4QE9A

Open mthk pore structure soaked in 10 mm ba2+/100 mm k+
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
83
structure length
83
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ionic interactions of Ba2+ blockades in the MthK K+ channel
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transport protein
molecule keywords Calcium-gated potassium channel MthK
total genus 31
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qe9A00
3ASOC 2A9HA 4P2ZA 5EC1C 5EBMC 3K0DA 4JTAB 4PDLA 3FB8C 3KG2A 2AHYA 4GX1A 3RW0A 3SPJA 1G4YB 3TCUA 3F7YC 4LP8A 3FB6C 4TWKA 3SJQC 1XL4A 3ZJZA 4HYOA 3SYCA 4MVOA 4QE7A 3T2MA 3SYAA 3K06A 4GX5A 4LBEC 2Q6AA 3LDDA 3GB7C 3IFXA 3ABKC 3AG2C 3ABLC 4RO2A 1R3KC 2Q67A 2HG5C 4MVRA 4MVSA 3OUSA 4MVQA 2DWDC 2BOBC 2EIMC 4XDKA 3SPHA 2QKSA 4HZ3A 4ZBMA 2BOCC 2WLLB 4DXWA 1K4CC 1R3JC 2WLJA 1OCCC 3E8HA 4I9WA 3R65A 4WFFA 4MVMA 3UKMA 3K0GA 3SYPA 3ASNC 4P30A 2ATKC 4MW3A 3RBZA 4KFMA 4MTOA 1ORQC 1ZWIC 4LCUC 2EIJC 3E8FA 3LDEA 3HPLC 2ITDC 2ITCC 2WLNA 4J9ZB 4P9PA 3SYOA 3AG3C 3LUTB 4WFEA 3F5WC 1KKDA 1M56C 2HFEC 2NLJC 2WLLA 3K04A 5B1AC 2Y69C 1R3LC 2OCCC 3X2QC 2KB1A 2ZD9A 4PA4A 5EC2C 3IGAC 4WFHA 2HJFC 1K4DC 4PDRA 5BZBA 1BL8A 4MS2A 2WLIB 3PJSK 4MW8A 3RVYA 4OXSA 2EILC 1S5HC 2IH1C 3RVZA 5CBFA 3K08A 3T4ZA 3SPCA 5IY5C 1J95A 3ZRSA 1V55C 2A79B 3AG4C 2Q69A 4MVUA 3SYQA 3UM7A 4QE9A 4R50A 2ZXWC 2EINC 4PA7A 3LNMB 4CBCA 2HVJC 3E8BA 3STZC 4EKWA 1OCRC 3OR7C 1V54C 4GX0A 5KUMA 4R7CA 3T4DA 4RUFA 4RUEA 5B3SC 2DWEC 3JYCA 3VOUA 3BEHA 1XL6A 4R6ZA 3OUFA 2WLHA 4MTFA 4G28B 4XDLA 1JVMA 2IH3C 4G27B 3E86A 4X89A 4WFGA 3T1CA 3SPIA 3OGCC 2QTOA 3FB7C 4MSWC 5KUKA 2W0FC 4PA6A 5EK0A 3ABMC 2JK5C 1R3IC 4MTGA 4PDMA 5CBHA 4QNHB 1OCZC 3WG7C 3EFFK 1OCOC 4GX2A 3FB5C 5CBGA 1P7BA 3AG1C 4X88A 2X6CA 4JTDB 4PA3A 4H37A 3SPGA 2H8PC 5EBLC 2X6AA 2P7TC 2DYSC 1LNQA 2A0LA 2Q68A 2YEVA 4MVZA 5E1AC 5EBWC 3TETA 3F7VC 4PA9A 4P9OA 2HVKC 2WLKA 3K03A 1QLEC 2AHZA 2WLMA 3STLC 4RAIA 3E8GA 2WLIA 1M57C 4UUJC 3OR6C 4PDVA 5J9PC 4H33A 3LDCA 4F4LA 2DYRC 3E89A 2X6BA 2R9RB 2EIKC 4BW5A 5B1BC 4XDJA 4J9YB 4R8CA 3E83A 2K1EA 4X8AA 4JTCB
chains in the Genus database with same CATH superfamily
2HHHB 5DM6V 3LNNA 1L0NH 3TCUA 2AW9A 4JI4O 5H6RA 3RT3C 1WA8A 2BCCH 4OX9B 1PL0A 2A3QA 1KP3A 1E1RG 2F43G 1N8RW 2E5LB 4AI8A 5JCOC 3K5OA 2DQ0A 4X20A 1SA0A 4ZBMA 1GM8A 4IT5A 4GUNA 2QWOB 1HP8A 1B04A 5HFLA 4JI4B 1AR1B 4X1KB 3H1IH 1MA1A 1WLEA 1K73W 1FXHA 3QO5A 5IY5B 5L3BA 1X4TA 4FM0A 4NVPA 3BVOA 1QCEA 4I0XB 1FPOA 3UCSC 3JD3A 2DE0X 3ZMUA 5A2QN 2QM7A 2VWJA 5IY5C 1NKDA 1WB7A 1Y74B 4C7UA 2ADQB 2LQTA 2ZCEA 1OCOB 4FFBA 3H01A 1XMQB 1GM9A 2HR3A 4EKWA 2EULA 1V54C 3T4DA 2DWEC 3CCJV 4FM2A 3G67A 2GDSA 2Q7EA 3MHHC 1DF4A 4QNHB 4LF5B 1RM1B 2EJRA 2A7WA 1KKCA 2UXBO 3UQ8A 3BA9A 3OW2U 3TETA 2ZE8A 4P9OA 4FFBB 2WLMA 3ICXA 3ZN0A 1GM7A 3DSQA 1NT2B 2JGUA 4J7ZA 4J9YB 4EFEA 3HR0A 4LFBO 3K0DA 2JGDA 4LF7O 4D7SA 1I08A 2OTJV 4PD4F 3P30A 3SR2C 4BR6A 4GZRB 4LF8B 3GVMA 4QE7A 2RQ6A 1YTFB 5TISZ 4JI7B 1WNSA 3KZIZ 3ABKC 3HB3B 3WFVA 3ETDA 1QLEB 1DF5A 3ZRWA 1OV9A 4GKJB 3HKDB 2ZKOA 4J7JA 1EZJA 1RP3B 3TJTA 2F95B 1IX9A 2ADPA 4UB6Z 1SQGA 1SZXA 2DQ3A 3RYFA 4LCUC 4BIOA 3P3NA 1WP8A 2AGAA 1Q7YW 1KD1W 2LGQA 4Q20A 2P6JA 1AI4A 2UUCB 5JWPA 3Q4HB 3X2QC 1A32A 2WLIB 4MW8A 4LFAB 4AQYO 2R70A 1H2SB 4B7KA 2A79B 3AG4C 1OCZB 2QKCA 2ODMA 1BE3H 4I4TA 1I5YA 3H1LH 3L71H 2PI4A 1NQTA 3CPWU 3I55V 5B1AB 4XDLA 4LWSA 1AI5A 2PZSA 5CBHA 3D3QA 3JASA 4JASA 2Y48A 1VQOV 4DV0B 3JATA 1JR9A 2JJ2G 3OD4A 1VQKV 3CRCA 2AHZA 5H2FZ 2IU3A 1M57C 2FTKA 1Q90D 4JZGA 3H1KH 2HEPA 1JFFA 3E89A 3L9DA 5LBQA 3W7WA 2ZQMA 2B5UA 4XDJA 3A0RA 4X65O 1EM1A 5EC1C 5EBMC 2M7WA 2QWNB 3RYHA 2OTLV 1BHAA 3G6BA 3H1JH 3SJQC 4YIPA 2XTAA 4FZ0A 1N33O 1GK9A 1ZTEA 3GWOA 1QNMA 1MNGA 1VQ4V 5IE9A 2AZ2A 2WSSG 1Z5WA 4EB6A 2EIMC 1AR4A 4XDKA 1RPOA 2BOCC 4DUYO 1QVGU 2ZE6A 4WBNB 1XI1A 3SYPA 5LHIA 1D5AA 4TV8B 3RYHB 3DC6A 4WFBV 2ITDC 1BQ0A 4X62B 1SQQH 1YVWA 2HFEC 1KYOF 2IJHA 1K4DC 3JD0A 2QSAA 2HKOA 3PJSK 4GLXA 1XOUA 5LOVB 4DR7B 4J11A 5BR8O 1SQBH 4E4EA 4JAUA 2JGDB 1NH2D 4I7ZB 1HDJA 2GTSA 4B3MB 4I55A 1URFA 2LW1A 1LR1A 4IIJB 1UJWB 2QE7G 4J42A 1AJNA 4U7NA 2LFSA 3C3TA 4JI7O 2FMLA 3CMEV 2B1GA 5BMVA 1VP7A 5IT9N 1IZ3A 5A9GA 4O4JB 4K0KO 2ZE5A 2KG7A 1FJGB 3CHXA 4Z1VA 4BW5A 5B1BC 4NTXA 4R8CA 1N4CA 3CRRA 2RDCA 4P2ZA 4FK5C 3NXSA 2GBOA 2CDYA 4I9QA 4DRXA 2E5LO 4LR3A 2Z3YA 4K0KB 2B9ZA 3QG5A 1M5IA 4LBEC 3ZRVA 1ENVA 4HAMA 1Q6IA 1NVPB 4FVMA 5KA6A 5LMUO 1JA8A 1QBZA 1XBLA 3K58A 2OIEA 4QPKA 1M1KW 2WLJA 3E8HA 5LYJA 1XMOB 4DV4B 4JI3O 5LMNB 5LMUB 4P9PA 1B3QA 2Y4TA 4UFZA 3LUTB 1JOYA 1K5SA 4NKGB 3O65A 5CA3A 1V54B 4TUYB 3E22B 4DV0O 4PHZA 1TGOA 2CH7B 3OTOB 2P4VA 3OTFA 4WFAV 3CS5A 3H9VA 5JJJB 2XAGA 5FPRA 1FS0G 4CH5A 1MOFA 2E75B 2CUGA 1MSDA 1PPJH 4HNAA 3CCEV 4JYBA 4G27B 4YXWG 3MHSC 4CS4A 5KHKA 4U3JA 4DV2B 4O4LA 2QA4V 1K34A 1ZX3A 1IBLO 1N33B 1E79G 5LL6Y 3K5LA 2IBZH 2H8PC 2PY5A 5EBWC 4KUMA 4I50A 3ZHRA 3U10A 2UXNA 2EJ7A 3NR7A 3VBBA 1AP6A 3CX5F 1BZKA 3HKBA 1O9HA 1Y4MA 1N0JA 3FKSG 3QO8A 5JQGB 1G6UA 1ZLZA 5JJNB 1JMKC 2MK3A 1GAXA 4FFKA 2Q0OC 1S5JA 2JEXA 3L74H 1N34O 4GX5A 2CH7A 1D5NA 5L3DA 2V4DA 3B2EE 4JI1O 3ZS8C 4UCTA 1FXKC 1VQ9V 4TOIA 1VF6C 5BR8B 1H8HG 4WF9V 3B77A 4LF4O 2EINB 2W6IG 2ZIOA 4HNAB 3UKMA 1YJWV 2BTQB 1SF9A 4P30A 2UU9O 3RBZA 5IWAB 3LDEA 4JGSA 1VQ8V 1G1XB 2M6YA 4NTYA 2E74B 5LYJB 3AG2B 1YTFD 2QWQB 2CE4A 4TT3G 4X64O 5CBFA 1XNQO 2VRZA 1VIBA 2QM4A 2W6JG 1SQPH 1PL4A 4O4IB 3UT5B 1ROPA 4FLUA 2XAJA 4JYAO 4I4TB 3AK3A 2IW5A 3DC5A 5B3SC 3JYCA 4YJ2B 4CS3A 1I7FA 3B4SA 1LUVA 2UUAB 3CP1A 4MTGA 2RN9A 4UB8Z 3WG7C 2R72A 4GX2A 3FB5C 1TA8A 5E1AC 3CE2A 3OEEG 1EBOA 4PA9A 4BIUA 4EFBA 4UVBA 1Y67A 3E8GA 1XDCA 4LFCB 1M90W 1YDXA 2UUAO 3OR6C 3T1YO 1PP9H 3CSXA 4O4HB 1PKXA 5B3SB 3JAWA 4X66B 1I5XA 3ETGA 3P32A 5KA5A 1XREA 1W2BU 4NXMB 4JTCB 2B1IA 3ASOC 3DGEA 4AHCA 3IC9A 3K57A 1VF5B 2QWRB 4JF3A 4B08A 1GO3F 3SPJA 2F4VB 4YJ3A 1G4YB 4DV7O 3WB0A 4I5SA 3ZJZA 4DR4B 2UXBB 1DLBA 2DYRB 5B1BB 4DUYB 2ZNJA 3B09A 3HKBB 3D8CA 3QO7A 4LH7A 3IJ4A 4JI5O 1NR7A 4YY3O 4DV7B 4YJ2A 4I9WA 2E3CA 5JVDB 3FFQA 4KFMA 5HFMA 1J5EB 4PV1B 1H2KA 1SQXH 2XASA 5LXTA 2VS0A 4DR6B 5DEDA 4UCVA 3W7XA 5CA0A 2Q8VA 4LF7B 4JI2O 2DOSA 3F5TA 1KECA 4KHPO 1YCIA 2PYJA 1N36B 5LGNA 5DECA 4GT1A 4KL1A 4DR2B 1WN7A 4DR6O 3ZHTA 1YEWA 4WBNA 2CTQA 4DR3O 4JI2B 2BE3A 5L3GA 2EIKB 2YS8A 4KHPB 3E35A 1AI7A 1BT8A 3E86A 1PNLA 3T1HO 2L35A 2ARHA 5CB4A 1GRJA 2Q9LA 4PDMA 2Z5UA 1MZEA 3J81N 3OE7G 3W7SA 2QWPB 5JH7A 1N34B 4JI1B 2X6AA 5L3EA 4DW0A 2WLKA 1IBKB 5IYBO 5BMVB 5J2TB 4ZOLB 4AQYB 4JAVA 3HKCB 4F4LA 4F6EA 4JI8O 1H8EG 1GN2A 2YIBA 2UU9B 4UCRA 5KMGB 4PDLA 2ZR2A 2XNDG 2VQFB 1YJ9V 4LP8A 4OPHA 5JH7B 2ZM6B 3ZEDA 1S72V 1VQLV 2GTAA 4O4IA 5GONA 3UT5A 3K06A 4PJ0Z 3GB7C 2XAQA 2GUZB 3ABTA 2HG5C 1FD9A 3SPHA 1K5QA 4KP4A 2VQFO 2YUAA 4MTOA 1V55B 1MMMA 3OMAB 5EIBC 2ZNIA 3K04A 3EVKA 3JALB 3D36A 4UVCA 3CXCU 1EN6A 4PDRA 1XHZA 4B3RB 3LSQA 1MABG 1CEZA 4DUZB 3DXRB 5J2TA 3DTUB 1EN4A 4QGPA 1H2GA 3ZX6A 4DR1O 2RJZA 4DK0A 3LSSA 3SYQA 1BQZA 4H44B 2R9IA 1IXMA 1ZL8B 4PI2A 1VARA 5KHHA 3JCUZ 3JARA 3IC7A 1L8DA 1YXBA 4DR1B 3X2QB 4GKKB 2V1DA 4TSFG 4IIJA 2N74A 5EK0A 2JK5C 2D3OW 1B06A 5B66Z 2QEXV 1OJHA 4DV3O 1FYJA 4CC5A 1BS3A 3AG1C 3ZRXA 4PA3A 3ZBHA 3A0HZ 1SS3A 1QHTA 4FMTA 4FM1A 2YEVA 3APOA 4X1YA 2HVKC 2CGNA 3BRCA 1TUEB 4RAIA 4GKKO 1X59A 4FLYA 3K9AA 1BMFG 1QR9A 4UXNA 3JASB 1OCCB 3ZIAG 4J80A 4D6TH 4EEQA 2K1EA 4B7EA 1AJQA 4X8AA 1W0JG 2A9HA 2WPDG 4JV5B 2JVDA 3CCQV 3EHBB 4Z2WA 5B1OA 5IYZB 4ZHQA 1HNZB 1IBMB 4B3TO 1M4UA 4DRXB 3G71V 1P49A 3IFXA 4LF4B 1E1QG 1SERA 4RO2A 1R3KC 4TUYA 5ITZA 2QKSA 1BSMA 2WLLB 4JI0O 1KB9F 3PN1A 2X0LA 1HNZO 2K9PA 4WFFA 4MVMA 2HJDA 2KSDA 3OMNB 1JQ0A 1ORQC 4JZ2A 2P67A 3F5WC 4F6RA 3AG7A 1Y76A 2JEUA 4PA4A 2DW4A 1EFRG 4WFHA 4LF6O 4GYCB 4U3JB 4DV1O 2Q4PA 2UXCB 4X20B 5LGUA 5LGTA 4MVUA 2IM9A 4K35A 5GTIZ 2P06A 1I0HA 2PGGA 3BCCH 2OT5A 4FPPA 4TQFA 5C8YB 3J80N 3STZC 2JS5A 3N27A 5KUMA 3N2GA 4RUEA 3VOUA 3BEHA 1O9GA 4LH6A 1ZSPA 4QJFB 2BTQA 3OGCC 4AILC 3EFFK 3ABUA 5CBGA 1VQ6V 2ETNA 1NTMH 1L1FA 1LUWA 1YF2A 1KP2A 1VQMV 1SESA 3K03A 5C8YA 4CC6A 2L6LA 4DYLA 4X1KA 3M99B 1N0NA 2X6BA 2D2CB 5J2UB 3RWRD 3MAQA 3JSNA 1OZ0A 3C90A 1HNXB 2E76B 1M9NA 2F23A 2AHYA 4GX1A 3RW0A 4X1YB 3F7YC 1SQFA 5KHIA 2XT9A 3HKEB 4FLZA 4IL6Z 2EIJB 2OYQA 1WAZA 1FFTB 4DUZO 3CEIA 1PD3A 4B3MO 4LC1A 2WAMA 4CH4A 3E2EA 5IJ9B 1IBLB 1K4CC 1FKAO 3WB1A 3ZRWB 3TGUH 1J5EO 1B6QA 2LW7A 4MW3A 4JYYA 5EYPB 1HR0B 3B8MA 2ITCC 2GSMB 1F4NA 3AG3C 1Q6UA 2UUBB 1BL8A 4J41A 1Q5OA 1CPYA 1FJGO 3ZRSA 1U97A 3ZCCA 1V55C 2P4KA 3UM7A 4QE9A 2CTRA 3AG1B 4WCEV 4DR3B 3L73H 4ZHQB 5IWAO 2AXTZ 1VQNV 3BPZA 1W59A 4FLVA 4WFGA 4MSWC 4JPRA 5KUKA 1S0VA 3MDSA 4NXNO 5E79Z 4LNUB 2YI9A 2X6CA 4K8ZA 4X64B 1K9MW 3G80A 2A0LA 3OM3B 4JI8B 5IJ0B 4BIZA 3VQWA 1HWYA 3LDCA 3O9OA 5CA1B 3E83A 3J7AU 3RYCA 2ZM6O 1NR1A 2RNBA 1WPXA 5LP6A 1JCHA 1I94O 1XL4A 2Y69B 4YHHO 3ASNB 4H0LB 4NYKA 3BABA 1R6NA 2JS3A 4N21A 3OTOO 2XAHA 3AG2C 1QQCA 2O57A 2UXCO 2BOBC 4X1IB 2FYUH 1CP9A 2YEVB 3CXHF 1VF6A 4NXMO 2ATKC 4DV2O 1K33A 4UV8A 4OGQB 4LNUA 2GHYA 4J9ZB 3AG4B 1SRYA 4WFEA 2ZR3A 2HJFC 1Z2GA 4NR1A 5CMUA 2Z0AA 4IGGA 1GN3A 2CK3G 5LHHA 3TXSA 1K8AW 3TK1A 3CCVV 1KC8W 5FNVA 1GTOA 5D5QA 4ZIBA 3AK2A 2EZOA 3A2FA 1SKVA 1TUBB 1ZUQA 2BTOA 4CH6A 4R7CA 3RYFB 1XUQA 4FLWA 1VF7A 4MT8A 4ASUG 3B8NA 4LWSB 3K79A 1KQSU 1S76D 2P7TC 2Q68A 5FNVB 1JX9A 1N32O 3GWKC 2YIBD 1JFFB 3VQYA 4UUJC 4DR2O 4CZZA 1P7GA 3ABLB 4JV5O 4FIPC 2R9RB 2A06H 1N36O 1V9PA 3SJCC 4UCSA 5K1XA 5EZYA 2CTPA 4MVOA 1NBMG 2IJIA 4X9QA 5IYZA 3S3WA 2H3OA 5EIBD 5KHGA 3JSLA 1GN4A 4O2AA 4JYAB 2BSKB 3K3WA 1R73A 5LA6B 4UVAA 1IBKO 1AI6A 3I56V 4DXWA 4XBFA 1VEWA 2N05A 2Y4UA 2Y0PA 2HP8A 4J7KA 4E2LA 1P4RA 2MW2B 4IHJA 4TV8A 1Q3EA 4JI3B 2VQEB 1L0LH 2YIDA 1M56C 3OAAG 5J2UA 3W7TA 2KB1A 2ZD9A 4DV1B 3IGAC 1RSOB 4NXNB 2YXLA 4MS2A 1PNKA 4LFCO 1NJIW 2QJ1A 3CMAV 2W0XA 3QF7A 2JRIA 3DXRA 4UV9A 1J95A 1QLNA 4L87A 1BGYH 3SDLA 2WA4A 3G4SV 4DV6O 1QU7A 2HVJC 3E8BA 1F7YA 2QGNA 3OR7C 4GX0A 5FPOA 4RUFA 1TAEA 1K3EA 1XL6A 1M56B 2WLHA 4MTFA 3WU2Z 1FFXB 1BCCH 2PTMA 4F6RB 4PA6A 3ABMC 3JD4A 4ABMA 1OCOC 5D5PA 1KBHA 1P7BA 1XMQO 2LP7A 4BW9A 1Y76B 4K8XA 2AZ0A 1MZFA 3R66A 3KCXA 4UCOA 2PUSA 1YJNV 1WA8B 1ZL8A 4DW1A 3K5NA 4LF5O 4CS2A 2EIKC 4JI6O 3JCZA 4YIOA 3FB8C 2H94A 4W4LA 5GTHZ 4W4KA 4K3AA 1AP5A 4ZI7B 3FAVB 4U3FH 3OMIB 4HYOA 3SYCA 1W0KG 3CCRV 3LDDA 3HKEA 4JI6B 2Q67A 3P3PA 3OUSA 1AJPA 4HZ3A 4NTWA 3D36C 1YSCA 1H2NA 3R65A 3RYIA 4I0XA 2EBOA 2Q5ZA 4LF8O 1FXVA 2VWKA 3K5MA 2FB5A 4D7TA 3CC2V 1Q8IA 3FAVA 4ZKIA 2KQXA 3ZHQA 2UUBO 3CRQA 3ETQA 2JIZG 3A0BZ 1AR5A 2Y69C 4GKJO 4HBNA 4LFBB 3E22A 1T5EA 3RVYA 1IVSA 2ZE7A 1Q6HA 1F51A 2YXHA 2ZDIA 5B5EZ 3THOA 2Q69A 2CGOA 1XNQB 2EINC 2UUCO 4CBCA 3SJBC 5EZYB 1K92A 2DYSB 2YXYA 4TV9A 5CN0A 3CCUV 5KLVH 1GKFA 2FL4A 4J10A 4OX9O 3LSUA 4R6ZA 1PM9A 1XQ8A 4X89A 1NZ6A 4PI0A 4O4LB 4BWAA 2IU0A 1R1BA 2W0FC 2ILMA 1M93A 3ZN1A 4DV5O 4CH3A 4H37A 4L8JA 4JYCA 5EBLC 4I50B 3FYEB 4O4JA 4U7OA 2PF4E 3CC7V 3STLC 1PV0A 1XEQA 2YSUB 4B3SO 4OPAA 4DV5B 4FLTA 3JAMN 2QDOA 2N04A 3T1YB 1RSOA 1NS1A 5EYPA 2CAZC 4TWKA 3KCYA 3L75H 1R6TA 3WG7B 3VQVA 2XOKG 1XNRO 2Q6AA 4MTXA 1IURA 4MVRA 2PYLA 4DR4O 3QTCA 3BHPA 3OGIB 3CCMV 3UO2A 2UXDO 1OCCC 5IJ9A 2YICA 3N2KA 1UFIA 5JCOA 1XNRB 3ASNC 1WPBA 1H38A 4FZ1A 1BHBA 4BAYA 3E8FA 3K59A 2WLNA 2LGWA 5JQGA 5LP6B 2UXDB 4IYIA 2WLLA 3ABKB 2P90A 3CCLV 4OXSA 2IH1C 1Q86W 3RVZA 3SPCA 1TVKB 4IYHA 2OWOA 4R50A 2ZXWC 2CTWA 3KKYA 2FKXA 2OCCB 3JD2A 4RQFA 1IBMO 4B3TB 1HR0O 1QVFU 3OUFA 4DR7O 5CA1A 3AG3B 1Q82W 3CB2A 3ZMZA 4TQDA 2EX3A 1R3IC 3ZHVA 1OCZC 5L3CA 3T1HB 4JTDB 4IHJB 3ZMSA 1PNMA 3N2GB 2ZXWB 4MVZA 3ZMTA 5F2VO 1GMGA 1QLEC 3W7UA 1Z5VA 2C2AA 2F66C 3HKDA 4H33A 5IJ0A 2F1MA 1Y6XA 2LFRA 4O4HA 1MG1A 1KU9A 2P5OA 1NTKH 1SC5B 1GH6A 3FB6C 2HHHO 1R6KA 1NTZH 1IXBA 2UXXA 1RFYA 3RN4A 1Q43A 3B40A 4MVQA 5L3FA 2DWDC 1K7DA 2BSKA 5BY1A 1OHHG 5LP6C 3AK1A 5JVDA 5KHJA 1R3JC 2Q0AA 3FYIB 4LF6B 2P22C 1EZVH 3JAWB 3HKCA 1U96A 3JAKA 3H1HH 3HPLC 5FL7G 1F23A 5K1PA 2ZDIC 1WB8A 3M8AA 1R3LC 3C3SA 1SETA 5AG2A 5LXTB 2DN9A 1S5HC 3CRAA 3K9SA 1I94B 3T4ZA 4DV6B 4NB5A 1EN5A 2NN4A 4X1IA 3U11A 4PA7A 3BY6A 3ZHSA 3LNMB 1NU1H 1HNXO 2QKAA 3FD9A 2EZPA 3VQXA 3RGBA 1OCRC 3MD0A 4KXRA 1P84F 2YC0A 3AEIA 4G28B 1JJOA 5CB4B 4A5UB 3ZHUA 1RPRA 3RYIB 3T1CA 3SPIA 4DV4O 1KMIZ 3CWBH 2KG7B 5LMNO 2PI5A 3JALA 1AVMA 1YI2V 1NH2B 4DR5B 3WB2A 5H9CA 3BA8A 2GUZA 3CJHA 1AILA 3ASOB 4DV3B 1ZAUA 2XUMA 1AROP 2WWWA 4X66O 1H2LA 2JJ1G 1CXZB 5J9PC 1MSWD 3A8TA 2Q7GA 3ABMB 4UCUA 2YI8A 4DR5O 2EIMB 3KG2A 1S3JA 1K97A 4X62O 5JJEB 3Q4HA 5GONB 3U0ZA 4RWUA 1VQ5V 4LF9O 1S77D 5BXZA 1Y74A 3CJHB 4ZI7A 4QPJA 2DJVA 5H6QA 5DN6G 4JI5B 5B1NA 3ABLC 3RYCB 2IJKA 3OFNG 4N23A 2YIAA 4ICGA 3BAAA 5LA6A 4FLXA 3TXQA 1M57B 4ZOLA 2RMKB 2IJJA 4JI0B 4FJCC 2Q73A 4O2BB 1D2DA 2GV9A 3JD1A 2EIJC 1FXKB 5KMGA 1WP7A 3SYOA 3S3XA 1GN6A 3ETEA 1YZBA 3JATB 5CA0B 2OCCC 3EXAA 2JDIG 5KX5A 3CC4V 2ZINA 2F93B 1YIJV 1HW7A 3G6EV 2EILC 1US6A 1Y66A 3K08A 5H5NA 1SQVH 4LFAO 2KKWA 2QM8A 1DK1A 4DK1A 1NVPD 1IDSA 4DO2A 1XHXA 2OIGA 4YHHB 3RFRA 1XILA 2IH3C 3APQA 3N2KB 2X7RB 1VMGA 4Q6GA 4G2KA 2DMXA 2ZT9B 3CYOA 2QTOA 3FB7C 5FLXN 2XAFA 2LO1A 2EILB 2QTSA 1Q81W 3OT7A 1TUBA 3SPGA 2VQEO 2DYSC 1LNQA 3F7VC 4B3SB 3JAKB 3UO3A 5IDJA 5KAIZ 2G38A 2NR5A 3I5DA 4RQEA 3BFRA 4PDVA 1XMOO 5IYCO 1HNWB 1SZTA 1KKDA 1SA0B 3ZMVA 5KX5B 2NNUA 1G8MA 1RM1C 1NI8A 3CRMA 4JTAB 1FFXA 4TV9B 4X65B 1YITV 4PELA 3T2MA 3SYAA 4JAAA 3SGIA 1HNWO 4MVSA 2F4VO 5ITZB 1JPXA 1F4MA 3CCSV 2HLDG 1S5LZ 3K0GA 4I55B 1H2MA 4Z1MG 5C93A 3JARB 3M7MX 1ZWIC 4O2AB 3L70H 4B3RO 5B1AC 2NLJC 2WA3A 3L72H 4YY3B 3SJAC 2R9AA 5EC2C 2LJ2A 5LOVA 1N32B 5BZBA 1DTOA 1VQPV 1VQ7V 2QR4A 1FXKA 1THZA 1JJ2U 2YDEA 1UPGA 3QNEA 2ZIMA 4H13B 5GW7A 3CD6V 1JVMA 1QR8A 1DGSA 5IYDO 1KUQA 1AB3A 4GCZA 4EB6B 3ML0A 5LHGA 4LF9B 2V7QG 3FX7A 1YHQV 3IAYA 4X88A 1FAFA 5KAFZ 3QVNA 2Y0IA 2OCHA 1TVKA 4QIWF 4YJ3B 4O2BA 3D3IA 1WJZA 2WLIA 2RCVA 2Q7HA 2DYRC 2XHBA 3OEHG 1COWG 1OCRB
chains in the Genus database with same CATH topology
1OZ0A 5DM6V 1Y4MA 1M9NA 3FKSG 2AHYA 3QO8A 4GX1A 3RW0A 3TCUA 3F7YC 2MK3A 4TWKA 5H6RA 3WG7B 1PL0A 2JEXA 2XOKG 1KP3A 1E1RG 2EIJB 2F43G 4GX5A 1N8RW 2Q6AA 5L3DA 1FFTB 4MTXA 2DQ0A 1FXKC 4MVRA 1VQ9V 1PD3A 4LC1A 2WAMA 3CCMV 1H8HG 4ZBMA 1GM8A 4WF9V 3B77A 3E2EA 2EINB 1K4CC 2W6IG 1OCCC 5HFLA 3UKMA 3ZRWB 1YJWV 1AR1B 1B6QA 3ASNC 4P30A 1WLEA 1H38A 4MW3A 3RBZA 1BHBA 4BAYA 1FXHA 1K73W 3LDEA 3E8FA 3QO5A 5IY5B 5L3BA 4JGSA 3B8MA 2ITCC 2WLNA 2GSMB 1F4NA 3AG3C 1VQ8V 2WLLA 3ABKB 3AG2B 1YTFD 1QCEA 1BL8A 2P90A 3CCLV 3JD3A 4OXSA 2IH1C 4TT3G 1Q86W 3RVZA 3ZMUA 5CBFA 2QM7A 1CPYA 3SPCA 5IY5C 1NKDA 3ZRSA 3ZCCA 1V55C 3UM7A 2W6JG 4QE9A 4R50A 2ZXWC 1ROPA 2XAJA 3AG1B 4WCEV 1OCOB 3H01A 1GM9A 2HR3A 2OCCB 3JD2A 4EKWA 4RQFA 1V54C 3T4DA 1QVFU 2IW5A 5B3SC 2DWEC 1VQNV 3JYCA 3CCJV 3OUFA 3AG3B 4WFGA 1Q82W 4MSWC 4JPRA 3ZMZA 5KUKA 1S0VA 1R3IC 3CP1A 3MHHC 4MTGA 1DF4A 4QNHB 1OCZC 3WG7C 5L3CA 4GX2A 3FB5C 1RM1B 2EJRA 2X6CA 4JTDB 1K9MW 3ZMSA 3OW2U 1PNMA 5E1AC 2A0LA 2ZXWB 3TETA 4MVZA 3OEEG 3ZMTA 1EBOA 4PA9A 4P9OA 1GMGA 3OM3B 4BIUA 1QLEC 2WLMA 3W7UA 4UVBA 3E8GA 3ZN0A 1GM7A 1M90W 2C2AA 4BIZA 3OR6C 1HWYA 1PKXA 4H33A 5B3SB 3LDCA 1I5XA 3ETGA 3P32A 5KA5A 2LFRA 4J9YB 3E83A 1W2BU 4JTCB 2B1IA 3ASOC 3DGEA 1MG1A 3K0DA 4JF3A 1NR1A 1WPXA 1GO3F 3SPJA 2OTJV 1G4YB 1JCHA 3FB6C 1XL4A 2Y69B 3P30A 4I5SA 1R6KA 3ZJZA 3ASNB 4QE7A 1R6NA 2UXXA 1DLBA 2DYRB 4N21A 1YTFB 5B1BB 2XAHA 3ABKC 3AG2C 3HB3B 3WFVA 4MVQA 5L3FA 3QO7A 2DWDC 2BOBC 1K7DA 1QLEB 1DF5A 3ETDA 3ZRWA 1OHHG 1CP9A 1NR7A 1R3JC 4I9WA 3FYIB 1EZJA 2YEVB 2ATKC 1K33A 2DQ3A 4KFMA 4UV8A 4LCUC 5HFMA 1Q7YW 3HPLC 1KD1W 2GHYA 4J9ZB 4Q20A 3AG4B 5FL7G 1F23A 1SRYA 2P6JA 1AI4A 4WFEA 2ZDIC 2XASA 1R3LC 3X2QC 2ZR3A 1SETA 2HJFC 5CMUA 3W7XA 2WLIB 4MW8A 1S5HC 3T4ZA 2CK3G 5LHHA 1KECA 1K8AW 2A79B 3AG4C 1OCZB 3TK1A 5LGNA 4GT1A 3CCVV 4PA7A 1KC8W 1GTOA 3BY6A 1I5YA 3LNMB 2EZOA 2EZPA 2PI4A 1OCRC 1NQTA 3MD0A 4R7CA 3CPWU 3I55V 5L3GA 5B1AB 2EIKB 3AEIA 4G28B 4XDLA 3E35A 1AI7A 1RPRA 3E86A 4MT8A 4ASUG 1PNLA 3SPIA 3T1CA 3B8NA 4PDMA 3K79A 1AI5A 1KQSU 2Z5UA 5CBHA 2PI5A 1S76D 3OE7G 1YI2V 3W7SA 1NH2B 4JASA 5H9CA 2Y48A 1VQOV 2X6AA 3ASOB 2JJ2G 2P7TC 2Q68A 5L3EA 1VQKV 1JX9A 2WLKA 1AROP 2AHZA 2WWWA 5IYBO 2JJ1G 2IU3A 1M57C 2FTKA 4UUJC 4CZZA 4JAVA 5J9PC 1MSWD 3ABLB 4F4LA 3E89A 5LBQA 3ABMB 2R9RB 1H8EG 4FIPC 3W7WA 2ZQMA 2B5UA 2EIMB 4XDJA 3A0RA 5EC1C 5EBMC 4PDLA 3KG2A 2ZR2A 1S3JA 2M7WA 1K97A 2XNDG 2OTLV 1BHAA 1YJ9V 4LP8A 3SJQC 1S77D 1VQ5V 1S72V 1VQLV 4MVOA 1NBMG 2IJIA 3K06A 4QPJA 1GK9A 3GB7C 2XAQA 3GWOA 5H6QA 5DN6G 3K3WA 5B1NA 1VQ4V 3ABLC 3ABTA 1R73A 2HG5C 2IJKA 2WSSG 3OFNG 4N23A 4UVAA 2EIMC 1AI6A 3SPHA 4XDKA 3I56V 1K5QA 1RPOA 4KP4A 2BOCC 4DXWA 1QVGU 1M57B 4XBFA 2IJJA 3SYPA 4FJCC 5LHIA 4MTOA 4WFBV 3JD1A 2EIJC 1FXKB 4E2LA 2ITDC 1P4RA 1V55B 3SYOA 3OMAB 3ETEA 1M56C 2HFEC 3K04A 3OAAG 3D36A 2OCCC 4UVCA 3W7TA 3CXCU 2JDIG 2KB1A 2IJHA 2ZD9A 3IGAC 3CC4V 1K4DC 4PDRA 3JD0A 1YIJV 3LSQA 1MABG 4MS2A 1CEZA 1PNKA 2HKOA 3PJSK 3G6EV 2EILC 3DTUB 1Y66A 1NJIW 1H2GA 3K08A 3CMAV 4UV9A 1J95A 1QLNA 3LSSA 3SYQA 4L87A 2R9IA 1IXMA 2QM8A 3G4SV 4JAUA 2HVJC 1NVPD 3E8BA 1NH2D 4DO2A 3OR7C 4GX0A 4RUFA 1K3EA 1XL6A 1M56B 2WLHA 3IC7A 4MTFA 3X2QB 2IH3C 2X7RB 1UJWB 2QE7G 2V1DA 3CYOA 4G2KA 2QTOA 3FB7C 4TSFG 4PA6A 2XAFA 5EK0A 2JK5C 3ABMC 3JD4A 2D3OW 2QEXV 2EILB 1OCOC 1AJNA 4U7NA 1Q81W 1P7BA 3AG1C 3ZRXA 4PA3A 2LFSA 3SPGA 2LP7A 3CMEV 2B1GA 4FMTA 2DYSC 1LNQA 2YEVA 3F7VC 2HVKC 5IDJA 1YJNV 1TUEB 4RAIA 4RQEA 3K9AA 1BMFG 1QR9A 4PDVA 4UXNA 1OCCB 2EIKC 3ZIAG 4BW5A 5B1BC 5IYCO 4R8CA 2K1EA 1SZTA 4P2ZA 1KKDA 1AJQA 4X8AA 1W0JG 3JCZA 3ZMVA 4FK5C 2NNUA 1G8MA 2A9HA 3NXSA 1RM1C 2WPDG 4JTAB 3FB8C 3CCQV 3EHBB 2H94A 5B1OA 2Z3YA 1YITV 3OMIB 4HYOA 3SYCA 4PELA 3T2MA 1W0KG 3SYAA 3G71V 3CCRV 4LBEC 3ZRVA 3LDDA 1ENVA 3IFXA 4HAMA 1NVPB 1E1QG 1SERA 4RO2A 1R3KC 5KA6A 2Q67A 4MVSA 3OUSA 1QBZA 1AJPA 2QKSA 4HZ3A 4QPKA 2WLLB 1M1KW 2X0LA 1JPXA 1YSCA 2WLJA 1F4MA 3E8HA 3R65A 4WFFA 4MVMA 3CCSV 2HLDG 2EBOA 3K0GA 1FXVA 4Z1MG 5C93A 3OMNB 1JQ0A 1ORQC 1ZWIC 3CC2V 2P67A 4ZKIA 4P9PA 3LUTB 3F5WC 2JIZG 5B1AC 2NLJC 2JEUA 1JOYA 2Y69C 1K5SA 4PA4A 5EC2C 2DW4A 1EFRG 4WFHA 5BZBA 5CA3A 1DTOA 3RVYA 1V54B 1VQPV 1F51A 1VQ7V 2ZDIA 1FXKA 1THZA 5LGTA 4MVUA 2Q69A 5LGUA 1JJ2U 2EINC 4WFAV 4CBCA 2OT5A 4FPPA 2XAGA 3STZC 1K92A 2DYSB 3QNEA 1FS0G 5CN0A 3CCUV 1MOFA 5KUMA 1GKFA 4RUEA 3VOUA 5GW7A 3BEHA 4R6ZA 3CCEV 3CD6V 4JYBA 4QJFB 1JVMA 4G27B 4YXWG 1QR8A 4X89A 5IYDO 3MHSC 2IU0A 3OGCC 2W0FC 4GCZA 5LHGA 3ML0A 2QA4V 2V7QG 3EFFK 3ZN1A 1YHQV 1K34A 3ABUA 5CBGA 4X88A 1VQ6V 1E79G 4H37A 1L1FA 4JYCA 2H8PC 5EBLC 3FYEB 5EBWC 4U7OA 1KP2A 4KUMA 3CC7V 1VQMV 4QIWF 1SESA 3D3IA 3K03A 3STLC 2UXNA 2WLIA 3VBBA 2YSUB 3M99B 2DYRC 2X6BA 3OEHG 1COWG 1OCRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO C;  2A9H A;  4P2Z A;  5EC1 C;  5EBM C;  3K0D A;  4JTA B;  4PDL A;  3FB8 C;  3KG2 A;  2AHY A;  4GX1 A;  3RW0 A;  3SPJ A;  1G4Y B;  3TCU A;  3F7Y C;  4LP8 A;  3FB6 C;  4TWK A;  3SJQ C;  1XL4 A;  3ZJZ A;  4HYO A;  3SYC A;  4MVO A;  4QE7 A;  3T2M A;  3SYA A;  3K06 A;  4GX5 A;  4LBE C;  2Q6A A;  3LDD A;  3GB7 C;  3IFX A;  3ABK C;  3AG2 C;  3ABL C;  4RO2 A;  1R3K C;  2Q67 A;  2HG5 C;  4MVR A;  4MVS A;  3OUS A;  4MVQ A;  2DWD C;  2BOB C;  2EIM C;  4XDK A;  3SPH A;  2QKS A;  4HZ3 A;  4ZBM A;  2BOC C;  2WLL B;  4DXW A;  1K4C C;  1R3J C;  2WLJ A;  1OCC C;  3E8H A;  4I9W A;  3R65 A;  4WFF A;  4MVM A;  3UKM A;  3K0G A;  3SYP A;  3ASN C;  4P30 A;  2ATK C;  4MW3 A;  3RBZ A;  4KFM A;  4MTO A;  1ORQ C;  1ZWI C;  4LCU C;  2EIJ C;  3E8F A;  3LDE A;  3HPL C;  2ITD C;  2ITC C;  2WLN A;  4J9Z B;  4P9P A;  3SYO A;  3AG3 C;  3LUT B;  4WFE A;  3F5W C;  1KKD A;  1M56 C;  2HFE C;  2NLJ C;  2WLL A;  3K04 A;  5B1A C;  2Y69 C;  1R3L C;  2OCC C;  3X2Q C;  2KB1 A;  2ZD9 A;  4PA4 A;  5EC2 C;  3IGA C;  4WFH A;  2HJF C;  1K4D C;  4PDR A;  5BZB A;  1BL8 A;  4MS2 A;  2WLI B;  3PJS K;  4MW8 A;  3RVY A;  4OXS A;  2EIL C;  1S5H C;  2IH1 C;  3RVZ A;  5CBF A;  3K08 A;  3T4Z A;  3SPC A;  5IY5 C;  1J95 A;  3ZRS A;  1V55 C;  2A79 B;  3AG4 C;  2Q69 A;  4MVU A;  3SYQ A;  3UM7 A;  4QE9 A;  4R50 A;  2ZXW C;  2EIN C;  4PA7 A;  3LNM B;  4CBC A;  2HVJ C;  3E8B A;  3STZ C;  4EKW A;  1OCR C;  3OR7 C;  1V54 C;  4GX0 A;  5KUM A;  4R7C A;  3T4D A;  4RUF A;  4RUE A;  5B3S C;  2DWE C;  3JYC A;  3VOU A;  3BEH A;  1XL6 A;  4R6Z A;  3OUF A;  2WLH A;  4MTF A;  4G28 B;  4XDL A;  1JVM A;  2IH3 C;  4G27 B;  3E86 A;  4X89 A;  4WFG A;  3T1C A;  3SPI A;  3OGC C;  2QTO A;  3FB7 C;  4MSW C;  5KUK A;  2W0F C;  4PA6 A;  5EK0 A;  3ABM C;  2JK5 C;  1R3I C;  4MTG A;  4PDM A;  5CBH A;  4QNH B;  1OCZ C;  3WG7 C;  3EFF K;  1OCO C;  4GX2 A;  3FB5 C;  5CBG A;  1P7B A;  3AG1 C;  4X88 A;  2X6C A;  4JTD B;  4PA3 A;  4H37 A;  3SPG A;  2H8P C;  5EBL C;  2X6A A;  2P7T C;  2DYS C;  1LNQ A;  2A0L A;  2Q68 A;  2YEV A;  4MVZ A;  5E1A C;  5EBW C;  3TET A;  3F7V C;  4PA9 A;  4P9O A;  2HVK C;  2WLK A;  3K03 A;  1QLE C;  2AHZ A;  2WLM A;  3STL C;  4RAI A;  3E8G A;  2WLI A;  1M57 C;  4UUJ C;  3OR6 C;  4PDV A;  5J9P C;  4H33 A;  3LDC A;  4F4L A;  2DYR C;  3E89 A;  2X6B A;  2R9R B;  2EIK C;  4BW5 A;  5B1B C;  4XDJ A;  4J9Y B;  4R8C A;  3E83 A;  2K1E A;  4X8A A;  4JTC B; 
#chains in the Genus database with same CATH topology
 2HHH B;  5DM6 V;  3LNN A;  1L0N H;  3TCU A;  2AW9 A;  4JI4 O;  5H6R A;  3RT3 C;  1WA8 A;  2BCC H;  4OX9 B;  1PL0 A;  2A3Q A;  1KP3 A;  1E1R G;  2F43 G;  1N8R W;  2E5L B;  4AI8 A;  5JCO C;  3K5O A;  2DQ0 A;  4X20 A;  1SA0 A;  4ZBM A;  1GM8 A;  4IT5 A;  4GUN A;  2QWO B;  1HP8 A;  1B04 A;  5HFL A;  4JI4 B;  1AR1 B;  4X1K B;  3H1I H;  1MA1 A;  1WLE A;  1K73 W;  1FXH A;  3QO5 A;  5IY5 B;  5L3B A;  1X4T A;  4FM0 A;  4NVP A;  3BVO A;  1QCE A;  4I0X B;  1FPO A;  3UCS C;  3JD3 A;  2DE0 X;  3ZMU A;  5A2Q N;  2QM7 A;  2VWJ A;  5IY5 C;  1NKD A;  1WB7 A;  1Y74 B;  4C7U A;  2ADQ B;  2LQT A;  2ZCE A;  1OCO B;  4FFB A;  3H01 A;  1XMQ B;  1GM9 A;  2HR3 A;  4EKW A;  2EUL A;  1V54 C;  3T4D A;  2DWE C;  3CCJ V;  4FM2 A;  3G67 A;  2GDS A;  2Q7E A;  3MHH C;  1DF4 A;  4QNH B;  4LF5 B;  1RM1 B;  2EJR A;  2A7W A;  1KKC A;  2UXB O;  3UQ8 A;  3BA9 A;  3OW2 U;  3TET A;  2ZE8 A;  4P9O A;  4FFB B;  2WLM A;  3ICX A;  3ZN0 A;  1GM7 A;  3DSQ A;  1NT2 B;  2JGU A;  4J7Z A;  4J9Y B;  4EFE A;  3HR0 A;  4LFB O;  3K0D A;  2JGD A;  4LF7 O;  4D7S A;  1I08 A;  2OTJ V;  4PD4 F;  3P30 A;  3SR2 C;  4BR6 A;  4GZR B;  4LF8 B;  3GVM A;  4QE7 A;  2RQ6 A;  1YTF B;  5TIS Z;  4JI7 B;  1WNS A;  3KZI Z;  3ABK C;  3HB3 B;  3WFV A;  3ETD A;  1QLE B;  1DF5 A;  3ZRW A;  1OV9 A;  4GKJ B;  3HKD B;  2ZKO A;  4J7J A;  1EZJ A;  1RP3 B;  3TJT A;  2F95 B;  1IX9 A;  2ADP A;  4UB6 Z;  1SQG A;  1SZX A;  2DQ3 A;  3RYF A;  4LCU C;  4BIO A;  3P3N A;  1WP8 A;  2AGA A;  1Q7Y W;  1KD1 W;  2LGQ A;  4Q20 A;  2P6J A;  1AI4 A;  2UUC B;  5JWP A;  3Q4H B;  3X2Q C;  1A32 A;  2WLI B;  4MW8 A;  4LFA B;  4AQY O;  2R70 A;  1H2S B;  4B7K A;  2A79 B;  3AG4 C;  1OCZ B;  2QKC A;  2ODM A;  1BE3 H;  4I4T A;  1I5Y A;  3H1L H;  3L71 H;  2PI4 A;  1NQT A;  3CPW U;  3I55 V;  5B1A B;  4XDL A;  4LWS A;  1AI5 A;  2PZS A;  5CBH A;  3D3Q A;  3JAS A;  4JAS A;  2Y48 A;  1VQO V;  4DV0 B;  3JAT A;  1JR9 A;  2JJ2 G;  3OD4 A;  1VQK V;  3CRC A;  2AHZ A;  5H2F Z;  2IU3 A;  1M57 C;  2FTK A;  1Q90 D;  4JZG A;  3H1K H;  2HEP A;  1JFF A;  3E89 A;  3L9D A;  5LBQ A;  3W7W A;  2ZQM A;  2B5U A;  4XDJ A;  3A0R A;  4X65 O;  1EM1 A;  5EC1 C;  5EBM C;  2M7W A;  2QWN B;  3RYH A;  2OTL V;  1BHA A;  3G6B A;  3H1J H;  3SJQ C;  4YIP A;  2XTA A;  4FZ0 A;  1N33 O;  1GK9 A;  1ZTE A;  3GWO A;  1QNM A;  1MNG A;  1VQ4 V;  5IE9 A;  2AZ2 A;  2WSS G;  1Z5W A;  4EB6 A;  2EIM C;  1AR4 A;  4XDK A;  1RPO A;  2BOC C;  4DUY O;  1QVG U;  2ZE6 A;  4WBN B;  1XI1 A;  3SYP A;  5LHI A;  1D5A A;  4TV8 B;  3RYH B;  3DC6 A;  4WFB V;  2ITD C;  1BQ0 A;  4X62 B;  1SQQ H;  1YVW A;  2HFE C;  1KYO F;  2IJH A;  1K4D C;  3JD0 A;  2QSA A;  2HKO A;  3PJS K;  4GLX A;  1XOU A;  5LOV B;  4DR7 B;  4J11 A;  5BR8 O;  1SQB H;  4E4E A;  4JAU A;  2JGD B;  1NH2 D;  4I7Z B;  1HDJ A;  2GTS A;  4B3M B;  4I55 A;  1URF A;  2LW1 A;  1LR1 A;  4IIJ B;  1UJW B;  2QE7 G;  4J42 A;  1AJN A;  4U7N A;  2LFS A;  3C3T A;  4JI7 O;  2FML A;  3CME V;  2B1G A;  5BMV A;  1VP7 A;  5IT9 N;  1IZ3 A;  5A9G A;  4O4J B;  4K0K O;  2ZE5 A;  2KG7 A;  1FJG B;  3CHX A;  4Z1V A;  4BW5 A;  5B1B C;  4NTX A;  4R8C A;  1N4C A;  3CRR A;  2RDC A;  4P2Z A;  4FK5 C;  3NXS A;  2GBO A;  2CDY A;  4I9Q A;  4DRX A;  2E5L O;  4LR3 A;  2Z3Y A;  4K0K B;  2B9Z A;  3QG5 A;  1M5I A;  4LBE C;  3ZRV A;  1ENV A;  4HAM A;  1Q6I A;  1NVP B;  4FVM A;  5KA6 A;  5LMU O;  1JA8 A;  1QBZ A;  1XBL A;  3K58 A;  2OIE A;  4QPK A;  1M1K W;  2WLJ A;  3E8H A;  5LYJ A;  1XMO B;  4DV4 B;  4JI3 O;  5LMN B;  5LMU B;  4P9P A;  1B3Q A;  2Y4T A;  4UFZ A;  3LUT B;  1JOY A;  1K5S A;  4NKG B;  3O65 A;  5CA3 A;  1V54 B;  4TUY B;  3E22 B;  4DV0 O;  4PHZ A;  1TGO A;  2CH7 B;  3OTO B;  2P4V A;  3OTF A;  4WFA V;  3CS5 A;  3H9V A;  5JJJ B;  2XAG A;  5FPR A;  1FS0 G;  4CH5 A;  1MOF A;  2E75 B;  2CUG A;  1MSD A;  1PPJ H;  4HNA A;  3CCE V;  4JYB A;  4G27 B;  4YXW G;  3MHS C;  4CS4 A;  5KHK A;  4U3J A;  4DV2 B;  4O4L A;  2QA4 V;  1K34 A;  1ZX3 A;  1IBL O;  1N33 B;  1E79 G;  5LL6 Y;  3K5L A;  2IBZ H;  2H8P C;  2PY5 A;  5EBW C;  4KUM A;  4I50 A;  3ZHR A;  3U10 A;  2UXN A;  2EJ7 A;  3NR7 A;  3VBB A;  1AP6 A;  3CX5 F;  1BZK A;  3HKB A;  1O9H A;  1Y4M A;  1N0J A;  3FKS G;  3QO8 A;  5JQG B;  1G6U A;  1ZLZ A;  5JJN B;  1JMK C;  2MK3 A;  1GAX A;  4FFK A;  2Q0O C;  1S5J A;  2JEX A;  3L74 H;  1N34 O;  4GX5 A;  2CH7 A;  1D5N A;  5L3D A;  2V4D A;  3B2E E;  4JI1 O;  3ZS8 C;  4UCT A;  1FXK C;  1VQ9 V;  4TOI A;  1VF6 C;  5BR8 B;  1H8H G;  4WF9 V;  3B77 A;  4LF4 O;  2EIN B;  2W6I G;  2ZIO A;  4HNA B;  3UKM A;  1YJW V;  2BTQ B;  1SF9 A;  4P30 A;  2UU9 O;  3RBZ A;  5IWA B;  3LDE A;  4JGS A;  1VQ8 V;  1G1X B;  2M6Y A;  4NTY A;  2E74 B;  5LYJ B;  3AG2 B;  1YTF D;  2QWQ B;  2CE4 A;  4TT3 G;  4X64 O;  5CBF A;  1XNQ O;  2VRZ A;  1VIB A;  2QM4 A;  2W6J G;  1SQP H;  1PL4 A;  4O4I B;  3UT5 B;  1ROP A;  4FLU A;  2XAJ A;  4JYA O;  4I4T B;  3AK3 A;  2IW5 A;  3DC5 A;  5B3S C;  3JYC A;  4YJ2 B;  4CS3 A;  1I7F A;  3B4S A;  1LUV A;  2UUA B;  3CP1 A;  4MTG A;  2RN9 A;  4UB8 Z;  3WG7 C;  2R72 A;  4GX2 A;  3FB5 C;  1TA8 A;  5E1A C;  3CE2 A;  3OEE G;  1EBO A;  4PA9 A;  4BIU A;  4EFB A;  4UVB A;  1Y67 A;  3E8G A;  1XDC A;  4LFC B;  1M90 W;  1YDX A;  2UUA O;  3OR6 C;  3T1Y O;  1PP9 H;  3CSX A;  4O4H B;  1PKX A;  5B3S B;  3JAW A;  4X66 B;  1I5X A;  3ETG A;  3P32 A;  5KA5 A;  1XRE A;  1W2B U;  4NXM B;  4JTC B;  2B1I A;  3ASO C;  3DGE A;  4AHC A;  3IC9 A;  3K57 A;  1VF5 B;  2QWR B;  4JF3 A;  4B08 A;  1GO3 F;  3SPJ A;  2F4V B;  4YJ3 A;  1G4Y B;  4DV7 O;  3WB0 A;  4I5S A;  3ZJZ A;  4DR4 B;  2UXB B;  1DLB A;  2DYR B;  5B1B B;  4DUY B;  2ZNJ A;  3B09 A;  3HKB B;  3D8C A;  3QO7 A;  4LH7 A;  3IJ4 A;  4JI5 O;  1NR7 A;  4YY3 O;  4DV7 B;  4YJ2 A;  4I9W A;  2E3C A;  5JVD B;  3FFQ A;  4KFM A;  5HFM A;  1J5E B;  4PV1 B;  1H2K A;  1SQX H;  2XAS A;  5LXT A;  2VS0 A;  4DR6 B;  5DED A;  4UCV A;  3W7X A;  5CA0 A;  2Q8V A;  4LF7 B;  4JI2 O;  2DOS A;  3F5T A;  1KEC A;  4KHP O;  1YCI A;  2PYJ A;  1N36 B;  5LGN A;  5DEC A;  4GT1 A;  4KL1 A;  4DR2 B;  1WN7 A;  4DR6 O;  3ZHT A;  1YEW A;  4WBN A;  2CTQ A;  4DR3 O;  4JI2 B;  2BE3 A;  5L3G A;  2EIK B;  2YS8 A;  4KHP B;  3E35 A;  1AI7 A;  1BT8 A;  3E86 A;  1PNL A;  3T1H O;  2L35 A;  2ARH A;  5CB4 A;  1GRJ A;  2Q9L A;  4PDM A;  2Z5U A;  1MZE A;  3J81 N;  3OE7 G;  3W7S A;  2QWP B;  5JH7 A;  1N34 B;  4JI1 B;  2X6A A;  5L3E A;  4DW0 A;  2WLK A;  1IBK B;  5IYB O;  5BMV B;  5J2T B;  4ZOL B;  4AQY B;  4JAV A;  3HKC B;  4F4L A;  4F6E A;  4JI8 O;  1H8E G;  1GN2 A;  2YIB A;  2UU9 B;  4UCR A;  5KMG B;  4PDL A;  2ZR2 A;  2XND G;  2VQF B;  1YJ9 V;  4LP8 A;  4OPH A;  5JH7 B;  2ZM6 B;  3ZED A;  1S72 V;  1VQL V;  2GTA A;  4O4I A;  5GON A;  3UT5 A;  3K06 A;  4PJ0 Z;  3GB7 C;  2XAQ A;  2GUZ B;  3ABT A;  2HG5 C;  1FD9 A;  3SPH A;  1K5Q A;  4KP4 A;  2VQF O;  2YUA A;  4MTO A;  1V55 B;  1MMM A;  3OMA B;  5EIB C;  2ZNI A;  3K04 A;  3EVK A;  3JAL B;  3D36 A;  4UVC A;  3CXC U;  1EN6 A;  4PDR A;  1XHZ A;  4B3R B;  3LSQ A;  1MAB G;  1CEZ A;  4DUZ B;  3DXR B;  5J2T A;  3DTU B;  1EN4 A;  4QGP A;  1H2G A;  3ZX6 A;  4DR1 O;  2RJZ A;  4DK0 A;  3LSS A;  3SYQ A;  1BQZ A;  4H44 B;  2R9I A;  1IXM A;  1ZL8 B;  4PI2 A;  1VAR A;  5KHH A;  3JCU Z;  3JAR A;  3IC7 A;  1L8D A;  1YXB A;  4DR1 B;  3X2Q B;  4GKK B;  2V1D A;  4TSF G;  4IIJ A;  2N74 A;  5EK0 A;  2JK5 C;  2D3O W;  1B06 A;  5B66 Z;  2QEX V;  1OJH A;  4DV3 O;  1FYJ A;  4CC5 A;  1BS3 A;  3AG1 C;  3ZRX A;  4PA3 A;  3ZBH A;  3A0H Z;  1SS3 A;  1QHT A;  4FMT A;  4FM1 A;  2YEV A;  3APO A;  4X1Y A;  2HVK C;  2CGN A;  3BRC A;  1TUE B;  4RAI A;  4GKK O;  1X59 A;  4FLY A;  3K9A A;  1BMF G;  1QR9 A;  4UXN A;  3JAS B;  1OCC B;  3ZIA G;  4J80 A;  4D6T H;  4EEQ A;  2K1E A;  4B7E A;  1AJQ A;  4X8A A;  1W0J G;  2A9H A;  2WPD G;  4JV5 B;  2JVD A;  3CCQ V;  3EHB B;  4Z2W A;  5B1O A;  5IYZ B;  4ZHQ A;  1HNZ B;  1IBM B;  4B3T O;  1M4U A;  4DRX B;  3G71 V;  1P49 A;  3IFX A;  4LF4 B;  1E1Q G;  1SER A;  4RO2 A;  1R3K C;  4TUY A;  5ITZ A;  2QKS A;  1BSM A;  2WLL B;  4JI0 O;  1KB9 F;  3PN1 A;  2X0L A;  1HNZ O;  2K9P A;  4WFF A;  4MVM A;  2HJD A;  2KSD A;  3OMN B;  1JQ0 A;  1ORQ C;  4JZ2 A;  2P67 A;  3F5W C;  4F6R A;  3AG7 A;  1Y76 A;  2JEU A;  4PA4 A;  2DW4 A;  1EFR G;  4WFH A;  4LF6 O;  4GYC B;  4U3J B;  4DV1 O;  2Q4P A;  2UXC B;  4X20 B;  5LGU A;  5LGT A;  4MVU A;  2IM9 A;  4K35 A;  5GTI Z;  2P06 A;  1I0H A;  2PGG A;  3BCC H;  2OT5 A;  4FPP A;  4TQF A;  5C8Y B;  3J80 N;  3STZ C;  2JS5 A;  3N27 A;  5KUM A;  3N2G A;  4RUE A;  3VOU A;  3BEH A;  1O9G A;  4LH6 A;  1ZSP A;  4QJF B;  2BTQ A;  3OGC C;  4AIL C;  3EFF K;  3ABU A;  5CBG A;  1VQ6 V;  2ETN A;  1NTM H;  1L1F A;  1LUW A;  1YF2 A;  1KP2 A;  1VQM V;  1SES A;  3K03 A;  5C8Y A;  4CC6 A;  2L6L A;  4DYL A;  4X1K A;  3M99 B;  1N0N A;  2X6B A;  2D2C B;  5J2U B;  3RWR D;  3MAQ A;  3JSN A;  1OZ0 A;  3C90 A;  1HNX B;  2E76 B;  1M9N A;  2F23 A;  2AHY A;  4GX1 A;  3RW0 A;  4X1Y B;  3F7Y C;  1SQF A;  5KHI A;  2XT9 A;  3HKE B;  4FLZ A;  4IL6 Z;  2EIJ B;  2OYQ A;  1WAZ A;  1FFT B;  4DUZ O;  3CEI A;  1PD3 A;  4B3M O;  4LC1 A;  2WAM A;  4CH4 A;  3E2E A;  5IJ9 B;  1IBL B;  1K4C C;  1FKA O;  3WB1 A;  3ZRW B;  3TGU H;  1J5E O;  1B6Q A;  2LW7 A;  4MW3 A;  4JYY A;  5EYP B;  1HR0 B;  3B8M A;  2ITC C;  2GSM B;  1F4N A;  3AG3 C;  1Q6U A;  2UUB B;  1BL8 A;  4J41 A;  1Q5O A;  1CPY A;  1FJG O;  3ZRS A;  1U97 A;  3ZCC A;  1V55 C;  2P4K A;  3UM7 A;  4QE9 A;  2CTR A;  3AG1 B;  4WCE V;  4DR3 B;  3L73 H;  4ZHQ B;  5IWA O;  2AXT Z;  1VQN V;  3BPZ A;  1W59 A;  4FLV A;  4WFG A;  4MSW C;  4JPR A;  5KUK A;  1S0V A;  3MDS A;  4NXN O;  5E79 Z;  4LNU B;  2YI9 A;  2X6C A;  4K8Z A;  4X64 B;  1K9M W;  3G80 A;  2A0L A;  3OM3 B;  4JI8 B;  5IJ0 B;  4BIZ A;  3VQW A;  1HWY A;  3LDC A;  3O9O A;  5CA1 B;  3E83 A;  3J7A U;  3RYC A;  2ZM6 O;  1NR1 A;  2RNB A;  1WPX A;  5LP6 A;  1JCH A;  1I94 O;  1XL4 A;  2Y69 B;  4YHH O;  3ASN B;  4H0L B;  4NYK A;  3BAB A;  1R6N A;  2JS3 A;  4N21 A;  3OTO O;  2XAH A;  3AG2 C;  1QQC A;  2O57 A;  2UXC O;  2BOB C;  4X1I B;  2FYU H;  1CP9 A;  2YEV B;  3CXH F;  1VF6 A;  4NXM O;  2ATK C;  4DV2 O;  1K33 A;  4UV8 A;  4OGQ B;  4LNU A;  2GHY A;  4J9Z B;  3AG4 B;  1SRY A;  4WFE A;  2ZR3 A;  2HJF C;  1Z2G A;  4NR1 A;  5CMU A;  2Z0A A;  4IGG A;  1GN3 A;  2CK3 G;  5LHH A;  3TXS A;  1K8A W;  3TK1 A;  3CCV V;  1KC8 W;  5FNV A;  1GTO A;  5D5Q A;  4ZIB A;  3AK2 A;  2EZO A;  3A2F A;  1SKV A;  1TUB B;  1ZUQ A;  2BTO A;  4CH6 A;  4R7C A;  3RYF B;  1XUQ A;  4FLW A;  1VF7 A;  4MT8 A;  4ASU G;  3B8N A;  4LWS B;  3K79 A;  1KQS U;  1S76 D;  2P7T C;  2Q68 A;  5FNV B;  1JX9 A;  1N32 O;  3GWK C;  2YIB D;  1JFF B;  3VQY A;  4UUJ C;  4DR2 O;  4CZZ A;  1P7G A;  3ABL B;  4JV5 O;  4FIP C;  2R9R B;  2A06 H;  1N36 O;  1V9P A;  3SJC C;  4UCS A;  5K1X A;  5EZY A;  2CTP A;  4MVO A;  1NBM G;  2IJI A;  4X9Q A;  5IYZ A;  3S3W A;  2H3O A;  5EIB D;  5KHG A;  3JSL A;  1GN4 A;  4O2A A;  4JYA B;  2BSK B;  3K3W A;  1R73 A;  5LA6 B;  4UVA A;  1IBK O;  1AI6 A;  3I56 V;  4DXW A;  4XBF A;  1VEW A;  2N05 A;  2Y4U A;  2Y0P A;  2HP8 A;  4J7K A;  4E2L A;  1P4R A;  2MW2 B;  4IHJ A;  4TV8 A;  1Q3E A;  4JI3 B;  2VQE B;  1L0L H;  2YID A;  1M56 C;  3OAA G;  5J2U A;  3W7T A;  2KB1 A;  2ZD9 A;  4DV1 B;  3IGA C;  1RSO B;  4NXN B;  2YXL A;  4MS2 A;  1PNK A;  4LFC O;  1NJI W;  2QJ1 A;  3CMA V;  2W0X A;  3QF7 A;  2JRI A;  3DXR A;  4UV9 A;  1J95 A;  1QLN A;  4L87 A;  1BGY H;  3SDL A;  2WA4 A;  3G4S V;  4DV6 O;  1QU7 A;  2HVJ C;  3E8B A;  1F7Y A;  2QGN A;  3OR7 C;  4GX0 A;  5FPO A;  4RUF A;  1TAE A;  1K3E A;  1XL6 A;  1M56 B;  2WLH A;  4MTF A;  3WU2 Z;  1FFX B;  1BCC H;  2PTM A;  4F6R B;  4PA6 A;  3ABM C;  3JD4 A;  4ABM A;  1OCO C;  5D5P A;  1KBH A;  1P7B A;  1XMQ O;  2LP7 A;  4BW9 A;  1Y76 B;  4K8X A;  2AZ0 A;  1MZF A;  3R66 A;  3KCX A;  4UCO A;  2PUS A;  1YJN V;  1WA8 B;  1ZL8 A;  4DW1 A;  3K5N A;  4LF5 O;  4CS2 A;  2EIK C;  4JI6 O;  3JCZ A;  4YIO A;  3FB8 C;  2H94 A;  4W4L A;  5GTH Z;  4W4K A;  4K3A A;  1AP5 A;  4ZI7 B;  3FAV B;  4U3F H;  3OMI B;  4HYO A;  3SYC A;  1W0K G;  3CCR V;  3LDD A;  3HKE A;  4JI6 B;  2Q67 A;  3P3P A;  3OUS A;  1AJP A;  4HZ3 A;  4NTW A;  3D36 C;  1YSC A;  1H2N A;  3R65 A;  3RYI A;  4I0X A;  2EBO A;  2Q5Z A;  4LF8 O;  1FXV A;  2VWK A;  3K5M A;  2FB5 A;  4D7T A;  3CC2 V;  1Q8I A;  3FAV A;  4ZKI A;  2KQX A;  3ZHQ A;  2UUB O;  3CRQ A;  3ETQ A;  2JIZ G;  3A0B Z;  1AR5 A;  2Y69 C;  4GKJ O;  4HBN A;  4LFB B;  3E22 A;  1T5E A;  3RVY A;  1IVS A;  2ZE7 A;  1Q6H A;  1F51 A;  2YXH A;  2ZDI A;  5B5E Z;  3THO A;  2Q69 A;  2CGO A;  1XNQ B;  2EIN C;  2UUC O;  4CBC A;  3SJB C;  5EZY B;  1K92 A;  2DYS B;  2YXY A;  4TV9 A;  5CN0 A;  3CCU V;  5KLV H;  1GKF A;  2FL4 A;  4J10 A;  4OX9 O;  3LSU A;  4R6Z A;  1PM9 A;  1XQ8 A;  4X89 A;  1NZ6 A;  4PI0 A;  4O4L B;  4BWA A;  2IU0 A;  1R1B A;  2W0F C;  2ILM A;  1M93 A;  3ZN1 A;  4DV5 O;  4CH3 A;  4H37 A;  4L8J A;  4JYC A;  5EBL C;  4I50 B;  3FYE B;  4O4J A;  4U7O A;  2PF4 E;  3CC7 V;  3STL C;  1PV0 A;  1XEQ A;  2YSU B;  4B3S O;  4OPA A;  4DV5 B;  4FLT A;  3JAM N;  2QDO A;  2N04 A;  3T1Y B;  1RSO A;  1NS1 A;  5EYP A;  2CAZ C;  4TWK A;  3KCY A;  3L75 H;  1R6T A;  3WG7 B;  3VQV A;  2XOK G;  1XNR O;  2Q6A A;  4MTX A;  1IUR A;  4MVR A;  2PYL A;  4DR4 O;  3QTC A;  3BHP A;  3OGI B;  3CCM V;  3UO2 A;  2UXD O;  1OCC C;  5IJ9 A;  2YIC A;  3N2K A;  1UFI A;  5JCO A;  1XNR B;  3ASN C;  1WPB A;  1H38 A;  4FZ1 A;  1BHB A;  4BAY A;  3E8F A;  3K59 A;  2WLN A;  2LGW A;  5JQG A;  5LP6 B;  2UXD B;  4IYI A;  2WLL A;  3ABK B;  2P90 A;  3CCL V;  4OXS A;  2IH1 C;  1Q86 W;  3RVZ A;  3SPC A;  1TVK B;  4IYH A;  2OWO A;  4R50 A;  2ZXW C;  2CTW A;  3KKY A;  2FKX A;  2OCC B;  3JD2 A;  4RQF A;  1IBM O;  4B3T B;  1HR0 O;  1QVF U;  3OUF A;  4DR7 O;  5CA1 A;  3AG3 B;  1Q82 W;  3CB2 A;  3ZMZ A;  4TQD A;  2EX3 A;  1R3I C;  3ZHV A;  1OCZ C;  5L3C A;  3T1H B;  4JTD B;  4IHJ B;  3ZMS A;  1PNM A;  3N2G B;  2ZXW B;  4MVZ A;  3ZMT A;  5F2V O;  1GMG A;  1QLE C;  3W7U A;  1Z5V A;  2C2A A;  2F66 C;  3HKD A;  4H33 A;  5IJ0 A;  2F1M A;  1Y6X A;  2LFR A;  4O4H A;  1MG1 A;  1KU9 A;  2P5O A;  1NTK H;  1SC5 B;  1GH6 A;  3FB6 C;  2HHH O;  1R6K A;  1NTZ H;  1IXB A;  2UXX A;  1RFY A;  3RN4 A;  1Q43 A;  3B40 A;  4MVQ A;  5L3F A;  2DWD C;  1K7D A;  2BSK A;  5BY1 A;  1OHH G;  5LP6 C;  3AK1 A;  5JVD A;  5KHJ A;  1R3J C;  2Q0A A;  3FYI B;  4LF6 B;  2P22 C;  1EZV H;  3JAW B;  3HKC A;  1U96 A;  3JAK A;  3H1H H;  3HPL C;  5FL7 G;  1F23 A;  5K1P A;  2ZDI C;  1WB8 A;  3M8A A;  1R3L C;  3C3S A;  1SET A;  5AG2 A;  5LXT B;  2DN9 A;  1S5H C;  3CRA A;  3K9S A;  1I94 B;  3T4Z A;  4DV6 B;  4NB5 A;  1EN5 A;  2NN4 A;  4X1I A;  3U11 A;  4PA7 A;  3BY6 A;  3ZHS A;  3LNM B;  1NU1 H;  1HNX O;  2QKA A;  3FD9 A;  2EZP A;  3VQX A;  3RGB A;  1OCR C;  3MD0 A;  4KXR A;  1P84 F;  2YC0 A;  3AEI A;  4G28 B;  1JJO A;  5CB4 B;  4A5U B;  3ZHU A;  1RPR A;  3RYI B;  3T1C A;  3SPI A;  4DV4 O;  1KMI Z;  3CWB H;  2KG7 B;  5LMN O;  2PI5 A;  3JAL A;  1AVM A;  1YI2 V;  1NH2 B;  4DR5 B;  3WB2 A;  5H9C A;  3BA8 A;  2GUZ A;  3CJH A;  1AIL A;  3ASO B;  4DV3 B;  1ZAU A;  2XUM A;  1ARO P;  2WWW A;  4X66 O;  1H2L A;  2JJ1 G;  1CXZ B;  5J9P C;  1MSW D;  3A8T A;  2Q7G A;  3ABM B;  4UCU A;  2YI8 A;  4DR5 O;  2EIM B;  3KG2 A;  1S3J A;  1K97 A;  4X62 O;  5JJE B;  3Q4H A;  5GON B;  3U0Z A;  4RWU A;  1VQ5 V;  4LF9 O;  1S77 D;  5BXZ A;  1Y74 A;  3CJH B;  4ZI7 A;  4QPJ A;  2DJV A;  5H6Q A;  5DN6 G;  4JI5 B;  5B1N A;  3ABL C;  3RYC B;  2IJK A;  3OFN G;  4N23 A;  2YIA A;  4ICG A;  3BAA A;  5LA6 A;  4FLX A;  3TXQ A;  1M57 B;  4ZOL A;  2RMK B;  2IJJ A;  4JI0 B;  4FJC C;  2Q73 A;  4O2B B;  1D2D A;  2GV9 A;  3JD1 A;  2EIJ C;  1FXK B;  5KMG A;  1WP7 A;  3SYO A;  3S3X A;  1GN6 A;  3ETE A;  1YZB A;  3JAT B;  5CA0 B;  2OCC C;  3EXA A;  2JDI G;  5KX5 A;  3CC4 V;  2ZIN A;  2F93 B;  1YIJ V;  1HW7 A;  3G6E V;  2EIL C;  1US6 A;  1Y66 A;  3K08 A;  5H5N A;  1SQV H;  4LFA O;  2KKW A;  2QM8 A;  1DK1 A;  4DK1 A;  1NVP D;  1IDS A;  4DO2 A;  1XHX A;  2OIG A;  4YHH B;  3RFR A;  1XIL A;  2IH3 C;  3APQ A;  3N2K B;  2X7R B;  1VMG A;  4Q6G A;  4G2K A;  2DMX A;  2ZT9 B;  3CYO A;  2QTO A;  3FB7 C;  5FLX N;  2XAF A;  2LO1 A;  2EIL B;  2QTS A;  1Q81 W;  3OT7 A;  1TUB A;  3SPG A;  2VQE O;  2DYS C;  1LNQ A;  3F7V C;  4B3S B;  3JAK B;  3UO3 A;  5IDJ A;  5KAI Z;  2G38 A;  2NR5 A;  3I5D A;  4RQE A;  3BFR A;  4PDV A;  1XMO O;  5IYC O;  1HNW B;  1SZT A;  1KKD A;  1SA0 B;  3ZMV A;  5KX5 B;  2NNU A;  1G8M A;  1RM1 C;  1NI8 A;  3CRM A;  4JTA B;  1FFX A;  4TV9 B;  4X65 B;  1YIT V;  4PEL A;  3T2M A;  3SYA A;  4JAA A;  3SGI A;  1HNW O;  4MVS A;  2F4V O;  5ITZ B;  1JPX A;  1F4M A;  3CCS V;  2HLD G;  1S5L Z;  3K0G A;  4I55 B;  1H2M A;  4Z1M G;  5C93 A;  3JAR B;  3M7M X;  1ZWI C;  4O2A B;  3L70 H;  4B3R O;  5B1A C;  2NLJ C;  2WA3 A;  3L72 H;  4YY3 B;  3SJA C;  2R9A A;  5EC2 C;  2LJ2 A;  5LOV A;  1N32 B;  5BZB A;  1DTO A;  1VQP V;  1VQ7 V;  2QR4 A;  1FXK A;  1THZ A;  1JJ2 U;  2YDE A;  1UPG A;  3QNE A;  2ZIM A;  4H13 B;  5GW7 A;  3CD6 V;  1JVM A;  1QR8 A;  1DGS A;  5IYD O;  1KUQ A;  1AB3 A;  4GCZ A;  4EB6 B;  3ML0 A;  5LHG A;  4LF9 B;  2V7Q G;  3FX7 A;  1YHQ V;  3IAY A;  4X88 A;  1FAF A;  5KAF Z;  3QVN A;  2Y0I A;  2OCH A;  1TVK A;  4QIW F;  4YJ3 B;  4O2B A;  3D3I A;  1WJZ A;  2WLI A;  2RCV A;  2Q7H A;  2DYR C;  2XHB A;  3OEH G;  1COW G;  1OCR B; 
#chains in the Genus database with same CATH homology
 1OZ0 A;  5DM6 V;  1Y4M A;  1M9N A;  3FKS G;  2AHY A;  3QO8 A;  4GX1 A;  3RW0 A;  3TCU A;  3F7Y C;  2MK3 A;  4TWK A;  5H6R A;  3WG7 B;  1PL0 A;  2JEX A;  2XOK G;  1KP3 A;  1E1R G;  2EIJ B;  2F43 G;  4GX5 A;  1N8R W;  2Q6A A;  5L3D A;  1FFT B;  4MTX A;  2DQ0 A;  1FXK C;  4MVR A;  1VQ9 V;  1PD3 A;  4LC1 A;  2WAM A;  3CCM V;  1H8H G;  4ZBM A;  1GM8 A;  4WF9 V;  3B77 A;  3E2E A;  2EIN B;  1K4C C;  2W6I G;  1OCC C;  5HFL A;  3UKM A;  3ZRW B;  1YJW V;  1AR1 B;  1B6Q A;  3ASN C;  4P30 A;  1WLE A;  1H38 A;  4MW3 A;  3RBZ A;  1BHB A;  4BAY A;  1FXH A;  1K73 W;  3LDE A;  3E8F A;  3QO5 A;  5IY5 B;  5L3B A;  4JGS A;  3B8M A;  2ITC C;  2WLN A;  2GSM B;  1F4N A;  3AG3 C;  1VQ8 V;  2WLL A;  3ABK B;  3AG2 B;  1YTF D;  1QCE A;  1BL8 A;  2P90 A;  3CCL V;  3JD3 A;  4OXS A;  2IH1 C;  4TT3 G;  1Q86 W;  3RVZ A;  3ZMU A;  5CBF A;  2QM7 A;  1CPY A;  3SPC A;  5IY5 C;  1NKD A;  3ZRS A;  3ZCC A;  1V55 C;  3UM7 A;  2W6J G;  4QE9 A;  4R50 A;  2ZXW C;  1ROP A;  2XAJ A;  3AG1 B;  4WCE V;  1OCO B;  3H01 A;  1GM9 A;  2HR3 A;  2OCC B;  3JD2 A;  4EKW A;  4RQF A;  1V54 C;  3T4D A;  1QVF U;  2IW5 A;  5B3S C;  2DWE C;  1VQN V;  3JYC A;  3CCJ V;  3OUF A;  3AG3 B;  4WFG A;  1Q82 W;  4MSW C;  4JPR A;  3ZMZ A;  5KUK A;  1S0V A;  1R3I C;  3CP1 A;  3MHH C;  4MTG A;  1DF4 A;  4QNH B;  1OCZ C;  3WG7 C;  5L3C A;  4GX2 A;  3FB5 C;  1RM1 B;  2EJR A;  2X6C A;  4JTD B;  1K9M W;  3ZMS A;  3OW2 U;  1PNM A;  5E1A C;  2A0L A;  2ZXW B;  3TET A;  4MVZ A;  3OEE G;  3ZMT A;  1EBO A;  4PA9 A;  4P9O A;  1GMG A;  3OM3 B;  4BIU A;  1QLE C;  2WLM A;  3W7U A;  4UVB A;  3E8G A;  3ZN0 A;  1GM7 A;  1M90 W;  2C2A A;  4BIZ A;  3OR6 C;  1HWY A;  1PKX A;  4H33 A;  5B3S B;  3LDC A;  1I5X A;  3ETG A;  3P32 A;  5KA5 A;  2LFR A;  4J9Y B;  3E83 A;  1W2B U;  4JTC B;  2B1I A;  3ASO C;  3DGE A;  1MG1 A;  3K0D A;  4JF3 A;  1NR1 A;  1WPX A;  1GO3 F;  3SPJ A;  2OTJ V;  1G4Y B;  1JCH A;  3FB6 C;  1XL4 A;  2Y69 B;  3P30 A;  4I5S A;  1R6K A;  3ZJZ A;  3ASN B;  4QE7 A;  1R6N A;  2UXX A;  1DLB A;  2DYR B;  4N21 A;  1YTF B;  5B1B B;  2XAH A;  3ABK C;  3AG2 C;  3HB3 B;  3WFV A;  4MVQ A;  5L3F A;  3QO7 A;  2DWD C;  2BOB C;  1K7D A;  1QLE B;  1DF5 A;  3ETD A;  3ZRW A;  1OHH G;  1CP9 A;  1NR7 A;  1R3J C;  4I9W A;  3FYI B;  1EZJ A;  2YEV B;  2ATK C;  1K33 A;  2DQ3 A;  4KFM A;  4UV8 A;  4LCU C;  5HFM A;  1Q7Y W;  3HPL C;  1KD1 W;  2GHY A;  4J9Z B;  4Q20 A;  3AG4 B;  5FL7 G;  1F23 A;  1SRY A;  2P6J A;  1AI4 A;  4WFE A;  2ZDI C;  2XAS A;  1R3L C;  3X2Q C;  2ZR3 A;  1SET A;  2HJF C;  5CMU A;  3W7X A;  2WLI B;  4MW8 A;  1S5H C;  3T4Z A;  2CK3 G;  5LHH A;  1KEC A;  1K8A W;  2A79 B;  3AG4 C;  1OCZ B;  3TK1 A;  5LGN A;  4GT1 A;  3CCV V;  4PA7 A;  1KC8 W;  1GTO A;  3BY6 A;  1I5Y A;  3LNM B;  2EZO A;  2EZP A;  2PI4 A;  1OCR C;  1NQT A;  3MD0 A;  4R7C A;  3CPW U;  3I55 V;  5L3G A;  5B1A B;  2EIK B;  3AEI A;  4G28 B;  4XDL A;  3E35 A;  1AI7 A;  1RPR A;  3E86 A;  4MT8 A;  4ASU G;  1PNL A;  3SPI A;  3T1C A;  3B8N A;  4PDM A;  3K79 A;  1AI5 A;  1KQS U;  2Z5U A;  5CBH A;  2PI5 A;  1S76 D;  3OE7 G;  1YI2 V;  3W7S A;  1NH2 B;  4JAS A;  5H9C A;  2Y48 A;  1VQO V;  2X6A A;  3ASO B;  2JJ2 G;  2P7T C;  2Q68 A;  5L3E A;  1VQK V;  1JX9 A;  2WLK A;  1ARO P;  2AHZ A;  2WWW A;  5IYB O;  2JJ1 G;  2IU3 A;  1M57 C;  2FTK A;  4UUJ C;  4CZZ A;  4JAV A;  5J9P C;  1MSW D;  3ABL B;  4F4L A;  3E89 A;  5LBQ A;  3ABM B;  2R9R B;  1H8E G;  4FIP C;  3W7W A;  2ZQM A;  2B5U A;  2EIM B;  4XDJ A;  3A0R A;  5EC1 C;  5EBM C;  4PDL A;  3KG2 A;  2ZR2 A;  1S3J A;  2M7W A;  1K97 A;  2XND G;  2OTL V;  1BHA A;  1YJ9 V;  4LP8 A;  3SJQ C;  1S77 D;  1VQ5 V;  1S72 V;  1VQL V;  4MVO A;  1NBM G;  2IJI A;  3K06 A;  4QPJ A;  1GK9 A;  3GB7 C;  2XAQ A;  3GWO A;  5H6Q A;  5DN6 G;  3K3W A;  5B1N A;  1VQ4 V;  3ABL C;  3ABT A;  1R73 A;  2HG5 C;  2IJK A;  2WSS G;  3OFN G;  4N23 A;  4UVA A;  2EIM C;  1AI6 A;  3SPH A;  4XDK A;  3I56 V;  1K5Q A;  1RPO A;  4KP4 A;  2BOC C;  4DXW A;  1QVG U;  1M57 B;  4XBF A;  2IJJ A;  3SYP A;  4FJC C;  5LHI A;  4MTO A;  4WFB V;  3JD1 A;  2EIJ C;  1FXK B;  4E2L A;  2ITD C;  1P4R A;  1V55 B;  3SYO A;  3OMA B;  3ETE A;  1M56 C;  2HFE C;  3K04 A;  3OAA G;  3D36 A;  2OCC C;  4UVC A;  3W7T A;  3CXC U;  2JDI G;  2KB1 A;  2IJH A;  2ZD9 A;  3IGA C;  3CC4 V;  1K4D C;  4PDR A;  3JD0 A;  1YIJ V;  3LSQ A;  1MAB G;  4MS2 A;  1CEZ A;  1PNK A;  2HKO A;  3PJS K;  3G6E V;  2EIL C;  3DTU B;  1Y66 A;  1NJI W;  1H2G A;  3K08 A;  3CMA V;  4UV9 A;  1J95 A;  1QLN A;  3LSS A;  3SYQ A;  4L87 A;  2R9I A;  1IXM A;  2QM8 A;  3G4S V;  4JAU A;  2HVJ C;  1NVP D;  3E8B A;  1NH2 D;  4DO2 A;  3OR7 C;  4GX0 A;  4RUF A;  1K3E A;  1XL6 A;  1M56 B;  2WLH A;  3IC7 A;  4MTF A;  3X2Q B;  2IH3 C;  2X7R B;  1UJW B;  2QE7 G;  2V1D A;  3CYO A;  4G2K A;  2QTO A;  3FB7 C;  4TSF G;  4PA6 A;  2XAF A;  5EK0 A;  2JK5 C;  3ABM C;  3JD4 A;  2D3O W;  2QEX V;  2EIL B;  1OCO C;  1AJN A;  4U7N A;  1Q81 W;  1P7B A;  3AG1 C;  3ZRX A;  4PA3 A;  2LFS A;  3SPG A;  2LP7 A;  3CME V;  2B1G A;  4FMT A;  2DYS C;  1LNQ A;  2YEV A;  3F7V C;  2HVK C;  5IDJ A;  1YJN V;  1TUE B;  4RAI A;  4RQE A;  3K9A A;  1BMF G;  1QR9 A;  4PDV A;  4UXN A;  1OCC B;  2EIK C;  3ZIA G;  4BW5 A;  5B1B C;  5IYC O;  4R8C A;  2K1E A;  1SZT A;  4P2Z A;  1KKD A;  1AJQ A;  4X8A A;  1W0J G;  3JCZ A;  3ZMV A;  4FK5 C;  2NNU A;  1G8M A;  2A9H A;  3NXS A;  1RM1 C;  2WPD G;  4JTA B;  3FB8 C;  3CCQ V;  3EHB B;  2H94 A;  5B1O A;  2Z3Y A;  1YIT V;  3OMI B;  4HYO A;  3SYC A;  4PEL A;  3T2M A;  1W0K G;  3SYA A;  3G71 V;  3CCR V;  4LBE C;  3ZRV A;  3LDD A;  1ENV A;  3IFX A;  4HAM A;  1NVP B;  1E1Q G;  1SER A;  4RO2 A;  1R3K C;  5KA6 A;  2Q67 A;  4MVS A;  3OUS A;  1QBZ A;  1AJP A;  2QKS A;  4HZ3 A;  4QPK A;  2WLL B;  1M1K W;  2X0L A;  1JPX A;  1YSC A;  2WLJ A;  1F4M A;  3E8H A;  3R65 A;  4WFF A;  4MVM A;  3CCS V;  2HLD G;  2EBO A;  3K0G A;  1FXV A;  4Z1M G;  5C93 A;  3OMN B;  1JQ0 A;  1ORQ C;  1ZWI C;  3CC2 V;  2P67 A;  4ZKI A;  4P9P A;  3LUT B;  3F5W C;  2JIZ G;  5B1A C;  2NLJ C;  2JEU A;  1JOY A;  2Y69 C;  1K5S A;  4PA4 A;  5EC2 C;  2DW4 A;  1EFR G;  4WFH A;  5BZB A;  5CA3 A;  1DTO A;  3RVY A;  1V54 B;  1VQP V;  1F51 A;  1VQ7 V;  2ZDI A;  1FXK A;  1THZ A;  5LGT A;  4MVU A;  2Q69 A;  5LGU A;  1JJ2 U;  2EIN C;  4WFA V;  4CBC A;  2OT5 A;  4FPP A;  2XAG A;  3STZ C;  1K92 A;  2DYS B;  3QNE A;  1FS0 G;  5CN0 A;  3CCU V;  1MOF A;  5KUM A;  1GKF A;  4RUE A;  3VOU A;  5GW7 A;  3BEH A;  4R6Z A;  3CCE V;  3CD6 V;  4JYB A;  4QJF B;  1JVM A;  4G27 B;  4YXW G;  1QR8 A;  4X89 A;  5IYD O;  3MHS C;  2IU0 A;  3OGC C;  2W0F C;  4GCZ A;  5LHG A;  3ML0 A;  2QA4 V;  2V7Q G;  3EFF K;  3ZN1 A;  1YHQ V;  1K34 A;  3ABU A;  5CBG A;  4X88 A;  1VQ6 V;  1E79 G;  4H37 A;  1L1F A;  4JYC A;  2H8P C;  5EBL C;  3FYE B;  5EBW C;  4U7O A;  1KP2 A;  4KUM A;  3CC7 V;  1VQM V;  4QIW F;  1SES A;  3D3I A;  3K03 A;  3STL C;  2UXN A;  2WLI A;  3VBB A;  2YSU B;  3M99 B;  2DYR C;  2X6B A;  3OEH G;  1COW G;  1OCR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...