3H1JH

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 25
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1jH00
3L75H 3H1JH 1L0NH 1BGYH 1BE3H 1L0LH 1KYOF 1SQQH 2A06H 3BCCH 1SQXH 3H1IH 4D6TH 1KB9F 4U3FH 3TGUH 1SQBH 1PPJH 3CWBH 1BCCH 1NU1H 3H1KH 3H1LH 1SQVH 1SQPH 4PD4F 2BCCH 3L70H 5KLVH 1NTKH 3L71H 2FYUH 1NTZH 1EZVH 1PP9H 1NTMH 3CXHF 3CX5F 3L74H 3L73H 2IBZH 1P84F 3L72H 3H1HH
chains in the Genus database with same CATH superfamily
2PY5A 1FXKC 4MSWC 1Y74A 3JAKB 2X6BA 4J9YB 1MZFA 1NS1A 3SJCC 5EIBD 2ZM6B 1IDSA 1AI4A 3LDEA 3CRCA 4BIUA 1EFRG 5JJJB 3H9VA 3FFQA 3AG3C 3J7AU 3T1YB 3K57A 3C3TA 5FLXN 5FPOA 1W0KG 2Q0OC 4LH6A 1K9MW 2EILC 3OEHG 1SQXH 4A5UB 1WNSA 1PKXA 3PN1A 4P30A 5GONB 3W7XA 5KHKA 1VMGA 2BOCC 3LDDA 4LFCB 1PP9H 2QWPB 1NH2B 4Z1MG 4WFHA 3QO8A 2XAHA 4J10A 4IHJB 1P4RA 1XUQA 5GTHZ 4DR5O 4DR7B 1AP6A 2UU9O 3K79A 2JGDB 3K5OA 1S76D 4DV6B 1KYOF 3CC4V 4MTFA 3SJQC 2P67A 3K03A 4KP4A 2VWJA 1ZUQA 5KHJA 1RM1C 2ARHA 5IYCO 1VQ7V 3JD4A 1HDJA 2IJIA 4JZGA 5CBFA 2RCVA 1QVFU 1LNQA 3CHXA 2Y69C 4JAVA 2P22C 1ZAUA 4H33A 1SQFA 3AG2C 5KAIZ 2YICA 1NKDA 5B1BB 3M99B 2EIJB 2WA3A 5AG2A 1E79G 4X1KA 1Y74B 2IM9A 5JQGA 2XASA 2WA4A 2YIBD 3FD9A 4UB6Z 1LUVA 4JI3O 4QJFB 4PI2A 3CC7V 4UFZA 1H2NA 2YDEA 4I9QA 4CH3A 3LSSA 3ASOB 4QNHB 2BE3A 2HJFC 2QWNB 4KUMA 4ASUG 1GN6A 3K5NA 5CBHA 3OR6C 4JI2O 4O2BA 4DR5B 5FL7G 1SQPH 3I5DA 5L3BA 2UU9B 1OCCB 4EB6A 2FYUH 5CMUA 4UCRA 4YHHO 3RYHB 1Q5OA 2LFSA 1URFA 4PHZA 1GM9A 4DV1O 2E75B 2ZE8A 1IVSA 4X20A 3UO2A 4TV8A 3SPGA 2Q6AA 5LMNO 5EYPA 4FLVA 1FXVA 3AG3B 2ATKC 2BCCH 2A0LA 3F7VC 4GYCB 2IU0A 1EZVH 2IU3A 2ZD9A 2ZR3A 4DV4O 2FMLA 2LW1A 1RPRA 3RVYA 2NN4A 2UUBO 2ZIOA 1O9GA 4LF5O 1GTOA 2AGAA 3OW2U 1KUQA 5LP6B 3JARB 2X7RB 3S3XA 2LGQA 1GK9A 3K0GA 4PD4F 3DC5A 2HLDG 4X89A 5D5QA 4JV5O 2X0LA 1VF6C 4DV3B 1O9HA 1WPXA 4ZIBA 4RUEA 2WLKA 2ZXWB 5IY5C 4X1KB 4JI2B 3CRRA 1P84F 5JQGB 1FYJA 5KMGA 3MD0A 4DUZO 2Y4TA 3A0HZ 4BW5A 1XI1A 4NR1A 3HKDB 4FZ0A 2VS0A 4YHHB 2Y0PA 4DV1B 1W59A 3E83A 2Y69B 3CB2A 1L8DA 4PA6A 2ZNIA 2WLNA 4O2BB 5LHGA 1KKDA 3J81N 5LMNB 4NXNO 4EB6B 1VQNV 2XUMA 3JATA 1K3EA 1N4CA 1VF6A 2CGOA 3S3WA 3BFRA 3W7WA 2KB1A 4X65O 2LP7A 1VQPV 4DV4B 1VF7A 2UXCO 1QU7A 2LFRA 3A2FA 2CE4A 4X20B 1R3IC 3MAQA 4TV8B 2CTQA 4LF5B 1DLBA 1WB7A 2FTKA 2W6JG 1H8EG 5J2TA 3K5LA 3ZS8C 3ABMC 4TOIA 4JTAB 1SS3A 4JV5B 3P3PA 5EZYA 4KFMA 2GUZA 3OM3B 4YXWG 3WB2A 4PDLA 3TK1A 2A79B 2QWOB 5B1AC 4DK0A 3N2KA 1VQOV 4GX0A 1IBLB 4LC1A 5H5NA 1NQTA 3UCSC 4X1YA 1Y76A 5LL6Y 4J9ZB 4LH7A 3QNEA 3QO5A 2HEPA 1K4CC 1EN5A 1R73A 1IXBA 4PDVA 3U11A 5KMGB 4NXNB 3SPIA 4HYOA 3A8TA 4B3TO 1ROPA 1SA0A 3BABA 1K33A 1KP2A 4FFKA 2ZINA 2A3QA 4X65B 3ZHTA 1SERA 2OT5A 2UXCB 3JCUZ 2QM8A 3OMNB 3T2MA 2IW5A 1MOFA 4C7UA 5ITZA 5H6QA 2ODMA 2R70A 1XOUA 4PDMA 3SJAC 5KA5A 3JD2A 5IDJA 5JH7A 2CAZC 3JATB 4D6TH 5EBMC 4EFBA 4UB8Z 2DYRC 2EBOA 3VQYA 3CD6V 1Q3EA 1I7FA 3BEHA 3JD1A 1DF5A 1G4YB 2H8PC 3EXAA 5LYJB 1YF2A 4G2KA 2LQTA 3T1CA 3SGIA 5J2TB 2RNBA 1Z5WA 3CJHB 1VQ8V 1FJGO 1M56C 2YEVB 5DECA 3P3NA 5EZYB 2DW4A 1Q86W 4PA4A 3C3SA 4UV9A 4B3TB 3N2KB 1D5NA 4CBCA 2LGWA 4JI1O 4X1YB 1KD1W 1GN4A 3RWRD 3M8AA 1Y76B 2DE0X 3SJBC 4OX9O 3DXRA 2Y48A 1AR5A 3E89A 4NTWA 2QR4A 1SA0B 1LR1A 1S5JA 1QLEB 4JZ2A 4B7KA 3H1JH 5LBQA 2ETNA 3KCXA 5B1AB 2EJ7A 1FXHA 4CH5A 2UXDO 1W2BU 5ITZB 5LXTA 4HNAA 5JH7B 5IT9N 1XEQA 4GX1A 4Q6GA 4BR6A 1PL4A 1FJGB 1QHTA 1XNRB 4WBNA 2Y0IA 2Z5UA 3K06A 3JSLA 4DV5O 1HWYA 3B4SA 5EBWC 5KHGA 4R8CA 3KG2A 2PI5A 3P30A 2DJVA 4UXNA 4XBFA 4P9OA 4JI1B 4X66O 4TV9A 1XL4A 4OX9B 1YTFB 5JJEB 3QVNA 4X62O 1YIJV 4H13B 2JJ2G 1QQCA 1T5EA 3E22A 4TQDA 1AILA 2UXDB 3DXRB 3E2EA 1VP7A 3U0ZA 3G6EV 4IT5A 3JSNA 3OGCC 3E8BA 1WAZA 1ZX3A 3EHBB 3ASNB 2D3OW 1AVMA 1IBKO 2HHHO 4FM1A 1YCIA 2XAGA 4K3AA 3UM7A 4DV5B 3AK2A 5IJ0A 5C8YA 4ZKIA 5LXTB 1XMQB 2AZ0A 4HNAB 1VQ4V 3SPHA 3ZRVA 4X66B 3VQWA 4YJ3A 2UXXA 4WBNB 4DW1A 1M9NA 1NVPB 3CRMA 4JI0O 3FB7C 3B09A 4JYAO 1BSMA 4BW9A 4X62B 5IYDO 4U3JA 2PTMA 2QTOA 4PA3A 5BMVA 3OGIB 4UCUA 3BY6A 3P32A 1PV0A 4MVZA 2Q7EA 1Q43A 1CP9A 4RQFA 4LFAB 1YJ9V 4TUYA 2JGDA 5B1BC 3BAAA 2KSDA 2EINB 4K8ZA 1IBKB 3ZRXA 1H2KA 2HHHB 1BHAA 4GKJB 2VQEO 3E22B 4GCZA 4LWSA 1JJ2U 5H6RA 4DV2O 5FNVA 1XQ8A 1IBMB 3FX7A 3SR2C 1GM8A 1NT2B 4MVUA 5LGNA 4LF7O 1N0NA 3E8HA 4JI7O 4WFAV 1YSCA 2AZ2A 5LOVA 3VBBA 1E1QG 1OCCC 4DV7O 5DEDA 3CCLV 5IJ0B 1Y4MA 5C8YB 2PI4A 2JRIA 3F7YC 1VQ9V 4JYAB 1SRYA 1SZTA 1WA8A 4F6RA 2AXTZ 3ZHSA 3RYCA 3JALA 5EC2C 3CWBH 1MNGA 2C2AA 2ITCC 2B5UA 1MG1A 3B40A 1J5EB 4YJ3B 3Q4HA 4DUYO 1XHXA 3LDCA 2JJ1G 3BA9A 4AQYB 4LF8B 3A0RA 4UCOA 1TAEA 3GVMA 1WN7A 4U3JB 3CCJV 1R6KA 3HKBB 5BMVB 3K59A 1YDXA 1XDCA 2PF4E 1QNMA 5EIBC 1U96A 2ZE6A 4KHPO 3RYHA 2VQEB 3W7SA 4I55A 3ZHUA 4X64O 5LP6C 3TXSA 4UCVA 3CCMV 1NZ6A 2HG5C 2NR5A 2W6IG 2ZR2A 4BIOA 4LF7B 3ZJZA 3WU2Z 5B66Z 2QM7A 1VF5B 2V7QG 4TUYB 1SQQH 5B3SC 2EJRA 2ZXWC 2P06A 1KKCA 3B8MA 4AHCA 1V55C 1FD9A 3TXQA 3K9SA 3ZMSA 4WFBV 4LWSB 4DV7B 1NTKH 1ZSPA 5CBGA 2YSUB 3VOUA 5FNVB 4FLZA 1VQ5V 1ZL8A 1U97A 4W4KA 4MTXA 1YJNV 4UCTA 5LP6A 3JARA 3CSXA 4N23A 3BHPA 5LOVB 4W4LA 4DUYB 5L3EA 2Y4UA 2VQFO 5LGTA 1FS0G 2M6YA 2PYLA 1WA8B 4F6RB 1AJNA 2O57A 3K04A 3CRAA 4LCUC 4JI5O 2KQXA 1FKAO 3RYCB 3OUFA 3JALB 5LA6B 4IL6Z 4CZZA 1DTOA 1K34A 3ETGA 1Q90D 3CX5F 1AROP 1COWG 3HKDA 1M57C 3Q4HB 4LR3A 4X64B 5BZBA 5CA0A 2OCCC 3H01A 2F43G 1UJWB 2JEXA 2XHBA 4HZ3A 2HR3A 3ETEA 2YXYA 1H2GA 2WSSG 4ABMA 3J80N 2B1IA 2GSMB 2CH7A 4I55B 3T1HO 1RP3B 5IJ9A 3NXSA 2R72A 3U10A 2A06H 4NB5A 4JF3A 3SPJA 2E74B 3ABUA 1I94O 1TA8A 2RN9A 4NTYA 2R9IA 2ZCEA 3E86A 4O4JB 1M93A 3SYQA 2VQFB 4J7ZA 4NXMO 1OCOC 2YIBA 1F4NA 4GLXA 2RMKB 4L87A 3AEIA 1ZL8B 3X2QC 5B1NA 2Q68A 4RAIA 4JI3B 1JJOA 3TGUH 1HR0O 1H2SB 2BTQA 5A9GA 1UPGA 5BXZA 1AI6A 1BL8A 2LW7A 2CTPA 3HPLC 1MMMA 3RYFA 5B3SB 4PDRA 2M7WA 1A32A 2IBZH 2VWKA 4YIOA 1V55B 4CC5A 1ZWIC 1H2MA 4NTXA 1OCRB 3N2GA 1QBZA 3H1IH 1SC5B 3T4DA 3T1HB 3F5WC 5CA0B 2EIMC 5JJNB 1N0JA 1M5IA 1I5YA 4D7SA 3RVZA 4BWAA 2V4DA 1WJZA 2QWRB 1CEZA 1AI7A 4EEQA 1Q82W 3ZMVA 1BE3H 3LSUA 4J7JA 2CH7B 2Q0AA 5IJ9B 4NXMB 1S5HC 1YXBA 3FYIB 4DYLA 1K73W 4ZBMA 1ZTEA 1M57B 3APOA 2UUBB 4QE7A 5LYJA 4QE9A 3G80A 2OCCB 4PV1B 1GAXA 1HR0B 4N21A 2IJJA 1TUBA 2LO1A 3CJHA 3STLC 2IH3C 2YEVA 2Z0AA 3MHSC 3O9OA 2JIZG 1QLEC 3L70H 2CDYA 3JD0A 4DUZB 3RBZA 4Z1VA 4I4TB 4EFEA 3ZHQA 2ZE7A 3RW0A 1VQKV 3DTUB 3FYEB 4CC6A 1MSDA 2BTQB 5CA1A 3L73H 5HFMA 1KC8W 4AILC 2QEXV 1HP8A 4J42A 5B5EZ 1MABG 1EM1A 3ZEDA 3D36C 3RYFB 4LNUA 2Q67A 4B08A 2JGUA 1GO3F 1BQ0A 3OTFA 4I5SA 3G4SV 3RN4A 3CMEV 1K4DC 2YS8A 5JWPA 4CS3A 4JI8O 3ICXA 1CXZB 4NKGB 3N2GB 1R3JC 4J11A 1OCOB 4CH4A 4OPHA 1EN6A 3CCQV 3R66A 3X2QB 5CB4A 1N34O 5J2UA 1AP5A 2OIEA 2FL4A 4QPJA 3AK3A 2OYQA 3D36A 3CCVV 3GB7C 4L8JA 3RFRA 3K5MA 1DK1A 2F4VO 4J80A 4GX5A 1K5SA 4DRXA 3SYPA 5E79Z 4K35A 3ZHRA 5GTIZ 3TCUA 5CA3A 2ADPA 2Q5ZA 4X1IA 2EIMB 3T4ZA 4ZHQA 1TUBB 3F5TA 3R65A 5TISZ 3BRCA 4LP8A 5KX5A 3VQXA 3FB8C 3ASNC 3ETDA 2OTJV 5H2FZ 4IYIA 2RQ6A 3K58A 4KL1A 4JI8B 4GT1A 4H0LB 1Y6XA 5CA1B 2E3CA 2K1EA 4LFBO 1X4TA 2PGGA 2EIKB 1WPBA 1GM7A 5IE9A 1K8AW 4LNUB 3BA8A 4WFGA 1QVGU 1KECA 4MVRA 2H94A 5LMUO 5DM6V 2QJ1A 2WLMA 2Q7HA 3SYAA 2R9RB 2A9HA 4D7TA 1PNLA 4B3SO 4JPRA 3IGAC 3OUSA 2F4VB 1XMOO 2B1GA 5CB4B 5J2UB 2RDCA 2PYJA 1NTMH 3RT3C 1MA1A 4O4HA 5JCOC 3QTCA 4JYBA 2HVJC 1QR8A 3GWKC 1L0NH 1IURA 2YI9A 2EINC 3B8NA 4DRXB 2E5LO 4UV8A 3CXCU 4X1IB 1SQVH 3OT7A 1K7DA 2KKWA 2UXNA 4ZHQB 2Q7GA 5KUKA 4LFBB 2QWQB 4R6ZA 2K9PA 3TJTA 5KX5B 4FJCC 4B3RO 2WLJA 5JCOA 3WFVA 2IJHA 3IC7A 4JI6O 3WB1A 4HAMA 1RSOA 2P4VA 5LMUB 1V54B 1H8HG 1M4UA 4I9WA 2CTWA 4F4LA 1YEWA 1YJWV 4FVMA 1ORQC 3CCEV 1NR7A 4B3SB 1N32O 2P6JA 4UVAA 1B6QA 4XDJA 1XMOB 3IAYA 3G6BA 3E8FA 4DXWA 3CPWU 5EC1C 1DGSA 1G8MA 1H2LA 1F4MA 1GH6A 4O4LA 3WG7C 1SQBH 4IGGA 4UVBA 5KLVH 2BOBC 4G28B 1THZA 4IIJA 2E5LB 2ZKOA 2WWWA 1JQ0A 1G6UA 4MTGA 3UQ8A 2HKOA 4DR3O 1NH2D 3ZRWA 4O4HB 1VQMV 4RUFA 4LBEC 4JYYA 1Q8IA 3ETQA 1KB9F 2F95B 2D2CB 4B3RB 3UO3A 3HKCA 4ZOLA 5LHHA 2OTLV 5HFLA 4F6EA 4DR6O 4CS4A 4X9QA 1Q6HA 4H37A 1I08A 1V9PA 1P49A 3HKBA 1AR1B 2WLLA 3CYOA 2YI8A 2Z3YA 1AJPA 1N32B 1HNZO 1Z2GA 4JTCB 1G1XB 2W0XA 4TQFA 5IYBO 2PUSA 4X88A 2G38A 5KHIA 2V1DA 3APQA 3DGEA 3HR0A 1RSOB 3QO7A 2FKXA 2BSKA 2XOKG 3SYCA 2AHZA 5BY1A 4BIZA 2QSAA 2MK3A 2JEUA 3SPCA 2EZPA 4O2AA 4Z2WA 4U7OA 2WAMA 1SF9A 2UUAO 3AG7A 1AB3A 2DMXA 4DR3B 1JX9A 2Q4PA 1VQLV 4FM2A 4O4LB 2CUGA 4K8XA 3BPZA 5KAFZ 2WLIA 4DR4O 5EK0A 1GN3A 2ILMA 4JI0B 5F2VO 3LUTB 4LFCO 3CS5A 2XTAA 4IIJB 2AHYA 2P5OA 2ZDIC 3ZMUA 4YJ2B 5LA6A 3ZRWB 4DR7O 1F23A 1ZLZA 1SQGA 1SETA 3CE2A 1HNZB 3UT5A 2R9AA 4LF6O 3C90A 3HKCB 3E8GA 4ZOLB 2GBOA 2OIGA 3OFNG 3WG7B 1YVWA 2MW2B 3ZN0A 3CEIA 2YXHA 4PA7A 4TSFG 1R3KC 2WLLB 2OCHA 3K08A 5DN6G 4FPPA 2E76B 2ZDIA 3K0DA 4DW0A 2DN9A 4DO2A 1BQZA 4RWUA 2UUAB 1R1BA 4DV2B 4NYKA 4U7NA 1PNMA 4GKKO 3OEEG 2QA4V 3FKSG 3VQVA 2L6LA 3IJ4A 1SKVA 3CRQA 1L1FA 2BSKB 4I50A 2GTSA 4YY3O 4JI7B 2JS3A 4MT8A 1FXKA 4DR4B 4R7CA 3OTOO 1XBLA 4O4JA 4MVSA 3W7TA 4PELA 5L3CA 1WP8A 1OCRC 2XAJA 4O2AB 2DQ0A 4FLTA 1HNWO 4OGQB 1FAFA 1JA8A 2UXBO 4MS2A 3QG5A 1K5QA 1IX9A 2CTRA 1JOYA 5IWAO 3THOA 4FZ1A 3DSQA 1VARA 4LF6B 2Q73A 2WLIB 5J9PC 1XREA 2QKCA 3H1KH 3PJSK 2WPDG 2ZIMA 1EZJA 2Q9LA 1Q7YW 4E4EA 1VEWA 1KMIZ 4UVCA 2HVKC 2FB5A 4QPKA 4O4IA 4AI8A 5KHHA 2ZNJA 4HBNA 4KHPB 4FIPC 4GX2A 3UT5B 4PA9A 2QKAA 4B3MO 1EN4A 2N05A 2ITDC 4GKKB 5K1PA 2HP8A 2N04A 2ZT9B 1ENVA 3ZIAG 4YY3B 2A7WA 4JYCA 4UCSA 3ZX6A 3OTOB 1QLNA 1Q6UA 3OMAB 1HNWB 3BVOA 3CCUV 4DV3O 2UXBB 5H9CA 1RFYA 1WB8A 1E1RG 2OWOA 3GWOA 1JVMA 1HNXO 5IWAB 4E2LA 2DWEC 1VQ6V 4I50B 1NTZH 1FXKB 1I0HA 2W0FC 3OR7C 2Q69A 2GTAA 4NVPA 1GRJA 1MZEA 4FK5C 2GDSA 4JI5B 1OHHG 2DWDC 2IJKA 4I4TA 5C93A 3TETA 1BT8A 4WCEV 5E1AC 4B3MB 2EILB 4LF4O 4CH6A 3ZBHA 3JD3A 4ICGA 1S72V 3DC6A 3WB0A 4O4IB 2BTOA 1YZBA 1N36O 1YITV 1OZ0A 3ZHVA 4DK1A 4JAAA 3AG1C 2PZSA 3L72H 4XDLA 1HNXB 1I94B 5FPRA 1WP7A 1RM1B 1JCHA 1IBLO 2AW9A 5GW7A 1FFTB 1JR9A 2QKSA 5B1OA 1BCCH 4JTDB 3KZIZ 5JVDA 1KBHA 3L71H 1QR9A 2YIDA 5LGUA 2JDIG 3AG2B 1NJIW 1B04A 1D2DA 2EIKC 2NNUA 4I0XA 4FM0A 2F23A 2IH1C 1DF4A 3AK1A 3G67A 2F66C 3ZN1A 2CGNA 3STZC 2EULA 3EVKA 1P7BA 4LF4B 3RYIA 3H1LH 2EX3A 1R3LC 4EKWA 5KUMA 1AR4A 4MW8A 4MTOA 5EYPB 1S3JA 2QE7G 1N36B 3CC2V 4XDKA 1B06A 2P90A 1FFXA 1Y67A 3N27A 4J41A 2QGNA 2GHYA 1H38A 1R6NA 2N74A 3JYCA 1Q6IA 3CXHF 1N33O 2LJ2A 3QF7A 4K0KO 1Z5VA 3JASA 4FFBA 3H1HH 2KG7A 3ABKC 1XHZA 4LF9O 1JFFA 5LHIA 4KXRA 2X6AA 4P9PA 1YTFD 2P7TC 3E35A 1QCEA 2F1MA 3OD4A 1HW7A 2QTSA 3A0BZ 1V54C 1S5LZ 4JAUA 1XNQO 4G27B 2Q8VA 5JVDB 2JK5C 1Y66A 3L75H 1D5AA 3JAWA 1P7GA 2HJDA 4I0XB 1NBMG 1TUEB 3B77A 5IY5B 3AG1B 2CK3G 2B9ZA 3RYIB 2VRZA 4GZRB 4JI4O 4YIPA 3ZRSA 4FLYA 2WLHA 4DV0O 1US6A 2GV9A 4QIWF 3AG4C 1LUWA 1N33B 1BS3A 4K0KB 1XNRO 3ABLC 4MVQA 1FFXB 4PJ0Z 1N34B 1OJHA 2GUZB 4H44B 4ZI7A 1PL0A 3MDSA 4LF9B 2JS5A 1VIBA 1NVPD 1N8RW 3FB6C 3K3WA 3HKEA 2ZQMA 3OMIB 2XT9A 1R6TA 3JASB 1EBOA 5L3DA 4FFBB 1XNQB 2KG7B 3ABMB 3D3QA 3FB5C 5BR8O 1JFFB 1M90W 2DOSA 4MW3A 1W0JG 5A2QN 4JGSA 3RGBA 1BZKA 3BCCH 4JI4B 4UUJC 4OPAA 1TVKA 4R50A 3O65A 3NR7A 1OCZC 2P4KA 1NU1H 4WF9V 1PD3A 4DV0B 3OE7G 3JAWB 2DYSC 3LNNA 5IYZA 3ABKB 1XL6A 1TGOA 2YC0A 3G71V 4IYHA 1AJQA 5K1XA 1PM9A 3ZMZA 2NLJC 3D8CA 1WLEA 1XMQO 3LSQA 3FAVA 1IZ3A 2XAQA 4FMTA 3HB3B 3B2EE 3JAMN 1KQSU 2EZOA 2RJZA 2F93B 1KP3A 1CPYA 1J95A 4ZI7B 1UFIA 1MSWD 4X8AA 3IFXA 5BR8B 2DYRB 1IXMA 4FLWA 4J7KA 4BAYA 3HKEB 1PPJH 3W7UA 4MVMA 3M7MX 2QDOA 4PI0A 4GUNA 3AG4B 1SESA 4QGPA 1XILA 4LFAO 2QM4A 3CP1A 1NR1A 1AI5A 4YJ2A 3ABLB 1M56B 2L35A 1PNKA 1KU9A 4DR1O 4GKJO 1GMGA 1I5XA 1FPOA 1F7YA 4TT3G 3KCYA 3D3IA 4RQEA 1TVKB 4JI6B 5CN0A 3JAKA 3KKYA 4OXSA 4CS2A 1IBMO 4B7EA 1JPXA 1OV9A 2YIAA 5IYZB 4FLXA 4WFFA 2UUCO 1S0VA 4DR2O 4I7ZB 3IC9A 5L3FA 3MHHC 2HFEC 1YHQV 1RPOA 3FAVB 1S77D 3EFFK 3I56V 3L9DA 5KA6A 2ZM6O 1NI8A 4P2ZA 3CCRV 3CCSV 1Q81W 4TWKA 4JASA 1J5EO 1OCZB 2XNDG 4FLUA 1M1KW 4TV9B 1BGYH 5GONA 2DQ3A 1B3QA 3SYOA 2DYSB 4RO2A 1K92A 3CMAV 3SDLA 4AQYO 3T1YO 4Q20A 4LF8O 4U3FH 2ADQB 2JVDA 3ZMTA 3LNMB 4IHJA 1BMFG 1JMKC 2YXLA 2EIJC 5EBLC 4DR1B 4MVOA 3L74H 5L3GA 2ZE5A 1YI2V 1L0LH 4DR6B 1X59A 1BHBA 1GKFA 1SZXA 2YUAA 3UKMA 2H3OA 1F51A 4WFEA 3ASOC 3ZCCA 3I55V 3ABTA 3ML0A 3OAAG 4DV6O 3JCZA 2UUCB 1GN2A 2XAFA 5D5PA 3K9AA 4DR2B 1K97A 2X6CA
chains in the Genus database with same CATH topology
3L75H 3H1JH 1L0NH 1BGYH 1BE3H 1L0LH 1KYOF 1SQQH 2A06H 3BCCH 1SQXH 3H1IH 4D6TH 1KB9F 4U3FH 3TGUH 1SQBH 1PPJH 3CWBH 1BCCH 1NU1H 3H1KH 3H1LH 1SQVH 1SQPH 4PD4F 2BCCH 3L70H 5KLVH 1NTKH 3L71H 2FYUH 1NTZH 1EZVH 1PP9H 1NTMH 3CXHF 3CX5F 3L74H 3L73H 2IBZH 1P84F 3L72H 3H1HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 H;  3H1J H;  1L0N H;  1BGY H;  1BE3 H;  1L0L H;  1KYO F;  1SQQ H;  2A06 H;  3BCC H;  1SQX H;  3H1I H;  4D6T H;  1KB9 F;  4U3F H;  3TGU H;  1SQB H;  1PPJ H;  3CWB H;  1BCC H;  1NU1 H;  3H1K H;  3H1L H;  1SQV H;  1SQP H;  4PD4 F;  2BCC H;  3L70 H;  5KLV H;  1NTK H;  3L71 H;  2FYU H;  1NTZ H;  1EZV H;  1PP9 H;  1NTM H;  3CXH F;  3CX5 F;  3L74 H;  3L73 H;  2IBZ H;  1P84 F;  3L72 H;  3H1H H; 
#chains in the Genus database with same CATH topology
 2PY5 A;  1FXK C;  4MSW C;  1Y74 A;  3JAK B;  2X6B A;  4J9Y B;  1MZF A;  1NS1 A;  3SJC C;  5EIB D;  2ZM6 B;  1IDS A;  1AI4 A;  3LDE A;  3CRC A;  4BIU A;  1EFR G;  5JJJ B;  3H9V A;  3FFQ A;  3AG3 C;  3J7A U;  3T1Y B;  3K57 A;  3C3T A;  5FLX N;  5FPO A;  1W0K G;  2Q0O C;  4LH6 A;  1K9M W;  2EIL C;  3OEH G;  1SQX H;  4A5U B;  1WNS A;  1PKX A;  3PN1 A;  4P30 A;  5GON B;  3W7X A;  5KHK A;  1VMG A;  2BOC C;  3LDD A;  4LFC B;  1PP9 H;  2QWP B;  1NH2 B;  4Z1M G;  4WFH A;  3QO8 A;  2XAH A;  4J10 A;  4IHJ B;  1P4R A;  1XUQ A;  5GTH Z;  4DR5 O;  4DR7 B;  1AP6 A;  2UU9 O;  3K79 A;  2JGD B;  3K5O A;  1S76 D;  4DV6 B;  1KYO F;  3CC4 V;  4MTF A;  3SJQ C;  2P67 A;  3K03 A;  4KP4 A;  2VWJ A;  1ZUQ A;  5KHJ A;  1RM1 C;  2ARH A;  5IYC O;  1VQ7 V;  3JD4 A;  1HDJ A;  2IJI A;  4JZG A;  5CBF A;  2RCV A;  1QVF U;  1LNQ A;  3CHX A;  2Y69 C;  4JAV A;  2P22 C;  1ZAU A;  4H33 A;  1SQF A;  3AG2 C;  5KAI Z;  2YIC A;  1NKD A;  5B1B B;  3M99 B;  2EIJ B;  2WA3 A;  5AG2 A;  1E79 G;  4X1K A;  1Y74 B;  2IM9 A;  5JQG A;  2XAS A;  2WA4 A;  2YIB D;  3FD9 A;  4UB6 Z;  1LUV A;  4JI3 O;  4QJF B;  4PI2 A;  3CC7 V;  4UFZ A;  1H2N A;  2YDE A;  4I9Q A;  4CH3 A;  3LSS A;  3ASO B;  4QNH B;  2BE3 A;  2HJF C;  2QWN B;  4KUM A;  4ASU G;  1GN6 A;  3K5N A;  5CBH A;  3OR6 C;  4JI2 O;  4O2B A;  4DR5 B;  5FL7 G;  1SQP H;  3I5D A;  5L3B A;  2UU9 B;  1OCC B;  4EB6 A;  2FYU H;  5CMU A;  4UCR A;  4YHH O;  3RYH B;  1Q5O A;  2LFS A;  1URF A;  4PHZ A;  1GM9 A;  4DV1 O;  2E75 B;  2ZE8 A;  1IVS A;  4X20 A;  3UO2 A;  4TV8 A;  3SPG A;  2Q6A A;  5LMN O;  5EYP A;  4FLV A;  1FXV A;  3AG3 B;  2ATK C;  2BCC H;  2A0L A;  3F7V C;  4GYC B;  2IU0 A;  1EZV H;  2IU3 A;  2ZD9 A;  2ZR3 A;  4DV4 O;  2FML A;  2LW1 A;  1RPR A;  3RVY A;  2NN4 A;  2UUB O;  2ZIO A;  1O9G A;  4LF5 O;  1GTO A;  2AGA A;  3OW2 U;  1KUQ A;  5LP6 B;  3JAR B;  2X7R B;  3S3X A;  2LGQ A;  1GK9 A;  3K0G A;  4PD4 F;  3DC5 A;  2HLD G;  4X89 A;  5D5Q A;  4JV5 O;  2X0L A;  1VF6 C;  4DV3 B;  1O9H A;  1WPX A;  4ZIB A;  4RUE A;  2WLK A;  2ZXW B;  5IY5 C;  4X1K B;  4JI2 B;  3CRR A;  1P84 F;  5JQG B;  1FYJ A;  5KMG A;  3MD0 A;  4DUZ O;  2Y4T A;  3A0H Z;  4BW5 A;  1XI1 A;  4NR1 A;  3HKD B;  4FZ0 A;  2VS0 A;  4YHH B;  2Y0P A;  4DV1 B;  1W59 A;  3E83 A;  2Y69 B;  3CB2 A;  1L8D A;  4PA6 A;  2ZNI A;  2WLN A;  4O2B B;  5LHG A;  1KKD A;  3J81 N;  5LMN B;  4NXN O;  4EB6 B;  1VQN V;  2XUM A;  3JAT A;  1K3E A;  1N4C A;  1VF6 A;  2CGO A;  3S3W A;  3BFR A;  3W7W A;  2KB1 A;  4X65 O;  2LP7 A;  1VQP V;  4DV4 B;  1VF7 A;  2UXC O;  1QU7 A;  2LFR A;  3A2F A;  2CE4 A;  4X20 B;  1R3I C;  3MAQ A;  4TV8 B;  2CTQ A;  4LF5 B;  1DLB A;  1WB7 A;  2FTK A;  2W6J G;  1H8E G;  5J2T A;  3K5L A;  3ZS8 C;  3ABM C;  4TOI A;  4JTA B;  1SS3 A;  4JV5 B;  3P3P A;  5EZY A;  4KFM A;  2GUZ A;  3OM3 B;  4YXW G;  3WB2 A;  4PDL A;  3TK1 A;  2A79 B;  2QWO B;  5B1A C;  4DK0 A;  3N2K A;  1VQO V;  4GX0 A;  1IBL B;  4LC1 A;  5H5N A;  1NQT A;  3UCS C;  4X1Y A;  1Y76 A;  5LL6 Y;  4J9Z B;  4LH7 A;  3QNE A;  3QO5 A;  2HEP A;  1K4C C;  1EN5 A;  1R73 A;  1IXB A;  4PDV A;  3U11 A;  5KMG B;  4NXN B;  3SPI A;  4HYO A;  3A8T A;  4B3T O;  1ROP A;  1SA0 A;  3BAB A;  1K33 A;  1KP2 A;  4FFK A;  2ZIN A;  2A3Q A;  4X65 B;  3ZHT A;  1SER A;  2OT5 A;  2UXC B;  3JCU Z;  2QM8 A;  3OMN B;  3T2M A;  2IW5 A;  1MOF A;  4C7U A;  5ITZ A;  5H6Q A;  2ODM A;  2R70 A;  1XOU A;  4PDM A;  3SJA C;  5KA5 A;  3JD2 A;  5IDJ A;  5JH7 A;  2CAZ C;  3JAT B;  4D6T H;  5EBM C;  4EFB A;  4UB8 Z;  2DYR C;  2EBO A;  3VQY A;  3CD6 V;  1Q3E A;  1I7F A;  3BEH A;  3JD1 A;  1DF5 A;  1G4Y B;  2H8P C;  3EXA A;  5LYJ B;  1YF2 A;  4G2K A;  2LQT A;  3T1C A;  3SGI A;  5J2T B;  2RNB A;  1Z5W A;  3CJH B;  1VQ8 V;  1FJG O;  1M56 C;  2YEV B;  5DEC A;  3P3N A;  5EZY B;  2DW4 A;  1Q86 W;  4PA4 A;  3C3S A;  4UV9 A;  4B3T B;  3N2K B;  1D5N A;  4CBC A;  2LGW A;  4JI1 O;  4X1Y B;  1KD1 W;  1GN4 A;  3RWR D;  3M8A A;  1Y76 B;  2DE0 X;  3SJB C;  4OX9 O;  3DXR A;  2Y48 A;  1AR5 A;  3E89 A;  4NTW A;  2QR4 A;  1SA0 B;  1LR1 A;  1S5J A;  1QLE B;  4JZ2 A;  4B7K A;  3H1J H;  5LBQ A;  2ETN A;  3KCX A;  5B1A B;  2EJ7 A;  1FXH A;  4CH5 A;  2UXD O;  1W2B U;  5ITZ B;  5LXT A;  4HNA A;  5JH7 B;  5IT9 N;  1XEQ A;  4GX1 A;  4Q6G A;  4BR6 A;  1PL4 A;  1FJG B;  1QHT A;  1XNR B;  4WBN A;  2Y0I A;  2Z5U A;  3K06 A;  3JSL A;  4DV5 O;  1HWY A;  3B4S A;  5EBW C;  5KHG A;  4R8C A;  3KG2 A;  2PI5 A;  3P30 A;  2DJV A;  4UXN A;  4XBF A;  4P9O A;  4JI1 B;  4X66 O;  4TV9 A;  1XL4 A;  4OX9 B;  1YTF B;  5JJE B;  3QVN A;  4X62 O;  1YIJ V;  4H13 B;  2JJ2 G;  1QQC A;  1T5E A;  3E22 A;  4TQD A;  1AIL A;  2UXD B;  3DXR B;  3E2E A;  1VP7 A;  3U0Z A;  3G6E V;  4IT5 A;  3JSN A;  3OGC C;  3E8B A;  1WAZ A;  1ZX3 A;  3EHB B;  3ASN B;  2D3O W;  1AVM A;  1IBK O;  2HHH O;  4FM1 A;  1YCI A;  2XAG A;  4K3A A;  3UM7 A;  4DV5 B;  3AK2 A;  5IJ0 A;  5C8Y A;  4ZKI A;  5LXT B;  1XMQ B;  2AZ0 A;  4HNA B;  1VQ4 V;  3SPH A;  3ZRV A;  4X66 B;  3VQW A;  4YJ3 A;  2UXX A;  4WBN B;  4DW1 A;  1M9N A;  1NVP B;  3CRM A;  4JI0 O;  3FB7 C;  3B09 A;  4JYA O;  1BSM A;  4BW9 A;  4X62 B;  5IYD O;  4U3J A;  2PTM A;  2QTO A;  4PA3 A;  5BMV A;  3OGI B;  4UCU A;  3BY6 A;  3P32 A;  1PV0 A;  4MVZ A;  2Q7E A;  1Q43 A;  1CP9 A;  4RQF A;  4LFA B;  1YJ9 V;  4TUY A;  2JGD A;  5B1B C;  3BAA A;  2KSD A;  2EIN B;  4K8Z A;  1IBK B;  3ZRX A;  1H2K A;  2HHH B;  1BHA A;  4GKJ B;  2VQE O;  3E22 B;  4GCZ A;  4LWS A;  1JJ2 U;  5H6R A;  4DV2 O;  5FNV A;  1XQ8 A;  1IBM B;  3FX7 A;  3SR2 C;  1GM8 A;  1NT2 B;  4MVU A;  5LGN A;  4LF7 O;  1N0N A;  3E8H A;  4JI7 O;  4WFA V;  1YSC A;  2AZ2 A;  5LOV A;  3VBB A;  1E1Q G;  1OCC C;  4DV7 O;  5DED A;  3CCL V;  5IJ0 B;  1Y4M A;  5C8Y B;  2PI4 A;  2JRI A;  3F7Y C;  1VQ9 V;  4JYA B;  1SRY A;  1SZT A;  1WA8 A;  4F6R A;  2AXT Z;  3ZHS A;  3RYC A;  3JAL A;  5EC2 C;  3CWB H;  1MNG A;  2C2A A;  2ITC C;  2B5U A;  1MG1 A;  3B40 A;  1J5E B;  4YJ3 B;  3Q4H A;  4DUY O;  1XHX A;  3LDC A;  2JJ1 G;  3BA9 A;  4AQY B;  4LF8 B;  3A0R A;  4UCO A;  1TAE A;  3GVM A;  1WN7 A;  4U3J B;  3CCJ V;  1R6K A;  3HKB B;  5BMV B;  3K59 A;  1YDX A;  1XDC A;  2PF4 E;  1QNM A;  5EIB C;  1U96 A;  2ZE6 A;  4KHP O;  3RYH A;  2VQE B;  3W7S A;  4I55 A;  3ZHU A;  4X64 O;  5LP6 C;  3TXS A;  4UCV A;  3CCM V;  1NZ6 A;  2HG5 C;  2NR5 A;  2W6I G;  2ZR2 A;  4BIO A;  4LF7 B;  3ZJZ A;  3WU2 Z;  5B66 Z;  2QM7 A;  1VF5 B;  2V7Q G;  4TUY B;  1SQQ H;  5B3S C;  2EJR A;  2ZXW C;  2P06 A;  1KKC A;  3B8M A;  4AHC A;  1V55 C;  1FD9 A;  3TXQ A;  3K9S A;  3ZMS A;  4WFB V;  4LWS B;  4DV7 B;  1NTK H;  1ZSP A;  5CBG A;  2YSU B;  3VOU A;  5FNV B;  4FLZ A;  1VQ5 V;  1ZL8 A;  1U97 A;  4W4K A;  4MTX A;  1YJN V;  4UCT A;  5LP6 A;  3JAR A;  3CSX A;  4N23 A;  3BHP A;  5LOV B;  4W4L A;  4DUY B;  5L3E A;  2Y4U A;  2VQF O;  5LGT A;  1FS0 G;  2M6Y A;  2PYL A;  1WA8 B;  4F6R B;  1AJN A;  2O57 A;  3K04 A;  3CRA A;  4LCU C;  4JI5 O;  2KQX A;  1FKA O;  3RYC B;  3OUF A;  3JAL B;  5LA6 B;  4IL6 Z;  4CZZ A;  1DTO A;  1K34 A;  3ETG A;  1Q90 D;  3CX5 F;  1ARO P;  1COW G;  3HKD A;  1M57 C;  3Q4H B;  4LR3 A;  4X64 B;  5BZB A;  5CA0 A;  2OCC C;  3H01 A;  2F43 G;  1UJW B;  2JEX A;  2XHB A;  4HZ3 A;  2HR3 A;  3ETE A;  2YXY A;  1H2G A;  2WSS G;  4ABM A;  3J80 N;  2B1I A;  2GSM B;  2CH7 A;  4I55 B;  3T1H O;  1RP3 B;  5IJ9 A;  3NXS A;  2R72 A;  3U10 A;  2A06 H;  4NB5 A;  4JF3 A;  3SPJ A;  2E74 B;  3ABU A;  1I94 O;  1TA8 A;  2RN9 A;  4NTY A;  2R9I A;  2ZCE A;  3E86 A;  4O4J B;  1M93 A;  3SYQ A;  2VQF B;  4J7Z A;  4NXM O;  1OCO C;  2YIB A;  1F4N A;  4GLX A;  2RMK B;  4L87 A;  3AEI A;  1ZL8 B;  3X2Q C;  5B1N A;  2Q68 A;  4RAI A;  4JI3 B;  1JJO A;  3TGU H;  1HR0 O;  1H2S B;  2BTQ A;  5A9G A;  1UPG A;  5BXZ A;  1AI6 A;  1BL8 A;  2LW7 A;  2CTP A;  3HPL C;  1MMM A;  3RYF A;  5B3S B;  4PDR A;  2M7W A;  1A32 A;  2IBZ H;  2VWK A;  4YIO A;  1V55 B;  4CC5 A;  1ZWI C;  1H2M A;  4NTX A;  1OCR B;  3N2G A;  1QBZ A;  3H1I H;  1SC5 B;  3T4D A;  3T1H B;  3F5W C;  5CA0 B;  2EIM C;  5JJN B;  1N0J A;  1M5I A;  1I5Y A;  4D7S A;  3RVZ A;  4BWA A;  2V4D A;  1WJZ A;  2QWR B;  1CEZ A;  1AI7 A;  4EEQ A;  1Q82 W;  3ZMV A;  1BE3 H;  3LSU A;  4J7J A;  2CH7 B;  2Q0A A;  5IJ9 B;  4NXM B;  1S5H C;  1YXB A;  3FYI B;  4DYL A;  1K73 W;  4ZBM A;  1ZTE A;  1M57 B;  3APO A;  2UUB B;  4QE7 A;  5LYJ A;  4QE9 A;  3G80 A;  2OCC B;  4PV1 B;  1GAX A;  1HR0 B;  4N21 A;  2IJJ A;  1TUB A;  2LO1 A;  3CJH A;  3STL C;  2IH3 C;  2YEV A;  2Z0A A;  3MHS C;  3O9O A;  2JIZ G;  1QLE C;  3L70 H;  2CDY A;  3JD0 A;  4DUZ B;  3RBZ A;  4Z1V A;  4I4T B;  4EFE A;  3ZHQ A;  2ZE7 A;  3RW0 A;  1VQK V;  3DTU B;  3FYE B;  4CC6 A;  1MSD A;  2BTQ B;  5CA1 A;  3L73 H;  5HFM A;  1KC8 W;  4AIL C;  2QEX V;  1HP8 A;  4J42 A;  5B5E Z;  1MAB G;  1EM1 A;  3ZED A;  3D36 C;  3RYF B;  4LNU A;  2Q67 A;  4B08 A;  2JGU A;  1GO3 F;  1BQ0 A;  3OTF A;  4I5S A;  3G4S V;  3RN4 A;  3CME V;  1K4D C;  2YS8 A;  5JWP A;  4CS3 A;  4JI8 O;  3ICX A;  1CXZ B;  4NKG B;  3N2G B;  1R3J C;  4J11 A;  1OCO B;  4CH4 A;  4OPH A;  1EN6 A;  3CCQ V;  3R66 A;  3X2Q B;  5CB4 A;  1N34 O;  5J2U A;  1AP5 A;  2OIE A;  2FL4 A;  4QPJ A;  3AK3 A;  2OYQ A;  3D36 A;  3CCV V;  3GB7 C;  4L8J A;  3RFR A;  3K5M A;  1DK1 A;  2F4V O;  4J80 A;  4GX5 A;  1K5S A;  4DRX A;  3SYP A;  5E79 Z;  4K35 A;  3ZHR A;  5GTI Z;  3TCU A;  5CA3 A;  2ADP A;  2Q5Z A;  4X1I A;  2EIM B;  3T4Z A;  4ZHQ A;  1TUB B;  3F5T A;  3R65 A;  5TIS Z;  3BRC A;  4LP8 A;  5KX5 A;  3VQX A;  3FB8 C;  3ASN C;  3ETD A;  2OTJ V;  5H2F Z;  4IYI A;  2RQ6 A;  3K58 A;  4KL1 A;  4JI8 B;  4GT1 A;  4H0L B;  1Y6X A;  5CA1 B;  2E3C A;  2K1E A;  4LFB O;  1X4T A;  2PGG A;  2EIK B;  1WPB A;  1GM7 A;  5IE9 A;  1K8A W;  4LNU B;  3BA8 A;  4WFG A;  1QVG U;  1KEC A;  4MVR A;  2H94 A;  5LMU O;  5DM6 V;  2QJ1 A;  2WLM A;  2Q7H A;  3SYA A;  2R9R B;  2A9H A;  4D7T A;  1PNL A;  4B3S O;  4JPR A;  3IGA C;  3OUS A;  2F4V B;  1XMO O;  2B1G A;  5CB4 B;  5J2U B;  2RDC A;  2PYJ A;  1NTM H;  3RT3 C;  1MA1 A;  4O4H A;  5JCO C;  3QTC A;  4JYB A;  2HVJ C;  1QR8 A;  3GWK C;  1L0N H;  1IUR A;  2YI9 A;  2EIN C;  3B8N A;  4DRX B;  2E5L O;  4UV8 A;  3CXC U;  4X1I B;  1SQV H;  3OT7 A;  1K7D A;  2KKW A;  2UXN A;  4ZHQ B;  2Q7G A;  5KUK A;  4LFB B;  2QWQ B;  4R6Z A;  2K9P A;  3TJT A;  5KX5 B;  4FJC C;  4B3R O;  2WLJ A;  5JCO A;  3WFV A;  2IJH A;  3IC7 A;  4JI6 O;  3WB1 A;  4HAM A;  1RSO A;  2P4V A;  5LMU B;  1V54 B;  1H8H G;  1M4U A;  4I9W A;  2CTW A;  4F4L A;  1YEW A;  1YJW V;  4FVM A;  1ORQ C;  3CCE V;  1NR7 A;  4B3S B;  1N32 O;  2P6J A;  4UVA A;  1B6Q A;  4XDJ A;  1XMO B;  3IAY A;  3G6B A;  3E8F A;  4DXW A;  3CPW U;  5EC1 C;  1DGS A;  1G8M A;  1H2L A;  1F4M A;  1GH6 A;  4O4L A;  3WG7 C;  1SQB H;  4IGG A;  4UVB A;  5KLV H;  2BOB C;  4G28 B;  1THZ A;  4IIJ A;  2E5L B;  2ZKO A;  2WWW A;  1JQ0 A;  1G6U A;  4MTG A;  3UQ8 A;  2HKO A;  4DR3 O;  1NH2 D;  3ZRW A;  4O4H B;  1VQM V;  4RUF A;  4LBE C;  4JYY A;  1Q8I A;  3ETQ A;  1KB9 F;  2F95 B;  2D2C B;  4B3R B;  3UO3 A;  3HKC A;  4ZOL A;  5LHH A;  2OTL V;  5HFL A;  4F6E A;  4DR6 O;  4CS4 A;  4X9Q A;  1Q6H A;  4H37 A;  1I08 A;  1V9P A;  1P49 A;  3HKB A;  1AR1 B;  2WLL A;  3CYO A;  2YI8 A;  2Z3Y A;  1AJP A;  1N32 B;  1HNZ O;  1Z2G A;  4JTC B;  1G1X B;  2W0X A;  4TQF A;  5IYB O;  2PUS A;  4X88 A;  2G38 A;  5KHI A;  2V1D A;  3APQ A;  3DGE A;  3HR0 A;  1RSO B;  3QO7 A;  2FKX A;  2BSK A;  2XOK G;  3SYC A;  2AHZ A;  5BY1 A;  4BIZ A;  2QSA A;  2MK3 A;  2JEU A;  3SPC A;  2EZP A;  4O2A A;  4Z2W A;  4U7O A;  2WAM A;  1SF9 A;  2UUA O;  3AG7 A;  1AB3 A;  2DMX A;  4DR3 B;  1JX9 A;  2Q4P A;  1VQL V;  4FM2 A;  4O4L B;  2CUG A;  4K8X A;  3BPZ A;  5KAF Z;  2WLI A;  4DR4 O;  5EK0 A;  1GN3 A;  2ILM A;  4JI0 B;  5F2V O;  3LUT B;  4LFC O;  3CS5 A;  2XTA A;  4IIJ B;  2AHY A;  2P5O A;  2ZDI C;  3ZMU A;  4YJ2 B;  5LA6 A;  3ZRW B;  4DR7 O;  1F23 A;  1ZLZ A;  1SQG A;  1SET A;  3CE2 A;  1HNZ B;  3UT5 A;  2R9A A;  4LF6 O;  3C90 A;  3HKC B;  3E8G A;  4ZOL B;  2GBO A;  2OIG A;  3OFN G;  3WG7 B;  1YVW A;  2MW2 B;  3ZN0 A;  3CEI A;  2YXH A;  4PA7 A;  4TSF G;  1R3K C;  2WLL B;  2OCH A;  3K08 A;  5DN6 G;  4FPP A;  2E76 B;  2ZDI A;  3K0D A;  4DW0 A;  2DN9 A;  4DO2 A;  1BQZ A;  4RWU A;  2UUA B;  1R1B A;  4DV2 B;  4NYK A;  4U7N A;  1PNM A;  4GKK O;  3OEE G;  2QA4 V;  3FKS G;  3VQV A;  2L6L A;  3IJ4 A;  1SKV A;  3CRQ A;  1L1F A;  2BSK B;  4I50 A;  2GTS A;  4YY3 O;  4JI7 B;  2JS3 A;  4MT8 A;  1FXK A;  4DR4 B;  4R7C A;  3OTO O;  1XBL A;  4O4J A;  4MVS A;  3W7T A;  4PEL A;  5L3C A;  1WP8 A;  1OCR C;  2XAJ A;  4O2A B;  2DQ0 A;  4FLT A;  1HNW O;  4OGQ B;  1FAF A;  1JA8 A;  2UXB O;  4MS2 A;  3QG5 A;  1K5Q A;  1IX9 A;  2CTR A;  1JOY A;  5IWA O;  3THO A;  4FZ1 A;  3DSQ A;  1VAR A;  4LF6 B;  2Q73 A;  2WLI B;  5J9P C;  1XRE A;  2QKC A;  3H1K H;  3PJS K;  2WPD G;  2ZIM A;  1EZJ A;  2Q9L A;  1Q7Y W;  4E4E A;  1VEW A;  1KMI Z;  4UVC A;  2HVK C;  2FB5 A;  4QPK A;  4O4I A;  4AI8 A;  5KHH A;  2ZNJ A;  4HBN A;  4KHP B;  4FIP C;  4GX2 A;  3UT5 B;  4PA9 A;  2QKA A;  4B3M O;  1EN4 A;  2N05 A;  2ITD C;  4GKK B;  5K1P A;  2HP8 A;  2N04 A;  2ZT9 B;  1ENV A;  3ZIA G;  4YY3 B;  2A7W A;  4JYC A;  4UCS A;  3ZX6 A;  3OTO B;  1QLN A;  1Q6U A;  3OMA B;  1HNW B;  3BVO A;  3CCU V;  4DV3 O;  2UXB B;  5H9C A;  1RFY A;  1WB8 A;  1E1R G;  2OWO A;  3GWO A;  1JVM A;  1HNX O;  5IWA B;  4E2L A;  2DWE C;  1VQ6 V;  4I50 B;  1NTZ H;  1FXK B;  1I0H A;  2W0F C;  3OR7 C;  2Q69 A;  2GTA A;  4NVP A;  1GRJ A;  1MZE A;  4FK5 C;  2GDS A;  4JI5 B;  1OHH G;  2DWD C;  2IJK A;  4I4T A;  5C93 A;  3TET A;  1BT8 A;  4WCE V;  5E1A C;  4B3M B;  2EIL B;  4LF4 O;  4CH6 A;  3ZBH A;  3JD3 A;  4ICG A;  1S72 V;  3DC6 A;  3WB0 A;  4O4I B;  2BTO A;  1YZB A;  1N36 O;  1YIT V;  1OZ0 A;  3ZHV A;  4DK1 A;  4JAA A;  3AG1 C;  2PZS A;  3L72 H;  4XDL A;  1HNX B;  1I94 B;  5FPR A;  1WP7 A;  1RM1 B;  1JCH A;  1IBL O;  2AW9 A;  5GW7 A;  1FFT B;  1JR9 A;  2QKS A;  5B1O A;  1BCC H;  4JTD B;  3KZI Z;  5JVD A;  1KBH A;  3L71 H;  1QR9 A;  2YID A;  5LGU A;  2JDI G;  3AG2 B;  1NJI W;  1B04 A;  1D2D A;  2EIK C;  2NNU A;  4I0X A;  4FM0 A;  2F23 A;  2IH1 C;  1DF4 A;  3AK1 A;  3G67 A;  2F66 C;  3ZN1 A;  2CGN A;  3STZ C;  2EUL A;  3EVK A;  1P7B A;  4LF4 B;  3RYI A;  3H1L H;  2EX3 A;  1R3L C;  4EKW A;  5KUM A;  1AR4 A;  4MW8 A;  4MTO A;  5EYP B;  1S3J A;  2QE7 G;  1N36 B;  3CC2 V;  4XDK A;  1B06 A;  2P90 A;  1FFX A;  1Y67 A;  3N27 A;  4J41 A;  2QGN A;  2GHY A;  1H38 A;  1R6N A;  2N74 A;  3JYC A;  1Q6I A;  3CXH F;  1N33 O;  2LJ2 A;  3QF7 A;  4K0K O;  1Z5V A;  3JAS A;  4FFB A;  3H1H H;  2KG7 A;  3ABK C;  1XHZ A;  4LF9 O;  1JFF A;  5LHI A;  4KXR A;  2X6A A;  4P9P A;  1YTF D;  2P7T C;  3E35 A;  1QCE A;  2F1M A;  3OD4 A;  1HW7 A;  2QTS A;  3A0B Z;  1V54 C;  1S5L Z;  4JAU A;  1XNQ O;  4G27 B;  2Q8V A;  5JVD B;  2JK5 C;  1Y66 A;  3L75 H;  1D5A A;  3JAW A;  1P7G A;  2HJD A;  4I0X B;  1NBM G;  1TUE B;  3B77 A;  5IY5 B;  3AG1 B;  2CK3 G;  2B9Z A;  3RYI B;  2VRZ A;  4GZR B;  4JI4 O;  4YIP A;  3ZRS A;  4FLY A;  2WLH A;  4DV0 O;  1US6 A;  2GV9 A;  4QIW F;  3AG4 C;  1LUW A;  1N33 B;  1BS3 A;  4K0K B;  1XNR O;  3ABL C;  4MVQ A;  1FFX B;  4PJ0 Z;  1N34 B;  1OJH A;  2GUZ B;  4H44 B;  4ZI7 A;  1PL0 A;  3MDS A;  4LF9 B;  2JS5 A;  1VIB A;  1NVP D;  1N8R W;  3FB6 C;  3K3W A;  3HKE A;  2ZQM A;  3OMI B;  2XT9 A;  1R6T A;  3JAS B;  1EBO A;  5L3D A;  4FFB B;  1XNQ B;  2KG7 B;  3ABM B;  3D3Q A;  3FB5 C;  5BR8 O;  1JFF B;  1M90 W;  2DOS A;  4MW3 A;  1W0J G;  5A2Q N;  4JGS A;  3RGB A;  1BZK A;  3BCC H;  4JI4 B;  4UUJ C;  4OPA A;  1TVK A;  4R50 A;  3O65 A;  3NR7 A;  1OCZ C;  2P4K A;  1NU1 H;  4WF9 V;  1PD3 A;  4DV0 B;  3OE7 G;  3JAW B;  2DYS C;  3LNN A;  5IYZ A;  3ABK B;  1XL6 A;  1TGO A;  2YC0 A;  3G71 V;  4IYH A;  1AJQ A;  5K1X A;  1PM9 A;  3ZMZ A;  2NLJ C;  3D8C A;  1WLE A;  1XMQ O;  3LSQ A;  3FAV A;  1IZ3 A;  2XAQ A;  4FMT A;  3HB3 B;  3B2E E;  3JAM N;  1KQS U;  2EZO A;  2RJZ A;  2F93 B;  1KP3 A;  1CPY A;  1J95 A;  4ZI7 B;  1UFI A;  1MSW D;  4X8A A;  3IFX A;  5BR8 B;  2DYR B;  1IXM A;  4FLW A;  4J7K A;  4BAY A;  3HKE B;  1PPJ H;  3W7U A;  4MVM A;  3M7M X;  2QDO A;  4PI0 A;  4GUN A;  3AG4 B;  1SES A;  4QGP A;  1XIL A;  4LFA O;  2QM4 A;  3CP1 A;  1NR1 A;  1AI5 A;  4YJ2 A;  3ABL B;  1M56 B;  2L35 A;  1PNK A;  1KU9 A;  4DR1 O;  4GKJ O;  1GMG A;  1I5X A;  1FPO A;  1F7Y A;  4TT3 G;  3KCY A;  3D3I A;  4RQE A;  1TVK B;  4JI6 B;  5CN0 A;  3JAK A;  3KKY A;  4OXS A;  4CS2 A;  1IBM O;  4B7E A;  1JPX A;  1OV9 A;  2YIA A;  5IYZ B;  4FLX A;  4WFF A;  2UUC O;  1S0V A;  4DR2 O;  4I7Z B;  3IC9 A;  5L3F A;  3MHH C;  2HFE C;  1YHQ V;  1RPO A;  3FAV B;  1S77 D;  3EFF K;  3I56 V;  3L9D A;  5KA6 A;  2ZM6 O;  1NI8 A;  4P2Z A;  3CCR V;  3CCS V;  1Q81 W;  4TWK A;  4JAS A;  1J5E O;  1OCZ B;  2XND G;  4FLU A;  1M1K W;  4TV9 B;  1BGY H;  5GON A;  2DQ3 A;  1B3Q A;  3SYO A;  2DYS B;  4RO2 A;  1K92 A;  3CMA V;  3SDL A;  4AQY O;  3T1Y O;  4Q20 A;  4LF8 O;  4U3F H;  2ADQ B;  2JVD A;  3ZMT A;  3LNM B;  4IHJ A;  1BMF G;  1JMK C;  2YXL A;  2EIJ C;  5EBL C;  4DR1 B;  4MVO A;  3L74 H;  5L3G A;  2ZE5 A;  1YI2 V;  1L0L H;  4DR6 B;  1X59 A;  1BHB A;  1GKF A;  1SZX A;  2YUA A;  3UKM A;  2H3O A;  1F51 A;  4WFE A;  3ASO C;  3ZCC A;  3I55 V;  3ABT A;  3ML0 A;  3OAA G;  4DV6 O;  3JCZ A;  2UUC B;  1GN2 A;  2XAF A;  5D5P A;  3K9A A;  4DR2 B;  1K97 A;  2X6C A; 
#chains in the Genus database with same CATH homology
 3L75 H;  3H1J H;  1L0N H;  1BGY H;  1BE3 H;  1L0L H;  1KYO F;  1SQQ H;  2A06 H;  3BCC H;  1SQX H;  3H1I H;  4D6T H;  1KB9 F;  4U3F H;  3TGU H;  1SQB H;  1PPJ H;  3CWB H;  1BCC H;  1NU1 H;  3H1K H;  3H1L H;  1SQV H;  1SQP H;  4PD4 F;  2BCC H;  3L70 H;  5KLV H;  1NTK H;  3L71 H;  2FYU H;  1NTZ H;  1EZV H;  1PP9 H;  1NTM H;  3CXH F;  3CX5 F;  3L74 H;  3L73 H;  2IBZ H;  1P84 F;  3L72 H;  3H1H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...