5KHGA

Hcn2 cnbd in complex with cytidine-3', 5'-cyclic monophosphate (ccmp)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khgA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khgA02
5KHIA 2GC0A 5JSPA 3FWEA 2PAKA 4IEPA 2PFWA 4HMZA 2BEOA 4R52A 4GULA 4D7SA 1OMIA 1ZRRA 2E9QA 4XF9A 4MV2A 3WW2A 3ELNA 4Q29A 2QVSB 5I0UA 4Q0VA 1NE4A 5EFUA 1X7NA 1ZRFA 2GAUA 2O1QA 3OF1A 5I0SA 2OZJA 3GYDA 4ONUA 4IERA 1WLTA 4YSFA 2UY8A 3PLQA 4EWDA 3KCCA 4HLTA 1CAXA 1OFNA 3IIAA 4L11A 4EWEA 2FMYA 2PYTA 4IEQA 5D1IA 2HKXA 3CF6E 1RC6A 5CU1A 4R8HA 5FLJA 2QJVA 3U0ZA 5BV6A 3TNPB 2P17A 3I54A 1LRHA 2H0VA 1XRUA 5AVPA 1EPZA 5JSOA 5I8SA 2PHDA 4IEZA 3DN7A 3OGJA 5LEJA 1ZRDA 3CLPA 3PNAA 1OI6A 2PQQA 4HBNA 3IWZA 2ET7A 2V09A 1YFWA 2MPFA 4LA3A 5LRSA 5BY5A 1O3RA 4IESA 5I93A 5JR7B 4IETA 4E2GA 1CAXB 2QNKA 4WBBA 5KHKA 1ZZ7A 4DINB 4BIFA 5I0TA 2O8QA 1O4TA 5LEKA 1RUNA 1PM7A 4HN0A 2Q4SA 4E2SA 3RYPA 3USSA 4XF0A 3RZZA 3EQEA 4LUKA 2FQPA 4MGZE 2PHLA 4Z07A 2Z69A 5I91A 4BHPA 3D0SA 3U10A 2XLGA 2MNGA 2VQAA 4I3PA 3RYKA 4PJYA 5CADA 4IEYA 4J1WA 5EZWA 4BYYA 5JSRA 3FZ3A 4FT8A 4LULA 2K9ZA 1NYWA 2PAEA 5FPXA 4MH0E 2CAUA 3E97A 4Z82A 5I8YA 4FBFA 4L2NA 2ATFA 1RGSA 4KL1A 1LR5A 4KU8A 1O3TA 3ZDSA 3BU7A 4ZU7A 1ZX5A 1LB2A 1SQ4A 3EO6A 4P9GA 4XF4A 4QGMA 4RD7A 5FLIA 1CGPA 1O3QA 3VHRA 5J48A 1NE6A 1Q5OA 4YRDA 3GBFA 3G7DA 5FDBA 1WGPA 3EHKA 4AQ6A 4F8AA 3NVCA 1QXJA 2UYBA 3EJKA 1O3SA 3FHIB 4HVOA 3OD0A 1UW8A 3CO2A 3S7IA 3DL3A 4O9EA 3S7EA 1YHFA 2B9UA 3M3IA 3UKTA 1QY4A 2ZCWA 3FJSA 4PIYA 3NSTA 4I02A 4J1XA 2K0GA 4AVBA 2OYZA 1YUDA 4QX5A 1O5UA 2ET1A 2BGCA 4O9GA 3LA7A 5T3NA 3I59A 4MGIE 4EROA 4YARA 3SCFA 1ZZCA 4LEJA 3HT2A 2UY9A 1UPIA 1YWKA 2IXHA 1G6NA 1DGRA 2GC2A 2UYAA 3LWCA 4I2OA 3IDBB 1I6XA 3IDCB 1TQ5A 3SXWA 3NL1A 3FX3A 3BB6A 4BH9A 1J58A 4H7LA 3RYRA 1PMIA 3QACA 3LA2A 1EP0A 2D40A 4JTNA 1SFNA 2N7GA 3U11A 3NJZA 4X6QB 4A2UA 4FAGA 4N9IA 1NXMA 4HVQA 2CGPA 2B5HA 5JCTA 3NKTA 4OFGA 4IEXA 2GZWA 2GC1A 3HQXA 3I59B 4AXOA 5KBFA 3I7DA 1OD5A 5BPXA 4N9HA 2F4PA 2KXLA 3M70A 4ORFA 2Y0OA 1Y3TA 2XGXA 3SCGA 3H7JA 3UKNA 2VPVA 2WC2A 4YYOA 1FI2A 3FFQA 2XLAA 2OPKA 5BUVA 1H1MA 4LLOA 3ROUA 1YFUA 3LAGA 4HN1A 5C8WA 4I01A 2C0ZA 5J3UA 4XFIA 1L3JA 4HVRA 4QGLA 1YLLA 1ZREA 3LOIA 1VJ2A 3JZVA 2IXKA 5BXXA 5KHJA 1Y9QA 2IXIA 4OLLA 4KWJA 1U12A 4YNIA 3PVBB 4CYDA 4AVCA 3H7YA 1ZZ9A 1IPKA 4MGKE 5FLHA 4MGYE 2GC3A 4IEUA 3MYXA 1SEFA 2H6BA 2XKOA 1FT9A 4B29A 2VECA 4D7TA 2OZ6A 1ZZ8A 3R6SA 2PA7A 3H3ZA 4AVAA 4F7ZA 1VP6A 1EYBA 1QXRA 3D82A 4KWKA 4JTOA 4XETA 4QM9A 5KHGA 3N4MA 3H9AA 1J3QA 3RNSA 2GU9A 3HIFA 4ZU4A 1Q43A 3NW4A 2GH2A 5LRRA 4PIZA 3IBMA 5F1RA 3OCPA 1O7FA 4MX3A 1J59A 1GQGA 1Q3EA 1EY2A 1X8MA 4WVZA 4UBHA 4XFBA 1IPJA 2XL9A 2I45A 1X8EA 3RPQA 4XFAA 4HZFA 3CJXA 2IXLA 4JVAA 2XHKA 4IEWA 2BNMA 4WZCA 3KMHA 2BNNA 1CX4A 1FXZA 2IXCA 3E6BA 4XF3A 4XF1A 1J1LA 2ETEA 4UBGA 4MUVA 3BPZA 4LA2A 3WW4A 2XLFA 1XE8A 4PIXA 3MZHA 1I5ZA 3B02A 4XFGA 3KSCA 1J3RA 1O5LA 3H1MA 3BCWA 1VR3A 3H1WA 1CAWA 4XFHA 3TNQA 3LA3A 1UCXA 3E5QA 4TLFA 1ZNPA 1UIJA 1CAUA 2H6CA 3SCHA 1CAVA 2ZKLA 4Q0QA 4QXKA 4K8FA 4Q0PA 1HW5A 1LKNA 3CL1A 1X82A 2PAMA 4UXAA 4XFCA 1DGWA 2IXJA 3C3VA 2CAVA 3E5UA 3KGZA 4MZUA 3ST7A 1DZRA 3MPBA 4Q0SA 5KHHA 3HT1A 4XFFA 2EA7A 4NVPA 1RL3A 4META 2D5HA 4EV0A 1YFXA 2HJIA 3L2HA 1ZVFA 3SHRA 3KGLA 1CAWB 4QGNA 5HI0A 1ZZBA 1ZZ6A 2CV6A 5E16A 3FE5A 2BYVE 1GQHA 5I8TA 3WW3A 1YFYA 4LTAA 2BNOA 3H1YA 3H3UA 3E6DA 4FAHA 1NZCA 1CAUB 3BALA 3DV8A 1CAVB 3H8UA 3WW1A 4E2QA 3QOPA 5E1RA 1H1IA 3UKVA 4EWAA 4HSJA 3O14A 2Q1ZB 2Z2SB 1J3PA 2EAAA 4HSLA 3ES1A 2D5FA 4I09A 1DZTA 1JUHA 3DKWA 5FQ0A 4QM8A 2QDRA 1UIKA 4Q0UA 1XE7A 5C6CA 2WFPA 1RUOA 3CEWA 3D0JA 4IEVA 4QMAA 2XL7A 2QCSB 2MHFA 4I0AA 1ZRCA 2EVXA 2B8MA 5FPZA 4I0BA 2Q0AA 3H50A 3S0MA 3E6CC 3RDIA 5CVRA 2DCTA 5K8SA 3EBRA 3SMHA 2IC1A 3MDPA 4AQ2A 2OA2A 4KWLA 5J7MA 4XEZA 2D93A 2PTMA 4ZU5A 5JAXA 4JV4A 4IEOA 4X6RB 1RTVA 1V70A 1WA4A 3ETQA 1QWRA 3LZZA 2XKPA 3ACLA 3ES4A 5I0RA 5FQ0B 1UD1A 4KU7A 5FCCA 3OTFA 4LUMA 2Q30A 3E5XA
chains in the Genus database with same CATH superfamily
2YPDA 2WNVC 2Y6LA 3IFXA 4IV1A 4OI1A 1FJGB 5EFUA 3LCPA 3WG2A 3GYDA 4P00B 4UVCA 3KWVA 1XU1A 1OF4A 4YHHO 1OLRA 3KCCA 5G05L 1CPMA 2BVVA 3S3WA 4O2BB 2GALA 4NTWA 3ACIA 2H0VA 5GW7A 1AR93 4CEYA 5JI9A 2E53A 4HOOA 5LEJA 5A3UA 4OGQB 1AF9A 4QX7A 1X59A 2GBOA 3D3IA 3FBYA 4QPIB 3I3QA 2YXYA 1ND2C 2DVDA 4IESA 1W2OA 3PJQA 5BY1A 3CCSV 2CAZC 5IAXA 2HG5C 4DK1A 5CA1A 2ZMNA 4E4HA 4JI7B 4K35A 3VBOC 3AP4A 4TTGA 4P9WA 3ZFEB 3B2EE 4L0PA 1NG0A 5SV5A 3ABTA 4I3PA 2R062 5L3BA 1GN3A 4MTOA 3RZLA 2FYUH 2NPIA 5H6QA 2Z5UA 2VXRA 2YBKA 5JOYA 3IC7A 1O3TA 4BK4A 4QXCA 4GMP0 4HANA 3ILNA 3O1TA 1SQ4A 3EO6A 4G3YC 3MFAA 4IV3C 2N04A 1HNWO 1GUIA 4LF4O 4GAZA 1AR91 3G7DA 2V7QG 3GWOA 3PU8A 4KG8A 2J7MA 2C9KA 1U97A 2QKAA 1RHI3 4BQ3A 2WO1A 2DQ3A 1W06A 3B77A 3BU0A 1JFFB 1HNZB 3ECQA 4KG0A 2WSVA 1XNBA 4Y33A 4LEJA 1AXKA 2C26A 4QXBA 3RQ0A 4P9JA 4DR5B 3AP6A 2GHYA 1QVGU 2AW9A 1DGLA 1AX0A 3WVJA 3A4UA 4FAGA 3O1OA 1S0JA 2DBIA 3VZMA 5B1NA 5IY5B 1MZFA 5HCFA 3A0NA 2QDOA 2DYCA 2QKCA 5FYIA 2PQSA 4B3SB 1RHI1 4CP1A 3K4DA 4NIGA 5LXTB 2B5UA 3LOIA 2YXHA 5ABJB 5LMUB 1H2KA 5IDJA 2VJXA 4YNIA 4CYDA 2BU9A 3TETA 2ID4A 2D6PA 3LPFA 4S2GA 4P14A 3S5QA 2BOBC 2JG8B 4XACA 2H6BA 1FT9A 4LR3A 3WFVA 2R30A 4D7TA 3O7OA 3MHHC 4F7ZA 1EYBA 5ITZB 1AR92 5C4WA 1K5MA 1QJY3 4PDVA 3K46A 4LF7B 1UOGA 4K8ZA 3CCMV 4XHXA 2WSSG 3OGVA 4JI1O 4AFMA 4R9AA 3LKJA 1VIWB 2R042 2YGLA 5LMNB 2CL2A 1Q3EA 2WLHA 1QMJA 2ZT9B 2ADEA 1W6QB 4Z8BA 1XQ8A 2OX0A 3I2KA 4ZXEA 4EN0A 5JCOA 2HYKA 2HWB3 2BNNA 3SISA 4XURA 2ETEA 5FZ3A 3NNMA 4C1XA 5FPAA 3ZYGA 4DV0B 3FD9A 4DR7O 1OC1A 4P02B 1Q6IA 4RGGA 3C3SA 2BP6A 1LUWA 1BK1A 2R0HA 3ZXGA 3LOBA 1VB2A 1C8NA 3NV3A 2PYLA 4DRXA 5LP6A 2VUDA 3RVHA 3E5UA 5FYYA 5FY4A 2FDKA 3BOWA 4HK8A 4LBQB 4UFLA 4LOTA 4QGNA 5KX5B 2IUWA 1RHI2 1S0IA 2A73B 1RITA 4W4KA 2JGDB 3ORJA 3WW1A 1XYNA 4R9BA 1AJOA 5JOXA 3C7GA 3GJBA 3T2QA 2HWB1 4BJ0A 1FS0G 3VGIA 3VBUB 2Y6HA 3DKWA 5LZ6A 4Q0UA 4TUYA 1XE7A 3KKYA 4QMAA 2PGGA 4FI9A 3K3NA 2VZTA 1I5YA 5FYZA 2WQZC 2WO7A 1UX7A 3UGGA 1MSWD 2DCTA 2RN9A 4CDQC 5C71A 1HV0A 4D0QA 2CTQA 2XONA 1VIBA 3VKLA 1ORQC 5JI7A 4W4LA 2UU9B 4AQTA 4CCDA 4YVSC 3ZMZA 4JYAO 2RVAA 4NHMA 4X8AA 3VL9A 4FPGA 1WCSA 3SEPA 4QQHA 1NKDA 3J9SA 3D36C 2GSYA 3HVDA 5F5AA 3I2HA 2D2CB 3SQOA 2H8PC 3APQA 4FK5C 5LYJA 3PLQA 1FXVA 2E33A 5G04L 2PELA 4ZPIA 5C3OA 4MVSA 4HG6B 1AI7A 1D5AA 4OYUA 1NLRA 2R6QA 2WAAA 1J1TA 2P3KA 4CP2A 1QEXA 4YZ1A 2QQIA 4H7MA 1PGL2 1QJY2 4X8NA 5LOVB 2FCVA 5LRSA 2CY6A 2EIMB 5I93A 5C8CA 4KQ7A 3UT0A 5JR7B 2HWF3 5KHKA 3ZHQA 5JLVA 4BIFA 1DHKB 2QM4A 1H8EG 2UURA 2WZ8A 1MS0A 4CEWA 3H8XA 2WJSA 1RUH1 4Z07A 1JI6A 4EE2A 2RJLA 3RYFA 1S0VA 2OIIA 3W5MA 1WAZA 4X1KB 4DMIA 4J1WA 2O14A 3ICXA 3BY6A 3LSSA 4DR4B 4L2NA 2VQ0A 1LHWA 3JAMN 3O1UA 1U0AA 4QWNA 4QGMA 3VBSC 2UXDB 3JQWA 1LEMA 1CIWA 4WFFA 1BCCH 4MHRA 3ZHSA 4DW0A 3PURA 4GB31 1B6QA 4LO8A 3HPLC 1MS3A 3AM2A 2ZDIC 1ND3C 4X62B 2JXAA 5CA0A 1KDKA 1AI4A 2XJUA 1YUDA 2D6LX 1ZTEA 1K3EA 2Z4FA 4O2AA 2HEPA 4OCTA 1ZZCA 5FY9A 2YC0A 1UPIA 3GF6A 2FZ2A 4FSJA 3APBA 2XAGA 2UYAA 3ZRXA 3LWCA 5GONA 4GJYA 3QACA 1K7DA 4JTNA 3RS6A 1UYPA 3NJZA 3EYPA 4AEJA 4SLIA 3RZMA 4MS2A 2W87A 2VQEO 1W2UA 1BYHA 4AXOA 4UB6Z 3JALA 4LHLA 4Y1VA 4DOUA 4LLFA 2ADQB 3AXEA 5FZFA 3BHPA 4G9SB 1W8WA 3FFQA 2Y4UA 2XLAA 4Y5TA 4XFIA 2BOIA 2OIGA 5EP9A 1VJ2A 1XBLA 2RJKA 4MGTA 1RM1B 5CKNA 1NA1C 1NAEA 2IM9A 4ARYA 1A78A 1R6NA 3K06A 3ZJZA 5A3TA 2JDPA 3HKBB 1YQCA 2WZPP 2RCVA 1KEXA 3URFA 3WHTA 1YJNV 4RHV2 3STZC 4NXMB 1E5HA 5CFDA 3I97A 2WYSA 4D7YA 1O7FA 4AOCA 3DUIA 4AGVA 2XL9A 2HWF2 3KVAA 3NKGA 3M99B 1X8EA 4YFZA 2RQ6A 3CJXA 1SERA 3CJIB 4UYBA 4XF3A 3T0BA 1J1LA 5JVVA 1VARA 4UBGA 4LA2A 2XLFA 1GO3F 4OULA 4BW9A 5JZGA 2UXXA 3BCWA 1VR3A 1YJKA 4N53A 2ZE8A 3ZFFB 1OA4A 1DLLA 1QOTA 1BL8A 3LSQA 4M3CF 1QOSA 4N43B 1W8UA 1DZQA 5CZKA 3T30A 3WDTA 5F8PA 4S2FA 2QQVA 1H2GA 1N0NA 2YIAA 1W6OB 2E7TA 1DGWA 3GM8A 1RUD3 2DCZA 1N3PA 2YFUA 3MPBA 3AKQA 1YFXA 4ZZ8A 1Y66A 3HQRA 3MF6A 2BNOA 4S2HA 3H8UA 3QOPA 1D7PM 1H1IA 1LOFA 1IBLO 3J8F1 3QG5A 3ENRA 3EXAA 1W6NB 3AZVA 4LH6A 1XNRO 4AI8A 1XNDA 5DECA 1JUHA 3V56A 5FZDA 1Y6XA 2QCSB 4FCAA 2XAHA 1VQMV 5LA6A 4RGAA 2RHPA 2WKKA 3MUY1 3VDAA 2XJQA 4EFBA 4GWIA 2Q5ZA 3ILFA 3VBBA 1RUE3 1ZL8B 5JXHA 3CRCA 2IWGB 5IE9A 2KKWA 2UXCO 2XAJA 3M8LA 3LZZA 3ZXKA 1UD1A 3K5LA 3L74H 2Z5WA 4QPGC 5K1XA 5LCWL 4J80A 1A6CA 2ZIOA 3E86A 4JAAA 4D7SA 1OMIA 2YC2A 3WW2A 4Q0VA 4UV9A 2QWRB 3F2ZA 4AE2A 2VH9A 1SZBA 4ONUA 2IJKA 4YSFA 2BFUS 1UOBA 3VBFC 3OBRA 2YC4A 5D1IA 2VVFA 1M9NA 5FLJA 2PXJA 3U0ZA 4DUZO 5IHRA 2QQUA 4DO0A 3I54A 3CDZB 4RSUA 3OTOB 3VBUA 3LE0A 1ZRDA 4A6SA 5CKMA 2FDIA 4HBNA 4GMP3 5D8AB 4LA3A 1RUE1 4M00A 3O0VA 5JJNB 1VF7A 4GZRB 4CP9A 1F8VA 4LP8A 4IGPA 5C9AA 5T5OA 4FZ1A 1CAXB 2EICA 3LEMA 2CUGA 1W8ZA 5FMBA 3AKRA 2ADPA 3AKSA 4WM8C 4YY3B 2RDRA 3E8BA 1JZ6A 1OCRB 4TOIA 3D0SA 3RYKA 4LBOA 3N7LA 1HR0B 4MOAA 2VNGA 1WCDJ 2WLKA 4BYYA 5JSRA 4FT8A 1POV0 3OR7C 3C7OA 4OUMA 2PAEA 2G9GA 3E97A 1GN6A 5GZFA 1L0NH 4F83A 3CS5A 1R1A3 4MVOA 1LB2A 4JV5B 4BQ4A 1YI9A 2XMLA 3KT1A 3DPRC 1RUD2 1Z78A 4XAEA 1WMDA 1UY2A 3OGIB 1WPXA 3SJCC 1ZBA3 3EHKA 3JB8A 4WV8A 4MTFA 4Q4X2 2YV8A 4GMP1 3MV01 1AI5A 1VLNA 5B3SB 4X1IA 4KH9A 4I02A 2H3OA 4EJRA 3KB5A 3Q4HB 4GKJB 3V0BA 5CBGA 3C3TA 2M6YA 1GQPA 4RUFA 1AVMA 2L6LA 3VL8A 3HMYA 4NTYA 4BQ5A 3CRRA 1RXGA 2GNDA 4HYOA 4I2OA 3I5DA 1QH7A 1TQ5A 1A34A 3SXWA 1IG3A 5FLXN 1WCUA 3BB6A 1IZ3A 2V1DA 2AGAA 2Y26A 3EXUA 4HL0A 3PJYA 4QDSA 5B1BB 4NAMA 4NN0A 3A0RA 3BEHA 3SPHA 1R1A1 5CFCC 3SC7X 1HV1A 1RUE2 2H0BA 4KUMA 4YIPA 3CPWU 5BYNA 4GWJA 1E79G 5FKCA 3KHCA 4AEDA 1ACCA 4AW7A 4B4RA 5EPAA 4N90A 3WNLA 2LP7A 1OVSA 3B40A 3T2OA 1ZM1A 1FFXA 2YICA 4G2KA 1AYN2 3ROUA 1JPXA 3W9AA 5ACA3 1QNMA 2PI5A 2MEV3 4UF0B 1ULOA 1I0HA 4CDXB 2G9ZA 1YC61 4J9ZB 3P5BA 2BFUL 2PUSA 4X65B 3BFRA 1W0KG 2Z79A 1W28A 4KWUA 4JQRA 5KA6A 4KBZA 1TMF1 3AX4A 2JIGA 1OCZB 1VQKV 3TXQA 1GOHA 2HJFC 5EBWC 2ARXA 5CN0A 1T6BX 1VPHA 1NU1H 1W2NA 4DO2A 4QIWF 4DR2O 3G6JB 5KUKA 2QJ1A 1C4RA 1NXD1 4UT5A 5IW0A 4KNCA 2HYXA 3VBHA 4CPBA 1SQVH 2WSUA 3KMHA 2OXBA 1YNAA 4CUAA 5A3PA 4MXWA 2EIGA 3UESA 4MUVA 4NHXA 5E1AC 1GP5A 2J1VA 4PIXA 3MZHA 1E1QG 1SQFA 4FO9A 4FFFA 2MEV1 3SJAC 1HB1A 3VDDC 3BAAA 3ZMTA 4Y20B 5EIBC 4XDPA 2F17A 2E63A 5H9SA 4FLYA 4YM1A 2BJSA 4KI5M 1BVVA 1KQRA 1HW5A 1R1A2 1LKNA 1GYKA 2PAMA 5IFTA 2W46A 1DZRA 1XJAA 4XFFA 1OUSA 1ZBA2 4SBVA 3POYA 1KS4A 1GH6A 1WA6X 1H4GA 4B3TB 3FE5A 5F6KA 1IXBA 1OJHA 1NOVA 1SESA 1MQTA 3JD2A 4DR3O 2VCCA 1HP8A 3WG7B 2Z2SB 4B7EA 1PK6C 2P5BA 3ZYPA 1ENSA 2KA3A 3JATB 2V73A 5C6CA 1SMVA 4LNVA 1WKYA 3U07A 2D43A 2TNFA 5C33A 1OURA 1ZRCA 1D4M2 1FATA 1QQP1 5AC91 3WF3A 1DQ4A 2VZOA 2PHWA 3ZHUA 5FOJB 3SMHA 3BN6A 4LF8O 2BPA2 1NH2D 3LUTB 3VKFC 4N43A 4JI3B 1VMFA 2IJIA 4GXLA 1RUJ1 3PU3A 2UUCB 3C90A 4Q8LA 4DEQA 3ZX7A 5CB4B 3C7EA 4AK3A 2Q68A 5EHDA 1AILA 3V64A 1HJFA 2GC0A 2A70A 5ACA2 4DR1B 2DYSC 2MEV2 3HR0A 4AVTA 3RYIA 3FLTA 1UYXA 2RM23 1H8HG 3VN4A 1ASJ3 4J6GA 4CPBD 2BTVC 4PA6A 3A8TA 3SPIA 1G9FA 5BXZA 4EKWA 5F3GA 1JYWA 4X66B 4JI4O 4FJCC 5I8SA 1O6UA 2B42B 3OGJA 1GZTA 3OG2A 2X10A 2HFEC 2J1AA 4LFBB 1VBB3 1AUYA 4CDWA 4JGZB 2L35A 4Q4W3 3NV2A 1AJPA 4IETA 4QGPA 3C7HA 2UWAA 2LW7A 3HKDB 1VE0A 4OPAA 3OGRA 3T1YO 1UO9A 4DUYB 3WEZA 2Q4SA 3L73H 4JKLA 1YJLA 2GSMB 4HXCA 2FQPA 2GNTA 4ATFA 3WQ0A 3CC7V 1JYCA 4CCCA 1M4UA 4RR3C 4CXWA 4YM3A 3CJHB 2WNVA 4NKGB 5IYDO 1FYJA 2RM21 1FYUA 2RS53 4BIUA 5H9QA 1N33B 3QNEA 4D6RA 3D3AA 4QHOA 2E75B 3H9VA 1LR5A 1DG6A 3ZSJA 3N9OA 3A7QA 1V6KA 4W6WA 2DFCA 1FFTB 2BTQB 2ZE5A 2ITDC 2AYHA 1VP7A 2UYBA 3EJKA 2Z0AA 1F35A 3OD0A 5GM0A 4XDKA 1G8WA 4INDA 4P9OA 2WZR1 5FYSA 3VZKA 4JGYB 4Y3OA 5FZIA 1PNKA 3LDRA 2ARBA 5T3NA 3I59A 4P5HA 4PI0A 3WQBA 4DXSA 1YWKA 4FOQA 5DUXA 3RYCB 5FP8A 3W5NA 2YEVA 3ZXAC 2E6VA 2RS51 2W95A 1EP0A 4FMTA 2CDYA 1IS5A 2WLQA 1C5HA 4E8CA 1MOFA 3I55V 3NJYA 3NNGA 2XOKG 1HN1A 3GGLA 4HPKB 1EZVH 1NCQA 4YYOA 2C6SA 4Z1MG 5JQGB 3A0HZ 4LKEA 1MNGA 4FLWA 3IM0A 1TZOA 4EN7B 3K75B 4XBQA 1H9WA 3QBQA 5C8WA 5FNVB 4ZZ5A 3V0AB 4TV8B 4QGLA 2HBTA 4K0KB 1K5JA 2RM22 4M0NA 2YI9A 4IHJA 5CNAA 4KFMA 3PVBB 1ASJ2 2QQLA 4G27B 1HB3A 1P84F 3MYXA 4CEYC 4JZGA 2WT0A 2F43G 4NHLA 5KC5A 1Q8QA 1SHWB 3M3OA 2QUOA 1SBDA 1VP6A 4LBMA 2EZPA 4PDWB 1GWLA 2ZE6A 2JDIG 2DCJA 4QKDA 2WLLA 3RMYA 1VBB2 4MYEA 3W7XA 4BXFA 4Q4W2 4NTXA 1Q7YW 2AZ0A 5LA1A 1JR9A 5D5PA 3N2GA 3WUDA 3AG1B 3OB8A 2Y64A 2ZA9A 3GCXA 1NCRB 2LGWA 2ZM6B 4AG4A 1NKGA 4X64B 4DK0A 1TME3 1UXZA 2ZACA 4LR4A 3VBRB 2Q8OA 1CEZA 1E57A 1S0CA 1CAWA 2XNDG 5LL6Y 1COV1 2RS52 3FYEB 4Q1RA 3SEEA 4TLFA 1KJRA 4NIIA 4V1PA 4QXKA 4K8FA 4YGEA 2DWEC 4TYSA 1ULEA 2DYRC 4R4ZA 4EB6A 2E32A 4A7YA 3ZRWA 4K8RB 4HONA 3Q8FA 4EV0A 1R1BA 1OOPA 1C8M3 4UCRA 3T0DA 4NHKA 2WPDG 1FXKA 1KB9F 1OKOA 4BM8A 2VC9A 1JYVA 1RUF2 4I0XA 1MS4A 1ENQA 2XJPA 3IDAA 4CE8A 1GSLA 2FBEA 4PDLA 3VKOA 3CEWA 3MIBA 1R082 3K5MA 1OLMA 4NWWA 3ABKB 2WDBA 4JDMA 4I0BA 2WZEA 1EFRG 2JEMA 4F6EA 3ABLB 2EILB 3FB5C 4Y20A 2F66C 3JD1A 1LGNA 2DOSA 1HNXB 1R3IC 2ZXQA 1S3JA 1RSOB 1DTOA 4CDUA 1CJDA 1S55A 3KZIZ 5LHHA 1LENA 4DIQA 2A6WA 4FM2A 2DWRA 3CRAA 3E5XA 4XBFA 1C8M1 2KG7A 1RB8G 2E9QA 2P4VA 4IGGA 4Q29A 2EAKA 2HR3A 3RI8A 3QTCA 4BQWA 2IU0A 4JI5O 2DBNA 2PHTA 5A7OA 4LNUB 4XXAA 3BABA 1W6PA 4EWEA 4CS2A 4R8HA 4RFRB 4DV3O 4OHVA 4CP0A 5BV6A 3VQWA 1K5MC 1POV3 2QKSA 2JS5A 2UUAB 2VBDA 4L8QA 5FYVA 3I3DA 4WM7B 3PNAA 4FXKB 1AR81 2PQQA 1WWYA 1BHAA 3VQYA 2Q7HA 4W6YA 4RUEA 2TBVA 4BQ1A 2IJHA 5JCOC 4X1YA 1TA8A 1ENXA 3ZDVA 2DF7A 1G4YB 4J25A 1S77D 4M4RA 3J7HA 5C3PA 1XNQO 3EB7A 1TME2 2XLGA 3RFRA 2QFEA 5KLVH 5CADA 4MGQA 5F3EA 2W3JA 4MH0E 1I7FA 2QTSA 1RGSA 3SPJA 3BU7A 3LF7A 2X0LA 3WDUA 1SG3A 2E7QA 1KFXL 1POV1 4LWSB 2WT2A 3VHRA 2YBPA 1NE6A 1LOBA 4OI2A 1UWWA 1YJ9V 3JD71 2CDPA 1A8MA 5FZ6A 5HXVA 3SPCA 4LIUA 5LW9A 4Q4V1 1J5EB 1BZWA 4A7ZA 5LY2A 1LOEA 3CMGA 4O9EA 4LORA 2P90A 1GZCA 2F4VB 1QY4A 1P4RA 1SC5B 1PVC1 3TAYA 1QR8A 3FHQA 4RA0A 5IWAO 2UY9A 4G28B 2JB4A 1PIV3 4CUBA 1Z7S3 1AROP 5L73A 1NY72 1Q6UA 4IQPA 2ZGNA 1UZVA 1F5JA 4YW7A 1PMIA 4XDJA 3WF1A 1MR5A 4CCOA 3VZNA 5C70A 2N7GA 3Q8CA 2ILMA 1J84A 3K0GA 1AYM1 1WD4A 4X20A 4XMIA 1PZ8A 3M7AA 2GZWA 1LOGA 2GC1A 1GM7A 1WLCA 5KBFA 1VBA3 4LKDA 4HK9A 4HKWA 4ORFA 2K1EA 2D7FA 1QVFU 4UCUA 1JJOA 4V2VA 5GLWA 1YFUA 2CH7A 5EZYA 1OVPA 1UZWA 3KVBA 2VZSA 1YLLA 4NOTA 1OSGA 2WL1A 4I55A 3FAVA 3JZVA 5IJ9A 4LF9B 2VGDA 3R0RA 1WMEA 4OLLA 1ND3A 1IBMB 5EQUA 2PLV1 5FLHA 3LFMA 5GJ6A 4DNYA 1Z7S1 5BNPA 3ACHA 3H3ZA 3AFKA 3CQOA 1OCCB 4JTOA 3OYWA 3UM7A 3ZSKA 4BMEA 5C8CC 2Y6GA 3HIFA 4LITA 3ZMVA 4FFGA 3B09A 1Z5VA 4MX3A 4RAIA 4AI2A 3WP3A 3AFGA 1VBA1 5FTTC 4XILA 3DC5A 2BNMA 1LU1A 2OT5A 3VHOA 4WFAV 4YXWG 4HKOA 5FYBA 2P6HA 1GN2A 5DAPA 5ISLA 1D0GA 5DN2A 2Y38A 2Q8DA 4LF7O 4NPMA 4JI6B 3WUCA 2ZGTA 4L97A 1R73A 5IK7A 2PYJA 3AP7A 5IVBA 2VMDA 5FXWA 3O9OA 1VAVA 4O4LA 1XSQA 4Q0QA 5J2TA 2VMIA 1ND2B 3N7KA 1RFYA 3PTRB 4DXZA 4K3UA 5A33A 4UOJA 4TZDA 3VBOB 5FZOA 4CVUA 3L2HA 1F4HA 5H6RA 4ZOLA 3RRDA 1ZZ6A 4WFBV 5FV3A 1SFPA 5F9TA 4C0HA 3FFZA 1YFYA 1PKXA 2EX3A 3IPVA 4BK5A 5DXDA 5JVDB 3HWJA 2KQXA 2QM8A 1N4CA 1GN4A 4YG6A 3AMMA 4HSLA 2YZ4A 3HNYM 2RMKB 3BCCH 4KP4A 4ZI7A 1JZ3A 3HD8B 3ZR5A 5L3CA 1PIV2 5FQ0A 4A3ZA 4IV3B 1Z7S2 1EN6A 3QO8A 4K9SA 3BKZA 5KAIZ 4JI0O 3T1HO 1XNTA 2EULA 3MV11 3GZEA 3JAWB 1VBA2 4M3CA 4B08A 1QWRA 2XKPA 4NRQA 4BA6A 1SLLA 3OTFA 4RWUA 4GX0A 5DN6G 1JX9A 1RYYA 2LALA 4HMZA 3ZSEA 4MV2A 3B8NA 3ELNA 2QVSB 1WPBA 1HRI2 4FFHA 5I0SA 2WINB 3EMRA 4F6RB 5JPMB 3ZPOA 3RT3C 2HEYF 1LHUA 4LO7A 3ASIA 4N7IA 4L11A 3VD5A 1RC6A 3OMNB 3DXTA 2QJVA 1UQXA 5DDJ3 1SLCA 5FZ8A 1XRUA 3J26N 1PMHX 2PHDA 1N47A 3ZFGA 4XMAA 2XJVA 1HRV3 1PHMA 1Y76A 3HBKA 4PJ0Z 1YFWA 1QJFA 1YSCA 3G6EV 3BTZA 1MG1A 2DE0X 1FNYA 4TWTA 5CA3A 4WBBA 4BWAA 5LEKA 5DG1A 4K20A 4JHZA 3IT8A 2ZE7A 4XVHA 3MAQA 3U14A 3WU2Z 2OKXA 4O4IB 4H3WA 1DQ1A 5F7UA 1KDMA 4DY5A 4LULA 3FB7C 3U4XA 2X8KA 5FPXA 1YTFB 2ZEYA 5A9GA 2YU2A 2ARAA 1KBHA 1V9PA 5KMGB 2B46X 1MEC2 2JG8C 2A06H 4YHHB 4LFAO 3T0AA 4TQDA 5C3SA 1CIYA 1AR4A 5B1AB 5E89A 4FPEA 2P1BA 3SYAA 4LK6A 3LGRA 2D98A 3WSOA 4N23A 2VOVA 4DV4O 3UO3A 2Y0IA 1LOFC 4K8XA 3N36A 2VBBA 3FJSA 4WVVA 2B9ZA 1JQ0A 2BOJA 4FFBA 1JHJA 4R7CA 4PDRA 1KRIA 4URTA 2EALA 1QJX3 2XVLA 1DIWA 1C1LA 5ANNA 1HN0A 1ONAA 4HT1T 4R50A 1BK0A 1B35B 1DQ0A 4YZ4A 3KS7A 1FOD3 4ISRA 3PJSK 2ERFA 4FP3A 5DUUA 3MHSC 1QJZA 1G8MA 4XTMA 4HVQA 2ZIMA 4X62O 1IURA 2A5ZA 1FXHA 3B01A 2MW2B 1RMU3 1WP8A 1OUXA 1IQDC 3TN93 1JMUB 2P3YA 5CISA 5K0UA 4LF4B 1Y43B 4BAYA 4RQPA 3CCLV 2W94A 1VBE1 4HAMA 1K9MW 2YDEA 5IVJA 4MLOA 3TWIA 2XJRA 2IXIA 2YIDA 4KWJA 1U12A 1DDLA 2E51A 4AFBA 3UNPA 4CDQB 1QJX1 4BZ4A 1BS3A 4Z2WA 5EV7A 1JTZX 3UCSC 3VBUC 4COVA 4N7UA 2ZHKA 1BEV3 3ZPYA 2FCTA 1ZZ8A 2BE3A 2WQ4A 4AVAA 2EINC 3JB4C 5DDJ2 5FJKA 5IYCO 1FOD1 3SH5A 4YVSB 3PVOA 2ZR2A 3UJOA 3TRSB 1Q43A 1HRV2 5C9AC 1SLBA 2HWC3 3B00A 4UBHA 4YVWB 3RZKA 4U36A 4XZPA 3RJRA 3THDA 4JVAA 1RUC3 4WZCA 4QNHB 2P6CA 4RQFA 3LSDA 4XF1A 2OVUA 3A21A 1V6LA 2R1BA 1XU2A 5L9RA 2JIZG 3IAQA 1QF3A 4NXMO 3TNQA 1XL6A 2HWD3 5A6XA 3MDSA 5BMVB 2O57A 1WA8B 1B06A 2PF4E 1YQ5A 4LH7A 1ZNPA 1RUI3 1BQPA 1LESA 2Q5TA 4X9QA 1WJZA 2QQMA 1COWG 1PM4A 4UVAA 2DN9A 1NQDA 1BEV1 3ACGA 2A9HA 4AYUA 2IU3A 4LPLA 1ULDA 3C8XA 3USUA 2WWSA 4DR6B 4ZHQA 3OM3B 3POWA 4YGBA 2BYVE 5A1FA 4B3RO 1KKCA 3H3UA 3AP5A 4JI1B 3RN4A 2YB7A 2QQOA 3W20A 1J3PA 1FNZA 1V9U3 4H44B 2ETNA 2WS91 1ROPA 4FVVA 4PQ9A 2QDRA 1PNGA 2VD7A 2AXTZ 3VBSB 1GOFA 2Z3YA 3AZYA 4AF9A 3CU7A 2G9FA 5EYPB 1FOD2 2VZUA 4FOYA 4DR7B 1RUI1 2G38A 1YO8A 3ZOIA 2XAQA 1REEA 2ZX0A 3QLQA 4AEDC 1LTEA 4K21A 4AI1A 3T1MA 1H1AA 3LDEA 2JD9A 4C90A 1RMU2 3G67A 4NYKA 5KA5A 3N2KA 5L36A 4O4JA 1KD1W 2Y48A 2GV9A 2F1MA 3TN92 4AAXA 3T09A 4BE3A 2PFWA 3K3OA 4E2LA 1H8TA 2JDMA 4CXXA 5IWFA 4O7XA 2GAUA 2P7TC 2OZJA 5BR8O 4FTBA 4K1YA 2BSKA 3R65A 3UT5A 1V9U1 1AB3A 3AMHA 1VF6C 3NAPA 4XDOA 2VW1A 1JOBA 3LEGA 1SZTA 2P67A 1LCLA 2VAUA 3JASA 3OMIB 3WNMA 2VCBA 4Y5Z0 1BEV2 2JKXA 5CEHA 2P17A 1JYNA 4J7ZA 2VZ1A 1OQ1A 3ZMUA 2DTWA 2LTNA 1XOYA 1BT8A 1EZJA 1HQWA 4W6XA 1BKZA 4ATEA 1PVXA 1X4TA 1UL9A 1XBFA 1S76D 3AYDA 3PDQA 1F4NA 5BY5A 2HWC2 3PUQA 3VBHC 5KR7A 1YDXA 1H2MA 5CAZA 1NA1B 4E2GA 4A7KA 2F23A 1ZZ7A 1CXZB 3AG7A 1O4TA 1U5ZA 2Z42A 1RUC2 5D5QA 2FDGA 5T54A 1WBLA 4E9KA 3SNMA 2LGQA 3W59A 1RP3B 2QKDA 2ARHA 2HKOA 4H2AA 4JYAB 4PJYA 5EYXA 2Y4TA 4IEYA 5J96B 1J83A 1EBOA 2GUZA 2HWD2 1VBD3 4LIVA 4Q6GA 4BLJA 1X9PA 4I0WB 4FBFA 1RUI2 1QBZA 3ZXDA 1UY4A 4P9GA 2NYYA 4LE3A 5FLIA 1NR1A 3CZJA 3ON7A 1CGPA 3LSEA 4YRDA 4H13B 4MVMA 4QB6A 3WNXA 1GNZA 5F5QA 2OQ6A 1HR0O 1BMFG 4R6ZA 2R9AA 1IS4A 5FPLA 4J1XA 2WNUB 3D3QA 4UFKA 4AVBA 2Q1MA 1CX1A 1V9U2 3HEIA 3SCFA 4IYHA 3M3CA 1HDJA 2UWCA 1FAYA 1R093 3DXUA 3RYHA 5A6YA 1D2SA 1IKQA 3ETGA 2PZSA 2W91A 1J58A 1VBC1 4BH9A 1ZYBA 4FM0A 3AKPA 1VBD1 2D40A 4HETA 3ZFFC 3UGHA 4PBOA 2A3XA 2RE9A 2E7AA 5GZEA 4QHZA 4N43C 4Y4YA 3ZKYA 2BRTA 4JI8O 1T5EA 2P6JA 2F4PA 3AP9A 3IDEA 3M70A 2R1DA 1YF2A 3SCGA 1Y3TA 4QB1A 4EYUA 1VMHA 1A3KA 4OX9O 5F2WA 3GVMA 3K5OA 1EPWA 2QM7A 2C0ZA 4IE4A 3OEBA 3ZR6A 2E74B 1UYYA 5J2UA 3SH3A 1FMD3 3S57A 1MMMA 3T2MA 2RDQA 5L7OA 3H7YA 3A22A 2Q7EA 4FQZA 2YI8A 3TEXA 2TEPA 1TVKA 4LO4B 4H0LB 1CQ9A 1R091 4KBBA 2XASA 5D21A 1KC8W 4QU1A 2UUBO 2YXLA 5A7WA 3NQHA 3OGGA 4QPGB 4CUGA 3KHBA 3WNOA 3N4MA 3H9AA 5IVYA 2GDSA 1BJQA 1BE3H 5DEDA 4ZU4A 2W0FC 5A7NA 3AZXA 2XVKA 4JRAA 4XFBA 1BQ0A 1D2QA 2W1WA 3M7MX 2WWJA 2VL4A 1HDKA 4HZFA 1POQA 1BGYH 3KD4A 3OD4A 4TQFA 2VQEB 3VBFB 2IXCA 3SYQA 3DYPA 4FTSA 3H1JH 3O5SA 4JAUA 4NAOA 1XE8A 2QSAA 3K08A 4XFGA 1J3RA 3GBGA 4O4HB 2EJRA 3JAKA 3IJ4A 4YM2A 1FMD1 1QQCA 2F95B 3STLC 1S0FA 2PI4A 5FL7G 1VBD2 2Y60A 1DK1A 3LDCA 1WLDA 4FPYA 4QX3A 2H6CA 3IIIA 1RPRA 1H38A 2Q7GA 5F5IA 3T08A 1EAH3 5J1XA 3VHPA 4XFCA 2A71A 4UI9L 2CTRA 5FKBA 5L3DA 4HNAA 1ZA7A 5JR2A 4OZOA 2TUNA 2XG3A 5IJ0A 5DZFA 4WM8B 1VEWA 2YS8A 3IAYA 4ASLA 1KD7A 4FLVA 1RL3A 5FP4A 3H1HH 3F5TA 2R072 5HI0A 1AJKA 1GQHA 4DXTA 4EN8B 3WW3A 3I2FA 1CAVB 3ZN6B 3L72H 1PX3A 4FPHA 4EWAA 5FZHA 5JIUA 1EV11 2EAAA 1W90A 3BTXA 1W6MB 1I1EA 1R092 2WFPA 3DPRB 2ITCC 5L9BA 1SA0A 1OCRC 4IEVA 1UZZA 3HKEA 4K1ZA 2E76B 2B8MA 1GM8A 5CVRA 5F6LB 3MFCA 3HKCB 4O61A 2IC1A 5GLUA 1EAH1 1NCQC 2OA2A 4KWLA 4JV4A 3CCRV 1WA4A 2OPWA 5LBBA 4XW3A 2XHNA 3L2YA 1MVEA 2R49A 2XPJA 1JU3A 1MVQA 1ZRRA 2Y69C 1FMD2 3OY8A 4Q8KA 2WLIB 5T5LA 5B3SC 5HV4A 4IXLA 4LT5A 2CHHA 1WLTA 5FR3A 1LULA 3ZIWA 3KCYA 4GKKB 4YIOA 5CFCB 3RVYA 1VRH3 4DY3A 1K8AW 4AGRA 2VE1A 1WB7A 4QQLA 3NV1A 1BHBA 1SPPA 1ENVA 1JZ8A 3OJBA 1K3IA 1I9RA 4LBLA 3WZ1A 2GP3A 2WAMA 2MPFA 3D8CA 1XMQO 3K51A 5FO8B 1Q8OA 2DU1A 2ZGMA 3Q8BA 5DUVA 4G4FA 3JSLA 5GLZA 1RUNA 3BTAA 2JG9B 2UXCB 1XB9A 3N9LA 2BBVA 1HB2A 5LY1A 4Y1XA 2XQRA 4DRRA 5GALA 3NMBA 5EXOA 4LFBO 3O1SA 5LB6A 2EXJA 5EK0A 1QDCA 2D6OX 3K2OA 1VQ4V 5H9CA 3ZYRA 2V4VA 3LIGA 4CDXC 2KB1A 1GANA 3HNMA 1WW5A 1DP0A 3T1LA 1VRH1 2B1IA 1U96A 1EAH2 2W08A 4XF4A 1F4MA 1OCZC 1KJLA 1OOPC 2SBAA 1WGPA 4GD4A 4DUZB 4A5UB 3IC9A 2DMXA 1FXKC 3CO2A 3S7IA 3JARA 3AG2C 1N3OA 3VDDB 5IK8A 5T5JA 5A3WA 2ZCWA 2RMU3 1N33O 1C5IA 2WNEA 2EIJC 3OPTA 2X53S 2JDNA 1UF2C 4XXPA 1F7YA 1O5UA 2IFRA 3LA7A 4WBNA 1ZBE3 4X88A 4Y22A 1NR7A 3K48A 5FK8A 1CD3G 3IDCB 4AVVA 3RYRA 3FYIB 1XXNA 5C8YB 4TV9B 1FD9A 2LW1A 4CDUC 1TUBB 3ITQA 2ENRA 2IH1C 5A70A 2JK5C 1GZWB 4GLXA 2VOTA 3ZMSA 1NZIA 1W2AX 2BOCC 4ASMB 1PK6B 4JI2O 1IHMA 5IK4A 4CZSA 2W9XA 4LO6B 3I2OA 2RV9A 4Q5OA 1MS1A 2JDKA 3OUHA 3JBG3 2QQJA 4I01A 5KWRA 3ZXJA 1PV0A 1IXMA 1NJIW 1AR5A 2RMU1 5DZEA 2F4LA 5F3CA 3WP4A 3ZIXA 2D3SA 2QTOA 1ZBE1 5JH7A 4YG3A 3QD6A 5HCAA 3WXPA 4GH4A 4DXRA 1VRH2 1YZBA 3E22B 1ZLZA 5FBJA 5J09A 3CE2A 5BNOA 5EYYA 4RO2A 4QM9A 4MO3M 4TSVA 5FZBA 4H33A 2J1RA 4CCJA 3TJTA 3WCRA 3JCIA 1UMIA 2DYSB 3CCJV 2XUEA 2BBAA 1OF3A 3ZYBA 1HXS3 1UY1A 2HJDA 4Y26A 4UCOA 2W47A 2XHKA 3WV6A 2DURA 4GKYA 4JHTA 2IVIB 3H3LA 4BB3A 4UAPA 2P4EA 3JBG1 1RUH3 5C3QA 3ASOC 2XDVA 4RS5A 1NQJA 1AXYA 1Q90D 2DU0A 1I5ZA 5B4XA 2NNUA 1Q81W 4LO5B 4BISA 2W6JG 3LA3A 1I08A 4DB5A 3JD4A 4QPWA 4GA9A 1DF4A 3AMNA 4GX1A 2OTJV 4R4XA 5A6QA 3WQ1A 3ZXEA 4I50A 4LC1A 4UXAA 3O12A 1K92A 2K9PA 4YM0A 1RJ7A 4OVEA 4U3JB 3B93A 3BA9A 3J80N 1L7RA 5FUNA 2OYQA 5C7GA 3WF0A 4GB33 4AVSA 4DV1O 1RPOA 2K46A 3IN9A 5I8TA 4RR3B 5J36A 3SR2C 2XJSA 3H1YA 4I4TB 3CKHA 3E6DA 2AEZA 4JGZC 1CAUB 4YJ3B 1HXS1 1IQAA 5LATA 2Q1ZB 1HX6A 3VUOA 2HWB2 5JXIA 1S0EA 1SKVA 1ZBE2 2CDOA 1DF5A 3WG4A 5FBZA 1YJWV 2LS6A 5KC6A 3VKNA 5CA6A 3AJYA 5EWSA 2F93B 5IYZB 4I0AA 4LFCO 3ZMOA 1GKBA 3S0MA 3HN3A 5IVFA 1UU5A 2D3RA 4B7KA 4YW4A 2PHUA 3NNLA 3BOPA 1XMOO 1Y74B 2Y6JA 4JRLA 4IUGA 5F2VO 4LHSA 1LHNA 5FZ9A 3ACLA 2ZZJA 4KGGA 5FCCA 3JXSA 4YG0A 4O2BA 3N9QA 2X5IB 4RQEA 2WFF3 3JBG2 1OD3A 5T5PA 4OHZA 3FHAA 3OEEG 1E5RA 2JEXA 2ZHLA 3OF1A 2O1QA 2PHXA 1K42A 4P2ZA 4QPIA 1SETA 3KG2A 5LHIA 5FMCA 1E1RG 4DR3B 2XJTA 3CMAV 4GQ7A 5BNPC 1LOCA 1OFNA 4R9DA 2NN4A 4CH6A 2HKXA 4I9WA 3O1MA 3ZX6A 3GZUC 5CU1A 3H1KH 1W2BU 3ZO0B 3ZFEA 4XIOA 3POFA 4EFEA 2HHHO 4GUNA 4IV1B 5FYTA 5A6ZA 3U75A 2ZKOA 1WD3A 2Q1FA 3ME2A 4WVWA 1BHGA 1N3QA 2IH3C 1K33A 2JRIA 1GM9A 1HXS2 2JD4A 5DPNA 3LDKA 2RS33 1JA8A 5SV8A 4IE7A 3ZXLA 5EBLC 1KECA 3O65A 3OBZA 3RZZA 2WFF1 1RUH2 4FQ4A 2V4AA 3R66A 3T4ZA 4CEYB 2HVJC 4XQWA 2UUAO 2UXNA 5IUQA 3FC0A 5FJHA 5BNNB 1US6A 4H55A 3CIHA 3DC6A 4W65A 1OXCA 1W2TA 2R0FA 5JMCA 5CA1B 1JFFA 1NBMG 3UQ8A 2ORXA 3N27A 1BMV1 4DV7O 3GBFA 5FDBA 1Z5WA 2XAFA 4F8AA 4EEQA 2IJJA 2G4IA 4GB32 4JI4B 1JW6A 2AGSA 1NTMH 2HP8A 3AEIA 3DTUB 1HJGA 1ODMA 2R9RB 1YHFA 4OMCA 1O91A 1Q6HA 1MA1A 1AR1B 1CWPA 1BBT3 3E83A 3J8F3 2RS31 2OYZA 4URAA 2ET1A 3O1VA 2VMEA 3AG1C 4YARA 4MHUA 3UK9A 3T1YB 1NCRC 2DYRB 1AR71 4NO4A 2V5YA 5FMOS 3FX3A 4CC5A 4QPKA 1SS3A 3N35A 2Q9LA 1OH4A 5LXTA 4KHPO 3AL6A 2A3QA 5FAXA 4QKBA 4A2UA 4YZ5A 2J22A 1K97A 5DZGA 5ABJA 3NKTA 5FZEA 3H01A 2X6AA 3VHNA 4PELA 1W99A 3B9IA 2JG8A 4XHBA 3AVRA 1HW7A 1D2DA 1GMMA 2ZX4A 3K04A 3E89A 3U78A 3OT7A 2YXSA 1X36A 3ZRSA 2Y8KA 4ISQA 2WFF2 5ITZA 1LOAA 3VQXA 5FK7A 4Z92B 3K0DA 2XBO3 3HOBA 3RJ2X 1BBT1 4UWDA 4YW6A 4W50A 1N36O 4AVCA 3K5NA 1M90W 1W6QA 4MGYE 1K4DC 1I94B 2A7AA 5EBMC 4LBEC 3ZFGC 1Q86W 4QB2A 2AH2A 5HFMA 4FVMA 2PN5A 4DPNA 4BMBA 2JKBA 4OQ9A 4NXNO 2R70A 3GZAA 5KHGA 3K77A 2LW8A 1JZ4A 5FUPA 3ABLC 1K5QA 3UKMA 5A1LA 2JDAA 4ZIBA 4BWOA 1L7QA 1HQLA 3AVSA 3Q8AA 1W8HA 3GHNA 4PT6A 4XFAA 4OI0A 2NLJC 2RS32 3MIGA 4YFWA 2OT7A 4DUWA 2EIKC 3ZS8C 5IYBO 5A7QA 1F31A 3CD6V 5GKAC 5C4WB 4LBQA 3ZYJB 1K5MB 4FPPA 2XBO1 3H1WA 1LHVA 4BQYA 1LGCA 5KX5A 1UCXA 2JGDA 3SCHA 3WQ7A 4QPJA 3C7FA 3VZJA 1W0NA 1SF9A 3UV9A 3B3QE 5DUWA 2ADDA 1TEIA 2FZ1A 2NM1A 3WP5A 4WM7C 4NPRA 3WLUA 2JDYA 1RIRA 1WMFA 3AK2A 3O1RA 2ZTNA 4CCKA 2BGPA 1S0BA 2CYFA 3CRQA 1R3KC 4LTAA 1WW6A 3HR9A 1AHSA 1S5HC 1C28A 3J8F2 2WUHA 2GP5A 2A3YA 4DRXB 5LP6B 3AK0A 4BW5A 5L3GA 1HB4A 5GZDA 4QM8A 3T2TA 1RUOA 1LEDA 2R72A 3DXRB 4L87A 1PGW1 3D0JA 2YU1A 2YGMA 4GWMA 5CBHA 1MZ5A 1N32O 1TG7A 1O9HA 2ZJCA 1OCOC 1GICA 5FZ4A 2Q67A 2JE7A 3HBZA 3WCSA 4NRMA 4JPRA 1XYOA 3POBA 1FV3A 1ZAUA 2D93A 3DKQA 5K0UC 2BVBA 5FZGA 2DUPA 2YUAA 4TUYB 1MZEA 2P06A 4RQPC 2WYFA 4DYLA 5JSPA 4DZGA 1QH6A 1DLCA 1F51A 2AZ5A 1CZSA 3IKWA 3BVOA 3QVNA 4I7ZB 5FP7A 2OS2A 5A1AA 1XREA 2XBO2 1ZRFA 2QQPA 5LOVA 2WLPA 4U2AA 1VAMA 3ZEDA 4XCBA 4I9QA 1UXXX 1W9YA 2YMZA 4PLOA 2Q8VA 4I4TA 3TCUA 3ZN0A 1MPXA 1WBFA 1UX6A 4XQ4A 4DV6O 3MUZ1 2FMYA 5FO7B 5A7PA 3FUQA 3AG3C 1BLZA 2J1UA 5LK7B 1TMF3 2VMCA 2VQUA 2OCCC 3H8OA 4LBQD 3GALA 1F23A 4AWDA 4IEZA 3BGAA 3DN7A 3K79A 4UUJC 4X1KA 4CCMA 3W7WA 4CCNA 2IVJA 1F4AA 5LYJB 2B45X 2EXHA 2B39A 2CWSA 4XTPA 1OH3A 4EQVA 2EBOA 1OPOA 2WT1A 2O8QA 5FYHA 1Y67A 4PBPA 1T6GC 1GRJA 1Y74A 1YEWA 1RINA 2QQKA 4QKFA 2YIBA 4WFEA 2W92A 4D6QA 1CR7A 4CA9A 1NYWA 3EHBB 5C8CB 3VQVA 3A0KA 3HPNA 4KU8A 4NIAA 2Y0PA 1VF6A 1PX4A 2CTVA 3G71V 4COUA 1URXA 4CEWB 2ZX3A 5EC1C 3NR7A 4Y1UA 2LUWA 3KZ4C 5F5CA 1V6JA 1NVPB 4DV3B 3RYFB 3NVCA 4AHCA 3FLRA 4OXSA 3MO4A 1DCSA 4A6OA 3DL3A 5DMYA 3Q8EA 4XABA 5FPRA 1GOGA 1DYOA 1OFSA 3M3IA 3QF7A 4MG2A 1S2BA 4PA7A 4Q26A 4CU6A 4IL6Z 4QX5A 4O9GA 4MGIE 4EROA 3CZUA 4Q2FA 3WG3A 2IW5A 3RVZA 1OKQA 2VVEA 5LA9A 2D44A 2VY0A 4W8JA 1QHTA 1QQP3 5AC93 3LA2A 4PA3A 1XNQB 3CWBH 3U11A 5BNNA 3DF0A 4CXYA 4QKNA 5CA0B 2M7WA 1REFA 2ORZA 2R043 4LHKA 2W52A 3S30A 4O2AB 3WF4A 1A32A 1RUJ3 3I2GA 4QPYA 3HKBA 3OBTA 4LBJA 1H8TC 5GONB 1VMJA 2OPKA 1H1MA 1SZXA 4Y24A 4JAVA 2VUCA 5BNQA 2GH8A 1UOJA 4JDOA 1A8DA 3NAPC 1TGOA 3QH6A 4L99A 1IPKA 2E5LO 1EUTA 3BODA 3OW2U 3JALB 1GV9A 2GC3A 4H14A 1BCXA 1IBKO 3CJIA 1UOFA 5IWAB 1TMF2 3ZBHA 2XHBA 4X8PA 1AI6A 1KFUL 5B1OA 1QXRA 3D82A 3ABUA 2R32A 1GFF2 2VCAA 2YIBD 3FKSG 2W6IG 2QTWB 5DABA 1XNCA 2R16A 3ABMC 2GH2A 3ZFFA 4NIDA 4FLXA 2C2AA 3P32A 4B8EA 2R041 4AI3A 3ZM8A 1W0PA 2WA4A 1QOOA 1ZRIA 4TSFG 3X2QC 1JCHA 4MVTA 4Q4Y3 4QE9A 3RPQA 2WN3A 4LKSA 1W6OA 2RS13 3CCUV 4AQYO 5D2AA 1YXBA 4WF9V 1N8RW 3GCWA 5BZBA 1AX2A 3R4SA 5JXJA 5GTIZ 3KSCA 4NHYA 2WBKA 3H1MA 5CFDB 1KKDA 4UVBA 1JUIA 1DBNA 2FMDA 3NXSA 4PLNA 5KXBA 5HBAA 4QD2A 1N1YA 1VB4A 4XCAA 4CZZA 4A4AA 3NNJA 1DYPA 3JD0A 2P37A 4JCKA 2FDFA 1W6NA 2LFSA 1D4VB 1OA2A 1H2SB 2D6MA 1VQ5V 5JZGB 3SHRA 3WNNA 4X89A 3G6BA 4N53B 3WF2A 4AI0A 1VALA 1L8DA 3B8MA 2WZR3 4WZFA 3CXCU 4Q4Y1 3B5LB 2WN2A 5F37A 2J1EA 4AHYA 1F9KA 1Q56A 4OZXA 3O14A 3WINE 2RS11 2UXBO 1ZL8A 3C2UA 1ODNA 2HVKC 5FXZA 2D5FA 5K9YA 3WP6A 3OUFA 5EJ1B 2A79B 1Q8PA 5HXMA 2RJZA 4DR6O 1OT5A 3GHMA 1WLEA 1QQP2 5AC92 5FZAA 2JWPA 2D3PA 1B04A 1ZX3A 3OMAB 4C91A 1KP3A 1L7LA 3P3PA 3NV4A 2W5FA 1M57C 4JYBA 4LF5O 3U37A 5J7MA 3HNBM 1RUJ2 4D94A 1ZWIC 3ES4A 4LHNA 4FOVA 4LUMA 5B1AC 3KLSA 5LA6B 3FL7A 4FOWA 5FYUA 3POIA 1W3VA 5L7OC 4DV2O 5D8AA 4D3WA 1JMKC 1LECA 4FPJA 3E8FA 2VZPA 1CAXA 2BWAA 4RN5A 4AHXA 2GDFA 1PP9H 1H30A 2DFBA 3SJBC 4DV5O 5IT6A 3TNPB 1GZ9A 2RDCA 3LDDA 1EPZA 1B35C 2VUAA 4M4PA 1IS6A 1PGL1 1W8OA 1GTOA 5IJRA 1QJY1 3DXRA 3HN1A 3IWZA 2YUEA 2QGNA 2RJ2A 2O8OA 2ZINA 1VQ6V 2MK3A 3PVEA 1ALYA 3CXHF 3T1HB 4JI0B 1B3QA 4Q4Y2 1LHOA 3TOJA 2WO3A 4O65A 3MD0A 3P6BA 1JS9A 2RS12 2AEYA 3OUSA 5FZ0A 4E4SA 2XWBB 1O4ZA 4P9PA 2Z69A 5I91A 1WUVA 4BHPA 1DYKA 2EXKA 4L9BA 3WG1A 4DUXA 5CG8A 4Z1VA 3CC2V 1UU4A 2EINB 1COV3 1ZA4A 1LODA 4CP9B 3ASNC 5C9AB 4CS4A 1V55B 1GWKA 1UU6A 3Q4HA 5IVEA 5JJEB 5FYCA 5GLTA 3RBZA 4D6TH 1O3QA 2VMGA 4MT8A 1VQ7V 2B1GA 4UW5A 2WWWA 4AQ6A 1OLQA 1QXJA 4L92A 4QE7A 1GWMA 4HVOA 2WA3A 1UW8A 2AENA 5A32B 2WZR2 5L9VA 3I3EA 1URFA 4AQSA 4F3JA 1V00A 2FMLA 3H1IH 1QGLA 2P3IA 3WB0A 3IMNA 4YVWC 1SLIA 5IVCA 1JBCA 2BGCA 3DSQA 4J11A 4Y4RA 1K4CC 4B3NA 4EZHA 1RUG3 1VQ9V 3ZN1A 1DGRA 2VO5A 2FB5A 3M4FA 3IDBB 2DVGA 2P34A 4QAWA 2HEVF 4XIKA 1EM1A 4RHV3 2HWE3 4UF0A 1SBFA 1DQ2A 4X1IB 1FPOA 1XUQA 3T2PA 1NXMA 4CDXA 5T52A 3V0BB 4S2DA 1NQTA 1GBGA 2BWCA 4OFGA 3T4HB 3W7SA 4K6BA 1W9TA 1Q8SA 3AL5A 4IGOA 1CPNA 2XGXA 3UKNA 3BI3A 2WC2A 4LFAB 1FI2A 1AJNA 3X29B 2ARCA 3NO8A 3LAGA 5J3UA 4B3MO 2W1UA 4COZA 3ML0A 2NLRA 1BQZA 3J7AU 4DV4B 1Y9QA 2HBUA 1XE0A 5A3LA 4MGKE 4AEDB 1RUG1 1XQNA 2ZGUA 2XKOA 4A41A 1H4HA 3M3EA 2V5DA 3P1IA 2B9VA 1FFXB 2PA7A 4ZY9A 1M93A 3Q9OA 3I3MA 2KD7A 4XETA 1AR83 4RHV1 2HWE1 2VWKA 3RNSA 5JUVA 3NW4A 4GYCB 1N34B 3IBMA 3H8RA 3THPA 1GQGA 4XQDA 1NH2B 3ATGA 1IPJA 2HWF1 5FZKA 2QWOB 4OI4A 3K4ZA 1Y7BA 4IEWA 5FP3A 1QLEC 1CZVA 2DV9A 3RZJA 1FXZA 3E6BA 3MW2A 4LF6B 3W7UA 5LASA 1VAKA 1XNAA 3FLPA 3RZHA 2VZVA 1LR1A 2YROA 1COV2 5LWBA 1PZ7A 2QE7G 2X7RB 2VWJA 2AR6A 3VBHB 1BSMA 2ZNIA 1H6XA 3PVNA 3V65A 4YZ3A 2BTOA 2ZHMA 1SLAA 3JATA 3C3VA 4MXWB 4WVMB 5KHHA 4C7UA 3JD73 2A3WA 2YPJA 4XYXA 4YZ2A 2D97A 2A6XA 4Q4V3 2HJIA 3LEIA 1FJGO 2ZXWB 1ZZBA 1LJ7A 5E16A 1V54B 1UPSA 1PD3A 1H8VA 4FAHA 1V6OA 1FAFA 3LSUA 1PVC3 1R1ZA 2X6BA 5FZMA 1UKRA 1AL23 4FPCA 1Y9GA 3E8GA 3AMPA 1RUG2 1G9BA 3N9MA 5FZ7A 2QBXA 1VF5B 1IGOA 5CB4A 3KM5A 2VM9A 2EZOA 1R64A 1XYPA 5FPZA 1NVPD 1MQTB 4J9YB 1DQ6A 2CTPA 2HWE2 5K8SA 3EBRA 1JJ2U 1AYM3 1QNWA 5E8AA 1K5SA 2VS0A 1MACA 2VZRA 2ZS6B 1CVNA 4JI7O 1PMJX 5K7PA 2BZDA 2C9AA 4XDQA 1QJEA 4FP2A 1DGRN 3ZN5A 1QNYA 2ZEZA 3B69A 5KHIA 3FWEA 3T1CA 1C8M2 4UB8Z 3WT3A 1X9TA 2BEOA 1G6UA 2EF6A 4XF9A 1SQPH 5I0UA 1IS3A 1JYXA 4IE0A 4DRVA 4B3RB 1NX9A 3WNPA 2IFWA 4JGZA 4GH4C 2WNUC 3T3YA 4I3GA 1AL21 4YJ2B 1REDA 2PLV3 1M06G 3AZZA 3J7LA 3HKDA 4IEQA 5BNOC 2CE4A 4P9XA 4UXNA 2DVFA 4CU9A 2A75A 3LNNA 2VTXA 1PO13 4COYA 5HCHA 3J7NA 3GBWA 1AR82 1ULGA 4RFT0 3CJHA 1YXWA 3RYIB 5J37A 2ET7A 4XPVA 4Q4X3 3POGA 5TISZ 3AG4C 3CC4V 2BERA 1IOAA 3I8TA 4PQQA 1HNZO 4QDRA 1CONA 1XEQA 2QNKA 4GKKO 3BYWA 1JZ5A 5I0TA 3OPZA 4RS5C 4Q1PA 4HN0A 4DR5O 5FREA 4XF0A 3POJA 3K9SA 5FOBB 2BTQA 1WW7A 3U10A 2NN8A 2VQAA 3CRMA 3CHXA 4DFSA 3DECA 3K9AA 1ZUQA 3LNMB 3FZ3A 1QCEA 4CH4A 4XJWA 4CDWB 5ANQA 2J1TA 2CAUA 3CSXA 2D6NA 3KQ4B 5BR8B 3WNKA 4JGYA 3CCQV 3LIHA 1M56C 1UY0A 1QHDA 3K4AA 5KAFZ 2CWMA 2VQFB 1RUD1 4B3SO 3AB0A 1W8NA 1PO11 3JD72 3VOUA 3RYCA 4Q4V2 2XTAA 1JYTA 2WNVB 1AYN3 3VZLA 4Q4X1 2KR2A 1S5LZ 3S7EA 4LBNA 5LMUO 2B4KA 4BIOA 4ASUG 1VRBA 3L75H 3NSTA 5A3OA 1PVC2 3CMEV 4LK7A 5KXEA 1W05A 4QU2A 1K34A 3PMSA 4UFZA 1AL22 4AFDA 4OUEA 3GXUA 3HT2A 4HPKA 5DAXA 3CP1A 4PCRA 1VQ8V 1QJU3 3RWRD 1SQGA 2WQ8A 2AHZA 5JQGA 1UN1A 3UETA 1JN2P 3U1XA 4CH5A 3P30A 5FNVA 3ACFA 3V0AA 4TV8A 1UFIA 1W9FA 1BVP1 3M3QA 5LMNO 4P30A 1AYM2 2CGPA 3SGIA 1EUUA 5GZGA 3HQXA 3I59B 1K45A 2ZX1A 4EN6B 3T4VA 4LCUC 3VDCA 2VULA 5L3FA 1H2LA 4NWVA 2DVBA 2ZGOA 2UU8A 2YEVB 4DV0O 5FXVA 1AYN1 4LKFA 4PDWA 4A44A 2JDZA 4QPIC 5CBLA 1OQEA 4EZ4A 4PF1A 1JZ7A 5KHJA 1XI1A 1SRYA 4DQAA 4K3AA 5A32A 2PLV2 4BCUA 3A23A 1SFYA 1NCQB 1QJU1 3ZFEC 3PN1A 2GMMA 5CG9A 2AACA 2OZ6A 1NCRA 5FPOA 1GR3A 2QZ2A 1PO12 2WABA 3OE7G 5GLVA 5LBEA 3VBRA 2C5DA 2OIEA 5LRRA 4XJ8A 2Y69B 3OCPA 4IHJB 3IZOA 4WVZA 3TK1A 4XJAA 4QHBA 2K2SA 4JI8B 3QH7A 5FWEA 4D69A 4UCVA 1W59A 3LDBA 4IT5A 2F6BA 5FMDA 1W9SA 1JOJA 2AZ2A 3WW4A 2VTFA 4OQ8A 4XJUA 4OX9B 4P08A 5GZCA 3AZWA 2WLLB 4NE9A 3UL2A 1NTZH 4CU8A 2P22C 4XFHA 1D4M3 2RDSA 2ZEXA 2H94A 1X33A 4LJHA 1UIJA 2D6KA 4HFSA 4KMQA 4QX0A 4Q0PA 3N2GB 2ZNJA 3CL1A 4MTXA 2V72A 3OPWA 3WOGA 2UU9O 2JECA 5T50A 2VVDA 2DUQA 3KGZA 4NRPA 4MZUA 4Q0SA 1YRZA 4QDQA 2Q6AA 1ZBA1 2EA7A 2UUBB 2VMFA 3RI9A 1VMGA 2QE3A 1CAWB 4MSVA 3MW4A 4JYYA 4NROA 2XT9A 5IY5C 4FPKA 3AC0A 5K1PA 4EB6B 2FCUA 2VNVA 1RSOA 2JE8A 2JG9C 5B5EZ 2X29A 1DZTA 5FO9B 3ZRWB 5AG2A 5E79Z 1QJU2 3LB9A 2C1FA 3INAA 4NMIA 2JS3A 2VOKA 3WY6A 4FLUA 1OOPB 1V6NA 2JE9A 1D4M1 2QZ3A 3OEHG 3SYPA 3H50A 5JOZA 1T2XA 1KITA 5ABJC 1S0GA 3RDIA 4ZXKA 1FXKB 5I0DA 4BU2A 2P2KA 2CGNA 4I0XB 3AG2B 3RSJA 2GMEA 2FL4A 3L9JT 4ZU5A 2E3CA 2EIJB 2PTMA 4X6RB 4LNUA 2QWQB 3MW3A 4UFMA 4KU7A 4EN9B 4D6SA 3MLLA 2HLEA 3TB0A 2DUOA 1Z0HA 4GJZA 3SITA 1TNFA 4WVMA 4YW1A 4ZS2A 4WM7A 5ACA1 3I3BA 1VBE3 4FFIA 3CEIA 4DR4O 1X7NA 2ZHNA 1N1VA 4YW3A 3ZHRA 4ZONA 1G86A 3THTA 4CDUB 2LFRA 4MW8A 2CTWA 2ZGPA 5JMOA 4ASKA 2UXDO 2PYTA 2JB8A 2KM2A 5KXCA 3BUCA 3AMQA 2OW4A 1C3HA 4J7JA 2VU9A 3GB7C 3LQCA 4C8DA 2KG7B 5AVPA 1H2NA 2G1MA 1AL0G 1OI6A 1QDOA 4ES8A 4P9LA 3AYAA 2BV4A 3B94A 3SYOA 1W6PB 4LOSA 2VZ3A 5IFPA 1HNWB 1UKGA 3RYPA 1S2EA 4LWSA 3THOA 1YITV 2JVDA 2ZOEB 1NZ6A 4IE6A 2JX9A 4FLZA 1KQSU 2OQ7A 1PGSA 4Z82A 3OFNG 4X1YB 3G4SV 2ZGQA 4KL1A 1UNBA 4ZU7A 3DYOA 1ZX5A 4QT6A 5CB7A 5L19A 1WLWA 3PUSA 4IDZA 4YJ2A 4BQ2A 4DXWA 2J42A 3CB2A 4GX5A 3VV1A 1N1TA 3ETPA 3ASOB 3THCA 3R4UA 4XUOA 5A7SA 3UKTA 3IMMA 2NMOA 1XMQB 2HEWF 1R3JC 4XJZA 4PHZA 4J41A 1SLTA 1ULPA 3WX5A 1E5IA 2WS93 3QO7A 3WDYA 3ZN4A 3VD4A 3AKTA 5DAVA 4YPJA 1P7BA 1F15A 2Q4PA 1H6YA 3FX7A 3VD3A 1P8JA 1V6MA 4K7JA 4CSWA 4NIHA 1S5JA 5ERLA 2WWUA 2GMPA 4ZBMA 2NZ9A 1SQBH 3TEZA 4PF5A 4JQTA 5KUMA 4YLZA 1KYOF 4LQRA 3HAGA 4ES9A 3RGBA 4PA4A 3H7JA 1BXHA 4K40A 2EXIA 1W04A 2QQWA 5DQ0A 1SACA 3OGSA 1L3JA 2ZGSA 2EIMC 1MS5A 1VBE2 4AFCA 4X20B 1JYIA 1MABG 3PUHA 4ET7A 4M01A 1XSRA 5LA2A 4ZKTB 3MBWA 1ASJ1 1XL4A 5H9RA 1QJX2 4MGSA 3LFIA 4I5SA 1P49A 4JTCB 4UV8A 4JTAB 3R4DB 1G9CA 4DS0A 1XILA 2N74A 3H42B 3JSNA 3UYJA 2CH7B 3BIWE 4XAAA 5EZYB 3ZVXA 2PHRA 2GNMA 3PHMA 4BQXA 1J3QA 4I55B 3FAVB 3CBNA 5F2SA 3B4SA 1VBB1 2AUYA 5IJ9B 4YW5A 1J59A 1ND3B 2VW0A 3WB1A 1AX1A 4Q4W1 4GWNA 1RUF3 1ND2A 2IXLA 4R8CA 1I94O 1LU2A 5BNPB 3PIJA 3BPZA 4JI2B 2X5IC 4JZRA 3VBOA 3OYWB 4B1MA 2I2SA 2LROA 3IGAC 4N8MA 1R083 2GTAA 1O5LA 2RG4A 1THZA 1STMA 5DM6V 3QO5A 3E5QA 4FTEA 5JDBA 5JVDA 3J7MA 2R7EB 1X82A 2VNRA 2CAVA 4XJ9A 4CRQA 3OSDA 4NVPA 4IV3A 4IV1C 1ZVFA 5FP9A 1UZYA 4OMDA 1VQPV 2N05A 4AGGA 4OUSA 1NZCA 3SKVA 4O4LB 5J2TB 1RUF1 1U5YA 4CC6A 2CSGA 2AC1A 4QX2A 3TYJA 4HZ3A 3M8AA 2WS92 3ES1A 5A33B 1UMHA 4I09A 3JAWA 3OTOO 1TUEB 5FZOB 4CS3A 1R081 3BPSA 3SLIA 5BNNC 2ZMKA 4ZOLB 1VBC3 1AVBA 1RM1C 3IPVB 3NNFA 2XQXA 2A6VA 2C24A 2OTLV 4AHWA 4F6RA 4MVUA 1FX5A 3KV4A 3B7MA 1WNSA 4XEZA 2R9IA 1Q8IA 1TNRA 4YY3O 4ZI7B 4JKKA 1XHXA 1I5XA 5FQ0B 4AFAA 3ZLIA 2ZABA 2P5OA 2Q30A 4TXWA 2GN3A 1NT0A 4COWA 1DGSA 2VOWA 1RXFA 4CU7A 4GULA 2JEUA 2VG9A 4NB5A 1NE4A 1WP7A 4DV1B 4AHZA 1XHZA 2A1XA 4NJ4A 2JDHA 5DG2A 3K59A 2BCCH 3QCWA 2I07B 3CJIC 4JV5O 2YY1A 2ZZQA 1US2A 4M0HA 1WB8A 1OQDA 3CNAA 4M3CB 2ZCEA 3BIEA 4OPHA 3SKJE 4ABMA 3JD3A 2Y34A 3JYCA 3S3XA 4U7NA 1LRHA 5JSOA 4O4IA 3VLBB 2EJ7A 3ZMNA 1SQQH 3E8HA 4LFCB 1UJWB 4FM1A 2V09A 3O0WA 3J81N 1ULCA 4E4EA 2KSDA 4GKJO 4DW1A 1LGBA 4Z2AA 3ZSMA 3TEYA 5KMGA 4IL7A 5JOWA 4DINB 1M4WA 4TT3G 1R6KA 1XMOB 5TSWA 1CESA 3USSA 4YW2A 4LUKA 2PHLA 1IKPA 1QU0A 3FUOA 1O8PA 3MPPG 3ZFGB 1TME1 2EIEA 1QKQA 3MF9A 1Y76B 1PO23 1S1AA 2LM3A 1W8TA 3ZRVA 5I8YA 2JICA 2ATFA 3PIGA 1LNQA 4UW6A 4H37A 1F5FA 3TBDA 3JQXA 1P7GA 1KXGA 1KUQA 5FFOC 3DEMA 3CCVV 1R6TA 1YHQV 1YCIA 2EIKB 5JWPA 1UMZA 2P3JA 1B35A 1O3SA 3FHIB 2HHHB 4FPLA 1DU3D 1PL0A 4PIYA 4A42A 5JXGA 1JH5A 1AJQA 4X65O 3AJZA 2X09A 1EV13 3EVKA 3ALQA 1V0AA 4OHWA 4I30A 2DVAA 1AP6A 2IBZH 4IYIA 3MLKA 2Q0OC 4JTDB 5FWJA 1CZTA 1NY71 5C4WC 1I6XA 2DQ0A 4QX1A 5AFBA 1PO21 1VBC2 2RDNA 1SFNA 4V2WA 5C5TA 4BIZA 2EIBA 2I74A 3KF3A 2B5HA 1CJPA 5JCTA 4FFBB 2DTYA 3KF5A 4IEXA 2XB6C 2NR5A 2SLIA 3S6PA 4CDQA 1D5NA 1OZ0A 1CN1A 1JODA 4TN7A 1JXNA 5A2QN 1G9AA 3HB3B 3E35A 1GMGA 2FDHA 4JC1A 4PD4F 5M0TA 5KXDA 5IYYA 3GWKC 4DV7B 5D8AC 1YI7A 4YVSA 4F4LA 1ZREA 1M5IA 1YQ2A 3D36A 5BXXA 1YTFD 1OCOB 1G9DA 4MADA 2VZQA 1HQNA 4YVWA 5LP6C 1K12A 2NQYA 3GDBA 2Q8CA 3KV6A 5HV0A 5K0UB 2DW4A 3KT7A 3OAAG 4KWKA 4RQPB 4B3TO 1IVSA 4XDLA 1OHFA 1APNA 2YHJA 3O1PA 2WIIB 2ZX2A 1X50A 2JJ1G 3G80A 4GCZA 1OV9A 5BMVA 2XVGA 1V6IA 1WA8A 4KHPB 1YQ6A 1NUKA 1O9GA 5FY0A 1S4CA 2I45A 1DFQA 2WRAA 4MSWC 2FKXA 4TWKA 4ZS3A 3MIHA 1U5IA 1TAEA 1L0LH 3AG3B 1L1FA 3IAPA 1Y4MA 5EIYB 4L8JA 2OCCB 3SYCA 1U5XA 2ZGRA 1S2KA 1YYNA 1PO22 2YG0A 4BPZA 1W03A 3H0OA 2VOXA 5CMUA 3ZYFA 2JJ6A 4Q27A 2WNOA 4JI3O 1IBLB 1PNMA 2UUCO 3KCXA 2B7YA 3EFFK 1N36B 5APAA 4P9IA 1XNRB 2IXJA 1YQ8A 4LE4A 1PZ9A 3HT1A 3F95A 1GP6A 3W7TA 2D5HA 3VBSA 4DR1O 3NJVA 5B1BC 4JDNA 2HH9A 4GZ9A 2BGOA 4NXNB 2WAOA 5EYPA 1KU9A 1PNLA 4QX8A 3BALA 1VQLV 1N0JA 1HRI3 2W68A 2W1QA 4XBLA 3UKVA 2CK3G 5CKQA 2ZDIA 1EV12 4QQPA 1UAIA 4Y1YA 4AEMA 2J1SA 2XUMA 2VNOA 5F32A 3ZYIB 3J4UH 1Z2GA 1PIV1 4X66O 1AR63 3USUB 4Y5SA 5AVAA 5FZLA 1IG0A 4ZHQB 5LHGA 4P9YA 3FN9A 2LJ2A 3PUAA 2QWPB 3I2IA 4CCEA 5H2FZ 5LA0A 5IK5A 5FUIA 1XNKA 3OEAA 2RR13 1GNYA 5F39A 1DQ5A 4TLGA 4AQ2A 2W1SA 1ZSPA 3OOXA 2XR4A 4DUYO 4WFGA 3GJAA 5DAQA 3NRUA 4CEWC 4R9CA 1WMXA 1SCSA 1WZXA 2PY5A 2PAKA 2XWJB 3POEA 3SDLA 3D5OA 1XPWA 3FMGA 4FPFA 4PV1B 1HRI1 3JCUZ 4DUVA 4CUCA 2O0OA 3H1LH 2UY8A 2OWOA 3A2FA 1NA1A 2VCMA 4HLTA 4AL9A 4JKMA 3IIAA 3N2KB 1F2NA 3VDBA 2WR9A 4O4JB 1AR61 2P4KA 4C0BA 5EJZB 3F5WC 1MEC3 3CF6E 4UFJA 1LAJA 1NLSA 4QXHA 3OGCC 3ILRA 2XXZA 3AK3A 1H8TB 3CLPA 4FFKA 3VD7A 2RR11 1N1SA 1Q8VA 2ZMLA 1N32B 4ARXA 2BSKB 3UT5B 1OPMA 4E4ZA 1O3RA 1DLBA 2BQPA 3NAPB 5JPNB 3I49A 1I5PA 3M2MA 5HCBA 3R05A 3JASB 1PM7A 4BDVB 3JUUA 4E2SA 1I3HA 4GIQA 3EQEA 2VXJA 2NP0A 1B09A 5FZ1A 4UCTA 3VZOA 1S0DA 3FB8C 5LBQA 3O0XA 3PUIA 1G1XB 3WG7C 1W8FA 4BXSV 2LQTA 3ABMB 1LNSA 4CTEA 5L3EA 2WNUA 4UCSA 1DGWX 1MEC1 3X2QB 3POSA 4NPLA 1S72V 4DV6B 5J48A 3RMXA 5CIRA 1Q5OA 4MVQA 1NTKH 3RWNA 5HFLA 1WW4A 1WN7A 3TXSA 4XC9A 2Y6FA 5EC2C 2GUZB 5LGTA 2GNBA 1HIXA 4K0KO 2W39A 3WDVA 2GN7A 3WDXA 4ITCA 4AILC 2K0GA 3UO2A 2ES3A 2JDUA 1JU4A 1ENRA 1PM9A 1XDCA 3WD5A 2IXHA 3I2DA 3D4KA 2V4DA 4UFHA 1AR62 2GC2A 1G7YA 4MXVA 4H7LA 5CFDC 3BTYA 3LEKA 1FV2A 4X6QB 2RNBA 4N9IA 3MICA 2RR12 2ZKNA 4BLIA 4WCEV 5B2GB 5H9PA 5JJJB 5FY7A 1NT2B 2WO2A 2KXLA 3ABZA 2ZM6O 3E1F1 2OCHA 4X64O 3M1HA 3L70H 3RYHB 3WB2A 2LRPA 5BUVA 4RGKA 5JZGC 3I56V 4QPGA 1EN4A 4HVRA 4N53C 1W39A 4YGDA 3LD8A 2JGUA 2RMU2 1K73W 1GK9A 4CH3A 2IXKA 3MI8A 4DR2B 3ETEA 3WR0A 3ZCCA 1WCKA 2WLNA 2AHYA 4KGQA 1JOPA 1PL4A 4IEUA 1M57B 4W4ZA 3VKMA 4LMFA 1W3XA 2VECA 3VBFA 3SH4A 2A7WA 1LUVA 4NUBA 5C93A 3TEWA 2JJ2G 1OLME 5DDJ1 5LGNA 2QEXV 1E5SA 2VW2A 1J95A 5J2UB 4O4HA 2GU9A 2Y33A 3DYMA 5FPVA 3JU9A 1HRV1 5A80A 1MS9A 3I4IA 4RYDA 2VBPA 3SPGA 5L7OB 1EY2A 2ZQMA 5IAVA 3PTYA 1YI2V 2QDNA 4MVRA 1TVKB 5IVVA 3KQRA 3K03A 1WCQA 2A6ZA 1CX4A 5F3IA 4JGSA 3N7JA 5A7WB 2ZEWA 5J98B 4IIJB 4E27A 4WM8A 1GKFA 4AR2A 3U4SA 4U7OA 5H5NA 4GT1A 1TE1B 4AEKA 4JGYC 3VD9A 1N34O 1HNXO 4XUQA 2ZPXA 2XOMA 1CAVA 2YBSA 3ZN6A 1R3LC 4UW4A 1M1KW 3RW0A 4MW3A 4XE9A 2FTKA 1SBEA 3W21A 3ZIAG 2Q69A 2QA4V 5B4NA 2E5LB 1W6MA 5FPUA 3RZGA 1IBKB 5LBFA 3ZYHA 2CU5A 3MIDA 4LF6O 3DPRA 3JAKB 4META 3BVCA 3KGLA 5J9PC 5FRAA 5AFEA 1GNHA 3SJQC 3TGUH 1C57A 3DV8A 4E2QA 1JZ2A 3HKCA 4LF8B 1QR9A 3ASNB 1H0BA 2IZWA 4Q20A 4ICGA 4XZUG 3ZXFA 5A3MA 4HNAB 5IJ0B 4IW3A 1H9PA 4AQYB 1AR73 1MZ6A 1UIKA 2E26A 1NLQA 3OBAA 2OUJA 3K57A 4HKLA 4GX2A 3CYOA 1AXZA 2EVXA 1SDWA 4FZ0A 1JHNA 3ZSLA 3W58A 2QR4A 1PPJH 4XOGA 4E4DX 2WLIA 2YSUB 1V55C 5FY8A 3D6EA 3N9PA 3ZHVA 1RMU1 2ZD9A 1TVGA 3OR6C 5JAXA 5CFCA 4RL7A 4MVZA 2CGOA 4PDWC 1SA0B 2LO1A 3TN91 1VQNV 1MSDA 4BOWA 1OBNA 1UY3A 4B4QA 3HKEB 4IEPA 3RG0A 3AYEA 4R52A 3S5AA 2PMWB 2W0XA 4PI2A 3E2EA 2DCKA 1FKAO 3PL0A 2FD8A 4IERA 5EJ3A 1Y4WA 2ZAAA 3N3HA 3AYCA 4EWDA 5GTHZ 1KP2A 2QWNB 3GZTB 2UXBB 2FHRA 2JG9A 1J5EO 2X05A 3VBRC 3DGTA 5HPOA 3ZHTA 5JIAA 5E88A 3MEPA 2L9LA 1HLCA 2AREA 4IGQA 2F4VO 3UJQA 3OY8B 2VTXJ 3VB9A 3I2JA 4BR6A 4PA9A 2HWC1 5C5UA 2WLJA 1Y9MA 1BZKA 2NMNA 1AZDA 2A0LA 5FXXA 4YGCA 4WFHA 4LF5B 5E6HA 1RUC1 4J7KA 3GNEA 3PMEA 4MGZE 1SPPB 4LBKA 2MNGA 2OUHA 3LPGA 2ZBJA 5EZWA 4XUPA 5DAWA 2ZR3A 2HWD1 2K9ZA 1KMIZ 3VDDA 1GLHA 3KV9A 3AK1A 4DV2B 1C1FA 2JIJA 1XOUA 2D3OW 3ZDSA 5IT9N 3IB3A 3HJRA 4GALA 1W0OA 4RD7A 4ZKIA 3N9NA 1BMV2 1QLEB 2WLMA 3K3WA 3ABKC 1NI8A 4DV5B 3F7YC 4J10A 2VRZA 4JX0A 3CCEV 2EILC 4AAPA 4LF9O 5C8YA 4FIPC 2B9UA 2UWBA 1IBMO 1SDDB 1KGYA 4TV9A 4MTGA 4AI9A 1HWYA 3OUJA 1RJ8A 1TUBA 1DF0A 5LGUA 3WDWA 1GZWA 4E8DA 4A3XA 1EN5A 1RVF3 2VQFO 4QQOA 1PK6A 1G6NA 2VMHA 1AR72 3APOA 1ULFA 1UPGA 3NL1A 1UYZA 3L71H 5A3NA 1FPN3 3JARB 1IPSA 5FYMA 1QIQA 1Q82W 3AXDA 2DJVA 2VUJA 2W2IA 1YIFA 2DCYA 2Q73A 4QJFB 1NS1A 3DCQA 4U3FH 4WBNB 4UFIA 3I7DA 1OD5A 5BPXA 4A45A 4N9HA 4NR1A 2CNAA 4Y22B 1GAXA 2Y0OA 5B66Z 1QLNA 2VPVA 3E22A 1OHHG 2PHFA 4LLOA 3N7MA 4HN1A 4LXLA 2C4XA 5K4LA 2ZXWC 2XH6A 3CX5F 4J42A 4JI6O 4YWAA 1ST8A 4ZHNA 1QU7A 1V54C 2BUKA 4D8MA 3NJXA 1BBT2 1YIJV 2X6CA 2Q8EA 1ZZ9A 1AP5A 1RVF1 4FXGB 1SEFA 4B29A 4N21A 1O4YA 5FY1A 3R6SA