5KHGA

Hcn2 cnbd in complex with cytidine-3', 5'-cyclic monophosphate (ccmp)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
200
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 59
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khgA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khgA02
2Q0AA 2VQAA 1CAWA 1TQ5A 1Y9QA 4A2UA 4TLFA 4AVCA 2VECA 5EFUA 3SHRA 3OCPA 3PNAA 1QY4A 4LUMA 4MGIE 2EA7A 3WW1A 3NVCA 4PIZA 4KL1A 3G7DA 1UCXA 2MNGA 3DKWA 1O5LA 3E5QA 3SCFA 4MH0E 1RC6A 3EJKA 4ZU4A 3FFQA 4EWEA 4JVAA 2ZKLA 1O3SA 1ZVFA 3S7EA 3IWZA 4FAHA 4IEVA 5FQ0B 1EPZA 1O7FA 3NL1A 2QVSB 3FE5A 1FI2A 1DZRA 2GAUA 1X8MA 1CAXA 3ROUA 4P9GA 3IDBB 4IEQA 3ACLA 1O5UA 5I0UA 4O9GA 4HVOA 2GC3A 4IETA 5FDBA 1U12A 2Q4SA 4QMAA 2ET1A 4LA3A 1ZRRA 3S0MA 2BGCA 5I8TA 1O4TA 4IESA 3CF6E 2B8MA 4KWKA 2UYAA 1ZRDA 2H6CA 3MYXA 4H7LA 1SFNA 2OYZA 3H7YA 2OZJA 3GBFA 3OF1A 5FPZA 1CX4A 3EHKA 5I0RA 2XLAA 5BUVA 3CO2A 1CAWB 2WC2A 4XF1A 3M70A 4MGYE 4E2SA 4AQ2A 2PAMA 4XFBA 4AQ6A 3IBMA 1EY2A 4EROA 2GZWA 5LEJA 4MGKE 4F8AA 3CLPA 1EYBA 2Q1ZB 4MV2A 4WVZA 4UXAA 2PAEA 2CV6A 3HQXA 3M3IA 3LWCA 1CAUB 4IEYA 4ORFA 1VR3A 2C0ZA 4Q0SA 1I6XA 4HSJA 1ZZ7A 4XFFA 1Q3EA 3SXWA 4D7TA 4BH9A 2E9QA 2D5HA 3BPZA 2GC1A 4PIYA 3UKNA 4ONUA 4Q0UA 3ES1A 4IEPA 4XETA 3MZHA 4I01A 2XL7A 3QOPA 2WFPA 2F4PA 4XF9A 3KGLA 2QNKA 3ES4A 4META 1G6NA 2PA7A 4FBFA 5I93A 2XKOA 3BB6A 1QXJA 4N9HA 2ET7A 4HBNA 1DGRA 3HT2A 5CU1A 2BEOA 4BIFA 1J3QA 1J3RA 3CL1A 2UY8A 4XEZA 1ZZ8A 4HLTA 4I0BA 3U11A 3I59B 2CAVA 2P17A 4UBGA 4MX3A 1YLLA 5JSPA 1X7NA 5JCTA 1O3TA 3E5UA 2I45A 4MZUA 1ZZCA 4JTOA 2Z69A 3SMHA 3JZVA 1QXRA 4XFGA 3I54A 2CAUA 3ZDSA 5C8WA 3CJXA 4I0AA 3S7IA 2EAAA 1NE6A 5T3NA 3EO6A 1RL3A 4AVBA 3EQEA 4L11A 4WZCA 3TNPB 2FQPA 5JSRA 4QM9A 4Q0VA 3D0JA 3H8UA 1SEFA 1EP0A 2MHFA 5KHHA 3KSCA 3BCWA 2PHDA 1WLTA 2EVXA 3MDPA 3FX3A 3H9AA 3NJZA 4WBBA 3C3VA 1IPKA 4RD7A 5I91A 2ATFA 3IDCB 5KBFA 3H1MA 3H7JA 3FHIB 2N7GA 2BNNA 4QGLA 1NYWA 5FLHA 1CAVA 2OPKA 1ZX5A 1ZREA 4PIXA 1GQGA 1H1MA 4DINB 4I2OA 4EV0A 1RTVA 3HIFA 2XLFA 4ZU7A 2OA2A 4JTNA 4GULA 3LOIA 2D93A 2XHKA 2FMYA 3GYDA 4XFCA 4HZFA 5EZWA 1Q43A 1ZNPA 4XFIA 5I8YA 3KCCA 3E6BA 1J1LA 1LRHA 2QJVA 2DCTA 4LLOA 2HKXA 3H3ZA 4N9IA 2BYVE 4HMZA 3IIAA 3R6SA 1LR5A 5E1RA 3ELNA 5BPXA 3PVBB 3LA3A 4Q0PA 1J59A 3H1YA 3E97A 4NVPA 1XRUA 1YFWA 3LA7A 5KHJA 2V09A 1WA4A 3H1WA 1QWRA 2IXHA 3H50A 3KMHA 4Z07A 4HN0A 5AVPA 1Y3TA 3L2HA 4B29A 5BY5A 3H3UA 2PHLA 4BYYA 5HI0A 4LEJA 1NXMA 2Q30A 3RNSA 4D7SA 4XF4A 1X82A 1O3QA 4IEWA 3E6CC 2XL9A 1OMIA 1CAXB 1DGWA 1YFYA 4LULA 1WGPA 1YHFA 4QGMA 1L3JA 2Z2SB 2O8QA 4FT8A 4I09A 3VHRA 3FZ3A 3FJSA 2PTMA 3ST7A 1CGPA 4E2QA 4XF0A 4YNIA 2PYTA 5FCCA 1LB2A 4EWAA 5KHGA 4OFGA 4XF3A 4IERA 1ZZ6A 5JR7B 1OD5A 3RYRA 1ZZBA 2PFWA 3BALA 5D1IA 5E16A 5LEKA 3OD0A 3RYKA 5J7MA 2IXIA 2GC0A 4I02A 2IXJA 2PAKA 3I7DA 3D82A 1GQHA 1CAUA 4X6RB 4E2GA 3FWEA 3U10A 1RGSA 1J3PA 5BXXA 3RPQA 2GU9A 4LUKA 3QACA 3UKVA 2UY9A 4KU8A 1X8EA 4QGNA 5I0SA 5CADA 2MPFA 2XKPA 2D5FA 1O3RA 4Q0QA 1YUDA 3KGZA 3HT1A 4R52A 3SCHA 4LA2A 3BU7A 1LKNA 5KHIA 4I3PA 1RUOA 3CEWA 1XE8A 3N4MA 4IEZA 1DZTA 5C6CA 1RUNA 3LAGA 4IEUA 3E5XA 3OGJA 1VP6A 3DL3A 4LTAA 5FPXA 1YWKA 2B9UA 2XLGA 2BNMA 4XFAA 4KU7A 5JSOA 3MPBA 5CVRA 2CGPA 2D40A 2VPVA 4ZU5A 3PLQA 4J1WA 1I5ZA 3LZZA 2K9ZA 1UIKA 5J48A 2QCSB 4HVQA 3RZZA 3SCGA 2B5HA 5J3UA 1OFNA 4R8HA 3WW2A 4PJYA 3RYPA 4YYOA 3OTFA 2ZCWA 4BHPA 3WW4A 2GH2A 4HVRA 3I59A 2KXLA 4HSLA 2IXCA 4YSFA 4UBHA 1V70A 4KWJA 4YARA 1ZRFA 2QDRA 2K0GA 2BNOA 4IEOA 3TNQA 1YFXA 5K8SA 1OI6A 3UKTA 2IC1A 1UD1A 2XGXA 3DV8A 5I8SA 4FAGA 3LA2A 5JAXA 4X6QB 4L2NA 5FQ0A 4CYDA 1YFUA 5FLJA 4AXOA 2IXKA 3ETQA 1UIJA 4HN1A 1H1IA 5FLIA 4IEXA 1PMIA 2PQQA 4K8FA 3EBRA 1XE7A 1J58A 5I0TA 1VJ2A 2IXLA 1IPJA 3B02A 1FXZA 1NZCA 4EWDA 4J1XA 4MGZE 3NKTA 3WW3A 3U0ZA 5KHKA 4MUVA 4O9EA 2O1QA 4QM8A 2H0VA 5BV6A 4QX5A 4KWLA 1FT9A 2Y0OA 4QXKA 1NE4A 1HW5A 4JV4A 4YRDA 1JUHA 1Q5OA 4AVAA 3NSTA 1ZRCA 2HJIA 1UW8A 2ETEA 2GC2A 3D0SA 3DN7A 3RDIA 4F7ZA 1SQ4A 5F1RA 1ZZ9A 2OZ6A 3E6DA 4OLLA 4XFHA 4Z82A 1CAVB 1UPIA 3NW4A 3USSA 3O14A 5LRSA 2H6BA 1PM7A 4Q29A 2UYBA 5LRRA
chains in the Genus database with same CATH superfamily
2Y34A 2NZ9A 3MICA 4TLFA 5H9QA 3SHRA 1B35C 5FZ4A 4BQYA 4ATEA 2OQ6A 5FPVA 1POQA 2ZDIC 4NHLA 4TV9A 2ZNIA 1XSQA 2PHWA 4NPMA 4FVMA 2VO5A 3UYJA 4C90A 4QNHB 2JECA 1W99A 1GWLA 3INAA 4CC5A 1VBA3 4FFKA 2BE3A 3WX5A 3CRQA 1RUE3 3ZFFA 3OGVA 4EJRA 2XASA 3ACLA 4O9GA 1K4CC 3LPGA 4BQXA 4CDXA 5GLVA 4FLYA 3JCZA 1W8FA 2HWD3 1SLAA 3G71V 4JHTA 1AR5A 1F9KA 1AP6A 3K9AA 3OTOB 2ZKOA 3GJAA 2YV8A 2W6JG 5C93A 2JKXA 3RG0A 1A78A 2CV6A 3HQXA 1GNYA 2RMKB 4XJ9A 4ORFA 2WWJA 2EICA 5C3RA 2X6BA 1G4YB 2RM21 2WYSA 3K5OA 4R4ZA 4RS5B 1PO23 1S77D 3MZHA 4BLJA 4FTSA 3VBSB 3HPNA 4JQTA 3K51A 5LA2A 4C0HA 1K34A 2OVUA 3AMHA 3PVOA 1WBLA 5I93A 4GZRB 1RIRA 3BB6A 5GZFA 3CDZB 1UXZA 2ZE7A 1W0KG 4HBNA 4M4PA 2V1DA 2VBBA 5CU1A 1QJY1 2UXBO 3N7JA 5F5QA 2OXBA 5FZFA 5DAVA 3AM2A 4JGYA 3ABMB 3NNMA 2RS31 1HR0B 4UFIA 4YJ2B 4P2ZA 3KCYA 1M93A 4HFSA 1CX1A 3GJBA 5F2VO 5CBLA 2ZACA 5JVDB 3J8F1 2PHRA 3RZLA 2GDFA 3RYHA 2Y64A 1VPHA 4GD4A 4AQSA 2XJRA 3JATA 1UKGA 4NKGB 4AVBA 2VW0A 4LBLA 3TNPB 4DV7B 3VD5A 1C8M2 4LF5B 4XOGA 4KNCA 3GB7C 4KUMA 1DZQA 2XJSA 4RFT0 1FJGB 4JYAB 1B6QA 1ZREA 4JI5B 3T4VA 3MHSC 1FMD3 1Y74A 3W7XA 5FUPA 4DV0O 4YZ4A 3MLKA 3FLPA 5FZHA 2AC1A 4O4JA 1SPPB 3HIFA 3NV4A 1SQGA 3K08A 4BQ1A 4OPHA 5F6KA 1U5IA 1JU4A 4G2KA 3W5MA 2EALA 2JEMA 3FFZA 5A1AA 1E5SA 3ACHA 2VE1A 3T1HO 1GYKA 3J81N 5E89A 4N43B 4X1KA 3Q8FA 1W8NA 3M7MX 2FZ1A 2YBPA 2BP6A 1L0LH 2ZAAA 3WG4A 1VBE1 4OCTA 5JCOC 3RYIB 1SDDB 1UY0A 5K0UA 1NXMA 3KKYA 1IG3A 3CU7A 5FYYA 1V6OA 4L92A 2XJUA 2BOJA 4IIJB 1PIV1 5HXMA 1YCIA 2PF4E 4S2FA 1R093 1PNFA 3DPRC 5A6XA 4UCVA 3GHNA 4E9KA 3LCPA 3LIGA 4RFRB 4R9BA 3ZPYA 1KP2A 4QPGB 1N34O 3J7MA 1VAMA 3CNAA 4L9BA 4BIUA 4QKBA 1U5YA 4CCCA 2ADQB 1OVSA 4ITCA 2HWC3 3TN93 2IU0A 2A3QA 5KHIA 1WD4A 5L7OA 1NQTA 3A0HZ 1LEMA 2ZNJA 2CUGA 3E5XA 1OF3A 5GTHZ 1WW4A 3RSJA 4LP8A 5JSOA 1SERA 3K9SA 1VRH1 4X20A 2QCSB 2GUZA 2A6WA 3AFGA 3K46A 3QNEA 4R8HA 1UOJA 2XTAA 1YXBA 1H1AA 2YPDA 2IUWA 1N32O 1UYPA 1UFIA 2CU5A 3AL5A 5B1BB 1AJQA 2NN4A 2WZR2 4QE9A 5BZBA 5CA1A 5H9RA 4JI3B 3CRCA 1QHTA 2P3KA 1RUI3 1EAH3 4EB6A 4ZHQB 1WNSA 1D4M2 1W06A 4CU7A 4YW7A 2Q69A 4IEXA 3ABLB 4RN5A 2W52A 4MVRA 3K57A 4ZXEA 1CEZA 2XJQA 3WNPA 2YIDA 4NO4A 5CEHA 3U0ZA 1I08A 4QM8A 4RGAA 5GLUA 2EIDA 2ZEWA 1LGBA 5B4XA 2Y69C 1ULEA 1BK1A 4GH4B 2J1VA 4K9SA 5DECA 1DK1A 2V72A 3O14A 1FKAO 1XNDA 4EZ4A 2P90A 1Y9QA 3BTAA 4P9JA 5GW7A 1JN2P 1OUSA 2YMZA 1QY4A 4QD2A 1KITA 3TK1A 3UJQA 3OUHA 2YXSA 4WVVA 4ZU4A 1PVC1 2LW8A 4EFBA 3Q8AA 2NNUA 3VD7A 2A6YA 2LUWA 3CC2V 3UT5B 5F8PA 2EINC 1PM4A 3FUQA 3ZFEC 4ZI7B 3FE5A 1AHSA 1R1A1 3VBBA 1XOUA 4DR3B 4DRXA 4FZ1A 1QJEA 1RINA 2JG8A 5FP7A 4D3WA 5FDBA 1YQ2A 4QB1A 1ZRRA 1L7RA 3JQXA 4QX0A 1WCQA 4Q4V1 1XXNA 1O4TA 5IJRA 3ZN6A 4OGQB 1UMHA 4AYUA 4H7LA 1POV1 2X53S 1IBLO 3GBFA 1GN4A 3WP4A 1KB9F 1KKCA 2HKOA 4QB6A 3AJZA 1QJU1 2PAMA 1NY72 2ZD9A 4CS4A 1JOYA 3WB0A 5EBWC 4UWDA 1NU1H 1PNGA 2FTKA 2E6VA 4LFBO 1YIJV 1LNQA 4GWIA 3WG2A 4Q0SA 3ZN5A 2E5LB 3B3QE 4HSJA 4IHJB 5FY7A 2ZOEB 1U97A 4HK9A 3JB4C 3ZHUA 3N2KA 2E9QA 1K8AW 1OZ0A 1YRZA 5C8CC 4Y5Z0 4IEPA 2Y60A 2WZEA 4JTAB 4X1IA 2NMNA 2ZIMA 2EXHA 3VL9A 2QNKA 5FPOA 1XYNA 3MF6A 2ET7A 2PHXA 2GNTA 5FZGA 4HXCA 1FPN2 3V64A 2V5YA 1O3TA 3SISA 1VQ9V 2ZZJA 1B04A 1W8ZA 3I54A 5FZ9A 2W6IG 1Y9GA 2CTWA 5LL6Y 2PHUA 2V73A 4FPGA 4ARXA 4DV3O 2QWPB 4QPIA 1TNFA 1WLTA 5FK8A 3BRCA 4NXMB 2Q4PA 2W3JA 2WQZC 1WA8B 1P84F 3EYPA 1AJKA 4ASUG 2JDPA 4Y20B 3EHBB 3VQXA 5IVVA 1B3QA 3T0AA 3HKBB 4P00B 4A42A 2ZAHA 3OG2A 4X8NA 2A3WA 5EXOA 3JAKB 4DMIA 1OLME 3O1PA 4MYEA 2WS92 3ZRWB 4MGSA 1QLNA 3QG5A 4XFCA 3AK0A 4HZFA 3E6BA 2ZCEA 2ZBJA 3I2KA 3VKLA 4JDMA 2JVDA 2ZR3A 5EK0A 3RZJA 5EC2C 2J1UA 5IK8A 4UFJA 4XPVA 1XNCA 2ITDC 1AR92 4XW3A 4CUCA 1S55A 3NNLA 3H0OA 1PNMA 3WOGA 2X6AA 2YB7A 1DIWA 2ZR2A 5LMUO 2XL9A 4DYLA 1S5LZ 2RMU1 1SBFA 2FDFA 1JZ4A 4HG6B 1EPWA 5IHRA 2PTMA 2PYJA 5IYCO 1AF9A 1ASJ3 5IYDO 1S2KA 4WM7B 3CKHA 5KHGA 3IIIA 1OD5A 4B1MA 2XT9A 2PFWA 3OEBA 5E16A 2R042 2JJ2G 4MS2A 3ZN0A 5FZLA 2W0FC 4R4XA 2X5IA 1RGSA 2GU9A 3WD5A 3ZHTA 2EULA 4QX3A 3I3EA 4LH6A 1S3JA 5AC93 1WMEA 1QQP1 3LSQA 2YIBD 4I7ZB 3VBUA 4IEUA 1V0AA 2R062 4I30A 2DFBA 2P7TC 3AL6A 4PI0A 3D6EA 3T1LA 2BSKB 2D40A 4ZU5A 4J1WA 3LSEA 2UUBO 4YW2A 1UF2C 1AR82 4PJYA 3OTFA 1IS4A 4QJFB 3PUQA 5J98B 1M5IA 4HSLA 1ZRFA 4XYXA 4I55A 3DV8A 3JYCA 5AFBA 1OT5A 3L72H 4PQ9A 4RQFA 3BA9A 4HN1A 3A4UA 1FXKB 1OPOA 1AR72 1WMFA 2VGDA 2VMCA 1MNGA 2KB1A 3POGA 4EFEA 4KXRA 4MUVA 3ZS8C 2G19A 3NNGA 2FCVA 4AVAA 3VDDB 2VMEA 4Q4X3 2QTOA 1QBZA 4XJAA 2F1MA 2KG7A 4B08A 4GX5A 3ZN1A 1LU1A 5DPNA 5IY5B 4O4LB 5L19A 4QHOA 4JRLA 3ZIAG 4UF0A 4SLIA 1E1RG 1TQ5A 3JD72 5EBMC 2ZGOA 3MUY1 3SLIA 2O8OA 2HEYF 5HXVA 3G7DA 3IC9A 3MLLA 3AKQA 2VCCA 4ZBMA 2VUAA 1RC6A 2BVVA 3WZ1A 4AWDA 1C8NA 3URFA 1IPSA 3ASIA 2DVBA 3OUFA 4CU8A 3ASNC 3NL1A 1F5JA 1H4HA 4DR5B 1VMFA 2AGAA 3K04A 3KHBA 2F4VB 1PK6A 4IEQA 1O5UA 5I0UA 4HVOA 5JJJB 3AG2B 3MUZ1 4PDWC 4LA3A 3FUOA 4UCRA 2YI8A 2ZM6O 3THTA 5JOXA 1COV1 1H2MA 4HNAA 2HWE2 2OZJA 4E2LA 1GANA 3RW0A 3FYIB 4GX1A 4CEYC 2JB4A 3ZXKA 4NHYA 4MW8A 3HWJA 4TTGA 4URAA 4W4LA 4CDQA 5EIBC 3HN3A 4WVZA 4D6QA 5A6QA 2BZDA 2GMEA 1IQAA 3RWRD 1V54C 2V4AA 4YVSA 1APNA 1I5XA 1U96A 3N2GA 4LXLA 1H6YA 1N47A 1NLQA 1DGSA 5F7UA 4UCTA 4JI2O 2VM9A 3JALA 4L8QA 1NVPB 2YEVB 4K8RB 4PDVA 1P7BA 4TSVA 4JASA 1XMOB 2V4DA 3MLJA 1BZWA 4CU9A 3ICXA 2O0OA 1H8HG 2WQ8A 3I59B 4UBGA 5IUQA 1YLLA 4IV3B 1RMU3 3TCUA 1SETA 3KD4A 1ZZCA 1KS5A 1FFTB 5A33B 4DNYA 2C9AA 2LJ2A 3VBOB 4NTYA 3P32A 1HN0A 1J84A 5DUVA 4DR1B 4QU1A 4FXGB 3LF7A 5CN0A 4E4ZA 2WAAA 2MHFA 4PF5A 1M57C 2XBO1 1YTFB 3MO4A 4XZUG 3CD6V 5FMOS 4PJ0Z 1ZUQA 2PHFA 5FXXA 3BAAA 4FP2A 3W9AA 4Q27A 4DINB 4LKFA 5H6RA 2XXZA 1VQNV 1CXZB 2X05A 3WDWA 1IDSA 5BYNA 2EIMB 4GYCB 1UZVA 1SKVA 4JTNA 5EZYB 4BZ4A 3N36A 2AUYA 2KQXA 4DV4O 5EZWA 3G6BA 4LLOA 3ZLIA 4CH6A 1ND3C 1IHMA 3U78A 4XURA 5D8AC 1UYXA 4NVPA 4D69A 1EZVH 1BZKA 4Z07A 5F3CA 2WLHA 2YFZA 1QLEC 5BY5A 1N0NA 1S0FA 2RM23 1TE1B 1REFA 2XUEA 2GN7A 3GVMA 4TSFG 3GBGA 3PU3A 4X66O 2ZX1A 4A6OA 4DXSA 1PO12 1S0IA 2BU9A 4FIPC 1OSGA 1CGPA 4ET7A 5FLXN 5BNPB 1PKXA 3RYCB 1DCSA 4PELA 1TME2 2GP3A 4YGDA 2RR11 4MT8A 1QJY3 1ZZBA 3VZMA 2EXJA 1A34A 1Z78A 4IE5A 1BHGA 3SNMA 1VQPV 3RYKA 3VL8A 1RHI2 1S2EA 1EN4A 1XI1A 3SH4A 5GONB 2A79B 4KU8A 3HKEA 4NUBA 1HJGA 2MEV1 2B9ZA 5F5AA 3DYMA 2E75B 3BU7A 4AK3A 1M4WA 4CBCA 3S3WA 4KG8A 4O4HB 2VUJA 3VBSA 1AR61 3SJCC 3IM0A 2UXBB 4KU7A 4NTWA 5FJKA 4LBQA 2QTWB 4P9YA 3ZFFC 2A7WA 1IS6A 4FXKB 5HFLA 2Q6AA 1BK0A 4NB5A 2ARHA 5K1PA 4PV1B 2ZCWA 3WW4A 5LK7B 1ZX3A 1V55C 3C3TA 3NWKA 1CJPA 1AX0A 2XUMA 1FOD1 2VZQA 1NVPD 1Z5WA 1XOYA 3EB7A 5JVDA 3NJYA 1LULA 5EHDA 5EP9A 2ODMA 3AG4C 3D3IA 2GNDA 4CYDA 1NCQC 3WDUA 3M7AA 4OX9O 4GQ7A 4J11A 3RJRA 5JQGA 2CWMA 3NAPA 1XE7A 3U4SA 3QO7A 2BGPA 1JI6A 4YVWB 3AFKA 5FYBA 2NP0A 1VBE3 4A3XA 4JRAA 4DV0B 3LSDA 4K1YA 4BA6A 1NQJA 3Q9OA 5KXCA 3FD9A 4OLLA 1MPXA 1PIV3 1UO9A 4DV6O 2QE3A 4MVTA 2VQ0A 4QAWA 2ATKC 4G9SB 1SCRA 3RVZA 1N4CA 4C1XA 4Z1MG 1HDKA 1JYXA 4QXBA 4Y5TA 1YTFD 3BIEA 4AFCA 1O5LA 3NNFA 5LHGA 5LP6A 2XQXA 4JVAA 1ND2B 4GB31 2AHYA 5FZOA 5C3QA 1OOPC 5F2SA 1OURA 2DCJA 1OC1A 2QQVA 4IIJA 1R64A 1UNBA 4IL7A 3I3BA 4CPBD 4WFAV 2H94A 2WO3A 2Y33A 1JQ0A 1OKQA 3T2TA 3PMEA 2UYAA 1VRH3 1CWPA 1N34B 4OULA 4QWNA 2J7MA 1OF4A 4PBPA 3ZXEA 3PUSA 4XMAA 1BHAA 2LRPA 2BERA 3IMNA 4KFMA 1D7PM 3OJBA 1VQ8V 1OQDA 2QKAA 4DRRA 3CCEV 2HHHO 3ZYJB 2R32A 4JYYA 3K5MA 3UO3A 4QQLA 1AILA 1I6XA 2IU3A 4X64B 5IJ0B 3B09A 3WVJA 4UI9L 1H6XA 1XQNA 4BQ5A 3LD8A 5K0UC 2QKCA 1LOFA 1N32B 5FP9A 2ZMKA 4FBFA 4WM8C 4E27A 1Y66A 5EBLC 3BTZA 3R4DB 3ILNA 2P17A 3TGUH 1UOGA 4COWA 1PM9A 5ANQA 3CWBH 3IDAA 1TUBB 4Q6GA 1GM7A 4AILC 5L3FA 3HNMA 1WB7A 4ZHQA 2NN8A 1C8M1 3SPGA 1PVC3 1SLLA 1M9NA 1Q6HA 3NJXA 1DYOA 4EQVA 4CEWB 3TEWA 3A23A 4UFZA 5JLVA 2E33A 2RJ2A 2DF7A 1V6JA 3C3VA 1IPKA 1R1A3 1S0DA 2VH9A 5FLHA 1OBNA 2WPDG 1RSOA 2DU0A 4I50A 3APBA 1LUVA 2WUHA 1ORQC 1HB2A 1YI2V 4Q20A 1VEWA 4GULA 5FY0A 2FMYA 1POV3 4N8MA 2BBVA 2FZ2A 2UUCO 1HB4A 1IS3A 3H8OA 1UJWB 1N1VA 1AB3A 2PLV2 1Z7S2 2AW9A 5CG8A 3SKVA 5J09A 3UT5A 2CTPA 2IXHA 2DTYA 1NX9A 3JB8A 5B1AC 3W5NA 3CEIA 3T0DA 1W0PA 2LALA 5KC6A 1L3JA 3S5QA 2Q67A 1IBLB 3OGCC 2X10A 4RYDA 3ASOB 5L9RA 3FZ3A 2JD9A 3ZMUA 4XDQA 1KJLA 2A71A 2M6YA 1XMQB 4CSWA 2NQYA 1RUJ2 4OFGA 4NWWA 4N53A 4A3ZA 1WD3A 3CYOA 4LFBB 2AH2A 5ANNA 3H9VA 4AEMA 3POIA 4LUKA 1DQ1A 4DV5O 5A1FA 1WW5A 1K5MB 3BGAA 1N3OA 3CEWA 3SKJE 1P4RA 3F5WC 4GWNA 4TWTA 4IEZA 4AEDA 3V0AB 3N4MA 3GGLA 1K3IA 3DXRA 1DZTA 5JXHA 1X4TA 1KBHA 4XFAA 4PLOA 4MXWB 1GSLA 3AKPA 2OIEA 1BHBA 3WF4A 5FPRA 3N9PA 1XBLA 1PP9H 3I2IA 3SCGA 4H13B 1H0BA 3F95A 2BGOA 4LHLA 4X62O 1IKPA 5B3SB 3C7HA 2WZR1 3RI9A 5CB4B 1WCSA 5FOBB 5T55A 1CPYA 3DXTA 1RVF3 3TNQA 4KQ7A 3K3WA 3AXDA 4ZHNA 2LM3A 2XGXA 3SC7X 3KF3A 4DV3B 2PGGA 3DYOA 3FLRA 3VBFB 5FY1A 1XNRB 2ADDA 5JZGA 3ZCCA 2WAOA 2IJJA 2YYOA 1VARA 5EYYA 1JZ5A 2J1RA 1PMIA 3EBRA 4YWAA 3I2OA 1VJ2A 2Q8CA 4TQDA 1QMJA 1K97A 4JKLA 3NNJA 2UU9O 5HCFA 5BV6A 1W9WA 4K8ZA 4XHXA 2Y0OA 1WA8A 1JZ6A 1Q5OA 5IVJA 2HLEA 1HNXB 2WSSG 1FD9A 4Y20A 3RDIA 1ZZ9A 5E88A 2WQ4A 4YW1A 4YXWG 4FTEA 2JG9A 4XDJA 4YW6A 3FN9A 3LFIA 1NKDA 3IT8A 4AZZA 4OQ8A 1OHHG 4DOUA 4I3GA 4UV8A 3SPHA 1FYJA 4A44A 1MEC1 1H38A 4PIZA 4BB3A 4O4IB 3RVYA 3O0VA 2JICA 3PTRB 3C2UA 4FM1A 3W7SA 4MG2A 1YJNV 3IWZA 2CH7A 5FXWA 3CSXA 5LMUB 4K35A 5C3SA 1VBA2 2DMXA 1BT8A 4JYCA 2QVSB 5EPAA 3PL0A 1XQ8A 1RUE2 1FX5A 2GAUA 4TV8A 2DVDA 1LNSA 1QQP3 1PD3A 3WF1A 5DAXA 1JZ8A 4Y4YA 4IE6A 2YHJA 3RWNA 1U12A 1R3JC 4QMAA 4IESA 2OCHA 3X2QC 1S0BA 2W68A 2LO1A 4WM7A 2ILMA 3AZVA 2HWD2 3OGIB 2ZINA 5FUIA 1KFUL 3J9SA 3OFNG 4MVQA 1UY4A 3CCJV 5FMOL 5I0RA 1FXHA 4UW4A 1VBC1 4RGGA 5SV5A 3GWKC 2WS93 1JBCA 3UETA 2PXJA 1VR3A 4TV9B 1YI7A 2P3IA 1SACA 2RHPA 3MFCA 2JDUA 1PO22 5F39A 3VZJA 3VKFC 2OCCB 4RUEA 2GTAA 1AR93 4UCOA 3VBRA 2UUBB 3UV9A 5FZ0A 1YJWV 2BSKA 1QR9A 4BWAA 4XF9A 5EIBD 1AX2A 4FPOB 5JXGA 4CDXB 5FP8A 2X09A 1JMKC 1SFPA 3JCUZ 1HQLA 2ZXQA 2EIJC 3UESA 4COUA 5ITZB 1PL4A 5JH7A 2B46X 2PHTA 1WCUA 2ZGPA 3B69A 1FXKA 3OTOO 1UZWA 3JD1A 4O2BA 2GN3A 4JGZB 3K3OA 2EVXA 3VDDA 4QDSA 3NJZA 4RD7A 2EILB 1MR5A 3VBUC 2KM2A 3DC5A 1FMD2 1ULCA 2B39A 3H7JA 4OQ9A 3D36C 3O1UA 3RJ2X 4O4LA 5IVCA 5FAXA 1JR9A 1SQQH 5KAIZ 5FZAA 2R6QA 1W2OA 4J7ZA 3WB1A 1C3HA 4J6GA 2D93A 1W6NA 4R9DA 1SZTA 5DMYA 1OA2A 1GLHA 2VMFA 4ASLA 1UY3A 4DRVA 4JGYB 2HKXA 4FK5C 1Z2GA 5JXIA 2G9FA 4CCJA 2ZX3A 3IIAA 5E1RA 4IV1C 4OMDA 4GMP1 3AZXA 4ZKIA 2XVKA 1OV9A 1G6UA 5EC1C 2ZMLA 3RYHB 3TOJA 3JAWA 1OH3A 1H2KA 3JATB 4Y1ZA 5IATA 2ZM6B 3VUOA 4I4TA 1R092 4NPLA 4QGMA 3AJYA 5EV7A 4FT8A 1VBB3 4MGTA 1H8VA 1S0EA 4LF5O 1PPJH 1YSCA 1FJGO 1Y74B 5B4NA 1NT2B 2Y6FA 4JI6O 3ZRXA 1AYN1 2A6ZA 3OM3B 1F15A 4BQWA 4RR3A 5BR8O 1IG0A 2UWCA 3AP4A 1XNKA 5FYIA 2DV9A 3N9LA 1SG3A 3RPQA 2HWC2 4JI2B 3TN92 2WT0A 2F95B 5F32A 3KT7A 3NXSA 2WA4A 2EF6A 1PL0A 2R061 2ZABA 4BIOA 2CTQA 1W9TA 3L74H 3CB2A 1RUNA 3LAGA 2YEVA 4LC1A 4KWUA 3O0XA 5K0UB 4NHKA 3E22B 1JW6A 3WQ7A 4A7ZA 1VALA 1RUH1 3FMGA 1D5NA 4J7JA 1D0HA 4LF6O 4P9OA 2WLKA 4TUYA 4HKLA 2R9RB 3WW2A 4CP2A 4RHV1 1VLNA 5FYTA 2UU8A 4HVRA 5E1AC 3I59A 4IV3A 3WFVA 4EZHA 3NMBA 4FJCC 3MF9A 2R071 4L87A 3LIHA 4YG6A 1RUI2 1ENVA 3APQA 5BNNA 1EAH2 2VU9A 4AHZA 5FPUA 2UWBA 5IW0A 4F6RA 4IE0A 5FQ0A 2JIJA 1IOAA 1O8SA 5T5LA 1XJAA 1A8MA 3LDCA 4KH9A 3B02A 1Q90D 4FO9A 1X33A 5DQ0A 5T54A 1QH6A 1GWMA 4YVSC 5FKBA 3T3YA 2DURA 4YRDA 4NYKA 4PF1A 1KECA 5L7OB 3PIJA 4CUGA 3S6PA 4HT1T 1WW6A 3ZOIA 3E6DA 4Y1UA 3JD71 1GAXA 4W6YA 2HWF3 2TEPA 4AI2A 5ABJC 1GM9A 4X20B 1ENXA 3SEPA 2GUZB 3F7VC 5EZYA 3RI8A 2OYQA 1N0JA 2Y4UA 4NRQA 3K4DA 1F23A 1H4GA 1AYM1 5LHIA 2QE7G 3VKNA 1ZA4A 3MIHA 3FFQA 3WNMA 5CA1B 5CFCC 2VW2A 4QKNA 4FQ4A 5DZEA 2VL4A 4EB6B 4BU2A 1D2DA 5E8AA 1Q56A 4X66B 2MEV3 5IWAO 2RG4A 5FYVA 2EIKC 3AP6A 4LKDA 2GSYA 4CCDA 4U36A 3CZJA 1E57A 4N7UA 1I5YA 2GC3A 3W20A 2YXHA 2YC4A 1AR63 1AL22 3ZMSA 2EX3A 2WYFA 1JYTA 3HN1A 3G6JB 3DGEA 2B8MA 4KBBA 1I0HA 1UXXX 2E51A 4MO3M 3VBHC 2H6CA 1I9RA 2OYZA 1MS5A 4LFCO 5K4LA 2VTXJ 2V5DA 3CO2A 3JAMN 1XPWA 3M99B 4TYSA 5GM0A 1H30A 2XAJA 1US3A 4RQPB 2GZWA 4CZSA 1VF7A 2WO1A 3AMQA 1RITA 5BXZA 5FZEA 4R9CA 2WWUA 2WSUA 2WLPA 1GN3A 3B40A 4W6XA 1HB3A 4O4HA 5JOYA 1MS1A 4EN6B 2XAFA 5LCWL 4LLFA 4I01A 1ZBE1 3M2MA 2VBDA 1PGW2 1RJ8A 1SDWA 4DRXB 2X8KA 1VF6A 2JG8B 3AZWA 2O14A 3HT2A 1WN7A 2G1MA 1PVXA 4UOJA 3ZXJA 4HLTA 4FPJA 1KS4A 1HWYA 1JYCA 2OT7A 1Y43B 4A7KA 5CFDA 2LROA 4ASMB 4AQYO 4QPWA 1RUD1 2QM4A 1BJQA 4TXWA 1Q8IA 4JPRA 4DZGA 4OI4A 4LFAO 3KG2A 1ENRA 2G9ZA 2EAAA 1NE6A 4S2GA 3LEIA 4JHZA 5T3NA 2E7TA 3EO6A 1MZEA 5HFMA 4GB33 2B42B 1JJ2U 4FFGA 4XILA 4YM2A 5JSRA 2A73B 3N35A 1XILA 2DN9A 4QXCA 3IAQA 4EE2A 3ITQA 4DV6B 1ZWIC 4RS5C 3MDPA 2F23A 1S2BA 3N2KB 3CIHA 3P3NA 2RDCA 5I91A 2E5LO 3OPWA 3LDRA 1YO8A 4Q4W1 2N7GA 3VBSC 5CBGA 2OPKA 5C4WA 4PIXA 4X1IB 5FPLA 2QBXA 2XLFA 4V2WA 4J7KA 4FI9A 4NN0A 2JX9A 4GT1A 3O9OA 3VKOA 1YZBA 4K40A 4FLZA 1H8TA 1E1QG 3ABMC 2OUJA 5JVVA 1OCZB 3QTCA 2BYVE 2E32A 4R50A 3H1YA 1A6CA 3W7UA 3A0NA 5LBBA 2UXDO 1LHWA 4Z2AA 2B4KA 2A6VA 3LA7A 5C3PA 4WVWA 1J5EO 1Y3TA 2BWAA 4RWUA 1WW7A 4LEJA 4YHHO 4XF4A 1O3QA 2WL1A 2AREA 4QPIB 1OMIA 3SJBC 2EAKA 1KD7A 3KLSA 3FBMA 5D5QA 5J37A 4D7YA 1EM1A 1RUF3 2ORXA 4NXMO 4X65O 3RZHA 5LBCA 2BV4A 3RYRA 1ZAUA 1U5ZA 3K03A 3SYCA 2GC0A 1GZCA 1BE3H 2PAKA 2Y38A 3AMMA 5FZMA 2GBOA 5L9VA 2ZE5A 3Q4HA 4N43C 5AC92 2VW1A 1JHJA 5FY4A 4TOIA 4MTFA 5A2QN 3WHTA 1FNYA 1DLLA 3SR2C 1RUOA 1UU4A 3ZBHA 5C6CA 3MIGA 1HRI1 4YGBA 5FPXA 5JOZA 3NR7A 3K59A 2CDOA 1QKQA 1LR1A 2B5UA 5CA0A 3WHUA 3U37A 5A7QA 3KM5A 3MBWA 3I2JA 2IXCA 4KWJA 3HKDA 1BKZA 2DQ0A 3GBWA 4UYBA 4QPGC 3LA2A 4BXSV 2LGWA 2ZHNA 2Z5UA 5FLIA 4DY3A 2ZQMA 2X5IB 4E4HA 1SCSA 4J1XA 1VQKV 1LHUA 5JXJA 4Q4X2 4B1LA 4JKMA 4OUMA 2FDJA 4EN8B 1NAEA 4GKJB 2XG3A 2R0FA 1GWKA 2P6HA 2HJIA 2ETEA 3DN7A 5FTTC 5F3GA 5FNVA 3HR0A 2VMGA 4P5HA 2W47A 4LNUA 4LF9O 3R05A 4WV8A 2UUCB 1NA1A 1BMV2 5BNOB 1K73W 3PVNA 3A21A 4PA9A 1YEWA 2EA7A 2FMLA 3ABUA 1ENQA 2QR4A 3DKWA 4LF4O 4PQQA 5B1BC 4MH0E 4ZOLB 4W8JA 2UUAB 3DCQA 3M3QA 2NYYA 3V65A 1ZVFA 3VD3A 2YZ4A 4K1ZA 4QX7A 3WQ0A 1O7FA 4E8CA 3ABKB 2NLJC 3ABLC 3JD2A 2D44A 1W2NA 4YFWA 5FPAA 1QVFU 1MOFA 4BQ4A 5KXBA 2P06A 4R9AA 1SQXH 1YF2A 3I55V 3V0BA 2A7AA 1KD1W 1YVWA 3ZDVA 3S0MA 1GQPA 1O9HA 1JYIA 1X36A 2KG7B 4DB5A 5LGNA 3VB9A 4GH4C 4CS3A 1JCHA 3FHQA 2ZGQA 3EHKA 3VV1A 4UF0B 2AXTZ 4DV5B 4XFBA 1MQTA 1JPXA 4MGKE 3J7AU 1EYBA 1K5SA 2VNOA 1CJDA 3CMEV 2CK3G 4DO0A 2RDQA 3MW3A 4JF3A 1DGRN 2PYLA 1K5MA 2ZHMA 3UT0A 2FDKA 1Z7S3 4MOAA 3SYAA 3UKNA 3P30A 3QOPA 4MXWA 2DJVA 4X62B 3WNOA 4KHPO 1XNTA 1PK6B 2PA7A 1KFXL 1JYWA 1TVKB 4AHXA 2D43A 2R7EB 3JASA 3CP1A 2RJZA 4GXLA 1RMU2 5CB4A 1R6NA 1NJIW 5JSPA 1Q81W 4RL7A 1X7NA 3E5UA 1Q6IA 2I45A 5IWFA 4JTOA 3JZVA 1MEC3 3VBFA 2DU1A 4J41A 4AFDA 3A8TA 1F4HA 5A3WA 5GLZA 1QCEA 3IAPA 3K4AA 4CDQB 1VE0A 1YDXA 4ICGA 4NIDA 2B45X 2FMDA 2D3PA 4A5UB 1K45A 2W1QA 1WAZA 4K0KO 4YVSB 5TISZ 2PHDA 3N2GB 2WIIB 3H1LH 3WDYA 1Q8SA 4XUOA 4AEDC 2KSDA 3ABZA 2DYSB 5IFPA 3TB0A 2Q1MA 3JALB 5CKNA 2QWRB 1NYWA 4YGCA 4CDWB 1MVQA 2HJFC 1D0GA 1KU9A 1RM1B 3B9CA 1Y9MA 1DQ4A 5EQUA 2Q1FA 1K5QA 3VHNA 4DW1A 2TNFA 4K3AA 4CDUB 5FZ3A 2RDRA 2YG0A 1VQOV 2XWJB 3LGRA 4FPKA 2QQWA 1DGLA 3ENRA 2GDSA 4UT5A 4N23A 1DF4A 4B7EA 5FRAA 3CJIB 4Q0PA 2J1TA 1XRUA 4F6EA 3UQ8A 4LF8O 5L9BA 4XDPA 2ADEA 4BPZA 2RM22 2PHLA 3CCSV 1W6MB 3JXSA 3RNSA 2Q73A 2LTNA 5DUWA 1CAXB 1IS5A 1DQ2A 2R0HA 4XBFA 1B35A 4KGGA 3ZMVA 4HANA 1TMF1 4E8DA 5ACA1 2XAGA 4R8CA 1F35A 4FLTA 3ZHRA 4LBJA 2ZDIA 2JGDA 3H01A 1QJY2 1P8JA 1YQ6A 1UX6A 4YM3A 5DG1A 2XVLA 1JXNA 1EZJA 2Y4TA 1RUC1 3DF0A 4UW6A 2IXIA 1OQEA 3RYFA 2UWAA 3J8F2 2BTQA 3U10A 4OPAA 1SESA 4B7KA 2UY9A 1X8EA 2WBKA 5F9TA 2JDMA 1US6A 2DCZA 5FP4A 3POSA 1RB8G 3WINE 4DK1A 3AKTA 3NKGA 3RZKA 2B9UA 2YDEA 1JOPA 2XLGA 4LBNA 2I74A 5JMCA 3MPBA 5FO7B 1UZZA 4CCEA 2P22C 1QOOA 2G38A 4AGGA 2L6LA 2JWPA 3ON7A 5K9YA 2OW4A 4XC9A 4WM7C 3ZXAC 3WG7B 2IC1A 3E8BA 3RT3C 5ITZA 5I8SA 2QQIA 1QEXA 2VZPA 3APOA 1QGLA 4AAXA 2W1UA 4AFBA 1GU3A 2PQQA 2QQPA 2MK3A 3H1JH 4GMP3 1J58A 1W6OB 1I5PA 1MSWD 1VBE2 1HXS1 3WW3A 4JGZA 3HKEB 4MTXA 1FYUA 3VHPA 3OT7A 1IBMO 3U75A 4M4RA 3VGIA 1JUHA 5CKMA 2R16A 2WABA 1AROP 1PIV2 3VBRC 1OH4A 2OZ6A 4IQPA 2XOMA 2AZ0A 2HH9A 2YGLA 2HVKC 3POEA 5L73A 4LBQB 3OEEG 1GZTA 2W94A 2VNVA 3NO8A 4QIWF 3AG1B 4ZONA 4C8DA 1UCXA 2N74A 4XCBA 3OPZA 3ZSMA 1R1ZA 2A75A 3TEZA 1AYN3 1MACA 3S7EA 2D3RA 1FATA 4IGPA 4P30A 1SF9A 1Y4MA 1FXKC 5JQGB 3NAPB 1I94O 5LASA 3TYJA 1KC8W 1K7DA 1QDCA 4WCEV 4IETA 3FLTA 2ET1A 3VDDC 4O65A 3VOUA 1VRH2 3CF6E 4JI6B 4XXPA 2EZOA 1RUH3 1K4DC 3BABA 3AG7A 5DXDA 2VG9A 3MYXA 5DAPA 3CJHB 5IY5C 3H7YA 5BR8B 4PT6A 5EIYB 1L8DA 4RHV3 2VOKA 2K9PA 1BMFG 2FD8A 4QX1A 2QQLA 4E2SA 3UK9A 1UZ0A 1NH2B 4A45A 2R073 1THZA 4UXAA 1PO21 5KAFZ 5LP6B 2VMDA 3WUDA 2D97A 3SXWA 4AVVA 4WF9V 3N7LA 1YJLA 4NROA 1S0CA 4LF6B 5FZOB 2GC1A 4PIYA 3I3DA 3DPRA 5FFOC 3E22A 1Y76A 4FLUA 3ZYHA 3BOWA 1UN1A 2Q68A 3OW2U 3KGLA 4OHVA 3FB5C 3AG2C 3D4KA 2D6LX 1DGRA 4GAZA 2UY8A 2GMPA 4QDQA 3N7KA 4XHBA 3OMAB 1ZSPA 3U11A 2HWB1 4PA6A 2VR4A 4I9WA 2PI5A 1BEV3 4AFMA 1QXRA 4XFGA 4YZ1A 3LDBA 1UY1A 5BMVA 1BQPA 1LOBA 1PVC2 1LESA 1AYM3 3AK1A 4XDLA 4QX2A 2VVFA 3J7NA 2E3CA 3BU0A 2JE7A 4M3CB 2UXNA 2ENRA 1LTEA 3N27A 4FOQA 4DUWA 1YNAA 1V6LA 1R1A2 3K48A 3CQOA 2VOVA 1J83A 4X64O 4MLOA 4QGLA 4DY5A 1QJX1 4IE7A 5A80A 1XBFA 4OXSA 1RTVA 3WF3A 3K06A 3I3QA 5A32A 5FKCA 4AQTA 4DXZA 2JIZG 3GYDA 1XHXA 2A6XA 4IV3C 3W59A 3VDBA 3LDDA 3VBOC 1AI5A 3IPVA 1J59A 3B8MA 2JK5C 2XWBB 2IVJA 5IWAB 4DIQA 3H1WA 4LBQD 2X6CA 4B29A 1HV1A 3K3NA 2GMMA 2EXIA 2ZGTA 5F5CA 5FREA 2ZT9B 4YG3A 5EJ3A 5LYJA 1GKBA 4LFCB 1ZBE3 5LB6A 2ZGKA 2ZX4A 2XH6A 4YNIA 2L35A 1OLRA 5JIUA 5T5PA 2WZ8A 1X9PA 5DAWA 4NIAA 4FPPA 1RSOB 3KVAA 1SQFA 4I50B 2P4KA 2WNUA 1V9U1 4F83A 2EIMC 2VNRA 3P3PA 5J7MA 4RQPA 1C57A 3KV6A 1AI7A 2HWC1 3HEIA 3I49A 3ZFEA 1DBNA 4QQOA 3LQCA 1GK9A 4O2AB 1RUD3 4TWKA 3O1VA 3UKVA 2RS11 2E7AA 4NPRA 3ACIA 5CADA 1AJPA 4LPLA 4Q0QA 4L8JA 4DXRA 5LXTA 5EJ1B 2ZXWB 1NXD1 3WDVA 2PELA 2J1SA 2XJVA 3ATGA 3RRDA 4DK0A 4Y1XA 1NH2D 4XDKA 2ZJCA 1OUXA 1UIKA 2CNAA 2GALA 2EIBA 4FPHA 2ZKNA 4Q4W3 4AQYB 4I5SA 5A3UA 3HKCB 2RNBA 3VDCA 3KZIZ 1NZ6A 4U7OA 1AL23 1VQ7V 5BNPC 1RVF2 2ZPXA 4LFAB 4YSFA 1MS8A 2UXCB 3BHPA 2JENA 1K5JA 4N53B 1SLBA 5DM6V 2P34A 3AK2A 1XMQO 4Y24A 1QJFA 1DYKA 4P9XA 5L3DA 3RQ0A 2HYKA 3WF0A 3IMMA 2LW1A 4B3MO 4K8FA 3UGGA 2Q5ZA 4UFHA 1WLEA 5FYSA 1ULPA 4EWDA 4MGZE 3BVCA 4XJWA 2OIGA 1GP5A 5KHKA 4O9EA 4Z92B 1FT9A 3JARB 1NE4A 4P9IA 1H2GA 4URTA 4AEDB 4IT5A 3DXRB 2RQ6A 3FB8C 1RUG1 2E7QA 4DV2O 2K2SA 2WJSA 4M01A 2DCYA 4I9QA 4GX0A 3P5BA 4XBNA 2UYBA 3ORJA 2VQAA 1CAWA 1NZIA 3HR9A 4GUNA 4NIGA 2G9GA 2BOBC 1PZ8A 3PNAA 1W8WA 2RV9A 1HQWA 4N90A 5LMNO 1WLDA 1SS3A 4FPFA 1AXZA 1OCRB 2MNGA 2UXDB 1KKDA 4GALA 1J5EB 3LOBA 2JE8A 5CAZA 3MW2A 3UM7A 4YHHB 5AVAA 3H1KH 3V56A 5LA9A 5FL7G 2J1AA 1W3VA 5JZGB 1TAEA 3E35A 1QQP2 1OQ1A 4YVWC 2B9VA 1R083 3ROUA 3M3OA 1XNRO 1K92A 1O91A 2A3XA 1US2A 4ZKTB 5IVEA 5LBFA 4X65B 1HRI3 2PN5A 3OR7C 4PLNA 2DUQA 2WFF3 4AVTA 5F2WA 1QQCA 1N1SA 2WNVA 2C6SA 2E26A 4HAMA 2AYHA 4MVOA 2JG9B 1SA0A 1HNXO 4LH7A 5LK5A 4AR2A 3P6BA 2VOTA 2WC2A 4JI7O 2YGMA 3N7MA 1S72V 1EN5A 4IGQA 2EZPA 4LO6B 2F66C 4NMIA 1ROPA 4FPEA 2UXXA 2Z0AA 1YHQV 1ND2C 5C5TA 4GKYA 1GZWA 4QU2A 3MW4A 1REDA 5BY1A 1FAYA 1Q3EA 1W2UA 2CH7B 4FLVA 1AP5A 4RGKA 3BUCA 1GR3A 1XE0A 4ONUA 1PGW1 2QWQB 4G4FA 4XETA 1DTOA 2BTVC 1W03A 5IT9N 4UCSA 4TV8B 3VQWA 2FDHA 4CTEA 1W6QB 1BYHA 2DYRB 1B09A 3MHZA 1OFSA 2W87A 1BBT1 1GP4A 1ULFA 1J3QA 3CL1A 5FXZA 3LDKA 1IURA 3UJOA 5H9SA 2XHNA 3VDAA 1DDLA 4CVUA 2Z69A 2TBVA 3K0GA 1ODMA 3LFMA 4COYA 5IYYA 2DW4A 1UU6A 2A3YA 3I4IA 4DR2B 2FCTA 2Z5WA 3R66A 4INDA 4ZS2A 3IC7A 3FYEB 1A32A 2HFEC 1SLCA 2FQPA 3O1MA 2A70A 3AB0A 1SEFA 1FFXA 1GTOA 3HNBM 4LF9B 2QQOA 5J2TB 3PIGA 2ZHKA 3VBRB 3VHOA 1C1FA 1FXVA 4XVHA 4JTCB 2R72A 4DXWA 1C5IA 1AR1B 3MV01 3I5DA 5BNOA 4CUAA 4LF4B 2P5BA 2LGQA 1COV2 3SJQC 4UAPA 4C7UA 3AVRA 1MVEA 2JEUA 4MHRA 1VMHA 4YIPA 2PMWB 3QLQA 3OGGA 2YS8A 4K8XA 4ZOLA 4H0LB 1YJKA 2QJVA 2DCTA 3PMSA 4M3CF 4Q1RA 2AENA 3OBTA 3IZOA 3JQWA 2YU1A 2BRTA 4IL6Z 2OIIA 4NAMA 2Y0PA 5JH7B 2V09A 3WQ1A 3QH7A 1BSMA 4DUZB 3WNXA 3GZTB 2VXJA 4CEWC 4HETA 3X29B 1ASJ1 1DGWA 4O2BB 2XJPA 5GJ6A 2IJIA 2YBSA 3ZFGB 2VZVA 1VBB2 2O8QA 1J1TA 4BMBA 4WFFA 3FJSA 4Q4Y1 4U7NA 1QNYA 4E2QA 3DTUB 4LK6A 1K33A 4J10A 4IERA 4BDVB 2QDOA 4ASKA 1DLCA 2R9IA 5D1IA 1E79G 5A1LA 5IYZA 4LMFA 2W9XA 4J9YB 4ISQA 4AHYA 3K2OA 1WPXA 3WDTA 5G04L 4RO2A 1W6NB 4JZRA 2C5DA 1EV11 3D82A 1K3EA 4AEKA 5KX5A 3KQ4B 3FWEA 2W1SA 5KUMA 3QACA 3T4HB 5KMGA 4QQ2A 2MW2B 1W8TA 3NRUA 1NTMH 1O3RA 1YUDA 5DDJ1 4LA2A 2DWRA 4CZZA 4KHPB 5L3EA 4PD4F 4FTBA 2Y6JA 1JFFA 1X59A 5G05L 1R6TA 3DL3A 1PMHX 3JAWB 1VF5B 2BNMA 3JBG1 1YXWA 5B1OA 2WKKA 3F2ZA 1HRV1 4P9LA 2WAMA 4QKDA 1TVKA 2OQ7A 5J48A 4I4TB 5LA6A 4CEYA 2KKWA 5J3UA 1WKYA 2RDSA 3ASOC 4CH3A 2BTOA 2DOSA 4DPNA 4XAAA 4CP1A 4XUTA 3OOXA 3WF2A 1W8OA 4UBHA 1UPGA 5K8SA 3UKTA 3T4DA 5DG2A 5JAXA 5LGUA 2TUNA 3DYPA 4K0KB 3T2MA 4RR3B 4AXOA 2IXKA 5ERLA 1W6PB 1GICA 1IGOA 3UNPA 3CE2A 1FXZA 3WY6A 1XNBA 1Y6XA 1CONA 1W05A 1K5MC 4QX5A 4XBLA 4K6BA 4ZS3A 3OB8A 2XOKG 4YZ5A 1GRJA 4CDWA 2WWWA 3EXAA 5F1RA 1AX1A 5EWSA 2HWF2 4WFBV 1LAJA 3THCA 3USSA 3L70H 5L36A 1TMF3 5ACA3 3WNLA 3KT1A 2YI9A 4CDUA 2VECA 3WG1A 4TUYB 2HR3A 5FBZA 2B1IA 4DQAA 3THDA 5B3SC 3WW1A 3NVCA 4CCOA 3WNKA 3NQHA 4IE4A 4LF8B 1RUC3 3CJIA 5CNAA 5BNNB 5J2UB 4FAHA 2CHHA 3VBFC 1M56B 2F4LA 4F6RB 5FQ0B 1KQRA 1OCCB 1W6MA 2MEV2 4ARYA 1G9BA 1JOBA 3FAVA 1FI2A 5E79Z 2EIGA 1CAXA 2JDAA 2IJHA 4N21A 1AR62 2HYXA 2AZ2A 1W2BU 2JJ1G 2JD4A 2BGCA 5IVYA 2P37A 1M4UA 2YIAA 3BOPA 4AFAA 2D98A 1C28A 2ARBA 1X50A 3UGFA 1SFNA 1NS1A 4AI1A 4LKEA 4OI2A 1CX4A 2ES3A 1OA3A 4YM1A 1JTZX 1DG6A 1F8VA 1QHDA 4GKXA 4DS0A 1FOD2 4UB8Z 4B3SO 4BK5A 1ZBA1 4QXHA 4CP9A 4LO4B 1RPOA 3OYWA 4MV2A 3FC0A 4FCAA 4LOSA 4JAVA 1R3KC 4UFMA 1CAUB 4AF9A 5L3BA 3AYCA 3ZM8A 1W04A 3AP5A 3ABTA 1ZZ7A 1LGCA 2VUDA 1KUQA 3ZO0B 4KI5M 4BW9A 4JI0O 2VQFB 5FMBA 1A3KA 1HXS3 4TZDA 3Q8BA 3AYAA 4RUFA 4META 1G6NA 2C26A 1QXJA 4MGQA 4GJYA 1MSDA 3I8TA 1TGOA 5FMCA 3ZRVA 4BIFA 4OI0A 3OGSA 4I0BA 3TAYA 3O1OA 2LFSA 2K46A 3OBAA 3SMHA 5A7WA 4GCZA 1D2QA 1DLBA 1CIWA 4FVVA 4XTMA 3RFRA 3CJXA 4I0AA 5A70A 1XB9A 5HCHA 4GB32 4GWMA 2RS33 1IBMB 1W6OA 2BDRA 3EQEA 3I2FA 4FLXA 3J8F3 1NUKA 1EUTA 3H8UA 5LA0A 2CE4A 3KV4A 5GZDA 5IK7A 2D6PA 3FX3A 2OCCC 2H0BA 2XDVA 3T1YO 3I3MA 3IDCB 1OA4A 4C1WA 1BS3A 2O57A 2GH8A 4TN7A 1KEXA 3TRSB 3KQRA 5C9AB 2E74B 1KXGA 4ZU7A 3BTYA 5FPBA 4IYHA 1NCQA 3B94A 4CDXC 1KDKA 2VBPA 2A9HA 3D3QA 3USUB 3PDQA 2GP5A 1VBD1 5CFDB 2WLLB 3JD4A 2RS51 2QQUA 2RE9A 2OUHA 4O61A 1I94B 1CESA 3M8AA 3KMHA 3ZMOA 1HV0A 3AG3B 2ZE6A 1H9PA 2P1BA 1ZLZA 3U07A 2Q0OC 5JUVA 5D2AA 2OT5A 5HV0A 2YUAA 4PBOA 4JGZC 1M06G 1SBDA 5GLWA 1JA8A 3LKJA 2EILC 1N8RW 1RUF2 5FUNA 3I97A 3CJHA 1L7LA 5C4WB 3T09A 5LBQA 5F37A 3BALA 1T2XA 3STZC 1PMJX 2EJRA 2HWB3 1XNQB 1QIQA 1STMA 1OOPA 4Q2FA 1H8TB 3ACFA 4JGYC 3ZYIB 2WT1A 2C24A 2EIEA 4YPJA 2BWCA 3JD0A 2A1XA 1HNZO 2JJ6A 4PA3A 3KT4A 4AEJA 2JGUA 3ZIXA 4NJ4A 1XC6A 3PLQA 1IQDC 2L9LA 1WMXA 2BOIA 3OD4A 4FFIA 4Q1PA 2B5HA 3B8NA 1QJX3 1LECA 1LOAA 4YGEA 3SYQA 4U3JB 4CUBA 3AK3A 4G28B 3T2PA 2D3SA 1IXMA 5HV4A 1SQPH 5FMDA 3ETGA 3LEKA 4ABMA 4HL0A 4IDZA 4M3CA 1AUYA 1L0NH 3BFRA 1OCOB 4ES9A 3WU2Z 1G9FA 1ULDA 5I0TA 1M90W 3Q4HB 4LBKA 3PTYA 2BUKA 4WM8A 1GKFA 3NSTA 2RJLA 1UW8A 3WNNA 3JUUA 2GNBA 4BQ2A 4Z82A 4OI1A 3IB3A 1EFRG 1RP3B 4AI8A 2VMIA 2J22A 3BA8A 4AGVA 2WLIA 1R73A 4SBVA 5A7PA 1TUEB 4D94A 5CA0B 1CR7A 3B7MA 1JYNA 1XDCA 3E5QA 3R0RA 1VB2A 4JZ2A 1JOJA 1V9U3 4Q8KA 2XAHA 2QEXV 2HP8A 3HKDB 5FYCA 1NCRA 3CC4V 2FCUA 4OUSA 1AI4A 2VTFA 2FBEA 4MTOA 2RS13 2IH1C 2IM9A 1DZRA 3NV1A 1Q82W 4FMTA 4WBNB 3TXQA 4S2HA 4P9GA 1AXKA 1W8HA 2JDKA 4BOWA 3AP9A 3R4SA 5DN6G 5L7OC 4COZA 1WP8A 3B2EE 2QM7A 5DZFA 1LCLA 3LEMA 1MS4A 4BW5A 1ZRDA 5FNVB 2YSUB 3KWVA 4GKJO 3OF1A 4LNUB 4Q4V3 3GHMA 4FFHA 3O5SA 1NA1B 3OY8A 3LDEA 1HNWB 1UMZA 4LBOA 1SLTA 3BKZA 4LE3A 4O2AA 3CLPA 5IJ9A 2Q1ZB 1AVMA 1S76D 4MVMA 2R1BA 3LWCA 2C0ZA 1QJU3 4P08A 1HKDA 3MGUA 4JDOA 3PHMA 2UUAO 1HIXA 2FHRA 2VULA 1GOFA 2DFCA 2XL7A 1Z0HA 2EJ7A 4M0NA 1G9CA 4EN9B 3VZNA 3V0BB 3SPJA 1VMGA 3HKCA 1RUG3 1KP3A 1I3HA 5L3CA 2DYCA 4CS2A 2WNEA 5A3MA 1D5AA 2XB6C 2ORZA 3CCMV 3L73H 1MEC2 1PGL2 3B77A 2DBIA 4B3MB 1MG1A 2WNUC 2W1WA 3A0BZ 4OHYA 2VQUA 4IUGA 2BJSA 4DFSA 5LHHA 4RQPC 2VCMA 3IDEA 3LNNA 2CWSA 1MQTB 4XUPA 5BNQA 5IVFA 2V4VA 3HD8B 2FDGA 4CP0A 2NM1A 3B93A 3BN6A 5EYPB 1KMIZ 2XR4A 1NG0A 4NXNO 4DV2B 3JARA 5KHHA 3KSCA 3MIFA 4BMEA 2ZA9A 2DWEC 4JKKA 4B3RB 4QQHA 4WBBA 2ATFA 3ZHQA 3H1MA 1LHOA 2BNNA 1UYYA 1QF3A 5JI7A 3ZSLA 4NRMA 1GQGA 2QTSA 3G80A 1W0JG 5LMNB 5FY5A 2CDYA 3O65A 2JG8C 1NBMG 3JASB 2LP7A 4CE8A 3ZEDA 3CXCU 5JDBA 1VBC2 1ZNPA 4PA7A 2WN2A 3MIBA 2QKDA 2ZGRA 4PDLA 4HMZA 4YY3O 1LR5A 3LSSA 1D4M1 2XJTA 4A41A 2W08A 4AAPA 2ZZQA 3J7HA 5J36A 4LNVA 3I56V 3HVDA 3F7YC 3E8GA 4BYYA 3O1RA 3A0RA 1CZVA 3JSNA 4LULA 2P67A 5FZBA 3N9NA 3KV9A 2WLNA 1HQNA 1POV0 2K1EA 4R7CA 3AKSA 3OAAG 4JI7B 1KJRA 4WZFA 5KXEA 2JDZA 2RMU3 4NHXA 5I0DA 2JE9A 1BBT3 1CIYA 4FPLA 3THPA 2XONA 4XAEA 3FHAA 5LEKA 1MS9A 2AEZA 2A06H 4L99A 2VZ1A 2VZTA 4P02B 2QZ2A 4AL9A 1AJOA 5JPNB 1OCZC 1VB4A 4XJUA 4LQRA 2BW8A 2MPFA 5C71A 3BY6A 1I1EA 2DVFA 2HEWF 2WN3A 3CCVV 3DECA 4JI4B 3E8FA 3ZPOA 1WMDA 5KA6A 3ZXDA 5LW9A 3L75H 1W6QA 2LFRA 1W9FA 4QPIC 1O9GA 1JZ2A 2C4XA 5JWPA 5GZEA 3ZMZA 3A0KA 1RVF1 1B35B 3ZHVA 5H6QA 3PJQA 4NOTA 4X8PA 3T0BA 2WNVC 1ZYBA 1BXHA 4FSJA 2JGDB 1Q7YW 4YARA 3A2FA 2BNOA 2W2IA 1NY71 2WSVA 2CGOA 1UD1A 1R1BA 2VXRA 1SFYA 1XL4A 3SITA 3EXUA 1GO3F 3L71H 5FY9A 4OZXA 1WWYA 3RYFB 5GLTA 2VMHA 1TNRA 2BTQB 3FX7A 4AW7A 1T6BX 4QXKA 1BL8A 4UVAA 5J2TA 1N33B 1PV0A 5HBAA 1ZRCA 3C3SA 1UU5A 2GC2A 3D0SA 4F7ZA 1Y7BA 5D21A 4ZXKA 1PX4A 4XQDA 1UOBA 4NWVA 5IVBA 3CRAA 4GKKO 5LRSA 1WCDJ 3C8XA 5F3IA 2Q0AA 3QH6A 4Q4Y3 1FPN1 2F6BA 4LUMA 2ZGMA 1VP7A 5C8YA 1G7YA 3OPTA 4JZGA 4HYOA 2QFEA 3OSDA 3WP5A 1AYN2 5LOVA 3RS6A 4LIVA 3IKWA 5FZCA 2IBZH 2IJKA 1HJFA 1GFF2 1EV13 5LY2A 1Y4WA 3ZRSA 3B4SA 1EPZA 4HOOA 4HPKA 4K20A 4FFBB 2IFWA 4W6WA 3D36A 3J26N 1X8MA 2E31A 2X5IC 5DDJ3 4L0PA 4I0XB 4P5YA 4V2VA 1IXBA 1JH5A 3BPSA 4FPYA 3BI3A 5A7OA 4LJHA 3ZFGA 5HCAA 4DUVA 4LF7O 2DWDC 5H9CA 1RUH2 5I8TA 5CYYA 3CMAV 3AKRA 3JBG3 3N9MA 4X9QA 1HRV3 2ETNA 1F51A 4QQPA 4Q26A 4RHV2 2WS91 5CG9A 4IV1A 5BNOC 2BPA2 3SPCA 1SHWB 2VWJA 4Y4RA 4AGRA 1OD3A 4UW3A 1U0AA 1COV3 4BCUA 3ZR6A 2R072 2BOCC 1EY2A 4XTPA 4CXXA 5GKAC 2YY1A 2R70A 1MA1A 2JEXA 1AR91 3AYDA 1Q8PA 1UYZA 3R65A 5JR2A 1QH7A 4XFFA 1AI6A 4HZ3A 4BH9A 3J7LA 1Y67A 4QKFA 3ABKC 4Q0UA 4Y1YA 1O59A 1DGWX 3CRRA 5E6HA 4HK8A 1JX9A 4PDMA 1QOTA 1GN6A 1AJNA 5FIXA 1F31A 1DU3D 2IFRA 5AFEA 4FFFA 2W5FA 4FM2A 5JCTA 2R041 3T2QA 1BEV2 3C7GA 2GNMA 4X1YA 1AYM2 4D6RA 2V7QG 5JIAA 2Q7HA 4QPJA 3K58A 4D6SA 1J95A 1W6PA 4QPKA 4D0QA 4Y22A 3J4UH 1YJ9V 4L11A 2A0LA 2JDIG 4Q0VA 1EP0A 4BAYA 4MHUA 2G4IA 4BR6A 4TLGA 4DR6O 2RJKA 2ZIOA 1Z5VA 4NTXA 3DPRB 3FHIB 2XBO3 3O7OA 3ZR5A 3I2DA 4XABA 1Y76B 4EV0A 1AR81 1PK6C 3SGIA 1GNZA 5B1NA 3F5TA 1V6IA 5LY1A 3E89A 2R9AA 1FPOA 3KCCA 1J1LA 1D2SA 1L1FA 5FZDA 3QO5A 3H3ZA 1VAVA 5FYHA 4DO2A 5J2UA 1ZBA3 3ML0A 5BMVB 1MS3A 1AR71 1YFWA 5T52A 3L2YA 5T5OA 3MDSA 4CDQC 3GALA 2VQEB 2DUOA 4IEWA 1VBB1 2VUCA 2ZGSA 2JIGA 1UX7A 1WGPA 5ABJA 1ZBE2 1JZ7A 4XDOA 3VHRA 4UXNA 4BJ0A 5IFTA 5FZKA 5JMOA 3ZHSA 2DYSC 3H8RA 1PZ9A 2JB8A 1SLIA 4CDWC 1C1LA 5APAA 1RM1C 2HG5C 4B3SB 4XF3A 1BCCH 4LK7A 2FYUH 2WLMA 2VRZA 2QA4V 4NE9A 2QM8A 5A32B 2WZPP 4AI9A 4LITA 5CFCA 2XNDG 4CDUC 3KVBA 3PVEA 5DABA 1NI8A 3HOBA 2VZUA 1RUD2 2QWNB 1N36B 5H2FZ 2RR13 4JI0B 1GQHA 1CAUA 3ALQA 4JV5B 4DUYB 3CJIC 1TZOA 2GSMB 2OWOA 3BVOA 4WVMB 3IPVB 1V6NA 4XJZA 4Z8BA 2PUSA 4P9PA 1VP6A 2Q7EA 1KQSU 2QDNA 1YWKA 1XYOA 2SBAA 2Y69B 3VBHA 1NT0A 4G27B 5IDJA 1EUUA 5CZKA 4Q4W2 1BQZA 5LYJB 1WBFA 1G1XB 1GP6A 1CPNA 2HWE1 4YYOA 2VVEA 2FL4A 1CPMA 1IBKO 3ETDA 1OJHA 5IK5A 5K7PA 4FOWA 1O4YA 2K0GA 1O6UA 1MMMA 1PGSA 5A7SA 3WUCA 4CCLA 3GZAA 4AHCA 1S5HC 2WNUB 3PUAA 5FZ8A 3CCLV 4YW4A 1SC5B 4L2NA 5FZIA 3OEAA 3G67A 2EINB 1VBD3 3ZFEB 3ETQA 1FOD3 1UIJA 1H9WA 2RS53 1MZ5A 3FBYA 1JVMA 5A9GA 3T1YB 1JZ3A 5TSWA 3MIDA 3CCRV 5SV8A 2QQNA 5AG2A 2HWF1 2M7WA 5LXTB 4ISRA 3PJSK 4YZ2A 2QGNA 2VZRA 2JDHA 5FO8B 1CAVB 1SQBH 2WDBA 4XMIA 2PI4A 2HEVF 1PM7A 1COWG 4Q29A 4OHWA 5C9AA 4L97A 5LRRA 4AVCA 5EFUA 1W8UA 3GXUA 2AACA 4KMQA 5B2GB 3USUA 2VOXA 2X29A 3B5LB 5C70A 2WLLA 3W7TA 4YFZA 3WG7C 2QKSA 1DFQA 4DR4O 2DBNA 4LCUC 4E4EA 3SDLA 4RS5A 2VS0A 2AGSA 4Y3OA 4IEVA 2UXCO 2DVAA 5C8CB 4CXWA 4YG0A 4MADA 2RN9A 5FK7A 1R082 1OLMA 2DTWA 1BQ0A 3IDBB 1HRI2 4HKWA 2P3YA 1F5FA 2E76B 1S5JA 2WFF2 2WLQA 3G6EV 2VD7A 1FV3A 3AXEA 2AR6A 1W28A 3M4FA 4H55A 1L7QA 5KWRA 4J42A 3WDXA 4BIZA 4YJ2A 4XJ8A 5FPZA 4IGOA 4UW5A 1W3XA 1CAWB 3AG1C 1ZL8B 3UKMA 3ZJZA 3GZUC 4JYBA 4MTGA 5LEJA 1HNZB 1LUWA 5GZCA 3ZXGA 3FB7C 2EXKA 5ISLA 2VZ3A 1HW7A 4CC6A 3I2HA 2ZGNA 3KF5A 3IGAC 5FP3A 2VY0A 1TVGA 5IAVA 4MSWC 1PX3A 4K3UA 1H2NA 4B4PA 2ZEZA 4XCAA 4BWOA 3WSOA 1OPMA 3ES1A 3NAPC 2WFPA 1LJ7A 2ZTNA 1PO11 3ZX6A 2VC9A 1SPPA 2OX0A 3T1HB 1NR7A 4N9HA 1AZDA 5CIRA 2PY5A 1G8WA 1TME1 2Q7GA 3IFXA 1C4RA 4XEZA 4U3JA 2WNVB 4N43A 2P4VA 1RHI1 2WWSA 1SA0B 4LO8A 3ZYPA 2QQJA 2CAUA 5DUXA 4JGSA 2AZ5A 2B7YA 2JDNA 3S7IA 1F2NA 1SQVH 1DQ6A 1NLRA 4QDRA 3RYIA 2JDYA 1RL3A 2VWKA 1SMVA 4WZCA 3QCWA 3CC7V 5FWEA 5LP6C 2CSGA 3ZKUA 3VQYA 1SZXA 1E5IA 1C8M3 3KHCA 1GZWB 4MXVA 1K12A 2RDNA 1IVSA 1T6GC 1WJZA 2Z79A 5KBFA 4KGQA 3VN4A 1ZX5A 4LIUA 2NR5A 1GBGA 3LPFA 3VQVA 3JCIA 4MVUA 3RMYA 4AE2A 1UWWA 4QPGA 1HDJA 1AXYA 4JAUA 5GTIZ 2OA2A 3CMGA 2NMOA 4JI1O 4WFGA 3SYOA 1RPRA 4COVA 1CZSA 4RAIA 3HAGA 5B5EZ 4YLZA 2Z3YA 4J25A 1Q43A 5I8YA 4YIOA 4KG0A 5CB7A 3JSLA 4N9IA 3R6SA 5JPMB 3ZMNA 3AC0A 4LBMA 1WA4A 4QX8A 1NLSA 4PLMA 1P7GA 4B4QA 3AEIA 4LR3A 3WCRA 4WBNA 2Q30A 1CZTA 4DR2O 4Z2WA 1RUF1 4F3JA 3HNYM 1R3LC 1FFXB 1YIPA 3U1XA 5T50A 4WFEA 3ST7A 4OHXA 4XF0A 3WG3A 3WLUA 2IVIB 4NIHA 1WP7A 2HVJC 2ZE8A 2D6OX 4NIIA 3VD9A 2LS6A 3E2EA 1V6KA 4FPCA 1LOFC 1ZZ6A 4QE7A 4G3YC 3OUJA 4LBEC 1RXFA 5IAXA 1O8PA 4QGPA 3AP7A 1RXGA 2CDPA 2YXLA 2IXJA 3HPLC 3I7DA 3ZXFA 3ETPA 4BE3A 5J96B 1J3PA 4FP3A 5BXXA 3VD4A 2QSAA 1NKGA 5A3PA 3THOA 4H14A 5KXDA 3POYA 2D5FA 1NCRC 3C90A 5L3GA 4R52A 2F17A 4I3PA 4GLXA 4ZZ8A 3ZN4A 4YW3A 3M8LA 3RN4A 1Q86W 5FR3A 5FWJA 4GH4A 1GMMA 2EBOA 1UQXA 2BCCH 3OBZA 5CMUA 3LZZA 3Q8EA 4DUZO 2K9ZA 1NOVA 1W59A 2Y6HA 5J1XA 1OFNA 4BXFA 2QJ1A 4H37A 2SLIA 4AI3A 4UB6Z 3KS7A 4BHPA 4LT5A 3UCSC 4LHSA 5GZGA 2ZMNA 3JU9A 2Y48A 2W92A 2QDRA 4IEOA 2Q8DA 1G8MA 2WZR3 4FAGA 3POBA 2DQ3A 5IYZB 1OHFA 1G9DA 4NXNB 4ZI7A 5FLJA 3ASNB 2DDUA 3ME2A 1D4M3 5EYPA 2OS2A 5KX5B 4DEVA 2IXLA 4XXAA 5LWBA 3EFFK 3VZLA 2AHZA 4UVBA 5KMGB 2H0VA 3TXSA 3OEHG 4YJ3B 1QU0A 1HW5A 1VQLV 2ZXWC 4B3TO 4PDWB 4UFKA 5H5NA 3PJYA 1JFFB 1VRBA 4DUXA 1PNLA 3MIEA 1TMF2 1UPIA 5ACA2 2E63A 1ZTEA 1UPSA 2YIBA 4AHWA 1JUIA 4A2UA 3BYWA 5DN2A 5LA6B 4CEYB 3OCPA 3GNEA 2WRAA 4YY3B 4MGIE 4QHZA 3GM8A 2ADPA 1RUC2 3S30A 1QJZA 3EJKA 4N53C 5A3LA 1RFYA 4IHJA 4EWEA 3T1CA 1V54B 3AX4A 1O3SA 1GZ9A 3P1IA 4DV1O 2XMLA 2VCAA 3ZSKA 4JX0A 1A8DA 1YIFA 2ZX0A 4AG4A 3NJVA 1KDMA 2Y26A 3WV6A 1WPBA 2GV9A 4ZY9A 1XSRA 4NRPA 4CA9A 5EJZB 2Q4SA 3KB5A 4GZ9A 1LODA 4OYUA 3HJRA 2YROA 1W90A 4EYUA 3S3XA 5JJEB 3LB9A 2XLAA 1GMGA 5BUVA 2WO7A 4ATFA 1DF0A 4MGYE 5FYUA 5DUUA 4DR7O 4AQ6A 5IK4A 1DP0A 2RVAA 5FYZA 2HLDG 2ZS6B 1YQ5A 4F8AA 4DXTA 2PLV1 1OCRC 1Z7S1 2CTRA 4H7MA 2BFUS 3N9OA 1VBC3 1AL0G 3MPPG 4LO7A 2VNGA 5D5PA 1RYYA 1SBEA 3ZYBA 1DQ5A 3B9IA 3ZVXA 3E83A 1M57B 1PNKA 1VIWB 4EKWA 1HXS2 5JZGC 3BPZA 3FAVB 3HKBA 1UAIA 1WUVA 1ACCA 3U14A 3ES4A 2KR2A 1XHZA 2XKOA 3JAKA 5J9PC 4QT6A 5CKQA 1BCXA 1RUJ1 3ZRWA 4CH4A 2BEOA 4JI8O 1J3RA 1PGL1 1KGYA 2X7RB 3E1F1 2WA3A 2DVGA 1P49A 1FPN3 2JG9C 1DF5A 1ND3B 4ZIBA 5EYXA 3ZDSA 5D8AB 3RGBA 2WNOA 2GHYA 4TT3G 1Q8VA 2RS32 4HKOA 2VOWA 4IGGA 5CA6A 4CP9B 1QLEB 5IT6A 3OYWB 4DW0A 4QM9A 1ULOA 4MVSA 3TJTA 3D0JA 1N1TA 4LORA 4YM0A 4ES8A 4GJZA 4GKKB 2N04A 5CISA 1TEIA 2KA3A 4LWSB 5FO9B 5KLVH 5H9PA 3C7FA 2VQFO 5CBFA 2DYRC 1UOFA 1Q8QA 4Y33A 4NHMA 2XHKA 4XIOA 4DEQA 4XFIA 3MAQA 3T30A 2YU2A 1B06A 1W39A 3ZSEA 3B00A 5LA1A 1D4VB 3ZIWA 2IH3C 5A7WB 1LOEA 3ELNA 1JMUB 1LENA 3LA3A 1C5HA 4CRQA 3MV11 5KHJA 1W0OA 1QWRA 3OUSA 3H50A 4FFBA 4OUEA 2R30A 3L2HA 4BM8A 5HI0A 4LF7B 4I0XA 1GOGA 4M00A 3ZKYA 4S2DA 3ZFFB 1YHFA 3TBDA 3O1SA 1S4CA 1E5RA 3DUIA 1V6MA 4I09A 2H3OA 2Q5TA 1K42A 1W2TA 3RBZA 5FCCA 1V55B 4CU6A 4BK4A 5JR7B 3KCXA 1BVP1 2HWB2 4E4SA 1K9MW 1N3PA 3OD0A 3AG4B 3RMXA 3O1TA 3H3LA 2R043 1NCQB 2Y6KA 2JS3A 2J42A 4CH5A 3DC6A 2I2SA 1W9YA 4QPYA 1LU2A 2DCKA 3A7QA 3SEEA 5I0SA 1XREA 2XKPA 1VBA1 2ITCC 3SCHA 4YZ3A 4OHZA 3ZX7A 1LKNA 1RUE1 1QR8A 1GV9A 4XUQA 1ZM1A 3VKMA 4C0BA 4OVEA 1Q6UA 1VQ5V 3LNMB 2R063 2CGPA 4A7YA 3OUIA 3CBNA 1XL6A 5FZ6A 1CP9A 1OVPA 3ZFGC 3RZMA 1QJX2 3MI8A 2HWD1 4R6ZA 3QBQA 3U4XA 3QF7A 4W4ZA 5KR7A 3K79A 1AR83 2KXLA 3SJAC 4BLIA 4A6SA 3POJA 1AR4A 1V70A 1YYNA 4XQWA 3PURA 4LR4A 3H1IH 3GF6A 4FZ0A 5DZGA 3Q8CA 4K7JA 1CD3G 3ZYRA 2IZWA 5FJHA 2OTJV 5JCOA 1LEDA 4RQEA 5KA5A 1OOPB 1HR0O 4LHKA 3AYEA 3WP6A 4DR6B 2LW7A 3GCXA 1NZCA 1XNQO 1AR73 3K4ZA 5FV3A 1H2SB 3HMYA 2O1QA 2A5ZA 3BEHA 2PQSA 3TWIA 4JV4A 3JD3A 4DV7O 1OXCA 1ONAA 1CVNA 2QQMA 4LO5B 4J80A 3HQUA 4MVZA 4Y1VA 3A22A 5CA3A 5T5JA 4JYAO 4Q8LA 4EN7B 4O4JB 3T2OA 4UV9A 1M1KW 4WFHA 2ZX2A 2Q8OA 1DHKB 4JI5O 3JD73 3OMIB 3GZEA 2ARCA 4KL1A 3MD0A 4A4AA 1V9U2 4V1PA 4GMP0 1MZFA 3TEYA 2C9KA 2ZGUA 2I07B 1WLWA 4Z1VA 4X1KB 1HLCA 3HQRA 2OKXA 3T4ZA 5B66Z 1BVVA 1I7FA 2RS12 1S0VA 4RR3C 3NV3A 2N05A 1GNHA 2C2AA 4BQ3A 3PN1A 4M0HA 3W58A 5DEDA 1V00A 3M3CA 4H44B 4QB2A 2IW5A 1FMD1 4WM8B 1YITV 2HBUA 4KP4A 5A7NA 1X9TA 2J1EA 4RA0A 3TEXA 4BISA 1KYOF 3O12A 4ZPIA 3M1HA 4Q4V2 3STLC 3T1MA 4IW3A 5A33A 2HWE3 3VBOA 3SH3A 1NQDA 2HBTA 4OMCA 5JJNB 4XF1A 2WLIB 3E86A 3M70A 3CPWU 3BCCH 3H1HH 3H8XA 1F7YA 3N3HA 3IBMA 4EROA 1XEQA 3CCQV 2W91A 2VZOA 4X89A 2D6MA 1QJU2 1HP8A 3M3IA 3ECQA 4IEYA 2F93B 5FZ1A 2OTLV 3DKQA 4WVMA 1LHNA 5BNNC 1LHVA 1NCRB 3AVSA 1M56C 2CAZC 2WO2A 3B01A 2D5HA 3KV5A 1OCCC 4NAOA 1EBOA 1JJOA 1R091 2YUEA 4W4KA 4GA9A 2GTSA 1IBKB 1LOGA 2F4PA 4FOVA 1VQ4V 3D3AA 4DV4B 1RUG2 2XHBA 1KRIA 5C33A 2YICA 3HBKA 3WT3A 1BEV1 4Q5OA 5JOWA 4J9ZB 5K1XA 1F4AA 3PUIA 4MX3A 3ILFA 1N1YA 3LUTB 3MEPA 2ZEYA 4CPBA 1ODNA 3GCWA 3OY8B 5IE9A 3TN91 1GUIA 1QNWA 1NTKH 3BTXA 5B1AB 4JI3O 5IJ9B 1HNWO 3K75B 2JS5A 1ALYA 1F4MA 3MFAA 4XQ4A 5A6YA 2H8PC 1PZ7A 5BNPA 3TETA 3RYCA 1CAVA 2Z4FA 4I2OA 2DE0X 4XACA 3IN9A 1H8EG 3DSQA 1IKQA 1G86A 4U2AA 2NPIA 3FL7A 4DR4B 3PUHA 1HX6A 2BQPA 1UY2A 1RUI1 4JCKA 3CS5A 1EAH1 1W9SA 3S5AA 5GONA 1JS9A 4CCNA 3RZGA 5BPXA 1SRYA 3WCSA 3PVBB 1UMIA 2WR9A 3ACGA 3DXUA 5C8CA 3ZMTA 3DEMA 5AVPA 3VLBB 4GIQA 3H3UA 2VZSA 2XPJA 1HN1A 3PU8A 3I2GA 1NTZH 2QWOB 4D7SA 1X82A 4UCUA 1YFYA 1FAFA 3VZKA 4DR3O 4Y5SA 1PO13 2PYTA 2RMU2 1LOCA 3RWKX 2LQTA 3ZN6B 1LB2A 1BBT2 1OLQA 3WP3A 1UZYA 1URFA 1QNMA 4B3RO 4OX9B 5FBJA 2B1GA 1TME3 5C9AC 1ZL8A 5F3EA 1GN2A 1O4ZA 4JC1A 1VF6C 2UURA 1ULGA 4JQRA 1LGNA 1RHI3 5CBHA 4PHZA 1UKRA 3WR0A 3IAYA 4YVWA 5CFDC 3R4UA 4D6TH 2CL2A 2VCBA 3OE7G 4PA4A 3N9QA 3HT1A 3K0DA 4X8AA 2C1FA 2XVGA 2W46A 4QHBA 5C5UA 1XE8A 3POWA 1GM8A 3AG3C 1V9PA 4FM0A 4MW3A 2YFUA 2Y6GA 5CVRA 1AL21 5LGTA 2DUPA 3ILRA 2NLRA 1URXA 5F5IA 4HVQA 5KC5A 3CRMA 2ID4A 3RYPA 3WB2A 4LHNA 4X88A 5C7GA 3GDBA 5C4WC 5LBEA 3ZXLA 1W0NA 2Q8VA 1OI6A 1ND2A 5FOJB 2Y8KA 3E8HA 1YQ8A 4X6QB 1TG7A 1XU1A 2VQTA 1MABG 1H8TC 2ZHLA 3FB6C 5A3OA 4FLWA 1R6KA 1IPJA 5DAQA 4C91A 1YC61 3NKTA 1Q8OA 3ZYFA 3W21A 3T08A 2BFUL 5M0TA 3CZUA 4P14A 2Y6LA 4CCMA 2BBAA 1ASJ2 3X2QB 1XYPA 4OZOA 3G4SV 4XZPA 1WLCA 5A3NA 2ARXA 3SH5A 4JI1B 2VVDA 2HHHB 3NW4A 1FV2A 4JI4O 3LE0A 4Q4Y2 5FY8A 1E5HA 4PCRA 2W39A 5A6ZA 3POFA 1JHNA 2P2KA 3QD6A 4AVSA 3L9DA 3W7WA 3HB3B 1EN6A 4XIKA 2BVBA 2PZSA 4K21A 2OPWA 5FYMA 3SCFA 1TA8A 1XNAA 2RCVA 4W65A 3D8CA 1YI9A 1UL9A 1EV12 2ZKLA 5IJ0A 3UL2A 5JI9A 4IXLA 1R081 4H2AA 3RVHA 1ST8A 1OCOC 2W0XA 5DDJ2 5GALA 3OR6C 3AZYA 1N3QA 3CCUV 5C3OA 4HONA 2WFF1 5F6LB 4PI2A 2ERFA 1HB1A 4ZZ5A 1ENSA 1NR1A 3S57A 4O7XA 1AVBA 3JBG2 2Y0IA 2P3JA 1HRV2 4P9WA 2D7FA 4KWKA 1CQ9A 3SQOA 3OGRA 2AEYA 1N33O 1QVGU 2EIJB 1TUBA 3ETEA 2CGNA 4Y26A 3J80N 4U3FH 4AQ2A 2Q9LA 5C8YB 4FOYA 4IYIA 4RSUA 2PAEA 3L9JT 5LOVB 4CEWA 3EVKA 4D7TA 1FNZA 2X0LA 2ZEXA 2WLJA 2VAUA 4HPKB 3VBUB 2YXYA 3LEGA 1G9AA 4TQFA 1JU3A 1MS0A 3AZZA 4B8EA 4XBQA 1VQMV 4M3CE 2QUOA 4EEQA 1QXPA 3AMNA 1U5XA 2F43G 1ZZ8A 3AMPA 2CAVA 1DYPA 3IJ4A 4MZUA 2P6JA 2KD7A 3UGHA 1NA1C 4IV1B 1FS0G 4I55B 5C8WA 1ZA7A 4E4DX 4H33A 2WT2A 1BLZA 5AC91 2Z42A 1MZ6A 3NV2A 2FB5A 4B3TB 2VJXA 3K77A 4EN0A 2ZGLA 1QU7A 4YW5A 4N7IA 3WXPA 2IWGB 4YJ3A 3BCWA 3M3EA 4PDWA 2JKBA 1ZRIA 4CCKA 1XUQA 3H9AA 3OBRA 3QVNA 2YC0A 2XBO2 4XUNA 1WZXA 3SPIA 5HPOA 3EMRA 1H1MA 1WCKA 4B3NA 2P6CA 4H3WA 3CX5F 3BODA 1W2AX 3H42B 5LATA 3VZOA 3LOIA 4B4RA 3C7OA 1RJ7A 2CYFA 4DV1B 1LRHA 2Q8EA 2VTXA 3CXHF 2YBKA