4YY3O

30s ribosomal subunit- higb complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4yy3O00
3J81N 1N33O 2DJVA 4DR5O 1HNWO 1X59A 3OTOO 1I94O 4DUZO 4JV5O 4NXNO 2DOSA 2AGAA 1XMOO 2UUCO 4DUYO 4DV6O 4DV4O 4KHPO 4DR1O 5IWAO 1A32A 4DV0O 5BY1A 1AILA 4DR7O 1HNXO 1XNRO 4YY3O 4DV7O 1IBLO 4DR4O 1DK1A 4LFAO 3R66A 4GKKO 4OPHA 2VQFO 2JRIA 1G1XB 1FKAO 4X66O 4LF9O 4DV5O 1FJGO 3T1HO 4OX9O 1HNZO 2Z0AA 5BR8O 4JI8O 4LFCO 4JYAO 1N36O 2UXBO 3JAMN 1J5EO 3O65A 4JI2O 2ZKOA 4B3TO 2UXDO 5FLXN 4DV1O 1IBKO 2LW7A 1IBMO 4X65O 3RT3C 4LFBO 1HR0O 1R1BA 4JI1O 4B3MO 5H5NA 2N74A 4X64O 2HHHO 1AB3A 1XEQA 4LF7O 4K0KO 5BXZA 4LF4O 5LMUO 2UUAO 1XNQO 4JI3O 4JI5O 1N32O 4DR2O 1XMQO 4A5UB 4B3RO 1YZBA 4OPAA 1FYJA 4B3SO 3J80N 2E5LO 2FKXA 1KUQA 5IT9N 1D2DA 3T1YO 1R6TA 4JI6O 4JI0O 4X62O 4DV3O 4DV2O 4LF5O 2VQEO 4GKJO 4DR6O 3SDLA 4LF6O 3J7AU 1NS1A 4JI4O 4AQYO 1F7YA 5A2QN 4JI7O 4NXMO 2UXCO 3M8AA 5LL6Y 2ZM6O 2F4VO 4YHHO 2UU9O 2UUBO 4LF8O 4DR3O 3F5TA 1N34O 5LMNO
chains in the Genus database with same CATH superfamily
5EIBC 4FLVA 4YIPA 3QTCA 3ABKB 5CB4A 4L8JA 1KKDA 4DO2A 2QEXV 4TOIA 3SJCC 1WP7A 5L3BA 3D8CA 3H1HH 1TAEA 2IU3A 4O2AB 3K03A 3SJBC 5C8YA 2BOCC 1YJ9V 1URFA 1E1QG 1RSOB 2HKOA 1BCCH 1OV9A 2WPDG 1WB7A 1SA0B 1JMKC 5GONB 4LFAO 2K1EA 4MSWC 4JYCA 1NBMG 3T1HB 3L74H 1S5HC 4UVBA 4OX9O 3SPGA 1H2MA 4N23A 3BY6A 3W7XA 3EHBB 5LP6C 4DV1O 4O4LA 1PM9A 1S0VA 3E35A 4XDLA 1U96A 5LMUB 4PA3A 3SPHA 4WFBV 2LFRA 3L75H 1YTFB 4I4TB 2WLNA 1I7FA 1S77D 4MVSA 4JI2B 3AG3C 1COWG 5KUMA 5IJ9B 3FAVA 4A5UB 1Y76A 3LSQA 5B3SC 1XBLA 2E5LO 4IYIA 5CBHA 4DRXA 3OUFA 5CA1B 3B09A 4RO2A 1R6TA 4DV3O 3EFFK 5KMGB 2FTKA 3SYCA 1SZXA 2R9AA 4LF6O 2FMLA 4WF9V 2P7TC 3CC2V 5J2UB 4HNAA 1JX9A 5JH7B 3RVZA 2QE7G 4PDLA 2Q0OC 1VQ5V 4XDJA 5IYCO 1QR8A 3M7MX 3RYIA 4X8AA 2CE4A 3L72H 5CBGA 4JI0B 5L3DA 2B5UA 2QTSA 3CE2A 1MABG 1I94O 4DUZO 2DW4A 4J7ZA 1HDJA 2HFEC 2AHYA 5L3EA 4FFBB 4DV6O 1VQ4V 3ZMUA 2P67A 3F7VC 4KUMA 5F2VO 4JASA 4WBNA 1QNMA 1H2NA 2XAJA 3N27A 4DR5B 3WU2Z 4UB8Z 4UCTA 2P4KA 3PN1A 2UUCB 4DUYB 4NR1A 4JI8B 1WP8A 3ZRWA 4EEQA 4KHPB 1OCOC 2EIMB 4IIJA 1OJHA 4J10A 3FD9A 4D7SA 3DC5A 1N8RW 2EBOA 3BHPA 2ZQMA 2G38A 3EXAA 1H2LA 2AXTZ 3IJ4A 3ZHUA 3E8GA 3CHXA 3BABA 2ARHA 1Z2GA 1QVGU 1AJQA 2OWOA 2HHHO 4K0KO 1N32B 2WLJA 5CN0A 1ZAUA 4JI3O 1WJZA 2KG7A 3CCLV 3OEEG 4B3SB 1SQPH 4O4JA 4O2AA 5LOVA 1ZTEA 5E1AC 3BPZA 2CDYA 5BMVB 2VQEB 4TV8B 4FM0A 1WPXA 5D5QA 3SR2C 1M57C 1NKDA 2LQTA 2A9HA 3N2KA 2F4VO 4UUJC 4FJCC 3UO3A 4CH3A 1G4YB 1JA8A 5FNVA 2LP7A 1G8MA 1ZX3A 4JI6B 2L6LA 4DK1A 2RNBA 3E86A 4PDVA 1XMOO 1GKFA 3QO7A 3JYCA 4JPRA 4I4TA 2V1DA 1IZ3A 3MHHC 4DV0O 1BQZA 1SKVA 1N0JA 1XNRO 5H9CA 2JEUA 5LP6A 1VQPV 1IBLO 1YEWA 2ZR3A 1ENVA 2YIBA 1Q5OA 2Q4PA 1P7GA 2ZDIC 2C2AA 3F7YC 2GUZB 3RYCB 5BR8O 5KMGA 2JK5C 4NTWA 3OMNB 1OCZC 4UV8A 2JVDA 2YXYA 4JF3A 2JEXA 1FD9A 4U3JA 4LFAB 4JI1B 4JYBA 1K7DA 4B3MB 5HFMA 1WPBA 1R1BA 3OMIB 2OIGA 1THZA 3HR0A 3ABMB 1K92A 1B3QA 2WA4A 4BR6A 4TV9B 4OX9B 4J7KA 2IH3C 1KKCA 1XNQO 1BGYH 2VWKA 2EIKC 3QF7A 4O2BB 3OEHG 1SC5B 2WSSG 2CGOA 2DE0X 4DV1B 3WB1A 4IL6Z 2LGQA 4OPAA 3WG7C 1FYJA 3W7SA 2FYUH 4U7OA 3UKMA 3JATA 2QTOA 1TUEB 4LF5O 4JI4B 4AQYB 1RPRA 3QVNA 1VQ6V 1NS1A 4CC6A 3B4SA 4X20B 3CMAV 1HWYA 4B7KA 1M90W 1PL0A 1MSWD 2E5LB 2BOBC 3AK2A 1NR1A 2AW9A 2UXXA 1N33O 1FFTB 5LGNA 4DV3B 4PV1B 3OTOO 4X1IB 4LF6B 5GTIZ 2DQ3A 4DR1B 3ICXA 1NZ6A 2ZINA 4MVMA 4X88A 3SPJA 5IWAB 2ZCEA 2QM8A 1O9HA 4X1KB 3RYFB 1AILA 2GTSA 2VRZA 3O9OA 2K9PA 1Q86W 2PYLA 2Z3YA 4FLXA 2PYJA 1AVMA 1Y74B 4RUFA 1I94B 4DUZB 4O4IB 1TUBA 1W59A 1NTKH 4DV6B 2Q6AA 3T1HO 2JGUA 2YS8A 3P32A 4TV8A 1ZSPA 2KB1A 5EBLC 1KC8W 2UXBO 4DW0A 4LH7A 2OCHA 4B3TO 3QNEA 3AG1B 3A0BZ 2YXLA 3JASA 4NVPA 1R3KC 3OAAG 2QWOB 4LF7O 3JD2A 2NN4A 3LNNA 5LMUO 3K59A 5J2TA 4BW9A 1P84F 1K5SA 4ABMA 2WLLB 3TXSA 3AEIA 1VARA 3IC7A 1VIBA 2YIDA 2AZ2A 5KHJA 2Q5ZA 4QE7A 4QNHB 2FKXA 2QWNB 3T1YO 5H6RA 1VQKV 5CB4B 3T1CA 5LHHA 3ZHTA 2R70A 2Q7HA 3K57A 1NTZH 5L3GA 4Z2WA 4GKJO 1B06A 3H9VA 3J7AU 1IXBA 2UXCO 4UCRA 5C8YB 2AHZA 1R3IC 2JIZG 2QKCA 2QWPB 1XREA 4GX0A 1CXZB 4LF8O 3C90A 4X89A 1GRJA 5LMNO 4CS4A 2DJVA 4YJ2A 1FXKA 3ZBHA 2ZT9B 1XDCA 1Q82W 3E8BA 1Q43A 5K1XA 4DV4O 3ABLB 2M7WA 1E79G 3U11A 2HEPA 4Q20A 5IJ0A 2F4VB 4I0XA 3ZX6A 3BAAA 3ABUA 4FM1A 2D2CB 4O4LB 4DR7O 3F5WC 2IBZH 3CJHB 4UVCA 1Y66A 1Y4MA 5KHIA 1DK1A 3L71H 4MT8A 4UFZA 3FX7A 3CB2A 3R66A 1XMOB 4X66O 3S3WA 3DGEA 2EILC 4J80A 1GAXA 1ZUQA 2Z0AA 4JI8O 4JYAO 4DV0B 3M99B 2HJFC 5KAIZ 4XBFA 1Y76B 4FLTA 3BEHA 5AG2A 3TJTA 2ATKC 1IBLB 3U10A 4DRXB 4JTAB 4UXNA 4PA6A 3OD4A 4MVOA 1GM8A 4K3AA 3AK3A 3TETA 1R6KA 5BR8B 1W2BU 2A7WA 2EILB 2UUAO 1R73A 1GO3F 3C3SA 2YIAA 4HNAB 1N32O 3PJSK 3QG5A 1XI1A 5KLVH 3RYIB 2DMXA 4B3SO 1KUQA 1BL8A 1AI6A 1GN3A 1CEZA 1NR7A 1Y74A 3CCRV 2WLIA 3K04A 3ZHRA 3VQXA 1XNQB 2VQEO 3DC6A 3GWKC 2ILMA 1MG1A 2Q68A 1US6A 1NI8A 3AG4B 2UU9B 4WBNB 5DN6G 4AI8A 1GTOA 2XAQA 2O57A 1KQSU 2X7RB 3NXSA 2OT5A 2DYSB 4I50B 2ZD9A 1RM1B 4PELA 3ZRWB 4LF5B 1XILA 1NTMH 1TGOA 4X9QA 3RVYA 3ZIAG 1SS3A 4MTGA 4KFMA 1JJOA 1L8DA 2GV9A 1A32A 4IT5A 1PNKA 3OTOB 1YCIA 1FXHA 3B77A 1DGSA 2KG7B 4E2LA 3K0DA 1RFYA 2WAMA 3T4ZA 1J5EO 4O4JB 2ZKOA 1FXVA 1F4MA 4YXWG 1BT8A 2XTAA 1H8EG 3SJAC 4RWUA 4ZKIA 5LOVB 3OM3B 3B8NA 4JZGA 4LP8A 1QVFU 2Y48A 3QO8A 4JI1O 1AI5A 4B3MO 3OGIB 1KECA 2N74A 4X64O 1QR9A 1AB3A 1L0LH 3P30A 4CS2A 4LBEC 3GB7C 2UXBB 1BHBA 4JZ2A 3N2KB 4B3TB 2LW1A 3L9DA 1KB9F 2ODMA 1PD3A 1OZ0A 5FNVB 5FL7G 3G6BA 1AP5A 3OT7A 3CJHA 4N21A 4G2KA 4W4KA 2CAZC 3CRQA 1JOYA 4LF7B 1M56C 2F1MA 2DQ0A 3CCJV 3MDSA 4FLUA 4QPKA 2IM9A 4JI4O 4AQYO 4HYOA 3M8AA 4YHHO 3JAWA 5LP6B 1M5IA 3T1YB 3X2QC 3CXCU 2L35A 1PKXA 3ETGA 2CTQA 4GKJB 1XUQA 2ADQB 2RCVA 4DXWA 3CRAA 2UXCB 4BIUA 5JCOC 1QLEC 3L70H 4DR1O 5H6QA 1VMGA 4GX1A 1HNXB 5IWAO 4LF8B 1DF4A 2X6AA 3AG3B 5LMNB 2QM4A 4U3JB 1YHQV 2YC0A 1ZLZA 5B3SB 1NVPB 2JS5A 3C3TA 4FM2A 1G1XB 3JARB 4KP4A 4DV4B 2OTLV 3OR7C 4DV5O 4PDMA 2R9IA 5IE9A 1NT2B 5L3FA 1R3JC 1UJWB 4LFCO 1QLEB 1SRYA 4DR7B 5K1PA 2CH7B 2Q8VA 4CC5A 3W7UA 1WAZA 5KA6A 3CD6V 1FS0G 3JATB 3CSXA 5B1BC 2IJIA 4X66B 1P49A 4I50A 4TSFG 2BTOA 4JYAB 3JSNA 3VQYA 4F6EA 2YEVA 2QM7A 5IYZA 4TQFA 3CXHF 3BCCH 3CCSV 2CTRA 5EK0A 5LHIA 3RWRD 4LH6A 3ZMZA 4BAYA 3CS5A 3BA9A 3K06A 2UUAB 3MD0A 2BSKA 2WA3A 1JCHA 4PDRA 1L0NH 1XOUA 1OCOB 4MVQA 4PI2A 1BE3H 2H8PC 3CCVV 5B5EZ 1K9MW 4KXRA 1R6NA 1OCCC 4H0LB 2W6IG 1TUBB 3CMEV 1K5QA 4TQDA 1AR1B 3KCXA 2P22C 5JVDB 1KYOF 3ZMSA 1G6UA 3I55V 1JPXA 4ZHQB 2DWDC 5B1NA 3JASB 1OCCB 2JJ1G 3N2GA 3A0HZ 2DWEC 2Q0AA 1FKAO 4LF9O 2QWRB 5JJEB 1N4CA 5J2TB 5GTHZ 1AP6A 1TA8A 3UM7A 3LDDA 1EN4A 3LDCA 1IURA 4JYYA 1M57B 4FPPA 1EBOA 4GYCB 1YIJV 1FXKC 4DYLA 1D5NA 2E74B 2CTPA 4FZ1A 5D5PA 5KUKA 3G67A 1W0JG 1VQ9V 4QGPA 4TT3G 1J5EB 2EJRA 1XQ8A 3E2EA 3ZHVA 2Q67A 4WFGA 4WFAV 1PV0A 5EC1C 1P4RA 1XL6A 4YJ2B 3BRCA 1FXKB 1D2DA 4X64B 3AG2C 1S5LZ 4H44B 4HBNA 3IAYA 3SDLA 3JARA 4I0XB 5IJ0B 4J42A 1Q3EA 2HJDA 3RGBA 4NXMO 4WFHA 1VQMV 1L1FA 2ZNJA 2ZE8A 1OCZB 1Q8IA 5JCOA 2UU9O 2CH7A 1IX9A 3W7TA 2ZR2A 3UCSC 4EFBA 2CGNA 3CPWU 3J81N 3A8TA 1MOFA 4YJ3A 1MMMA 3D3QA 3SJQC 5B66Z 2NR5A 1BS3A 3E8HA 2F43G 3L73H 1Q81W 4YHHB 3ZHQA 1IVSA 4YY3B 2EIKB 4PHZA 2VWJA 1N0NA 4UB6Z 3B8MA 3WG7B 4DV7O 3H1KH 4CH6A 2PI4A 1IXMA 3EVKA 2GHYA 1VF7A 1HNZB 2QA4V 2PGGA 1Y67A 3CEIA 1WNSA 3HKCB 1RPOA 2P06A 1O9GA 4BIOA 2EZPA 3E89A 1IBKB 4NB5A 5FLXN 1QHTA 5KAFZ 3UQ8A 2IU0A 4TUYA 2WLIB 1QLNA 3RN4A 5KHGA 3U0ZA 5H5NA 4DV5B 2QGNA 2PI5A 5FPOA 5LGUA 4K8XA 2QKAA 4LFCB 1Z5WA 4LF4O 2D3OW 4L87A 3IC9A 5JVDA 1PL4A 2GDSA 1PP9H 4B3RB 2XAHA 2HVJC 4FLYA 2ZIOA 4ZHQA 1E1RG 2X0LA 1NH2B 2X6CA 3J80N 2WLKA 3VBBA 3STLC 1ZL8A 4DR6B 3IFXA 2IJKA 3K9AA 3SYPA 5LBQA 3UO2A 5H2FZ 2RQ6A 3UT5A 4WFEA 2RMKB 5A2QN 4UV9A 4C7UA 1PNLA 4E4EA 2QWQB 3CX5F 5LL6Y 2F66C 4X1YB 5JQGB 3G6EV 2EIJC 2YI8A 1EM1A 4Q6GA 5JJNB 1KP3A 3E22A 4IHJA 3ZMVA 2H94A 2NNUA 2P90A 4U7NA 1ORQC 4MTOA 4J11A 4PI0A 4RQFA 3BA8A 1AR5A 4UCOA 2P6JA 1HNXO 3RYHA 4GKKB 5EIBD 2EIJB 4DR4O 1ZWIC 4GUNA 3FB8C 2JRIA 4JAAA 4NKGB 5EC2C 3JAKB 3OFNG 3APOA 4GZRB 1K3EA 4I7ZB 3SYOA 3K9SA 2F23A 2QJ1A 5B1AC 4FFKA 3GWOA 1PPJH 4MTFA 3ASNC 5EYPA 3DXRB 4FIPC 4X65O 4H33A 4LFBO 1RP3B 3JCUZ 3JCZA 1T5EA 4LF9B 2P5OA 4H13B 1FFXA 1YTFD 2CUGA 5BXZA 4F6RB 4WFFA 3BVOA 2KQXA 3JAWB 4OXSA 4MS2A 1M9NA 2YIBD 3ASNB 1FPOA 1Z5VA 1H2KA 2ZE7A 4FZ0A 3CCQV 2LGWA 1TVKA 5KX5A 1W0KG 4I55B 2GTAA 1BHAA 3CRCA 4P30A 3QO5A 1I5XA 5IYBO 4MW3A 2B1GA 2ZNIA 1QQCA 3W7WA 2VS0A 2YI9A 2ZM6O 3HKCA 3BFRA 4EB6B 1I5YA 2ZXWC 1EFRG 1N34O 4J9ZB 3MAQA 1M1KW 4IGGA 5EZYA 1SQGA 2Y69C 1MZFA 3LUTB 1K4CC 4LWSA 4NXMB 2ITDC 2FB5A 1KP2A 4MVRA 1VQ8V 4RAIA 3D36A 1YI2V 3WB0A 3NR7A 4ZIBA 3AK1A 3Q4HA 3JALA 1SQBH 4KL1A 3SGIA 1SERA 2M6YA 5DEDA 1SESA 1K4DC 2CTWA 4BW5A 4FK5C 4GX5A 1BZKA 4QE9A 3ZN1A 2YEVB 1D5AA 5IYZB 1OCRC 1VF6A 1N36O 2A0LA 1UFIA 1SZTA 2UXDO 4DV7B 1B6QA 1LUWA 3RT3C 2HP8A 4X1YA 4CH5A 3H1LH 4ZI7A 5JQGA 1HR0O 3ABKC 2Z5UA 1EZVH 2BSKB 3LNMB 3ETDA 4DR2B 2E75B 4FVMA 1UPGA 3OE7G 1V9PA 1OCRB 2IJHA 3JD4A 3ZRVA 4PA4A 2LJ2A 5CA3A 3G71V 3T2MA 5LA6A 4LC1A 2XAFA 5BZBA 1NJIW 3ZN0A 2X6BA 4X62O 4LF4B 1KD1W 4Z1VA 3RBZA 3JAKA 4LNUA 4CH4A 3K08A 3JSLA 1KMIZ 1F51A 1GN4A 2BTQA 2XUMA 2ZE6A 1GN6A 3FB6C 5IYDO 3SPCA 4RUEA 3HPLC 1PNMA 2Q7GA 4G28B 1DLBA 3WFVA 4NYKA 3G4SV 3N2GB 3DXRA 1CP9A 2JJ2G 1EN6A 2A79B 3H01A 5LHGA 1HNWO 3HKDA 4B7EA 1YF2A 2AGAA 5HFLA 4ASUG 2QDOA 2W0XA 4F6RA 1IDSA 4J9YB 4F4LA 4O4HA 4UVAA 5BY1A 5FPRA 2B9ZA 3I56V 4YY3O 4LCUC 3FYEB 1ROPA 2YICA 4EFEA 4PA7A 5CBFA 4I55A 1M56B 1HNZO 1VF5B 2EINC 1Q6IA 1DTOA 1AI4A 1Q6HA 2KKWA 1MNGA 1GN2A 2YXHA 2ETNA 2A06H 1IBKO 1IBMO 4K35A 4MVZA 4DR4B 4EB6A 1VP7A 1DF5A 2PUSA 1JR9A 3X2QB 3A0RA 4R6ZA 2PTMA 3K58A 4JGSA 2IJJA 1H8HG 2W6JG 3ABTA 5CA0A 3VOUA 3IGAC 3KZIZ 2EINB 1XMQO 5E79Z 3CCMV 1AR4A 1Q90D 4X65B 3ZCCA 4B3RO 1YZBA 4LFBB 1R3LC 1GM9A 4YJ3B 2CK3G 4AILC 3OW2U 1HP8A 2HG5C 4NTXA 1S3JA 1SF9A 4DV2O 2EIMC 4DR6O 3CCUV 1JJ2U 4CZZA 4DW1A 4JTDB 4CS3A 3HKBA 4JI7O 2UUBB 3ZRSA 3OUSA 1H2GA 1YJWV 2R72A 1I08A 3JD3A 1VQLV 2A3QA 1Q7YW 2XOKG 4ZOLB 1JVMA 3E83A 2XNDG 5B1BB 5KHHA 2OCCC 2HLDG 4MVUA 3VQVA 3ZMTA 3CRRA 5DECA 2ZM6B 3GVMA 3ZRXA 5LXTA 2F95B 2YSUB 1N34B 2MW2B 4IYHA 4TUYB 2OYQA 4W4LA 3TCUA 5LYJA 5CMUA 2RJZA 4GKKO 1FJGB 2EX3A 1Q6UA 4J41A 4UCVA 3T4DA 1SQFA 2Y0IA 2OCCB 1XHZA 5LGTA 4JAUA 4QIWF 3S3XA 2EZOA 1NH2D 3O65A 1VEWA 2LW7A 3A2FA 4Z1MG 1VQNV 1ZL8B 1RSOA 1SA0A 3VQWA 4QJFB 2XAGA 5GONA 2EJ7A 1K33A 5A9GA 1K97A 3UT5B 2V7QG 1N36B 2QSAA 4HZ3A 3I5DA 5L3CA 1VQOV 2UXDB 2XASA 3G80A 2RDCA 3CC4V 3TK1A 1HR0B 3DTUB 3E22B 4IHJB 3P3PA 4PJ0Z 2OIEA 4GCZA 2R9RB 4PD4F 1SQXH 3E8FA 1GH6A 2YUAA 2YDEA 2P4VA 4PA9A 3JD0A 1NU1H 3JD1A 4YIOA 3H1IH 5IDJA 3B2EE 1B04A 3AG7A 3RYHB 5IJ9A 1NQTA 4DR3O 2JDIG 2ZIMA 1SETA 3ABMC 4OGQB 4X62B 3STZC 4I9QA 5CA1A 2PY5A 1JQ0A 2F93B 2QKSA 4P2ZA 4NXNO 4JV5O 1GK9A 5EYPB 5J2UA 1BSMA 5JH7A 3ZEDA 3CCEV 2RN9A 1H2SB 2KSDA 1HNWB 3FKSG 3RW0A 4TWKA 4JTCB 1FFXB 2VQFO 3AG2B 1K8AW 4ICGA 3CWBH 4FFBA 4P9OA 1J95A 1LNQA 2BE3A 3JAMN 3HB3B 3HKEB 2Q9LA 3CYOA 4MTXA 1TVKB 4UCSA 5KX5B 4B08A 3ZHSA 3LDEA 3ETQA 2Q7EA 1K34A 4ZOLA 1EN5A 1SQQH 2Y4UA 4GLXA 4D6TH 1FAFA 5JWPA 5KHKA 4JI5O 4DR2O 3D36C 4ZBMA 3K79A 1XL4A 1X4TA 1IBMB 5TISZ 2WWWA 4JAVA 5EZYB 1GMGA 5IT9N 1MZEA 2JGDB 4LWSB 2E3CA 2LFSA 1S72V 3K5MA 3CC7V 1VF6C 1MA1A 4GT1A 5KA5A 4R8CA 1XMQB 3ASOC 2UXNA 3P3NA 1F4NA 5IY5C 1AJNA 3SPIA 1F23A 3AG1C 3Q4HB 3JALB 1QCEA 2DN9A 2QR4A 2JS3A 2AZ0A 1XHXA 4DV2B 1WA8B 5ITZB 2PF4E 5BMVA 2DOSA 1YVWA 3B40A 2E76B 2PZSA 2IH1C 4JI7B 4MW8A 5EBMC 1P7BA 4WCEV 3ASOB 1MSDA 1V55C 3FB5C 5IY5B 1OHHG 4FMTA 1S76D 4ZI7B 3CRMA 2N04A 4QPJA 3D3IA 4DK0A 2ITCC 4G27B 1LUVA 4OPHA 1JFFB 4UCUA 2EULA 2LO1A 1YITV 3KCYA 4P9PA 3TGUH 3H1JH 1WN7A 2Y0PA 4GX2A 1WB8A 2W0FC 3ZJZA 1YSCA 4JI2O 1VQ7V 1V55B 2HR3A 2Q69A 5LA6B 2WLMA 3K0GA 3OMAB 2HHHB 3K5OA 3KKYA 4K0KB 4RQEA 4JI3B 3ABLC 3R65A 3KG2A 4LNUB 5C93A 1YXBA 2BCCH 2N05A 4BIZA 2WLHA 2GUZA 3RYCA 2BTQB 1K73W 1I0HA 1M4UA 5J9PC 3OTFA 1YJNV 1YDXA 1BQ0A 5JJJB 3HKDB 3DSQA 1KU9A 4JI0O 2GSMB 4I5SA 4TV9A 4O4HB 2ZDIA 4CBCA 2Q73A 4I9WA 1SQVH 2FL4A 4O2BA 5B1AB 2XHBA 1U97A 1GM7A 2UUBO 5B1OA 3FYIB 3HKEA 2Y4TA 4NTYA 4K8ZA 4DR5O 1BMFG 1H38A 1X59A 3TXQA 4R50A 1AJPA 2ADPA 2UUCO 4DUYO 1S5JA 3MHSC 3K3WA 4U3FH 2DYRC 3WB2A 4KHPO 3FAVB 1XNRB 4HAMA 4X20A 4BWAA 3K5LA 4DR3B 2ZE5A 4FLWA 1NVPD 1V54C 1LR1A 4JV5B 4NXNB 2NLJC 4J7JA 2JGDA 3RFRA 5CA0B 1FJGO 3ETEA 4H37A 3AG4C 4X1IA 1WLEA 2DYRB 4R7CA 3APQA 4X1KA 4AHCA 3RYFA 3THOA 2OTJV 5GW7A 2V4DA 2DYSC 2ZXWB 1AI7A 3K5NA 4EKWA 2VQFB 1RM1C 1CPYA 1M93A 1V54B 2MK3A 4D7TA 5EBWC 3SYQA 1EZJA 2Y69B 4O4IA 1XEQA 1Y6XA 4XDKA 1WA8A 4LR3A 3HKBB 5ITZA 3LSSA 2B1IA 3LSUA 3FFQA 2GBOA 3CP1A 1HW7A 2HVKC 1QU7A 3ML0A 3SYAA 2IW5A 4JI6O 3FB7C 1KBHA 4IIJB 1JFFA 4JI5B 5LXTB 1F7YA 2XT9A 3OGCC 3OR6C 5DM6V 1AROP 4FLZA 2WLLA 1N33B 3F5TA 3ZS8C 1QBZA 5LYJB 2H3OA
chains in the Genus database with same CATH topology
3J81N 1N33O 2DJVA 4DR5O 1HNWO 1X59A 3OTOO 1I94O 4DUZO 4JV5O 4NXNO 2DOSA 2AGAA 1XMOO 2UUCO 4DUYO 4DV6O 4DV4O 4KHPO 4DR1O 5IWAO 1A32A 4DV0O 5BY1A 1AILA 4DR7O 1HNXO 1XNRO 4YY3O 4DV7O 1IBLO 4DR4O 1DK1A 4LFAO 3R66A 4GKKO 4OPHA 2VQFO 2JRIA 1G1XB 1FKAO 4X66O 4LF9O 4DV5O 1FJGO 3T1HO 4OX9O 1HNZO 2Z0AA 5BR8O 4JI8O 4LFCO 4JYAO 1N36O 2UXBO 3JAMN 1J5EO 3O65A 4JI2O 2ZKOA 4B3TO 2UXDO 5FLXN 4DV1O 1IBKO 2LW7A 1IBMO 4X65O 3RT3C 4LFBO 1HR0O 1R1BA 4JI1O 4B3MO 5H5NA 2N74A 4X64O 2HHHO 1AB3A 1XEQA 4LF7O 4K0KO 5BXZA 4LF4O 5LMUO 2UUAO 1XNQO 4JI3O 4JI5O 1N32O 4DR2O 1XMQO 4A5UB 4B3RO 1YZBA 4OPAA 1FYJA 4B3SO 3J80N 2E5LO 2FKXA 1KUQA 5IT9N 1D2DA 3T1YO 1R6TA 4JI6O 4JI0O 4X62O 4DV3O 4DV2O 4LF5O 2VQEO 4GKJO 4DR6O 3SDLA 4LF6O 3J7AU 1NS1A 4JI4O 4AQYO 1F7YA 5A2QN 4JI7O 4NXMO 2UXCO 3M8AA 5LL6Y 2ZM6O 2F4VO 4YHHO 2UU9O 2UUBO 4LF8O 4DR3O 3F5TA 1N34O 5LMNO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 N;  1N33 O;  2DJV A;  4DR5 O;  1HNW O;  1X59 A;  3OTO O;  1I94 O;  4DUZ O;  4JV5 O;  4NXN O;  2DOS A;  2AGA A;  1XMO O;  2UUC O;  4DUY O;  4DV6 O;  4DV4 O;  4KHP O;  4DR1 O;  5IWA O;  1A32 A;  4DV0 O;  5BY1 A;  1AIL A;  4DR7 O;  1HNX O;  1XNR O;  4YY3 O;  4DV7 O;  1IBL O;  4DR4 O;  1DK1 A;  4LFA O;  3R66 A;  4GKK O;  4OPH A;  2VQF O;  2JRI A;  1G1X B;  1FKA O;  4X66 O;  4LF9 O;  4DV5 O;  1FJG O;  3T1H O;  4OX9 O;  1HNZ O;  2Z0A A;  5BR8 O;  4JI8 O;  4LFC O;  4JYA O;  1N36 O;  2UXB O;  3JAM N;  1J5E O;  3O65 A;  4JI2 O;  2ZKO A;  4B3T O;  2UXD O;  5FLX N;  4DV1 O;  1IBK O;  2LW7 A;  1IBM O;  4X65 O;  3RT3 C;  4LFB O;  1HR0 O;  1R1B A;  4JI1 O;  4B3M O;  5H5N A;  2N74 A;  4X64 O;  2HHH O;  1AB3 A;  1XEQ A;  4LF7 O;  4K0K O;  5BXZ A;  4LF4 O;  5LMU O;  2UUA O;  1XNQ O;  4JI3 O;  4JI5 O;  1N32 O;  4DR2 O;  1XMQ O;  4A5U B;  4B3R O;  1YZB A;  4OPA A;  1FYJ A;  4B3S O;  3J80 N;  2E5L O;  2FKX A;  1KUQ A;  5IT9 N;  1D2D A;  3T1Y O;  1R6T A;  4JI6 O;  4JI0 O;  4X62 O;  4DV3 O;  4DV2 O;  4LF5 O;  2VQE O;  4GKJ O;  4DR6 O;  3SDL A;  4LF6 O;  3J7A U;  1NS1 A;  4JI4 O;  4AQY O;  1F7Y A;  5A2Q N;  4JI7 O;  4NXM O;  2UXC O;  3M8A A;  5LL6 Y;  2ZM6 O;  2F4V O;  4YHH O;  2UU9 O;  2UUB O;  4LF8 O;  4DR3 O;  3F5T A;  1N34 O;  5LMN O; 
#chains in the Genus database with same CATH topology
 5EIB C;  4FLV A;  4YIP A;  3QTC A;  3ABK B;  5CB4 A;  4L8J A;  1KKD A;  4DO2 A;  2QEX V;  4TOI A;  3SJC C;  1WP7 A;  5L3B A;  3D8C A;  3H1H H;  1TAE A;  2IU3 A;  4O2A B;  3K03 A;  3SJB C;  5C8Y A;  2BOC C;  1YJ9 V;  1URF A;  1E1Q G;  1RSO B;  2HKO A;  1BCC H;  1OV9 A;  2WPD G;  1WB7 A;  1SA0 B;  1JMK C;  5GON B;  4LFA O;  2K1E A;  4MSW C;  4JYC A;  1NBM G;  3T1H B;  3L74 H;  1S5H C;  4UVB A;  4OX9 O;  3SPG A;  1H2M A;  4N23 A;  3BY6 A;  3W7X A;  3EHB B;  5LP6 C;  4DV1 O;  4O4L A;  1PM9 A;  1S0V A;  3E35 A;  4XDL A;  1U96 A;  5LMU B;  4PA3 A;  3SPH A;  4WFB V;  2LFR A;  3L75 H;  1YTF B;  4I4T B;  2WLN A;  1I7F A;  1S77 D;  4MVS A;  4JI2 B;  3AG3 C;  1COW G;  5KUM A;  5IJ9 B;  3FAV A;  4A5U B;  1Y76 A;  3LSQ A;  5B3S C;  1XBL A;  2E5L O;  4IYI A;  5CBH A;  4DRX A;  3OUF A;  5CA1 B;  3B09 A;  4RO2 A;  1R6T A;  4DV3 O;  3EFF K;  5KMG B;  2FTK A;  3SYC A;  1SZX A;  2R9A A;  4LF6 O;  2FML A;  4WF9 V;  2P7T C;  3CC2 V;  5J2U B;  4HNA A;  1JX9 A;  5JH7 B;  3RVZ A;  2QE7 G;  4PDL A;  2Q0O C;  1VQ5 V;  4XDJ A;  5IYC O;  1QR8 A;  3M7M X;  3RYI A;  4X8A A;  2CE4 A;  3L72 H;  5CBG A;  4JI0 B;  5L3D A;  2B5U A;  2QTS A;  3CE2 A;  1MAB G;  1I94 O;  4DUZ O;  2DW4 A;  4J7Z A;  1HDJ A;  2HFE C;  2AHY A;  5L3E A;  4FFB B;  4DV6 O;  1VQ4 V;  3ZMU A;  2P67 A;  3F7V C;  4KUM A;  5F2V O;  4JAS A;  4WBN A;  1QNM A;  1H2N A;  2XAJ A;  3N27 A;  4DR5 B;  3WU2 Z;  4UB8 Z;  4UCT A;  2P4K A;  3PN1 A;  2UUC B;  4DUY B;  4NR1 A;  4JI8 B;  1WP8 A;  3ZRW A;  4EEQ A;  4KHP B;  1OCO C;  2EIM B;  4IIJ A;  1OJH A;  4J10 A;  3FD9 A;  4D7S A;  3DC5 A;  1N8R W;  2EBO A;  3BHP A;  2ZQM A;  2G38 A;  3EXA A;  1H2L A;  2AXT Z;  3IJ4 A;  3ZHU A;  3E8G A;  3CHX A;  3BAB A;  2ARH A;  1Z2G A;  1QVG U;  1AJQ A;  2OWO A;  2HHH O;  4K0K O;  1N32 B;  2WLJ A;  5CN0 A;  1ZAU A;  4JI3 O;  1WJZ A;  2KG7 A;  3CCL V;  3OEE G;  4B3S B;  1SQP H;  4O4J A;  4O2A A;  5LOV A;  1ZTE A;  5E1A C;  3BPZ A;  2CDY A;  5BMV B;  2VQE B;  4TV8 B;  4FM0 A;  1WPX A;  5D5Q A;  3SR2 C;  1M57 C;  1NKD A;  2LQT A;  2A9H A;  3N2K A;  2F4V O;  4UUJ C;  4FJC C;  3UO3 A;  4CH3 A;  1G4Y B;  1JA8 A;  5FNV A;  2LP7 A;  1G8M A;  1ZX3 A;  4JI6 B;  2L6L A;  4DK1 A;  2RNB A;  3E86 A;  4PDV A;  1XMO O;  1GKF A;  3QO7 A;  3JYC A;  4JPR A;  4I4T A;  2V1D A;  1IZ3 A;  3MHH C;  4DV0 O;  1BQZ A;  1SKV A;  1N0J A;  1XNR O;  5H9C A;  2JEU A;  5LP6 A;  1VQP V;  1IBL O;  1YEW A;  2ZR3 A;  1ENV A;  2YIB A;  1Q5O A;  2Q4P A;  1P7G A;  2ZDI C;  2C2A A;  3F7Y C;  2GUZ B;  3RYC B;  5BR8 O;  5KMG A;  2JK5 C;  4NTW A;  3OMN B;  1OCZ C;  4UV8 A;  2JVD A;  2YXY A;  4JF3 A;  2JEX A;  1FD9 A;  4U3J A;  4LFA B;  4JI1 B;  4JYB A;  1K7D A;  4B3M B;  5HFM A;  1WPB A;  1R1B A;  3OMI B;  2OIG A;  1THZ A;  3HR0 A;  3ABM B;  1K92 A;  1B3Q A;  2WA4 A;  4BR6 A;  4TV9 B;  4OX9 B;  4J7K A;  2IH3 C;  1KKC A;  1XNQ O;  1BGY H;  2VWK A;  2EIK C;  3QF7 A;  4O2B B;  3OEH G;  1SC5 B;  2WSS G;  2CGO A;  2DE0 X;  4DV1 B;  3WB1 A;  4IL6 Z;  2LGQ A;  4OPA A;  3WG7 C;  1FYJ A;  3W7S A;  2FYU H;  4U7O A;  3UKM A;  3JAT A;  2QTO A;  1TUE B;  4LF5 O;  4JI4 B;  4AQY B;  1RPR A;  3QVN A;  1VQ6 V;  1NS1 A;  4CC6 A;  3B4S A;  4X20 B;  3CMA V;  1HWY A;  4B7K A;  1M90 W;  1PL0 A;  1MSW D;  2E5L B;  2BOB C;  3AK2 A;  1NR1 A;  2AW9 A;  2UXX A;  1N33 O;  1FFT B;  5LGN A;  4DV3 B;  4PV1 B;  3OTO O;  4X1I B;  4LF6 B;  5GTI Z;  2DQ3 A;  4DR1 B;  3ICX A;  1NZ6 A;  2ZIN A;  4MVM A;  4X88 A;  3SPJ A;  5IWA B;  2ZCE A;  2QM8 A;  1O9H A;  4X1K B;  3RYF B;  1AIL A;  2GTS A;  2VRZ A;  3O9O A;  2K9P A;  1Q86 W;  2PYL A;  2Z3Y A;  4FLX A;  2PYJ A;  1AVM A;  1Y74 B;  4RUF A;  1I94 B;  4DUZ B;  4O4I B;  1TUB A;  1W59 A;  1NTK H;  4DV6 B;  2Q6A A;  3T1H O;  2JGU A;  2YS8 A;  3P32 A;  4TV8 A;  1ZSP A;  2KB1 A;  5EBL C;  1KC8 W;  2UXB O;  4DW0 A;  4LH7 A;  2OCH A;  4B3T O;  3QNE A;  3AG1 B;  3A0B Z;  2YXL A;  3JAS A;  4NVP A;  1R3K C;  3OAA G;  2QWO B;  4LF7 O;  3JD2 A;  2NN4 A;  3LNN A;  5LMU O;  3K59 A;  5J2T A;  4BW9 A;  1P84 F;  1K5S A;  4ABM A;  2WLL B;  3TXS A;  3AEI A;  1VAR A;  3IC7 A;  1VIB A;  2YID A;  2AZ2 A;  5KHJ A;  2Q5Z A;  4QE7 A;  4QNH B;  2FKX A;  2QWN B;  3T1Y O;  5H6R A;  1VQK V;  5CB4 B;  3T1C A;  5LHH A;  3ZHT A;  2R70 A;  2Q7H A;  3K57 A;  1NTZ H;  5L3G A;  4Z2W A;  4GKJ O;  1B06 A;  3H9V A;  3J7A U;  1IXB A;  2UXC O;  4UCR A;  5C8Y B;  2AHZ A;  1R3I C;  2JIZ G;  2QKC A;  2QWP B;  1XRE A;  4GX0 A;  1CXZ B;  4LF8 O;  3C90 A;  4X89 A;  1GRJ A;  5LMN O;  4CS4 A;  2DJV A;  4YJ2 A;  1FXK A;  3ZBH A;  2ZT9 B;  1XDC A;  1Q82 W;  3E8B A;  1Q43 A;  5K1X A;  4DV4 O;  3ABL B;  2M7W A;  1E79 G;  3U11 A;  2HEP A;  4Q20 A;  5IJ0 A;  2F4V B;  4I0X A;  3ZX6 A;  3BAA A;  3ABU A;  4FM1 A;  2D2C B;  4O4L B;  4DR7 O;  3F5W C;  2IBZ H;  3CJH B;  4UVC A;  1Y66 A;  1Y4M A;  5KHI A;  1DK1 A;  3L71 H;  4MT8 A;  4UFZ A;  3FX7 A;  3CB2 A;  3R66 A;  1XMO B;  4X66 O;  3S3W A;  3DGE A;  2EIL C;  4J80 A;  1GAX A;  1ZUQ A;  2Z0A A;  4JI8 O;  4JYA O;  4DV0 B;  3M99 B;  2HJF C;  5KAI Z;  4XBF A;  1Y76 B;  4FLT A;  3BEH A;  5AG2 A;  3TJT A;  2ATK C;  1IBL B;  3U10 A;  4DRX B;  4JTA B;  4UXN A;  4PA6 A;  3OD4 A;  4MVO A;  1GM8 A;  4K3A A;  3AK3 A;  3TET A;  1R6K A;  5BR8 B;  1W2B U;  2A7W A;  2EIL B;  2UUA O;  1R73 A;  1GO3 F;  3C3S A;  2YIA A;  4HNA B;  1N32 O;  3PJS K;  3QG5 A;  1XI1 A;  5KLV H;  3RYI B;  2DMX A;  4B3S O;  1KUQ A;  1BL8 A;  1AI6 A;  1GN3 A;  1CEZ A;  1NR7 A;  1Y74 A;  3CCR V;  2WLI A;  3K04 A;  3ZHR A;  3VQX A;  1XNQ B;  2VQE O;  3DC6 A;  3GWK C;  2ILM A;  1MG1 A;  2Q68 A;  1US6 A;  1NI8 A;  3AG4 B;  2UU9 B;  4WBN B;  5DN6 G;  4AI8 A;  1GTO A;  2XAQ A;  2O57 A;  1KQS U;  2X7R B;  3NXS A;  2OT5 A;  2DYS B;  4I50 B;  2ZD9 A;  1RM1 B;  4PEL A;  3ZRW B;  4LF5 B;  1XIL A;  1NTM H;  1TGO A;  4X9Q A;  3RVY A;  3ZIA G;  1SS3 A;  4MTG A;  4KFM A;  1JJO A;  1L8D A;  2GV9 A;  1A32 A;  4IT5 A;  1PNK A;  3OTO B;  1YCI A;  1FXH A;  3B77 A;  1DGS A;  2KG7 B;  4E2L A;  3K0D A;  1RFY A;  2WAM A;  3T4Z A;  1J5E O;  4O4J B;  2ZKO A;  1FXV A;  1F4M A;  4YXW G;  1BT8 A;  2XTA A;  1H8E G;  3SJA C;  4RWU A;  4ZKI A;  5LOV B;  3OM3 B;  3B8N A;  4JZG A;  4LP8 A;  1QVF U;  2Y48 A;  3QO8 A;  4JI1 O;  1AI5 A;  4B3M O;  3OGI B;  1KEC A;  2N74 A;  4X64 O;  1QR9 A;  1AB3 A;  1L0L H;  3P30 A;  4CS2 A;  4LBE C;  3GB7 C;  2UXB B;  1BHB A;  4JZ2 A;  3N2K B;  4B3T B;  2LW1 A;  3L9D A;  1KB9 F;  2ODM A;  1PD3 A;  1OZ0 A;  5FNV B;  5FL7 G;  3G6B A;  1AP5 A;  3OT7 A;  3CJH A;  4N21 A;  4G2K A;  4W4K A;  2CAZ C;  3CRQ A;  1JOY A;  4LF7 B;  1M56 C;  2F1M A;  2DQ0 A;  3CCJ V;  3MDS A;  4FLU A;  4QPK A;  2IM9 A;  4JI4 O;  4AQY O;  4HYO A;  3M8A A;  4YHH O;  3JAW A;  5LP6 B;  1M5I A;  3T1Y B;  3X2Q C;  3CXC U;  2L35 A;  1PKX A;  3ETG A;  2CTQ A;  4GKJ B;  1XUQ A;  2ADQ B;  2RCV A;  4DXW A;  3CRA A;  2UXC B;  4BIU A;  5JCO C;  1QLE C;  3L70 H;  4DR1 O;  5H6Q A;  1VMG A;  4GX1 A;  1HNX B;  5IWA O;  4LF8 B;  1DF4 A;  2X6A A;  3AG3 B;  5LMN B;  2QM4 A;  4U3J B;  1YHQ V;  2YC0 A;  1ZLZ A;  5B3S B;  1NVP B;  2JS5 A;  3C3T A;  4FM2 A;  1G1X B;  3JAR B;  4KP4 A;  4DV4 B;  2OTL V;  3OR7 C;  4DV5 O;  4PDM A;  2R9I A;  5IE9 A;  1NT2 B;  5L3F A;  1R3J C;  1UJW B;  4LFC O;  1QLE B;  1SRY A;  4DR7 B;  5K1P A;  2CH7 B;  2Q8V A;  4CC5 A;  3W7U A;  1WAZ A;  5KA6 A;  3CD6 V;  1FS0 G;  3JAT B;  3CSX A;  5B1B C;  2IJI A;  4X66 B;  1P49 A;  4I50 A;  4TSF G;  2BTO A;  4JYA B;  3JSN A;  3VQY A;  4F6E A;  2YEV A;  2QM7 A;  5IYZ A;  4TQF A;  3CXH F;  3BCC H;  3CCS V;  2CTR A;  5EK0 A;  5LHI A;  3RWR D;  4LH6 A;  3ZMZ A;  4BAY A;  3CS5 A;  3BA9 A;  3K06 A;  2UUA B;  3MD0 A;  2BSK A;  2WA3 A;  1JCH A;  4PDR A;  1L0N H;  1XOU A;  1OCO B;  4MVQ A;  4PI2 A;  1BE3 H;  2H8P C;  3CCV V;  5B5E Z;  1K9M W;  4KXR A;  1R6N A;  1OCC C;  4H0L B;  2W6I G;  1TUB B;  3CME V;  1K5Q A;  4TQD A;  1AR1 B;  3KCX A;  2P22 C;  5JVD B;  1KYO F;  3ZMS A;  1G6U A;  3I55 V;  1JPX A;  4ZHQ B;  2DWD C;  5B1N A;  3JAS B;  1OCC B;  2JJ1 G;  3N2G A;  3A0H Z;  2DWE C;  2Q0A A;  1FKA O;  4LF9 O;  2QWR B;  5JJE B;  1N4C A;  5J2T B;  5GTH Z;  1AP6 A;  1TA8 A;  3UM7 A;  3LDD A;  1EN4 A;  3LDC A;  1IUR A;  4JYY A;  1M57 B;  4FPP A;  1EBO A;  4GYC B;  1YIJ V;  1FXK C;  4DYL A;  1D5N A;  2E74 B;  2CTP A;  4FZ1 A;  5D5P A;  5KUK A;  3G67 A;  1W0J G;  1VQ9 V;  4QGP A;  4TT3 G;  1J5E B;  2EJR A;  1XQ8 A;  3E2E A;  3ZHV A;  2Q67 A;  4WFG A;  4WFA V;  1PV0 A;  5EC1 C;  1P4R A;  1XL6 A;  4YJ2 B;  3BRC A;  1FXK B;  1D2D A;  4X64 B;  3AG2 C;  1S5L Z;  4H44 B;  4HBN A;  3IAY A;  3SDL A;  3JAR A;  4I0X B;  5IJ0 B;  4J42 A;  1Q3E A;  2HJD A;  3RGB A;  4NXM O;  4WFH A;  1VQM V;  1L1F A;  2ZNJ A;  2ZE8 A;  1OCZ B;  1Q8I A;  5JCO A;  2UU9 O;  2CH7 A;  1IX9 A;  3W7T A;  2ZR2 A;  3UCS C;  4EFB A;  2CGN A;  3CPW U;  3J81 N;  3A8T A;  1MOF A;  4YJ3 A;  1MMM A;  3D3Q A;  3SJQ C;  5B66 Z;  2NR5 A;  1BS3 A;  3E8H A;  2F43 G;  3L73 H;  1Q81 W;  4YHH B;  3ZHQ A;  1IVS A;  4YY3 B;  2EIK B;  4PHZ A;  2VWJ A;  1N0N A;  4UB6 Z;  3B8M A;  3WG7 B;  4DV7 O;  3H1K H;  4CH6 A;  2PI4 A;  1IXM A;  3EVK A;  2GHY A;  1VF7 A;  1HNZ B;  2QA4 V;  2PGG A;  1Y67 A;  3CEI A;  1WNS A;  3HKC B;  1RPO A;  2P06 A;  1O9G A;  4BIO A;  2EZP A;  3E89 A;  1IBK B;  4NB5 A;  5FLX N;  1QHT A;  5KAF Z;  3UQ8 A;  2IU0 A;  4TUY A;  2WLI B;  1QLN A;  3RN4 A;  5KHG A;  3U0Z A;  5H5N A;  4DV5 B;  2QGN A;  2PI5 A;  5FPO A;  5LGU A;  4K8X A;  2QKA A;  4LFC B;  1Z5W A;  4LF4 O;  2D3O W;  4L87 A;  3IC9 A;  5JVD A;  1PL4 A;  2GDS A;  1PP9 H;  4B3R B;  2XAH A;  2HVJ C;  4FLY A;  2ZIO A;  4ZHQ A;  1E1R G;  2X0L A;  1NH2 B;  2X6C A;  3J80 N;  2WLK A;  3VBB A;  3STL C;  1ZL8 A;  4DR6 B;  3IFX A;  2IJK A;  3K9A A;  3SYP A;  5LBQ A;  3UO2 A;  5H2F Z;  2RQ6 A;  3UT5 A;  4WFE A;  2RMK B;  5A2Q N;  4UV9 A;  4C7U A;  1PNL A;  4E4E A;  2QWQ B;  3CX5 F;  5LL6 Y;  2F66 C;  4X1Y B;  5JQG B;  3G6E V;  2EIJ C;  2YI8 A;  1EM1 A;  4Q6G A;  5JJN B;  1KP3 A;  3E22 A;  4IHJ A;  3ZMV A;  2H94 A;  2NNU A;  2P90 A;  4U7N A;  1ORQ C;  4MTO A;  4J11 A;  4PI0 A;  4RQF A;  3BA8 A;  1AR5 A;  4UCO A;  2P6J A;  1HNX O;  3RYH A;  4GKK B;  5EIB D;  2EIJ B;  4DR4 O;  1ZWI C;  4GUN A;  3FB8 C;  2JRI A;  4JAA A;  4NKG B;  5EC2 C;  3JAK B;  3OFN G;  3APO A;  4GZR B;  1K3E A;  4I7Z B;  3SYO A;  3K9S A;  2F23 A;  2QJ1 A;  5B1A C;  4FFK A;  3GWO A;  1PPJ H;  4MTF A;  3ASN C;  5EYP A;  3DXR B;  4FIP C;  4X65 O;  4H33 A;  4LFB O;  1RP3 B;  3JCU Z;  3JCZ A;  1T5E A;  4LF9 B;  2P5O A;  4H13 B;  1FFX A;  1YTF D;  2CUG A;  5BXZ A;  4F6R B;  4WFF A;  3BVO A;  2KQX A;  3JAW B;  4OXS A;  4MS2 A;  1M9N A;  2YIB D;  3ASN B;  1FPO A;  1Z5V A;  1H2K A;  2ZE7 A;  4FZ0 A;  3CCQ V;  2LGW A;  1TVK A;  5KX5 A;  1W0K G;  4I55 B;  2GTA A;  1BHA A;  3CRC A;  4P30 A;  3QO5 A;  1I5X A;  5IYB O;  4MW3 A;  2B1G A;  2ZNI A;  1QQC A;  3W7W A;  2VS0 A;  2YI9 A;  2ZM6 O;  3HKC A;  3BFR A;  4EB6 B;  1I5Y A;  2ZXW C;  1EFR G;  1N34 O;  4J9Z B;  3MAQ A;  1M1K W;  4IGG A;  5EZY A;  1SQG A;  2Y69 C;  1MZF A;  3LUT B;  1K4C C;  4LWS A;  4NXM B;  2ITD C;  2FB5 A;  1KP2 A;  4MVR A;  1VQ8 V;  4RAI A;  3D36 A;  1YI2 V;  3WB0 A;  3NR7 A;  4ZIB A;  3AK1 A;  3Q4H A;  3JAL A;  1SQB H;  4KL1 A;  3SGI A;  1SER A;  2M6Y A;  5DED A;  1SES A;  1K4D C;  2CTW A;  4BW5 A;  4FK5 C;  4GX5 A;  1BZK A;  4QE9 A;  3ZN1 A;  2YEV B;  1D5A A;  5IYZ B;  1OCR C;  1VF6 A;  1N36 O;  2A0L A;  1UFI A;  1SZT A;  2UXD O;  4DV7 B;  1B6Q A;  1LUW A;  3RT3 C;  2HP8 A;  4X1Y A;  4CH5 A;  3H1L H;  4ZI7 A;  5JQG A;  1HR0 O;  3ABK C;  2Z5U A;  1EZV H;  2BSK B;  3LNM B;  3ETD A;  4DR2 B;  2E75 B;  4FVM A;  1UPG A;  3OE7 G;  1V9P A;  1OCR B;  2IJH A;  3JD4 A;  3ZRV A;  4PA4 A;  2LJ2 A;  5CA3 A;  3G71 V;  3T2M A;  5LA6 A;  4LC1 A;  2XAF A;  5BZB A;  1NJI W;  3ZN0 A;  2X6B A;  4X62 O;  4LF4 B;  1KD1 W;  4Z1V A;  3RBZ A;  3JAK A;  4LNU A;  4CH4 A;  3K08 A;  3JSL A;  1KMI Z;  1F51 A;  1GN4 A;  2BTQ A;  2XUM A;  2ZE6 A;  1GN6 A;  3FB6 C;  5IYD O;  3SPC A;  4RUE A;  3HPL C;  1PNM A;  2Q7G A;  4G28 B;  1DLB A;  3WFV A;  4NYK A;  3G4S V;  3N2G B;  3DXR A;  1CP9 A;  2JJ2 G;  1EN6 A;  2A79 B;  3H01 A;  5LHG A;  1HNW O;  3HKD A;  4B7E A;  1YF2 A;  2AGA A;  5HFL A;  4ASU G;  2QDO A;  2W0X A;  4F6R A;  1IDS A;  4J9Y B;  4F4L A;  4O4H A;  4UVA A;  5BY1 A;  5FPR A;  2B9Z A;  3I56 V;  4YY3 O;  4LCU C;  3FYE B;  1ROP A;  2YIC A;  4EFE A;  4PA7 A;  5CBF A;  4I55 A;  1M56 B;  1HNZ O;  1VF5 B;  2EIN C;  1Q6I A;  1DTO A;  1AI4 A;  1Q6H A;  2KKW A;  1MNG A;  1GN2 A;  2YXH A;  2ETN A;  2A06 H;  1IBK O;  1IBM O;  4K35 A;  4MVZ A;  4DR4 B;  4EB6 A;  1VP7 A;  1DF5 A;  2PUS A;  1JR9 A;  3X2Q B;  3A0R A;  4R6Z A;  2PTM A;  3K58 A;  4JGS A;  2IJJ A;  1H8H G;  2W6J G;  3ABT A;  5CA0 A;  3VOU A;  3IGA C;  3KZI Z;  2EIN B;  1XMQ O;  5E79 Z;  3CCM V;  1AR4 A;  1Q90 D;  4X65 B;  3ZCC A;  4B3R O;  1YZB A;  4LFB B;  1R3L C;  1GM9 A;  4YJ3 B;  2CK3 G;  4AIL C;  3OW2 U;  1HP8 A;  2HG5 C;  4NTX A;  1S3J A;  1SF9 A;  4DV2 O;  2EIM C;  4DR6 O;  3CCU V;  1JJ2 U;  4CZZ A;  4DW1 A;  4JTD B;  4CS3 A;  3HKB A;  4JI7 O;  2UUB B;  3ZRS A;  3OUS A;  1H2G A;  1YJW V;  2R72 A;  1I08 A;  3JD3 A;  1VQL V;  2A3Q A;  1Q7Y W;  2XOK G;  4ZOL B;  1JVM A;  3E83 A;  2XND G;  5B1B B;  5KHH A;  2OCC C;  2HLD G;  4MVU A;  3VQV A;  3ZMT A;  3CRR A;  5DEC A;  2ZM6 B;  3GVM A;  3ZRX A;  5LXT A;  2F95 B;  2YSU B;  1N34 B;  2MW2 B;  4IYH A;  4TUY B;  2OYQ A;  4W4L A;  3TCU A;  5LYJ A;  5CMU A;  2RJZ A;  4GKK O;  1FJG B;  2EX3 A;  1Q6U A;  4J41 A;  4UCV A;  3T4D A;  1SQF A;  2Y0I A;  2OCC B;  1XHZ A;  5LGT A;  4JAU A;  4QIW F;  3S3X A;  2EZO A;  1NH2 D;  3O65 A;  1VEW A;  2LW7 A;  3A2F A;  4Z1M G;  1VQN V;  1ZL8 B;  1RSO A;  1SA0 A;  3VQW A;  4QJF B;  2XAG A;  5GON A;  2EJ7 A;  1K33 A;  5A9G A;  1K97 A;  3UT5 B;  2V7Q G;  1N36 B;  2QSA A;  4HZ3 A;  3I5D A;  5L3C A;  1VQO V;  2UXD B;  2XAS A;  3G80 A;  2RDC A;  3CC4 V;  3TK1 A;  1HR0 B;  3DTU B;  3E22 B;  4IHJ B;  3P3P A;  4PJ0 Z;  2OIE A;  4GCZ A;  2R9R B;  4PD4 F;  1SQX H;  3E8F A;  1GH6 A;  2YUA A;  2YDE A;  2P4V A;  4PA9 A;  3JD0 A;  1NU1 H;  3JD1 A;  4YIO A;  3H1I H;  5IDJ A;  3B2E E;  1B04 A;  3AG7 A;  3RYH B;  5IJ9 A;  1NQT A;  4DR3 O;  2JDI G;  2ZIM A;  1SET A;  3ABM C;  4OGQ B;  4X62 B;  3STZ C;  4I9Q A;  5CA1 A;  2PY5 A;  1JQ0 A;  2F93 B;  2QKS A;  4P2Z A;  4NXN O;  4JV5 O;  1GK9 A;  5EYP B;  5J2U A;  1BSM A;  5JH7 A;  3ZED A;  3CCE V;  2RN9 A;  1H2S B;  2KSD A;  1HNW B;  3FKS G;  3RW0 A;  4TWK A;  4JTC B;  1FFX B;  2VQF O;  3AG2 B;  1K8A W;  4ICG A;  3CWB H;  4FFB A;  4P9O A;  1J95 A;  1LNQ A;  2BE3 A;  3JAM N;  3HB3 B;  3HKE B;  2Q9L A;  3CYO A;  4MTX A;  1TVK B;  4UCS A;  5KX5 B;  4B08 A;  3ZHS A;  3LDE A;  3ETQ A;  2Q7E A;  1K34 A;  4ZOL A;  1EN5 A;  1SQQ H;  2Y4U A;  4GLX A;  4D6T H;  1FAF A;  5JWP A;  5KHK A;  4JI5 O;  4DR2 O;  3D36 C;  4ZBM A;  3K79 A;  1XL4 A;  1X4T A;  1IBM B;  5TIS Z;  2WWW A;  4JAV A;  5EZY B;  1GMG A;  5IT9 N;  1MZE A;  2JGD B;  4LWS B;  2E3C A;  2LFS A;  1S72 V;  3K5M A;  3CC7 V;  1VF6 C;  1MA1 A;  4GT1 A;  5KA5 A;  4R8C A;  1XMQ B;  3ASO C;  2UXN A;  3P3N A;  1F4N A;  5IY5 C;  1AJN A;  3SPI A;  1F23 A;  3AG1 C;  3Q4H B;  3JAL B;  1QCE A;  2DN9 A;  2QR4 A;  2JS3 A;  2AZ0 A;  1XHX A;  4DV2 B;  1WA8 B;  5ITZ B;  2PF4 E;  5BMV A;  2DOS A;  1YVW A;  3B40 A;  2E76 B;  2PZS A;  2IH1 C;  4JI7 B;  4MW8 A;  5EBM C;  1P7B A;  4WCE V;  3ASO B;  1MSD A;  1V55 C;  3FB5 C;  5IY5 B;  1OHH G;  4FMT A;  1S76 D;  4ZI7 B;  3CRM A;  2N04 A;  4QPJ A;  3D3I A;  4DK0 A;  2ITC C;  4G27 B;  1LUV A;  4OPH A;  1JFF B;  4UCU A;  2EUL A;  2LO1 A;  1YIT V;  3KCY A;  4P9P A;  3TGU H;  3H1J H;  1WN7 A;  2Y0P A;  4GX2 A;  1WB8 A;  2W0F C;  3ZJZ A;  1YSC A;  4JI2 O;  1VQ7 V;  1V55 B;  2HR3 A;  2Q69 A;  5LA6 B;  2WLM A;  3K0G A;  3OMA B;  2HHH B;  3K5O A;  3KKY A;  4K0K B;  4RQE A;  4JI3 B;  3ABL C;  3R65 A;  3KG2 A;  4LNU B;  5C93 A;  1YXB A;  2BCC H;  2N05 A;  4BIZ A;  2WLH A;  2GUZ A;  3RYC A;  2BTQ B;  1K73 W;  1I0H A;  1M4U A;  5J9P C;  3OTF A;  1YJN V;  1YDX A;  1BQ0 A;  5JJJ B;  3HKD B;  3DSQ A;  1KU9 A;  4JI0 O;  2GSM B;  4I5S A;  4TV9 A;  4O4H B;  2ZDI A;  4CBC A;  2Q73 A;  4I9W A;  1SQV H;  2FL4 A;  4O2B A;  5B1A B;  2XHB A;  1U97 A;  1GM7 A;  2UUB O;  5B1O A;  3FYI B;  3HKE A;  2Y4T A;  4NTY A;  4K8Z A;  4DR5 O;  1BMF G;  1H38 A;  1X59 A;  3TXQ A;  4R50 A;  1AJP A;  2ADP A;  2UUC O;  4DUY O;  1S5J A;  3MHS C;  3K3W A;  4U3F H;  2DYR C;  3WB2 A;  4KHP O;  3FAV B;  1XNR B;  4HAM A;  4X20 A;  4BWA A;  3K5L A;  4DR3 B;  2ZE5 A;  4FLW A;  1NVP D;  1V54 C;  1LR1 A;  4JV5 B;  4NXN B;  2NLJ C;  4J7J A;  2JGD A;  3RFR A;  5CA0 B;  1FJG O;  3ETE A;  4H37 A;  3AG4 C;  4X1I A;  1WLE A;  2DYR B;  4R7C A;  3APQ A;  4X1K A;  4AHC A;  3RYF A;  3THO A;  2OTJ V;  5GW7 A;  2V4D A;  2DYS C;  2ZXW B;  1AI7 A;  3K5N A;  4EKW A;  2VQF B;  1RM1 C;  1CPY A;  1M93 A;  1V54 B;  2MK3 A;  4D7T A;  5EBW C;  3SYQ A;  1EZJ A;  2Y69 B;  4O4I A;  1XEQ A;  1Y6X A;  4XDK A;  1WA8 A;  4LR3 A;  3HKB B;  5ITZ A;  3LSS A;  2B1I A;  3LSU A;  3FFQ A;  2GBO A;  3CP1 A;  1HW7 A;  2HVK C;  1QU7 A;  3ML0 A;  3SYA A;  2IW5 A;  4JI6 O;  3FB7 C;  1KBH A;  4IIJ B;  1JFF A;  4JI5 B;  5LXT B;  1F7Y A;  2XT9 A;  3OGC C;  3OR6 C;  5DM6 V;  1ARO P;  4FLZ A;  2WLL A;  1N33 B;  3F5T A;  3ZS8 C;  1QBZ A;  5LYJ B;  2H3O A; 
#chains in the Genus database with same CATH homology
 3J81 N;  1N33 O;  2DJV A;  4DR5 O;  1HNW O;  1X59 A;  3OTO O;  1I94 O;  4DUZ O;  4JV5 O;  4NXN O;  2DOS A;  2AGA A;  1XMO O;  2UUC O;  4DUY O;  4DV6 O;  4DV4 O;  4KHP O;  4DR1 O;  5IWA O;  1A32 A;  4DV0 O;  5BY1 A;  1AIL A;  4DR7 O;  1HNX O;  1XNR O;  4YY3 O;  4DV7 O;  1IBL O;  4DR4 O;  1DK1 A;  4LFA O;  3R66 A;  4GKK O;  4OPH A;  2VQF O;  2JRI A;  1G1X B;  1FKA O;  4X66 O;  4LF9 O;  4DV5 O;  1FJG O;  3T1H O;  4OX9 O;  1HNZ O;  2Z0A A;  5BR8 O;  4JI8 O;  4LFC O;  4JYA O;  1N36 O;  2UXB O;  3JAM N;  1J5E O;  3O65 A;  4JI2 O;  2ZKO A;  4B3T O;  2UXD O;  5FLX N;  4DV1 O;  1IBK O;  2LW7 A;  1IBM O;  4X65 O;  3RT3 C;  4LFB O;  1HR0 O;  1R1B A;  4JI1 O;  4B3M O;  5H5N A;  2N74 A;  4X64 O;  2HHH O;  1AB3 A;  1XEQ A;  4LF7 O;  4K0K O;  5BXZ A;  4LF4 O;  5LMU O;  2UUA O;  1XNQ O;  4JI3 O;  4JI5 O;  1N32 O;  4DR2 O;  1XMQ O;  4A5U B;  4B3R O;  1YZB A;  4OPA A;  1FYJ A;  4B3S O;  3J80 N;  2E5L O;  2FKX A;  1KUQ A;  5IT9 N;  1D2D A;  3T1Y O;  1R6T A;  4JI6 O;  4JI0 O;  4X62 O;  4DV3 O;  4DV2 O;  4LF5 O;  2VQE O;  4GKJ O;  4DR6 O;  3SDL A;  4LF6 O;  3J7A U;  1NS1 A;  4JI4 O;  4AQY O;  1F7Y A;  5A2Q N;  4JI7 O;  4NXM O;  2UXC O;  3M8A A;  5LL6 Y;  2ZM6 O;  2F4V O;  4YHH O;  2UU9 O;  2UUB O;  4LF8 O;  4DR3 O;  3F5T A;  1N34 O;  5LMN O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...