4YY3O

30s ribosomal subunit- higb complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4yy3O00
2UUBO 4JI5O 4X62O 4JI7O 1X59A 3R66A 2FKXA 4JI6O 2HHHO 4AQYO 1J5EO 3O65A 2DOSA 4DR4O 1G1XB 1AILA 1NS1A 3J81N 1N34O 4JV5O 1HNZO 1F7YA 4DR2O 4JYAO 4LFAO 4DR6O 4DR1O 4JI4O 5A2QN 4JI8O 2UXBO 4DUYO 1XMQO 3J80N 1N36O 4YY3O 4X66O 4JI0O 5LL6Y 1KUQA 4LF8O 4LF6O 4LFCO 1YZBA 1IBKO 3SDLA 1R6TA 1FKAO 4GKJO 5LMNO 1XNRO 2AGAA 4X64O 4OPHA 1XMOO 1N32O 3M8AA 5BR8O 3T1YO 4DUZO 4X65O 5IWAO 4K0KO 4DV5O 4GKKO 3J7AU 4OX9O 4DV0O 4A5UB 4LF7O 5BXZA 1HNWO 1R1BA 4DR5O 3T1HO 1HNXO 4OPAA 2LW7A 4B3TO 2ZKOA 5IT9N 1N33O 2VQFO 2F4VO 1I94O 1IBMO 1IBLO 4DR7O 4DV4O 1A32A 1XNQO 2UXCO 1FYJA 1FJGO 4JI1O 4LF4O 4KHPO 3JAMN 4NXNO 1AB3A 4DV6O 3RT3C 4DV2O 2UU9O 1D2DA 4LF9O 4YHHO 4LFBO 1XEQA 2ZM6O 4LF5O 2UXDO 4NXMO 5FLXN 2UUCO 1HR0O 5LMUO 4JI3O 2JRIA 4B3SO 2N74A 1DK1A 2DJVA 4B3MO 4DV1O 4JI2O 4B3RO 4DV7O 2E5LO 2VQEO 2UUAO 5H5NA 5BY1A 3OTOO 4DV3O 4DR3O 3F5TA 2Z0AA
chains in the Genus database with same CATH superfamily
2HEPA 3GWOA 3CP1A 3JARA 1S5JA 4K35A 2CE4A 2UUBO 1K7DA 5CBGA 4AILC 4LCUC 1W59A 2QWOB 1E1RG 3R66A 4D6TH 4DRXB 4I50A 2XHBA 3KZIZ 4MT8A 3ICXA 3CRMA 4QGPA 3HKEB 2YICA 4ZBMA 2ZNJA 3GWKC 1GM9A 4PA3A 1IBMB 3B2EE 1ZL8B 3JAWA 4PA6A 4DR1O 3E83A 1J5EB 2HJDA 1K4DC 4ZOLB 4BIZA 1HNXB 1YIJV 2X6CA 3ASNB 2GUZA 1H8HG 3ZMZA 1KUQA 4DXWA 1VF7A 3SJAC 2JEUA 4O4HA 3K06A 1AI7A 4P2ZA 4DR1B 4U7NA 5JH7B 5KX5B 2VRZA 3I55V 3R65A 4UUJC 2HLDG 1WPBA 3JSLA 2RN9A 1RPOA 3ZHSA 3OE7G 4OX9O 4DV0O 3IC7A 3LNNA 4YY3B 2F66C 3U0ZA 2PY5A 4TUYB 1AJPA 1EZJA 4ZHQB 2QEXV 1XNQO 2Y4UA 1MNGA 1TUEB 4MTFA 3W7WA 1QHTA 1FAFA 5EIBD 3CRAA 4LF9O 4H37A 2FL4A 3QO5A 1NVPB 4HYOA 4K3AA 3SPGA 3G4SV 1DF5A 4H0LB 2IJKA 4JAUA 4MVUA 1FD9A 1AP5A 2QWNB 3P30A 4CZZA 3ZX6A 2RMKB 3K59A 1GM7A 3CEIA 3SPCA 3BRCA 4TOIA 4TQDA 2UUAO 1OCOC 2WPDG 1PPJH 3OTOO 4DV3O 3RVYA 3D3QA 1N0NA 3WG7B 1FXKB 4I4TA 5BZBA 3K79A 4JI4B 2DYRB 1TAEA 1WP8A 3A2FA 4Z2WA 3ZHTA 1SERA 4DR2O 4QNHB 4I9WA 2XNDG 3ZS8C 3ZRSA 4PA4A 4JI4O 4GX1A 4N21A 2OCCB 2WWWA 2UUBB 2L35A 1FXKC 2P90A 1IVSA 2LO1A 1TUBB 1L0LH 1VF6A 5ITZB 4JI1B 3UM7A 4JYAB 3AG4C 2YXLA 4YJ3A 1KP3A 4X64O 4H44B 4P30A 4UVCA 4JF3A 3FAVA 1BQZA 4GX5A 1JPXA 1PM9A 1G6UA 4LFCB 3O9OA 4L8JA 4FFBB 1N33O 5B1BC 3ZMVA 3N2KA 2VQEB 1EN4A 2UU9B 1BHBA 4DR6B 1A32A 4GKJB 1GN4A 3SYCA 3AG4B 3CCRV 3JYCA 2EIJB 3OGIB 1XOUA 2UU9O 4FLZA 2XASA 2EINC 3ZRWB 3WB2A 4X62B 2UXDO 4X1KA 1I5YA 4NXMO 1Z5WA 1HNZB 4O4JB 2ITCC 3UT5A 2ZNIA 1NKDA 4IHJA 4WFAV 1K4CC 5A9GA 1XBLA 5FNVA 4TQFA 5EYPA 1SQPH 3UKMA 4RUFA 2YIAA 5HFMA 1K33A 1JA8A 1SZXA 3KCYA 2F43G 2EZPA 2E76B 4DUYB 2QWRB 3AEIA 2Y48A 3D36C 4FPPA 2UXXA 2WLMA 3J81N 1XL6A 4B08A 1I94B 4DV7B 4DK0A 2RJZA 2LGWA 3QNEA 2CH7B 1AR1B 5B66Z 4NTXA 2ZE6A 2Y0PA 4TV9B 2HFEC 3RYCA 3SR2C 3MHSC 4JTCB 4X66O 2FB5A 3OTFA 3HKBB 4DV6B 1VQ9V 3CXCU 5LMNO 3JSNA 3CCUV 1M56C 1ZL8A 2W0FC 3HB3B 2OTLV 5BR8O 2ZE7A 1IDSA 2Q7HA 5LMUB 4LFBB 4NTWA 5JJNB 3T1HO 2M6YA 1TVKB 1NU1H 1QU7A 1SETA 4HBNA 2DE0X 4X64B 3TK1A 4ZIBA 3ZRXA 3RGBA 5L3BA 3WB1A 1S3JA 2AW9A 3E35A 4X88A 2X0LA 2WAMA 1YI2V 2ZQMA 4I9QA 3ZRVA 1R6KA 3RBZA 5GTIZ 1AI6A 5IYCO 3SPHA 4YHHO 1XEQA 2CGNA 2YEVB 5L3DA 1OCRB 4P9OA 3CRRA 3PN1A 1BZKA 3K5NA 1M1KW 4I55A 4LNUB 5KA6A 5DN6G 1KU9A 1G8MA 1WA8B 3OGCC 2BOBC 3P3PA 3CE2A 3LSSA 3CXHF 2OCCC 2AZ2A 3K9AA 3CHXA 3OMIB 3WFVA 1I7FA 3RWRD 3HPLC 2Q7EA 4DV0B 3CRCA 2FKXA 2R9IA 4AQYO 4JTDB 1S76D 1AILA 1URFA 3AG2B 2KG7B 3BHPA 3ZMTA 2HJFC 4UCTA 1OCZB 2JVDA 2AHYA 2P4VA 4CH4A 2PGGA 3IFXA 3CJHB 2V4DA 3OMNB 1YXBA 2ZIMA 1EN5A 1RSOA 2FMLA 5B1OA 2WSSG 2ZR2A 4Z1MG 3AK1A 1AI4A 1H2MA 1IBKB 3OR6C 1OZ0A 2NLJC 4YIOA 1ZSPA 5IWAO 4IT5A 2Q7GA 4JZ2A 5D5PA 1BCCH 5LHIA 2QWPB 4K8XA 4E2LA 3STZC 4TT3G 3UCSC 3X2QC 2OTJV 3SGIA 3DXRB 5JVDB 4RQEA 1IBLO 1V55B 4DR7O 1F4MA 3S3XA 3EFFK 4DV4O 1AR5A 4HNAB 4R8CA 1ZX3A 4JI1O 4O2BA 4I0XB 5LMNB 1Q3EA 4E4EA 2EIKB 2ZXWB 3T1HB 3I5DA 3EHBB 1WLEA 2YDEA 2WLNA 3S3WA 1OCOB 1P49A 3KKYA 5CA1A 2BOCC 1AP6A 2YI8A 1DTOA 1VQ6V 4J41A 3E8HA 1V55C 2QTSA 1N33B 3HKDA 3B09A 4JV5B 1IXBA 1LUWA 3JD0A 4DR4B 2CK3G 3E2EA 3LDEA 1CXZB 4QE7A 3I56V 4G2KA 2ZE8A 4JAVA 3H1IH 4TWKA 1YJ9V 1Y74B 4WFGA 2WLHA 5B1NA 3G71V 2HP8A 5C8YB 2YC0A 2JGDB 1PNLA 5CMUA 1JR9A 1GM8A 5JWPA 1VQ5V 1G1XB 4BWAA 3RYFA 4DR6O 3ABLC 2DYSB 2UXCB 4B3MB 4Q6GA 4ZI7B 5A2QN 4OX9B 5GONB 3JATA 1OCCC 1NR7A 2CTQA 2HR3A 1PP9H 4KFMA 4X20B 2IU0A 5CBFA 1H38A 4LF6O 5GTHZ 1VMGA 2ADQB 1CPYA 2ODMA 2EBOA 4GYCB 4HAMA 3TXQA 1KB9F 5BMVB 1Y76B 2CDYA 4J42A 4YJ2B 3CCLV 3VQXA 5DECA 1Q82W 1B3QA 2QM4A 3CC7V 4NTYA 3AG3B 2WLLB 5J2TB 4B3TO 4WFHA 1MMMA 2DWEC 1X4TA 4NR1A 4B3RB 2H3OA 5KHGA 2Q67A 4CC5A 4J7JA 1KBHA 2P22C 4RO2A 2X6BA 2PF4E 1KP2A 4DR5B 3JD1A 3OEEG 4MVSA 3BA8A 5CN0A 2A3QA 4LFBO 5JCOC 2DQ0A 5LYJB 2IJIA 4RQFA 2DMXA 5LMUO 1NH2B 3ZN0A 1B6QA 5IJ0A 2DQ3A 4DR7B 1XUQA 1QNMA 1GO3F 1WN7A 4XBFA 4UCVA 1VQOV 3K5OA 4J80A 2JJ1G 3W7UA 1ZWIC 5IDJA 1GN2A 5LP6B 5L3CA 1YCIA 5CA3A 3Q4HA 3LDCA 2QTOA 3K5LA 1Z2GA 4LFAO 1VP7A 1NTMH 2Q73A 2PUSA 4JI0O 5FL7G 3ZJZA 4JYYA 4PELA 1JFFB 1V54B 1R6TA 2DWDC 4GKJO 1YTFD 3ETDA 2RDCA 3SPIA 5B3SC 4FM2A 3UQ8A 3B8NA 1SESA 5KUMA 3J7AU 1KKDA 2JEXA 1NH2D 4X1KB 1GH6A 5BXZA 2DYRC 1ZAUA 1M93A 1NQTA 2LW1A 1PD3A 3DC6A 3E8FA 2ZKOA 3OMAB 3RYHA 4IHJB 3OR7C 2FTKA 4MVRA 4PI2A 2ZINA 3OFNG 2KQXA 1RPRA 4FM1A 1VQNV 3H1LH 4BIOA 1QR9A 3F7YC 3SYOA 2YI9A 3E8GA 2QA4V 4BW9A 2ZD9A 5LXTA 1NI8A 4F4LA 2HVKC 2ATKC 5K1XA 3CB2A 2GHYA 4DR2B 1VQ4V 1ROPA 2IU3A 2NR5A 4WCEV 3BAAA 3BVOA 1YDXA 2QR4A 1AI5A 3ETGA 1MOFA 2QGNA 1JCHA 4H33A 3E22B 2UXNA 1J5EO 2CTRA 3PJSK 1NS1A 4MTOA 2JK5C 3F7VC 4JYAO 4FLYA 1ORQC 4I5SA 3TXSA 3MDSA 4D7SA 1DLBA 1B06A 2LJ2A 3J80N 3AG7A 3L75H 1JX9A 4LFCO 3AK2A 1EM1A 2XT9A 1W2BU 1RFYA 4AI8A 4CS2A 3AG1C 3QO8A 4IIJB 3ABTA 5JJEB 4GKKO 2R70A 2E3CA 2EIKC 3DGEA 1WP7A 1H2KA 4LH7A 4RWUA 3CC2V 1QVGU 4CS4A 3RYIB 5IYZB 1FFXA 4UCOA 3JALB 1Q86W 4L87A 4TV8B 4JI3B 4J11A 3JAMN 1Y6XA 4DYLA 3NXSA 3RN4A 5KHIA 1KQSU 3ML0A 3VBBA 3JARB 3AG1B 4UFZA 5KUKA 2BTOA 4QIWF 4LF5O 3HKCA 3KG2A 3LUTB 5FLXN 1VEWA 5CA0B 2LQTA 2XOKG 2DJVA 1T5EA 1D5AA 4QJFB 3L9DA 4JI2O 3WG7C 1B04A 5H5NA 2IJHA 1W0KG 1NJIW 5L3EA 2UXBB 2V7QG 1Q7YW 5KX5A 4K0KB 1H2GA 1Q6UA 5LGTA 2YIDA 3MHHC 2ZCEA 1YSCA 5E1AC 3D8CA 4CS3A 3JASB 3IGAC 4WFFA 5LP6A 4UCRA 1XQ8A 1YZBA 4NXNB 5JVDA 2IH1C 2Q69A 2YXYA 1WAZA 1L0NH 4KHPB 5LOVA 4O2AB 5F2VO 5E79Z 5LHHA 3T1YO 1LR1A 5J2UA 4DUZO 1CEZA 3STLC 3AG2C 4N23A 1NTZH 3HKBA 1M57B 3RFRA 4PJ0Z 5LA6A 5KMGB 1GTOA 4TSFG 5IT9N 4U3JB 1S5LZ 2VQFO 3N2GA 3FAVB 1FYJA 3T1YB 2UXCO 2E74B 2ARHA 4NXMB 2VQFB 1I08A 4EB6A 2GTAA 1QLEC 4PDMA 3G6EV 1Q43A 4I50B 1JOYA 4FZ1A 4GKKB 4G28B 5IJ9B 1NTKH 1P4RA 1VQLV 5B1AC 3F5WC 3QVNA 2OIGA 4JI3O 3ZBHA 3JAWB 1FXKA 2XAQA 1M56B 1DGSA 3IAYA 1S5HC 4AQYB 3CWBH 2ZR3A 2YXHA 1SQQH 4GX2A 1WB8A 2GUZB 4JASA 5H9CA 2ADPA 4O4JA 3A0HZ 3ZHVA 4ZKIA 2QKAA 3G67A 1X59A 4LF5B 1MABG 2ETNA 4JI6O 2BE3A 5CB4B 2XTAA 3O65A 4LP8A 3CCJV 1O9GA 1SZTA 4EEQA 4JI6B 3BFRA 1FFTB 4YJ3B 3T2MA 1NR1A 1SA0A 2UXBO 2Z5UA 4DUYO 1XMQO 1HWYA 2QJ1A 3DXRA 3WB0A 4DV5B 3SJQC 3B77A 1JJ2U 3CC4V 4BAYA 4ZHQA 3K0DA 4R6ZA 1CP9A 1BSMA 1Q81W 4FLWA 2ZIOA 3OT7A 2Y69B 4X1IB 2IBZH 3M8AA 4ICGA 4X89A 4Z1VA 3TJTA 1R1BA 3QF7A 1XI1A 1BL8A 1Z5VA 2WLJA 3WU2Z 1EZVH 4JPRA 4LFAB 4B3SB 2YS8A 4PA7A 4LF4O 2EIJC 5L3GA 3BY6A 1OCCB 1Y74A 2V1DA 5FNVB 1SQGA 1VF5B 2EX3A 4FK5C 4FLXA 2OCHA 4GUNA 3LSQA 3FX7A 1HNWB 3JALA 3FB8C 3JD4A 3CPWU 3K57A 4QPKA 1YEWA 2G38A 3ABKB 4CH5A 4JGSA 3APOA 4XDLA 2ITDC 2OT5A 1THZA 1JVMA 1L1FA 4D7TA 3W7SA 1H2NA 3P3NA 1K5SA 2F23A 4JI7O 5EBMC 2BSKB 2HHHO 3MAQA 4B7KA 2GBOA 1JJOA 4X65B 4QPJA 3L74H 1N8RW 3HKDB 1RM1C 3E86A 1K97A 1QQCA 2QKSA 4U7OA 1OHHG 4DRXA 3CSXA 3OM3B 1AROP 3JD2A 2ZE5A 2P7TC 3HKEA 1S72V 1IBKO 2JDIG 2IJJA 1FKAO 5EIBC 1K92A 2W0XA 3FYEB 4PDLA 2P6JA 1VQMV 1MZFA 1XMOO 1RM1B 5LYJA 2ZDIA 4IYIA 3H1HH 2OWOA 4CH3A 4K0KO 3U11A 3QG5A 4WBNB 2LFRA 4O4HB 5KLVH 2WLIA 5IJ0B 1COWG 1PKXA 3ZMSA 3H1JH 3K04A 2A79B 3LSUA 1SKVA 5B1AB 4DV2B 3FB5C 2F4VO 2Q8VA 2R9AA 1IURA 5BMVA 1M90W 1FS0G 2WA4A 4KHPO 5JH7A 5ITZA 4GT1A 4DV2O 1WJZA 2F4VB 2EULA 1PNMA 5H6RA 5B3SB 4B3TB 5EZYA 5JQGA 4CC6A 2Y4TA 4DUZB 4HNAA 4ABMA 2HG5C 1KYOF 3JD3A 1LNQA 1DF4A 4DO2A 3T4ZA 2H8PC 3ZMUA 2ILMA 1SQBH 2K1EA 2E5LO 2VQEO 1R73A 1P7GA 3TCUA 3ABMB 1BE3H 4DR3O 1TA8A 3CJHA 1JFFA 2KG7A 2W6IG 1KMIZ 2P06A 2LGQA 4JI5O 2EJ7A 4MVMA 4F6RB 1KKCA 4FZ0A 1MSDA 1XNRB 1OV9A 2RNBA 3SYPA 5KHKA 3ETEA 3W7TA 1HNZO 4FJCC 4FFKA 4I4TB 3FYIB 4JI5B 1YTFB 3DTUB 3GVMA 4J9ZB 3RYIA 5IYZA 3SDLA 1ZLZA 3E89A 4YXWG 2DN9A 5B5EZ 3L72H 2C2AA 4LWSB 1P84F 2IM9A 2DW4A 1Q5OA 4X1YB 1XNQB 5H2FZ 4GZRB 4PV1B 3HKCB 2GTSA 4HZ3A 5LHGA 3BABA 5LP6C 1QLEB 4LF9B 2QM7A 3K3WA 3CYOA 1NZ6A 3VQYA 4KXRA 1JMKC 1F51A 2ZXWC 1N0JA 4DV1B 3ABKC 4DV6O 2E75B 4X8AA 3RT3C 1AJQA 2YIBD 4LF7B 5J2TA 2R9RB 4BR6A 3TETA 1L8DA 3SYQA 4EFBA 4O4LA 5C93A 2N05A 1GMGA 1AR4A 4PDVA 1XMQB 2JRIA 1PNKA 1K5QA 3SPJA 4LH6A 2B9ZA 3RYFB 5IY5B 1XL4A 1K34A 3ZHRA 3DC5A 2QSAA 5BY1A 4LF8B 3JASA 2CUGA 1H2SB 3JCUZ 3H01A 3CD6V 3RVZA 4X20A 3CCEV 1HW7A 5K1PA 5J9PC 4UV9A 1KD1W 2XAJA 4AHCA 1GKFA 3FD9A 3UT5B 1M9NA 2BTQB 3B4SA 4DR4O 1N32B 4MVQA 4MW3A 1Q8IA 1BHAA 2H94A 4O4IB 2DYSC 3SJCC 5EYPB 1SS3A 4UB6Z 5JCOA 4XDJA 1I5XA 1EBOA 3BCCH 3ZHQA 4JI8O 2Z3YA 2Y69C 4R7CA 2Q68A 2CTWA 1Y67A 3Q4HB 4FVMA 2PYJA 2BSKA 4EKWA 3ZCCA 4F6EA 4I0XA 3N2GB 1PL0A 3SYAA 4NVPA 3CMEV 2AGAA 4FFBA 4TUYA 2KB1A 2RQ6A 3BEHA 2HHHB 3OUSA 4X65O 2L6LA 5CA1B 1YVWA 3AG3C 1AJNA 4R50A 2XUMA 5EBWC 4OPAA 2LW7A 3G6BA 1R3JC 3BA9A 4ZOLA 4K8ZA 4UVBA 3D3IA 4UB8Z 4JI2B 2W6JG 3D36A 1AB3A 2F1MA 3GB7C 2Q0AA 1HP8A 3EXAA 1MSWD 1NVPD 1D2DA 3ABMC 3ZN1A 1QBZA 3RYHB 1U97A 3BPZA 1HR0O 1OCRC 2Q5ZA 2YSUB 4IGGA 3W7XA 4B3MO 4PHZA 3CMAV 1K9MW 3NR7A 4XDKA 1IZ3A 2EILC 1K8AW 5LGNA 3UO3A 2VS0A 1O9HA 5GONA 1AVMA 2YEVA 1SA0B 1SQFA 1XHZA 1N36B 1F23A 5LXTB 1HR0B 5JJJB 1H8EG 3L71H 1FPOA 4X9QA 4EFEA 2PZSA 3QTCA 1Q6IA 2JGUA 4I55B 4LF4B 4JZGA 5B1BB 1YHQV 2DOSA 3AK3A 5TISZ 3P32A 4CBCA 2P5OA 2JIZG 4J10A 3CCMV 1N34O 3JAKB 4WFEA 2PYLA 1J95A 1F7YA 3QO7A 5IYBO 1H2LA 3B8MA 1R6NA 1W0JG 4JYBA 3IC9A 5EC1C 4F6RA 1VIBA 4MSWC 1V54C 3CRQA 4U3FH 4DW1A 1YJWV 1ZUQA 1XNRO 3LDDA 2HKOA 1UPGA 1N32O 3K9SA 1F4NA 5EC2C 4MVZA 4WFBV 4G27B 1IBLB 2EIMC 3CCVV 4FLVA 2WLKA 4A5UB 1HNXO 1EN6A 1ZTEA 2YIBA 4MS2A 1E1QG 4UCUA 2XAGA 1M5IA 1XDCA 2EZOA 2ZT9B 2RCVA 1FJGO 4X1YA 2GV9A 4IYHA 1R3KC 1QLNA 1SC5B 2AHZA 4UCSA 1U96A 5GW7A 2ZM6O 3LNMB 3K08A 3OD4A 3OW2U 4J7ZA 2UUCO 3CX5F 3FFQA 1DK1A 4JI0B 3K0GA 4MW8A 5FPRA 2CTPA 3FB6C 2NNUA 5CA0A 3K58A 2UUCB 2GDSA 4PDRA 1QCEA 4UXNA 3VQWA 4GX0A 2KKWA 5D5QA 2O57A 4YIPA 3C3SA 2KSDA 2Q6AA 1S77D 3FKSG 2QM8A 2VWKA 2XAFA 3RW0A 3A0BZ 1XILA 3ETQA 4W4KA 4WBNA 5C8YA 2WLIB 2A06H 3ASOC 1N36O 5IWAB 1I0HA 4LF8O 1GAXA 1QVFU 1TVKA 5IE9A 4TV8A 4FLUA 4O4IA 3A8TA 1P7BA 1BGYH 1R3IC 2ZDIC 4DV4B 4WF9V 1GK9A 3ASNC 4JYCA 3C90A 1N4CA 3THOA 4QE9A 4O2BB 1NT2B 2P67A 5EZYB 5JQGB 5EK0A 1BQ0A 1HNWO 4DV3B 4DR5O 2D2CB 4FM0A 4YHHB 2QDOA 3CS5A 3RYCB 4CH6A 1Y76A 1IBMO 2B5UA 5FPOA 2IW5A 1TUBA 1E79G 4NKGB 1IX9A 3L73H 2E5LB 2M7WA 2BCCH 2EILB 4IL6Z 4LNUA 2QKCA 1WNSA 1NBMG 4W4LA 2HVJC 2PTMA 2GSMB 3G80A 1FXHA 4JI8B 1Q90D 4GLXA 1MA1A 2WLLA 2VWJA 2JJ2G 4FLTA 1M4UA 4RUEA 4B3SO 3H1KH 3N2KB 1IXMA 1PV0A 3T1CA 5HFLA 2Q4PA 5IYDO 1HDJA 2X7RB 1VARA 3OAAG 1FJGB 2EJRA 1YJNV 1UJWB 2NN4A 2Z0AA 5CBHA 1SQVH 4KP4A 4MTGA 2QWQB 4KUMA 4ZI7A 4X62O 2UXDB 5LBQA 2ZM6B 1D5NA 4NYKA 4Q20A 5KAIZ 2Y0IA 1KECA 1VF6C 4NB5A 2OYQA 4DK1A 3EVKA 1PL4A 1XMOB 3UO2A 5DEDA 5J2UB 3M7MX 3H9VA 3TGUH 1SQXH 3CCSV 1GN6A 3IJ4A 4O2AA 4BW5A 5KHJA 2B1IA 1SRYA 4JI7B 5CB4A 4YJ2A 4YY3O 4U3JA 1R3LC 1VQPV 4JAAA 3VOUA 4GCZA 4FIPC 4I7ZB 1XHXA 1N34B 3MD0A 4DV5O 5IJ9A 4MVOA 4O4LB 1M57C 4TV9A 5H6QA 1VQ7V 4PI0A 3ZIAG 2YUAA 1EFRG 1VQKV 3E8BA 1V9PA 3K5MA 2UUAB 4C7UA 2JS5A 3HR0A 4RAIA 3B40A 4UV8A 4DW0A 3OTOB 3VQVA 3DSQA 3CCQV 1Y66A 2F95B 4P9PA 2P4KA 4BIUA 2F93B 3JCZA 2FYUH 2XAHA 1Q6HA 4DR3B 1TGOA 2Q0OC 1Y4MA 1QR8A 1BMFG 2IH3C 1GN3A 1OCZC 1FXVA 3C3TA 1US6A 2PI4A 2PI5A 1K3EA 3A0RA 2A7WA 1KC8W 3ASOB 3JATB 3M99B 3ZHUA 2LFSA 2MK3A 3SJBC 1K73W 4J7KA 4JV5O 5EBLC 3KCXA 3K03A 2MW2B 1WA8A 5LA6B 4B7EA 5KMGA 4X1IA 5IY5C 3X2QB 1S0VA 5DM6V 1WB7A 3L70H 1BT8A 2EIMB 5LL6Y 2Q9LA 2CAZC 1OJHA 4KL1A 4J9YB 2K9PA 4OGQB 1LUVA 4LBEC 4EB6B 3U10A 4FMTA 2JGDA 4OPHA 4JTAB 3APQA 1WPXA 1UFIA 2B1GA 1SF9A 2JS3A 1MG1A 2CGOA 1JQ0A 5LGUA 1XREA 1MZEA 3N27A 1RP3B 4LF6B 4LF7O 5KHHA 3ZRWA 4H13B 3ZEDA 3OEHG 1YITV 4LR3A 2A9HA 2WA3A 1I94O 3OUFA 4LWSA 2AZ0A 1RSOB 3FB7C 2QE7G 4NXNO 5L3FA 2A0LA 4MTXA 3T4DA 4ASUG 5LOVB 4X66B 4IIJA 3ABUA 4PD4F 2AXTZ 2X6AA 1YF2A 1FFXB 2R72A 2BTQA 4OXSA 4PA9A 2N04A 4UVAA 5KAFZ 2N74A 3ABLB 2D3OW 1GRJA 3JAKA 4DV1O 5BR8B 4B3RO 1VQ8V 4DV7O 5KA5A 2LP7A 1BS3A 3E22A 1ENVA 1G4YB 2EINB 2CH7A 3F5TA 4LC1A 5AG2A 2OIEA
chains in the Genus database with same CATH topology
2UUBO 4JI5O 4X62O 4JI7O 1X59A 3R66A 2FKXA 4JI6O 2HHHO 4AQYO 1J5EO 3O65A 2DOSA 4DR4O 1G1XB 1AILA 1NS1A 3J81N 1N34O 4JV5O 1HNZO 1F7YA 4DR2O 4JYAO 4LFAO 4DR6O 4DR1O 4JI4O 5A2QN 4JI8O 2UXBO 4DUYO 1XMQO 3J80N 1N36O 4YY3O 4X66O 4JI0O 5LL6Y 1KUQA 4LF8O 4LF6O 4LFCO 1YZBA 1IBKO 3SDLA 1R6TA 1FKAO 4GKJO 5LMNO 1XNRO 2AGAA 4X64O 4OPHA 1XMOO 1N32O 3M8AA 5BR8O 3T1YO 4DUZO 4X65O 5IWAO 4K0KO 4DV5O 4GKKO 3J7AU 4OX9O 4DV0O 4A5UB 4LF7O 5BXZA 1HNWO 1R1BA 4DR5O 3T1HO 1HNXO 4OPAA 2LW7A 4B3TO 2ZKOA 5IT9N 1N33O 2VQFO 2F4VO 1I94O 1IBMO 1IBLO 4DR7O 4DV4O 1A32A 1XNQO 2UXCO 1FYJA 1FJGO 4JI1O 4LF4O 4KHPO 3JAMN 4NXNO 1AB3A 4DV6O 3RT3C 4DV2O 2UU9O 1D2DA 4LF9O 4YHHO 4LFBO 1XEQA 2ZM6O 4LF5O 2UXDO 4NXMO 5FLXN 2UUCO 1HR0O 5LMUO 4JI3O 2JRIA 4B3SO 2N74A 1DK1A 2DJVA 4B3MO 4DV1O 4JI2O 4B3RO 4DV7O 2E5LO 2VQEO 2UUAO 5H5NA 5BY1A 3OTOO 4DV3O 4DR3O 3F5TA 2Z0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB O;  4JI5 O;  4X62 O;  4JI7 O;  1X59 A;  3R66 A;  2FKX A;  4JI6 O;  2HHH O;  4AQY O;  1J5E O;  3O65 A;  2DOS A;  4DR4 O;  1G1X B;  1AIL A;  1NS1 A;  3J81 N;  1N34 O;  4JV5 O;  1HNZ O;  1F7Y A;  4DR2 O;  4JYA O;  4LFA O;  4DR6 O;  4DR1 O;  4JI4 O;  5A2Q N;  4JI8 O;  2UXB O;  4DUY O;  1XMQ O;  3J80 N;  1N36 O;  4YY3 O;  4X66 O;  4JI0 O;  5LL6 Y;  1KUQ A;  4LF8 O;  4LF6 O;  4LFC O;  1YZB A;  1IBK O;  3SDL A;  1R6T A;  1FKA O;  4GKJ O;  5LMN O;  1XNR O;  2AGA A;  4X64 O;  4OPH A;  1XMO O;  1N32 O;  3M8A A;  5BR8 O;  3T1Y O;  4DUZ O;  4X65 O;  5IWA O;  4K0K O;  4DV5 O;  4GKK O;  3J7A U;  4OX9 O;  4DV0 O;  4A5U B;  4LF7 O;  5BXZ A;  1HNW O;  1R1B A;  4DR5 O;  3T1H O;  1HNX O;  4OPA A;  2LW7 A;  4B3T O;  2ZKO A;  5IT9 N;  1N33 O;  2VQF O;  2F4V O;  1I94 O;  1IBM O;  1IBL O;  4DR7 O;  4DV4 O;  1A32 A;  1XNQ O;  2UXC O;  1FYJ A;  1FJG O;  4JI1 O;  4LF4 O;  4KHP O;  3JAM N;  4NXN O;  1AB3 A;  4DV6 O;  3RT3 C;  4DV2 O;  2UU9 O;  1D2D A;  4LF9 O;  4YHH O;  4LFB O;  1XEQ A;  2ZM6 O;  4LF5 O;  2UXD O;  4NXM O;  5FLX N;  2UUC O;  1HR0 O;  5LMU O;  4JI3 O;  2JRI A;  4B3S O;  2N74 A;  1DK1 A;  2DJV A;  4B3M O;  4DV1 O;  4JI2 O;  4B3R O;  4DV7 O;  2E5L O;  2VQE O;  2UUA O;  5H5N A;  5BY1 A;  3OTO O;  4DV3 O;  4DR3 O;  3F5T A;  2Z0A A; 
#chains in the Genus database with same CATH topology
 2HEP A;  3GWO A;  3CP1 A;  3JAR A;  1S5J A;  4K35 A;  2CE4 A;  2UUB O;  1K7D A;  5CBG A;  4AIL C;  4LCU C;  1W59 A;  2QWO B;  1E1R G;  3R66 A;  4D6T H;  4DRX B;  4I50 A;  2XHB A;  3KZI Z;  4MT8 A;  3ICX A;  3CRM A;  4QGP A;  3HKE B;  2YIC A;  4ZBM A;  2ZNJ A;  3GWK C;  1GM9 A;  4PA3 A;  1IBM B;  3B2E E;  1ZL8 B;  3JAW A;  4PA6 A;  4DR1 O;  3E83 A;  1J5E B;  2HJD A;  1K4D C;  4ZOL B;  4BIZ A;  1HNX B;  1YIJ V;  2X6C A;  3ASN B;  2GUZ A;  1H8H G;  3ZMZ A;  1KUQ A;  4DXW A;  1VF7 A;  3SJA C;  2JEU A;  4O4H A;  3K06 A;  1AI7 A;  4P2Z A;  4DR1 B;  4U7N A;  5JH7 B;  5KX5 B;  2VRZ A;  3I55 V;  3R65 A;  4UUJ C;  2HLD G;  1WPB A;  3JSL A;  2RN9 A;  1RPO A;  3ZHS A;  3OE7 G;  4OX9 O;  4DV0 O;  3IC7 A;  3LNN A;  4YY3 B;  2F66 C;  3U0Z A;  2PY5 A;  4TUY B;  1AJP A;  1EZJ A;  4ZHQ B;  2QEX V;  1XNQ O;  2Y4U A;  1MNG A;  1TUE B;  4MTF A;  3W7W A;  1QHT A;  1FAF A;  5EIB D;  3CRA A;  4LF9 O;  4H37 A;  2FL4 A;  3QO5 A;  1NVP B;  4HYO A;  4K3A A;  3SPG A;  3G4S V;  1DF5 A;  4H0L B;  2IJK A;  4JAU A;  4MVU A;  1FD9 A;  1AP5 A;  2QWN B;  3P30 A;  4CZZ A;  3ZX6 A;  2RMK B;  3K59 A;  1GM7 A;  3CEI A;  3SPC A;  3BRC A;  4TOI A;  4TQD A;  2UUA O;  1OCO C;  2WPD G;  1PPJ H;  3OTO O;  4DV3 O;  3RVY A;  3D3Q A;  1N0N A;  3WG7 B;  1FXK B;  4I4T A;  5BZB A;  3K79 A;  4JI4 B;  2DYR B;  1TAE A;  1WP8 A;  3A2F A;  4Z2W A;  3ZHT A;  1SER A;  4DR2 O;  4QNH B;  4I9W A;  2XND G;  3ZS8 C;  3ZRS A;  4PA4 A;  4JI4 O;  4GX1 A;  4N21 A;  2OCC B;  2WWW A;  2UUB B;  2L35 A;  1FXK C;  2P90 A;  1IVS A;  2LO1 A;  1TUB B;  1L0L H;  1VF6 A;  5ITZ B;  4JI1 B;  3UM7 A;  4JYA B;  3AG4 C;  2YXL A;  4YJ3 A;  1KP3 A;  4X64 O;  4H44 B;  4P30 A;  4UVC A;  4JF3 A;  3FAV A;  1BQZ A;  4GX5 A;  1JPX A;  1PM9 A;  1G6U A;  4LFC B;  3O9O A;  4L8J A;  4FFB B;  1N33 O;  5B1B C;  3ZMV A;  3N2K A;  2VQE B;  1EN4 A;  2UU9 B;  1BHB A;  4DR6 B;  1A32 A;  4GKJ B;  1GN4 A;  3SYC A;  3AG4 B;  3CCR V;  3JYC A;  2EIJ B;  3OGI B;  1XOU A;  2UU9 O;  4FLZ A;  2XAS A;  2EIN C;  3ZRW B;  3WB2 A;  4X62 B;  2UXD O;  4X1K A;  1I5Y A;  4NXM O;  1Z5W A;  1HNZ B;  4O4J B;  2ITC C;  3UT5 A;  2ZNI A;  1NKD A;  4IHJ A;  4WFA V;  1K4C C;  5A9G A;  1XBL A;  5FNV A;  4TQF A;  5EYP A;  1SQP H;  3UKM A;  4RUF A;  2YIA A;  5HFM A;  1K33 A;  1JA8 A;  1SZX A;  3KCY A;  2F43 G;  2EZP A;  2E76 B;  4DUY B;  2QWR B;  3AEI A;  2Y48 A;  3D36 C;  4FPP A;  2UXX A;  2WLM A;  3J81 N;  1XL6 A;  4B08 A;  1I94 B;  4DV7 B;  4DK0 A;  2RJZ A;  2LGW A;  3QNE A;  2CH7 B;  1AR1 B;  5B66 Z;  4NTX A;  2ZE6 A;  2Y0P A;  4TV9 B;  2HFE C;  3RYC A;  3SR2 C;  3MHS C;  4JTC B;  4X66 O;  2FB5 A;  3OTF A;  3HKB B;  4DV6 B;  1VQ9 V;  3CXC U;  5LMN O;  3JSN A;  3CCU V;  1M56 C;  1ZL8 A;  2W0F C;  3HB3 B;  2OTL V;  5BR8 O;  2ZE7 A;  1IDS A;  2Q7H A;  5LMU B;  4LFB B;  4NTW A;  5JJN B;  3T1H O;  2M6Y A;  1TVK B;  1NU1 H;  1QU7 A;  1SET A;  4HBN A;  2DE0 X;  4X64 B;  3TK1 A;  4ZIB A;  3ZRX A;  3RGB A;  5L3B A;  3WB1 A;  1S3J A;  2AW9 A;  3E35 A;  4X88 A;  2X0L A;  2WAM A;  1YI2 V;  2ZQM A;  4I9Q A;  3ZRV A;  1R6K A;  3RBZ A;  5GTI Z;  1AI6 A;  5IYC O;  3SPH A;  4YHH O;  1XEQ A;  2CGN A;  2YEV B;  5L3D A;  1OCR B;  4P9O A;  3CRR A;  3PN1 A;  1BZK A;  3K5N A;  1M1K W;  4I55 A;  4LNU B;  5KA6 A;  5DN6 G;  1KU9 A;  1G8M A;  1WA8 B;  3OGC C;  2BOB C;  3P3P A;  3CE2 A;  3LSS A;  3CXH F;  2OCC C;  2AZ2 A;  3K9A A;  3CHX A;  3OMI B;  3WFV A;  1I7F A;  3RWR D;  3HPL C;  2Q7E A;  4DV0 B;  3CRC A;  2FKX A;  2R9I A;  4AQY O;  4JTD B;  1S76 D;  1AIL A;  1URF A;  3AG2 B;  2KG7 B;  3BHP A;  3ZMT A;  2HJF C;  4UCT A;  1OCZ B;  2JVD A;  2AHY A;  2P4V A;  4CH4 A;  2PGG A;  3IFX A;  3CJH B;  2V4D A;  3OMN B;  1YXB A;  2ZIM A;  1EN5 A;  1RSO A;  2FML A;  5B1O A;  2WSS G;  2ZR2 A;  4Z1M G;  3AK1 A;  1AI4 A;  1H2M A;  1IBK B;  3OR6 C;  1OZ0 A;  2NLJ C;  4YIO A;  1ZSP A;  5IWA O;  4IT5 A;  2Q7G A;  4JZ2 A;  5D5P A;  1BCC H;  5LHI A;  2QWP B;  4K8X A;  4E2L A;  3STZ C;  4TT3 G;  3UCS C;  3X2Q C;  2OTJ V;  3SGI A;  3DXR B;  5JVD B;  4RQE A;  1IBL O;  1V55 B;  4DR7 O;  1F4M A;  3S3X A;  3EFF K;  4DV4 O;  1AR5 A;  4HNA B;  4R8C A;  1ZX3 A;  4JI1 O;  4O2B A;  4I0X B;  5LMN B;  1Q3E A;  4E4E A;  2EIK B;  2ZXW B;  3T1H B;  3I5D A;  3EHB B;  1WLE A;  2YDE A;  2WLN A;  3S3W A;  1OCO B;  1P49 A;  3KKY A;  5CA1 A;  2BOC C;  1AP6 A;  2YI8 A;  1DTO A;  1VQ6 V;  4J41 A;  3E8H A;  1V55 C;  2QTS A;  1N33 B;  3HKD A;  3B09 A;  4JV5 B;  1IXB A;  1LUW A;  3JD0 A;  4DR4 B;  2CK3 G;  3E2E A;  3LDE A;  1CXZ B;  4QE7 A;  3I56 V;  4G2K A;  2ZE8 A;  4JAV A;  3H1I H;  4TWK A;  1YJ9 V;  1Y74 B;  4WFG A;  2WLH A;  5B1N A;  3G71 V;  2HP8 A;  5C8Y B;  2YC0 A;  2JGD B;  1PNL A;  5CMU A;  1JR9 A;  1GM8 A;  5JWP A;  1VQ5 V;  1G1X B;  4BWA A;  3RYF A;  4DR6 O;  3ABL C;  2DYS B;  2UXC B;  4B3M B;  4Q6G A;  4ZI7 B;  5A2Q N;  4OX9 B;  5GON B;  3JAT A;  1OCC C;  1NR7 A;  2CTQ A;  2HR3 A;  1PP9 H;  4KFM A;  4X20 B;  2IU0 A;  5CBF A;  1H38 A;  4LF6 O;  5GTH Z;  1VMG A;  2ADQ B;  1CPY A;  2ODM A;  2EBO A;  4GYC B;  4HAM A;  3TXQ A;  1KB9 F;  5BMV B;  1Y76 B;  2CDY A;  4J42 A;  4YJ2 B;  3CCL V;  3VQX A;  5DEC A;  1Q82 W;  1B3Q A;  2QM4 A;  3CC7 V;  4NTY A;  3AG3 B;  2WLL B;  5J2T B;  4B3T O;  4WFH A;  1MMM A;  2DWE C;  1X4T A;  4NR1 A;  4B3R B;  2H3O A;  5KHG A;  2Q67 A;  4CC5 A;  4J7J A;  1KBH A;  2P22 C;  4RO2 A;  2X6B A;  2PF4 E;  1KP2 A;  4DR5 B;  3JD1 A;  3OEE G;  4MVS A;  3BA8 A;  5CN0 A;  2A3Q A;  4LFB O;  5JCO C;  2DQ0 A;  5LYJ B;  2IJI A;  4RQF A;  2DMX A;  5LMU O;  1NH2 B;  3ZN0 A;  1B6Q A;  5IJ0 A;  2DQ3 A;  4DR7 B;  1XUQ A;  1QNM A;  1GO3 F;  1WN7 A;  4XBF A;  4UCV A;  1VQO V;  3K5O A;  4J80 A;  2JJ1 G;  3W7U A;  1ZWI C;  5IDJ A;  1GN2 A;  5LP6 B;  5L3C A;  1YCI A;  5CA3 A;  3Q4H A;  3LDC A;  2QTO A;  3K5L A;  1Z2G A;  4LFA O;  1VP7 A;  1NTM H;  2Q73 A;  2PUS A;  4JI0 O;  5FL7 G;  3ZJZ A;  4JYY A;  4PEL A;  1JFF B;  1V54 B;  1R6T A;  2DWD C;  4GKJ O;  1YTF D;  3ETD A;  2RDC A;  3SPI A;  5B3S C;  4FM2 A;  3UQ8 A;  3B8N A;  1SES A;  5KUM A;  3J7A U;  1KKD A;  2JEX A;  1NH2 D;  4X1K B;  1GH6 A;  5BXZ A;  2DYR C;  1ZAU A;  1M93 A;  1NQT A;  2LW1 A;  1PD3 A;  3DC6 A;  3E8F A;  2ZKO A;  3OMA B;  3RYH A;  4IHJ B;  3OR7 C;  2FTK A;  4MVR A;  4PI2 A;  2ZIN A;  3OFN G;  2KQX A;  1RPR A;  4FM1 A;  1VQN V;  3H1L H;  4BIO A;  1QR9 A;  3F7Y C;  3SYO A;  2YI9 A;  3E8G A;  2QA4 V;  4BW9 A;  2ZD9 A;  5LXT A;  1NI8 A;  4F4L A;  2HVK C;  2ATK C;  5K1X A;  3CB2 A;  2GHY A;  4DR2 B;  1VQ4 V;  1ROP A;  2IU3 A;  2NR5 A;  4WCE V;  3BAA A;  3BVO A;  1YDX A;  2QR4 A;  1AI5 A;  3ETG A;  1MOF A;  2QGN A;  1JCH A;  4H33 A;  3E22 B;  2UXN A;  1J5E O;  2CTR A;  3PJS K;  1NS1 A;  4MTO A;  2JK5 C;  3F7V C;  4JYA O;  4FLY A;  1ORQ C;  4I5S A;  3TXS A;  3MDS A;  4D7S A;  1DLB A;  1B06 A;  2LJ2 A;  3J80 N;  3AG7 A;  3L75 H;  1JX9 A;  4LFC O;  3AK2 A;  1EM1 A;  2XT9 A;  1W2B U;  1RFY A;  4AI8 A;  4CS2 A;  3AG1 C;  3QO8 A;  4IIJ B;  3ABT A;  5JJE B;  4GKK O;  2R70 A;  2E3C A;  2EIK C;  3DGE A;  1WP7 A;  1H2K A;  4LH7 A;  4RWU A;  3CC2 V;  1QVG U;  4CS4 A;  3RYI B;  5IYZ B;  1FFX A;  4UCO A;  3JAL B;  1Q86 W;  4L87 A;  4TV8 B;  4JI3 B;  4J11 A;  3JAM N;  1Y6X A;  4DYL A;  3NXS A;  3RN4 A;  5KHI A;  1KQS U;  3ML0 A;  3VBB A;  3JAR B;  3AG1 B;  4UFZ A;  5KUK A;  2BTO A;  4QIW F;  4LF5 O;  3HKC A;  3KG2 A;  3LUT B;  5FLX N;  1VEW A;  5CA0 B;  2LQT A;  2XOK G;  2DJV A;  1T5E A;  1D5A A;  4QJF B;  3L9D A;  4JI2 O;  3WG7 C;  1B04 A;  5H5N A;  2IJH A;  1W0K G;  1NJI W;  5L3E A;  2UXB B;  2V7Q G;  1Q7Y W;  5KX5 A;  4K0K B;  1H2G A;  1Q6U A;  5LGT A;  2YID A;  3MHH C;  2ZCE A;  1YSC A;  5E1A C;  3D8C A;  4CS3 A;  3JAS B;  3IGA C;  4WFF A;  5LP6 A;  4UCR A;  1XQ8 A;  1YZB A;  4NXN B;  5JVD A;  2IH1 C;  2Q69 A;  2YXY A;  1WAZ A;  1L0N H;  4KHP B;  5LOV A;  4O2A B;  5F2V O;  5E79 Z;  5LHH A;  3T1Y O;  1LR1 A;  5J2U A;  4DUZ O;  1CEZ A;  3STL C;  3AG2 C;  4N23 A;  1NTZ H;  3HKB A;  1M57 B;  3RFR A;  4PJ0 Z;  5LA6 A;  5KMG B;  1GTO A;  4TSF G;  5IT9 N;  4U3J B;  1S5L Z;  2VQF O;  3N2G A;  3FAV B;  1FYJ A;  3T1Y B;  2UXC O;  2E74 B;  2ARH A;  4NXM B;  2VQF B;  1I08 A;  4EB6 A;  2GTA A;  1QLE C;  4PDM A;  3G6E V;  1Q43 A;  4I50 B;  1JOY A;  4FZ1 A;  4GKK B;  4G28 B;  5IJ9 B;  1NTK H;  1P4R A;  1VQL V;  5B1A C;  3F5W C;  3QVN A;  2OIG A;  4JI3 O;  3ZBH A;  3JAW B;  1FXK A;  2XAQ A;  1M56 B;  1DGS A;  3IAY A;  1S5H C;  4AQY B;  3CWB H;  2ZR3 A;  2YXH A;  1SQQ H;  4GX2 A;  1WB8 A;  2GUZ B;  4JAS A;  5H9C A;  2ADP A;  4O4J A;  3A0H Z;  3ZHV A;  4ZKI A;  2QKA A;  3G67 A;  1X59 A;  4LF5 B;  1MAB G;  2ETN A;  4JI6 O;  2BE3 A;  5CB4 B;  2XTA A;  3O65 A;  4LP8 A;  3CCJ V;  1O9G A;  1SZT A;  4EEQ A;  4JI6 B;  3BFR A;  1FFT B;  4YJ3 B;  3T2M A;  1NR1 A;  1SA0 A;  2UXB O;  2Z5U A;  4DUY O;  1XMQ O;  1HWY A;  2QJ1 A;  3DXR A;  3WB0 A;  4DV5 B;  3SJQ C;  3B77 A;  1JJ2 U;  3CC4 V;  4BAY A;  4ZHQ A;  3K0D A;  4R6Z A;  1CP9 A;  1BSM A;  1Q81 W;  4FLW A;  2ZIO A;  3OT7 A;  2Y69 B;  4X1I B;  2IBZ H;  3M8A A;  4ICG A;  4X89 A;  4Z1V A;  3TJT A;  1R1B A;  3QF7 A;  1XI1 A;  1BL8 A;  1Z5V A;  2WLJ A;  3WU2 Z;  1EZV H;  4JPR A;  4LFA B;  4B3S B;  2YS8 A;  4PA7 A;  4LF4 O;  2EIJ C;  5L3G A;  3BY6 A;  1OCC B;  1Y74 A;  2V1D A;  5FNV B;  1SQG A;  1VF5 B;  2EX3 A;  4FK5 C;  4FLX A;  2OCH A;  4GUN A;  3LSQ A;  3FX7 A;  1HNW B;  3JAL A;  3FB8 C;  3JD4 A;  3CPW U;  3K57 A;  4QPK A;  1YEW A;  2G38 A;  3ABK B;  4CH5 A;  4JGS A;  3APO A;  4XDL A;  2ITD C;  2OT5 A;  1THZ A;  1JVM A;  1L1F A;  4D7T A;  3W7S A;  1H2N A;  3P3N A;  1K5S A;  2F23 A;  4JI7 O;  5EBM C;  2BSK B;  2HHH O;  3MAQ A;  4B7K A;  2GBO A;  1JJO A;  4X65 B;  4QPJ A;  3L74 H;  1N8R W;  3HKD B;  1RM1 C;  3E86 A;  1K97 A;  1QQC A;  2QKS A;  4U7O A;  1OHH G;  4DRX A;  3CSX A;  3OM3 B;  1ARO P;  3JD2 A;  2ZE5 A;  2P7T C;  3HKE A;  1S72 V;  1IBK O;  2JDI G;  2IJJ A;  1FKA O;  5EIB C;  1K92 A;  2W0X A;  3FYE B;  4PDL A;  2P6J A;  1VQM V;  1MZF A;  1XMO O;  1RM1 B;  5LYJ A;  2ZDI A;  4IYI A;  3H1H H;  2OWO A;  4CH3 A;  4K0K O;  3U11 A;  3QG5 A;  4WBN B;  2LFR A;  4O4H B;  5KLV H;  2WLI A;  5IJ0 B;  1COW G;  1PKX A;  3ZMS A;  3H1J H;  3K04 A;  2A79 B;  3LSU A;  1SKV A;  5B1A B;  4DV2 B;  3FB5 C;  2F4V O;  2Q8V A;  2R9A A;  1IUR A;  5BMV A;  1M90 W;  1FS0 G;  2WA4 A;  4KHP O;  5JH7 A;  5ITZ A;  4GT1 A;  4DV2 O;  1WJZ A;  2F4V B;  2EUL A;  1PNM A;  5H6R A;  5B3S B;  4B3T B;  5EZY A;  5JQG A;  4CC6 A;  2Y4T A;  4DUZ B;  4HNA A;  4ABM A;  2HG5 C;  1KYO F;  3JD3 A;  1LNQ A;  1DF4 A;  4DO2 A;  3T4Z A;  2H8P C;  3ZMU A;  2ILM A;  1SQB H;  2K1E A;  2E5L O;  2VQE O;  1R73 A;  1P7G A;  3TCU A;  3ABM B;  1BE3 H;  4DR3 O;  1TA8 A;  3CJH A;  1JFF A;  2KG7 A;  2W6I G;  1KMI Z;  2P06 A;  2LGQ A;  4JI5 O;  2EJ7 A;  4MVM A;  4F6R B;  1KKC A;  4FZ0 A;  1MSD A;  1XNR B;  1OV9 A;  2RNB A;  3SYP A;  5KHK A;  3ETE A;  3W7T A;  1HNZ O;  4FJC C;  4FFK A;  4I4T B;  3FYI B;  4JI5 B;  1YTF B;  3DTU B;  3GVM A;  4J9Z B;  3RYI A;  5IYZ A;  3SDL A;  1ZLZ A;  3E89 A;  4YXW G;  2DN9 A;  5B5E Z;  3L72 H;  2C2A A;  4LWS B;  1P84 F;  2IM9 A;  2DW4 A;  1Q5O A;  4X1Y B;  1XNQ B;  5H2F Z;  4GZR B;  4PV1 B;  3HKC B;  2GTS A;  4HZ3 A;  5LHG A;  3BAB A;  5LP6 C;  1QLE B;  4LF9 B;  2QM7 A;  3K3W A;  3CYO A;  1NZ6 A;  3VQY A;  4KXR A;  1JMK C;  1F51 A;  2ZXW C;  1N0J A;  4DV1 B;  3ABK C;  4DV6 O;  2E75 B;  4X8A A;  3RT3 C;  1AJQ A;  2YIB D;  4LF7 B;  5J2T A;  2R9R B;  4BR6 A;  3TET A;  1L8D A;  3SYQ A;  4EFB A;  4O4L A;  5C93 A;  2N05 A;  1GMG A;  1AR4 A;  4PDV A;  1XMQ B;  2JRI A;  1PNK A;  1K5Q A;  3SPJ A;  4LH6 A;  2B9Z A;  3RYF B;  5IY5 B;  1XL4 A;  1K34 A;  3ZHR A;  3DC5 A;  2QSA A;  5BY1 A;  4LF8 B;  3JAS A;  2CUG A;  1H2S B;  3JCU Z;  3H01 A;  3CD6 V;  3RVZ A;  4X20 A;  3CCE V;  1HW7 A;  5K1P A;  5J9P C;  4UV9 A;  1KD1 W;  2XAJ A;  4AHC A;  1GKF A;  3FD9 A;  3UT5 B;  1M9N A;  2BTQ B;  3B4S A;  4DR4 O;  1N32 B;  4MVQ A;  4MW3 A;  1Q8I A;  1BHA A;  2H94 A;  4O4I B;  2DYS C;  3SJC C;  5EYP B;  1SS3 A;  4UB6 Z;  5JCO A;  4XDJ A;  1I5X A;  1EBO A;  3BCC H;  3ZHQ A;  4JI8 O;  2Z3Y A;  2Y69 C;  4R7C A;  2Q68 A;  2CTW A;  1Y67 A;  3Q4H B;  4FVM A;  2PYJ A;  2BSK A;  4EKW A;  3ZCC A;  4F6E A;  4I0X A;  3N2G B;  1PL0 A;  3SYA A;  4NVP A;  3CME V;  2AGA A;  4FFB A;  4TUY A;  2KB1 A;  2RQ6 A;  3BEH A;  2HHH B;  3OUS A;  4X65 O;  2L6L A;  5CA1 B;  1YVW A;  3AG3 C;  1AJN A;  4R50 A;  2XUM A;  5EBW C;  4OPA A;  2LW7 A;  3G6B A;  1R3J C;  3BA9 A;  4ZOL A;  4K8Z A;  4UVB A;  3D3I A;  4UB8 Z;  4JI2 B;  2W6J G;  3D36 A;  1AB3 A;  2F1M A;  3GB7 C;  2Q0A A;  1HP8 A;  3EXA A;  1MSW D;  1NVP D;  1D2D A;  3ABM C;  3ZN1 A;  1QBZ A;  3RYH B;  1U97 A;  3BPZ A;  1HR0 O;  1OCR C;  2Q5Z A;  2YSU B;  4IGG A;  3W7X A;  4B3M O;  4PHZ A;  3CMA V;  1K9M W;  3NR7 A;  4XDK A;  1IZ3 A;  2EIL C;  1K8A W;  5LGN A;  3UO3 A;  2VS0 A;  1O9H A;  5GON A;  1AVM A;  2YEV A;  1SA0 B;  1SQF A;  1XHZ A;  1N36 B;  1F23 A;  5LXT B;  1HR0 B;  5JJJ B;  1H8E G;  3L71 H;  1FPO A;  4X9Q A;  4EFE A;  2PZS A;  3QTC A;  1Q6I A;  2JGU A;  4I55 B;  4LF4 B;  4JZG A;  5B1B B;  1YHQ V;  2DOS A;  3AK3 A;  5TIS Z;  3P32 A;  4CBC A;  2P5O A;  2JIZ G;  4J10 A;  3CCM V;  1N34 O;  3JAK B;  4WFE A;  2PYL A;  1J95 A;  1F7Y A;  3QO7 A;  5IYB O;  1H2L A;  3B8M A;  1R6N A;  1W0J G;  4JYB A;  3IC9 A;  5EC1 C;  4F6R A;  1VIB A;  4MSW C;  1V54 C;  3CRQ A;  4U3F H;  4DW1 A;  1YJW V;  1ZUQ A;  1XNR O;  3LDD A;  2HKO A;  1UPG A;  1N32 O;  3K9S A;  1F4N A;  5EC2 C;  4MVZ A;  4WFB V;  4G27 B;  1IBL B;  2EIM C;  3CCV V;  4FLV A;  2WLK A;  4A5U B;  1HNX O;  1EN6 A;  1ZTE A;  2YIB A;  4MS2 A;  1E1Q G;  4UCU A;  2XAG A;  1M5I A;  1XDC A;  2EZO A;  2ZT9 B;  2RCV A;  1FJG O;  4X1Y A;  2GV9 A;  4IYH A;  1R3K C;  1QLN A;  1SC5 B;  2AHZ A;  4UCS A;  1U96 A;  5GW7 A;  2ZM6 O;  3LNM B;  3K08 A;  3OD4 A;  3OW2 U;  4J7Z A;  2UUC O;  3CX5 F;  3FFQ A;  1DK1 A;  4JI0 B;  3K0G A;  4MW8 A;  5FPR A;  2CTP A;  3FB6 C;  2NNU A;  5CA0 A;  3K58 A;  2UUC B;  2GDS A;  4PDR A;  1QCE A;  4UXN A;  3VQW A;  4GX0 A;  2KKW A;  5D5Q A;  2O57 A;  4YIP A;  3C3S A;  2KSD A;  2Q6A A;  1S77 D;  3FKS G;  2QM8 A;  2VWK A;  2XAF A;  3RW0 A;  3A0B Z;  1XIL A;  3ETQ A;  4W4K A;  4WBN A;  5C8Y A;  2WLI B;  2A06 H;  3ASO C;  1N36 O;  5IWA B;  1I0H A;  4LF8 O;  1GAX A;  1QVF U;  1TVK A;  5IE9 A;  4TV8 A;  4FLU A;  4O4I A;  3A8T A;  1P7B A;  1BGY H;  1R3I C;  2ZDI C;  4DV4 B;  4WF9 V;  1GK9 A;  3ASN C;  4JYC A;  3C90 A;  1N4C A;  3THO A;  4QE9 A;  4O2B B;  1NT2 B;  2P67 A;  5EZY B;  5JQG B;  5EK0 A;  1BQ0 A;  1HNW O;  4DV3 B;  4DR5 O;  2D2C B;  4FM0 A;  4YHH B;  2QDO A;  3CS5 A;  3RYC B;  4CH6 A;  1Y76 A;  1IBM O;  2B5U A;  5FPO A;  2IW5 A;  1TUB A;  1E79 G;  4NKG B;  1IX9 A;  3L73 H;  2E5L B;  2M7W A;  2BCC H;  2EIL B;  4IL6 Z;  4LNU A;  2QKC A;  1WNS A;  1NBM G;  4W4L A;  2HVJ C;  2PTM A;  2GSM B;  3G80 A;  1FXH A;  4JI8 B;  1Q90 D;  4GLX A;  1MA1 A;  2WLL A;  2VWJ A;  2JJ2 G;  4FLT A;  1M4U A;  4RUE A;  4B3S O;  3H1K H;  3N2K B;  1IXM A;  1PV0 A;  3T1C A;  5HFL A;  2Q4P A;  5IYD O;  1HDJ A;  2X7R B;  1VAR A;  3OAA G;  1FJG B;  2EJR A;  1YJN V;  1UJW B;  2NN4 A;  2Z0A A;  5CBH A;  1SQV H;  4KP4 A;  4MTG A;  2QWQ B;  4KUM A;  4ZI7 A;  4X62 O;  2UXD B;  5LBQ A;  2ZM6 B;  1D5N A;  4NYK A;  4Q20 A;  5KAI Z;  2Y0I A;  1KEC A;  1VF6 C;  4NB5 A;  2OYQ A;  4DK1 A;  3EVK A;  1PL4 A;  1XMO B;  3UO2 A;  5DED A;  5J2U B;  3M7M X;  3H9V A;  3TGU H;  1SQX H;  3CCS V;  1GN6 A;  3IJ4 A;  4O2A A;  4BW5 A;  5KHJ A;  2B1I A;  1SRY A;  4JI7 B;  5CB4 A;  4YJ2 A;  4YY3 O;  4U3J A;  1R3L C;  1VQP V;  4JAA A;  3VOU A;  4GCZ A;  4FIP C;  4I7Z B;  1XHX A;  1N34 B;  3MD0 A;  4DV5 O;  5IJ9 A;  4MVO A;  4O4L B;  1M57 C;  4TV9 A;  5H6Q A;  1VQ7 V;  4PI0 A;  3ZIA G;  2YUA A;  1EFR G;  1VQK V;  3E8B A;  1V9P A;  3K5M A;  2UUA B;  4C7U A;  2JS5 A;  3HR0 A;  4RAI A;  3B40 A;  4UV8 A;  4DW0 A;  3OTO B;  3VQV A;  3DSQ A;  3CCQ V;  1Y66 A;  2F95 B;  4P9P A;  2P4K A;  4BIU A;  2F93 B;  3JCZ A;  2FYU H;  2XAH A;  1Q6H A;  4DR3 B;  1TGO A;  2Q0O C;  1Y4M A;  1QR8 A;  1BMF G;  2IH3 C;  1GN3 A;  1OCZ C;  1FXV A;  3C3T A;  1US6 A;  2PI4 A;  2PI5 A;  1K3E A;  3A0R A;  2A7W A;  1KC8 W;  3ASO B;  3JAT B;  3M99 B;  3ZHU A;  2LFS A;  2MK3 A;  3SJB C;  1K73 W;  4J7K A;  4JV5 O;  5EBL C;  3KCX A;  3K03 A;  2MW2 B;  1WA8 A;  5LA6 B;  4B7E A;  5KMG A;  4X1I A;  5IY5 C;  3X2Q B;  1S0V A;  5DM6 V;  1WB7 A;  3L70 H;  1BT8 A;  2EIM B;  5LL6 Y;  2Q9L A;  2CAZ C;  1OJH A;  4KL1 A;  4J9Y B;  2K9P A;  4OGQ B;  1LUV A;  4LBE C;  4EB6 B;  3U10 A;  4FMT A;  2JGD A;  4OPH A;  4JTA B;  3APQ A;  1WPX A;  1UFI A;  2B1G A;  1SF9 A;  2JS3 A;  1MG1 A;  2CGO A;  1JQ0 A;  5LGU A;  1XRE A;  1MZE A;  3N27 A;  1RP3 B;  4LF6 B;  4LF7 O;  5KHH A;  3ZRW A;  4H13 B;  3ZED A;  3OEH G;  1YIT V;  4LR3 A;  2A9H A;  2WA3 A;  1I94 O;  3OUF A;  4LWS A;  2AZ0 A;  1RSO B;  3FB7 C;  2QE7 G;  4NXN O;  5L3F A;  2A0L A;  4MTX A;  3T4D A;  4ASU G;  5LOV B;  4X66 B;  4IIJ A;  3ABU A;  4PD4 F;  2AXT Z;  2X6A A;  1YF2 A;  1FFX B;  2R72 A;  2BTQ A;  4OXS A;  4PA9 A;  2N04 A;  4UVA A;  5KAF Z;  2N74 A;  3ABL B;  2D3O W;  1GRJ A;  3JAK A;  4DV1 O;  5BR8 B;  4B3R O;  1VQ8 V;  4DV7 O;  5KA5 A;  2LP7 A;  1BS3 A;  3E22 A;  1ENV A;  1G4Y B;  2EIN B;  2CH7 A;  3F5T A;  4LC1 A;  5AG2 A;  2OIE A; 
#chains in the Genus database with same CATH homology
 2UUB O;  4JI5 O;  4X62 O;  4JI7 O;  1X59 A;  3R66 A;  2FKX A;  4JI6 O;  2HHH O;  4AQY O;  1J5E O;  3O65 A;  2DOS A;  4DR4 O;  1G1X B;  1AIL A;  1NS1 A;  3J81 N;  1N34 O;  4JV5 O;  1HNZ O;  1F7Y A;  4DR2 O;  4JYA O;  4LFA O;  4DR6 O;  4DR1 O;  4JI4 O;  5A2Q N;  4JI8 O;  2UXB O;  4DUY O;  1XMQ O;  3J80 N;  1N36 O;  4YY3 O;  4X66 O;  4JI0 O;  5LL6 Y;  1KUQ A;  4LF8 O;  4LF6 O;  4LFC O;  1YZB A;  1IBK O;  3SDL A;  1R6T A;  1FKA O;  4GKJ O;  5LMN O;  1XNR O;  2AGA A;  4X64 O;  4OPH A;  1XMO O;  1N32 O;  3M8A A;  5BR8 O;  3T1Y O;  4DUZ O;  4X65 O;  5IWA O;  4K0K O;  4DV5 O;  4GKK O;  3J7A U;  4OX9 O;  4DV0 O;  4A5U B;  4LF7 O;  5BXZ A;  1HNW O;  1R1B A;  4DR5 O;  3T1H O;  1HNX O;  4OPA A;  2LW7 A;  4B3T O;  2ZKO A;  5IT9 N;  1N33 O;  2VQF O;  2F4V O;  1I94 O;  1IBM O;  1IBL O;  4DR7 O;  4DV4 O;  1A32 A;  1XNQ O;  2UXC O;  1FYJ A;  1FJG O;  4JI1 O;  4LF4 O;  4KHP O;  3JAM N;  4NXN O;  1AB3 A;  4DV6 O;  3RT3 C;  4DV2 O;  2UU9 O;  1D2D A;  4LF9 O;  4YHH O;  4LFB O;  1XEQ A;  2ZM6 O;  4LF5 O;  2UXD O;  4NXM O;  5FLX N;  2UUC O;  1HR0 O;  5LMU O;  4JI3 O;  2JRI A;  4B3S O;  2N74 A;  1DK1 A;  2DJV A;  4B3M O;  4DV1 O;  4JI2 O;  4B3R O;  4DV7 O;  2E5L O;  2VQE O;  2UUA O;  5H5N A;  5BY1 A;  3OTO O;  4DV3 O;  4DR3 O;  3F5T A;  2Z0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...