4YY3O

30s ribosomal subunit- higb complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4yy3O00
1XNRO 4DR5O 1AB3A 1AILA 4DR7O 4B3SO 4LF4O 4X64O 3J81N 4JYAO 5BXZA 4LFBO 1R1BA 2HHHO 4JI2O 2LW7A 2DJVA 5IT9N 1G1XB 4DV1O 3JAMN 4LFAO 1D2DA 4JI1O 1N36O 2FKXA 1DK1A 3O65A 3SDLA 2UUBO 2UXDO 3R66A 2E5LO 4K0KO 1KUQA 4X65O 2UUAO 4JI5O 5BY1A 1IBKO 1XMOO 1HNWO 2ZM6O 1NS1A 2N74A 4DV0O 1XMQO 1R6TA 1A32A 4DUZO 2VQFO 4GKKO 3T1YO 3J7AU 1HNZO 1XEQA 4LF5O 1IBMO 4LFCO 1HNXO 4JI4O 1I94O 5LMUO 2ZKOA 4LF9O 1YZBA 3M8AA 3OTOO 4DV7O 4DR2O 4AQYO 3F5TA 3RT3C 4DV4O 1X59A 4OPAA 1F7YA 4OX9O 4LF7O 4DV2O 1FKAO 4B3RO 4GKJO 4YHHO 5LL6Y 4DV6O 1N33O 1FYJA 1J5EO 4DR6O 4LF8O 1FJGO 4YY3O 4DR1O 1IBLO 1N34O 2UXCO 4DV3O 5FLXN 5A2QN 4X66O 2UUCO 3T1HO 4JV5O 4DR3O 2UXBO 4OPHA 2DOSA 4NXNO 4JI7O 1N32O 4A5UB 2VQEO 4X62O 3J80N 4B3TO 4KHPO 5IWAO 5BR8O 2AGAA 2F4VO 5H5NA 1XNQO 2JRIA 4LF6O 1HR0O 4JI8O 5LMNO 4DR4O 4JI6O 4JI3O 2UU9O 4NXMO 4B3MO 4DV5O 4DUYO 4JI0O 2Z0AA
chains in the Genus database with same CATH superfamily
5FPOA 4Z2WA 4ZHQB 2DYRB 4B3SO 3FAVA 4UCRA 4KHPB 5BXZA 2FL4A 3SYAA 3ZRSA 3H1HH 1PNKA 5C93A 5LA6B 4R8CA 4HAMA 3T2MA 1BZKA 1N36B 3GVMA 2WA4A 1BGYH 2YEVA 2UXDB 5B3SC 3N2KA 3HKDB 1XMOB 4RAIA 2CH7B 4IHJB 1BS3A 5EZYB 2B5UA 1YTFD 4DRXB 3LNMB 2KQXA 3T1YO 3ML0A 1SZTA 4RQFA 4LFCO 2HHHB 2RCVA 4O4HB 4DXWA 4PA7A 2BSKA 5ITZB 2D2CB 4W4KA 3JALB 5IJ0A 1YTFB 4DR2O 2E5LB 4DK0A 1AI4A 1I5YA 1S5JA 4AQYB 1FKAO 1IZ3A 4G27B 5B1OA 3WG7B 5IYZA 3JSLA 4EEQA 4NVPA 1S3JA 4AILC 5FLXN 2YIDA 3W7TA 3OD4A 2H94A 5E79Z 2OTJV 5GW7A 3BRCA 1TUBB 1XL6A 2BTOA 2ZQMA 1XQ8A 2E74B 3H01A 1GM8A 2XTAA 2EULA 1P84F 3OMIB 3BA9A 4NYKA 4MW3A 2YS8A 4LF6O 3LSSA 3TJTA 2Q5ZA 3LSQA 1SC5B 4ZIBA 1VQMV 4WFEA 3ZX6A 2BTQA 3AG3B 3N2GA 3CD6V 2UXBB 3FKSG 3CSXA 4PI2A 4IYHA 4X64O 4DR7B 2QSAA 3LDCA 2AZ0A 1MSWD 1VMGA 1UJWB 5GONA 3VOUA 3UKMA 1G8MA 3ZRVA 1K33A 4QPKA 3RGBA 4FJCC 2NLJC 4R7CA 2P7TC 4JYCA 1MG1A 4K3AA 2PGGA 3P32A 4X65O 5KHJA 4J7JA 1OCRC 1Y76A 1COWG 1W2BU 2JGDA 2M7WA 4EFEA 2HKOA 1Q5OA 2ZR2A 4EFBA 1M56C 2WA3A 4JI2B 2Q4PA 1M57C 5CBFA 1W0KG 5C8YB 4FLVA 4JI4B 4LF9O 4O2BA 1JX9A 2LGQA 1F7YA 3EXAA 5L3DA 5KX5A 1RP3B 3K3WA 4DV6O 3SPJA 1S72V 4GKJB 5LHGA 1VIBA 2Y0PA 1NVPD 5DECA 5KMGA 3CP1A 4X9QA 4E4EA 4BW9A 1ENVA 4FM2A 1I94B 5B1AC 2CUGA 3CCRV 3AG1C 3CJHB 5IY5C 1NVPB 1NU1H 2DW4A 1ZL8A 2PZSA 2LJ2A 3E35A 1QLEB 3K58A 2HFEC 1Y6XA 4B7EA 5CN0A 5KAFZ 2NR5A 3SPGA 3CB2A 2YIBA 5CBHA 4NKGB 1LUVA 1FXKB 1RSOA 2CTRA 3FB6C 5JQGB 3CRAA 1AILA 2HVJC 3UO2A 3CEIA 4MTXA 2QWQB 3B8NA 3O9OA 1IDSA 3CCQV 4CZZA 1Y74A 1QCEA 5BR8B 5CA1B 1XNQB 1D2DA 3BY6A 3O65A 1K92A 4K0KO 2C2AA 3ABLC 2GBOA 3TETA 2HJFC 2UUAO 4UCUA 2E76B 3D8CA 4BAYA 2JK5C 3ZMTA 2DN9A 1JFFB 1FAFA 1H2LA 1IXBA 1YDXA 2IH1C 2JDIG 1AJPA 4NTWA 1O9GA 4X1YA 4MVOA 1AP5A 2JS5A 1EN5A 2F43G 4I9QA 4LF5O 5JH7B 1V55B 3CX5F 1Z5WA 2Z5UA 1YXBA 4QIWF 3R65A 4OPAA 3JAKB 2WLLB 3H1IH 1J5EO 4JYYA 4CBCA 1JVMA 4LF8B 4FVMA 1AJNA 3RN4A 1IBLB 1I7FA 5H6QA 3APOA 4RUEA 4FMTA 1PV0A 4R6ZA 2GTSA 3D3IA 3T1CA 4X62O 2F95B 4KHPO 3HPLC 4ZI7A 5FNVB 5F2VO 1GH6A 4JI8O 4JI6O 1HR0B 1Q6HA 4FLZA 4OGQB 2Q7EA 1PNMA 3I5DA 1U96A 4HNAB 1XHXA 1P7GA 2XUMA 4JF3A 3KZIZ 1JJ2U 2VS0A 3AG4B 2Z3YA 1QVGU 4DR5B 1ZTEA 3JD1A 2W0XA 3W7WA 2V7QG 5GTHZ 2HHHO 1IXMA 1OCZB 1G1XB 4TV8A 3BFRA 1URFA 1JMKC 1PD3A 4JI3B 1L1FA 2XNDG 3RYFB 2E5LO 1S0VA 3L70H 1AI7A 5J2UA 1M5IA 1XOUA 4J10A 1KUQA 2IU3A 3L74H 4JI5B 1GO3F 2Y48A 3T4ZA 4PA4A 1P4RA 2ZNJA 4DV0B 2IJIA 3AK2A 4MTGA 4DUZB 2LFRA 2QA4V 2OWOA 4FLWA 2QKAA 3SJCC 3JATA 4D6TH 3EVKA 1S77D 1V54B 2JEXA 3T4DA 2Q73A 4MVQA 4JGSA 4TUYB 1AR5A 3BPZA 3ETDA 2OTLV 1P49A 3OTOB 3SPCA 2JJ1G 1EZJA 4UCVA 4F4LA 4O2AA 1WLEA 4PDLA 1XDCA 3VQWA 1K73W 2CGOA 2CE4A 1XMQB 1B06A 4DR6B 1D5NA 3JCUZ 4GYCB 1WPXA 4BIZA 3CCLV 3DXRB 2GHYA 1H2MA 4C7UA 2UXBO 2RMKB 1R3JC 3AG7A 3ETGA 4WBNB 1YEWA 2R70A 2PUSA 4B3TO 1EN6A 1GM7A 2AGAA 5KA5A 4YJ2B 3E2EA 3WB2A 3JAWB 1ZWIC 4J42A 2Y69C 2R9AA 3ZHUA 5BZBA 3QVNA 3JASB 4X1IA 1K8AW 1XL4A 3ZBHA 2DQ3A 3RYCB 3H1KH 4DUYO 3K0DA 1R73A 4TOIA 2CK3G 2ITDC 1OV9A 3T1HB 3CXHF 3ICXA 4FLXA 5IDJA 1HP8A 1ZAUA 2JJ2G 3E83A 1VQ4V 3X2QB 5LOVA 1H2KA 4LFBO 2FYUH 3HKCA 4WFGA 1H2SB 4JI2O 4DV1O 1E1QG 4RUFA 1QLNA 1K5SA 3JSNA 1WA8B 1QU7A 4I4TB 5LXTA 4IIJB 5L3FA 1XNRB 2XAGA 2ZXWB 4FFBA 3B2EE 1HNWB 1DLBA 4J80A 4CH6A 1QVFU 4CS2A 2XOKG 1YCIA 2KG7A 4JYAB 3K5NA 1TUEB 4D7SA 5IYCO 1WB8A 1SS3A 2EIKC 1I94O 1IBMB 4LFAB 3OR7C 3ZHTA 1KP3A 1BHAA 4OXSA 4B3RO 4YHHO 1GN4A 1N33O 1NQTA 2R9IA 2RNBA 3FAVB 1WJZA 1VEWA 4JZ2A 2ZE7A 3IC9A 2ETNA 3U0ZA 4DV3B 1SF9A 2ODMA 3BA8A 1E79G 2YEVB 3HR0A 5BR8O 1XNQO 1T5EA 3N2KB 2F4VB 2H8PC 1TVKA 3ZS8C 2ZDIC 4GT1A 1SQGA 4DV5O 4JI0O 5H2FZ 2P06A 2RN9A 1Q86W 3ZMSA 5IJ0B 1BMFG 1R3IC 2QDOA 1ROPA 1B3QA 3DGEA 4J9ZB 5DM6V 1X4TA 1N0JA 1QQCA 2P67A 5IYZB 1TGOA 3JYCA 1KYOF 3JAMN 4ICGA 2Q8VA 4MTFA 2X6AA 1SQQH 1VQPV 1RFYA 1JPXA 1IURA 4BIUA 3RFRA 4MVUA 3MHSC 3AEIA 5BY1A 1BT8A 2M6YA 3ZN0A 1J95A 1OCOC 1R6TA 2ZM6B 3TXQA 2WLIA 3CC7V 3A2FA 3AG2B 2F1MA 3FYIB 1VQKV 1THZA 2LO1A 1QHTA 1HDJA 3SJAC 1EFRG 5LMUO 2HG5C 5JVDA 1PKXA 2IJHA 1H8EG 5EC2C 1K5QA 2VRZA 2QTOA 1X59A 4O4IB 2BTQB 3HKBA 5DEDA 3N2GB 1Q8IA 4DV4B 4CC6A 4RO2A 3OUFA 1Y67A 4GZRB 3K5MA 2BOBC 4PI0A 1N34O 2LP7A 4YXWG 1K7DA 5GONB 3E8BA 4DR1B 1G4YB 5B1AB 4XBFA 4UCSA 4LC1A 4ABMA 2F93B 1YF2A 4I50A 5EBMC 1SA0A 4K8XA 1SQFA 4LNUA 3UM7A 1D5AA 1Y76B 4NTYA 2H3OA 4JI3O 2Q0OC 2JGDB 4L87A 1VF6A 3HKEA 1KU9A 4NXMB 4B3MB 3TGUH 3MDSA 3THOA 2QEXV 1JOYA 4O2BB 3CC2V 2X7RB 1GN2A 1ZUQA 3L72H 3RYHB 4PV1B 1KKDA 1LUWA 3J81N 4LF4B 4YIOA 5LP6C 3QO7A 1R3KC 5IT9N 4L8JA 3CRCA 1DK1A 2A9HA 2UUBO 4JI1B 5KMGB 3SPHA 5IYDO 3KG2A 1RM1C 4X20A 2CAZC 4WF9V 4PELA 1IBKO 2F66C 1SQBH 5HFMA 3OGIB 1XMQO 2EJRA 2HEPA 2VQFO 1ZL8B 4JTCB 2YIBD 3OR6C 3QO5A 2YDEA 5DN6G 1HNZB 3FFQA 3QO8A 4UVAA 3M8AA 1VF6C 3TCUA 4ASUG 3HKDA 1Q3EA 2BE3A 4OX9O 1OJHA 1IX9A 1RSOB 1F23A 3HB3B 4X88A 4CH4A 1PNLA 1MSDA 5H9CA 1ZX3A 4MVMA 2QJ1A 2PI5A 4DV2B 3A0RA 1Q81W 1MMMA 1SERA 3OEHG 4FM0A 5LGTA 1XI1A 3CMEV 1V9PA 2QTSA 3H9VA 4KFMA 3T1HO 1VARA 2R9RB 2F23A 4Q20A 3SGIA 4DR3O 2UUCB 4H33A 2B1GA 1B6QA 2DYRC 2Y0IA 4NXNB 2YSUB 3DTUB 3ETQA 1WP8A 1N8RW 2ITCC 1M4UA 5B5EZ 3I56V 5LMNB 4I9WA 2UU9B 4PA9A 4X8AA 1XNRO 2IJJA 3CMAV 1W59A 3U11A 2OIGA 1FPOA 5EIBD 3DC5A 5EC1C 4X1KA 4JYAO 3QG5A 2EIMC 4TQDA 4LFAO 4UVBA 3SJQC 1YJNV 1OCCB 3SDLA 4FLUA 3R66A 1GKFA 3TK1A 3UQ8A 1LNQA 2KKWA 2JEUA 4LCUC 1JR9A 5JJEB 4FLYA 5B66Z 3UT5A 4UFZA 3F5WC 4ZI7B 1MZFA 4GKKO 2EX3A 5D5PA 1KD1W 2DQ0A 2EILB 4J7KA 4MT8A 4DK1A 2XAFA 1HNXB 2QWOB 1VQ5V 3K5LA 1NZ6A 3ZJZA 3NXSA 4CH5A 3SYCA 1YITV 5LGNA 2QGNA 1FYJA 3C3SA 1U97A 2LFSA 1FJGO 2P6JA 2K1EA 4FFKA 4IGGA 3U10A 5C8YA 2UXCO 5E1AC 3ZRXA 4YY3B 3RWRD 1TA8A 1DF4A 4X66B 2RJZA 1O9HA 3CCSV 4LH7A 2IM9A 4Z1VA 3AG3C 4IYIA 5J2UB 2G38A 1YI2V 1N32B 3G80A 2HVKC 5IE9A 5IJ9A 2A3QA 1NH2D 1VQ8V 5J9PC 3CC4V 1DF5A 1NT2B 4J11A 4KP4A 3ZMUA 1NR1A 4O4JA 2PF4E 1NH2B 4QJFB 4HBNA 1RPRA 2FTKA 4MVZA 4B3SB 1P7BA 4W4LA 2EBOA 4MTOA 4WFHA 1I08A 3L73H 4O2AB 4XDJA 2FMLA 4BR6A 3AK1A 1VQNV 1N36O 1LR1A 2UXDO 4I55B 1DTOA 2EINB 3STLC 3OUSA 2GDSA 3W7SA 4XDKA 1XMOO 2JGUA 1H38A 4UV8A 4FZ1A 3K04A 2V4DA 2GUZA 1XEQA 2ZCEA 3T1YB 5B1NA 2EIJC 1SQPH 4X1IB 2WLKA 4UB6Z 1VQ7V 4LFCB 3RVZA 1K3EA 3CCUV 4NB5A 1K34A 4FK5C 4AQYO 4DR2B 4JAAA 2CGNA 5LL6Y 2ZD9A 3BCCH 4LBEC 5CA0A 1YJWV 5LOVB 4XDLA 3ASOB 3G71V 4KUMA 1QLEC 1B04A 3HKCB 3ABUA 3ZHSA 2RDCA 2HLDG 2IW5A 2OCCB 2QWNB 3OMNB 1FXKC 1KB9F 3ZEDA 4PDMA 4O4LA 4DO2A 2EZOA 5LXTB 3JARB 4LF7B 4FFBB 3MD0A 4U3JA 1I0HA 1OZ0A 2Q0AA 2B1IA 2ZE6A 4LF6B 3SPIA 5EYPA 4BIOA 3ASNC 2KG7B 4G28B 1N0NA 3ABTA 4WFFA 3ABKB 1KP2A 5BMVB 4DR7O 2WAMA 3UO3A 1BCCH 5FPRA 4X64B 1MA1A 3ZN1A 1NI8A 5L3GA 3MHHC 2YXYA 1V55C 3LSUA 4PA3A 3JD2A 1UPGA 1YIJV 5KLVH 1OCOB 1SKVA 2P4VA 3H1JH 1GTOA 4X65B 4YJ3A 4PD4F 4LR3A 4EB6B 4LWSA 4ZOLA 2Q6AA 4GX5A 4ZBMA 5JJJB 3F7VC 1BQZA 2DWDC 1TVKB 2IH3C 2Y4UA 4JI4O 3K79A 3L75H 4LF9B 3DC6A 2BCCH 2DMXA 5B3SB 4B08A 3WB0A 3M7MX 3OM3B 4GKJO 1FFXA 2ZDIA 2WSSG 5K1XA 5LYJA 3M99B 3P3NA 2DYSC 1PP9H 1WN7A 4DW1A 3BVOA 5A2QN 3DSQA 5KHKA 1PPJH 3LNNA 4JTAB 2HR3A 3B8MA 2IBZH 1WB7A 3CS5A 3QTCA 3AG4C 2PYLA 4K35A 3K9SA 2UXNA 3C3TA 3ZRWA 2Q69A 2Q7GA 2GTAA 3DXRA 1YSCA 2WLIB 4J41A 2OYQA 1OCZC 2LQTA 1FXHA 2Z0AA 2P4KA 2ILMA 1AB3A 2A79B 5JVDB 4JV5B 3JAWA 3P3PA 2YXLA 3ABMC 3HKBB 2XAQA 3CRMA 2QM4A 2VQEB 5H6RA 1GN3A 1AP6A 2DJVA 2FKXA 1H2NA 2AXTZ 3N27A 1FFTB 1RM1B 1VQLV 3CE2A 4J7ZA 2BSKB 4PDVA 4CH3A 3K59A 4TV9A 4D7TA 3ZMZA 2UUAB 1CPYA 4GX2A 4H37A 4I50B 3SJBC 1A32A 1SA0B 1MZEA 4PA6A 1JCHA 2RQ6A 4LNUB 3WU2Z 1PM9A 2ZE8A 1QBZA 1WA8A 4LF5B 2L35A 2JIZG 1EN4A 2ZE5A 3HKEB 4IIJA 3RVYA 1M93A 1Y4MA 4R50A 3F5TA 4CS3A 1OCRB 5LHIA 1CXZB 3OTFA 4NR1A 3D36C 4LF8O 1NJIW 2DWEC 1J5EB 2YXHA 5KA6A 1IBLO 1M56B 2MW2B 1M57B 5J2TA 5L3EA 4JAVA 1F4MA 4K8ZA 4GLXA 3BHPA 4F6RA 4MVRA 3IGAC 5KUMA 5CBGA 3ZHVA 4X20B 5LP6A 4DV7B 3K03A 1KBHA 3X2QC 4X62B 3GWKC 1VQ9V 5LGUA 2P5OA 1S5HC 3W7UA 1HR0O 1WPBA 3CWBH 5CB4A 4JI8B 1NTKH 1H8HG 4H13B 2V1DA 4JI6B 3RYIA 1N4CA 5K1PA 4JYBA 4DR5O 3OAAG 4I0XA 3JD4A 3AG1B 4GUNA 4X89A 5IY5B 3E22A 1M9NA 2B9ZA 2ZXWC 2KB1A 4LP8A 4E2LA 3ZHRA 1R1BA 2EIMB 1YJ9V 2N05A 2OT5A 3JD3A 2ZIMA 3ZCCA 3IC7A 4BWAA 4GX0A 1PL4A 3SYQA 4WFAV 3BEHA 2FB5A 2CTWA 3E8FA 4JI5O 2OCHA 3E89A 3WB1A 2YI8A 4DV0O 3Q4HA 2AHZA 1CP9A 5KX5B 1NKDA 3S3WA 4DUZO 4IT5A 2IU0A 1GK9A 2YIAA 1Z5VA 3H1LH 1BHBA 1GRJA 4ZHQA 4RQEA 3K5OA 3ABLB 1M90W 2N04A 3OTOO 2X0LA 2WLJA 3D3QA 4LF7O 5EBWC 4QE9A 2W6JG 5A9GA 4DR6O 1KECA 3ZMVA 2BOCC 5EBLC 5HFLA 4X1KB 3CCVV 5LA6A 4MVSA 4PDRA 4WFBV 2XHBA 3PJSK 3GB7C 4UB8Z 3G6BA 3B77A 3G6EV 4O4IA 1QNMA 2A7WA 2CH7A 4IHJA 3G67A 5EZYA 1DGSA 4DRXA 4B3TB 1S76D 3UT5B 1UFIA 3VQXA 5B1BC 2Y4TA 2XT9A 4O4HA 4N23A 3L9DA 1Y74B 5ITZA 1K4CC 2YI9A 4WCEV 1EM1A 3K57A 3JALA 2YC0A 4DUYB 3PN1A 3ZHQA 3OEEG 2QM7A 4BW5A 4P2ZA 3IFXA 4KXRA 4DW0A 4QGPA 5EK0A 3RBZA 2QKCA 3BABA 3FB5C 1YHQV 4LFBB 3AG2C 1KC8W 4CC5A 1M1KW 4DR4B 4PHZA 4DV1B 1TUBA 2WLHA 3JD0A 1VF5B 4JZGA 4X1YB 2YUAA 3RYHA 4FM1A 3W7XA 3VBBA 5KHGA 1HNWO 1S5LZ 1NS1A 1WP7A 1JJOA 2GSMB 3VQYA 5IJ9B 3SYOA 1WNSA 5GTIZ 3J7AU 2EIJB 1IBMO 1SQXH 1YZBA 4TWKA 1Q6IA 4O4JB 4U7OA 1HWYA 3S3XA 2CTQA 1L8DA 1VQ6V 4B3RB 4YHHB 4GCZA 1N33B 4PJ0Z 3WG7C 3KKYA 1H2GA 1FD9A 4DV3O 4JV5O 4OPHA 2WPDG 1R6KA 2VQEO 2NN4A 3EFFK 2XAHA 2F4VO 2NNUA 4FIPC 3K9AA 5L3BA 1MOFA 3ASNB 1YVWA 1MNGA 1RPOA 4JASA 2GUZB 3KCYA 2ZIOA 3E8HA 5L3CA 4RWUA 4TQFA 4TV8B 4DV5B 1SQVH 2E75B 4JI0B 3OW2U 1IVSA 3CCJV 2E3CA 2AW9A 4JI7B 1R6NA 1US6A 2Q9LA 4AI8A 4U7NA 2Y69B 1FXVA 4ZKIA 3B09A 4I7ZB 5IWAB 3ETEA 5CA0B 1NTMH 2ZNIA 4UXNA 1XILA 3A8TA 1NTZH 3CJHA 3JATB 2XAJA 2X6CA 3VQVA 3OFNG 1BQ0A 2YICA 2ZM6O 2R72A 2A06H 4O4LB 4F6EA 1SRYA 5KHHA 2GV9A 3FYEB 4U3JB 3STZC 3E86A 3CRRA 1AVMA 4FZ0A 5EYPB 1FXKA 5CA3A 5JQGA 4IL6Z 5LMUB 2JVDA 3OGCC 4P9PA 4DV7O 4DV4O 3K0GA 1XBLA 2MK3A 5CA1A 2CTPA 1F4NA 1AI5A 2DYSB 3B40A 1XHZA 2P22C 2OIEA 2L6LA 4DR1O 2UXXA 2EIKB 1N34B 3UCSC 2QR4A 1I5XA 1KKCA 4JPRA 5KHIA 4JAUA 4A5UB 1G6UA 4DYLA 2ARHA 1JFFA 4AHCA 1KQSU 2LW1A 1AI6A 2EZPA 1XUQA 1Y66A 3FD9A 4YJ3B 4LWSB 2QWRB 3JCZA 5KUKA 2P90A 4ZOLB 5JH7A 1VQOV 1KMIZ 4NXMO 4B3MO 5EIBC 4YIPA 4Z1MG 2WWWA 1OCCC 2Q67A 4P9OA 3SR2C 5JCOA 4QNHB 4GX1A 3JAKA 2WLLA 3CRQA 3MAQA 3ABMB 4LF4O 4MW8A 2ADQB 2ATKC 3LUTB 1FFXB 1ZSPA 2QM8A 4HYOA 5LYJB 2LW7A 1K9MW 1BE3H 2ZR3A 2PY5A 4JI1O 4H44B 3ZIAG 2EILC 1ORQC 3IAYA 1QR8A 1F51A 2UUBB 1BSMA 2Q68A 1K4DC 3CYOA 5FNVA 1BL8A 3CCMV 3OMAB 1IBKB 2N74A 1JA8A 1EZVH 1AR1B 3ZRWB 2QE7G 1Q6UA 1NBMG 2EJ7A 2VQFB 1HNZO 4HNAA 2LGWA 3K08A 5LBQA 4B7KA 2ADPA 4I55A 3KCXA 3QNEA 1GM9A 3BAAA 4UUJC 1HW7A 1TAEA 3SYPA 2XASA 1PL0A 4UCOA 5JCOC 4DV2O 4OX9B 4HZ3A 2JS3A 3F7YC 2D3OW 2QKSA 3RYFA 2CDYA 1FS0G 2UUCO 4UCTA 3C90A 4FPPA 1SESA 4QE7A 2Q7HA 4TT3G 3L71H 4DR3B 4NXNO 1MABG 5JJNB 2HJDA 3J80N 1GN6A 2W6IG 4TV9B 1VF7A 2WLMA 1ZLZA 1Q43A 1VP7A 2A0LA 4DV6B 4H0LB 4DR4O 5LMNO 1JQ0A 2ZT9B 4EKWA 1K97A 1AR4A 2UU9O 1QR9A 1Q90D 1EBOA 5JWPA 4TUYA 4G2KA 2K9PA 4P30A 3K06A 1GAXA 3JARA 2EINC 1OHHG 3IJ4A 1WAZA 1SZXA 4CS4A 4MS2A 4NTXA 1AROP 4J9YB 5KAIZ 3LDDA 4KL1A 5D5QA 3CPWU 5BMVA 2O57A 2HP8A 4WBNA 5CMUA 1Q7YW 1Q82W 5TISZ 5J2TB 2PI4A 2W0FC 1R3LC 2WLNA 3OE7G 3D36A 5AG2A 3A0BZ 4F6RB 4YJ2A 2AZ2A 2PYJA 2IJKA 3E8GA 3CHXA 5LP6B 1L0NH 3AK3A 3NR7A 3JASA 3WFVA 2QWPB 3ASOC 2X6BA 4MSWC 4UV9A 4TSFG 4UVCA 4GKKB 1SETA 3B4SA 3RYCA 1HNXO 2DE0X 3CCEV 4N21A 5CB4B 3FB8C 3FX7A 3CXCU 2ZKOA 3TXSA 3GWOA 4Q6GA 1V54C 2OCCC 3RYIB 4EB6A 3RT3C 4K0KB 1GMGA 2VWKA 4I0XB 4I5SA 1CEZA 3E22B 3FB7C 1L0LH 5LHHA 3OT7A 3APQA 4U3FH 1XREA 3EHBB 1AJQA 4YY3O 2ZINA 1FJGB 4X66O 2KSDA 3LDEA 2UXCB 5IYBO 4I4TA 3ABKC 4LH6A 4FLTA 3QF7A 3G4SV 2VWJA 2DOSA 1N32O 4JI7O 4QPJA 1W0JG 1Z2GA 5IWAO 2AHYA 5B1BB 5H5NA 3P30A 1E1RG 3RW0A 2JRIA 3Q4HB 5FL7G 2PTMA 4JTDB 3A0HZ 3I55V 1NR7A
chains in the Genus database with same CATH topology
1XNRO 4DR5O 1AB3A 1AILA 4DR7O 4B3SO 4LF4O 4X64O 3J81N 4JYAO 5BXZA 4LFBO 1R1BA 2HHHO 4JI2O 2LW7A 2DJVA 5IT9N 1G1XB 4DV1O 3JAMN 4LFAO 1D2DA 4JI1O 1N36O 2FKXA 1DK1A 3O65A 3SDLA 2UUBO 2UXDO 3R66A 2E5LO 4K0KO 1KUQA 4X65O 2UUAO 4JI5O 5BY1A 1IBKO 1XMOO 1HNWO 2ZM6O 1NS1A 2N74A 4DV0O 1XMQO 1R6TA 1A32A 4DUZO 2VQFO 4GKKO 3T1YO 3J7AU 1HNZO 1XEQA 4LF5O 1IBMO 4LFCO 1HNXO 4JI4O 1I94O 5LMUO 2ZKOA 4LF9O 1YZBA 3M8AA 3OTOO 4DV7O 4DR2O 4AQYO 3F5TA 3RT3C 4DV4O 1X59A 4OPAA 1F7YA 4OX9O 4LF7O 4DV2O 1FKAO 4B3RO 4GKJO 4YHHO 5LL6Y 4DV6O 1N33O 1FYJA 1J5EO 4DR6O 4LF8O 1FJGO 4YY3O 4DR1O 1IBLO 1N34O 2UXCO 4DV3O 5FLXN 5A2QN 4X66O 2UUCO 3T1HO 4JV5O 4DR3O 2UXBO 4OPHA 2DOSA 4NXNO 4JI7O 1N32O 4A5UB 2VQEO 4X62O 3J80N 4B3TO 4KHPO 5IWAO 5BR8O 2AGAA 2F4VO 5H5NA 1XNQO 2JRIA 4LF6O 1HR0O 4JI8O 5LMNO 4DR4O 4JI6O 4JI3O 2UU9O 4NXMO 4B3MO 4DV5O 4DUYO 4JI0O 2Z0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR O;  4DR5 O;  1AB3 A;  1AIL A;  4DR7 O;  4B3S O;  4LF4 O;  4X64 O;  3J81 N;  4JYA O;  5BXZ A;  4LFB O;  1R1B A;  2HHH O;  4JI2 O;  2LW7 A;  2DJV A;  5IT9 N;  1G1X B;  4DV1 O;  3JAM N;  4LFA O;  1D2D A;  4JI1 O;  1N36 O;  2FKX A;  1DK1 A;  3O65 A;  3SDL A;  2UUB O;  2UXD O;  3R66 A;  2E5L O;  4K0K O;  1KUQ A;  4X65 O;  2UUA O;  4JI5 O;  5BY1 A;  1IBK O;  1XMO O;  1HNW O;  2ZM6 O;  1NS1 A;  2N74 A;  4DV0 O;  1XMQ O;  1R6T A;  1A32 A;  4DUZ O;  2VQF O;  4GKK O;  3T1Y O;  3J7A U;  1HNZ O;  1XEQ A;  4LF5 O;  1IBM O;  4LFC O;  1HNX O;  4JI4 O;  1I94 O;  5LMU O;  2ZKO A;  4LF9 O;  1YZB A;  3M8A A;  3OTO O;  4DV7 O;  4DR2 O;  4AQY O;  3F5T A;  3RT3 C;  4DV4 O;  1X59 A;  4OPA A;  1F7Y A;  4OX9 O;  4LF7 O;  4DV2 O;  1FKA O;  4B3R O;  4GKJ O;  4YHH O;  5LL6 Y;  4DV6 O;  1N33 O;  1FYJ A;  1J5E O;  4DR6 O;  4LF8 O;  1FJG O;  4YY3 O;  4DR1 O;  1IBL O;  1N34 O;  2UXC O;  4DV3 O;  5FLX N;  5A2Q N;  4X66 O;  2UUC O;  3T1H O;  4JV5 O;  4DR3 O;  2UXB O;  4OPH A;  2DOS A;  4NXN O;  4JI7 O;  1N32 O;  4A5U B;  2VQE O;  4X62 O;  3J80 N;  4B3T O;  4KHP O;  5IWA O;  5BR8 O;  2AGA A;  2F4V O;  5H5N A;  1XNQ O;  2JRI A;  4LF6 O;  1HR0 O;  4JI8 O;  5LMN O;  4DR4 O;  4JI6 O;  4JI3 O;  2UU9 O;  4NXM O;  4B3M O;  4DV5 O;  4DUY O;  4JI0 O;  2Z0A A; 
#chains in the Genus database with same CATH topology
 5FPO A;  4Z2W A;  4ZHQ B;  2DYR B;  4B3S O;  3FAV A;  4UCR A;  4KHP B;  5BXZ A;  2FL4 A;  3SYA A;  3ZRS A;  3H1H H;  1PNK A;  5C93 A;  5LA6 B;  4R8C A;  4HAM A;  3T2M A;  1BZK A;  1N36 B;  3GVM A;  2WA4 A;  1BGY H;  2YEV A;  2UXD B;  5B3S C;  3N2K A;  3HKD B;  1XMO B;  4RAI A;  2CH7 B;  4IHJ B;  1BS3 A;  5EZY B;  2B5U A;  1YTF D;  4DRX B;  3LNM B;  2KQX A;  3T1Y O;  3ML0 A;  1SZT A;  4RQF A;  4LFC O;  2HHH B;  2RCV A;  4O4H B;  4DXW A;  4PA7 A;  2BSK A;  5ITZ B;  2D2C B;  4W4K A;  3JAL B;  5IJ0 A;  1YTF B;  4DR2 O;  2E5L B;  4DK0 A;  1AI4 A;  1I5Y A;  1S5J A;  4AQY B;  1FKA O;  1IZ3 A;  4G27 B;  5B1O A;  3WG7 B;  5IYZ A;  3JSL A;  4EEQ A;  4NVP A;  1S3J A;  4AIL C;  5FLX N;  2YID A;  3W7T A;  3OD4 A;  2H94 A;  5E79 Z;  2OTJ V;  5GW7 A;  3BRC A;  1TUB B;  1XL6 A;  2BTO A;  2ZQM A;  1XQ8 A;  2E74 B;  3H01 A;  1GM8 A;  2XTA A;  2EUL A;  1P84 F;  3OMI B;  3BA9 A;  4NYK A;  4MW3 A;  2YS8 A;  4LF6 O;  3LSS A;  3TJT A;  2Q5Z A;  3LSQ A;  1SC5 B;  4ZIB A;  1VQM V;  4WFE A;  3ZX6 A;  2BTQ A;  3AG3 B;  3N2G A;  3CD6 V;  2UXB B;  3FKS G;  3CSX A;  4PI2 A;  4IYH A;  4X64 O;  4DR7 B;  2QSA A;  3LDC A;  2AZ0 A;  1MSW D;  1VMG A;  1UJW B;  5GON A;  3VOU A;  3UKM A;  1G8M A;  3ZRV A;  1K33 A;  4QPK A;  3RGB A;  4FJC C;  2NLJ C;  4R7C A;  2P7T C;  4JYC A;  1MG1 A;  4K3A A;  2PGG A;  3P32 A;  4X65 O;  5KHJ A;  4J7J A;  1OCR C;  1Y76 A;  1COW G;  1W2B U;  2JGD A;  2M7W A;  4EFE A;  2HKO A;  1Q5O A;  2ZR2 A;  4EFB A;  1M56 C;  2WA3 A;  4JI2 B;  2Q4P A;  1M57 C;  5CBF A;  1W0K G;  5C8Y B;  4FLV A;  4JI4 B;  4LF9 O;  4O2B A;  1JX9 A;  2LGQ A;  1F7Y A;  3EXA A;  5L3D A;  5KX5 A;  1RP3 B;  3K3W A;  4DV6 O;  3SPJ A;  1S72 V;  4GKJ B;  5LHG A;  1VIB A;  2Y0P A;  1NVP D;  5DEC A;  5KMG A;  3CP1 A;  4X9Q A;  4E4E A;  4BW9 A;  1ENV A;  4FM2 A;  1I94 B;  5B1A C;  2CUG A;  3CCR V;  3AG1 C;  3CJH B;  5IY5 C;  1NVP B;  1NU1 H;  2DW4 A;  1ZL8 A;  2PZS A;  2LJ2 A;  3E35 A;  1QLE B;  3K58 A;  2HFE C;  1Y6X A;  4B7E A;  5CN0 A;  5KAF Z;  2NR5 A;  3SPG A;  3CB2 A;  2YIB A;  5CBH A;  4NKG B;  1LUV A;  1FXK B;  1RSO A;  2CTR A;  3FB6 C;  5JQG B;  3CRA A;  1AIL A;  2HVJ C;  3UO2 A;  3CEI A;  4MTX A;  2QWQ B;  3B8N A;  3O9O A;  1IDS A;  3CCQ V;  4CZZ A;  1Y74 A;  1QCE A;  5BR8 B;  5CA1 B;  1XNQ B;  1D2D A;  3BY6 A;  3O65 A;  1K92 A;  4K0K O;  2C2A A;  3ABL C;  2GBO A;  3TET A;  2HJF C;  2UUA O;  4UCU A;  2E76 B;  3D8C A;  4BAY A;  2JK5 C;  3ZMT A;  2DN9 A;  1JFF B;  1FAF A;  1H2L A;  1IXB A;  1YDX A;  2IH1 C;  2JDI G;  1AJP A;  4NTW A;  1O9G A;  4X1Y A;  4MVO A;  1AP5 A;  2JS5 A;  1EN5 A;  2F43 G;  4I9Q A;  4LF5 O;  5JH7 B;  1V55 B;  3CX5 F;  1Z5W A;  2Z5U A;  1YXB A;  4QIW F;  3R65 A;  4OPA A;  3JAK B;  2WLL B;  3H1I H;  1J5E O;  4JYY A;  4CBC A;  1JVM A;  4LF8 B;  4FVM A;  1AJN A;  3RN4 A;  1IBL B;  1I7F A;  5H6Q A;  3APO A;  4RUE A;  4FMT A;  1PV0 A;  4R6Z A;  2GTS A;  3D3I A;  3T1C A;  4X62 O;  2F95 B;  4KHP O;  3HPL C;  4ZI7 A;  5FNV B;  5F2V O;  1GH6 A;  4JI8 O;  4JI6 O;  1HR0 B;  1Q6H A;  4FLZ A;  4OGQ B;  2Q7E A;  1PNM A;  3I5D A;  1U96 A;  4HNA B;  1XHX A;  1P7G A;  2XUM A;  4JF3 A;  3KZI Z;  1JJ2 U;  2VS0 A;  3AG4 B;  2Z3Y A;  1QVG U;  4DR5 B;  1ZTE A;  3JD1 A;  2W0X A;  3W7W A;  2V7Q G;  5GTH Z;  2HHH O;  1IXM A;  1OCZ B;  1G1X B;  4TV8 A;  3BFR A;  1URF A;  1JMK C;  1PD3 A;  4JI3 B;  1L1F A;  2XND G;  3RYF B;  2E5L O;  1S0V A;  3L70 H;  1AI7 A;  5J2U A;  1M5I A;  1XOU A;  4J10 A;  1KUQ A;  2IU3 A;  3L74 H;  4JI5 B;  1GO3 F;  2Y48 A;  3T4Z A;  4PA4 A;  1P4R A;  2ZNJ A;  4DV0 B;  2IJI A;  3AK2 A;  4MTG A;  4DUZ B;  2LFR A;  2QA4 V;  2OWO A;  4FLW A;  2QKA A;  3SJC C;  3JAT A;  4D6T H;  3EVK A;  1S77 D;  1V54 B;  2JEX A;  3T4D A;  2Q73 A;  4MVQ A;  4JGS A;  4TUY B;  1AR5 A;  3BPZ A;  3ETD A;  2OTL V;  1P49 A;  3OTO B;  3SPC A;  2JJ1 G;  1EZJ A;  4UCV A;  4F4L A;  4O2A A;  1WLE A;  4PDL A;  1XDC A;  3VQW A;  1K73 W;  2CGO A;  2CE4 A;  1XMQ B;  1B06 A;  4DR6 B;  1D5N A;  3JCU Z;  4GYC B;  1WPX A;  4BIZ A;  3CCL V;  3DXR B;  2GHY A;  1H2M A;  4C7U A;  2UXB O;  2RMK B;  1R3J C;  3AG7 A;  3ETG A;  4WBN B;  1YEW A;  2R70 A;  2PUS A;  4B3T O;  1EN6 A;  1GM7 A;  2AGA A;  5KA5 A;  4YJ2 B;  3E2E A;  3WB2 A;  3JAW B;  1ZWI C;  4J42 A;  2Y69 C;  2R9A A;  3ZHU A;  5BZB A;  3QVN A;  3JAS B;  4X1I A;  1K8A W;  1XL4 A;  3ZBH A;  2DQ3 A;  3RYC B;  3H1K H;  4DUY O;  3K0D A;  1R73 A;  4TOI A;  2CK3 G;  2ITD C;  1OV9 A;  3T1H B;  3CXH F;  3ICX A;  4FLX A;  5IDJ A;  1HP8 A;  1ZAU A;  2JJ2 G;  3E83 A;  1VQ4 V;  3X2Q B;  5LOV A;  1H2K A;  4LFB O;  2FYU H;  3HKC A;  4WFG A;  1H2S B;  4JI2 O;  4DV1 O;  1E1Q G;  4RUF A;  1QLN A;  1K5S A;  3JSN A;  1WA8 B;  1QU7 A;  4I4T B;  5LXT A;  4IIJ B;  5L3F A;  1XNR B;  2XAG A;  2ZXW B;  4FFB A;  3B2E E;  1HNW B;  1DLB A;  4J80 A;  4CH6 A;  1QVF U;  4CS2 A;  2XOK G;  1YCI A;  2KG7 A;  4JYA B;  3K5N A;  1TUE B;  4D7S A;  5IYC O;  1WB8 A;  1SS3 A;  2EIK C;  1I94 O;  1IBM B;  4LFA B;  3OR7 C;  3ZHT A;  1KP3 A;  1BHA A;  4OXS A;  4B3R O;  4YHH O;  1GN4 A;  1N33 O;  1NQT A;  2R9I A;  2RNB A;  3FAV B;  1WJZ A;  1VEW A;  4JZ2 A;  2ZE7 A;  3IC9 A;  2ETN A;  3U0Z A;  4DV3 B;  1SF9 A;  2ODM A;  3BA8 A;  1E79 G;  2YEV B;  3HR0 A;  5BR8 O;  1XNQ O;  1T5E A;  3N2K B;  2F4V B;  2H8P C;  1TVK A;  3ZS8 C;  2ZDI C;  4GT1 A;  1SQG A;  4DV5 O;  4JI0 O;  5H2F Z;  2P06 A;  2RN9 A;  1Q86 W;  3ZMS A;  5IJ0 B;  1BMF G;  1R3I C;  2QDO A;  1ROP A;  1B3Q A;  3DGE A;  4J9Z B;  5DM6 V;  1X4T A;  1N0J A;  1QQC A;  2P67 A;  5IYZ B;  1TGO A;  3JYC A;  1KYO F;  3JAM N;  4ICG A;  2Q8V A;  4MTF A;  2X6A A;  1SQQ H;  1VQP V;  1RFY A;  1JPX A;  1IUR A;  4BIU A;  3RFR A;  4MVU A;  3MHS C;  3AEI A;  5BY1 A;  1BT8 A;  2M6Y A;  3ZN0 A;  1J95 A;  1OCO C;  1R6T A;  2ZM6 B;  3TXQ A;  2WLI A;  3CC7 V;  3A2F A;  3AG2 B;  2F1M A;  3FYI B;  1VQK V;  1THZ A;  2LO1 A;  1QHT A;  1HDJ A;  3SJA C;  1EFR G;  5LMU O;  2HG5 C;  5JVD A;  1PKX A;  2IJH A;  1H8E G;  5EC2 C;  1K5Q A;  2VRZ A;  2QTO A;  1X59 A;  4O4I B;  2BTQ B;  3HKB A;  5DED A;  3N2G B;  1Q8I A;  4DV4 B;  4CC6 A;  4RO2 A;  3OUF A;  1Y67 A;  4GZR B;  3K5M A;  2BOB C;  4PI0 A;  1N34 O;  2LP7 A;  4YXW G;  1K7D A;  5GON B;  3E8B A;  4DR1 B;  1G4Y B;  5B1A B;  4XBF A;  4UCS A;  4LC1 A;  4ABM A;  2F93 B;  1YF2 A;  4I50 A;  5EBM C;  1SA0 A;  4K8X A;  1SQF A;  4LNU A;  3UM7 A;  1D5A A;  1Y76 B;  4NTY A;  2H3O A;  4JI3 O;  2Q0O C;  2JGD B;  4L87 A;  1VF6 A;  3HKE A;  1KU9 A;  4NXM B;  4B3M B;  3TGU H;  3MDS A;  3THO A;  2QEX V;  1JOY A;  4O2B B;  3CC2 V;  2X7R B;  1GN2 A;  1ZUQ A;  3L72 H;  3RYH B;  4PV1 B;  1KKD A;  1LUW A;  3J81 N;  4LF4 B;  4YIO A;  5LP6 C;  3QO7 A;  1R3K C;  5IT9 N;  4L8J A;  3CRC A;  1DK1 A;  2A9H A;  2UUB O;  4JI1 B;  5KMG B;  3SPH A;  5IYD O;  3KG2 A;  1RM1 C;  4X20 A;  2CAZ C;  4WF9 V;  4PEL A;  1IBK O;  2F66 C;  1SQB H;  5HFM A;  3OGI B;  1XMQ O;  2EJR A;  2HEP A;  2VQF O;  1ZL8 B;  4JTC B;  2YIB D;  3OR6 C;  3QO5 A;  2YDE A;  5DN6 G;  1HNZ B;  3FFQ A;  3QO8 A;  4UVA A;  3M8A A;  1VF6 C;  3TCU A;  4ASU G;  3HKD A;  1Q3E A;  2BE3 A;  4OX9 O;  1OJH A;  1IX9 A;  1RSO B;  1F23 A;  3HB3 B;  4X88 A;  4CH4 A;  1PNL A;  1MSD A;  5H9C A;  1ZX3 A;  4MVM A;  2QJ1 A;  2PI5 A;  4DV2 B;  3A0R A;  1Q81 W;  1MMM A;  1SER A;  3OEH G;  4FM0 A;  5LGT A;  1XI1 A;  3CME V;  1V9P A;  2QTS A;  3H9V A;  4KFM A;  3T1H O;  1VAR A;  2R9R B;  2F23 A;  4Q20 A;  3SGI A;  4DR3 O;  2UUC B;  4H33 A;  2B1G A;  1B6Q A;  2DYR C;  2Y0I A;  4NXN B;  2YSU B;  3DTU B;  3ETQ A;  1WP8 A;  1N8R W;  2ITC C;  1M4U A;  5B5E Z;  3I56 V;  5LMN B;  4I9W A;  2UU9 B;  4PA9 A;  4X8A A;  1XNR O;  2IJJ A;  3CMA V;  1W59 A;  3U11 A;  2OIG A;  1FPO A;  5EIB D;  3DC5 A;  5EC1 C;  4X1K A;  4JYA O;  3QG5 A;  2EIM C;  4TQD A;  4LFA O;  4UVB A;  3SJQ C;  1YJN V;  1OCC B;  3SDL A;  4FLU A;  3R66 A;  1GKF A;  3TK1 A;  3UQ8 A;  1LNQ A;  2KKW A;  2JEU A;  4LCU C;  1JR9 A;  5JJE B;  4FLY A;  5B66 Z;  3UT5 A;  4UFZ A;  3F5W C;  4ZI7 B;  1MZF A;  4GKK O;  2EX3 A;  5D5P A;  1KD1 W;  2DQ0 A;  2EIL B;  4J7K A;  4MT8 A;  4DK1 A;  2XAF A;  1HNX B;  2QWO B;  1VQ5 V;  3K5L A;  1NZ6 A;  3ZJZ A;  3NXS A;  4CH5 A;  3SYC A;  1YIT V;  5LGN A;  2QGN A;  1FYJ A;  3C3S A;  1U97 A;  2LFS A;  1FJG O;  2P6J A;  2K1E A;  4FFK A;  4IGG A;  3U10 A;  5C8Y A;  2UXC O;  5E1A C;  3ZRX A;  4YY3 B;  3RWR D;  1TA8 A;  1DF4 A;  4X66 B;  2RJZ A;  1O9H A;  3CCS V;  4LH7 A;  2IM9 A;  4Z1V A;  3AG3 C;  4IYI A;  5J2U B;  2G38 A;  1YI2 V;  1N32 B;  3G80 A;  2HVK C;  5IE9 A;  5IJ9 A;  2A3Q A;  1NH2 D;  1VQ8 V;  5J9P C;  3CC4 V;  1DF5 A;  1NT2 B;  4J11 A;  4KP4 A;  3ZMU A;  1NR1 A;  4O4J A;  2PF4 E;  1NH2 B;  4QJF B;  4HBN A;  1RPR A;  2FTK A;  4MVZ A;  4B3S B;  1P7B A;  4W4L A;  2EBO A;  4MTO A;  4WFH A;  1I08 A;  3L73 H;  4O2A B;  4XDJ A;  2FML A;  4BR6 A;  3AK1 A;  1VQN V;  1N36 O;  1LR1 A;  2UXD O;  4I55 B;  1DTO A;  2EIN B;  3STL C;  3OUS A;  2GDS A;  3W7S A;  4XDK A;  1XMO O;  2JGU A;  1H38 A;  4UV8 A;  4FZ1 A;  3K04 A;  2V4D A;  2GUZ A;  1XEQ A;  2ZCE A;  3T1Y B;  5B1N A;  2EIJ C;  1SQP H;  4X1I B;  2WLK A;  4UB6 Z;  1VQ7 V;  4LFC B;  3RVZ A;  1K3E A;  3CCU V;  4NB5 A;  1K34 A;  4FK5 C;  4AQY O;  4DR2 B;  4JAA A;  2CGN A;  5LL6 Y;  2ZD9 A;  3BCC H;  4LBE C;  5CA0 A;  1YJW V;  5LOV B;  4XDL A;  3ASO B;  3G71 V;  4KUM A;  1QLE C;  1B04 A;  3HKC B;  3ABU A;  3ZHS A;  2RDC A;  2HLD G;  2IW5 A;  2OCC B;  2QWN B;  3OMN B;  1FXK C;  1KB9 F;  3ZED A;  4PDM A;  4O4L A;  4DO2 A;  2EZO A;  5LXT B;  3JAR B;  4LF7 B;  4FFB B;  3MD0 A;  4U3J A;  1I0H A;  1OZ0 A;  2Q0A A;  2B1I A;  2ZE6 A;  4LF6 B;  3SPI A;  5EYP A;  4BIO A;  3ASN C;  2KG7 B;  4G28 B;  1N0N A;  3ABT A;  4WFF A;  3ABK B;  1KP2 A;  5BMV B;  4DR7 O;  2WAM A;  3UO3 A;  1BCC H;  5FPR A;  4X64 B;  1MA1 A;  3ZN1 A;  1NI8 A;  5L3G A;  3MHH C;  2YXY A;  1V55 C;  3LSU A;  4PA3 A;  3JD2 A;  1UPG A;  1YIJ V;  5KLV H;  1OCO B;  1SKV A;  2P4V A;  3H1J H;  1GTO A;  4X65 B;  4YJ3 A;  4PD4 F;  4LR3 A;  4EB6 B;  4LWS A;  4ZOL A;  2Q6A A;  4GX5 A;  4ZBM A;  5JJJ B;  3F7V C;  1BQZ A;  2DWD C;  1TVK B;  2IH3 C;  2Y4U A;  4JI4 O;  3K79 A;  3L75 H;  4LF9 B;  3DC6 A;  2BCC H;  2DMX A;  5B3S B;  4B08 A;  3WB0 A;  3M7M X;  3OM3 B;  4GKJ O;  1FFX A;  2ZDI A;  2WSS G;  5K1X A;  5LYJ A;  3M99 B;  3P3N A;  2DYS C;  1PP9 H;  1WN7 A;  4DW1 A;  3BVO A;  5A2Q N;  3DSQ A;  5KHK A;  1PPJ H;  3LNN A;  4JTA B;  2HR3 A;  3B8M A;  2IBZ H;  1WB7 A;  3CS5 A;  3QTC A;  3AG4 C;  2PYL A;  4K35 A;  3K9S A;  2UXN A;  3C3T A;  3ZRW A;  2Q69 A;  2Q7G A;  2GTA A;  3DXR A;  1YSC A;  2WLI B;  4J41 A;  2OYQ A;  1OCZ C;  2LQT A;  1FXH A;  2Z0A A;  2P4K A;  2ILM A;  1AB3 A;  2A79 B;  5JVD B;  4JV5 B;  3JAW A;  3P3P A;  2YXL A;  3ABM C;  3HKB B;  2XAQ A;  3CRM A;  2QM4 A;  2VQE B;  5H6R A;  1GN3 A;  1AP6 A;  2DJV A;  2FKX A;  1H2N A;  2AXT Z;  3N27 A;  1FFT B;  1RM1 B;  1VQL V;  3CE2 A;  4J7Z A;  2BSK B;  4PDV A;  4CH3 A;  3K59 A;  4TV9 A;  4D7T A;  3ZMZ A;  2UUA B;  1CPY A;  4GX2 A;  4H37 A;  4I50 B;  3SJB C;  1A32 A;  1SA0 B;  1MZE A;  4PA6 A;  1JCH A;  2RQ6 A;  4LNU B;  3WU2 Z;  1PM9 A;  2ZE8 A;  1QBZ A;  1WA8 A;  4LF5 B;  2L35 A;  2JIZ G;  1EN4 A;  2ZE5 A;  3HKE B;  4IIJ A;  3RVY A;  1M93 A;  1Y4M A;  4R50 A;  3F5T A;  4CS3 A;  1OCR B;  5LHI A;  1CXZ B;  3OTF A;  4NR1 A;  3D36 C;  4LF8 O;  1NJI W;  2DWE C;  1J5E B;  2YXH A;  5KA6 A;  1IBL O;  1M56 B;  2MW2 B;  1M57 B;  5J2T A;  5L3E A;  4JAV A;  1F4M A;  4K8Z A;  4GLX A;  3BHP A;  4F6R A;  4MVR A;  3IGA C;  5KUM A;  5CBG A;  3ZHV A;  4X20 B;  5LP6 A;  4DV7 B;  3K03 A;  1KBH A;  3X2Q C;  4X62 B;  3GWK C;  1VQ9 V;  5LGU A;  2P5O A;  1S5H C;  3W7U A;  1HR0 O;  1WPB A;  3CWB H;  5CB4 A;  4JI8 B;  1NTK H;  1H8H G;  4H13 B;  2V1D A;  4JI6 B;  3RYI A;  1N4C A;  5K1P A;  4JYB A;  4DR5 O;  3OAA G;  4I0X A;  3JD4 A;  3AG1 B;  4GUN A;  4X89 A;  5IY5 B;  3E22 A;  1M9N A;  2B9Z A;  2ZXW C;  2KB1 A;  4LP8 A;  4E2L A;  3ZHR A;  1R1B A;  2EIM B;  1YJ9 V;  2N05 A;  2OT5 A;  3JD3 A;  2ZIM A;  3ZCC A;  3IC7 A;  4BWA A;  4GX0 A;  1PL4 A;  3SYQ A;  4WFA V;  3BEH A;  2FB5 A;  2CTW A;  3E8F A;  4JI5 O;  2OCH A;  3E89 A;  3WB1 A;  2YI8 A;  4DV0 O;  3Q4H A;  2AHZ A;  1CP9 A;  5KX5 B;  1NKD A;  3S3W A;  4DUZ O;  4IT5 A;  2IU0 A;  1GK9 A;  2YIA A;  1Z5V A;  3H1L H;  1BHB A;  1GRJ A;  4ZHQ A;  4RQE A;  3K5O A;  3ABL B;  1M90 W;  2N04 A;  3OTO O;  2X0L A;  2WLJ A;  3D3Q A;  4LF7 O;  5EBW C;  4QE9 A;  2W6J G;  5A9G A;  4DR6 O;  1KEC A;  3ZMV A;  2BOC C;  5EBL C;  5HFL A;  4X1K B;  3CCV V;  5LA6 A;  4MVS A;  4PDR A;  4WFB V;  2XHB A;  3PJS K;  3GB7 C;  4UB8 Z;  3G6B A;  3B77 A;  3G6E V;  4O4I A;  1QNM A;  2A7W A;  2CH7 A;  4IHJ A;  3G67 A;  5EZY A;  1DGS A;  4DRX A;  4B3T B;  1S76 D;  3UT5 B;  1UFI A;  3VQX A;  5B1B C;  2Y4T A;  2XT9 A;  4O4H A;  4N23 A;  3L9D A;  1Y74 B;  5ITZ A;  1K4C C;  2YI9 A;  4WCE V;  1EM1 A;  3K57 A;  3JAL A;  2YC0 A;  4DUY B;  3PN1 A;  3ZHQ A;  3OEE G;  2QM7 A;  4BW5 A;  4P2Z A;  3IFX A;  4KXR A;  4DW0 A;  4QGP A;  5EK0 A;  3RBZ A;  2QKC A;  3BAB A;  3FB5 C;  1YHQ V;  4LFB B;  3AG2 C;  1KC8 W;  4CC5 A;  1M1K W;  4DR4 B;  4PHZ A;  4DV1 B;  1TUB A;  2WLH A;  3JD0 A;  1VF5 B;  4JZG A;  4X1Y B;  2YUA A;  3RYH A;  4FM1 A;  3W7X A;  3VBB A;  5KHG A;  1HNW O;  1S5L Z;  1NS1 A;  1WP7 A;  1JJO A;  2GSM B;  3VQY A;  5IJ9 B;  3SYO A;  1WNS A;  5GTI Z;  3J7A U;  2EIJ B;  1IBM O;  1SQX H;  1YZB A;  4TWK A;  1Q6I A;  4O4J B;  4U7O A;  1HWY A;  3S3X A;  2CTQ A;  1L8D A;  1VQ6 V;  4B3R B;  4YHH B;  4GCZ A;  1N33 B;  4PJ0 Z;  3WG7 C;  3KKY A;  1H2G A;  1FD9 A;  4DV3 O;  4JV5 O;  4OPH A;  2WPD G;  1R6K A;  2VQE O;  2NN4 A;  3EFF K;  2XAH A;  2F4V O;  2NNU A;  4FIP C;  3K9A A;  5L3B A;  1MOF A;  3ASN B;  1YVW A;  1MNG A;  1RPO A;  4JAS A;  2GUZ B;  3KCY A;  2ZIO A;  3E8H A;  5L3C A;  4RWU A;  4TQF A;  4TV8 B;  4DV5 B;  1SQV H;  2E75 B;  4JI0 B;  3OW2 U;  1IVS A;  3CCJ V;  2E3C A;  2AW9 A;  4JI7 B;  1R6N A;  1US6 A;  2Q9L A;  4AI8 A;  4U7N A;  2Y69 B;  1FXV A;  4ZKI A;  3B09 A;  4I7Z B;  5IWA B;  3ETE A;  5CA0 B;  1NTM H;  2ZNI A;  4UXN A;  1XIL A;  3A8T A;  1NTZ H;  3CJH A;  3JAT B;  2XAJ A;  2X6C A;  3VQV A;  3OFN G;  1BQ0 A;  2YIC A;  2ZM6 O;  2R72 A;  2A06 H;  4O4L B;  4F6E A;  1SRY A;  5KHH A;  2GV9 A;  3FYE B;  4U3J B;  3STZ C;  3E86 A;  3CRR A;  1AVM A;  4FZ0 A;  5EYP B;  1FXK A;  5CA3 A;  5JQG A;  4IL6 Z;  5LMU B;  2JVD A;  3OGC C;  4P9P A;  4DV7 O;  4DV4 O;  3K0G A;  1XBL A;  2MK3 A;  5CA1 A;  2CTP A;  1F4N A;  1AI5 A;  2DYS B;  3B40 A;  1XHZ A;  2P22 C;  2OIE A;  2L6L A;  4DR1 O;  2UXX A;  2EIK B;  1N34 B;  3UCS C;  2QR4 A;  1I5X A;  1KKC A;  4JPR A;  5KHI A;  4JAU A;  4A5U B;  1G6U A;  4DYL A;  2ARH A;  1JFF A;  4AHC A;  1KQS U;  2LW1 A;  1AI6 A;  2EZP A;  1XUQ A;  1Y66 A;  3FD9 A;  4YJ3 B;  4LWS B;  2QWR B;  3JCZ A;  5KUK A;  2P90 A;  4ZOL B;  5JH7 A;  1VQO V;  1KMI Z;  4NXM O;  4B3M O;  5EIB C;  4YIP A;  4Z1M G;  2WWW A;  1OCC C;  2Q67 A;  4P9O A;  3SR2 C;  5JCO A;  4QNH B;  4GX1 A;  3JAK A;  2WLL A;  3CRQ A;  3MAQ A;  3ABM B;  4LF4 O;  4MW8 A;  2ADQ B;  2ATK C;  3LUT B;  1FFX B;  1ZSP A;  2QM8 A;  4HYO A;  5LYJ B;  2LW7 A;  1K9M W;  1BE3 H;  2ZR3 A;  2PY5 A;  4JI1 O;  4H44 B;  3ZIA G;  2EIL C;  1ORQ C;  3IAY A;  1QR8 A;  1F51 A;  2UUB B;  1BSM A;  2Q68 A;  1K4D C;  3CYO A;  5FNV A;  1BL8 A;  3CCM V;  3OMA B;  1IBK B;  2N74 A;  1JA8 A;  1EZV H;  1AR1 B;  3ZRW B;  2QE7 G;  1Q6U A;  1NBM G;  2EJ7 A;  2VQF B;  1HNZ O;  4HNA A;  2LGW A;  3K08 A;  5LBQ A;  4B7K A;  2ADP A;  4I55 A;  3KCX A;  3QNE A;  1GM9 A;  3BAA A;  4UUJ C;  1HW7 A;  1TAE A;  3SYP A;  2XAS A;  1PL0 A;  4UCO A;  5JCO C;  4DV2 O;  4OX9 B;  4HZ3 A;  2JS3 A;  3F7Y C;  2D3O W;  2QKS A;  3RYF A;  2CDY A;  1FS0 G;  2UUC O;  4UCT A;  3C90 A;  4FPP A;  1SES A;  4QE7 A;  2Q7H A;  4TT3 G;  3L71 H;  4DR3 B;  4NXN O;  1MAB G;  5JJN B;  2HJD A;  3J80 N;  1GN6 A;  2W6I G;  4TV9 B;  1VF7 A;  2WLM A;  1ZLZ A;  1Q43 A;  1VP7 A;  2A0L A;  4DV6 B;  4H0L B;  4DR4 O;  5LMN O;  1JQ0 A;  2ZT9 B;  4EKW A;  1K97 A;  1AR4 A;  2UU9 O;  1QR9 A;  1Q90 D;  1EBO A;  5JWP A;  4TUY A;  4G2K A;  2K9P A;  4P30 A;  3K06 A;  1GAX A;  3JAR A;  2EIN C;  1OHH G;  3IJ4 A;  1WAZ A;  1SZX A;  4CS4 A;  4MS2 A;  4NTX A;  1ARO P;  4J9Y B;  5KAI Z;  3LDD A;  4KL1 A;  5D5Q A;  3CPW U;  5BMV A;  2O57 A;  2HP8 A;  4WBN A;  5CMU A;  1Q7Y W;  1Q82 W;  5TIS Z;  5J2T B;  2PI4 A;  2W0F C;  1R3L C;  2WLN A;  3OE7 G;  3D36 A;  5AG2 A;  3A0B Z;  4F6R B;  4YJ2 A;  2AZ2 A;  2PYJ A;  2IJK A;  3E8G A;  3CHX A;  5LP6 B;  1L0N H;  3AK3 A;  3NR7 A;  3JAS A;  3WFV A;  2QWP B;  3ASO C;  2X6B A;  4MSW C;  4UV9 A;  4TSF G;  4UVC A;  4GKK B;  1SET A;  3B4S A;  3RYC A;  1HNX O;  2DE0 X;  3CCE V;  4N21 A;  5CB4 B;  3FB8 C;  3FX7 A;  3CXC U;  2ZKO A;  3TXS A;  3GWO A;  4Q6G A;  1V54 C;  2OCC C;  3RYI B;  4EB6 A;  3RT3 C;  4K0K B;  1GMG A;  2VWK A;  4I0X B;  4I5S A;  1CEZ A;  3E22 B;  3FB7 C;  1L0L H;  5LHH A;  3OT7 A;  3APQ A;  4U3F H;  1XRE A;  3EHB B;  1AJQ A;  4YY3 O;  2ZIN A;  1FJG B;  4X66 O;  2KSD A;  3LDE A;  2UXC B;  5IYB O;  4I4T A;  3ABK C;  4LH6 A;  4FLT A;  3QF7 A;  3G4S V;  2VWJ A;  2DOS A;  1N32 O;  4JI7 O;  4QPJ A;  1W0J G;  1Z2G A;  5IWA O;  2AHY A;  5B1B B;  5H5N A;  3P30 A;  1E1R G;  3RW0 A;  2JRI A;  3Q4H B;  5FL7 G;  2PTM A;  4JTD B;  3A0H Z;  3I55 V;  1NR7 A; 
#chains in the Genus database with same CATH homology
 1XNR O;  4DR5 O;  1AB3 A;  1AIL A;  4DR7 O;  4B3S O;  4LF4 O;  4X64 O;  3J81 N;  4JYA O;  5BXZ A;  4LFB O;  1R1B A;  2HHH O;  4JI2 O;  2LW7 A;  2DJV A;  5IT9 N;  1G1X B;  4DV1 O;  3JAM N;  4LFA O;  1D2D A;  4JI1 O;  1N36 O;  2FKX A;  1DK1 A;  3O65 A;  3SDL A;  2UUB O;  2UXD O;  3R66 A;  2E5L O;  4K0K O;  1KUQ A;  4X65 O;  2UUA O;  4JI5 O;  5BY1 A;  1IBK O;  1XMO O;  1HNW O;  2ZM6 O;  1NS1 A;  2N74 A;  4DV0 O;  1XMQ O;  1R6T A;  1A32 A;  4DUZ O;  2VQF O;  4GKK O;  3T1Y O;  3J7A U;  1HNZ O;  1XEQ A;  4LF5 O;  1IBM O;  4LFC O;  1HNX O;  4JI4 O;  1I94 O;  5LMU O;  2ZKO A;  4LF9 O;  1YZB A;  3M8A A;  3OTO O;  4DV7 O;  4DR2 O;  4AQY O;  3F5T A;  3RT3 C;  4DV4 O;  1X59 A;  4OPA A;  1F7Y A;  4OX9 O;  4LF7 O;  4DV2 O;  1FKA O;  4B3R O;  4GKJ O;  4YHH O;  5LL6 Y;  4DV6 O;  1N33 O;  1FYJ A;  1J5E O;  4DR6 O;  4LF8 O;  1FJG O;  4YY3 O;  4DR1 O;  1IBL O;  1N34 O;  2UXC O;  4DV3 O;  5FLX N;  5A2Q N;  4X66 O;  2UUC O;  3T1H O;  4JV5 O;  4DR3 O;  2UXB O;  4OPH A;  2DOS A;  4NXN O;  4JI7 O;  1N32 O;  4A5U B;  2VQE O;  4X62 O;  3J80 N;  4B3T O;  4KHP O;  5IWA O;  5BR8 O;  2AGA A;  2F4V O;  5H5N A;  1XNQ O;  2JRI A;  4LF6 O;  1HR0 O;  4JI8 O;  5LMN O;  4DR4 O;  4JI6 O;  4JI3 O;  2UU9 O;  4NXM O;  4B3M O;  4DV5 O;  4DUY O;  4JI0 O;  2Z0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...