4YY3O

30s ribosomal subunit- higb complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4yy3O00
3T1HO 1XNQO 4X64O 1IBLO 2N74A 5BY1A 1AB3A 4DR5O 4OPAA 2VQFO 4LF5O 1R1BA 1IBMO 2ZKOA 4DV0O 1I94O 2VQEO 2LW7A 4DV2O 4JI8O 1HNXO 4AQYO 5FLXN 3JAMN 2Z0AA 3R66A 4DUYO 5LMUO 4JI4O 4DR6O 3M8AA 4LF7O 5LMNO 4NXMO 4GKJO 5BR8O 5A2QN 3SDLA 3J80N 4DV5O 3F5TA 2DOSA 1FJGO 4K0KO 2DJVA 1N34O 4LF6O 1R6TA 1FYJA 1D2DA 1AILA 4DR3O 1G1XB 4JI2O 1XMOO 4DR2O 4KHPO 4YY3O 4JI5O 4JI0O 4X65O 5IWAO 3J81N 2F4VO 4OX9O 2HHHO 4DV4O 4DV3O 4JI1O 1A32A 1YZBA 4B3MO 2FKXA 5LL6Y 2UU9O 5IT9N 4DV6O 2UXCO 1N33O 3J7AU 5H5NA 4YHHO 4DV1O 4LF4O 4NXNO 1XEQA 5BXZA 1X59A 4JI3O 4LFBO 3OTOO 2UUAO 2UUBO 4B3RO 2E5LO 1N32O 4X62O 4OPHA 4A5UB 3T1YO 4JI6O 4LF8O 2ZM6O 4GKKO 2UXBO 1HR0O 4JI7O 4X66O 4DR7O 4DV7O 4LFAO 4DR4O 2UUCO 1IBKO 1HNWO 1KUQA 4B3TO 1XMQO 1NS1A 4JYAO 4DR1O 4JV5O 1N36O 1FKAO 1F7YA 4LFCO 1DK1A 3RT3C 4LF9O 4DUZO 2AGAA 4B3SO 2JRIA 1XNRO 3O65A 1HNZO 1J5EO 2UXDO
chains in the Genus database with same CATH superfamily
1VARA 3ETEA 1B3QA 1JA8A 1MOFA 4O4LB 3CD6V 2HP8A 4F6RA 3T4DA 3UM7A 2OCCB 2VQFO 5IYZA 1YCIA 4DV0O 2VQEO 1RM1B 2DWDC 3AG4C 4Q6GA 4X1KA 4JI4O 2QEXV 4LH7A 3SPGA 5GONA 1H2KA 4RUFA 2YICA 4PI2A 5FPOA 3OEHG 1KECA 4K0KO 4QPKA 1Q6UA 3L75H 2JEUA 1AJQA 2P4KA 2AHZA 4RUEA 5EIBD 2CK3G 4BW5A 5LMUB 2F4VO 2PUSA 3CP1A 4R6ZA 4OX9O 3EFFK 4GT1A 2JK5C 3RYCA 3F5WC 1OCCC 3K06A 3F7YC 4TSFG 1ZTEA 2P06A 3CC4V 5ITZA 4O4JA 1BHBA 4KHPB 4X65B 4JI0B 3JD2A 4F6RB 2P4VA 5IYZB 5KHIA 5H5NA 3BPZA 4LFBO 4DR6B 4UV9A 4X1KB 5BR8B 1BL8A 1SC5B 3STLC 2AXTZ 2QKSA 5IY5B 3NXSA 4A5UB 3T1YO 5GONB 4FM2A 2Q7GA 3U11A 3LNMB 4J7JA 2UXCB 4K8ZA 4G27B 1ZWIC 1IBKO 4YHHB 2MW2B 4DV1B 3W7SA 4ZIBA 1M90W 1G4YB 2F1MA 3AG2C 3T2MA 1DLBA 3RYCB 1N0NA 1Q5OA 2P90A 3MAQA 4QE7A 3ASNC 4ZOLA 2P7TC 1WNSA 3CXHF 4JV5B 4O4JB 4F6EA 4WCEV 1I94O 3A2FA 2GV9A 2BOCC 3ICXA 1W0JG 3CCSV 3HKCB 4LWSA 2QTOA 2IW5A 3VQVA 1WPXA 5J2UA 2F93B 2JVDA 3LNNA 1YF2A 3H1HH 1Q8IA 4LF5B 2IJJA 1F23A 1BZKA 1N34O 2EULA 3AG3B 4CBCA 5B5EZ 2ZD9A 4Q20A 1KU9A 1V54C 3K0GA 4FLUA 4B3SB 3E8HA 3RYFA 4CH5A 2PYLA 3D8CA 1SESA 1AJPA 1GH6A 4LCUC 2Y48A 4BIZA 1GTOA 5DEDA 4ZOLB 5KX5B 4CS4A 2WA3A 1BCCH 5KHGA 4GX2A 4K8XA 3B8MA 1S77D 1XHXA 1I5XA 1BGYH 4AILC 3P3NA 4LWSB 3ASOC 4LF8O 3K3WA 3KKYA 3ZHRA 2Q7HA 2WPDG 3AG7A 2UUCO 1QU7A 4XDJA 2PF4E 1V55C 3ABLC 4DR1O 3KCYA 4FFBA 3BEHA 3RT3C 4DYLA 3OW2U 4JI6B 3RYFB 4DR7B 2DWEC 1R73A 1FXKA 1EN4A 3QNEA 5DM6V 3UCSC 4MTFA 5JWPA 4FM1A 5B3SC 3FB8C 4UXNA 4K35A 2CTRA 2B1GA 2YEVA 1N8RW 2BSKA 3RYHA 1Q3EA 3CX5F 5LA6A 2Q6AA 4R50A 1THZA 5JH7A 1HP8A 3AK3A 2DYSC 2XAGA 2ZR2A 3QVNA 1D5NA 1K92A 3ZHTA 3EXAA 4DV2B 2QE7G 3RN4A 2XHBA 3L73H 2XASA 1TA8A 5L3EA 2CTWA 3IFXA 4UVCA 4FFBB 2XAHA 4Z1VA 4NXMB 1SKVA 4H13B 1E1RG 2F43G 1KP2A 5L3DA 2ZXWC 3LDEA 4WFGA 2RQ6A 5CA3A 3N27A 3TGUH 4MW3A 1VF7A 2GHYA 1FXKB 5C8YA 1MNGA 2WLIA 3ETDA 2DQ3A 4JGSA 3O9OA 4J10A 1M56B 2YEVB 3STZC 1BT8A 3RYHB 1VF5B 5LA6B 2KQXA 1NQTA 4B3MB 3K57A 1OZ0A 5JH7B 2W0FC 1WP7A 3I5DA 3JALA 2UXBO 2WLJA 2VRZA 4X66O 3G6EV 1PL0A 1ZLZA 3VBBA 4H37A 2FYUH 3CC2V 2X7RB 2CE4A 2V1DA 3HKEA 4B7EA 1GKFA 3ZRVA 2UUAB 1YJNV 1VP7A 1K34A 3O65A 5JJJB 1RFYA 3AK2A 1Y74B 1I08A 2Q0AA 3C90A 4B08A 4JI7B 1G6UA 2WLKA 4DV7B 2W6JG 1AB3A 4IHJB 2P22C 3CE2A 3HKDA 1V9PA 5C8YB 1NJIW 2WLIB 4LF9B 3ZS8C 3S3XA 1OCRC 2CUGA 2X6CA 3OTOB 1K73W 2Z0AA 4DUYO 2L35A 3ZBHA 4LBEC 5LBQA 2FB5A 2OYQA 3AK1A 2ZM6B 2LW1A 1FS0G 4GLXA 3ZN0A 4O2AA 3JALB 1N0JA 2QDOA 2PGGA 4D6TH 1P49A 1AILA 4TV9A 1G1XB 3KCXA 1W2BU 3VOUA 1NH2D 3H01A 3FD9A 2PI4A 3HKEB 4P30A 3GWKC 4RWUA 5DN6G 3K59A 4CS2A 1FJGB 3W7WA 4D7SA 5LGTA 3RYIA 5IJ0B 2F23A 2RMKB 4GUNA 3HKDB 1KC8W 3QF7A 2BOBC 5D5PA 2Y0PA 4FJCC 2HHHB 3CCUV 1X59A 4DV3B 1QLEC 4LF7B 3WG7C 3SPCA 4N23A 1NKDA 3LSSA 1ZAUA 2F66C 4X62O 1E79G 5IJ9A 2EZOA 2EZPA 2WA4A 4O2AB 4TV9B 1WAZA 4EEQA 1VQ9V 5IE9A 1P84F 3OGCC 4X64O 2L6LA 1PD3A 3RYIB 1XMQB 2LGQA 1L0LH 1N36B 3CRRA 3E2EA 1ROPA 4MTOA 2GTSA 2OWOA 1XI1A 1RPOA 5FLXN 5LOVA 2UXDB 3QO8A 4PDVA 4I55A 4FPPA 5A2QN 3SDLA 4ZBMA 5B1BB 3CCVV 2JGUA 1K33A 5IJ9B 2HR3A 2PYJA 1K4DC 4JAAA 4X20B 2HLDG 4NTXA 4EKWA 4JI5O 2HJFC 4AQYB 4FVMA 1QLNA 2AHYA 1MZFA 3CCRV 3BRCA 4JI1O 2JDIG 5LHGA 4BR6A 1YIJV 2HFEC 2Q7EA 3THOA 3TXSA 4DV6O 2QTSA 4NTWA 3ZHQA 1MA1A 2FMLA 1NBMG 3JSLA 3IGAC 4JAUA 3CCJV 2Q73A 5L3CA 3CYOA 5LOVB 1K3EA 1LUWA 2Q69A 4GX1A 4I55B 2R9IA 1D5AA 1HR0O 3L72H 1URFA 3G80A 2YI8A 4J42A 2ADQB 1FFXA 4J11A 1HNWO 3FB5C 3I56V 3B8NA 4CC6A 2N05A 4X8AA 4JYAO 1CP9A 3RWRD 1SS3A 1H8HG 4DO2A 2CTQA 1EM1A 2WSSG 4O4HA 4PHZA 3H9VA 4P9OA 2IH3C 1YJ9V 1T5EA 1SQXH 2ZE5A 1QBZA 2XUMA 4KUMA 2Z5UA 1S0VA 2RNBA 1GK9A 5LGUA 3D36C 2ZIOA 1R3KC 2IM9A 3K5OA 2KG7A 2M6YA 4X1IB 4FZ0A 1M57C 3BVOA 1M93A 3G71V 3CHXA 1XNRB 3FFQA 3CJHA 3A0RA 2LJ2A 4GX0A 2EJRA 4I4TA 5L3BA 5LHHA 3L9DA 4YJ2A 2EINC 1IZ3A 3RVZA 2VQFB 1R3LC 4EB6A 2QA4V 2EBOA 4ZHQA 4DV0B 2VQEB 4J9YB 1QVGU 1FFXB 2YIAA 3HPLC 4UB6Z 3UKMA 4JI4B 4CH3A 2Y4TA 1WP8A 5IDJA 5EBLC 3DC6A 1EN5A 1XUQA 1XHZA 4GYCB 5KHKA 1ZL8A 1Y6XA 3SYCA 4L87A 3ZRXA 2HVJC 1IBLB 4K0KB 4FLXA 3E22A 3R65A 3ABKC 4TT3G 3P30A 4HAMA 4MTXA 2EIMB 4O4IB 4XBFA 2EIKB 1Z5WA 3TJTA 2F4VB 1HNXB 4FLYA 1ZX3A 3U0ZA 1FPOA 1JPXA 3B77A 3CJHB 5JJEB 1H2MA 2Y0IA 5LYJA 4I4TB 4YJ2B 3TETA 3ZMVA 1COWG 4JPRA 4EB6B 1UPGA 1NVPD 4B3TO 3GWOA 3C3SA 2FTKA 4R7CA 1RP3B 4GCZA 4OXSA 3SYAA 1SQVH 3X2QC 2QR4A 1TVKA 1ZL8B 3CMAV 4FLWA 2IJHA 2JIZG 1PP9H 4YXWG 2DMXA 1VQPV 1YHQV 3T1CA 3ZRSA 3RFRA 2H3OA 4FFKA 1VIBA 3TXQA 2ADPA 1NU1H 3JASA 1P4RA 1S3JA 2ZKOA 4X1YA 5JQGA 4HBNA 4JZ2A 5EBWC 2X0LA 5CBHA 4ZI7A 1M5IA 3ZHVA 4DR6O 1AI4A 4MT8A 4P9PA 5BR8O 4TUYA 2QM4A 2G38A 1O9HA 1VQ5V 3BY6A 3BA9A 4LNUA 5FNVA 2WAMA 3ZRWA 1I94B 5ITZB 1EN6A 1FYJA 3H1IH 3K03A 3ZX6A 4UVBA 2YUAA 1XMOO 4AI8A 3E89A 1CEZA 3CMEV 5B1AB 1LUVA 4KFMA 3IC7A 3DSQA 4YIOA 2Y69C 3WFVA 1TVKB 4RAIA 1KYOF 2QWRB 4N21A 1N34B 5LL6Y 3G4SV 5IT9N 2ITDC 1RPRA 1IBMB 3T4ZA 1SRYA 1JFFA 4BIUA 3G67A 1GO3F 4UCVA 2QJ1A 4NB5A 5JQGB 4ZI7B 4GKJB 1B6QA 1GN3A 1VQKV 1DF4A 4MTGA 1EZJA 3QG5A 1N32O 4TUYB 1NI8A 1S76D 3LUTB 4QJFB 1NTMH 3APQA 2P6JA 2D3OW 4FZ1A 3ABUA 1FKAO 4LFCO 1Y76A 1BQ0A 1OCOC 4B3SO 4H33A 4LC1A 1H8EG 1N4CA 4DK0A 4LF8B 1QR9A 1BQZA 1U97A 5J2UB 1Q90D 1OHHG 2UUCB 2Q8VA 1H2GA 1AI5A 2R9RB 4FIPC 5K1XA 4DR1B 4KL1A 2B5UA 4GX5A 4KXRA 1Z5VA 1JFFB 3CEIA 3OD4A 3AG4B 3E8BA 2R9AA 1UFIA 3M99B 2HVKC 1BS3A 2CDYA 2DOSA 2X6AA 5IYDO 1OV9A 2NLJC 4J9ZB 4WFEA 1AR1B 3AG1C 4LF6O 4CZZA 1AVMA 4DR3O 4WFBV 4JI2O 4WBNA 3MHHC 4IYIA 4YY3O 4DR2O 3WB0A 2WWWA 3BFRA 2DW4A 3KG2A 2ZCEA 1Y76B 2A7WA 4DV4O 3K08A 3CB2A 3VQXA 4UCSA 2ITCC 2YXYA 1OCCB 1F4MA 1KP3A 1HWYA 1JVMA 1BMFG 3BHPA 1IDSA 2ARHA 3LSUA 2ZE6A 3CCEV 3CPWU 2EILC 1TUBA 4PA6A 1JR9A 4IGGA 3J7AU 5B66Z 1K5QA 3FB7C 4LF4O 3FYIB 3UT5A 4MVZA 2ZINA 3ZMZA 5KAIZ 1M4UA 1YSCA 3L71H 5KHHA 1MMMA 1PKXA 3IC9A 2V7QG 4YJ3A 1S5HC 1IX9A 4WBNB 3K9AA 4BAYA 1H2NA 2BSKB 4I0XA 3JAWA 3I55V 1GM8A 1XL6A 1J5EO 3AG2B 4PI0A 5H6RA 2UXBB 2P5OA 2EIJC 5C93A 1MG1A 4X66B 1SA0A 3CWBH 3CRAA 5BY1A 3OUSA 3ASNB 3W7UA 1I0HA 5EK0A 4OPAA 3JCZA 2YS8A 4U3FH 4J7ZA 2ILMA 4NYKA 2QKAA 4DRXA 2ZIMA 3UO3A 1EBOA 1SQGA 4UCTA 3JD4A 3PJSK 5A9GA 5B1OA 3JAMN 5CA0A 4MVMA 2JJ1G 1YTFD 5LMNO 4GZRB 5E1AC 4MS2A 3UT5B 1SQPH 2Y69B 3OMAB 4DW1A 4LFAB 4DR4B 2O57A 1BHAA 1WB7A 3OFNG 3BA8A 4YJ3B 4JYBA 3QTCA 1Y4MA 3B09A 3JATA 3J81N 4AHCA 1V54B 3OR7C 1B04A 1R3IC 2BCCH 2PY5A 1CXZB 1R6KA 1WLEA 1A32A 5GTIZ 5CA1A 1MSWD 3IJ4A 5JVDA 2GBOA 2YIDA 1SA0B 2KSDA 4X89A 2DN9A 5IYBO 1N33O 2N04A 1NT2B 4JI8B 2QM7A 3DXRA 1XEQA 4DRXB 2PI5A 1OCOB 3OTOO 4MVSA 3E83A 5CA0B 3ML0A 1K5SA 4XDLA 3OT7A 1XBLA 2ZE8A 2Q67A 1AI7A 5AG2A 1AR5A 4IT5A 2ZM6O 4R8CA 3ASOB 2BE3A 2GTAA 1VQ6V 3H1JH 1MZEA 5EC1C 5LP6C 4WFFA 3K5LA 4WF9V 4DXWA 4JYCA 1V55B 2LFSA 1DF5A 3ABLB 4DUZO 1XDCA 3SYPA 3JATB 4CS3A 2ZNJA 3MDSA 4X62B 1XNQO 4I9WA 4PJ0Z 5CA1B 1PNMA 1QCEA 2OCCC 5JVDB 4DR5O 2XNDG 4H44B 4I9QA 1ORQC 1L8DA 3DC5A 1RM1C 1VMGA 1W0KG 4RQEA 5B3SB 2YIBD 2QWNB 3ETQA 2NR5A 3A0HZ 2ETNA 4PELA 1Q81W 4LF7O 1H2LA 2UUBB 2LFRA 3FX7A 4DV5O 2WLLA 1WN7A 1ZSPA 2GUZA 2DYSB 2ATKC 1AJNA 2AZ2A 1D2DA 4NTYA 4X88A 1JJ2U 4I7ZB 3JAKA 2DYRC 3SPJA 1P7GA 2WLHA 3T1HB 1G8MA 5KMGA 5L3FA 1GN4A 1PM9A 2NN4A 3WB1A 2HKOA 2ZXWB 1Y67A 2CH7A 3CXCU 2UU9O 5KAFZ 4JI5B 4JTAB 2Q9LA 4JF3A 4TV8A 2OTLV 3HKBA 1IURA 1WPBA 1AP5A 4NXNO 4JI3O 4JI1B 5IY5C 1H2SB 2A9HA 4MSWC 4PA9A 1JJOA 2LGWA 4B3RO 2YIBA 2Z3YA 1YEWA 2E3CA 2WLLB 4K3AA 1NTZH 4GKKO 1NH2B 1VQLV 4DV6B 3RW0A 2GUZB 4YIPA 1VQNV 4Z1MG 2RJZA 3GB7C 2QGNA 5H9CA 1VQ8V 3JARA 3JAKB 2HEPA 1HNZO 4I5SA 1HR0B 2CAZC 1J95A 3H1LH 3MHSC 3ABMC 1HNWB 2CH7B 4RQFA 5LP6A 2RCVA 2A3QA 2KKWA 2A0LA 3HKBB 2RDCA 3M7MX 5JCOC 4HZ3A 2ZDIC 1OCRB 4PA3A 3B4SA 3M8AA 3B2EE 5H2FZ 3F5TA 5FPRA 3CC7V 4O4LA 1NR7A 2QSAA 3AG3C 4JYYA 1I5YA 2B1IA 4H0LB 5IWAO 5CBFA 2EX3A 4UCRA 1U96A 3SPIA 3JARB 1WA8A 1UJWB 1QHTA 4ZKIA 2OIGA 1E1QG 3OUFA 4MW8A 1JQ0A 3CSXA 3MD0A 2ZT9B 4JAVA 3OMNB 4OGQB 1S5JA 5FL7G 5LP6B 1JX9A 1KKCA 5L3GA 1GAXA 1BE3H 2W0XA 2IU3A 3SJAC 4ABMA 1QLEB 4QGPA 4O4HB 1FXHA 3OGIB 3WG7B 2AW9A 2E5LO 1SZXA 1KBHA 1NZ6A 1JMKC 2OIEA 2A79B 1KUQA 2R70A 4MVOA 1EZVH 1LNQA 1GMGA 5HFLA 4OX9B 1HDJA 2KG7B 2JRIA 2ZE7A 1WA8B 4TWKA 4FLZA 3WU2Z 1IBLO 1AR4A 3W7XA 4HNAA 3E8GA 4B3TB 1KQSU 3CCQV 2LW7A 4ZHQB 4LFBB 3TK1A 2JS5A 1HNXO 2YXLA 4PDRA 5K1PA 4EFBA 2UXXA 5CB4A 5LMUO 2DYRB 3CRQA 4PD4F 4MVUA 1R3JC 3T1YB 1XREA 3ZHUA 1US6A 1MSDA 4J7KA 1B06A 1IBKB 1QR8A 2DJVA 1ZUQA 3E22B 4IIJA 1R6TA 5JJNB 2LO1A 4KHPO 4JI0O 4X65O 3BABA 3HKCA 3CRMA 5JCOA 2ZDIA 1X4TA 2A06H 1GN2A 2V4DA 3JYCA 1FXKC 3RBZA 1K97A 2D2CB 4P2ZA 5LYJB 3D36A 1XMOB 1RSOA 4HNAB 3RVYA 3ABTA 2UXCO 1XILA 3ZIAG 1M56C 4YHHO 4DV1O 1GM7A 2XAFA 2DQ0A 5BXZA 1M9NA 4QIWF 2QKCA 1IXMA 1CPYA 3ETGA 5CB4B 2Q4PA 1IXBA 5KX5A 3P32A 3JSNA 2ODMA 1VQOV 5LHIA 5J2TA 4UUJC 3B40A 3ABMB 2DE0X 4L8JA 1R6NA 4IIJB 4JV5O 4JZGA 4BW9A 3JASB 3FKSG 1F7YA 2XOKG 4JASA 4X1YB 2AGAA 4TQFA 3K79A 2JEXA 1N32B 3N2KA 4NKGB 3OTFA 3PN1A 2B9ZA 1K8AW 2Q5ZA 4LF5O 1R1BA 4LNUB 1Y66A 4I50A 5FNVB 1RSOB 4LFCB 1IBMO 3ZRWB 3K5NA 5EC2C 1S72V 1Q6HA 2Q0OC 2R72A 5LGNA 1M57B 5BZBA 4UCUA 1NVPB 4GKJO 5GW7A 1JOYA 3JCUZ 1PNKA 1M1KW 2QWQB 2EINB 5J2TB 3HR0A 2YDEA 4CH4A 1PPJH 3K04A 1F4NA 3GVMA 3K5MA 3SJQC 1KB9F 4QPJA 3EHBB 3N2KB 1NR1A 4JTDB 1TGOA 2FKXA 1FD9A 1K4CC 4LF6B 4PV1B 4DR3B 4JI2B 3DGEA 4FMTA 4DR2B 3ABKB 1FXVA 4YY3B 4BIOA 1K9MW 2E75B 2JS3A 3AEIA 4I50B 3WB2A 4DV4B 3E35A 2QWPB 2H94A 1ENVA 2IJKA 3FYEB 4EFEA 2WLNA 2CTPA 1XL4A 2BTOA 5GTHZ 1WJZA 4E4EA 4JI6O 1GN6A 1Q7YW 3SYQA 4B7KA 3FAVA 4DR7O 3G6BA 3ZN1A 2OCHA 4LF4B 4J80A 5H6QA 2IU0A 2VS0A 2H8PC 2Y4UA 3Q4HA 4WFAV 3L74H 2QM8A 2CGOA 4PDLA 3ZMUA 3X2QB 1WB8A 1YI2V 3P3PA 4ICGA 4CH6A 4PDMA 3H1KH 4QE9A 1GRJA 1TAEA 2HJDA 2IBZH 2FL4A 2VWKA 4DV2O 2OTJV 1J5EB 3F7VC 3R66A 1SF9A 1Q82W 1KD1W 3ZMTA 4NXMO 1Y74A 5B1BC 3W7TA 2OT5A 1AI6A 4IHJA 3LDDA 4D7TA 3OE7G 3FAVB 4X9QA 5KA6A 5CN0A 1Z2GA 3E86A 1YXBA 1TUBB 2NNUA 3VQWA 2IH1C 2YC0A 5LMNB 4TOIA 2CGNA 3Q4HB 5EYPA 3KZIZ 1YZBA 5KHJA 4B3MO 5KA5A 1SQQH 1VQMV 4MVQA 3VQYA 3SJCC 1PV0A 4UVAA 3RGBA 3TCUA 4NR1A 4G2KA 1VF6C 5E79Z 4DUYB 3L70H 2E74B 3ZCCA 4I0XB 2UUAO 2EJ7A 3JAWB 5IJ0A 4OPHA 1K7DA 5D5QA 5KUMA 1Q6IA 2Q68A 3QO7A 3BAAA 3LSQA 4JI7O 2GDSA 4DV7O 4LFAO 2ZNIA 4DR4O 1N33B 1FFTB 2YI9A 2LQTA 1NS1A 3IAYA 1OCZC 5CMUA 2GSMB 1JCHA 1DK1A 4LF9O 4HYOA 1SQFA 4W4LA 4IYHA 1SZTA 1XQ8A 3D3QA 5EYPB 3SYOA 1SETA 1I7FA 4O2BA 4ASUG 3A8TA 1O9GA 5J9PC 4DUZB 1SQBH 2PZSA 4JI8O 1PNLA 1MABG 1XNQB 3A0BZ 3E8FA 2E76B 4U3JA 3U10A 1VEWA 3JD1A 4JTCB 4DR5B 5IYCO 1YVWA 1FJGO 3OMIB 3ZJZA 5BMVA 3UQ8A 5KLVH 2JJ2G 2BTQA 4NVPA 3OEEG 1Q86W 4UV8A 3AG1B 3NR7A 3N2GA 4WFHA 1XOUA 5B1NA 1VQ7V 2QWOB 4W4KA 4FLTA 2HHHO 4DV5B 3DXRB 4DV3O 3SGIA 4X64B 1HW7A 3D3IA 4FK5C 3QO5A 1VQ4V 5LXTA 5HFMA 2EIMC 1QVFU 4X20A 2EIKC 1YTFB 3FB6C 4O2BB 2ZR3A 2F95B 4MVRA 4LR3A 3SJBC 2X6BA 2EILB 3LDCA 4G28B 1YITV 5CBGA 2HG5C 3CRCA 2UUBO 1Q43A 4FLVA 4U3JB 4BWAA 2XAQA 3SPHA 4DK1A 2UU9B 1YJWV 1GM9A 5BMVB 4FM0A 1XMQO 2BTQB 4NXNB 4JI3B 1N36O 1VF6A 3UO2A 2WLMA 4E2LA 2W6IG 3N2GB 3OAAG 1FAFA 4B3RB 4U7OA 2UXDO 3S3WA 3T1HO 4GKKB 3OM3B 2N74A 1KMIZ 4LP8A 1EFRG 1S5LZ 2MK3A 5DECA 1DTOA 2EIJB 4XDKA 5LXTB 1IVSA 1H38A 1KKDA 1LR1A 2UXNA 1OJHA 4J41A 2C2AA 5EZYA 2YXHA 3DTUB 4AQYO 1HNZB 3ZEDA 4C7UA 1P7BA 3J80N 1QNMA 5F2VO 3CCLV 1L1FA 2VWJA 5KMGB 3K0DA 1DGSA 4X1IA 4RO2A 3SR2C 4JYAB 5B1AC 2JGDA 3CS5A 4CC5A 2ZQMA 4TV8B 2YSUB 1AROP 3ZHSA 5TISZ 4PA4A 2AZ0A 1TUEB 4UB8Z 2LP7A 4UCOA 4QNHB 2XT9A 3HB3B 3K9SA 2XAJA 2RN9A 1W59A 5EBMC 4DW0A 3CCMV 4Z2WA 5IWAB 3EVKA 4U7NA 2KB1A 2XTAA 1OCZB 3K58A 1AP6A 5EIBC 5EZYB 5KUKA 2K9PA 4PA7A 1PL4A 1YDXA 2P67A 2PTMA 1F51A 3ZMSA 4O4IA 1QQCA 3OR6C 4KP4A 4LH6A 3APOA 2M7WA 3JD0A 1NTKH 3JD3A 1L0NH 1BSMA 2JGDB 1SERA 4UFZA 3BCCH 3C3TA 2IJIA 4TQDA 4IL6Z 4F4LA 2E5LB 1XNRO 2K1EA
chains in the Genus database with same CATH topology
3T1HO 1XNQO 4X64O 1IBLO 2N74A 5BY1A 1AB3A 4DR5O 4OPAA 2VQFO 4LF5O 1R1BA 1IBMO 2ZKOA 4DV0O 1I94O 2VQEO 2LW7A 4DV2O 4JI8O 1HNXO 4AQYO 5FLXN 3JAMN 2Z0AA 3R66A 4DUYO 5LMUO 4JI4O 4DR6O 3M8AA 4LF7O 5LMNO 4NXMO 4GKJO 5BR8O 5A2QN 3SDLA 3J80N 4DV5O 3F5TA 2DOSA 1FJGO 4K0KO 2DJVA 1N34O 4LF6O 1R6TA 1FYJA 1D2DA 1AILA 4DR3O 1G1XB 4JI2O 1XMOO 4DR2O 4KHPO 4YY3O 4JI5O 4JI0O 4X65O 5IWAO 3J81N 2F4VO 4OX9O 2HHHO 4DV4O 4DV3O 4JI1O 1A32A 1YZBA 4B3MO 2FKXA 5LL6Y 2UU9O 5IT9N 4DV6O 2UXCO 1N33O 3J7AU 5H5NA 4YHHO 4DV1O 4LF4O 4NXNO 1XEQA 5BXZA 1X59A 4JI3O 4LFBO 3OTOO 2UUAO 2UUBO 4B3RO 2E5LO 1N32O 4X62O 4OPHA 4A5UB 3T1YO 4JI6O 4LF8O 2ZM6O 4GKKO 2UXBO 1HR0O 4JI7O 4X66O 4DR7O 4DV7O 4LFAO 4DR4O 2UUCO 1IBKO 1HNWO 1KUQA 4B3TO 1XMQO 1NS1A 4JYAO 4DR1O 4JV5O 1N36O 1FKAO 1F7YA 4LFCO 1DK1A 3RT3C 4LF9O 4DUZO 2AGAA 4B3SO 2JRIA 1XNRO 3O65A 1HNZO 1J5EO 2UXDO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H O;  1XNQ O;  4X64 O;  1IBL O;  2N74 A;  5BY1 A;  1AB3 A;  4DR5 O;  4OPA A;  2VQF O;  4LF5 O;  1R1B A;  1IBM O;  2ZKO A;  4DV0 O;  1I94 O;  2VQE O;  2LW7 A;  4DV2 O;  4JI8 O;  1HNX O;  4AQY O;  5FLX N;  3JAM N;  2Z0A A;  3R66 A;  4DUY O;  5LMU O;  4JI4 O;  4DR6 O;  3M8A A;  4LF7 O;  5LMN O;  4NXM O;  4GKJ O;  5BR8 O;  5A2Q N;  3SDL A;  3J80 N;  4DV5 O;  3F5T A;  2DOS A;  1FJG O;  4K0K O;  2DJV A;  1N34 O;  4LF6 O;  1R6T A;  1FYJ A;  1D2D A;  1AIL A;  4DR3 O;  1G1X B;  4JI2 O;  1XMO O;  4DR2 O;  4KHP O;  4YY3 O;  4JI5 O;  4JI0 O;  4X65 O;  5IWA O;  3J81 N;  2F4V O;  4OX9 O;  2HHH O;  4DV4 O;  4DV3 O;  4JI1 O;  1A32 A;  1YZB A;  4B3M O;  2FKX A;  5LL6 Y;  2UU9 O;  5IT9 N;  4DV6 O;  2UXC O;  1N33 O;  3J7A U;  5H5N A;  4YHH O;  4DV1 O;  4LF4 O;  4NXN O;  1XEQ A;  5BXZ A;  1X59 A;  4JI3 O;  4LFB O;  3OTO O;  2UUA O;  2UUB O;  4B3R O;  2E5L O;  1N32 O;  4X62 O;  4OPH A;  4A5U B;  3T1Y O;  4JI6 O;  4LF8 O;  2ZM6 O;  4GKK O;  2UXB O;  1HR0 O;  4JI7 O;  4X66 O;  4DR7 O;  4DV7 O;  4LFA O;  4DR4 O;  2UUC O;  1IBK O;  1HNW O;  1KUQ A;  4B3T O;  1XMQ O;  1NS1 A;  4JYA O;  4DR1 O;  4JV5 O;  1N36 O;  1FKA O;  1F7Y A;  4LFC O;  1DK1 A;  3RT3 C;  4LF9 O;  4DUZ O;  2AGA A;  4B3S O;  2JRI A;  1XNR O;  3O65 A;  1HNZ O;  1J5E O;  2UXD O; 
#chains in the Genus database with same CATH topology
 1VAR A;  3ETE A;  1B3Q A;  1JA8 A;  1MOF A;  4O4L B;  3CD6 V;  2HP8 A;  4F6R A;  3T4D A;  3UM7 A;  2OCC B;  2VQF O;  5IYZ A;  1YCI A;  4DV0 O;  2VQE O;  1RM1 B;  2DWD C;  3AG4 C;  4Q6G A;  4X1K A;  4JI4 O;  2QEX V;  4LH7 A;  3SPG A;  5GON A;  1H2K A;  4RUF A;  2YIC A;  4PI2 A;  5FPO A;  3OEH G;  1KEC A;  4K0K O;  4QPK A;  1Q6U A;  3L75 H;  2JEU A;  1AJQ A;  2P4K A;  2AHZ A;  4RUE A;  5EIB D;  2CK3 G;  4BW5 A;  5LMU B;  2F4V O;  2PUS A;  3CP1 A;  4R6Z A;  4OX9 O;  3EFF K;  4GT1 A;  2JK5 C;  3RYC A;  3F5W C;  1OCC C;  3K06 A;  3F7Y C;  4TSF G;  1ZTE A;  2P06 A;  3CC4 V;  5ITZ A;  4O4J A;  1BHB A;  4KHP B;  4X65 B;  4JI0 B;  3JD2 A;  4F6R B;  2P4V A;  5IYZ B;  5KHI A;  5H5N A;  3BPZ A;  4LFB O;  4DR6 B;  4UV9 A;  4X1K B;  5BR8 B;  1BL8 A;  1SC5 B;  3STL C;  2AXT Z;  2QKS A;  5IY5 B;  3NXS A;  4A5U B;  3T1Y O;  5GON B;  4FM2 A;  2Q7G A;  3U11 A;  3LNM B;  4J7J A;  2UXC B;  4K8Z A;  4G27 B;  1ZWI C;  1IBK O;  4YHH B;  2MW2 B;  4DV1 B;  3W7S A;  4ZIB A;  1M90 W;  1G4Y B;  2F1M A;  3AG2 C;  3T2M A;  1DLB A;  3RYC B;  1N0N A;  1Q5O A;  2P90 A;  3MAQ A;  4QE7 A;  3ASN C;  4ZOL A;  2P7T C;  1WNS A;  3CXH F;  4JV5 B;  4O4J B;  4F6E A;  4WCE V;  1I94 O;  3A2F A;  2GV9 A;  2BOC C;  3ICX A;  1W0J G;  3CCS V;  3HKC B;  4LWS A;  2QTO A;  2IW5 A;  3VQV A;  1WPX A;  5J2U A;  2F93 B;  2JVD A;  3LNN A;  1YF2 A;  3H1H H;  1Q8I A;  4LF5 B;  2IJJ A;  1F23 A;  1BZK A;  1N34 O;  2EUL A;  3AG3 B;  4CBC A;  5B5E Z;  2ZD9 A;  4Q20 A;  1KU9 A;  1V54 C;  3K0G A;  4FLU A;  4B3S B;  3E8H A;  3RYF A;  4CH5 A;  2PYL A;  3D8C A;  1SES A;  1AJP A;  1GH6 A;  4LCU C;  2Y48 A;  4BIZ A;  1GTO A;  5DED A;  4ZOL B;  5KX5 B;  4CS4 A;  2WA3 A;  1BCC H;  5KHG A;  4GX2 A;  4K8X A;  3B8M A;  1S77 D;  1XHX A;  1I5X A;  1BGY H;  4AIL C;  3P3N A;  4LWS B;  3ASO C;  4LF8 O;  3K3W A;  3KKY A;  3ZHR A;  2Q7H A;  2WPD G;  3AG7 A;  2UUC O;  1QU7 A;  4XDJ A;  2PF4 E;  1V55 C;  3ABL C;  4DR1 O;  3KCY A;  4FFB A;  3BEH A;  3RT3 C;  4DYL A;  3OW2 U;  4JI6 B;  3RYF B;  4DR7 B;  2DWE C;  1R73 A;  1FXK A;  1EN4 A;  3QNE A;  5DM6 V;  3UCS C;  4MTF A;  5JWP A;  4FM1 A;  5B3S C;  3FB8 C;  4UXN A;  4K35 A;  2CTR A;  2B1G A;  2YEV A;  1N8R W;  2BSK A;  3RYH A;  1Q3E A;  3CX5 F;  5LA6 A;  2Q6A A;  4R50 A;  1THZ A;  5JH7 A;  1HP8 A;  3AK3 A;  2DYS C;  2XAG A;  2ZR2 A;  3QVN A;  1D5N A;  1K92 A;  3ZHT A;  3EXA A;  4DV2 B;  2QE7 G;  3RN4 A;  2XHB A;  3L73 H;  2XAS A;  1TA8 A;  5L3E A;  2CTW A;  3IFX A;  4UVC A;  4FFB B;  2XAH A;  4Z1V A;  4NXM B;  1SKV A;  4H13 B;  1E1R G;  2F43 G;  1KP2 A;  5L3D A;  2ZXW C;  3LDE A;  4WFG A;  2RQ6 A;  5CA3 A;  3N27 A;  3TGU H;  4MW3 A;  1VF7 A;  2GHY A;  1FXK B;  5C8Y A;  1MNG A;  2WLI A;  3ETD A;  2DQ3 A;  4JGS A;  3O9O A;  4J10 A;  1M56 B;  2YEV B;  3STZ C;  1BT8 A;  3RYH B;  1VF5 B;  5LA6 B;  2KQX A;  1NQT A;  4B3M B;  3K57 A;  1OZ0 A;  5JH7 B;  2W0F C;  1WP7 A;  3I5D A;  3JAL A;  2UXB O;  2WLJ A;  2VRZ A;  4X66 O;  3G6E V;  1PL0 A;  1ZLZ A;  3VBB A;  4H37 A;  2FYU H;  3CC2 V;  2X7R B;  2CE4 A;  2V1D A;  3HKE A;  4B7E A;  1GKF A;  3ZRV A;  2UUA B;  1YJN V;  1VP7 A;  1K34 A;  3O65 A;  5JJJ B;  1RFY A;  3AK2 A;  1Y74 B;  1I08 A;  2Q0A A;  3C90 A;  4B08 A;  4JI7 B;  1G6U A;  2WLK A;  4DV7 B;  2W6J G;  1AB3 A;  4IHJ B;  2P22 C;  3CE2 A;  3HKD A;  1V9P A;  5C8Y B;  1NJI W;  2WLI B;  4LF9 B;  3ZS8 C;  3S3X A;  1OCR C;  2CUG A;  2X6C A;  3OTO B;  1K73 W;  2Z0A A;  4DUY O;  2L35 A;  3ZBH A;  4LBE C;  5LBQ A;  2FB5 A;  2OYQ A;  3AK1 A;  2ZM6 B;  2LW1 A;  1FS0 G;  4GLX A;  3ZN0 A;  4O2A A;  3JAL B;  1N0J A;  2QDO A;  2PGG A;  4D6T H;  1P49 A;  1AIL A;  4TV9 A;  1G1X B;  3KCX A;  1W2B U;  3VOU A;  1NH2 D;  3H01 A;  3FD9 A;  2PI4 A;  3HKE B;  4P30 A;  3GWK C;  4RWU A;  5DN6 G;  3K59 A;  4CS2 A;  1FJG B;  3W7W A;  4D7S A;  5LGT A;  3RYI A;  5IJ0 B;  2F23 A;  2RMK B;  4GUN A;  3HKD B;  1KC8 W;  3QF7 A;  2BOB C;  5D5P A;  2Y0P A;  4FJC C;  2HHH B;  3CCU V;  1X59 A;  4DV3 B;  1QLE C;  4LF7 B;  3WG7 C;  3SPC A;  4N23 A;  1NKD A;  3LSS A;  1ZAU A;  2F66 C;  4X62 O;  1E79 G;  5IJ9 A;  2EZO A;  2EZP A;  2WA4 A;  4O2A B;  4TV9 B;  1WAZ A;  4EEQ A;  1VQ9 V;  5IE9 A;  1P84 F;  3OGC C;  4X64 O;  2L6L A;  1PD3 A;  3RYI B;  1XMQ B;  2LGQ A;  1L0L H;  1N36 B;  3CRR A;  3E2E A;  1ROP A;  4MTO A;  2GTS A;  2OWO A;  1XI1 A;  1RPO A;  5FLX N;  5LOV A;  2UXD B;  3QO8 A;  4PDV A;  4I55 A;  4FPP A;  5A2Q N;  3SDL A;  4ZBM A;  5B1B B;  3CCV V;  2JGU A;  1K33 A;  5IJ9 B;  2HR3 A;  2PYJ A;  1K4D C;  4JAA A;  4X20 B;  2HLD G;  4NTX A;  4EKW A;  4JI5 O;  2HJF C;  4AQY B;  4FVM A;  1QLN A;  2AHY A;  1MZF A;  3CCR V;  3BRC A;  4JI1 O;  2JDI G;  5LHG A;  4BR6 A;  1YIJ V;  2HFE C;  2Q7E A;  3THO A;  3TXS A;  4DV6 O;  2QTS A;  4NTW A;  3ZHQ A;  1MA1 A;  2FML A;  1NBM G;  3JSL A;  3IGA C;  4JAU A;  3CCJ V;  2Q73 A;  5L3C A;  3CYO A;  5LOV B;  1K3E A;  1LUW A;  2Q69 A;  4GX1 A;  4I55 B;  2R9I A;  1D5A A;  1HR0 O;  3L72 H;  1URF A;  3G80 A;  2YI8 A;  4J42 A;  2ADQ B;  1FFX A;  4J11 A;  1HNW O;  3FB5 C;  3I56 V;  3B8N A;  4CC6 A;  2N05 A;  4X8A A;  4JYA O;  1CP9 A;  3RWR D;  1SS3 A;  1H8H G;  4DO2 A;  2CTQ A;  1EM1 A;  2WSS G;  4O4H A;  4PHZ A;  3H9V A;  4P9O A;  2IH3 C;  1YJ9 V;  1T5E A;  1SQX H;  2ZE5 A;  1QBZ A;  2XUM A;  4KUM A;  2Z5U A;  1S0V A;  2RNB A;  1GK9 A;  5LGU A;  3D36 C;  2ZIO A;  1R3K C;  2IM9 A;  3K5O A;  2KG7 A;  2M6Y A;  4X1I B;  4FZ0 A;  1M57 C;  3BVO A;  1M93 A;  3G71 V;  3CHX A;  1XNR B;  3FFQ A;  3CJH A;  3A0R A;  2LJ2 A;  4GX0 A;  2EJR A;  4I4T A;  5L3B A;  5LHH A;  3L9D A;  4YJ2 A;  2EIN C;  1IZ3 A;  3RVZ A;  2VQF B;  1R3L C;  4EB6 A;  2QA4 V;  2EBO A;  4ZHQ A;  4DV0 B;  2VQE B;  4J9Y B;  1QVG U;  1FFX B;  2YIA A;  3HPL C;  4UB6 Z;  3UKM A;  4JI4 B;  4CH3 A;  2Y4T A;  1WP8 A;  5IDJ A;  5EBL C;  3DC6 A;  1EN5 A;  1XUQ A;  1XHZ A;  4GYC B;  5KHK A;  1ZL8 A;  1Y6X A;  3SYC A;  4L87 A;  3ZRX A;  2HVJ C;  1IBL B;  4K0K B;  4FLX A;  3E22 A;  3R65 A;  3ABK C;  4TT3 G;  3P30 A;  4HAM A;  4MTX A;  2EIM B;  4O4I B;  4XBF A;  2EIK B;  1Z5W A;  3TJT A;  2F4V B;  1HNX B;  4FLY A;  1ZX3 A;  3U0Z A;  1FPO A;  1JPX A;  3B77 A;  3CJH B;  5JJE B;  1H2M A;  2Y0I A;  5LYJ A;  4I4T B;  4YJ2 B;  3TET A;  3ZMV A;  1COW G;  4JPR A;  4EB6 B;  1UPG A;  1NVP D;  4B3T O;  3GWO A;  3C3S A;  2FTK A;  4R7C A;  1RP3 B;  4GCZ A;  4OXS A;  3SYA A;  1SQV H;  3X2Q C;  2QR4 A;  1TVK A;  1ZL8 B;  3CMA V;  4FLW A;  2IJH A;  2JIZ G;  1PP9 H;  4YXW G;  2DMX A;  1VQP V;  1YHQ V;  3T1C A;  3ZRS A;  3RFR A;  2H3O A;  4FFK A;  1VIB A;  3TXQ A;  2ADP A;  1NU1 H;  3JAS A;  1P4R A;  1S3J A;  2ZKO A;  4X1Y A;  5JQG A;  4HBN A;  4JZ2 A;  5EBW C;  2X0L A;  5CBH A;  4ZI7 A;  1M5I A;  3ZHV A;  4DR6 O;  1AI4 A;  4MT8 A;  4P9P A;  5BR8 O;  4TUY A;  2QM4 A;  2G38 A;  1O9H A;  1VQ5 V;  3BY6 A;  3BA9 A;  4LNU A;  5FNV A;  2WAM A;  3ZRW A;  1I94 B;  5ITZ B;  1EN6 A;  1FYJ A;  3H1I H;  3K03 A;  3ZX6 A;  4UVB A;  2YUA A;  1XMO O;  4AI8 A;  3E89 A;  1CEZ A;  3CME V;  5B1A B;  1LUV A;  4KFM A;  3IC7 A;  3DSQ A;  4YIO A;  2Y69 C;  3WFV A;  1TVK B;  4RAI A;  1KYO F;  2QWR B;  4N21 A;  1N34 B;  5LL6 Y;  3G4S V;  5IT9 N;  2ITD C;  1RPR A;  1IBM B;  3T4Z A;  1SRY A;  1JFF A;  4BIU A;  3G67 A;  1GO3 F;  4UCV A;  2QJ1 A;  4NB5 A;  5JQG B;  4ZI7 B;  4GKJ B;  1B6Q A;  1GN3 A;  1VQK V;  1DF4 A;  4MTG A;  1EZJ A;  3QG5 A;  1N32 O;  4TUY B;  1NI8 A;  1S76 D;  3LUT B;  4QJF B;  1NTM H;  3APQ A;  2P6J A;  2D3O W;  4FZ1 A;  3ABU A;  1FKA O;  4LFC O;  1Y76 A;  1BQ0 A;  1OCO C;  4B3S O;  4H33 A;  4LC1 A;  1H8E G;  1N4C A;  4DK0 A;  4LF8 B;  1QR9 A;  1BQZ A;  1U97 A;  5J2U B;  1Q90 D;  1OHH G;  2UUC B;  2Q8V A;  1H2G A;  1AI5 A;  2R9R B;  4FIP C;  5K1X A;  4DR1 B;  4KL1 A;  2B5U A;  4GX5 A;  4KXR A;  1Z5V A;  1JFF B;  3CEI A;  3OD4 A;  3AG4 B;  3E8B A;  2R9A A;  1UFI A;  3M99 B;  2HVK C;  1BS3 A;  2CDY A;  2DOS A;  2X6A A;  5IYD O;  1OV9 A;  2NLJ C;  4J9Z B;  4WFE A;  1AR1 B;  3AG1 C;  4LF6 O;  4CZZ A;  1AVM A;  4DR3 O;  4WFB V;  4JI2 O;  4WBN A;  3MHH C;  4IYI A;  4YY3 O;  4DR2 O;  3WB0 A;  2WWW A;  3BFR A;  2DW4 A;  3KG2 A;  2ZCE A;  1Y76 B;  2A7W A;  4DV4 O;  3K08 A;  3CB2 A;  3VQX A;  4UCS A;  2ITC C;  2YXY A;  1OCC B;  1F4M A;  1KP3 A;  1HWY A;  1JVM A;  1BMF G;  3BHP A;  1IDS A;  2ARH A;  3LSU A;  2ZE6 A;  3CCE V;  3CPW U;  2EIL C;  1TUB A;  4PA6 A;  1JR9 A;  4IGG A;  3J7A U;  5B66 Z;  1K5Q A;  3FB7 C;  4LF4 O;  3FYI B;  3UT5 A;  4MVZ A;  2ZIN A;  3ZMZ A;  5KAI Z;  1M4U A;  1YSC A;  3L71 H;  5KHH A;  1MMM A;  1PKX A;  3IC9 A;  2V7Q G;  4YJ3 A;  1S5H C;  1IX9 A;  4WBN B;  3K9A A;  4BAY A;  1H2N A;  2BSK B;  4I0X A;  3JAW A;  3I55 V;  1GM8 A;  1XL6 A;  1J5E O;  3AG2 B;  4PI0 A;  5H6R A;  2UXB B;  2P5O A;  2EIJ C;  5C93 A;  1MG1 A;  4X66 B;  1SA0 A;  3CWB H;  3CRA A;  5BY1 A;  3OUS A;  3ASN B;  3W7U A;  1I0H A;  5EK0 A;  4OPA A;  3JCZ A;  2YS8 A;  4U3F H;  4J7Z A;  2ILM A;  4NYK A;  2QKA A;  4DRX A;  2ZIM A;  3UO3 A;  1EBO A;  1SQG A;  4UCT A;  3JD4 A;  3PJS K;  5A9G A;  5B1O A;  3JAM N;  5CA0 A;  4MVM A;  2JJ1 G;  1YTF D;  5LMN O;  4GZR B;  5E1A C;  4MS2 A;  3UT5 B;  1SQP H;  2Y69 B;  3OMA B;  4DW1 A;  4LFA B;  4DR4 B;  2O57 A;  1BHA A;  1WB7 A;  3OFN G;  3BA8 A;  4YJ3 B;  4JYB A;  3QTC A;  1Y4M A;  3B09 A;  3JAT A;  3J81 N;  4AHC A;  1V54 B;  3OR7 C;  1B04 A;  1R3I C;  2BCC H;  2PY5 A;  1CXZ B;  1R6K A;  1WLE A;  1A32 A;  5GTI Z;  5CA1 A;  1MSW D;  3IJ4 A;  5JVD A;  2GBO A;  2YID A;  1SA0 B;  2KSD A;  4X89 A;  2DN9 A;  5IYB O;  1N33 O;  2N04 A;  1NT2 B;  4JI8 B;  2QM7 A;  3DXR A;  1XEQ A;  4DRX B;  2PI5 A;  1OCO B;  3OTO O;  4MVS A;  3E83 A;  5CA0 B;  3ML0 A;  1K5S A;  4XDL A;  3OT7 A;  1XBL A;  2ZE8 A;  2Q67 A;  1AI7 A;  5AG2 A;  1AR5 A;  4IT5 A;  2ZM6 O;  4R8C A;  3ASO B;  2BE3 A;  2GTA A;  1VQ6 V;  3H1J H;  1MZE A;  5EC1 C;  5LP6 C;  4WFF A;  3K5L A;  4WF9 V;  4DXW A;  4JYC A;  1V55 B;  2LFS A;  1DF5 A;  3ABL B;  4DUZ O;  1XDC A;  3SYP A;  3JAT B;  4CS3 A;  2ZNJ A;  3MDS A;  4X62 B;  1XNQ O;  4I9W A;  4PJ0 Z;  5CA1 B;  1PNM A;  1QCE A;  2OCC C;  5JVD B;  4DR5 O;  2XND G;  4H44 B;  4I9Q A;  1ORQ C;  1L8D A;  3DC5 A;  1RM1 C;  1VMG A;  1W0K G;  4RQE A;  5B3S B;  2YIB D;  2QWN B;  3ETQ A;  2NR5 A;  3A0H Z;  2ETN A;  4PEL A;  1Q81 W;  4LF7 O;  1H2L A;  2UUB B;  2LFR A;  3FX7 A;  4DV5 O;  2WLL A;  1WN7 A;  1ZSP A;  2GUZ A;  2DYS B;  2ATK C;  1AJN A;  2AZ2 A;  1D2D A;  4NTY A;  4X88 A;  1JJ2 U;  4I7Z B;  3JAK A;  2DYR C;  3SPJ A;  1P7G A;  2WLH A;  3T1H B;  1G8M A;  5KMG A;  5L3F A;  1GN4 A;  1PM9 A;  2NN4 A;  3WB1 A;  2HKO A;  2ZXW B;  1Y67 A;  2CH7 A;  3CXC U;  2UU9 O;  5KAF Z;  4JI5 B;  4JTA B;  2Q9L A;  4JF3 A;  4TV8 A;  2OTL V;  3HKB A;  1IUR A;  1WPB A;  1AP5 A;  4NXN O;  4JI3 O;  4JI1 B;  5IY5 C;  1H2S B;  2A9H A;  4MSW C;  4PA9 A;  1JJO A;  2LGW A;  4B3R O;  2YIB A;  2Z3Y A;  1YEW A;  2E3C A;  2WLL B;  4K3A A;  1NTZ H;  4GKK O;  1NH2 B;  1VQL V;  4DV6 B;  3RW0 A;  2GUZ B;  4YIP A;  1VQN V;  4Z1M G;  2RJZ A;  3GB7 C;  2QGN A;  5H9C A;  1VQ8 V;  3JAR A;  3JAK B;  2HEP A;  1HNZ O;  4I5S A;  1HR0 B;  2CAZ C;  1J95 A;  3H1L H;  3MHS C;  3ABM C;  1HNW B;  2CH7 B;  4RQF A;  5LP6 A;  2RCV A;  2A3Q A;  2KKW A;  2A0L A;  3HKB B;  2RDC A;  3M7M X;  5JCO C;  4HZ3 A;  2ZDI C;  1OCR B;  4PA3 A;  3B4S A;  3M8A A;  3B2E E;  5H2F Z;  3F5T A;  5FPR A;  3CC7 V;  4O4L A;  1NR7 A;  2QSA A;  3AG3 C;  4JYY A;  1I5Y A;  2B1I A;  4H0L B;  5IWA O;  5CBF A;  2EX3 A;  4UCR A;  1U96 A;  3SPI A;  3JAR B;  1WA8 A;  1UJW B;  1QHT A;  4ZKI A;  2OIG A;  1E1Q G;  3OUF A;  4MW8 A;  1JQ0 A;  3CSX A;  3MD0 A;  2ZT9 B;  4JAV A;  3OMN B;  4OGQ B;  1S5J A;  5FL7 G;  5LP6 B;  1JX9 A;  1KKC A;  5L3G A;  1GAX A;  1BE3 H;  2W0X A;  2IU3 A;  3SJA C;  4ABM A;  1QLE B;  4QGP A;  4O4H B;  1FXH A;  3OGI B;  3WG7 B;  2AW9 A;  2E5L O;  1SZX A;  1KBH A;  1NZ6 A;  1JMK C;  2OIE A;  2A79 B;  1KUQ A;  2R70 A;  4MVO A;  1EZV H;  1LNQ A;  1GMG A;  5HFL A;  4OX9 B;  1HDJ A;  2KG7 B;  2JRI A;  2ZE7 A;  1WA8 B;  4TWK A;  4FLZ A;  3WU2 Z;  1IBL O;  1AR4 A;  3W7X A;  4HNA A;  3E8G A;  4B3T B;  1KQS U;  3CCQ V;  2LW7 A;  4ZHQ B;  4LFB B;  3TK1 A;  2JS5 A;  1HNX O;  2YXL A;  4PDR A;  5K1P A;  4EFB A;  2UXX A;  5CB4 A;  5LMU O;  2DYR B;  3CRQ A;  4PD4 F;  4MVU A;  1R3J C;  3T1Y B;  1XRE A;  3ZHU A;  1US6 A;  1MSD A;  4J7K A;  1B06 A;  1IBK B;  1QR8 A;  2DJV A;  1ZUQ A;  3E22 B;  4IIJ A;  1R6T A;  5JJN B;  2LO1 A;  4KHP O;  4JI0 O;  4X65 O;  3BAB A;  3HKC A;  3CRM A;  5JCO A;  2ZDI A;  1X4T A;  2A06 H;  1GN2 A;  2V4D A;  3JYC A;  1FXK C;  3RBZ A;  1K97 A;  2D2C B;  4P2Z A;  5LYJ B;  3D36 A;  1XMO B;  1RSO A;  4HNA B;  3RVY A;  3ABT A;  2UXC O;  1XIL A;  3ZIA G;  1M56 C;  4YHH O;  4DV1 O;  1GM7 A;  2XAF A;  2DQ0 A;  5BXZ A;  1M9N A;  4QIW F;  2QKC A;  1IXM A;  1CPY A;  3ETG A;  5CB4 B;  2Q4P A;  1IXB A;  5KX5 A;  3P32 A;  3JSN A;  2ODM A;  1VQO V;  5LHI A;  5J2T A;  4UUJ C;  3B40 A;  3ABM B;  2DE0 X;  4L8J A;  1R6N A;  4IIJ B;  4JV5 O;  4JZG A;  4BW9 A;  3JAS B;  3FKS G;  1F7Y A;  2XOK G;  4JAS A;  4X1Y B;  2AGA A;  4TQF A;  3K79 A;  2JEX A;  1N32 B;  3N2K A;  4NKG B;  3OTF A;  3PN1 A;  2B9Z A;  1K8A W;  2Q5Z A;  4LF5 O;  1R1B A;  4LNU B;  1Y66 A;  4I50 A;  5FNV B;  1RSO B;  4LFC B;  1IBM O;  3ZRW B;  3K5N A;  5EC2 C;  1S72 V;  1Q6H A;  2Q0O C;  2R72 A;  5LGN A;  1M57 B;  5BZB A;  4UCU A;  1NVP B;  4GKJ O;  5GW7 A;  1JOY A;  3JCU Z;  1PNK A;  1M1K W;  2QWQ B;  2EIN B;  5J2T B;  3HR0 A;  2YDE A;  4CH4 A;  1PPJ H;  3K04 A;  1F4N A;  3GVM A;  3K5M A;  3SJQ C;  1KB9 F;  4QPJ A;  3EHB B;  3N2K B;  1NR1 A;  4JTD B;  1TGO A;  2FKX A;  1FD9 A;  1K4C C;  4LF6 B;  4PV1 B;  4DR3 B;  4JI2 B;  3DGE A;  4FMT A;  4DR2 B;  3ABK B;  1FXV A;  4YY3 B;  4BIO A;  1K9M W;  2E75 B;  2JS3 A;  3AEI A;  4I50 B;  3WB2 A;  4DV4 B;  3E35 A;  2QWP B;  2H94 A;  1ENV A;  2IJK A;  3FYE B;  4EFE A;  2WLN A;  2CTP A;  1XL4 A;  2BTO A;  5GTH Z;  1WJZ A;  4E4E A;  4JI6 O;  1GN6 A;  1Q7Y W;  3SYQ A;  4B7K A;  3FAV A;  4DR7 O;  3G6B A;  3ZN1 A;  2OCH A;  4LF4 B;  4J80 A;  5H6Q A;  2IU0 A;  2VS0 A;  2H8P C;  2Y4U A;  3Q4H A;  4WFA V;  3L74 H;  2QM8 A;  2CGO A;  4PDL A;  3ZMU A;  3X2Q B;  1WB8 A;  1YI2 V;  3P3P A;  4ICG A;  4CH6 A;  4PDM A;  3H1K H;  4QE9 A;  1GRJ A;  1TAE A;  2HJD A;  2IBZ H;  2FL4 A;  2VWK A;  4DV2 O;  2OTJ V;  1J5E B;  3F7V C;  3R66 A;  1SF9 A;  1Q82 W;  1KD1 W;  3ZMT A;  4NXM O;  1Y74 A;  5B1B C;  3W7T A;  2OT5 A;  1AI6 A;  4IHJ A;  3LDD A;  4D7T A;  3OE7 G;  3FAV B;  4X9Q A;  5KA6 A;  5CN0 A;  1Z2G A;  3E86 A;  1YXB A;  1TUB B;  2NNU A;  3VQW A;  2IH1 C;  2YC0 A;  5LMN B;  4TOI A;  2CGN A;  3Q4H B;  5EYP A;  3KZI Z;  1YZB A;  5KHJ A;  4B3M O;  5KA5 A;  1SQQ H;  1VQM V;  4MVQ A;  3VQY A;  3SJC C;  1PV0 A;  4UVA A;  3RGB A;  3TCU A;  4NR1 A;  4G2K A;  1VF6 C;  5E79 Z;  4DUY B;  3L70 H;  2E74 B;  3ZCC A;  4I0X B;  2UUA O;  2EJ7 A;  3JAW B;  5IJ0 A;  4OPH A;  1K7D A;  5D5Q A;  5KUM A;  1Q6I A;  2Q68 A;  3QO7 A;  3BAA A;  3LSQ A;  4JI7 O;  2GDS A;  4DV7 O;  4LFA O;  2ZNI A;  4DR4 O;  1N33 B;  1FFT B;  2YI9 A;  2LQT A;  1NS1 A;  3IAY A;  1OCZ C;  5CMU A;  2GSM B;  1JCH A;  1DK1 A;  4LF9 O;  4HYO A;  1SQF A;  4W4L A;  4IYH A;  1SZT A;  1XQ8 A;  3D3Q A;  5EYP B;  3SYO A;  1SET A;  1I7F A;  4O2B A;  4ASU G;  3A8T A;  1O9G A;  5J9P C;  4DUZ B;  1SQB H;  2PZS A;  4JI8 O;  1PNL A;  1MAB G;  1XNQ B;  3A0B Z;  3E8F A;  2E76 B;  4U3J A;  3U10 A;  1VEW A;  3JD1 A;  4JTC B;  4DR5 B;  5IYC O;  1YVW A;  1FJG O;  3OMI B;  3ZJZ A;  5BMV A;  3UQ8 A;  5KLV H;  2JJ2 G;  2BTQ A;  4NVP A;  3OEE G;  1Q86 W;  4UV8 A;  3AG1 B;  3NR7 A;  3N2G A;  4WFH A;  1XOU A;  5B1N A;  1VQ7 V;  2QWO B;  4W4K A;  4FLT A;  2HHH O;  4DV5 B;  3DXR B;  4DV3 O;  3SGI A;  4X64 B;  1HW7 A;  3D3I A;  4FK5 C;  3QO5 A;  1VQ4 V;  5LXT A;  5HFM A;  2EIM C;  1QVF U;  4X20 A;  2EIK C;  1YTF B;  3FB6 C;  4O2B B;  2ZR3 A;  2F95 B;  4MVR A;  4LR3 A;  3SJB C;  2X6B A;  2EIL B;  3LDC A;  4G28 B;  1YIT V;  5CBG A;  2HG5 C;  3CRC A;  2UUB O;  1Q43 A;  4FLV A;  4U3J B;  4BWA A;  2XAQ A;  3SPH A;  4DK1 A;  2UU9 B;  1YJW V;  1GM9 A;  5BMV B;  4FM0 A;  1XMQ O;  2BTQ B;  4NXN B;  4JI3 B;  1N36 O;  1VF6 A;  3UO2 A;  2WLM A;  4E2L A;  2W6I G;  3N2G B;  3OAA G;  1FAF A;  4B3R B;  4U7O A;  2UXD O;  3S3W A;  3T1H O;  4GKK B;  3OM3 B;  2N74 A;  1KMI Z;  4LP8 A;  1EFR G;  1S5L Z;  2MK3 A;  5DEC A;  1DTO A;  2EIJ B;  4XDK A;  5LXT B;  1IVS A;  1H38 A;  1KKD A;  1LR1 A;  2UXN A;  1OJH A;  4J41 A;  2C2A A;  5EZY A;  2YXH A;  3DTU B;  4AQY O;  1HNZ B;  3ZED A;  4C7U A;  1P7B A;  3J80 N;  1QNM A;  5F2V O;  3CCL V;  1L1F A;  2VWJ A;  5KMG B;  3K0D A;  1DGS A;  4X1I A;  4RO2 A;  3SR2 C;  4JYA B;  5B1A C;  2JGD A;  3CS5 A;  4CC5 A;  2ZQM A;  4TV8 B;  2YSU B;  1ARO P;  3ZHS A;  5TIS Z;  4PA4 A;  2AZ0 A;  1TUE B;  4UB8 Z;  2LP7 A;  4UCO A;  4QNH B;  2XT9 A;  3HB3 B;  3K9S A;  2XAJ A;  2RN9 A;  1W59 A;  5EBM C;  4DW0 A;  3CCM V;  4Z2W A;  5IWA B;  3EVK A;  4U7N A;  2KB1 A;  2XTA A;  1OCZ B;  3K58 A;  1AP6 A;  5EIB C;  5EZY B;  5KUK A;  2K9P A;  4PA7 A;  1PL4 A;  1YDX A;  2P67 A;  2PTM A;  1F51 A;  3ZMS A;  4O4I A;  1QQC A;  3OR6 C;  4KP4 A;  4LH6 A;  3APO A;  2M7W A;  3JD0 A;  1NTK H;  3JD3 A;  1L0N H;  1BSM A;  2JGD B;  1SER A;  4UFZ A;  3BCC H;  3C3T A;  2IJI A;  4TQD A;  4IL6 Z;  4F4L A;  2E5L B;  1XNR O;  2K1E A; 
#chains in the Genus database with same CATH homology
 3T1H O;  1XNQ O;  4X64 O;  1IBL O;  2N74 A;  5BY1 A;  1AB3 A;  4DR5 O;  4OPA A;  2VQF O;  4LF5 O;  1R1B A;  1IBM O;  2ZKO A;  4DV0 O;  1I94 O;  2VQE O;  2LW7 A;  4DV2 O;  4JI8 O;  1HNX O;  4AQY O;  5FLX N;  3JAM N;  2Z0A A;  3R66 A;  4DUY O;  5LMU O;  4JI4 O;  4DR6 O;  3M8A A;  4LF7 O;  5LMN O;  4NXM O;  4GKJ O;  5BR8 O;  5A2Q N;  3SDL A;  3J80 N;  4DV5 O;  3F5T A;  2DOS A;  1FJG O;  4K0K O;  2DJV A;  1N34 O;  4LF6 O;  1R6T A;  1FYJ A;  1D2D A;  1AIL A;  4DR3 O;  1G1X B;  4JI2 O;  1XMO O;  4DR2 O;  4KHP O;  4YY3 O;  4JI5 O;  4JI0 O;  4X65 O;  5IWA O;  3J81 N;  2F4V O;  4OX9 O;  2HHH O;  4DV4 O;  4DV3 O;  4JI1 O;  1A32 A;  1YZB A;  4B3M O;  2FKX A;  5LL6 Y;  2UU9 O;  5IT9 N;  4DV6 O;  2UXC O;  1N33 O;  3J7A U;  5H5N A;  4YHH O;  4DV1 O;  4LF4 O;  4NXN O;  1XEQ A;  5BXZ A;  1X59 A;  4JI3 O;  4LFB O;  3OTO O;  2UUA O;  2UUB O;  4B3R O;  2E5L O;  1N32 O;  4X62 O;  4OPH A;  4A5U B;  3T1Y O;  4JI6 O;  4LF8 O;  2ZM6 O;  4GKK O;  2UXB O;  1HR0 O;  4JI7 O;  4X66 O;  4DR7 O;  4DV7 O;  4LFA O;  4DR4 O;  2UUC O;  1IBK O;  1HNW O;  1KUQ A;  4B3T O;  1XMQ O;  1NS1 A;  4JYA O;  4DR1 O;  4JV5 O;  1N36 O;  1FKA O;  1F7Y A;  4LFC O;  1DK1 A;  3RT3 C;  4LF9 O;  4DUZ O;  2AGA A;  4B3S O;  2JRI A;  1XNR O;  3O65 A;  1HNZ O;  1J5E O;  2UXD O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...