3H1JH

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 25
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1jH00
1NTZH 1PP9H 1P84F 1SQXH 4D6TH 1KYOF 1SQBH 3L73H 1BCCH 1SQPH 3L72H 1KB9F 2FYUH 3L70H 3H1LH 3L74H 3TGUH 2BCCH 3CWBH 5KLVH 3H1JH 1BE3H 1EZVH 1NU1H 4U3FH 1NTMH 2A06H 3BCCH 1SQQH 2IBZH 1PPJH 1L0LH 1BGYH 3L71H 3H1KH 3CX5F 1L0NH 4PD4F 3H1HH 3CXHF 3L75H 1NTKH 3H1IH 1SQVH
chains in the Genus database with same CATH superfamily
4NYKA 5JQGB 1H8EG 3GWOA 2GBOA 3G6BA 1N8RW 3JYCA 2P90A 3E83A 3ICXA 2CH7B 4FM2A 1D5AA 4LF8B 5IT9N 3IC7A 1Q5OA 2YICA 4NTYA 1PKXA 3AG1B 3DC6A 3JALB 5L3DA 3K58A 5KHKA 2ZXWC 3N2KA 4PD4F 3T1HB 1YIJV 4XDKA 4K0KB 4UCTA 4XDJA 5B3SC 4LCUC 2LW7A 1I94B 2YIAA 4FVMA 3CRRA 2CTQA 1MA1A 2AGAA 4OX9B 2HR3A 2ODMA 3TGUH 1IX9A 2OCCC 5J2UA 2YEVA 4GUNA 2HFEC 3FX7A 1SKVA 4O4HB 3CHXA 4HNAB 4K8ZA 5D5QA 1R3LC 2UXNA 3IGAC 2B1IA 3RYHA 3T1CA 2F95B 4BIZA 3ZN0A 1JA8A 4J7KA 1PL0A 4JZGA 4TV9B 4KHPO 1AP6A 1KQSU 1GMGA 3O65A 5CBGA 4FZ1A 4PI2A 4YY3B 2UUAO 2ADPA 4DV1B 1H2KA 3SYQA 3ETDA 1M56B 3K57A 1HNZO 3JAMN 1XMOO 3FYEB 3P3NA 1XMQO 3U0ZA 5DM6V 3BA9A 4U7NA 1N33B 3JD2A 1W59A 3AK1A 3SYAA 4J80A 1VARA 2AW9A 2ZDIC 2UXDB 1U96A 4JZ2A 3ZRSA 4JI4O 1ZTEA 1B04A 2WSSG 4UVAA 2JK5C 4TV9A 2R70A 2WA3A 1XEQA 3QTCA 5BR8B 3CB2A 4XBFA 2Q69A 5LHIA 4FLWA 4DR2O 2W6IG 1TGOA 1R6TA 4YXWG 4GKJB 4EB6A 3OEHG 2QA4V 5BY1A 4JAVA 2WPDG 2RN9A 1IBKB 3ZHQA 3B2EE 1SQBH 2V7QG 4DR1B 4LC1A 3OM3B 1MZEA 2ZDIA 4X20B 1YXBA 3AG3B 5IJ9A 1PPJH 2HHHB 1OCZC 3E89A 2XAJA 1GKFA 3CS5A 3QG5A 4LF5B 3GB7C 3L75H 2BOBC 5IYCO 4DK0A 1XQ8A 3EVKA 1NJIW 5CN0A 1G1XB 1BQZA 4CC6A 4GLXA 4LF7B 3EHBB 5KAFZ 1EBOA 2YXYA 3ABKB 4E4EA 5B1BB 3SYOA 3T4ZA 1TA8A 3T1YB 4GKKO 1B3QA 1N4CA 2B9ZA 3OR6C 1HNXB 4DR4O 4DW0A 4LBEC 4G2KA 4CS3A 2HVKC 4FIPC 1J95A 1N34B 2YIBD 1V9PA 2YXLA 4E2LA 5JJNB 1TUBB 1Q90D 3BAAA 2ZNJA 3OR7C 3CRCA 3FKSG 2JS3A 2F4VO 3VQYA 2R9RB 3MAQA 1SERA 4DR6B 3E8FA 5IYDO 5H6QA 4B3SB 4I5SA 2B1GA 4FJCC 2Y0IA 1H2LA 4MW8A 4HZ3A 4IHJB 5FNVA 3BY6A 1ZLZA 4MVOA 3KZIZ 3M99B 1JJOA 4NTXA 5BMVB 3DTUB 5KX5A 4TWKA 2F23A 4CH6A 4MVZA 3VQWA 5IY5B 3GVMA 2GHYA 1GN6A 4JI1O 2NLJC 2Q0OC 3CSXA 4X64B 3SJQC 4OPAA 3L71H 1VF7A 2HEPA 1WLEA 4JI7B 3IC9A 3HKCB 4UUJC 1D2DA 5LMUB 3I56V 1XNRB 2QEXV 3ZHRA 5FPRA 1FJGB 1AI5A 2DYSB 3WG7C 3ZHUA 2UUBB 2OYQA 4Q20A 2YIBA 2KKWA 2LQTA 3E2EA 1NKDA 2PTMA 3C90A 2ZQMA 3JCZA 1WB8A 3N2GB 2OTJV 5LXTB 3X2QB 3D8CA 3JARB 3WB2A 4JV5O 2PI5A 2F1MA 2OCHA 1QLEB 3J80N 1HDJA 1K9MW 4Z1VA 3CRAA 1RPOA 1JVMA 4LP8A 1JCHA 4I9WA 2D2CB 1AJPA 1N32B 3QO5A 3U10A 3M7MX 3UM7A 2LFSA 2GV9A 4PI0A 2M7WA 1KKCA 1Q6HA 2YSUB 4JASA 2C2AA 3RWRD 5GTHZ 1QVFU 5KHJA 1EM1A 3F7VC 4R7CA 2DN9A 4TT3G 2CTPA 5H6RA 5C8YB 1HWYA 1GO3F 2P06A 3CPWU 1EN4A 3N2GA 4A5UB 4JF3A 1V55C 1VQNV 1ZL8A 3VQVA 2X6BA 1DTOA 5GONA 3JAKB 4B3RB 1XUQA 4IL6Z 1SF9A 1F4MA 1Y6XA 4I4TB 2QR4A 2FMLA 2IJKA 1HR0B 2ETNA 4H13B 3L9DA 1N36B 4LFAB 2FB5A 1MNGA 4PA9A 2DYRC 4LFBO 4DR5O 1VQPV 2NR5A 4X9QA 1YF2A 3OTOO 4UCUA 3CCJV 3SPJA 3SJAC 2EIMB 4CH5A 2GTAA 3CC2V 1F23A 3H1KH 3JSLA 3RBZA 3K3WA 1R6NA 1Y74A 3K5MA 4DV2O 2JGDB 1UPGA 1WAZA 5L3CA 1OCCC 1W0KG 1K97A 4FFBB 4GX2A 3DC5A 4X1KA 2PI4A 3QF7A 3OGIB 4I55A 4I4TA 3WU2Z 1BGYH 2K9PA 2JJ1G 1B6QA 3N27A 1DLBA 1VQ4V 1AROP 4DV5O 4JYAO 4FM1A 1YHQV 2VWJA 1EZJA 4O4IA 4RUFA 3GWKC 4DV6B 1TVKB 1JFFA 1Q43A 2IJJA 2DQ3A 1R6KA 1PD3A 2VRZA 1FFTB 4TUYA 2MW2B 1VEWA 2QKSA 2Q4PA 2ADQB 4PDMA 4O4JB 2WLIB 1BT8A 1THZA 3G67A 1Q8IA 3ZHSA 4ZKIA 3ETGA 2NNUA 4WBNB 3J81N 3BCCH 5BZBA 1SQQH 3ZEDA 1G6UA 5KHGA 1GK9A 1Q6IA 4MS2A 4UB8Z 3CXHF 5LMNO 4P9PA 2Z5UA 2EIKC 2LFRA 1YVWA 1NR7A 2EIJC 2O57A 4FLYA 1SZXA 2A79B 2Q0AA 1XILA 2AZ2A 2VQEB 1WN7A 3T1HO 3ZCCA 2OIGA 1KMIZ 2Q8VA 2ZT9B 3JATB 4K0KO 3B09A 5C93A 1QU7A 1Q86W 3AG2C 1L0NH 3RYFB 2WLIA 2ZR3A 4DUYB 1KU9A 3ABLB 2LW1A 1WP7A 4IIJA 3BFRA 1E1QG 5FLXN 4LFCO 3B8MA 1QVGU 3L73H 2VS0A 4DV0B 1JQ0A 3T4DA 1XDCA 1IURA 3SJBC 4K8XA 1NVPD 5E1AC 2E76B 4G27B 1X59A 1P7BA 2H3OA 1FYJA 4F6EA 4BAYA 2CTWA 3N2KB 3FFQA 5EIBC 5KMGA 2ITCC 1SQXH 4ICGA 2Q67A 4N21A 4XDLA 4YY3O 4DV1O 5LYJA 1RM1C 3CEIA 3P3PA 3ABUA 2YXHA 3JATA 3F5TA 1QHTA 2FKXA 1NVPB 5J2UB 1IDSA 1XNQO 3WB0A 2QM7A 5CB4A 4WFGA 5FPOA 3RYFA 1K92A 5L3GA 1N33O 1DK1A 3KCYA 3K06A 5JWPA 5JH7B 5A2QN 4JI0B 2DOSA 4U3JA 1Y4MA 2ZNIA 1YSCA 1VQ7V 5IWAB 1BE3H 3TK1A 1AP5A 2ZXWB 3K0GA 1PM9A 3ZS8C 4GX5A 3F5WC 5B3SB 1P4RA 2GTSA 4FFKA 5BR8O 1UJWB 2XAHA 5CBHA 1ZSPA 5JJEB 2Z3YA 1GN2A 4FLXA 2K1EA 2OCCB 3SPIA 4LF4B 2XOKG 4Z1MG 2XAGA 4HBNA 4TOIA 3OW2U 1P7GA 1YDXA 2FTKA 3U11A 2LO1A 2Q73A 4YIOA 4GYCB 5IYZA 4ABMA 1IBKO 1R3IC 1K4DC 2G38A 4TV8B 1OV9A 1Y76A 4ZHQA 5KUKA 4DR1O 4LWSB 2GUZA 1PNLA 3CD6V 5JH7A 1XBLA 2EBOA 4FLZA 2IJHA 4CS4A 3BVOA 2HHHO 4X1IA 4FLVA 4LF5O 2BCCH 1YJNV 2XAQA 3HPLC 3B77A 2ZE8A 4ZIBA 3A8TA 4EB6B 3MDSA 4O4LB 3QO7A 1P84F 4DV3B 4X62B 2EINC 2OTLV 3L72H 1T5EA 1OCOC 3THOA 1KP2A 2EILC 3K9SA 2QWOB 1IXBA 3DSQA 3RN4A 1BHBA 4B08A 2V1DA 1J5EB 4B3TB 4W4KA 4NKGB 5IJ9B 4Q6GA 1MG1A 4TQFA 4TV8A 2A7WA 1K7DA 2DE0X 3AG4C 5KHIA 4LWSA 1N34O 3CJHB 3NR7A 2BTOA 4DR3B 4JAAA 3LSQA 3RYCA 1HW7A 2UU9O 1GM9A 3BRCA 3ZMZA 2X6AA 5DN6G 1GTOA 3JD3A 1TUEB 3CP1A 4CBCA 3E22B 4JPRA 1FD9A 1VMGA 4R8CA 3ZJZA 4B3SO 4O4LA 1M9NA 4RQEA 1AJNA 5H9CA 2PYLA 1S72V 5HFMA 5L3BA 1LUWA 4LF9O 4O2AA 4L87A 1OCZB 1XOUA 2XT9A 1I5XA 4JI6B 5B1AC 2UXBB 3CJHA 4JTDB 4OXSA 4F6RB 5KA5A 3IJ4A 3OUSA 4EKWA 3B8NA 3UO2A 2ZM6B 1SETA 3CWBH 4JI7O 4OGQB 4J10A 3LDDA 2BOCC 3ABMC 2E5LO 5LMUO 1XNRO 4KHPB 3E22A 2RNBA 5FNVB 2DJVA 3NXSA 1BMFG 4WFBV 3ZMVA 1H2GA 4DYLA 1SQVH 5KX5B 1K3EA 2NN4A 2XUMA 4WFEA 5FL7G 2UUBO 2IU3A 3R66A 5TISZ 5LA6A 1BQ0A 1QR8A 4DR7B 5CA3A 1ORQC 1Z2GA 1XMQB 1RPRA 2IH3C 1TAEA 3MD0A 2JVDA 3TXSA 1EFRG 2JGUA 1IBMB 2ZE7A 1MZFA 4F6RA 2X7RB 3JSNA 2IH1C 1Z5VA 3ML0A 2YI8A 2XAFA 1WPXA 1M57C 4PV1B 1N32O 5B5EZ 1Q3EA 1OHHG 3K9AA 4B3MB 3C3SA 1M93A 3KKYA 3STZC 1XI1A 2DWEC 3QNEA 4R50A 1HNWB 4C7UA 2Y69C 1G8MA 3JCUZ 2WLMA 1XREA 3SPGA 2QSAA 3K0DA 5EK0A 3HR0A 1K8AW 1GM8A 4LH7A 3FAVA 2WLHA 1CXZB 2BTQB 1YTFD 4AILC 1NS1A 2OT5A 1AR4A 5J2TA 1K5QA 4DV4O 3A0RA 4B3RO 1AILA 4ZOLB 3ZMUA 4WFFA 3J7AU 3WG7B 1F7YA 3ZN1A 1AJQA 2CE4A 1N36O 4LFAO 3K04A 2P4VA 4UVBA 2X6CA 2ZIMA 4X89A 4UB6Z 3RYIB 3SGIA 4RWUA 2HG5C 1VQ8V 3HKDA 2Y4UA 1QNMA 1YJ9V 4CZZA 2KB1A 4CH4A 1SS3A 1YTFB 4MTFA 2ILMA 4GKKB 4J7JA 1BCCH 1ZL8B 5GONB 2ZKOA 1L1FA 4DRXA 2P6JA 1GN3A 1QLNA 4MVUA 4EEQA 3UKMA 4GZRB 4FK5C 2BTQA 1XL4A 3Q4HA 1PP9H 4ZOLA 4D7SA 4YJ2A 4NXNB 5EBMC 4DUZO 2FL4A 2KSDA 2ZIOA 4KFMA 1O9HA 3SPCA 4RUEA 3RYIA 3FYIB 2JS5A 2QWQB 1V55B 3TCUA 1K73W 3K5NA 5BXZA 2QKAA 1H8HG 1Y74B 3CXCU 2ATKC 2VWKA 3RW0A 2UUCB 1YJWV 4X1KB 4GT1A 3SYPA 3DXRA 2RJZA 3ZIAG 2A06H 4I55B 4BW9A 4PA7A 1KECA 1V54C 1SESA 4NXMB 1AVMA 4QPKA 4JI1B 2DYRB 1XHXA 1X4TA 5CBFA 5GW7A 2BSKA 3OTFA 3K03A 1N0JA 4O4IB 1WPBA 1JFFB 3A2FA 2Q6AA 4TUYB 3RT3C 4LF6B 3CCQV 4P30A 5GTIZ 2RQ6A 5H2FZ 1S5LZ 4OPHA 3CMAV 2VQEO 1VQKV 1OCCB 5KUMA 3JD1A 1BZKA 1JJ2U 2YDEA 2LP7A 2XASA 2P67A 1JMKC 1H2SB 5CMUA 1BL8A 1SC5B 4JI5B 2F66C 4JI2B 1SQGA 3ASNC 1ZUQA 3OMIB 4UCOA 3A0BZ 5B66Z 2BE3A 4DV0O 1LNQA 1RSOB 5HFLA 1SA0A 1AB3A 2E75B 3QO8A 1NTZH 3OE7G 4BIOA 2VQFB 4R6ZA 1DF4A 1KC8W 2MK3A 1FFXB 1COWG 1MABG 4DV7O 1N0NA 3H1JH 2ITDC 1AR5A 2UXXA 1KP3A 4H0LB 2PY5A 4GCZA 4YHHB 2Q68A 3SYCA 3LNNA 3H1HH 4W4LA 2OWOA 3FB7C 4KUMA 3OMAB 1W0JG 2Q9LA 4IIJB 2IU0A 2PUSA 4TSFG 1M90W 1VP7A 5EZYA 1WP8A 2ZR2A 4TQDA 4MVRA 2QDOA 4X65O 5IE9A 3LDEA 1CEZA 2GDSA 4JI8B 1OJHA 2QM8A 1E1RG 3BHPA 5KA6A 1RSOA 2EIKB 3PN1A 2EIJB 4UVCA 5IWAO 1Z5WA 5KMGB 4LF8O 3JAWB 3CMEV 1JPXA 3HKEB 1QQCA 5B1NA 3F7YC 1MMMA 1FFXA 2F43G 3CRMA 5LYJB 3RGBA 1VIBA 3ZMTA 2HJFC 3G4SV 3AG2B 2E74B 5EIBD 3RVYA 2WLLB 1EN5A 4FLUA 4UXNA 5CB4B 2UXCB 4NTWA 3E35A 1I94O 4LF4O 1PL4A 2JDIG 3H1IH 4JGSA 4OX9O 2EZOA 4I0XA 4P2ZA 5LOVA 4KXRA 2WLKA 1QCEA 4U3JB 4QJFB 2H8PC 2KQXA 4FMTA 1RP3B 3JD0A 4X1YA 2EJ7A 3TXQA 4JYBA 2HKOA 2YIDA 5EBLC 4DXWA 1WA8A 3OEEG 1RM1B 4X66B 1YEWA 1FXKC 3JAWA 3KCXA 2QJ1A 4DV5B 3HKEA 3CC4V 1VQ6V 5LGUA 2PGGA 5DECA 5LBQA 4K35A 4MSWC 3HKBA 4B7EA 2QTOA 3S3XA 2WLLA 2ZCEA 3ASOC 3CCLV 1W2BU 4DV3O 5IYZB 4MT8A 2W0XA 4PHZA 3CCRV 1RFYA 3DGEA 1Y76B 2DQ0A 4ZHQB 2GUZB 2DWDC 3JASA 3LUTB 3M8AA 1OCRC 1J5EO 2LGWA 2UXDO 5CA1B 4IYIA 2QWRB 4X1IB 1NU1H 4BIUA 4DR3O 3UT5A 4UCRA 2AZ0A 1GN4A 3PJSK 1NTKH 1FXKA 1I7FA 3CCUV 2A0LA 4YJ3B 4CC5A 5LP6C 4AQYB 1VQ9V 2QM4A 3MHSC 3W7SA 3D36C 5J9PC 1IZ3A 1SRYA 2WAMA 4MTGA 4GKJO 5LMNB 4GX1A 2XHBA 3C3TA 5AG2A 3ZHTA 4JI3B 2V4DA 3HB3B 3VBBA 5A9GA 3AG1C 4F4LA 4NVPA 4UCSA 2JRIA 3H01A 3RYCB 5CA1A 2YUAA 4JI6O 1IBLB 5CA0A 4LFCB 4MTOA 2CGOA 2UXBO 3BPZA 3VQXA 5KAIZ 2LJ2A 1ZAUA 4LNUA 2Y4TA 4IYHA 4PJ0Z 3ZMSA 1HP8A 1KKDA 3ZRVA 2ZM6O 5LP6A 2EINB 4LF7O 5JQGA 3D36A 1OCOB 2EILB 3H9VA 4YJ3A 4QE7A 2IJIA 1GH6A 4DO2A 5K1PA 2ZD9A 2Z0AA 2CH7A 1GM7A 2HLDG 5EC2C 3T1YO 1HNXO 4O2AB 3JALA 3AG4B 2ZE6A 1SQFA 1VQOV 1Q81W 4DR7O 3BABA 4H37A 1ENVA 1XNQB 1Y67A 1SZTA 2EULA 2H94A 1H2MA 1KBHA 4ASUG 1M56C 2RMKB 2ZINA 4MVSA 2P7TC 3OT7A 2AHZA 2N04A 3P32A 1IBMO 1AI4A 3K5OA 5K1XA 4O4HA 3LNMB 3STLC 4HNAA 4U7OA 2B5UA 4DR6O 2N05A 5JVDB 2Y0PA 3K08A 3K79A 2HJDA 4B3MO 3AG7A 5LA6B 1Y66A 4J42A 3CRQA 1S77D 4GX0A 4Z2WA 1HNWO 1K5SA 2LGQA 5LGNA 1JOYA 5B1AB 5LGTA 3LDCA 2HP8A 4DW1A 1VF6C 1WJZA 2WLNA 1VF5B 4X64O 4AI8A 4I9QA 3CCEV 3T2MA 1L8DA 2AHYA 3ABMB 3W7UA 3FD9A 5JCOC 4PA6A 1FS0G 5L3EA 2QWPB 1L0LH 5IDJA 4X8AA 2R9IA 3CX5F 1K4CC 5JVDA 3AG3C 4HYOA 1FJGO 1YCIA 1Q82W 3CYOA 3W7WA 2FYUH 3FB5C 2UUAB 5JJJB 5F2VO 1KYOF 3OFNG 3E8BA 1KB9F 1HNZB 1XMOB 4I7ZB 3MHHC 3ETEA 3I55V 1WB7A 2IW5A 3FAVB 1VF6A 1M1KW 2Q5ZA 3ABKC 4J9ZB 5IJ0B 5B1BC 3ZHVA 1BS3A 4J9YB 5J2TB 1M5IA 4PA3A 4UV8A 1M57B 5JCOA 4JI4B 3L70H 3L74H 3APQA 4MW3A 3ZBHA 4QIWF 4X20A 1M4UA 2WLJA 2UU9B 2QGNA 2Y69B 1I5YA 2PYJA 4RO2A 4QE9A 4NXNO 1MSDA 3HKDB 2A3QA 3WB1A 4DR2B 3E86A 2YS8A 2Q7HA 2W6JG 2RCVA 4B7KA 4CH3A 3E8HA 4DRXB 3K5LA 1VQMV 2E3CA 2P22C 1S5HC 1NQTA 2P5OA 3OD4A 5IJ0A 1CPYA 1K34A 3AK2A 4EFEA 4LH6A 2F93B 5H5NA 4LF9B 2UUCO 3B4SA 2R72A 4MVQA 3ZX6A 3Q4HB 5L3FA 4PDVA 2XTAA 4FPPA 4YJ2B 4WFAV 1CP9A 4NXMO 5EBWC 4HAMA 5IY5C 1HR0O 1GAXA 2QWNB 1TUBA 1Q6UA 4J41A 2CTRA 5EYPB 4I50B 1IVSA 3D3QA 1I0HA 4JTCB 2KG7B 3CCMV 4H33A 1GRJA 2E5LB 3BA8A 2ARHA 1H2NA 4EFBA 4WFHA 4LF6O 4DR4B 3AK3A 3G6EV 3RVZA 3K59A 5KLVH 3EFFK 2DYSC 3OAAG 4IHJA 3FB6C 3DXRB 3IFXA 1E79G 4KP4A 1B06A 5BMVA 1R73A 1OZ0A 5ITZB 4JAUA 1BHAA 2N74A 4JI5O 2DMXA 4JI2O 1G4YB 1NBMG 4L8JA 3X2QC 2BSKB 1NT2B 1UFIA 2F4VB 1QLEC 3B40A 2AXTZ 1FXHA 4JYCA 5EYPA 4I50A 1VQLV 1JR9A 3OMNB 1ZWIC 1AR1B 2VQFO 2KG7A 3HKCA 4DV6O 2PF4E 1U97A 1SQPH 4DK1A 4YHHO 2WA4A 1AI6A 2GSMB 1US6A 3S3WA 1V54B 4MTXA 1MOFA 1H38A 4IT5A 3OGCC 4KL1A 5ITZA 5LXTA 4J11A 4NR1A 1P49A 3JARA 1SA0B 4D6TH 4N23A 4JI8O 2JJ2G 3BEHA 1KUQA 4DV4B 3W7XA 2JIZG 2Y48A 4U3FH 2A9HA 2Q7GA 3CE2A 3QVNA 3UQ8A 3KG2A 4RQFA 4JYYA 3LSUA 1ZX3A 2M6YA 1Q7YW 1YI2V 1PNMA 4PDLA 4G28B 4ZBMA 3UCSC 1QR9A 1R3KC 4BWAA 1QBZA 5EZYB 1MSWD 3ASNB 5LHGA 4JV5B 5C8YA 2JEUA 2UXCO 5DEDA 3E8GA 4DUYO 1AI7A 1DGSA 4JTAB 2L6LA 4PDRA 5B1OA 2EIMC 3AEIA 2RDCA 3ABTA 3CCVV 4QPJA 4WF9V 4AHCA 2ZE5A 3ZRWB 1F51A 2D3OW 2EX3A 3JAKA 3A0HZ 1XL6A 4QNHB 1ROPA 1IXMA 1VQ5V 3I5DA 4X88A 4DUZB 4QGPA 4X66O 4NB5A 1NI8A 1S76D 2OIEA 5KHHA 1S3JA 5EC1C 4FM0A 4ZI7B 3TJTA 4I0XB 2IM9A 5LOVB 2P4KA 2EJRA 1URFA 3H1LH 5D5PA 4P9OA 3W7TA 1LR1A 2HVJC 3RFRA 2JEXA 4WCEV 2CAZC 3G80A 3OUFA 2IBZH 4YIPA 4X1YB 3SR2C 2CDYA 2DW4A 2JGDA 4J7ZA 4JI0O 1R3JC 3ETQA 3D3IA 3SJCC 3FB8C 2Q7EA 1WA8B 4FZ0A 3ZRWA 4FFBA 1D5NA 2CUGA 3CCSV 1K33A 1JX9A 5LL6Y 4LFBB 4DR5B 2QKCA 1NR1A 3LSSA 4BR6A 1NTMH 2CGNA 3CC7V 4UFZA 3OTOB 3HKBB 1NH2D 3UO3A 1NZ6A 4AQYO 5E79Z 4IGGA 4UV9A 5LHHA 4FLTA 1FPOA 3EXAA 1YZBA 1DF5A 3JASB 4ZI7A 2L35A 1TVKA 3JD4A 4JI3O 2WWWA 4H44B 1I08A 4PA4A 4DV2B 4UCVA 1FAFA 1BSMA 1EZVH 1FXVA 1R1BA 3APOA 4K3AA 1YITV 3VOUA 5IYBO 3TETA 4O4JA 1NH2B 4O2BB 3UT5B 3ZRXA 1IBLO 1FXKB 3ABLC 1PNKA 4JYAB 2YC0A 2YI9A 3SDLA 3WFVA 2W0FC 4WBNA 3P30A 3ASOB 4LR3A 2X0LA 4D7TA 1O9GA 1KD1W 1PV0A 3SPHA 4DV7B 4X62O 2R9AA 2QE7G 1FKAO 2EZPA 1OCRB 2PZSA 4BW5A 3O9OA 2CK3G 1WNSA 1A32A 4MVMA 4B3TO 4PELA 4RAIA 1XHZA 1S0VA 5CA0B 2YEVB 1EN6A 4CS2A 2QTSA 4X65B 4LNUB 4O2BA 1F4NA 3G71V 3R65A 2XNDG 1LUVA 1S5JA 3RYHB 3IAYA 5LP6B
chains in the Genus database with same CATH topology
1NTZH 1PP9H 1P84F 1SQXH 4D6TH 1KYOF 1SQBH 3L73H 1BCCH 1SQPH 3L72H 1KB9F 2FYUH 3L70H 3H1LH 3L74H 3TGUH 2BCCH 3CWBH 5KLVH 3H1JH 1BE3H 1EZVH 1NU1H 4U3FH 1NTMH 2A06H 3BCCH 1SQQH 2IBZH 1PPJH 1L0LH 1BGYH 3L71H 3H1KH 3CX5F 1L0NH 4PD4F 3H1HH 3CXHF 3L75H 1NTKH 3H1IH 1SQVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ H;  1PP9 H;  1P84 F;  1SQX H;  4D6T H;  1KYO F;  1SQB H;  3L73 H;  1BCC H;  1SQP H;  3L72 H;  1KB9 F;  2FYU H;  3L70 H;  3H1L H;  3L74 H;  3TGU H;  2BCC H;  3CWB H;  5KLV H;  3H1J H;  1BE3 H;  1EZV H;  1NU1 H;  4U3F H;  1NTM H;  2A06 H;  3BCC H;  1SQQ H;  2IBZ H;  1PPJ H;  1L0L H;  1BGY H;  3L71 H;  3H1K H;  3CX5 F;  1L0N H;  4PD4 F;  3H1H H;  3CXH F;  3L75 H;  1NTK H;  3H1I H;  1SQV H; 
#chains in the Genus database with same CATH topology
 4NYK A;  5JQG B;  1H8E G;  3GWO A;  2GBO A;  3G6B A;  1N8R W;  3JYC A;  2P90 A;  3E83 A;  3ICX A;  2CH7 B;  4FM2 A;  1D5A A;  4LF8 B;  5IT9 N;  3IC7 A;  1Q5O A;  2YIC A;  4NTY A;  1PKX A;  3AG1 B;  3DC6 A;  3JAL B;  5L3D A;  3K58 A;  5KHK A;  2ZXW C;  3N2K A;  4PD4 F;  3T1H B;  1YIJ V;  4XDK A;  4K0K B;  4UCT A;  4XDJ A;  5B3S C;  4LCU C;  2LW7 A;  1I94 B;  2YIA A;  4FVM A;  3CRR A;  2CTQ A;  1MA1 A;  2AGA A;  4OX9 B;  2HR3 A;  2ODM A;  3TGU H;  1IX9 A;  2OCC C;  5J2U A;  2YEV A;  4GUN A;  2HFE C;  3FX7 A;  1SKV A;  4O4H B;  3CHX A;  4HNA B;  4K8Z A;  5D5Q A;  1R3L C;  2UXN A;  3IGA C;  2B1I A;  3RYH A;  3T1C A;  2F95 B;  4BIZ A;  3ZN0 A;  1JA8 A;  4J7K A;  1PL0 A;  4JZG A;  4TV9 B;  4KHP O;  1AP6 A;  1KQS U;  1GMG A;  3O65 A;  5CBG A;  4FZ1 A;  4PI2 A;  4YY3 B;  2UUA O;  2ADP A;  4DV1 B;  1H2K A;  3SYQ A;  3ETD A;  1M56 B;  3K57 A;  1HNZ O;  3JAM N;  1XMO O;  3FYE B;  3P3N A;  1XMQ O;  3U0Z A;  5DM6 V;  3BA9 A;  4U7N A;  1N33 B;  3JD2 A;  1W59 A;  3AK1 A;  3SYA A;  4J80 A;  1VAR A;  2AW9 A;  2ZDI C;  2UXD B;  1U96 A;  4JZ2 A;  3ZRS A;  4JI4 O;  1ZTE A;  1B04 A;  2WSS G;  4UVA A;  2JK5 C;  4TV9 A;  2R70 A;  2WA3 A;  1XEQ A;  3QTC A;  5BR8 B;  3CB2 A;  4XBF A;  2Q69 A;  5LHI A;  4FLW A;  4DR2 O;  2W6I G;  1TGO A;  1R6T A;  4YXW G;  4GKJ B;  4EB6 A;  3OEH G;  2QA4 V;  5BY1 A;  4JAV A;  2WPD G;  2RN9 A;  1IBK B;  3ZHQ A;  3B2E E;  1SQB H;  2V7Q G;  4DR1 B;  4LC1 A;  3OM3 B;  1MZE A;  2ZDI A;  4X20 B;  1YXB A;  3AG3 B;  5IJ9 A;  1PPJ H;  2HHH B;  1OCZ C;  3E89 A;  2XAJ A;  1GKF A;  3CS5 A;  3QG5 A;  4LF5 B;  3GB7 C;  3L75 H;  2BOB C;  5IYC O;  4DK0 A;  1XQ8 A;  3EVK A;  1NJI W;  5CN0 A;  1G1X B;  1BQZ A;  4CC6 A;  4GLX A;  4LF7 B;  3EHB B;  5KAF Z;  1EBO A;  2YXY A;  3ABK B;  4E4E A;  5B1B B;  3SYO A;  3T4Z A;  1TA8 A;  3T1Y B;  4GKK O;  1B3Q A;  1N4C A;  2B9Z A;  3OR6 C;  1HNX B;  4DR4 O;  4DW0 A;  4LBE C;  4G2K A;  4CS3 A;  2HVK C;  4FIP C;  1J95 A;  1N34 B;  2YIB D;  1V9P A;  2YXL A;  4E2L A;  5JJN B;  1TUB B;  1Q90 D;  3BAA A;  2ZNJ A;  3OR7 C;  3CRC A;  3FKS G;  2JS3 A;  2F4V O;  3VQY A;  2R9R B;  3MAQ A;  1SER A;  4DR6 B;  3E8F A;  5IYD O;  5H6Q A;  4B3S B;  4I5S A;  2B1G A;  4FJC C;  2Y0I A;  1H2L A;  4MW8 A;  4HZ3 A;  4IHJ B;  5FNV A;  3BY6 A;  1ZLZ A;  4MVO A;  3KZI Z;  3M99 B;  1JJO A;  4NTX A;  5BMV B;  3DTU B;  5KX5 A;  4TWK A;  2F23 A;  4CH6 A;  4MVZ A;  3VQW A;  5IY5 B;  3GVM A;  2GHY A;  1GN6 A;  4JI1 O;  2NLJ C;  2Q0O C;  3CSX A;  4X64 B;  3SJQ C;  4OPA A;  3L71 H;  1VF7 A;  2HEP A;  1WLE A;  4JI7 B;  3IC9 A;  3HKC B;  4UUJ C;  1D2D A;  5LMU B;  3I56 V;  1XNR B;  2QEX V;  3ZHR A;  5FPR A;  1FJG B;  1AI5 A;  2DYS B;  3WG7 C;  3ZHU A;  2UUB B;  2OYQ A;  4Q20 A;  2YIB A;  2KKW A;  2LQT A;  3E2E A;  1NKD A;  2PTM A;  3C90 A;  2ZQM A;  3JCZ A;  1WB8 A;  3N2G B;  2OTJ V;  5LXT B;  3X2Q B;  3D8C A;  3JAR B;  3WB2 A;  4JV5 O;  2PI5 A;  2F1M A;  2OCH A;  1QLE B;  3J80 N;  1HDJ A;  1K9M W;  4Z1V A;  3CRA A;  1RPO A;  1JVM A;  4LP8 A;  1JCH A;  4I9W A;  2D2C B;  1AJP A;  1N32 B;  3QO5 A;  3U10 A;  3M7M X;  3UM7 A;  2LFS A;  2GV9 A;  4PI0 A;  2M7W A;  1KKC A;  1Q6H A;  2YSU B;  4JAS A;  2C2A A;  3RWR D;  5GTH Z;  1QVF U;  5KHJ A;  1EM1 A;  3F7V C;  4R7C A;  2DN9 A;  4TT3 G;  2CTP A;  5H6R A;  5C8Y B;  1HWY A;  1GO3 F;  2P06 A;  3CPW U;  1EN4 A;  3N2G A;  4A5U B;  4JF3 A;  1V55 C;  1VQN V;  1ZL8 A;  3VQV A;  2X6B A;  1DTO A;  5GON A;  3JAK B;  4B3R B;  1XUQ A;  4IL6 Z;  1SF9 A;  1F4M A;  1Y6X A;  4I4T B;  2QR4 A;  2FML A;  2IJK A;  1HR0 B;  2ETN A;  4H13 B;  3L9D A;  1N36 B;  4LFA B;  2FB5 A;  1MNG A;  4PA9 A;  2DYR C;  4LFB O;  4DR5 O;  1VQP V;  2NR5 A;  4X9Q A;  1YF2 A;  3OTO O;  4UCU A;  3CCJ V;  3SPJ A;  3SJA C;  2EIM B;  4CH5 A;  2GTA A;  3CC2 V;  1F23 A;  3H1K H;  3JSL A;  3RBZ A;  3K3W A;  1R6N A;  1Y74 A;  3K5M A;  4DV2 O;  2JGD B;  1UPG A;  1WAZ A;  5L3C A;  1OCC C;  1W0K G;  1K97 A;  4FFB B;  4GX2 A;  3DC5 A;  4X1K A;  2PI4 A;  3QF7 A;  3OGI B;  4I55 A;  4I4T A;  3WU2 Z;  1BGY H;  2K9P A;  2JJ1 G;  1B6Q A;  3N27 A;  1DLB A;  1VQ4 V;  1ARO P;  4DV5 O;  4JYA O;  4FM1 A;  1YHQ V;  2VWJ A;  1EZJ A;  4O4I A;  4RUF A;  3GWK C;  4DV6 B;  1TVK B;  1JFF A;  1Q43 A;  2IJJ A;  2DQ3 A;  1R6K A;  1PD3 A;  2VRZ A;  1FFT B;  4TUY A;  2MW2 B;  1VEW A;  2QKS A;  2Q4P A;  2ADQ B;  4PDM A;  4O4J B;  2WLI B;  1BT8 A;  1THZ A;  3G67 A;  1Q8I A;  3ZHS A;  4ZKI A;  3ETG A;  2NNU A;  4WBN B;  3J81 N;  3BCC H;  5BZB A;  1SQQ H;  3ZED A;  1G6U A;  5KHG A;  1GK9 A;  1Q6I A;  4MS2 A;  4UB8 Z;  3CXH F;  5LMN O;  4P9P A;  2Z5U A;  2EIK C;  2LFR A;  1YVW A;  1NR7 A;  2EIJ C;  2O57 A;  4FLY A;  1SZX A;  2A79 B;  2Q0A A;  1XIL A;  2AZ2 A;  2VQE B;  1WN7 A;  3T1H O;  3ZCC A;  2OIG A;  1KMI Z;  2Q8V A;  2ZT9 B;  3JAT B;  4K0K O;  3B09 A;  5C93 A;  1QU7 A;  1Q86 W;  3AG2 C;  1L0N H;  3RYF B;  2WLI A;  2ZR3 A;  4DUY B;  1KU9 A;  3ABL B;  2LW1 A;  1WP7 A;  4IIJ A;  3BFR A;  1E1Q G;  5FLX N;  4LFC O;  3B8M A;  1QVG U;  3L73 H;  2VS0 A;  4DV0 B;  1JQ0 A;  3T4D A;  1XDC A;  1IUR A;  3SJB C;  4K8X A;  1NVP D;  5E1A C;  2E76 B;  4G27 B;  1X59 A;  1P7B A;  2H3O A;  1FYJ A;  4F6E A;  4BAY A;  2CTW A;  3N2K B;  3FFQ A;  5EIB C;  5KMG A;  2ITC C;  1SQX H;  4ICG A;  2Q67 A;  4N21 A;  4XDL A;  4YY3 O;  4DV1 O;  5LYJ A;  1RM1 C;  3CEI A;  3P3P A;  3ABU A;  2YXH A;  3JAT A;  3F5T A;  1QHT A;  2FKX A;  1NVP B;  5J2U B;  1IDS A;  1XNQ O;  3WB0 A;  2QM7 A;  5CB4 A;  4WFG A;  5FPO A;  3RYF A;  1K92 A;  5L3G A;  1N33 O;  1DK1 A;  3KCY A;  3K06 A;  5JWP A;  5JH7 B;  5A2Q N;  4JI0 B;  2DOS A;  4U3J A;  1Y4M A;  2ZNI A;  1YSC A;  1VQ7 V;  5IWA B;  1BE3 H;  3TK1 A;  1AP5 A;  2ZXW B;  3K0G A;  1PM9 A;  3ZS8 C;  4GX5 A;  3F5W C;  5B3S B;  1P4R A;  2GTS A;  4FFK A;  5BR8 O;  1UJW B;  2XAH A;  5CBH A;  1ZSP A;  5JJE B;  2Z3Y A;  1GN2 A;  4FLX A;  2K1E A;  2OCC B;  3SPI A;  4LF4 B;  2XOK G;  4Z1M G;  2XAG A;  4HBN A;  4TOI A;  3OW2 U;  1P7G A;  1YDX A;  2FTK A;  3U11 A;  2LO1 A;  2Q73 A;  4YIO A;  4GYC B;  5IYZ A;  4ABM A;  1IBK O;  1R3I C;  1K4D C;  2G38 A;  4TV8 B;  1OV9 A;  1Y76 A;  4ZHQ A;  5KUK A;  4DR1 O;  4LWS B;  2GUZ A;  1PNL A;  3CD6 V;  5JH7 A;  1XBL A;  2EBO A;  4FLZ A;  2IJH A;  4CS4 A;  3BVO A;  2HHH O;  4X1I A;  4FLV A;  4LF5 O;  2BCC H;  1YJN V;  2XAQ A;  3HPL C;  3B77 A;  2ZE8 A;  4ZIB A;  3A8T A;  4EB6 B;  3MDS A;  4O4L B;  3QO7 A;  1P84 F;  4DV3 B;  4X62 B;  2EIN C;  2OTL V;  3L72 H;  1T5E A;  1OCO C;  3THO A;  1KP2 A;  2EIL C;  3K9S A;  2QWO B;  1IXB A;  3DSQ A;  3RN4 A;  1BHB A;  4B08 A;  2V1D A;  1J5E B;  4B3T B;  4W4K A;  4NKG B;  5IJ9 B;  4Q6G A;  1MG1 A;  4TQF A;  4TV8 A;  2A7W A;  1K7D A;  2DE0 X;  3AG4 C;  5KHI A;  4LWS A;  1N34 O;  3CJH B;  3NR7 A;  2BTO A;  4DR3 B;  4JAA A;  3LSQ A;  3RYC A;  1HW7 A;  2UU9 O;  1GM9 A;  3BRC A;  3ZMZ A;  2X6A A;  5DN6 G;  1GTO A;  3JD3 A;  1TUE B;  3CP1 A;  4CBC A;  3E22 B;  4JPR A;  1FD9 A;  1VMG A;  4R8C A;  3ZJZ A;  4B3S O;  4O4L A;  1M9N A;  4RQE A;  1AJN A;  5H9C A;  2PYL A;  1S72 V;  5HFM A;  5L3B A;  1LUW A;  4LF9 O;  4O2A A;  4L87 A;  1OCZ B;  1XOU A;  2XT9 A;  1I5X A;  4JI6 B;  5B1A C;  2UXB B;  3CJH A;  4JTD B;  4OXS A;  4F6R B;  5KA5 A;  3IJ4 A;  3OUS A;  4EKW A;  3B8N A;  3UO2 A;  2ZM6 B;  1SET A;  3CWB H;  4JI7 O;  4OGQ B;  4J10 A;  3LDD A;  2BOC C;  3ABM C;  2E5L O;  5LMU O;  1XNR O;  4KHP B;  3E22 A;  2RNB A;  5FNV B;  2DJV A;  3NXS A;  1BMF G;  4WFB V;  3ZMV A;  1H2G A;  4DYL A;  1SQV H;  5KX5 B;  1K3E A;  2NN4 A;  2XUM A;  4WFE A;  5FL7 G;  2UUB O;  2IU3 A;  3R66 A;  5TIS Z;  5LA6 A;  1BQ0 A;  1QR8 A;  4DR7 B;  5CA3 A;  1ORQ C;  1Z2G A;  1XMQ B;  1RPR A;  2IH3 C;  1TAE A;  3MD0 A;  2JVD A;  3TXS A;  1EFR G;  2JGU A;  1IBM B;  2ZE7 A;  1MZF A;  4F6R A;  2X7R B;  3JSN A;  2IH1 C;  1Z5V A;  3ML0 A;  2YI8 A;  2XAF A;  1WPX A;  1M57 C;  4PV1 B;  1N32 O;  5B5E Z;  1Q3E A;  1OHH G;  3K9A A;  4B3M B;  3C3S A;  1M93 A;  3KKY A;  3STZ C;  1XI1 A;  2DWE C;  3QNE A;  4R50 A;  1HNW B;  4C7U A;  2Y69 C;  1G8M A;  3JCU Z;  2WLM A;  1XRE A;  3SPG A;  2QSA A;  3K0D A;  5EK0 A;  3HR0 A;  1K8A W;  1GM8 A;  4LH7 A;  3FAV A;  2WLH A;  1CXZ B;  2BTQ B;  1YTF D;  4AIL C;  1NS1 A;  2OT5 A;  1AR4 A;  5J2T A;  1K5Q A;  4DV4 O;  3A0R A;  4B3R O;  1AIL A;  4ZOL B;  3ZMU A;  4WFF A;  3J7A U;  3WG7 B;  1F7Y A;  3ZN1 A;  1AJQ A;  2CE4 A;  1N36 O;  4LFA O;  3K04 A;  2P4V A;  4UVB A;  2X6C A;  2ZIM A;  4X89 A;  4UB6 Z;  3RYI B;  3SGI A;  4RWU A;  2HG5 C;  1VQ8 V;  3HKD A;  2Y4U A;  1QNM A;  1YJ9 V;  4CZZ A;  2KB1 A;  4CH4 A;  1SS3 A;  1YTF B;  4MTF A;  2ILM A;  4GKK B;  4J7J A;  1BCC H;  1ZL8 B;  5GON B;  2ZKO A;  1L1F A;  4DRX A;  2P6J A;  1GN3 A;  1QLN A;  4MVU A;  4EEQ A;  3UKM A;  4GZR B;  4FK5 C;  2BTQ A;  1XL4 A;  3Q4H A;  1PP9 H;  4ZOL A;  4D7S A;  4YJ2 A;  4NXN B;  5EBM C;  4DUZ O;  2FL4 A;  2KSD A;  2ZIO A;  4KFM A;  1O9H A;  3SPC A;  4RUE A;  3RYI A;  3FYI B;  2JS5 A;  2QWQ B;  1V55 B;  3TCU A;  1K73 W;  3K5N A;  5BXZ A;  2QKA A;  1H8H G;  1Y74 B;  3CXC U;  2ATK C;  2VWK A;  3RW0 A;  2UUC B;  1YJW V;  4X1K B;  4GT1 A;  3SYP A;  3DXR A;  2RJZ A;  3ZIA G;  2A06 H;  4I55 B;  4BW9 A;  4PA7 A;  1KEC A;  1V54 C;  1SES A;  4NXM B;  1AVM A;  4QPK A;  4JI1 B;  2DYR B;  1XHX A;  1X4T A;  5CBF A;  5GW7 A;  2BSK A;  3OTF A;  3K03 A;  1N0J A;  4O4I B;  1WPB A;  1JFF B;  3A2F A;  2Q6A A;  4TUY B;  3RT3 C;  4LF6 B;  3CCQ V;  4P30 A;  5GTI Z;  2RQ6 A;  5H2F Z;  1S5L Z;  4OPH A;  3CMA V;  2VQE O;  1VQK V;  1OCC B;  5KUM A;  3JD1 A;  1BZK A;  1JJ2 U;  2YDE A;  2LP7 A;  2XAS A;  2P67 A;  1JMK C;  1H2S B;  5CMU A;  1BL8 A;  1SC5 B;  4JI5 B;  2F66 C;  4JI2 B;  1SQG A;  3ASN C;  1ZUQ A;  3OMI B;  4UCO A;  3A0B Z;  5B66 Z;  2BE3 A;  4DV0 O;  1LNQ A;  1RSO B;  5HFL A;  1SA0 A;  1AB3 A;  2E75 B;  3QO8 A;  1NTZ H;  3OE7 G;  4BIO A;  2VQF B;  4R6Z A;  1DF4 A;  1KC8 W;  2MK3 A;  1FFX B;  1COW G;  1MAB G;  4DV7 O;  1N0N A;  3H1J H;  2ITD C;  1AR5 A;  2UXX A;  1KP3 A;  4H0L B;  2PY5 A;  4GCZ A;  4YHH B;  2Q68 A;  3SYC A;  3LNN A;  3H1H H;  4W4L A;  2OWO A;  3FB7 C;  4KUM A;  3OMA B;  1W0J G;  2Q9L A;  4IIJ B;  2IU0 A;  2PUS A;  4TSF G;  1M90 W;  1VP7 A;  5EZY A;  1WP8 A;  2ZR2 A;  4TQD A;  4MVR A;  2QDO A;  4X65 O;  5IE9 A;  3LDE A;  1CEZ A;  2GDS A;  4JI8 B;  1OJH A;  2QM8 A;  1E1R G;  3BHP A;  5KA6 A;  1RSO A;  2EIK B;  3PN1 A;  2EIJ B;  4UVC A;  5IWA O;  1Z5W A;  5KMG B;  4LF8 O;  3JAW B;  3CME V;  1JPX A;  3HKE B;  1QQC A;  5B1N A;  3F7Y C;  1MMM A;  1FFX A;  2F43 G;  3CRM A;  5LYJ B;  3RGB A;  1VIB A;  3ZMT A;  2HJF C;  3G4S V;  3AG2 B;  2E74 B;  5EIB D;  3RVY A;  2WLL B;  1EN5 A;  4FLU A;  4UXN A;  5CB4 B;  2UXC B;  4NTW A;  3E35 A;  1I94 O;  4LF4 O;  1PL4 A;  2JDI G;  3H1I H;  4JGS A;  4OX9 O;  2EZO A;  4I0X A;  4P2Z A;  5LOV A;  4KXR A;  2WLK A;  1QCE A;  4U3J B;  4QJF B;  2H8P C;  2KQX A;  4FMT A;  1RP3 B;  3JD0 A;  4X1Y A;  2EJ7 A;  3TXQ A;  4JYB A;  2HKO A;  2YID A;  5EBL C;  4DXW A;  1WA8 A;  3OEE G;  1RM1 B;  4X66 B;  1YEW A;  1FXK C;  3JAW A;  3KCX A;  2QJ1 A;  4DV5 B;  3HKE A;  3CC4 V;  1VQ6 V;  5LGU A;  2PGG A;  5DEC A;  5LBQ A;  4K35 A;  4MSW C;  3HKB A;  4B7E A;  2QTO A;  3S3X A;  2WLL A;  2ZCE A;  3ASO C;  3CCL V;  1W2B U;  4DV3 O;  5IYZ B;  4MT8 A;  2W0X A;  4PHZ A;  3CCR V;  1RFY A;  3DGE A;  1Y76 B;  2DQ0 A;  4ZHQ B;  2GUZ B;  2DWD C;  3JAS A;  3LUT B;  3M8A A;  1OCR C;  1J5E O;  2LGW A;  2UXD O;  5CA1 B;  4IYI A;  2QWR B;  4X1I B;  1NU1 H;  4BIU A;  4DR3 O;  3UT5 A;  4UCR A;  2AZ0 A;  1GN4 A;  3PJS K;  1NTK H;  1FXK A;  1I7F A;  3CCU V;  2A0L A;  4YJ3 B;  4CC5 A;  5LP6 C;  4AQY B;  1VQ9 V;  2QM4 A;  3MHS C;  3W7S A;  3D36 C;  5J9P C;  1IZ3 A;  1SRY A;  2WAM A;  4MTG A;  4GKJ O;  5LMN B;  4GX1 A;  2XHB A;  3C3T A;  5AG2 A;  3ZHT A;  4JI3 B;  2V4D A;  3HB3 B;  3VBB A;  5A9G A;  3AG1 C;  4F4L A;  4NVP A;  4UCS A;  2JRI A;  3H01 A;  3RYC B;  5CA1 A;  2YUA A;  4JI6 O;  1IBL B;  5CA0 A;  4LFC B;  4MTO A;  2CGO A;  2UXB O;  3BPZ A;  3VQX A;  5KAI Z;  2LJ2 A;  1ZAU A;  4LNU A;  2Y4T A;  4IYH A;  4PJ0 Z;  3ZMS A;  1HP8 A;  1KKD A;  3ZRV A;  2ZM6 O;  5LP6 A;  2EIN B;  4LF7 O;  5JQG A;  3D36 A;  1OCO B;  2EIL B;  3H9V A;  4YJ3 A;  4QE7 A;  2IJI A;  1GH6 A;  4DO2 A;  5K1P A;  2ZD9 A;  2Z0A A;  2CH7 A;  1GM7 A;  2HLD G;  5EC2 C;  3T1Y O;  1HNX O;  4O2A B;  3JAL A;  3AG4 B;  2ZE6 A;  1SQF A;  1VQO V;  1Q81 W;  4DR7 O;  3BAB A;  4H37 A;  1ENV A;  1XNQ B;  1Y67 A;  1SZT A;  2EUL A;  2H94 A;  1H2M A;  1KBH A;  4ASU G;  1M56 C;  2RMK B;  2ZIN A;  4MVS A;  2P7T C;  3OT7 A;  2AHZ A;  2N04 A;  3P32 A;  1IBM O;  1AI4 A;  3K5O A;  5K1X A;  4O4H A;  3LNM B;  3STL C;  4HNA A;  4U7O A;  2B5U A;  4DR6 O;  2N05 A;  5JVD B;  2Y0P A;  3K08 A;  3K79 A;  2HJD A;  4B3M O;  3AG7 A;  5LA6 B;  1Y66 A;  4J42 A;  3CRQ A;  1S77 D;  4GX0 A;  4Z2W A;  1HNW O;  1K5S A;  2LGQ A;  5LGN A;  1JOY A;  5B1A B;  5LGT A;  3LDC A;  2HP8 A;  4DW1 A;  1VF6 C;  1WJZ A;  2WLN A;  1VF5 B;  4X64 O;  4AI8 A;  4I9Q A;  3CCE V;  3T2M A;  1L8D A;  2AHY A;  3ABM B;  3W7U A;  3FD9 A;  5JCO C;  4PA6 A;  1FS0 G;  5L3E A;  2QWP B;  1L0L H;  5IDJ A;  4X8A A;  2R9I A;  3CX5 F;  1K4C C;  5JVD A;  3AG3 C;  4HYO A;  1FJG O;  1YCI A;  1Q82 W;  3CYO A;  3W7W A;  2FYU H;  3FB5 C;  2UUA B;  5JJJ B;  5F2V O;  1KYO F;  3OFN G;  3E8B A;  1KB9 F;  1HNZ B;  1XMO B;  4I7Z B;  3MHH C;  3ETE A;  3I55 V;  1WB7 A;  2IW5 A;  3FAV B;  1VF6 A;  1M1K W;  2Q5Z A;  3ABK C;  4J9Z B;  5IJ0 B;  5B1B C;  3ZHV A;  1BS3 A;  4J9Y B;  5J2T B;  1M5I A;  4PA3 A;  4UV8 A;  1M57 B;  5JCO A;  4JI4 B;  3L70 H;  3L74 H;  3APQ A;  4MW3 A;  3ZBH A;  4QIW F;  4X20 A;  1M4U A;  2WLJ A;  2UU9 B;  2QGN A;  2Y69 B;  1I5Y A;  2PYJ A;  4RO2 A;  4QE9 A;  4NXN O;  1MSD A;  3HKD B;  2A3Q A;  3WB1 A;  4DR2 B;  3E86 A;  2YS8 A;  2Q7H A;  2W6J G;  2RCV A;  4B7K A;  4CH3 A;  3E8H A;  4DRX B;  3K5L A;  1VQM V;  2E3C A;  2P22 C;  1S5H C;  1NQT A;  2P5O A;  3OD4 A;  5IJ0 A;  1CPY A;  1K34 A;  3AK2 A;  4EFE A;  4LH6 A;  2F93 B;  5H5N A;  4LF9 B;  2UUC O;  3B4S A;  2R72 A;  4MVQ A;  3ZX6 A;  3Q4H B;  5L3F A;  4PDV A;  2XTA A;  4FPP A;  4YJ2 B;  4WFA V;  1CP9 A;  4NXM O;  5EBW C;  4HAM A;  5IY5 C;  1HR0 O;  1GAX A;  2QWN B;  1TUB A;  1Q6U A;  4J41 A;  2CTR A;  5EYP B;  4I50 B;  1IVS A;  3D3Q A;  1I0H A;  4JTC B;  2KG7 B;  3CCM V;  4H33 A;  1GRJ A;  2E5L B;  3BA8 A;  2ARH A;  1H2N A;  4EFB A;  4WFH A;  4LF6 O;  4DR4 B;  3AK3 A;  3G6E V;  3RVZ A;  3K59 A;  5KLV H;  3EFF K;  2DYS C;  3OAA G;  4IHJ A;  3FB6 C;  3DXR B;  3IFX A;  1E79 G;  4KP4 A;  1B06 A;  5BMV A;  1R73 A;  1OZ0 A;  5ITZ B;  4JAU A;  1BHA A;  2N74 A;  4JI5 O;  2DMX A;  4JI2 O;  1G4Y B;  1NBM G;  4L8J A;  3X2Q C;  2BSK B;  1NT2 B;  1UFI A;  2F4V B;  1QLE C;  3B40 A;  2AXT Z;  1FXH A;  4JYC A;  5EYP A;  4I50 A;  1VQL V;  1JR9 A;  3OMN B;  1ZWI C;  1AR1 B;  2VQF O;  2KG7 A;  3HKC A;  4DV6 O;  2PF4 E;  1U97 A;  1SQP H;  4DK1 A;  4YHH O;  2WA4 A;  1AI6 A;  2GSM B;  1US6 A;  3S3W A;  1V54 B;  4MTX A;  1MOF A;  1H38 A;  4IT5 A;  3OGC C;  4KL1 A;  5ITZ A;  5LXT A;  4J11 A;  4NR1 A;  1P49 A;  3JAR A;  1SA0 B;  4D6T H;  4N23 A;  4JI8 O;  2JJ2 G;  3BEH A;  1KUQ A;  4DV4 B;  3W7X A;  2JIZ G;  2Y48 A;  4U3F H;  2A9H A;  2Q7G A;  3CE2 A;  3QVN A;  3UQ8 A;  3KG2 A;  4RQF A;  4JYY A;  3LSU A;  1ZX3 A;  2M6Y A;  1Q7Y W;  1YI2 V;  1PNM A;  4PDL A;  4G28 B;  4ZBM A;  3UCS C;  1QR9 A;  1R3K C;  4BWA A;  1QBZ A;  5EZY B;  1MSW D;  3ASN B;  5LHG A;  4JV5 B;  5C8Y A;  2JEU A;  2UXC O;  5DED A;  3E8G A;  4DUY O;  1AI7 A;  1DGS A;  4JTA B;  2L6L A;  4PDR A;  5B1O A;  2EIM C;  3AEI A;  2RDC A;  3ABT A;  3CCV V;  4QPJ A;  4WF9 V;  4AHC A;  2ZE5 A;  3ZRW B;  1F51 A;  2D3O W;  2EX3 A;  3JAK A;  3A0H Z;  1XL6 A;  4QNH B;  1ROP A;  1IXM A;  1VQ5 V;  3I5D A;  4X88 A;  4DUZ B;  4QGP A;  4X66 O;  4NB5 A;  1NI8 A;  1S76 D;  2OIE A;  5KHH A;  1S3J A;  5EC1 C;  4FM0 A;  4ZI7 B;  3TJT A;  4I0X B;  2IM9 A;  5LOV B;  2P4K A;  2EJR A;  1URF A;  3H1L H;  5D5P A;  4P9O A;  3W7T A;  1LR1 A;  2HVJ C;  3RFR A;  2JEX A;  4WCE V;  2CAZ C;  3G80 A;  3OUF A;  2IBZ H;  4YIP A;  4X1Y B;  3SR2 C;  2CDY A;  2DW4 A;  2JGD A;  4J7Z A;  4JI0 O;  1R3J C;  3ETQ A;  3D3I A;  3SJC C;  3FB8 C;  2Q7E A;  1WA8 B;  4FZ0 A;  3ZRW A;  4FFB A;  1D5N A;  2CUG A;  3CCS V;  1K33 A;  1JX9 A;  5LL6 Y;  4LFB B;  4DR5 B;  2QKC A;  1NR1 A;  3LSS A;  4BR6 A;  1NTM H;  2CGN A;  3CC7 V;  4UFZ A;  3OTO B;  3HKB B;  1NH2 D;  3UO3 A;  1NZ6 A;  4AQY O;  5E79 Z;  4IGG A;  4UV9 A;  5LHH A;  4FLT A;  1FPO A;  3EXA A;  1YZB A;  1DF5 A;  3JAS B;  4ZI7 A;  2L35 A;  1TVK A;  3JD4 A;  4JI3 O;  2WWW A;  4H44 B;  1I08 A;  4PA4 A;  4DV2 B;  4UCV A;  1FAF A;  1BSM A;  1EZV H;  1FXV A;  1R1B A;  3APO A;  4K3A A;  1YIT V;  3VOU A;  5IYB O;  3TET A;  4O4J A;  1NH2 B;  4O2B B;  3UT5 B;  3ZRX A;  1IBL O;  1FXK B;  3ABL C;  1PNK A;  4JYA B;  2YC0 A;  2YI9 A;  3SDL A;  3WFV A;  2W0F C;  4WBN A;  3P30 A;  3ASO B;  4LR3 A;  2X0L A;  4D7T A;  1O9G A;  1KD1 W;  1PV0 A;  3SPH A;  4DV7 B;  4X62 O;  2R9A A;  2QE7 G;  1FKA O;  2EZP A;  1OCR B;  2PZS A;  4BW5 A;  3O9O A;  2CK3 G;  1WNS A;  1A32 A;  4MVM A;  4B3T O;  4PEL A;  4RAI A;  1XHZ A;  1S0V A;  5CA0 B;  2YEV B;  1EN6 A;  4CS2 A;  2QTS A;  4X65 B;  4LNU B;  4O2B A;  1F4N A;  3G71 V;  3R65 A;  2XND G;  1LUV A;  1S5J A;  3RYH B;  3IAY A;  5LP6 B; 
#chains in the Genus database with same CATH homology
 1NTZ H;  1PP9 H;  1P84 F;  1SQX H;  4D6T H;  1KYO F;  1SQB H;  3L73 H;  1BCC H;  1SQP H;  3L72 H;  1KB9 F;  2FYU H;  3L70 H;  3H1L H;  3L74 H;  3TGU H;  2BCC H;  3CWB H;  5KLV H;  3H1J H;  1BE3 H;  1EZV H;  1NU1 H;  4U3F H;  1NTM H;  2A06 H;  3BCC H;  1SQQ H;  2IBZ H;  1PPJ H;  1L0L H;  1BGY H;  3L71 H;  3H1K H;  3CX5 F;  1L0N H;  4PD4 F;  3H1H H;  3CXH F;  3L75 H;  1NTK H;  3H1I H;  1SQV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...