2JS5A

Nmr structure of protein q60c73_metca. northeast structural genomics consortium target mcr1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTASLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of protein Q60C73_METCA.
rcsb
source organism Methylococcus capsulatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 28
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05082 Rop-like Rop-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2js5A00
3SJBC 2JS5A 1NT2B 2F66C 3SJAC 1X4TA 1SKVA 3CSXA 3ICXA 3QF7A 3SJCC 2CAZC 3QG5A 3B2EE 3THOA 3ZS8C 2P22C
chains in the Genus database with same CATH superfamily
1HP8A 2E74B 5IY5C 5B1BC 1G4YB 1Q81W 3D3QA 2WPDG 5B3SC 1TVKB 5HFMA 4YIPA 5CA3A 3DXRA 5EZYA 2MW2B 1B04A 4X20A 5BZBA 3B09A 1RPOA 4EB6A 2XT9A 4NTWA 1FXKB 3CRCA 2LP7A 4UV9A 3CXCU 4LF5O 1SQBH 5E79Z 2VRZA 2Y0PA 4GKKO 2UXDO 3NR7A 5JCOA 3ZX6A 4NXNB 3SPIA 4FLUA 5KAIZ 1TUBB 3G71V 5B1OA 2AW9A 3LDEA 2A79B 4X62B 2AHYA 4FM2A 1E1QG 3LDDA 3S3XA 3STZC 4DR6O 1HWYA 1P49A 2GUZB 2IJJA 4TV8B 1IBMB 3RYHA 2VQFB 3K0GA 3VQVA 1K92A 5KLVH 4DW0A 1QR8A 1VF6C 2PY5A 4K8ZA 1EN5A 4ZI7A 4FIPC 1L1FA 5KX5A 2EILB 1VF7A 3CWBH 4MVSA 4O4HB 4LH7A 3FFQA 2CTQA 2HLDG 3FB6C 1NU1H 2XAGA 5DEDA 1OCZB 2ITDC 4PA3A 2PZSA 1K73W 4I9QA 1XQ8A 1GM7A 4KHPB 1F7YA 5KMGB 1K7DA 1AILA 5B1AB 1IX9A 5EC1C 1HDJA 1G8MA 1KC8W 4KUMA 4GKJB 5KUKA 2CDYA 3RYCB 3E89A 3ABMB 1M9NA 2V7QG 3SR2C 1AR5A 3D3IA 1WN7A 3VBBA 2WSSG 4LP8A 1AJPA 4LFCO 1VEWA 1GN6A 4I9WA 4OX9O 2F93B 5LA6B 4UV8A 4H33A 4J41A 2PI5A 3RYFB 4LF6B 4GYCB 1R3IC 2H94A 3T1CA 2BOCC 3SPCA 4U3JA 1Q6UA 3CJHA 2E5LO 2D3OW 2GBOA 4UFZA 1PNMA 3MD0A 1VF6A 2HJFC 1H8EG 1R6TA 4JPRA 2WLMA 5EIBD 2CGOA 4WFGA 4ZOLA 1GN3A 5H6QA 4JI6B 1H2KA 1JPXA 3BVOA 4PA4A 2YIBD 5DN6G 3JAWA 3T1YB 1SERA 4K35A 2Q68A 4O2AB 3UO2A 1HNXB 2Z5UA 4D7SA 1WP8A 4JI5B 4K0KB 4MVRA 2CH7A 3AEIA 4FLYA 1J5EO 3OGIB 2A9HA 4I5SA 3JD2A 3HPLC 1QHTA 3APQA 2WLHA 1FKAO 2QTSA 4EFBA 4J10A 2DQ3A 4IYIA 1KP2A 1SETA 4WF9V 2FTKA 1H2GA 1QLEB 4FMTA 1AI4A 2LJ2A 1MZEA 2YIBA 3ICXA 3RVZA 2VWJA 1I5XA 4B08A 2ILMA 3IC9A 2X6CA 3ZRSA 4DV2O 1PL4A 1VQ5V 4DR6B 4X64B 4RWUA 4LF9O 4A5UB 1KKCA 4GZRB 3HB3B 2JS5A 2XAQA 4MVMA 3CCRV 4DYLA 4J9YB 1HNZB 1A32A 2FB5A 3I5DA 4JI8O 1YZBA 2P06A 1E1RG 2YC0A 2HVKC 3IJ4A 4DV7B 1AP5A 4MVOA 3RVYA 4DV5B 3ZHUA 2OT5A 2DYRB 4JZGA 3JCUZ 1Z2GA 3B77A 2AHZA 2NR5A 3VQYA 1MNGA 1Y74A 4MVZA 1Y76B 3H1IH 3U10A 1E79G 4JTCB 2RNBA 5BR8O 1QNMA 3ZEDA 4DV6B 1K5SA 4QE9A 2YICA 4UB6Z 2ZE7A 1Q43A 1PV0A 3J80N 5A2QN 4XDJA 1SZTA 1B06A 2QM8A 2VS0A 3EXAA 5H9CA 4EFEA 1UFIA 2R9RB 5EBLC 5LYJA 2B1IA 1R6KA 5E1AC 1GM8A 2GDSA 4JI2O 1OJHA 4LWSA 2V1DA 4P30A 2VWKA 4UVAA 3ZHTA 4CBCA 4GKKB 3JYCA 2JJ1G 1M57B 2LO1A 5JJNB 1DF5A 3B40A 5C8YB 5EYPB 4ICGA 3OW2U 5IWAO 3SDLA 1K4DC 3CSXA 1NS1A 1XEQA 5IY5B 1QVFU 4JV5O 1WP7A 2LQTA 1XI1A 2XASA 3OUFA 1N32B 3W7WA 1XNRB 1GH6A 3W7SA 3SYPA 4IIJA 2KB1A 3NXSA 4N23A 5CB4A 5JCOC 2VQFO 2UUAO 1BQ0A 3L9DA 5FNVB 4XDLA 1FYJA 2AXTZ 4U7NA 2FMLA 1VP7A 2F66C 2X6AA 5EZYB 3U0ZA 3K06A 5IJ9A 2JVDA 2GUZA 1N8RW 2IH1C 1VQNV 1FS0G 3EFFK 2ZM6O 5LP6C 1FXKA 1TUEB 4UCVA 3ETGA 4HNAA 2A3QA 4B7KA 2F1MA 3LSSA 4NR1A 4WCEV 3TJTA 4N21A 4FFBA 1JFFA 4TWKA 1QCEA 2CGNA 1D5AA 3UQ8A 3O9OA 3E83A 1BMFG 4TSFG 2EILC 3STLC 4LR3A 2DW4A 2XAJA 4O4LB 3THOA 3K0DA 2PTMA 1BS3A 3B8MA 3IAYA 3ZJZA 4LNUA 1PKXA 2GV9A 3E22B 1GO3F 1NZ6A 4IYHA 3K5NA 4PDLA 2EIMC 3ABKC 2C2AA 1YF2A 3HKDB 2YXYA 4I4TB 1QBZA 4DR4B 2Y0IA 1S0VA 5B1NA 1KKDA 5LL6Y 3L75H 1GM9A 2ZQMA 4IGGA 1FAFA 4LFAB 2Q7HA 3BHPA 3CXHF 4PD4F 4DR2B 2O57A 5KA5A 4WFEA 1IBLO 5CA1A 4LH6A 4MW3A 3TXSA 4X1YB 2N05A 3JD1A 1XOUA 2UXDB 1MMMA 3CCEV 2XUMA 1Y74B 3BABA 1FD9A 2PUSA 4PJ0Z 4MVUA 2ZR2A 2BTOA 3OM3B 1R1BA 4B3RB 1ZWIC 3K03A 4R50A 2WA3A 4JYCA 3TETA 3CMAV 3K3WA 4WFAV 1PPJH 1DLBA 4DUZO 1MSWD 4HYOA 4UCTA 4RQEA 1OCCC 2R70A 4QNHB 3RGBA 1NTZH 1HNWB 4ZOLB 2CH7B 1Y67A 3RFRA 4PELA 2UXCO 4TV9A 4JAAA 1IXMA 2ZE8A 1BCCH 1J95A 3WU2Z 5IYZA 2BTQB 3C3SA 2PF4E 4IT5A 2X6BA 3QG5A 5EYPA 1VQ4V 1F4MA 4X66B 2ODMA 3HKCB 2IJKA 1XHXA 2DYSB 5J2UA 4TV9B 1RM1B 4PV1B 1BGYH 4K0KO 4NVPA 2HFEC 5LOVB 1KU9A 4X89A 1K34A 3SPHA 3OMIB 1COWG 4DR3B 3JATB 4LFBO 1Y4MA 3AG2B 4JI3O 3ZHSA 3JAKA 2KQXA 2BOBC 4UCRA 4YJ2B 5FNVA 3ABTA 2UUCO 1MA1A 2JIZG 4CS4A 1V54C 4WFBV 1P4RA 4W4LA 3CCMV 4CH5A 1YTFD 5CB4B 1XNQB 3N2KB 3AK1A 1MG1A 4DR2O 2KG7B 2E5LB 5BR8B 5CBFA 5JJEB 1DTOA 5K1XA 4X1YA 3K57A 3CC7V 3FD9A 1RSOA 1AP6A 1XMOB 5JH7B 1FPOA 4OX9B 2X7RB 3JALB 3ML0A 1XNRO 4X1IA 2WAMA 4FLVA 4DR5O 3G67A 1Q6HA 4MS2A 1ZL8A 1DF4A 1NH2B 3F7VC 3ZS8C 4DV3B 4NKGB 3UT5B 2P7TC 4GLXA 3CYOA 2JJ2G 2ADQB 1RM1C 1PM9A 2Y69C 2JK5C 4H0LB 1P7GA 2RCVA 2V4DA 3QF7A 1WB8A 2JRIA 3CB2A 2Q67A 2Y69B 4QJFB 5BMVA 3AG4B 4L87A 1JR9A 2YI8A 4I7ZB 2QEXV 3CEIA 4X1KB 1QQCA 3LUTB 3OE7G 3FB7C 2CTWA 1JX9A 3GWKC 1M93A 2QWRB 1H2NA 4PDVA 1K3EA 4YJ3A 4X20B 5H5NA 1TAEA 2ZE6A 1NR7A 3AG4C 3D8CA 2OIGA 3A0HZ 1Z5WA 1QLNA 3N2GB 1L0LH 4PA6A 4U7OA 1IDSA 1NKDA 1XL6A 1SRYA 4J42A 1AROP 1X59A 4EKWA 3SPGA 1KYOF 2OTJV 1H38A 4PDRA 3ZRWB 3JAWB 3W7TA 3CPWU 4X64O 4KFMA 4BIZA 1F4NA 1W2BU 2CTRA 4I50A 3HKEA 2B1GA 2F23A 4RO2A 1BHBA 3ZHQA 2R9AA 1N4CA 1BT8A 2W6IG 4K8XA 3LNNA 2QR4A 1SESA 1URFA 4Z1VA 4Z1MG 4GX5A 5KHGA 3IC7A 2PYLA 5LHIA 1VF5B 5KA6A 2Q5ZA 2DYRC 4TT3G 3M7MX 3PN1A 1PD3A 4JYAB 2F4VO 3Q4HB 1JCHA 4F6EA 1YTFB 3M99B 4HNAB 5IDJA 3EHBB 3C90A 1S77D 3ZN1A 4PI2A 5IWAB 4FZ0A 4JTAB 1VQ9V 1Z5VA 1EZJA 1JFFB 5IJ9B 1YXBA 5CA0B 4ZHQA 2IU3A 1MSDA 3D36C 4CC6A 2GTAA 3Q4HA 4GX1A 4YJ2A 2EIKC 3K9SA 3VQWA 5JQGA 1GN2A 3R65A 4O4IB 1K9MW 3WB1A 1QR9A 4I4TA 4QGPA 1OCRC 5CMUA 2LFRA 3F7YC 2W0XA 1LUWA 4B7EA 4QE7A 2IJHA 5TISZ 2UUAB 1ZX3A 2Y4TA 3OAAG 4I55B 1M56C 1SQQH 5H6RA 4DUZB 4FM0A 1S5HC 3T4DA 1ZL8B 1TGOA 1R3LC 2DE0X 1SC5B 1S5JA 1R73A 3BRCA 3DSQA 5KAFZ 1CXZB 2Q7EA 2A0LA 3UT5A 5LMUB 4LCUC 1EBOA 5JJJB 3E8HA 2QSAA 2N04A 1GMGA 3ZMUA 4JYYA 4MTXA 2KSDA 1AI7A 4H44B 2XAFA 1UJWB 1M1KW 4LWSB 2QA4V 4HBNA 5AG2A 2OYQA 4UCUA 3SJQC 1PNLA 4MW8A 5L3EA 1SZXA 4O4JA 4UCOA 3W7XA 2UU9O 4DR5B 2E76B 2F95B 4DR1B 1KD1W 1JJ2U 3SJCC 3RYCA 5CBGA 1ZSPA 1AI6A 1M4UA 1BHAA 3SYCA 3KCYA 1P84F 2ZNJA 3RN4A 2BSKA 4R8CA 2EIJC 4BIOA 5L3FA 4FLXA 3OGCC 1YJ9V 4X65O 4X62O 2OCHA 4O2BB 4O4LA 1IZ3A 4U3FH 2Y48A 4KXRA 3K04A 4MTGA 5J2UB 2MK3A 4CS2A 3HKBB 4KL1A 3CE2A 4J9ZB 3SPJA 2CAZC 3ASNC 4LFBB 2N74A 5EBMC 4JI2B 5B1AC 1SF9A 3A8TA 3DXRB 2ZKOA 3SYOA 1VIBA 3AG1B 1YDXA 4FPPA 4LFAO 3CRMA 3OTOO 4ABMA 1L0NH 1XHZA 2EJ7A 2PI4A 3LSQA 2RN9A 3TXQA 3CRAA 3FB8C 4JI6O 1WAZA 4ZHQB 2E75B 2QKSA 4R7CA 2Q69A 2EINB 1Q6IA 5EIBC 5LBQA 1M5IA 3K08A 3BCCH 1I5YA 4FLTA 3OR7C 3K9AA 5ITZB 1QLEC 3AG3C 3JARB 3WB2A 1MOFA 1VQPV 2P5OA 2H8PC 3APOA 1VQMV 1RP3B 4ZIBA 3ETEA 4GX2A 2XTAA 3WB0A 3GWOA 3RYFA 2ZNIA 2D2CB 1WA8B 4B3TB 1HNZO 3K5MA 5LXTA 2OTLV 4DR3O 4F4LA 3G6BA 1NJIW 4WFHA 2WLLA 3WG7C 3X2QB 1HW7A 3E8BA 1KP3A 2BSKB 2ZDIA 3CCQV 3D36A 5LMUO 1JOYA 2IU0A 4L8JA 2HP8A 1FFXB 2HKOA 3ASNB 4YHHB 4EEQA 3JASB 1ZLZA 1EZVH 2Q6AA 1KB9F 4BW5A 3K59A 5FPRA 5L3CA 3OUSA 1N0JA 4UUJC 2QM4A 1Q7YW 4FM1A 3CRRA 1OCCB 1K97A 4J80A 3AG3B 2BE3A 1FJGO 4NB5A 4JF3A 2HR3A 3SJBC 1XNQO 2HEPA 2IJIA 2A7WA 2EZPA 2EIKB 3ETQA 4X88A 4AHCA 3VOUA 2Z3YA 2ZIMA 1D5NA 3RYHB 3FB5C 4QPJA 4LF5B 1JQ0A 2ARHA 4F6RB 2NLJC 3CP1A 4NXNO 3RWRD 5EBWC 4RUEA 3HKEB 4LF8B 3FAVB 4OPAA 1R3KC 3A2FA 3K79A 3L74H 1WLEA 2B5UA 1X4TA 2ZXWC 3E8GA 3ZMVA 1FXVA 2JEXA 4LF4B 4IIJB 3H1LH 4JTDB 3KCXA 1WPBA 1K8AW 2NN4A 3ZIAG 2EIMB 2CUGA 1YJNV 3A0RA 1R3JC 2JGDA 1AVMA 3EVKA 5LGTA 3ABLB 2XAHA 2IBZH 3CS5A 4CZZA 3ZCCA 2Q4PA 4HAMA 4O2AA 1BSMA 2A06H 4DR1O 2WLIB 1S3JA 4GUNA 1V54B 4ZBMA 3CX5F 5CA0A 1EN4A 3UKMA 3RBZA 3JSNA 1VARA 5IYDO 3FKSG 2YXLA 4MSWC 3QO5A 3ZMSA 3LDCA 3OEEG 4GKJO 2JS3A 4WBNB 1SA0B 3B4SA 4KP4A 4PHZA 3KG2A 3QO8A 5GW7A 2WA4A 4BAYA 1WPXA 3MDSA 3JARA 3JCZA 2EJRA 5LGNA 2R72A 1U96A 4TUYA 1EN6A 1CP9A 3TCUA 2LW7A 2EX3A 3OD4A 1AI5A 5J9PC 1XUQA 2HJDA 1DK1A 4X65B 2B9ZA 2YIAA 5GONB 3P3PA 1WA8A 4JAUA 2VQEO 4DV4B 2UUBB 3F5WC 1UPGA 1P7BA 5L3BA 2YS8A 1YHQV 4DK1A 1V55C 4TQFA 1N32O 4PA9A 2ZIOA 2EULA 3CJHB 3FX7A 4G2KA 5J2TB 3F5TA 2QWNB 4O4JB 5FL7G 2WLIA 2FKXA 1FFTB 2GHYA 3N2GA 3KZIZ 4DV7O 1LR1A 4DR7B 5LP6B 3OTOB 3H9VA 4DV3O 3QVNA 4JYAO 5IYBO 3SJAC 4GX0A 4FLWA 1KMIZ 1LNQA 2QDOA 3J81N 1KQSU 1I08A 1SA0A 1MZFA 1BE3H 1BL8A 5CA1B 2ITCC 1GN4A 1AR4A 1VQLV 5IYCO 1YEWA 4J7ZA 4F6RA 1ZAUA 2M6YA 2QM7A 2W6JG 3ASOC 4P9PA 2K1EA 2UXBB 4D6TH 3CMEV 2RMKB 3MAQA 3JATA 3ABUA 3U11A 3JSLA 3ABKB 5CN0A 4UXNA 5JWPA 4B3SO 3ASOB 4JV5B 4DO2A 1SS3A 2DN9A 3E35A 4JI5O 3HKCA 2P22C 1N33O 1YSCA 1OCOB 4QPKA 1O9HA 5BY1A 4LF7B 3BA9A 5L3DA 1N0NA 5D5QA 1THZA 4FFBB 2WLJA 2UU9B 4NXMO 3UM7A 4UVBA 2LW1A 4JAVA 1WB7A 2YSUB 1NVPB 4AILC 1XMQO 4WFFA 1ORQC 3MHHC 5KMGA 3OFNG 2Z0AA 5GONA 3T2MA 4RUFA 3RW0A 4Z2WA 3IFXA 3CCVV 2XNDG 2OCCC 4G28B 2HHHO 4JI0O 3L71H 5DECA 5LHHA 1IBKO 1I0HA 2OIEA 1I94B 5FPOA 4CS3A 4DRXA 1Y6XA 4PDMA 3KKYA 1M56B 1NR1A 3B2EE 5EK0A 1OHHG 1XREA 4LF6O 4ASUG 1VQKV 3BFRA 4NYKA 3OMNB 1ENVA 3JAMN 3BEHA 1HNXO 3SYAA 3CCLV 3H1JH 3ZRWA 4BW9A 2UXXA 4MVQA 1RSOB 2ZXWB 3ZMTA 2RDCA 4IHJB 1H2SB 3CCSV 2P4VA 4MTOA 5IE9A 1FFXA 2HVJC 3FAVA 1H2MA 4YY3B 2RJZA 3X2QC 2P6JA 1VMGA 3W7UA 1S5LZ 3AG2C 3T1YO 1VQ6V 3K5LA 3E22A 1SQXH 4PI0A 3GB7C 2YIDA 3G4SV 4X66O 3MHSC 3T1HO 1VQ8V 4DRXB 3GVMA 4DV2B 4FJCC 5LP6A 1V9PA 2E3CA 5KHHA 1HR0O 5LYJB 2R9IA 2QKCA 5K1PA 2JGDB 3BAAA 4LF7O 5KHIA 2QWPB 3VQXA 4W4KA 4CC5A 3K5OA 1RPRA 4DXWA 1MABG 3FYIB 3L70H 5HFLA 3DGEA 1CPYA 2EINC 4J11A 3G80A 2DMXA 4GT1A 2DJVA 2GTSA 5B66Z 3ZHRA 2WLLB 2DWEC 3QTCA 3J7AU 3I56V 4B3MB 5C93A 4UCSA 3SYQA 1IBLB 2IW5A 2LGWA 3O65A 3TK1A 5L3GA 2DOSA 1M90W 4XBFA 1RFYA 1H8HG 5IJ0B 4JYBA 2QJ1A 1SQVH 3CRQA 1KBHA 1AJQA 4JI4B 5B1BB 1SQPH 2QGNA 2KKWA 4E2LA 4DR4O 2BCCH 1O9GA 1XILA 4GCZA 3AK3A 5D5PA 1KECA 4O4IA 1Q90D 2M7WA 1V55B 2Q7GA 4DV0O 3JD4A 3CC4V 1FJGB 2EZOA 5ITZA 4DV6O 1PNKA 3ABLC 2LGQA 1JMKC 1YVWA 3ABMC 2UUBO 2PYJA 4DV1O 2ZR3A 1VQ7V 3AG7A 4B3RO 3JAKB 4FLZA 4JI1B 3QNEA 1NTKH 3S3WA 1YCIA 4DUYO 5JVDA 1OV9A 1FXKC 2AGAA 1GAXA 4JI7B 3LSUA 4TUYB 4DR7O 1K33A 4OGQB 1GK9A 2GSMB 2BTQA 2F4VB 2JEUA 4X1KA 2F43G 5GTHZ 1YI2V 1N33B 3PJSK 4X9QA 5EC2C 2XHBA 3BA8A 3FYEB 4AI8A 2ZT9B 1U97A 3JD0A 4OXSA 3L73H 4O2BA 1TUBA 2UXBO 1ZUQA 2P67A 3CCJV 2ZD9A 2UXCB 2P90A 2Q9LA 5LHGA 2QTOA 1PP9H 1FXHA 2ATKC 2FYUH 1G1XB 2ZCEA 2EBOA 1IBMO 2Q73A 4AQYB 1K4CC 1Q86W 3DTUB 2HHHB 4FK5C 5F2VO 5LA6A 2P4KA 2HG5C 2YEVB 4IL6Z 4J7JA 3ETDA 5DM6V 1N36B 3CD6V 3OMAB 1NQTA 1ROPA 1JA8A 1ZTEA 4E4EA 3HKBA 4OPHA 3AG1C 1LUVA 1N34B 4NXMB 1AJNA 5JVDB 2H3OA 4I50B 1DGSA 3ZMZA 4EB6B 1EFRG 1IVSA 1H2LA 5FLXN 1GRJA 2NNUA 2IM9A 4K3AA 2W0FC 4JGSA 2RQ6A 1Q8IA 3H01A 2QE7G 1TVKA 2LFSA 1OCOC 4B3SB 1W59A 2PGGA 1WNSA 4YIOA 3RT3C 5KX5B 3E2EA 4QIWF 2CTPA 1WJZA 3H1HH 4XDKA 4J7KA 4LNUB 3P3NA 1F51A 5KUMA 3M8AA 4JI4O 3N27A 4D7TA 4X8AA 3R66A 4PA7A 1YIJV 1G6UA 1W0KG 1JJOA 3AK2A 4TV8A 2DWDC 2CK3G 1T5EA 2Q0AA 5LMNB 5CBHA 2UUCB 4YY3O 5C8YA 4MTFA 1CEZA 4UVCA 3OR6C 4BIUA 3OT7A 1KUQA 4BWAA 1NT2B 1W0JG 2ZE5A 4LF8O 1NH2D 3HR0A 1QVGU 2Q8VA 1AR1B 1XMOO 1SQGA 2L35A 3WFVA 4AQYO 3G6EV 4JI1O 1Q82W 3IGAC 4RQFA 3CHXA 4I0XA 1IURA 1NTMH 1PL0A 1I7FA 4MT8A 4CH3A 3JASA 4FZ1A 4H13B 5H2FZ 4BR6A 5B5EZ 4I55A 4RAIA 4TQDA 2OWOA 2ZDIC 1XDCA 3I55V 4JI8B 3CC2V 1Q3EA 4DV0B 2KG7A 5JQGB 4DV5O 4O4HA 4JZ2A 3ZHVA 1L8DA 4WBNA 2FL4A 1XMQB 3P30A 4DW1A 2DYSC 3BPZA 4CH6A 2IH3C 4ZI7B 3ZRVA 1VQOV 3SGIA 4KHPO 4ZKIA 3ZN0A 4LC1A 3JALA 3L72H 3RYIA 4DV1B 3A0BZ 1K5QA 5LGUA 1N36O 1QU7A 5A9GA 2K9PA 1GTOA 3UO3A 3JD3A 3LNMB 3H1KH 2JDIG 2XOKG 1B6QA 4R6ZA 4I0XB 4P9OA 2ETNA 5IJ0A 1Q5OA 2YEVA 2X0LA 4NTXA 4JI0B 1US6A 3OTFA 2L6LA 1IBKB 4Q20A 1S76D 3ZBHA 1IXBA 3CCUV 1R6NA 4B3MO 2Q0OC 2UXNA 1OCRB 5LOVA 4LFCB 1YITV 1M57C 1TA8A 2YI9A 4DUYB 2YDEA 3E86A 3RYIB 4LF9B 2DQ0A 1BZKA 3DC6A 4JI7O 2ADPA 1J5EB 2CE4A 4NTYA 4UB8Z 4YJ3B 5B3SB 5JH7A 5LMNO 4JASA 2WLKA 2WWWA 2QWOB 1OCZC 4FVMA 1B3QA 2AZ0A 1HNWO 3B8NA 3E8FA 4X1IB 5KHKA 4U3JB 3QO7A 3C3TA 2YXHA 5IYZB 1JVMA 3K58A 3T1HB 4YXWG 4LF4O 1OZ0A 1YJWV 3TGUH 1D2DA 3ZRXA 1HR0B 3OEHG 1EM1A 1NBMG 3N2KA 4CH4A 5BMVB 1NI8A 5J2TA 1S72V 4LBEC 4TOIA 4IHJA 2OCCB 2Y4UA 3HKDA 2ZM6B 5IT9N 1SKVA 4JI3B 1Y76A 1BQZA 1NVPD 2YUAA 1N34O 4G27B 1F23A 1GKFA 4FFKA 2AZ2A 3P32A 1XBLA 3WG7B 3BY6A 3DC5A 4H37A 1XL4A 2ZINA 4B3TO 5BXZA 3T4ZA 3UCSC 2G38A 5GTIZ 2JGUA 4HZ3A 4P2ZA 1SQFA 4Q6GA 2EIJB 4C7UA 4DK0A 1AB3A 4YHHO 2QWQB 2VQEB 4DV4O 5KHJA 1I94O 1Y66A 2QKAA 2WLNA 5LXTB
chains in the Genus database with same CATH topology
2P5OA 2BTOA 4B3RB 4ZIBA 5IJ0B 2QJ1A 4JI4B 1TVKB 2KKWA 1O9GA 5D5PA 3WB0A 4O4IA 3RYFA 2ZNIA 5EZYA 1B04A 2Q7GA 4X20A 4B3TB 3K5MA 5LXTA 1FJGB 4UCTA 2R70A 3RGBA 4EB6A 1HNWB 4ZOLB 3RFRA 1HW7A 5ITZA 4TV9A 1JMKC 5JCOA 4NXNB 5IYZA 4FLUA 1TUBB 2PYJA 2BTQB 4L8JA 1FFXB 3QG5A 5EYPA 4X62B 4YHHB 4FM2A 4EEQA 3JASB 4X66B 3JAKB 4FLZA 3HKCB 4JI1B 1XHXA 3K59A 5FPRA 5JVDA 1P49A 5J2UA 2QM4A 4TV9B 4TV8B 1IBMB 3RYHA 4NVPA 2VQFB 3VQVA 4JI7B 5LOVB 4FM1A 1KU9A 2PY5A 4K8ZA 4TUYB 4DR3B 3JATB 2BTQA 4ZI7A 2F4VB 5KX5A 4X1KA 1N33B 3JAKA 3SJBC 1VF7A 2HEPA 4O4HB 4LH7A 3FFQA 2XHBA 3BA8A 4UCRA 4YJ2B 5FNVA 4CS4A 3ETQA 1TUBA 4O2BA 4AHCA 4CH5A 3RYHB 2ZIMA 5CB4B 1XNQB 4LF5B 2UXCB 3N2KB 2PZSA 4I9QA 1XQ8A 4F6RB 4KHPB 5KMGB 2E5LB 3RWRD 5BR8B 5JJEB 3HKEB 5K1XA 4LF8B 2ZCEA 4X1YA 3A2FA 3K57A 1RSOA 4AQYB 1XMOB 5JH7B 1X4TA 4GKJB 3RYCB 2HHHB 4OX9B 3SR2C 5LA6A 3JALB 4LF4B 1WN7A 4IIJB 4X1IA 1N36B 4FLVA 1WPBA 2F93B 5LA6B 3ZS8C 4DV3B 3HKBA 3UT5B 4GLXA 3RYFB 4LF6B 1N34B 4NXMB 4GYCB 5JVDB 2V4DA 4I50B 3QF7A 4U3JA 1DGSA 3CB2A 4EB6B 4O2AA 5BMVA 4UFZA 2IM9A 2YI8A 5CA0A 4X1KB 2RQ6A 1Q8IA 1QQCA 4ZOLA 5EIBD 3JSNA 4JI6B 2YXLA 1TVKA 4B3SB 2PGGA 1M93A 2YIBD 1WNSA 3JAWA 3T1YB 5KX5B 4WBNB 1SA0B 4YJ3A 4X20B 4O2AB 4LNUB 1HNXB 4D7SA 4JI5B 4K0KB 1TAEA 4PHZA 4FLYA 4D7TA 1Z5WA 1G6UA 3N2GB 1JJOA 1QHTA 4TV8A 1T5EA 2Q0AA 3JARA 4EFBA 5LMNB 2R72A 4TUYA 2UUCB 5C8YA 2EX3A 4X65B 2YIAA 5GONB 4BWAA 1NT2B 2YIBA 3ICXA 4DV4B 2UUBB 3JAWB 2VWJA 4B08A 4DK1A 4I50A 3HKEA 4TQFA 2ZIOA 1SQGA 5J2TB 4DR6B 4X64B 3CHXA 4O4JB 2R9AA 1I7FA 3N2GA 4CH3A 3JASA 2JS5A 4K8XA 3LNNA 4DR7B 5LP6B 3OTOB 1HNZB 3SJAC 4I55A 4TQDA 4FLWA 1KMIZ 5KHGA 2PYLA 4DV7B 2OWOA 4DV5B 1SA0A 3M7MX 3PN1A 4JI8B 4JYAB 4HNAB 5CA1B 1Q3EA 4PI2A 5IWAB 4DV0B 1YEWA 4F6RA 5JQGB 1ZAUA 3VQYA 4O4HA 1Z5VA 1L8DA 4WBNA 5IJ9B 1JFFB 3U10A 1XMQB 5CA0B 2UXBB 4ZHQA 3BPZA 4CH6A 3ZEDA 3MAQA 3JATA 4ZI7B 4DV6B 3JSLA 3U11A 1Q43A 3SGIA 4CC6A 4YJ2A 4JV5B 3JALA 3RYIA 4DV1B 3VQWA 5JQGA 4EFEA 3HKCA 4O4IB 2P22C 5LYJA 1O9HA 4I4TA 3WB1A 4LF7B 3BA9A 5D5QA 4FFBB 2UU9B 2UUAB 4I55B 2VWKA 4DUZB 4GKKB 4FM0A 5JJNB 4AILC 1TGOA 5IJ0A 5C8YB 5EYPB 5KMGA 1Q5OA 1S5JA 4JI0B 3BRCA 5GONA 3DSQA 3OTFA 3CSXA 1IBKB 2Q7EA 3UT5A 5LMUB 1XI1A 5JJJB 1N32B 1XNRB 5LOVA 4LFCB 1I94B 5FPOA 4IIJA 4CS3A 4DRXA 2YI9A 1TA8A 4DUYB 3RYIB 4LF9B 5CB4A 3B2EE 5JCOC 4HBNA 2OYQA 1J5EB 4UCUA 5FNVB 4O4JA 4UCOA 2F66C 4YJ3B 5EZYB 3U0ZA 4BW9A 5IJ9A 4DR5B 2JVDA 5JH7A 2F95B 4DR1B 4IHJB 3SJCC 3RYCA 4FVMA 1H2SB 5LP6C 4UCVA 4HNAA 1M4UA 4X1IB 1FFXA 2F1MA 5KHKA 4U3JB 2ZNJA 5IYZB 4YY3B 2RJZA 4FFBA 1JFFA 4FLXA 3K58A 3T1HB 3K5LA 3E22A 4PI0A 1D5AA 3UQ8A 4O2BB 4O4LA 1HR0B 5J2UB 4CS2A 3N2KA 3HKBB 4KL1A 4CH4A 4DRXB 4LR3A 5BMVB 4DV2B 2CAZC 5LP6A 1V9PA 2E3CA 4O4LB 5KHHA 3THOA 5J2TA 2PTMA 5LYJB 3IAYA 5K1PA 4TOIA 4LNUA 4IHJA 3BAAA 4LFBB 5KHIA 3HKDA 2GV9A 3E22B 2ZM6B 4JI2B 3VQXA 1SKVA 4JI3B 3K5NA 4CC5A 3K5OA 3HKDB 4I4TB 1XHZA 4DR4B 2ZINA 4LFAB 2Q7HA 3BHPA 4ZHQB 4DR2B 2JGUA 5EIBC 1M5IA 1SQFA 4Q6GA 5CA1A 4LH6A 4DK0A 3QTCA 4FLTA 5ITZB 4X1YB 2UXDB 4B3MB 3JARB 3WB2A 2VQEB 5KHJA 4UCSA 5LXTB 3BABA 1IBLB 2PUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJB C;  2JS5 A;  1NT2 B;  2F66 C;  3SJA C;  1X4T A;  1SKV A;  3CSX A;  3ICX A;  3QF7 A;  3SJC C;  2CAZ C;  3QG5 A;  3B2E E;  3THO A;  3ZS8 C;  2P22 C; 
#chains in the Genus database with same CATH topology
 1HP8 A;  2E74 B;  5IY5 C;  5B1B C;  1G4Y B;  1Q81 W;  3D3Q A;  2WPD G;  5B3S C;  1TVK B;  5HFM A;  4YIP A;  5CA3 A;  3DXR A;  5EZY A;  2MW2 B;  1B04 A;  4X20 A;  5BZB A;  3B09 A;  1RPO A;  4EB6 A;  2XT9 A;  4NTW A;  1FXK B;  3CRC A;  2LP7 A;  4UV9 A;  3CXC U;  4LF5 O;  1SQB H;  5E79 Z;  2VRZ A;  2Y0P A;  4GKK O;  2UXD O;  3NR7 A;  5JCO A;  3ZX6 A;  4NXN B;  3SPI A;  4FLU A;  5KAI Z;  1TUB B;  3G71 V;  5B1O A;  2AW9 A;  3LDE A;  2A79 B;  4X62 B;  2AHY A;  4FM2 A;  1E1Q G;  3LDD A;  3S3X A;  3STZ C;  4DR6 O;  1HWY A;  1P49 A;  2GUZ B;  2IJJ A;  4TV8 B;  1IBM B;  3RYH A;  2VQF B;  3K0G A;  3VQV A;  1K92 A;  5KLV H;  4DW0 A;  1QR8 A;  1VF6 C;  2PY5 A;  4K8Z A;  1EN5 A;  4ZI7 A;  4FIP C;  1L1F A;  5KX5 A;  2EIL B;  1VF7 A;  3CWB H;  4MVS A;  4O4H B;  4LH7 A;  3FFQ A;  2CTQ A;  2HLD G;  3FB6 C;  1NU1 H;  2XAG A;  5DED A;  1OCZ B;  2ITD C;  4PA3 A;  2PZS A;  1K73 W;  4I9Q A;  1XQ8 A;  1GM7 A;  4KHP B;  1F7Y A;  5KMG B;  1K7D A;  1AIL A;  5B1A B;  1IX9 A;  5EC1 C;  1HDJ A;  1G8M A;  1KC8 W;  4KUM A;  4GKJ B;  5KUK A;  2CDY A;  3RYC B;  3E89 A;  3ABM B;  1M9N A;  2V7Q G;  3SR2 C;  1AR5 A;  3D3I A;  1WN7 A;  3VBB A;  2WSS G;  4LP8 A;  1AJP A;  4LFC O;  1VEW A;  1GN6 A;  4I9W A;  4OX9 O;  2F93 B;  5LA6 B;  4UV8 A;  4H33 A;  4J41 A;  2PI5 A;  3RYF B;  4LF6 B;  4GYC B;  1R3I C;  2H94 A;  3T1C A;  2BOC C;  3SPC A;  4U3J A;  1Q6U A;  3CJH A;  2E5L O;  2D3O W;  2GBO A;  4UFZ A;  1PNM A;  3MD0 A;  1VF6 A;  2HJF C;  1H8E G;  1R6T A;  4JPR A;  2WLM A;  5EIB D;  2CGO A;  4WFG A;  4ZOL A;  1GN3 A;  5H6Q A;  4JI6 B;  1H2K A;  1JPX A;  3BVO A;  4PA4 A;  2YIB D;  5DN6 G;  3JAW A;  3T1Y B;  1SER A;  4K35 A;  2Q68 A;  4O2A B;  3UO2 A;  1HNX B;  2Z5U A;  4D7S A;  1WP8 A;  4JI5 B;  4K0K B;  4MVR A;  2CH7 A;  3AEI A;  4FLY A;  1J5E O;  3OGI B;  2A9H A;  4I5S A;  3JD2 A;  3HPL C;  1QHT A;  3APQ A;  2WLH A;  1FKA O;  2QTS A;  4EFB A;  4J10 A;  2DQ3 A;  4IYI A;  1KP2 A;  1SET A;  4WF9 V;  2FTK A;  1H2G A;  1QLE B;  4FMT A;  1AI4 A;  2LJ2 A;  1MZE A;  2YIB A;  3ICX A;  3RVZ A;  2VWJ A;  1I5X A;  4B08 A;  2ILM A;  3IC9 A;  2X6C A;  3ZRS A;  4DV2 O;  1PL4 A;  1VQ5 V;  4DR6 B;  4X64 B;  4RWU A;  4LF9 O;  4A5U B;  1KKC A;  4GZR B;  3HB3 B;  2JS5 A;  2XAQ A;  4MVM A;  3CCR V;  4DYL A;  4J9Y B;  1HNZ B;  1A32 A;  2FB5 A;  3I5D A;  4JI8 O;  1YZB A;  2P06 A;  1E1R G;  2YC0 A;  2HVK C;  3IJ4 A;  4DV7 B;  1AP5 A;  4MVO A;  3RVY A;  4DV5 B;  3ZHU A;  2OT5 A;  2DYR B;  4JZG A;  3JCU Z;  1Z2G A;  3B77 A;  2AHZ A;  2NR5 A;  3VQY A;  1MNG A;  1Y74 A;  4MVZ A;  1Y76 B;  3H1I H;  3U10 A;  1E79 G;  4JTC B;  2RNB A;  5BR8 O;  1QNM A;  3ZED A;  4DV6 B;  1K5S A;  4QE9 A;  2YIC A;  4UB6 Z;  2ZE7 A;  1Q43 A;  1PV0 A;  3J80 N;  5A2Q N;  4XDJ A;  1SZT A;  1B06 A;  2QM8 A;  2VS0 A;  3EXA A;  5H9C A;  4EFE A;  1UFI A;  2R9R B;  5EBL C;  5LYJ A;  2B1I A;  1R6K A;  5E1A C;  1GM8 A;  2GDS A;  4JI2 O;  1OJH A;  4LWS A;  2V1D A;  4P30 A;  2VWK A;  4UVA A;  3ZHT A;  4CBC A;  4GKK B;  3JYC A;  2JJ1 G;  1M57 B;  2LO1 A;  5JJN B;  1DF5 A;  3B40 A;  5C8Y B;  5EYP B;  4ICG A;  3OW2 U;  5IWA O;  3SDL A;  1K4D C;  3CSX A;  1NS1 A;  1XEQ A;  5IY5 B;  1QVF U;  4JV5 O;  1WP7 A;  2LQT A;  1XI1 A;  2XAS A;  3OUF A;  1N32 B;  3W7W A;  1XNR B;  1GH6 A;  3W7S A;  3SYP A;  4IIJ A;  2KB1 A;  3NXS A;  4N23 A;  5CB4 A;  5JCO C;  2VQF O;  2UUA O;  1BQ0 A;  3L9D A;  5FNV B;  4XDL A;  1FYJ A;  2AXT Z;  4U7N A;  2FML A;  1VP7 A;  2F66 C;  2X6A A;  5EZY B;  3U0Z A;  3K06 A;  5IJ9 A;  2JVD A;  2GUZ A;  1N8R W;  2IH1 C;  1VQN V;  1FS0 G;  3EFF K;  2ZM6 O;  5LP6 C;  1FXK A;  1TUE B;  4UCV A;  3ETG A;  4HNA A;  2A3Q A;  4B7K A;  2F1M A;  3LSS A;  4NR1 A;  4WCE V;  3TJT A;  4N21 A;  4FFB A;  1JFF A;  4TWK A;  1QCE A;  2CGN A;  1D5A A;  3UQ8 A;  3O9O A;  3E83 A;  1BMF G;  4TSF G;  2EIL C;  3STL C;  4LR3 A;  2DW4 A;  2XAJ A;  4O4L B;  3THO A;  3K0D A;  2PTM A;  1BS3 A;  3B8M A;  3IAY A;  3ZJZ A;  4LNU A;  1PKX A;  2GV9 A;  3E22 B;  1GO3 F;  1NZ6 A;  4IYH A;  3K5N A;  4PDL A;  2EIM C;  3ABK C;  2C2A A;  1YF2 A;  3HKD B;  2YXY A;  4I4T B;  1QBZ A;  4DR4 B;  2Y0I A;  1S0V A;  5B1N A;  1KKD A;  5LL6 Y;  3L75 H;  1GM9 A;  2ZQM A;  4IGG A;  1FAF A;  4LFA B;  2Q7H A;  3BHP A;  3CXH F;  4PD4 F;  4DR2 B;  2O57 A;  5KA5 A;  4WFE A;  1IBL O;  5CA1 A;  4LH6 A;  4MW3 A;  3TXS A;  4X1Y B;  2N05 A;  3JD1 A;  1XOU A;  2UXD B;  1MMM A;  3CCE V;  2XUM A;  1Y74 B;  3BAB A;  1FD9 A;  2PUS A;  4PJ0 Z;  4MVU A;  2ZR2 A;  2BTO A;  3OM3 B;  1R1B A;  4B3R B;  1ZWI C;  3K03 A;  4R50 A;  2WA3 A;  4JYC A;  3TET A;  3CMA V;  3K3W A;  4WFA V;  1PPJ H;  1DLB A;  4DUZ O;  1MSW D;  4HYO A;  4UCT A;  4RQE A;  1OCC C;  2R70 A;  4QNH B;  3RGB A;  1NTZ H;  1HNW B;  4ZOL B;  2CH7 B;  1Y67 A;  3RFR A;  4PEL A;  2UXC O;  4TV9 A;  4JAA A;  1IXM A;  2ZE8 A;  1BCC H;  1J95 A;  3WU2 Z;  5IYZ A;  2BTQ B;  3C3S A;  2PF4 E;  4IT5 A;  2X6B A;  3QG5 A;  5EYP A;  1VQ4 V;  1F4M A;  4X66 B;  2ODM A;  3HKC B;  2IJK A;  1XHX A;  2DYS B;  5J2U A;  4TV9 B;  1RM1 B;  4PV1 B;  1BGY H;  4K0K O;  4NVP A;  2HFE C;  5LOV B;  1KU9 A;  4X89 A;  1K34 A;  3SPH A;  3OMI B;  1COW G;  4DR3 B;  3JAT B;  4LFB O;  1Y4M A;  3AG2 B;  4JI3 O;  3ZHS A;  3JAK A;  2KQX A;  2BOB C;  4UCR A;  4YJ2 B;  5FNV A;  3ABT A;  2UUC O;  1MA1 A;  2JIZ G;  4CS4 A;  1V54 C;  4WFB V;  1P4R A;  4W4L A;  3CCM V;  4CH5 A;  1YTF D;  5CB4 B;  1XNQ B;  3N2K B;  3AK1 A;  1MG1 A;  4DR2 O;  2KG7 B;  2E5L B;  5BR8 B;  5CBF A;  5JJE B;  1DTO A;  5K1X A;  4X1Y A;  3K57 A;  3CC7 V;  3FD9 A;  1RSO A;  1AP6 A;  1XMO B;  5JH7 B;  1FPO A;  4OX9 B;  2X7R B;  3JAL B;  3ML0 A;  1XNR O;  4X1I A;  2WAM A;  4FLV A;  4DR5 O;  3G67 A;  1Q6H A;  4MS2 A;  1ZL8 A;  1DF4 A;  1NH2 B;  3F7V C;  3ZS8 C;  4DV3 B;  4NKG B;  3UT5 B;  2P7T C;  4GLX A;  3CYO A;  2JJ2 G;  2ADQ B;  1RM1 C;  1PM9 A;  2Y69 C;  2JK5 C;  4H0L B;  1P7G A;  2RCV A;  2V4D A;  3QF7 A;  1WB8 A;  2JRI A;  3CB2 A;  2Q67 A;  2Y69 B;  4QJF B;  5BMV A;  3AG4 B;  4L87 A;  1JR9 A;  2YI8 A;  4I7Z B;  2QEX V;  3CEI A;  4X1K B;  1QQC A;  3LUT B;  3OE7 G;  3FB7 C;  2CTW A;  1JX9 A;  3GWK C;  1M93 A;  2QWR B;  1H2N A;  4PDV A;  1K3E A;  4YJ3 A;  4X20 B;  5H5N A;  1TAE A;  2ZE6 A;  1NR7 A;  3AG4 C;  3D8C A;  2OIG A;  3A0H Z;  1Z5W A;  1QLN A;  3N2G B;  1L0L H;  4PA6 A;  4U7O A;  1IDS A;  1NKD A;  1XL6 A;  1SRY A;  4J42 A;  1ARO P;  1X59 A;  4EKW A;  3SPG A;  1KYO F;  2OTJ V;  1H38 A;  4PDR A;  3ZRW B;  3JAW B;  3W7T A;  3CPW U;  4X64 O;  4KFM A;  4BIZ A;  1F4N A;  1W2B U;  2CTR A;  4I50 A;  3HKE A;  2B1G A;  2F23 A;  4RO2 A;  1BHB A;  3ZHQ A;  2R9A A;  1N4C A;  1BT8 A;  2W6I G;  4K8X A;  3LNN A;  2QR4 A;  1SES A;  1URF A;  4Z1V A;  4Z1M G;  4GX5 A;  5KHG A;  3IC7 A;  2PYL A;  5LHI A;  1VF5 B;  5KA6 A;  2Q5Z A;  2DYR C;  4TT3 G;  3M7M X;  3PN1 A;  1PD3 A;  4JYA B;  2F4V O;  3Q4H B;  1JCH A;  4F6E A;  1YTF B;  3M99 B;  4HNA B;  5IDJ A;  3EHB B;  3C90 A;  1S77 D;  3ZN1 A;  4PI2 A;  5IWA B;  4FZ0 A;  4JTA B;  1VQ9 V;  1Z5V A;  1EZJ A;  1JFF B;  5IJ9 B;  1YXB A;  5CA0 B;  4ZHQ A;  2IU3 A;  1MSD A;  3D36 C;  4CC6 A;  2GTA A;  3Q4H A;  4GX1 A;  4YJ2 A;  2EIK C;  3K9S A;  3VQW A;  5JQG A;  1GN2 A;  3R65 A;  4O4I B;  1K9M W;  3WB1 A;  1QR9 A;  4I4T A;  4QGP A;  1OCR C;  5CMU A;  2LFR A;  3F7Y C;  2W0X A;  1LUW A;  4B7E A;  4QE7 A;  2IJH A;  5TIS Z;  2UUA B;  1ZX3 A;  2Y4T A;  3OAA G;  4I55 B;  1M56 C;  1SQQ H;  5H6R A;  4DUZ B;  4FM0 A;  1S5H C;  3T4D A;  1ZL8 B;  1TGO A;  1R3L C;  2DE0 X;  1SC5 B;  1S5J A;  1R73 A;  3BRC A;  3DSQ A;  5KAF Z;  1CXZ B;  2Q7E A;  2A0L A;  3UT5 A;  5LMU B;  4LCU C;  1EBO A;  5JJJ B;  3E8H A;  2QSA A;  2N04 A;  1GMG A;  3ZMU A;  4JYY A;  4MTX A;  2KSD A;  1AI7 A;  4H44 B;  2XAF A;  1UJW B;  1M1K W;  4LWS B;  2QA4 V;  4HBN A;  5AG2 A;  2OYQ A;  4UCU A;  3SJQ C;  1PNL A;  4MW8 A;  5L3E A;  1SZX A;  4O4J A;  4UCO A;  3W7X A;  2UU9 O;  4DR5 B;  2E76 B;  2F95 B;  4DR1 B;  1KD1 W;  1JJ2 U;  3SJC C;  3RYC A;  5CBG A;  1ZSP A;  1AI6 A;  1M4U A;  1BHA A;  3SYC A;  3KCY A;  1P84 F;  2ZNJ A;  3RN4 A;  2BSK A;  4R8C A;  2EIJ C;  4BIO A;  5L3F A;  4FLX A;  3OGC C;  1YJ9 V;  4X65 O;  4X62 O;  2OCH A;  4O2B B;  4O4L A;  1IZ3 A;  4U3F H;  2Y48 A;  4KXR A;  3K04 A;  4MTG A;  5J2U B;  2MK3 A;  4CS2 A;  3HKB B;  4KL1 A;  3CE2 A;  4J9Z B;  3SPJ A;  2CAZ C;  3ASN C;  4LFB B;  2N74 A;  5EBM C;  4JI2 B;  5B1A C;  1SF9 A;  3A8T A;  3DXR B;  2ZKO A;  3SYO A;  1VIB A;  3AG1 B;  1YDX A;  4FPP A;  4LFA O;  3CRM A;  3OTO O;  4ABM A;  1L0N H;  1XHZ A;  2EJ7 A;  2PI4 A;  3LSQ A;  2RN9 A;  3TXQ A;  3CRA A;  3FB8 C;  4JI6 O;  1WAZ A;  4ZHQ B;  2E75 B;  2QKS A;  4R7C A;  2Q69 A;  2EIN B;  1Q6I A;  5EIB C;  5LBQ A;  1M5I A;  3K08 A;  3BCC H;  1I5Y A;  4FLT A;  3OR7 C;  3K9A A;  5ITZ B;  1QLE C;  3AG3 C;  3JAR B;  3WB2 A;  1MOF A;  1VQP V;  2P5O A;  2H8P C;  3APO A;  1VQM V;  1RP3 B;  4ZIB A;  3ETE A;  4GX2 A;  2XTA A;  3WB0 A;  3GWO A;  3RYF A;  2ZNI A;  2D2C B;  1WA8 B;  4B3T B;  1HNZ O;  3K5M A;  5LXT A;  2OTL V;  4DR3 O;  4F4L A;  3G6B A;  1NJI W;  4WFH A;  2WLL A;  3WG7 C;  3X2Q B;  1HW7 A;  3E8B A;  1KP3 A;  2BSK B;  2ZDI A;  3CCQ V;  3D36 A;  5LMU O;  1JOY A;  2IU0 A;  4L8J A;  2HP8 A;  1FFX B;  2HKO A;  3ASN B;  4YHH B;  4EEQ A;  3JAS B;  1ZLZ A;  1EZV H;  2Q6A A;  1KB9 F;  4BW5 A;  3K59 A;  5FPR A;  5L3C A;  3OUS A;  1N0J A;  4UUJ C;  2QM4 A;  1Q7Y W;  4FM1 A;  3CRR A;  1OCC B;  1K97 A;  4J80 A;  3AG3 B;  2BE3 A;  1FJG O;  4NB5 A;  4JF3 A;  2HR3 A;  3SJB C;  1XNQ O;  2HEP A;  2IJI A;  2A7W A;  2EZP A;  2EIK B;  3ETQ A;  4X88 A;  4AHC A;  3VOU A;  2Z3Y A;  2ZIM A;  1D5N A;  3RYH B;  3FB5 C;  4QPJ A;  4LF5 B;  1JQ0 A;  2ARH A;  4F6R B;  2NLJ C;  3CP1 A;  4NXN O;  3RWR D;  5EBW C;  4RUE A;  3HKE B;  4LF8 B;  3FAV B;  4OPA A;  1R3K C;  3A2F A;  3K79 A;  3L74 H;  1WLE A;  2B5U A;  1X4T A;  2ZXW C;  3E8G A;  3ZMV A;  1FXV A;  2JEX A;  4LF4 B;  4IIJ B;  3H1L H;  4JTD B;  3KCX A;  1WPB A;  1K8A W;  2NN4 A;  3ZIA G;  2EIM B;  2CUG A;  1YJN V;  3A0R A;  1R3J C;  2JGD A;  1AVM A;  3EVK A;  5LGT A;  3ABL B;  2XAH A;  2IBZ H;  3CS5 A;  4CZZ A;  3ZCC A;  2Q4P A;  4HAM A;  4O2A A;  1BSM A;  2A06 H;  4DR1 O;  2WLI B;  1S3J A;  4GUN A;  1V54 B;  4ZBM A;  3CX5 F;  5CA0 A;  1EN4 A;  3UKM A;  3RBZ A;  3JSN A;  1VAR A;  5IYD O;  3FKS G;  2YXL A;  4MSW C;  3QO5 A;  3ZMS A;  3LDC A;  3OEE G;  4GKJ O;  2JS3 A;  4WBN B;  1SA0 B;  3B4S A;  4KP4 A;  4PHZ A;  3KG2 A;  3QO8 A;  5GW7 A;  2WA4 A;  4BAY A;  1WPX A;  3MDS A;  3JAR A;  3JCZ A;  2EJR A;  5LGN A;  2R72 A;  1U96 A;  4TUY A;  1EN6 A;  1CP9 A;  3TCU A;  2LW7 A;  2EX3 A;  3OD4 A;  1AI5 A;  5J9P C;  1XUQ A;  2HJD A;  1DK1 A;  4X65 B;  2B9Z A;  2YIA A;  5GON B;  3P3P A;  1WA8 A;  4JAU A;  2VQE O;  4DV4 B;  2UUB B;  3F5W C;  1UPG A;  1P7B A;  5L3B A;  2YS8 A;  1YHQ V;  4DK1 A;  1V55 C;  4TQF A;  1N32 O;  4PA9 A;  2ZIO A;  2EUL A;  3CJH B;  3FX7 A;  4G2K A;  5J2T B;  3F5T A;  2QWN B;  4O4J B;  5FL7 G;  2WLI A;  2FKX A;  1FFT B;  2GHY A;  3N2G A;  3KZI Z;  4DV7 O;  1LR1 A;  4DR7 B;  5LP6 B;  3OTO B;  3H9V A;  4DV3 O;  3QVN A;  4JYA O;  5IYB O;  3SJA C;  4GX0 A;  4FLW A;  1KMI Z;  1LNQ A;  2QDO A;  3J81 N;  1KQS U;  1I08 A;  1SA0 A;  1MZF A;  1BE3 H;  1BL8 A;  5CA1 B;  2ITC C;  1GN4 A;  1AR4 A;  1VQL V;  5IYC O;  1YEW A;  4J7Z A;  4F6R A;  1ZAU A;  2M6Y A;  2QM7 A;  2W6J G;  3ASO C;  4P9P A;  2K1E A;  2UXB B;  4D6T H;  3CME V;  2RMK B;  3MAQ A;  3JAT A;  3ABU A;  3U11 A;  3JSL A;  3ABK B;  5CN0 A;  4UXN A;  5JWP A;  4B3S O;  3ASO B;  4JV5 B;  4DO2 A;  1SS3 A;  2DN9 A;  3E35 A;  4JI5 O;  3HKC A;  2P22 C;  1N33 O;  1YSC A;  1OCO B;  4QPK A;  1O9H A;  5BY1 A;  4LF7 B;  3BA9 A;  5L3D A;  1N0N A;  5D5Q A;  1THZ A;  4FFB B;  2WLJ A;  2UU9 B;  4NXM O;  3UM7 A;  4UVB A;  2LW1 A;  4JAV A;  1WB7 A;  2YSU B;  1NVP B;  4AIL C;  1XMQ O;  4WFF A;  1ORQ C;  3MHH C;  5KMG A;  3OFN G;  2Z0A A;  5GON A;  3T2M A;  4RUF A;  3RW0 A;  4Z2W A;  3IFX A;  3CCV V;  2XND G;  2OCC C;  4G28 B;  2HHH O;  4JI0 O;  3L71 H;  5DEC A;  5LHH A;  1IBK O;  1I0H A;  2OIE A;  1I94 B;  5FPO A;  4CS3 A;  4DRX A;  1Y6X A;  4PDM A;  3KKY A;  1M56 B;  1NR1 A;  3B2E E;  5EK0 A;  1OHH G;  1XRE A;  4LF6 O;  4ASU G;  1VQK V;  3BFR A;  4NYK A;  3OMN B;  1ENV A;  3JAM N;  3BEH A;  1HNX O;  3SYA A;  3CCL V;  3H1J H;  3ZRW A;  4BW9 A;  2UXX A;  4MVQ A;  1RSO B;  2ZXW B;  3ZMT A;  2RDC A;  4IHJ B;  1H2S B;  3CCS V;  2P4V A;  4MTO A;  5IE9 A;  1FFX A;  2HVJ C;  3FAV A;  1H2M A;  4YY3 B;  2RJZ A;  3X2Q C;  2P6J A;  1VMG A;  3W7U A;  1S5L Z;  3AG2 C;  3T1Y O;  1VQ6 V;  3K5L A;  3E22 A;  1SQX H;  4PI0 A;  3GB7 C;  2YID A;  3G4S V;  4X66 O;  3MHS C;  3T1H O;  1VQ8 V;  4DRX B;  3GVM A;  4DV2 B;  4FJC C;  5LP6 A;  1V9P A;  2E3C A;  5KHH A;  1HR0 O;  5LYJ B;  2R9I A;  2QKC A;  5K1P A;  2JGD B;  3BAA A;  4LF7 O;  5KHI A;  2QWP B;  3VQX A;  4W4K A;  4CC5 A;  3K5O A;  1RPR A;  4DXW A;  1MAB G;  3FYI B;  3L70 H;  5HFL A;  3DGE A;  1CPY A;  2EIN C;  4J11 A;  3G80 A;  2DMX A;  4GT1 A;  2DJV A;  2GTS A;  5B66 Z;  3ZHR A;  2WLL B;  2DWE C;  3QTC A;  3J7A U;  3I56 V;  4B3M B;  5C93 A;  4UCS A;  3SYQ A;  1IBL B;  2IW5 A;  2LGW A;  3O65 A;  3TK1 A;  5L3G A;  2DOS A;  1M90 W;  4XBF A;  1RFY A;  1H8H G;  5IJ0 B;  4JYB A;  2QJ1 A;  1SQV H;  3CRQ A;  1KBH A;  1AJQ A;  4JI4 B;  5B1B B;  1SQP H;  2QGN A;  2KKW A;  4E2L A;  4DR4 O;  2BCC H;  1O9G A;  1XIL A;  4GCZ A;  3AK3 A;  5D5P A;  1KEC A;  4O4I A;  1Q90 D;  2M7W A;  1V55 B;  2Q7G A;  4DV0 O;  3JD4 A;  3CC4 V;  1FJG B;  2EZO A;  5ITZ A;  4DV6 O;  1PNK A;  3ABL C;  2LGQ A;  1JMK C;  1YVW A;  3ABM C;  2UUB O;  2PYJ A;  4DV1 O;  2ZR3 A;  1VQ7 V;  3AG7 A;  4B3R O;  3JAK B;  4FLZ A;  4JI1 B;  3QNE A;  1NTK H;  3S3W A;  1YCI A;  4DUY O;  5JVD A;  1OV9 A;  1FXK C;  2AGA A;  1GAX A;  4JI7 B;  3LSU A;  4TUY B;  4DR7 O;  1K33 A;  4OGQ B;  1GK9 A;  2GSM B;  2BTQ A;  2F4V B;  2JEU A;  4X1K A;  2F43 G;  5GTH Z;  1YI2 V;  1N33 B;  3PJS K;  4X9Q A;  5EC2 C;  2XHB A;  3BA8 A;  3FYE B;  4AI8 A;  2ZT9 B;  1U97 A;  3JD0 A;  4OXS A;  3L73 H;  4O2B A;  1TUB A;  2UXB O;  1ZUQ A;  2P67 A;  3CCJ V;  2ZD9 A;  2UXC B;  2P90 A;  2Q9L A;  5LHG A;  2QTO A;  1PP9 H;  1FXH A;  2ATK C;  2FYU H;  1G1X B;  2ZCE A;  2EBO A;  1IBM O;  2Q73 A;  4AQY B;  1K4C C;  1Q86 W;  3DTU B;  2HHH B;  4FK5 C;  5F2V O;  5LA6 A;  2P4K A;  2HG5 C;  2YEV B;  4IL6 Z;  4J7J A;  3ETD A;  5DM6 V;  1N36 B;  3CD6 V;  3OMA B;  1NQT A;  1ROP A;  1JA8 A;  1ZTE A;  4E4E A;  3HKB A;  4OPH A;  3AG1 C;  1LUV A;  1N34 B;  4NXM B;  1AJN A;  5JVD B;  2H3O A;  4I50 B;  1DGS A;  3ZMZ A;  4EB6 B;  1EFR G;  1IVS A;  1H2L A;  5FLX N;  1GRJ A;  2NNU A;  2IM9 A;  4K3A A;  2W0F C;  4JGS A;  2RQ6 A;  1Q8I A;  3H01 A;  2QE7 G;  1TVK A;  2LFS A;  1OCO C;  4B3S B;  1W59 A;  2PGG A;  1WNS A;  4YIO A;  3RT3 C;  5KX5 B;  3E2E A;  4QIW F;  2CTP A;  1WJZ A;  3H1H H;  4XDK A;  4J7K A;  4LNU B;  3P3N A;  1F51 A;  5KUM A;  3M8A A;  4JI4 O;  3N27 A;  4D7T A;  4X8A A;  3R66 A;  4PA7 A;  1YIJ V;  1G6U A;  1W0K G;  1JJO A;  3AK2 A;  4TV8 A;  2DWD C;  2CK3 G;  1T5E A;  2Q0A A;  5LMN B;  5CBH A;  2UUC B;  4YY3 O;  5C8Y A;  4MTF A;  1CEZ A;  4UVC A;  3OR6 C;  4BIU A;  3OT7 A;  1KUQ A;  4BWA A;  1NT2 B;  1W0J G;  2ZE5 A;  4LF8 O;  1NH2 D;  3HR0 A;  1QVG U;  2Q8V A;  1AR1 B;  1XMO O;  1SQG A;  2L35 A;  3WFV A;  4AQY O;  3G6E V;  4JI1 O;  1Q82 W;  3IGA C;  4RQF A;  3CHX A;  4I0X A;  1IUR A;  1NTM H;  1PL0 A;  1I7F A;  4MT8 A;  4CH3 A;  3JAS A;  4FZ1 A;  4H13 B;  5H2F Z;  4BR6 A;  5B5E Z;  4I55 A;  4RAI A;  4TQD A;  2OWO A;  2ZDI C;  1XDC A;  3I55 V;  4JI8 B;  3CC2 V;  1Q3E A;  4DV0 B;  2KG7 A;  5JQG B;  4DV5 O;  4O4H A;  4JZ2 A;  3ZHV A;  1L8D A;  4WBN A;  2FL4 A;  1XMQ B;  3P30 A;  4DW1 A;  2DYS C;  3BPZ A;  4CH6 A;  2IH3 C;  4ZI7 B;  3ZRV A;  1VQO V;  3SGI A;  4KHP O;  4ZKI A;  3ZN0 A;  4LC1 A;  3JAL A;  3L72 H;  3RYI A;  4DV1 B;  3A0B Z;  1K5Q A;  5LGU A;  1N36 O;  1QU7 A;  5A9G A;  2K9P A;  1GTO A;  3UO3 A;  3JD3 A;  3LNM B;  3H1K H;  2JDI G;  2XOK G;  1B6Q A;  4R6Z A;  4I0X B;  4P9O A;  2ETN A;  5IJ0 A;  1Q5O A;  2YEV A;  2X0L A;  4NTX A;  4JI0 B;  1US6 A;  3OTF A;  2L6L A;  1IBK B;  4Q20 A;  1S76 D;  3ZBH A;  1IXB A;  3CCU V;  1R6N A;  4B3M O;  2Q0O C;  2UXN A;  1OCR B;  5LOV A;  4LFC B;  1YIT V;  1M57 C;  1TA8 A;  2YI9 A;  4DUY B;  2YDE A;  3E86 A;  3RYI B;  4LF9 B;  2DQ0 A;  1BZK A;  3DC6 A;  4JI7 O;  2ADP A;  1J5E B;  2CE4 A;  4NTY A;  4UB8 Z;  4YJ3 B;  5B3S B;  5JH7 A;  5LMN O;  4JAS A;  2WLK A;  2WWW A;  2QWO B;  1OCZ C;  4FVM A;  1B3Q A;  2AZ0 A;  1HNW O;  3B8N A;  3E8F A;  4X1I B;  5KHK A;  4U3J B;  3QO7 A;  3C3T A;  2YXH A;  5IYZ B;  1JVM A;  3K58 A;  3T1H B;  4YXW G;  4LF4 O;  1OZ0 A;  1YJW V;  3TGU H;  1D2D A;  3ZRX A;  1HR0 B;  3OEH G;  1EM1 A;  1NBM G;  3N2K A;  4CH4 A;  5BMV B;  1NI8 A;  5J2T A;  1S72 V;  4LBE C;  4TOI A;  4IHJ A;  2OCC B;  2Y4U A;  3HKD A;  2ZM6 B;  5IT9 N;  1SKV A;  4JI3 B;  1Y76 A;  1BQZ A;  1NVP D;  2YUA A;  1N34 O;  4G27 B;  1F23 A;  1GKF A;  4FFK A;  2AZ2 A;  3P32 A;  1XBL A;  3WG7 B;  3BY6 A;  3DC5 A;  4H37 A;  1XL4 A;  2ZIN A;  4B3T O;  5BXZ A;  3T4Z A;  3UCS C;  2G38 A;  5GTI Z;  2JGU A;  4HZ3 A;  4P2Z A;  1SQF A;  4Q6G A;  2EIJ B;  4C7U A;  4DK0 A;  1AB3 A;  4YHH O;  2QWQ B;  2VQE B;  4DV4 O;  5KHJ A;  1I94 O;  1Y66 A;  2QKA A;  2WLN A;  5LXT B; 
#chains in the Genus database with same CATH homology
 2P5O A;  2BTO A;  4B3R B;  4ZIB A;  5IJ0 B;  2QJ1 A;  4JI4 B;  1TVK B;  2KKW A;  1O9G A;  5D5P A;  3WB0 A;  4O4I A;  3RYF A;  2ZNI A;  5EZY A;  1B04 A;  2Q7G A;  4X20 A;  4B3T B;  3K5M A;  5LXT A;  1FJG B;  4UCT A;  2R70 A;  3RGB A;  4EB6 A;  1HNW B;  4ZOL B;  3RFR A;  1HW7 A;  5ITZ A;  4TV9 A;  1JMK C;  5JCO A;  4NXN B;  5IYZ A;  4FLU A;  1TUB B;  2PYJ A;  2BTQ B;  4L8J A;  1FFX B;  3QG5 A;  5EYP A;  4X62 B;  4YHH B;  4FM2 A;  4EEQ A;  3JAS B;  4X66 B;  3JAK B;  4FLZ A;  3HKC B;  4JI1 B;  1XHX A;  3K59 A;  5FPR A;  5JVD A;  1P49 A;  5J2U A;  2QM4 A;  4TV9 B;  4TV8 B;  1IBM B;  3RYH A;  4NVP A;  2VQF B;  3VQV A;  4JI7 B;  5LOV B;  4FM1 A;  1KU9 A;  2PY5 A;  4K8Z A;  4TUY B;  4DR3 B;  3JAT B;  2BTQ A;  4ZI7 A;  2F4V B;  5KX5 A;  4X1K A;  1N33 B;  3JAK A;  3SJB C;  1VF7 A;  2HEP A;  4O4H B;  4LH7 A;  3FFQ A;  2XHB A;  3BA8 A;  4UCR A;  4YJ2 B;  5FNV A;  4CS4 A;  3ETQ A;  1TUB A;  4O2B A;  4AHC A;  4CH5 A;  3RYH B;  2ZIM A;  5CB4 B;  1XNQ B;  4LF5 B;  2UXC B;  3N2K B;  2PZS A;  4I9Q A;  1XQ8 A;  4F6R B;  4KHP B;  5KMG B;  2E5L B;  3RWR D;  5BR8 B;  5JJE B;  3HKE B;  5K1X A;  4LF8 B;  2ZCE A;  4X1Y A;  3A2F A;  3K57 A;  1RSO A;  4AQY B;  1XMO B;  5JH7 B;  1X4T A;  4GKJ B;  3RYC B;  2HHH B;  4OX9 B;  3SR2 C;  5LA6 A;  3JAL B;  4LF4 B;  1WN7 A;  4IIJ B;  4X1I A;  1N36 B;  4FLV A;  1WPB A;  2F93 B;  5LA6 B;  3ZS8 C;  4DV3 B;  3HKB A;  3UT5 B;  4GLX A;  3RYF B;  4LF6 B;  1N34 B;  4NXM B;  4GYC B;  5JVD B;  2V4D A;  4I50 B;  3QF7 A;  4U3J A;  1DGS A;  3CB2 A;  4EB6 B;  4O2A A;  5BMV A;  4UFZ A;  2IM9 A;  2YI8 A;  5CA0 A;  4X1K B;  2RQ6 A;  1Q8I A;  1QQC A;  4ZOL A;  5EIB D;  3JSN A;  4JI6 B;  2YXL A;  1TVK A;  4B3S B;  2PGG A;  1M93 A;  2YIB D;  1WNS A;  3JAW A;  3T1Y B;  5KX5 B;  4WBN B;  1SA0 B;  4YJ3 A;  4X20 B;  4O2A B;  4LNU B;  1HNX B;  4D7S A;  4JI5 B;  4K0K B;  1TAE A;  4PHZ A;  4FLY A;  4D7T A;  1Z5W A;  1G6U A;  3N2G B;  1JJO A;  1QHT A;  4TV8 A;  1T5E A;  2Q0A A;  3JAR A;  4EFB A;  5LMN B;  2R72 A;  4TUY A;  2UUC B;  5C8Y A;  2EX3 A;  4X65 B;  2YIA A;  5GON B;  4BWA A;  1NT2 B;  2YIB A;  3ICX A;  4DV4 B;  2UUB B;  3JAW B;  2VWJ A;  4B08 A;  4DK1 A;  4I50 A;  3HKE A;  4TQF A;  2ZIO A;  1SQG A;  5J2T B;  4DR6 B;  4X64 B;  3CHX A;  4O4J B;  2R9A A;  1I7F A;  3N2G A;  4CH3 A;  3JAS A;  2JS5 A;  4K8X A;  3LNN A;  4DR7 B;  5LP6 B;  3OTO B;  1HNZ B;  3SJA C;  4I55 A;  4TQD A;  4FLW A;  1KMI Z;  5KHG A;  2PYL A;  4DV7 B;  2OWO A;  4DV5 B;  1SA0 A;  3M7M X;  3PN1 A;  4JI8 B;  4JYA B;  4HNA B;  5CA1 B;  1Q3E A;  4PI2 A;  5IWA B;  4DV0 B;  1YEW A;  4F6R A;  5JQG B;  1ZAU A;  3VQY A;  4O4H A;  1Z5V A;  1L8D A;  4WBN A;  5IJ9 B;  1JFF B;  3U10 A;  1XMQ B;  5CA0 B;  2UXB B;  4ZHQ A;  3BPZ A;  4CH6 A;  3ZED A;  3MAQ A;  3JAT A;  4ZI7 B;  4DV6 B;  3JSL A;  3U11 A;  1Q43 A;  3SGI A;  4CC6 A;  4YJ2 A;  4JV5 B;  3JAL A;  3RYI A;  4DV1 B;  3VQW A;  5JQG A;  4EFE A;  3HKC A;  4O4I B;  2P22 C;  5LYJ A;  1O9H A;  4I4T A;  3WB1 A;  4LF7 B;  3BA9 A;  5D5Q A;  4FFB B;  2UU9 B;  2UUA B;  4I55 B;  2VWK A;  4DUZ B;  4GKK B;  4FM0 A;  5JJN B;  4AIL C;  1TGO A;  5IJ0 A;  5C8Y B;  5EYP B;  5KMG A;  1Q5O A;  1S5J A;  4JI0 B;  3BRC A;  5GON A;  3DSQ A;  3OTF A;  3CSX A;  1IBK B;  2Q7E A;  3UT5 A;  5LMU B;  1XI1 A;  5JJJ B;  1N32 B;  1XNR B;  5LOV A;  4LFC B;  1I94 B;  5FPO A;  4IIJ A;  4CS3 A;  4DRX A;  2YI9 A;  1TA8 A;  4DUY B;  3RYI B;  4LF9 B;  5CB4 A;  3B2E E;  5JCO C;  4HBN A;  2OYQ A;  1J5E B;  4UCU A;  5FNV B;  4O4J A;  4UCO A;  2F66 C;  4YJ3 B;  5EZY B;  3U0Z A;  4BW9 A;  5IJ9 A;  4DR5 B;  2JVD A;  5JH7 A;  2F95 B;  4DR1 B;  4IHJ B;  3SJC C;  3RYC A;  4FVM A;  1H2S B;  5LP6 C;  4UCV A;  4HNA A;  1M4U A;  4X1I B;  1FFX A;  2F1M A;  5KHK A;  4U3J B;  2ZNJ A;  5IYZ B;  4YY3 B;  2RJZ A;  4FFB A;  1JFF A;  4FLX A;  3K58 A;  3T1H B;  3K5L A;  3E22 A;  4PI0 A;  1D5A A;  3UQ8 A;  4O2B B;  4O4L A;  1HR0 B;  5J2U B;  4CS2 A;  3N2K A;  3HKB B;  4KL1 A;  4CH4 A;  4DRX B;  4LR3 A;  5BMV B;  4DV2 B;  2CAZ C;  5LP6 A;  1V9P A;  2E3C A;  4O4L B;  5KHH A;  3THO A;  5J2T A;  2PTM A;  5LYJ B;  3IAY A;  5K1P A;  4TOI A;  4LNU A;  4IHJ A;  3BAA A;  4LFB B;  5KHI A;  3HKD A;  2GV9 A;  3E22 B;  2ZM6 B;  4JI2 B;  3VQX A;  1SKV A;  4JI3 B;  3K5N A;  4CC5 A;  3K5O A;  3HKD B;  4I4T B;  1XHZ A;  4DR4 B;  2ZIN A;  4LFA B;  2Q7H A;  3BHP A;  4ZHQ B;  4DR2 B;  2JGU A;  5EIB C;  1M5I A;  1SQF A;  4Q6G A;  5CA1 A;  4LH6 A;  4DK0 A;  3QTC A;  4FLT A;  5ITZ B;  4X1Y B;  2UXD B;  4B3M B;  3JAR B;  3WB2 A;  2VQE B;  5KHJ A;  4UCS A;  5LXT B;  3BAB A;  1IBL B;  2PUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...