4YY3O

30s ribosomal subunit- higb complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4yy3O00
4YY3O 2UUCO 4KHPO 2HHHO 5LMUO 2UXBO 2ZKOA 3R66A 2JRIA 4JYAO 1A32A 4DR1O 5IT9N 3O65A 5A2QN 1XNQO 4DV5O 4GKKO 1N34O 2DJVA 1I94O 4NXMO 4K0KO 1AB3A 4JI6O 4JI1O 1XMQO 5BY1A 4X62O 1X59A 4LFBO 4OPHA 1HNXO 4DUZO 4JI8O 3SDLA 1HNZO 4JI5O 4GKJO 2UXCO 3JAMN 3T1HO 4B3SO 4JI2O 1R6TA 4DR4O 2DOSA 4DV3O 3F5TA 2AGAA 2FKXA 4DR5O 4DV0O 4LF4O 3T1YO 4DV2O 5IWAO 4DV1O 4LF7O 5BXZA 4LF6O 4DV7O 1N36O 2UU9O 1FJGO 1F7YA 5BR8O 4A5UB 4X65O 4LF5O 1FYJA 1XMOO 4X64O 2UXDO 4DV6O 1IBMO 1NS1A 2N74A 3J7AU 4B3RO 1IBLO 4DR7O 1N32O 3RT3C 4AQYO 4LFCO 5LL6Y 1HR0O 1D2DA 4OPAA 3J81N 1IBKO 4LFAO 4JI7O 2UUAO 4JI3O 4DR2O 1R1BA 4JI0O 4LF8O 2VQFO 4DV4O 1N33O 4JV5O 2UUBO 4B3MO 1KUQA 1FKAO 1G1XB 1AILA 4DR6O 4B3TO 2Z0AA 3M8AA 2ZM6O 4DR3O 1XNRO 4DUYO 4NXNO 1DK1A 5LMNO 2F4VO 1J5EO 4JI4O 1HNWO 5H5NA 4YHHO 3J80N 1XEQA 3OTOO 5FLXN 2LW7A 4OX9O 2VQEO 4X66O 1YZBA 2E5LO 4LF9O
chains in the Genus database with same CATH superfamily
1TVKB 2IU3A 2UXBO 3SPCA 5FPOA 1P7GA 1Q90D 3BVOA 1ZLZA 3G80A 2RJZA 1WAZA 1YSCA 2EIMB 4NTYA 1VQOV 1E1QG 4QE9A 5B1NA 2P5OA 1VQ7V 3BCCH 1N34O 3E8HA 5A9GA 1XMOB 1TA8A 1YIJV 1I5XA 1CPYA 3JAWB 3AG3C 4JI5O 2BCCH 5CA3A 1N8RW 5L3EA 2W6JG 3C90A 4DUYB 3VQVA 3F5TA 2FTKA 3EVKA 4RUEA 3OAAG 3CCEV 2BOBC 1HWYA 4DV1O 1VQ5V 4TV9A 3RYHB 4ZHQB 3HKDB 3G4SV 2VWKA 1SQBH 4OGQB 2EBOA 3DXRA 4MTXA 3TXQA 4QJFB 5CBGA 4BWAA 4X64O 4DXWA 5LYJA 3ZHSA 4I4TB 1EZJA 1EN4A 4CH3A 3CHXA 3ICXA 1WLEA 4GT1A 1YTFD 5B3SC 4NXNB 1AI6A 5LL6Y 4B7KA 1URFA 3RBZA 3VQXA 2EIJC 4MSWC 1FXHA 1GTOA 5LP6C 3UO3A 2VS0A 3L73H 3QO7A 3B8MA 4PA9A 3K9AA 3DTUB 4FM0A 3UT5A 2UUBO 4B3MO 3K06A 4JTDB 3E8GA 5CA1A 3HKCA 5LP6A 3ABMB 4KFMA 4K3AA 1AILA 1R6KA 1LNQA 4KUMA 5LMNO 2FYUH 1I5YA 3ASOC 5CA0A 4MVQA 3CYOA 2Y4UA 1R3JC 5GW7A 5KAIZ 2X6BA 4OX9O 1YZBA 3AK1A 1K34A 4K35A 4B3SB 3GWOA 3ETGA 4DR5B 3STLC 4O4HB 4LF4B 2AHZA 4N21A 2HLDG 2FL4A 2ITCC 1RP3B 1K33A 1TAEA 2A79B 3TJTA 1SQPH 4JASA 2WWWA 1AB3A 5LHIA 2WA3A 3SJCC 4X1KA 4MVZA 2L6LA 1OCCC 2P06A 4PELA 5JQGA 1AJPA 2LGQA 2X6CA 1PP9H 1XNRB 3BRCA 4DV0O 4RAIA 2N05A 4MTGA 5B1AC 1J5EB 3DC5A 3E35A 2IU0A 2YXLA 2PYLA 2M7WA 4H44B 1B6QA 1AR4A 4HNAA 5J2UA 1GM9A 1V9PA 4YY3B 2F93B 5LMUB 3ZRWA 3ZX6A 2JDIG 1GM7A 2N74A 3L70H 1F23A 1JR9A 1BCCH 3W7UA 1DTOA 3B8NA 1AI5A 5EBMC 1WA8A 1R1BA 2LW1A 4MVSA 2W0FC 3BA9A 3H1JH 4X66B 5KA5A 3E89A 1Y74B 4D6TH 1H2GA 3AG4C 5JVDA 1VF6A 5E1AC 4HAMA 4JZGA 4BIUA 1KKCA 1HDJA 4LWSA 3K5MA 4DUYO 1ZL8A 1QR9A 3A0HZ 4JAUA 4FLVA 3W7XA 2FMLA 1H2KA 1FXKC 1OCZC 2AXTZ 4JTCB 1HNXB 4TT3G 2FB5A 2XUMA 3K08A 4B3RB 1WPXA 4B7EA 5LXTB 5JJJB 4CS2A 2QR4A 2JIZG 2H94A 3JSLA 1WNSA 4R8CA 1RM1C 5IT9N 4JYCA 1R3KC 2NN4A 1Q86W 4X1IB 2DJVA 1I94O 2WLIA 4YJ3A 1GN3A 1X59A 3SYAA 4DUZO 5CMUA 4O4LB 4B3TB 5DN6G 2AZ0A 3CCSV 2ZE7A 4X88A 1R73A 1VQNV 2CAZC 1HNWB 2Y4TA 4YHHB 3Q4HA 3BA8A 2YSUB 3ASNC 2DMXA 4LF5O 1L0LH 3CCQV 1R3IC 2UXXA 4UB6Z 4KHPB 5H2FZ 3J7AU 3K0GA 3BHPA 4PHZA 3H1KH 3U11A 2EX3A 3DGEA 3L75H 5H6RA 4HBNA 3SPGA 4PDLA 1HR0O 2OIGA 3THOA 5C93A 3ZBHA 2P4KA 3ABTA 3OMNB 1YCIA 5LOVB 3L74H 1W59A 4O2AB 1JPXA 4UCOA 1OHHG 5EZYB 3ZMTA 4DK1A 1JOYA 2QKCA 3N2GA 4LF7B 3OUSA 1XNRO 2JS3A 3CCRV 1NI8A 3UCSC 2E74B 3W7WA 2IH1C 4J7JA 3UO2A 4U3JA 1J5EO 1SQGA 2XHBA 5H5NA 1SF9A 1SZTA 2YEVA 5FLXN 1JFFB 2RN9A 4X20A 2E5LO 4YY3O 4JI2B 4FMTA 5LMUO 2B9ZA 2DYSC 2JS5A 2X7RB 1KP3A 4GYCB 4WF9V 1SQQH 3JYCA 4EB6B 3CX5F 1SS3A 2EULA 2F23A 2ODMA 3F5WC 4AILC 3ML0A 4PDRA 1B06A 2GSMB 1YXBA 5J9PC 3CPWU 2AW9A 1K7DA 2ETNA 1V54C 4LCUC 4J10A 4GLXA 4GX0A 5ITZB 2Y48A 2BSKA 1RFYA 4DR4O 1NTKH 1MG1A 3K5LA 3ZRXA 3QNEA 4ASUG 4WFEA 1EN5A 2DQ0A 4YIPA 3RYIB 5LA6A 2D2CB 5EYPA 1OCOB 3MDSA 1TUBA 3OGCC 3CB2A 4AHCA 4Z2WA 3CXCU 5IYZB 3CRMA 3LUTB 3E2EA 3FYEB 2QSAA 5IJ9B 1RSOB 1Q7YW 1D5AA 4O4JB 1QCEA 4B3RO 4F6RB 5KHGA 5CB4A 4WBNA 1EN6A 5FNVA 3W7SA 1S72V 4PJ0Z 4U7NA 1M56B 2ZE6A 1AP6A 3JATA 3CS5A 4NYKA 5JJNB 2HP8A 5IY5C 4LH6A 4E2LA 2UXBB 4CS3A 2QTOA 4B3TO 5CBFA 1XHZA 2Z0AA 4RWUA 4JTAB 2CTPA 3SJAC 1N34B 4X65B 3CCVV 1DF4A 4YJ2B 1HNWO 4MVUA 2GUZB 1QLNA 4YHHO 1S3JA 2IJJA 1WJZA 3OTFA 4KHPO 4TUYA 1P7BA 1QLEB 5GTHZ 3JD4A 5TISZ 3ZHRA 2YIAA 4JI7B 2OT5A 1BS3A 4DV1B 1QBZA 2CK3G 2OYQA 3S3WA 3STZC 5KHHA 1R3LC 5KAFZ 2RQ6A 3WG7C 2E3CA 2QE7G 3CE2A 1PM9A 1H8HG 4O4IA 3OFNG 5EIBC 3FAVB 4OPHA 5IJ0B 1HNZO 4JGSA 2YXHA 4WFAV 4I50A 5J2TA 2DOSA 3CWBH 1H38A 2OIEA 4MVOA 2MK3A 4LF7O 3CCJV 3RYCB 1M90W 1Q6HA 1H2NA 5CBHA 2BTOA 5KUMA 1J95A 3CJHB 3A0BZ 2PY5A 4B3MB 4TWKA 3F7YC 4N23A 4DR7O 3HKBA 2Q67A 2ATKC 1PD3A 5LMNB 1L8DA 2XAJA 3ZHQA 2K1EA 2QWQB 2R9RB 3BPZA 1H8EG 3MHHC 4OX9B 4MT8A 4G27B 3RWRD 2QM7A 4GX1A 4UV9A 4UVCA 1M5IA 2EIKB 2P67A 5KMGB 2JJ2G 1YVWA 4FFBA 2QA4V 4DR6O 3APOA 3CCMV 3GB7C 1M9NA 1Y66A 2E75B 2F4VO 3K04A 5B1OA 2ZD9A 2YC0A 1FFTB 1IZ3A 1K3EA 1EZVH 1GK9A 2G38A 5LGUA 2A7WA 4ZIBA 2XNDG 1SERA 2NR5A 5IYBO 5B1BB 1NQTA 4QE7A 1PPJH 1VQ6V 2LQTA 1NT2B 4CBCA 1A32A 3ABLB 4X1YA 1XNQO 4TV9B 1Y76A 1KP2A 2ITDC 4DRXA 1YI2V 1ZAUA 1YEWA 3DXRB 2W0XA 4NB5A 1Z2GA 2NNUA 2WAMA 3SR2C 3T1HO 4MS2A 4UCVA 1OJHA 4Q6GA 4LC1A 5GONA 1K4DC 3H9VA 5LGTA 1GN2A 4FLWA 4X65O 3OEHG 5C8YA 3VQWA 3ZS8C 1QR8A 5CA1B 3L72H 3HKCB 2ILMA 1N32O 2LGWA 4DW1A 3UQ8A 4JI7O 2Q5ZA 3CRQA 5CA0B 3T1CA 1MABG 2YS8A 4FM1A 2CGOA 1GO3F 1ZX3A 4HYOA 4I55B 2B1GA 5DEDA 2OCCC 1QHTA 3AG2C 4U3FH 4DV7B 3T4ZA 1GAXA 2VWJA 1I94B 4OXSA 2UXDB 2EIMC 2X6AA 4FLYA 2QEXV 1NTZH 3JCUZ 4ZI7A 4DUZB 4X1KB 4LF9O 3B77A 5JQGB 3ABKB 1Z5VA 1K92A 4UCTA 1G6UA 4IT5A 3C3TA 4YIOA 3H1IH 2UUAB 3JAKA 3ZIAG 4FFKA 3MAQA 1K8AW 2XT9A 4LF5B 1S0VA 4R6ZA 1E79G 4HNAB 5J2UB 4BR6A 5EIBD 1GRJA 3LSQA 3KZIZ 1XMQO 3SJQC 3JAWA 3ZRWB 5BMVB 3K5OA 3EXAA 4PI0A 2JVDA 2ZINA 1Q82W 1DF5A 1XILA 2ZE5A 3CC7V 3AEIA 3CMAV 2HFEC 1HR0B 2FKXA 2KB1A 3X2QB 3ETDA 2ZE8A 1KD1W 2C2AA 2YIBD 1MA1A 1RPRA 1WA8B 3A8TA 5F2VO 3G67A 1BQZA 1EBOA 1WPBA 3FB5C 3EHBB 4G2KA 3FYIB 1SC5B 2AZ2A 1JCHA 4LFCO 3BY6A 3D8CA 1ZL8B 3ABMC 3CSXA 3ZRSA 4U7OA 3E8BA 1UFIA 4MVRA 4FM2A 2E5LB 1FPOA 2JGUA 1I08A 1IVSA 2ZIMA 5KA6A 2IJHA 1AJQA 4CS4A 5KUKA 4KL1A 1MOFA 3JCZA 2P22C 2CTWA 1QU7A 1DK1A 1JMKC 3UM7A 3IJ4A 4JI4O 4X8AA 3X2QC 3ZJZA 2WLLA 1ORQC 3IC7A 3J80N 3OTOO 1PNLA 1AR5A 2ARHA 4J80A 2UUCO 2HHHO 4DR4B 1P49A 2D3OW 5KLVH 3CC2V 4FPPA 5IE9A 5AG2A 4NKGB 4DR2B 2Y69B 4CC5A 4LF8B 4K0KO 1PV0A 4IYHA 5IYDO 5KX5A 1Q3EA 5JH7A 4JYYA 2A3QA 2UXCO 2QWPB 1K9MW 4K8XA 2EINB 3VOUA 1FXKA 3ETQA 2X0LA 1ZWIC 1I0HA 1FFXA 4W4KA 4DV7O 1FAFA 2OTJV 1K4CC 2YIDA 2EZOA 2UXDO 1NS1A 1G8MA 4JAAA 3SJBC 3UKMA 1NTMH 3AG1B 1VQKV 1ZTEA 3N2GB 1GM8A 4H13B 1SA0A 1VF5B 1WP7A 4XBFA 4LFAO 2ZR2A 2UUAO 1B04A 1MNGA 1O9HA 2PF4E 3FB8C 2XOKG 4LP8A 2HVKC 2WPDG 3SPIA 3G6EV 2YEVB 1Y74A 2P7TC 3ZMZA 1BHBA 1N33O 4X20B 4X89A 2KG7B 3BFRA 2EINC 1COWG 3P3NA 1JJ2U 3OEEG 1UJWB 4UXNA 4DW0A 2CH7A 2DYRB 1DLBA 1HNZB 2ZQMA 1VQ8V 5LXTA 2M6YA 4D7SA 2IH3C 4EKWA 1Y4MA 4IHJB 2BSKB 1H2MA 3D3IA 1NBMG 4X9QA 1AVMA 4GZRB 1THZA 5LA6B 1SZXA 1VIBA 5EYPB 1H2LA 1TUBB 4XDLA 2QKAA 2HG5C 4JPRA 1SQFA 4JI1O 4UCSA 1VF7A 4F6EA 3KG2A 2GTAA 3JAMN 1XUQA 4DR7B 3ZCCA 2QWRB 2WLKA 4AI8A 5CB4B 5B66Z 2OTLV 2YUAA 3D36C 4L87A 4LF6O 3W7TA 2XASA 4H0LB 1M57B 2LP7A 5BR8O 4UB8Z 3JATB 5L3DA 4BAYA 4WFHA 1BSMA 1XI1A 4I0XA 1VQ9V 2WLMA 4DR6B 2DYRC 1SQXH 4TV8A 4NVPA 4GKKB 3RW0A 2F4VB 1IURA 1IBKO 3JASA 1YJ9V 1KMIZ 4DR2O 4JI6B 1KC8W 3C3SA 4LF8O 3OR7C 1XL6A 1MZEA 1F4MA 2ADPA 1E1RG 5EBLC 2ZDIC 4TUYB 2ADQB 1JA8A 2IBZH 3SYQA 5CN0A 2WLNA 3M8AA 3T4DA 1XNQB 1XDCA 3VBBA 1AI4A 2XTAA 1QQCA 1NVPB 4Q20A 4FZ1A 2QWOB 4O4IB 3OM3B 1WB8A 1Q5OA 2RMKB 3T1HB 2VRZA 3QG5A 3JARA 4QNHB 4AQYB 5HFMA 2PZSA 3N2KB 3LSSA 3FB7C 3P32A 4I50B 5J2TB 2BOCC 4UVAA 2GBOA 2A9HA 1EFRG 3B4SA 2YICA 3O65A 5A2QN 5DM6V 1H2SB 2R9IA 2BE3A 3E86A 1N4CA 1SESA 2HEPA 4O2BB 1L1FA 3OMIB 1OCOC 5ITZA 1WP8A 4TSFG 4BW9A 3SDLA 4HZ3A 4RQFA 4ZOLA 4IIJA 1N32B 4NTXA 5LGNA 4F4LA 1R6TA 3HKBB 1VARA 2Q6AA 5LBQA 2QWNB 3KCXA 4L8JA 4DO2A 4PD4F 4PA4A 3O9OA 1Q8IA 3ZEDA 1F4NA 2YXYA 3JSNA 4JZ2A 1P4RA 1ROPA 2H3OA 4PA6A 3JALB 5IJ9A 4DV6O 3E22A 1M56C 5K1PA 2LO1A 1M93A 1VMGA 2IJKA 4JYAB 4J9YB 3RT3C 4WCEV 3H1LH 5EBWC 4EEQA 3FX7A 1K73W 4MVMA 3EFFK 4KXRA 2V4DA 3L71H 1YITV 3IC9A 4JI0O 4LFBB 4LF9B 1D5NA 4DV4O 4W4LA 2HR3A 1O9GA 2QJ1A 1XHXA 2XAHA 1BQ0A 2YIBA 3ZHTA 4DR3O 1TUEB 2HJDA 3TETA 1U97A 3WB0A 1QLEC 3RFRA 4YXWG 2JEXA 1KECA 2V1DA 2GUZA 4DRXB 1MMMA 4JYBA 4R7CA 1XMQB 1IBMB 5JCOC 2LW7A 2VQEO 4GX5A 4NTWA 3OUFA 1I7FA 4CH5A 4FJCC 3RN4A 3RYFA 5FL7G 1YF2A 4TOIA 3I55V 5GONB 3U0ZA 2XAFA 2EILB 4J7ZA 1MZFA 4GKKO 3K0DA 1MSWD 2PI4A 1Z5WA 1DGSA 1YDXA 4JI6O 2CGNA 4XDKA 3HKEA 5BY1A 5C8YB 1ZSPA 4RO2A 4Z1MG 2F1MA 2YDEA 4LFCB 1BGYH 1SQVH 3CCLV 4ABMA 1RPOA 1QVFU 3RYCA 1R6NA 1N0NA 4EFEA 2KQXA 5L3CA 3JD3A 3AG3B 3CJHA 3H01A 4TQFA 5LHGA 3G71V 1OCRB 4JF3A 3WU2Z 2JGDA 5JWPA 3H1HH 4K8ZA 1PNMA 2DWDC 4PA3A 5LYJB 4LNUA 3SYCA 2GDSA 1UPGA 4DR1B 3K3WA 4AQYO 2L35A 3U10A 2EIKC 1KBHA 4MTOA 1S77D 3J81N 4JI4B 1AR1B 3OTOB 4MTFA 2EILC 4ZI7B 2VQFO 5B3SB 2UUCB 2HHHB 5KMGA 3UT5B 2EIJB 1XREA 3ZMVA 4PV1B 4J7KA 5LP6B 4FLXA 2CTRA 3SGIA 1AI7A 5IWAB 4E4EA 3K59A 4FVMA 3L9DA 5B1BC 2LFRA 3JAKB 2F43G 1JX9A 3BAAA 2Y0PA 4K0KB 3ABLC 3IFXA 3MD0A 2ZT9B 2O57A 3TGUH 2UXCB 1IBLB 1OCRC 1AJNA 3HR0A 3RVZA 2RNBA 3ASOB 5LHHA 4FIPC 4JYAO 2OCHA 1K97A 2BTQA 3DC6A 2XAGA 4RQEA 1NR7A 3S3XA 1PL0A 4BW5A 5DECA 3OE7G 5IYCO 2XAQA 2R72A 3BABA 4LFBO 4I9QA 1TVKA 4JI8O 1NH2B 2R70A 3LNNA 1MSDA 1V55B 2P4VA 4H33A 4UCRA 1GN6A 4LFAB 3OD4A 3K58A 2LFSA 1VQPV 1XOUA 2A0LA 3QO5A 1OCCB 4QPKA 1FJGO 3E83A 1BT8A 3R65A 4A5UB 2PI5A 1VQ4V 1P84F 2ZXWB 1N33B 1NVPD 1IBMO 1JQ0A 1Y67A 4P9OA 5IDJA 5B1AB 3D3QA 1S5HC 2N04A 3A0RA 1LUWA 1HW7A 2ZIOA 3RYHA 4ZHQA 3HKDA 2B5UA 2WLHA 4X62B 2WLLB 3GVMA 1W2BU 3FKSG 5B5EZ 1XBLA 4PDVA 4XDJA 4I4TA 1FS0G 5JVDB 4DV3B 4I55A 2EJRA 4ZKIA 2AHYA 3DSQA 2ZM6O 2CUGA 4LWSB 3K9SA 3CRRA 3ABKC 1AP5A 2EJ7A 1V55C 2Z5UA 3P3PA 3AG4B 1Q6IA 2IW5A 1GN4A 4EFBA 3CRAA 4JI1B 3GWKC 5KHIA 3FD9A 3K03A 1XEQA 2RCVA 5KX5B 2PTMA 4TQDA 5JH7B 3FB6C 2ZXWC 1OV9A 4CZZA 2ZKOA 3R66A 1GMGA 1FXKB 4LF6B 4DR1O 1OCZB 1FFXB 4DV5O 5BR8B 1IX9A 3ZN0A 4NXMO 1US6A 1EM1A 2WSSG 2CTQA 4JV5B 1NKDA 2WLIB 4YJ3B 5BMVA 3ETEA 3OR6C 4I7ZB 4GKJO 1RM1B 1M1KW 3LDCA 3RVYA 4GCZA 2CDYA 4O4HA 3CD6V 3QTCA 1SA0B 1IBKB 1S76D 1KKDA 5IWAO 1VF6C 4R50A 5BXZA 4P2ZA 4WFFA 3M99B 3Q4HB 2PUSA 4IL6Z 1XMOO 1T5EA 4LH7A 4FLTA 1BL8A 2YI8A 4BIZA 1IBLO 5EC2C 2GV9A 4P30A 4DK0A 3ASNB 1CEZA 4WFGA 2Q7GA 4I5SA 3K57A 2DW4A 1XQ8A 2CH7B 2RDCA 2MW2B 4J9ZB 1KUQA 4PDMA 1G1XB 3CCUV 2NLJC 3T1YB 2PYJA 1SKVA 5H6QA 1N36B 3OGIB 4NXNO 2CE4A 3CRCA 1OZ0A 3NXSA 4B08A 4MW3A 1XL4A 3JD0A 4U3JB 4PA7A 3WFVA 1N0JA 3B40A 1NU1H 4Z1VA 2Y69C 4WFBV 2WA4A 5D5PA 1IDSA 3SPHA 4FLUA 4CH4A 3K5NA 1S5JA 4JI3B 3B09A 1FD9A 2B1IA 3ZRVA 4P9PA 1L0NH 4J11A 1VEWA 1KQSU 1G4YB 2DYSB 4DV6B 2QTSA 4KP4A 2DQ3A 4X62O 5HFLA 4I0XB 3IGAC 4B3SO 2Q69A 2Q68A 4DV3O 3AK2A 3NR7A 2AGAA 4TV8B 4DR5O 4LF4O 3E8FA 3LSUA 1WN7A 3AG1C 2HVJC 1KB9F 4J42A 3JASB 1V54B 3A2FA 1ENVA 4X1IA 4JI0B 2QKSA 4DV4B 1FYJA 3ZHUA 2PGGA 1QNMA 3M7MX 1QVGU 3AG7A 3F7VC 2Z3YA 4O4LA 3APQA 2Q0AA 3JD2A 5JJEB 4DR3B 3K79A 4GX2A 1NZ6A 1JJOA 4WBNB 3IAYA 3CEIA 2P6JA 2Q4PA 4OPAA 5FNVB 1BE3H 5K1XA 5GTIZ 3HB3B 2VQEB 1GH6A 3MHSC 4I9WA 4JV5O 2K9PA 2QDOA 3D36A 1FKAO 3JARB 4UVBA 2KG7A 1X4TA 1LR1A 1FXVA 4DV2B 1S5LZ 1NH2D 2ZNJA 1ZUQA 2UU9B 2ZCEA 2DN9A 5IY5B 5FPRA 1NR1A 4JAVA 5LOVA 4O2AA 1KYOF 4X66O 3OT7A 1Y6XA 5EZYA 1YTFB 4PI2A 3KCYA 3ZMSA 4ZOLB 4IIJB 4IHJA 4CC6A 2GTSA 5BZBA 2JEUA 3PN1A 4CH6A 4MW8A 3OMAB 3WB1A 3BEHA 2A06H 2E76B 3SYOA 2F95B 2ZDIA 5E79Z 4NR1A 1VP7A 4LR3A 1JFFA 5L3FA 1HNXO 3E22B 1M57C 1B3QA 2HJFC 2JK5C 2ZR3A 1TGOA 3WG7B 4EB6A 2IM9A 3QO8A 3T1YO 3LNMB 3T2MA 2DWEC 3QF7A 4J41A 1N36O 4C7UA 1CP9A 3VQYA 2QGNA 2W6IG 1F7YA 2VQFB 4IGGA 2Q0OC 3OW2U 1VQLV 4LBEC 4D7TA 2Q73A 1GKFA 4G28B 3JD1A 1NJIW 1Q81W 1K5QA 1BZKA 1Q6UA 4UCUA 4DYLA 4ICGA 3RYIA 3PJSK 3SYPA 2HKOA 4GUNA 2UXNA 2ZNIA 1PNKA 1AROP 4JI3O 3CXHF 2Q7HA 2LJ2A 5IYZA 3ABUA 5EC1C 4JI5B 2Q9LA 3I56V 1RSOA 1W0JG 2JJ1G 4O4JA 3RYFB 4F6RA 4FFBB 1BMFG 1IXMA 1YJWV 5EK0A 4QGPA 3WB2A 4FZ0A 3ZMUA 4X64B 3KKYA 4FK5C 3ZHVA 2Y0IA 3TK1A 3HKEB 4JI8B 1M4UA 1PL4A 5KHKA 1YHQV 1BHAA 3FFQA 4FLZA 1Q43A 3CC4V 3N2KA 5KHJA 4ZBMA 3I5DA 2JRIA 2KKWA 2QM4A 4X1YB 1FJGB 2WLJA 3P30A 3AK3A 1Y76B 2IJIA 1SETA 4YJ2A 4O2BA 2JGDB 3G6BA 2UUBB 1LUVA 4H37A 4LNUB 2Q7EA 4JI2O 1U96A 3TXSA 3B2EE 2QM8A 4UFZA 4DV2O 1SRYA 5JCOA 4IYIA 4UUJC 1W0KG 2EZPA 2UU9O 4BIOA 2YI9A 3JALA 3FAVA 5IJ0A 2OWOA 5L3GA 3ZN1A 1YJNV 2ZM6B 5L3BA 2KSDA 5D5QA 1CXZB 1PKXA 2P90A 3LDDA 1D2DA 3CMEV 1WB7A 2DE0X 2V7QG 2Q8VA 4QPJA 1K5SA 4RUFA 3RGBA 4UV8A 2R9AA 1HP8A 4DV0B 1JVMA 3TCUA 2GHYA 5H9CA 4DV5B 3CP1A 1IXBA 1KU9A 3LDEA 2BTQB 4NXMB 3QVNA 4QIWF 3SPJA 3N27A 1VQMV 2H8PC 3HPLC 2OCCB 4GKJB 3AG2B 2F66C 1F51A
chains in the Genus database with same CATH topology
4YY3O 2UUCO 4KHPO 2HHHO 5LMUO 2UXBO 2ZKOA 3R66A 2JRIA 4JYAO 1A32A 4DR1O 5IT9N 3O65A 5A2QN 1XNQO 4DV5O 4GKKO 1N34O 2DJVA 1I94O 4NXMO 4K0KO 1AB3A 4JI6O 4JI1O 1XMQO 5BY1A 4X62O 1X59A 4LFBO 4OPHA 1HNXO 4DUZO 4JI8O 3SDLA 1HNZO 4JI5O 4GKJO 2UXCO 3JAMN 3T1HO 4B3SO 4JI2O 1R6TA 4DR4O 2DOSA 4DV3O 3F5TA 2AGAA 2FKXA 4DR5O 4DV0O 4LF4O 3T1YO 4DV2O 5IWAO 4DV1O 4LF7O 5BXZA 4LF6O 4DV7O 1N36O 2UU9O 1FJGO 1F7YA 5BR8O 4A5UB 4X65O 4LF5O 1FYJA 1XMOO 4X64O 2UXDO 4DV6O 1IBMO 1NS1A 2N74A 3J7AU 4B3RO 1IBLO 4DR7O 1N32O 3RT3C 4AQYO 4LFCO 5LL6Y 1HR0O 1D2DA 4OPAA 3J81N 1IBKO 4LFAO 4JI7O 2UUAO 4JI3O 4DR2O 1R1BA 4JI0O 4LF8O 2VQFO 4DV4O 1N33O 4JV5O 2UUBO 4B3MO 1KUQA 1FKAO 1G1XB 1AILA 4DR6O 4B3TO 2Z0AA 3M8AA 2ZM6O 4DR3O 1XNRO 4DUYO 4NXNO 1DK1A 5LMNO 2F4VO 1J5EO 4JI4O 1HNWO 5H5NA 4YHHO 3J80N 1XEQA 3OTOO 5FLXN 2LW7A 4OX9O 2VQEO 4X66O 1YZBA 2E5LO 4LF9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 O;  2UUC O;  4KHP O;  2HHH O;  5LMU O;  2UXB O;  2ZKO A;  3R66 A;  2JRI A;  4JYA O;  1A32 A;  4DR1 O;  5IT9 N;  3O65 A;  5A2Q N;  1XNQ O;  4DV5 O;  4GKK O;  1N34 O;  2DJV A;  1I94 O;  4NXM O;  4K0K O;  1AB3 A;  4JI6 O;  4JI1 O;  1XMQ O;  5BY1 A;  4X62 O;  1X59 A;  4LFB O;  4OPH A;  1HNX O;  4DUZ O;  4JI8 O;  3SDL A;  1HNZ O;  4JI5 O;  4GKJ O;  2UXC O;  3JAM N;  3T1H O;  4B3S O;  4JI2 O;  1R6T A;  4DR4 O;  2DOS A;  4DV3 O;  3F5T A;  2AGA A;  2FKX A;  4DR5 O;  4DV0 O;  4LF4 O;  3T1Y O;  4DV2 O;  5IWA O;  4DV1 O;  4LF7 O;  5BXZ A;  4LF6 O;  4DV7 O;  1N36 O;  2UU9 O;  1FJG O;  1F7Y A;  5BR8 O;  4A5U B;  4X65 O;  4LF5 O;  1FYJ A;  1XMO O;  4X64 O;  2UXD O;  4DV6 O;  1IBM O;  1NS1 A;  2N74 A;  3J7A U;  4B3R O;  1IBL O;  4DR7 O;  1N32 O;  3RT3 C;  4AQY O;  4LFC O;  5LL6 Y;  1HR0 O;  1D2D A;  4OPA A;  3J81 N;  1IBK O;  4LFA O;  4JI7 O;  2UUA O;  4JI3 O;  4DR2 O;  1R1B A;  4JI0 O;  4LF8 O;  2VQF O;  4DV4 O;  1N33 O;  4JV5 O;  2UUB O;  4B3M O;  1KUQ A;  1FKA O;  1G1X B;  1AIL A;  4DR6 O;  4B3T O;  2Z0A A;  3M8A A;  2ZM6 O;  4DR3 O;  1XNR O;  4DUY O;  4NXN O;  1DK1 A;  5LMN O;  2F4V O;  1J5E O;  4JI4 O;  1HNW O;  5H5N A;  4YHH O;  3J80 N;  1XEQ A;  3OTO O;  5FLX N;  2LW7 A;  4OX9 O;  2VQE O;  4X66 O;  1YZB A;  2E5L O;  4LF9 O; 
#chains in the Genus database with same CATH topology
 1TVK B;  2IU3 A;  2UXB O;  3SPC A;  5FPO A;  1P7G A;  1Q90 D;  3BVO A;  1ZLZ A;  3G80 A;  2RJZ A;  1WAZ A;  1YSC A;  2EIM B;  4NTY A;  1VQO V;  1E1Q G;  4QE9 A;  5B1N A;  2P5O A;  1VQ7 V;  3BCC H;  1N34 O;  3E8H A;  5A9G A;  1XMO B;  1TA8 A;  1YIJ V;  1I5X A;  1CPY A;  3JAW B;  3AG3 C;  4JI5 O;  2BCC H;  5CA3 A;  1N8R W;  5L3E A;  2W6J G;  3C90 A;  4DUY B;  3VQV A;  3F5T A;  2FTK A;  3EVK A;  4RUE A;  3OAA G;  3CCE V;  2BOB C;  1HWY A;  4DV1 O;  1VQ5 V;  4TV9 A;  3RYH B;  4ZHQ B;  3HKD B;  3G4S V;  2VWK A;  1SQB H;  4OGQ B;  2EBO A;  3DXR A;  4MTX A;  3TXQ A;  4QJF B;  5CBG A;  4BWA A;  4X64 O;  4DXW A;  5LYJ A;  3ZHS A;  4I4T B;  1EZJ A;  1EN4 A;  4CH3 A;  3CHX A;  3ICX A;  1WLE A;  4GT1 A;  1YTF D;  5B3S C;  4NXN B;  1AI6 A;  5LL6 Y;  4B7K A;  1URF A;  3RBZ A;  3VQX A;  2EIJ C;  4MSW C;  1FXH A;  1GTO A;  5LP6 C;  3UO3 A;  2VS0 A;  3L73 H;  3QO7 A;  3B8M A;  4PA9 A;  3K9A A;  3DTU B;  4FM0 A;  3UT5 A;  2UUB O;  4B3M O;  3K06 A;  4JTD B;  3E8G A;  5CA1 A;  3HKC A;  5LP6 A;  3ABM B;  4KFM A;  4K3A A;  1AIL A;  1R6K A;  1LNQ A;  4KUM A;  5LMN O;  2FYU H;  1I5Y A;  3ASO C;  5CA0 A;  4MVQ A;  3CYO A;  2Y4U A;  1R3J C;  5GW7 A;  5KAI Z;  2X6B A;  4OX9 O;  1YZB A;  3AK1 A;  1K34 A;  4K35 A;  4B3S B;  3GWO A;  3ETG A;  4DR5 B;  3STL C;  4O4H B;  4LF4 B;  2AHZ A;  4N21 A;  2HLD G;  2FL4 A;  2ITC C;  1RP3 B;  1K33 A;  1TAE A;  2A79 B;  3TJT A;  1SQP H;  4JAS A;  2WWW A;  1AB3 A;  5LHI A;  2WA3 A;  3SJC C;  4X1K A;  4MVZ A;  2L6L A;  1OCC C;  2P06 A;  4PEL A;  5JQG A;  1AJP A;  2LGQ A;  2X6C A;  1PP9 H;  1XNR B;  3BRC A;  4DV0 O;  4RAI A;  2N05 A;  4MTG A;  5B1A C;  1J5E B;  3DC5 A;  3E35 A;  2IU0 A;  2YXL A;  2PYL A;  2M7W A;  4H44 B;  1B6Q A;  1AR4 A;  4HNA A;  5J2U A;  1GM9 A;  1V9P A;  4YY3 B;  2F93 B;  5LMU B;  3ZRW A;  3ZX6 A;  2JDI G;  1GM7 A;  2N74 A;  3L70 H;  1F23 A;  1JR9 A;  1BCC H;  3W7U A;  1DTO A;  3B8N A;  1AI5 A;  5EBM C;  1WA8 A;  1R1B A;  2LW1 A;  4MVS A;  2W0F C;  3BA9 A;  3H1J H;  4X66 B;  5KA5 A;  3E89 A;  1Y74 B;  4D6T H;  1H2G A;  3AG4 C;  5JVD A;  1VF6 A;  5E1A C;  4HAM A;  4JZG A;  4BIU A;  1KKC A;  1HDJ A;  4LWS A;  3K5M A;  4DUY O;  1ZL8 A;  1QR9 A;  3A0H Z;  4JAU A;  4FLV A;  3W7X A;  2FML A;  1H2K A;  1FXK C;  1OCZ C;  2AXT Z;  4JTC B;  1HNX B;  4TT3 G;  2FB5 A;  2XUM A;  3K08 A;  4B3R B;  1WPX A;  4B7E A;  5LXT B;  5JJJ B;  4CS2 A;  2QR4 A;  2JIZ G;  2H94 A;  3JSL A;  1WNS A;  4R8C A;  1RM1 C;  5IT9 N;  4JYC A;  1R3K C;  2NN4 A;  1Q86 W;  4X1I B;  2DJV A;  1I94 O;  2WLI A;  4YJ3 A;  1GN3 A;  1X59 A;  3SYA A;  4DUZ O;  5CMU A;  4O4L B;  4B3T B;  5DN6 G;  2AZ0 A;  3CCS V;  2ZE7 A;  4X88 A;  1R73 A;  1VQN V;  2CAZ C;  1HNW B;  2Y4T A;  4YHH B;  3Q4H A;  3BA8 A;  2YSU B;  3ASN C;  2DMX A;  4LF5 O;  1L0L H;  3CCQ V;  1R3I C;  2UXX A;  4UB6 Z;  4KHP B;  5H2F Z;  3J7A U;  3K0G A;  3BHP A;  4PHZ A;  3H1K H;  3U11 A;  2EX3 A;  3DGE A;  3L75 H;  5H6R A;  4HBN A;  3SPG A;  4PDL A;  1HR0 O;  2OIG A;  3THO A;  5C93 A;  3ZBH A;  2P4K A;  3ABT A;  3OMN B;  1YCI A;  5LOV B;  3L74 H;  1W59 A;  4O2A B;  1JPX A;  4UCO A;  1OHH G;  5EZY B;  3ZMT A;  4DK1 A;  1JOY A;  2QKC A;  3N2G A;  4LF7 B;  3OUS A;  1XNR O;  2JS3 A;  3CCR V;  1NI8 A;  3UCS C;  2E74 B;  3W7W A;  2IH1 C;  4J7J A;  3UO2 A;  4U3J A;  1J5E O;  1SQG A;  2XHB A;  5H5N A;  1SF9 A;  1SZT A;  2YEV A;  5FLX N;  1JFF B;  2RN9 A;  4X20 A;  2E5L O;  4YY3 O;  4JI2 B;  4FMT A;  5LMU O;  2B9Z A;  2DYS C;  2JS5 A;  2X7R B;  1KP3 A;  4GYC B;  4WF9 V;  1SQQ H;  3JYC A;  4EB6 B;  3CX5 F;  1SS3 A;  2EUL A;  2F23 A;  2ODM A;  3F5W C;  4AIL C;  3ML0 A;  4PDR A;  1B06 A;  2GSM B;  1YXB A;  5J9P C;  3CPW U;  2AW9 A;  1K7D A;  2ETN A;  1V54 C;  4LCU C;  4J10 A;  4GLX A;  4GX0 A;  5ITZ B;  2Y48 A;  2BSK A;  1RFY A;  4DR4 O;  1NTK H;  1MG1 A;  3K5L A;  3ZRX A;  3QNE A;  4ASU G;  4WFE A;  1EN5 A;  2DQ0 A;  4YIP A;  3RYI B;  5LA6 A;  2D2C B;  5EYP A;  1OCO B;  3MDS A;  1TUB A;  3OGC C;  3CB2 A;  4AHC A;  4Z2W A;  3CXC U;  5IYZ B;  3CRM A;  3LUT B;  3E2E A;  3FYE B;  2QSA A;  5IJ9 B;  1RSO B;  1Q7Y W;  1D5A A;  4O4J B;  1QCE A;  4B3R O;  4F6R B;  5KHG A;  5CB4 A;  4WBN A;  1EN6 A;  5FNV A;  3W7S A;  1S72 V;  4PJ0 Z;  4U7N A;  1M56 B;  2ZE6 A;  1AP6 A;  3JAT A;  3CS5 A;  4NYK A;  5JJN B;  2HP8 A;  5IY5 C;  4LH6 A;  4E2L A;  2UXB B;  4CS3 A;  2QTO A;  4B3T O;  5CBF A;  1XHZ A;  2Z0A A;  4RWU A;  4JTA B;  2CTP A;  3SJA C;  1N34 B;  4X65 B;  3CCV V;  1DF4 A;  4YJ2 B;  1HNW O;  4MVU A;  2GUZ B;  1QLN A;  4YHH O;  1S3J A;  2IJJ A;  1WJZ A;  3OTF A;  4KHP O;  4TUY A;  1P7B A;  1QLE B;  5GTH Z;  3JD4 A;  5TIS Z;  3ZHR A;  2YIA A;  4JI7 B;  2OT5 A;  1BS3 A;  4DV1 B;  1QBZ A;  2CK3 G;  2OYQ A;  3S3W A;  3STZ C;  5KHH A;  1R3L C;  5KAF Z;  2RQ6 A;  3WG7 C;  2E3C A;  2QE7 G;  3CE2 A;  1PM9 A;  1H8H G;  4O4I A;  3OFN G;  5EIB C;  3FAV B;  4OPH A;  5IJ0 B;  1HNZ O;  4JGS A;  2YXH A;  4WFA V;  4I50 A;  5J2T A;  2DOS A;  3CWB H;  1H38 A;  2OIE A;  4MVO A;  2MK3 A;  4LF7 O;  3CCJ V;  3RYC B;  1M90 W;  1Q6H A;  1H2N A;  5CBH A;  2BTO A;  5KUM A;  1J95 A;  3CJH B;  3A0B Z;  2PY5 A;  4B3M B;  4TWK A;  3F7Y C;  4N23 A;  4DR7 O;  3HKB A;  2Q67 A;  2ATK C;  1PD3 A;  5LMN B;  1L8D A;  2XAJ A;  3ZHQ A;  2K1E A;  2QWQ B;  2R9R B;  3BPZ A;  1H8E G;  3MHH C;  4OX9 B;  4MT8 A;  4G27 B;  3RWR D;  2QM7 A;  4GX1 A;  4UV9 A;  4UVC A;  1M5I A;  2EIK B;  2P67 A;  5KMG B;  2JJ2 G;  1YVW A;  4FFB A;  2QA4 V;  4DR6 O;  3APO A;  3CCM V;  3GB7 C;  1M9N A;  1Y66 A;  2E75 B;  2F4V O;  3K04 A;  5B1O A;  2ZD9 A;  2YC0 A;  1FFT B;  1IZ3 A;  1K3E A;  1EZV H;  1GK9 A;  2G38 A;  5LGU A;  2A7W A;  4ZIB A;  2XND G;  1SER A;  2NR5 A;  5IYB O;  5B1B B;  1NQT A;  4QE7 A;  1PPJ H;  1VQ6 V;  2LQT A;  1NT2 B;  4CBC A;  1A32 A;  3ABL B;  4X1Y A;  1XNQ O;  4TV9 B;  1Y76 A;  1KP2 A;  2ITD C;  4DRX A;  1YI2 V;  1ZAU A;  1YEW A;  3DXR B;  2W0X A;  4NB5 A;  1Z2G A;  2NNU A;  2WAM A;  3SR2 C;  3T1H O;  4MS2 A;  4UCV A;  1OJH A;  4Q6G A;  4LC1 A;  5GON A;  1K4D C;  3H9V A;  5LGT A;  1GN2 A;  4FLW A;  4X65 O;  3OEH G;  5C8Y A;  3VQW A;  3ZS8 C;  1QR8 A;  5CA1 B;  3L72 H;  3HKC B;  2ILM A;  1N32 O;  2LGW A;  4DW1 A;  3UQ8 A;  4JI7 O;  2Q5Z A;  3CRQ A;  5CA0 B;  3T1C A;  1MAB G;  2YS8 A;  4FM1 A;  2CGO A;  1GO3 F;  1ZX3 A;  4HYO A;  4I55 B;  2B1G A;  5DED A;  2OCC C;  1QHT A;  3AG2 C;  4U3F H;  4DV7 B;  3T4Z A;  1GAX A;  2VWJ A;  1I94 B;  4OXS A;  2UXD B;  2EIM C;  2X6A A;  4FLY A;  2QEX V;  1NTZ H;  3JCU Z;  4ZI7 A;  4DUZ B;  4X1K B;  4LF9 O;  3B77 A;  5JQG B;  3ABK B;  1Z5V A;  1K92 A;  4UCT A;  1G6U A;  4IT5 A;  3C3T A;  4YIO A;  3H1I H;  2UUA B;  3JAK A;  3ZIA G;  4FFK A;  3MAQ A;  1K8A W;  2XT9 A;  4LF5 B;  1S0V A;  4R6Z A;  1E79 G;  4HNA B;  5J2U B;  4BR6 A;  5EIB D;  1GRJ A;  3LSQ A;  3KZI Z;  1XMQ O;  3SJQ C;  3JAW A;  3ZRW B;  5BMV B;  3K5O A;  3EXA A;  4PI0 A;  2JVD A;  2ZIN A;  1Q82 W;  1DF5 A;  1XIL A;  2ZE5 A;  3CC7 V;  3AEI A;  3CMA V;  2HFE C;  1HR0 B;  2FKX A;  2KB1 A;  3X2Q B;  3ETD A;  2ZE8 A;  1KD1 W;  2C2A A;  2YIB D;  1MA1 A;  1RPR A;  1WA8 B;  3A8T A;  5F2V O;  3G67 A;  1BQZ A;  1EBO A;  1WPB A;  3FB5 C;  3EHB B;  4G2K A;  3FYI B;  1SC5 B;  2AZ2 A;  1JCH A;  4LFC O;  3BY6 A;  3D8C A;  1ZL8 B;  3ABM C;  3CSX A;  3ZRS A;  4U7O A;  3E8B A;  1UFI A;  4MVR A;  4FM2 A;  2E5L B;  1FPO A;  2JGU A;  1I08 A;  1IVS A;  2ZIM A;  5KA6 A;  2IJH A;  1AJQ A;  4CS4 A;  5KUK A;  4KL1 A;  1MOF A;  3JCZ A;  2P22 C;  2CTW A;  1QU7 A;  1DK1 A;  1JMK C;  3UM7 A;  3IJ4 A;  4JI4 O;  4X8A A;  3X2Q C;  3ZJZ A;  2WLL A;  1ORQ C;  3IC7 A;  3J80 N;  3OTO O;  1PNL A;  1AR5 A;  2ARH A;  4J80 A;  2UUC O;  2HHH O;  4DR4 B;  1P49 A;  2D3O W;  5KLV H;  3CC2 V;  4FPP A;  5IE9 A;  5AG2 A;  4NKG B;  4DR2 B;  2Y69 B;  4CC5 A;  4LF8 B;  4K0K O;  1PV0 A;  4IYH A;  5IYD O;  5KX5 A;  1Q3E A;  5JH7 A;  4JYY A;  2A3Q A;  2UXC O;  2QWP B;  1K9M W;  4K8X A;  2EIN B;  3VOU A;  1FXK A;  3ETQ A;  2X0L A;  1ZWI C;  1I0H A;  1FFX A;  4W4K A;  4DV7 O;  1FAF A;  2OTJ V;  1K4C C;  2YID A;  2EZO A;  2UXD O;  1NS1 A;  1G8M A;  4JAA A;  3SJB C;  3UKM A;  1NTM H;  3AG1 B;  1VQK V;  1ZTE A;  3N2G B;  1GM8 A;  4H13 B;  1SA0 A;  1VF5 B;  1WP7 A;  4XBF A;  4LFA O;  2ZR2 A;  2UUA O;  1B04 A;  1MNG A;  1O9H A;  2PF4 E;  3FB8 C;  2XOK G;  4LP8 A;  2HVK C;  2WPD G;  3SPI A;  3G6E V;  2YEV B;  1Y74 A;  2P7T C;  3ZMZ A;  1BHB A;  1N33 O;  4X20 B;  4X89 A;  2KG7 B;  3BFR A;  2EIN C;  1COW G;  3P3N A;  1JJ2 U;  3OEE G;  1UJW B;  4UXN A;  4DW0 A;  2CH7 A;  2DYR B;  1DLB A;  1HNZ B;  2ZQM A;  1VQ8 V;  5LXT A;  2M6Y A;  4D7S A;  2IH3 C;  4EKW A;  1Y4M A;  4IHJ B;  2BSK B;  1H2M A;  3D3I A;  1NBM G;  4X9Q A;  1AVM A;  4GZR B;  1THZ A;  5LA6 B;  1SZX A;  1VIB A;  5EYP B;  1H2L A;  1TUB B;  4XDL A;  2QKA A;  2HG5 C;  4JPR A;  1SQF A;  4JI1 O;  4UCS A;  1VF7 A;  4F6E A;  3KG2 A;  2GTA A;  3JAM N;  1XUQ A;  4DR7 B;  3ZCC A;  2QWR B;  2WLK A;  4AI8 A;  5CB4 B;  5B66 Z;  2OTL V;  2YUA A;  3D36 C;  4L87 A;  4LF6 O;  3W7T A;  2XAS A;  4H0L B;  1M57 B;  2LP7 A;  5BR8 O;  4UB8 Z;  3JAT B;  5L3D A;  4BAY A;  4WFH A;  1BSM A;  1XI1 A;  4I0X A;  1VQ9 V;  2WLM A;  4DR6 B;  2DYR C;  1SQX H;  4TV8 A;  4NVP A;  4GKK B;  3RW0 A;  2F4V B;  1IUR A;  1IBK O;  3JAS A;  1YJ9 V;  1KMI Z;  4DR2 O;  4JI6 B;  1KC8 W;  3C3S A;  4LF8 O;  3OR7 C;  1XL6 A;  1MZE A;  1F4M A;  2ADP A;  1E1R G;  5EBL C;  2ZDI C;  4TUY B;  2ADQ B;  1JA8 A;  2IBZ H;  3SYQ A;  5CN0 A;  2WLN A;  3M8A A;  3T4D A;  1XNQ B;  1XDC A;  3VBB A;  1AI4 A;  2XTA A;  1QQC A;  1NVP B;  4Q20 A;  4FZ1 A;  2QWO B;  4O4I B;  3OM3 B;  1WB8 A;  1Q5O A;  2RMK B;  3T1H B;  2VRZ A;  3QG5 A;  3JAR A;  4QNH B;  4AQY B;  5HFM A;  2PZS A;  3N2K B;  3LSS A;  3FB7 C;  3P32 A;  4I50 B;  5J2T B;  2BOC C;  4UVA A;  2GBO A;  2A9H A;  1EFR G;  3B4S A;  2YIC A;  3O65 A;  5A2Q N;  5DM6 V;  1H2S B;  2R9I A;  2BE3 A;  3E86 A;  1N4C A;  1SES A;  2HEP A;  4O2B B;  1L1F A;  3OMI B;  1OCO C;  5ITZ A;  1WP8 A;  4TSF G;  4BW9 A;  3SDL A;  4HZ3 A;  4RQF A;  4ZOL A;  4IIJ A;  1N32 B;  4NTX A;  5LGN A;  4F4L A;  1R6T A;  3HKB B;  1VAR A;  2Q6A A;  5LBQ A;  2QWN B;  3KCX A;  4L8J A;  4DO2 A;  4PD4 F;  4PA4 A;  3O9O A;  1Q8I A;  3ZED A;  1F4N A;  2YXY A;  3JSN A;  4JZ2 A;  1P4R A;  1ROP A;  2H3O A;  4PA6 A;  3JAL B;  5IJ9 A;  4DV6 O;  3E22 A;  1M56 C;  5K1P A;  2LO1 A;  1M93 A;  1VMG A;  2IJK A;  4JYA B;  4J9Y B;  3RT3 C;  4WCE V;  3H1L H;  5EBW C;  4EEQ A;  3FX7 A;  1K73 W;  4MVM A;  3EFF K;  4KXR A;  2V4D A;  3L71 H;  1YIT V;  3IC9 A;  4JI0 O;  4LFB B;  4LF9 B;  1D5N A;  4DV4 O;  4W4L A;  2HR3 A;  1O9G A;  2QJ1 A;  1XHX A;  2XAH A;  1BQ0 A;  2YIB A;  3ZHT A;  4DR3 O;  1TUE B;  2HJD A;  3TET A;  1U97 A;  3WB0 A;  1QLE C;  3RFR A;  4YXW G;  2JEX A;  1KEC A;  2V1D A;  2GUZ A;  4DRX B;  1MMM A;  4JYB A;  4R7C A;  1XMQ B;  1IBM B;  5JCO C;  2LW7 A;  2VQE O;  4GX5 A;  4NTW A;  3OUF A;  1I7F A;  4CH5 A;  4FJC C;  3RN4 A;  3RYF A;  5FL7 G;  1YF2 A;  4TOI A;  3I55 V;  5GON B;  3U0Z A;  2XAF A;  2EIL B;  4J7Z A;  1MZF A;  4GKK O;  3K0D A;  1MSW D;  2PI4 A;  1Z5W A;  1DGS A;  1YDX A;  4JI6 O;  2CGN A;  4XDK A;  3HKE A;  5BY1 A;  5C8Y B;  1ZSP A;  4RO2 A;  4Z1M G;  2F1M A;  2YDE A;  4LFC B;  1BGY H;  1SQV H;  3CCL V;  4ABM A;  1RPO A;  1QVF U;  3RYC A;  1R6N A;  1N0N A;  4EFE A;  2KQX A;  5L3C A;  3JD3 A;  3AG3 B;  3CJH A;  3H01 A;  4TQF A;  5LHG A;  3G71 V;  1OCR B;  4JF3 A;  3WU2 Z;  2JGD A;  5JWP A;  3H1H H;  4K8Z A;  1PNM A;  2DWD C;  4PA3 A;  5LYJ B;  4LNU A;  3SYC A;  2GDS A;  1UPG A;  4DR1 B;  3K3W A;  4AQY O;  2L35 A;  3U10 A;  2EIK C;  1KBH A;  4MTO A;  1S77 D;  3J81 N;  4JI4 B;  1AR1 B;  3OTO B;  4MTF A;  2EIL C;  4ZI7 B;  2VQF O;  5B3S B;  2UUC B;  2HHH B;  5KMG A;  3UT5 B;  2EIJ B;  1XRE A;  3ZMV A;  4PV1 B;  4J7K A;  5LP6 B;  4FLX A;  2CTR A;  3SGI A;  1AI7 A;  5IWA B;  4E4E A;  3K59 A;  4FVM A;  3L9D A;  5B1B C;  2LFR A;  3JAK B;  2F43 G;  1JX9 A;  3BAA A;  2Y0P A;  4K0K B;  3ABL C;  3IFX A;  3MD0 A;  2ZT9 B;  2O57 A;  3TGU H;  2UXC B;  1IBL B;  1OCR C;  1AJN A;  3HR0 A;  3RVZ A;  2RNB A;  3ASO B;  5LHH A;  4FIP C;  4JYA O;  2OCH A;  1K97 A;  2BTQ A;  3DC6 A;  2XAG A;  4RQE A;  1NR7 A;  3S3X A;  1PL0 A;  4BW5 A;  5DEC A;  3OE7 G;  5IYC O;  2XAQ A;  2R72 A;  3BAB A;  4LFB O;  4I9Q A;  1TVK A;  4JI8 O;  1NH2 B;  2R70 A;  3LNN A;  1MSD A;  1V55 B;  2P4V A;  4H33 A;  4UCR A;  1GN6 A;  4LFA B;  3OD4 A;  3K58 A;  2LFS A;  1VQP V;  1XOU A;  2A0L A;  3QO5 A;  1OCC B;  4QPK A;  1FJG O;  3E83 A;  1BT8 A;  3R65 A;  4A5U B;  2PI5 A;  1VQ4 V;  1P84 F;  2ZXW B;  1N33 B;  1NVP D;  1IBM O;  1JQ0 A;  1Y67 A;  4P9O A;  5IDJ A;  5B1A B;  3D3Q A;  1S5H C;  2N04 A;  3A0R A;  1LUW A;  1HW7 A;  2ZIO A;  3RYH A;  4ZHQ A;  3HKD A;  2B5U A;  2WLH A;  4X62 B;  2WLL B;  3GVM A;  1W2B U;  3FKS G;  5B5E Z;  1XBL A;  4PDV A;  4XDJ A;  4I4T A;  1FS0 G;  5JVD B;  4DV3 B;  4I55 A;  2EJR A;  4ZKI A;  2AHY A;  3DSQ A;  2ZM6 O;  2CUG A;  4LWS B;  3K9S A;  3CRR A;  3ABK C;  1AP5 A;  2EJ7 A;  1V55 C;  2Z5U A;  3P3P A;  3AG4 B;  1Q6I A;  2IW5 A;  1GN4 A;  4EFB A;  3CRA A;  4JI1 B;  3GWK C;  5KHI A;  3FD9 A;  3K03 A;  1XEQ A;  2RCV A;  5KX5 B;  2PTM A;  4TQD A;  5JH7 B;  3FB6 C;  2ZXW C;  1OV9 A;  4CZZ A;  2ZKO A;  3R66 A;  1GMG A;  1FXK B;  4LF6 B;  4DR1 O;  1OCZ B;  1FFX B;  4DV5 O;  5BR8 B;  1IX9 A;  3ZN0 A;  4NXM O;  1US6 A;  1EM1 A;  2WSS G;  2CTQ A;  4JV5 B;  1NKD A;  2WLI B;  4YJ3 B;  5BMV A;  3ETE A;  3OR6 C;  4I7Z B;  4GKJ O;  1RM1 B;  1M1K W;  3LDC A;  3RVY A;  4GCZ A;  2CDY A;  4O4H A;  3CD6 V;  3QTC A;  1SA0 B;  1IBK B;  1S76 D;  1KKD A;  5IWA O;  1VF6 C;  4R50 A;  5BXZ A;  4P2Z A;  4WFF A;  3M99 B;  3Q4H B;  2PUS A;  4IL6 Z;  1XMO O;  1T5E A;  4LH7 A;  4FLT A;  1BL8 A;  2YI8 A;  4BIZ A;  1IBL O;  5EC2 C;  2GV9 A;  4P30 A;  4DK0 A;  3ASN B;  1CEZ A;  4WFG A;  2Q7G A;  4I5S A;  3K57 A;  2DW4 A;  1XQ8 A;  2CH7 B;  2RDC A;  2MW2 B;  4J9Z B;  1KUQ A;  4PDM A;  1G1X B;  3CCU V;  2NLJ C;  3T1Y B;  2PYJ A;  1SKV A;  5H6Q A;  1N36 B;  3OGI B;  4NXN O;  2CE4 A;  3CRC A;  1OZ0 A;  3NXS A;  4B08 A;  4MW3 A;  1XL4 A;  3JD0 A;  4U3J B;  4PA7 A;  3WFV A;  1N0J A;  3B40 A;  1NU1 H;  4Z1V A;  2Y69 C;  4WFB V;  2WA4 A;  5D5P A;  1IDS A;  3SPH A;  4FLU A;  4CH4 A;  3K5N A;  1S5J A;  4JI3 B;  3B09 A;  1FD9 A;  2B1I A;  3ZRV A;  4P9P A;  1L0N H;  4J11 A;  1VEW A;  1KQS U;  1G4Y B;  2DYS B;  4DV6 B;  2QTS A;  4KP4 A;  2DQ3 A;  4X62 O;  5HFL A;  4I0X B;  3IGA C;  4B3S O;  2Q69 A;  2Q68 A;  4DV3 O;  3AK2 A;  3NR7 A;  2AGA A;  4TV8 B;  4DR5 O;  4LF4 O;  3E8F A;  3LSU A;  1WN7 A;  3AG1 C;  2HVJ C;  1KB9 F;  4J42 A;  3JAS B;  1V54 B;  3A2F A;  1ENV A;  4X1I A;  4JI0 B;  2QKS A;  4DV4 B;  1FYJ A;  3ZHU A;  2PGG A;  1QNM A;  3M7M X;  1QVG U;  3AG7 A;  3F7V C;  2Z3Y A;  4O4L A;  3APQ A;  2Q0A A;  3JD2 A;  5JJE B;  4DR3 B;  3K79 A;  4GX2 A;  1NZ6 A;  1JJO A;  4WBN B;  3IAY A;  3CEI A;  2P6J A;  2Q4P A;  4OPA A;  5FNV B;  1BE3 H;  5K1X A;  5GTI Z;  3HB3 B;  2VQE B;  1GH6 A;  3MHS C;  4I9W A;  4JV5 O;  2K9P A;  2QDO A;  3D36 A;  1FKA O;  3JAR B;  4UVB A;  2KG7 A;  1X4T A;  1LR1 A;  1FXV A;  4DV2 B;  1S5L Z;  1NH2 D;  2ZNJ A;  1ZUQ A;  2UU9 B;  2ZCE A;  2DN9 A;  5IY5 B;  5FPR A;  1NR1 A;  4JAV A;  5LOV A;  4O2A A;  1KYO F;  4X66 O;  3OT7 A;  1Y6X A;  5EZY A;  1YTF B;  4PI2 A;  3KCY A;  3ZMS A;  4ZOL B;  4IIJ B;  4IHJ A;  4CC6 A;  2GTS A;  5BZB A;  2JEU A;  3PN1 A;  4CH6 A;  4MW8 A;  3OMA B;  3WB1 A;  3BEH A;  2A06 H;  2E76 B;  3SYO A;  2F95 B;  2ZDI A;  5E79 Z;  4NR1 A;  1VP7 A;  4LR3 A;  1JFF A;  5L3F A;  1HNX O;  3E22 B;  1M57 C;  1B3Q A;  2HJF C;  2JK5 C;  2ZR3 A;  1TGO A;  3WG7 B;  4EB6 A;  2IM9 A;  3QO8 A;  3T1Y O;  3LNM B;  3T2M A;  2DWE C;  3QF7 A;  4J41 A;  1N36 O;  4C7U A;  1CP9 A;  3VQY A;  2QGN A;  2W6I G;  1F7Y A;  2VQF B;  4IGG A;  2Q0O C;  3OW2 U;  1VQL V;  4LBE C;  4D7T A;  2Q73 A;  1GKF A;  4G28 B;  3JD1 A;  1NJI W;  1Q81 W;  1K5Q A;  1BZK A;  1Q6U A;  4UCU A;  4DYL A;  4ICG A;  3RYI A;  3PJS K;  3SYP A;  2HKO A;  4GUN A;  2UXN A;  2ZNI A;  1PNK A;  1ARO P;  4JI3 O;  3CXH F;  2Q7H A;  2LJ2 A;  5IYZ A;  3ABU A;  5EC1 C;  4JI5 B;  2Q9L A;  3I56 V;  1RSO A;  1W0J G;  2JJ1 G;  4O4J A;  3RYF B;  4F6R A;  4FFB B;  1BMF G;  1IXM A;  1YJW V;  5EK0 A;  4QGP A;  3WB2 A;  4FZ0 A;  3ZMU A;  4X64 B;  3KKY A;  4FK5 C;  3ZHV A;  2Y0I A;  3TK1 A;  3HKE B;  4JI8 B;  1M4U A;  1PL4 A;  5KHK A;  1YHQ V;  1BHA A;  3FFQ A;  4FLZ A;  1Q43 A;  3CC4 V;  3N2K A;  5KHJ A;  4ZBM A;  3I5D A;  2JRI A;  2KKW A;  2QM4 A;  4X1Y B;  1FJG B;  2WLJ A;  3P30 A;  3AK3 A;  1Y76 B;  2IJI A;  1SET A;  4YJ2 A;  4O2B A;  2JGD B;  3G6B A;  2UUB B;  1LUV A;  4H37 A;  4LNU B;  2Q7E A;  4JI2 O;  1U96 A;  3TXS A;  3B2E E;  2QM8 A;  4UFZ A;  4DV2 O;  1SRY A;  5JCO A;  4IYI A;  4UUJ C;  1W0K G;  2EZP A;  2UU9 O;  4BIO A;  2YI9 A;  3JAL A;  3FAV A;  5IJ0 A;  2OWO A;  5L3G A;  3ZN1 A;  1YJN V;  2ZM6 B;  5L3B A;  2KSD A;  5D5Q A;  1CXZ B;  1PKX A;  2P90 A;  3LDD A;  1D2D A;  3CME V;  1WB7 A;  2DE0 X;  2V7Q G;  2Q8V A;  4QPJ A;  1K5S A;  4RUF A;  3RGB A;  4UV8 A;  2R9A A;  1HP8 A;  4DV0 B;  1JVM A;  3TCU A;  2GHY A;  5H9C A;  4DV5 B;  3CP1 A;  1IXB A;  1KU9 A;  3LDE A;  2BTQ B;  4NXM B;  3QVN A;  4QIW F;  3SPJ A;  3N27 A;  1VQM V;  2H8P C;  3HPL C;  2OCC B;  4GKJ B;  3AG2 B;  2F66 C;  1F51 A; 
#chains in the Genus database with same CATH homology
 4YY3 O;  2UUC O;  4KHP O;  2HHH O;  5LMU O;  2UXB O;  2ZKO A;  3R66 A;  2JRI A;  4JYA O;  1A32 A;  4DR1 O;  5IT9 N;  3O65 A;  5A2Q N;  1XNQ O;  4DV5 O;  4GKK O;  1N34 O;  2DJV A;  1I94 O;  4NXM O;  4K0K O;  1AB3 A;  4JI6 O;  4JI1 O;  1XMQ O;  5BY1 A;  4X62 O;  1X59 A;  4LFB O;  4OPH A;  1HNX O;  4DUZ O;  4JI8 O;  3SDL A;  1HNZ O;  4JI5 O;  4GKJ O;  2UXC O;  3JAM N;  3T1H O;  4B3S O;  4JI2 O;  1R6T A;  4DR4 O;  2DOS A;  4DV3 O;  3F5T A;  2AGA A;  2FKX A;  4DR5 O;  4DV0 O;  4LF4 O;  3T1Y O;  4DV2 O;  5IWA O;  4DV1 O;  4LF7 O;  5BXZ A;  4LF6 O;  4DV7 O;  1N36 O;  2UU9 O;  1FJG O;  1F7Y A;  5BR8 O;  4A5U B;  4X65 O;  4LF5 O;  1FYJ A;  1XMO O;  4X64 O;  2UXD O;  4DV6 O;  1IBM O;  1NS1 A;  2N74 A;  3J7A U;  4B3R O;  1IBL O;  4DR7 O;  1N32 O;  3RT3 C;  4AQY O;  4LFC O;  5LL6 Y;  1HR0 O;  1D2D A;  4OPA A;  3J81 N;  1IBK O;  4LFA O;  4JI7 O;  2UUA O;  4JI3 O;  4DR2 O;  1R1B A;  4JI0 O;  4LF8 O;  2VQF O;  4DV4 O;  1N33 O;  4JV5 O;  2UUB O;  4B3M O;  1KUQ A;  1FKA O;  1G1X B;  1AIL A;  4DR6 O;  4B3T O;  2Z0A A;  3M8A A;  2ZM6 O;  4DR3 O;  1XNR O;  4DUY O;  4NXN O;  1DK1 A;  5LMN O;  2F4V O;  1J5E O;  4JI4 O;  1HNW O;  5H5N A;  4YHH O;  3J80 N;  1XEQ A;  3OTO O;  5FLX N;  2LW7 A;  4OX9 O;  2VQE O;  4X66 O;  1YZB A;  2E5L O;  4LF9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...