2JS5A

Nmr structure of protein q60c73_metca. northeast structural genomics consortium target mcr1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTASLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR Structure of protein Q60C73_METCA.
rcsb
source organism Methylococcus capsulatus
molecule tags Structural genomics, unknown function
total genus 28
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05082 Rop-like Rop-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2js5A00
2F66C 1NT2B 3ZS8C 3B2EE 3QG5A 2JS5A 2CAZC 3THOA 3CSXA 3SJBC 2P22C 3SJAC 3SJCC 3ICXA 3QF7A 1X4TA 1SKVA
chains in the Genus database with same CATH superfamily
2VWJA 3AG2C 2Z0AA 4ZOLB 3T4ZA 4YJ3A 4O4LB 4GCZA 1WPXA 5FPOA 3P32A 1GMGA 2GBOA 5J9PC 2CAZC 4LFAO 1SQPH 4RUEA 3VQXA 2EZPA 4X1KA 2UXCB 3K5OA 4ICGA 4EEQA 5J2TA 2Y0PA 5IDJA 1VQLV 3ZRSA 1K8AW 3I56V 3RYHB 3LNNA 1G1XB 4PA4A 1KC8W 3LDEA 2UUAB 1M5IA 1TAEA 3ZHSA 4JI1B 1ZL8A 3L74H 4JGSA 4DV6B 4BW9A 4LF4B 1VQKV 1EN5A 3H1HH 1I5YA 2HFEC 1N32B 1EZJA 3SYPA 1FFXB 5L3CA 4UV8A 1XBLA 4DV1O 4OX9O 1FAFA 4PDLA 4CH3A 1YTFB 3ETGA 2X0LA 3CB2A 4X1IB 5LYJA 5GTHZ 4FFBB 3HR0A 4LWSA 4R7CA 5EBMC 4I7ZB 4X20B 2V1DA 1P84F 3HPLC 5L3FA 4E2LA 3SYCA 5BXZA 1WLEA 3JAWA 3AG1C 1HR0B 4IGGA 5C93A 3FB8C 4FZ1A 1GO3F 3CRQA 2E5LB 1QLNA 1IBLB 2CE4A 1Y76A 1U97A 3CMEV 3E89A 4FLTA 2UUCB 1HNWB 2RQ6A 3N2KB 1SA0B 4P2ZA 1D5AA 3CCRV 2CH7B 4UCTA 3ZN0A 4X88A 1Y66A 2BOCC 2MW2B 1KKDA 5KA5A 3JCUZ 5JVDA 3F7VC 3B2EE 4X66O 2PI5A 2YXHA 2LO1A 5IYCO 1AR5A 5FNVB 2ZXWB 3DXRA 1VF6C 1E1QG 4HNAA 3G6EV 3CE2A 1F51A 4O2BA 3CC4V 3ZHTA 1IBMB 4GX1A 3QO7A 2Q67A 3CCJV 5B1AB 1SRYA 4P9PA 3CCLV 4TUYA 1Z5VA 2Q4PA 1FJGO 4X8AA 3A0RA 2EJ7A 5L3BA 1VQPV 2ZDIA 3JSLA 1NVPB 1EBOA 2WLLB 3KCYA 1PM9A 1WP7A 1ZSPA 3JASB 4WFFA 1I08A 3H9VA 4KL1A 1VQ7V 4DV3O 3FYEB 2QWNB 1R3JC 5H9CA 5IJ0B 3ASNC 4JAUA 4J80A 3JALA 2DN9A 3KCXA 1WB7A 2ZD9A 3OMNB 3RBZA 3DSQA 1VEWA 4DR5B 1S3JA 2K1EA 4L8JA 1H2GA 5J2UB 2XAHA 3RVYA 4B3RB 2JS5A 1JMKC 2ILMA 2HKOA 3OEEG 2RN9A 4UFZA 5LGNA 3UQ8A 2K9PA 4LF7O 1N4CA 2M7WA 2UXXA 1XEQA 1OCRB 2DQ0A 3CXHF 1AI6A 2QA4V 1CXZB 1OCCC 3LSSA 1H8EG 3MDSA 4UXNA 1R6KA 2Q9LA 2ZR2A 4I50A 3E83A 3UO3A 1WJZA 1ZLZA 1RFYA 3OFNG 3CJHB 2QTSA 3WB2A 4RUFA 3G6BA 3RN4A 4OX9B 2BCCH 2IJIA 1WNSA 4ABMA 1F7YA 1D5NA 4ZHQB 5GONB 2NNUA 4J9ZB 1GN2A 3OMIB 3OTOB 4U7NA 2EBOA 3ZRWA 3L70H 2FYUH 3G67A 2ITDC 4DW1A 3ZRXA 3G71V 4JI2O 4Z1VA 4FM2A 4QNHB 4W4LA 3B77A 1W59A 4G28B 2VQFO 3JAKA 2PUSA 4LNUB 4DV2B 1KB9F 1H2NA 3HKBB 3OT7A 3ZEDA 1FPOA 2RNBA 5EZYA 3BAAA 3NXSA 5LMUB 2YDEA 2O57A 2ZCEA 3X2QB 2IU0A 3S3WA 2R9RB 2D3OW 4LWSB 2QWOB 1OJHA 1GM9A 1VF5B 1V54C 1Q8IA 3ZHVA 5IJ9A 1N34O 2W0FC 4D7TA 4EB6B 4UVCA 2OT5A 3CX5F 4DV7B 1XMQO 4FLVA 1VQ5V 3HKEB 1PP9H 3CWBH 5IWAB 4WCEV 3ZIAG 2DMXA 4NTWA 4LF8O 4DR1O 1GKFA 1YJ9V 3ASNB 2R70A 1X59A 1SKVA 4TOIA 3BHPA 2YXLA 3W7XA 4GKKB 1WP8A 4HZ3A 4QE9A 4DV3B 4B3SO 1AROP 1RPOA 4TWKA 3UM7A 4JYBA 4YXWG 5LA6A 3E35A 2IJKA 3OM3B 1XHZA 1S5JA 2EINC 2RJZA 1KU9A 5IE9A 3DXRB 4RWUA 4PELA 1YJWV 2QDOA 2BE3A 1Q6UA 2HR3A 1FS0G 2KG7A 4J7KA 5JQGB 4K0KO 1B6QA 4CZZA 4DV0O 1JPXA 4FK5C 4H44B 4QGPA 4YJ2A 3ABKC 1S5LZ 3APOA 1RSOA 1OCCB 3D36C 2Y4TA 3AG4C 1I0HA 4MTXA 2OTJV 1YJNV 2ZE8A 3RYIB 5L3EA 2Q73A 2W6IG 2ZE6A 3FB6C 3O9OA 2IU3A 1S76D 4EKWA 3E22B 3AEIA 2AXTZ 3N27A 2VS0A 1MSWD 2CTRA 1QVFU 1MZEA 3CYOA 5IYDO 1AILA 4FLZA 4JI5B 2UXCO 3HKDA 5A9GA 3FAVB 3JATB 1PNLA 1H2MA 4B7KA 3F7YC 2Q69A 5F2VO 2VWKA 1JFFB 2WLJA 4U3JB 5KMGA 2UUAO 5E79Z 2YIBA 4FLUA 4JI1O 2L35A 2OIGA 2H94A 5CBHA 5EIBC 3STLC 4AI8A 1LUWA 2F93B 4DV6O 4LF4O 5LGTA 3DC5A 1I5XA 1N32O 2YSUB 1NH2B 3PN1A 1BSMA 3RVZA 5C8YA 4NR1A 5HFLA 3EVKA 3LDCA 3KZIZ 1T5EA 1WAZA 3AK2A 4KUMA 5IY5C 4DUYB 2Q7HA 1ZUQA 1QVGU 1H38A 1V54B 3FD9A 2JK5C 1SQGA 1GM7A 4UV9A 3TGUH 2Y0IA 3CCMV 2UXBB 1SZXA 4WF9V 4HYOA 3EFFK 2BOBC 5LXTB 1FXHA 3SYQA 4E4EA 3OUFA 2JEUA 3ZRWB 4MVUA 3ZMUA 1HR0O 2A79B 2ZE7A 1YSCA 4LH7A 1I94B 1BQ0A 2UUBB 2E5LO 1YEWA 1LUVA 2F1MA 3ABMC 4XBFA 5A2QN 5CB4A 2GUZA 4DW0A 2UUCO 1HNWO 1XDCA 1URFA 4J41A 1XHXA 3B40A 4WFBV 4DR1B 4H0LB 1WA8A 3RT3C 1TUBA 2YUAA 3CCVV 3A8TA 2JGDA 4TSFG 1KP3A 1IXBA 2EINB 3H01A 3TK1A 1NU1H 3CC7V 4WFEA 5IJ9B 5KUMA 1M1KW 3ZS8C 1IBMO 5LBQA 5EYPA 3OMAB 4DRXA 3L73H 3K0DA 4DR2B 3ABKB 3ASOB 5LHGA 3N2GB 3FYIB 3MD0A 1XI1A 1MG1A 3AG4B 5LGUA 3IC9A 1Q3EA 2WPDG 4LBEC 2QM8A 1BT8A 4U7OA 1JX9A 1EN4A 3K5MA 4CS4A 3IGAC 1Q7YW 2AHZA 5EBLC 5BZBA 4IYHA 2JRIA 2WA3A 4IL6Z 1XNRB 3JYCA 5LA6B 5BR8B 4B08A 3LUTB 4NYKA 4DR5O 1KBHA 2EILC 2Q0AA 5H2FZ 1XL6A 4B3RO 3BCCH 4YIPA 2Y69C 5BY1A 1JOYA 3GVMA 4B3MB 1QR9A 4UB8Z 4JV5O 4JI0B 4YY3B 2PI4A 2QR4A 2XTAA 4A5UB 4LCUC 5GTIZ 1KECA 4ZI7B 5K1PA 4LFCB 3T1YB 5CA1B 5KHJA 4MVOA 4WBNB 3QTCA 4X62O 5IY5B 1AP6A 1GAXA 4O2AB 1YDXA 2UU9B 4B3TB 4JTDB 4FLXA 2ZT9B 2Z5UA 3BRCA 2BTOA 1EZVH 1UPGA 1TA8A 2XASA 2EX3A 5TISZ 4TV9A 5JH7A 2VQEB 1BZKA 4LFBB 4NVPA 2WLIB 3G4SV 4Q6GA 4RAIA 1IDSA 3OTOO 3QG5A 5E1AC 1IZ3A 4I4TB 4I55B 2FL4A 4UCRA 1AR4A 5IYZA 5KAFZ 2QTOA 1LNQA 4MVSA 3CCEV 1JA8A 3ABMB 1RM1C 4JTCB 4DUZB 2E3CA 4FJCC 1Y74B 3ZHQA 4DV2O 5KX5A 1SQVH 3BY6A 4PHZA 4QIWF 3T1HB 4MTOA 3CRAA 4DK0A 4ZKIA 5LMUO 2Q7GA 1IBKB 1QCEA 2DWEC 2GSMB 2GDSA 1NI8A 4ZIBA 3A0BZ 2WLNA 2XAQA 3JD1A 3VQVA 3D8CA 5LP6A 2XAGA 2IBZH 3FX7A 2QGNA 4X1YB 1H2KA 1VIBA 3K5NA 1Z5WA 2FB5A 4LF9B 1JR9A 1R6TA 1G4YB 2ZQMA 3BVOA 4ZBMA 2QM7A 3JARA 4DV7O 4BIUA 1N33B 2QE7G 4N21A 2BSKA 3APQA 2LGQA 1US6A 5IWAO 4YHHB 3AK1A 5DECA 4QJFB 1FD9A 1TGOA 4I0XB 3DC6A 4K3AA 2F66C 3UT5B 2P6JA 1W0KG 1GN6A 4O4IB 4OGQB 3AG2B 2CK3G 3K57A 4MVZA 2XAJA 4GKKO 1Q90D 3F5WC 4GKJB 3B4SA 3RGBA 3I5DA 4FLWA 2EIMC 2ZIMA 1GRJA 2EIJC 1TUEB 4GT1A 2PY5A 2HJDA 3U0ZA 5LP6C 4IHJB 1BHAA 2Y69B 1PPJH 2OIEA 2ZE5A 1NZ6A 3AK3A 3ZRVA 4F6RA 1Z2GA 4J11A 4DRXB 2IM9A 4UUJC 4DO2A 4PDVA 3K58A 2HLDG 1QNMA 2R72A 4FM1A 3CRCA 3MAQA 4JV5B 2HVJC 4B7EA 3WG7C 2P06A 2KKWA 5ITZA 1FFTB 3FFQA 1KD1W 1ZAUA 4JAAA 2YI9A 2XNDG 3CP1A 1QBZA 3H1IH 4XDJA 2ZDIC 1COWG 3L72H 1VQMV 4YJ3B 3CMAV 1V55C 4X62B 4PI0A 1L8DA 5CA0A 3BABA 4JI5O 5K1XA 4H33A 2QKSA 2F4VO 1HWYA 3P30A 1Q82W 1NJIW 2ZKOA 2YS8A 4LR3A 4X1KB 2WLHA 3ZHRA 1MA1A 1AVMA 3ICXA 5J2TB 1SETA 3W7WA 3OUSA 1RM1B 4CS2A 1N36B 2ODMA 1PNKA 3AG1B 3ABUA 4D7SA 4MT8A 1UJWB 1VQ9V 5JCOA 1ZL8B 4UVBA 5KHKA 1OHHG 3ZN1A 4C7UA 3IFXA 4TQFA 4R8CA 4WFHA 4CC6A 4NB5A 1J95A 4DR6B 3RYFA 2F95B 3I55V 4DUYO 2F43G 1PD3A 2YXYA 4QE7A 5HFMA 4RQFA 3G80A 3W7UA 2JJ1G 4Z2WA 3ZMZA 2B5UA 2ZNJA 2UXBO 4IT5A 2P5OA 2RCVA 1NR7A 5LYJB 3CCUV 4X64O 3SDLA 1B06A 2BTQA 1YTFD 2QEXV 3ZMTA 1DLBA 1V9PA 1NTZH 2YEVA 1I94O 2UUBO 4BIZA 3K03A 3JAWB 2XUMA 2CUGA 2X6CA 1TVKA 3VQWA 3OGIB 5JCOC 1Y6XA 4FIPC 4UCOA 1Y76B 5B1OA 3OR7C 1S5HC 1B3QA 2A3QA 1JQ0A 2PF4E 1PKXA 4JF3A 4DR4B 3RYCA 1R6NA 2EIMB 2EIJB 2OCHA 2EIKC 4O4HA 1N0JA 5LHHA 1S72V 5JVDB 4MTGA 4O4JA 3S3XA 4EFBA 1P7BA 1K34A 1A32A 4LF5B 3LNMB 1Q81W 2AGAA 2C2AA 5JJEB 4DR2O 4HNAB 2XOKG 3K9AA 3ABTA 1H2SB 2UXNA 4O2BB 4CH6A 4ZOLA 4LP8A 4O4LA 5CMUA 1DGSA 3WG7B 4XDLA 3B8MA 4TUYB 3K04A 4F6EA 2V4DA 4KHPB 3RFRA 1AJNA 1O9GA 2N74A 1AI5A 3SPCA 1V55B 5CN0A 3E86A 2UXDB 1XNRO 5AG2A 1M57C 2XAFA 3VBBA 4DV5O 3RYHA 5BR8O 3OGCC 2R9IA 1NVPD 1P7GA 4I9WA 3JALB 2ATKC 2OYQA 2EULA 2E74B 2QWPB 2CTPA 1VQOV 1JCHA 3BFRA 1NR1A 3TCUA 4CBCA 1U96A 2F4VB 5KHIA 4JI6B 4JYCA 3SPJA 3L75H 4F6RB 4B3MO 4BIOA 4JI0O 4YY3O 1XREA 1S0VA 4TQDA 2ITCC 1FFXA 3H1LH 4UVAA 3J7AU 1W0JG 2F23A 1BQZA 1NS1A 1ZX3A 4PA3A 4LFCO 3T1YO 3JCZA 1R3LC 5B66Z 2HHHB 4X1IA 3FB5C 1YXBA 4FFBA 4BR6A 3CXCU 1AR1B 4X20A 4HBNA 2Y48A 2UU9O 5CA3A 4B3TO 3RWRD 2W0XA 4I50B 4CC5A 2IW5A 1R3IC 1UFIA 1P49A 5D5QA 4NXNB 2VQEO 3ETDA 4LFBO 4LF6B 2GV9A 3OE7G 3J81N 2GTAA 3JD0A 2P4VA 2ADPA 3AG7A 3M8AA 3LSQA 1WN7A 4X64B 3N2KA 1SA0A 3EXAA 4DR3B 2B1GA 2CTQA 4DUZO 2RMKB 4NXMB 2Q7EA 2ADQB 4JYAB 3FKSG 3ML0A 3M99B 1R73A 5LMNB 5H6QA 3CRMA 1K7DA 3E2EA 1Q86W 1M9NA 1KYOF 5JJNB 1Q5OA 3T1HO 1NBMG 4JI3B 3JAKB 1H2LA 5FNVA 1YHQV 4DR7B 1IBKO 2IJJA 3ZCCA 2YC0A 2HVKC 1F23A 3SPIA 4G27B 3R66A 3SJAC 5BMVA 2DWDC 5KA6A 5EZYB 5L3DA 5DN6G 3C3TA 1SQXH 2LJ2A 3H1JH 2ETNA 3BPZA 3M7MX 4JI4B 4CH4A 4J7ZA 4LF9O 2PTMA 3H1KH 1QQCA 2W6JG 4JYYA 3JASA 1N33O 2A0LA 4X89A 2HP8A 1N8RW 1ENVA 1OCOC 3U11A 4JI8B 2A9HA 2P22C 5EC2C 4YHHO 1HP8A 4JI7O 4U3FH 3KKYA 2XT9A 4YIOA 2PYJA 1SESA 1YZBA 3OD4A 3K59A 4MW3A 2DW4A 1GK9A 3L9DA 4R50A 1XILA 1BE3H 3QO8A 4QPKA 3T4DA 4QPJA 1K4CC 5J2UA 3CPWU 4GLXA 1M57B 4GKJO 2HEPA 1BHBA 4J10A 5IT9N 3CHXA 3HB3B 5KHGA 5H5NA 1JJOA 1BS3A 2ZR3A 2H3OA 4DV5B 1XQ8A 3K0GA 1K97A 2IJHA 1E79G 4KFMA 3T1CA 2X7RB 4DYLA 3D3QA 1NKDA 2P90A 2KG7B 1X4TA 4PI2A 1DK1A 2CDYA 1AI7A 1W2BU 3U10A 1KUQA 3IAYA 4I5SA 1GN3A 3CSXA 4YJ2B 3F5TA 4UCSA 3SJCC 1RSOB 3K06A 2N05A 3CJHA 1YVWA 4P30A 1CP9A 4UB6Z 4GYCB 1QHTA 2A7WA 2IH3C 2WWWA 4X65B 2DYRC 4H37A 3ZJZA 2KSDA 4ZHQA 3QF7A 1SZTA 5GONA 3PJSK 3AG3C 1SQQH 1HDJA 2X6BA 3Q4HA 1F4NA 1KQSU 2R9AA 3HKDB 1QLEC 5LHIA 3R65A 1AJPA 1OCRC 5KAIZ 3ZMSA 1N36O 5LOVA 4LNUA 3VOUA 4TT3G 5KMGB 3HKBA 2LGWA 2E75B 1Q6HA 2PGGA 1O9HA 4WFAV 1PV0A 4MVRA 4MTFA 2QWRB 2DOSA 1IURA 4DR6O 1K5SA 1VF6A 1YI2V 1K33A 5DEDA 5C8YB 4OPHA 2HG5C 3K79A 1AI4A 1NH2D 1EM1A 4EB6A 3B09A 1XMOB 1HNXB 5KUKA 3UKMA 3D3IA 3HKEA 4AQYB 3BEHA 1PL0A 2XHBA 4PA7A 1K3EA 1AP5A 2D2CB 1OCOB 3OTFA 3TXQA 4L87A 3MHSC 3JAMN 1GH6A 2AZ0A 3NR7A 3WU2Z 4TV8A 3BA8A 2ZM6B 3JSNA 4GX2A 4GX0A 1VMGA 5CB4B 1SC5B 2GUZB 3X2QC 1DTOA 4JI7B 2G38A 4JZ2A 4K8ZA 4N23A 1L0LH 1AB3A 4H13B 1J5EB 5L3GA 3ETEA 4PA6A 4DR4O 3T2MA 3STZC 2JEXA 5JQGA 1WA8B 4WFGA 1Q43A 1RP3B 1TUBB 3ZX6A 5BMVB 4OPAA 2Q8VA 5GW7A 5JJJB 3W7SA 2JGDB 2B1IA 3CEIA 2EILB 5B3SC 1QR8A 1JVMA 2ZIOA 3QO5A 3K9SA 4LF5O 3K08A 4DXWA 2L6LA 2E76B 2ARHA 3CCQV 3ZHUA 1MABG 4FPPA 2OTLV 1DF4A 4DV4B 1XNQB 3RYIA 5EYPB 2Y4UA 3P3PA 3E22A 1OCZC 1DF5A 3HKCA 1FXKA 4PDRA 1SERA 4EFEA 5B5EZ 4KHPO 1JJ2U 2DYRB 2B9ZA 3FAVA 3JATA 3E8BA 3CS5A 3GB7C 4RQEA 5B1BC 5EC1C 3AG3B 4LFAB 2UXDO 4OXSA 1JFFA 1ORQC 2VRZA 4PD4F 4U3JA 3SPHA 4J42A 1IX9A 3VQYA 1FYJA 4PDMA 1QLEB 2FMLA 4D6TH 4JAVA 4MVQA 4JI6O 3WB1A 1S77D 5EK0A 2YIAA 1ZWIC 4JTAB 4G2KA 2AHYA 2HJFC 2Z3YA 3SYOA 3W7TA 1D2DA 1YCIA 1I7FA 2OCCC 4BWAA 2AZ2A 2HHHO 2Q5ZA 2IH1C 1FXKC 2ZINA 4DV1B 2V7QG 3DGEA 5EIBD 1FKAO 3SGIA 4GZRB 4PV1B 2DYSC 2JIZG 2OWOA 5LXTA 4AHCA 4Q20A 4DK1A 4LH6A 4NXNO 4FLYA 3LSUA 3Q4HB 1M93A 5D5PA 4Z1MG 4LF6O 1L0NH 4W4KA 4R6ZA 2FTKA 3JD4A 4TV9B 5JH7B 2Q6AA 4RO2A 1VQNV 2KQXA 5CBFA 2P4KA 5LOVB 2LFSA 4K35A 4DR3O 1PL4A 1K5QA 1SF9A 1VF7A 4NXMO 3A0HZ 4JYAO 5IYZB 3SJBC 5LMNO 3CC2V 5KHHA 2QJ1A 5FL7G 4MS2A 1SS3A 1EN6A 2Q68A 3K5LA 4BW5A 2Q0OC 5EBWC 3QNEA 4PJ0Z 1EFRG 4IIJA 2WLKA 4JPRA 3ZMVA 4F4LA 1G8MA 2YIBD 4LC1A 1MZFA 4JI3O 4DR7O 4X66B 5KX5B 1BL8A 1Y4MA 3THOA 1MNGA 2NN4A 5B3SB 1M56C 1Y67A 3E8HA 3N2GA 4JI4O 3DTUB 1K4DC 3D36A 1R1BA 5LP6B 3ETQA 3ABLC 1IVSA 1YF2A 3L71H 2AW9A 2H8PC 2WA4A 1FJGB 4FFKA 4UCUA 1OCZB 1NT2B 4JI8O 5FLXN 3GWOA 3OAAG 4TV8B 3JARB 2BSKB 5JWPA 1PNMA 4FMTA 3SR2C 2QM4A 4P9OA 2LW1A 2JS3A 5B1BB 3CD6V 4NTYA 1XUQA 2JGUA 5KLVH 4KP4A 1HNZO 3BA9A 4I9QA 1XOUA 3QVNA 3WB0A 2ZNIA 1BCCH 1MSDA 3OW2U 2WSSG 4MVMA 5CBGA 3ASOC 1YITV 2N04A 4ZI7A 1AJQA 4LF7B 1K92A 3E8GA 1WPBA 5CA1A 2YICA 4WBNA 1OV9A 2DQ3A 2OCCB 3GWKC 3JD3A 1THZA 2PZSA 2P67A 4FVMA 1IXMA 3HKCB 4O2AA 1FXKB 2CGNA 4BAYA 1QU7A 1CPYA 2FKXA 2YIDA 3TXSA 1KP2A 1K73W 2WLMA 5ITZB 2LFRA 4X65O 1G6UA 2DYSB 2WLIA 2KB1A 3C3SA 1E1RG 2QSAA 4GX5A 3K3WA 3SYAA 1Q6IA 1ROPA 4I4TA 4UCVA 1F4MA 4I55A 2EZOA 3MHHC 3ZBHA 1NTMH 5CA0B 1WB8A 2QKAA 3WFVA 1HW7A 4KXRA 1YIJV 3IC7A 3FB7C 5IYBO 4JI2B 1Y74A 3SPGA 2LW7A 1N0NA 2QKCA 2VQFB 3P3NA 1M4UA 1CEZA 2LQTA 2GHYA 1SQBH 1VQ4V 1P4RA 4MW8A 5B1NA 2CH7A 3B8NA 2P7TC 1H8HG 4X9QA 4MSWC 4ASUG 4CS3A 2X6AA 1SQFA 3LDDA 2YI8A 4J7JA 1NQTA 3UCSC 4X1YA 1L1FA 3RYFB 1FXVA 1LR1A 1VQ8V 1M56B 3CRRA 1N34B 1BMFG 1ZTEA 1XMOO 1MMMA 1HNXO 2DE0X 2EIKB 1GTOA 3ABLB 4AQYO 3C90A 1MOFA 1IBLO 2M6YA 3TJTA 4IYIA 4PA9A 1XMQB 2DJVA 2CGOA 2NLJC 4I0XA 5LL6Y 3UO2A 1RPRA 3SJQC 3UT5A 2MK3A 3IJ4A 2BTQB 2EJRA 4O4IA 3KG2A 2WAMA 2PYLA 2WLLA 5FPRA 1GM8A 4LF8B 1B04A 4AILC 2ZM6O 1R3KC 2YEVB 3J80N 1KMIZ 3JD2A 1NTKH 2JVDA 1XL4A 5IJ0A 4XDKA 4IIJB 2QWQB 3CCSV 1TVKB 2RDCA 4B3SB 1VP7A 1J5EO 4IHJA 4J9YB 2JJ2G 3A2FA 2GTSA 1VQ6V 2CTWA 4FZ0A 3OR6C 2LP7A 1GN4A 4HAMA 1VARA 5DM6V 2A06H 2ZXWC 3RYCB 1HNZB 4JZGA 4K0KB 1KKCA 4NKGB 3E8FA 3RW0A 4O4HB 4FM0A 4DV0B 2NR5A 1K9MW 4O4JB 4K8XA 5B1AC 4JASA 3O65A 3TETA 4GUNA 4DV4O 4CH5A 1BGYH 2JDIG 1XNQO 5H6RA 1M90W 1OZ0A 4NTXA 3OEHG 3EHBB
chains in the Genus database with same CATH topology
2VWJA 5LYJB 1J5EB 5EIBC 4ZOLB 4YJ3A 4O4LB 2F93B 5JQGA 5FPOA 1Q43A 2BTQA 1TUBB 5BMVB 5JJJB 2CAZC 1V9PA 3PN1A 2ZIOA 3VQXA 4X1KA 2UXCB 5C8YA 3K5OA 3JAWB 4EEQA 5J2TA 1T5EA 4DUYB 1TVKA 3VQWA 2Q7HA 5JCOC 4DV4B 4UCOA 3RYHB 1XNQB 3LNNA 3RYIA 5EYPB 1SQGA 2UUAB 1M5IA 1TAEA 3E22A 2UXBB 3HKCA 4JI1B 4EFEA 4DR4B 3RYCA 5LXTB 4DV6B 4BW9A 4LF4B 3JATA 4O4HA 1N32B 5JVDB 4O4JA 4LFAB 4LH7A 1I94B 4EFBA 1FFXB 2UUBB 1JFFA 1YEWA 4LF5B 2F1MA 4U3JA 5CB4A 5JJEB 3VQYA 4CH3A 4HNAB 3CB2A 1H2SB 4X1IB 4O2BB 5LYJA 4CH6A 4FFBB 4ZOLA 2P5OA 1XHXA 4O4LA 1DGSA 4DR1B 4X20B 3WB1A 1TUBA 4TUYB 2YIAA 2V4DA 4KHPB 3RFRA 1I7FA 1O9GA 3JAWA 4BWAA 1HR0B 5IJ9B 2UXDB 3ZS8C 2ZINA 2E5LB 3RYHA 1IBLB 5EYPA 4DV1B 3JALB 4DRXA 5EIBD 4DR2B 2OYQA 4FLTA 2UUCB 3SGIA 1HNWB 2RQ6A 3N2KB 1SA0B 1D5AA 3N2GB 2OWOA 1XI1A 4UCTA 5LXTA 2F4VB 4AHCA 5KHIA 4JI6B 4F6RB 1Q3EA 4DK1A 4LH6A 4FLYA 1M93A 5JVDA 5D5PA 3K5MA 4CS4A 4TQDA 3B2EE 1FFXA 4TV9B 5JH7B 5FNVB 2HHHB 4HNAA 4X1IA 1XNRB 5LOVB 4O2BA 4FFBA 1IBMB 5LA6B 5BR8B 4B08A 1VF7A 2Q0AA 5IYZB 3SJBC 4X20A 4HBNA 5KHHA 2QJ1A 4TUYA 1Z5VA 3RWRD 4I50B 3K5LA 4CC5A 4IIJA 3JSLA 4B3MB 1P49A 2YIBD 5D5QA 4NXNB 4JI0B 4YY3B 3JASB 4LF6B 2GV9A 4KL1A 4X66B 5KX5B 5IJ0B 3THOA 3JALA 4ZI7B 5K1PA 4LFCB 1WN7A 3T1YB 4X64B 5CA1B 5KHJA 3N2KA 1SA0A 4DR3B 4WBNB 3N2GA 3QTCA 3DSQA 4NXMB 2Q7EA 5LP6B 4DR5B 4JYAB 3ETQA 4L8JA 4O2AB 5J2UB 5LMNB 2UU9B 4B3TB 4B3RB 2JS5A 1FJGB 1JMKC 4FLXA 3BRCA 4UCUA 2BTOA 1NT2B 1TA8A 2EX3A 4UFZA 5JJNB 1Q5OA 4TV9A 5JH7A 3UQ8A 2VQEB 4TV8B 3JAKB 3JARB 5FNVA 4JI3B 4NVPA 4LFBB 4DR7B 4Q6GA 3SR2C 3QG5A 2QM4A 4I4TB 3SJAC 5BMVA 4I55B 5EZYB 4UCRA 5IYZA 2JGUA 4JI4B 3BPZA 3M7MX 4I50A 4CH4A 4DUZB 3BA9A 4I9QA 2E3CA 2PTMA 1QQCA 3WB0A 3JASA 2ZNIA 3WB2A 5KX5A 4OX9B 3U11A 1WNSA 4JI8B 4PHZA 2P22C 3T1HB 4ZI7A 4DK0A 4ZHQB 2PYJA 4LF7B 5GONB 2Q7GA 1IBKB 1WPBA 3K59A 5CA1A 4WBNA 3OTOB 4ZIBA 3VQVA 5LP6A 2PZSA 4FVMA 3HKCB 4O2AA 5J2UA 4GLXA 2HEPA 4X1YB 4FM2A 3K5NA 1Z5WA 4LF9B 3CHXA 5KHGA 1JJOA 5ITZB 1G6UA 3JAKA 3JARA 1N33B 2PUSA 4LNUB 4DV5B 1XQ8A 4DV2B 3HKBB 3ZEDA 4YHHB 4I4TA 1TGOA 4UCVA 4I55A 5EZYA 3BAAA 5LMUB 2ZCEA 1X4TA 4PI2A 2F66C 3UT5B 5CA0B 1HW7A 4O4IB 3U10A 3K57A 3IAYA 1Q8IA 5IJ9A 3CSXA 4YJ2B 4UCSA 3SJCC 4GKJB 4JI2B 3RGBA 4D7TA 4GYCB 1QHTA 4FLWA 2ZIMA 4EB6B 2VQFB 4X65B 2PY5A 1M4UA 4DV7B 3U0ZA 5LP6C 4IHJB 4ZHQA 5GONA 3QF7A 4FLVA 3HKEB 5IWAB 4F6RA 4CS3A 4DRXB 1SQFA 2IM9A 2YI8A 3K58A 2R9AA 2R70A 3HKDB 4X1YA 2R72A 3RYFB 4FM1A 1SKVA 3MAQA 4JV5B 4TOIA 3BHPA 2YXLA 4GKKB 1N34B 2KKWA 5ITZA 4DV3B 3FFQA 5LOVA 1ZAUA 4LNUA 5LA6A 5KMGB 2YI9A 3HKBA 2PGGA 1XHZA 1S5JA 1O9HA 2RJZA 1KU9A 1XMQB 4YJ3B 4X62B 4PI0A 1L8DA 3UT5A 5CA0A 5JQGB 3BABA 2BTQB 5K1XA 4O4IA 2PYLA 5FPRA 4LF8B 1B04A 4AILC 4YJ2A 1KMIZ 4LR3A 1RSOA 4X1KB 5C8YB 2JVDA 3ICXA 5IJ0A 5J2TB 4IIJB 1TVKB 4EB6A 4B3SB 1XMOB 1HNXB 4CS2A 1N36B 4IHJA 3RYIB 3A2FA 3HKEA 4AQYB 4D7SA 3E22B 2XHBA 5JCOA 5KHKA 3RYCB 3OTFA 1HNZB 4FLZA 4TQFA 4JI5B 4CC6A 4K0KB 3HKDA 3JATB 4DR6B 3RYFA 4O4HB 4FM0A 4DV0B 4TV8A 2F95B 3BA8A 2ZM6B 4O4JB 4K8XA 3JSNA 2VWKA 1JFFB 4CH5A 4U3JB 5CB4B 5KMGA 2ZNJA 4JI7B 4K8ZA 2YIBA 4FLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F66 C;  1NT2 B;  3ZS8 C;  3B2E E;  3QG5 A;  2JS5 A;  2CAZ C;  3THO A;  3CSX A;  3SJB C;  2P22 C;  3SJA C;  3SJC C;  3ICX A;  3QF7 A;  1X4T A;  1SKV A; 
#chains in the Genus database with same CATH topology
 2VWJ A;  3AG2 C;  2Z0A A;  4ZOL B;  3T4Z A;  4YJ3 A;  4O4L B;  4GCZ A;  1WPX A;  5FPO A;  3P32 A;  1GMG A;  2GBO A;  5J9P C;  2CAZ C;  4LFA O;  1SQP H;  4RUE A;  3VQX A;  2EZP A;  4X1K A;  2UXC B;  3K5O A;  4ICG A;  4EEQ A;  5J2T A;  2Y0P A;  5IDJ A;  1VQL V;  3ZRS A;  1K8A W;  3I56 V;  3RYH B;  3LNN A;  1G1X B;  4PA4 A;  1KC8 W;  3LDE A;  2UUA B;  1M5I A;  1TAE A;  3ZHS A;  4JI1 B;  1ZL8 A;  3L74 H;  4JGS A;  4DV6 B;  4BW9 A;  4LF4 B;  1VQK V;  1EN5 A;  3H1H H;  1I5Y A;  2HFE C;  1N32 B;  1EZJ A;  3SYP A;  1FFX B;  5L3C A;  4UV8 A;  1XBL A;  4DV1 O;  4OX9 O;  1FAF A;  4PDL A;  4CH3 A;  1YTF B;  3ETG A;  2X0L A;  3CB2 A;  4X1I B;  5LYJ A;  5GTH Z;  4FFB B;  3HR0 A;  4LWS A;  4R7C A;  5EBM C;  4I7Z B;  4X20 B;  2V1D A;  1P84 F;  3HPL C;  5L3F A;  4E2L A;  3SYC A;  5BXZ A;  1WLE A;  3JAW A;  3AG1 C;  1HR0 B;  4IGG A;  5C93 A;  3FB8 C;  4FZ1 A;  1GO3 F;  3CRQ A;  2E5L B;  1QLN A;  1IBL B;  2CE4 A;  1Y76 A;  1U97 A;  3CME V;  3E89 A;  4FLT A;  2UUC B;  1HNW B;  2RQ6 A;  3N2K B;  1SA0 B;  4P2Z A;  1D5A A;  3CCR V;  2CH7 B;  4UCT A;  3ZN0 A;  4X88 A;  1Y66 A;  2BOC C;  2MW2 B;  1KKD A;  5KA5 A;  3JCU Z;  5JVD A;  3F7V C;  3B2E E;  4X66 O;  2PI5 A;  2YXH A;  2LO1 A;  5IYC O;  1AR5 A;  5FNV B;  2ZXW B;  3DXR A;  1VF6 C;  1E1Q G;  4HNA A;  3G6E V;  3CE2 A;  1F51 A;  4O2B A;  3CC4 V;  3ZHT A;  1IBM B;  4GX1 A;  3QO7 A;  2Q67 A;  3CCJ V;  5B1A B;  1SRY A;  4P9P A;  3CCL V;  4TUY A;  1Z5V A;  2Q4P A;  1FJG O;  4X8A A;  3A0R A;  2EJ7 A;  5L3B A;  1VQP V;  2ZDI A;  3JSL A;  1NVP B;  1EBO A;  2WLL B;  3KCY A;  1PM9 A;  1WP7 A;  1ZSP A;  3JAS B;  4WFF A;  1I08 A;  3H9V A;  4KL1 A;  1VQ7 V;  4DV3 O;  3FYE B;  2QWN B;  1R3J C;  5H9C A;  5IJ0 B;  3ASN C;  4JAU A;  4J80 A;  3JAL A;  2DN9 A;  3KCX A;  1WB7 A;  2ZD9 A;  3OMN B;  3RBZ A;  3DSQ A;  1VEW A;  4DR5 B;  1S3J A;  2K1E A;  4L8J A;  1H2G A;  5J2U B;  2XAH A;  3RVY A;  4B3R B;  2JS5 A;  1JMK C;  2ILM A;  2HKO A;  3OEE G;  2RN9 A;  4UFZ A;  5LGN A;  3UQ8 A;  2K9P A;  4LF7 O;  1N4C A;  2M7W A;  2UXX A;  1XEQ A;  1OCR B;  2DQ0 A;  3CXH F;  1AI6 A;  2QA4 V;  1CXZ B;  1OCC C;  3LSS A;  1H8E G;  3MDS A;  4UXN A;  1R6K A;  2Q9L A;  2ZR2 A;  4I50 A;  3E83 A;  3UO3 A;  1WJZ A;  1ZLZ A;  1RFY A;  3OFN G;  3CJH B;  2QTS A;  3WB2 A;  4RUF A;  3G6B A;  3RN4 A;  4OX9 B;  2BCC H;  2IJI A;  1WNS A;  4ABM A;  1F7Y A;  1D5N A;  4ZHQ B;  5GON B;  2NNU A;  4J9Z B;  1GN2 A;  3OMI B;  3OTO B;  4U7N A;  2EBO A;  3ZRW A;  3L70 H;  2FYU H;  3G67 A;  2ITD C;  4DW1 A;  3ZRX A;  3G71 V;  4JI2 O;  4Z1V A;  4FM2 A;  4QNH B;  4W4L A;  3B77 A;  1W59 A;  4G28 B;  2VQF O;  3JAK A;  2PUS A;  4LNU B;  4DV2 B;  1KB9 F;  1H2N A;  3HKB B;  3OT7 A;  3ZED A;  1FPO A;  2RNB A;  5EZY A;  3BAA A;  3NXS A;  5LMU B;  2YDE A;  2O57 A;  2ZCE A;  3X2Q B;  2IU0 A;  3S3W A;  2R9R B;  2D3O W;  4LWS B;  2QWO B;  1OJH A;  1GM9 A;  1VF5 B;  1V54 C;  1Q8I A;  3ZHV A;  5IJ9 A;  1N34 O;  2W0F C;  4D7T A;  4EB6 B;  4UVC A;  2OT5 A;  3CX5 F;  4DV7 B;  1XMQ O;  4FLV A;  1VQ5 V;  3HKE B;  1PP9 H;  3CWB H;  5IWA B;  4WCE V;  3ZIA G;  2DMX A;  4NTW A;  4LF8 O;  4DR1 O;  1GKF A;  1YJ9 V;  3ASN B;  2R70 A;  1X59 A;  1SKV A;  4TOI A;  3BHP A;  2YXL A;  3W7X A;  4GKK B;  1WP8 A;  4HZ3 A;  4QE9 A;  4DV3 B;  4B3S O;  1ARO P;  1RPO A;  4TWK A;  3UM7 A;  4JYB A;  4YXW G;  5LA6 A;  3E35 A;  2IJK A;  3OM3 B;  1XHZ A;  1S5J A;  2EIN C;  2RJZ A;  1KU9 A;  5IE9 A;  3DXR B;  4RWU A;  4PEL A;  1YJW V;  2QDO A;  2BE3 A;  1Q6U A;  2HR3 A;  1FS0 G;  2KG7 A;  4J7K A;  5JQG B;  4K0K O;  1B6Q A;  4CZZ A;  4DV0 O;  1JPX A;  4FK5 C;  4H44 B;  4QGP A;  4YJ2 A;  3ABK C;  1S5L Z;  3APO A;  1RSO A;  1OCC B;  3D36 C;  2Y4T A;  3AG4 C;  1I0H A;  4MTX A;  2OTJ V;  1YJN V;  2ZE8 A;  3RYI B;  5L3E A;  2Q73 A;  2W6I G;  2ZE6 A;  3FB6 C;  3O9O A;  2IU3 A;  1S76 D;  4EKW A;  3E22 B;  3AEI A;  2AXT Z;  3N27 A;  2VS0 A;  1MSW D;  2CTR A;  1QVF U;  1MZE A;  3CYO A;  5IYD O;  1AIL A;  4FLZ A;  4JI5 B;  2UXC O;  3HKD A;  5A9G A;  3FAV B;  3JAT B;  1PNL A;  1H2M A;  4B7K A;  3F7Y C;  2Q69 A;  5F2V O;  2VWK A;  1JFF B;  2WLJ A;  4U3J B;  5KMG A;  2UUA O;  5E79 Z;  2YIB A;  4FLU A;  4JI1 O;  2L35 A;  2OIG A;  2H94 A;  5CBH A;  5EIB C;  3STL C;  4AI8 A;  1LUW A;  2F93 B;  4DV6 O;  4LF4 O;  5LGT A;  3DC5 A;  1I5X A;  1N32 O;  2YSU B;  1NH2 B;  3PN1 A;  1BSM A;  3RVZ A;  5C8Y A;  4NR1 A;  5HFL A;  3EVK A;  3LDC A;  3KZI Z;  1T5E A;  1WAZ A;  3AK2 A;  4KUM A;  5IY5 C;  4DUY B;  2Q7H A;  1ZUQ A;  1QVG U;  1H38 A;  1V54 B;  3FD9 A;  2JK5 C;  1SQG A;  1GM7 A;  4UV9 A;  3TGU H;  2Y0I A;  3CCM V;  2UXB B;  1SZX A;  4WF9 V;  4HYO A;  3EFF K;  2BOB C;  5LXT B;  1FXH A;  3SYQ A;  4E4E A;  3OUF A;  2JEU A;  3ZRW B;  4MVU A;  3ZMU A;  1HR0 O;  2A79 B;  2ZE7 A;  1YSC A;  4LH7 A;  1I94 B;  1BQ0 A;  2UUB B;  2E5L O;  1YEW A;  1LUV A;  2F1M A;  3ABM C;  4XBF A;  5A2Q N;  5CB4 A;  2GUZ A;  4DW0 A;  2UUC O;  1HNW O;  1XDC A;  1URF A;  4J41 A;  1XHX A;  3B40 A;  4WFB V;  4DR1 B;  4H0L B;  1WA8 A;  3RT3 C;  1TUB A;  2YUA A;  3CCV V;  3A8T A;  2JGD A;  4TSF G;  1KP3 A;  1IXB A;  2EIN B;  3H01 A;  3TK1 A;  1NU1 H;  3CC7 V;  4WFE A;  5IJ9 B;  5KUM A;  1M1K W;  3ZS8 C;  1IBM O;  5LBQ A;  5EYP A;  3OMA B;  4DRX A;  3L73 H;  3K0D A;  4DR2 B;  3ABK B;  3ASO B;  5LHG A;  3N2G B;  3FYI B;  3MD0 A;  1XI1 A;  1MG1 A;  3AG4 B;  5LGU A;  3IC9 A;  1Q3E A;  2WPD G;  4LBE C;  2QM8 A;  1BT8 A;  4U7O A;  1JX9 A;  1EN4 A;  3K5M A;  4CS4 A;  3IGA C;  1Q7Y W;  2AHZ A;  5EBL C;  5BZB A;  4IYH A;  2JRI A;  2WA3 A;  4IL6 Z;  1XNR B;  3JYC A;  5LA6 B;  5BR8 B;  4B08 A;  3LUT B;  4NYK A;  4DR5 O;  1KBH A;  2EIL C;  2Q0A A;  5H2F Z;  1XL6 A;  4B3R O;  3BCC H;  4YIP A;  2Y69 C;  5BY1 A;  1JOY A;  3GVM A;  4B3M B;  1QR9 A;  4UB8 Z;  4JV5 O;  4JI0 B;  4YY3 B;  2PI4 A;  2QR4 A;  2XTA A;  4A5U B;  4LCU C;  5GTI Z;  1KEC A;  4ZI7 B;  5K1P A;  4LFC B;  3T1Y B;  5CA1 B;  5KHJ A;  4MVO A;  4WBN B;  3QTC A;  4X62 O;  5IY5 B;  1AP6 A;  1GAX A;  4O2A B;  1YDX A;  2UU9 B;  4B3T B;  4JTD B;  4FLX A;  2ZT9 B;  2Z5U A;  3BRC A;  2BTO A;  1EZV H;  1UPG A;  1TA8 A;  2XAS A;  2EX3 A;  5TIS Z;  4TV9 A;  5JH7 A;  2VQE B;  1BZK A;  4LFB B;  4NVP A;  2WLI B;  3G4S V;  4Q6G A;  4RAI A;  1IDS A;  3OTO O;  3QG5 A;  5E1A C;  1IZ3 A;  4I4T B;  4I55 B;  2FL4 A;  4UCR A;  1AR4 A;  5IYZ A;  5KAF Z;  2QTO A;  1LNQ A;  4MVS A;  3CCE V;  1JA8 A;  3ABM B;  1RM1 C;  4JTC B;  4DUZ B;  2E3C A;  4FJC C;  1Y74 B;  3ZHQ A;  4DV2 O;  5KX5 A;  1SQV H;  3BY6 A;  4PHZ A;  4QIW F;  3T1H B;  4MTO A;  3CRA A;  4DK0 A;  4ZKI A;  5LMU O;  2Q7G A;  1IBK B;  1QCE A;  2DWE C;  2GSM B;  2GDS A;  1NI8 A;  4ZIB A;  3A0B Z;  2WLN A;  2XAQ A;  3JD1 A;  3VQV A;  3D8C A;  5LP6 A;  2XAG A;  2IBZ H;  3FX7 A;  2QGN A;  4X1Y B;  1H2K A;  1VIB A;  3K5N A;  1Z5W A;  2FB5 A;  4LF9 B;  1JR9 A;  1R6T A;  1G4Y B;  2ZQM A;  3BVO A;  4ZBM A;  2QM7 A;  3JAR A;  4DV7 O;  4BIU A;  1N33 B;  2QE7 G;  4N21 A;  2BSK A;  3APQ A;  2LGQ A;  1US6 A;  5IWA O;  4YHH B;  3AK1 A;  5DEC A;  4QJF B;  1FD9 A;  1TGO A;  4I0X B;  3DC6 A;  4K3A A;  2F66 C;  3UT5 B;  2P6J A;  1W0K G;  1GN6 A;  4O4I B;  4OGQ B;  3AG2 B;  2CK3 G;  3K57 A;  4MVZ A;  2XAJ A;  4GKK O;  1Q90 D;  3F5W C;  4GKJ B;  3B4S A;  3RGB A;  3I5D A;  4FLW A;  2EIM C;  2ZIM A;  1GRJ A;  2EIJ C;  1TUE B;  4GT1 A;  2PY5 A;  2HJD A;  3U0Z A;  5LP6 C;  4IHJ B;  1BHA A;  2Y69 B;  1PPJ H;  2OIE A;  2ZE5 A;  1NZ6 A;  3AK3 A;  3ZRV A;  4F6R A;  1Z2G A;  4J11 A;  4DRX B;  2IM9 A;  4UUJ C;  4DO2 A;  4PDV A;  3K58 A;  2HLD G;  1QNM A;  2R72 A;  4FM1 A;  3CRC A;  3MAQ A;  4JV5 B;  2HVJ C;  4B7E A;  3WG7 C;  2P06 A;  2KKW A;  5ITZ A;  1FFT B;  3FFQ A;  1KD1 W;  1ZAU A;  4JAA A;  2YI9 A;  2XND G;  3CP1 A;  1QBZ A;  3H1I H;  4XDJ A;  2ZDI C;  1COW G;  3L72 H;  1VQM V;  4YJ3 B;  3CMA V;  1V55 C;  4X62 B;  4PI0 A;  1L8D A;  5CA0 A;  3BAB A;  4JI5 O;  5K1X A;  4H33 A;  2QKS A;  2F4V O;  1HWY A;  3P30 A;  1Q82 W;  1NJI W;  2ZKO A;  2YS8 A;  4LR3 A;  4X1K B;  2WLH A;  3ZHR A;  1MA1 A;  1AVM A;  3ICX A;  5J2T B;  1SET A;  3W7W A;  3OUS A;  1RM1 B;  4CS2 A;  1N36 B;  2ODM A;  1PNK A;  3AG1 B;  3ABU A;  4D7S A;  4MT8 A;  1UJW B;  1VQ9 V;  5JCO A;  1ZL8 B;  4UVB A;  5KHK A;  1OHH G;  3ZN1 A;  4C7U A;  3IFX A;  4TQF A;  4R8C A;  4WFH A;  4CC6 A;  4NB5 A;  1J95 A;  4DR6 B;  3RYF A;  2F95 B;  3I55 V;  4DUY O;  2F43 G;  1PD3 A;  2YXY A;  4QE7 A;  5HFM A;  4RQF A;  3G80 A;  3W7U A;  2JJ1 G;  4Z2W A;  3ZMZ A;  2B5U A;  2ZNJ A;  2UXB O;  4IT5 A;  2P5O A;  2RCV A;  1NR7 A;  5LYJ B;  3CCU V;  4X64 O;  3SDL A;  1B06 A;  2BTQ A;  1YTF D;  2QEX V;  3ZMT A;  1DLB A;  1V9P A;  1NTZ H;  2YEV A;  1I94 O;  2UUB O;  4BIZ A;  3K03 A;  3JAW B;  2XUM A;  2CUG A;  2X6C A;  1TVK A;  3VQW A;  3OGI B;  5JCO C;  1Y6X A;  4FIP C;  4UCO A;  1Y76 B;  5B1O A;  3OR7 C;  1S5H C;  1B3Q A;  2A3Q A;  1JQ0 A;  2PF4 E;  1PKX A;  4JF3 A;  4DR4 B;  3RYC A;  1R6N A;  2EIM B;  2EIJ B;  2OCH A;  2EIK C;  4O4H A;  1N0J A;  5LHH A;  1S72 V;  5JVD B;  4MTG A;  4O4J A;  3S3X A;  4EFB A;  1P7B A;  1K34 A;  1A32 A;  4LF5 B;  3LNM B;  1Q81 W;  2AGA A;  2C2A A;  5JJE B;  4DR2 O;  4HNA B;  2XOK G;  3K9A A;  3ABT A;  1H2S B;  2UXN A;  4O2B B;  4CH6 A;  4ZOL A;  4LP8 A;  4O4L A;  5CMU A;  1DGS A;  3WG7 B;  4XDL A;  3B8M A;  4TUY B;  3K04 A;  4F6E A;  2V4D A;  4KHP B;  3RFR A;  1AJN A;  1O9G A;  2N74 A;  1AI5 A;  3SPC A;  1V55 B;  5CN0 A;  3E86 A;  2UXD B;  1XNR O;  5AG2 A;  1M57 C;  2XAF A;  3VBB A;  4DV5 O;  3RYH A;  5BR8 O;  3OGC C;  2R9I A;  1NVP D;  1P7G A;  4I9W A;  3JAL B;  2ATK C;  2OYQ A;  2EUL A;  2E74 B;  2QWP B;  2CTP A;  1VQO V;  1JCH A;  3BFR A;  1NR1 A;  3TCU A;  4CBC A;  1U96 A;  2F4V B;  5KHI A;  4JI6 B;  4JYC A;  3SPJ A;  3L75 H;  4F6R B;  4B3M O;  4BIO A;  4JI0 O;  4YY3 O;  1XRE A;  1S0V A;  4TQD A;  2ITC C;  1FFX A;  3H1L H;  4UVA A;  3J7A U;  1W0J G;  2F23 A;  1BQZ A;  1NS1 A;  1ZX3 A;  4PA3 A;  4LFC O;  3T1Y O;  3JCZ A;  1R3L C;  5B66 Z;  2HHH B;  4X1I A;  3FB5 C;  1YXB A;  4FFB A;  4BR6 A;  3CXC U;  1AR1 B;  4X20 A;  4HBN A;  2Y48 A;  2UU9 O;  5CA3 A;  4B3T O;  3RWR D;  2W0X A;  4I50 B;  4CC5 A;  2IW5 A;  1R3I C;  1UFI A;  1P49 A;  5D5Q A;  4NXN B;  2VQE O;  3ETD A;  4LFB O;  4LF6 B;  2GV9 A;  3OE7 G;  3J81 N;  2GTA A;  3JD0 A;  2P4V A;  2ADP A;  3AG7 A;  3M8A A;  3LSQ A;  1WN7 A;  4X64 B;  3N2K A;  1SA0 A;  3EXA A;  4DR3 B;  2B1G A;  2CTQ A;  4DUZ O;  2RMK B;  4NXM B;  2Q7E A;  2ADQ B;  4JYA B;  3FKS G;  3ML0 A;  3M99 B;  1R73 A;  5LMN B;  5H6Q A;  3CRM A;  1K7D A;  3E2E A;  1Q86 W;  1M9N A;  1KYO F;  5JJN B;  1Q5O A;  3T1H O;  1NBM G;  4JI3 B;  3JAK B;  1H2L A;  5FNV A;  1YHQ V;  4DR7 B;  1IBK O;  2IJJ A;  3ZCC A;  2YC0 A;  2HVK C;  1F23 A;  3SPI A;  4G27 B;  3R66 A;  3SJA C;  5BMV A;  2DWD C;  5KA6 A;  5EZY B;  5L3D A;  5DN6 G;  3C3T A;  1SQX H;  2LJ2 A;  3H1J H;  2ETN A;  3BPZ A;  3M7M X;  4JI4 B;  4CH4 A;  4J7Z A;  4LF9 O;  2PTM A;  3H1K H;  1QQC A;  2W6J G;  4JYY A;  3JAS A;  1N33 O;  2A0L A;  4X89 A;  2HP8 A;  1N8R W;  1ENV A;  1OCO C;  3U11 A;  4JI8 B;  2A9H A;  2P22 C;  5EC2 C;  4YHH O;  1HP8 A;  4JI7 O;  4U3F H;  3KKY A;  2XT9 A;  4YIO A;  2PYJ A;  1SES A;  1YZB A;  3OD4 A;  3K59 A;  4MW3 A;  2DW4 A;  1GK9 A;  3L9D A;  4R50 A;  1XIL A;  1BE3 H;  3QO8 A;  4QPK A;  3T4D A;  4QPJ A;  1K4C C;  5J2U A;  3CPW U;  4GLX A;  1M57 B;  4GKJ O;  2HEP A;  1BHB A;  4J10 A;  5IT9 N;  3CHX A;  3HB3 B;  5KHG A;  5H5N A;  1JJO A;  1BS3 A;  2ZR3 A;  2H3O A;  4DV5 B;  1XQ8 A;  3K0G A;  1K97 A;  2IJH A;  1E79 G;  4KFM A;  3T1C A;  2X7R B;  4DYL A;  3D3Q A;  1NKD A;  2P90 A;  2KG7 B;  1X4T A;  4PI2 A;  1DK1 A;  2CDY A;  1AI7 A;  1W2B U;  3U10 A;  1KUQ A;  3IAY A;  4I5S A;  1GN3 A;  3CSX A;  4YJ2 B;  3F5T A;  4UCS A;  3SJC C;  1RSO B;  3K06 A;  2N05 A;  3CJH A;  1YVW A;  4P30 A;  1CP9 A;  4UB6 Z;  4GYC B;  1QHT A;  2A7W A;  2IH3 C;  2WWW A;  4X65 B;  2DYR C;  4H37 A;  3ZJZ A;  2KSD A;  4ZHQ A;  3QF7 A;  1SZT A;  5GON A;  3PJS K;  3AG3 C;  1SQQ H;  1HDJ A;  2X6B A;  3Q4H A;  1F4N A;  1KQS U;  2R9A A;  3HKD B;  1QLE C;  5LHI A;  3R65 A;  1AJP A;  1OCR C;  5KAI Z;  3ZMS A;  1N36 O;  5LOV A;  4LNU A;  3VOU A;  4TT3 G;  5KMG B;  3HKB A;  2LGW A;  2E75 B;  1Q6H A;  2PGG A;  1O9H A;  4WFA V;  1PV0 A;  4MVR A;  4MTF A;  2QWR B;  2DOS A;  1IUR A;  4DR6 O;  1K5S A;  1VF6 A;  1YI2 V;  1K33 A;  5DED A;  5C8Y B;  4OPH A;  2HG5 C;  3K79 A;  1AI4 A;  1NH2 D;  1EM1 A;  4EB6 A;  3B09 A;  1XMO B;  1HNX B;  5KUK A;  3UKM A;  3D3I A;  3HKE A;  4AQY B;  3BEH A;  1PL0 A;  2XHB A;  4PA7 A;  1K3E A;  1AP5 A;  2D2C B;  1OCO B;  3OTF A;  3TXQ A;  4L87 A;  3MHS C;  3JAM N;  1GH6 A;  2AZ0 A;  3NR7 A;  3WU2 Z;  4TV8 A;  3BA8 A;  2ZM6 B;  3JSN A;  4GX2 A;  4GX0 A;  1VMG A;  5CB4 B;  1SC5 B;  2GUZ B;  3X2Q C;  1DTO A;  4JI7 B;  2G38 A;  4JZ2 A;  4K8Z A;  4N23 A;  1L0L H;  1AB3 A;  4H13 B;  1J5E B;  5L3G A;  3ETE A;  4PA6 A;  4DR4 O;  3T2M A;  3STZ C;  2JEX A;  5JQG A;  1WA8 B;  4WFG A;  1Q43 A;  1RP3 B;  1TUB B;  3ZX6 A;  5BMV B;  4OPA A;  2Q8V A;  5GW7 A;  5JJJ B;  3W7S A;  2JGD B;  2B1I A;  3CEI A;  2EIL B;  5B3S C;  1QR8 A;  1JVM A;  2ZIO A;  3QO5 A;  3K9S A;  4LF5 O;  3K08 A;  4DXW A;  2L6L A;  2E76 B;  2ARH A;  3CCQ V;  3ZHU A;  1MAB G;  4FPP A;  2OTL V;  1DF4 A;  4DV4 B;  1XNQ B;  3RYI A;  5EYP B;  2Y4U A;  3P3P A;  3E22 A;  1OCZ C;  1DF5 A;  3HKC A;  1FXK A;  4PDR A;  1SER A;  4EFE A;  5B5E Z;  4KHP O;  1JJ2 U;  2DYR B;  2B9Z A;  3FAV A;  3JAT A;  3E8B A;  3CS5 A;  3GB7 C;  4RQE A;  5B1B C;  5EC1 C;  3AG3 B;  4LFA B;  2UXD O;  4OXS A;  1JFF A;  1ORQ C;  2VRZ A;  4PD4 F;  4U3J A;  3SPH A;  4J42 A;  1IX9 A;  3VQY A;  1FYJ A;  4PDM A;  1QLE B;  2FML A;  4D6T H;  4JAV A;  4MVQ A;  4JI6 O;  3WB1 A;  1S77 D;  5EK0 A;  2YIA A;  1ZWI C;  4JTA B;  4G2K A;  2AHY A;  2HJF C;  2Z3Y A;  3SYO A;  3W7T A;  1D2D A;  1YCI A;  1I7F A;  2OCC C;  4BWA A;  2AZ2 A;  2HHH O;  2Q5Z A;  2IH1 C;  1FXK C;  2ZIN A;  4DV1 B;  2V7Q G;  3DGE A;  5EIB D;  1FKA O;  3SGI A;  4GZR B;  4PV1 B;  2DYS C;  2JIZ G;  2OWO A;  5LXT A;  4AHC A;  4Q20 A;  4DK1 A;  4LH6 A;  4NXN O;  4FLY A;  3LSU A;  3Q4H B;  1M93 A;  5D5P A;  4Z1M G;  4LF6 O;  1L0N H;  4W4K A;  4R6Z A;  2FTK A;  3JD4 A;  4TV9 B;  5JH7 B;  2Q6A A;  4RO2 A;  1VQN V;  2KQX A;  5CBF A;  2P4K A;  5LOV B;  2LFS A;  4K35 A;  4DR3 O;  1PL4 A;  1K5Q A;  1SF9 A;  1VF7 A;  4NXM O;  3A0H Z;  4JYA O;  5IYZ B;  3SJB C;  5LMN O;  3CC2 V;  5KHH A;  2QJ1 A;  5FL7 G;  4MS2 A;  1SS3 A;  1EN6 A;  2Q68 A;  3K5L A;  4BW5 A;  2Q0O C;  5EBW C;  3QNE A;  4PJ0 Z;  1EFR G;  4IIJ A;  2WLK A;  4JPR A;  3ZMV A;  4F4L A;  1G8M A;  2YIB D;  4LC1 A;  1MZF A;  4JI3 O;  4DR7 O;  4X66 B;  5KX5 B;  1BL8 A;  1Y4M A;  3THO A;  1MNG A;  2NN4 A;  5B3S B;  1M56 C;  1Y67 A;  3E8H A;  3N2G A;  4JI4 O;  3DTU B;  1K4D C;  3D36 A;  1R1B A;  5LP6 B;  3ETQ A;  3ABL C;  1IVS A;  1YF2 A;  3L71 H;  2AW9 A;  2H8P C;  2WA4 A;  1FJG B;  4FFK A;  4UCU A;  1OCZ B;  1NT2 B;  4JI8 O;  5FLX N;  3GWO A;  3OAA G;  4TV8 B;  3JAR B;  2BSK B;  5JWP A;  1PNM A;  4FMT A;  3SR2 C;  2QM4 A;  4P9O A;  2LW1 A;  2JS3 A;  5B1B B;  3CD6 V;  4NTY A;  1XUQ A;  2JGU A;  5KLV H;  4KP4 A;  1HNZ O;  3BA9 A;  4I9Q A;  1XOU A;  3QVN A;  3WB0 A;  2ZNI A;  1BCC H;  1MSD A;  3OW2 U;  2WSS G;  4MVM A;  5CBG A;  3ASO C;  1YIT V;  2N04 A;  4ZI7 A;  1AJQ A;  4LF7 B;  1K92 A;  3E8G A;  1WPB A;  5CA1 A;  2YIC A;  4WBN A;  1OV9 A;  2DQ3 A;  2OCC B;  3GWK C;  3JD3 A;  1THZ A;  2PZS A;  2P67 A;  4FVM A;  1IXM A;  3HKC B;  4O2A A;  1FXK B;  2CGN A;  4BAY A;  1QU7 A;  1CPY A;  2FKX A;  2YID A;  3TXS A;  1KP2 A;  1K73 W;  2WLM A;  5ITZ B;  2LFR A;  4X65 O;  1G6U A;  2DYS B;  2WLI A;  2KB1 A;  3C3S A;  1E1R G;  2QSA A;  4GX5 A;  3K3W A;  3SYA A;  1Q6I A;  1ROP A;  4I4T A;  4UCV A;  1F4M A;  4I55 A;  2EZO A;  3MHH C;  3ZBH A;  1NTM H;  5CA0 B;  1WB8 A;  2QKA A;  3WFV A;  1HW7 A;  4KXR A;  1YIJ V;  3IC7 A;  3FB7 C;  5IYB O;  4JI2 B;  1Y74 A;  3SPG A;  2LW7 A;  1N0N A;  2QKC A;  2VQF B;  3P3N A;  1M4U A;  1CEZ A;  2LQT A;  2GHY A;  1SQB H;  1VQ4 V;  1P4R A;  4MW8 A;  5B1N A;  2CH7 A;  3B8N A;  2P7T C;  1H8H G;  4X9Q A;  4MSW C;  4ASU G;  4CS3 A;  2X6A A;  1SQF A;  3LDD A;  2YI8 A;  4J7J A;  1NQT A;  3UCS C;  4X1Y A;  1L1F A;  3RYF B;  1FXV A;  1LR1 A;  1VQ8 V;  1M56 B;  3CRR A;  1N34 B;  1BMF G;  1ZTE A;  1XMO O;  1MMM A;  1HNX O;  2DE0 X;  2EIK B;  1GTO A;  3ABL B;  4AQY O;  3C90 A;  1MOF A;  1IBL O;  2M6Y A;  3TJT A;  4IYI A;  4PA9 A;  1XMQ B;  2DJV A;  2CGO A;  2NLJ C;  4I0X A;  5LL6 Y;  3UO2 A;  1RPR A;  3SJQ C;  3UT5 A;  2MK3 A;  3IJ4 A;  2BTQ B;  2EJR A;  4O4I A;  3KG2 A;  2WAM A;  2PYL A;  2WLL A;  5FPR A;  1GM8 A;  4LF8 B;  1B04 A;  4AIL C;  2ZM6 O;  1R3K C;  2YEV B;  3J80 N;  1KMI Z;  3JD2 A;  1NTK H;  2JVD A;  1XL4 A;  5IJ0 A;  4XDK A;  4IIJ B;  2QWQ B;  3CCS V;  1TVK B;  2RDC A;  4B3S B;  1VP7 A;  1J5E O;  4IHJ A;  4J9Y B;  2JJ2 G;  3A2F A;  2GTS A;  1VQ6 V;  2CTW A;  4FZ0 A;  3OR6 C;  2LP7 A;  1GN4 A;  4HAM A;  1VAR A;  5DM6 V;  2A06 H;  2ZXW C;  3RYC B;  1HNZ B;  4JZG A;  4K0K B;  1KKC A;  4NKG B;  3E8F A;  3RW0 A;  4O4H B;  4FM0 A;  4DV0 B;  2NR5 A;  1K9M W;  4O4J B;  4K8X A;  5B1A C;  4JAS A;  3O65 A;  3TET A;  4GUN A;  4DV4 O;  4CH5 A;  1BGY H;  2JDI G;  1XNQ O;  5H6R A;  1M90 W;  1OZ0 A;  4NTX A;  3OEH G;  3EHB B; 
#chains in the Genus database with same CATH homology
 2VWJ A;  5LYJ B;  1J5E B;  5EIB C;  4ZOL B;  4YJ3 A;  4O4L B;  2F93 B;  5JQG A;  5FPO A;  1Q43 A;  2BTQ A;  1TUB B;  5BMV B;  5JJJ B;  2CAZ C;  1V9P A;  3PN1 A;  2ZIO A;  3VQX A;  4X1K A;  2UXC B;  5C8Y A;  3K5O A;  3JAW B;  4EEQ A;  5J2T A;  1T5E A;  4DUY B;  1TVK A;  3VQW A;  2Q7H A;  5JCO C;  4DV4 B;  4UCO A;  3RYH B;  1XNQ B;  3LNN A;  3RYI A;  5EYP B;  1SQG A;  2UUA B;  1M5I A;  1TAE A;  3E22 A;  2UXB B;  3HKC A;  4JI1 B;  4EFE A;  4DR4 B;  3RYC A;  5LXT B;  4DV6 B;  4BW9 A;  4LF4 B;  3JAT A;  4O4H A;  1N32 B;  5JVD B;  4O4J A;  4LFA B;  4LH7 A;  1I94 B;  4EFB A;  1FFX B;  2UUB B;  1JFF A;  1YEW A;  4LF5 B;  2F1M A;  4U3J A;  5CB4 A;  5JJE B;  3VQY A;  4CH3 A;  4HNA B;  3CB2 A;  1H2S B;  4X1I B;  4O2B B;  5LYJ A;  4CH6 A;  4FFB B;  4ZOL A;  2P5O A;  1XHX A;  4O4L A;  1DGS A;  4DR1 B;  4X20 B;  3WB1 A;  1TUB A;  4TUY B;  2YIA A;  2V4D A;  4KHP B;  3RFR A;  1I7F A;  1O9G A;  3JAW A;  4BWA A;  1HR0 B;  5IJ9 B;  2UXD B;  3ZS8 C;  2ZIN A;  2E5L B;  3RYH A;  1IBL B;  5EYP A;  4DV1 B;  3JAL B;  4DRX A;  5EIB D;  4DR2 B;  2OYQ A;  4FLT A;  2UUC B;  3SGI A;  1HNW B;  2RQ6 A;  3N2K B;  1SA0 B;  1D5A A;  3N2G B;  2OWO A;  1XI1 A;  4UCT A;  5LXT A;  2F4V B;  4AHC A;  5KHI A;  4JI6 B;  4F6R B;  1Q3E A;  4DK1 A;  4LH6 A;  4FLY A;  1M93 A;  5JVD A;  5D5P A;  3K5M A;  4CS4 A;  4TQD A;  3B2E E;  1FFX A;  4TV9 B;  5JH7 B;  5FNV B;  2HHH B;  4HNA A;  4X1I A;  1XNR B;  5LOV B;  4O2B A;  4FFB A;  1IBM B;  5LA6 B;  5BR8 B;  4B08 A;  1VF7 A;  2Q0A A;  5IYZ B;  3SJB C;  4X20 A;  4HBN A;  5KHH A;  2QJ1 A;  4TUY A;  1Z5V A;  3RWR D;  4I50 B;  3K5L A;  4CC5 A;  4IIJ A;  3JSL A;  4B3M B;  1P49 A;  2YIB D;  5D5Q A;  4NXN B;  4JI0 B;  4YY3 B;  3JAS B;  4LF6 B;  2GV9 A;  4KL1 A;  4X66 B;  5KX5 B;  5IJ0 B;  3THO A;  3JAL A;  4ZI7 B;  5K1P A;  4LFC B;  1WN7 A;  3T1Y B;  4X64 B;  5CA1 B;  5KHJ A;  3N2K A;  1SA0 A;  4DR3 B;  4WBN B;  3N2G A;  3QTC A;  3DSQ A;  4NXM B;  2Q7E A;  5LP6 B;  4DR5 B;  4JYA B;  3ETQ A;  4L8J A;  4O2A B;  5J2U B;  5LMN B;  2UU9 B;  4B3T B;  4B3R B;  2JS5 A;  1FJG B;  1JMK C;  4FLX A;  3BRC A;  4UCU A;  2BTO A;  1NT2 B;  1TA8 A;  2EX3 A;  4UFZ A;  5JJN B;  1Q5O A;  4TV9 A;  5JH7 A;  3UQ8 A;  2VQE B;  4TV8 B;  3JAK B;  3JAR B;  5FNV A;  4JI3 B;  4NVP A;  4LFB B;  4DR7 B;  4Q6G A;  3SR2 C;  3QG5 A;  2QM4 A;  4I4T B;  3SJA C;  5BMV A;  4I55 B;  5EZY B;  4UCR A;  5IYZ A;  2JGU A;  4JI4 B;  3BPZ A;  3M7M X;  4I50 A;  4CH4 A;  4DUZ B;  3BA9 A;  4I9Q A;  2E3C A;  2PTM A;  1QQC A;  3WB0 A;  3JAS A;  2ZNI A;  3WB2 A;  5KX5 A;  4OX9 B;  3U11 A;  1WNS A;  4JI8 B;  4PHZ A;  2P22 C;  3T1H B;  4ZI7 A;  4DK0 A;  4ZHQ B;  2PYJ A;  4LF7 B;  5GON B;  2Q7G A;  1IBK B;  1WPB A;  3K59 A;  5CA1 A;  4WBN A;  3OTO B;  4ZIB A;  3VQV A;  5LP6 A;  2PZS A;  4FVM A;  3HKC B;  4O2A A;  5J2U A;  4GLX A;  2HEP A;  4X1Y B;  4FM2 A;  3K5N A;  1Z5W A;  4LF9 B;  3CHX A;  5KHG A;  1JJO A;  5ITZ B;  1G6U A;  3JAK A;  3JAR A;  1N33 B;  2PUS A;  4LNU B;  4DV5 B;  1XQ8 A;  4DV2 B;  3HKB B;  3ZED A;  4YHH B;  4I4T A;  1TGO A;  4UCV A;  4I55 A;  5EZY A;  3BAA A;  5LMU B;  2ZCE A;  1X4T A;  4PI2 A;  2F66 C;  3UT5 B;  5CA0 B;  1HW7 A;  4O4I B;  3U10 A;  3K57 A;  3IAY A;  1Q8I A;  5IJ9 A;  3CSX A;  4YJ2 B;  4UCS A;  3SJC C;  4GKJ B;  4JI2 B;  3RGB A;  4D7T A;  4GYC B;  1QHT A;  4FLW A;  2ZIM A;  4EB6 B;  2VQF B;  4X65 B;  2PY5 A;  1M4U A;  4DV7 B;  3U0Z A;  5LP6 C;  4IHJ B;  4ZHQ A;  5GON A;  3QF7 A;  4FLV A;  3HKE B;  5IWA B;  4F6R A;  4CS3 A;  4DRX B;  1SQF A;  2IM9 A;  2YI8 A;  3K58 A;  2R9A A;  2R70 A;  3HKD B;  4X1Y A;  2R72 A;  3RYF B;  4FM1 A;  1SKV A;  3MAQ A;  4JV5 B;  4TOI A;  3BHP A;  2YXL A;  4GKK B;  1N34 B;  2KKW A;  5ITZ A;  4DV3 B;  3FFQ A;  5LOV A;  1ZAU A;  4LNU A;  5LA6 A;  5KMG B;  2YI9 A;  3HKB A;  2PGG A;  1XHZ A;  1S5J A;  1O9H A;  2RJZ A;  1KU9 A;  1XMQ B;  4YJ3 B;  4X62 B;  4PI0 A;  1L8D A;  3UT5 A;  5CA0 A;  5JQG B;  3BAB A;  2BTQ B;  5K1X A;  4O4I A;  2PYL A;  5FPR A;  4LF8 B;  1B04 A;  4AIL C;  4YJ2 A;  1KMI Z;  4LR3 A;  1RSO A;  4X1K B;  5C8Y B;  2JVD A;  3ICX A;  5IJ0 A;  5J2T B;  4IIJ B;  1TVK B;  4EB6 A;  4B3S B;  1XMO B;  1HNX B;  4CS2 A;  1N36 B;  4IHJ A;  3RYI B;  3A2F A;  3HKE A;  4AQY B;  4D7S A;  3E22 B;  2XHB A;  5JCO A;  5KHK A;  3RYC B;  3OTF A;  1HNZ B;  4FLZ A;  4TQF A;  4JI5 B;  4CC6 A;  4K0K B;  3HKD A;  3JAT B;  4DR6 B;  3RYF A;  4O4H B;  4FM0 A;  4DV0 B;  4TV8 A;  2F95 B;  3BA8 A;  2ZM6 B;  4O4J B;  4K8X A;  3JSN A;  2VWK A;  1JFF B;  4CH5 A;  4U3J B;  5CB4 B;  5KMG A;  2ZNJ A;  4JI7 B;  4K8Z A;  2YIB A;  4FLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...