4QE9A

Open mthk pore structure soaked in 10 mm ba2+/100 mm k+
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
83
structure length
83
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Calcium-gated potassium channel MthK
publication title Ionic interactions of Ba2+ blockades in the MthK K+ channel
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 31
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qe9A00
3OGCC 5KUKA 2A79B 2HJFC 4MTOA 2W0FC 3AG4C 3X2QC 1BL8A 2WLLA 2X6CA 4EKWA 2WLHA 3K0GA 4J9ZB 4WFGA 3LDCA 4RAIA 4MVOA 3TCUA 2ITDC 3LDEA 4MW8A 4PDLA 4GX5A 1M56C 3FB5C 2H8PC 4MS2A 1V54C 4XDKA 5J9PC 2HFEC 4GX0A 3TETA 3T4DA 3E8HA 4G28B 4MSWC 3UM7A 5EK0A 5CBHA 3ASNC 4PA3A 4H37A 1LNQA 4MVQA 4MVRA 2X6AA 3ABKC 3IFXA 3VOUA 3OUFA 4PDRA 4DXWA 5BZBA 1OCZC 3UKMA 1P7BA 2YEVA 2EILC 1XL4A 4QNHB 3F7VC 3E83A 4XDJA 5IY5C 4R7CA 1J95A 2Q67A 4BW5A 1JVMA 3AG3C 2WLNA 3LUTB 3OUSA 4GX2A 3OR6C 4HYOA 4HZ3A 4KFMA 5EC2C 3STZC 5EBLC 3K0DA 4LCUC 3SPIA 4P30A 2Q68A 4XDLA 1OCCC 4GX1A 4PA6A 2DYRC 4P9OA 3RVYA 3SPHA 4WFFA 3RBZA 3ABMC 3LDDA 1K4CC 4WFEA 4RUFA 3AG2C 2QKSA 3SYCA 2IH3C 2DYSC 2WLIB 5E1AC 2R9RB 4MW3A 4OXSA 3K08A 2AHYA 1R3JC 3E8FA 3PJSK 4MVSA 3ZJZA 4R6ZA 3FB7C 4P9PA 3WG7C 2ATKC 2OCCC 4LBEC 2ZXWC 3K03A 2IH1C 4JTAB 3AG1C 4I9WA 4PA4A 5EBWC 4PA9A 3SJQC 3E8BA 4R50A 3SYOA 1G4YB 2A0LA 3JYCA 2K1EA 4LP8A 3GB7C 2Q69A 1K4DC 2WLJA 3LNMB 3OR7C 4RUEA 2EINC 2ITCC 3ASOC 4PA7A 3K06A 1XL6A 2Q6AA 3E8GA 2ZD9A 5B1BC 2WLIA 4CBCA 3FB8C 2BOBC 2AHZA 2X6BA 3ABLC 3HPLC 4RO2A 4TWKA 5B3SC 4QE7A 3SYQA 4J9YB 5EBMC 5KUMA 2EIKC 4MTGA 3SYAA 5CBFA 3ZRSA 2WLKA 3RVZA 2BOCC 4MTFA 1ZWIC 3IGAC 2P7TC 1OCRC 3SPJA 4R8CA 4UUJC 1M57C 4ZBMA 3SYPA 3SPCA 2WLLB 3T1CA 3F5WC 4MVUA 2WLMA 4WFHA 3R65A 1S5HC 3F7YC 1ORQC 4PDVA 2A9HA 2EIJC 4P2ZA 5B1AC 3STLC 4MVZA 4JTCB 2DWEC 1R3IC 2HVKC 4PDMA 4F4LA 4X89A 3K04A 3E89A 2EIMC 2KB1A 2Y69C 5EC1C 1R3KC 4X88A 3T4ZA 4X8AA 4G27B 4MVMA 1KKDA 2HG5C 2JK5C 2QTOA 4H33A 3KG2A 5CBGA 1OCOC 4JTDB 4QE9A 3T2MA 2NLJC 3E86A 3FB6C 1QLEC 1V55C 1R3LC 2DWDC 3BEHA 3RW0A 3SPGA 3EFFK 2HVJC
chains in the Genus database with same CATH superfamily
1TUEB 2A79B 3HR0A 1VQMV 1WLEA 4DV3O 3K0GA 4JI8O 5FNVB 4KXRA 1YTFB 1QR9A 4LF5O 1VF6A 2ZE7A 1QCEA 3OUFA 1PPJH 3P3PA 3ZS8C 1N36B 2PI4A 1IXBA 3CWBH 4TOIA 3ZHRA 4IIJA 2VQEB 2Q67A 4BW5A 1AI4A 3AG3C 2N74A 4JAVA 4JI7O 1J5EB 4LCUC 5LGNA 5J2UA 3DC5A 1K5SA 4LC1A 4X1YB 2PGGA 3B2EE 1Y4MA 4KL1A 4QPJA 4Z2WA 1COWG 3FB7C 1VIBA 4IL6Z 3HKCA 3K5LA 5IYCO 1NQTA 1SQVH 3AEIA 1XNRO 1Q6HA 2H94A 1HNXB 4ZKIA 5C93A 2ZD9A 4RO2A 2PF4E 1JJ2U 4JAUA 3SYAA 2ADPA 3ZRSA 4FVMA 5B1NA 2ADQB 3OTFA 5EZYB 3THOA 2P90A 1NZ6A 3MHHC 4R8CA 4DV4B 4AQYO 1AR5A 4UCRA 4DYLA 1XNQB 2ZNJA 4J11A 2ZIMA 3ZRWA 1MZFA 1TGOA 4NKGB 5AG2A 2GDSA 4WBNA 4CC5A 4DR2B 4QE9A 2UUBO 3RW0A 2HHHB 2UUCB 2IJIA 2W0FC 3X2QC 3JCZA 3JASB 3M99B 2VRZA 1N32O 1H8EG 3G4SV 1I94O 2HFEC 3T4DA 3UM7A 1OZ0A 3D3IA 4FMTA 4H37A 4O4JA 2F93B 3BCCH 1GRJA 1ZL8B 1VF7A 4B7KA 1S72V 3AG2B 2NR5A 2D3OW 2DYSB 1D2DA 1WB7A 4X9QA 2JGDB 1S77D 3ZN0A 1JR9A 4HZ3A 1QVFU 4YJ3B 4JV5O 3CS5A 2IU3A 3CD6V 2AXTZ 1H2NA 3JSNA 3QVNA 3ZCCA 4DR6B 1YXBA 3E22B 5HFMA 2UUAO 3DSQA 5B1BB 4DUZO 5JH7B 4DW1A 1Q86W 4UFZA 3AK1A 1QLNA 1IBKO 3AG1C 2HJDA 1AB3A 4DR7O 3D3QA 4OPHA 3QNEA 5DEDA 5GW7A 3FB8C 1D5NA 5B1AB 5B3SC 1XMOB 5LA6A 5D5QA 2Q7EA 5LP6C 3RYCA 1L1FA 3BA8A 1FXKB 4E2LA 3B40A 1M57C 3SYPA 1A32A 2P4VA 3CC4V 1L8DA 5JJEB 2WLMA 3HKDB 4DV7O 1JOYA 3CYOA 3CCQV 1RSOB 1NTKH 5LHIA 1S76D 5JJJB 3HKEB 1BGYH 3I56V 5CA0B 1V54B 1XQ8A 1LUVA 1PKXA 2GBOA 1IVSA 4LF7O 1M1KW 2YXYA 1WP7A 1KU9A 3G80A 1SQBH 1AI7A 5LMUO 4X62B 1MZEA 5LMNO 1WB8A 3TCUA 4PI2A 1MSWD 1BE3H 4GX0A 4U3FH 4UCVA 1H2KA 3ASNC 4DV6O 2DJVA 2ZE5A 1BT8A 4JI0O 3ABKB 3UQ8A 4I0XA 3OD4A 4JZGA 2Y48A 1HW7A 3OR6C 1CEZA 1YHQV 3ABUA 5EBLC 1FPOA 5LXTA 2OTLV 4XDLA 3SPHA 4LWSA 5LL6Y 3JD1A 3SYCA 2ETNA 3PJSK 1SS3A 1MNGA 3H1KH 3SGIA 3JATB 3KKYA 3K03A 1XMQB 4YXWG 4AHCA 2JS3A 1R1BA 1NR1A 4JZ2A 2FB5A 1K97A 4FFBA 3ZHQA 2M7WA 2QWNB 4DRXB 4FLUA 2BTQB 2EJ7A 1YJWV 1N4CA 3JALB 2DQ3A 3JARB 2QTSA 1GN4A 3JSLA 5JCOC 3A8TA 1Q43A 4JAAA 3AG4B 1Q6IA 2N05A 4MVZA 4DK1A 2DWEC 1JJOA 2W6IG 3UO2A 2Y69C 1R3KC 1XILA 5KHIA 3RYHB 1V55C 2EIMB 5KUKA 4G2KA 3OT7A 1NVPD 2EILB 2BCCH 1K34A 1SF9A 2QM7A 3W7TA 5J2TA 5C8YB 1GN3A 4JI1O 5LHGA 5BY1A 1BMFG 3CCRV 4FK5C 2BE3A 4PA3A 4B3RO 3W7XA 4OX9O 2CH7A 2F23A 5BXZA 4GX2A 5B66Z 1OHHG 3ZMVA 4BR6A 5BR8B 4CH5A 4K0KO 1OCCC 2DYRC 1M93A 3IC7A 1M4UA 3LDDA 4I55A 4U7OA 4HNAA 4IYHA 3JCUZ 3G6BA 1F23A 3WG7C 2HEPA 5FLXN 1XDCA 1YTFD 1HNWB 2B5UA 1K9MW 3K57A 5KLVH 2IU0A 4O2AB 3GB7C 2PYLA 1QU7A 1TAEA 4PJ0Z 1K7DA 2QWOB 2EIJB 3ABLC 5KMGB 2ZDIA 4NTWA 2XUMA 2VQFB 3CJHA 1FJGO 4MTGA 3TXQA 2QKCA 2XAFA 4OPAA 1SZTA 1VQOV 2AZ0A 3SPCA 4MVUA 5F2VO 5CA0A 2FKXA 3KCYA 5KAIZ 1PP9H 3BHPA 2XAGA 3D36C 4X20A 3ETGA 3T2MA 4JI3O 4JI2B 2F43G 3JAMN 3FKSG 5EC2C 2YSUB 1QHTA 4B3MB 2QWPB 1JPXA 1EZJA 5DN6G 3LDEA 1VF6C 3Q4HA 5K1XA 2QM4A 2UXXA 3APQA 2H8PC 4GKJB 1D5AA 4DO2A 4DR1O 4LFAO 4MSWC 3G6EV 3CXHF 3W7UA 4MVRA 1B06A 1VQ5V 5LYJB 3VQVA 1N0JA 1AP5A 1X4TA 1ZLZA 1SQQH 2E75B 4PELA 1DK1A 4LF4O 1Y66A 3S3WA 5IY5C 1B04A 1NT2B 4DR3B 3U0ZA 1JVMA 3WU2Z 4Z1MG 1FD9A 4DUYO 3QF7A 2V4DA 1U96A 2KG7B 3DXRB 2UXDB 3QO7A 1EFRG 1PNLA 2R9RB 3BRCA 1Y6XA 2K9PA 5IDJA 1N34O 4WF9V 4ZI7B 2EBOA 2OCCC 3ZMTA 3QTCA 4LBEC 2YICA 2QKAA 2XASA 4UCOA 4I9WA 1WJZA 3ZBHA 1FYJA 1GMGA 4NXNO 3CRAA 3K06A 3OTOO 3JD4A 1RPRA 1AROP 1TVKA 5BMVA 3CCLV 2LGWA 4TWKA 2OCHA 3ASOB 2BTQA 1RM1B 4LF9O 4F6EA 3CCVV 1KYOF 4F6RB 4JI7B 5H6RA 2BOCC 1FFTB 1IBMB 1OCRC 1QVGU 3F5TA 1IBLO 1THZA 4UVAA 4JI6O 3F5WC 3R65A 1NVPB 1QNMA 2A9HA 5KHJA 2LQTA 1DLBA 2IW5A 2NNUA 4ZOLB 1R3IC 2KB1A 1F7YA 4LF6B 4MVMA 1KKDA 1JMKC 3KZIZ 2UXCB 2NLJC 2EX3A 1XNRB 1BS3A 4GLXA 2HVJC 2HJFC 5IYZB 1Z2GA 2ILMA 4J9ZB 4YHHB 3AG3B 2YC0A 4MW8A 5B1OA 4GX5A 3B4SA 4O4LA 4ZHQA 3ZRXA 4MVQA 3VOUA 3MHSC 4DXWA 3BA9A 1VARA 2YEVA 3RT3C 1SKVA 3NR7A 2PYJA 1M5IA 1EM1A 4UXNA 4O2BB 3RYIB 3M7MX 4UB6Z 4FM2A 2WAMA 2RMKB 2YXHA 2QA4V 2DMXA 3ZHSA 5A9GA 3MDSA 2Y0PA 1KP3A 5JVDB 1I5YA 2WLIB 4CS2A 4UCTA 5E1AC 2R9IA 2AHYA 2E74B 1TUBA 4H0LB 4PHZA 3HKBB 1N32B 1G6UA 1E79G 4JI5B 5TISZ 4PV1B 4BAYA 5KHHA 5GONA 3K5OA 1BCCH 4L8JA 4CBCA 2WPDG 2ZIOA 3SYQA 1Q82W 1H2SB 5EBMC 5LGTA 4PI0A 3OGIB 2GSMB 4JV5B 5H9CA 1S5JA 3GVMA 3QO5A 1LUWA 3BAAA 4O4IB 4UV9A 2YUAA 2NN4A 1I7FA 1SA0B 2UUAB 4DV2B 3DGEA 1JFFB 2RJZA 5CBGA 1P84F 2XNDG 4FM0A 3P32A 4FZ0A 3N2GB 1L0NH 3UCSC 3HPLC 1H38A 4D6TH 4KP4A 1Y74B 1OCOB 2EULA 4L87A 2E3CA 4LNUB 5CA1B 1KMIZ 3FX7A 1BZKA 3CCMV 3ML0A 3ZEDA 4XDKA 2IBZH 4QJFB 4PDRA 4EFBA 1OCZC 2V7QG 2YIDA 3F7VC 4DV7B 4DV1B 2JJ1G 2WSSG 1K3EA 5IJ9B 4H13B 4U3JA 4E4EA 5KX5A 4I5SA 3AG1B 4X1IB 3RVYA 4NXMB 1SC5B 3B09A 2XAJA 4WFEA 2KKWA 3VBBA 4RUFA 5B5EZ 2IJKA 3AK2A 1YI2V 2O57A 1FFXB 4R6ZA 4K35A 5B3SB 5LP6B 1F4MA 2ATKC 1KECA 1W0KG 4JTAB 2Y4UA 4TT3G 5CMUA 4TV8A 4DV6B 4LP8A 2WLJA 3OR7C 1M57B 3LSSA 2BSKA 4A5UB 1UFIA 2EJRA 4JI0B 3HB3B 2Q6AA 1O9GA 5IWAO 2QEXV 1GKFA 1R73A 4BWAA 1OJHA 4D7SA 1VQ8V 5ITZB 3T1HB 3JD3A 5IJ0A 5KAFZ 1WNSA 4QGPA 4ZBMA 3N2KB 1VQ7V 3CCSV 3T1CA 3CRRA 4JYCA 3WB2A 3FYIB 4P2ZA 4DV5B 3K9AA 4JTCB 2XT9A 2OWOA 4X65B 3CEIA 4I50B 1AR1B 2QE7G 2HG5C 1P7GA 5CB4A 3FAVA 1M90W 3ASNB 3SPGA 3EFFK 2OIGA 1PM9A 2UXNA 3JAWB 3APOA 1IXMA 1BL8A 2WLLA 2X6CA 2Q7HA 4GUNA 4ASUG 2CTPA 4YJ2A 3DTUB 4X1KB 3T1YB 1KUQA 2YIBA 1DF4A 4JI4B 4DV4O 2GUZB 2FTKA 3CRQA 1QR8A 1K33A 1XNQO 3JD2A 2Y4TA 2R70A 4RWUA 1J95A 1Q81W 4DR2O 5FNVA 1AJQA 1EBOA 1WA8B 4J80A 2HHHO 1H2LA 2UUCO 3SPIA 2B9ZA 2LFRA 1NBMG 1GTOA 1NJIW 2QKSA 4IHJB 2RQ6A 3ZHVA 2HLDG 1H8HG 2DOSA 2Q0AA 2Q73A 4PA9A 2GTSA 2XTAA 2YIAA 3OMAB 3E2EA 4FLTA 4X1YA 4KHPO 4B3RB 3UT5B 4EB6B 1HNZO 4OX9B 1RFYA 2ZDIC 3CSXA 4FLVA 2ARHA 2CGOA 4LFBB 4O4HB 4QE7A 5EYPB 2UXBO 1UPGA 2QJ1A 1HWYA 2Y69B 4J7ZA 4DR6O 4MTFA 1ZWIC 2P7TC 1GM8A 3SPJA 1V55B 4UUJC 2LGQA 1DTOA 4YY3B 4WFHA 2DQ0A 1F4NA 4CZZA 5DECA 1I08A 1IDSA 1PL4A 3ETQA 2JS5A 2X7RB 4PDMA 2P06A 2RDCA 2QR4A 2H3OA 5L3CA 3DC6A 2JDIG 4CS3A 2PTMA 4LFCB 1Z5VA 3BEHA 5EZYA 2YXLA 3B8NA 4LNUA 2JEXA 5D5PA 4FLZA 3OE7G 3LSUA 4MVOA 1SRYA 2UU9B 1FJGB 5J9PC 3E8HA 2QWQB 4PD4F 1OCCB 2DYRB 2Q0OC 1SZXA 2X6AA 3ABKC 3CC2V 5BZBA 4H44B 2W0XA 4XDJA 5A2QN 3JASA 1VQKV 4B7EA 3WG7B 4KUMA 2CTRA 1PD3A 4J42A 2BTOA 3JAKB 3ABMC 3RBZA 4BIZA 3IJ4A 1RPOA 4X62O 5H2FZ 2ZE6A 1ZL8A 3A0RA 2JEUA 3E8FA 4TUYB 2PZSA 3ABLB 3O9OA 3RYFB 4I4TB 1LR1A 2MW2B 2JGDA 2IJJA 4LFAB 3C3SA 2CTQA 2LP7A 4YJ3A 2Q7GA 1G4YB 4UV8A 2JGUA 1K4DC 1PNMA 4UB8Z 2EINC 2ITCC 1MABG 2LJ2A 1XL6A 4I9QA 3E22A 4TV9B 4J7JA 4TQDA 4J9YB 5JH7A 5ITZA 2EIKC 1EN6A 2HKOA 1X59A 2JIZG 4JF3A 3BY6A 3N2KA 1XREA 2XAQA 4ICGA 2JJ2G 1IURA 5KHKA 3C90A 1N34B 4N23A 1N33B 2EIMC 2QTOA 1BQZA 3J80N 3TGUH 3E86A 4JPRA 1FXKA 3G67A 2WWWA 2A7WA 3TXSA 1SQFA 4IIJB 5EIBC 3SJAC 5IY5B 3HKDA 3MD0A 2CGNA 4X66O 1RSOA 2DN9A 2R9AA 3HKEA 3TJTA 3GWKC 5JQGB 2E5LO 2C2AA 5IE9A 3W7SA 1BQ0A 4DV0O 1KKCA 1P7BA 1HDJA 4GKKO 1XEQA 1Y76B 1I5XA 1FAFA 2Q4PA 3HKCB 3K59A 1NS1A 3L70H 4FIPC 5E79Z 1AI6A 4B3TO 5DM6V 2OCCB 1AI5A 4P9OA 3H1LH 4LF8O 1WN7A 1XBLA 2FMLA 4JYAO 3OMNB 3LNNA 3P30A 1SERA 2FL4A 2P67A 2WA4A 4EEQA 3K08A 1R3JC 5KHGA 1QBZA 5FPOA 2OTJV 2IM9A 4DR4B 1VF5B 5EBWC 3S3XA 3SJQC 1OCRB 3UT5A 4X64B 4PA7A 5EYPA 5GTHZ 5BR8O 3ZRWB 3VQYA 1US6A 5LHHA 2WA3A 5K1PA 1Q5OA 4DV3B 3VQXA 4WBNB 3ETDA 4NTXA 3I5DA 1E1QG 2L35A 3JATA 4JI8B 3L75H 2X0LA 3H9VA 4LF5B 1VQ9V 1S5LZ 4J41A 5FL7G 1HR0O 3ETEA 4UVCA 4DRXA 1HNWO 2LW1A 3E89A 5EC1C 4X88A 4X8AA 2JK5C 4O4JB 3RN4A 1QLEC 5IT9N 3JALA 3JARA 4IYIA 2RCVA 2AW9A 4RQEA 4EKWA 2VQFO 1MG1A 1KBHA 4RAIA 4B3SO 3H1JH 4MS2A 2ZKOA 3TETA 1JX9A 3K9SA 4D7TA 5EK0A 2LW7A 3RYHA 3WB0A 4CS4A 3IC9A 1VMGA 1RP3B 1W0JG 3LUTB 4JI2O 4FLWA 5C8YA 3STZC 1CP9A 2CAZC 4OGQB 3JAKA 1FXVA 4P30A 4GX1A 1K73W 2ZM6O 2N04A 1K4CC 2MK3A 3CMAV 3ZHUA 2QWRB 2P5OA 1SQXH 5LA6B 4OXSA 4GKJO 4I4TA 3RYCB 4FLYA 1B6QA 4AQYB 2GV9A 2OT5A 1G1XB 3NXSA 4UVBA 2CE4A 2ZXWC 2FYUH 3B77A 2LFSA 5H5NA 1BHAA 1KD1W 4DR3O 3ASOC 1RM1C 2UUBB 3WB1A 2PUSA 2VWKA 1KB9F 4GYCB 2VWJA 1NU1H 1P4RA 2UXDO 1F51A 2KQXA 3QG5A 4LH7A 1I94B 1U97A 4O2AA 3ZMSA 1ROPA 2Q9LA 4WCEV 4MTXA 1VQPV 1UJWB 1SQGA 1XI1A 5KMGA 4X89A 4BW9A 1KQSU 1GM7A 3MAQA 1AP6A 2Q5ZA 3KG2A 3RFRA 4CC6A 2F4VO 3OAAG 1QQCA 3EVKA 1OCZB 1H2GA 3OW2U 4I0XB 5IWAB 2DW4A 3LDCA 1EN5A 4NR1A 3X2QB 1IBMO 5JQGA 1M56C 3ABTA 3FB5C 5LXTB 3FD9A 2Q8VA 4DUZB 4LWSB 1Y76A 5L3BA 1IBKB 1YZBA 1XL4A 2QDOA 4DR7B 4NVPA 2PY5A 1K92A 4LF6O 1PNKA 3M8AA 2WLNA 2UXCO 3OUSA 3OEEG 3SJCC 1FXHA 2ZINA 2Q68A 2CTWA 4JYYA 1R6TA 4YHHO 4FFBB 1M9NA 4DR5O 3SJBC 5LYJA 4MT8A 1GAXA 4MW3A 1DF5A 4ABMA 4MVSA 4YIOA 4P9PA 5H6QA 3ZN1A 4FLXA 4NB5A 3CX5F 4RQFA 4W4KA 2M6YA 3L72H 3QO8A 1I0HA 1H2MA 2F66C 4AI8A 3LNMB 4RUEA 2KG7A 2Z5UA 3DXRA 3OM3B 4LF7B 1WAZA 2X6BA 2RNBA 5LMUB 1NTMH 1YF2A 3O65A 4ZI7A 5LMNB 3RVZA 1MSDA 2AGAA 1FKAO 1W59A 3H1IH 1ZSPA 1N36O 2P4KA 5J2TB 1MMMA 1ORQC 2VQEO 3WFVA 4F4LA 4JI5O 1AR4A 3T4ZA 1J5EO 4F6RA 1OCOC 1VP7A 2HP8A 3K0DA 4PDVA 1CXZB 2QM8A 3PN1A 4KHPB 1HNZB 5EIBD 2CH7B 4WFGA 3CRCA 2Z3YA 1AILA 4PDLA 2UXBB 3K79A 4ZOLA 3CRMA 4K8ZA 3AG7A 2GHYA 3CXCU 3FFQA 4I55B 1LNQA 3IFXA 4HNAB 4DV2O 3UKMA 1HNXO 5IYZA 4N21A 2RN9A 2QGNA 2F1MA 2P6JA 5IYDO 3U11A 4K8XA 3CP1A 1YJ9V 2EZOA 3L9DA 4AILC 3AG2C 3CCJV 2DYSC 2ODMA 2IJHA 4LH6A 3H1HH 1JQ0A 3CJHB 1S3JA 1SESA 2JRIA 1ZAUA 4O2BA 3RYIA 4FJCC 1R6NA 1Q90D 3CCEV 3H01A 3JYCA 3LSQA 3RWRD 5LGUA 4DV1O 2XOKG 2XAHA 3K5MA 5JVDA 5B1BC 2WLIA 4TQFA 4BIOA 1SETA 1YIJV 4NXMO 3J81N 3EHBB 4XBFA 3HKBA 4X20B 2WLKA 3OEHG 3IGAC 4JI1B 3OMIB 2LO1A 1NKDA 4J7KA 2ZQMA 5B1AC 4K3AA 1NH2D 3Q4HB 1FS0G 3K04A 1Z5WA 1YCIA 1FXKC 5L3FA 1XHZA 4JTDB 2YDEA 1URFA 2KSDA 5JJNB 1AVMA 4O4IA 3OGCC 4K0KB 3I55V 1SA0A 3ZX6A 1YEWA 5L3DA 2ITDC 1MA1A 3T1HO 1VQ4V 3CE2A 1TA8A 4JYBA 3L71H 1V54C 1S0VA 1JFFA 2ZR3A 4B08A 4FPPA 4GT1A 1ZUQA 3ABMB 5LOVB 4DV5O 3N2GA 3TK1A 4X65O 2OYQA 4QNHB 1Y74A 3ZMZA 1XMOO 1AJPA 5CA1A 5LBQA 4NYKA 2GTAA 4KFMA 1YITV 3CCUV 4WFFA 4WFBV 4YIPA 3A0BZ 3BVOA 2EINB 5BMVB 4HBNA 1TVKB 1L0LH 3ZJZA 3T1YO 1GN2A 1GO3F 4J10A 2OIEA 4X66B 4JI4O 4CH6A 1XHXA 1ENVA 5IJ9A 2EIKB 4ZIBA 2IH1C 1Q6UA 3SYOA 2E5LB 2A0LA 2YI9A 4X1IA 5L3GA 2K1EA 1GH6A 1B3QA 4DV0B 1ZX3A 3CPWU 4NTYA 4QPKA 4JI3B 4GKKB 3ICXA 2YI8A 1GN6A 1IZ3A 1EZVH 2JVDA 2CDYA 5CN0A 4JGSA 1FFXA 2Z0AA 3W7WA 4B3TB 2A3QA 5LP6A 5CBFA 4JASA 1JA8A 2EZPA 3CHXA 4LF8B 4Q6GA 4DR1B 2A06H 4JYAB 4CH3A 4I7ZB 3F7YC 3N27A 4LF4B 4O4LB 4ZHQB 1P49A 1R6KA 3FB6C 3GWOA 2ZR2A 1N8RW 2YEVB 4LFBO 2F95B 3AG4C 4DUYB 4UCSA 3CB2A 1VQ6V 4IT5A 2WLHA 1XOUA 2YIBD 4FFKA 1G8MA 2D2CB 2Y0IA 1VQNV 4G28B 4I50A 1XMQO 4YY3O 3CC7V 1Q3EA 5CA3A 4IGGA 3J7AU 3L73H 2EILC 2ZE8A 3JAWA 1TUBB 1HR0B 1BHBA 4NXNB 4LFCO 3OTOB 3KCXA 4X1KA 3BABA 3ZRVA 4LF9B 5J2UB 5GONB 2GUZA 1XUQA 2IH3C 2UU9O 5KA5A 1O9HA 3R66A 4DW0A 3K3WA 1IBLB 4B3SB 4JI6B 1MOFA 3IAYA 1WA8A 1K5QA 1WPBA 3A0HZ 4PA4A 4R50A 1WPXA 3SR2C 1KC8W 1T5EA 4UCUA 3FYEB 4C7UA 3SDLA 4FZ1A 4IHJA 2BOBC 2AHZA 1NH2B 5L3EA 2R72A 5JWPA 3ZHTA 1Q7YW 3EXAA 1QLEB 2ZM6B 2ZT9B 1AJNA 1S5HC 4EB6A 3G71V 5JCOA 2EIJC 2PI5A 3STLC 4O4HA 3ZIAG 4BIUA 3C3TA 4WFAV 2P22C 4G27B 4U7NA 2B1GA 1GM9A 1W2BU 2DWDC 5FPRA 3CMEV 4MTOA 4HAMA 1KP2A 1BSMA 1NR7A 4U3JB 3OFNG 1Y67A 2VS0A 5KX5B 4DK0A 5CBHA 5LOVA 3ZMUA 1E1RG 4LR3A 1Q8IA 4CH4A 1VEWA 3P3NA 4GZRB 1NTZH 3E83A 1N33O 5IYBO 1PV0A 2QSAA 4R7CA 5KA6A 3VQWA 2XHBA 3B8MA 2CUGA 2HR3A 3U10A 4HYOA 2L6LA 1VQLV 1EN4A 2ZXWB 3RGBA 3E35A 4PA6A 4TV8B 2F4VB 4TSFG 3BPZA 2BSKB 1YJNV 1OV9A 3BFRA 1IX9A 1ZTEA 4W4LA 3JD0A 4Z1VA 3UO3A 1N0NA 3K5NA 4QIWF 1CPYA 5IJ0B 1WP8A 3E8BA 2W6JG 3AK3A 2Q69A 2YS8A 1PL0A 4B3MO 3E8GA 3K58A 2B1IA 4TUYA 1GK9A 2G38A 5KUMA 3RYFA 5CB4B 1V9PA 3FAVB 3A2FA 2CK3G 1SQPH 4FM1A 5HFLA 1DGSA 4Q20A 2ZNIA 5GTIZ 2WLLB 4DR5B 2DE0X 3L74H 2AZ2A 1NI8A 4TV9A 4DR4O 1YDXA 1YSCA 1HP8A 2E76B 4YJ2B 2HVKC 2V1DA 4EFEA 2ZCEA 1M56B 4H33A 1K8AW 4X64O 3D8CA 4GCZA 1YVWA 1JCHA 3D36A 1R3LC
chains in the Genus database with same CATH topology
2QM8A 2YSUB 1TUEB 2A79B 3B8NA 2JEXA 1VQMV 1WLEA 3OE7G 3K0GA 4WFGA 1JPXA 2Z3YA 4MVOA 1EZJA 1SRYA 3LDEA 5DN6G 1YTFB 4PDLA 3K79A 2UXXA 1QR9A 5J9PC 2H8PC 2GHYA 3CXCU 4DO2A 3E8HA 4MSWC 1QCEA 3G6EV 1OCCB 3W7UA 2DYRB 1LNQA 4MVRA 2X6AA 3ABKC 3IFXA 3OUFA 3CC2V 5BZBA 1VQ5V 3UKMA 2PI4A 4PELA 4XDJA 1Y66A 5IY5C 4N21A 2Q67A 4BW5A 1AI4A 1VQKV 1JVMA 3AG3C 2P6JA 3WG7B 5IYDO 4JAVA 4KUMA 1PD3A 4LCUC 4Z1MG 5LGNA 1K5SA 4LC1A 3CP1A 3RBZA 3ABMC 1YJ9V 4BIZA 1RPOA 2EZOA 3QO7A 1EFRG 3AG2C 1Y4MA 1PNLA 3CCJV 2DYSC 2IJHA 3A0RA 2R9RB 2JEUA 4QPJA 3E8FA 1JQ0A 3ABLB 1COWG 1S3JA 3FB7C 5IDJA 1SESA 4WF9V 2EBOA 2OCCC 2IJJA 3ZMTA 5IYCO 4LBEC 2XASA 1R6NA 1NQTA 4FJCC 3CCEV 2LP7A 4I9WA 3H01A 3AEIA 1G4YB 3JYCA 3LSQA 4UV8A 1GMGA 5LGUA 2H94A 1K4DC 1PNMA 2EINC 2ITCC 2XOKG 1MABG 4ZKIA 2XAHA 5C93A 3K06A 1XL6A 3JD4A 1RPRA 1AROP 2ZD9A 2WLIA 5B1BC 3CCLV 4RO2A 4TWKA 4J9YB 3ASOB 1SETA 1RM1B 1YIJV 1JJ2U 3CCVV 3EHBB 2EIKC 4JAUA 3SYAA 4XBFA 5H6RA 2HKOA 2JIZG 2WLKA 4JF3A 3ZRSA 3OEHG 2BOCC 3BY6A 5B1NA 1FFTB 3IGAC 1OCRC 1QVGU 2P90A 3MHHC 4R8CA 3OMIB 1THZA 4UVAA 2XAQA 2JJ2G 3F5WC 1NKDA 3R65A 1NVPB 2A9HA 2ZQMA 5B1AC 1NH2D 1DLBA 2IW5A 2NNUA 1FS0G 1R3IC 3ZRWA 4N23A 3K04A 2EIMC 2KB1A 4MVMA 1FXKC 2QTOA 1KKDA 5L3FA 4JTDB 4QE9A 2NLJC 3E86A 4JPRA 1FXKA 3RW0A 2WWWA 2HVJC 3OGCC 2HJFC 2IJIA 2W0FC 3X2QC 3JCZA 3I55V 4J9ZB 5IY5B 3M99B 3MD0A 5L3DA 2ITDC 3AG3B 4MW8A 1VQ4V 5B1OA 4GX5A 4JYBA 1H8EG 3G4SV 1V54C 1S0VA 2HFEC 3ZRXA 3T4DA 3UM7A 2ZR3A 1OZ0A 2C2AA 3D3IA 4FMTA 4H37A 4MVQA 3VOUA 4FPPA 3W7SA 4GT1A 3MHSC 3ABMB 4DXWA 1P7BA 1S72V 3TK1A 2YEVA 3AG2B 4QNHB 2D3OW 2DYSB 1I5XA 3ZMZA 1AJPA 4UXNA 5LBQA 4FIPC 3ZN0A 1S77D 1AI6A 4HZ3A 2WAMA 4KFMA 2OCCB 5DM6V 1YITV 1QVFU 3CCUV 2QA4V 1AI5A 2IU3A 4P9OA 4WFFA 3CD6V 4WFBV 3ZCCA 3OMNB 3P30A 5HFMA 1KP3A 2EINB 1I5YA 2WLIB 1SERA 2P67A 5E1AC 2R9IA 3K08A 2AHYA 1R3JC 5B1BB 3ZJZA 1GO3F 1QBZA 1ENVA 2OTJV 1Q86W 2EIKB 1E79G 2IH1C 1QLNA 3AG1C 5EBWC 3SYOA 3SJQC 1OCRB 2A0LA 5L3GA 2K1EA 3QNEA 4BAYA 3CPWU 4QPKA 4PA7A 5GW7A 4CBCA 3FB8C 3ZRWB 2WPDG 5B1AB 5B3SC 3SYQA 5CN0A 5LHHA 1Q82W 4JGSA 5EBMC 3W7WA 1L1FA 5LGTA 3ETDA 5CBFA 1E1QG 4JASA 2GSMB 1FXKB 2X0LA 2EZPA 5H9CA 3QO5A 4E2LA 4UV9A 1M57C 3SYPA 1VQ9V 3CC4V 5FL7G 2WLMA 3ETEA 3F7YC 4PDVA 1JOYA 3CYOA 4UVCA 3CCQV 5LHIA 3DGEA 3E89A 1S76D 5EC1C 3I56V 4X88A 4X8AA 1V54B 2JK5C 1R6KA 5CBGA 2XNDG 3FB6C 1QLEC 3GWOA 1PKXA 2ZR2A 3P32A 1M1KW 1N8RW 2YEVB 3HPLC 1H38A 4KP4A 4RQEA 3AG4C 1AI7A 1OCOB 4EKWA 1VQ6V 4L87A 1MG1A 2WLHA 4RAIA 3TCUA 3CCMV 1G8MA 1MSWD 3ML0A 4MS2A 4XDKA 4GX0A 1JX9A 3TETA 1VQNV 4G28B 5EK0A 3ASNC 3CC7V 4QJFB 4PDRA 5CA3A 1OCZC 2V7QG 2EILC 3F7VC 1BHBA 2JJ1G 3ABKB 2WSSG 1K3EA 1W0JG 3LUTB 2Y48A 3OR6C 1CEZA 3STZC 1YHQV 3ABUA 1CP9A 3K0DA 5EBLC 4P30A 1FXVA 2OTLV 4XDLA 3SPHA 4I5SA 3AG1B 4GX1A 3RVYA 3ZRVA 1K73W 2XAJA 1K4CC 4WFEA 2MK3A 3JD1A 3VBBA 3CMAV 4RUFA 2IJKA 3SYCA 1YI2V 2IH3C 5KA5A 3K3WA 4OXSA 3PJSK 4R6ZA 5B3SB 1B6QA 1F4MA 2OT5A 1MOFA 2ATKC 3NXSA 4UVBA 1KECA 1W0KG 2ZXWC 3K03A 4JTAB 1K5QA 4PA4A 3B77A 2LFSA 4R50A 4YXWG 4TT3G 1WPXA 5CMUA 1KC8W 1BHAA 4LP8A 1NR1A 2WLJA 3OR7C 5EC2C 1M57B 1KD1W 3LSSA 3FYEB 3ASOC 2EJRA 1RM1C 1K97A 3HB3B 2M7WA 2Q6AA 2BOBC 2AHZA 2QEXV 1GKFA 1R73A 1NH2B 5L3EA 1P4RA 1YJWV 1Q7YW 1VQ8V 1F51A 2DQ3A 3JD3A 1QLEB 4ZBMA 3ZMSA 1VQ7V 3CCSV 1AJNA 3T1CA 1ROPA 4WCEV 3AG4B 4JYCA 1S5HC 4MTXA 3G71V 3FYIB 2PI5A 2EIJC 4P2ZA 3STLC 3K9AA 4MVZA 1UJWB 1VQPV 4JTCB 2DWEC 4X89A 3ZIAG 2W6IG 1KQSU 2Y69C 4BIUA 1GM7A 1R3KC 4WFAV 4G27B 1AR1B 2QE7G 2HG5C 4U7NA 3KG2A 2B1GA 1GM9A 1M90W 1V55C 1W2BU 2EIMB 2DWDC 3ASNB 3OAAG 3SPGA 3CMEV 3EFFK 5KUKA 1OCZB 2UXNA 4G2KA 4MTOA 1NVPD 1IXMA 1H2GA 3OW2U 2EILB 4HAMA 1BL8A 1KP2A 2WLLA 2X6CA 1K34A 2DW4A 2QM7A 3LDCA 3W7TA 4ASUG 1NR7A 3OFNG 3X2QB 1M56C 3ABTA 3FB5C 5LHGA 3DTUB 1BMFG 3CCRV 4FK5C 1DF4A 5CBHA 4PA3A 3ZMUA 2FTKA 1E1RG 1QR8A 1K33A 5L3BA 3W7XA 1XL4A 3E83A 3JD2A 5IYBO 1K92A 4R7CA 5KA6A 1J95A 1PNKA 1Q81W 2WLNA 3B8MA 3OUSA 3OEEG 2HR3A 4GX2A 1AJQA 1OHHG 1EBOA 4HYOA 1FXHA 3ZMVA 1VQLV 3SPIA 2ZXWB 2Q68A 1OCCC 2LFRA 3E35A 2DYRC 4PA6A 4TSFG 3IC7A 3LDDA 1NBMG 1YJNV 1GTOA 1M9NA 1NJIW 2QKSA 4U7OA 4MT8A 3JD0A 2HLDG 4MW3A 1DF5A 1F23A 4MVSA 4P9PA 3WG7C 5H6QA 3ZN1A 4RQFA 1YTFD 2B5UA 1K9MW 1H8HG 4QIWF 1CPYA 4PA9A 3E8BA 2IU0A 2W6JG 3E2EA 3OMAB 3QO8A 3GB7C 2Q69A 3LNMB 4RUEA 2Z5UA 3OM3B 1PL0A 2ZDIC 1K7DA 3E8GA 2X6BA 2EIJB 3ABLC 2B1IA 2ZDIA 4QE7A 1GK9A 5KUMA 1HWYA 2Y69B 4MTGA 3RVZA 2CK3G 4MTFA 2XAFA 1ZWIC 1SZTA 2P7TC 1GM8A 3SPJA 1V55B 5HFLA 4UUJC 4Q20A 1VQOV 3SPCA 2WLLB 4MVUA 1DTOA 4WFHA 2DQ0A 1F4NA 4CZZA 1ORQC 1YSCA 3WFVA 2X7RB 2HVKC 4PDMA 4F4LA 2V1DA 3T4ZA 5L3CA 1M56B 2XAGA 4H33A 2JDIG 1K8AW 1OCOC 3ETGA 4GCZA 3T2MA 1JCHA 3BEHA 3D36A 2F43G 3FKSG 1R3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGC C;  5KUK A;  2A79 B;  2HJF C;  4MTO A;  2W0F C;  3AG4 C;  3X2Q C;  1BL8 A;  2WLL A;  2X6C A;  4EKW A;  2WLH A;  3K0G A;  4J9Z B;  4WFG A;  3LDC A;  4RAI A;  4MVO A;  3TCU A;  2ITD C;  3LDE A;  4MW8 A;  4PDL A;  4GX5 A;  1M56 C;  3FB5 C;  2H8P C;  4MS2 A;  1V54 C;  4XDK A;  5J9P C;  2HFE C;  4GX0 A;  3TET A;  3T4D A;  3E8H A;  4G28 B;  4MSW C;  3UM7 A;  5EK0 A;  5CBH A;  3ASN C;  4PA3 A;  4H37 A;  1LNQ A;  4MVQ A;  4MVR A;  2X6A A;  3ABK C;  3IFX A;  3VOU A;  3OUF A;  4PDR A;  4DXW A;  5BZB A;  1OCZ C;  3UKM A;  1P7B A;  2YEV A;  2EIL C;  1XL4 A;  4QNH B;  3F7V C;  3E83 A;  4XDJ A;  5IY5 C;  4R7C A;  1J95 A;  2Q67 A;  4BW5 A;  1JVM A;  3AG3 C;  2WLN A;  3LUT B;  3OUS A;  4GX2 A;  3OR6 C;  4HYO A;  4HZ3 A;  4KFM A;  5EC2 C;  3STZ C;  5EBL C;  3K0D A;  4LCU C;  3SPI A;  4P30 A;  2Q68 A;  4XDL A;  1OCC C;  4GX1 A;  4PA6 A;  2DYR C;  4P9O A;  3RVY A;  3SPH A;  4WFF A;  3RBZ A;  3ABM C;  3LDD A;  1K4C C;  4WFE A;  4RUF A;  3AG2 C;  2QKS A;  3SYC A;  2IH3 C;  2DYS C;  2WLI B;  5E1A C;  2R9R B;  4MW3 A;  4OXS A;  3K08 A;  2AHY A;  1R3J C;  3E8F A;  3PJS K;  4MVS A;  3ZJZ A;  4R6Z A;  3FB7 C;  4P9P A;  3WG7 C;  2ATK C;  2OCC C;  4LBE C;  2ZXW C;  3K03 A;  2IH1 C;  4JTA B;  3AG1 C;  4I9W A;  4PA4 A;  5EBW C;  4PA9 A;  3SJQ C;  3E8B A;  4R50 A;  3SYO A;  1G4Y B;  2A0L A;  3JYC A;  2K1E A;  4LP8 A;  3GB7 C;  2Q69 A;  1K4D C;  2WLJ A;  3LNM B;  3OR7 C;  4RUE A;  2EIN C;  2ITC C;  3ASO C;  4PA7 A;  3K06 A;  1XL6 A;  2Q6A A;  3E8G A;  2ZD9 A;  5B1B C;  2WLI A;  4CBC A;  3FB8 C;  2BOB C;  2AHZ A;  2X6B A;  3ABL C;  3HPL C;  4RO2 A;  4TWK A;  5B3S C;  4QE7 A;  3SYQ A;  4J9Y B;  5EBM C;  5KUM A;  2EIK C;  4MTG A;  3SYA A;  5CBF A;  3ZRS A;  2WLK A;  3RVZ A;  2BOC C;  4MTF A;  1ZWI C;  3IGA C;  2P7T C;  1OCR C;  3SPJ A;  4R8C A;  4UUJ C;  1M57 C;  4ZBM A;  3SYP A;  3SPC A;  2WLL B;  3T1C A;  3F5W C;  4MVU A;  2WLM A;  4WFH A;  3R65 A;  1S5H C;  3F7Y C;  1ORQ C;  4PDV A;  2A9H A;  2EIJ C;  4P2Z A;  5B1A C;  3STL C;  4MVZ A;  4JTC B;  2DWE C;  1R3I C;  2HVK C;  4PDM A;  4F4L A;  4X89 A;  3K04 A;  3E89 A;  2EIM C;  2KB1 A;  2Y69 C;  5EC1 C;  1R3K C;  4X88 A;  3T4Z A;  4X8A A;  4G27 B;  4MVM A;  1KKD A;  2HG5 C;  2JK5 C;  2QTO A;  4H33 A;  3KG2 A;  5CBG A;  1OCO C;  4JTD B;  4QE9 A;  3T2M A;  2NLJ C;  3E86 A;  3FB6 C;  1QLE C;  1V55 C;  1R3L C;  2DWD C;  3BEH A;  3RW0 A;  3SPG A;  3EFF K;  2HVJ C; 
#chains in the Genus database with same CATH topology
 1TUE B;  2A79 B;  3HR0 A;  1VQM V;  1WLE A;  4DV3 O;  3K0G A;  4JI8 O;  5FNV B;  4KXR A;  1YTF B;  1QR9 A;  4LF5 O;  1VF6 A;  2ZE7 A;  1QCE A;  3OUF A;  1PPJ H;  3P3P A;  3ZS8 C;  1N36 B;  2PI4 A;  1IXB A;  3CWB H;  4TOI A;  3ZHR A;  4IIJ A;  2VQE B;  2Q67 A;  4BW5 A;  1AI4 A;  3AG3 C;  2N74 A;  4JAV A;  4JI7 O;  1J5E B;  4LCU C;  5LGN A;  5J2U A;  3DC5 A;  1K5S A;  4LC1 A;  4X1Y B;  2PGG A;  3B2E E;  1Y4M A;  4KL1 A;  4QPJ A;  4Z2W A;  1COW G;  3FB7 C;  1VIB A;  4IL6 Z;  3HKC A;  3K5L A;  5IYC O;  1NQT A;  1SQV H;  3AEI A;  1XNR O;  1Q6H A;  2H94 A;  1HNX B;  4ZKI A;  5C93 A;  2ZD9 A;  4RO2 A;  2PF4 E;  1JJ2 U;  4JAU A;  3SYA A;  2ADP A;  3ZRS A;  4FVM A;  5B1N A;  2ADQ B;  3OTF A;  5EZY B;  3THO A;  2P90 A;  1NZ6 A;  3MHH C;  4R8C A;  4DV4 B;  4AQY O;  1AR5 A;  4UCR A;  4DYL A;  1XNQ B;  2ZNJ A;  4J11 A;  2ZIM A;  3ZRW A;  1MZF A;  1TGO A;  4NKG B;  5AG2 A;  2GDS A;  4WBN A;  4CC5 A;  4DR2 B;  4QE9 A;  2UUB O;  3RW0 A;  2HHH B;  2UUC B;  2IJI A;  2W0F C;  3X2Q C;  3JCZ A;  3JAS B;  3M99 B;  2VRZ A;  1N32 O;  1H8E G;  3G4S V;  1I94 O;  2HFE C;  3T4D A;  3UM7 A;  1OZ0 A;  3D3I A;  4FMT A;  4H37 A;  4O4J A;  2F93 B;  3BCC H;  1GRJ A;  1ZL8 B;  1VF7 A;  4B7K A;  1S72 V;  3AG2 B;  2NR5 A;  2D3O W;  2DYS B;  1D2D A;  1WB7 A;  4X9Q A;  2JGD B;  1S77 D;  3ZN0 A;  1JR9 A;  4HZ3 A;  1QVF U;  4YJ3 B;  4JV5 O;  3CS5 A;  2IU3 A;  3CD6 V;  2AXT Z;  1H2N A;  3JSN A;  3QVN A;  3ZCC A;  4DR6 B;  1YXB A;  3E22 B;  5HFM A;  2UUA O;  3DSQ A;  5B1B B;  4DUZ O;  5JH7 B;  4DW1 A;  1Q86 W;  4UFZ A;  3AK1 A;  1QLN A;  1IBK O;  3AG1 C;  2HJD A;  1AB3 A;  4DR7 O;  3D3Q A;  4OPH A;  3QNE A;  5DED A;  5GW7 A;  3FB8 C;  1D5N A;  5B1A B;  5B3S C;  1XMO B;  5LA6 A;  5D5Q A;  2Q7E A;  5LP6 C;  3RYC A;  1L1F A;  3BA8 A;  1FXK B;  4E2L A;  3B40 A;  1M57 C;  3SYP A;  1A32 A;  2P4V A;  3CC4 V;  1L8D A;  5JJE B;  2WLM A;  3HKD B;  4DV7 O;  1JOY A;  3CYO A;  3CCQ V;  1RSO B;  1NTK H;  5LHI A;  1S76 D;  5JJJ B;  3HKE B;  1BGY H;  3I56 V;  5CA0 B;  1V54 B;  1XQ8 A;  1LUV A;  1PKX A;  2GBO A;  1IVS A;  4LF7 O;  1M1K W;  2YXY A;  1WP7 A;  1KU9 A;  3G80 A;  1SQB H;  1AI7 A;  5LMU O;  4X62 B;  1MZE A;  5LMN O;  1WB8 A;  3TCU A;  4PI2 A;  1MSW D;  1BE3 H;  4GX0 A;  4U3F H;  4UCV A;  1H2K A;  3ASN C;  4DV6 O;  2DJV A;  2ZE5 A;  1BT8 A;  4JI0 O;  3ABK B;  3UQ8 A;  4I0X A;  3OD4 A;  4JZG A;  2Y48 A;  1HW7 A;  3OR6 C;  1CEZ A;  1YHQ V;  3ABU A;  5EBL C;  1FPO A;  5LXT A;  2OTL V;  4XDL A;  3SPH A;  4LWS A;  5LL6 Y;  3JD1 A;  3SYC A;  2ETN A;  3PJS K;  1SS3 A;  1MNG A;  3H1K H;  3SGI A;  3JAT B;  3KKY A;  3K03 A;  1XMQ B;  4YXW G;  4AHC A;  2JS3 A;  1R1B A;  1NR1 A;  4JZ2 A;  2FB5 A;  1K97 A;  4FFB A;  3ZHQ A;  2M7W A;  2QWN B;  4DRX B;  4FLU A;  2BTQ B;  2EJ7 A;  1YJW V;  1N4C A;  3JAL B;  2DQ3 A;  3JAR B;  2QTS A;  1GN4 A;  3JSL A;  5JCO C;  3A8T A;  1Q43 A;  4JAA A;  3AG4 B;  1Q6I A;  2N05 A;  4MVZ A;  4DK1 A;  2DWE C;  1JJO A;  2W6I G;  3UO2 A;  2Y69 C;  1R3K C;  1XIL A;  5KHI A;  3RYH B;  1V55 C;  2EIM B;  5KUK A;  4G2K A;  3OT7 A;  1NVP D;  2EIL B;  2BCC H;  1K34 A;  1SF9 A;  2QM7 A;  3W7T A;  5J2T A;  5C8Y B;  1GN3 A;  4JI1 O;  5LHG A;  5BY1 A;  1BMF G;  3CCR V;  4FK5 C;  2BE3 A;  4PA3 A;  4B3R O;  3W7X A;  4OX9 O;  2CH7 A;  2F23 A;  5BXZ A;  4GX2 A;  5B66 Z;  1OHH G;  3ZMV A;  4BR6 A;  5BR8 B;  4CH5 A;  4K0K O;  1OCC C;  2DYR C;  1M93 A;  3IC7 A;  1M4U A;  3LDD A;  4I55 A;  4U7O A;  4HNA A;  4IYH A;  3JCU Z;  3G6B A;  1F23 A;  3WG7 C;  2HEP A;  5FLX N;  1XDC A;  1YTF D;  1HNW B;  2B5U A;  1K9M W;  3K57 A;  5KLV H;  2IU0 A;  4O2A B;  3GB7 C;  2PYL A;  1QU7 A;  1TAE A;  4PJ0 Z;  1K7D A;  2QWO B;  2EIJ B;  3ABL C;  5KMG B;  2ZDI A;  4NTW A;  2XUM A;  2VQF B;  3CJH A;  1FJG O;  4MTG A;  3TXQ A;  2QKC A;  2XAF A;  4OPA A;  1SZT A;  1VQO V;  2AZ0 A;  3SPC A;  4MVU A;  5F2V O;  5CA0 A;  2FKX A;  3KCY A;  5KAI Z;  1PP9 H;  3BHP A;  2XAG A;  3D36 C;  4X20 A;  3ETG A;  3T2M A;  4JI3 O;  4JI2 B;  2F43 G;  3JAM N;  3FKS G;  5EC2 C;  2YSU B;  1QHT A;  4B3M B;  2QWP B;  1JPX A;  1EZJ A;  5DN6 G;  3LDE A;  1VF6 C;  3Q4H A;  5K1X A;  2QM4 A;  2UXX A;  3APQ A;  2H8P C;  4GKJ B;  1D5A A;  4DO2 A;  4DR1 O;  4LFA O;  4MSW C;  3G6E V;  3CXH F;  3W7U A;  4MVR A;  1B06 A;  1VQ5 V;  5LYJ B;  3VQV A;  1N0J A;  1AP5 A;  1X4T A;  1ZLZ A;  1SQQ H;  2E75 B;  4PEL A;  1DK1 A;  4LF4 O;  1Y66 A;  3S3W A;  5IY5 C;  1B04 A;  1NT2 B;  4DR3 B;  3U0Z A;  1JVM A;  3WU2 Z;  4Z1M G;  1FD9 A;  4DUY O;  3QF7 A;  2V4D A;  1U96 A;  2KG7 B;  3DXR B;  2UXD B;  3QO7 A;  1EFR G;  1PNL A;  2R9R B;  3BRC A;  1Y6X A;  2K9P A;  5IDJ A;  1N34 O;  4WF9 V;  4ZI7 B;  2EBO A;  2OCC C;  3ZMT A;  3QTC A;  4LBE C;  2YIC A;  2QKA A;  2XAS A;  4UCO A;  4I9W A;  1WJZ A;  3ZBH A;  1FYJ A;  1GMG A;  4NXN O;  3CRA A;  3K06 A;  3OTO O;  3JD4 A;  1RPR A;  1ARO P;  1TVK A;  5BMV A;  3CCL V;  2LGW A;  4TWK A;  2OCH A;  3ASO B;  2BTQ A;  1RM1 B;  4LF9 O;  4F6E A;  3CCV V;  1KYO F;  4F6R B;  4JI7 B;  5H6R A;  2BOC C;  1FFT B;  1IBM B;  1OCR C;  1QVG U;  3F5T A;  1IBL O;  1THZ A;  4UVA A;  4JI6 O;  3F5W C;  3R65 A;  1NVP B;  1QNM A;  2A9H A;  5KHJ A;  2LQT A;  1DLB A;  2IW5 A;  2NNU A;  4ZOL B;  1R3I C;  2KB1 A;  1F7Y A;  4LF6 B;  4MVM A;  1KKD A;  1JMK C;  3KZI Z;  2UXC B;  2NLJ C;  2EX3 A;  1XNR B;  1BS3 A;  4GLX A;  2HVJ C;  2HJF C;  5IYZ B;  1Z2G A;  2ILM A;  4J9Z B;  4YHH B;  3AG3 B;  2YC0 A;  4MW8 A;  5B1O A;  4GX5 A;  3B4S A;  4O4L A;  4ZHQ A;  3ZRX A;  4MVQ A;  3VOU A;  3MHS C;  4DXW A;  3BA9 A;  1VAR A;  2YEV A;  3RT3 C;  1SKV A;  3NR7 A;  2PYJ A;  1M5I A;  1EM1 A;  4UXN A;  4O2B B;  3RYI B;  3M7M X;  4UB6 Z;  4FM2 A;  2WAM A;  2RMK B;  2YXH A;  2QA4 V;  2DMX A;  3ZHS A;  5A9G A;  3MDS A;  2Y0P A;  1KP3 A;  5JVD B;  1I5Y A;  2WLI B;  4CS2 A;  4UCT A;  5E1A C;  2R9I A;  2AHY A;  2E74 B;  1TUB A;  4H0L B;  4PHZ A;  3HKB B;  1N32 B;  1G6U A;  1E79 G;  4JI5 B;  5TIS Z;  4PV1 B;  4BAY A;  5KHH A;  5GON A;  3K5O A;  1BCC H;  4L8J A;  4CBC A;  2WPD G;  2ZIO A;  3SYQ A;  1Q82 W;  1H2S B;  5EBM C;  5LGT A;  4PI0 A;  3OGI B;  2GSM B;  4JV5 B;  5H9C A;  1S5J A;  3GVM A;  3QO5 A;  1LUW A;  3BAA A;  4O4I B;  4UV9 A;  2YUA A;  2NN4 A;  1I7F A;  1SA0 B;  2UUA B;  4DV2 B;  3DGE A;  1JFF B;  2RJZ A;  5CBG A;  1P84 F;  2XND G;  4FM0 A;  3P32 A;  4FZ0 A;  3N2G B;  1L0N H;  3UCS C;  3HPL C;  1H38 A;  4D6T H;  4KP4 A;  1Y74 B;  1OCO B;  2EUL A;  4L87 A;  2E3C A;  4LNU B;  5CA1 B;  1KMI Z;  3FX7 A;  1BZK A;  3CCM V;  3ML0 A;  3ZED A;  4XDK A;  2IBZ H;  4QJF B;  4PDR A;  4EFB A;  1OCZ C;  2V7Q G;  2YID A;  3F7V C;  4DV7 B;  4DV1 B;  2JJ1 G;  2WSS G;  1K3E A;  5IJ9 B;  4H13 B;  4U3J A;  4E4E A;  5KX5 A;  4I5S A;  3AG1 B;  4X1I B;  3RVY A;  4NXM B;  1SC5 B;  3B09 A;  2XAJ A;  4WFE A;  2KKW A;  3VBB A;  4RUF A;  5B5E Z;  2IJK A;  3AK2 A;  1YI2 V;  2O57 A;  1FFX B;  4R6Z A;  4K35 A;  5B3S B;  5LP6 B;  1F4M A;  2ATK C;  1KEC A;  1W0K G;  4JTA B;  2Y4U A;  4TT3 G;  5CMU A;  4TV8 A;  4DV6 B;  4LP8 A;  2WLJ A;  3OR7 C;  1M57 B;  3LSS A;  2BSK A;  4A5U B;  1UFI A;  2EJR A;  4JI0 B;  3HB3 B;  2Q6A A;  1O9G A;  5IWA O;  2QEX V;  1GKF A;  1R73 A;  4BWA A;  1OJH A;  4D7S A;  1VQ8 V;  5ITZ B;  3T1H B;  3JD3 A;  5IJ0 A;  5KAF Z;  1WNS A;  4QGP A;  4ZBM A;  3N2K B;  1VQ7 V;  3CCS V;  3T1C A;  3CRR A;  4JYC A;  3WB2 A;  3FYI B;  4P2Z A;  4DV5 B;  3K9A A;  4JTC B;  2XT9 A;  2OWO A;  4X65 B;  3CEI A;  4I50 B;  1AR1 B;  2QE7 G;  2HG5 C;  1P7G A;  5CB4 A;  3FAV A;  1M90 W;  3ASN B;  3SPG A;  3EFF K;  2OIG A;  1PM9 A;  2UXN A;  3JAW B;  3APO A;  1IXM A;  1BL8 A;  2WLL A;  2X6C A;  2Q7H A;  4GUN A;  4ASU G;  2CTP A;  4YJ2 A;  3DTU B;  4X1K B;  3T1Y B;  1KUQ A;  2YIB A;  1DF4 A;  4JI4 B;  4DV4 O;  2GUZ B;  2FTK A;  3CRQ A;  1QR8 A;  1K33 A;  1XNQ O;  3JD2 A;  2Y4T A;  2R70 A;  4RWU A;  1J95 A;  1Q81 W;  4DR2 O;  5FNV A;  1AJQ A;  1EBO A;  1WA8 B;  4J80 A;  2HHH O;  1H2L A;  2UUC O;  3SPI A;  2B9Z A;  2LFR A;  1NBM G;  1GTO A;  1NJI W;  2QKS A;  4IHJ B;  2RQ6 A;  3ZHV A;  2HLD G;  1H8H G;  2DOS A;  2Q0A A;  2Q73 A;  4PA9 A;  2GTS A;  2XTA A;  2YIA A;  3OMA B;  3E2E A;  4FLT A;  4X1Y A;  4KHP O;  4B3R B;  3UT5 B;  4EB6 B;  1HNZ O;  4OX9 B;  1RFY A;  2ZDI C;  3CSX A;  4FLV A;  2ARH A;  2CGO A;  4LFB B;  4O4H B;  4QE7 A;  5EYP B;  2UXB O;  1UPG A;  2QJ1 A;  1HWY A;  2Y69 B;  4J7Z A;  4DR6 O;  4MTF A;  1ZWI C;  2P7T C;  1GM8 A;  3SPJ A;  1V55 B;  4UUJ C;  2LGQ A;  1DTO A;  4YY3 B;  4WFH A;  2DQ0 A;  1F4N A;  4CZZ A;  5DEC A;  1I08 A;  1IDS A;  1PL4 A;  3ETQ A;  2JS5 A;  2X7R B;  4PDM A;  2P06 A;  2RDC A;  2QR4 A;  2H3O A;  5L3C A;  3DC6 A;  2JDI G;  4CS3 A;  2PTM A;  4LFC B;  1Z5V A;  3BEH A;  5EZY A;  2YXL A;  3B8N A;  4LNU A;  2JEX A;  5D5P A;  4FLZ A;  3OE7 G;  3LSU A;  4MVO A;  1SRY A;  2UU9 B;  1FJG B;  5J9P C;  3E8H A;  2QWQ B;  4PD4 F;  1OCC B;  2DYR B;  2Q0O C;  1SZX A;  2X6A A;  3ABK C;  3CC2 V;  5BZB A;  4H44 B;  2W0X A;  4XDJ A;  5A2Q N;  3JAS A;  1VQK V;  4B7E A;  3WG7 B;  4KUM A;  2CTR A;  1PD3 A;  4J42 A;  2BTO A;  3JAK B;  3ABM C;  3RBZ A;  4BIZ A;  3IJ4 A;  1RPO A;  4X62 O;  5H2F Z;  2ZE6 A;  1ZL8 A;  3A0R A;  2JEU A;  3E8F A;  4TUY B;  2PZS A;  3ABL B;  3O9O A;  3RYF B;  4I4T B;  1LR1 A;  2MW2 B;  2JGD A;  2IJJ A;  4LFA B;  3C3S A;  2CTQ A;  2LP7 A;  4YJ3 A;  2Q7G A;  1G4Y B;  4UV8 A;  2JGU A;  1K4D C;  1PNM A;  4UB8 Z;  2EIN C;  2ITC C;  1MAB G;  2LJ2 A;  1XL6 A;  4I9Q A;  3E22 A;  4TV9 B;  4J7J A;  4TQD A;  4J9Y B;  5JH7 A;  5ITZ A;  2EIK C;  1EN6 A;  2HKO A;  1X59 A;  2JIZ G;  4JF3 A;  3BY6 A;  3N2K A;  1XRE A;  2XAQ A;  4ICG A;  2JJ2 G;  1IUR A;  5KHK A;  3C90 A;  1N34 B;  4N23 A;  1N33 B;  2EIM C;  2QTO A;  1BQZ A;  3J80 N;  3TGU H;  3E86 A;  4JPR A;  1FXK A;  3G67 A;  2WWW A;  2A7W A;  3TXS A;  1SQF A;  4IIJ B;  5EIB C;  3SJA C;  5IY5 B;  3HKD A;  3MD0 A;  2CGN A;  4X66 O;  1RSO A;  2DN9 A;  2R9A A;  3HKE A;  3TJT A;  3GWK C;  5JQG B;  2E5L O;  2C2A A;  5IE9 A;  3W7S A;  1BQ0 A;  4DV0 O;  1KKC A;  1P7B A;  1HDJ A;  4GKK O;  1XEQ A;  1Y76 B;  1I5X A;  1FAF A;  2Q4P A;  3HKC B;  3K59 A;  1NS1 A;  3L70 H;  4FIP C;  5E79 Z;  1AI6 A;  4B3T O;  5DM6 V;  2OCC B;  1AI5 A;  4P9O A;  3H1L H;  4LF8 O;  1WN7 A;  1XBL A;  2FML A;  4JYA O;  3OMN B;  3LNN A;  3P30 A;  1SER A;  2FL4 A;  2P67 A;  2WA4 A;  4EEQ A;  3K08 A;  1R3J C;  5KHG A;  1QBZ A;  5FPO A;  2OTJ V;  2IM9 A;  4DR4 B;  1VF5 B;  5EBW C;  3S3X A;  3SJQ C;  1OCR B;  3UT5 A;  4X64 B;  4PA7 A;  5EYP A;  5GTH Z;  5BR8 O;  3ZRW B;  3VQY A;  1US6 A;  5LHH A;  2WA3 A;  5K1P A;  1Q5O A;  4DV3 B;  3VQX A;  4WBN B;  3ETD A;  4NTX A;  3I5D A;  1E1Q G;  2L35 A;  3JAT A;  4JI8 B;  3L75 H;  2X0L A;  3H9V A;  4LF5 B;  1VQ9 V;  1S5L Z;  4J41 A;  5FL7 G;  1HR0 O;  3ETE A;  4UVC A;  4DRX A;  1HNW O;  2LW1 A;  3E89 A;  5EC1 C;  4X88 A;  4X8A A;  2JK5 C;  4O4J B;  3RN4 A;  1QLE C;  5IT9 N;  3JAL A;  3JAR A;  4IYI A;  2RCV A;  2AW9 A;  4RQE A;  4EKW A;  2VQF O;  1MG1 A;  1KBH A;  4RAI A;  4B3S O;  3H1J H;  4MS2 A;  2ZKO A;  3TET A;  1JX9 A;  3K9S A;  4D7T A;  5EK0 A;  2LW7 A;  3RYH A;  3WB0 A;  4CS4 A;  3IC9 A;  1VMG A;  1RP3 B;  1W0J G;  3LUT B;  4JI2 O;  4FLW A;  5C8Y A;  3STZ C;  1CP9 A;  2CAZ C;  4OGQ B;  3JAK A;  1FXV A;  4P30 A;  4GX1 A;  1K73 W;  2ZM6 O;  2N04 A;  1K4C C;  2MK3 A;  3CMA V;  3ZHU A;  2QWR B;  2P5O A;  1SQX H;  5LA6 B;  4OXS A;  4GKJ O;  4I4T A;  3RYC B;  4FLY A;  1B6Q A;  4AQY B;  2GV9 A;  2OT5 A;  1G1X B;  3NXS A;  4UVB A;  2CE4 A;  2ZXW C;  2FYU H;  3B77 A;  2LFS A;  5H5N A;  1BHA A;  1KD1 W;  4DR3 O;  3ASO C;  1RM1 C;  2UUB B;  3WB1 A;  2PUS A;  2VWK A;  1KB9 F;  4GYC B;  2VWJ A;  1NU1 H;  1P4R A;  2UXD O;  1F51 A;  2KQX A;  3QG5 A;  4LH7 A;  1I94 B;  1U97 A;  4O2A A;  3ZMS A;  1ROP A;  2Q9L A;  4WCE V;  4MTX A;  1VQP V;  1UJW B;  1SQG A;  1XI1 A;  5KMG A;  4X89 A;  4BW9 A;  1KQS U;  1GM7 A;  3MAQ A;  1AP6 A;  2Q5Z A;  3KG2 A;  3RFR A;  4CC6 A;  2F4V O;  3OAA G;  1QQC A;  3EVK A;  1OCZ B;  1H2G A;  3OW2 U;  4I0X B;  5IWA B;  2DW4 A;  3LDC A;  1EN5 A;  4NR1 A;  3X2Q B;  1IBM O;  5JQG A;  1M56 C;  3ABT A;  3FB5 C;  5LXT B;  3FD9 A;  2Q8V A;  4DUZ B;  4LWS B;  1Y76 A;  5L3B A;  1IBK B;  1YZB A;  1XL4 A;  2QDO A;  4DR7 B;  4NVP A;  2PY5 A;  1K92 A;  4LF6 O;  1PNK A;  3M8A A;  2WLN A;  2UXC O;  3OUS A;  3OEE G;  3SJC C;  1FXH A;  2ZIN A;  2Q68 A;  2CTW A;  4JYY A;  1R6T A;  4YHH O;  4FFB B;  1M9N A;  4DR5 O;  3SJB C;  5LYJ A;  4MT8 A;  1GAX A;  4MW3 A;  1DF5 A;  4ABM A;  4MVS A;  4YIO A;  4P9P A;  5H6Q A;  3ZN1 A;  4FLX A;  4NB5 A;  3CX5 F;  4RQF A;  4W4K A;  2M6Y A;  3L72 H;  3QO8 A;  1I0H A;  1H2M A;  2F66 C;  4AI8 A;  3LNM B;  4RUE A;  2KG7 A;  2Z5U A;  3DXR A;  3OM3 B;  4LF7 B;  1WAZ A;  2X6B A;  2RNB A;  5LMU B;  1NTM H;  1YF2 A;  3O65 A;  4ZI7 A;  5LMN B;  3RVZ A;  1MSD A;  2AGA A;  1FKA O;  1W59 A;  3H1I H;  1ZSP A;  1N36 O;  2P4K A;  5J2T B;  1MMM A;  1ORQ C;  2VQE O;  3WFV A;  4F4L A;  4JI5 O;  1AR4 A;  3T4Z A;  1J5E O;  4F6R A;  1OCO C;  1VP7 A;  2HP8 A;  3K0D A;  4PDV A;  1CXZ B;  2QM8 A;  3PN1 A;  4KHP B;  1HNZ B;  5EIB D;  2CH7 B;  4WFG A;  3CRC A;  2Z3Y A;  1AIL A;  4PDL A;  2UXB B;  3K79 A;  4ZOL A;  3CRM A;  4K8Z A;  3AG7 A;  2GHY A;  3CXC U;  3FFQ A;  4I55 B;  1LNQ A;  3IFX A;  4HNA B;  4DV2 O;  3UKM A;  1HNX O;  5IYZ A;  4N21 A;  2RN9 A;  2QGN A;  2F1M A;  2P6J A;  5IYD O;  3U11 A;  4K8X A;  3CP1 A;  1YJ9 V;  2EZO A;  3L9D A;  4AIL C;  3AG2 C;  3CCJ V;  2DYS C;  2ODM A;  2IJH A;  4LH6 A;  3H1H H;  1JQ0 A;  3CJH B;  1S3J A;  1SES A;  2JRI A;  1ZAU A;  4O2B A;  3RYI A;  4FJC C;  1R6N A;  1Q90 D;  3CCE V;  3H01 A;  3JYC A;  3LSQ A;  3RWR D;  5LGU A;  4DV1 O;  2XOK G;  2XAH A;  3K5M A;  5JVD A;  5B1B C;  2WLI A;  4TQF A;  4BIO A;  1SET A;  1YIJ V;  4NXM O;  3J81 N;  3EHB B;  4XBF A;  3HKB A;  4X20 B;  2WLK A;  3OEH G;  3IGA C;  4JI1 B;  3OMI B;  2LO1 A;  1NKD A;  4J7K A;  2ZQM A;  5B1A C;  4K3A A;  1NH2 D;  3Q4H B;  1FS0 G;  3K04 A;  1Z5W A;  1YCI A;  1FXK C;  5L3F A;  1XHZ A;  4JTD B;  2YDE A;  1URF A;  2KSD A;  5JJN B;  1AVM A;  4O4I A;  3OGC C;  4K0K B;  3I55 V;  1SA0 A;  3ZX6 A;  1YEW A;  5L3D A;  2ITD C;  1MA1 A;  3T1H O;  1VQ4 V;  3CE2 A;  1TA8 A;  4JYB A;  3L71 H;  1V54 C;  1S0V A;  1JFF A;  2ZR3 A;  4B08 A;  4FPP A;  4GT1 A;  1ZUQ A;  3ABM B;  5LOV B;  4DV5 O;  3N2G A;  3TK1 A;  4X65 O;  2OYQ A;  4QNH B;  1Y74 A;  3ZMZ A;  1XMO O;  1AJP A;  5CA1 A;  5LBQ A;  4NYK A;  2GTA A;  4KFM A;  1YIT V;  3CCU V;  4WFF A;  4WFB V;  4YIP A;  3A0B Z;  3BVO A;  2EIN B;  5BMV B;  4HBN A;  1TVK B;  1L0L H;  3ZJZ A;  3T1Y O;  1GN2 A;  1GO3 F;  4J10 A;  2OIE A;  4X66 B;  4JI4 O;  4CH6 A;  1XHX A;  1ENV A;  5IJ9 A;  2EIK B;  4ZIB A;  2IH1 C;  1Q6U A;  3SYO A;  2E5L B;  2A0L A;  2YI9 A;  4X1I A;  5L3G A;  2K1E A;  1GH6 A;  1B3Q A;  4DV0 B;  1ZX3 A;  3CPW U;  4NTY A;  4QPK A;  4JI3 B;  4GKK B;  3ICX A;  2YI8 A;  1GN6 A;  1IZ3 A;  1EZV H;  2JVD A;  2CDY A;  5CN0 A;  4JGS A;  1FFX A;  2Z0A A;  3W7W A;  4B3T B;  2A3Q A;  5LP6 A;  5CBF A;  4JAS A;  1JA8 A;  2EZP A;  3CHX A;  4LF8 B;  4Q6G A;  4DR1 B;  2A06 H;  4JYA B;  4CH3 A;  4I7Z B;  3F7Y C;  3N27 A;  4LF4 B;  4O4L B;  4ZHQ B;  1P49 A;  1R6K A;  3FB6 C;  3GWO A;  2ZR2 A;  1N8R W;  2YEV B;  4LFB O;  2F95 B;  3AG4 C;  4DUY B;  4UCS A;  3CB2 A;  1VQ6 V;  4IT5 A;  2WLH A;  1XOU A;  2YIB D;  4FFK A;  1G8M A;  2D2C B;  2Y0I A;  1VQN V;  4G28 B;  4I50 A;  1XMQ O;  4YY3 O;  3CC7 V;  1Q3E A;  5CA3 A;  4IGG A;  3J7A U;  3L73 H;  2EIL C;  2ZE8 A;  3JAW A;  1TUB B;  1HR0 B;  1BHB A;  4NXN B;  4LFC O;  3OTO B;  3KCX A;  4X1K A;  3BAB A;  3ZRV A;  4LF9 B;  5J2U B;  5GON B;  2GUZ A;  1XUQ A;  2IH3 C;  2UU9 O;  5KA5 A;  1O9H A;  3R66 A;  4DW0 A;  3K3W A;  1IBL B;  4B3S B;  4JI6 B;  1MOF A;  3IAY A;  1WA8 A;  1K5Q A;  1WPB A;  3A0H Z;  4PA4 A;  4R50 A;  1WPX A;  3SR2 C;  1KC8 W;  1T5E A;  4UCU A;  3FYE B;  4C7U A;  3SDL A;  4FZ1 A;  4IHJ A;  2BOB C;  2AHZ A;  1NH2 B;  5L3E A;  2R72 A;  5JWP A;  3ZHT A;  1Q7Y W;  3EXA A;  1QLE B;  2ZM6 B;  2ZT9 B;  1AJN A;  1S5H C;  4EB6 A;  3G71 V;  5JCO A;  2EIJ C;  2PI5 A;  3STL C;  4O4H A;  3ZIA G;  4BIU A;  3C3T A;  4WFA V;  2P22 C;  4G27 B;  4U7N A;  2B1G A;  1GM9 A;  1W2B U;  2DWD C;  5FPR A;  3CME V;  4MTO A;  4HAM A;  1KP2 A;  1BSM A;  1NR7 A;  4U3J B;  3OFN G;  1Y67 A;  2VS0 A;  5KX5 B;  4DK0 A;  5CBH A;  5LOV A;  3ZMU A;  1E1R G;  4LR3 A;  1Q8I A;  4CH4 A;  1VEW A;  3P3N A;  4GZR B;  1NTZ H;  3E83 A;  1N33 O;  5IYB O;  1PV0 A;  2QSA A;  4R7C A;  5KA6 A;  3VQW A;  2XHB A;  3B8M A;  2CUG A;  2HR3 A;  3U10 A;  4HYO A;  2L6L A;  1VQL V;  1EN4 A;  2ZXW B;  3RGB A;  3E35 A;  4PA6 A;  4TV8 B;  2F4V B;  4TSF G;  3BPZ A;  2BSK B;  1YJN V;  1OV9 A;  3BFR A;  1IX9 A;  1ZTE A;  4W4L A;  3JD0 A;  4Z1V A;  3UO3 A;  1N0N A;  3K5N A;  4QIW F;  1CPY A;  5IJ0 B;  1WP8 A;  3E8B A;  2W6J G;  3AK3 A;  2Q69 A;  2YS8 A;  1PL0 A;  4B3M O;  3E8G A;  3K58 A;  2B1I A;  4TUY A;  1GK9 A;  2G38 A;  5KUM A;  3RYF A;  5CB4 B;  1V9P A;  3FAV B;  3A2F A;  2CK3 G;  1SQP H;  4FM1 A;  5HFL A;  1DGS A;  4Q20 A;  2ZNI A;  5GTI Z;  2WLL B;  4DR5 B;  2DE0 X;  3L74 H;  2AZ2 A;  1NI8 A;  4TV9 A;  4DR4 O;  1YDX A;  1YSC A;  1HP8 A;  2E76 B;  4YJ2 B;  2HVK C;  2V1D A;  4EFE A;  2ZCE A;  1M56 B;  4H33 A;  1K8A W;  4X64 O;  3D8C A;  4GCZ A;  1YVW A;  1JCH A;  3D36 A;  1R3L C; 
#chains in the Genus database with same CATH homology
 2QM8 A;  2YSU B;  1TUE B;  2A79 B;  3B8N A;  2JEX A;  1VQM V;  1WLE A;  3OE7 G;  3K0G A;  4WFG A;  1JPX A;  2Z3Y A;  4MVO A;  1EZJ A;  1SRY A;  3LDE A;  5DN6 G;  1YTF B;  4PDL A;  3K79 A;  2UXX A;  1QR9 A;  5J9P C;  2H8P C;  2GHY A;  3CXC U;  4DO2 A;  3E8H A;  4MSW C;  1QCE A;  3G6E V;  1OCC B;  3W7U A;  2DYR B;  1LNQ A;  4MVR A;  2X6A A;  3ABK C;  3IFX A;  3OUF A;  3CC2 V;  5BZB A;  1VQ5 V;  3UKM A;  2PI4 A;  4PEL A;  4XDJ A;  1Y66 A;  5IY5 C;  4N21 A;  2Q67 A;  4BW5 A;  1AI4 A;  1VQK V;  1JVM A;  3AG3 C;  2P6J A;  3WG7 B;  5IYD O;  4JAV A;  4KUM A;  1PD3 A;  4LCU C;  4Z1M G;  5LGN A;  1K5S A;  4LC1 A;  3CP1 A;  3RBZ A;  3ABM C;  1YJ9 V;  4BIZ A;  1RPO A;  2EZO A;  3QO7 A;  1EFR G;  3AG2 C;  1Y4M A;  1PNL A;  3CCJ V;  2DYS C;  2IJH A;  3A0R A;  2R9R B;  2JEU A;  4QPJ A;  3E8F A;  1JQ0 A;  3ABL B;  1COW G;  1S3J A;  3FB7 C;  5IDJ A;  1SES A;  4WF9 V;  2EBO A;  2OCC C;  2IJJ A;  3ZMT A;  5IYC O;  4LBE C;  2XAS A;  1R6N A;  1NQT A;  4FJC C;  3CCE V;  2LP7 A;  4I9W A;  3H01 A;  3AEI A;  1G4Y B;  3JYC A;  3LSQ A;  4UV8 A;  1GMG A;  5LGU A;  2H94 A;  1K4D C;  1PNM A;  2EIN C;  2ITC C;  2XOK G;  1MAB G;  4ZKI A;  2XAH A;  5C93 A;  3K06 A;  1XL6 A;  3JD4 A;  1RPR A;  1ARO P;  2ZD9 A;  2WLI A;  5B1B C;  3CCL V;  4RO2 A;  4TWK A;  4J9Y B;  3ASO B;  1SET A;  1RM1 B;  1YIJ V;  1JJ2 U;  3CCV V;  3EHB B;  2EIK C;  4JAU A;  3SYA A;  4XBF A;  5H6R A;  2HKO A;  2JIZ G;  2WLK A;  4JF3 A;  3ZRS A;  3OEH G;  2BOC C;  3BY6 A;  5B1N A;  1FFT B;  3IGA C;  1OCR C;  1QVG U;  2P90 A;  3MHH C;  4R8C A;  3OMI B;  1THZ A;  4UVA A;  2XAQ A;  2JJ2 G;  3F5W C;  1NKD A;  3R65 A;  1NVP B;  2A9H A;  2ZQM A;  5B1A C;  1NH2 D;  1DLB A;  2IW5 A;  2NNU A;  1FS0 G;  1R3I C;  3ZRW A;  4N23 A;  3K04 A;  2EIM C;  2KB1 A;  4MVM A;  1FXK C;  2QTO A;  1KKD A;  5L3F A;  4JTD B;  4QE9 A;  2NLJ C;  3E86 A;  4JPR A;  1FXK A;  3RW0 A;  2WWW A;  2HVJ C;  3OGC C;  2HJF C;  2IJI A;  2W0F C;  3X2Q C;  3JCZ A;  3I55 V;  4J9Z B;  5IY5 B;  3M99 B;  3MD0 A;  5L3D A;  2ITD C;  3AG3 B;  4MW8 A;  1VQ4 V;  5B1O A;  4GX5 A;  4JYB A;  1H8E G;  3G4S V;  1V54 C;  1S0V A;  2HFE C;  3ZRX A;  3T4D A;  3UM7 A;  2ZR3 A;  1OZ0 A;  2C2A A;  3D3I A;  4FMT A;  4H37 A;  4MVQ A;  3VOU A;  4FPP A;  3W7S A;  4GT1 A;  3MHS C;  3ABM B;  4DXW A;  1P7B A;  1S72 V;  3TK1 A;  2YEV A;  3AG2 B;  4QNH B;  2D3O W;  2DYS B;  1I5X A;  3ZMZ A;  1AJP A;  4UXN A;  5LBQ A;  4FIP C;  3ZN0 A;  1S77 D;  1AI6 A;  4HZ3 A;  2WAM A;  4KFM A;  2OCC B;  5DM6 V;  1YIT V;  1QVF U;  3CCU V;  2QA4 V;  1AI5 A;  2IU3 A;  4P9O A;  4WFF A;  3CD6 V;  4WFB V;  3ZCC A;  3OMN B;  3P30 A;  5HFM A;  1KP3 A;  2EIN B;  1I5Y A;  2WLI B;  1SER A;  2P67 A;  5E1A C;  2R9I A;  3K08 A;  2AHY A;  1R3J C;  5B1B B;  3ZJZ A;  1GO3 F;  1QBZ A;  1ENV A;  2OTJ V;  1Q86 W;  2EIK B;  1E79 G;  2IH1 C;  1QLN A;  3AG1 C;  5EBW C;  3SYO A;  3SJQ C;  1OCR B;  2A0L A;  5L3G A;  2K1E A;  3QNE A;  4BAY A;  3CPW U;  4QPK A;  4PA7 A;  5GW7 A;  4CBC A;  3FB8 C;  3ZRW B;  2WPD G;  5B1A B;  5B3S C;  3SYQ A;  5CN0 A;  5LHH A;  1Q82 W;  4JGS A;  5EBM C;  3W7W A;  1L1F A;  5LGT A;  3ETD A;  5CBF A;  1E1Q G;  4JAS A;  2GSM B;  1FXK B;  2X0L A;  2EZP A;  5H9C A;  3QO5 A;  4E2L A;  4UV9 A;  1M57 C;  3SYP A;  1VQ9 V;  3CC4 V;  5FL7 G;  2WLM A;  3ETE A;  3F7Y C;  4PDV A;  1JOY A;  3CYO A;  4UVC A;  3CCQ V;  5LHI A;  3DGE A;  3E89 A;  1S76 D;  5EC1 C;  3I56 V;  4X88 A;  4X8A A;  1V54 B;  2JK5 C;  1R6K A;  5CBG A;  2XND G;  3FB6 C;  1QLE C;  3GWO A;  1PKX A;  2ZR2 A;  3P32 A;  1M1K W;  1N8R W;  2YEV B;  3HPL C;  1H38 A;  4KP4 A;  4RQE A;  3AG4 C;  1AI7 A;  1OCO B;  4EKW A;  1VQ6 V;  4L87 A;  1MG1 A;  2WLH A;  4RAI A;  3TCU A;  3CCM V;  1G8M A;  1MSW D;  3ML0 A;  4MS2 A;  4XDK A;  4GX0 A;  1JX9 A;  3TET A;  1VQN V;  4G28 B;  5EK0 A;  3ASN C;  3CC7 V;  4QJF B;  4PDR A;  5CA3 A;  1OCZ C;  2V7Q G;  2EIL C;  3F7V C;  1BHB A;  2JJ1 G;  3ABK B;  2WSS G;  1K3E A;  1W0J G;  3LUT B;  2Y48 A;  3OR6 C;  1CEZ A;  3STZ C;  1YHQ V;  3ABU A;  1CP9 A;  3K0D A;  5EBL C;  4P30 A;  1FXV A;  2OTL V;  4XDL A;  3SPH A;  4I5S A;  3AG1 B;  4GX1 A;  3RVY A;  3ZRV A;  1K73 W;  2XAJ A;  1K4C C;  4WFE A;  2MK3 A;  3JD1 A;  3VBB A;  3CMA V;  4RUF A;  2IJK A;  3SYC A;  1YI2 V;  2IH3 C;  5KA5 A;  3K3W A;  4OXS A;  3PJS K;  4R6Z A;  5B3S B;  1B6Q A;  1F4M A;  2OT5 A;  1MOF A;  2ATK C;  3NXS A;  4UVB A;  1KEC A;  1W0K G;  2ZXW C;  3K03 A;  4JTA B;  1K5Q A;  4PA4 A;  3B77 A;  2LFS A;  4R50 A;  4YXW G;  4TT3 G;  1WPX A;  5CMU A;  1KC8 W;  1BHA A;  4LP8 A;  1NR1 A;  2WLJ A;  3OR7 C;  5EC2 C;  1M57 B;  1KD1 W;  3LSS A;  3FYE B;  3ASO C;  2EJR A;  1RM1 C;  1K97 A;  3HB3 B;  2M7W A;  2Q6A A;  2BOB C;  2AHZ A;  2QEX V;  1GKF A;  1R73 A;  1NH2 B;  5L3E A;  1P4R A;  1YJW V;  1Q7Y W;  1VQ8 V;  1F51 A;  2DQ3 A;  3JD3 A;  1QLE B;  4ZBM A;  3ZMS A;  1VQ7 V;  3CCS V;  1AJN A;  3T1C A;  1ROP A;  4WCE V;  3AG4 B;  4JYC A;  1S5H C;  4MTX A;  3G71 V;  3FYI B;  2PI5 A;  2EIJ C;  4P2Z A;  3STL C;  3K9A A;  4MVZ A;  1UJW B;  1VQP V;  4JTC B;  2DWE C;  4X89 A;  3ZIA G;  2W6I G;  1KQS U;  2Y69 C;  4BIU A;  1GM7 A;  1R3K C;  4WFA V;  4G27 B;  1AR1 B;  2QE7 G;  2HG5 C;  4U7N A;  3KG2 A;  2B1G A;  1GM9 A;  1M90 W;  1V55 C;  1W2B U;  2EIM B;  2DWD C;  3ASN B;  3OAA G;  3SPG A;  3CME V;  3EFF K;  5KUK A;  1OCZ B;  2UXN A;  4G2K A;  4MTO A;  1NVP D;  1IXM A;  1H2G A;  3OW2 U;  2EIL B;  4HAM A;  1BL8 A;  1KP2 A;  2WLL A;  2X6C A;  1K34 A;  2DW4 A;  2QM7 A;  3LDC A;  3W7T A;  4ASU G;  1NR7 A;  3OFN G;  3X2Q B;  1M56 C;  3ABT A;  3FB5 C;  5LHG A;  3DTU B;  1BMF G;  3CCR V;  4FK5 C;  1DF4 A;  5CBH A;  4PA3 A;  3ZMU A;  2FTK A;  1E1R G;  1QR8 A;  1K33 A;  5L3B A;  3W7X A;  1XL4 A;  3E83 A;  3JD2 A;  5IYB O;  1K92 A;  4R7C A;  5KA6 A;  1J95 A;  1PNK A;  1Q81 W;  2WLN A;  3B8M A;  3OUS A;  3OEE G;  2HR3 A;  4GX2 A;  1AJQ A;  1OHH G;  1EBO A;  4HYO A;  1FXH A;  3ZMV A;  1VQL V;  3SPI A;  2ZXW B;  2Q68 A;  1OCC C;  2LFR A;  3E35 A;  2DYR C;  4PA6 A;  4TSF G;  3IC7 A;  3LDD A;  1NBM G;  1YJN V;  1GTO A;  1M9N A;  1NJI W;  2QKS A;  4U7O A;  4MT8 A;  3JD0 A;  2HLD G;  4MW3 A;  1DF5 A;  1F23 A;  4MVS A;  4P9P A;  3WG7 C;  5H6Q A;  3ZN1 A;  4RQF A;  1YTF D;  2B5U A;  1K9M W;  1H8H G;  4QIW F;  1CPY A;  4PA9 A;  3E8B A;  2IU0 A;  2W6J G;  3E2E A;  3OMA B;  3QO8 A;  3GB7 C;  2Q69 A;  3LNM B;  4RUE A;  2Z5U A;  3OM3 B;  1PL0 A;  2ZDI C;  1K7D A;  3E8G A;  2X6B A;  2EIJ B;  3ABL C;  2B1I A;  2ZDI A;  4QE7 A;  1GK9 A;  5KUM A;  1HWY A;  2Y69 B;  4MTG A;  3RVZ A;  2CK3 G;  4MTF A;  2XAF A;  1ZWI C;  1SZT A;  2P7T C;  1GM8 A;  3SPJ A;  1V55 B;  5HFL A;  4UUJ C;  4Q20 A;  1VQO V;  3SPC A;  2WLL B;  4MVU A;  1DTO A;  4WFH A;  2DQ0 A;  1F4N A;  4CZZ A;  1ORQ C;  1YSC A;  3WFV A;  2X7R B;  2HVK C;  4PDM A;  4F4L A;  2V1D A;  3T4Z A;  5L3C A;  1M56 B;  2XAG A;  4H33 A;  2JDI G;  1K8A W;  1OCO C;  3ETG A;  4GCZ A;  3T2M A;  1JCH A;  3BEH A;  3D36 A;  2F43 G;  3FKS G;  1R3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...