5KHGA

Hcn2 cnbd in complex with cytidine-3', 5'-cyclic monophosphate (ccmp)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 59
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khgA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khgA02
2XGXA 3B02A 5K8SA 2IXKA 3IDBB 3CL1A 2B9UA 2K0GA 4HVRA 1X8MA 5CADA 2XLGA 2Q0AA 5LRSA 2IC1A 3CF6E 1UD1A 3LAGA 4QM8A 5FLJA 4N9HA 3KGLA 1Q3EA 3UKVA 5KHIA 4HVQA 3FZ3A 1YFYA 4IEXA 3NJZA 4IEPA 1XE7A 2MHFA 4XFIA 3E5QA 2PTMA 5BY5A 5J3UA 1HW5A 3CJXA 4XF3A 2XHKA 3EQEA 4FBFA 2GAUA 2WC2A 1DGWA 1NYWA 4J1XA 1RUOA 1IPJA 2OZ6A 3KGZA 4I0BA 4IEQA 4QM9A 4PIZA 2GH2A 3BPZA 1OFNA 4XF9A 2D40A 4IEUA 1PM7A 1I6XA 2BNOA 3MDPA 4H7LA 2PA7A 4HLTA 4MH0E 4QX5A 2FMYA 2PAKA 3NW4A 4Q0SA 3H8UA 3ROUA 4F7ZA 3LA7A 4FAGA 4LTAA 5JR7B 1QWRA 3WW3A 2GU9A 5CU1A 1NXMA 4Q29A 4QGLA 2K9ZA 3CEWA 4I09A 4Q0UA 4UBGA 2GZWA 4GULA 1J3QA 4A2UA 1J59A 2ET1A 1YUDA 4R52A 1FT9A 1YLLA 2BGCA 1EPZA 2B8MA 3S7IA 1QXJA 4LEJA 1X82A 1O4TA 4ONUA 5JSPA 3IIAA 4FT8A 2XL7A 5BPXA 4WZCA 3CO2A 3H1YA 4LA3A 3E6CC 3SXWA 4I3PA 3D0JA 1RC6A 4E2SA 1H1MA 1O7FA 3OCPA 5AVPA 2BNNA 3ST7A 2I45A 1LRHA 2Q30A 2H0VA 1UIKA 4XFCA 3ETQA 2FQPA 2GC2A 3NKTA 4YYOA 3EJKA 3TNPB 2O8QA 5J48A 5FDBA 4LA2A 2ET7A 4JV4A 5E16A 2HJIA 2PQQA 2B5HA 4BIFA 3NSTA 4AQ6A 5CVRA 1Q43A 1XE8A 2Z2SB 1CAVB 1V70A 3DKWA 3UKNA 4IEZA 4LULA 3WW2A 3WW4A 4FAHA 3GBFA 1X7NA 4KL1A 3FX3A 3DV8A 3RZZA 4YSFA 1G6NA 3ACLA 2OA2A 1VP6A 3U10A 2OZJA 3ES4A 3PNAA 3PVBB 1JUHA 5JCTA 5BUVA 1DGRA 1UIJA 5FLHA 3FHIB 3VHRA 5LEKA 1RL3A 3LOIA 4BHPA 5KHGA 1DZRA 4WBBA 3MPBA 3PLQA 3RDIA 4HSJA 4YNIA 2WFPA 4YRDA 1CAWB 5BV6A 4AQ2A 4MUVA 4QGMA 3LWCA 1J3RA 4P9GA 4MGIE 1ZRCA 3HT2A 1QY4A 4QXKA 2PAMA 1O5UA 4QGNA 3DN7A 4Q0VA 4IEWA 3S7EA 1X8EA 2PAEA 2H6CA 4YARA 1CAUB 2F4PA 2GC0A 3G7DA 4Z82A 2BYVE 3BCWA 3IDCB 4IEOA 4KWJA 1SQ4A 1PMIA 4E2GA 1VR3A 2PHDA 2Z69A 2UYAA 1YFWA 1ZNPA 3D82A 2ETEA 2OPKA 1Q5OA 4X6QB 3SMHA 4D7SA 4MGYE 3EHKA 5KHJA 1O3SA 5KHHA 1WA4A 4KU8A 1O3QA 1ZREA 1OI6A 3I7DA 4HN1A 2OYZA 4AVCA 3QOPA 3M70A 3H9AA 3IBMA 1OD5A 1ZVFA 1IPKA 5EFUA 5EZWA 1EYBA 2D93A 5HI0A 5I0TA 2CV6A 4Z07A 3OGJA 4KU7A 1ZRFA 3I54A 1H1IA 2UY9A 5KBFA 4NVPA 5I91A 3BU7A 4EWDA 2MNGA 3RPQA 2XKOA 5C8WA 3H7JA 4J1WA 1ZX5A 3USSA 4O9GA 4XF4A 1YFUA 3U11A 3ZDSA 3OTFA 3H1WA 2ZKLA 1O5LA 1LR5A 1Y9QA 2IXLA 2XLFA 4CYDA 4I2OA 2CAUA 4IETA 2Q1ZB 2CAVA 2EAAA 1VJ2A 5FPZA 1SFNA 2BEOA 4PIXA 2VPVA 3HT1A 2PYTA 4I01A 4JTOA 1ZZCA 4LLOA 4XFGA 4AVAA 3EBRA 2O1QA 2C0ZA 5C6CA 2PFWA 3L2HA 1YWKA 3LA2A 4B29A 3E5XA 4EWAA 2H6BA 4IEVA 1LKNA 4PJYA 5LEJA 5JSRA 3KSCA 5I8TA 5FQ0A 4X6RB 2E9QA 2IXHA 4LUKA 1L3JA 4XETA 3SHRA 1DZTA 1RUNA 5I0SA 1Y3TA 4XEZA 1UPIA 5I8SA 3E6BA 1U12A 2GC3A 4HBNA 3QACA 1UCXA 2MPFA 3BB6A 3FFQA 5I8YA 3U0ZA 3E5UA 3RYKA 4E2QA 1UW8A 3OF1A 3WW1A 5F1RA 4JVAA 3SCHA 2N7GA 3O14A 3GYDA 2IXJA 4HZFA 3FE5A 4XFBA 2D5FA 5I0RA 4WVZA 1O3RA 3R6SA 2DCTA 2HKXA 4IERA 4ZU4A 3M3IA 2ATFA 4UXAA 1EY2A 2XL9A 4QMAA 1FI2A 5LRRA 3SCFA 3NVCA 2BNMA 3ES1A 4EROA 4KWKA 4RD7A 3ELNA 2KXLA 2PHLA 3I59A 4Q0QA 3MZHA 4XFAA 3RNSA 3SCGA 4BYYA 3CLPA 4IEYA 2XLAA 4F8AA 4Q0PA 4ORFA 2IXIA 4KWLA 4N9IA 3HIFA 2CGPA 1J3PA 4ZU7A 4UBHA 3H7YA 1LB2A 1ZZ8A 1TQ5A 5FLIA 3S0MA 5KHKA 1J1LA 1J58A 1CAWA 4L11A 3E97A 3JZVA 4JTNA 4XF0A 1GQGA 2Y0OA 4EWEA 4BH9A 3N4MA 4I0AA 4MX3A 3I59B 5FCCA 4LUMA 2ZCWA 2QCSB 1RGSA 2EVXA 4R8HA 4I02A 3UKTA 5JAXA 3DL3A 2IXCA 1ZZ6A 3H3ZA 4MZUA 1ZZBA 4HN0A 2VECA 4IESA 1CAXA 4MGKE 4OFGA 3RYPA 2QNKA 4OLLA 2V09A 4MV2A 3NL1A 2D5HA 4L2NA 4XFFA 4MGZE 4ZU5A 1WLTA 4HMZA 4K8FA 1ZZ9A 4XF1A 5E1RA 1WGPA 1QXRA 2UYBA 2GC1A 1SEFA 3E6DA 3H3UA 4AVBA 3LZZA 1RTVA 1ZRDA 1I5ZA 1ZRRA 3KCCA 4HSLA 5T3NA 5FQ0B 4TLFA 4DINB 3HQXA 3C3VA 1NE4A 1CGPA 1NE6A 1NZCA 3BALA 2UY8A 5I93A 3RYRA 5J7MA 2P17A 4EV0A 1CAXB 4HVOA 3EO6A 3D0SA 1CAUA 4D7TA 2VQAA 1ZZ7A 5BXXA 1CAVA 3FWEA 3OD0A 5JSOA 2QDRA 5D1IA 1YFXA 3KMHA 4O9EA 2Q4SA 2QVSB 3IWZA 3MYXA 1FXZA 4AXOA 2EA7A 3FJSA 1CX4A 1EP0A 2QJVA 3TNQA 1OMIA 5I0UA 1YHFA 4PIYA 4META 3H50A 1O3TA 1XRUA 2XKPA 5FPXA 3H1MA 3LA3A 1GQHA 4XFHA
chains in the Genus database with same CATH superfamily
1ASJ3 2IXKA 4B3TB 1UMHA 3ZFFC 2QDNA 2HEWF 2L35A 1EUTA 1PZ8A 3T1YB 1OPMA 2C5DA 4RA0A 4NHLA 1JZ8A 3FN9A 1WD3A 2ZGUA 1MEC1 2MHFA 1PIV2 5FZHA 3LSQA 2QTSA 1NX9A 3U07A 3OTOO 4COUA 2WC2A 4HG6B 3JB4C 4AFAA 4BU2A 1QEXA 3WCSA 3NKGA 3FD9A 3IJ4A 2JG9C 5FV3A 2WYFA 1V0AA 1GMMA 2BU9A 3ZR5A 5C33A 5GM0A 2WAOA 3CC7V 1OUSA 1QJZA 5IWAB 1V6OA 3HKEA 5B4NA 1MOFA 2HR3A 4XDJA 4GULA 1FT9A 2ZMNA 2RS53 4XQWA 2ZINA 1G6UA 4LWSB 2PY5A 3NAPC 4LCUC 2BFUL 4CSWA 1PO21 4L8QA 2RMKB 5D8AB 4JAAA 3ABMC 1ULCA 3J8F3 2B5HA 4UW5A 1F5JA 3OW2U 1TVGA 1NBMG 1DF0A 2FDFA 2JEMA 4KL1A 2VQFO 4RYDA 1NH2B 2WT2A 4GD4A 4OX9O 1K73W 1C28A 1QR8A 2A5ZA 4RFT0 1GU3A 3WNLA 3OAAG 3QH6A 2J7MA 2WFPA 4YVSA 4HL0A 4MGIE 4AEDA 4X65B 3C2UA 4IE0A 4AWDA 3NR7A 4CDWB 1TUBA 4O2BA 5F6KA 4LO8A 2XJPA 1YJNV 2BYVE 1WBLA 1SBFA 2HWE2 4IEOA 1SQ4A 4E2GA 2XBO3 1AJQA 2UYAA 3CQOA 5FR3A 4NRMA 3MFAA 3ZMUA 3ZYJB 1K34A 3CYOA 3VD7A 2NM1A 1RXFA 4XDKA 1GZCA 2ZHLA 3H9AA 1A78A 2B7YA 4FZ0A 4LBJA 2WZ8A 4LE3A 4UFKA 5E6HA 2DE0X 1KU9A 3DECA 1IBMO 4IE5A 4JRAA 4XBQA 1VB2A 4KUMA 5CB4B 4DS0A 1OT5A 3ZDSA 3JB8A 4KXRA 2DWRA 1M1KW 4Q5OA 2A6WA 1PK6B 2Q1ZB 4FOQA 2R6QA 2LM3A 5BNOA 3VZMA 2YZ4A 3ASNC 3RFRA 4I01A 3LGRA 1QJFA 3VD5A 3HKDA 5FXZA 2QWOB 4JI1B 2R70A 1QJX2 3FHQA 4DQAA 1KQRA 3VBSC 2W39A 2WDBA 2YBKA 1WCUA 1H2LA 2VCMA 1G9BA 3MLKA 2V4DA 2ODMA 3SHRA 1NVPD 4WFEA 2VMHA 3NNLA 3U1XA 4ZXEA 4ASMB 1W2BU 5I8YA 1WBFA 2ZIMA 3WCRA 4JVAA 4WM8C 5D2AA 2KD7A 1LOGA 2V73A 2EXHA 3BN6A 3JBG3 5C4WA 2FBEA 1RMU3 4D94A 2HVKC 5BNNB 3ES1A 3PUSA 1V6LA 4R4ZA 3IMMA 5FY7A 2ZGQA 4NKGB 1YJ9V 2PHLA 1JI6A 4R9BA 3SKJE 2DTWA 2CY6A 4DZGA 4TUYB 5A3PA 4TSVA 4EN8B 3B2EE 4DNYA 2GMMA 1BT8A 5FXXA 1TQ5A 1B3QA 2G38A 2NQYA 5D5QA 4KMQA 1B04A 4JYCA 4OHWA 4LUMA 4YFWA 4WM7C 4TZDA 4WCEV 3KVBA 2NNUA 4M4PA 1VQNV 3I97A 1ZZ6A 2GUZB 2JG9A 5BMVB 1T6GC 5GZDA 4BJ0A 3BYWA 4LO4B 1H8HG 5EZYA 4R50A 3N9LA 1UQXA 4UV8A 4LF8O 4ZU5A 4FMTA 1O6UA 4XF1A 1FFXA 1BQ0A 1AI7A 3ABKB 4CUGA 2K2SA 5A33B 1W6MA 5T50A 3IC7A 1CEZA 3H8XA 5KC6A 3O1VA 4X65O 1XYOA 1HDJA 2UY8A 5J7MA 2QUOA 4AXOA 4GB32 4Y1UA 5HCHA 5I0UA 2NMNA 2BJSA 4U36A 2PXJA 3DYOA 4XJWA 4XDOA 5K0UA 1BXHA 1RJ7A 5F5AA 2ZACA 4INDA 3LAGA 4QM8A 1AR5A 4N9HA 3ACHA 5KXEA 5CB7A 5J9PC 5DEDA 1YFYA 2A6ZA 1P4RA 2ZGMA 1RVF1 5J3UA 3CJXA 2H94A 4GUNA 3LUTB 3RI9A 4JI4O 1GM7A 1PO13 4XDPA 3HVDA 2OCHA 4IEQA 3CBNA 4M00A 3B4SA 4OPHA 3TN92 1LOAA 4CC5A 4JTAB 2EIBA 4QX5A 2FMYA 4HONA 1QQCA 3GZTB 4LTAA 5JXJA 4N53A 1YYNA 1NXMA 3JD3A 5A3LA 4Q0UA 5T5PA 4URAA 1J3QA 5GZEA 2R072 1FPOA 2A6YA 1ND2B 2PUSA 4JI0O 1GO3F 1R081 2JG8C 1OD3A 5IJ0B 2CGNA 3IIAA 2AGSA 1ZAUA 4BMBA 1Q6HA 5A6ZA 1PGSA 3W7XA 1WCKA 1M93A 2X8KA 1QF3A 5FZGA 1QJU1 1DQ4A 2PMWB 1QDOA 4YGEA 1Y9GA 4JV4A 5LMUB 4Y4RA 4IV1A 2ZS6B 2HLDG 2IVJA 4WVWA 1C4RA 4XJZA 2E5LB 4GWNA 3WNOA 4U3JA 2H8PC 1XDCA 2BOIA 4ATFA 3PNAA 4F3JA 1U97A 4O2AA 1JTZX 3AP7A 3LOIA 5LL6Y 4JV5O 2E3CA 2WN3A 3JASB 3R4UA 2JE8A 2BCCH 2RR11 3HT2A 3TK1A 1D4VB 4Q8LA 4NJ4A 3ZVXA 4BK5A 5JLVA 1CX1A 1HLCA 2D97A 5IK4A 1XILA 1HR0O 2EBOA 3LD8A 1W8HA 5H9PA 4KHPO 2XBO1 1R1A1 2JB4A 1Q5OA 1AR81 2F4LA 3K51A 5L9RA 3N36A 4P9IA 4QQOA 2HEVF 5KLVH 4RQFA 4IGOA 1HNZO 2YUEA 1OXCA 2AACA 4E4SA 3TEYA 3T1LA 5C9AC 1H9PA 4Z07A 1Q6UA 1Y66A 1VMFA 3I54A 2CH7B 3AG2B 4JI2B 4PJ0Z 2UWBA 3FAVB 4LFAB 2ZEZA 4QB2A 3JCIA 1R73A 3OTFA 4ZBMA 2CDOA 4V1PA 1K4CC 1TNFA 2KSDA 1GAXA 4GALA 2Y34A 5FO9B 5FPZA 5HPOA 4FLXA 2ZGTA 3RYHA 1W9FA 5B3SB 1FAYA 3KV5A 3M2MA 4J7ZA 3A0NA 5C6CA 4DV7O 4JI5B 3M7AA 1GOGA 1XNTA 4EWAA 4GMP1 3JD71 1LR1A 3I2IA 5FNVB 4LUKA 4IW3A 3M3QA 1VMJA 1AR72 5A7WA 2WPDG 3W7WA 5JCOC 4CP9B 2Y4UA 1BEV1 1WCDJ 4IL6Z 2WLLB 4AAXA 2MW2B 4X8NA 5DUWA 2DBNA 4GYCB 2QGNA 3O12A 2PF4E 2HKOA 1V6KA 3WLUA 4K1ZA 3H1JH 3GYDA 4TLGA 4WVZA 1N1VA 4CUCA 1W9TA 1GANA 1OUXA 5J1XA 1N36B 2ATFA 1VBE1 4UW6A 4JHZA 3ZMOA 3CJIA 4ZZ8A 1Z78A 2YI9A 5IYBO 4TV8A 1LOCA 2CTRA 4JGZA 3MW2A 4Q0QA 5FAXA 5B1AC 1GQPA 5BNPB 2PHUA 1Y6XA 4IEYA 2WSVA 2R073 4JCKA 2AEZA 4XURA 3KG2A 5L3CA 4Z92B 3N9NA 3O0WA 3VLBB 2AZ2A 4ZU7A 3IC9A 1N33B 3WQ7A 2VS0A 2R041 1LODA 3L72H 4LF7O 2JGDA 5CB4A 4TT3G 2WS92 5FCCA 4DW1A 3QBQA 3A0RA 1NCQB 3UKTA 1IHMA 1JJ2U 3CZJA 2OCCB 4QPIC 3WB2A 1DGRN 4QHBA 4IESA 1SLLA 2V09A 1VBC2 1RMU1 3AX4A 1W3XA 3D36A 1WLTA 1ZZ9A 2HWD1 4H2AA 5KR7A 4LNUB 1GN3A 2CGOA 4BW5A 1OZ0A 3KCCA 3SJBC 3ZSEA 2ZE8A 1AXKA 2W95A 3DTUB 1TVKB 1CGPA 4GWIA 1PGL2 1F4AA 2CYFA 2VOTA 5A7OA 4EV0A 3EO6A 3D0SA 5GLVA 5A7PA 5BXXA 4JI3B 2DU0A 1GKFA 4YWAA 3ASOB 1MVEA 2GSYA 3ZHTA 5FZBA 4GB33 1UWWA 2QWRB 4WM8B 3AK1A 1XQ8A 3SJQC 5JUVA 1YITV 3DYPA 3VBFC 1RB8G 1FPN1 1VBE3 2LFRA 3T1HB 4IV3B 5CADA 5LRSA 1GN4A 2CTVA 2WABA 2XJTA 2R72A 1JYVA 5BZBA 3OE7G 1XE7A 3JATA 2UURA 1WAZA 1JYIA 1S5JA 2DOSA 2Q7EA 2VMFA 2CAZC 2JDAA 4XYXA 1OOPC 4IEUA 3SEPA 4KH9A 5LBEA 5B4XA 1GNZA 2RMU2 3RYHB 1IG3A 3NAPB 5CU1A 4C1XA 4NPLA 4XILA 4R52A 4PT6A 4FVMA 1V55C 4OCTA 4QPWA 1VPHA 4MYEA 2GTAA 4DUVA 3IPVA 1IKPA 2QSAA 3BTZA 3JAWA 1GN6A 4FFBA 2JDMA 1F15A 1RVF2 3OCPA 5LGUA 2VMDA 3ST7A 2ZR2A 3HMYA 5J48A 1I08A 1Q8IA 5FDBA 1PK6A 2ET7A 1D2SA 4ISQA 4J80A 2Z2SB 2JJ1G 3UO2A 4B3MO 1U5ZA 2VBPA 4WBNA 5C5TA 3MUY1 2XH6A 4XAAA 1SQGA 3DV8A 3VKOA 2XVLA 4DV0B 2WQ8A 4OULA 3WG7B 2RV9A 4EN7B 4I0WB 1NJIW 1UZYA 1JOYA 3VHRA 5CIRA 1FPN2 4OUSA 3BI3A 5DDJ3 5CFCA 4G27B 2ORZA 4MXVA 3MICA 1W8NA 1ZA4A 1UFIA 2RS12 3G67A 3D3AA 2RN9A 4OUMA 2H6CA 2D3OW 3RJRA 3CD6V 2F4PA 2ZTNA 3VBFA 1EV12 2W1UA 1V9U2 2OKXA 5EBMC 4OI4A 1KP3A 4WM7A 2YXLA 5JH7A 2VOVA 3QLQA 4QPGC 1A32A 4MO3M 2EALA 5EHDA 1SRYA 3M70A 3Q8BA 4AFMA 1R3IC 4IIJB 4XE9A 2A6VA 2JG8B 3DC5A 5HI0A 5I0TA 3WG1A 2AXTZ 1GUIA 1G9CA 1ZRFA 1ZBE3 4LFCO 1L7RA 2QEXV 4MSVA 1ULPA 4GZRB 2MNGA 2DWEC 1AJPA 3W59A 3CSXA 3JASA 5FOJB 2A70A 4KGGA 3RW0A 4OX9B 4DRRA 2EAAA 1YDXA 1CZSA 1JZ5A 5IAVA 3WHTA 3HT1A 4QPIA 5F5QA 2LW1A 1TMF3 4JI2O 1JA8A 3ABTA 2C0ZA 1GM8A 3L2HA 1BQPA 4CXYA 3MD0A 4B29A 2QQLA 4YW7A 4YM0A 5FPBA 2LFSA 2F95B 4DK1A 4XMIA 2X6CA 4QPJA 5LHIA 3T1CA 1BL8A 3ZXJA 2RJZA 1MS5A 3OYWA 1RUNA 3KCXA 1OHFA 2I2SA 2EXJA 1CP9A 1H2KA 2ZGOA 4O4HB 3G80A 1Y76A 2ZPXA 4OYUA 1S0IA 2WZR1 4CXWA 3KB5A 5LA6B 5L36A 4PDVA 3HOBA 2CL2A 5E79Z 3OM3B 2Y6HA 1G9FA 4FPHA 3BA8A 4ARXA 1YF2A 2XAFA 1JHJA 1TUBB 3H8OA 4ABMA 4RHV3 1E1RG 3M3IA 3OUIA 4XBFA 2ZGKA 4M3CE 4KBBA 2Y48A 4LO6B 3UV9A 3HAGA 3ELNA 2KXLA 1BBT3 4HANA 1SQXH 1IX9A 2LW7A 1VBA2 3RNSA 2D3PA 3JD73 1RUF2 4UF0A 3H8RA 1SFPA 4LFBO 1DQ0A 3HIFA 2FD8A 4FPYA 5FZIA 1RUI3 5GZFA 2WSSG 1KDKA 4E9KA 5CA1A 3T4ZA 4KG8A 1MMMA 3T09A 5JXGA 2VNOA 3C90A 2FB5A 1VQPV 5FO8B 2E76B 4YY3O 4LIUA 4XCAA 3K5LA 1AL22 3JARA 3C7FA 5LOVB 4OVEA 2JIGA 1SEFA 2R063 1GZWB 2JDKA 4AAPA 1IZ3A 3TBDA 4WFBV 4XHBA 3RQ0A 3WNKA 1RSOA 5FZ0A 3SYAA 3BALA 2RDCA 1NY72 4D7TA 1JPXA 4N7IA 3FWEA 4PD4F 4QDSA 4MVQA 4TOIA 2A71A 2YBPA 3PUIA 4JRLA 3LDCA 5TSWA 5KA5A 4PV1B 2WLPA 2HWC3 3HN1A 5DM6V 3MAQA 3FC0A 3GM8A 2Z5UA 4YW1A 4JASA 2DFCA 3CL1A 2E75B 1GOHA 2ORXA 4DXZA 3SLIA 4COYA 5FLJA 4I3GA 1BBT1 1GNHA 4JGZB 1MQTB 3AC0A 3NAPA 3B8NA 3U4XA 2QQNA 4CDUB 4DR1O 5FY8A 1IPJA 2X10A 4I0BA 4QM9A 1Q82W 4LKEA 4PA4A 3A0HZ 1TVKA 2IFWA 3QD6A 1Q8OA 3KVAA 4CRQA 3FBYA 1QJY1 3ZLIA 1WCQA 3ABLB 1VQ8V 3ML0A 2ZNJA 3B01A 4XACA 2YICA 3G6JB 4Q1PA 4IV1C 2P67A 2TBVA 2YB7A 1DQ6A 3RZHA 5FY0A 2WA3A 2EJRA 2CH7A 1E79G 2BOJA 2ZAHA 5BMVA 5GLZA 2Q73A 2X5IC 1ST8A 4P02B 4MVOA 5JSPA 2XL7A 2HYXA 3LNNA 2BDRA 5A6XA 1RM1C 4NE9A 1NA1A 4KFMA 5LA6A 4DY5A 4JI7O 2BNNA 1F4HA 1VBB3 2A06H 3N9MA 1MNGA 4ZOLB 5ACA3 4WFAV 2HJIA 3VBRA 3E83A 3TETA 4YGCA 4DUZO 5FZEA 4C90A 5ABJC 4Y1VA 4N53C 5JZGB 5CFDA 5KUKA 3FX3A 4BQ1A 2EF6A 3AMMA 1BZKA 2RNBA 1O4YA 4Q2FA 3ES4A 5EJ1B 2PYJA 1COV1 4W4ZA 3WG3A 1LESA 1BMFG 4GWJA 3VDDB 1HJFA 4LBKA 2VBBA 4CC6A 1DZRA 5J96B 3PLQA 4HSJA 1QOTA 1MS1A 2W68A 2WN2A 5A7WB 4QXHA 1Q8VA 4AQ2A 3CKHA 1I7FA 1PIV1 2IWGB 1GN2A 4TXWA 2L6LA 3OGVA 4COWA 5LP6A 1H8TA 3ZFGA 5D8AC 1AI5A 2JJ2G 2R1BA 5B1NA 3QH7A 2FZ2A 2Y0IA 2UUBO 4CZZA 1AR63 3VKNA 1O3SA 5KHHA 4AEDB 1KFUL 4CDXA 4XIOA 1VAKA 5TISZ 3K5OA 3CCVV 5LW9A 4U2AA 1YIJV 1OD5A 2YIBD 4DR2B 1P8JA 4PLOA 3PIJA 4CDQA 1H2MA 3ZFEC 4FP2A 1ND2A 1OHHG 1BEV3 4NVPA 3MPPG 4AG4A 2DCZA 3K9AA 4I7ZB 4QX7A 4OHYA 2E5LO 4FM0A 4KI5M 3FL7A 1SPPA 4TQDA 3UT0A 1ODNA 3I8TA 4RWUA 1O8PA 1NCQA 2RE9A 2VPVA 4KWUA 1EV13 2JIJA 1N3PA 2A3XA 3UT5B 1Z7S2 4P14A 3F5TA 3PVOA 2ZGLA 5BY1A 4QU1A 4XOGA 3OGGA 4MVZA 4X64O 3U37A 4IEVA 2IVIB 3K0GA 1REFA 4O2AB 5I8TA 2VRZA 3HR0A 4JQRA 3AKSA 1LUVA 1ZBA1 1AR73 1QQP1 3AG3B 5FZCA 1FS0G 5APAA 1U12A 2OWOA 3DPRC 5C7GA 4S2FA 2DJVA 1UCXA 2R1DA 1SQBH 5DG1A 1I0HA 2CNAA 3K03A 4CVUA 3FB6C 1A8DA 1IQAA 4YJ2A 3ORJA 3NV1A 3AM2A 1RUD1 3K0DA 3FB7C 1EAH1 3VQWA 1AYN3 3ZRWA 2IXJA 3M3CA 4SLIA 5LXTA 4XJ9A 4UXAA 4I30A 2YIAA 1R1A2 5FZMA 1V9U1 2A1XA 2YPDA 3SCFA 2W0FC 1N47A 1JJOA 5EJZB 3AKRA 4KGQA 2FL4A 4PQQA 3W9AA 2LS6A 2FKXA 2IJKA 2Y8KA 3WP4A 3CS5A 4DV2O 1J3PA 4LH7A 3H0OA 3OR6C 1SLCA 1V55B 5FP3A 3BCCH 4YM1A 2IU3A 4DV3O 1X33A 2V4AA 2ADDA 4QQPA 5KHKA 1GTOA 2Q8VA 1XEQA 5BR8O 1GQGA 1XBFA 1KFXL 3I59B 2QTWB 2QCSB 5EPAA 5H9CA 2QZ2A 3USUA 4QQ2A 3UCSC 3B5LB 3VHOA 2VZ1A 3KF5A 2DVAA 4DOUA 1SHWB 3O5SA 3ZXFA 2B5UA 4F6RB 1WMXA 2AW9A 1WGPA 3H1LH 4LKFA 2YUAA 1QLNA 4MG2A 2LRPA 1SLAA 1Q8QA 3JAWB 1QDCA 4N8MA 4RQPA 3MV11 1WB8A 3OYWB 3RYRA 1RUI1 2A3QA 3K46A 4HVOA 1R6KA 1AR71 1QQP3 3WF2A 1CAVA 3TN93 2QVSB 3V56A 4BOWA 2RM21 4FPGA 3EMRA 4AHZA 3ASIA 3IB3A 3PHMA 3V64A 4I55A 3VBUA 5HBAA 3VQYA 4U3JB 5E1AC 4Q4V3 2W1WA 1FATA 2WR9A 2JIZG 5EYPA 3F5WC 1DGSA 4AFDA 3N2KA 4YIPA 3SJCC 5SV5A 1SBDA 2JECA 3T1YO 5KHIA 2C26A 3FZ3A 3I5DA 1RUC2 2PTMA 3EVKA 4A3ZA 3TWIA 4XF3A 3CCLV 4XZPA 1SPPB 3GALA 4FOWA 1LUWA 1VBC3 3CB2A 3CZUA 2N05A 4HLTA 2D6MA 5FUIA 1R1A3 2WUHA 3ZHVA 4GH4B 1PX3A 3A8TA 3OGRA 4FFBB 4B3SO 2RHPA 2YC2A 2BBAA 3K5NA 4UW4A 2VW2A 4QGLA 3CEWA 4H0LB 3AZYA 2RDQA 1J59A 1RUH2 4HK8A 4GJYA 5EC1C 2BGCA 1SA0A 1EPZA 5KWRA 1D4M2 3N9QA 1QXJA 4LT5A 2ZD9A 4RR3C 3GVMA 3K57A 1Q8SA 3UGHA 3VKLA 4WVMB 3SPGA 2VUJA 5L7OA 1UMIA 4N43A 3KT7A 2OVUA 1RUI2 4DB5A 1QHTA 3P32A 5JJJB 1DCSA 3ZYBA 4PA6A 2VY0A 4W6XA 1WP8A 3C3SA 5FPAA 1W06A 1HDKA 2NMOA 3U75A 4ZS3A 3HPNA 4Z1VA 4DR7O 2J1EA 5C8CB 5IJ9B 3MV01 2UXDO 2E6VA 1AYM2 3VQXA 1NG0A 4DV7B 2QE3A 2DYRB 3P6BA 5DG2A 4JAVA 5LEKA 1WZXA 5IYZA 4BQ3A 3MPBA 1MZ6A 5EV7A 1IURA 4MXWB 4X20A 3VQVA 3RJ2X 1GMGA 4H44B 2QBXA 4TTGA 1QY4A 1SZBA 2FDJA 1ULOA 1VBB2 4ITCA 1URFA 2RJKA 3W5NA 4NWVA 1V9U3 3BCWA 2GNMA 4B3SB 2ARHA 5IK7A 2LQTA 3OJBA 1I5XA 2Z69A 3GXUA 1DZQA 2OPKA 1D2DA 2EZPA 1S3JA 3B09A 4KU8A 3I7DA 2ZXWB 2KG7B 4E4EA 1OVSA 1ZVFA 3LSSA 5EZWA 4RHV1 4AILC 1XJAA 1QR9A 5T5JA 2ZNIA 1YQ6A 2V72A 3OGJA 2QTOA 2F6BA 3FBMA 1ZX3A 4R6ZA 3A7QA 5LA2A 4IL7A 4Q4W2 5CMUA 2JGDB 1W9YA 2WZR3 4QQLA 4UCRA 3JSNA 3WVJA 5CEHA 3VBHB 2JXAA 3AJZA 2BVVA 3THTA 3BVOA 5IVCA 4CYDA 2XLFA 1FXHA 2CAVA 4CU9A 4NPMA 4RHV2 2JK5C 3GHMA 4RS5A 5FMOS 3VBOA 1H30A 3W58A 4Y4YA 3B77A 4J9YB 1QIQA 4CCOA 1Y43B 5FY5A 4WFFA 1MQTA 4D7YA 3ZMTA 4F83A 2OUJA 5F2VO 3RI8A 5JSRA 2DCYA 3CJHB 4BIOA 2RDSA 4C0HA 1N4CA 3OBTA 1Y3TA 3TN91 1XNRO 2ZX0A 1M4UA 5LMUO 4CPBA 3BUCA 1DFQA 5EBLC 4TWKA 2E31A 5IWAO 5JQGB 5IVYA 4B4QA 1VF6C 4D6QA 2RDRA 3BIEA 2GNDA 5CA0B 4BXSV 5A32A 4N43C 2Z3YA 4KWKA 3R65A 1Y76B 2XJRA 3L73H 3ZYPA 1NS1A 4AHYA 3EB7A 4CDUA 3AG3C 4XFAA 2Q7HA 2KKWA 2DUPA 1QLEB 2YSUB 1ENQA 2DW4A 4ZOLA 1LOBA 1ASJ1 1DG6A 5H9SA 4AVSA 3HBKA 1QLEC 4BQYA 2ITCC 1JQ0A 4KHPB 1C8M3 4D8MA 4FO9A 4N21A 3N4MA 3J81N 4JI4B 3AMQA 3I2HA 5BYNA 2VOXA 4NUBA 2VECA 5C8CA 1FXKB 1KKDA 3KQ4B 3ZXGA 5A80A 1W03A 4MGZE 2HWE1 4K8FA 3L70H 3KQRA 1PL4A 3NNGA 1H9WA 3OGCC 3CRMA 3MIHA 3CX5F 1GYKA 3N7LA 1WB7A 2VQ0A 2H3OA 4UYBA 4CS4A 1NE4A 4XUNA 2DU1A 3OOXA 1UYXA 1CAXB 4PQ9A 2CU5A 4X64B 2QDRA 3EHBB 1N1YA 3IZOA 4ZXKA 2ATKC 4WBNB 1OMIA 5J2TB 2VNVA 1YHFA 4NYKA 1B6QA 1WWYA 3E22B 3CCJV 2QKAA 4FLVA 4EZHA 1XNCA 2DVDA 4LF4O 4Z1MG 1I1EA 1HNXO 1S0JA 5F39A 3LDRA 4DV6B 4XFHA 5FZ4A 4LBNA 1HV1A 3N2GB 4RGGA 1BKZA 2VZUA 2B9UA 2VNGA 4FQ4A 4YLZA 1SQQH 4YXWG 1W8ZA 3N9OA 2QWNB 1SDDB 1WP7A 4XFIA 4CU8A 1DK1A 3BPSA 1HW5A 1KD7A 3CXHF 1AYM3 4X89A 1JXNA 3HKBA 1TE1B 3JD0A 4NHKA 3KGZA 3IMNA 1WLCA 5CG9A 1GFF2 1PM7A 1W2TA 1B35A 3F95A 1Q86W 3Q8EA 4FPOB 4MH0E 4RS5B 2XBO2 3D6EA 2EZOA 5ABJB 2RMU3 4RAIA 3AP6A 1QWRA 5F5IA 3OMAB 3WU2Z 3SEEA 1XREA 1K3IA 5GLUA 3ZN6A 1W9WA 2B8MA 4AVTA 1IQDC 3JARB 1I9RA 5CN0A 4YW5A 1N33O 1VAMA 1ZTEA 2G9GA 2ZKNA 5E89A 3H1IH 2VZRA 3D0JA 2P1BA 1O7FA 4Q8KA 1PKXA 3QO5A 3VZJA 1Y9MA 2Q30A 1UY0A 2GC2A 3AFKA 5T55A 3WFVA 4FFKA 4DR6O 1P84F 3EXUA 1IPSA 4YVWB 1NCRB 2FDGA 1VAVA 4NXMO 2DMXA 1Q43A 4XQDA 5CA6A 2OT7A 2QA4V 2Q69A 3WW4A 3L2YA 4IT5A 3GBFA 4MLOA 3JALA 2WNUB 5KXDA 4XUOA 2MEV2 4UI9L 2BGPA 2OA2A 2XT9A 3KT1A 3KZ4C 4K21A 2FCUA 3ZFGB 1Y67A 1X59A 1IS3A 3MIDA 4EQVA 2GDFA 1W8TA 1G9AA 1URXA 1FMD1 1C8M2 5F8PA 4H55A 3INAA 1F35A 1FOD1 3IAQA 3D8CA 5IVFA 4AEMA 1ENVA 2IM9A 4G2KA 3WQ0A 4FPEA 4G9SB 1WA8A 5DAQA 3S7EA 4CEWB 4X66B 3WT3A 1RUE3 3ZRWB 1DQ1A 1NU1H 2DYRC 1HXS1 3NV4A 4RQEA 1MSWD 2IZWA 4XMAA 1AX0A 4E27A 3GCWA 5JXIA 1GKBA 5FMBA 3HKCA 4I9QA 4YIOA 1I5YA 1Q8PA 1Z2GA 5HCFA 2HH9A 2CV6A 1PGW1 3ZX7A 2XDVA 2W92A 2P06A 3H7JA 2ZIOA 4URTA 1YQ5A 2QQWA 2BOCC 2Q68A 1NA1B 4BE3A 1R1BA 1EN5A 3VZLA 3GJBA 4L87A 5JOXA 2HWE3 1X9PA 2WAAA 2F4VB 1JYNA 1EZVH 5LP6C 2WFF2 4E8DA 5HCAA 3M8LA 3WP6A 5A9GA 4AVAA 4Y5TA 1S0GA 3VZOA 4NXMB 2A6XA 4L92A 4M3CF 4JC1A 4HAMA 3DKQA 5A3TA 2WNOA 3TAYA 4JGYC 1DZTA 4EZ4A 5IHRA 1FV2A 1UU5A 4JHTA 4X1YA 5L9BA 3LFIA 3ZYRA 3UKMA 2BPA2 5FYVA 2MK3A 4CCKA 4E4DX 3KKYA 1MSDA 2QKDA 4LLFA 5ABJA 4W6YA 1CR7A 1JW6A 1PX4A 3EYPA 1MA1A 4HZFA 3LIHA 2D5FA 4P2ZA 1W99A 3OSDA 3ABUA 4J42A 1HQWA 4M0HA 2B45X 2B39A 4QMAA 3C7GA 5DPNA 2J1RA 4AI3A 1LULA 1BGYH 1BHBA 3ZXEA 1PM9A 4J6GA 5LY2A 2W6JG 1VBD3 2BSKA 4Q0PA 3X2QB 3SQOA 1U0AA 2IXIA 3ZHQA 3E8FA 2GBOA 4MS2A 1KJRA 2YHJA 4NN0A 1CAWA 1I5PA 3FLPA 4JX0A 4XF0A 5J37A 2C1FA 4EWEA 4HYOA 4CCCA 4AQSA 4UF0B 1Z5WA 3KD4A 4J41A 2J1TA 4Q26A 1H8EG 4LKSA 3CPWU 2YEVB 4JYYA 4BXFA 3S57A 4JI5O 2D5HA 4L2NA 4FTEA 3THPA 3ZYIB 3ZR6A 2RJLA 4CDXB 2VOKA 2QDOA 1I5ZA 3GHNA 5JDBA 2RR12 2GP5A 2WIIB 4P5YA 1RUF3 2X6BA 3JD72 3AG2C 1VB4A 3J7NA 5AFEA 4P9YA 3WSOA 4RR3A 3B7MA 4X1IA 3IAPA 4HKOA 5C9AB 2VVEA 2GMEA 1SESA 3KMHA 5DUXA 4O4JA 1XOUA 3M7MX 4B4PA 2M7WA 2AGAA 3OD4A 4META 4FM2A 1UX7A 1E57A 2RS32 2VW0A 3PJYA 4LBQD 3ZN0A 4X9QA 4RQPB 3I2GA 2VU9A 3O65A 2BTVC 1C1FA 3RS6A 4M3CA 1OVPA 3JQXA 2PELA 3K9SA 5L9VA 5LASA 5FZ7A 4LPLA 5JVDB 4JTDB 1W6QA 2OXBA 2WT1A 5DUVA 1JYWA 1VIBA 5IVBA 2VOWA 4H7LA 4LWSA 1RJ8A 2ADPA 1WN7A 2GU9A 4I09A 3I2JA 3ILRA 1C1LA 4L99A 2PLV2 1UY1A 3A23A 2JVDA 1IOAA 1UXXX 3S7IA 2R7EB 3UJQA 3MBWA 1AL0G 4YVWA 4AI0A 5AC92 1KYOF 4ONUA 2FDKA 2VZPA 5BPXA 2JE9A 3R66A 5FJKA 3B9CA 3SXWA 3QTCA 3SYCA 4ES9A 4DR1B 4FIPC 1R093 2C6SA 1W0KG 1P49A 2E26A 1YQCA 2WLIB 2VTXA 2BTOA 1VARA 3M99B 4LA2A 4LMFA 4ZKTB 5IYZB 4QAWA 3JSLA 4GMP0 2WINB 3CRCA 4FQZA 2DWDC 1CAVB 3DKWA 4X20B 5DUUA 3UT5A 3VD3A 1GV9A 4FAHA 4DXTA 5H6RA 3UJOA 1RIRA 1K5MC 3H9VA 1NI8A 4LBQB 3TRSB 5HV4A 2Y33A 2OZJA 3WQ1A 2QQPA 1C5HA 5C3QA 3T0DA 2P3KA 1KMIZ 5EBWC 2Q67A 4ZI7A 2A7AA 1VF5B 4YJ3A 1YJWV 3WINE 1XI1A 2AH2A 1XHXA 3ZHRA 3MEPA 4MUVA 2WZR2 2OTLV 2WNVB 4Q27A 5L3GA 1WMFA 1FOD3 4QGNA 4C1WA 3T4DA 5A2QN 2LGWA 2OIGA 5C8CC 4EKWA 2HWF2 1XNBA 4BQ2A 1K5JA 1LHUA 3NQHA 1FKAO 3SMHA 3EHKA 3J7MA 3RYCB 1SACA 5IJRA 2V7QG 1OURA 1FJGO 3LDEA 1PVC1 1JHNA 4HN1A 4KNCA 4MT8A 1REDA 5LHHA 5LP6B 2X05A 4CCMA 5GKAC 2YIBA 3T4VA 2EINC 1XHZA 2FDHA 4FPFA 3CMEV 2XVKA 3ILFA 5CKNA 4CDUC 5C71A 3KV6A 1VQKV 4LFBB 5FP8A 3T1HO 4O65A 2W9XA 5CAZA 5FUPA 5LA0A 5FZ6A 4DUWA 1N0NA 1RUE2 4I0XA 3J8F2 4JDOA 1JU3A 2Y60A 5DDJ2 4YM3A 1ZZCA 4IV1B 2WYSA 3UQ8A 4COVA 2Y64A 4P9OA 2ZXWC 1W04A 3WV6A 2SBAA 5A7QA 3O9OA 4S2GA 4LHSA 4GQ7A 4NRQA 1US6A 2WSUA 2OYQA 4K3UA 5I0SA 1LNQA 3HQRA 1NY71 5I8SA 5FZ1A 1JYTA 4GZ9A 4QT6A 2IJIA 5C3PA 1MQTC 1MZEA 3RYKA 4OQ8A 2YXSA 4NMIA 1FMD2 1OCRB 5KAIZ 4DXRA 4YHHO 1M90W 2X6AA 4Y26A 3KS7A 3AK3A 2YS8A 1CN1A 3VBOC 3ZFGC 4DY3A 2P6JA 3RGBA 4QKFA 1ODMA 4RD7A 3AK2A 5A3NA 3GZUC 4ORFA 4FCAA 1JU4A 1K5QA 3T30A 3POSA 2NYYA 3H7YA 2OUHA 1LCLA 1W6PA 5FLIA 3S0MA 4YZ4A 2Q4PA 5CFDC 4PLMA 1NQTA 2W5FA 2ZM6B 1HB2A 3N3HA 1RGSA 4R8HA 3VB9A 4YPJA 4TN7A 4PDMA 2J42A 1CAXA 3PTYA 4C91A 1SA0B 3BAAA 4Y3OA 3CCQV 1E5IA 3BOWA 4HMZA 3ZHSA 5J2UB 1KDMA 4OHVA 2FCTA 3PVNA 2R30A 1RTVA 4N23A 3IT8A 2A0LA 4QE9A 4GH4C 1J83A 4N90A 2KG7A 3WP5A 1IS6A 3LPGA 4A7YA 2P17A 1FXKA 3S5AA 3OD0A 1YFXA 3GZAA 1OC1A 2Q1FA 2WFF3 2QKSA 1YJKA 3HKEB 1TEIA 1PNGA 3C8XA 4K6BA 1O3TA 4BZ4A 4DV0O 4MHRA 2JDPA 1NQJA 2ZGNA 4B1MA 2D2CB 2B1IA 4ARYA 1MG1A 5LA1A 3AL6A 1WW6A 1UY4A 2IH3C 5DN2A 2Q0AA 2YEVA 4BLIA 4NHMA 1GH6A 5L3EA 1ZLZA 3UKVA 4HVQA 2RVAA 4QNHB 3WG4A 3HNYM 2WO7A 2Q0OC 1HKDA 3VBUB 2B1GA 3DUIA 2XTAA 4PI2A 4PF5A 1RUG2 4LBOA 3EXAA 4HFSA 4X62O 2D40A 4QX2A 2HBUA 1LJ7A 3JD2A 3ZMVA 2BNOA 3LDDA 5IYDO 1F5FA 3ROUA 1IXBA 4QB1A 1SG3A 2GP3A 2OPWA 5GLWA 1W3VA 1FYUA 1MZ5A 5B1BC 2ENRA 1ENXA 3ECQA 4UBGA 2WQZC 4AGRA 4Q20A 5KXBA 2WZEA 2VQTA 1KXGA 3V0AA 2VO5A 2GUZA 2UUCO 1O4TA 4MXWA 2AUYA 4IUGA 5EZYB 1S1AA 2P2KA 4Q4W3 3G6EV 4CCLA 4LH6A 2VZ3A 3MHZA 1JOPA 5GLTA 1H2SB 3CCEV 1GLHA 1LRHA 2YU1A 3G71V 2ITDC 3K04A 3DCQA 4R4XA 4BIFA 1KRIA 4NIIA 1XE8A 3LEKA 4CEYC 3VBUC 2DQ0A 3QO8A 4K3AA 1AR92 4BPZA 1W0JG 1L7QA 2QR4A 4AYUA 2VG9A 2AZ0A 1VP6A 2P3JA 1RUH3 4P9JA 3HR9A 3HJRA 1N34O 5LB6A 3BFRA 2YPJA 1IBLO 4PDWA 1X50A 5JOZA 4LF8B 1OQDA 4RQPC 3QVNA 1K4DC 3NJYA 1GR3A 2FMLA 3DC6A 4PBPA 3ZXLA 1IBKB 2PI5A 3WY6A 1V9PA 2F1MA 1OF4A 1AX1A 1TME3 3DN7A 4S2DA 3VDDC 1X8EA 1SKVA 3FB5C 4AVVA 1SF9A 3HKDB 4F6EA 2KR2A 4KWJA 4GX2A 1KS4A 3T0AA 1YFWA 1B35B 1ZNPA 2VJXA 1F31A 5JIUA 1XOYA 3CJIB 4LBLA 4MGYE 4XZUG 4BW9A 4P5HA 4UFLA 1ZREA 2OYZA 4G28B 1N3OA 5C3RA 3AMNA 3UO3A 5J36A 1IPKA 1S0FA 1S0EA 2JDYA 1RM1B 4AF9A 1F2NA 1YFUA 3UGFA 4FI9A 3AYEA 1XPWA 3PL0A 4KP4A 3W7TA 3ZKYA 5LBCA 2DCKA 4PIXA 4LBEC 2JDUA 1PL0A 1JOJA 5EWSA 3OUFA 1G7YA 4DUXA 5DZEA 4U7OA 1K92A 2HWC1 2VQEB 1JZ3A 3S3XA 1TA8A 1AB3A 4AOCA 1K97A 1O4ZA 1L3JA 1IBKO 1POV3 2V1DA 3MW4A 1RP3B 4A3XA 5FYSA 1R6NA 2KB1A 1UOJA 5A1FA 3WB1A 1IBLB 4QPGA 4K40A 5HV0A 2HWC2 4CEWA 1NXD1 2JG9B 4JPRA 1BMV1 2VTXJ 4NAOA 5G04L 4JYAB 1XYNA 4UWDA 3U4SA 2DCTA 1F4MA 4XDLA 5ERLA 2ILMA 2XL9A 2NZ9A 5ANQA 5IVJA 2D6NA 4EROA 3IPVB 4OZOA 4UXNA 2P6CA 3RMYA 4MVUA 2BTQA 1SZXA 3QCWA 4DEQA 2UXNA 2UWCA 1BMV2 3MZHA 5LMNB 1L7LA 3RN4A 2O14A 4W6WA 2WO3A 1AYM1 2BW8A 3SCGA 3RYFA 1H4HA 5CFCC 5F3CA 4BR6A 3H1KH 3HWJA 2JG8A 3K3OA 5K4LA 1X36A 4DR4B 4ZKIA 2WLNA 2HJDA 3VOUA 3OUJA 4I5SA 1J58A 4FXKB 3JZVA 4Y22B 4CDXC 1W90A 4BH9A 2UU9O 1OA3A 1HNXB 2ZEWA 2ZCWA 2EIKB 3ZSJA 2MEV1 5FYYA 4MVTA 4XVHA 1OLQA 4BDVB 2HEYF 2WZPP 5CBHA 3LIGA 2EINB 4HN0A 2DUOA 4MGKE 1R082 3LB9A 1HWYA 3TEXA 4CUBA 1XYPA 3O0VA 5CFCB 1E1QG 1NLRA 4LR4A 1RUC3 5IYCO 2HLEA 4CCNA 2C24A 5EYYA 4AVBA 3MUZ1 3WF3A 4U3FH 4AEKA 4GX5A 3MHSC 1XNAA 4HK9A 2ZX2A 2Z4FA 1YCIA 5FZ3A 2D44A 5GTIZ 3MYXA 2EA7A 3I2KA 2EJ7A 3ZIWA 1W6PB 2XNDG 3FJSA 4Y1YA 1F23A 2WNVC 2I74A 5GALA 1JR9A 4MW8A 1W6QB 2W47A 2XUEA 3RMXA 3VBOB 3KV9A 3HNMA 4L9BA 5K8SA 1OOPA 1CZTA 3CCRV 4HVRA 4TV9B 2XWJB 3I3EA 1UZ0A 3VHNA 2GN3A 2LTNA 5JVVA 2YROA 4P9XA 4L8JA 2R061 5BY5A 5H6QA 3EQEA 4A5UB 2UUAO 1YIFA 4RSUA 4GKKO 1BS3A 1KKCA 4Q4V1 1H38A 2P4EA 1ZM1A 1W28A 5FZ8A 5D5PA 1D5NA 3L74H 1KECA 3Q8CA 4JYBA 4FAGA 4DRVA 4K20A 2A79B 3WW3A 3CMGA 1MEC3 1T2XA 3UESA 1YVWA 4Q29A 5HXMA 3HNBM 4YW4A 4Q4V2 1CVNA 2RJ2A 1YUDA 5CBGA 1DYKA 2RCVA 3ZEDA 2VVDA 1FYJA 5A1LA 3FHAA 3Q9OA 4LEJA 2JKXA 3RZJA 3VBBA 5FO7B 2VGDA 4FOYA 1XMOO 5A7SA 3ZMSA 1UOBA 2HWD3 3E8BA 1NR1A 4TUYA 5DABA 1R091 2WA4A 1WW4A 3AXEA 1Q56A 2VVFA 1C3HA 3JUUA 5FY1A 3D36C 2H0BA 2H0VA 5I0DA 3JCUZ 4ZIBA 1RUG1 3OT7A 5C4WC 2XJSA 3ZSLA 3NSTA 5CVRA 2XG3A 1V70A 3UKNA 4UFHA 1LOEA 4WM8A 3WW2A 2C2AA 4A6SA 1U96A 2FTKA 2MEV3 3MDSA 3APBA 1RUD3 1VQMV 2GNTA 2RS11 3OUSA 4Q6GA 3N9PA 1VQ5V 3ILNA 4QX8A 2YU2A 1EV11 3ON7A 3KCYA 1WW7A 5A33A 5BV6A 3WR0A 1HR0B 2AEYA 4JGZC 1MZFA 5FZOA 3LWCA 3VBSA 1J3RA 4X62B 2YC4A 5FUNA 2GV9A 4CCJA 3APOA 3OB8A 1L0LH 2PAEA 2QM8A 5EJ3A 3BABA 3SPCA 5ACA1 3J7HA 2CTQA 3B8MA 2QWPB 3O1RA 1W2AX 2RM23 3OY8B 4R9AA 4MTXA 3D82A 3PUAA 4CU7A 2D6OX 2R16A 1ENSA 4IE6A 1XQNA 3RZKA 4GKKB 4A41A 5ITZB 5JCOA 2PLV1 1H4GA 1SMVA 5BXZA 5J09A 4K8XA 1W6NB 1XSRA 5LHGA 1H1IA 2BUKA 3Q8FA 5DZFA 3POJA 1BBT2 4DV4B 4JYAO 5B3SC 4FLYA 2W0XA 5L3BA 2DYSB 1LR5A 4QE7A 5FZKA 1GP4A 4OUEA 1JZ7A 1FXVA 4Z2WA 1PNLA 4CP0A 2O1QA 4AEDC 4K7JA 2PFWA 1JZ6A 1YWKA 3DXRA 1AR91 4O61A 3LOBA 1LKNA 2JB8A 3FLTA 3KSCA 5FLXN 1GZWA 2Q1MA 4YG0A 1D0HA 3JBG1 1UY2A 5C9AA 1UPIA 3SPHA 4FOVA 4MADA 2N74A 4HBNA 1QH7A 4O4JB 1KJLA 3E5UA 4PELA 3SH5A 4ASUG 3OF1A 3WW1A 5F1RA 3WNNA 2NLJC 2DF7A 1N3QA 1OCOB 4GX1A 1QU7A 1CPYA 4RN5A 1F7YA 2XJQA 2ARAA 1YSCA 3WP3A 2VUAA 1AP6A 4MTFA 2PQSA 1O9GA 3FYEB 1VRBA 3JALB 2WNUA 5H9RA 1QNMA 4JF3A 4IYIA 2YGMA 1MS9A 3T1MA 5CBFA 4C0BA 3E1F1 1YIPA 3P5BA 1NH2D 1PO23 2XLAA 5A3WA 5FMDA 4KWLA 2CGPA 3GWKC 2Y6FA 2ZMLA 4QHZA 2EIMB 1GWLA 4YGDA 4M0NA 2RS51 1OH3A 4XBLA 1J1LA 1AZDA 3E97A 3VBHC 2Q8EA 2IU0A 4XHXA 3OBRA 4LF6O 5G05L 1HRI3 5CFDB 3LSUA 3BTAA 4FSJA 1RUE1 4O4LB 5FYIA 2QNKA 2VCCA 4A7KA 1NCQC 2VMEA 3DGEA 2ZR3A 3NL1A 2DFBA 5FWJA 3LNMB 3FFZA 1A34A 3BIWE 1S0DA 1N34B 1WPBA 1QGLA 4RGAA 3H3UA 3S30A 1JFFB 1S0BA 4FPCA 4UB8Z 4LXLA 5T3NA 3HQXA 1THZA 1ND2C 3WG2A 3ZFEA 1F9KA 1W0PA 1X4TA 4TSFG 1S72V 1DBNA 2XJUA 5FRAA 2NP0A 2X7RB 5C93A 2IJJA 1UMZA 2Y6JA 1A8MA 4Q4W1 2YGLA 4JKKA 4NTWA 1HQLA 1XRUA 4X66O 4B4RA 3O0XA 4FPPA 2R49A 4PDWB 2CTPA 2XGXA 3J8F1 4UAPA 2IC1A 3A4UA 1UD1A 3K5MA 4H33A 3SKVA 2LGQA 1BK1A 3CHXA 1J5EB 2Q5ZA 1WCSA 3NRUA 3I3MA 3E5QA 1ENRA 4WV8A 3ZM8A 3CXCU 3O1OA 2WLIA 2GAUA 1P7GA 4LHNA 5KMGA 5F2SA 4QHOA 3P1IA 1GP5A 2P4VA 3R4SA 1R3KC 4LQRA 4JI6B 2HWB2 2EIKC 2Y0PA 3GCXA 1PVC3 5IAXA 3AP9A 4KQ7A 3DXTA 2GTSA 2DUQA 4FP3A 3OEHG 4HKWA 3BU0A 4W8JA 5F5CA 1X82A 5LOVA 1BLZA 4WZCA 3CO2A 1W39A 2J1SA 3E6CC 1MS8A 1DGLA 4E2SA 2BVBA 2VMIA 2NN8A 5LYJB 5AVPA 1F8VA 4ZONA 2O57A 4YYOA 3NXSA 4GA9A 3ABZA 4LKDA 3UK9A 3EJKA 3M3EA 3I2DA 2OW4A 4DR5B 5AFBA 1NT2B 4BISA 4I4TA 3TEWA 3ZO0B 4CEWC 4COZA 1LHVA 1LTEA 4LORA 2UXBO 5T52A 4JKMA 4GIQA 4Y5SA 1OFSA 3ACLA 2XAQA 4ZS2A 3CEIA 1LEDA 4A44A 4CP1A 1JMKC 3WF4A 1UXZA 4HNAB 1UIJA 4HPKB 3RVZA 3CMAV 3K77A 2HEPA 3KLSA 2XPJA 1RUJ3 4K0KO 3TYJA 2ZX3A 1SETA 2X0LA 4AHCA 4CE8A 4XXPA 2IJHA 2HWB3 4J7KA 5FZDA 4WVMA 1O5UA 1Q81W 4A6OA 3M4FA 1RHI2 1QKQA 3PDQA 4K35A 1UOFA 1ULEA 1Q6IA 4OPAA 4ZI7B 1GNYA 1VR3A 2DYSC 4F6RA 1N32B 1Z7S3 2ID4A 5LGTA 2ETEA 1N32O 4R9CA 4ZHNA 1N0JA 1OQEA 3R05A 2DCJA 4QX0A 2PHWA 1GK9A 2PHXA 1W8OA 1K3EA 2HG5C 3LKJA 4NIAA 1AP5A 4LK6A 5JMOA 3D3QA 1VLNA 2WLQA 1SLBA 3C7OA 3BU7A 1QJX1 3FUQA 4ASKA 1OCCB 1HB4A 1HRV3 5HCBA 5A6YA 3SISA 3CJIC 3T2MA 2CDPA 4CDWA 4DUYO 2Q8OA 4BQ5A 3OPTA 1SS3A 2TUNA 4XTPA 4LITA 4ZY9A 4LLOA 3EBRA 3K59A 3ACFA 1L0NH 4XQ4A 2Y4TA 4RL7A 2G4IA 3U14A 3POBA 1PNFA 4UFJA 2EICA 1K45A 2EIGA 2RG4A 4Y20A 2H6BA 3CDZB 2VZTA 2VULA 1R64A 1ZYBA 1PGL1 5FQ0A 5LXTB 3CNAA 2R0FA 3A21A 4XEZA 3MF9A 3BHPA 4SBVA 4IE4A 3L9JT 4AEJA 2GC3A 2QKCA 3BB6A 3ZCCA 2W1QA 3MGUA 1U5YA 3W20A 5IWFA 4UFIA 3EFFK 4B3RB 5JI9A 2EXIA 1H8TB 1OCZC 5LATA 2O8OA 4WVVA 5I0RA 3KHCA 4DXSA 1VIWB 4ZU4A 4CDWC 4GKJO 1RITA 5LRRA 1K5MB 5T5OA 1TMF2 4LF9B 1NLSA 3C7HA 5CA3A 5K7PA 5LZ6A 2BP6A 3B9IA 2P3IA 4B3TO 3J7AU 1DLBA 1OKQA 4I9WA 3HQUA 2ZEYA 5FBZA 5FBJA 4LOSA 4CDQB 1CQ9A 3Q8AA 3F2ZA 3T0BA 2D6PA 1ZZ8A 1AXYA 4XIKA 2QM7A 1AXZA 4B3MB 1J5EO 4ISRA 3ABKC 3PMEA 5FYZA 2C9KA 2JE7A 2XB6C 2CHHA 5B1BB 2GH8A 1F4NA 2WO1A 3DL3A 1IS5A 5FYCA 1G86A 2A73B 3ZFEB 2Z42A 3WB0A 2C9AA 4MV2A 2EIMC 2I07B 3ZXDA 5LCWL 1M56B 4GKJB 1PPJH 1XB9A 1HQNA 3WX5A 2GC1A 3DYMA 3LZZA 4HXCA 4G4FA 4X8PA 1NQDA 3PTRB 3SNMA 3AEIA 1R3LC 1NZCA 1AJKA 5I93A 2HFEC 2XAJA 4DR7B 1ZBE1 1LNSA 3URFA 5JPMB 4CH5A 1HN0A 1OA2A 1VQ4V 5LWBA 1OLME 1KQSU 1M57C 5JI7A 4PIYA 1HNWB 5FPLA 4GAZA 5JIAA 4XXAA 1RSOB 2WLHA 2A3YA 1W0NA 4NHXA 5GZGA 2YIDA 1QJY2 4B7KA 5JPNB 2ZT9B 2W87A 4NAMA 2CK3G 3FKSG 5FPUA 4CH3A 2VAUA 1SLTA 1VQOV 1CPNA 3OBZA 3RYFB 2WQ4A 1C5IA 1WPXA 2B9VA 1N1TA 2QQIA 3ZFFA 4MHUA 2JD4A 4AFCA 4O2BB 4DRXB 4UCSA 1CIYA 1ZL8A 1OCZB 3LEMA 1OJHA 2PA7A 2ZGPA 4LJHA 2VTFA 1QH6A 4A42A 4PBOA 3AKQA 2B4KA 5J2TA 5CZKA 5LY1A 3WF0A 5KX5A 4YW3A 4XC9A 2XUMA 3MIGA 1W9SA 1PK6C 3SDLA 5A3OA 2D3RA 5IVEA 3BVCA 4Q4Y2 3WNXA 2ZKOA 4LA3A 4QKBA 3RSJA 1OKOA 1JFFA 1HRV1 1AR83 1HIXA 2E33A 4XABA 3VUOA 5FXWA 2W1SA 3TJTA 1TG7A 4CP2A 1UL9A 4D69A 2D6KA 3LF7A 5K0UC 4AQ6A 2WNEA 2BWCA 2IFRA 3I2OA 1V54B 2EIEA 1HP8A 2PZSA 4LULA 3ZRSA 4EYUA 4YY3B 1X7NA 2ZX1A 3MIEA 4UVAA 2EILB 1OCRC 1YNAA 4EE2A 4M01A 4N43B 2WBKA 2R071 4AHWA 1JUHA 1D4M3 5J2UA 3FYIB 1PHMA 4F4LA 4DV4O 5ANNA 1RYYA 4LF9O 1VEWA 1SQVH 3UETA 4UFMA 2Y6KA 4NPRA 1APNA 3ZDVA 1P7BA 4JZGA 4IV3C 1DLCA 3WUCA 3OPZA 5K1XA 4IEWA 4CBCA 1RHI3 4IHJA 3IN9A 4B3RO 2IBZH 3RVYA 1W8FA 5KUMA 3PJSK 1PVXA 4X6QB 4JDMA 4DR2O 4UB6Z 2HP8A 4W50A 3NMBA 3QF7A 1V00A 5FYBA 3VBHA 1O3QA 5A6QA 5C8YA 1LHOA 3HEIA 4JI8B 3ABMB 1BVVA 2PLV3 2ZX4A 1ZSPA 3PMSA 3KHBA 2NLRA 3WDTA 2XOKG 4C8DA 4IYHA 2P6HA 3WDVA 4O9GA 3T2OA 1AR1B 4CTEA 4DO0A 2Y69C 2IXLA 4XUTA 1KBHA 3M8AA 3PU3A 4W4LA 2X29A 2E53A 2F93B 3AYCA 4BB3A 1JBCA 1PIV3 2Z5WA 5IE9A 4DV5B 1ULFA 4YHHB 1G8MA 4X6RB 3K3WA 4ASLA 4B8EA 3G6BA 2UXCB 5LA9A 3IDAA 5AC91 2F4VO 4DMIA 2KQXA 3FFQA 2QQKA 1UF2C 1V6MA 1C57A 4YVSB 3VHPA 4OMDA 2V5YA 5KAFZ 2EILC 4LF5O 3K4AA 2WLKA 4OI2A 2UXDB 3ZS8C 1PM4A 1V54C 3OGSA 4B7EA 3SC7X 1Q90D 3R6SA 2HKXA 3POFA 5BNOC 2P3YA 4TV9A 1XL4A 5C70A 4LHKA 5FK7A 3R4DB 5JR2A 3AJYA 4O4IA 1LGCA 3S6PA 4I50B 1ND3B 4J10A 1CONA 1HW7A 4Y1XA 1CWPA 1NCRC 3QNEA 4N9IA 1FX5A 5B66Z 1MS0A 4UBHA 3ZYGA 1QMJA 2E51A 2ZA9A 2YG0A 1UPSA 2P90A 1UO9A 3VD4A 2AYHA 4GXLA 4PLNA 5BNNA 1W6NA 1R6TA 3PN1A 1XMQO 1DYPA 3ENRA 1I94B 3P30A 1T5EA 1YQ2A 3N7KA 3O1SA 5C5UA 2X53S 3B94A 1WLDA 3G4SV 3NJVA 3H3ZA 1ZZBA 1AUYA 4OFGA 2YV8A 4QB6A 2W94A 4QIWF 1K7DA 1JVMA 1EZJA 4YJ3B 1ZRDA 3E22A 1WA6X 1JMUB 1GWKA 4YVSC 4AI1A 3USUB 2PGGA 3RVHA 4H37A 2IUWA 4H13B 3AZWA 4YW2A 4FXGB 1CPMA 2UU8A 4FZ1A 4AHXA 1S77D 5F2WA 2BWAA 5JSOA 1AL21 1UOGA 2XMLA 4FPJA 1OCOC 3TNQA 1FMD3 5CISA 3JATB 1YXBA 2OIIA 2DYCA 4RFRB 3RYCA 2XKPA 3ZMNA 4GLXA 3BEHA 4PCRA 3GBGA 1GQHA 1LHNA 4GKXA 1KC8W 3B02A 5JJNB 3D4KA 4EN9B 1XE0A 2CDYA 3K06A 1DU3D 4Y1ZA 1WLWA 3K75B 4UCTA 4IEPA 1GICA 3AG7A 1AYN1 1FOD2 4UVCA 3ZXAC 2D7FA 4FBFA 1DGWA 1NYWA 1RUOA 3S3WA 1NVPB 2GH2A 1ZBA3 3ZPOA 4YW6A 1CJDA 1OPOA 5LMNO 4XF9A 4CZSA 3D5OA 1LOFC 1YI2V 1IXMA 4I0XB 1ALYA 1N1SA 1O9HA 4PI0A 3IDEA 2PAKA 3K79A 3H8UA 4FFFA 3TEZA 2CSGA 4FVVA 4IGGA 1VMGA 3LA7A 5EXOA 3KV4A 2JS3A 4Y33A 2HBTA 5KC5A 2GDSA 4OHZA 3W21A 3E2EA 5KMGB 3LCPA 4N7UA 4MOAA 3AMHA 4XJUA 5CA0A 1DQ5A 2XJVA 1VBC1 1J84A 2XQXA 2OT5A 3SPIA 4GH4A 4CA9A 2PI4A 3X2QC 2M6YA 2UXXA 5GONA 5IY5C 2Q8DA 3NO8A 4MGTA 1AVBA 5CKQA 1PO12 4XFCA 3THDA 1NTMH 2WWSA 3TNPB 3NKTA 5KA6A 2ZE5A 5EIBC 5DDJ1 1JYCA 2PQQA 4AQTA 1Y4WA 2WFF1 4Y22A 1L1FA 1GZTA 3ACIA 2Z79A 1J1TA 2WNVA 4BLJA 3DXUA 3RZZA 2Y38A 1G6NA 1PO11 5FNVA 3UYJA 5BR8B 3DGTA 1DGRA 3FHIB 5F3GA 4IGQA 4JGYA 5FY4A 2CWMA 4WBBA 3RDIA 1ROPA 2UUCB 3AKPA 4Q4Y3 1O59A 2PHTA 3HBZA 4FTSA 2P5BA 2PAMA 3FUOA 4FFIA 3RWNA 3CP1A 1QJEA 2OQ6A 4GWMA 3DPRB 2JDNA 3E89A 2F23A 2K1EA 2Q6AA 4QX3A 3W7SA 5C4WB 1DQ2A 4AI9A 3HN3A 1PMIA 3WNMA 1XMQB 2Y69B 1NZ6A 4N53B 5JZGC 3GDBA 5KHJA 1V6NA 2RMU1 5FREA 4FJCC 3T2QA 5KX5B 4WFHA 4AVCA 3ASNB 3N2GA 1WD4A 4KBZA 5F3EA 5EFUA 1EYBA 2D93A 2BSKB 2ZHNA 3WZ1A 1OQ1A 2R0HA 2X5IB 3OMNB 4QPIB 4WFGA 5KBFA 4EN0A 2VD7A 5I91A 2OTJV 3W5MA 2D43A 3I3BA 5C8WA 4J1WA 1U5IA 1G1XB 4XF4A 1HRV2 5HXVA 4EFEA 1MABG 5LYJA 4DV6O 2A75A 4O4LA 2VCBA 3T4HB 1R083 4NB5A 2LJ2A 1G8WA 3LDBA 1J95A 3CWBH 4JTOA 3WUDA 1NTZH 5AVAA 5FP9A 1OH4A 1PMJX 4MSWC 4PJYA 3T2TA 5FIXA 4HNAA 2ADEA 2IXHA 1D7PM 3E8GA 1SQFA 4TYSA 1YEWA 1ZL8B 1PD3A 3O1MA 3KF3A 2YY1A 3K08A 3SH4A 5B1OA 5BNPA 1WA8B 2GN7A 4DV2B 2WNUC 4WF9V 4UCOA 2ZM6O 4FK5C 3FE5A 1RHI1 1O3RA 1ASJ2 4FFGA 1EY2A 3AG4C 3APQA 4DUZB 3NVCA 1VBA3 1EAH2 4AK3A 1KP2A 1FAFA 1OLRA 1XNQO 4QXCA 2WWWA 2WO2A 3CLPA 3SPJA 3ACGA 1EPWA 3JAKA 3ETGA 4QD2A 5JOWA 1K5MA 3SR2C 1Y74A 3FAVA 1DF4A 5B2GB 5FK8A 2QQUA 1KUQA 2WAMA 3JD4A 5A70A 3NNMA 3ZOIA 5DZGA 5JAXA 4MZUA 4HOOA 2HVJC 4P9WA 1COV3 5IFPA 3VDDA 3J80N 3J4UH 4FTBA 2WWUA 1QXRA 4PDLA 2UYBA 3P3NA 2VXRA 3E6DA 2G9ZA 1DHKB 5M0TA 2CE4A 1AR82 3AKTA 1R092 4JKLA 1TZOA 5FQ0B 3AB0A 1YXWA 2G19A 1FD9A 3ABLC 3NV3A 4Y20B 1OSGA 2VMCA 4FPKA 4CH4A 2ZMKA 2E7TA 4CP9A 3STLC 3BTYA 1VF7A 1ZZ7A 2GNBA 4O9EA 2RQ6A 2Q4SA 4P30A 1NOVA 2Q8CA 3L9DA 2QQVA 1CX4A 3MIFA 3ZMZA 1EP0A 1W8UA 5FYMA 1W6OB 1W6MB 3AZZA 5CG8A 2ZDIC 3H50A 3H1MA 5FZ9A 2V5DA 4CEYA 5FP4A 3ZFFB 4P9LA 1VQ6V 1POQA 4YG6A 4BIUA 5FPOA 3IDBB 1X9TA 4LO7A 2XLGA 4J25A 2FCVA 3L71H 3AVSA 1DGWX 4RGKA 4IEXA 4YG3A 2E74B 3QO7A 4CXXA 5GJ6A 3P3PA 2XHKA 1ZRIA 4OZXA 4NTYA 5EYXA 5FPRA 2F17A 1FJGB 2QE7G 3GB7C 1OFNA 5ACA2 1EUUA 2ES3A 2VW1A 1T6BX 4UUJC 1D4M1 4P08A 3PUHA 2QZ3A 1OF3A 2BBVA 3JCZA 1JCHA 3LDKA 2QWQB 2VCAA 1PVC2 1S5LZ 4CCDA 5JVDA 4IIJA 2VZOA 1I94O 1JODA 1FV3A 2ET1A 1PP9H 1MS3A 1YLLA 1UPGA 5F6LB 1BHAA 4EB6B 2R043 1UZVA 1UN1A 4AE2A 3RBZA 1AI4A 1RUJ2 2EXKA 4XCBA 4AGVA 2G9FA 3WDWA 4MW3A 1RC6A 1QCEA 2RR13 5JOYA 4H7MA 1RUH1 1WMDA 5JXHA 3POEA 1UIKA 3O1PA 3ETQA 1O91A 2FQPA 3BRCA 4W4KA 2L9LA 1AHSA 4LOTA 4U7NA 4JZRA 1HNWO 2QJ1A 1VBE2 2PHFA 2G1MA 5GZCA 3VGIA 4QPKA 1JZ4A 1QJU3 2JKBA 4LIVA 4LBMA 1VMHA 1XC6A 3PVBB 5JCTA 1VRH2 5KHGA 1QNWA 1H1AA 3H01A 5L73A 1SFYA 2JDIG 1JH5A 2JRIA 4QGMA 4P00B 1ZRCA 3I49A 3ZN4A 2HYKA 3DEMA 3GF6A 1QOOA 3MIBA 3V0BA 4Q0VA 1QNYA 3ZN5A 2AZ5A 2ARBA 3UM7A 1K12A 5DQ0A 2GC0A 1POV1 3BGAA 1VQ7V 5H5NA 2K46A 2LO1A 4UFZA 4A45A 3TXSA 2F66C 5D21A 1OCCC 4DIQA 2Q5TA 3K2OA 1OI6A 3OUHA 4ZHQA 4YZ1A 5IFTA 1V6JA 1L8DA 3IBMA 1U5XA 3VL8A 4JTCB 2DN9A 1S2BA 1HXS2 2ZGSA 3ICXA 4FLZA 4Q4Y1 5DAWA 2UXCO 4LFCB 2R9AA 3E35A 2QM4A 4EWDA 1YC61 3RPQA 2JDZA 1US2A 4UCUA 2DTYA 1E5HA 4JQTA 1TUEB 3J26N 3AYDA 5DECA 4OQ9A 1JS9A 4M4RA 4QGPA 5CNAA 2BEOA 1SQPH 4BWOA 2Q9LA 1OOPB 4LK7A 4DV1B 4CPBD 3B93A 2QFEA 1SDWA 3J7LA 4QPGB 4YJ2B 3U78A 1TGOA 4AW7A 2Y26A 4Q4X2 2YI8A 3OR7C 1QBZA 3ITQA 1RINA 2ZE7A 4AI8A 5IJ0A 2CUGA 1JZ2A 1Y4MA 1STMA 3A2FA 1MR5A 2AREA 4QX1A 4X8AA 3W7UA 3QACA 1NR7A 5C3OA 1NT0A 1UW8A 5CYYA 2WS93 3ZIXA 4ICGA 4DYLA 2ZABA 3SCHA 1HV0A 2N7GA 1NTKH 3O14A 4CUAA 1RUG3 3MLLA 1VQLV 2P34A 5F37A 3WDYA 3UL2A 3NJXA 5K1PA 3B69A 1DP0A 2VM9A 4MTGA 3FB8C 2JICA 3ZJZA 4O4HA 2YBSA 2ERFA 3SYQA 4CCEA 4S2HA 1Y74B 3ASOC 2SLIA 4BA6A 1RUD2 1PO22 2FHRA 2YFUA 3S5QA 4F8AA 3JD1A 1QJY3 3LE0A 2NPIA 2XOMA 2BZDA 3Q4HB 4NIDA 2R32A 2GMPA 1K9MW 4JTNA 4UV9A 2HHHB 3ATGA 2CTWA 4I0AA 4MX3A 3K48A 5IUQA 4BQXA 2F43G 4QPYA 5KXCA 3O1TA 1OA4A 4LC1A 2ZE6A 2JJ6A 4AZZA 3OEBA 4DPNA 2VZVA 4TWTA 3I2FA 4OHXA 1NKDA 1YI9A 3I4IA 5E1RA 1WNSA 5IT6A 1H6XA 1RUC1 1F51A 3OPWA 2OX0A 1ZRRA 4HSLA 4MTOA 4PA9A 1QOSA 3AL5A 4AI2A 1RPRA 5IT9N 1CAUA 2WRAA 3A0BZ 2HHHO 5B1AB 1MVQA 3IWZA 3N2KB 4OXSA 2YYOA 4DEVA 3OY8A 2QJVA 3WD5A 3WXPA 3R0RA 2NR5A 4MVMA 5IATA 1UY3A 5DAVA 3UNPA 1QU0A 2NN4A 2IW5A 4XUQA 1FPN3 4PA7A 3K4DA 3SYOA 1Q3EA 4XPVA 4O4IB 5FY9A 2HJFC 3MHHC 1AI6A 1WMEA 1REEA 4QDQA 4J1XA 2JGUA 2J1AA 1ND3A 1KB9F 4UCVA 3SJAC 4YVWC 2OZ6A 3NNJA 2ZOEB 4BAYA 4PIZA 4PDWC 2CWSA 5FZAA 2VE1A 3JBG2 3PURA 2KA3A 4Q0SA 4F7ZA 4UW3A 3M3OA 5CA1B 3N7MA 4QJFB 5JH7B 5JR7B 1KEXA 5CBLA 5HFLA 1HRI2 3GNEA 2K9ZA 1W2UA 4LHLA 2VH9A 4DFSA 1ULDA 1BZWA 3MLJA 3TB0A 4JI3O 5EYPB 2OCCC 3ZSKA 3BA9A 4UT5A 4PA3A 1YTFD 5BNQA 2EIJC 1YJLA 1V6IA 4OGQB 3PVEA 2DVGA 2LUWA 1UU4A 2OS2A 3IFXA 3CRQA 1UU6A 4JDNA 1LECA 5JQGA 4AR2A 5E16A 1S0CA 4NRPA 4LR3A 4JI6O 5DN6G 2XAHA 2HWF1 1KGYA 2O0OA 3A22A 3VV1A 1AL23 1PNMA 3OFNG 5BNPC 4IEZA 4DR6B 4FLWA 3B00A 4I55B 3O1UA 3OBAA 1G9DA 3ZN1A 2WT0A 3U10A 4GX0A 5EC2C 4EEQA 4XJ8A 3MF6A 3NNFA 5FLHA 2ADQB 1LHWA 4BHPA 1HX6A 2X09A 3MW3A 1BEV2 2WWJA 1A3KA 3WHUA 4P9GA 1BK0A 3SH3A 1H2GA 4Z8BA 1B09A 1YRZA 3O7OA 4E8CA 3F7VC 3POYA 4YARA 4Z82A 1VF6A 4DR3B 1VE0A 5H9QA 1MPXA 3ZX6A 4NO4A 3OG2A 2EX3A 2BV4A 3POWA 4D7SA 4DUYB 5DAXA 1WA4A 1M57B 3WNPA 3JAMN 2BTQB 2ZQMA 3AZXA 1H0BA 1Z0HA 3RWKX 5T5LA 1FXKC 2A9HA 1HXS3 3CC2V 1W2NA 1XNDA 2UY9A 4WM7B 4GB31 1NKGA 2XKOA 2XVGA 3USSA 4AGGA 3ZRVA 1AYN2 4C7UA 3H1WA 1O5LA 1Y9QA 4EJRA 4IETA 2XQRA 2P37A 2YDEA 1C8NA 4RS5C 4LF6B 2VBDA 1SFNA 1TAEA 3ZIAG 3VDBA 1RMU2 2RDNA 3CU7A 1EBOA 3RWRD 1AJNA 2YXYA 1S55A 1WW5A 1GM9A 3D3IA 5F7UA 3RZGA 3ETDA 1JUIA 3CC4V 5LEJA 1DTOA 3V0AB 4XETA 1VP7A 1SLIA 5JMCA 4BCUA 3AVRA 3E6BA 2OQ7A 1VRH1 4LF7B 4LNVA 3LEIA 2VC9A 3K3NA 1DDLA 4Q1RA 5DMYA 4PF1A 2N04A 2HWB1 1HN1A 1HNZB 4RUEA 2KM2A 5FJHA 4XFBA 1IGOA 1ORQC 4XDQA 2DQ3A 4ES8A 3VBRC 4CEYB 4XAEA 3VDAA 4IERA 3KT4A 3OEAA 4JGSA 2B46X 2B9ZA 2YXHA 1NA1C 2VR4A 2LROA 3I59A 3JYCA 3GWOA 2QQOA 3ZHUA 2GALA 5FOBB 1BHGA 4Q4X1 1XL6A 2E63A 1UAIA 2X5IA 3THCA 4BIZA 1UZWA 2P22C 2A3WA 1YZBA 3BY6A 4FLUA 2FDIA 3AYAA 4JV5B 4JI1O 2JDHA 2JS5A 2ZHKA 5FYTA 1CXZB 4JI0B 3LFMA 5L19A 4I50A 3ZRXA 1AVMA 3OTOB 1Q7YW 2W2IA 1PZ9A 4UVBA 1FFTB 3VD9A 2IH1C 4IXLA 1LOFA 4LF4B 1OV9A 5K9YA 5F32A 3AG4B 4LF5B 4XFFA 3JAKB 3HD8B 1XSQA 1LAJA 1XNRB 5GW7A 1FNZA 5AG2A 5B5EZ 4BMEA 5LGNA 1H8VA 1M56C 4TLFA 1JYXA 1S4CA 2PHRA 2TEPA 5LK5A 1BCXA 1GSLA 4RUFA 2VMGA 1ZUQA 5D1IA 3JQWA 4LFAO 1GBGA 1S76D 1QVGU 3JXSA 4XBNA 4DV3B 4V2WA 5CKMA 4O7XA 1MEC2 2QQMA 4QQHA 4H3WA 3LA3A 1M06G 5A7NA 2ZZJA 1VBD2 3BKZA 5IJ9A 1TNRA 2XR4A 2JENA 1RPOA 1X8MA 1ZA7A 2AHYA 3KWVA 1DF5A 1BQZA 1ACCA 2P4KA 1XMOB 3WEZA 1Z7S1 1POV0 4FLTA 5FFOC 1FFXB 4X1KB 4EN6B 3V0BB 1LGBA 2XONA 1VBA1 4Y5Z0 3SGIA 1EN6A 3LSEA 1S0VA 1I6XA 3MDPA 3NW4A 1PZ7A 2ZZQA 4D3WA 1CJPA 2ZDIA 4BWAA 1WUVA 4ZHQB 2BE3A 5LBBA 1W8WA 5C3SA 1UJWB 1WLEA 1UKRA 4A2UA 4JGYB 1B35C 2LALA 3PJQA 3GZEA 4D6SA 1QQP2 2WJSA 4Y24A 3ZPYA 1DYOA 3MFCA 1GWMA 3RT3C 4JAUA 5JWPA 4DR5O 3UGGA 2I45A 4L97A 2D3SA 2W6IG 2O8QA 4QKNA 3RG0A 3M1HA 3I55V 3LQCA 2Z0AA 1D0GA 1LGNA 1PV0A 2VUCA 2ZAAA 3ZKUA 3STZC 1QJX3 1E5SA 5ISLA 3ETPA 4TV8B 3CIHA 2WS91 5FL7G 4YSFA 4NXNB 2UUAB 1VBD1 5EIYB 3VBRB 2JX9A 1IVSA 1VRH3 5LBQA 5A3MA 2RS52 3VKFC 1GOFA 1BE3H 2UUBB 2VXJA 4YNIA 4MGQA 1D2QA 2HWD2 3AP4A 4HKLA 4YRDA 3K4ZA 3L75H 4QXKA 1TME2 2ZBJA 1EN4A 3C3TA 4GCZA 5FKBA 1W0OA 4D6RA 4Z2AA 2W52A 1SZTA 4R9DA 2JEXA 3G7DA 3TCUA 3GBWA 4K1YA 1UKGA 3RZMA 2UU9B 3RRDA 3AFGA 5DXDA 5IYYA 2WLJA 4J7JA 3MO4A 4FM1A 4NWWA 1HJGA 4LNUA 2Y6LA 3IIIA 3VBSB 1CZVA 1S2EA 4GJZA 1HRI1 3B40A 1VBB1 3QOPA 3DPRA 4A4AA 1RUF1 3I3DA 2Y6GA 2EAKA 1K8AW 3IAYA 1JOBA 1MACA 4BQWA 2R042 4FPLA 4KU7A 1RUJ1 1AF9A 5EP9A 3SYPA 4CS3A 1N36O 1PNKA 2ZXQA 3VDCA 1R3JC 3DXRB 1YTFB 5FWEA 5L3DA 1DIWA 1ZX5A 5J98B 4DK0A 4PHZA 4I2OA 1SCRA 4R8CA 4JI7B 4E2LA 2JWPA 3HPLC 5IK8A 1BVP1 2TNFA 4I4TB 5EK0A 1IS4A 3AXDA 3V65A 3WOGA 3LPFA 4OI1A 4GT1A 5EQUA 4NIHA 2W3JA 1M5IA 2PN5A 4DO2A 4MVSA 3LEGA 4XUPA 4X1KA 2LP7A 2YFZA 4CS2A 2UWAA 3HKBB 4QWNA 2E9QA 2E32A 4CDQC 4EB6A 4QXBA 1M9NA 3BODA 5FMCA 2ZGRA 2BGOA 4LP8A 1WJZA 4YFZA 5GONB 1PMHX 3MI8A 1KD1W 1XU2A 4IDZA 2YC0A 3U0ZA 3WG7C 5IDJA 1O8SA 4OMCA 2J1UA 1W6OA 4DR3O 1SCSA 4XW3A 3ZYFA 4TQFA 1E5RA 1NUKA 3WQBA 1UZZA 2DVFA 5D8AA 5EIBD 2DDUA 3CJHA 1JX9A 1UYZA 1H8TC 3BOPA 2R9IA 1FI2A 5F9TA 2BNMA 4H14A 4HETA 1VALA 2BOBC 3VL9A 2EIDA 3TOJA 1UYYA 1XNKA 5H2FZ 1LU1A 1LU2A 1LB2A 4A7ZA 1IKQA 3T3YA 3AMPA 2VZQA 1UX6A 1OLMA 1AX2A 1COWG 4XJAA 1UYPA 4J9ZB 1MS4A 1IG0A 4YGBA 2FZ1A 2Y0OA 3CCMV 1YHQV 4NTXA 4IGPA 2AENA 5L3FA 5FZLA 1EFRG 2EVXA 3RYIA 1JN2P 2VQUA 4MGSA 4AQYO 2WLMA 3RYPA 2WKKA 4OLLA 4X88A 1NZIA 1D5AA 4X1IB 1ZWIC 3VKMA 2DBIA 3SITA 1SC5B 3I56V 1W59A 5FKCA 4XTMA 1Y7BA 4NROA 3J9SA 2XHBA 2ZJCA 4CU6A 4OI0A 4BK4A 4DW0A 4YZ3A 1EAH3 4DINB 3C3VA 4P9PA 2UXBB 4NR1A 3LSDA 4QKDA 4YZ2A 4ET7A 2VQAA 3OEEG 4IHJB 3PU8A 1K5SA 2J22A 1AJOA 5IW0A 1FXZA 4ATEA 3OMIB 3K58A 3THOA 1XU1A 3POGA 3KM5A 5LBFA 4QU2A 4HZ3A 3FLRA 4HT1T 4YZ5A 3E86A 5T54A 2VWKA 2Q7GA 5BNOB 1ONAA 1COV2 3DSQA 1K42A 2W46A 2K0GA 4DRXA 4AFBA 4DV1O 3CF6E 5HFMA 4YM2A 4IE7A 3KGLA 5L7OC 2AC1A 3NJZA 1WKYA 2ZEXA 3E8HA 3ZYHA 4W65A 1B06A 3WDUA 2RS31 5FXVA 3ZSMA 3BPZA 1AILA 1ZBA2 1SBEA 4B1LA 4J11A 3AP5A 3FMGA 2HWF3 3GJAA 5FP7A 1W2OA 4D0QA 2GZWA 4ZZ5A 1QJU2 2E7AA 4DV5O 2VQFB 2D6LX 1QHDA 4NHYA 1CD3G 4L0PA 4FT8A 2EIJB 3KZIZ 2WLLA 2BRTA 3H1YA 4K0KB 2XWBB 4K9SA 4I3PA 2XAGA 4WZFA 2R062 1H1MA 1S2KA 1XXNA 4K8ZA 2GHYA 3BTXA 3CRRA 3IKWA 2ZCEA 2VL4A 4LO5B 5GTHZ 4HPKA 1GZ9A 3AG1B 1TMF1 1YO8A 2VWJA 4ZPIA 1H2NA 5DAPA 3WDXA 4K8RB 3TXQA 1AR62 2AR6A 3H1HH 4B3NA 5A3UA 1QXPA 1BSMA 2FYUH 1XBLA 5ITZA 3A0KA 5BNNC 5FZFA 3I3QA 1KS5A 2XXZA 4JI8O 4BM8A 5FMOL 2FMDA 2JD9A 5BUVA 1RL3A 1GP6A 1NCRA 2XHNA 1S5HC 1ND3C 2ETNA 4DR4O 3IM0A 3PUQA 1AR61 3IGAC 4D6TH 1BCCH 1CAWB 2LW8A 2DURA 2BFUS 3T2PA 1CESA 1XUQA 2VQEO 2R9RB 3CCSV 2P5OA 4AQYB 4B08A 1R1ZA 1OBNA 1LENA 2P7TC 3C7EA 5IK5A 1CAUB 1SERA 2BQPA 3CRAA 3IDCB 4E4ZA 2PHDA 3GGLA 2RM22 5E8AA 4IQPA 1Z5VA 3ALQA 4MVRA 4QDRA 1US3A 2BERA 2AHZA 3AG1C 1TME1 2WL1A 4GMP3 1K33A