW 2W6JG 2IH3C 2DQ3A 3BY6A 4JAVA 2HJFC 4MS2A 3E8GA 4MSWC 1S3JA 4QNHB 1NQTA 3ZN0A 1P7BA 1F51A 4KFMA 3F7YC 2WWWA 3FYEB 4X88A 3CMEV 4MVZA 3I56V 1VQKV 1GM7A 2AHYA 5E1AC 2A79B 3STLC 1VQ4V 1MOFA 2ITCC 1Q7YW 2X6AA 3ASNC 1CEZA 3K0GA 1K33A 2Y48A 3ZMZA 2JK5C 2XAHA 3SYQA 2P7TC 4HZ3A 4U7NA 1H2GA 5B1OA 3AG1B 4ZKIA 1MABG 3AG2C 1DLBA 3B77A 1H8HG 3OFNG 1YIJV 1PNLA 1NVPD 1Y4MA 3LDDA 2P90A 3OEHG 2P67A 3ZJZA 1NR1A 4JYCA 2XAQA 4JAUA 2XAGA 4EKWA 5B3SB 2EJRA 2DW4A 2JEXA 4GX2A 1RPRA 2X7RB 1FXVA 3SPGA 1FS0G 1KP2A 2ZR3A 3ETDA 4R6ZA 1EZJA 3ZCCA 1K9MW 1PNKA 2XAFA 4P2ZA 4TT3G 3OAAG 1R3LC 3IGAC 2LP7A 3SYPA 1VQ9V 1MSWD 2JDIG 3SYAA 4BW5A 3AG4B 3ZRWB 4GX5A 5KUKA 1KQSU 1YJWV 3UKMA 1SETA 1W0KG 3E8FA 4P9PA 4RUFA 3W7TA 1YJNV 1AJPA 3ZIAG 1IXMA 3ABKB 3JD3A 1E79G 3KG2A 2WLIB 5EBLC 2DYSB 1GM9A 2B1GA 2EILC 3ZMVA 2WPDG 2B1IA 5EK0A 1VQLV 5J9PC 2HKOA 4XDJA 2ZD9A 1K5QA 4CBCA 2IJIA 3SPHA 2X6CA 4GX1A 1M57C 5B1BC 3RVYA 2JJ2G 3W7SA 3AG3C 3JD0A 4WFAV 3TCUA 2HG5C 2IU3A 2MK3A 3F7VC 3E83A 1OCCC 2XNDG 3WFVA 3RVZA 3JD1A 5IY5C 3ZRWA 4XBFA 3E35A 2WLKA 4FJCC 3CCUV 2K1EA 4QE9A 4UV8A 1F4NA 3OUSA 3ASNB 2WLIA 1QBZA 1VQOV 3PJSK 3QO8A 2Q68A 1Y66A 1OCOC 3STZC 1K73W 3H01A 1YITV 3AG2B 4CZZA 5LHIA 2QKSA 3CC7V 2IJJA 1NR7A 4LC1A 1RPOA 1NH2B 1JVMA 2V7QG 2IH1C 2C2AA 1DF5A 2KB1A 4OXSA 2HVKC 1R3KC 1NBMG 5B1NA 3CPWU 2UXXA 3ZRXA 1SRYA 2EBOA 4ASUG 3K06A 2YEVB 1OCRC 4RAIA 4H37A 3CD6V 2D3OW 4J9YB 4MTGA 1VQ8V 3IFXA 1JPXA 2IW5A 3RW0A 1W2BU 4R8CA 1YJ9V 1GO3F 4RUEA 5LGUA 1QLEC 3SPJA 4JPRA 1KECA 1JQ0A 2X0LA 5L3DA 1AI7A 2EZPA 2ZXWC 4YXWG 1VQ7V 4PDVA 3K9AA 3E89A 2F43G 1VQPV 4N21A 4I5SA 4MTXA 4MVQA 3ZMSA 4MVUA 2WLLA 3ABTA 4HYOA 2DYRC 2EILB 2QM7A 2GSMB 3P32A 4QPKA 1Q81W 1AI6A 1HWYA 1ORQC 3LDCA 1H38A 2YEVA 3FB6C 2PI4A 4QPJA 3FYIB 5KA6A 5B1BB 1M57B 4MVRA 1R3IC 3OW2U 1BHAA 3AG3B 1PD3A 1W0JG 4X8AA 2JJ1G 2ZDIA 1OCCB 1CPYA 5IYDO 5IY5B 1S76D 3K79A 1KKDA 1H8EG 1WLEA 4PA9A 1LNQA 2Y69C 5L3FA 1UJWB 3LSQA 1JJ2U 1R6NA 3A0RA 2PI5A 4QIWF 2WLMA 1G4YB 1AJNA 1P4RA 3JD2A 3X2QC 1GKFA 2BOBC 4P30A 2ZDIC 1OCOB 3QNEA 3EHBB 3OMNB 4QE7A 3D36A 4UXNA 1NH2D 4UUJC 4DO2A 2LFRA 2B5UA 3DGEA 1EFRG 1KP3A 1V55C 4UVBA 3ZMUA 5CA3A 4Z1MG 4MW3A 1G8MA 3CXCU 2HVJC 4JYBA 4N23A 1VQMV 1SERA 1BHBA 3GWOA 5FL7G 3JCZA 4PELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBW C;  4GX0 A;  3LNM B;  4MVS A;  4PA6 A;  4ZBM A;  3ASO C;  3VOU A;  3OUS A;  3K0D A;  2WLI A;  3K08 A;  5CBG A;  2EIK C;  3PJS K;  2Q69 A;  2IH3 C;  2Q68 A;  4I9W A;  1K4C C;  4PDL A;  2HJF C;  4MS2 A;  3E8G A;  1OCO C;  4MSW C;  4QNH B;  3STZ C;  2A9H A;  5B1B C;  2DWD C;  2H8P C;  2QKS A;  3OR6 C;  1P7B A;  4KFM A;  3E8H A;  3F7Y C;  3SJQ C;  1JVM A;  2IH1 C;  1S5H C;  2WLN A;  3K03 A;  2KB1 A;  4OXS A;  4PDM A;  2HVK C;  4X88 A;  1V54 C;  4R7C A;  4XDK A;  1R3K C;  4PA7 A;  4MVZ A;  3RBZ A;  1OCZ C;  1J95 A;  2AHY A;  3K06 A;  2A79 B;  3OUF A;  4H33 A;  5E1A C;  1OCR C;  4RAI A;  3STL C;  3FB8 C;  2ITC C;  4H37 A;  2X6A A;  3ASN C;  2WLJ A;  3K0G A;  3OGC C;  3IFX A;  4J9Y B;  4JTD B;  4MW8 A;  2A0L A;  4MTG A;  4PA3 A;  4R8C A;  5EBM C;  3RW0 A;  2EIN C;  3UM7 A;  2JK5 C;  4TWK A;  4RUE A;  3LUT B;  1QLE C;  3SPJ A;  3SYQ A;  2P7T C;  4HZ3 A;  3WG7 C;  2ZXW C;  3AG2 C;  1K4D C;  2EIM C;  4PDV A;  3E89 A;  3SYC A;  3LDD A;  2BOC C;  4WFF A;  3T4D A;  4XDL A;  3ZJZ A;  4EKW A;  2WLL B;  3SPI A;  4GX2 A;  2DWE C;  4X89 A;  3SYO A;  3SPC A;  4MVQ A;  2Q67 A;  4MVO A;  4WFG A;  4MVU A;  3SPG A;  3K04 A;  4R50 A;  2WLL A;  4HYO A;  4R6Z A;  2DYR C;  4MTO A;  3E86 A;  3E8B A;  1ZWI C;  4WFE A;  1ORQ C;  4DXW A;  3LDC A;  2YEV A;  3T1C A;  3FB6 C;  3HPL C;  4P2Z A;  4MVM A;  5EC1 C;  3ABL C;  1R3J C;  3EFF K;  1R3L C;  3IGA C;  3SYP A;  4PA4 A;  4G27 B;  4LBE C;  3SYA A;  2ITD C;  3BEH A;  4MVR A;  1R3I C;  2EIJ C;  3AG1 C;  4RO2 A;  4BW5 A;  5CBF A;  4GX5 A;  4WFH A;  5EC2 C;  4JTC B;  5KUK A;  2QTO A;  4X8A A;  3UKM A;  3E8F A;  4P9P A;  4J9Z B;  4RUF A;  1BL8 A;  2X6B A;  5B3S C;  5BZB A;  3T2M A;  3F5W C;  1KKD A;  2WLH A;  2OCC C;  4PA9 A;  3KG2 A;  1LNQ A;  3ABM C;  2WLI B;  3JYC A;  5EBL C;  3FB7 C;  2Y69 C;  1M56 C;  2ATK C;  2NLJ C;  3TET A;  2EIL C;  3LDE A;  5EK0 A;  5J9P C;  5KUM A;  4XDJ A;  2R9R B;  2WLM A;  2Q6A A;  2ZD9 A;  4CBC A;  1G4Y B;  2HFE C;  3R65 A;  3T4Z A;  4MTF A;  2W0F C;  3X2Q C;  3SPH A;  2BOB C;  2X6C A;  1M57 C;  3OR7 C;  4GX1 A;  4PDR A;  4P30 A;  1XL6 A;  3GB7 C;  4JTA B;  3AG4 C;  3RVY A;  4F4L A;  5CBH A;  3FB5 C;  3AG3 C;  4QE7 A;  3TCU A;  4UUJ C;  2HG5 C;  3F7V C;  1XL4 A;  1OCC C;  3E83 A;  2AHZ A;  3RVZ A;  1V55 C;  5IY5 C;  4P9O A;  4MW3 A;  2WLK A;  2HVJ C;  3ABK C;  4G28 B;  3ZRS A;  5B1A C;  4LCU C;  2K1E A;  2DYS C;  4QE9 A;  4LP8 A; 
#chains in the Genus database with same CATH topology
 1OCR B;  3ASO C;  1XMO O;  5BMV B;  3AEI A;  4I55 A;  2Q69 A;  1HNZ O;  1EBO A;  4NXM B;  1K4C C;  1VIB A;  1WB7 A;  1N34 O;  4K3A A;  2HEP A;  3JSN A;  5L3E A;  2L35 A;  4CC6 A;  4XDK A;  3CCS V;  2Z5U A;  3O9O A;  2QWO B;  4TSF G;  2LO1 A;  3IC9 A;  2DYR B;  3ML0 A;  5EBM C;  4K35 A;  3HKD A;  1AP5 A;  1NU1 H;  3LSS A;  2UUA B;  1NI8 A;  2YIB A;  5KA5 A;  4GKK B;  1FFX B;  4FM0 A;  3D3I A;  4Q20 A;  3KZI Z;  2WLL B;  5IYC O;  4TUY B;  3SYO A;  4WFG A;  1K34 A;  5LP6 C;  2Y69 B;  4TV9 B;  4D6T H;  3E86 A;  3MD0 A;  3E8B A;  5IYZ B;  1OZ0 A;  4FIP C;  5EC1 C;  3UQ8 A;  1R3J C;  2BTO A;  3T1H B;  2XHB A;  2OWO A;  3L71 H;  4FM1 A;  5EC2 C;  1BE3 H;  5CMU A;  5JQG B;  4GUN A;  5D5Q A;  4FFK A;  3P3P A;  2HR3 A;  3N2K B;  1FFX A;  1J5E B;  2OCC C;  2CH7 B;  4QJF B;  3HKB B;  2GBO A;  1XRE A;  5LA6 B;  4TUY A;  2ATK C;  3S3W A;  3LDE A;  4NTW A;  4UV9 A;  4LF7 O;  1JR9 A;  5IYZ A;  2YXY A;  3CYO A;  3GB7 C;  3CS5 A;  4OX9 O;  2Q7H A;  2YIA A;  4LF6 B;  2LW7 A;  2Q0O C;  5JQG A;  3CCM V;  2HHH O;  2W6I G;  4FMT A;  2UU9 O;  2CH7 A;  5EYP B;  3HKB A;  5LA6 A;  1QVF U;  2CTW A;  2CGO A;  2R9I A;  2EIK C;  1HNX B;  3CCL V;  2JS3 A;  4DV5 B;  1IBM B;  1VQ5 V;  4PDL A;  1B6Q A;  4KHP O;  1BCC H;  1FXK B;  3E8H A;  2ZNI A;  1E1R G;  1KD1 W;  1VP7 A;  4B3M O;  4R7C A;  4BWA A;  4FLW A;  3ABM B;  1QQC A;  1U96 A;  4EB6 B;  2ZE7 A;  1AI4 A;  2GV9 A;  1WPX A;  4WFB V;  4X65 B;  4PA3 A;  1TUB A;  3OTO O;  5LOV B;  5EYP A;  3IC7 A;  3RYH B;  1YI2 V;  2EIJ B;  5DM6 V;  5FNV B;  2HP8 A;  2BOC C;  5GW7 A;  1T5E A;  1WP7 A;  1MZE A;  3ZN1 A;  5A9G A;  2JS5 A;  3Q4H A;  4YIO A;  1YDX A;  4W4L A;  1M56 B;  4JI1 B;  2JIZ G;  5E79 Z;  1I94 B;  1NT2 B;  1FJG B;  4J7K A;  1KBH A;  1XHX A;  1VQN V;  4G27 B;  5LOV A;  4RO2 A;  3BA8 A;  3AG1 C;  5LGN A;  3VBB A;  3JAT B;  2AZ0 A;  4O4J B;  1ZUQ A;  4B3T B;  2YIC A;  2JEU A;  5FNV A;  3TJT A;  1Y76 B;  3IAY A;  4UVA A;  2WLH A;  3K59 A;  3OE7 G;  1YVW A;  1VF6 A;  4WCE V;  4DV2 B;  3CCE V;  3NXS A;  2Q6A A;  1SES A;  2ZR2 A;  1SQV H;  3E22 A;  3QVN A;  3E2E A;  4JI2 B;  4JI4 B;  3OEE G;  1DTO A;  3A2F A;  2QM4 A;  4DV1 B;  1PL4 A;  1EN4 A;  4G2K A;  4JZ2 A;  3CCQ V;  2DYS C;  1Y76 A;  3TXQ A;  4O2A B;  4DK0 A;  1Q90 D;  3P3N A;  5ITZ A;  1XDC A;  4DR5 B;  2W0X A;  4X9Q A;  4JAV A;  4MSW C;  2HJF C;  4MS2 A;  1S3J A;  4QNH B;  1NQT A;  3ZN0 A;  4O4L B;  5EIB C;  5JVD B;  2OIG A;  3M8A A;  2Y0I A;  1XHZ A;  4X88 A;  4TOI A;  3I56 V;  3L73 H;  2AHY A;  2A79 B;  3STL C;  1LUW A;  3ASN C;  1AVM A;  1XQ8 A;  1UFI A;  3KCY A;  5H2F Z;  2QWP B;  2F93 B;  1Q8I A;  4O2A A;  1H2G A;  4DR7 O;  1SF9 A;  3B77 A;  1PNL A;  1M5I A;  3OEH G;  2P67 A;  1YXB A;  4JYC A;  4O4L A;  5B3S B;  5JVD A;  4U3J A;  2ZKO A;  2EJR A;  4TV8 B;  1M93 A;  3RYI A;  1B04 A;  1FS0 G;  2AZ2 A;  5TIS Z;  4R6Z A;  1PP9 H;  1NS1 A;  2AW9 A;  1EZJ A;  4J41 A;  2OCH A;  3CRR A;  2XAF A;  2ZNJ A;  2A3Q A;  4TT3 G;  3SYP A;  4BW5 A;  3AG4 B;  5KUK A;  1IUR A;  1YJW V;  4DR6 O;  3UKM A;  1Y74 B;  1W0K G;  1FKA O;  3E8F A;  1RSO B;  2ZCE A;  3JAS A;  3ABK B;  1R1B A;  1O9G A;  2WLI B;  5EBL C;  2UXB B;  1K5Q A;  2ZD9 A;  4CBC A;  1SS3 A;  2Q5Z A;  2Q8V A;  3RVY A;  3NR7 A;  3W7S A;  4WFA V;  1GN4 A;  2XND G;  3RVZ A;  5IY5 C;  4XBF A;  2EX3 A;  1Y74 A;  3CCU V;  4GLX A;  1RSO A;  4UV8 A;  1SA0 B;  5IJ0 B;  1HNW B;  1BT8 A;  3UCS C;  2WLI A;  4CS4 A;  3PJS K;  4DR3 O;  1SQB H;  2F4V B;  4JYA B;  1SQQ H;  1OCO C;  3STZ C;  2PZS A;  2E76 B;  4LFC B;  1Q43 A;  4NTY A;  5EZY B;  1RPO A;  2IH1 C;  2C2A A;  2QDO A;  4B3R O;  3JAW B;  3FD9 A;  4ASU G;  5LMU B;  2PYJ A;  3WB1 A;  2RJZ A;  4LFA B;  3IFX A;  2IW5 A;  4O4I A;  3ETQ A;  1SA0 A;  5IJ0 A;  4CS3 A;  3RN4 A;  3SPJ A;  5IWA O;  1JQ0 A;  1AI7 A;  4PV1 B;  1XNR O;  4DV3 B;  4PDV A;  3SJB C;  3K9A A;  3AK1 A;  2F95 B;  1QHT A;  4N21 A;  4J10 A;  4MTX A;  4NXN B;  4LF9 B;  2D2C B;  2N74 A;  5EZY A;  3ABT A;  4X66 B;  3JAW A;  4JV5 O;  1Z2G A;  3JAM N;  3H9V A;  1M57 B;  1XEQ A;  4MVR A;  4X62 O;  3AG3 B;  3J7A U;  5CA0 A;  4FLY A;  1CPY A;  2O57 A;  2JVD A;  4NKG B;  1S76 D;  3AK2 A;  4IYH A;  2UXC O;  1YCI A;  4UB8 Z;  4DUZ B;  5L3F A;  1R6N A;  3JD2 A;  1SKV A;  3QNE A;  1AR4 A;  1W59 A;  3EHB B;  3OMN B;  4DO2 A;  1D5N A;  4K0K O;  2ETN A;  1BQ0 A;  3BA9 A;  2LGW A;  4DYL A;  4UVB A;  3ZMU A;  4Z1M G;  4Z2W A;  4JYB A;  4N23 A;  1SER A;  1Y6X A;  2LFS A;  1DK1 A;  2N04 A;  4B08 A;  2E75 B;  1B3Q A;  4FZ0 A;  3EVK A;  3G6E V;  2OTJ V;  1S72 V;  2HLD G;  2ZXW B;  5JJE B;  1SZT A;  1SZX A;  4LF8 B;  1S5H C;  3HKE B;  3THO A;  4BIZ A;  1ARO P;  4UCU A;  2VWK A;  1J95 A;  3OUF A;  2Q7E A;  4CS2 A;  2WLJ A;  3OGC C;  4MW8 A;  4JI6 B;  4DXW A;  4JTD B;  4LWS B;  1RM1 C;  3L9D A;  2EIN C;  4DR2 B;  3K58 A;  2OTL V;  4PI2 A;  2UUA O;  4YJ3 A;  4BIU A;  5C8Y B;  2EIM C;  3B40 A;  4NB5 A;  1H2K A;  1Q6I A;  4WFF A;  1FD9 A;  2G38 A;  3VQW A;  4X89 A;  4ZHQ B;  2KG7 B;  3HKE A;  4I4T B;  3N2G B;  1GMG A;  3HPL C;  2ZM6 O;  1Q86 W;  2DOS A;  3ABL C;  1ENV A;  4LWS A;  2QA4 V;  4GT1 A;  3G71 V;  1K3E A;  5CBF A;  4LH7 A;  1K7D A;  2QTO A;  3N27 A;  1S5J A;  1VQ6 V;  1V55 B;  2P6J A;  3CCR V;  3CCV V;  2UUB B;  3ZX6 A;  4DV7 O;  2M7W A;  2KQX A;  1JOY A;  2Y4T A;  1IVS A;  2KG7 A;  4I4T A;  4AIL C;  3N2G A;  1ROP A;  4DW0 A;  1S77 D;  2QWN B;  4JTA B;  4DV4 B;  1FYJ A;  3HB3 B;  4JAS A;  1XL4 A;  3EXA A;  2QJ1 A;  3H1K H;  3U0Z A;  3ICX A;  2HJD A;  3DSQ A;  4JI0 O;  1MNG A;  1V54 B;  5B1A C;  5D5P A;  4JAA A;  3VQX A;  1OCZ B;  4LP8 A;  4I55 B;  4ZBM A;  1ZL8 A;  3ETG A;  3HKC B;  4DW1 A;  2B9Z A;  1XMQ B;  2BTQ B;  5HFL A;  4RQE A;  1HNX O;  3K3W A;  3B8N A;  4DV5 O;  1IBM O;  4MT8 A;  1US6 A;  2H8P C;  4H44 B;  1WJZ A;  5FLX N;  4AQY O;  1PNM A;  1N8R W;  4PDM A;  1THZ A;  4FM2 A;  2GTS A;  2V4D A;  3ZHU A;  3PN1 A;  3HKD B;  3FAV A;  2Y4U A;  1SQX H;  2KKW A;  1IBK B;  1AI5 A;  3ZMT A;  3QO7 A;  4TWK A;  1ZLZ A;  1ZTE A;  3HKC A;  3H1J H;  3WG7 C;  2BTQ A;  5B5E Z;  1K4D C;  4I0X A;  2K9P A;  3CMA V;  4XDL A;  1Q3E A;  3SPI A;  2DWE C;  3K04 A;  1R6K A;  1I5X A;  4A5U B;  1P84 F;  1KUQ A;  4WFE A;  4PJ0 Z;  4JI1 O;  3RWR D;  4X1K B;  5IDJ A;  3T1C A;  5H5N A;  4UCR A;  3K5N A;  1Y67 A;  1FJG O;  4LFB O;  3M99 B;  1VEW A;  3OT7 A;  4JTC B;  2DMX A;  1KC8 W;  1BL8 A;  1R73 A;  4FLV A;  3MHS C;  5JWP A;  4DV0 B;  3JYC A;  3FB7 C;  3I55 V;  2RMK B;  4JI8 O;  2WSS G;  4MTF A;  1JJO A;  2IJH A;  4X1K A;  1K97 A;  4NR1 A;  1VAR A;  2IM9 A;  2E74 B;  5GTH Z;  1WNS A;  1H2N A;  5DED A;  1GH6 A;  4J80 A;  4DV1 O;  3T1Y B;  1M9N A;  5EBW C;  4GX0 A;  1X59 A;  3K0D A;  2E5L B;  2W6J G;  2YIB D;  4DR5 O;  2NR5 A;  2JGD B;  2PGG A;  3DXR B;  2VQE B;  2IBZ H;  1P7B A;  1F51 A;  3F7Y C;  3C3S A;  2CDY A;  3FYE B;  2BE3 A;  3CME V;  1VQK V;  1TUB B;  2ITC C;  1RP3 B;  3K0G A;  1BGY H;  3BRC A;  2XAH A;  5DEC A;  2CTQ A;  4F6R A;  2F23 A;  4HZ3 A;  1MAB G;  3AG2 C;  1YIJ V;  3I5D A;  1Y4M A;  3LDD A;  2JGD A;  3IJ4 A;  3DXR A;  3ZJZ A;  3Q4H B;  1RPR A;  2BCC H;  3SPG A;  3WB2 A;  1KP2 A;  3ETD A;  3ZCC A;  3CSX A;  2AGA A;  1Z5V A;  4Q6G A;  3OAA G;  1R3L C;  1MSW D;  2LP7 A;  1VQ9 V;  2JDI G;  3SYA A;  2QSA A;  1XNQ B;  4GX5 A;  1JA8 A;  1SET A;  1SC5 B;  4RUF A;  4P9P A;  2A06 H;  1YJN V;  4D7T A;  1IXM A;  5KLV H;  3JD3 A;  4X20 A;  1XMO B;  1F7Y A;  2B1G A;  2EIL C;  1JMK C;  4O2B B;  5EK0 A;  2UXB O;  2IJI A;  3E22 B;  1N34 B;  1EN6 A;  4DR1 B;  1N32 O;  2HG5 C;  2MK3 A;  3E83 A;  4O4H B;  5BXZ A;  3WFV A;  4DV6 O;  1SQP H;  3E35 A;  2WLK A;  1KYO F;  4FJC C;  2RNB A;  4QE9 A;  5ITZ B;  1HNW O;  2PUS A;  3QO8 A;  4O2B A;  2WA3 A;  4JI7 B;  4JYA O;  2YXL A;  5LHI A;  1NR7 A;  4LC1 A;  4J7J A;  1NH2 B;  2GUZ A;  2V7Q G;  3SR2 C;  1EN5 A;  2KB1 A;  2L6L A;  4O4H A;  5LMN O;  2ZE5 A;  2EBO A;  1H2S B;  1OCR C;  3CD6 V;  2D3O W;  3A8T A;  5KHI A;  4RUE A;  5LGU A;  3C90 A;  2F1M A;  1EZV H;  2VWJ A;  4DV3 O;  3CRA A;  4U3J B;  1VF7 A;  3RYI B;  4I5S A;  4WBN A;  4JI5 B;  5LYJ A;  1A32 A;  1WPB A;  3HR0 A;  4MVQ A;  3ZMS A;  4X64 O;  4MVU A;  4UCV A;  2RQ6 A;  2QGN A;  2DYR C;  1DGS A;  4X66 O;  2GSM B;  3P32 A;  1AI6 A;  2FKX A;  3LDC A;  2UXD O;  4B3S O;  2PI4 A;  2YI8 A;  5KA6 A;  5B1B B;  1R3I C;  4GKJ B;  4X8A A;  3JAS B;  1OCC B;  1U97 A;  4IGG A;  3K79 A;  2YS8 A;  1H8E G;  4PA9 A;  1IBL B;  1LNQ A;  1N33 O;  2Y69 C;  4DUY B;  3A0R A;  1SQF A;  3CEI A;  2WLM A;  4NYK A;  5JJN B;  1AJN A;  2Q7G A;  4LF4 O;  4ZIB A;  3AK3 A;  4QE7 A;  1NH2 D;  4UUJ C;  3DGE A;  2B5U A;  1EFR G;  1KP3 A;  2CUG A;  5CA3 A;  3L70 H;  1GRJ A;  4YHH O;  1G8M A;  1VQM V;  2HVJ C;  1BHB A;  4PEL A;  3OD4 A;  2NN4 A;  1TA8 A;  5L3G A;  1QCE A;  2UUC O;  4RQF A;  3RYC B;  2CAZ C;  4QGP A;  3ETE A;  4NVP A;  3W7W A;  4WF9 V;  1QLE B;  4I9W A;  1YZB A;  5IE9 A;  3QF7 A;  1GAX A;  4FPP A;  4FVM A;  3CRQ A;  4DR4 B;  4PA7 A;  1PPJ H;  3RBZ A;  4O4I B;  1YEW A;  3W7X A;  5IT9 N;  4D7S A;  4UFZ A;  2A0L A;  4TQF A;  4JI6 O;  1DF4 A;  2OIE A;  3CJH B;  3TGU H;  3RYC A;  1FFT B;  4DR2 O;  4CH6 A;  5LXT A;  1QNM A;  2EZO A;  1FXK C;  1IZ3 A;  3T4D A;  3LSU A;  3BAA A;  3SPC A;  4JI3 B;  4R50 A;  1HP8 A;  3G4S V;  1M4U A;  2QR4 A;  1ZWI C;  2QEX V;  3X2Q B;  3EFF K;  4LBE C;  3ZHR A;  1BMF G;  3BEH A;  2EIJ C;  5CA0 B;  2H3O A;  3CJH A;  1N0N A;  2XT9 A;  3M7M X;  2GHY A;  2X6B A;  3CE2 A;  5BZB A;  1WN7 A;  1VF6 C;  4UCS A;  5DN6 G;  5KHG A;  4LF5 B;  5B66 Z;  5KX5 B;  1TVK B;  5C93 A;  1M56 C;  3U11 A;  3H1L H;  1GN2 A;  1WA8 A;  1X4T A;  3ASO B;  1JCH A;  1N36 B;  5BY1 A;  3P30 A;  3OR7 C;  3CB2 A;  1XL6 A;  1MMM A;  3WG7 B;  5CA1 B;  3FB5 C;  1HW7 A;  1MA1 A;  5HFM A;  2XOK G;  3ZRS A;  2YUA A;  3CX5 F;  3VOU A;  3RT3 C;  5KX5 A;  1TVK A;  3OM3 B;  4HAM A;  3FFQ A;  4GYC B;  2YXH A;  5JCO C;  1IXB A;  4BR6 A;  4BW9 A;  2Q4P A;  4HNA A;  2A9H A;  3K5O A;  2JGU A;  5CA1 A;  2WLN A;  2VRZ A;  1PL0 A;  1UPG A;  5JJJ B;  3C3T A;  5LP6 B;  4FLZ A;  2R72 A;  1HR0 O;  5IJ9 B;  1BZK A;  1D2D A;  3K5L A;  4YJ3 B;  1OV9 A;  4DR6 B;  4NXM O;  4JZG A;  3B8M A;  1E1Q G;  5CN0 A;  3CCJ V;  4NTX A;  3FKS G;  3BFR A;  4X1Y B;  1GN3 A;  3ZBH A;  1JX9 A;  2OCC B;  1F4M A;  2P22 C;  3ZHQ A;  5H6R A;  5LP6 A;  4B7E A;  3QO5 A;  4BAY A;  4MVM A;  5JH7 A;  1F23 A;  5IJ9 A;  1S0V A;  4PA4 A;  5LHG A;  1IX9 A;  4J11 A;  5J2U B;  3OMA B;  3OTF A;  3APQ A;  2CGN A;  3A0B Z;  5B3S C;  4GKK O;  1AJQ A;  2VS0 A;  4L87 A;  4X1Y A;  5H9C A;  4DR3 B;  4RWU A;  2OYQ A;  4E2L A;  2IU0 A;  5BR8 B;  2HFE C;  3T4Z A;  1AIL A;  2EIK B;  2W0F C;  3R66 A;  4IIJ B;  3AG4 C;  5H6Q A;  5CBH A;  1TUE B;  3T1H O;  3D8C A;  1MG1 A;  5J2T B;  4B3R B;  3QG5 A;  4JGS A;  5J2U A;  3CXH F;  1HDJ A;  3ABK C;  3ZHV A;  4G28 B;  4LCU C;  1ZL8 B;  1KB9 F;  2LGQ A;  1J5E O;  3FX7 A;  3LNM B;  4PA6 A;  2GDS A;  1URF A;  3MDS A;  3O65 A;  1S5L Z;  2H94 A;  5CBG A;  2IH3 C;  2DQ3 A;  1TAE A;  1XNR B;  4IIJ A;  1Q5O A;  5J2T A;  3FAV B;  4LF6 O;  5E1A C;  1VQ4 V;  1MOF A;  1CEZ A;  3ZMZ A;  4X62 B;  3SYQ A;  2P7T C;  4I0X B;  5K1P A;  5B1O A;  4ZKI A;  3AG1 B;  1DLB A;  2P90 A;  2UXC B;  1NR1 A;  1PV0 A;  2XAQ A;  4JAU A;  4EKW A;  4GX2 A;  2JEX A;  2X7R B;  3D3Q A;  3UO2 A;  3SDL A;  1K9M W;  1PNK A;  1RFY A;  4X65 O;  4P2Z A;  3IGA C;  4PI0 A;  4K0K B;  3ZRW B;  1JFF B;  2BSK B;  3KCX A;  1OJH A;  4OPA A;  4E4E A;  3KG2 A;  1GN6 A;  3BCC H;  4DRX B;  2DYS B;  1GM9 A;  4PHZ A;  3ZMV A;  1P7G A;  2WPD G;  2B1I A;  3F5T A;  1VQL V;  2HKO A;  1SQG A;  3APO A;  3LNN A;  3SPH A;  1XUQ A;  3TXS A;  2X6C A;  4GX1 A;  1M57 C;  1I94 O;  2VQF B;  3AG3 C;  3GVM A;  3JD0 A;  3TCU A;  4DR1 O;  1H2M A;  3ZRW A;  1P49 A;  4B3T O;  4IHJ B;  1JFF A;  2BSK A;  3RGB A;  1WAZ A;  4J42 A;  3BPZ A;  3CHX A;  3OUS A;  3ASN B;  4DRX A;  4DV2 O;  5BMV A;  2MW2 B;  4AI8 A;  3J81 N;  2ZE8 A;  3K57 A;  4JI7 O;  2DJV A;  4CZZ A;  2QKS A;  1WB8 A;  2IJJ A;  1O9H A;  4JI2 O;  4EFB A;  4UCT A;  1DF5 A;  4OXS A;  4JI4 O;  2HVK C;  1R3K C;  1NBM G;  2RDC A;  3L74 H;  3CPW U;  4YY3 B;  1SRY A;  4IHJ A;  4MTG A;  1VQ8 V;  2ZM6 B;  2CTP A;  1JPX A;  3RW0 A;  4F6R B;  4R8C A;  1KU9 A;  3G6B A;  5F2V O;  1VMG A;  4CH4 A;  1VF5 B;  1KEC A;  4IT5 A;  4LNU B;  2X0L A;  2ZXW C;  1VQP V;  2FML A;  4JI5 O;  2WLL A;  4DV7 B;  2ADQ B;  2AXT Z;  1WP8 A;  1R6T A;  2QM7 A;  5GON B;  1ORQ C;  4TV9 A;  1L0N H;  1H38 A;  5EIB D;  3WB0 A;  4FZ1 A;  1G6U A;  3OW2 U;  3ZED A;  4LNU A;  4GKJ O;  2JJ1 G;  5IYD O;  3BHP A;  4JI0 B;  5IY5 B;  4X20 B;  4TQD A;  3N2K A;  1IBL O;  3LSQ A;  3B4S A;  4DUY O;  1JJ2 U;  2PI5 A;  4QIW F;  1GKF A;  2LJ2 A;  2BOB C;  3BAB A;  5GON A;  4P30 A;  1KKC A;  2ZDI C;  5KAF Z;  1OCO B;  1BSM A;  2FYU H;  4AQY B;  2LFR A;  4CH3 A;  3DC5 A;  2ZIN A;  1V55 C;  3G80 A;  1ZSP A;  2YC0 A;  4MW3 A;  3CXC U;  5FL7 G;  2XUM A;  2XTA A;  2ILM A;  3L72 H;  1B06 A;  3DTU B;  1HNZ B;  3BVO A;  4FK5 C;  3CRC A;  1NJI W;  3D36 C;  2LQT A;  2ZE6 A;  3S3X A;  4W4K A;  1D5A A;  5L3B A;  1I5Y A;  3JAR B;  2GUZ B;  4UB6 Z;  1EM1 A;  3SJQ C;  1XIL A;  1FXK A;  1GK9 A;  5AG2 A;  1NTK H;  3UT5 B;  3ABU A;  2QWQ B;  3K03 A;  1V54 C;  2M6Y A;  4DR4 O;  2ZQM A;  1OCZ C;  2P4K A;  4H33 A;  3FB8 C;  4EB6 A;  1GTO A;  1K92 A;  3UM7 A;  3LUT B;  4LFB B;  1NKD A;  1CP9 A;  5KHH A;  2F4V O;  1OHH G;  1K5S A;  3CC4 V;  2A7W A;  3RYH A;  4EEQ A;  4WBN B;  3QTC A;  5LYJ B;  5IYB O;  4LFC O;  3JAR A;  2Q67 A;  2PTM A;  2YSU B;  4MVO A;  1H2L A;  4JI3 O;  3UT5 A;  2CK3 G;  4KL1 A;  4JI8 B;  4I9Q A;  1BQZ A;  2N05 A;  5LMU O;  2QM8 A;  2FTK A;  2YDE A;  4LFA O;  3JCU Z;  2UXN A;  4PD4 F;  3B09 A;  5KAI Z;  1YTF B;  3CC2 V;  1XI1 A;  2YID A;  1Z5W A;  3JAT A;  2XAS A;  4O4J A;  1LR1 A;  4BIO A;  4NXN O;  5LBQ A;  4LF9 O;  4LF5 O;  1QVG U;  3JAL B;  3WU2 Z;  4LF7 B;  2WAM A;  2GTA A;  2ZIM A;  4L8J A;  3R65 A;  1N36 O;  2ARH A;  4KUM A;  3JD4 A;  4PDR A;  1AR5 A;  4OX9 B;  5JCO A;  2Y0P A;  2XAJ A;  2HHH B;  4P9O A;  4IL6 Z;  1K8A W;  2UU9 B;  4DUZ O;  1QU7 A;  4MVS A;  4GZR B;  4OGQ B;  2DQ0 A;  3K08 A;  1MZF A;  1QR8 A;  1RM1 B;  2EIN B;  2QE7 G;  3JAL A;  4GCZ A;  3ZRV A;  4KHP B;  1YHQ V;  1BS3 A;  4ZOL B;  2DWD C;  2EIM B;  3U10 A;  3OR6 C;  4B3M B;  2OT5 A;  5KHJ A;  4YIP A;  4FLT A;  3SJC C;  1AR1 B;  1GM8 A;  3OTO B;  1M90 W;  3W7U A;  2CTR A;  2RN9 A;  5LXT B;  3CWB H;  3ABL B;  4U7O A;  1YTF D;  1L1F A;  3K5M A;  2WA4 A;  3SYC A;  4FFB B;  3VQV A;  4ZOL A;  1I7F A;  4AHC A;  1FXH A;  3K9S A;  3H1H H;  4LF8 O;  2DE0 X;  1QLN A;  2QKC A;  4ABM A;  4TV8 A;  1PKX A;  4MTO A;  5CB4 B;  4LR3 A;  2Z3Y A;  4F6E A;  4X1I B;  2V1D A;  1N32 B;  5LHH A;  2ITD C;  4WFH A;  5LGT A;  4DV6 B;  3CP1 A;  4H13 B;  1QR9 A;  4UVC A;  1COW G;  4J9Z B;  2FB5 A;  1NVP B;  3T2M A;  1YSC A;  3F5W C;  4CH5 A;  1Q82 W;  2ADP A;  4FFB A;  5L3C A;  2IJK A;  5B1A B;  3ABM C;  1WA8 B;  2EJ7 A;  3ZHS A;  2NLJ C;  3TET A;  4JF3 A;  4Z1V A;  5KUM A;  2Q9L A;  2R9R B;  2KSD A;  5BR8 O;  4KP4 A;  3MHH C;  5CB4 A;  2PY5 A;  2QKA A;  4F4L A;  3TK1 A;  1FPO A;  5A2Q N;  4X1I A;  3SJA C;  1NZ6 A;  2AHZ A;  3OMI B;  3GWK C;  4EFE A;  2NNU A;  4I7Z B;  5LMN B;  4B7K A;  3SGI A;  4K8X A;  4HBN A;  1LUV A;  1AB3 A;  2UUB O;  5LL6 Y;  1FAF A;  1M1K W;  1YF2 A;  4HNA B;  1XOU A;  1NTZ H;  3BY6 A;  4ICG A;  3JAK B;  3E8G A;  3RYF B;  3MAQ A;  2LW1 A;  4DV4 O;  3A0H Z;  4FLU A;  4KFM A;  4X64 B;  2WWW A;  2E3C A;  2Z0A A;  1N4C A;  4MVZ A;  1GM7 A;  5FPO A;  2UXD B;  1I08 A;  1Q7Y W;  2X6A A;  4B3S B;  1K33 A;  2Y48 A;  2JK5 C;  2ZT9 B;  4H0L B;  3H1I H;  1XMQ O;  4DR7 B;  4U7N A;  1IDS A;  1N0J A;  2QWR B;  4JYY A;  1H8H G;  3OFN G;  1NVP D;  3JAK A;  4UCO A;  3UO3 A;  3RYF A;  2XAG A;  1N33 B;  2DW4 A;  1FXV A;  2Q73 A;  5K1X A;  2ZR3 A;  2P4V A;  4YJ2 B;  5JH7 B;  4IYI A;  2PYL A;  4LF4 B;  3J80 N;  3B2E E;  1IBK O;  5FPR A;  2R9A A;  2RCV A;  1KQS U;  4YHH B;  2YI9 A;  3W7T A;  2Q0A A;  1AJP A;  3ZIA G;  1E79 G;  3JSL A;  2FL4 A;  2ODM A;  2UUC B;  3DC6 A;  5J9P C;  4XDJ A;  2QTS A;  4YJ2 A;  5B1B C;  1V9P A;  2JJ2 G;  4FLX A;  3L75 H;  2R70 A;  2VQF O;  2F66 C;  2IU3 A;  3F7V C;  1OCC C;  3JD1 A;  1I0H A;  2CE4 A;  3AG7 A;  3CRM A;  3RFR A;  5GTI Z;  1KMI Z;  2DN9 A;  2K1E A;  4DV0 O;  1F4N A;  1MSD A;  1L0L H;  1QBZ A;  1VQO V;  1NTM H;  1ZX3 A;  2Q68 A;  1Y66 A;  4C7U A;  1K73 W;  3H01 A;  5KHK A;  1YIT V;  3AG2 B;  3CC7 V;  1JVM A;  4J7Z A;  5B1N A;  2UXX A;  3ZRX A;  3K06 A;  4YY3 O;  2YEV B;  4RAI A;  3T1Y O;  4H37 A;  4J9Y B;  1CXZ B;  1W2B U;  1YJ9 V;  1GO3 F;  2E5L O;  1QLE C;  5IWA B;  4JPR A;  4I50 B;  4K8Z A;  4DK1 A;  3KKY A;  5L3D A;  2EZP A;  4YXW G;  1VQ7 V;  3VQY A;  3E89 A;  2F43 G;  2P5O A;  5C8Y A;  2VQE O;  1Q6H A;  5KMG B;  4HYO A;  3ZS8 C;  4ZHQ A;  4JV5 B;  2EIL B;  4QPK A;  1Q81 W;  1XBL A;  2JRI A;  1HWY A;  4KXR A;  3OGI B;  1ZAU A;  2YEV A;  3FB6 C;  4QPJ A;  3FYI B;  1BHA A;  1PD3 A;  4I50 A;  1W0J G;  2EUL A;  2ZDI A;  4ZI7 B;  2P06 A;  4OPH A;  4CC5 A;  1KKD A;  1L8D A;  4U3F H;  1WLE A;  1TGO A;  3G67 A;  1UJW B;  5KMG A;  4LH6 A;  1G4Y B;  1AP6 A;  1P4R A;  3X2Q C;  1Q6U A;  2PF4 E;  3ZHT A;  2ZIO A;  4UXN A;  3D36 A;  1PM9 A;  1XNQ O;  3GWO A;  4ZI7 A;  1G1X B;  3JCZ A;  1HR0 B; 
#chains in the Genus database with same CATH homology
 2LFS A;  1OCR B;  1QCE A;  3ASO C;  5L3G A;  4RQF A;  3DTU B;  3AEI A;  3ETE A;  3W7W A;  2Q69 A;  4FK5 C;  4WF9 V;  1EBO A;  1NJI W;  1QLE B;  4I9W A;  1K4C C;  3G6E V;  2OTJ V;  1S72 V;  2HLD G;  2ZXW B;  5L3B A;  1I5Y A;  1SZT A;  4FPP A;  3SJQ C;  1FXK A;  5L3E A;  1GK9 A;  1S5H C;  3ABU A;  4XDK A;  3K03 A;  4BIZ A;  1V54 C;  3CCS V;  2Z5U A;  4PA7 A;  1ARO P;  4TSF G;  2ZQM A;  3RBZ A;  1OCZ C;  1J95 A;  3OUF A;  4H33 A;  2DYR B;  3ML0 A;  3W7X A;  3FB8 C;  2WLJ A;  3OGC C;  4MW8 A;  5EBM C;  4DXW A;  4JTD B;  1GTO A;  2A0L A;  1RM1 C;  1K92 A;  2EIN C;  3UM7 A;  3LUT B;  2OTL V;  1DF4 A;  1NKD A;  3LSS A;  1CP9 A;  1FFT B;  1OHH G;  1K5S A;  2EZO A;  3CC4 V;  1FXK C;  4BIU A;  2EIM C;  5KA5 A;  4WFF A;  5IYB O;  3D3I A;  3T4D A;  4Q20 A;  2WLL B;  5IYC O;  4X89 A;  3SYO A;  3SPC A;  2Q67 A;  2YSU B;  4MVO A;  4WFG A;  1K34 A;  4R50 A;  3G4S V;  2CK3 G;  2Y69 B;  3E86 A;  3MD0 A;  3E8B A;  1ZWI C;  1OZ0 A;  1GMG A;  2QEX V;  2QM8 A;  2FTK A;  4FIP C;  3HPL C;  2UXN A;  1Q86 W;  5EC1 C;  3X2Q B;  3ABL C;  1R3J C;  3EFF K;  1ENV A;  4LBE C;  1BMF G;  3BEH A;  4GT1 A;  1K3E A;  3G71 V;  2EIJ C;  5CBF A;  2QA4 V;  5EC2 C;  1YTF B;  5CMU A;  3CC2 V;  1K7D A;  2QTO A;  1VQ6 V;  1V55 B;  2GHY A;  2X6B A;  2XAS A;  2P6J A;  2HR3 A;  3CCR V;  5BZB A;  3CCV V;  5DN6 G;  2OCC C;  4QJF B;  5LBQ A;  5C93 A;  1M56 C;  2ATK C;  1QVG U;  2M7W A;  3LDE A;  1JOY A;  3ASO B;  1JCH A;  2WAM A;  4UV9 A;  3R65 A;  1ROP A;  4KUM A;  3P30 A;  1S77 D;  3JD4 A;  3CYO A;  3OR7 C;  4PDR A;  1XL6 A;  3GB7 C;  4JTA B;  3WG7 B;  3FB5 C;  3HB3 B;  4JAS A;  1XL4 A;  2XAJ A;  5HFM A;  4P9O A;  2XOK G;  3CCM V;  3ZRS A;  1V54 B;  5B1A C;  2W6I G;  1K8A W;  4FMT A;  1OCZ B;  4LP8 A;  4MVS A;  4ZBM A;  3VOU A;  3ETG A;  2DQ0 A;  3K08 A;  1QVF U;  2R9I A;  1QR8 A;  1RM1 B;  2EIK C;  2EIN B;  2QE7 G;  3CCL V;  3OM3 B;  4HAM A;  4GCZ A;  5HFL A;  4RQE A;  3ZRV A;  3K3W A;  3B8N A;  1YHQ V;  4PDL A;  1B6Q A;  4MT8 A;  1VQ5 V;  2A9H A;  1FXK B;  2DWD C;  2EIM B;  2H8P C;  3OR6 C;  3E8H A;  1PNM A;  1E1R G;  1N8R W;  2OT5 A;  2WLN A;  1KD1 W;  4PDM A;  1THZ A;  4R7C A;  3ABM B;  1PL0 A;  1AR1 B;  1AI4 A;  1GM8 A;  1WPX A;  4WFB V;  1M90 W;  4PA3 A;  3W7U A;  1AI5 A;  3ZMT A;  3QO7 A;  4TWK A;  3IC7 A;  3ABL B;  4U7O A;  1YI2 V;  1YTF D;  3WG7 C;  1L1F A;  2EIJ B;  5DM6 V;  1K4D C;  3SYC A;  3B8M A;  3CMA V;  2BOC C;  1E1Q G;  4XDL A;  5GW7 A;  5CN0 A;  3CCJ V;  1FXH A;  3FKS G;  3SPI A;  2DWE C;  1QLN A;  3ZN1 A;  1JX9 A;  2OCC B;  3K04 A;  1F4M A;  1R6K A;  1I5X A;  1PKX A;  4MTO A;  1M56 B;  5H6R A;  4WFE A;  2JIZ G;  3QO5 A;  5IDJ A;  2Z3Y A;  3T1C A;  4BAY A;  4MVM A;  2V1D A;  1F23 A;  1S0V A;  1VQN V;  4PA4 A;  5LHG A;  4G27 B;  5LHH A;  2ITD C;  4RO2 A;  3M99 B;  3AG1 C;  5LGN A;  3VBB A;  4WFH A;  5LGT A;  4JTC B;  3OMA B;  3CP1 A;  1KC8 W;  1QR9 A;  4UVC A;  1COW G;  4J9Z B;  1BL8 A;  2JEU A;  1R73 A;  5B3S C;  1NVP B;  3T2M A;  1YSC A;  3F5W C;  1Q82 W;  3MHS C;  4UVA A;  2WLH A;  1AJQ A;  5L3C A;  2IJK A;  5B1A B;  3ABM C;  3JYC A;  3FB7 C;  3OE7 G;  4L87 A;  2NLJ C;  3I55 V;  3TET A;  4JF3 A;  5H9C A;  4WCE V;  3CCE V;  5KUM A;  4E2L A;  2R9R B;  3NXS A;  2Q6A A;  2WSS G;  2IU0 A;  2HFE C;  3T4Z A;  2EIK B;  4MTF A;  1SES A;  2W0F C;  3MHH C;  4KP4 A;  2ZR2 A;  2IJH A;  1K97 A;  3AG4 C;  5H6Q A;  4F4L A;  5CBH A;  3TK1 A;  1TUE B;  3E2E A;  1MG1 A;  2AHZ A;  3OMI B;  3OEE G;  1DTO A;  4JGS A;  2NNU A;  3ABK C;  4G28 B;  4LCU C;  4G2K A;  3CCQ V;  2DYS C;  1M9N A;  5EBW C;  4GX0 A;  3LNM B;  4PA6 A;  3K0D A;  2H94 A;  5CBG A;  1M1K W;  2W6J G;  2IH3 C;  2DQ3 A;  3BY6 A;  4JAV A;  2HJF C;  4MS2 A;  3E8G A;  4MSW C;  1S3J A;  4QNH B;  1NQT A;  3ZN0 A;  1P7B A;  1F51 A;  4KFM A;  3F7Y C;  2WWW A;  3FYE B;  4X88 A;  3CME V;  4MVZ A;  3I56 V;  1VQK V;  1GM7 A;  2AHY A;  5E1A C;  2A79 B;  3STL C;  1VQ4 V;  1MOF A;  2ITC C;  1Q7Y W;  2X6A A;  3ASN C;  1CEZ A;  3K0G A;  1K33 A;  2Y48 A;  3ZMZ A;  2JK5 C;  2XAH A;  3SYQ A;  2P7T C;  4HZ3 A;  4U7N A;  1H2G A;  5B1O A;  3AG1 B;  4ZKI A;  1MAB G;  3AG2 C;  1DLB A;  3B77 A;  1H8H G;  3OFN G;  1YIJ V;  1PNL A;  1NVP D;  1Y4M A;  3LDD A;  2P90 A;  3OEH G;  2P67 A;  3ZJZ A;  1NR1 A;  4JYC A;  2XAQ A;  4JAU A;  2XAG A;  4EKW A;  5B3S B;  2EJR A;  2DW4 A;  2JEX A;  4GX2 A;  1RPR A;  2X7R B;  1FXV A;  3SPG A;  1FS0 G;  1KP2 A;  2ZR3 A;  3ETD A;  4R6Z A;  1EZJ A;  3ZCC A;  1K9M W;  1PNK A;  2XAF A;  4P2Z A;  4TT3 G;  3OAA G;  1R3L C;  3IGA C;  2LP7 A;  3SYP A;  1VQ9 V;  1MSW D;  2JDI G;  3SYA A;  4BW5 A;  3AG4 B;  3ZRW B;  4GX5 A;  5KUK A;  1KQS U;  1YJW V;  3UKM A;  1SET A;  1W0K G;  3E8F A;  4P9P A;  4RUF A;  3W7T A;  1YJN V;  1AJP A;  3ZIA G;  1IXM A;  3ABK B;  3JD3 A;  1E79 G;  3KG2 A;  2WLI B;  5EBL C;  2DYS B;  1GM9 A;  2B1G A;  2EIL C;  3ZMV A;  2WPD G;  2B1I A;  5EK0 A;  1VQL V;  5J9P C;  2HKO A;  4XDJ A;  2ZD9 A;  1K5Q A;  4CBC A;  2IJI A;  3SPH A;  2X6C A;  4GX1 A;  1M57 C;  5B1B C;  3RVY A;  2JJ2 G;  3W7S A;  3AG3 C;  3JD0 A;  4WFA V;  3TCU A;  2HG5 C;  2IU3 A;  2MK3 A;  3F7V C;  3E83 A;  1OCC C;  2XND G;  3WFV A;  3RVZ A;  3JD1 A;  5IY5 C;  3ZRW A;  4XBF A;  3E35 A;  2WLK A;  4FJC C;  3CCU V;  2K1E A;  4QE9 A;  4UV8 A;  1F4N A;  3OUS A;  3ASN B;  2WLI A;  1QBZ A;  1VQO V;  3PJS K;  3QO8 A;  2Q68 A;  1Y66 A;  1OCO C;  3STZ C;  1K73 W;  3H01 A;  1YIT V;  3AG2 B;  4CZZ A;  5LHI A;  2QKS A;  3CC7 V;  2IJJ A;  1NR7 A;  4LC1 A;  1RPO A;  1NH2 B;  1JVM A;  2V7Q G;  2IH1 C;  2C2A A;  1DF5 A;  2KB1 A;  4OXS A;  2HVK C;  1R3K C;  1NBM G;  5B1N A;  3CPW U;  2UXX A;  3ZRX A;  1SRY A;  2EBO A;  4ASU G;  3K06 A;  2YEV B;  1OCR C;  4RAI A;  4H37 A;  3CD6 V;  2D3O W;  4J9Y B;  4MTG A;  1VQ8 V;  3IFX A;  1JPX A;  2IW5 A;  3RW0 A;  1W2B U;  4R8C A;  1YJ9 V;  1GO3 F;  4RUE A;  5LGU A;  1QLE C;  3SPJ A;  4JPR A;  1KEC A;  1JQ0 A;  2X0L A;  5L3D A;  1AI7 A;  2EZP A;  2ZXW C;  4YXW G;  1VQ7 V;  4PDV A;  3K9A A;  3E89 A;  2F43 G;  1VQP V;  4N21 A;  4I5S A;  4MTX A;  4MVQ A;  3ZMS A;  4MVU A;  2WLL A;  3ABT A;  4HYO A;  2DYR C;  2EIL B;  2QM7 A;  2GSM B;  3P32 A;  4QPK A;  1Q81 W;  1AI6 A;  1HWY A;  1ORQ C;  3LDC A;  1H38 A;  2YEV A;  3FB6 C;  2PI4 A;  4QPJ A;  3FYI B;  5KA6 A;  5B1B B;  1M57 B;  4MVR A;  1R3I C;  3OW2 U;  1BHA A;  3AG3 B;  1PD3 A;  1W0J G;  4X8A A;  2JJ1 G;  2ZDI A;  1OCC B;  1CPY A;  5IYD O;  5IY5 B;  1S76 D;  3K79 A;  1KKD A;  1H8E G;  1WLE A;  4PA9 A;  1LNQ A;  2Y69 C;  5L3F A;  1UJW B;  3LSQ A;  1JJ2 U;  1R6N A;  3A0R A;  2PI5 A;  4QIW F;  2WLM A;  1G4Y B;  1AJN A;  1P4R A;  3JD2 A;  3X2Q C;  1GKF A;  2BOB C;  4P30 A;  2ZDI C;  1OCO B;  3QNE A;  3EHB B;  3OMN B;  4QE7 A;  3D36 A;  4UXN A;  1NH2 D;  4UUJ C;  4DO2 A;  2LFR A;  2B5U A;  3DGE A;  1EFR G;  1KP3 A;  1V55 C;  4UVB A;  3ZMU A;  5CA3 A;  4Z1M G;  4MW3 A;  1G8M A;  3CXC U;  2HVJ C;  4JYB A;  4N23 A;  1VQM V;  1SER A;  1BHB A;  3GWO A;  5FL7 G;  3JCZ A;  4PEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...