2JS5A

Nmr structure of protein q60c73_metca. northeast structural genomics consortium target mcr1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTASLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title NMR Structure of protein Q60C73_METCA.
rcsb
source organism Methylococcus capsulatus
total genus 28
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05082 Rop-like Rop-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2js5A00
3QG5A 2CAZC 3SJBC 2JS5A 3B2EE 1SKVA 3SJAC 3THOA 3QF7A 3ZS8C 2F66C 3ICXA 2P22C 1X4TA 3SJCC 3CSXA 1NT2B
chains in the Genus database with same CATH superfamily
4CH3A 1I08A 1M56B 3C3TA 3T1YO 3SYCA 4DV4B 1FXKB 1KB9F 1AILA 4PJ0Z 4JI7B 4WFEA 1H2LA 1S76D 1VQPV 1E79G 4DV2B 1S5JA 3SJAC 3N2KA 3K04A 5IYBO 4Q20A 3E8GA 4KXRA 5LGTA 3J80N 2VRZA 3ZMZA 5JJNB 3ZHTA 1SZTA 4JI6B 2P5OA 2Q4PA 4ICGA 3RN4A 4DW1A 1JQ0A 5CBGA 2Q0AA 1YF2A 3WB0A 1EM1A 3UO3A 3JASB 3OGCC 2Y0IA 4OX9B 1FPOA 3HPLC 3CCEV 1QQCA 4PHZA 3STLC 1LUWA 4A5UB 2EZOA 1Z5WA 2YIBD 4PI0A 4CBCA 4JI1O 1ZX3A 2WAMA 3HKBA 4L87A 1GK9A 5C8YA 2KB1A 1EFRG 1KP3A 3N2GB 4J9ZB 4N21A 1DF4A 4DR7O 2YXHA 2EIJC 3ABKB 4X64O 3CRRA 1WP8A 3DXRB 3CC7V 1I5XA 5CB4A 3DGEA 4MVRA 4WBNB 1R1BA 4G27B 4RQEA 3D36C 2ETNA 1V55C 4KHPO 3O9OA 2OTLV 2ARHA 2OT5A 1B3QA 1TA8A 2Y4UA 4FJCC 4UUJC 5EC1C 5CMUA 1NH2B 4JYAO 2ZM6O 3U0ZA 2VQEO 4FPPA 1FAFA 1MMMA 3CE2A 5LMUO 1H8EG 1DLBA 2LP7A 1K92A 2WLLB 2IJIA 3PN1A 1GMGA 1SC5B 2A79B 4X1YB 2JGDB 3LDCA 2UU9B 3T4ZA 2XUMA 1QHTA 4NKGB 1RFYA 2RMKB 1AI5A 2Q6AA 1KUQA 1BL8A 1XOUA 4ASUG 5BZBA 4ABMA 4BR6A 1G4YB 1H2SB 3Q4HB 3FB5C 1XQ8A 3LSSA 4JI3B 1P7GA 2YC0A 4MTXA 1SZXA 4UV8A 4X20B 4LNUB 1GN3A 2ZXWC 4FM1A 2X7RB 3APQA 3JAWB 4TQDA 2WPDG 4FK5C 1FXKC 4I50B 5IY5B 4OXSA 3L75H 1OCOC 3VQYA 4DXWA 2N04A 2CTPA 4D7SA 3IGAC 2HLDG 4QPJA 2ZE5A 2GDSA 3B40A 2HJFC 5K1XA 3I56V 1YJ9V 1N36B 2ZR2A 2UUBO 3H1KH 3OR6C 2CAZC 4TOIA 1L8DA 4AI8A 3GB7C 5JJEB 4W4LA 2OIEA 1DF5A 3RYIA 1YJNV 4NB5A 1Q6HA 4OPHA 2WLMA 3AG2B 1G6UA 2YEVA 3SYAA 4YJ2B 2IJHA 2YIBA 4DR4B 5CA3A 1XILA 3OUFA 4MW8A 3ABKC 3CCUV 4U3FH 1YJWV 2CTQA 4FIPC 2LFRA 4DR3O 4F6EA 2GUZA 5IJ9A 1AJPA 5KLVH 3ABLC 2BSKA 4I55A 1R73A 3SJBC 1N33O 5IT9N 2YIAA 1QNMA 1W0JG 1A32A 2YI9A 4B3SO 4K0KB 1B06A 3FB7C 3M8AA 3HKDB 4H44B 5DN6G 3KG2A 2W6IG 4DUYB 1CP9A 3JD1A 3ZRSA 5K1PA 3T1CA 5JWPA 1U96A 3K5NA 2XTAA 2V7QG 1FKAO 1LR1A 1VQ6V 3M7MX 4JAAA 5JQGB 5GONB 2QM7A 3VBBA 1S72V 1EN6A 1BHBA 2CTRA 3E22B 3B4SA 1KQSU 1CEZA 5KHIA 4EFBA 1NU1H 1YHQV 4DV0B 4JGSA 5E79Z 5EBMC 3E35A 2FL4A 2ADPA 3H9VA 4O4HB 2QWNB 3ZCCA 3E8BA 3L70H 3ZIAG 3QO8A 3JD3A 1VQLV 3IAYA 1YVWA 3CX5F 2R9IA 1SQPH 1GKFA 3ICXA 4DO2A 2V1DA 4Z2WA 3QNEA 1VF6C 2HEPA 1Q6UA 1NH2D 4LFAO 4BIOA 2ZQMA 4I5SA 2JJ2G 2P67A 3VOUA 5IY5C 5LHIA 1QLNA 1PP9H 1M9NA 4J7ZA 1J95A 4U3JB 1SQQH 3FB6C 2A7WA 4MVUA 3MHHC 1JMKC 2EIKB 4CS3A 3F5WC 5JJJB 1I7FA 2ODMA 4PDMA 1IBMB 5FNVB 4FMTA 1K33A 1PKXA 3K5OA 1XMQO 4E2LA 3ZN1A 2ITDC 3HKEB 1OV9A 3T1YB 3JARB 4TWKA 4O4JB 4CC6A 1WA8A 2OCCC 3RYHA 4X62O 3K0DA 1FFTB 4HAMA 4DK0A 4GKJO 4JYBA 1MA1A 1M57B 1RPRA 4GCZA 2PYJA 3L72H 1SQFA 2QM4A 1DTOA 3AG2C 1SA0A 4DR2O 1NT2B 4U7NA 3CCVV 4W4KA 4CS2A 1SETA 1ZLZA 5H2FZ 2ZE7A 3ZMVA 2WLJA 2ZINA 4IHJB 1TAEA 5KMGB 3D3QA 1QVFU 4UB8Z 2PYLA 5CA0B 3T1HO 2H8PC 4KL1A 5IJ0B 1WAZA 1FJGO 1MG1A 2Q8VA 4YIOA 1RSOB 4FZ1A 4GLXA 3JCUZ 4H33A 3B8NA 4JI1B 2QKAA 4UCOA 2PF4E 1HDJA 5IYCO 4HZ3A 1VQ8V 3QTCA 1NVPB 3FAVA 4FVMA 2AW9A 1BMFG 1YXBA 3P30A 4DR7B 3JASA 3FB8C 4IGGA 4YJ3B 4X64B 5IYZB 3G4SV 2Z0AA 4X65O 2JGUA 2LGWA 4KHPB 4YIPA 3B77A 1OCZB 2O57A 1Q3EA 1AP5A 4PELA 2EULA 3G6EV 1WLEA 3N2GA 2W6JG 4FLWA 1GN4A 4NTYA 5LHHA 3X2QB 2ADQB 3OM3B 4DV6O 2Z5UA 4JYAB 3DXRA 5HFMA 5EBWC 2ZM6B 2VQEB 4WBNA 5LGUA 5LMUB 1ZAUA 3CRQA 5KHHA 2P06A 1VP7A 3LSQA 4NTXA 2WA4A 4CS4A 3KCXA 1NS1A 2JEXA 3SPHA 1HNZO 3MD0A 2QDOA 5H6RA 4AQYO 2DWDC 2E74B 3DSQA 2EIKC 4DUZO 5TISZ 4X9QA 3K5LA 3OR7C 3DTUB 3SJQC 2E75B 4QPKA 4X1YA 4IYHA 1EZVH 1ZWIC 1XBLA 1W2BU 3JALB 3ZX6A 5LXTB 4MTFA 4B3RO 3F5TA 3K79A 4FLZA 1IX9A 4J80A 5L3BA 1M57C 1Q86W 4B3MO 5KUMA 1HR0O 3ZHVA 4MSWC 1Q5OA 1B04A 4GX1A 4E4EA 2CUGA 1ZL8B 4LNUA 3RVZA 1R3LC 2E76B 1SRYA 2UUBB 4I50A 5IWAO 4LF7O 2OTJV 4DV1O 2AGAA 5D5QA 3K08A 1G1XB 1SESA 3JD0A 4AILC 3J81N 4O2AB 4TV9A 3CCMV 5KHGA 1XDCA 4GUNA 4DV3O 2RJZA 2B9ZA 4X8AA 5B1BC 1US6A 1Y74B 5EIBD 1UPGA 4NXMO 1IZ3A 4O4IA 1X59A 2L35A 4ZHQA 4DR3B 4LFCO 1KD1W 2ITCC 3OAAG 2KG7A 2CH7B 3I55V 3W7XA 1JPXA 1N33B 2YI8A 1AI4A 2Q68A 1JFFB 3AK1A 4UVCA 4DV5O 4BWAA 4B3SB 4X88A 3RBZA 1H38A 5J2UB 3BA8A 3X2QC 2XAFA 4TV8B 3SPGA 2BTQA 5BR8O 1MOFA 1HWYA 3ASOB 1OCOB 3OTOB 4Z1MG 4HNAB 3JSLA 5L3DA 4UV9A 4UVAA 2QWPB 4JF3A 2QR4A 4LP8A 3U10A 2YICA 4FZ0A 1XMOO 2QJ1A 3AEIA 5LOVA 5LP6A 4LF5O 3ETQA 4XBFA 4LCUC 2EBOA 3JYCA 1D5NA 1YTFD 3ML0A 5JQGA 4LF6O 4DR5O 2Q9LA 1EN5A 4NXNO 3RFRA 5CA1B 4LFAB 1Z2GA 1UFIA 2HJDA 1F4MA 1R6KA 3JAKA 4OPAA 4O4HA 1Y76B 4BW9A 4WFBV 3FYIB 5ITZB 3ABLB 3KCYA 4NVPA 4P9OA 1FD9A 2AZ2A 1XL6A 4H37A 2ZIMA 1K73W 2XHBA 3E89A 1K7DA 2WLIA 1HNXO 1XMQB 1XREA 3T4DA 1K4CC 1TUBA 2Q7HA 3GVMA 1QCEA 2UUAO 3T2MA 3CCSV 3BHPA 4X62B 1LUVA 1TVKA 1RM1B 3CXHF 5HFLA 4Z1VA 4GKJB 4U7OA 4YXWG 2DYRB 2CGNA 1YZBA 4FLVA 1Y67A 5FNVA 4DR2B 5F2VO 3ZN0A 3BABA 1BQZA 4PD4F 3CJHA 3HKEA 1MNGA 2IU3A 3A8TA 4O4JA 5JH7B 3T1HB 3CS5A 4JYCA 1ROPA 2PTMA 1FJGB 2FB5A 2OYQA 4JASA 4GKKO 2XNDG 4NYKA 1N8RW 4TUYA 1RPOA 1W0KG 3UCSC 5BMVB 3DC5A 3K9AA 1G8MA 4PDLA 1ZUQA 4GZRB 4LWSB 5KMGA 1X4TA 4UCTA 1Y6XA 3ZRXA 5CA0A 3F7VC 4WFGA 1KKCA 4RUFA 3SPIA 5EYPB 1WB7A 3ASOC 4MTGA 2ZIOA 4I4TA 2QEXV 1Z5VA 2CE4A 4X65B 1GM7A 3OD4A 1VQKV 3AG4B 4G28B 2EILB 3RVYA 1XNRO 3CB2A 5IE9A 3H1JH 4D6TH 2EJ7A 1HP8A 1IBKO 5KA6A 1SKVA 4FLXA 3RYFB 3K0GA 1AROP 2YXYA 4OGQB 5EBLC 3IC9A 5L3GA 4QE7A 4CC5A 1NZ6A 4DV6B 1NI8A 4J10A 1SERA 2KSDA 2VS0A 5FLXN 3EVKA 2OCCB 3E8FA 1N0NA 1UJWB 4RAIA 1VF7A 4X1KA 3C3SA 2FKXA 4IIJA 5JVDB 1VQ4V 4JI2O 5LYJB 1FXVA 3RWRD 1SF9A 1HNZB 3ZHUA 2PI4A 4AQYB 2MW2B 4J42A 5C93A 4DUZB 2C2AA 3A0RA 3BFRA 1R6NA 3CPWU 4QGPA 2LJ2A 2R9AA 1OHHG 3VQXA 4RQFA 3N27A 3SPJA 1JOYA 3RW0A 4Q6GA 2CK3G 3AG3B 2X6AA 2UXXA 1PM9A 4UVBA 3M99B 3RYCA 3LUTB 1AI6A 4BIZA 4N23A 1PL4A 1IDSA 4I9WA 1PPJH 4B3RB 3N2KB 1RM1C 4NR1A 2DYRC 5L3CA 3TGUH 3J7AU 1PNMA 2NNUA 5H5NA 4B3MB 2UXBO 3CCQV 2PY5A 4O2BA 5KX5B 1MSDA 1E1RG 2DOSA 4JI7O 4X1IA 4TT3G 5IWAB 4MVZA 4LF7B 4DV1B 4UCUA 3IFXA 1WJZA 1EZJA 1NBMG 1GRJA 1SQVH 3D36A 3OT7A 4JI6O 5JCOC 2QKCA 4MT8A 3UT5A 3FFQA 4DV3B 4FFBB 2WWWA 1ZL8A 4MVOA 4X89A 3SYPA 3JAMN 1S5HC 1WP7A 3IC7A 4NXMB 3WU2Z 4HYOA 2H3OA 2K9PA 2YSUB 3AG4C 1NR1A 2EILC 2QKSA 2E5LO 3FD9A 4L8JA 2EINB 4O2AA 3BEHA 3CHXA 4DV5B 1WN7A 3UQ8A 3OGIB 2WSSG 4ZIBA 4O4LA 2YXLA 2GSMB 2XAGA 3QF7A 3ZEDA 5BR8B 2DMXA 4RUEA 1OJHA 4GX2A 5J9PC 2HVKC 3AK3A 2EZPA 4ZI7A 4DYLA 2ZNIA 1JFFA 4C7UA 4G2KA 1XL4A 1BHAA 5KAFZ 4DW0A 5J2UA 3VQWA 1MZFA 1AR1B 1XUQA 4FLTA 3BCCH 1FXKA 3ZMSA 1XMOB 3SJCC 4EB6B 4JPRA 4JV5O 4LF5B 3OMIB 2Y0PA 1QR8A 1S5LZ 2X0LA 2B1IA 3UKMA 4B7KA 2OWOA 3SPCA 5B3SC 2JJ1G 1AR5A 4MTOA 4XDJA 4LF6B 2P4VA 4HNAA 4I7ZB 4X66O 4DR5B 1L1FA 2UXCO 1PNLA 4DK1A 3AG3C 1I94O 5B1BB 1F7YA 3U11A 3OEHG 3P32A 4BW5A 3K5MA 1D2DA 2DYSC 3BPZA 2BOCC 1BZKA 2Q67A 2IJJA 3OW2U 2RCVA 3ZRWB 3TETA 3CEIA 1N32O 4P2ZA 3OE7G 2MK3A 5CA1A 1KKDA 2BCCH 2HFEC 4B3TO 1HNXB 4LH7A 4QJFB 4JAUA 1Y76A 1D5AA 2UUAB 1PD3A 2XAQA 5ITZA 1W59A 2P6JA 4HBNA 1Y4MA 3ETGA 4UB6Z 2VWJA 1JJOA 1IBLO 3VQVA 1NR7A 1Q90D 5B1OA 2E3CA 1OZ0A 2GUZB 1VMGA 3A2FA 5IJ9B 1AP6A 3SDLA 2LO1A 4ZOLB 4J41A 4ZKIA 3R66A 4F4LA 2EINC 3ABMC 1FYJA 2F23A 4GKKB 1P84F 3ZMTA 2WLLA 3LSUA 3NXSA 4DR1O 3BVOA 4B7EA 2AZ0A 2JGDA 3S3XA 2HR3A 3K3WA 3SR2C 4QIWF 3D3IA 1WPXA 5D5PA 3P3NA 5L3FA 1NTZH 4LBEC 4K0KO 3I5DA 2XAHA 3Q4HA 2JIZG 5LMNO 1KP2A 2JS3A 1XNRB 5BMVA 4LF4O 1YSCA 2A06H 4X20A 2QE7G 1BQ0A 1DK1A 1VF6A 1IBKB 4K35A 1S0VA 3CRAA 4F6RB 2ZE6A 1V54C 3JAWA 2LFSA 1IXBA 5LA6B 3E86A 4J7KA 1VQ9V 1BE3H 1E1QG 4JTAB 2WLHA 1GTOA 4UCRA 1M5IA 2Q7GA 1ZSPA 3ZMUA 1Q43A 2BTOA 1JJ2U 2EIMC 5CN0A 2P22C 2NR5A 2RQ6A 1WPBA 3CCJV 3WB1A 4JI2B 3RYFA 1WNSA 3ZHRA 1KECA 5H6QA 4UXNA 3O65A 1H2NA 2ZDIC 3EFFK 5E1AC 2AHZA 3K57A 4I0XB 3A0BZ 1R6TA 3PJSK 2A3QA 5JVDA 3IJ4A 1MABG 4YJ2A 1XI1A 2V4DA 4JI4O 2Y69B 1L0LH 1XNQO 3RYHB 3SYOA 5H9CA 5FPRA 2N74A 2GV9A 4IYIA 3ASNB 3JATB 4MVMA 1SA0B 3CC4V 1VARA 1J5EO 2BOBC 5LGNA 2UXBB 1NVPD 3L71H 1I5YA 2W0FC 4B08A 4XDLA 4P30A 4TSFG 5EZYB 5IYDO 3JSNA 1JCHA 3HKDA 3AG1B 1AJNA 1T5EA 1N34O 1TGOA 4DV7O 5GTIZ 1ENVA 3EXAA 1SQBH 3QO5A 1F4NA 3HKCB 3S3WA 3W7WA 4DRXB 2JK5C 4JI5O 2JS5A 3A0HZ 4WFFA 4FM2A 1Q82W 1IVSA 2GHYA 5LHGA 5GONA 5FL7G 3FAVB 2CTWA 2QM8A 3E22A 4K8XA 4JZGA 2XAJA 5KX5A 3WB2A 1VQMV 1H8HG 1F51A 3TXQA 4LFBO 5GTHZ 2LW1A 2Q5ZA 2D3OW 4J11A 4YY3O 5FPOA 2E5LB 3ETEA 3SYQA 2QA4V 1GAXA 3E2EA 4FFBA 3B2EE 3RGBA 2XASA 1NQTA 2M7WA 4PV1B 3JD4A 5DEDA 3CXCU 4FLUA 4U3JA 4PA3A 3JCZA 3OMAB 2IW5A 2LQTA 1PV0A 4J9YB 1NTMH 2HKOA 3W7TA 2FYUH 2X6CA 2ZD9A 3APOA 1COWG 1P7BA 1AR4A 1ZTEA 2UXDO 1OCRB 2VWKA 1K5QA 3L73H 1AB3A 3WG7B 1VQNV 3EHBB 1I0HA 3P3PA 3H01A 3JARA 2WLKA 5A9GA 1KU9A 4IT5A 4TQFA 1K8AW 2P4KA 2RN9A 5KHJA 4JV5B 1N0JA 2HHHO 1BS3A 3HR0A 4LH6A 1VQ5V 3BRCA 1FFXB 2Q73A 4WCEV 5LBQA 4X66B 1K34A 3FYEB 4PA7A 2UXCB 2QTSA 2Y69C 2HG5C 4IHJA 1BSMA 1HNWO 1I94B 3ASNC 2JEUA 4H0LB 2XT9A 4H13B 3ZHQA 5IJ0A 4EB6A 2KQXA 1RSOA 4YHHO 1VQ7V 2PGGA 5A2QN 2F4VO 2XOKG 5EK0A 2HP8A 4WFAV 1M56C 4J7JA 4XDKA 1N32B 4JI0O 3AG1C 3ZBHA 5J2TB 2P90A 3BAAA 5B5EZ 4K8ZA 2IJKA 4B3TB 4LF9O 1AJQA 1FS0G 3ABTA 2UUCO 2A9HA 1SQXH 5L3EA 4DR6O 3ETDA 3MHSC 2QWOB 4GX0A 4LF8O 1BGYH 4YJ3A 2AHYA 4TV9B 5IYZA 1SQGA 2AXTZ 3H1LH 3ZRWA 2QSAA 2ZDIA 1IURA 1H2MA 4CH4A 1IBLB 3L74H 1JA8A 4JTCB 1MZEA 4NTWA 3D8CA 4O4IB 2VQFO 4ZHQB 2ZE8A 2ZT9B 2IBZH 1EBOA 2KG7B 2WA3A 1Q81W 1YITV 3LDDA 1P49A 1L0NH 5CBHA 1KYOF 3MDSA 1FXHA 2EX3A 1CPYA 1B6QA 5B3SB 5BXZA 1JVMA 1N4CA 2X6BA 4DR1B 5DM6V 3CD6V 2BTQB 4JI8O 2UXNA 2IH1C 1R3KC 1JX9A 5KA5A 1Q6IA 2JRIA 4P9PA 2FTKA 1MSWD 1Q8IA 2F93B 1YCIA 4ZOLA 2CGOA 2DYSB 2IH3C 1S3JA 4KFMA 4MS2A 5B66Z 3MAQA 4QNHB 2RDCA 1EN4A 3B8MA 4QE9A 4LR3A 2NN4A 1BCCH 5LMNB 1M90W 1HR0B 4IL6Z 1OCRC 1THZA 1M4UA 1XEQA 4LF4B 4EKWA 3WG7C 2CDYA 2ATKC 2DE0X 2FMLA 4DV4O 1NJIW 1YIJV 4WF9V 2B1GA 5LOVB 5LP6B 2DQ3A 3JALA 1PL0A 1GN2A 1BT8A 5LXTA 1QVGU 4DV2O 3OTOO 1XHZA 1SS3A 1P4RA 3HKBB 5C8YB 2W0XA 1GM9A 1H2KA 3OEEG 3JAKB 4WFHA 3BY6A 1GH6A 4OX9O 4F6RA 2R70A 3LNMB 3CRCA 5CB4B 5LA6A 2EJRA 1K4DC 3F7YC 3TJTA 5IDJA 4LFCB 3LNNA 4RWUA 3THOA 3KKYA 4I9QA 3CMAV 3W7SA 2D2CB 1OCCB 3FKSG 3ABMB 3B09A 2WLIB 3SGIA 4JAVA 4R8CA 3AG7A 4K3AA 1GO3F 2Y48A 3CMEV 1KMIZ 4ZBMA 1GM8A 1JR9A 1TUBB 3W7UA 1K3EA 4JI4B 1AI7A 1Y74A 1XNQB 1F23A 3GWOA 1K5SA 1TVKB 3CRMA 2B5UA 2GTSA 2CH7A 2YIDA 1VEWA 4FLYA 3H1IH 3STZC 1J5EB 2F43G 3E8HA 4PA4A 3E83A 4I0XA 1RP3B 3CJHB 1H2GA 4UCSA 2QGNA 1N34B 2YUAA 4DV7B 4TV8A 3CYOA 3WFVA 1V54B 2OCHA 1NTKH 3JATA 1K9MW 2YDEA 3AK2A 1URFA 3CCLV 4TUYB 2PI5A 2IM9A 3HB3B 4JI5B 2UU9O 2Q69A 4MW3A 2EIMB 4PDRA 5EZYA 1YEWA 4NXNB 4FFKA 4BIUA 1KC8W 2JVDA 1HW7A 4I4TB 1QLEB 3G80A 3HKCA 4PA6A 4GX5A 5KHKA 4LFBB 4EFEA 4DRXA 4JI3O 2ILMA 1CXZB 3H1HH 4YY3B 5B1AB 1WB8A 3RT3C 3CSXA 2Y4TA 2Q0OC 3CP1A 4UCVA 2QTOA 3K59A 4CH6A 2BE3A 5AG2A 3QVNA 2PZSA 5LL6Y 3L9DA 5LP6C 2DJVA 1PNKA 2RNBA 3G67A 3UO2A 3K06A 4CZZA 4RO2A 3G71V 5CBFA 3RYIB 2KKWA 2P7TC 1QR9A 1QBZA 2Q7EA 4EEQA 5KAIZ 4JTDB 4X1KB 2YEVB 1VQOV 2H94A 3OTFA 4IIJB 1YTFB 1KBHA 1N36O 2HVJC 3K03A 2ZKOA 3TXSA 2UXDB 1M1KW 1O9HA 3BA9A 2R9RB 3ZRVA 2IU0A 2BSKB 4I55B 3OUSA 2DW4A 3ABUA 4CH5A 2F95B 1OCCC 3C90A 4KUMA 1GN6A 1IXMA 1Q7YW 3TCUA 3FX7A 2G38A 2HHHB 4DR4O 3TK1A 2YS8A 4KP4A 4GT1A 5EC2C 1O9GA 2F66C 3RYCB 2L6LA 1M93A 3OMNB 3DC6A 4MVQA 1HNWB 1TUEB 1S77D 5JH7A 1V9PA 2Z3YA 1YDXA 4AHCA 4R6ZA 1DGSA 4R7CA 4PDVA 1QU7A 2LW7A 4YHHB 2JDIG 2F4VB 4LC1A 2OIGA 4O2BB 1FFXA 2DQ0A 4D7TA 4PI2A 5JCOA 3OFNG 4DUYO 3JD2A 4JI0B 4X1IB 5B1NA 1K97A 2DWEC 5EIBC 3QG5A 2EIJB 4LF9B 4LWSA 2UUCB 1XHXA 4DR6B 1AVMA 4LF8B 5EYPA 5KUKA 2GTAA 4JZ2A 3K9SA 2R72A 2M6YA 3KZIZ 4GYCB 3K58A 3CCRV 1V55B 3G6BA 4JYYA 2GBOA 3UT5B 3UM7A 4UFZA 4DV0O 2LGQA 4BAYA 5J2TA 2NLJC 3CWBH 3GWKC 2VQFB 2DN9A 1QLEC 2WLNA 1YI2V 1R3IC 1R3JC 1Y66A 3CC2V 1VF5B 3ZS8C 5B1AC 2PUSA 4FM0A 5DECA 5GW7A 3NR7A 3LDEA 5BY1A 2QWRB 4O4LB 2QWQB 2ZCEA 2N05A 4PA9A 5LYJA 2F1MA 4MVSA 4JI8B 3ZHSA 1WA8B 2ZR3A 2ZNJA 1U97A 3QO7A 1IBMO 4ZI7B 1OCZC 3ZJZA 2K1EA 4R50A 1LNQA 1ORQC 1VIBA 1NKDA 3R65A 2A0LA 2ZXWB
chains in the Genus database with same CATH topology
4CH3A 4EB6A 5LMUB 1ZAUA 1RSOA 4DV4B 2PGGA 5KHHA 4NXMB 4JI7B 4CS4A 1N32B 4DV2B 5J2TB 1S5JA 3BAAA 3N2KA 3SJAC 4K8ZA 4B3TB 5JJNB 4L8JA 4O2AA 3CHXA 3DSQA 4DV5B 1WN7A 4JI6B 4YJ3A 2P5OA 3UQ8A 4TV9B 4ZIBA 5IYZA 4O4LA 2Q0AA 1SQGA 3WB0A 2YXLA 3K5LA 3JASB 3QF7A 3ZEDA 4OX9B 5BR8B 1QQCA 4PHZA 4X1YA 4CH4A 1Z5WA 1IBLB 4O4IB 2YIBD 4PI0A 4ZHQB 3JALB 3HKBA 5LXTB 4ZI7A 2ZNIA 5C8YA 1JFFA 4FLZA 1P49A 3N2GB 5J2UA 3VQWA 2EX3A 1Q5OA 1B04A 4FLTA 5CB4A 4LNUA 4WBNB 1XMOB 3SJCC 4EB6B 4DR1B 4LF5B 2BTQB 2OWOA 2UUBB 4I50A 4LF6B 4HNAA 5D5QA 4DR5B 1TA8A 4DK1A 1Q8IA 2F93B 4ZOLA 4AILC 4O2AB 3MAQA 4TV9A 3U11A 5KHGA 3U0ZA 4LR3A 5LMNB 3K5MA 1HR0B 2RJZA 3BPZA 1M4UA 4LF4B 5EIBD 4O4IA 3PN1A 4ZHQA 5LOVB 5LP6B 4DR3B 3JALA 4X1YB 5LXTA 2UU9B 5CA1A 1QHTA 1XHZA 1HNXB 4LH7A 1N33B 2YI8A 3HKBB 5C8YB 1JFFB 4B3SB 4BWAA 1D5AA 1H2SB 2UUAB 5J2UB 3BA8A 1XQ8A 3JAKB 5ITZA 4TV8B 2BTQA 4JI3B 4F6RA 2R70A 4X20B 4HBNA 5CB4B 5LA6A 4LNUB 2VWJA 1JJOA 4FM1A 3VQVA 4LFCB 3LNNA 3JAWB 4TQDA 3THOA 4I9QA 2E3CA 4I50B 3OTOB 3A2FA 5IJ9B 4HNAB 3JSLA 3VQYA 3SGIA 4ZOLB 1KMIZ 1TUBB 3U10A 4D7SA 4JI4B 4GKKB 1XNQB 1TVKB 2QJ1A 5LOVA 5LP6A 3ETQA 5K1XA 1N36B 3SR2C 2CAZC 4TOIA 1L8DA 4FLYA 5JQGA 1J5EB 5JJEB 3RFRA 5D5PA 5CA1B 4LFAB 3RYIA 4UCSA 1N34B 3JAKA 4DV7B 4O4HA 4TV8A 1G6UA 1XNRB 4BW9A 5BMVA 4YJ2B 4X20A 2YIBA 4DR4B 3JATA 5ITZB 1IBKB 4TUYB 2IM9A 4NVPA 4F6RB 3JAWA 4JI5B 5LA6B 2ZIMA 5IJ9A 2XHBA 4I55A 4UCRA 1YEWA 5EZYA 1M5IA 3SJBC 4NXNB 2Q7GA 1XMQB 2YIAA 1Q43A 2BTOA 2YI9A 2JVDA 4K0KB 1TUBA 1HW7A 2Q7HA 4I4TB 2P22C 3HKDB 3HKCA 2RQ6A 3BHPA 1TVKA 1WPBA 4X62B 5KHKA 4LFBB 4EFEA 4GKJB 4DRXA 3WB1A 4JI2B 3RYFA 4DUYB 1WNSA 5K1PA 4YY3B 4FLVA 5FNVA 4DR2B 3CSXA 4UCVA 3K59A 4CH6A 3K5NA 2PZSA 3BABA 3M7MX 5JQGB 3HKEA 5LP6C 5GONB 4O4JA 5JH7B 3T1HB 3E22B 3K57A 5KHIA 2PTMA 3RYIB 4EFBA 2KKWA 1FJGB 4DV0B 5JVDA 2OYQA 4YJ2A 1XI1A 2V4DA 2Q7EA 4EEQA 4O4HB 4X1KB 4TUYA 3RYHB 5FPRA 3OTFA 2GV9A 4IIJB 5BMVB 3JATB 2UXDB 3IAYA 1SA0B 1O9HA 3BA9A 5KMGA 1X4TA 4UCTA 3ICXA 5CA0A 2UXBB 4B08A 2HEPA 5EYPB 4I55B 2ZIOA 5EZYB 4I4TA 3JSNA 4CH5A 2F95B 3HKDA 1Z5VA 4X65B 1T5EA 1TGOA 3CB2A 2HHHB 4U3JB 3HKCB 1JMKC 1SKVA 4DRXB 1O9GA 4CS3A 2F66C 5JJJB 3RYFB 1I7FA 3RYCB 4FLXA 1M93A 1IBMB 2JS5A 4FM2A 5FNVB 1HNWB 4CC5A 4DV6B 5GONA 5JH7A 1V9PA 3K5OA 3E22A 4K8XA 5KX5A 4AHCA 3HKEB 1DGSA 3T1YB 3WB2A 3JARB 4O4JB 4YHHB 4CC6A 1VF7A 2F4VB 4X1KA 4O2BB 1FFXA 3RYHA 4D7TA 4PI2A 4IIJA 5JVDB 4DK0A 5JCOA 5LYJB 4JI0B 2PYJA 4X1IB 3RWRD 1SQFA 2QM4A 5FPOA 1HNZB 1SA0A 1NT2B 2E5LB 5EIBC 3QG5A 4LF9B 4CS2A 2UUCB 1XHXA 4AQYB 4DR6B 2ZINA 4FFBA 5EYPA 4LF8B 4DUZB 4IHJB 3B2EE 3RGBA 1TAEA 2R72A 4GYCB 5KMGB 3K58A 2PYLA 5CA0B 3UT5B 4UFZA 4KL1A 5IJ0B 2R9AA 4FLUA 4U3JA 3VQXA 4GLXA 5J2TA 4Q6GA 3RYCA 2VQFB 4JI1B 4UCOA 4B3RB 3N2KB 3QTCA 2VWKA 3ZS8C 4FVMA 4B3MB 4DR7B 3JASA 4YJ3B 2PUSA 3JARA 4X64B 4FM0A 1KU9A 4TQFA 5IYZB 4O4LB 2PY5A 4O2BA 2ZCEA 5KX5B 2JGUA 5KHJA 4JV5B 4KHPB 5LYJA 2F1MA 4JI8B 4LH6A 4X1IA 3BRCA 5IWAB 1FFXB 4LF7B 2ZNJA 4DV1B 4X66B 1Q3EA 2UXCB 4UCUA 3N2GA 4FLWA 4IHJA 4ZI7B 1I94B 5JCOC 4JYAB 2ZM6B 2VQEB 3UT5A 3FFQA 4DV3B 4FFBB 4WBNA 5IJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QG5 A;  2CAZ C;  3SJB C;  2JS5 A;  3B2E E;  1SKV A;  3SJA C;  3THO A;  3QF7 A;  3ZS8 C;  2F66 C;  3ICX A;  2P22 C;  1X4T A;  3SJC C;  3CSX A;  1NT2 B; 
#chains in the Genus database with same CATH topology
 4CH3 A;  1I08 A;  1M56 B;  3C3T A;  3T1Y O;  3SYC A;  4DV4 B;  1FXK B;  1KB9 F;  1AIL A;  4PJ0 Z;  4JI7 B;  4WFE A;  1H2L A;  1S76 D;  1VQP V;  1E79 G;  4DV2 B;  1S5J A;  3SJA C;  3N2K A;  3K04 A;  5IYB O;  4Q20 A;  3E8G A;  4KXR A;  5LGT A;  3J80 N;  2VRZ A;  3ZMZ A;  5JJN B;  3ZHT A;  1SZT A;  4JI6 B;  2P5O A;  2Q4P A;  4ICG A;  3RN4 A;  4DW1 A;  1JQ0 A;  5CBG A;  2Q0A A;  1YF2 A;  3WB0 A;  1EM1 A;  3UO3 A;  3JAS B;  3OGC C;  2Y0I A;  4OX9 B;  1FPO A;  3HPL C;  3CCE V;  1QQC A;  4PHZ A;  3STL C;  1LUW A;  4A5U B;  2EZO A;  1Z5W A;  2YIB D;  4PI0 A;  4CBC A;  4JI1 O;  1ZX3 A;  2WAM A;  3HKB A;  4L87 A;  1GK9 A;  5C8Y A;  2KB1 A;  1EFR G;  1KP3 A;  3N2G B;  4J9Z B;  4N21 A;  1DF4 A;  4DR7 O;  2YXH A;  2EIJ C;  3ABK B;  4X64 O;  3CRR A;  1WP8 A;  3DXR B;  3CC7 V;  1I5X A;  5CB4 A;  3DGE A;  4MVR A;  4WBN B;  1R1B A;  4G27 B;  4RQE A;  3D36 C;  2ETN A;  1V55 C;  4KHP O;  3O9O A;  2OTL V;  2ARH A;  2OT5 A;  1B3Q A;  1TA8 A;  2Y4U A;  4FJC C;  4UUJ C;  5EC1 C;  5CMU A;  1NH2 B;  4JYA O;  2ZM6 O;  3U0Z A;  2VQE O;  4FPP A;  1FAF A;  1MMM A;  3CE2 A;  5LMU O;  1H8E G;  1DLB A;  2LP7 A;  1K92 A;  2WLL B;  2IJI A;  3PN1 A;  1GMG A;  1SC5 B;  2A79 B;  4X1Y B;  2JGD B;  3LDC A;  2UU9 B;  3T4Z A;  2XUM A;  1QHT A;  4NKG B;  1RFY A;  2RMK B;  1AI5 A;  2Q6A A;  1KUQ A;  1BL8 A;  1XOU A;  4ASU G;  5BZB A;  4ABM A;  4BR6 A;  1G4Y B;  1H2S B;  3Q4H B;  3FB5 C;  1XQ8 A;  3LSS A;  4JI3 B;  1P7G A;  2YC0 A;  4MTX A;  1SZX A;  4UV8 A;  4X20 B;  4LNU B;  1GN3 A;  2ZXW C;  4FM1 A;  2X7R B;  3APQ A;  3JAW B;  4TQD A;  2WPD G;  4FK5 C;  1FXK C;  4I50 B;  5IY5 B;  4OXS A;  3L75 H;  1OCO C;  3VQY A;  4DXW A;  2N04 A;  2CTP A;  4D7S A;  3IGA C;  2HLD G;  4QPJ A;  2ZE5 A;  2GDS A;  3B40 A;  2HJF C;  5K1X A;  3I56 V;  1YJ9 V;  1N36 B;  2ZR2 A;  2UUB O;  3H1K H;  3OR6 C;  2CAZ C;  4TOI A;  1L8D A;  4AI8 A;  3GB7 C;  5JJE B;  4W4L A;  2OIE A;  1DF5 A;  3RYI A;  1YJN V;  4NB5 A;  1Q6H A;  4OPH A;  2WLM A;  3AG2 B;  1G6U A;  2YEV A;  3SYA A;  4YJ2 B;  2IJH A;  2YIB A;  4DR4 B;  5CA3 A;  1XIL A;  3OUF A;  4MW8 A;  3ABK C;  3CCU V;  4U3F H;  1YJW V;  2CTQ A;  4FIP C;  2LFR A;  4DR3 O;  4F6E A;  2GUZ A;  5IJ9 A;  1AJP A;  5KLV H;  3ABL C;  2BSK A;  4I55 A;  1R73 A;  3SJB C;  1N33 O;  5IT9 N;  2YIA A;  1QNM A;  1W0J G;  1A32 A;  2YI9 A;  4B3S O;  4K0K B;  1B06 A;  3FB7 C;  3M8A A;  3HKD B;  4H44 B;  5DN6 G;  3KG2 A;  2W6I G;  4DUY B;  1CP9 A;  3JD1 A;  3ZRS A;  5K1P A;  3T1C A;  5JWP A;  1U96 A;  3K5N A;  2XTA A;  2V7Q G;  1FKA O;  1LR1 A;  1VQ6 V;  3M7M X;  4JAA A;  5JQG B;  5GON B;  2QM7 A;  3VBB A;  1S72 V;  1EN6 A;  1BHB A;  2CTR A;  3E22 B;  3B4S A;  1KQS U;  1CEZ A;  5KHI A;  4EFB A;  1NU1 H;  1YHQ V;  4DV0 B;  4JGS A;  5E79 Z;  5EBM C;  3E35 A;  2FL4 A;  2ADP A;  3H9V A;  4O4H B;  2QWN B;  3ZCC A;  3E8B A;  3L70 H;  3ZIA G;  3QO8 A;  3JD3 A;  1VQL V;  3IAY A;  1YVW A;  3CX5 F;  2R9I A;  1SQP H;  1GKF A;  3ICX A;  4DO2 A;  2V1D A;  4Z2W A;  3QNE A;  1VF6 C;  2HEP A;  1Q6U A;  1NH2 D;  4LFA O;  4BIO A;  2ZQM A;  4I5S A;  2JJ2 G;  2P67 A;  3VOU A;  5IY5 C;  5LHI A;  1QLN A;  1PP9 H;  1M9N A;  4J7Z A;  1J95 A;  4U3J B;  1SQQ H;  3FB6 C;  2A7W A;  4MVU A;  3MHH C;  1JMK C;  2EIK B;  4CS3 A;  3F5W C;  5JJJ B;  1I7F A;  2ODM A;  4PDM A;  1IBM B;  5FNV B;  4FMT A;  1K33 A;  1PKX A;  3K5O A;  1XMQ O;  4E2L A;  3ZN1 A;  2ITD C;  3HKE B;  1OV9 A;  3T1Y B;  3JAR B;  4TWK A;  4O4J B;  4CC6 A;  1WA8 A;  2OCC C;  3RYH A;  4X62 O;  3K0D A;  1FFT B;  4HAM A;  4DK0 A;  4GKJ O;  4JYB A;  1MA1 A;  1M57 B;  1RPR A;  4GCZ A;  2PYJ A;  3L72 H;  1SQF A;  2QM4 A;  1DTO A;  3AG2 C;  1SA0 A;  4DR2 O;  1NT2 B;  4U7N A;  3CCV V;  4W4K A;  4CS2 A;  1SET A;  1ZLZ A;  5H2F Z;  2ZE7 A;  3ZMV A;  2WLJ A;  2ZIN A;  4IHJ B;  1TAE A;  5KMG B;  3D3Q A;  1QVF U;  4UB8 Z;  2PYL A;  5CA0 B;  3T1H O;  2H8P C;  4KL1 A;  5IJ0 B;  1WAZ A;  1FJG O;  1MG1 A;  2Q8V A;  4YIO A;  1RSO B;  4FZ1 A;  4GLX A;  3JCU Z;  4H33 A;  3B8N A;  4JI1 B;  2QKA A;  4UCO A;  2PF4 E;  1HDJ A;  5IYC O;  4HZ3 A;  1VQ8 V;  3QTC A;  1NVP B;  3FAV A;  4FVM A;  2AW9 A;  1BMF G;  1YXB A;  3P30 A;  4DR7 B;  3JAS A;  3FB8 C;  4IGG A;  4YJ3 B;  4X64 B;  5IYZ B;  3G4S V;  2Z0A A;  4X65 O;  2JGU A;  2LGW A;  4KHP B;  4YIP A;  3B77 A;  1OCZ B;  2O57 A;  1Q3E A;  1AP5 A;  4PEL A;  2EUL A;  3G6E V;  1WLE A;  3N2G A;  2W6J G;  4FLW A;  1GN4 A;  4NTY A;  5LHH A;  3X2Q B;  2ADQ B;  3OM3 B;  4DV6 O;  2Z5U A;  4JYA B;  3DXR A;  5HFM A;  5EBW C;  2ZM6 B;  2VQE B;  4WBN A;  5LGU A;  5LMU B;  1ZAU A;  3CRQ A;  5KHH A;  2P06 A;  1VP7 A;  3LSQ A;  4NTX A;  2WA4 A;  4CS4 A;  3KCX A;  1NS1 A;  2JEX A;  3SPH A;  1HNZ O;  3MD0 A;  2QDO A;  5H6R A;  4AQY O;  2DWD C;  2E74 B;  3DSQ A;  2EIK C;  4DUZ O;  5TIS Z;  4X9Q A;  3K5L A;  3OR7 C;  3DTU B;  3SJQ C;  2E75 B;  4QPK A;  4X1Y A;  4IYH A;  1EZV H;  1ZWI C;  1XBL A;  1W2B U;  3JAL B;  3ZX6 A;  5LXT B;  4MTF A;  4B3R O;  3F5T A;  3K79 A;  4FLZ A;  1IX9 A;  4J80 A;  5L3B A;  1M57 C;  1Q86 W;  4B3M O;  5KUM A;  1HR0 O;  3ZHV A;  4MSW C;  1Q5O A;  1B04 A;  4GX1 A;  4E4E A;  2CUG A;  1ZL8 B;  4LNU A;  3RVZ A;  1R3L C;  2E76 B;  1SRY A;  2UUB B;  4I50 A;  5IWA O;  4LF7 O;  2OTJ V;  4DV1 O;  2AGA A;  5D5Q A;  3K08 A;  1G1X B;  1SES A;  3JD0 A;  4AIL C;  3J81 N;  4O2A B;  4TV9 A;  3CCM V;  5KHG A;  1XDC A;  4GUN A;  4DV3 O;  2RJZ A;  2B9Z A;  4X8A A;  5B1B C;  1US6 A;  1Y74 B;  5EIB D;  1UPG A;  4NXM O;  1IZ3 A;  4O4I A;  1X59 A;  2L35 A;  4ZHQ A;  4DR3 B;  4LFC O;  1KD1 W;  2ITC C;  3OAA G;  2KG7 A;  2CH7 B;  3I55 V;  3W7X A;  1JPX A;  1N33 B;  2YI8 A;  1AI4 A;  2Q68 A;  1JFF B;  3AK1 A;  4UVC A;  4DV5 O;  4BWA A;  4B3S B;  4X88 A;  3RBZ A;  1H38 A;  5J2U B;  3BA8 A;  3X2Q C;  2XAF A;  4TV8 B;  3SPG A;  2BTQ A;  5BR8 O;  1MOF A;  1HWY A;  3ASO B;  1OCO B;  3OTO B;  4Z1M G;  4HNA B;  3JSL A;  5L3D A;  4UV9 A;  4UVA A;  2QWP B;  4JF3 A;  2QR4 A;  4LP8 A;  3U10 A;  2YIC A;  4FZ0 A;  1XMO O;  2QJ1 A;  3AEI A;  5LOV A;  5LP6 A;  4LF5 O;  3ETQ A;  4XBF A;  4LCU C;  2EBO A;  3JYC A;  1D5N A;  1YTF D;  3ML0 A;  5JQG A;  4LF6 O;  4DR5 O;  2Q9L A;  1EN5 A;  4NXN O;  3RFR A;  5CA1 B;  4LFA B;  1Z2G A;  1UFI A;  2HJD A;  1F4M A;  1R6K A;  3JAK A;  4OPA A;  4O4H A;  1Y76 B;  4BW9 A;  4WFB V;  3FYI B;  5ITZ B;  3ABL B;  3KCY A;  4NVP A;  4P9O A;  1FD9 A;  2AZ2 A;  1XL6 A;  4H37 A;  2ZIM A;  1K73 W;  2XHB A;  3E89 A;  1K7D A;  2WLI A;  1HNX O;  1XMQ B;  1XRE A;  3T4D A;  1K4C C;  1TUB A;  2Q7H A;  3GVM A;  1QCE A;  2UUA O;  3T2M A;  3CCS V;  3BHP A;  4X62 B;  1LUV A;  1TVK A;  1RM1 B;  3CXH F;  5HFL A;  4Z1V A;  4GKJ B;  4U7O A;  4YXW G;  2DYR B;  2CGN A;  1YZB A;  4FLV A;  1Y67 A;  5FNV A;  4DR2 B;  5F2V O;  3ZN0 A;  3BAB A;  1BQZ A;  4PD4 F;  3CJH A;  3HKE A;  1MNG A;  2IU3 A;  3A8T A;  4O4J A;  5JH7 B;  3T1H B;  3CS5 A;  4JYC A;  1ROP A;  2PTM A;  1FJG B;  2FB5 A;  2OYQ A;  4JAS A;  4GKK O;  2XND G;  4NYK A;  1N8R W;  4TUY A;  1RPO A;  1W0K G;  3UCS C;  5BMV B;  3DC5 A;  3K9A A;  1G8M A;  4PDL A;  1ZUQ A;  4GZR B;  4LWS B;  5KMG A;  1X4T A;  4UCT A;  1Y6X A;  3ZRX A;  5CA0 A;  3F7V C;  4WFG A;  1KKC A;  4RUF A;  3SPI A;  5EYP B;  1WB7 A;  3ASO C;  4MTG A;  2ZIO A;  4I4T A;  2QEX V;  1Z5V A;  2CE4 A;  4X65 B;  1GM7 A;  3OD4 A;  1VQK V;  3AG4 B;  4G28 B;  2EIL B;  3RVY A;  1XNR O;  3CB2 A;  5IE9 A;  3H1J H;  4D6T H;  2EJ7 A;  1HP8 A;  1IBK O;  5KA6 A;  1SKV A;  4FLX A;  3RYF B;  3K0G A;  1ARO P;  2YXY A;  4OGQ B;  5EBL C;  3IC9 A;  5L3G A;  4QE7 A;  4CC5 A;  1NZ6 A;  4DV6 B;  1NI8 A;  4J10 A;  1SER A;  2KSD A;  2VS0 A;  5FLX N;  3EVK A;  2OCC B;  3E8F A;  1N0N A;  1UJW B;  4RAI A;  1VF7 A;  4X1K A;  3C3S A;  2FKX A;  4IIJ A;  5JVD B;  1VQ4 V;  4JI2 O;  5LYJ B;  1FXV A;  3RWR D;  1SF9 A;  1HNZ B;  3ZHU A;  2PI4 A;  4AQY B;  2MW2 B;  4J42 A;  5C93 A;  4DUZ B;  2C2A A;  3A0R A;  3BFR A;  1R6N A;  3CPW U;  4QGP A;  2LJ2 A;  2R9A A;  1OHH G;  3VQX A;  4RQF A;  3N27 A;  3SPJ A;  1JOY A;  3RW0 A;  4Q6G A;  2CK3 G;  3AG3 B;  2X6A A;  2UXX A;  1PM9 A;  4UVB A;  3M99 B;  3RYC A;  3LUT B;  1AI6 A;  4BIZ A;  4N23 A;  1PL4 A;  1IDS A;  4I9W A;  1PPJ H;  4B3R B;  3N2K B;  1RM1 C;  4NR1 A;  2DYR C;  5L3C A;  3TGU H;  3J7A U;  1PNM A;  2NNU A;  5H5N A;  4B3M B;  2UXB O;  3CCQ V;  2PY5 A;  4O2B A;  5KX5 B;  1MSD A;  1E1R G;  2DOS A;  4JI7 O;  4X1I A;  4TT3 G;  5IWA B;  4MVZ A;  4LF7 B;  4DV1 B;  4UCU A;  3IFX A;  1WJZ A;  1EZJ A;  1NBM G;  1GRJ A;  1SQV H;  3D36 A;  3OT7 A;  4JI6 O;  5JCO C;  2QKC A;  4MT8 A;  3UT5 A;  3FFQ A;  4DV3 B;  4FFB B;  2WWW A;  1ZL8 A;  4MVO A;  4X89 A;  3SYP A;  3JAM N;  1S5H C;  1WP7 A;  3IC7 A;  4NXM B;  3WU2 Z;  4HYO A;  2H3O A;  2K9P A;  2YSU B;  3AG4 C;  1NR1 A;  2EIL C;  2QKS A;  2E5L O;  3FD9 A;  4L8J A;  2EIN B;  4O2A A;  3BEH A;  3CHX A;  4DV5 B;  1WN7 A;  3UQ8 A;  3OGI B;  2WSS G;  4ZIB A;  4O4L A;  2YXL A;  2GSM B;  2XAG A;  3QF7 A;  3ZED A;  5BR8 B;  2DMX A;  4RUE A;  1OJH A;  4GX2 A;  5J9P C;  2HVK C;  3AK3 A;  2EZP A;  4ZI7 A;  4DYL A;  2ZNI A;  1JFF A;  4C7U A;  4G2K A;  1XL4 A;  1BHA A;  5KAF Z;  4DW0 A;  5J2U A;  3VQW A;  1MZF A;  1AR1 B;  1XUQ A;  4FLT A;  3BCC H;  1FXK A;  3ZMS A;  1XMO B;  3SJC C;  4EB6 B;  4JPR A;  4JV5 O;  4LF5 B;  3OMI B;  2Y0P A;  1QR8 A;  1S5L Z;  2X0L A;  2B1I A;  3UKM A;  4B7K A;  2OWO A;  3SPC A;  5B3S C;  2JJ1 G;  1AR5 A;  4MTO A;  4XDJ A;  4LF6 B;  2P4V A;  4HNA A;  4I7Z B;  4X66 O;  4DR5 B;  1L1F A;  2UXC O;  1PNL A;  4DK1 A;  3AG3 C;  1I94 O;  5B1B B;  1F7Y A;  3U11 A;  3OEH G;  3P32 A;  4BW5 A;  3K5M A;  1D2D A;  2DYS C;  3BPZ A;  2BOC C;  1BZK A;  2Q67 A;  2IJJ A;  3OW2 U;  2RCV A;  3ZRW B;  3TET A;  3CEI A;  1N32 O;  4P2Z A;  3OE7 G;  2MK3 A;  5CA1 A;  1KKD A;  2BCC H;  2HFE C;  4B3T O;  1HNX B;  4LH7 A;  4QJF B;  4JAU A;  1Y76 A;  1D5A A;  2UUA B;  1PD3 A;  2XAQ A;  5ITZ A;  1W59 A;  2P6J A;  4HBN A;  1Y4M A;  3ETG A;  4UB6 Z;  2VWJ A;  1JJO A;  1IBL O;  3VQV A;  1NR7 A;  1Q90 D;  5B1O A;  2E3C A;  1OZ0 A;  2GUZ B;  1VMG A;  3A2F A;  5IJ9 B;  1AP6 A;  3SDL A;  2LO1 A;  4ZOL B;  4J41 A;  4ZKI A;  3R66 A;  4F4L A;  2EIN C;  3ABM C;  1FYJ A;  2F23 A;  4GKK B;  1P84 F;  3ZMT A;  2WLL A;  3LSU A;  3NXS A;  4DR1 O;  3BVO A;  4B7E A;  2AZ0 A;  2JGD A;  3S3X A;  2HR3 A;  3K3W A;  3SR2 C;  4QIW F;  3D3I A;  1WPX A;  5D5P A;  3P3N A;  5L3F A;  1NTZ H;  4LBE C;  4K0K O;  3I5D A;  2XAH A;  3Q4H A;  2JIZ G;  5LMN O;  1KP2 A;  2JS3 A;  1XNR B;  5BMV A;  4LF4 O;  1YSC A;  2A06 H;  4X20 A;  2QE7 G;  1BQ0 A;  1DK1 A;  1VF6 A;  1IBK B;  4K35 A;  1S0V A;  3CRA A;  4F6R B;  2ZE6 A;  1V54 C;  3JAW A;  2LFS A;  1IXB A;  5LA6 B;  3E86 A;  4J7K A;  1VQ9 V;  1BE3 H;  1E1Q G;  4JTA B;  2WLH A;  1GTO A;  4UCR A;  1M5I A;  2Q7G A;  1ZSP A;  3ZMU A;  1Q43 A;  2BTO A;  1JJ2 U;  2EIM C;  5CN0 A;  2P22 C;  2NR5 A;  2RQ6 A;  1WPB A;  3CCJ V;  3WB1 A;  4JI2 B;  3RYF A;  1WNS A;  3ZHR A;  1KEC A;  5H6Q A;  4UXN A;  3O65 A;  1H2N A;  2ZDI C;  3EFF K;  5E1A C;  2AHZ A;  3K57 A;  4I0X B;  3A0B Z;  1R6T A;  3PJS K;  2A3Q A;  5JVD A;  3IJ4 A;  1MAB G;  4YJ2 A;  1XI1 A;  2V4D A;  4JI4 O;  2Y69 B;  1L0L H;  1XNQ O;  3RYH B;  3SYO A;  5H9C A;  5FPR A;  2N74 A;  2GV9 A;  4IYI A;  3ASN B;  3JAT B;  4MVM A;  1SA0 B;  3CC4 V;  1VAR A;  1J5E O;  2BOB C;  5LGN A;  2UXB B;  1NVP D;  3L71 H;  1I5Y A;  2W0F C;  4B08 A;  4XDL A;  4P30 A;  4TSF G;  5EZY B;  5IYD O;  3JSN A;  1JCH A;  3HKD A;  3AG1 B;  1AJN A;  1T5E A;  1N34 O;  1TGO A;  4DV7 O;  5GTI Z;  1ENV A;  3EXA A;  1SQB H;  3QO5 A;  1F4N A;  3HKC B;  3S3W A;  3W7W A;  4DRX B;  2JK5 C;  4JI5 O;  2JS5 A;  3A0H Z;  4WFF A;  4FM2 A;  1Q82 W;  1IVS A;  2GHY A;  5LHG A;  5GON A;  5FL7 G;  3FAV B;  2CTW A;  2QM8 A;  3E22 A;  4K8X A;  4JZG A;  2XAJ A;  5KX5 A;  3WB2 A;  1VQM V;  1H8H G;  1F51 A;  3TXQ A;  4LFB O;  5GTH Z;  2LW1 A;  2Q5Z A;  2D3O W;  4J11 A;  4YY3 O;  5FPO A;  2E5L B;  3ETE A;  3SYQ A;  2QA4 V;  1GAX A;  3E2E A;  4FFB A;  3B2E E;  3RGB A;  2XAS A;  1NQT A;  2M7W A;  4PV1 B;  3JD4 A;  5DED A;  3CXC U;  4FLU A;  4U3J A;  4PA3 A;  3JCZ A;  3OMA B;  2IW5 A;  2LQT A;  1PV0 A;  4J9Y B;  1NTM H;  2HKO A;  3W7T A;  2FYU H;  2X6C A;  2ZD9 A;  3APO A;  1COW G;  1P7B A;  1AR4 A;  1ZTE A;  2UXD O;  1OCR B;  2VWK A;  1K5Q A;  3L73 H;  1AB3 A;  3WG7 B;  1VQN V;  3EHB B;  1I0H A;  3P3P A;  3H01 A;  3JAR A;  2WLK A;  5A9G A;  1KU9 A;  4IT5 A;  4TQF A;  1K8A W;  2P4K A;  2RN9 A;  5KHJ A;  4JV5 B;  1N0J A;  2HHH O;  1BS3 A;  3HR0 A;  4LH6 A;  1VQ5 V;  3BRC A;  1FFX B;  2Q73 A;  4WCE V;  5LBQ A;  4X66 B;  1K34 A;  3FYE B;  4PA7 A;  2UXC B;  2QTS A;  2Y69 C;  2HG5 C;  4IHJ A;  1BSM A;  1HNW O;  1I94 B;  3ASN C;  2JEU A;  4H0L B;  2XT9 A;  4H13 B;  3ZHQ A;  5IJ0 A;  4EB6 A;  2KQX A;  1RSO A;  4YHH O;  1VQ7 V;  2PGG A;  5A2Q N;  2F4V O;  2XOK G;  5EK0 A;  2HP8 A;  4WFA V;  1M56 C;  4J7J A;  4XDK A;  1N32 B;  4JI0 O;  3AG1 C;  3ZBH A;  5J2T B;  2P90 A;  3BAA A;  5B5E Z;  4K8Z A;  2IJK A;  4B3T B;  4LF9 O;  1AJQ A;  1FS0 G;  3ABT A;  2UUC O;  2A9H A;  1SQX H;  5L3E A;  4DR6 O;  3ETD A;  3MHS C;  2QWO B;  4GX0 A;  4LF8 O;  1BGY H;  4YJ3 A;  2AHY A;  4TV9 B;  5IYZ A;  1SQG A;  2AXT Z;  3H1L H;  3ZRW A;  2QSA A;  2ZDI A;  1IUR A;  1H2M A;  4CH4 A;  1IBL B;  3L74 H;  1JA8 A;  4JTC B;  1MZE A;  4NTW A;  3D8C A;  4O4I B;  2VQF O;  4ZHQ B;  2ZE8 A;  2ZT9 B;  2IBZ H;  1EBO A;  2KG7 B;  2WA3 A;  1Q81 W;  1YIT V;  3LDD A;  1P49 A;  1L0N H;  5CBH A;  1KYO F;  3MDS A;  1FXH A;  2EX3 A;  1CPY A;  1B6Q A;  5B3S B;  5BXZ A;  1JVM A;  1N4C A;  2X6B A;  4DR1 B;  5DM6 V;  3CD6 V;  2BTQ B;  4JI8 O;  2UXN A;  2IH1 C;  1R3K C;  1JX9 A;  5KA5 A;  1Q6I A;  2JRI A;  4P9P A;  2FTK A;  1MSW D;  1Q8I A;  2F93 B;  1YCI A;  4ZOL A;  2CGO A;  2DYS B;  2IH3 C;  1S3J A;  4KFM A;  4MS2 A;  5B66 Z;  3MAQ A;  4QNH B;  2RDC A;  1EN4 A;  3B8M A;  4QE9 A;  4LR3 A;  2NN4 A;  1BCC H;  5LMN B;  1M90 W;  1HR0 B;  4IL6 Z;  1OCR C;  1THZ A;  1M4U A;  1XEQ A;  4LF4 B;  4EKW A;  3WG7 C;  2CDY A;  2ATK C;  2DE0 X;  2FML A;  4DV4 O;  1NJI W;  1YIJ V;  4WF9 V;  2B1G A;  5LOV B;  5LP6 B;  2DQ3 A;  3JAL A;  1PL0 A;  1GN2 A;  1BT8 A;  5LXT A;  1QVG U;  4DV2 O;  3OTO O;  1XHZ A;  1SS3 A;  1P4R A;  3HKB B;  5C8Y B;  2W0X A;  1GM9 A;  1H2K A;  3OEE G;  3JAK B;  4WFH A;  3BY6 A;  1GH6 A;  4OX9 O;  4F6R A;  2R70 A;  3LNM B;  3CRC A;  5CB4 B;  5LA6 A;  2EJR A;  1K4D C;  3F7Y C;  3TJT A;  5IDJ A;  4LFC B;  3LNN A;  4RWU A;  3THO A;  3KKY A;  4I9Q A;  3CMA V;  3W7S A;  2D2C B;  1OCC B;  3FKS G;  3ABM B;  3B09 A;  2WLI B;  3SGI A;  4JAV A;  4R8C A;  3AG7 A;  4K3A A;  1GO3 F;  2Y48 A;  3CME V;  1KMI Z;  4ZBM A;  1GM8 A;  1JR9 A;  1TUB B;  3W7U A;  1K3E A;  4JI4 B;  1AI7 A;  1Y74 A;  1XNQ B;  1F23 A;  3GWO A;  1K5S A;  1TVK B;  3CRM A;  2B5U A;  2GTS A;  2CH7 A;  2YID A;  1VEW A;  4FLY A;  3H1I H;  3STZ C;  1J5E B;  2F43 G;  3E8H A;  4PA4 A;  3E83 A;  4I0X A;  1RP3 B;  3CJH B;  1H2G A;  4UCS A;  2QGN A;  1N34 B;  2YUA A;  4DV7 B;  4TV8 A;  3CYO A;  3WFV A;  1V54 B;  2OCH A;  1NTK H;  3JAT A;  1K9M W;  2YDE A;  3AK2 A;  1URF A;  3CCL V;  4TUY B;  2PI5 A;  2IM9 A;  3HB3 B;  4JI5 B;  2UU9 O;  2Q69 A;  4MW3 A;  2EIM B;  4PDR A;  5EZY A;  1YEW A;  4NXN B;  4FFK A;  4BIU A;  1KC8 W;  2JVD A;  1HW7 A;  4I4T B;  1QLE B;  3G80 A;  3HKC A;  4PA6 A;  4GX5 A;  5KHK A;  4LFB B;  4EFE A;  4DRX A;  4JI3 O;  2ILM A;  1CXZ B;  3H1H H;  4YY3 B;  5B1A B;  1WB8 A;  3RT3 C;  3CSX A;  2Y4T A;  2Q0O C;  3CP1 A;  4UCV A;  2QTO A;  3K59 A;  4CH6 A;  2BE3 A;  5AG2 A;  3QVN A;  2PZS A;  5LL6 Y;  3L9D A;  5LP6 C;  2DJV A;  1PNK A;  2RNB A;  3G67 A;  3UO2 A;  3K06 A;  4CZZ A;  4RO2 A;  3G71 V;  5CBF A;  3RYI B;  2KKW A;  2P7T C;  1QR9 A;  1QBZ A;  2Q7E A;  4EEQ A;  5KAI Z;  4JTD B;  4X1K B;  2YEV B;  1VQO V;  2H94 A;  3OTF A;  4IIJ B;  1YTF B;  1KBH A;  1N36 O;  2HVJ C;  3K03 A;  2ZKO A;  3TXS A;  2UXD B;  1M1K W;  1O9H A;  3BA9 A;  2R9R B;  3ZRV A;  2IU0 A;  2BSK B;  4I55 B;  3OUS A;  2DW4 A;  3ABU A;  4CH5 A;  2F95 B;  1OCC C;  3C90 A;  4KUM A;  1GN6 A;  1IXM A;  1Q7Y W;  3TCU A;  3FX7 A;  2G38 A;  2HHH B;  4DR4 O;  3TK1 A;  2YS8 A;  4KP4 A;  4GT1 A;  5EC2 C;  1O9G A;  2F66 C;  3RYC B;  2L6L A;  1M93 A;  3OMN B;  3DC6 A;  4MVQ A;  1HNW B;  1TUE B;  1S77 D;  5JH7 A;  1V9P A;  2Z3Y A;  1YDX A;  4AHC A;  4R6Z A;  1DGS A;  4R7C A;  4PDV A;  1QU7 A;  2LW7 A;  4YHH B;  2JDI G;  2F4V B;  4LC1 A;  2OIG A;  4O2B B;  1FFX A;  2DQ0 A;  4D7T A;  4PI2 A;  5JCO A;  3OFN G;  4DUY O;  3JD2 A;  4JI0 B;  4X1I B;  5B1N A;  1K97 A;  2DWE C;  5EIB C;  3QG5 A;  2EIJ B;  4LF9 B;  4LWS A;  2UUC B;  1XHX A;  4DR6 B;  1AVM A;  4LF8 B;  5EYP A;  5KUK A;  2GTA A;  4JZ2 A;  3K9S A;  2R72 A;  2M6Y A;  3KZI Z;  4GYC B;  3K58 A;  3CCR V;  1V55 B;  3G6B A;  4JYY A;  2GBO A;  3UT5 B;  3UM7 A;  4UFZ A;  4DV0 O;  2LGQ A;  4BAY A;  5J2T A;  2NLJ C;  3CWB H;  3GWK C;  2VQF B;  2DN9 A;  1QLE C;  2WLN A;  1YI2 V;  1R3I C;  1R3J C;  1Y66 A;  3CC2 V;  1VF5 B;  3ZS8 C;  5B1A C;  2PUS A;  4FM0 A;  5DEC A;  5GW7 A;  3NR7 A;  3LDE A;  5BY1 A;  2QWR B;  4O4L B;  2QWQ B;  2ZCE A;  2N05 A;  4PA9 A;  5LYJ A;  2F1M A;  4MVS A;  4JI8 B;  3ZHS A;  1WA8 B;  2ZR3 A;  2ZNJ A;  1U97 A;  3QO7 A;  1IBM O;  4ZI7 B;  1OCZ C;  3ZJZ A;  2K1E A;  4R50 A;  1LNQ A;  1ORQ C;  1VIB A;  1NKD A;  3R65 A;  2A0L A;  2ZXW B; 
#chains in the Genus database with same CATH homology
 4CH3 A;  4EB6 A;  5LMU B;  1ZAU A;  1RSO A;  4DV4 B;  2PGG A;  5KHH A;  4NXM B;  4JI7 B;  4CS4 A;  1N32 B;  4DV2 B;  5J2T B;  1S5J A;  3BAA A;  3N2K A;  3SJA C;  4K8Z A;  4B3T B;  5JJN B;  4L8J A;  4O2A A;  3CHX A;  3DSQ A;  4DV5 B;  1WN7 A;  4JI6 B;  4YJ3 A;  2P5O A;  3UQ8 A;  4TV9 B;  4ZIB A;  5IYZ A;  4O4L A;  2Q0A A;  1SQG A;  3WB0 A;  2YXL A;  3K5L A;  3JAS B;  3QF7 A;  3ZED A;  4OX9 B;  5BR8 B;  1QQC A;  4PHZ A;  4X1Y A;  4CH4 A;  1Z5W A;  1IBL B;  4O4I B;  2YIB D;  4PI0 A;  4ZHQ B;  3JAL B;  3HKB A;  5LXT B;  4ZI7 A;  2ZNI A;  5C8Y A;  1JFF A;  4FLZ A;  1P49 A;  3N2G B;  5J2U A;  3VQW A;  2EX3 A;  1Q5O A;  1B04 A;  4FLT A;  5CB4 A;  4LNU A;  4WBN B;  1XMO B;  3SJC C;  4EB6 B;  4DR1 B;  4LF5 B;  2BTQ B;  2OWO A;  2UUB B;  4I50 A;  4LF6 B;  4HNA A;  5D5Q A;  4DR5 B;  1TA8 A;  4DK1 A;  1Q8I A;  2F93 B;  4ZOL A;  4AIL C;  4O2A B;  3MAQ A;  4TV9 A;  3U11 A;  5KHG A;  3U0Z A;  4LR3 A;  5LMN B;  3K5M A;  1HR0 B;  2RJZ A;  3BPZ A;  1M4U A;  4LF4 B;  5EIB D;  4O4I A;  3PN1 A;  4ZHQ A;  5LOV B;  5LP6 B;  4DR3 B;  3JAL A;  4X1Y B;  5LXT A;  2UU9 B;  5CA1 A;  1QHT A;  1XHZ A;  1HNX B;  4LH7 A;  1N33 B;  2YI8 A;  3HKB B;  5C8Y B;  1JFF B;  4B3S B;  4BWA A;  1D5A A;  1H2S B;  2UUA B;  5J2U B;  3BA8 A;  1XQ8 A;  3JAK B;  5ITZ A;  4TV8 B;  2BTQ A;  4JI3 B;  4F6R A;  2R70 A;  4X20 B;  4HBN A;  5CB4 B;  5LA6 A;  4LNU B;  2VWJ A;  1JJO A;  4FM1 A;  3VQV A;  4LFC B;  3LNN A;  3JAW B;  4TQD A;  3THO A;  4I9Q A;  2E3C A;  4I50 B;  3OTO B;  3A2F A;  5IJ9 B;  4HNA B;  3JSL A;  3VQY A;  3SGI A;  4ZOL B;  1KMI Z;  1TUB B;  3U10 A;  4D7S A;  4JI4 B;  4GKK B;  1XNQ B;  1TVK B;  2QJ1 A;  5LOV A;  5LP6 A;  3ETQ A;  5K1X A;  1N36 B;  3SR2 C;  2CAZ C;  4TOI A;  1L8D A;  4FLY A;  5JQG A;  1J5E B;  5JJE B;  3RFR A;  5D5P A;  5CA1 B;  4LFA B;  3RYI A;  4UCS A;  1N34 B;  3JAK A;  4DV7 B;  4O4H A;  4TV8 A;  1G6U A;  1XNR B;  4BW9 A;  5BMV A;  4YJ2 B;  4X20 A;  2YIB A;  4DR4 B;  3JAT A;  5ITZ B;  1IBK B;  4TUY B;  2IM9 A;  4NVP A;  4F6R B;  3JAW A;  4JI5 B;  5LA6 B;  2ZIM A;  5IJ9 A;  2XHB A;  4I55 A;  4UCR A;  1YEW A;  5EZY A;  1M5I A;  3SJB C;  4NXN B;  2Q7G A;  1XMQ B;  2YIA A;  1Q43 A;  2BTO A;  2YI9 A;  2JVD A;  4K0K B;  1TUB A;  1HW7 A;  2Q7H A;  4I4T B;  2P22 C;  3HKD B;  3HKC A;  2RQ6 A;  3BHP A;  1TVK A;  1WPB A;  4X62 B;  5KHK A;  4LFB B;  4EFE A;  4GKJ B;  4DRX A;  3WB1 A;  4JI2 B;  3RYF A;  4DUY B;  1WNS A;  5K1P A;  4YY3 B;  4FLV A;  5FNV A;  4DR2 B;  3CSX A;  4UCV A;  3K59 A;  4CH6 A;  3K5N A;  2PZS A;  3BAB A;  3M7M X;  5JQG B;  3HKE A;  5LP6 C;  5GON B;  4O4J A;  5JH7 B;  3T1H B;  3E22 B;  3K57 A;  5KHI A;  2PTM A;  3RYI B;  4EFB A;  2KKW A;  1FJG B;  4DV0 B;  5JVD A;  2OYQ A;  4YJ2 A;  1XI1 A;  2V4D A;  2Q7E A;  4EEQ A;  4O4H B;  4X1K B;  4TUY A;  3RYH B;  5FPR A;  3OTF A;  2GV9 A;  4IIJ B;  5BMV B;  3JAT B;  2UXD B;  3IAY A;  1SA0 B;  1O9H A;  3BA9 A;  5KMG A;  1X4T A;  4UCT A;  3ICX A;  5CA0 A;  2UXB B;  4B08 A;  2HEP A;  5EYP B;  4I55 B;  2ZIO A;  5EZY B;  4I4T A;  3JSN A;  4CH5 A;  2F95 B;  3HKD A;  1Z5V A;  4X65 B;  1T5E A;  1TGO A;  3CB2 A;  2HHH B;  4U3J B;  3HKC B;  1JMK C;  1SKV A;  4DRX B;  1O9G A;  4CS3 A;  2F66 C;  5JJJ B;  3RYF B;  1I7F A;  3RYC B;  4FLX A;  1M93 A;  1IBM B;  2JS5 A;  4FM2 A;  5FNV B;  1HNW B;  4CC5 A;  4DV6 B;  5GON A;  5JH7 A;  1V9P A;  3K5O A;  3E22 A;  4K8X A;  5KX5 A;  4AHC A;  3HKE B;  1DGS A;  3T1Y B;  3WB2 A;  3JAR B;  4O4J B;  4YHH B;  4CC6 A;  1VF7 A;  2F4V B;  4X1K A;  4O2B B;  1FFX A;  3RYH A;  4D7T A;  4PI2 A;  4IIJ A;  5JVD B;  4DK0 A;  5JCO A;  5LYJ B;  4JI0 B;  2PYJ A;  4X1I B;  3RWR D;  1SQF A;  2QM4 A;  5FPO A;  1HNZ B;  1SA0 A;  1NT2 B;  2E5L B;  5EIB C;  3QG5 A;  4LF9 B;  4CS2 A;  2UUC B;  1XHX A;  4AQY B;  4DR6 B;  2ZIN A;  4FFB A;  5EYP A;  4LF8 B;  4DUZ B;  4IHJ B;  3B2E E;  3RGB A;  1TAE A;  2R72 A;  4GYC B;  5KMG B;  3K58 A;  2PYL A;  5CA0 B;  3UT5 B;  4UFZ A;  4KL1 A;  5IJ0 B;  2R9A A;  4FLU A;  4U3J A;  3VQX A;  4GLX A;  5J2T A;  4Q6G A;  3RYC A;  2VQF B;  4JI1 B;  4UCO A;  4B3R B;  3N2K B;  3QTC A;  2VWK A;  3ZS8 C;  4FVM A;  4B3M B;  4DR7 B;  3JAS A;  4YJ3 B;  2PUS A;  3JAR A;  4X64 B;  4FM0 A;  1KU9 A;  4TQF A;  5IYZ B;  4O4L B;  2PY5 A;  4O2B A;  2ZCE A;  5KX5 B;  2JGU A;  5KHJ A;  4JV5 B;  4KHP B;  5LYJ A;  2F1M A;  4JI8 B;  4LH6 A;  4X1I A;  3BRC A;  5IWA B;  1FFX B;  4LF7 B;  2ZNJ A;  4DV1 B;  4X66 B;  1Q3E A;  2UXC B;  4UCU A;  3N2G A;  4FLW A;  4IHJ A;  4ZI7 B;  1I94 B;  5JCO C;  4JYA B;  2ZM6 B;  2VQE B;  3UT5 A;  3FFQ A;  4DV3 B;  4FFB B;  4WBN A;  5IJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...