5KHGA

Hcn2 cnbd in complex with cytidine-3', 5'-cyclic monophosphate (ccmp)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 59
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khgA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khgA02
1X82A 2OZJA 1ZZ6A 1UD1A 1Y3TA 3NL1A 3RYKA 1O3QA 3SHRA 4YNIA 2QJVA 3NVCA 4HSLA 4IETA 3B02A 4XF3A 5FCCA 4KWKA 5JSPA 4JVAA 3RYPA 1J3QA 4UXAA 4HZFA 1WLTA 1ZZ7A 1EYBA 3IDBB 5F1RA 4Q0UA 4MUVA 4Z82A 4X6RB 2B9UA 2UYAA 5I0SA 1LR5A 4EWAA 3FZ3A 3IBMA 2IXJA 4XETA 3GBFA 4QGMA 4E2QA 5FQ0A 3NKTA 4KL1A 2BYVE 4P9GA 3N4MA 3CF6E 4QXKA 4I3PA 2D40A 4I0BA 2GC2A 3E6CC 2UY9A 3EJKA 1CGPA 4IEPA 1FT9A 1ZRCA 2F4PA 5KHKA 1RTVA 5J3UA 1UPIA 3EBRA 3CL1A 2CGPA 4HBNA 1X7NA 3H3ZA 5I8SA 4LLOA 3DKWA 2GH2A 3I59A 4O9EA 2QCSB 1ZZ8A 3LWCA 3QACA 1UCXA 1QXRA 2PA7A 4YARA 4AVAA 2D93A 3I59B 3H7YA 5CU1A 5KHJA 2H6BA 4HMZA 4IESA 1WA4A 4ORFA 2HKXA 4UBGA 1CAWB 3MDPA 1EY2A 4LA2A 4IEOA 4QX5A 3DL3A 4LUMA 2KXLA 3OTFA 1QXJA 5FPZA 5EZWA 3U11A 5KBFA 1ZRFA 4A2UA 1LRHA 3E97A 4FAHA 1LB2A 1YWKA 2BEOA 3M70A 4F7ZA 4O9GA 2Q0AA 3RYRA 4I09A 2IXIA 1I6XA 2CV6A 1CAXA 1QY4A 4XFCA 4XFHA 2MHFA 5LRSA 1WGPA 1QWRA 1CAXB 1ZRDA 4MH0E 2XL7A 3O14A 4KU7A 4AVCA 5I8YA 2IC1A 4L2NA 3OF1A 3L2HA 1LKNA 1ZNPA 4MGYE 3SCGA 4J1XA 3S7EA 5AVPA 1O3TA 4RD7A 1UIKA 3DN7A 2OA2A 4IERA 2PHLA 5D1IA 1XRUA 4BYYA 3CLPA 4E2GA 3C3VA 3D0SA 3H50A 2VQAA 1V70A 3LAGA 3RNSA 4XFFA 3ROUA 2CAVA 3EQEA 1Q5OA 2H0VA 2K9ZA 4MZUA 4HVQA 3ELNA 3GYDA 2ZKLA 4WZCA 3FHIB 2VECA 4N9HA 2N7GA 4HVRA 4MX3A 4AQ6A 3BB6A 1J3PA 1YFXA 3MPBA 4R8HA 4BH9A 4KWLA 1EPZA 4FT8A 3UKTA 4AXOA 3QOPA 3RZZA 4N9IA 3SMHA 3MYXA 4YRDA 1DGRA 2UY8A 4XFGA 4HSJA 2Q1ZB 4JTNA 3CEWA 3H7JA 4YYOA 5I0UA 4LA3A 3HT1A 5C8WA 1ZRRA 5KHIA 1ZREA 4J1WA 4EWDA 2ZCWA 4QGLA 1PMIA 4R52A 2UYBA 4IEWA 4MGIE 3JZVA 3ES4A 1JUHA 1YFWA 2EA7A 1J58A 3RDIA 3NW4A 4OLLA 2GC0A 2EVXA 3KGZA 2MPFA 3NSTA 5I93A 4AVBA 4CYDA 3MZHA 1RL3A 1H1MA 3G7DA 3LA7A 1GQHA 4HN1A 1PM7A 1CAWA 3BALA 5J48A 2IXHA 4PJYA 1RGSA 3PLQA 1IPJA 3PVBB 5BV6A 3H1WA 4XEZA 4XF0A 4BHPA 4X6QB 4XF4A 4GULA 1I5ZA 1RC6A 2BNOA 1DGWA 2C0ZA 2E9QA 3WW4A 4BIFA 3LOIA 3SCFA 4EV0A 5E16A 1U12A 1NYWA 1J1LA 3ST7A 5K8SA 3IDCB 4JTOA 3ETQA 4HLTA 3FE5A 2XLAA 4Q29A 1OMIA 3M3IA 1EP0A 3DV8A 1OD5A 5FLIA 4ZU4A 4B29A 1YUDA 3ACLA 1NE6A 4LUKA 4JV4A 5FLJA 5BY5A 3S0MA 3FFQA 3U0ZA 1H1IA 1ZZCA 5FLHA 4DINB 1XE8A 1HW5A 2GU9A 4I02A 2PAKA 1J59A 2GAUA 2OZ6A 3NJZA 4WBBA 3E6BA 5KHHA 3WW1A 4D7SA 2WC2A 5HI0A 1NE4A 3BU7A 3SCHA 4KU8A 3H1MA 4FBFA 4IEQA 5JCTA 4Q0QA 1L3JA 4QM9A 1NZCA 2PYTA 3FWEA 3KMHA 3I54A 2B5HA 3H1YA 2ET7A 4I01A 1CX4A 3CJXA 3VHRA 1O5LA 3ES1A 4FAGA 3H8UA 1ZZ9A 1RUNA 1YHFA 2B8MA 2BNNA 5LEJA 3I7DA 5E1RA 3CO2A 2Q4SA 2XLFA 1RUOA 1CAUA 1ZVFA 2D5HA 3BCWA 1GQGA 1VJ2A 3WW2A 4XFIA 1CAUB 4QGNA 4MGKE 5FDBA 4H7LA 1SEFA 2MNGA 4IEZA 3BPZA 4UBHA 4KWJA 4IEXA 3IWZA 3KCCA 5I0RA 1NXMA 1UW8A 4LULA 3D0JA 2D5FA 3TNPB 5CADA 5BXXA 4YSFA 2BGCA 2P17A 1OFNA 2Q30A 4L11A 3ZDSA 2OPKA 3RPQA 1SFNA 1ZZBA 1ZX5A 2GZWA 4EWEA 5LRRA 4EROA 4PIYA 4E2SA 2BNMA 2ATFA 5LEKA 5EFUA 5I91A 3S7IA 1O4TA 2ET1A 2QDRA 2HJIA 4XFBA 5C6CA 3E5XA 1VP6A 4LTAA 2ETEA 3WW3A 2XKOA 4XF9A 2VPVA 5FQ0B 1O5UA 2H6CA 1DZRA 4F8AA 2XLGA 2I45A 1DZTA 5I0TA 3USSA 2OYZA 4WVZA 1O3RA 2FQPA 1SQ4A 2XL9A 4NVPA 2WFPA 2XKPA 2DCTA 2FMYA 1O3SA 4XF1A 3HQXA 3LZZA 1FXZA 4LEJA 3UKNA 3H9AA 2GC1A 4IEYA 5BPXA 4QMAA 3E5QA 4Z07A 4META 2PAMA 1VR3A 2PFWA 3R6SA 5JAXA 4TLFA 2Z69A 2Y0OA 4D7TA 1G6NA 3OD0A 3HIFA 3LA3A 5JSRA 3IIAA 4HVOA 1CAVA 4K8FA 1XE7A 2GC3A 3E6DA 1YLLA 1O7FA 4PIXA 3LA2A 4MV2A 2O8QA 5KHGA 1FI2A 2QNKA 1CAVB 3FX3A 1J3RA 1OI6A 3HT2A 3H3UA 1UIJA 2CAUA 2PHDA 2V09A 2IXLA 4ZU7A 3FJSA 5BUVA 2EAAA 3EO6A 3KGLA 3U10A 1YFUA 3PNAA 4QM8A 4AQ2A 5FPXA 1TQ5A 3E5UA 5I8TA 3UKVA 1Q3EA 2XHKA 5J7MA 4OFGA 5T3NA 4Q0SA 2XGXA 1Y9QA 2QVSB 2PQQA 4IEVA 2PTMA 1IPKA 2K0GA 5CVRA 4I2OA 1X8MA 4Q0VA 2O1QA 4IEUA 4ZU5A 3OCPA 4MGZE 3D82A 4HN0A 5JR7B 5JSOA 3OGJA 4I0AA 1X8EA 1YFYA 2PAEA 4ONUA 3KSCA 2IXCA 2IXKA 4XFAA 4PIZA 3TNQA 2Z2SB 4Q0PA 3EHKA 1Q43A 3SXWA
chains in the Genus database with same CATH superfamily
4OZXA 2FZ1A 1AJNA 5FYSA 4GZ9A 4ISQA 3WUCA 3CC2V 3NVCA 5EYPB 4YM3A 1N47A 3AFGA 2OWOA 2CHHA 4IE0A 3RI9A 1V0AA 2AW9A 4AFBA 3L9JT 3R4DB 5T5OA 4XJ8A 1PO13 1EV11 3K5LA 4CCNA 4PT6A 5F3IA 1PL0A 1QH6A 3PUQA 3E6CC 4DUYO 5DG2A 3OFNG 4DR7B 1FT9A 4AHCA 2QKDA 1BS3A 2WLQA 4M4RA 4J25A 1C8M3 3LWCA 3KV4A 1LNQA 3AYEA 3OUJA 2RS31 5FBZA 3VDAA 2J1SA 2OIGA 1ASJ3 1HN0A 1Q7YW 5AVAA 3CYOA 4BQ5A 1HV1A 2W1QA 1OPMA 2DYRB 1WCDJ 3JUUA 3LFMA 5CG8A 4Y3OA 2VCAA 1F4AA 4JGYA 1JOYA 4AI3A 4GB32 1SLTA 4O61A 3RBZA 2P2KA 2ZIOA 3RYRA 1YZBA 4RGKA 3JU9A 2CV6A 2E63A 2WLPA 4FK5C 1UNBA 1TGOA 3J26N 5K0UC 3OEEG 4KBBA 2XONA 1FNYA 2K2SA 1PIV2 3F7VC 4LK6A 4GWMA 1WKYA 1S5HC 3WNPA 4TQDA 2HHHO 4LNUA 4R50A 5TISZ 1YO8A 5H2FZ 4COWA 2TEPA 2DTWA 2W47A 3JAWA 4CH5A 3AG4C 2E5LB 5GLVA 4JDOA 2V5YA 4W6YA 5H9SA 1ULFA 2JJ6A 5HCHA 3VD5A 4LBKA 4DV7B 1GOGA 4YRDA 4CCMA 4TV8A 1JOBA 3H7JA 1WW4A 4YGBA 4UUJC 2JIGA 2JGDA 5FO8B 1RUD1 1R082 1XOYA 2CL2A 2X6CA 1HLCA 2RM21 4IW3A 4LE4A 4TXWA 5IVEA 3WEZA 1ULDA 1CQ9A 5J37A 3OPZA 2ZAAA 2EVXA 1YHQV 1AI6A 2MPFA 1VLNA 2V4AA 5KAFZ 2WN2A 5GZDA 2LUWA 4XPVA 2C5DA 1W3VA 2PY5A 1MS4A 2DWRA 2PMWB 2JD9A 4GWNA 4BWAA 2UXCB 2VG9A 3K77A 2NMNA 4GWIA 5F6KA 2FTKA 4WM8A 3VZLA 1ND3C 1JYNA 1RPRA 4N8MA 2P3IA 1UU5A 3ST7A 2LW7A 4DK0A 3M1HA 3S5QA 2XHNA 3M3IA 3DV8A 1N33B 5J1XA 4B29A 1UMHA 3ETEA 3CCRV 4LUKA 3SJAC 4OI1A 5CFDA 4YG0A 5BY5A 3WF4A 4J11A 4JHTA 1VBB3 2EALA 4JGSA 3WR0A 4LHLA 2J1EA 2OZ6A 4WBBA 2Q8CA 1BBT3 2WC2A 4PBOA 3SCHA 1VPHA 1XUQA 5IT6A 4R9CA 5JCTA 1H38A 4QHZA 2XAGA 4QM9A 4X64O 2XAHA 3WP3A 4H7MA 2WUHA 1PGW2 2ZX2A 3I2FA 4IE6A 3CJXA 4M0NA 1KFUL 5CKQA 1XU2A 2XAJA 1W6NB 3RI8A 3ZXAC 1CIYA 4C1XA 1SRYA 3HKBB 1WZXA 4GCZA 4GKKO 5BYNA 2NN4A 5B1BC 4K8XA 4IEZA 2A6WA 3AYDA 2D5FA 3WQ7A 2E7QA 1FATA 1IPSA 1SFNA 4NIIA 3ZFFB 5LRRA 3CDZB 1KS5A 2XBO1 1C8NA 5A3WA 1R091 3B8NA 3ZJZA 4Q4X3 1KYOF 2V4DA 4JYCA 2VVEA 2XKOA 4R8CA 1Q86W 1ZYBA 2YZ4A 5ABJB 3MHSC 1H8VA 2LQTA 2AHYA 4XBNA 1JZ6A 1ND2C 4AI0A 2Q67A 3VQXA 5CAZA 1UOGA 3FFZA 3UJQA 1D0GA 2VU9A 3OD0A 1DP0A 5F3CA 2Q73A 2B9ZA 2R72A 1AR72 1AYM2 2DDUA 4O4IA 1VMFA 5DUXA 1LODA 4QDQA 2XVLA 5F6LB 5FV3A 5DAQA 2V09A 5T5PA 2EAAA 3ILNA 1TQ5A 4OHWA 3WNLA 1XMQO 4E2LA 5FY4A 1MS8A 2PQQA 1IGOA 3WNOA 3OCPA 4CCEA 3OBTA 2YI8A 1PM4A 1YDXA 1X8EA 3GDBA 1BHAA 3VBBA 4JI0O 3WLUA 1DG6A 4LBJA 4PIZA 4ASKA 4BR6A 5JIUA 2VXJA 2HHHB 1X82A 3TEZA 1O8PA 1O3QA 5C3OA 4Y22B 3GJBA 4GUNA 1CPMA 1JBCA 2VMGA 1EYBA 3LQCA 4I30A 5JXHA 4QHOA 5JZGB 3RZJA 4CEWC 1IQAA 4PLMA 4Z82A 1X4TA 4GALA 5DAXA 3SEEA 3FZ3A 2VMHA 4KL1A 1HRI3 4K0KO 1FFXB 3NXSA 5L3CA 2VMEA 2ZAHA 3VBHA 2O57A 1WMXA 2BTQA 1K3EA 3AZYA 4FOQA 3AZXA 4AVAA 2ARAA 3T4HB 4LF5B 1NR1A 4IESA 2XG3A 2JENA 2JECA 2X29A 5H9QA 2UURA 4UBGA 2ZJCA 5F5QA 1HB1A 2HWD1 3AKSA 3ZDVA 1E5HA 4H37A 5KBFA 4CDXA 5GLTA 1K97A 5A1LA 3APBA 1OCZC 3QTCA 3WOGA 5CKMA 5GJ6A 5FAXA 4AOCA 3T1MA 2A6ZA 2WZ8A 2MHFA 4TUYB 2DWDC 1Y4WA 1XQ8A 1GWKA 2BUKA 1WJZA 1FV2A 4HONA 1RUJ3 5FZDA 4QPIA 2UXNA 3IFXA 1SFYA 1Y9MA 2IH1C 2XASA 3VHPA 3CLPA 3FAVA 3T1CA 5IK5A 2G38A 2J1RA 3QLQA 1W2UA 4Y22A 1Q5OA 2VE1A 4KH9A 4AK3A 1LCLA 3B01A 3TWIA 2CTQA 3IMNA 1M56B 1RSOB 1LEDA 2YXSA 4PI0A 4M3CF 3Q9OA 4Y5Z0 2D3PA 1AHSA 4XFGA 4LFCB 1W8HA 1OOPC 1POV0 1MOFA 1Y66A 1FFXA 2PF4E 3LFIA 1POV3 1Q6UA 4UCVA 4IV3B 4AVTA 5FYZA 2P6JA 2ZA9A 5L7OB 5LBBA 4LO8A 3VBRA 3L9DA 5GZCA 2JG9C 2WABA 4XJAA 2ZX4A 1NX9A 4PJYA 1WCKA 3T2MA 5FYMA 5DZEA 4BHPA 1LTEA 3P5BA 4HOOA 4ZY9A 2C0ZA 1EAH3 3LEGA 4LBQB 3SCFA 5E16A 3ZFFC 5BNPB 4JRLA 1W2OA 3ZN1A 3RVYA 1FJGO 1SQVH 3C7GA 4KHPO 4TUYA 2ZX1A 3TXQA 4JV4A 1JOPA 3WDVA 5GTIZ 3CMEV 1OFSA 5FMOL 5LL6Y 1JVMA 2JG8A 4RHV1 5FPUA 3AVSA 3AKPA 5FO9B 3TN92 4PF1A 4PQQA 3USUB 5A7QA 1J59A 1IBKB 3NV1A 4LORA 2G9ZA 5KXDA 2KKWA 3ON7A 3BPSA 1NE4A 1Y7BA 2ORZA 5JR2A 4Y4RA 4YVWB 4GKYA 4RQFA 2NN8A 3L72H 3J81N 4ZXEA 4CDWB 1AI4A 4DXWA 1RSOA 4FPFA 2BOBC 3BTZA 2H3OA 1O5LA 5FRAA 2WT0A 3SJCC 2Z5UA 2PN5A 3OGGA 3ES1A 3NAPB 1VBA1 2B8MA 2BNNA 2Q4SA 2WAOA 3PL0A 1QVGU 5C8YA 2VMIA 1E5SA 5L3DA 1H9PA 3Q8CA 2Q6AA 4UW3A 4JI4B 3BRCA 4IV3A 2MNGA 3OT7A 1V54B 4AHYA 2WNOA 2RNBA 3J80N 4I7ZB 3HOBA 5JCOC 4AFAA 3D8CA 3VL9A 4YSFA 1UY3A 2ZXQA 3VBFC 2BFUL 4CDQB 3O1UA 1YEWA 4DK1A 2W52A 3S7IA 1Y76B 2VO5A 3QNEA 2VPVA 1BEV2 4EN6B 2ZQMA 4LLFA 5K1PA 1EN6A 3JAKB 4AVSA 3WNNA 4K0KB 4HG6B 4QDSA 4XQDA 2XJSA 1DZQA 3E8FA 2W1WA 4LXLA 4MW8A 4TLFA 3F2ZA 3T1YO 1G6NA 2DF7A 1N0NA 4URTA 3P30A 2HLDG 5AFBA 4HANA 2XAQA 1HRV1 1OLMA 4MLOA 4FSJA 3A0KA 1MPXA 4W4LA 4HFSA 1R64A 4QPGC 5HFLA 3TGUH 1OHFA 4CDWA 4PDLA 4U7NA 3AMNA 2R6QA 4CUCA 1PX3A 3OGJA 4QX3A 3MF9A 3KSCA 3FKSG 3H1IH 1F9KA 4XFAA 1R1A2 1NTKH 1GV9A 2BV4A 4Y1YA 3EHKA 3C90A 4UV9A 2WR9A 5FR3A 3ZPYA 2YICA 1Y3TA 3NL1A 4P30A 3T09A 3VD4A 4HSLA 4TZDA 4NHMA 4XF3A 1LUVA 4Z92B 3OBAA 5C8CA 3TXSA 1VF6C 1OCOB 3J8F2 2G19A 4AVVA 4DR1O 1QDCA 1GM7A 4CDUC 1Y76A 1DTOA 1WLDA 2IWGB 2EULA 1NTMH 2JDHA 1LHVA 3EVKA 2F43G 4P9GA 2DE0X 2SBAA 1YVWA 3JAKA 5KA6A 3JYCA 1FMD1 2DYSB 1PVC1 3B4SA 1YF2A 5KHKA 5I0DA 3DYMA 1I5PA 1WB7A 1X33A 2ID4A 1ZX3A 3JD73 2W0XA 4GJZA 5LHHA 3JB4C 2Y60A 4YARA 1D4M1 4OI4A 3DPRB 4K35A 2BBAA 3I59B 2BVVA 4WFHA 2PI5A 1W0JG 2QQNA 2XOKG 4LMFA 3ZHQA 1P84F 3ABMB 3AK3A 4DXTA 1PPJH 3BVOA 1H2NA 2HWB1 3NJYA 3UGFA 2ZXWB 4TQFA 3OUIA 4LA2A 4CSWA 4QXCA 5FFOC 3OTFA 2N05A 4CH6A 2A3QA 1N3QA 4GH4C 1GM8A 4YVSB 2AZ2A 2OQ7A 2B46X 3RWNA 1RUH1 2ZE8A 3RJ2X 5FO7B 2JIZG 1EV13 3ABLB 1FJGB 2CTPA 3RS6A 2EZPA 1FOD2 4KHPB 3O14A 5LBFA 1H8TB 4AQYO 3ZN6A 4IERA 3WF2A 5BNPC 5BMVB 3DSQA 3H50A 4B3SO 1QXPA 2RS33 4XJUA 4H3WA 4JYBA 2CAVA 2CU5A 2VUCA 5KUKA 4Q4V2 3VGIA 4LF9O 5IJ0B 4HVQA 5F2VO 3AFKA 1B35C 3MIGA 1YSCA 5LP6A 2Q1MA 2Y64A 4GWJA 4X89A 2CYFA 1XILA 2C9AA 2A1XA 3BAAA 5HXMA 4K9SA 1IS4A 5ERLA 2YU1A 3BN6A 4KFMA 1G9CA 1UO9A 2W0FC 3AB0A 1QKQA 3ASIA 2Q5ZA 2WA3A 4I0XB 3CKHA 5FPAA 2W6JG 3ZOIA 2W1SA 4RGAA 1COV1 1G4YB 1Q90D 4WFBV 4MG2A 1RFYA 4Y24A 4XEZA 4XF0A 3N9PA 2FZ2A 1WW6A 5FMOS 2HWF2 1VQOV 4AGVA 4TWKA 2VCMA 1DGWA 1K42A 4ZHQA 4YVSA 1KU9A 4HLTA 4CDQC 4O2AB 2OTLV 5HCAA 4Z1VA 5D8AB 3BTAA 1Q8IA 1PK6B 1W9YA 1LU1A 3ZMNA 3T1YB 2AEYA 1RUD3 1BGYH 2QQWA 2RM23 2BOJA 5BMVA 2J22A 4K7JA 2YC4A 1PMJX 3E6BA 4NWVA 1NVPD 1R1A1 5HI0A 2Y4UA 1U0AA 4AAPA 1CZTA 2JDNA 3LDEA 1S76D 1JJOA 3FWEA 3NV2A 3LSQA 2RJ2A 3T4ZA 4HKOA 3I2GA 1YNAA 4FAGA 3DF0A 4OQ8A 1YQ6A 2D6KA 3BCWA 1K45A 4BK4A 4XFIA 4MGKE 4TTGA 4UFJA 1Z78A 3FYEB 1QQP2 3AL6A 4QX8A 4FP3A 4PA3A 5EBLC 2BNMA 4E2SA 4AFDA 4Q4W2 1KJLA 3ENRA 1N3PA 4URAA 3LNNA 2JKXA 2ADEA 4XF9A 2R1DA 1QU7A 2F95B 5CNAA 3D3QA 3QO8A 4O2AA 1K92A 2ZS6B 1VBE1 2WAMA 5D8AA 2P5BA 3R6SA 3WY6A 2QKAA 1PK6A 1WPBA 4X62O 1OJHA 2LFRA 2QZ3A 2DYSC 4N53C 2QSAA 3D36A 3DCQA 2L6LA 2CDYA 4IE7A 2CAZC 4KP4A 2FBEA 3G6JB 4GMP1 1CAVB 4Z2AA 1OCRB 2XT9A 4SLIA 3DPRC 3LDCA 2R072 2IXLA 3ZFEA 2XBO3 1BQPA 2P4EA 4LFBO 1H2MA 3CSXA 4QM8A 1R093 2XJTA 2XHKA 2OQ6A 3CMGA 3AKQA 1BL8A 1KD7A 4CS4A 1BZWA 4C0BA 3OUHA 3B94A 3CXHF 5LATA 2O1QA 4IEUA 4J7JA 4C1WA 4QHBA 1QOOA 4NXMO 3IC9A 2QM4A 4IGGA 2WLIB 2JEUA 2GDSA 2F4VO 3ABLC 5AG2A 1GNZA 4DV3O 1UD1A 4B3TB 4BQWA 2YGMA 4C90A 2WNEA 4JZ2A 2PLV2 2VCBA 3GHMA 1RUF2 1SDWA 1D4VB 4Y4YA 2WINB 1H8TC 5IYBO 1LOFA 2WWJA 1H8EG 4Y26A 3ASOC 5H9CA 2VNGA 5CBHA 2PELA 3IBMA 1NY72 4E2QA 1AXZA 1TVGA 5KX5A 4MGTA 3P32A 1M90W 4BE3A 1HQWA 1N36B 5FZMA 5C93A 2GH2A 1K9MW 3N7KA 1OHHG 4FLWA 1YIPA 1F51A 1L7QA 2IU0A 3SKVA 1LOEA 2XUEA 1VRH2 3TEWA 1K7DA 3W58A 3ZSMA 4N43C 3RVHA 1HXS2 5IWAO 3DL3A 1VQ9V 4FOYA 1QXJA 1W6OB 2TUNA 4LKDA 2JDZA 3M70A 4RYDA 4HK9A 4NROA 1QY4A 4UB6Z 1JYWA 2VC9A 1AR91 3ETGA 4OUSA 4FPGA 1JU4A 1ZRDA 2MEV2 4L2NA 2ITCC 1P8JA 5FZEA 2X5IB 4RQPC 1XREA 3BHPA 1LJ7A 2WLIA 2RDRA 1R73A 1ZSPA 5FP8A 5K1XA 4FM0A 4U3JB 1XYNA 1XNKA 2OIEA 1MZ6A 1SPPA 2EJ7A 4S2FA 4MVZA 5BXZA 4X8NA 4IIJA 3S3XA 4WZCA 3UJOA 4DUZO 3V56A 2W08A 4HVRA 2LRPA 4JF3A 1JZ7A 3NWKA 3KF5A 5LA9A 2HWD3 1XSRA 2VS0A 3X2QB 4NHKA 4NOTA 4LO4B 1BMV1 2YIBA 4JTNA 2AUYA 3N7JA 2D3RA 3OPTA 4JKLA 3I3MA 4XXAA 3AYCA 3PTRB 4UVCA 3DEMA 5IE9A 2F23A 1LOAA 4E9KA 1W8UA 1RP3B 1OCCB 3TETA 1BJQA 2A75A 4Y20B 2KQXA 1GQHA 3TRSB 4HN1A 4GYCB 3MF6A 1MEC2 4RSUA 4A42A 3VHOA 1N8RW 3CJIC 2XPJA 2HVKC 3LOIA 5FXWA 3K03A 2ZGTA 3DECA 3A7QA 2JE9A 4LFAB 4O65A 3UM7A 3IC7A 2VW2A 3MUZ1 2XQXA 4MW3A 4Q29A 5JH7B 4JKMA 4DR2O 1KQSU 1FXVA 1FXKC 3ZFGB 3PU8A 2X5IA 2BERA 4XDOA 1SDDB 1K5MB 4L92A 2R32A 4JDMA 3BIEA 5FTTC 1XOUA 4AI9A 4LWSA 1J5EO 4MXVA 4C0HA 1AR82 1URXA 4JTCB 5HBAA 3ILFA 1DF5A 5F8PA 5DPNA 1XI1A 1ULGA 3NQHA 3MFCA 4AI1A 4LFBB 4L8JA 4FPLA 3CXCU 1N1SA 4W6XA 4UFKA 2VTXJ 5EHDA 1DIWA 5LOVB 4F4LA 5CFDC 1OCRC 2EIBA 2F66C 2OT5A 5E1RA 2RS12 4M3CB 3ZYHA 1GM9A 4I50B 3DC5A 1EUUA 3KCCA 2F4VB 4LT5A 1MZEA 3D0JA 4XIOA 4H55A 3QF7A 4YIOA 2QJ1A 4RHV3 4CP2A 5EBWC 4JI6O 1ZZBA 3N9LA 1ZX5A 1YIJV 4XABA 4Y20A 1XMOO 2VW0A 2WZR2 2VZTA 4P5YA 1W8WA 2FDFA 1IBMO 1F31A 1N4CA 1QGLA 5C6CA 4LOTA 1GLHA 1VRH1 2ZE7A 2VAUA 3F95A 4YM0A 4Z2WA 3A2FA 2XLGA 1LAJA 2DVFA 4PD4F 4S2DA 2D6MA 3VDBA 4RA0A 2UUAO 3AYAA 2PHXA 1RM1C 4FPJA 1GN4A 1PO21 3OAAG 4O4JA 1WP8A 2GN3A 4MYEA 3UKMA 1VBA3 4QMAA 1GSLA 3VOUA 4AI8A 2ARHA 3ZFGA 1M4WA 3LA3A 4OHZA 1JHNA 1K5MA 5F3GA 2VUAA 2VQEO 3WNKA 3W7TA 3X29B 4P9XA 2R0HA 1W3XA 1V00A 5F37A 2JE7A 1AX0A 1Q6IA 3R4UA 4XAAA 2YGLA 1TNFA 1WA8A 2QWRB 5LOVA 1I1EA 2ETNA 1OKOA 3MW4A 3NNFA 1PO12 1YFYA 2VOWA 3LSSA 4M3CA 4LJHA 4NIGA 3R66A 1W2BU 4I50A 4CCJA 4X65O 1NU1H 2EIMB 3IJ4A 4JV5B 4YHHB 2HEYF 2X8KA 4V2WA 3B02A 3EB7A 1C8M2 4RL7A 4AFCA 4NHLA 3N2GA 1QNWA 4HZFA 4UXAA 2EIJB 1ASJ2 2BZDA 2D97A 4DQAA 1HRV3 2B4KA 4BQYA 2P4VA 4NRQA 4X6RB 5F5CA 2HWC2 1BVVA 1HJGA 3O7OA 4I9WA 2VNRA 1DLCA 2FDKA 1MEC1 1H2SB 2YBPA 3Q8FA 2GC2A 4KWUA 2OCCC 4WVVA 1F23A 2H0BA 2ZHLA 3O65A 1JFFB 2IVJA 3HBZA 2WZPP 1O91A 2G1MA 1ZZ8A 2PA7A 2JB8A 2VVFA 2X05A 5T55A 5KHJA 1EUTA 3W7WA 3B7MA 3T0BA 4LIUA 5FYBA 1YI2V 4E4HA 1G9AA 4I9QA 1M4UA 4LUMA 4QKFA 5JXIA 5DQ0A 3ZHTA 3FN9A 1ZRFA 3SH3A 2ZHNA 3VBHC 5CB7A 2Y48A 3WDTA 1MQTC 1AR81 2D2CB 5T5JA 4MXWB 4UXNA 3ZMOA 1F35A 5FZ0A 2R061 1CAXB 4DR2B 3D3IA 3HAGA 1FMD3 1PVC3 1ZNPA 4DV2O 3CZUA 3ABKC 4RD7A 4OYUA 3LDDA 2PHLA 2C1FA 3J9SA 2H8PC 3D0SA 4UW6A 3VDCA 5C3SA 5JJJB 1D4M3 2CTVA 5CB4B 1OQDA 3HNBM 4CDXC 1Y6XA 1MVQA 3GYDA 2ZKLA 4JCKA 4LBEC 5IY5B 1C4RA 1GANA 2XJQA 4N9HA 3BB6A 2HWB3 1U5ZA 4JI5B 2DYCA 5C3RA 2LS6A 3ZX7A 4ZHNA 3RZZA 4N9IA 5FZAA 1IOAA 2JB4A 2WZR1 3VZKA 1UYZA 1JYVA 1RUH3 2Y34A 1ZRRA 3N9QA 3G6BA 1JFFA 3AMPA 4QQHA 3Q4HB 2RJKA 3P6BA 2B5UA 4DEVA 5FWEA 2AZ5A 3A0HZ 4AW7A 2GMPA 3KGZA 3PN1A 5G05L 1OUSA 3HN1A 1H1MA 1MG1A 1WPXA 1UF2C 1XMOB 1VBB2 1AP6A 5CFCC 3FBYA 2V73A 4YGCA 4GULA 4LF8O 1I5ZA 3VD7A 1RC6A 2YV8A 2E9QA 2V7QG 4EV0A 5IFTA 4YZ1A 4IYHA 2JWPA 2XVGA 1AB3A 5E6HA 4Q8KA 4D6TH 1N34O 3UYJA 4IHJA 5C4WC 4MXWA 1K3IA 1OD5A 4FXKB 4U3FH 1AZDA 4R6ZA 4W8JA 2FMLA 2FL4A 3POGA 3FFQA 1VAKA 3ZR5A 2RQ6A 1XE8A 3CPWU 3VBOC 2QWNB 3O0WA 3WW1A 1GR3A 1AJOA 1A6CA 1KP2A 5CB4A 1COV3 1KECA 3KQ4B 2O14A 4LF6B 1OA4A 4DFSA 2J1TA 2YIAA 2ET7A 4I01A 1CJPA 2VMDA 1QJX2 4ATFA 1NH2D 1WD4A 4N90A 4G27B 1W9FA 3N9OA 1HIXA 4K40A 1MR5A 1B04A 2JG8C 1CESA 3WNXA 3IAQA 4A7ZA 2XLFA 2TBVA 2M7WA 3OGCC 2HWC1 4XYXA 4XBLA 2LTNA 1K5SA 1MS0A 3CIHA 1SEFA 4DXRA 3ZRWA 5EP9A 1Y67A 1O4YA 1S2KA 1X9TA 1M5IA 3VBSC 2BVBA 4OX9B 2A79B 5EIBC 2RS51 3O1MA 4ABMA 3E1F1 1SQXH 5FY0A 4JC1A 2EIMC 5SV5A 3WW3A 3PIGA 4C91A 5FQ0B 1L7RA 5FZ6A 4NKGB 3LKJA 3KV9A 1VMGA 5C70A 1UAIA 1YQ5A 4DNYA 3FC0A 3BKZA 3UKNA 2BGPA 3UO2A 1UMZA 1W6PB 3N35A 3LOBA 5JI7A 2YI9A 5JAXA 1LGBA 3MV11 5H9RA 3C7EA 4DV1B 1E57A 4XDKA 1KKCA 2O8QA 5KC6A 1YQCA 1Q56A 3IN9A 3MHZA 4ASUG 1H2KA 4KGQA 4ZU7A 4Y1ZA 1DF0A 3SGIA 3MAQA 2P6CA 2JDKA 4ICGA 1R3KC 1FV3A 1UKRA 1NTZH 5DAVA 1X8MA 1AJPA 1IURA 3F5WC 4CCKA 4ZU5A 2YHJA 2EX3A 2ZOEB 5A1AA 2PAEA 3PMEA 1UOBA 4EEQA 2EXIA 4DV2B 1HRI2 1VBE3 1W03A 5CMUA 5A32B 1TMF2 1NT0A 4BIZA 1Q8QA 4QX0A 2ZEZA 2QM7A 4LNVA 1RUC1 5EZYA 3G67A 3V65A 4GMP0 5FYIA 4R4ZA 1J3QA 5FZ1A 2QEXV 3IAYA 4GMP3 3JCIA 4BXSV 4JI8B 2ARCA 4MVUA 2VUJA 3CB2A 1SETA 3K04A 2W1UA 2H94A 4ASMB 5FQ0A 3NKTA 1GFF2 2BYVE 4Q26A 4I0BA 2ZGNA 3H3LA 4NUBA 3OY8B 4LP8A 1RTVA 5FPVA 4HBNA 3H3ZA 4Y5TA 2DOSA 4LOSA 4P2ZA 5GALA 3BI3A 2YS8A 3VZJA 3AP6A 1NQDA 1BCCH 2Q9LA 4J42A 3FMGA 1W6PA 1COWG 3H7YA 3BABA 3LEKA 2LGWA 4D6SA 3K3OA 2WO7A 4EQVA 4RUFA 4IL6Z 5T5LA 2D6LX 4YZ4A 1CAWB 1RUJ2 3KG2A 4W65A 3ME2A 5F7UA 3WNMA 3ITQA 1GNHA 1MVEA 4O4HB 1S0CA 2BPA2 3CX5F 4HNAB 2D6OX 4GIQA 4YJ3B 5B1AB 4I09A 5A3MA 4YFZA 4CU7A 4TV9B 1DHKB 1WN7A 1BHGA 1YTFB 1VP7A 1WGPA 1NCQB 4E8DA 4B4PA 5LXTB 1ENQA 4DO0A 2IW5A 1QJX1 3OMIB 4BMBA 2EINC 4RAIA 1Q8OA 3CEIA 4ET7A 2PHTA 3B69A 3SC7X 3C3SA 4LITA 2Z4FA 1HNXO 5EIYB 3ATGA 4YGEA 1EN4A 2DBIA 4IGOA 4S2HA 4XIKA 1IS6A 1YJNV 3K9AA 3ZXFA 4HZ3A 1HWYA 5LMUB 1GN6A 5BY1A 4FTBA 2DURA 4PF5A 2HVJC 1ZTEA 3BOPA 5IVBA 4DV5B 4G3YC 3C7FA 3OY8A 4EWDA 2MW2B 2XR4A 1EAH2 1AR93 5LA2A 1W05A 1AI5A 3G71V 1QJU1 3R4SA 4RR3B 2OX0A 5LP6C 3KB5A 4LBMA 3T2TA 5IJ9B 1URFA 4L9BA 1BLZA 1CAWA 2IXHA 5FYYA 1C5IA 1VF7A 3VL8A 1IPJA 4COUA 5LCWL 4PDMA 1FKAO 1DCSA 2AEZA 1JR9A 1VQNV 2ZDIC 2C2AA 4YW2A 1UYYA 4O4HA 4DR5O 4HNAA 4GKJO 5L3FA 3N2KB 1LENA 3ETQA 4YJ3A 1HB3A 2E7TA 2XMLA 3OGSA 1QQCA 3Q8AA 4D69A 4JHZA 1UZVA 2W9XA 3VKNA 1DQ0A 1NE6A 4FFKA 4JI1O 1ZLZA 4K21A 4LHSA 4JYAB 5FLHA 5KMGB 1HDKA 2ENRA 1CONA 3GXUA 4NMIA 2DUPA 4D7SA 1GYKA 4LH6A 3JBG1 3W5MA 5EJ1B 2BWAA 2QWPB 1TMF1 3AG7A 5JOXA 1IX9A 2P5OA 5JVDB 2VM9A 5FZIA 5FUPA 2F4LA 2RJLA 1DQ4A 4DW1A 1RUNA 2WZEA 1M57C 5IT9N 2GNDA 1LGCA 1VB2A 1PX4A 3VD9A 4P9PA 1RJ7A 4JTAB 3ECQA 1CAUB 1H2LA 1US6A 4CXWA 5A3TA 4IEXA 1NXMA 3K08A 2ZX0A 4I4TB 4QQOA 5ACA1 4RR3A 1A78A 1Z7S1 1CPYA 5IJ9A 3T0AA 1A32A 4Q5OA 2GNMA 3E5XA 4LTAA 1J83A 3VBUB 3WF0A 5DMYA 3U37A 3DGEA 4PELA 3T4VA 1S0BA 1PGL2 3O0XA 4UCOA 3N2KA 2D7FA 5IVJA 4XF1A 3CCUV 3LZZA 2AGSA 3PTYA 1SQBH 1SESA 3RZLA 3WB2A 4IEYA 1YRZA 4UW5A 2WO1A 2PFWA 4C7UA 3WG1A 4YW4A 1FPOA 4CXYA 3HKDB 3L71H 3EFFK 1XE7A 2WNUB 1D0HA 4ZI7B 4J7ZA 3T3YA 4U2AA 2W2IA 3CRMA 1UOFA 2ORXA 1OI6A 3H3UA 1UL9A 1GNYA 1GP4A 1SACA 2EXKA 5A7WB 3E5UA 1Q82W 4DR4O 2A6XA 2W6IG 1RUG1 3GALA 1VRH3 1ACCA 3H1HH 1O9GA 3A0BZ 2Q4PA 3JATA 1XL4A 1W06A 4I0AA 1D5NA 3D36C 3CRAA 1JQ0A 3HMYA 4FPKA 1PO23 3HKEB 3UT5B 3TNQA 1GUIA 2JJ1G 4A7KA 1ZL8B 3WU2Z 4MTGA 1QIQA 1SBEA 2ES3A 3RZGA 1TZOA 4GD4A 5EK0A 1NCQC 3JD72 1HNXB 1N32B 3JB8A 4I4TA 4NN0A 4TYSA 5J09A 4DXSA 2A6YA 3V0BA 5FOJB 4BDVB 3FYIB 2WDBA 2GDFA 3H1JH 4DR7O 4AQTA 2DVBA 3ASNC 1XHXA 4KMQA 3ZSKA 3OW2U 2VL4A 4MVQA 4UFLA 4JAUA 1QF3A 3E2EA 2RDNA 5BNOC 3OMNB 3Q8EA 1XNDA 4OMCA 1SQPH 2BSKA 4CPBA 4X88A 1EV12 5IHRA 4BQ4A 1IVSA 1FNZA 5LK7B 1AR5A 5FP4A 2WLLB 1SBFA 1HNWO 1SLIA 1FAFA 3HKDA 5K0UB 5L9RA 2WNUA 2RDQA 3DC6A 4TWTA 2NM1A 4BQ1A 1FPN1 3GZEA 1OH4A 4PA6A 1DYPA 2JDMA 2RS32 2OUJA 2D43A 4CVUA 2VW1A 4AE2A 4DR5B 1F5JA 2PHWA 4O9GA 5A7WA 4FM2A 5LASA 4ZZ8A 4A3ZA 3B3QE 2RG4A 3AC0A 4CH3A 3AG4B 4FFBA 3ZHVA 2Y8KA 4XDLA 1W6QB 1MEC3 5FKCA 3OOXA 3AVRA 1LKNA 3WHTA 3R05A 3KKYA 3F5TA 2J1AA 3HKEA 3UT5A 4OULA 3ZBHA 1ZL8A 3KZIZ 4NJ4A 3C3VA 1H9WA 1J95A 2QKSA 4CU8A 3DXRA 2LFSA 4DW0A 2XNDG 1LGNA 4AQ6A 1KC8W 5KXBA 4FT8A 3SQOA 3AMHA 1IG0A 3ZHSA 3I2OA 3EHBB 1S1AA 4Q2FA 4YJ2A 1JZ2A 1MZ5A 4HSJA 1BKZA 2Q1ZB 1ENXA 3BA9A 3MUY1 3WDUA 2WLKA 1X36A 4BQXA 2DFCA 3HT1A 1SLAA 2BJSA 3KS7A 1AR83 2UXDB 2J1VA 5EYXA 4Z8BA 1ND3B 3OMAB 2UYBA 2R063 1AROP 2R9AA 3KV6A 5GZEA 3CE2A 2WLLA 1LULA 3MW2A 5I93A 1LR1A 2UXCO 3IGAC 5K0UA 1KRIA 3I2DA 1HB2A 4H14A 1PM7A 4CTEA 5IATA 1RUD2 3N3HA 2W94A 2RM22 1RITA 4FLTA 4LO6B 2BNOA 3WW4A 5FUIA 1RYYA 4E4EA 3GZUC 2ARXA 2RMU1 2WZR3 1F5FA 4YPJA 3ZYRA 1SBDA 3VBUC 4FO9A 1L8DA 3S5AA 1J1TA 4OZOA 1OXCA 4WV8A 3NJZA 4NAOA 5T50A 1OLME 3KHBA 1FYUA 4FBFA 3OEHG 1SHWB 4Y1VA 5B1BB 4CE8A 2ZE6A 2WLHA 3MICA 4XACA 3MEPA 4LF4O 4JI3B 3U4XA 2ILMA 4NHXA 4DZGA 5A2QN 3D3AA 2TNFA 4MVOA 4ZBMA 5LB6A 1GWLA 4IXLA 3O9OA 2BP6A 1GN2A 2W91A 3E83A 1ND3A 5FZ7A 3RYHB 3GM8A 3STLC 1DQ5A 4J10A 3WCRA 3H1LH 5HCFA 2O8OA 1DBNA 3I55V 1ND2B 4ZPIA 2V5DA 4JI2B 5FYVA 3PUAA 1JJ2U 4PDWB 5DAWA 2EZOA 3D6EA 4XFBA 2ETEA 2N04A 2E26A 2H6CA 2QBXA 5GLUA 4P9IA 3MPPG 4ATEA 3WF3A 2VTXA 3WXPA 4YIPA 4ZS2A 1HW7A 3A0NA 2XBO2 5GW7A 3ABZA 2LJ2A 1R092 4BWOA 2NQYA 1F15A 4PI2A 3JXSA 4Z07A 2UWAA 4META 5IWFA 5EQUA 1VR3A 2WS91 3POFA 2F6BA 2VULA 5DZFA 5A6ZA 2EILB 3WG7C 2HWC3 2FDGA 1HNWB 5JSRA 4HVOA 3RVZA 4QU1A 3ZRSA 3HQRA 1FI2A 4E8CA 4UYBA 4AL9A 4YZ5A 3FUQA 3MFAA 5JJNB 3A21A 2UU9B 4JASA 3AG2C 4AEMA 4YW1A 2ITDC 3KGLA 3U10A 1YFUA 2RS53 5A3OA 5FPXA 2BTVC 1S0GA 1W0PA 4IEVA 2PTMA 4NR1A 5CVRA 2VQTA 3S3WA 3AXDA 4O4LB 2WWWA 2KD7A 4CEWB 4WM7B 3JD1A 5LYJB 2B1IA 3OTOO 3T2OA 5BR8O 2Z2SB 2YXYA 1S72V 1Q43A 5EYPA 1ZZ6A 3A22A 2ZTNA 4ZZ5A 5LY2A 3AM2A 3RYKA 3AG3C 3STZC 4IETA 4DY3A 4UOJA 1WA6X 5FCCA 1ND2A 4JAVA 4GX5A 1QH7A 2AACA 3TK1A 1C28A 2XWJB 1BZKA 1A34A 1NA1C 3AJZA 1MABG 1WBFA 3GBFA 4UCUA 1AVBA 3EJKA 1SZXA 3RT3C 3U14A 1D2SA 2EIGA 3UETA 3J7HA 2YY1A 1S3JA 3LUTB 4A4AA 4DRRA 3RJRA 1SZTA 1DK1A 3HVDA 4XUQA 4LF5O 3PVNA 3OGIB 2KR2A 1OCZB 3PU3A 4XUPA 5L3BA 4CS2A 4R9DA 1UQXA 2RVAA 4XUNA 4FVVA 5CYYA 1I5XA 1T6GC 3B93A 3MDPA 1LUWA 2ADDA 5B5EZ 2R041 3WV6A 1RUC3 1JA8A 2E74B 5IAXA 5LBQA 1GTOA 4OQ9A 1SZBA 1Z2GA 1LB2A 1C5HA 2YIDA 2A6VA 3IM0A 3E8HA 2CWMA 3ZN0A 4AYUA 4F3JA 4FZ0A 4PA9A 5LRSA 2W46A 2PYLA 2HWD2 2XL7A 3C8XA 1R6NA 4COVA 2FCUA 2ERFA 5LYJA 1GH6A 4LF7O 3W21A 2HFEC 1OOPB 3CCMV 4E2GA 1DLLA 4YXWG 2A0LA 3OUSA 4QJFB 3LGRA 3PVEA 1OF4A 1AX1A 4XCBA 4L99A 3EQEA 2ZM6O 2Q5TA 4CCDA 4YM1A 4IV1C 4MX3A 4LFCO 4AEDB 3HNYM 2QA4V 1ZA4A 1NAEA 2RN9A 1BQZA 4LCUC 4LF4B 2JG9B 1TA8A 1AILA 2DQ3A 3OM3B 4UFMA 2JDAA 1X59A 1E5IA 4N21A 3FHAA 1G8WA 1WMFA 1I0HA 1H4HA 3LNMB 1U5YA 3JZVA 3ES4A 4NHYA 4PDVA 4R4XA 4OLLA 1QJX3 1W2AX 1ZBE1 4JI7O 3MLKA 4CYDA 1WAZA 5C9AC 2IH3C 4I0WB 1UPGA 5FYHA 5BNNC 5A1FA 5H6QA 1JN2P 4A6OA 2EJRA 4XJ9A 3QCWA 4FLZA 1AL22 1PL4A 2B45X 4D7YA 2NMOA 4UCRA 3LPGA 4NE9A 4YW3A 2V1DA 1HKDA 4PDWC 1OZ0A 4CA9A 5FY1A 1AXKA 4LK7A 5B4NA 5LBCA 1XU1A 5C5UA 1AR61 4YZ2A 5CIRA 1JYXA 1IBKO 2K1EA 1HW5A 2DU0A 1Y4MA 1SF9A 3HKCB 1OOPA 1NT2B 1QJU3 2NR5A 5CG9A 2HWE1 3I8TA 2WYSA 2EF6A 4KU8A 4DMIA 3SKJE 4WFEA 1SERA 2RR11 2EILC 4Q0QA 2WQ8A 5KUMA 3BFRA 4RHV2 1N0JA 3M8LA 4MVTA 3ZLIA 2VOVA 3MHHC 2YDEA 3O1SA 4NRMA 3M7MX 4B3MB 1VBC1 1W6NA 1MS5A 3VBFB 2G9FA 4XMIA 2FCVA 4FMTA 2JG9A 3ZYGA 1V6IA 4NIHA 3HKBA 3I7DA 4JI4O 4CUAA 1DDLA 1ZVFA 3T08A 3OTOB 4LBLA 3ZKYA 2QDOA 5BR8B 3CWBH 2BOCC 4AI2A 1JHJA 1UFIA 2EICA 2A3XA 1KQRA 3ZFFA 2Y4TA 1VBA2 4W4KA 2BGCA 3ZDSA 3K0DA 4WM7C 5FY9A 2ATFA 4BISA 4FTEA 2ET1A 2DFBA 3JBG3 5A3PA 3AG1B 1QJFA 1TMF3 5H6RA 3ORJA 5ABJA 5CA1B 5EBMC 2QKCA 2JVDA 1JH5A 2FQPA 1U97A 5FLXN 4B3RO 4R9BA 1W99A 4CUBA 1AYN1 3I2HA 4QPGB 4Y1XA 4Z1MG 5JQGB 5CA6A 2ZGQA 1R3LC 1NQJA 3THPA 3ZN5A 3WQ1A 3H01A 1K33A 2ZGKA 4FPHA 3HKCA 3NV4A 1ENVA 4WVMB 3E6DA 3KWVA 2B1GA 1HR0B 5A7NA 1TUEB 3H8OA 4FQZA 2NLJC 5ACA3 1FFTB 3JD2A 4DV4O 3LSEA 1Z7S3 2JDUA 5I8TA 5JCOA 1UY4A 1JZ5A 5DECA 3VBFA 4H0LB 5EYYA 5B4XA 1HRV2 3BUCA 3IPVB 5JR7B 4F83A 1XXNA 2ZZQA 4AZZA 3RYIB 2C24A 3N9NA 4CDUB 4IE5A 1HQNA 2JDIG 5HXVA 4GX1A 5LA6B 4OUEA 2WT2A 5ANQA 3M2MA 4LF7B 5G04L 3B9IA 2I74A 1VQ7V 3CRRA 1XNCA 1VQ6V 1VBD1 2ZM6B 5JZGA 1JUIA 3VLBB 5LHGA 3NJVA 3RWRD 4AHXA 3ZXLA 4LQRA 5GZGA 5JPMB 4XDPA 4BPZA 1AXYA 4K8ZA 4GX0A 1F7YA 2DQ0A 2UY9A 1CGPA 4MHRA 1RUG3 4MTOA 5FZ9A 4GJYA 3SYOA 4AEDC 5I8SA 2XJVA 1AL21 2A5ZA 2ZEWA 1TG7A 4GH4B 4QPGA 2HJFC 1W90A 1LU2A 3M4FA 4JI7B 3I4IA 4GZRB 4IE4A 1FMD2 1PVC2 3KT1A 2JS3A 4AILC 1VALA 3O1RA 3L75H 1H4GA 2DV9A 2WO3A 3AL5A 2KXLA 5TSWA 2ZKNA 3OGRA 1D4M2 2ODMA 1KUQA 4RN5A 2Q7EA 2VBBA 2IJKA 1IS5A 1QLEC 4XFCA 3GCWA 1S5LZ 2HWB2 1B35B 3AK1A 1WW7A 2CGNA 5C71A 3M3QA 1VF6A 2VZ1A 3UCSC 4AVCA 4JTDB 3IPVA 1YJLA 3OF1A 2RV9A 3RYIA 4AG4A 4CCCA 5AVPA 4WCEV 2UWBA 4CEYB 5D1IA 1RUH2 3RYFB 1SLLA 1XRUA 1JZ4A 4JPRA 2BOIA 2VQAA 1CVNA 3P1IA 1QEXA 1RMU1 5B1NA 4XFFA 2A3YA 1B09A 2WWUA 4JYYA 2BCCH 4LIVA 4UF0B 1CJDA 1OF3A 2Y6HA 2PHUA 1FPN3 5A7SA 3POBA 5L9VA 4XHBA 3ZMTA 4HKLA 2NZ9A 3CEWA 5LMNO 4CBCA 2ZGSA 2V72A 1NLSA 1H6XA 4LA3A 4J1WA 2ZMNA 1UU6A 3ZEDA 2OCHA 5L7OA 2WFF1 5EPAA 5FZGA 1V55C 1S77D 4TLGA 4J9YB 1GU3A 2QQPA 4TOIA 4GH4A 1US3A 2D6PA 4HYOA 1DU3D 3UNPA 3K9SA 1GRJA 4RS5C 4WFGA 4PHZA 3ZMZA 4AVBA 3GHNA 4QE7A 1RL3A 2DCYA 5DDJ1 2OXBA 4WZFA 4K3UA 5AC91 2DVAA 4LKFA 2RJZA 3KT4A 2FYUH 3H1WA 4LBQA 5FIXA 2B7YA 1QJEA 1WCSA 5BNPA 3ZX6A 1PZ8A 1COV2 3H9VA 5JLVA 2Y6JA 1J1LA 5FZCA 4X1IB 1QOSA 4B3RB 4AHZA 1M1KW 1PNFA 4CU9A 1B35A 1QU0A 4ZU4A 3AG1C 3ACLA 1WD3A 1ZUQA 3JASB 3USUA 1JI6A 1UMIA 4DINB 1VB4A 4I02A 3RYFA 5FZ4A 2XJUA 2UUBB 4YVWA 1DYKA 2VZPA 1NCRC 3U75A 1MACA 3OEBA 1UX6A 2W87A 3DYPA 4DV4B 4XC9A 5LA0A 5F9TA 4PQ9A 4UF0A 5LGTA 2A7AA 4L0PA 3MIDA 4A41A 3NAPA 4O7XA 2VOTA 4WFFA 2AH2A 3H8UA 4Y1UA 4LE3A 4M3CE 2D5HA 2VQFO 3G6EV 3E22B 1Q81W 4LHNA 5B2GB 2RMU3 4H7LA 2VZOA 1Q6HA 1Q8SA 3TEYA 5CADA 4CDQA 4DR6B 2JD4A 1JTZX 1V9U1 4H44B 1JXNA 5I91A 3VDDC 4CC6A 1UJWB 3RRDA 2WRAA 1L0LH 3O5SA 1CZSA 4KQ7A 4N53B 3PJYA 4MHUA 1O5UA 4X1YB 1DGLA 2JS5A 3USSA 3K58A 3WB0A 1GBGA 2YFUA 2XL9A 4XJZA 1EZJA 3ABTA 2DCTA 4KG8A 2FMYA 3J4UH 2YB7A 2GC1A 4MGSA 5BPXA 4OCTA 3D5OA 1CD3G 5LGNA 3CJHB 3M3OA 3R0RA 2Y6KA 5K7PA 4D7TA 3JASA 1YQ8A 2EBOA 1W8OA 1UZZA 2GH8A 1K5JA 2WSSG 1GICA 1S55A 1P7BA 3NMBA 1VBE2 3AMMA 1H8HG 2FB5A 3FJSA 4QDRA 4DIQA 2VWKA 5KR7A 3CCJV 4X66O 4Y5SA 2LW1A 1TUBB 3W59A 4Q0VA 3PMSA 4MGZE 1YTFD 4I55B 4HN0A 5FZOB 3GBGA 5IW0A 3ASOB 3QD6A 4B3TO 1BT8A 5DG1A 4FM1A 5LK5A 3KVAA 2V4VA 4KUMA 3PUIA 2WS93 2YEVB 4XUOA 1AJQA 1X50A 1UYXA 1KD1W 3ILRA 4HPKB 2VH9A 2PHFA 3DXUA 2BWCA 1YJWV 3T30A 3UESA 4CEYC 2HEWF 4Q0UA 4XW3A 1SMVA 4JKKA 3OGVA 4N53A 3RZMA 5LMNB 1N36O 4X1YA 3EXAA 4N43B 3GWOA 1RUE1 2GBOA 3EBRA 1X7NA 3DPRA 3APQA 3I59A 4O9EA 3OJBA 4QPKA 1EBOA 1QXRA 3ZSLA 2IJJA 4OPAA 5GLWA 2GTSA 3BTYA 2XUMA 3SPJA 4DUVA 5IDJA 1I5YA 4B4QA 3ZRXA 2GUZB 3VQVA 4RQPB 2ZE5A 2OVUA 1EZVH 3WINE 2L35A 2B39A 3LIHA 4HL0A 3E97A 2UUCO 2BEOA 2ZGUA 2Q0AA 3T1HB 1HB4A 4X8PA 3AEIA 1TUBA 2R70A 4Q20A 3GGLA 1H8TA 2HEVF 4Q1PA 4X8AA 2KA3A 2JE8A 4I55A 2IC1A 4FXGB 1SG3A 5FZOA 2YXHA 3PHMA 1CPNA 1LHOA 3ZVXA 1JU3A 1QHDA 1TE1B 4M4PA 3PUHA 1V70A 5IJ0A 1AR92 2QQVA 2DW4A 2ZR3A 2E31A 2JIJA 4HPKA 3ML0A 3CCQV 2Y26A 2E51A 3FHIB 2VECA 3JAWB 2CTWA 2N7GA 1QDOA 1IKQA 2I07B 1T5EA 2R043 2BFUS 4QXBA 3UKTA 4AXOA 3QOPA 1OPOA 1EN5A 1NS1A 5APAA 5LA1A 4NB5A 4X20B 1UXXX 4TV8B 4N43A 4Q8LA 4I0XA 4IT5A 4QGLA 1VRBA 2VQFB 4X9QA 3CJIB 2JGDB 5CA0B 4YM2A 3RGBA 4BOWA 1BMV2 3RSJA 2WL1A 1VQLV 4H2AA 3MZHA 1GQPA 3LA7A 2GUZA 4DUXA 4NWWA 3SYPA 1FXKB 1RGSA 4RQPA 2QR4A 2XAFA 2RE9A 3LCPA 4LFAO 1KEXA 3K46A 2Y0IA 3A23A 1QR8A 3Q8BA 3ZN4A 3ICXA 3N9MA 1NYWA 5DZGA 5K8SA 2J1UA 3IDCB 1SS3A 3JARB 4Q6GA 4WM8B 2ZNJA 5FNVB 3M3EA 3ZS8C 4RUEA 3THTA 1VIBA 1EP0A 2EIKB 3ZIWA 4JGZC 2AYHA 4CPBD 4RGGA 5J2TB 2X6BA 4F6RB 4CCOA 3ZYFA 1RUI1 5CFDB 4HT1T 1ZRIA 1D2QA 1KJRA 1UXZA 4UFHA 1G8MA 1ZBE3 4P08A 2BU9A 1R3IC 1I9RA 3KMHA 1OKQA 4B7EA 2XB6C 4X66B 5J9PC 2WNVC 1D7PM 1W04A 4DEQA 3RFRA 3H42B 4UT5A 4IQPA 3ZYJB 3ZYPA 2VVDA 1JOJA 4X20A 4L87A 5J2UB 1TME1 4TN7A 4TSVA 3I5DA 4QX1A 2BQPA 1GQGA 1NI8A 3BODA 2DMXA 3CJIA 2DCKA 3WQBA 2XXZA 3BPZA 4FLVA 5FZ3A 1CEZA 5CA0A 3OSDA 4YY3O 1AR63 1Y43B 3VQWA 4JAAA 1RM1B 2EAKA 3SPGA 4UWDA 2Q30A 2OPKA 3RPQA 4CP9B 1F4MA 4XDJA 4QPYA 5LEKA 4XMAA 2VJXA 2LROA 1BSMA 1FXKA 2HWE3 1PVXA 2VR4A 2WIIB 2B9VA 1G6UA 5GLZA 4DV0B 2RR13 4Q4Y2 1S0IA 4F8AA 4NAMA 3TJTA 4WVZA 3ACFA 1O3RA 2XKPA 3JARA 5FPRA 1IXMA 1VBC3 4AHWA 5FNVA 4XOGA 4KBZA 1KDMA 1XQNA 3JSLA 1MA1A 5J2TA 1ZBA1 4F6RA 2VUDA 2YBSA 3QH6A 1K34A 2ZR2A 4NTXA 1CAVA 5FPOA 3M8AA 1PO22 4O4IB 2N74A 1YCIA 3J7NA 3N7MA 3POIA 4B4RA 2UUCB 4CS3A 4AQ2A 1STMA 2IFRA 2R9RB 1RVF3 5J7MA 1QBZA 2QVSB 4MGQA 4BLJA 2K0GA 1YXWA 5B3SC 1H0BA 4BZ4A 1NR7A 1QOTA 2P4KA 2DCJA 5J2UA 4XAEA 4GXLA 4MVMA 3LDBA 3BTXA 4JGYC 3SISA 1XNQB 4JV5O 3FLTA 4YHHO 4Q0PA 3OEAA 1V6MA 3PIJA 1JZ8A 4MSVA 1AYN3 2XWBB 2OZJA 5CZKA 2OCCB 1IBLB 1XNRB 2X6AA 1ST8A 1OA2A 4CP9A 5H9PA 2B42B 1ZZ7A 1S0EA 4MOAA 5F1RA 4MUVA 3FHQA 4JRAA 1GP6A 2EIDA 2B9UA 1V9PA 3PDQA 4BAYA 5IYZB 3W9AA 4QAWA 3EYPA 4QGMA 1HX6A 3MGUA 3CF6E 4OVEA 2Q8DA 3GWKC 2ZINA 5FP9A 5SV8A 4OHXA 1NKGA 5JDBA 4CXXA 5FXXA 3DKWA 4DUYB 2QCSB 5DM6V 2FDIA 4XE9A 3VBHB 2BTQB 2VGDA 4GB31 1MQTB 3E89A 4P9YA 4WBNB 2XDVA 3J7AU 1W6OA 2CK3G 2Q7HA 3UV9A 3ABKB 1VBD3 3I2KA 5EZWA 2E32A 2VCCA 1PIV1 4P9OA 5BZBA 1YWKA 4PA7A 3B8MA 2G4IA 1A8MA 5A3NA 4CDXB 1I6XA 5JXJA 4XFHA 2DYRC 2ZHMA 4INDA 1QWRA 1NH2B 5JOZA 4MH0E 4Y33A 1XNTA 2ZGOA 1C1FA 5I8YA 1W8NA 2VZUA 4Q27A 1FAYA 4U3JA 2ZHKA 1AL23 2A7WA 4OI2A 4WM8C 2WQZC 2DCZA 3CS5A 5FZLA 4XBQA 3LEIA 4QPIB 4QNHB 2AR6A 2GSMB 5C3QA 2EIKC 2X53S 3ROUA 3FAVB 1CZVA 2R062 4JI5O 1V6OA 3J7MA 1DLBA 3OYWB 1LEMA 3ZXKA 1CXZB 2HG5C 1REFA 3MPBA 1J3PA 5FZ8A 4R8HA 4V1PA 1HN1A 1XNBA 1R081 3O1TA 1AP5A 5IYZA 5CBFA 3R65A 2JEMA 5CFCB 1ZREA 5LBEA 4Q4Y1 1K12A 3JD3A 5LGUA 5FYUA 1QR9A 3SYQA 3RQ0A 3NW4A 4YY3B 2GN7A 2WSUA 4CC5A 2D6NA 4W4ZA 2ZD9A 1MQTA 2CDOA 3NSTA 5C4WB 2YC2A 3B9CA 4WBNA 3VBRB 4XUTA 4ASLA 1RMU3 3PLQA 2QQJA 4LBNA 2C4XA 3PVBB 2ZBJA 2W39A 4KI5M 1EPWA 2XTAA 3AX4A 4UV8A 2DBNA 3K79A 3WDYA 1W9SA 3VBOB 3NNGA 1U12A 5JH7A 1GZCA 1OH3A 4QQ2A 2VZRA 3L73H 1IXBA 1VQ8V 3MIFA 4QKNA 2Q8VA 1BE3H 1YUDA 2OPWA 1XBFA 4QQLA 3S0MA 2OUHA 5FJHA 3AP7A 2WFF3 2QQUA 4PLNA 1CWPA 3CQOA 4AEJA 4IUGA 2JG8B 1PGW1 1AI7A 1W2TA 2GAUA 5KHHA 4LF6O 3HNMA 3HQUA 1W6MB 1W9WA 4G2KA 3OYWA 5DDJ3 2ZIMA 4XJWA 1WWYA 3U78A 4U7OA 5AC93 2SLIA 4X64B 3VBSB 5DN2A 4NRPA 1ZZ9A 5A70A 4NTWA 1QJZA 4JQTA 5CFCA 3UL2A 1ZM1A 2LO1A 3SYCA 1MS9A 5C8YB 4UBHA 3LSUA 3IWZA 5I0RA 3J7LA 1UW8A 4QE9A 4OX9O 1M9NA 4GKKB 2JDPA 3AJYA 4J41A 1OFNA 3WFVA 5C4WA 3B77A 3VZMA 2QQKA 2QQLA 1VQ5V 1O4TA 4K8RB 2C6SA 5A7PA 4MT8A 1KBHA 4NIDA 2HBUA 4UI9L 2ZMLA 1DZRA 2I45A 5JMOA 1Y74B 3VBOA 1AR71 1AYM1 3BY6A 5C7GA 2QE3A 2RS52 1YXBA 1ENRA 5FOBB 1UPSA 4XDQA 4QU2A 3E5QA 4DV1O 2PAMA 5KLVH 3W7UA 5EJ3A 4QPJA 2Z69A 2Q8EA 2J42A 4FZ1A 4K8FA 2GC3A 4BA6A 1LHWA 5ABJC 4ZIBA 1XB9A 2XJPA 1W6MA 1S0JA 3GBWA 1UIJA 2IJIA 2PHDA 1V9U3 3NR7A 1QJY2 5L3GA 4UFIA 4FCAA 5FBJA 2YUAA 1APNA 3EXUA 1T6BX 4P9LA 4I2OA 1HP8A 3VBSA 1GZ9A 1XMQB 2DTYA 3D82A 3CC4V 4FLXA 1BVP1 4ONUA 3ZMSA 2PI4A 5LW9A 3LF7A 2VXRA 3I3EA 1N1YA 3SXWA 4JI0B 5JIAA 1OC1A 4LR3A 5FZFA 4OXSA 2XJRA 4QB6A 2WKKA 4JZGA 3LD8A 1OQ1A 3H0OA 4JI8O 4JVAA 3RYPA 3CD6V 2KSDA 2PXJA 1WLTA 5C8CB 4I3GA 2DUQA 1MSDA 3ETPA 4QT6A 4QPIC 2DN9A 3MLLA 3VN4A 3RMYA 1RUC2 3F7YC 4QX7A 1Y74A 4YW6A 2PZSA 2VNVA 1DQ6A 1F4NA 1K4DC 3ZMVA 4FQ4A 1LOCA 1B3QA 1XSQA 1P49A 5IYCO 3CCSV 3CC7V 5JZGC 4JZRA 5CU1A 1JZ3A 1J84A 4UAPA 4EYUA 3DUIA 5IK8A 2CY6A 3CMAV 2HKXA 1KKDA 5JI9A 5IYDO 2YC0A 2GNTA 2EINB 3OE7G 3THCA 3WG4A 2YMZA 2VQUA 1S0VA 4PA4A 1FYJA 3LDKA 5F3EA 2ZMKA 1AUYA 3VBRC 1CAXA 3WP4A 3B2EE 1WLWA 4QX2A 5L19A 3WCSA 3MIBA 4COYA 1SFPA 1RUE3 1L7LA 4EN9B 5FMCA 4B08A 5A6QA 5FY5A 3H8XA 3DN7A 2OA2A 5FY7A 3G80A 3ZN6B 1YYNA 2AENA 2ADQB 2QTSA 1KB9F 3O1OA 3ELNA 1B06A 3V0AB 3FL7A 5DEDA 1T2XA 3K57A 5LMUO 4KWLA 1OQEA 4DV5O 1MS3A 3CRCA 5LP6B 1S4CA 3OBZA 3Q4HA 1OT5A 4ZS3A 2ZCEA 1JUHA 2QQMA 5F5IA 3APOA 5D5PA 2M6YA 1M56C 3GCXA 2OTJV 5CBLA 3HN3A 2AZ0A 2FMDA 5H5NA 4QIWF 4AGRA 3ETDA 5EXOA 2JXAA 1A8DA 3BCCH 2RMKB 5B66Z 3KV5A 2AGAA 5CEHA 2DJVA 2QTOA 1CX1A 1PV0A 1R6KA 5FP3A 3SH4A 4HKWA 1ULEA 2WA4A 1QJU2 5LWBA 4IV3C 4QD2A 3NO8A 5L7OC 5FZBA 3TN91 5T54A 4DS0A 2JDYA 3D4KA 2XLAA 1RB8G 2ZGLA 4ZHQB 3C2UA 5IJRA 1QJY1 2HLEA 4BW9A 1XL6A 4ARXA 4JYAO 2LW8A 1BCXA 3SYAA 1GZTA 3BEHA 4X1KB 1E79G 3KHCA 4D94A 2LP7A 1M57B 4NXNO 1ULOA 4KG0A 1RHI2 1YI9A 4EFEA 1K4CC 2OIIA 5FKBA 1E1RG 2HYKA 2OW4A 1L3JA 3V0AA 2Q0OC 2Y0PA 4HK8A 4OPHA 5LZ6A 5FP7A 3AP4A 1JYIA 2IM9A 1K73W 2HJDA 4OGQB 4N23A 4EFBA 3JBG2 1LESA 1GMMA 2HEPA 1YHFA 2PYJA 3LB9A 2P6HA 1GWMA 4E4DX 4ARYA 2E76B 1SCRA 2GMEA 4YVWC 1IHMA 2ZDIA 1HNZO 4KWJA 4CDWC 4DY5A 3ZXGA 3VD3A 4PJ0Z 1BEV1 4AGGA 3A8TA 4B1LA 5BXXA 4FI9A 4JDNA 2I2SA 1RUI3 2W95A 3I2IA 2GZWA 3E35A 1O59A 3NAPC 4A6SA 3OB8A 2X0LA 4FOWA 3L74H 3RZHA 2Q68A 3B00A 1JMUB 2ZGPA 1OVSA 1W8TA 2FHRA 4LHKA 1V54C 3PJQA 2P06A 3O12A 5ACA2 1DQ1A 1SQ4A 5DAPA 1Z7S2 3KF3A 1O6UA 5C8CC 3HQXA 1OURA 1GKFA 2IFWA 3JAMN 3K5NA 1TME3 4RFT0 1PMHX 4XXPA 5EV7A 1TEIA 2L9LA 4X1KA 4EZ4A 1FXHA 4H13B 2R49A 4B8EA 4PIXA 3TAYA 3LA2A 1AX2A 5FYTA 1J3RA 1MNGA 1CP9A 1KFXL 3WF1A 1PD3A 4LBQD 2YYOA 3C3TA 2BE3A 1KMIZ 3ZFEB 4EN7B 2XGXA 2UXBO 1UOJA 2YFZA 4BQ3A 2JK5C 2W92A 4KGGA 1UX7A 5A32A 4E4SA 2JJ2G 2GALA 3J8F1 3I3QA 4FPPA 3SPHA 2VOKA 3GZAA 1BYHA 2ZPXA 3ASNB 1N32O 1RUG2 3VZNA 1NOVA 3PUSA 1SQQH 3QO7A 1ZBA3 2P90A 4YG6A 5BNOB 1OVPA 4KWKA 2BTOA 4R9AA 4BQ2A 2X09A 4K20A 3ZIXA 3LE0A 1RIRA 3FB7C 3ZSJA 2UYAA 2JKBA 4DR1B 4EWAA 1WMDA 3FD9A 2J7MA 4DRXB 4I3PA 5CN0A 4GQ7A 2QUOA 1O4ZA 2F4PA 1FS0G 5KXCA 5KX5B 1Q8PA 4LLOA 2GTAA 3SH5A 1OCOC 1REDA 1UCXA 5FUNA 3JQXA 2CNAA 3PJSK 5HFMA 5CA3A 5B1OA 2CUGA 1HQLA 1FOD1 2QE7G 1EM1A 3ZXDA 3WG2A 1PGSA 1GN3A 2GNBA 4OHVA 3E8BA 4TV9A 4K1YA 1LRHA 4MVRA 3W7SA 1RHI1 3P3PA 3M3CA 5F32A 3POEA 1NCQA 5LXTA 1K5QA 4CRQA 1G9DA 4OMDA 3ABMC 2Y6LA 1FPN2 4Q4V1 2NP0A 4KU7A 4A45A 1PNLA 1PNMA 4A7YA 3E86A 2ZXWC 3K5MA 4A44A 2IU3A 4BYYA 4AQYB 4YVSC 1YIFA 2XQRA 3RNSA 4NXNB 4GB33 3PVOA 5DXDA 4R7CA 5ITZB 1JYTA 3WUDA 1SPPB 4B3SB 5BNOA 3POYA 4XZUG 4BXFA 4IIJB 1R1ZA 4O2BB 4LF9B 1OLRA 4BH9A 4D3WA 2A3WA 2XOMA 3ZIAG 3MYXA 3ZKUA 3MO4A 1PIV3 3URFA 3UT0A 2KB1A 4MTXA 4ZOLB 2UXDO 2RDCA 4J9ZB 2WBKA 4DRXA 4CH4A 1UZYA 3U1XA 3TEXA 4QWNA 1NZ6A 5E89A 4MGIE 1HNZB 1J58A 1JW6A 1NJIW 2HWF1 4UVBA 2CWSA 4GX2A 2QZ2A 2GC0A 4AR2A 4CU6A 3M99B 1DGWX 1PNGA 5JWPA 1WMEA 3ZM8A 4CP1A 3BALA 4OI0A 2LM3A 1CIWA 4XF4A 2GMMA 4FFIA 5A6YA 3HWJA 3AP9A 1R083 4QKBA 2YROA 4XVHA 4EKWA 1ZWIC 2Y69B 1F4HA 2EXHA 1D5AA 4TT3G 4FVMA 3JCUZ 2ZKOA 2GSYA 4WVWA 3BU0A 3A4UA 5KMGA 1N1VA 2IJHA 4Q4Y3 4LKSA 4YLZA 2GU9A 2PAKA 2WLMA 3UK9A 4P14A 3OPWA 5FPBA 2RMU2 5ITZA 3H1MA 4LWSB 5JVDA 4JI3O 1NZCA 1BXHA 4G9SB 5D8AC 1VIWB 1PK6C 4O2BA 3LEMA 2UXBB 4JQRA 2P3YA 3KM5A 3MD0A 3RZKA 4ZOLA 1AF9A 4AWDA 1QQP1 2F1MA 1CAUA 3QBQA 3RN4A 5D2AA 2QQIA 4Q4W1 4QB1A 4ES8A 3ZFEC 2W68A 2P22C 5FDBA 4UW4A 1GO3F 4JI2O 2R0FA 1AR1B 1WLCA 2Q8OA 1YJKA 4EROA 4PIYA 3THOA 5EFUA 5FJKA 3VUOA 3P3NA 3VBUA 3NJXA 3WG7B 1BK1A 2QDRA 4D6RA 1NG0A 1UYPA 3WD5A 2NLRA 3HB3B 2AC1A 1DZTA 5I0TA 4B7KA 2Z5WA 2OYZA 3LSDA 1TVKB 2WFPA 1LHUA 3VB9A 3SITA 1O3SA 4XBFA 1XBLA 2WJSA 2P3JA 3AG2B 1LOFC 4QB2A 3K4ZA 1DGSA 4O4JB 2R071 1S0DA 1W0NA 1SC5B 3W20A 3KQRA 4ZI7A 3ABUA 2D3SA 1AJKA 4X62B 2UU9O 5C33A 2AREA 4MV2A 5HPOA 3C7HA 3K06A 2QNKA 3FX3A 1TNRA 4S2GA 3CBNA 1BMFG 2WS92 4LPLA 4Q1RA 5BUVA 5JOYA 3NNMA 1YJ9V 2VBPA 3AG3B 4IGPA 5T3NA 5K4LA 1Y9QA 4FJCC 1XNAA 1RJ8A 3VZOA 1NUKA 1REEA 2PLV1 4EN0A 1RUF1 1WA8B 5A6XA 3GNEA 2K46A 1JPXA 1AR73 1AYM3 1U5XA 1VMJA 4YW7A 5JMCA 3IT8A 3POWA 1G1XB 3I97A 1NA1B 3VV1A 4BJ0A 3U07A 4NXMB 1VQPV 3WHUA 4GKXA 3ACHA 3UGHA 1YI7A 1GKBA 1U5IA 1NY71 2QJVA 2RHPA 2YSUB 4A5UB 4DV3B 5IK4A 5C3PA 3K2OA 1MMMA 4FPEA 1VAVA 4IYIA 1C57A 3N2GB 1IDSA 2QM8A 2E3CA 4LC1A 3K51A 1UY2A 1Z0HA 1L0NH 1NBMG 5I0SA 1LR5A 4P9JA 2IXJA 1W0KG 2CE4A 1S0FA 1K8AW 3WDXA 1TVKA 1UPIA 4LO5B 1KP3A 3CL1A 5C5TA 4COZA 1HXS1 4NPRA 5HV0A 5DUWA 1VQ4V 3HPLC 4GAZA 4XTMA 3NKGA 2QGNA 4UCSA 4ORFA 3VKLA 1W9TA 3KCXA 4DXZA 2DU1A 3B5LB 3H1KH 4BCUA 5FK7A 1VF5B 2MEV1 2YUEA 2Y38A 5FPZA 1GK9A 3WP5A 2E33A 3K3WA 3MW3A 3VKOA 4HETA 5FMBA 5IWAB 2YXLA 5IAVA 2IXIA 1W6QA 2HP8A 3KT7A 2A06H 1DQ2A 3NNJA 2KG7B 1L1FA 2R042 2XHBA 4IV1B 2FD8A 1I08A 4GA9A 2E75B 4AQSA 5L9BA 2JRIA 5FXZA 3L2HA 2WPDG 4YW5A 2NNUA 3BOWA 1MS1A 5ANNA 1O3TA 4W6WA 1NA1A 2IVIB 2Y69C 4LR4A 4LKEA 3DXTA 4MZUA 1DF4A 1R6TA 3K5OA 1N3OA 4QXHA 3ZSEA 5FY8A 2X5IC 4XZPA 3U4SA 4IGQA 4DUZB 3SMHA 4ITCA 1DGRA 1AL0G 2R1BA 4BB3A 1OBNA 5C9AB 5I0UA 4XQ4A 5BNNB 5C8WA 3PURA 3K0GA 2OS2A 1E5RA 3WQ0A 2ZCWA 3SLIA 3LIGA 3K48A 3O1VA 3RDIA 2VZVA 5GONB 3ZCCA 5KWRA 2KM2A 4BM8A 3HPNA 3X2QC 2HR3A 2Z3YA 4XILA 2Z79A 1RXFA 3G7DA 5D5QA 5GTHZ 4WFAV 2FCTA 1LNSA 4WF9V 2YIBD 3H8RA 1ULPA 5BV6A 1UN1A 3K75B 4YFWA 1YC61 1ZBE2 3FBMA 1AR4A 2UU8A 1VQKV 1H6YA 1AVMA 5K9YA 1PZ9A 2CDPA 1OA3A 3I49A 2FDJA 4N7IA 5EWSA 1OCCC 1E1QG 2WQ4A 5T52A 2F17A 3M7AA 1FD9A 1KDKA 4DR3O 2KG7A 1CR7A 2VBDA 3IIIA 4IV1A 4IHJB 1SCSA 3WX5A 4ZKIA 1F2NA 5FWJA 2K9PA 2Z42A 1UY0A 3DGTA 1H30A 1UZ0A 3SEPA 3BU7A 2BBVA 2RS11 1AR62 2GHYA 4B3MO 3BIWE 1J5EB 2B5HA 3ZFGC 2VMFA 1R1BA 2XVKA 5FZKA 2DVGA 1K5MC 3KZ4C 2HWE2 1NKDA 5C9AA 3TN93 1YITV 2RR12 5BNNA 1P7GA 3RYHA 1VJ2A 1SKVA 3N7LA 4U36A 1KXGA 1QJY3 1SQFA 4MTFA 3POJA 3B40A 1VBC2 1ORQC 4LULA 2WWSA 5GONA 5EJZB 3O0VA 2JICA 3ZRWB 1SLCA 2P3KA 3E8GA 4L11A 4PDWA 1QCEA 4EWEA 1W8ZA 4NYKA 4DO2A 3CCLV 1JMKC 3NRUA 3OUFA 1C3HA 4JI6B 2AXTZ 1M06G 5E88A 2HJIA 4FFGA 2CGOA 2ZNIA 4KNCA 4MADA 2JEXA 2WAAA 1VP6A 4M0HA 2VZ3A 2Y6GA 2R30A 3ACIA 2A70A 1IBMB 3AKRA 2LGQA 2O0OA 3VHNA 3VQYA 2MK3A 1KS4A 4NVPA 2CTRA 1BBT2 3K3NA 3SJQC 3FLRA 3MLJA 3GZTB 1FXZA 3MBWA 3H9AA 1RVF2 4FPCA 2GP5A 4UFZA 1EFRG 2UUAB 4M00A 2XH6A 1W28A 3V64A 1XJAA 3AKTA 1HR0O 3KCYA 1R3JC 4C8DA 3OG2A 5DABA 4NO4A 5KHGA 1BEV3 1AYN2 1PO11 2VQEB 4PLOA 3HT2A 4FP2A 3FX7A 3W7XA 2NPIA 2DWEC 1H1AA 1U96A 4AAXA 2RCVA 3UKVA 3ZXJA 5L73A 5FMDA 3FB5C 4Q0SA 2Y33A 4IL7A 2WLJA 4O4LA 4CEWA 4WM7A 2PGGA 3RW0A 2JGUA 1C8M1 4DRVA 4CUGA 3ZXEA 2DVDA 1ASJ1 1W8FA 4UVAA 4H33A 1WUVA 4Q4X2 3RMXA 4L8QA 4CZZA 1JX9A 1VE0A 1MZFA 3NNLA 3AXEA 3DTUB 2E53A 4E27A 3WZ1A 1Q8VA 4YNIA 4X65B 2R16A 5JSPA 4PDRA 1HV0A 5EZYB 4UB8Z 3IDBB 4BW5A 4YGDA 3VKFC 1I94O 2WSVA 1X9PA 3KVBA 5LY1A 4RFRB 3T4DA 1R1A3 3N4MA 5HV4A 2VNOA 2R7EB 1VBD2 4QQPA 4NIAA 4IEPA 3DYOA 3JALB 1ZRCA 5J3UA 5FYCA 5E1AC 1VMHA 2VQ0A 3UGGA 2EIJC 1QNYA 1O8SA 1QLEB 3J8F3 5J96B 3TYJA 4HMZA 2QQOA 5KC5A 2ADPA 1P4RA 1CN1A 1EY2A 1S2BA 4IEOA 1G9FA 4QX5A 1ALYA 3U11A 2IZWA 5IFPA 1O9HA 2HKOA 1HJFA 4F7ZA 1D2DA 1W59A 3DKQA 5IVVA 4FTSA 4DR3B 2A71A 4BLIA 2VWJA 5IVFA 1IG3A 3B09A 5KA5A 1N1TA 3ZO0B 1VEWA 1QNMA 1W2NA 1S5JA 5F2SA 3ZPOA 3LAGA 2P34A 1UWWA 1YQ2A 3QO5A 1WP7A 2H0VA 2K9ZA 4AEDA 4PCRA 1V55B 4K3AA 4EB6B 2OKXA 1JODA 1HDJA 2ZACA 3A0RA 2P37A 1QLNA 1FOD3 4RS5B 3WT3A 1Z5WA 4RO2A 3L2YA 1PM9A 1OD3A 1RMU2 4FFHA 2BRTA 4YZ3A 1SA0B 4EN8B 2ZGMA 4BU2A 1RHI3 5EIBD 3JALA 2D98A 3IZOA 1VARA 1G7YA 1VBB1 4R52A 3W5NA 4IEWA 1NLQA 4Q4V3 2UWCA 5IY5C 4PV1B 4D8MA 1BBT1 2PUSA 3MIEA 3N27A 3ZYIB 3EMRA 1RVF1 1NZIA 1QHTA 2X10A 5J48A 4MO3M 2WFF2 1WB8A 4D0QA 3JCZA 5KAIZ 4BIUA 4X6QB 1RXGA 4NPLA 3TOJA 4FOVA 1NCRB 1GP5A 4LF8B 5DDJ2 3TCUA 2ZT9B 4HAMA 2ARBA 5FLIA 5AC92 3OR7C 1N34B 5FLJA 5JOWA 2BDRA 5HCBA 4J80A 2YBKA 2UUBO 2P1BA 2CSGA 1WNSA 2E6VA 2OT7A 1LECA 1QMJA 2HWF3 3AMQA 1GAXA 5DN6G 4Q4X1 2P67A 4XCAA 2R9IA 4IEQA 3WG3A 1OSGA 2PYTA 1GMGA 4EB6A 3IDEA 2WYFA 4PBPA 5CBGA 4RS5A 3OBRA 3L70H 3IAPA 3VHRA 1F8VA 3CP1A 4UCTA 5FZHA 3GB7C 3OD4A 4TSFG 1M93A 1SA0A 1ENSA 3CNAA 3I3BA 3VDDB 4MVSA 1H2GA 3POSA 5AFEA 1PP9H 3SR2C 3WW2A 4QGNA 1WCQA 4DR6O 4K1ZA 2YU2A 3TNPB 3CCVV 4YWAA 2P17A 1C1LA 3AZVA 4CZSA 3ZMUA 4ZONA 4BMEA 3OR6C 5CA1A 3GF6A 4AFMA 4L97A 1I94B 5F2WA 5IVCA 1XEQA 4P00B 1JS9A 3K4DA 2IBZH 5FXVA 4J6GA 1V9U2 1NCRA 5D21A 5JQGA 3ZHRA 3FB6C 3KLSA 1Z5VA 2G9GA 3MV01 5GM0A 3CCEV 2ATKC 4DYLA 5EC2C 1QQP3 4EJRA 5A7OA 3K4AA 2Y0OA 4WVMA 4Q4W3 2VZQA 3INAA 5JUVA 3AK0A 3QG5A 1ODNA 1US2A 3LPFA 1O7FA 1NVPB 3CHXA 4F6EA 3JD0A 5CKNA 3UQ8A 4ISRA 2QTWB 3EO6A 5A3UA 1XYOA 1XDCA 1HRI1 1Q3EA 3AK2A 3QH7A 4OFGA 1WBLA 4RWUA 2YPDA 3KD4A 4SBVA 4IDZA 5A80A 3SJBC 2D3OW 4CDUA 1I3HA 3BYWA 3I3DA 5JSOA 5LA6A 4JX0A 3SDLA 3VDDA 3JATB 2C9KA 3RG0A 3CRQA 2HYXA 2IXKA 3HEIA 5FK8A 1V6JA 2C26A 4DOUA 2VTFA 5ISLA 2R073 4DUWA 3JQWA 3SHRA 1XHZA 1GOHA 3NV3A 1LOGA 4FPOB 4XURA 1ODMA 3QVNA 1IS3A 3V0BB 1SQGA 4XHXA 2ZGRA 1MSWD 5JJEB 1UU4A 1ZAUA 4XETA 4QXKA 2D40A 3N36A 1LHNA 5EC1C 1RUJ1 2CGPA 2PLV3 1RUF3 2EIEA 5IK7A 4AEKA 3QACA 3TBDA 2D93A 3TB0A 2BSKB 2H6BA 4G4FA 5DUVA 1WA4A 3I2JA 3S30A 2QWOB 4V2VA 3BVCA 1RUE2 1GZWB 3CU7A 3O1PA 4ZKTB 4OUMA 1VQMV 3T1HO 2HH9A 2PQSA 4GLXA 4A2UA 4FAHA 4FIPC 3IDAA 5JPNB 2YG0A 5A9GA 1POV1 1DGRN 4DV6O 3RWKX 1UZWA 4P5HA 4MS2A 4LBOA 3VKMA 3WB1A 3WP6A 5JXGA 4D6QA 1XYPA 4FFBB 4FLYA 3T1LA 4CEYA 2ZABA 4LO7A 4MGYE 3SCGA 4J1XA 5DUUA 3S7EA 3HR0A 1UIKA 1QVFU 1JYCA 1HXS3 2VY0A 1GOFA 3FUOA 2IUWA 4N7UA 4MSWC 5B1AC 2UXXA 3T2PA 4XTPA 3SPIA 1V6NA 2FKXA 2WN3A 2W5FA 1EAH1 1YFXA 3DXRB 1EPZA 2GV9A 3MDSA 4BIOA 1BK0A 2MEV3 1XE0A 1ROPA 2UY8A 2JX9A 1PKXA 4YYOA 4YJ2B 3ZRVA 1PZ7A 2GP3A 1FX5A 4BK5A 5KHIA 1OUXA 4J7KA 1PMIA 1W0OA 4NTYA 2EA7A 1YFWA 3MI8A 1THZA 1TAEA 1RPOA 4HXCA 2F93B 3HR9A 2RDSA 3HD8B 3HBKA 4JGZB 3ZYBA 4M01A 1GZWA 3FLPA 1ONAA 5CISA 3ALQA 2X7RB 2WT1A 5FREA 3LDRA 2ZEXA 3RYCB 4FFFA 4BIFA 4X1IA 3S6PA 3UO3A 4B1MA 3T2QA 2A9HA 4JTOA 4FPYA 2D44A 3FE5A 3AZZA 4RR3C 1OMIA 1LOBA 4GKJB 4KXRA 1KITA 1WLEA 2QWQB 2BW8A 2E7AA 3U0ZA 2EXJA 5A3LA 2WNVB 1H1IA 1ZZCA 1G9BA 3HJRA 4JI1B 5GZFA 2E5LO 3ACGA 2YPJA 3S57A 2DUOA 2WLNA 3CZJA 3G4SV 3IMMA 1ZA7A 1XC6A 2ZEYA 3I54A 4CCLA 3JSNA 3H1YA 1RUI2 4LH7A 4QKDA 3GJAA 2CH7B 4DV7O </