2JS5A

Nmr structure of protein q60c73_metca. northeast structural genomics consortium target mcr1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTASLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR Structure of protein Q60C73_METCA.
rcsb
source organism Methylococcus capsulatus
molecule tags Structural genomics, unknown function
total genus 28
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05082 Rop-like Rop-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2js5A00
3THOA 1X4TA 3SJCC 3SJBC 1SKVA 3CSXA 2F66C 2JS5A 3ICXA 2P22C 3QG5A 3QF7A 1NT2B 3B2EE 3SJAC 3ZS8C 2CAZC
chains in the Genus database with same CATH superfamily
3J7AU 1KU9A 1KYOF 4TT3G 2YEVA 3ABTA 1AI7A 3O65A 1IBMO 1F4MA 3UKMA 4YHHO 4QJFB 2BSKB 4EB6A 3SPIA 1K92A 2ADQB 4D7TA 2R70A 1PNMA 4MVUA 3G6BA 5LXTA 2G38A 3QNEA 4Z1VA 4YHHB 2Q0AA 2QM8A 5KX5A 2O57A 4TV9B 3FFQA 2C2AA 1W2BU 2JS3A 1BS3A 4JAVA 3AK2A 3RYCA 4GKJO 4IYHA 4J41A 1ENVA 3LSSA 1VQKV 1H2KA 2ZXWB 4ZI7B 1CXZB 2NLJC 3FAVB 4X66O 1EZVH 1OCZC 4GKJB 2OT5A 1SS3A 5CA3A 3RT3C 3LNMB 3ZN0A 4GX2A 4X65O 4B3RO 4H13B 4B3MO 4X66B 4D7SA 1CP9A 1ZAUA 4GX0A 2BOCC 4B3RB 1XNRO 1N8RW 4NXNO 1YDXA 3CD6V 2F66C 1I7FA 3ETEA 3K5LA 4F6RA 2IJKA 1XNRB 3CWBH 1M93A 4NXNB 5IJ0B 3ASOB 1PNKA 4KFMA 4ZHQA 2PYLA 3JCZA 1FFXB 5EIBD 1PM9A 2CH7A 3Q4HA 2JGDA 4X1KB 3MHHC 4RUEA 4NYKA 4UCRA 5FNVA 3OE7G 2ZKOA 2OWOA 2CTRA 3ZN1A 4IL6Z 3J81N 1CEZA 1S5LZ 1TVKB 4DR5O 2JEUA 1Z5WA 3W7TA 2DQ3A 4I5SA 3AG2C 3G71V 3CCVV 5KMGB 4UCTA 4DR5B 3VBBA 1XI1A 3I55V 3L71H 4XDLA 4HBNA 2PI5A 3LDCA 4DV3B 5KHGA 3SYOA 3CC7V 4ZIBA 3UO2A 4LNUA 3G4SV 1P7GA 4PJ0Z 3BABA 4LF4O 5EZYA 5LP6C 1K8AW 5B66Z 1D2DA 4JZ2A 4UVBA 4LR3A 4LF4B 2XASA 2LJ2A 2Z3YA 5LL6Y 2HP8A 5CB4A 3QF7A 3ZMZA 3L74H 3CCSV 2KB1A 4YXWG 5JQGA 1SKVA 1UJWB 1W0JG 5KAFZ 1FXHA 3DXRB 2XTAA 1NTKH 3H9VA 1AI4A 4UV8A 3CJHB 4PA4A 4X62O 1KBHA 4O4JA 2ZNIA 4G2KA 4ZKIA 4FZ1A 3B09A 4QPJA 3H01A 1NR1A 4G27B 1JOYA 1WP7A 4TSFG 3X2QC 5EBLC 4X62B 2UUAB 3AEIA 2YI9A 1FXKA 3CMEV 3HR0A 3ETGA 4FFKA 2CGOA 1OCOC 2E3CA 2E74B 4KP4A 3W7SA 3HKCA 5EYPB 3N2GB 1SZXA 4LWSA 2DYRB 2ZR2A 2PYJA 4X20B 1KB9F 5JVDA 2XNDG 3DSQA 3A8TA 4HYOA 5EBWC 3T4DA 4GCZA 4B3TO 2ILMA 1YITV 1K3EA 2XT9A 1E1QG 5IE9A 3SJQC 5BMVA 3ICXA 1LNQA 4KXRA 4B3TB 1G1XB 2H94A 3CRAA 2EBOA 3VQWA 2OTLV 3DGEA 3OR7C 1F51A 1PL0A 3T1YO 4YJ3A 3K79A 4LF5B 3I5DA 2PF4E 5B1AC 1YIJV 1SC5B 2QTOA 3T1YB 4UV9A 2HG5C 4U3JA 2A7WA 1IVSA 2HJFC 2QSAA 4H44B 2CK3G 4FLVA 3SYCA 2OCHA 1S5JA 2Y0PA 5H6RA 3SJAC 3F7VC 1EN6A 4YIPA 1TAEA 5L3CA 4UCVA 3HKEB 1AP6A 4BIOA 3SYQA 4P9OA 5GW7A 3ASNB 2QWOB 4QE7A 2WLLB 3F5WC 4R50A 2XAHA 4F4LA 2PUSA 2ZDIC 2LGQA 1AR1B 5IYZA 4X1IA 3E35A 1Q6IA 1N0NA 4WF9V 2ZD9A 3WB2A 4GT1A 2GV9A 4DO2A 1GN2A 1OJHA 2EX3A 4CH5A 4LFAO 2E5LO 3C90A 3ABLB 5L3GA 1B3QA 4LF7B 4MTFA 3F7YC 4JTAB 4QIWF 4B08A 2KSDA 3E8BA 3EFFK 3JD0A 2LP7A 2D2CB 4LFAB 2E5LB 5C93A 5IWAO 4N21A 5LXTB 1N36B 4O4HB 5CA0A 1Q86W 3E22B 1YEWA 3KCYA 5IDJA 3K06A 2NR5A 3ABMB 2A06H 3RWRD 1RFYA 4DV4O 1H38A 4CZZA 4MT8A 2OCCC 4LF8O 3A0HZ 3OMNB 4IIJA 4PA6A 4QNHB 1BHBA 1QLNA 4DV4B 1M57B 1KKCA 5IYBO 2B9ZA 4LF8B 2IJJA 5GONA 3HPLC 4BW9A 4Z1MG 3IC9A 4JI5B 1BGYH 2EIMB 1J5EO 3A2FA 4WBNA 4BAYA 3P3NA 1K33A 2FTKA 2W0FC 4I55A 4JI1O 3SDLA 1HP8A 1QVFU 2IU3A 4DV5O 1ZL8A 2EIJB 1NU1H 4I9QA 5CMUA 1XMOO 5EIBC 2X6CA 3QO5A 2ZE8A 1V54C 1WA8A 1JA8A 2CE4A 4MVZA 1XMOB 1WP8A 4MTXA 3WG7C 3DC6A 2ETNA 4KHPB 4J9ZB 1DGSA 4DV6O 1Y6XA 3G80A 4YJ2B 3UCSC 3O9OA 3JAKB 5J2UA 3Q4HB 2YDEA 1BQZA 3ZMSA 2JGDB 4MS2A 2VQFO 4DV6B 4OX9O 2ATKC 3D36A 3OD4A 2Q6AA 3AG4C 2DW4A 2UU9O 3ABUA 4MTGA 2VQFB 1GKFA 4OX9B 4HNAB 2GBOA 1NTMH 1NZ6A 1IURA 2ZM6O 3CCLV 2UU9B 3H1IH 3SJBC 1JFFA 1PNLA 5EC1C 2PGGA 2Z5UA 1VARA 3JATA 4I0XB 2ZM6B 3UM7A 1S77D 5BZBA 3SGIA 2HKOA 4ICGA 1RPRA 1R6NA 3RYFA 2N74A 1KQSU 2LW7A 4WFHA 5LMUO 5EZYB 5BR8O 2JRIA 3CMAV 2IJHA 2YXHA 2A3QA 4P9PA 1QR8A 3J80N 2V4DA 3OAAG 4RO2A 4HAMA 4FM1A 3RBZA 2DOSA 2CUGA 2WLIB 5BR8B 1YJWV 4PI2A 1K97A 2UXBO 1R6KA 1SQFA 1GN4A 1WPXA 4XDKA 4CC6A 2P4KA 1L1FA 3OFNG 2Q8VA 5KA6A 3K0GA 2UXBB 1DLBA 1G8MA 1F7YA 3FB8C 1V9PA 1UPGA 1I94B 4TWKA 1YJ9V 2JDIG 4NXMO 1KECA 5B1OA 5J2TA 3CCJV 4YIOA 3K57A 5AG2A 5LYJA 4GKKO 2WLNA 4NXMB 2P6JA 1RM1B 4B3SO 1FXKC 3HKCB 1SZTA 4JV5B 1Q3EA 2OIGA 4J80A 3BY6A 5KUKA 1QQCA 4GKKB 4PV1B 1GAXA 2R9IA 5LGNA 3UT5A 2UXNA 4B3SB 4X88A 2IU0A 4WFBV 1GTOA 2B1GA 1RP3B 4UXNA 3CCQV 1NBMG 3D3IA 3CC4V 3T1HO 2YSUB 1V55B 4ZOLB 1YXBA 3HKDA 1M56C 1XOUA 3CRCA 3IC7A 4FFBB 2XAQA 3OTFA 5BMVB 2FL4A 4DR2O 1N32O 3W7UA 2FMLA 3WB0A 2PY5A 1QLEB 4F6EA 3T1HB 2DWDC 1WB8A 2ZDIA 1SQVH 1N32B 4U3FH 2V1DA 5CA1A 1ZWIC 1IXBA 3CRQA 1VQ4V 1IBLB 1US6A 4TOIA 3GWOA 4IT5A 3ZMVA 3OUSA 4UVCA 5LOVB 2QKCA 2PZSA 2JJ2G 2D3OW 4JI8O 5JCOA 3JD2A 3TXQA 5C8YA 4FK5C 4AI8A 4H33A 2V7QG 3JD3A 3FB7C 2IH3C 4FLXA 4JI8B 1O9GA 2ZNJA 3STLC 2UUBO 2QR4A 1YJNV 1QCEA 2ZQMA 1H8EG 5IYZB 1J95A 2YXLA 2WWWA 4NTWA 2KQXA 1ZUQA 4JI4O 1TUBB 3BCCH 2UUBB 2JS5A 1ZTEA 3OR6C 4DV1O 1OCZB 5LGTA 1VQPV 1OHHG 3CHXA 2RN9A 4JI4B 3JCUZ 4OGQB 5DN6G 4BR6A 1K73W 1WN7A 2EZPA 4DV1B 4LH7A 5IY5C 1GM9A 4KL1A 1BT8A 3JALB 1XHXA 3M99B 4R6ZA 4O2AA 4W4LA 3JASA 3QTCA 4GX5A 5CA0B 3E86A 2HHHO 2Y4UA 1JJ2U 2Q0OC 4E2LA 3APQA 4PA7A 4RQEA 2QA4V 2HHHB 4K35A 2N05A 5JH7A 2OYQA 4I50B 1QU7A 4PI0A 4TV8A 1R1BA 3BPZA 3RYIB 5IJ9A 1YTFD 1RPOA 1CPYA 1GMGA 2JGUA 3QO7A 4CH6A 5B5EZ 4LF9B 1Y74B 4L8JA 2QWNB 3BHPA 1Q7YW 4IHJB 1SF9A 1HNWO 4WBNB 1N4CA 2Q69A 3ZMUA 2HEPA 4H0LB 5FPRA 5B1NA 1FFTB 1HNWB 3AG2B 1MABG 2ZE5A 1OCCC 2GUZA 1F23A 4DRXA 3AG1C 2YS8A 3L73H 4DV3O 3EXAA 4MVRA 2QWRB 2DJVA 1NS1A 1VF7A 3LDDA 2W0XA 1QVGU 5CBGA 3JARA 2UXXA 1AR5A 1X4TA 3NXSA 2Q7HA 5LP6B 4O2BA 4DW0A 3P32A 4X1YA 2VWJA 1SQXH 1P84F 4DR4O 2QTSA 5FLXN 3NR7A 2QDOA 3CRMA 2P4VA 1G6UA 5H2FZ 3D36C 4DR4B 1EN5A 2HR3A 1SETA 1YCIA 4HZ3A 3FYEB 3P30A 2LFRA 1H2GA 1Q81W 2ZIOA 2DYSC 1H2NA 5KHJA 2UUAO 4GYCB 1K9MW 1Q5OA 3X2QB 4ZBMA 1M90W 2P5OA 3OT7A 4DV7O 2GDSA 1BQ0A 1COWG 1OCOB 5CBFA 1NVPD 1WPBA 4E4EA 1VMGA 3G67A 2R9AA 1FKAO 4DV7B 4X89A 2Y4TA 3M8AA 2EINC 2RJZA 5EK0A 2QWQB 3ZEDA 1YZBA 3A0RA 3ZMTA 2EIKC 2NNUA 4JPRA 1XQ8A 1NH2D 2KG7A 3BEHA 3ABKC 1FAFA 2JIZG 4J7KA 4DV2O 4Z2WA 2F23A 4JI2B 3P3PA 4LF5O 4R8CA 1W0KG 4DR1O 4RWUA 1B06A 5EC2C 5B3SC 3RW0A 1KUQA 3RYHB 1R3IC 1SA0A 2B1IA 4DV2B 2WLJA 3AG3C 1BZKA 4MW3A 3CSXA 5BY1A 3B77A 3ZRXA 5GTIZ 4DUZO 2EILC 3HKBB 4L87A 4PA9A 5B1AB 5LYJB 2ZR3A 4TUYA 4DR1B 3UO3A 5ITZB 2AZ2A 3D8CA 5LA6A 1VQLV 4DUZB 3ZHRA 3SPCA 4XDJA 1OV9A 3CPWU 3UT5B 4B7EA 3APOA 2X0LA 2X6BA 3MHSC 3U11A 1QBZA 1RSOA 4QPKA 4P30A 3OM3B 2QKSA 4I4TB 4JAUA 3H1LH 1LUVA 3CCRV 3OW2U 3IAYA 3SYAA 3IJ4A 1KKDA 2BTQB 4JYYA 5L3DA 4NVPA 2BSKA 4FMTA 4LCUC 1YSCA 4CC5A 1GO3F 3KZIZ 5H5NA 5L3FA 4GLXA 1K7DA 4PDVA 3ZRWB 4LF7O 4K8XA 2CDYA 2YEVB 4WFAV 2R9RB 4TV9A 5D5QA 4JI7B 5JJEB 1N36O 2AHYA 2GHYA 4BW5A 1I5YA 2RCVA 5KAIZ 4EB6B 1YI2V 3T4ZA 2FYUH 4UCUA 2LQTA 2F1MA 1SESA 4J10A 5JCOC 2AW9A 5KX5B 1VF5B 3ETQA 2OCCB 2K1EA 4K8ZA 3E2EA 1R3JC 3L70H 5B1BC 3RYCB 3FKSG 3OMAB 4RAIA 4JI5O 2K9PA 1M5IA 2EJRA 1R3LC 1VQ7V 4AHCA 1BHAA 3ZS8C 1GN3A 4CS3A 3R65A 3PJSK 4BIZA 4FLTA 1AROP 1O9HA 2A9HA 5FPOA 2QJ1A 2E75B 3CXHF 3GWKC 4O2AB 1FFXA 3SR2C 1V54B 3W7XA 1QR9A 4U7OA 4KHPO 3SPGA 1OCRC 4JYCA 3WG7B 3K9AA 4F6RB 5JH7B 4K3AA 2UUCO 1WLEA 1HNXO 1VQNV 1JCHA 1TVKA 5KLVH 2RQ6A 4ZHQB 4JYAO 2CH7B 1Y76A 5KMGA 2HJDA 5JWPA 2Z0AA 1HNXB 4DR7O 4DW1A 4I7ZB 5IYCO 4O4LA 4UCOA 4WFEA 5FNVB 1JR9A 3AG4B 3H1HH 4JYAB 4DR7B 2YI8A 3R66A 4JGSA 3JAMN 5KA5A 1GK9A 1A32A 4U7NA 2WLHA 1VQ8V 5E79Z 5KHKA 2RNBA 4X64O 3SPJA 4GZRB 1E1RG 2LO1A 1XNQO 4PA3A 4UVAA 3BRCA 3DTUB 5GTHZ 3MDSA 2IW5A 4X64B 4QGPA 4LNUB 4O2BB 1Z2GA 1XNQB 1BSMA 3K9SA 3DXRA 3L72H 1Q6UA 1BCCH 1SQPH 3IFXA 3CJHA 3CRRA 3QO8A 4NTXA 3CCEV 2XAGA 2ZE6A 5A9GA 5LHIA 1MSDA 5CB4B 1VQ9V 5JQGB 3S3XA 2P90A 2Q5ZA 5HFLA 3N27A 3OGIB 1I94O 4CS4A 1E79G 1R6TA 3RN4A 2Q9LA 3N2GA 4O4JB 3L75H 4UB8Z 1VQ5V 2HVJC 4X20A 2FKXA 3JYCA 3OEEG 2YXYA 2XHBA 3E89A 4JV5O 4G28B 1ORQC 2XUMA 1FXKB 1EZJA 2A0LA 2F95B 3SJCC 1IZ3A 2WSSG 2Y69C 1Y4MA 1L8DA 1HNZO 4DUYB 4LWSB 4QE9A 2Q68A 3OTOO 5JVDB 1VQOV 2RDCA 1M56B 1HNZB 1JQ0A 5H6QA 3DC5A 5F2VO 3OTOB 4LP8A 1JJOA 1MZFA 2JJ1G 4CH4A 3OMIB 2W6JG 5E1AC 1X59A 4MVMA 2CTQA 2IH1C 1XL4A 3B8MA 2F43G 2LW1A 1XUQA 1IBLO 1QHTA 3K08A 3FB6C 2OTJV 3TETA 2IJIA 4FIPC 4YJ3B 3KG2A 1U97A 3S3WA 4MVOA 4BWAA 4NR1A 4FM2A 1THZA 2ZINA 4JI3O 2GTAA 4CBCA 3VQXA 5DECA 3ZIAG 4D6TH 3U10A 4U3JB 1BL8A 1XEQA 2XOKG 4LFBO 4JI3B 1R3KC 2VWKA 3LUTB 3B2EE 1Q90D 1Q6HA 4JI0B 3K5OA 1DF5A 3JAWA 4X8AA 3QVNA 1FJGB 4LFBB 1L0NH 2YIAA 1GN6A 1K4CC 3OUFA 2KKWA 4X9QA 4UFZA 2DQ0A 2UUCB 4FM0A 3ZHSA 4X1IB 1P49A 1IBMB 3K59A 2YC0A 2OIEA 4O4HA 2Q67A 1BE3H 4YY3O 5BXZA 4WFFA 3E22A 5IY5B 1AI5A 4J9YB 1HDJA 4J7ZA 3RFRA 1XREA 4YY3B 3K5NA 1IXMA 3CE2A 4BIUA 2JEXA 1VF6A 2VS0A 2EJ7A 2ZXWC 2VRZA 2P22C 2NN4A 4O4IA 3AK1A 1EN4A 1JMKC 1KP3A 4MSWC 1Q8IA 1EFRG 3K3WA 2EULA 2Y48A 2L6LA 2LFSA 1AR4A 4IIJB 3FX7A 4LF9O 2R72A 4Q20A 2JK5C 1XL6A 3CP1A 1AVMA 2QEXV 1KP2A 2X7RB 3LNNA 3ML0A 4X65B 4B3MB 5GONB 1H2SB 4XBFA 3WB1A 3H1JH 4DV0O 1FXVA 2GSMB 4K0KO 1PD3A 1R73A 2QM7A 3JSNA 4GUNA 1EBOA 2F4VO 3B40A 4DK0A 4I55B 2W6IG 1TGOA 3W7WA 4DV0B 1OCCB 3CC2V 3K58A 4K0KB 2CGNA 1ZL8B 4YJ2A 3AG1B 3ASOC 4MVSA 3JAKA 2F4VB 3BFRA 4LF6O 1ZLZA 1Q82W 3KCXA 1YF2A 2M6YA 1WA8B 4OPAA 5L3EA 1K5QA 3SPHA 4LBEC 4LF6B 3OEHG 3T1CA 4PDRA 2P7TC 2GTSA 3E8GA 1PP9H 1GM8A 3E8FA 4FJCC 4FZ0A 4DR3O 1MZEA 4HNAA 4DK1A 4JASA 1XMQO 2CTPA 3BA8A 5J2UB 4KUMA 1D5NA 1Y76B 2ITCC 2BOBC 4PELA 1P4RA 1TUEB 4O4LB 3D3QA 1HR0O 3H1KH 3LSUA 2AHZA 4DR3B 1XMQB 1AB3A 1FD9A 4LH6A 4I0XA 5DEDA 1P7BA 3ZRSA 4GX1A 1S0VA 1HR0B 3ZHQA 1KC8W 3TJTA 2YUAA 1FS0G 2DYSB 3C3SA 1JFFB 2WAMA 3N2KA 3JATB 5KHIA 2WLIA 4TQDA 1SQGA 3M7MX 1Q43A 3ZHUA 3RYFB 1FPOA 1SQQH 3THOA 3RGBA 2H3OA 1HW7A 3BA9A 1H8HG 4ABMA 4FPPA 4MTOA 2EINB 4B7KA 2YIDA 4JTDB 1M1KW 1VEWA 1AJPA 2XAJA 2EIKB 1NR7A 1S3JA 1DF4A 2BCCH 2ITDC 4JI2O 1UFIA 3ZHVA 3ABKB 2AXTZ 5KUMA 3B4SA 1GRJA 3B8NA 3K04A 3WU2Z 3BVOA 5B3SB 1K4DC 4EFBA 3AG3B 4FLZA 2YICA 5J2TB 2WPDG 2DYRC 2EILB 1NKDA 4PDMA 5L3BA 2IBZH 1LR1A 2DMXA 1IBKO 4ZOLA 4AQYO 2QWPB 4FFBA 3CS5A 4CH3A 2M7WA 2QKAA 1MSWD 3ZCCA 1BMFG 1WAZA 1IBKB 4EFEA 4AQYB 1KD1W 3ZRVA 1TA8A 3STZC 1W59A 3TK1A 3ZX6A 2EZOA 2IM9A 3HKDB 3JD1A 1SRYA 4JI6O 2HVKC 1VQMV 4EKWA 4TQFA 1U96A 3ETDA 5LOVA 1SQBH 1ROPA 4JI6B 4FLUA 1GM7A 1S76D 1LUWA 1PL4A 3GB7C 1DK1A 4DXWA 5CA1B 3FD9A 2A79B 4J7JA 4JI7O 4A5UB 2DWEC 5H9CA 1I5XA 1GH6A 5JJJB 1AJNA 2LGWA 5LHHA 3CB2A 2ZIMA 3CCMV 2BE3A 2P67A 3TGUH 1MOFA 2JVDA 1MA1A 3ASNC 1AILA 3HB3B 2YIBA 4LC1A 4DYLA 1PPJH 2ZCEA 1TUBA 3A0BZ 3JAWB 4AILC 3MD0A 2WLMA 5C8YB 3TCUA 4ZI7A 5K1PA 1SERA 3U0ZA 3G6EV 3K0DA 3FAVA 4IGGA 5LBQA 1ZX3A 1EM1A 1URFA 3RVZA 3T2MA 1D5AA 2B5UA 5B1BB 2YIBD 3FB5C 3ABLC 3ZJZA 3JALA 2WA4A 3TXSA 3ZHTA 4JAAA 3BAAA 3MAQA 3EVKA 5CN0A 2H8PC 5LMNO 1Y66A 3FYIB 3WFVA 4UB6Z 4MW8A 3EHBB 4N23A 5FL7G 1L0LH 3SYPA 5IWAB 2DN9A 5HFMA 3ABMC 5LMNB 5DM6V 4NKGB 1XDCA 4RUFA 5KHHA 2WLKA 4H37A 4I50A 1VP7A 5IJ0A 3ZBHA 1YTFB 3RYIA 1NQTA 2BTOA 1I08A 3JASB 1NI8A 2Q73A 1M57C 1MG1A 1Y74A 1OCRB 1VF6C 4FLYA 4O4IB 1Z5VA 4IHJA 4X1KA 4OXSA 2X6AA 2EIMC 3L9DA 5TISZ 2Q4PA 1OZ0A 2Q7GA 4WCEV 4J11A 2FB5A 4TV8B 1QNMA 2CAZC 5IJ9B 1J5EB 5LHGA 4JI1B 2EIJC 1N0JA 1M9NA 5JJNB 1FYJA 4DV5B 3QG5A 5D5PA 2UXCO 4MVQA 2MW2B 2ODMA 2E76B 4J42A 4JF3A 4JYBA 4NTYA 1YHQV 2UXCB 2GUZB 4PD4F 5LP6A 2MK3A 1DTOA 4DRXB 1PV0A 1NT2B 3F5TA 2HFEC 5IT9N 3LDEA 3CYOA 1JX9A 2DE0X 2PI4A 2ZE7A 4JZGA 5A2QN 3JARB 2L35A 4UCSA 2F93B 4X1YB 1AI6A 2N04A 2WA3A 1WNSA 4RQFA 1VIBA 1HWYA 1KMIZ 2PTMA 1IDSA 1AJQA 3VQYA 3PN1A 4LFCO 3RVYA 2AZ0A 3VQVA 4WFGA 3E83A 4OPHA 3CCUV 3GVMA 4LFCB 1NVPB 4ASUG 4P2ZA 3UQ8A 3C3TA 2P06A 3CX5F 3CXCU 1G4YB 3N2KB 5EYPA 3AK3A 2QE7G 1NJIW 3KKYA 5LMUB 1MNGA 1AP5A 3IGAC 1K5SA 1PKXA 1I0HA 1NH2B 1MMMA 5CBHA 1WB7A 5J9PC 3VOUA 4DUYO 2Y69B 1XBLA 3LSQA 2UXDO 2HLDG 1F4NA 2QGNA 1IX9A 1YVWA 1S72V 1H2LA 2ZT9B 2QM4A 2UXDB 1Y67A 1B04A 2Q7EA 3RYHA 3K5MA 1XILA 3CEIA 4R7CA 1N34O 1T5EA 3HKBA 4NB5A 3JD4A 2KG7B 5ITZA 4C7UA 2XAFA 1N34B 1JPXA 1NTZH 1RM1C 4FLWA 2ADPA 2Y0IA 5LGUA 4JTCB 1WJZA 1SA0B 3AG7A 3K03A 3JSLA 1K34A 1ZSPA 1N33O 1XHZA 4EEQA 5K1XA 4I9WA 4TUYB 3OGCC 4Q6GA 1V55C 1JVMA 4I4TA 4PDLA 2VQEO 3HKEA 1N33B 5LA6B 1VQ6V 4JI0O 4DR6O 3I56V 2WLLA 1QLEC 4PHZA 1FJGO 2BTQA 4DR2B 2VQEB 5IYDO 1M4UA 3E8HA 4DR6B 1H2MA 2AGAA 4IYIA 2RMKB 4W4KA 4FVMA 1RSOB 1B6QA 4CS2A 5EBMC 4UUJC 2ARHA 1S5HC 3ZRWA 2CTWA
chains in the Genus database with same CATH topology
4LH6A 1KU9A 4CC5A 2UU9B 1HR0B 3SJBC 1JFFA 4GLXA 2PGGA 4EB6A 4K8XA 3JATA 2ZM6B 4D7TA 5D5QA 4TV9A 2R70A 4JI7B 3SGIA 5LXTA 5JJEB 1JFFB 3RYFA 4YHHB 2Q0AA 3N2KA 4EB6B 5KX5A 3JATB 5KHIA 5EZYB 4TQDA 4UCUA 4TV9B 3FFQA 1SQGA 3M7MX 2F1MA 2V4DA 1Q43A 3RYFB 5JCOC 5KX5B 4FM1A 3RYCA 3ETQA 5BR8B 3THOA 3RGBA 4PI2A 1HW7A 3BA9A 4K8ZA 1SQFA 4ZI7B 4CC6A 3RYCB 4GKJB 1M5IA 2UXBB 4AHCA 3ZS8C 1V9PA 4CS3A 4X66B 1I94B 4D7SA 5J2TA 4FLTA 1O9HA 1ZAUA 5FPOA 4B3RB 2QJ1A 3K57A 5LYJA 4EFBA 4NXMB 4FLZA 4O2AB 2F66C 5J2TB 1I7FA 1FFXA 3HKCB 3SR2C 3K5LA 4JV5B 4F6RA 1Q3EA 1XNRB 1QQCA 4GKKB 4ZOLA 1M93A 4NXNB 5IJ0B 4FFBA 3UT5A 4CH3A 4ZHQA 2PYLA 4B3SB 1FFXB 5EIBD 4F6RB 5JH7B 1IBKB 4EFEA 4ZOLB 4AQYB 3HKDA 1TA8A 1TVKA 4X1KB 4FFBB 3OTFA 4UCRA 5FNVA 2RQ6A 4ZHQB 5BMVB 2OWOA 2PY5A 3WB0A 5KMGA 1HNXB 3T1HB 2IM9A 3HKDB 1TVKB 4O4LA 4UCOA 5FNVB 1Z5WA 1N32B 4JYAB 5CA1A 5KMGB 4DR7B 4UCTA 4TQFA 2YI8A 4DR5B 5LOVA 1IBLB 4FLUA 1XI1A 4JI6B 4TOIA 5KHKA 4HBNA 5CA1B 4DV3B 5LOVB 5KHGA 2PZSA 4ZIBA 4LNUA 5JJJB 3BRCA 3BABA 3CB2A 2ZIMA 5EZYA 5LP6C 5JCOA 2JVDA 4X64B 5C8YA 2YIBA 2ZCEA 4LNUB 4O2BB 1XNQB 1TUBA 4LR3A 4LF4B 4FLXA 4JI8B 1O9GA 2ZNJA 3JAWB 4AILC 5CB4A 3QF7A 5JQGA 1SKVA 5C8YB 4ZI7A 5K1PA 5IYZB 2YXLA 3U0ZA 1TUBB 2UUBB 5CB4B 2JS5A 5JQGB 1D5AA 2YIBD 4O4JA 3CHXA 2ZNIA 4JI4B 3JALA 4CS4A 3BAAA 3MAQA 1WN7A 4DV1B 4LH7A 3N2GA 4X62B 2UUAB 4KL1A 4O4JB 3JALB 2YI9A 1XHXA 4X20A 5IWAB 4O2AA 5LMNB 2E3CA 3JASA 2XHBA 3QTCA 5CA0B 3HKCA 5EYPB 3N2GB 5KHHA 4I50A 2PYJA 5IJ0A 3SJCC 4X20B 2F95B 3RYIA 5JVDA 2BTOA 3DSQA 3JASB 1L8DA 2HHHB 5JH7A 4DUYB 2OYQA 4I50B 4PI0A 4TV8A 4FLYA 3BPZA 4O4IB 1Z5VA 4IHJA 4X1KA 3RYIB 5IJ9A 5JVDB 5BMVA 3ICXA 2JGUA 1HNZB 2Q7GA 4CH6A 4LF9B 4B3TB 4TV8B 4L8JA 3BHPA 3OTOB 1JJOA 4IHJB 3VQWA 5IJ9B 2CAZC 1J5EB 4CH4A 4WBNB 4YJ3A 2HEPA 4JI1B 5FPRA 4LF5B 5JJNB 4DV5B 3QG5A 1HNWB 1QHTA 5D5PA 3T1YB 4YJ3B 4DRXA 4U3JA 4BWAA 4FM2A 2ZINA 3VQXA 2UXCB 5LP6A 4FLVA 3U10A 4DRXB 1S5JA 4U3JB 3SJAC 1NT2B 1VF7A 1TAEA 4UCVA 3JARA 4JI3B 2VWKA 1X4TA 3B2EE 3HKEB 2Q7HA 5LP6B 4O2BA 4JI0B 3K5OA 4X1YA 2VWJA 3JAWA 1FJGB 4LFBB 2YIAA 3JARB 4UCSA 2F93B 2PUSA 5IYZA 4X1IA 1G6UA 4X1YB 2KKWA 4DR4B 3WB2A 1WNSA 4UFZA 2GV9A 2UUCB 1KMIZ 2PTMA 4FM0A 4X1IB 1P49A 3VQYA 3PN1A 2EX3A 4CH5A 1IBMB 3K59A 4O4HA 3VQVA 2ZIOA 4LF7B 5KHJA 3E22A 4B08A 4LFCB 4GYCB 1Q5OA 4LFAB 2E5LB 5LXTB 1N36B 4O4HB 3UQ8A 3RFRA 2P5OA 4YY3B 5CA0A 3N2KB 5EYPA 3E22B 1YEWA 3K5NA 5LMUB 3RWRD 1WPBA 2R9AA 4DV7B 4IIJA 2P22C 2RJZA 4O4IA 3ZEDA 4DV4B 1JMKC 1Q8IA 4LF8B 1XQ8A 5GONA 4IIJB 4BW9A 2QM4A 2R72A 4JI5B 2UXDB 1B04A 2Q7EA 3RYHA 3K5MA 4JI2B 3LNNA 3A2FA 4WBNA 1T5EA 4X65B 4B3MB 3HKBA 5GONB 4I55A 1H2SB 3WB1A 5ITZA 3RYHB 1SA0A 4DV2B 4I9QA 3JSNA 3CSXA 1N34B 5EIBC 3HKBB 4DK0A 5LYJB 4I55B 4FLWA 1TGOA 4TUYA 4DV0B 4DR1B 3K58A 5ITZB 4K0KB 1SA0B 4YJ2A 3JSLA 1XMOB 3JAKA 5LA6A 1XHZA 2F4VB 4EEQA 4DUZB 5K1XA 4TUYB 4KHPB 1DGSA 3UT5B 4Q6GA 4YJ2B 4I4TA 3HKEA 3JAKB 5LA6B 1N33B 5J2UA 4LF6B 3U11A 1RSOA 4PHZA 4DV6B 2BTQA 4HNAA 4I4TB 4DK1A 4DR2B 2VQEB 1M4UA 3BA8A 4DR6B 5J2UB 4FVMA 2VQFB 3IAYA 4CS2A 4O4LB 4OX9B 2BTQB 4DR3B 4HNAB 4NVPA 1XMQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THO A;  1X4T A;  3SJC C;  3SJB C;  1SKV A;  3CSX A;  2F66 C;  2JS5 A;  3ICX A;  2P22 C;  3QG5 A;  3QF7 A;  1NT2 B;  3B2E E;  3SJA C;  3ZS8 C;  2CAZ C; 
#chains in the Genus database with same CATH topology
 3J7A U;  1KU9 A;  1KYO F;  4TT3 G;  2YEV A;  3ABT A;  1AI7 A;  3O65 A;  1IBM O;  1F4M A;  3UKM A;  4YHH O;  4QJF B;  2BSK B;  4EB6 A;  3SPI A;  1K92 A;  2ADQ B;  4D7T A;  2R70 A;  1PNM A;  4MVU A;  3G6B A;  5LXT A;  2G38 A;  3QNE A;  4Z1V A;  4YHH B;  2Q0A A;  2QM8 A;  5KX5 A;  2O57 A;  4TV9 B;  3FFQ A;  2C2A A;  1W2B U;  2JS3 A;  1BS3 A;  4JAV A;  3AK2 A;  3RYC A;  4GKJ O;  4IYH A;  4J41 A;  1ENV A;  3LSS A;  1VQK V;  1H2K A;  2ZXW B;  4ZI7 B;  1CXZ B;  2NLJ C;  3FAV B;  4X66 O;  1EZV H;  1OCZ C;  4GKJ B;  2OT5 A;  1SS3 A;  5CA3 A;  3RT3 C;  3LNM B;  3ZN0 A;  4GX2 A;  4X65 O;  4B3R O;  4H13 B;  4B3M O;  4X66 B;  4D7S A;  1CP9 A;  1ZAU A;  4GX0 A;  2BOC C;  4B3R B;  1XNR O;  1N8R W;  4NXN O;  1YDX A;  3CD6 V;  2F66 C;  1I7F A;  3ETE A;  3K5L A;  4F6R A;  2IJK A;  1XNR B;  3CWB H;  1M93 A;  4NXN B;  5IJ0 B;  3ASO B;  1PNK A;  4KFM A;  4ZHQ A;  2PYL A;  3JCZ A;  1FFX B;  5EIB D;  1PM9 A;  2CH7 A;  3Q4H A;  2JGD A;  4X1K B;  3MHH C;  4RUE A;  4NYK A;  4UCR A;  5FNV A;  3OE7 G;  2ZKO A;  2OWO A;  2CTR A;  3ZN1 A;  4IL6 Z;  3J81 N;  1CEZ A;  1S5L Z;  1TVK B;  4DR5 O;  2JEU A;  1Z5W A;  3W7T A;  2DQ3 A;  4I5S A;  3AG2 C;  3G71 V;  3CCV V;  5KMG B;  4UCT A;  4DR5 B;  3VBB A;  1XI1 A;  3I55 V;  3L71 H;  4XDL A;  4HBN A;  2PI5 A;  3LDC A;  4DV3 B;  5KHG A;  3SYO A;  3CC7 V;  4ZIB A;  3UO2 A;  4LNU A;  3G4S V;  1P7G A;  4PJ0 Z;  3BAB A;  4LF4 O;  5EZY A;  5LP6 C;  1K8A W;  5B66 Z;  1D2D A;  4JZ2 A;  4UVB A;  4LR3 A;  4LF4 B;  2XAS A;  2LJ2 A;  2Z3Y A;  5LL6 Y;  2HP8 A;  5CB4 A;  3QF7 A;  3ZMZ A;  3L74 H;  3CCS V;  2KB1 A;  4YXW G;  5JQG A;  1SKV A;  1UJW B;  1W0J G;  5KAF Z;  1FXH A;  3DXR B;  2XTA A;  1NTK H;  3H9V A;  1AI4 A;  4UV8 A;  3CJH B;  4PA4 A;  4X62 O;  1KBH A;  4O4J A;  2ZNI A;  4G2K A;  4ZKI A;  4FZ1 A;  3B09 A;  4QPJ A;  3H01 A;  1NR1 A;  4G27 B;  1JOY A;  1WP7 A;  4TSF G;  3X2Q C;  5EBL C;  4X62 B;  2UUA B;  3AEI A;  2YI9 A;  1FXK A;  3CME V;  3HR0 A;  3ETG A;  4FFK A;  2CGO A;  1OCO C;  2E3C A;  2E74 B;  4KP4 A;  3W7S A;  3HKC A;  5EYP B;  3N2G B;  1SZX A;  4LWS A;  2DYR B;  2ZR2 A;  2PYJ A;  4X20 B;  1KB9 F;  5JVD A;  2XND G;  3DSQ A;  3A8T A;  4HYO A;  5EBW C;  3T4D A;  4GCZ A;  4B3T O;  2ILM A;  1YIT V;  1K3E A;  2XT9 A;  1E1Q G;  5IE9 A;  3SJQ C;  5BMV A;  3ICX A;  1LNQ A;  4KXR A;  4B3T B;  1G1X B;  2H94 A;  3CRA A;  2EBO A;  3VQW A;  2OTL V;  3DGE A;  3OR7 C;  1F51 A;  1PL0 A;  3T1Y O;  4YJ3 A;  3K79 A;  4LF5 B;  3I5D A;  2PF4 E;  5B1A C;  1YIJ V;  1SC5 B;  2QTO A;  3T1Y B;  4UV9 A;  2HG5 C;  4U3J A;  2A7W A;  1IVS A;  2HJF C;  2QSA A;  4H44 B;  2CK3 G;  4FLV A;  3SYC A;  2OCH A;  1S5J A;  2Y0P A;  5H6R A;  3SJA C;  3F7V C;  1EN6 A;  4YIP A;  1TAE A;  5L3C A;  4UCV A;  3HKE B;  1AP6 A;  4BIO A;  3SYQ A;  4P9O A;  5GW7 A;  3ASN B;  2QWO B;  4QE7 A;  2WLL B;  3F5W C;  4R50 A;  2XAH A;  4F4L A;  2PUS A;  2ZDI C;  2LGQ A;  1AR1 B;  5IYZ A;  4X1I A;  3E35 A;  1Q6I A;  1N0N A;  4WF9 V;  2ZD9 A;  3WB2 A;  4GT1 A;  2GV9 A;  4DO2 A;  1GN2 A;  1OJH A;  2EX3 A;  4CH5 A;  4LFA O;  2E5L O;  3C90 A;  3ABL B;  5L3G A;  1B3Q A;  4LF7 B;  4MTF A;  3F7Y C;  4JTA B;  4QIW F;  4B08 A;  2KSD A;  3E8B A;  3EFF K;  3JD0 A;  2LP7 A;  2D2C B;  4LFA B;  2E5L B;  5C93 A;  5IWA O;  4N21 A;  5LXT B;  1N36 B;  4O4H B;  5CA0 A;  1Q86 W;  3E22 B;  1YEW A;  3KCY A;  5IDJ A;  3K06 A;  2NR5 A;  3ABM B;  2A06 H;  3RWR D;  1RFY A;  4DV4 O;  1H38 A;  4CZZ A;  4MT8 A;  2OCC C;  4LF8 O;  3A0H Z;  3OMN B;  4IIJ A;  4PA6 A;  4QNH B;  1BHB A;  1QLN A;  4DV4 B;  1M57 B;  1KKC A;  5IYB O;  2B9Z A;  4LF8 B;  2IJJ A;  5GON A;  3HPL C;  4BW9 A;  4Z1M G;  3IC9 A;  4JI5 B;  1BGY H;  2EIM B;  1J5E O;  3A2F A;  4WBN A;  4BAY A;  3P3N A;  1K33 A;  2FTK A;  2W0F C;  4I55 A;  4JI1 O;  3SDL A;  1HP8 A;  1QVF U;  2IU3 A;  4DV5 O;  1ZL8 A;  2EIJ B;  1NU1 H;  4I9Q A;  5CMU A;  1XMO O;  5EIB C;  2X6C A;  3QO5 A;  2ZE8 A;  1V54 C;  1WA8 A;  1JA8 A;  2CE4 A;  4MVZ A;  1XMO B;  1WP8 A;  4MTX A;  3WG7 C;  3DC6 A;  2ETN A;  4KHP B;  4J9Z B;  1DGS A;  4DV6 O;  1Y6X A;  3G80 A;  4YJ2 B;  3UCS C;  3O9O A;  3JAK B;  5J2U A;  3Q4H B;  2YDE A;  1BQZ A;  3ZMS A;  2JGD B;  4MS2 A;  2VQF O;  4DV6 B;  4OX9 O;  2ATK C;  3D36 A;  3OD4 A;  2Q6A A;  3AG4 C;  2DW4 A;  2UU9 O;  3ABU A;  4MTG A;  2VQF B;  1GKF A;  4OX9 B;  4HNA B;  2GBO A;  1NTM H;  1NZ6 A;  1IUR A;  2ZM6 O;  3CCL V;  2UU9 B;  3H1I H;  3SJB C;  1JFF A;  1PNL A;  5EC1 C;  2PGG A;  2Z5U A;  1VAR A;  3JAT A;  4I0X B;  2ZM6 B;  3UM7 A;  1S77 D;  5BZB A;  3SGI A;  2HKO A;  4ICG A;  1RPR A;  1R6N A;  3RYF A;  2N74 A;  1KQS U;  2LW7 A;  4WFH A;  5LMU O;  5EZY B;  5BR8 O;  2JRI A;  3CMA V;  2IJH A;  2YXH A;  2A3Q A;  4P9P A;  1QR8 A;  3J80 N;  2V4D A;  3OAA G;  4RO2 A;  4HAM A;  4FM1 A;  3RBZ A;  2DOS A;  2CUG A;  2WLI B;  5BR8 B;  1YJW V;  4PI2 A;  1K97 A;  2UXB O;  1R6K A;  1SQF A;  1GN4 A;  1WPX A;  4XDK A;  4CC6 A;  2P4K A;  1L1F A;  3OFN G;  2Q8V A;  5KA6 A;  3K0G A;  2UXB B;  1DLB A;  1G8M A;  1F7Y A;  3FB8 C;  1V9P A;  1UPG A;  1I94 B;  4TWK A;  1YJ9 V;  2JDI G;  4NXM O;  1KEC A;  5B1O A;  5J2T A;  3CCJ V;  4YIO A;  3K57 A;  5AG2 A;  5LYJ A;  4GKK O;  2WLN A;  4NXM B;  2P6J A;  1RM1 B;  4B3S O;  1FXK C;  3HKC B;  1SZT A;  4JV5 B;  1Q3E A;  2OIG A;  4J80 A;  3BY6 A;  5KUK A;  1QQC A;  4GKK B;  4PV1 B;  1GAX A;  2R9I A;  5LGN A;  3UT5 A;  2UXN A;  4B3S B;  4X88 A;  2IU0 A;  4WFB V;  1GTO A;  2B1G A;  1RP3 B;  4UXN A;  3CCQ V;  1NBM G;  3D3I A;  3CC4 V;  3T1H O;  2YSU B;  1V55 B;  4ZOL B;  1YXB A;  3HKD A;  1M56 C;  1XOU A;  3CRC A;  3IC7 A;  4FFB B;  2XAQ A;  3OTF A;  5BMV B;  2FL4 A;  4DR2 O;  1N32 O;  3W7U A;  2FML A;  3WB0 A;  2PY5 A;  1QLE B;  4F6E A;  3T1H B;  2DWD C;  1WB8 A;  2ZDI A;  1SQV H;  1N32 B;  4U3F H;  2V1D A;  5CA1 A;  1ZWI C;  1IXB A;  3CRQ A;  1VQ4 V;  1IBL B;  1US6 A;  4TOI A;  3GWO A;  4IT5 A;  3ZMV A;  3OUS A;  4UVC A;  5LOV B;  2QKC A;  2PZS A;  2JJ2 G;  2D3O W;  4JI8 O;  5JCO A;  3JD2 A;  3TXQ A;  5C8Y A;  4FK5 C;  4AI8 A;  4H33 A;  2V7Q G;  3JD3 A;  3FB7 C;  2IH3 C;  4FLX A;  4JI8 B;  1O9G A;  2ZNJ A;  3STL C;  2UUB O;  2QR4 A;  1YJN V;  1QCE A;  2ZQM A;  1H8E G;  5IYZ B;  1J95 A;  2YXL A;  2WWW A;  4NTW A;  2KQX A;  1ZUQ A;  4JI4 O;  1TUB B;  3BCC H;  2UUB B;  2JS5 A;  1ZTE A;  3OR6 C;  4DV1 O;  1OCZ B;  5LGT A;  1VQP V;  1OHH G;  3CHX A;  2RN9 A;  4JI4 B;  3JCU Z;  4OGQ B;  5DN6 G;  4BR6 A;  1K73 W;  1WN7 A;  2EZP A;  4DV1 B;  4LH7 A;  5IY5 C;  1GM9 A;  4KL1 A;  1BT8 A;  3JAL B;  1XHX A;  3M99 B;  4R6Z A;  4O2A A;  4W4L A;  3JAS A;  3QTC A;  4GX5 A;  5CA0 B;  3E86 A;  2HHH O;  2Y4U A;  1JJ2 U;  2Q0O C;  4E2L A;  3APQ A;  4PA7 A;  4RQE A;  2QA4 V;  2HHH B;  4K35 A;  2N05 A;  5JH7 A;  2OYQ A;  4I50 B;  1QU7 A;  4PI0 A;  4TV8 A;  1R1B A;  3BPZ A;  3RYI B;  5IJ9 A;  1YTF D;  1RPO A;  1CPY A;  1GMG A;  2JGU A;  3QO7 A;  4CH6 A;  5B5E Z;  4LF9 B;  1Y74 B;  4L8J A;  2QWN B;  3BHP A;  1Q7Y W;  4IHJ B;  1SF9 A;  1HNW O;  4WBN B;  1N4C A;  2Q69 A;  3ZMU A;  2HEP A;  4H0L B;  5FPR A;  5B1N A;  1FFT B;  1HNW B;  3AG2 B;  1MAB G;  2ZE5 A;  1OCC C;  2GUZ A;  1F23 A;  4DRX A;  3AG1 C;  2YS8 A;  3L73 H;  4DV3 O;  3EXA A;  4MVR A;  2QWR B;  2DJV A;  1NS1 A;  1VF7 A;  3LDD A;  2W0X A;  1QVG U;  5CBG A;  3JAR A;  2UXX A;  1AR5 A;  1X4T A;  3NXS A;  2Q7H A;  5LP6 B;  4O2B A;  4DW0 A;  3P32 A;  4X1Y A;  2VWJ A;  1SQX H;  1P84 F;  4DR4 O;  2QTS A;  5FLX N;  3NR7 A;  2QDO A;  3CRM A;  2P4V A;  1G6U A;  5H2F Z;  3D36 C;  4DR4 B;  1EN5 A;  2HR3 A;  1SET A;  1YCI A;  4HZ3 A;  3FYE B;  3P30 A;  2LFR A;  1H2G A;  1Q81 W;  2ZIO A;  2DYS C;  1H2N A;  5KHJ A;  2UUA O;  4GYC B;  1K9M W;  1Q5O A;  3X2Q B;  4ZBM A;  1M90 W;  2P5O A;  3OT7 A;  4DV7 O;  2GDS A;  1BQ0 A;  1COW G;  1OCO B;  5CBF A;  1NVP D;  1WPB A;  4E4E A;  1VMG A;  3G67 A;  2R9A A;  1FKA O;  4DV7 B;  4X89 A;  2Y4T A;  3M8A A;  2EIN C;  2RJZ A;  5EK0 A;  2QWQ B;  3ZED A;  1YZB A;  3A0R A;  3ZMT A;  2EIK C;  2NNU A;  4JPR A;  1XQ8 A;  1NH2 D;  2KG7 A;  3BEH A;  3ABK C;  1FAF A;  2JIZ G;  4J7K A;  4DV2 O;  4Z2W A;  2F23 A;  4JI2 B;  3P3P A;  4LF5 O;  4R8C A;  1W0K G;  4DR1 O;  4RWU A;  1B06 A;  5EC2 C;  5B3S C;  3RW0 A;  1KUQ A;  3RYH B;  1R3I C;  1SA0 A;  2B1I A;  4DV2 B;  2WLJ A;  3AG3 C;  1BZK A;  4MW3 A;  3CSX A;  5BY1 A;  3B77 A;  3ZRX A;  5GTI Z;  4DUZ O;  2EIL C;  3HKB B;  4L87 A;  4PA9 A;  5B1A B;  5LYJ B;  2ZR3 A;  4TUY A;  4DR1 B;  3UO3 A;  5ITZ B;  2AZ2 A;  3D8C A;  5LA6 A;  1VQL V;  4DUZ B;  3ZHR A;  3SPC A;  4XDJ A;  1OV9 A;  3CPW U;  3UT5 B;  4B7E A;  3APO A;  2X0L A;  2X6B A;  3MHS C;  3U11 A;  1QBZ A;  1RSO A;  4QPK A;  4P30 A;  3OM3 B;  2QKS A;  4I4T B;  4JAU A;  3H1L H;  1LUV A;  3CCR V;  3OW2 U;  3IAY A;  3SYA A;  3IJ4 A;  1KKD A;  2BTQ B;  4JYY A;  5L3D A;  4NVP A;  2BSK A;  4FMT A;  4LCU C;  1YSC A;  4CC5 A;  1GO3 F;  3KZI Z;  5H5N A;  5L3F A;  4GLX A;  1K7D A;  4PDV A;  3ZRW B;  4LF7 O;  4K8X A;  2CDY A;  2YEV B;  4WFA V;  2R9R B;  4TV9 A;  5D5Q A;  4JI7 B;  5JJE B;  1N36 O;  2AHY A;  2GHY A;  4BW5 A;  1I5Y A;  2RCV A;  5KAI Z;  4EB6 B;  1YI2 V;  3T4Z A;  2FYU H;  4UCU A;  2LQT A;  2F1M A;  1SES A;  4J10 A;  5JCO C;  2AW9 A;  5KX5 B;  1VF5 B;  3ETQ A;  2OCC B;  2K1E A;  4K8Z A;  3E2E A;  1R3J C;  3L70 H;  5B1B C;  3RYC B;  3FKS G;  3OMA B;  4RAI A;  4JI5 O;  2K9P A;  1M5I A;  2EJR A;  1R3L C;  1VQ7 V;  4AHC A;  1BHA A;  3ZS8 C;  1GN3 A;  4CS3 A;  3R65 A;  3PJS K;  4BIZ A;  4FLT A;  1ARO P;  1O9H A;  2A9H A;  5FPO A;  2QJ1 A;  2E75 B;  3CXH F;  3GWK C;  4O2A B;  1FFX A;  3SR2 C;  1V54 B;  3W7X A;  1QR9 A;  4U7O A;  4KHP O;  3SPG A;  1OCR C;  4JYC A;  3WG7 B;  3K9A A;  4F6R B;  5JH7 B;  4K3A A;  2UUC O;  1WLE A;  1HNX O;  1VQN V;  1JCH A;  1TVK A;  5KLV H;  2RQ6 A;  4ZHQ B;  4JYA O;  2CH7 B;  1Y76 A;  5KMG A;  2HJD A;  5JWP A;  2Z0A A;  1HNX B;  4DR7 O;  4DW1 A;  4I7Z B;  5IYC O;  4O4L A;  4UCO A;  4WFE A;  5FNV B;  1JR9 A;  3AG4 B;  3H1H H;  4JYA B;  4DR7 B;  2YI8 A;  3R66 A;  4JGS A;  3JAM N;  5KA5 A;  1GK9 A;  1A32 A;  4U7N A;  2WLH A;  1VQ8 V;  5E79 Z;  5KHK A;  2RNB A;  4X64 O;  3SPJ A;  4GZR B;  1E1R G;  2LO1 A;  1XNQ O;  4PA3 A;  4UVA A;  3BRC A;  3DTU B;  5GTH Z;  3MDS A;  2IW5 A;  4X64 B;  4QGP A;  4LNU B;  4O2B B;  1Z2G A;  1XNQ B;  1BSM A;  3K9S A;  3DXR A;  3L72 H;  1Q6U A;  1BCC H;  1SQP H;  3IFX A;  3CJH A;  3CRR A;  3QO8 A;  4NTX A;  3CCE V;  2XAG A;  2ZE6 A;  5A9G A;  5LHI A;  1MSD A;  5CB4 B;  1VQ9 V;  5JQG B;  3S3X A;  2P90 A;  2Q5Z A;  5HFL A;  3N27 A;  3OGI B;  1I94 O;  4CS4 A;  1E79 G;  1R6T A;  3RN4 A;  2Q9L A;  3N2G A;  4O4J B;  3L75 H;  4UB8 Z;  1VQ5 V;  2HVJ C;  4X20 A;  2FKX A;  3JYC A;  3OEE G;  2YXY A;  2XHB A;  3E89 A;  4JV5 O;  4G28 B;  1ORQ C;  2XUM A;  1FXK B;  1EZJ A;  2A0L A;  2F95 B;  3SJC C;  1IZ3 A;  2WSS G;  2Y69 C;  1Y4M A;  1L8D A;  1HNZ O;  4DUY B;  4LWS B;  4QE9 A;  2Q68 A;  3OTO O;  5JVD B;  1VQO V;  2RDC A;  1M56 B;  1HNZ B;  1JQ0 A;  5H6Q A;  3DC5 A;  5F2V O;  3OTO B;  4LP8 A;  1JJO A;  1MZF A;  2JJ1 G;  4CH4 A;  3OMI B;  2W6J G;  5E1A C;  1X59 A;  4MVM A;  2CTQ A;  2IH1 C;  1XL4 A;  3B8M A;  2F43 G;  2LW1 A;  1XUQ A;  1IBL O;  1QHT A;  3K08 A;  3FB6 C;  2OTJ V;  3TET A;  2IJI A;  4FIP C;  4YJ3 B;  3KG2 A;  1U97 A;  3S3W A;  4MVO A;  4BWA A;  4NR1 A;  4FM2 A;  1THZ A;  2ZIN A;  4JI3 O;  2GTA A;  4CBC A;  3VQX A;  5DEC A;  3ZIA G;  4D6T H;  3U10 A;  4U3J B;  1BL8 A;  1XEQ A;  2XOK G;  4LFB O;  4JI3 B;  1R3K C;  2VWK A;  3LUT B;  3B2E E;  1Q90 D;  1Q6H A;  4JI0 B;  3K5O A;  1DF5 A;  3JAW A;  4X8A A;  3QVN A;  1FJG B;  4LFB B;  1L0N H;  2YIA A;  1GN6 A;  1K4C C;  3OUF A;  2KKW A;  4X9Q A;  4UFZ A;  2DQ0 A;  2UUC B;  4FM0 A;  3ZHS A;  4X1I B;  1P49 A;  1IBM B;  3K59 A;  2YC0 A;  2OIE A;  4O4H A;  2Q67 A;  1BE3 H;  4YY3 O;  5BXZ A;  4WFF A;  3E22 A;  5IY5 B;  1AI5 A;  4J9Y B;  1HDJ A;  4J7Z A;  3RFR A;  1XRE A;  4YY3 B;  3K5N A;  1IXM A;  3CE2 A;  4BIU A;  2JEX A;  1VF6 A;  2VS0 A;  2EJ7 A;  2ZXW C;  2VRZ A;  2P22 C;  2NN4 A;  4O4I A;  3AK1 A;  1EN4 A;  1JMK C;  1KP3 A;  4MSW C;  1Q8I A;  1EFR G;  3K3W A;  2EUL A;  2Y48 A;  2L6L A;  2LFS A;  1AR4 A;  4IIJ B;  3FX7 A;  4LF9 O;  2R72 A;  4Q20 A;  2JK5 C;  1XL6 A;  3CP1 A;  1AVM A;  2QEX V;  1KP2 A;  2X7R B;  3LNN A;  3ML0 A;  4X65 B;  4B3M B;  5GON B;  1H2S B;  4XBF A;  3WB1 A;  3H1J H;  4DV0 O;  1FXV A;  2GSM B;  4K0K O;  1PD3 A;  1R73 A;  2QM7 A;  3JSN A;  4GUN A;  1EBO A;  2F4V O;  3B40 A;  4DK0 A;  4I55 B;  2W6I G;  1TGO A;  3W7W A;  4DV0 B;  1OCC B;  3CC2 V;  3K58 A;  4K0K B;  2CGN A;  1ZL8 B;  4YJ2 A;  3AG1 B;  3ASO C;  4MVS A;  3JAK A;  2F4V B;  3BFR A;  4LF6 O;  1ZLZ A;  1Q82 W;  3KCX A;  1YF2 A;  2M6Y A;  1WA8 B;  4OPA A;  5L3E A;  1K5Q A;  3SPH A;  4LBE C;  4LF6 B;  3OEH G;  3T1C A;  4PDR A;  2P7T C;  2GTS A;  3E8G A;  1PP9 H;  1GM8 A;  3E8F A;  4FJC C;  4FZ0 A;  4DR3 O;  1MZE A;  4HNA A;  4DK1 A;  4JAS A;  1XMQ O;  2CTP A;  3BA8 A;  5J2U B;  4KUM A;  1D5N A;  1Y76 B;  2ITC C;  2BOB C;  4PEL A;  1P4R A;  1TUE B;  4O4L B;  3D3Q A;  1HR0 O;  3H1K H;  3LSU A;  2AHZ A;  4DR3 B;  1XMQ B;  1AB3 A;  1FD9 A;  4LH6 A;  4I0X A;  5DED A;  1P7B A;  3ZRS A;  4GX1 A;  1S0V A;  1HR0 B;  3ZHQ A;  1KC8 W;  3TJT A;  2YUA A;  1FS0 G;  2DYS B;  3C3S A;  1JFF B;  2WAM A;  3N2K A;  3JAT B;  5KHI A;  2WLI A;  4TQD A;  1SQG A;  3M7M X;  1Q43 A;  3ZHU A;  3RYF B;  1FPO A;  1SQQ H;  3THO A;  3RGB A;  2H3O A;  1HW7 A;  3BA9 A;  1H8H G;  4ABM A;  4FPP A;  4MTO A;  2EIN B;  4B7K A;  2YID A;  4JTD B;  1M1K W;  1VEW A;  1AJP A;  2XAJ A;  2EIK B;  1NR7 A;  1S3J A;  1DF4 A;  2BCC H;  2ITD C;  4JI2 O;  1UFI A;  3ZHV A;  3ABK B;  2AXT Z;  5KUM A;  3B4S A;  1GRJ A;  3B8N A;  3K04 A;  3WU2 Z;  3BVO A;  5B3S B;  1K4D C;  4EFB A;  3AG3 B;  4FLZ A;  2YIC A;  5J2T B;  2WPD G;  2DYR C;  2EIL B;  1NKD A;  4PDM A;  5L3B A;  2IBZ H;  1LR1 A;  2DMX A;  1IBK O;  4ZOL A;  4AQY O;  2QWP B;  4FFB A;  3CS5 A;  4CH3 A;  2M7W A;  2QKA A;  1MSW D;  3ZCC A;  1BMF G;  1WAZ A;  1IBK B;  4EFE A;  4AQY B;  1KD1 W;  3ZRV A;  1TA8 A;  3STZ C;  1W59 A;  3TK1 A;  3ZX6 A;  2EZO A;  2IM9 A;  3HKD B;  3JD1 A;  1SRY A;  4JI6 O;  2HVK C;  1VQM V;  4EKW A;  4TQF A;  1U96 A;  3ETD A;  5LOV A;  1SQB H;  1ROP A;  4JI6 B;  4FLU A;  1GM7 A;  1S76 D;  1LUW A;  1PL4 A;  3GB7 C;  1DK1 A;  4DXW A;  5CA1 B;  3FD9 A;  2A79 B;  4J7J A;  4JI7 O;  4A5U B;  2DWE C;  5H9C A;  1I5X A;  1GH6 A;  5JJJ B;  1AJN A;  2LGW A;  5LHH A;  3CB2 A;  2ZIM A;  3CCM V;  2BE3 A;  2P67 A;  3TGU H;  1MOF A;  2JVD A;  1MA1 A;  3ASN C;  1AIL A;  3HB3 B;  2YIB A;  4LC1 A;  4DYL A;  1PPJ H;  2ZCE A;  1TUB A;  3A0B Z;  3JAW B;  4AIL C;  3MD0 A;  2WLM A;  5C8Y B;  3TCU A;  4ZI7 A;  5K1P A;  1SER A;  3U0Z A;  3G6E V;  3K0D A;  3FAV A;  4IGG A;  5LBQ A;  1ZX3 A;  1EM1 A;  1URF A;  3RVZ A;  3T2M A;  1D5A A;  2B5U A;  5B1B B;  2YIB D;  3FB5 C;  3ABL C;  3ZJZ A;  3JAL A;  2WA4 A;  3TXS A;  3ZHT A;  4JAA A;  3BAA A;  3MAQ A;  3EVK A;  5CN0 A;  2H8P C;  5LMN O;  1Y66 A;  3FYI B;  3WFV A;  4UB6 Z;  4MW8 A;  3EHB B;  4N23 A;  5FL7 G;  1L0L H;  3SYP A;  5IWA B;  2DN9 A;  5HFM A;  3ABM C;  5LMN B;  5DM6 V;  4NKG B;  1XDC A;  4RUF A;  5KHH A;  2WLK A;  4H37 A;  4I50 A;  1VP7 A;  5IJ0 A;  3ZBH A;  1YTF B;  3RYI A;  1NQT A;  2BTO A;  1I08 A;  3JAS B;  1NI8 A;  2Q73 A;  1M57 C;  1MG1 A;  1Y74 A;  1OCR B;  1VF6 C;  4FLY A;  4O4I B;  1Z5V A;  4IHJ A;  4X1K A;  4OXS A;  2X6A A;  2EIM C;  3L9D A;  5TIS Z;  2Q4P A;  1OZ0 A;  2Q7G A;  4WCE V;  4J11 A;  2FB5 A;  4TV8 B;  1QNM A;  2CAZ C;  5IJ9 B;  1J5E B;  5LHG A;  4JI1 B;  2EIJ C;  1N0J A;  1M9N A;  5JJN B;  1FYJ A;  4DV5 B;  3QG5 A;  5D5P A;  2UXC O;  4MVQ A;  2MW2 B;  2ODM A;  2E76 B;  4J42 A;  4JF3 A;  4JYB A;  4NTY A;  1YHQ V;  2UXC B;  2GUZ B;  4PD4 F;  5LP6 A;  2MK3 A;  1DTO A;  4DRX B;  1PV0 A;  1NT2 B;  3F5T A;  2HFE C;  5IT9 N;  3LDE A;  3CYO A;  1JX9 A;  2DE0 X;  2PI4 A;  2ZE7 A;  4JZG A;  5A2Q N;  3JAR B;  2L35 A;  4UCS A;  2F93 B;  4X1Y B;  1AI6 A;  2N04 A;  2WA3 A;  1WNS A;  4RQF A;  1VIB A;  1HWY A;  1KMI Z;  2PTM A;  1IDS A;  1AJQ A;  3VQY A;  3PN1 A;  4LFC O;  3RVY A;  2AZ0 A;  3VQV A;  4WFG A;  3E83 A;  4OPH A;  3CCU V;  3GVM A;  4LFC B;  1NVP B;  4ASU G;  4P2Z A;  3UQ8 A;  3C3T A;  2P06 A;  3CX5 F;  3CXC U;  1G4Y B;  3N2K B;  5EYP A;  3AK3 A;  2QE7 G;  1NJI W;  3KKY A;  5LMU B;  1MNG A;  1AP5 A;  3IGA C;  1K5S A;  1PKX A;  1I0H A;  1NH2 B;  1MMM A;  5CBH A;  1WB7 A;  5J9P C;  3VOU A;  4DUY O;  2Y69 B;  1XBL A;  3LSQ A;  2UXD O;  2HLD G;  1F4N A;  2QGN A;  1IX9 A;  1YVW A;  1S72 V;  1H2L A;  2ZT9 B;  2QM4 A;  2UXD B;  1Y67 A;  1B04 A;  2Q7E A;  3RYH A;  3K5M A;  1XIL A;  3CEI A;  4R7C A;  1N34 O;  1T5E A;  3HKB A;  4NB5 A;  3JD4 A;  2KG7 B;  5ITZ A;  4C7U A;  2XAF A;  1N34 B;  1JPX A;  1NTZ H;  1RM1 C;  4FLW A;  2ADP A;  2Y0I A;  5LGU A;  4JTC B;  1WJZ A;  1SA0 B;  3AG7 A;  3K03 A;  3JSL A;  1K34 A;  1ZSP A;  1N33 O;  1XHZ A;  4EEQ A;  5K1X A;  4I9W A;  4TUY B;  3OGC C;  4Q6G A;  1V55 C;  1JVM A;  4I4T A;  4PDL A;  2VQE O;  3HKE A;  1N33 B;  5LA6 B;  1VQ6 V;  4JI0 O;  4DR6 O;  3I56 V;  2WLL A;  1QLE C;  4PHZ A;  1FJG O;  2BTQ A;  4DR2 B;  2VQE B;  5IYD O;  1M4U A;  3E8H A;  4DR6 B;  1H2M A;  2AGA A;  4IYI A;  2RMK B;  4W4K A;  4FVM A;  1RSO B;  1B6Q A;  4CS2 A;  5EBM C;  4UUJ C;  2ARH A;  1S5H C;  3ZRW A;  2CTW A; 
#chains in the Genus database with same CATH homology
 4LH6 A;  1KU9 A;  4CC5 A;  2UU9 B;  1HR0 B;  3SJB C;  1JFF A;  4GLX A;  2PGG A;  4EB6 A;  4K8X A;  3JAT A;  2ZM6 B;  4D7T A;  5D5Q A;  4TV9 A;  2R70 A;  4JI7 B;  3SGI A;  5LXT A;  5JJE B;  1JFF B;  3RYF A;  4YHH B;  2Q0A A;  3N2K A;  4EB6 B;  5KX5 A;  3JAT B;  5KHI A;  5EZY B;  4TQD A;  4UCU A;  4TV9 B;  3FFQ A;  1SQG A;  3M7M X;  2F1M A;  2V4D A;  1Q43 A;  3RYF B;  5JCO C;  5KX5 B;  4FM1 A;  3RYC A;  3ETQ A;  5BR8 B;  3THO A;  3RGB A;  4PI2 A;  1HW7 A;  3BA9 A;  4K8Z A;  1SQF A;  4ZI7 B;  4CC6 A;  3RYC B;  4GKJ B;  1M5I A;  2UXB B;  4AHC A;  3ZS8 C;  1V9P A;  4CS3 A;  4X66 B;  1I94 B;  4D7S A;  5J2T A;  4FLT A;  1O9H A;  1ZAU A;  5FPO A;  4B3R B;  2QJ1 A;  3K57 A;  5LYJ A;  4EFB A;  4NXM B;  4FLZ A;  4O2A B;  2F66 C;  5J2T B;  1I7F A;  1FFX A;  3HKC B;  3SR2 C;  3K5L A;  4JV5 B;  4F6R A;  1Q3E A;  1XNR B;  1QQC A;  4GKK B;  4ZOL A;  1M93 A;  4NXN B;  5IJ0 B;  4FFB A;  3UT5 A;  4CH3 A;  4ZHQ A;  2PYL A;  4B3S B;  1FFX B;  5EIB D;  4F6R B;  5JH7 B;  1IBK B;  4EFE A;  4ZOL B;  4AQY B;  3HKD A;  1TA8 A;  1TVK A;  4X1K B;  4FFB B;  3OTF A;  4UCR A;  5FNV A;  2RQ6 A;  4ZHQ B;  5BMV B;  2OWO A;  2PY5 A;  3WB0 A;  5KMG A;  1HNX B;  3T1H B;  2IM9 A;  3HKD B;  1TVK B;  4O4L A;  4UCO A;  5FNV B;  1Z5W A;  1N32 B;  4JYA B;  5CA1 A;  5KMG B;  4DR7 B;  4UCT A;  4TQF A;  2YI8 A;  4DR5 B;  5LOV A;  1IBL B;  4FLU A;  1XI1 A;  4JI6 B;  4TOI A;  5KHK A;  4HBN A;  5CA1 B;  4DV3 B;  5LOV B;  5KHG A;  2PZS A;  4ZIB A;  4LNU A;  5JJJ B;  3BRC A;  3BAB A;  3CB2 A;  2ZIM A;  5EZY A;  5LP6 C;  5JCO A;  2JVD A;  4X64 B;  5C8Y A;  2YIB A;  2ZCE A;  4LNU B;  4O2B B;  1XNQ B;  1TUB A;  4LR3 A;  4LF4 B;  4FLX A;  4JI8 B;  1O9G A;  2ZNJ A;  3JAW B;  4AIL C;  5CB4 A;  3QF7 A;  5JQG A;  1SKV A;  5C8Y B;  4ZI7 A;  5K1P A;  5IYZ B;  2YXL A;  3U0Z A;  1TUB B;  2UUB B;  5CB4 B;  2JS5 A;  5JQG B;  1D5A A;  2YIB D;  4O4J A;  3CHX A;  2ZNI A;  4JI4 B;  3JAL A;  4CS4 A;  3BAA A;  3MAQ A;  1WN7 A;  4DV1 B;  4LH7 A;  3N2G A;  4X62 B;  2UUA B;  4KL1 A;  4O4J B;  3JAL B;  2YI9 A;  1XHX A;  4X20 A;  5IWA B;  4O2A A;  5LMN B;  2E3C A;  3JAS A;  2XHB A;  3QTC A;  5CA0 B;  3HKC A;  5EYP B;  3N2G B;  5KHH A;  4I50 A;  2PYJ A;  5IJ0 A;  3SJC C;  4X20 B;  2F95 B;  3RYI A;  5JVD A;  2BTO A;  3DSQ A;  3JAS B;  1L8D A;  2HHH B;  5JH7 A;  4DUY B;  2OYQ A;  4I50 B;  4PI0 A;  4TV8 A;  4FLY A;  3BPZ A;  4O4I B;  1Z5V A;  4IHJ A;  4X1K A;  3RYI B;  5IJ9 A;  5JVD B;  5BMV A;  3ICX A;  2JGU A;  1HNZ B;  2Q7G A;  4CH6 A;  4LF9 B;  4B3T B;  4TV8 B;  4L8J A;  3BHP A;  3OTO B;  1JJO A;  4IHJ B;  3VQW A;  5IJ9 B;  2CAZ C;  1J5E B;  4CH4 A;  4WBN B;  4YJ3 A;  2HEP A;  4JI1 B;  5FPR A;  4LF5 B;  5JJN B;  4DV5 B;  3QG5 A;  1HNW B;  1QHT A;  5D5P A;  3T1Y B;  4YJ3 B;  4DRX A;  4U3J A;  4BWA A;  4FM2 A;  2ZIN A;  3VQX A;  2UXC B;  5LP6 A;  4FLV A;  3U10 A;  4DRX B;  1S5J A;  4U3J B;  3SJA C;  1NT2 B;  1VF7 A;  1TAE A;  4UCV A;  3JAR A;  4JI3 B;  2VWK A;  1X4T A;  3B2E E;  3HKE B;  2Q7H A;  5LP6 B;  4O2B A;  4JI0 B;  3K5O A;  4X1Y A;  2VWJ A;  3JAW A;  1FJG B;  4LFB B;  2YIA A;  3JAR B;  4UCS A;  2F93 B;  2PUS A;  5IYZ A;  4X1I A;  1G6U A;  4X1Y B;  2KKW A;  4DR4 B;  3WB2 A;  1WNS A;  4UFZ A;  2GV9 A;  2UUC B;  1KMI Z;  2PTM A;  4FM0 A;  4X1I B;  1P49 A;  3VQY A;  3PN1 A;  2EX3 A;  4CH5 A;  1IBM B;  3K59 A;  4O4H A;  3VQV A;  2ZIO A;  4LF7 B;  5KHJ A;  3E22 A;  4B08 A;  4LFC B;  4GYC B;  1Q5O A;  4LFA B;  2E5L B;  5LXT B;  1N36 B;  4O4H B;  3UQ8 A;  3RFR A;  2P5O A;  4YY3 B;  5CA0 A;  3N2K B;  5EYP A;  3E22 B;  1YEW A;  3K5N A;  5LMU B;  3RWR D;  1WPB A;  2R9A A;  4DV7 B;  4IIJ A;  2P22 C;  2RJZ A;  4O4I A;  3ZED A;  4DV4 B;  1JMK C;  1Q8I A;  4LF8 B;  1XQ8 A;  5GON A;  4IIJ B;  4BW9 A;  2QM4 A;  2R72 A;  4JI5 B;  2UXD B;  1B04 A;  2Q7E A;  3RYH A;  3K5M A;  4JI2 B;  3LNN A;  3A2F A;  4WBN A;  1T5E A;  4X65 B;  4B3M B;  3HKB A;  5GON B;  4I55 A;  1H2S B;  3WB1 A;  5ITZ A;  3RYH B;  1SA0 A;  4DV2 B;  4I9Q A;  3JSN A;  3CSX A;  1N34 B;  5EIB C;  3HKB B;  4DK0 A;  5LYJ B;  4I55 B;  4FLW A;  1TGO A;  4TUY A;  4DV0 B;  4DR1 B;  3K58 A;  5ITZ B;  4K0K B;  1SA0 B;  4YJ2 A;  3JSL A;  1XMO B;  3JAK A;  5LA6 A;  1XHZ A;  2F4V B;  4EEQ A;  4DUZ B;  5K1X A;  4TUY B;  4KHP B;  1DGS A;  3UT5 B;  4Q6G A;  4YJ2 B;  4I4T A;  3HKE A;  3JAK B;  5LA6 B;  1N33 B;  5J2U A;  4LF6 B;  3U11 A;  1RSO A;  4PHZ A;  4DV6 B;  2BTQ A;  4HNA A;  4I4T B;  4DK1 A;  4DR2 B;  2VQE B;  1M4U A;  3BA8 A;  4DR6 B;  5J2U B;  4FVM A;  2VQF B;  3IAY A;  4CS2 A;  4O4L B;  4OX9 B;  2BTQ B;  4DR3 B;  4HNA B;  4NVP A;  1XMQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...