3CSXA

Structural characterization of a protein in the duf683 family- crystal structure of cce_0567 from the cyanobacterium cyanothece 51142.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein,unknown function
molecule keywords Putative uncharacterized protein
publication title Structural characterization of the protein cce_0567 from Cyanothece 51142, a metalloprotein associated with nitrogen fixation in the DUF683 family.
pubmed doi rcsb
source organism Cyanothece
total genus 24
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05082 Rop-like Rop-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3csxA00
3QF7A 3SJAC 2JS5A 3QG5A 2CAZC 3ICXA 3THOA 1X4TA 2P22C 3B2EE 2F66C 3ZS8C 3SJCC 1NT2B 3CSXA 1SKVA 3SJBC
chains in the Genus database with same CATH superfamily
1BE3H 2EULA 4R7CA 1H2GA 3CRQA 3OEHG 3E8BA 3K5MA 4WBNA 2R70A 3D3IA 5A2QN 2YXHA 1AILA 1SQQH 4DUYO 1YVWA 3E2EA 2PF4E 3L71H 1PNKA 1GM8A 5LMNO 1S77D 5BY1A 3HKBA 3ZRSA 2YIBD 1Y76B 4XDKA 1HWYA 3M99B 4FLVA 3CCEV 4H44B 1GO3F 3FX7A 1EZVH 3OGIB 4YJ2B 1NTKH 1DLBA 4IIJA 2CUGA 1XL4A 3AG4B 1N33B 4UV9A 1H38A 1RFYA 3T1YO 2XT9A 1EN4A 4EB6A 3CRAA 1FFXA 5K1PA 1XL6A 4TWKA 3ASOC 3ETGA 3MHSC 5FPRA 3LSSA 3OD4A 4PDRA 2P4KA 2CAZC 1J5EO 3ZRWB 3UO2A 1KB9F 3H1KH 4QE7A 4OGQB 1VF6C 2UXCB 1KC8W 3SPGA 1AI4A 1GMGA 4LNUA 5B66Z 4E4EA 1AP6A 3BA9A 4NR1A 3ZHRA 2Y48A 3ETDA 3G6BA 3CC2V 2A3QA 1JJ2U 1YJ9V 3HKEB 4JI0B 4CS4A 1TAEA 5JWPA 2UUAB 3OTOB 2JS5A 4U3JA 4YJ3B 4K3AA 4B7KA 1HW7A 1ZUQA 3J81N 1AROP 5CA1B 3APQA 3AG1B 3FB8C 2EIKB 2IU3A 4YY3O 1G8MA 2GDSA 3ICXA 1R6NA 4HAMA 5JCOA 4JYYA 3K0GA 2R9RB 1A32A 4DV0B 3JD2A 2XHBA 2HJDA 3SYCA 2BTQA 2ILMA 3ABLB 4X88A 1D2DA 2JGDB 2YSUB 5C8YB 5H6QA 2GTSA 5LP6B 4LF4B 1SS3A 1F23A 2UXCO 3QNEA 1NR7A 2Y4UA 1NT2B 5GONA 4JI4B 1QBZA 2Q7GA 4FJCC 1N0NA 1BZKA 4NVPA 1R3LC 2CGNA 2M6YA 1VQ7V 2WLMA 4N21A 1XDCA 4JI0O 1JJOA 4O4JA 1BS3A 1V54B 3OT7A 2UUAO 3OTOO 5FL7G 4JI1B 1L8DA 4X1YB 4TV8B 2EZPA 4I4TA 1AB3A 4CZZA 3JYCA 1MA1A 3OUSA 2Q68A 1GRJA 1IBMB 3WB1A 4FZ0A 2OWOA 4IHJB 4DV0O 2CTWA 3JCZA 4L87A 2IJIA 3ZCCA 2YC0A 1J95A 4EEQA 1FXKB 3ZRXA 5LGUA 4LF4O 1ENVA 1DF4A 2QA4V 1Q82W 1XMOB 4PDLA 3D36A 1VQOV 1SQFA 2PTMA 4DV4B 1GN2A 1M4UA 1TUEB 4PD4F 1NTMH 2DMXA 3U11A 1NS1A 5JJEB 5LBQA 2V4DA 2FB5A 4PV1B 1I0HA 1IBKB 2F23A 1MOFA 3ABUA 4JI1O 1QLEB 4X1KA 1ROPA 3OE7G 4NYKA 4UCRA 3L70H 2ZXWB 4AQYB 1Y66A 2HHHO 5B1OA 3N2GB 3SYPA 5B3SC 1JMKC 5LXTB 1IBMO 5EZYB 5IYZA 4OPAA 1YI2V 4L8JA 2UU9B 4DR5B 2KG7B 4UB8Z 2ZKOA 2LGQA 2ZIMA 1OCCB 1P84F 3J80N 2W0FC 4C7UA 1WNSA 4NXNO 4FPPA 2H8PC 3CC7V 1OCZC 4OXSA 4IGGA 1RSOB 1E1RG 2FL4A 1XMOO 2EZOA 1LNQA 4DR7O 4O4HA 2ZR3A 5IYBO 3DGEA 3ZHTA 4DV4O 4KL1A 1P4RA 2R72A 1OCRC 1VQKV 2Y0PA 1AR4A 2OTLV 4YXWG 4GLXA 3A0RA 2D2CB 4BWAA 1IBKO 3BY6A 3N2KA 1KD1W 1T5EA 1M56C 3NR7A 3SYOA 5CBHA 1Z5VA 1WLEA 3CCSV 5LMUB 1VQ6V 3JASB 1JOYA 3GWOA 4AQYO 5FLXN 2PYJA 5EYPB 1THZA 5LOVB 3ABMC 1I5XA 3SPIA 2ZM6B 2UU9O 4DR5O 3CE2A 3ABTA 3CWBH 1GM9A 4WBNB 1SETA 3CCQV 1JFFA 1AJQA 4KFMA 4P9PA 4JAVA 2AZ2A 5H5NA 3U10A 3RN4A 3HKBB 4LC1A 4FM1A 1UFIA 4WFEA 2EIJB 1VQ9V 4AILC 3K03A 3MAQA 4PA4A 1EN5A 2GHYA 4BW5A 1BCCH 4K0KB 3FYEB 1P7GA 4DR4B 4IIJB 4YIPA 1AI6A 1NI8A 3BVOA 3A0HZ 1X4TA 3B40A 5CB4B 1FFXB 3ZN1A 4B3SB 2ZDIC 5KX5A 3OM3B 4XDLA 5C93A 5LHGA 1FXVA 1VQ4V 2ITDC 3CYOA 4FLYA 3KCXA 3WB0A 2PUSA 2ZM6O 3H1LH 4LF8B 4LF5B 2DN9A 1I7FA 4UCSA 1Q6IA 3BHPA 2JGDA 3E86A 5K1XA 4CC6A 4F6EA 4LNUB 4X65B 1KKCA 3RW0A 3SPCA 3CD6V 3NXSA 2G38A 3ZRVA 4G2KA 3WG7B 2YI9A 4U3JB 4DR4O 3F5TA 1PL0A 5JJNB 4K8XA 3TETA 1G6UA 1GKFA 1M5IA 4I50A 1XMQB 4DR3B 4B3SO 2Q5ZA 2H3OA 3X2QB 4ABMA 5KMGA 5L3CA 1QNMA 3EXAA 1V55C 2BTQB 2OTJV 2HG5C 4UCOA 3K08A 1I94B 4PHZA 5GW7A 2JS3A 2HLDG 1XEQA 4LF8O 4LF5O 1IVSA 5H9CA 1IZ3A 1WPBA 2PGGA 3CHXA 4Q20A 2EILB 2DQ0A 3CCUV 5GONB 1K7DA 4X20A 2OIGA 1K8AW 5KHGA 4MVMA 4X65O 2HFEC 1GK9A 4JI7B 2BOCC 1QQCA 4LWSA 4NKGB 3W7WA 3T1CA 3AK2A 3BFRA 2LQTA 1Y6XA 4O4JB 4WFFA 4Z1VA 3BRCA 3MDSA 2MW2B 4MW8A 2QWPB 2AHYA 4JI2B 2QWNB 4I9QA 1P7BA 3IC7A 2QM8A 2QR4A 1W0KG 1PM9A 3ZJZA 4J7JA 4I4TB 1XMQO 4TUYA 1PNLA 2ETNA 2GTAA 4DR3O 4DK1A 4KHPB 3K9SA 3AG3B 1PNMA 3MHHC 4JV5B 4CC5A 1M90W 2Q8VA 5KUKA 2Q7EA 2ZNIA 2BOBC 3AG1C 2QM4A 2EIKC 2YXYA 1NH2D 4JTAB 3OUFA 1I94O 1KMIZ 5LYJA 1HR0B 4AHCA 3RYFA 2NN4A 3ABLC 2RNBA 4O4LA 1L0NH 1MMMA 1ZX3A 1H2KA 4XBFA 5CA0A 5EC1C 3GVMA 1RSOA 4G28B 4JI7O 1L0LH 2DYRB 1CPYA 1VF6A 2CTQA 2WLKA 3OGCC 4UB6Z 3G4SV 4A5UB 2CE4A 4JI2O 5IYCO 1U97A 3IFXA 1RP3B 3LUTB 1EZJA 4X1KB 2BCCH 1V54C 3OEEG 2Q0AA 3T1HB 3CJHA 4ZI7A 3E35A 5IYZB 3W7UA 4JV5O 2D3OW 5HFMA 3I5DA 4FM2A 1WJZA 4B3RO 4CH5A 3DTUB 2UXDB 2OCHA 2JGUA 2IH3C 1EN6A 1YDXA 4CH6A 1OZ0A 4UFZA 1F4MA 2QTOA 2QE7G 1B04A 4CH4A 4MTXA 1HR0O 3SDLA 3P3PA 1YEWA 4O4IB 3JAKA 4O4HB 3LNMB 1PL4A 3T2MA 5EBMC 1JPXA 1NVPB 1K3EA 4N23A 2Q7HA 1MG1A 3IAYA 1FXKC 3D3QA 4RO2A 4W4LA 1N4CA 5IE9A 1G1XB 5ITZA 4ZIBA 4DV5B 3JATB 4K8ZA 1IXMA 5IY5C 4I9WA 3S3WA 1MZEA 1H2MA 2QGNA 4DV6O 3K58A 2XAHA 3N2KB 2ATKC 4X8AA 5CB4A 1CEZA 1CXZB 2QJ1A 3APOA 2E74B 3KG2A 3T1HO 3VQXA 3LDDA 1QLEC 1TA8A 2F95B 3SR2C 4DYLA 1HP8A 2N74A 4J9YB 1Q90D 2UXDO 3HR0A 1FJGO 1NKDA 2UXXA 1AP5A 2ZXWC 3QO7A 2YI8A 4MTFA 5L3DA 4MVRA 4O2BA 5CMUA 4YHHB 1N36B 1JFFB 4UV8A 2ZE7A 1KQSU 3IJ4A 1K4DC 1WP7A 2JJ1G 3CRCA 2ZE5A 4PI0A 2DJVA 2Q67A 5CBGA 1DK1A 1BQ0A 3DC6A 1OCCC 3ASNB 3ZS8C 4MVQA 2P5OA 1QR9A 4HZ3A 1FPOA 3E89A 4X1IA 1SA0A 5GTHZ 1N34B 1R3JC 3ABKC 1WB7A 3UT5A 4U7OA 2LW1A 4FFBA 5KLVH 1HNZB 1H2LA 1Q8IA 2P06A 5LA6A 2QKSA 4AI8A 4JTCB 2X0LA 3CEIA 2VS0A 1N33O 5KX5B 4MVUA 3A0BZ 2ZIOA 1S3JA 1OCOB 2YIBA 5LHIA 1ZAUA 3R65A 4MW3A 2YS8A 3PN1A 1VF5B 1FYJA 4JASA 4YHHO 4J42A 1BSMA 2P22C 3P3NA 2B1GA 4RUEA 5KAFZ 1LUWA 5HFLA 4F6RA 1S5HC 2GSMB 5IWAB 2ZD9A 2GUZA 4GUNA 5JVDA 1N34O 3J7AU 3B4SA 2NR5A 2EIJC 4DXWA 4EFEA 2ADQB 5EBWC 3JAMN 4I50B 5LGNA 1HNZO 1WA8A 2Q69A 4RQFA 2HKOA 4GX2A 4TQDA 3ZEDA 5KMGB 4PA9A 1YSCA 1IBLB 4J10A 1NZ6A 2OIEA 5CA3A 2PYLA 2M7WA 1SRYA 5J2UA 2W6JG 5IJ9A 2VRZA 3QO5A 3WU2Z 3DSQA 4F4LA 3JD0A 3BAAA 3EHBB 3FB6C 3K59A 1PKXA 4DUZB 1F51A 2JIZG 2IJHA 4J7ZA 4ZHQA 4X20B 4MVZA 4DR6B 5KAIZ 2K1EA 1KP2A 1R1BA 3U0ZA 4LWSB 3JCUZ 5IWAO 2PI4A 1F7YA 4JI4O 2QWRB 2BTOA 3N27A 4BR6A 4MVSA 3CMEV 2L6LA 4MTOA 4TUYB 2BE3A 4IYIA 3ML0A 3E8GA 3B8MA 4ZOLA 4ZBMA 2IH1C 1HNWB 1IBLO 2BSKA 1J5EB 2H94A 3Q4HB 2E3CA 3VOUA 4JZ2A 3X2QC 2F66C 5LYJB 1H8EG 1KUQA 4DUZO 2YIDA 3JD3A 3A2FA 4PI2A 3RYFB 1IURA 4JTDB 1AR5A 4O4LB 1SQPH 1VARA 1XBLA 4DR6O 2EIMC 3OMAB 5CA0B 3SYQA 2VQEB 1H2NA 4O4IA 1NTZH 1NU1H 2EILC 3JALA 4QIWF 4NTWA 1YTFB 3AG7A 4OX9B 3B77A 4CS3A 1W59A 5E79Z 2X6CA 1SESA 1Y4MA 2P7TC 3JATA 4KP4A 4QPJA 2EJ7A 3ZBHA 4Z2WA 4WCEV 4FLZA 1US6A 5EIBD 2P67A 3CJHB 4WF9V 4FLTA 4ZI7B 2RQ6A 2E76B 3E8FA 4DV2B 3W7XA 3LNNA 2P6JA 3OR6C 2A7WA 4LCUC 2GBOA 1Q7YW 4BAYA 1K4CC 1AJPA 2R9AA 2IJKA 2OCCC 2LP7A 3HPLC 3ZMZA 2Z5UA 2KB1A 3K0DA 3JAKB 1XHZA 2QM7A 3K3WA 4W4KA 3K79A 3ZMSA 5LHHA 4J41A 2VQEO 4DRXB 4P9OA 3WB2A 1FKAO 4FIPC 1AVMA 2XAQA 2FKXA 4H33A 4IT5A 3TXQA 5ITZB 2IBZH 3D36C 1NH2B 3DXRA 3K06A 1K9MW 4LF7B 4ZKIA 1S76D 1FFTB 1QCEA 3THOA 1TGOA 2AXTZ 4J7KA 1XOUA 2DYRC 2CH7A 2QWOB 3G6EV 3TGUH 2Y4TA 3JARA 2UUBB 3K5NA 1QVFU 2A79B 2RMKB 3E8HA 5LMUO 1M57C 3HKCA 3EVKA 2N04A 4DV2O 2RJZA 3FB5C 1URFA 2X6BA 3K5LA 4O2BB 2FMLA 2WSSG 3VBBA 4DR2B 3RVZA 2QDOA 2Q0OC 2E5LB 1WPXA 2Z0AA 3FFQA 1VQMV 1K92A 4IYHA 4DK0A 5JQGA 3FD9A 1QLNA 5EC2C 4X1IB 1VQ8V 1SA0B 4PJ0Z 3I56V 5KA5A 3UT5B 2HP8A 4FFBB 2WAMA 3ZX6A 3AK1A 4LF7O 4JI8B 4K0KO 4NTYA 1RPRA 3MD0A 5LA6B 3P30A 4P2ZA 3FB7C 4LF6B 3TXSA 2VQFB 2DYSB 3VQWA 5F2VO 2UUBO 4CBCA 2PZSA 1SQBH 1BHBA 2IW5A 4RQEA 2XASA 4DO2A 5DM6V 1Y74B 3AG4C 2IU0A 3TCUA 4B3TB 4JI5B 5DECA 2Y69B 4GZRB 2A0LA 5BR8B 4QPKA 1IX9A 2ADPA 4DR2O 4DR1B 5DEDA 4LFCB 4F6RB 3ZMUA 3ETQA 5B1BB 5LGTA 2GUZB 4TQFA 5IJ0A 3L75H 2CK3G 5JVDB 3SJQC 2XAGA 1BL8A 1FS0G 4JAUA 1JQ0A 4GX0A 2XAJA 1VQNV 1G4YB 4FLWA 2CDYA 1SC5B 3ASNC 2ARHA 2AZ0A 4LR3A 5KHHA 4JI8O 3T4DA 1WA8B 1B6QA 1OCRB 4LF6O 4UVCA 1OJHA 4DW0A 2VQFO 3CX5F 2UXNA 1WP8A 3F5WC 1L1FA 2ZE8A 3IC9A 1QVGU 4PA3A 4PELA 1GH6A 2HEPA 4PA6A 5J2UB 3ZMTA 3ZN0A 2XNDG 3ZHVA 5IJ9B 3P32A 5JJJB 5L3EA 5IYDO 4NXMB 1XNQB 3RFRA 1M56B 4JI5O 2V7QG 3T4ZA 3STZC 1XHXA 1ORQC 1ZL8A 3Q4HA 5EIBC 3FKSG 3K5OA 1PP9H 2LW7A 5BR8O 4OPHA 3OFNG 4ZHQB 2JDIG 4JI3B 4DR1O 3CCVV 4LFCO 1DTOA 1E1QG 4LFAB 3F7VC 2W0XA 5L3BA 4U7NA 2HJFC 4PDMA 1Q5OA 4G27B 4UUJC 5LP6C 4WFBV 4FLXA 3PJSK 1GN4A 2F43G 3OW2U 1RM1B 3H9VA 3ZMVA 4LH6A 4GX1A 4H13B 5LMNB 3L9DA 4ZOLB 2ZR2A 2IJJA 2BSKB 4H0LB 2DW4A 4KHPO 2FTKA 2F1MA 4LFBB 3G71V 3CXCU 4TOIA 1K5QA 4NXMO 2NNUA 5H6RA 1XNQO 1M93A 1K5SA 1V9PA 3FAVA 3L72H 4O2AB 4BIZA 1QU7A 5L3GA 3T1YB 3I55V 3TK1A 4FMTA 4JI3O 4MVOA 3GWKC 4LFAO 3CMAV 2YUAA 2F4VB 5EBLC 4DV7B 4I55A 4I5SA 2WLNA 2P4VA 1R3KC 3ZHSA 3JALB 2XTAA 5BXZA 3RGBA 2P90A 2JEXA 3KCYA 2DQ3A 4DRXA 2N05A 2JRIA 3CRMA 1JVMA 4X64B 3OAAG 4GX5A 1SKVA 4D7TA 1DF5A 2KQXA 1NQTA 1QHTA 2WLLA 1U96A 1D5AA 2Q9LA 1N8RW 3AEIA 4Z1MG 1KKDA 4XDJA 3LSUA 3O9OA 3E83A 2R9IA 5D5QA 2XUMA 3B2EE 2DOSA 4LFBO 3RYCA 2WLJA 2XOKG 3LDEA 4J80A 5CBFA 1UJWB 3W7TA 2NLJC 1K33A 5FPOA 1V55B 1ZLZA 4YY3B 1FAFA 4LF9B 1S72V 1BHAA 3CS5A 4ASUG 4GYCB 1VQLV 5KHJA 3K9AA 2F4VO 4DV7O 2A06H 3OMIB 1O9HA 3H1JH 1XI1A 5B1AB 1EFRG 2EJRA 1KYOF 3DXRB 1NJIW 3H01A 1BT8A 3R66A 4MSWC 2YEVA 4CH3A 3UM7A 1ZWIC 3VQYA 2CH7B 4DV5O 4GT1A 4X64O 1YITV 3JARB 1MSDA 2EINB 1YZBA 3G80A 3JD1A 4PDVA 4X62B 3SPJA 4FZ1A 3HKCB 2Q4PA 2YXLA 4R50A 4FM0A 1YXBA 5BZBA 3SGIA 5J9PC 3L73H 1Y74A 4I0XA 3CCRV 5JH7A 3B8NA 4WFGA 2RCVA 3LDCA 1N36O 1S0VA 4K35A 3CRRA 1Q6HA 1Q81W 1LUVA 1GN3A 5JQGB 4LF9O 3UKMA 3HKDA 2OT5A 1ZSPA 3SJCC 2WWWA 3AK3A 1K34A 3OR7C 2ZT9B 5L3FA 1YF2A 4P30A 1JR9A 1VEWA 3RYIA 4NB5A 3VQVA 4UCVA 3OMNB 4RWUA 2DWEC 4BIOA 3S3XA 3H1IH 4HYOA 5J2TA 3HB3B 1MABG 2JEUA 3BCCH 1TUBA 1F4NA 4UCUA 4QNHB 4X62O 3CSXA 2UUCB 1MZFA 5BMVA 1WB8A 1QR8A 3SJBC 1BMFG 2CGOA 4J11A 3JAWA 3RYHA 1XREA 4HNAA 2X6AA 3AG2B 3RWRD 2HHHB 1NVPD 5IJ0B 1O9GA 3GB7C 4UCTA 2ITCC 1K73W 4EKWA 3E22A 1BQZA 1TVKA 4NXNB 1B06A 1XUQA 2CTRA 1W2BU 1CP9A 4J9ZB 2AW9A 3WG7C 1XQ8A 4X66B 4DR7B 1SZXA 5IY5B 4TV9B 1VP7A 1HDJA 2E75B 2KKWA 2DYSC 3ZHQA 2UUCO 1OHHG 3C3SA 1ZL8B 1N32B 5FNVA 5A9GA 2RDCA 1YCIA 5JCOC 2XAFA 1K97A 2JJ2G 4WFAV 2ZDIA 3ASOB 4GKJB 1IDSA 4O2AA 1YHQV 2WLIA 2Y69C 2B5UA 1MNGA 2K9PA 1YJNV 2VWKA 2DWDC 1S5JA 4JF3A 1GTOA 3LSQA 1SERA 3RVYA 4JYAB 1NBMG 5B1BC 1IXBA 4TSFG 1OV9A 1VIBA 3ETEA 3CPWU 2IM9A 1KU9A 3ABKB 1WN7A 4BIUA 3JD4A 4X66O 2EBOA 1EM1A 5TISZ 1HNWO 2EX3A 1Y76A 1PV0A 2O57A 3JSLA 1S5LZ 3FAVB 3A8TA 2ODMA 4DV3B 1N32O 1VQPV 4B7EA 1VMGA 1W0JG 3AG3C 4YJ2A 4GKJO 3STLC 3SYAA 4I55B 1GM7A 3W7SA 3IGAC 4JZGA 5DN6G 4E2LA 2L35A 1DGSA 2LGWA 3QO8A 3QG5A 2HVJC 2B9ZA 4JYAO 3KKYA 4JYBA 1COWG 2Q73A 1AR1B 1M1KW 3QTCA 4OX9O 4KXRA 2WLLB 3ZRWA 4Q6GA 4X9QA 1Q43A 1SZTA 4GCZA 1RM1C 4D7SA 4JPRA 4JAAA 4JI6B 2AGAA 3RYCB 3CCJV 1XILA 5KHIA 2ZNJA 4FFKA 3HKEA 1KBHA 4DV3O 1M9NA 4IL6Z 4UVAA 4EB6B 4QE9A 4YJ3A 2YICA 5CA1A 4DV1B 3RT3C 3CC4V 4I7ZB 3O65A 5CN0A 4YIOA 5KA6A 1H8HG 5B5EZ 2QKCA 3M8AA 3BEHA 2YEVB 5H2FZ 1NR1A 1P49A 2JVDA 1Y67A 1WAZA 1SQXH 5C8YA 2QSAA 3SJAC 1SQVH 2X7RB 5LP6A 3CCLV 1JCHA 3DC5A 3CB2A 2A9HA 2YIAA 2JK5C 4LP8A 1Z5WA 2LO1A 1AI7A 4MS2A 1EBOA 5IT9N 4JI6O 4TT3G 3QF7A 4I0XB 1VF7A 2WLHA 2ZE6A 5JH7B 1YJWV 3M7MX 3K04A 3TJTA 4R6ZA 4H37A 3KZIZ 5B3SB 4QGPA 3HKDB 1AJNA 2LFRA 1FXHA 2E5LO 2KSDA 4X1YA 4TV8A 4DV1O 1H2SB 2UXBB 1LR1A 4FVMA 1YIJV 2LJ2A 1YTFD 2C2AA 2W6IG 4FK5C 4BW9A 2ZCEA 2HR3A 4PA7A 3ZIAG 2AHZA 1E79G 4LBEC 1B3QA 1OCZB 2EIMB 4IHJA 3RYIB 1Q3EA 1PD3A 2WA3A 2ZINA 2OYQA 2V1DA 4MTGA 1N0JA 5B1AC 4GKKB 3H1HH 5J2TB 2ZQMA 3EFFK 1HNXB 1FXKA 1BGYH 4ICGA 1KECA 1TUBB 1R6TA 4JYCA 3JSNA 1XNRB 4RAIA 5LL6Y 4DW1A 1R6KA 5IDJA 5EK0A 4D6TH 5BMVB 1ZTEA 3WFVA 4TV9A 2PI5A 4HBNA 2EINC 2YDEA 3BPZA 2F93B 5KUMA 4B3TO 2GV9A 1FD9A 3JAWB 3RYHB 2QTSA 4NTXA 4HNAB 2QKAA 4B3MB 1RPOA 3B09A 1SQGA 1OCOC 3C3TA 1Q6UA 3ABMB 1D5NA 4KUMA 2WA4A 1AI5A 3UCSC 3L74H 1R3IC 3QVNA 2HVKC 2UXBO 2OCCB 3BABA 4B3RB 3OTFA 4UXNA 1KP3A 2B1IA 2MK3A 3N2GA 4R8CA 5LXTA 4B08A 4RUFA 5EZYA 3E22B 2RN9A 1TVKB 1Q86W 2KG7A 5B1NA 1MSWD 5KHKA 5GTIZ 4QJFB 1PPJH 3CXHF 2PY5A 4UVBA 1I08A 2QWQB 4EFBA 3F7YC 4JGSA 4DUYB 4GKKO 1HNXO 1JA8A 1GAXA 3CP1A 3UQ8A 1XNRO 5D5PA 2DE0X 5E1AC 4X89A 1VQ5V 4FLUA 4WFHA 5FNVB 3SPHA 2Q6AA 1I5YA 2WPDG 3ZHUA 4DV6B 4U3FH 1SF9A 1UPGA 2VWJA 4LH7A 4B3MO 1M57B 5AG2A 2WLIB 4CS2A 1X59A 1JX9A 3UO3A 2Y0IA 3CCMV 3K57A 3D8CA 3JASA 4MT8A 3FYIB 1GN6A 2LFSA 1FJGB 1R73A 3BA8A 5EYPA 5LOVA 2FYUH 3AG2C 1Z2GA 3RBZA 3C90A 2CTPA 2Z3YA 3G67A 2QEXV
chains in the Genus database with same CATH topology
2BTQB 2RQ6A 4UCOA 3K5MA 5J2TA 1I94B 4WBNA 4PHZA 4DV2B 2R70A 3LNNA 1TUBA 4UCUA 1WPBA 2PGGA 3CHXA 3CSXA 2UUCB 5BMVA 2R9AA 3HKBA 5GONB 2YIBD 3SJBC 4X20A 5KHGA 3JAKB 3JAWA 4JI7B 4FLVA 1QQCA 3RYHA 1XHZA 4HNAA 4YJ2B 4O4JB 3WB2A 4IIJA 4DRXB 3BRCA 3RWRD 2HHHB 1N33B 5IJ0B 1O9GA 5ITZB 4UCTA 4JI2B 4I9QA 4EB6A 1FFXA 4LF7B 5K1PA 3THOA 5FPRA 1TGOA 4I4TB 4TUYA 4DK1A 4KHPB 3E22A 1TVKA 4NXNB 4JV5B 3JARA 4CC5A 2UUBB 3K5NA 2CAZC 2Q7EA 2ZNIA 2QM4A 1XQ8A 4X66B 4DR7B 3HKCA 2UXCB 1KMIZ 2RJZA 4TV9B 3K5LA 5LYJA 4O2BB 1HR0B 2KKWA 4LNUA 4AHCA 4DR2B 3BA9A 3RYFA 1N32B 5FNVA 4O4LA 2E5LB 3FFQA 5JCOC 3HKEB 5CA0A 4JI0B 4CS4A 1RSOA 4GKJB 4DK0A 1TAEA 5JQGA 2UUAB 4O2AA 3OTOB 2JS5A 4U3JA 4YJ3B 4X1IB 1SA0B 1HW7A 3UT5B 5CA1B 2VWKA 4FFBB 1S5JA 4X1KB 3ICXA 4JI8B 5JCOA 5LA6B 4JYAB 4LF6B 2VQFB 2Q0AA 4DV0B 3T1HB 3VQWA 4ZI7A 2XHBA 2BTQA 5IYZB 4FM2A 2PZSA 2IM9A 1KU9A 4CH5A 5C8YB 2UXDB 2JGUA 1WN7A 5LP6B 4CH6A 4LF4B 4B3TB 4UFZA 4JI5B 1B04A 4CH4A 1NT2B 2EX3A 5GONA 4JI4B 2Q7GA 5BR8B 1YEWA 3JSLA 4NVPA 4O4IB 3JAKA 4DR1B 4DV3B 4LFCB 4O4HB 4F6RB 2Q7HA 1JJOA 3ETQA 4YJ2A 3IAYA 4O4JA 4TQFA 5IJ0A 4I55B 5JVDB 5ITZA 4ZIBA 4JI1B 1L8DA 3JATB 4DV5B 4K8ZA 4X1YB 4TV8B 4FLWA 3K58A 3N2KB 4I4TA 4LR3A 5KHHA 1DGSA 3QG5A 1IBMB 5CB4A 3WB1A 2QJ1A 2OWOA 3QTCA 4IHJB 4Q6GA 3VQXA 1TA8A 1Q43A 2F95B 3SR2C 2HEPA 5J2UB 4D7SA 4EEQA 5IJ9B 2YI8A 5JJJB 4NXMB 4O2BA 4YHHB 1XNQB 1N36B 1JFFB 3RFRA 1XHXA 5EIBC 1XMOB 4JI6B 3K5OA 3RYCB 1SQFA 2PTMA 5KHIA 4PI0A 2ZNJA 4DV4B 3HKEA 4ZHQB 4JI3B 1M4UA 3ZS8C 4LFAB 2P5OA 3U11A 4EB6B 4YJ3A 5JJEB 4X1IA 1SA0A 1N34B 2V4DA 1IBKB 3UT5A 5CA1A 4DV1B 1Q5OA 4FFBA 5LP6C 4FLXA 4X1KA 1HNZB 1Q8IA 5LA6A 4UCRA 4AQYB 4LH6A 3N2GB 5KX5B 1JMKC 5LXTB 1P49A 5EZYB 2JVDA 5IYZA 4L8JA 5LMNB 2UU9B 4DR5B 4ZOLB 5C8YA 2ZIOA 3SJAC 2ZIMA 2YIBA 5LP6A 1ZAUA 1WNSA 2F1MA 3PN1A 3CB2A 4LFBB 4TOIA 2YIAA 1Z5WA 1M93A 1V9PA 2P22C 3QF7A 4O2AB 4O4HA 1VF7A 4F6RA 5JH7B 3T1YB 4KL1A 2R72A 3M7MX 5IWAB 2F4VB 4DV7B 4I55A 5JVDA 3HKDB 4GLXA 3JALB 4X1YA 4BWAA 4TV8A 3RGBA 1H2SB 2UXBB 4DRXA 3N2KA 4FVMA 4EFEA 1T5EA 4I50B 4BW9A 2ZCEA 1Z5VA 5LMUB 4X64B 3JASB 1SKVA 4D7TA 2PYJA 4TQDA 5EYPB 3ZEDA 4IHJA 3RYIB 1QHTA 5KMGB 1Q3EA 5LOVB 1D5AA 1IBLB 2ZINA 2ZM6B 2OYQA 2PYLA 5J2UA 4GKKB 5J2TB 5IJ9A 4WBNB 1HNXB 3DSQA 1JFFA 3BAAA 5D5QA 1TUBB 3K59A 3B2EE 3JSNA 1XNRB 4DUZB 3RYCA 5BMVB 3U10A 3HKBB 4TV9A 4HBNA 4FM1A 4ZHQA 4X20B 4DR6B 3BPZA 2F93B 5FPOA 2GV9A 4AILC 3JAWB 3MAQA 3RYHB 3U0ZA 4YY3B 4LF9B 4HNAB 4B3MB 4K0KB 4GYCB 5KHJA 4DR4B 1SQGA 4IIJB 2BTOA 1O9HA 1XI1A 1X4TA 5CB4B 3BABA 1FFXB 4B3RB 4B3SB 3OTFA 3N2GA 5KX5A 4CH3A 4TUYB 5LXTA 3VQYA 4B08A 5EZYA 3E22B 1TVKB 4ZOLA 4FLYA 5KHKA 3JARB 1HNWB 3WB0A 2PY5A 1J5EB 2PUSA 4EFBA 4LF8B 4DUYB 4LF5B 2E3CA 4X62B 3HKCB 1I7FA 2F66C 4UCSA 2YXLA 3BHPA 3UQ8A 4FM0A 5LYJB 5D5PA 3SGIA 5K1XA 4CC6A 4LNUB 4X65B 4FLUA 3A2FA 4PI2A 3RYFB 5JH7A 5FNVB 4O4LB 5CA0B 2VQEB 4DV6B 5JQGB 4O4IA 2VWJA 2YI9A 3HKDA 4LH7A 4U3JB 3JALA 4CS2A 3SJCC 5JJNB 4K8XA 1G6UA 4OX9B 4CS3A 1M5IA 4I50A 3K57A 1XMQB 4DR3B 3JATA 3JASA 1FJGB 4FLZA 5EYPA 3BA8A 3RYIA 5KMGA 5LOVA 5EIBD 3VQVA 4UCVA 4FLTA 4ZI7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QF7 A;  3SJA C;  2JS5 A;  3QG5 A;  2CAZ C;  3ICX A;  3THO A;  1X4T A;  2P22 C;  3B2E E;  2F66 C;  3ZS8 C;  3SJC C;  1NT2 B;  3CSX A;  1SKV A;  3SJB C; 
#chains in the Genus database with same CATH topology
 1BE3 H;  2EUL A;  4R7C A;  1H2G A;  3CRQ A;  3OEH G;  3E8B A;  3K5M A;  4WBN A;  2R70 A;  3D3I A;  5A2Q N;  2YXH A;  1AIL A;  1SQQ H;  4DUY O;  1YVW A;  3E2E A;  2PF4 E;  3L71 H;  1PNK A;  1GM8 A;  5LMN O;  1S77 D;  5BY1 A;  3HKB A;  3ZRS A;  2YIB D;  1Y76 B;  4XDK A;  1HWY A;  3M99 B;  4FLV A;  3CCE V;  4H44 B;  1GO3 F;  3FX7 A;  1EZV H;  3OGI B;  4YJ2 B;  1NTK H;  1DLB A;  4IIJ A;  2CUG A;  1XL4 A;  3AG4 B;  1N33 B;  4UV9 A;  1H38 A;  1RFY A;  3T1Y O;  2XT9 A;  1EN4 A;  4EB6 A;  3CRA A;  1FFX A;  5K1P A;  1XL6 A;  4TWK A;  3ASO C;  3ETG A;  3MHS C;  5FPR A;  3LSS A;  3OD4 A;  4PDR A;  2P4K A;  2CAZ C;  1J5E O;  3ZRW B;  3UO2 A;  1KB9 F;  3H1K H;  4QE7 A;  4OGQ B;  1VF6 C;  2UXC B;  1KC8 W;  3SPG A;  1AI4 A;  1GMG A;  4LNU A;  5B66 Z;  4E4E A;  1AP6 A;  3BA9 A;  4NR1 A;  3ZHR A;  2Y48 A;  3ETD A;  3G6B A;  3CC2 V;  2A3Q A;  1JJ2 U;  1YJ9 V;  3HKE B;  4JI0 B;  4CS4 A;  1TAE A;  5JWP A;  2UUA B;  3OTO B;  2JS5 A;  4U3J A;  4YJ3 B;  4K3A A;  4B7K A;  1HW7 A;  1ZUQ A;  3J81 N;  1ARO P;  5CA1 B;  3APQ A;  3AG1 B;  3FB8 C;  2EIK B;  2IU3 A;  4YY3 O;  1G8M A;  2GDS A;  3ICX A;  1R6N A;  4HAM A;  5JCO A;  4JYY A;  3K0G A;  2R9R B;  1A32 A;  4DV0 B;  3JD2 A;  2XHB A;  2HJD A;  3SYC A;  2BTQ A;  2ILM A;  3ABL B;  4X88 A;  1D2D A;  2JGD B;  2YSU B;  5C8Y B;  5H6Q A;  2GTS A;  5LP6 B;  4LF4 B;  1SS3 A;  1F23 A;  2UXC O;  3QNE A;  1NR7 A;  2Y4U A;  1NT2 B;  5GON A;  4JI4 B;  1QBZ A;  2Q7G A;  4FJC C;  1N0N A;  1BZK A;  4NVP A;  1R3L C;  2CGN A;  2M6Y A;  1VQ7 V;  2WLM A;  4N21 A;  1XDC A;  4JI0 O;  1JJO A;  4O4J A;  1BS3 A;  1V54 B;  3OT7 A;  2UUA O;  3OTO O;  5FL7 G;  4JI1 B;  1L8D A;  4X1Y B;  4TV8 B;  2EZP A;  4I4T A;  1AB3 A;  4CZZ A;  3JYC A;  1MA1 A;  3OUS A;  2Q68 A;  1GRJ A;  1IBM B;  3WB1 A;  4FZ0 A;  2OWO A;  4IHJ B;  4DV0 O;  2CTW A;  3JCZ A;  4L87 A;  2IJI A;  3ZCC A;  2YC0 A;  1J95 A;  4EEQ A;  1FXK B;  3ZRX A;  5LGU A;  4LF4 O;  1ENV A;  1DF4 A;  2QA4 V;  1Q82 W;  1XMO B;  4PDL A;  3D36 A;  1VQO V;  1SQF A;  2PTM A;  4DV4 B;  1GN2 A;  1M4U A;  1TUE B;  4PD4 F;  1NTM H;  2DMX A;  3U11 A;  1NS1 A;  5JJE B;  5LBQ A;  2V4D A;  2FB5 A;  4PV1 B;  1I0H A;  1IBK B;  2F23 A;  1MOF A;  3ABU A;  4JI1 O;  1QLE B;  4X1K A;  1ROP A;  3OE7 G;  4NYK A;  4UCR A;  3L70 H;  2ZXW B;  4AQY B;  1Y66 A;  2HHH O;  5B1O A;  3N2G B;  3SYP A;  5B3S C;  1JMK C;  5LXT B;  1IBM O;  5EZY B;  5IYZ A;  4OPA A;  1YI2 V;  4L8J A;  2UU9 B;  4DR5 B;  2KG7 B;  4UB8 Z;  2ZKO A;  2LGQ A;  2ZIM A;  1OCC B;  1P84 F;  3J80 N;  2W0F C;  4C7U A;  1WNS A;  4NXN O;  4FPP A;  2H8P C;  3CC7 V;  1OCZ C;  4OXS A;  4IGG A;  1RSO B;  1E1R G;  2FL4 A;  1XMO O;  2EZO A;  1LNQ A;  4DR7 O;  4O4H A;  2ZR3 A;  5IYB O;  3DGE A;  3ZHT A;  4DV4 O;  4KL1 A;  1P4R A;  2R72 A;  1OCR C;  1VQK V;  2Y0P A;  1AR4 A;  2OTL V;  4YXW G;  4GLX A;  3A0R A;  2D2C B;  4BWA A;  1IBK O;  3BY6 A;  3N2K A;  1KD1 W;  1T5E A;  1M56 C;  3NR7 A;  3SYO A;  5CBH A;  1Z5V A;  1WLE A;  3CCS V;  5LMU B;  1VQ6 V;  3JAS B;  1JOY A;  3GWO A;  4AQY O;  5FLX N;  2PYJ A;  5EYP B;  1THZ A;  5LOV B;  3ABM C;  1I5X A;  3SPI A;  2ZM6 B;  2UU9 O;  4DR5 O;  3CE2 A;  3ABT A;  3CWB H;  1GM9 A;  4WBN B;  1SET A;  3CCQ V;  1JFF A;  1AJQ A;  4KFM A;  4P9P A;  4JAV A;  2AZ2 A;  5H5N A;  3U10 A;  3RN4 A;  3HKB B;  4LC1 A;  4FM1 A;  1UFI A;  4WFE A;  2EIJ B;  1VQ9 V;  4AIL C;  3K03 A;  3MAQ A;  4PA4 A;  1EN5 A;  2GHY A;  4BW5 A;  1BCC H;  4K0K B;  3FYE B;  1P7G A;  4DR4 B;  4IIJ B;  4YIP A;  1AI6 A;  1NI8 A;  3BVO A;  3A0H Z;  1X4T A;  3B40 A;  5CB4 B;  1FFX B;  3ZN1 A;  4B3S B;  2ZDI C;  5KX5 A;  3OM3 B;  4XDL A;  5C93 A;  5LHG A;  1FXV A;  1VQ4 V;  2ITD C;  3CYO A;  4FLY A;  3KCX A;  3WB0 A;  2PUS A;  2ZM6 O;  3H1L H;  4LF8 B;  4LF5 B;  2DN9 A;  1I7F A;  4UCS A;  1Q6I A;  3BHP A;  2JGD A;  3E86 A;  5K1X A;  4CC6 A;  4F6E A;  4LNU B;  4X65 B;  1KKC A;  3RW0 A;  3SPC A;  3CD6 V;  3NXS A;  2G38 A;  3ZRV A;  4G2K A;  3WG7 B;  2YI9 A;  4U3J B;  4DR4 O;  3F5T A;  1PL0 A;  5JJN B;  4K8X A;  3TET A;  1G6U A;  1GKF A;  1M5I A;  4I50 A;  1XMQ B;  4DR3 B;  4B3S O;  2Q5Z A;  2H3O A;  3X2Q B;  4ABM A;  5KMG A;  5L3C A;  1QNM A;  3EXA A;  1V55 C;  2BTQ B;  2OTJ V;  2HG5 C;  4UCO A;  3K08 A;  1I94 B;  4PHZ A;  5GW7 A;  2JS3 A;  2HLD G;  1XEQ A;  4LF8 O;  4LF5 O;  1IVS A;  5H9C A;  1IZ3 A;  1WPB A;  2PGG A;  3CHX A;  4Q20 A;  2EIL B;  2DQ0 A;  3CCU V;  5GON B;  1K7D A;  4X20 A;  2OIG A;  1K8A W;  5KHG A;  4MVM A;  4X65 O;  2HFE C;  1GK9 A;  4JI7 B;  2BOC C;  1QQC A;  4LWS A;  4NKG B;  3W7W A;  3T1C A;  3AK2 A;  3BFR A;  2LQT A;  1Y6X A;  4O4J B;  4WFF A;  4Z1V A;  3BRC A;  3MDS A;  2MW2 B;  4MW8 A;  2QWP B;  2AHY A;  4JI2 B;  2QWN B;  4I9Q A;  1P7B A;  3IC7 A;  2QM8 A;  2QR4 A;  1W0K G;  1PM9 A;  3ZJZ A;  4J7J A;  4I4T B;  1XMQ O;  4TUY A;  1PNL A;  2ETN A;  2GTA A;  4DR3 O;  4DK1 A;  4KHP B;  3K9S A;  3AG3 B;  1PNM A;  3MHH C;  4JV5 B;  4CC5 A;  1M90 W;  2Q8V A;  5KUK A;  2Q7E A;  2ZNI A;  2BOB C;  3AG1 C;  2QM4 A;  2EIK C;  2YXY A;  1NH2 D;  4JTA B;  3OUF A;  1I94 O;  1KMI Z;  5LYJ A;  1HR0 B;  4AHC A;  3RYF A;  2NN4 A;  3ABL C;  2RNB A;  4O4L A;  1L0N H;  1MMM A;  1ZX3 A;  1H2K A;  4XBF A;  5CA0 A;  5EC1 C;  3GVM A;  1RSO A;  4G28 B;  4JI7 O;  1L0L H;  2DYR B;  1CPY A;  1VF6 A;  2CTQ A;  2WLK A;  3OGC C;  4UB6 Z;  3G4S V;  4A5U B;  2CE4 A;  4JI2 O;  5IYC O;  1U97 A;  3IFX A;  1RP3 B;  3LUT B;  1EZJ A;  4X1K B;  2BCC H;  1V54 C;  3OEE G;  2Q0A A;  3T1H B;  3CJH A;  4ZI7 A;  3E35 A;  5IYZ B;  3W7U A;  4JV5 O;  2D3O W;  5HFM A;  3I5D A;  4FM2 A;  1WJZ A;  4B3R O;  4CH5 A;  3DTU B;  2UXD B;  2OCH A;  2JGU A;  2IH3 C;  1EN6 A;  1YDX A;  4CH6 A;  1OZ0 A;  4UFZ A;  1F4M A;  2QTO A;  2QE7 G;  1B04 A;  4CH4 A;  4MTX A;  1HR0 O;  3SDL A;  3P3P A;  1YEW A;  4O4I B;  3JAK A;  4O4H B;  3LNM B;  1PL4 A;  3T2M A;  5EBM C;  1JPX A;  1NVP B;  1K3E A;  4N23 A;  2Q7H A;  1MG1 A;  3IAY A;  1FXK C;  3D3Q A;  4RO2 A;  4W4L A;  1N4C A;  5IE9 A;  1G1X B;  5ITZ A;  4ZIB A;  4DV5 B;  3JAT B;  4K8Z A;  1IXM A;  5IY5 C;  4I9W A;  3S3W A;  1MZE A;  1H2M A;  2QGN A;  4DV6 O;  3K58 A;  2XAH A;  3N2K B;  2ATK C;  4X8A A;  5CB4 A;  1CEZ A;  1CXZ B;  2QJ1 A;  3APO A;  2E74 B;  3KG2 A;  3T1H O;  3VQX A;  3LDD A;  1QLE C;  1TA8 A;  2F95 B;  3SR2 C;  4DYL A;  1HP8 A;  2N74 A;  4J9Y B;  1Q90 D;  2UXD O;  3HR0 A;  1FJG O;  1NKD A;  2UXX A;  1AP5 A;  2ZXW C;  3QO7 A;  2YI8 A;  4MTF A;  5L3D A;  4MVR A;  4O2B A;  5CMU A;  4YHH B;  1N36 B;  1JFF B;  4UV8 A;  2ZE7 A;  1KQS U;  3IJ4 A;  1K4D C;  1WP7 A;  2JJ1 G;  3CRC A;  2ZE5 A;  4PI0 A;  2DJV A;  2Q67 A;  5CBG A;  1DK1 A;  1BQ0 A;  3DC6 A;  1OCC C;  3ASN B;  3ZS8 C;  4MVQ A;  2P5O A;  1QR9 A;  4HZ3 A;  1FPO A;  3E89 A;  4X1I A;  1SA0 A;  5GTH Z;  1N34 B;  1R3J C;  3ABK C;  1WB7 A;  3UT5 A;  4U7O A;  2LW1 A;  4FFB A;  5KLV H;  1HNZ B;  1H2L A;  1Q8I A;  2P06 A;  5LA6 A;  2QKS A;  4AI8 A;  4JTC B;  2X0L A;  3CEI A;  2VS0 A;  1N33 O;  5KX5 B;  4MVU A;  3A0B Z;  2ZIO A;  1S3J A;  1OCO B;  2YIB A;  5LHI A;  1ZAU A;  3R65 A;  4MW3 A;  2YS8 A;  3PN1 A;  1VF5 B;  1FYJ A;  4JAS A;  4YHH O;  4J42 A;  1BSM A;  2P22 C;  3P3N A;  2B1G A;  4RUE A;  5KAF Z;  1LUW A;  5HFL A;  4F6R A;  1S5H C;  2GSM B;  5IWA B;  2ZD9 A;  2GUZ A;  4GUN A;  5JVD A;  1N34 O;  3J7A U;  3B4S A;  2NR5 A;  2EIJ C;  4DXW A;  4EFE A;  2ADQ B;  5EBW C;  3JAM N;  4I50 B;  5LGN A;  1HNZ O;  1WA8 A;  2Q69 A;  4RQF A;  2HKO A;  4GX2 A;  4TQD A;  3ZED A;  5KMG B;  4PA9 A;  1YSC A;  1IBL B;  4J10 A;  1NZ6 A;  2OIE A;  5CA3 A;  2PYL A;  2M7W A;  1SRY A;  5J2U A;  2W6J G;  5IJ9 A;  2VRZ A;  3QO5 A;  3WU2 Z;  3DSQ A;  4F4L A;  3JD0 A;  3BAA A;  3EHB B;  3FB6 C;  3K59 A;  1PKX A;  4DUZ B;  1F51 A;  2JIZ G;  2IJH A;  4J7Z A;  4ZHQ A;  4X20 B;  4MVZ A;  4DR6 B;  5KAI Z;  2K1E A;  1KP2 A;  1R1B A;  3U0Z A;  4LWS B;  3JCU Z;  5IWA O;  2PI4 A;  1F7Y A;  4JI4 O;  2QWR B;  2BTO A;  3N27 A;  4BR6 A;  4MVS A;  3CME V;  2L6L A;  4MTO A;  4TUY B;  2BE3 A;  4IYI A;  3ML0 A;  3E8G A;  3B8M A;  4ZOL A;  4ZBM A;  2IH1 C;  1HNW B;  1IBL O;  2BSK A;  1J5E B;  2H94 A;  3Q4H B;  2E3C A;  3VOU A;  4JZ2 A;  3X2Q C;  2F66 C;  5LYJ B;  1H8E G;  1KUQ A;  4DUZ O;  2YID A;  3JD3 A;  3A2F A;  4PI2 A;  3RYF B;  1IUR A;  4JTD B;  1AR5 A;  4O4L B;  1SQP H;  1VAR A;  1XBL A;  4DR6 O;  2EIM C;  3OMA B;  5CA0 B;  3SYQ A;  2VQE B;  1H2N A;  4O4I A;  1NTZ H;  1NU1 H;  2EIL C;  3JAL A;  4QIW F;  4NTW A;  1YTF B;  3AG7 A;  4OX9 B;  3B77 A;  4CS3 A;  1W59 A;  5E79 Z;  2X6C A;  1SES A;  1Y4M A;  2P7T C;  3JAT A;  4KP4 A;  4QPJ A;  2EJ7 A;  3ZBH A;  4Z2W A;  4WCE V;  4FLZ A;  1US6 A;  5EIB D;  2P67 A;  3CJH B;  4WF9 V;  4FLT A;  4ZI7 B;  2RQ6 A;  2E76 B;  3E8F A;  4DV2 B;  3W7X A;  3LNN A;  2P6J A;  3OR6 C;  2A7W A;  4LCU C;  2GBO A;  1Q7Y W;  4BAY A;  1K4C C;  1AJP A;  2R9A A;  2IJK A;  2OCC C;  2LP7 A;  3HPL C;  3ZMZ A;  2Z5U A;  2KB1 A;  3K0D A;  3JAK B;  1XHZ A;  2QM7 A;  3K3W A;  4W4K A;  3K79 A;  3ZMS A;  5LHH A;  4J41 A;  2VQE O;  4DRX B;  4P9O A;  3WB2 A;  1FKA O;  4FIP C;  1AVM A;  2XAQ A;  2FKX A;  4H33 A;  4IT5 A;  3TXQ A;  5ITZ B;  2IBZ H;  3D36 C;  1NH2 B;  3DXR A;  3K06 A;  1K9M W;  4LF7 B;  4ZKI A;  1S76 D;  1FFT B;  1QCE A;  3THO A;  1TGO A;  2AXT Z;  4J7K A;  1XOU A;  2DYR C;  2CH7 A;  2QWO B;  3G6E V;  3TGU H;  2Y4T A;  3JAR A;  2UUB B;  3K5N A;  1QVF U;  2A79 B;  2RMK B;  3E8H A;  5LMU O;  1M57 C;  3HKC A;  3EVK A;  2N04 A;  4DV2 O;  2RJZ A;  3FB5 C;  1URF A;  2X6B A;  3K5L A;  4O2B B;  2FML A;  2WSS G;  3VBB A;  4DR2 B;  3RVZ A;  2QDO A;  2Q0O C;  2E5L B;  1WPX A;  2Z0A A;  3FFQ A;  1VQM V;  1K92 A;  4IYH A;  4DK0 A;  5JQG A;  3FD9 A;  1QLN A;  5EC2 C;  4X1I B;  1VQ8 V;  1SA0 B;  4PJ0 Z;  3I56 V;  5KA5 A;  3UT5 B;  2HP8 A;  4FFB B;  2WAM A;  3ZX6 A;  3AK1 A;  4LF7 O;  4JI8 B;  4K0K O;  4NTY A;  1RPR A;  3MD0 A;  5LA6 B;  3P30 A;  4P2Z A;  3FB7 C;  4LF6 B;  3TXS A;  2VQF B;  2DYS B;  3VQW A;  5F2V O;  2UUB O;  4CBC A;  2PZS A;  1SQB H;  1BHB A;  2IW5 A;  4RQE A;  2XAS A;  4DO2 A;  5DM6 V;  1Y74 B;  3AG4 C;  2IU0 A;  3TCU A;  4B3T B;  4JI5 B;  5DEC A;  2Y69 B;  4GZR B;  2A0L A;  5BR8 B;  4QPK A;  1IX9 A;  2ADP A;  4DR2 O;  4DR1 B;  5DED A;  4LFC B;  4F6R B;  3ZMU A;  3ETQ A;  5B1B B;  5LGT A;  2GUZ B;  4TQF A;  5IJ0 A;  3L75 H;  2CK3 G;  5JVD B;  3SJQ C;  2XAG A;  1BL8 A;  1FS0 G;  4JAU A;  1JQ0 A;  4GX0 A;  2XAJ A;  1VQN V;  1G4Y B;  4FLW A;  2CDY A;  1SC5 B;  3ASN C;  2ARH A;  2AZ0 A;  4LR3 A;  5KHH A;  4JI8 O;  3T4D A;  1WA8 B;  1B6Q A;  1OCR B;  4LF6 O;  4UVC A;  1OJH A;  4DW0 A;  2VQF O;  3CX5 F;  2UXN A;  1WP8 A;  3F5W C;  1L1F A;  2ZE8 A;  3IC9 A;  1QVG U;  4PA3 A;  4PEL A;  1GH6 A;  2HEP A;  4PA6 A;  5J2U B;  3ZMT A;  3ZN0 A;  2XND G;  3ZHV A;  5IJ9 B;  3P32 A;  5JJJ B;  5L3E A;  5IYD O;  4NXM B;  1XNQ B;  3RFR A;  1M56 B;  4JI5 O;  2V7Q G;  3T4Z A;  3STZ C;  1XHX A;  1ORQ C;  1ZL8 A;  3Q4H A;  5EIB C;  3FKS G;  3K5O A;  1PP9 H;  2LW7 A;  5BR8 O;  4OPH A;  3OFN G;  4ZHQ B;  2JDI G;  4JI3 B;  4DR1 O;  3CCV V;  4LFC O;  1DTO A;  1E1Q G;  4LFA B;  3F7V C;  2W0X A;  5L3B A;  4U7N A;  2HJF C;  4PDM A;  1Q5O A;  4G27 B;  4UUJ C;  5LP6 C;  4WFB V;  4FLX A;  3PJS K;  1GN4 A;  2F43 G;  3OW2 U;  1RM1 B;  3H9V A;  3ZMV A;  4LH6 A;  4GX1 A;  4H13 B;  5LMN B;  3L9D A;  4ZOL B;  2ZR2 A;  2IJJ A;  2BSK B;  4H0L B;  2DW4 A;  4KHP O;  2FTK A;  2F1M A;  4LFB B;  3G71 V;  3CXC U;  4TOI A;  1K5Q A;  4NXM O;  2NNU A;  5H6R A;  1XNQ O;  1M93 A;  1K5S A;  1V9P A;  3FAV A;  3L72 H;  4O2A B;  4BIZ A;  1QU7 A;  5L3G A;  3T1Y B;  3I55 V;  3TK1 A;  4FMT A;  4JI3 O;  4MVO A;  3GWK C;  4LFA O;  3CMA V;  2YUA A;  2F4V B;  5EBL C;  4DV7 B;  4I55 A;  4I5S A;  2WLN A;  2P4V A;  1R3K C;  3ZHS A;  3JAL B;  2XTA A;  5BXZ A;  3RGB A;  2P90 A;  2JEX A;  3KCY A;  2DQ3 A;  4DRX A;  2N05 A;  2JRI A;  3CRM A;  1JVM A;  4X64 B;  3OAA G;  4GX5 A;  1SKV A;  4D7T A;  1DF5 A;  2KQX A;  1NQT A;  1QHT A;  2WLL A;  1U96 A;  1D5A A;  2Q9L A;  1N8R W;  3AEI A;  4Z1M G;  1KKD A;  4XDJ A;  3LSU A;  3O9O A;  3E83 A;  2R9I A;  5D5Q A;  2XUM A;  3B2E E;  2DOS A;  4LFB O;  3RYC A;  2WLJ A;  2XOK G;  3LDE A;  4J80 A;  5CBF A;  1UJW B;  3W7T A;  2NLJ C;  1K33 A;  5FPO A;  1V55 B;  1ZLZ A;  4YY3 B;  1FAF A;  4LF9 B;  1S72 V;  1BHA A;  3CS5 A;  4ASU G;  4GYC B;  1VQL V;  5KHJ A;  3K9A A;  2F4V O;  4DV7 O;  2A06 H;  3OMI B;  1O9H A;  3H1J H;  1XI1 A;  5B1A B;  1EFR G;  2EJR A;  1KYO F;  3DXR B;  1NJI W;  3H01 A;  1BT8 A;  3R66 A;  4MSW C;  2YEV A;  4CH3 A;  3UM7 A;  1ZWI C;  3VQY A;  2CH7 B;  4DV5 O;  4GT1 A;  4X64 O;  1YIT V;  3JAR B;  1MSD A;  2EIN B;  1YZB A;  3G80 A;  3JD1 A;  4PDV A;  4X62 B;  3SPJ A;  4FZ1 A;  3HKC B;  2Q4P A;  2YXL A;  4R50 A;  4FM0 A;  1YXB A;  5BZB A;  3SGI A;  5J9P C;  3L73 H;  1Y74 A;  4I0X A;  3CCR V;  5JH7 A;  3B8N A;  4WFG A;  2RCV A;  3LDC A;  1N36 O;  1S0V A;  4K35 A;  3CRR A;  1Q6H A;  1Q81 W;  1LUV A;  1GN3 A;  5JQG B;  4LF9 O;  3UKM A;  3HKD A;  2OT5 A;  1ZSP A;  3SJC C;  2WWW A;  3AK3 A;  1K34 A;  3OR7 C;  2ZT9 B;  5L3F A;  1YF2 A;  4P30 A;  1JR9 A;  1VEW A;  3RYI A;  4NB5 A;  3VQV A;  4UCV A;  3OMN B;  4RWU A;  2DWE C;  4BIO A;  3S3X A;  3H1I H;  4HYO A;  5J2T A;  3HB3 B;  1MAB G;  2JEU A;  3BCC H;  1TUB A;  1F4N A;  4UCU A;  4QNH B;  4X62 O;  3CSX A;  2UUC B;  1MZF A;  5BMV A;  1WB8 A;  1QR8 A;  3SJB C;  1BMF G;  2CGO A;  4J11 A;  3JAW A;  3RYH A;  1XRE A;  4HNA A;  2X6A A;  3AG2 B;  3RWR D;  2HHH B;  1NVP D;  5IJ0 B;  1O9G A;  3GB7 C;  4UCT A;  2ITC C;  1K73 W;  4EKW A;  3E22 A;  1BQZ A;  1TVK A;  4NXN B;  1B06 A;  1XUQ A;  2CTR A;  1W2B U;  1CP9 A;  4J9Z B;  2AW9 A;  3WG7 C;  1XQ8 A;  4X66 B;  4DR7 B;  1SZX A;  5IY5 B;  4TV9 B;  1VP7 A;  1HDJ A;  2E75 B;  2KKW A;  2DYS C;  3ZHQ A;  2UUC O;  1OHH G;  3C3S A;  1ZL8 B;  1N32 B;  5FNV A;  5A9G A;  2RDC A;  1YCI A;  5JCO C;  2XAF A;  1K97 A;  2JJ2 G;  4WFA V;  2ZDI A;  3ASO B;  4GKJ B;  1IDS A;  4O2A A;  1YHQ V;  2WLI A;  2Y69 C;  2B5U A;  1MNG A;  2K9P A;  1YJN V;  2VWK A;  2DWD C;  1S5J A;  4JF3 A;  1GTO A;  3LSQ A;  1SER A;  3RVY A;  4JYA B;  1NBM G;  5B1B C;  1IXB A;  4TSF G;  1OV9 A;  1VIB A;  3ETE A;  3CPW U;  2IM9 A;  1KU9 A;  3ABK B;  1WN7 A;  4BIU A;  3JD4 A;  4X66 O;  2EBO A;  1EM1 A;  5TIS Z;  1HNW O;  2EX3 A;  1Y76 A;  1PV0 A;  2O57 A;  3JSL A;  1S5L Z;  3FAV B;  3A8T A;  2ODM A;  4DV3 B;  1N32 O;  1VQP V;  4B7E A;  1VMG A;  1W0J G;  3AG3 C;  4YJ2 A;  4GKJ O;  3STL C;  3SYA A;  4I55 B;  1GM7 A;  3W7S A;  3IGA C;  4JZG A;  5DN6 G;  4E2L A;  2L35 A;  1DGS A;  2LGW A;  3QO8 A;  3QG5 A;  2HVJ C;  2B9Z A;  4JYA O;  3KKY A;  4JYB A;  1COW G;  2Q73 A;  1AR1 B;  1M1K W;  3QTC A;  4OX9 O;  4KXR A;  2WLL B;  3ZRW A;  4Q6G A;  4X9Q A;  1Q43 A;  1SZT A;  4GCZ A;  1RM1 C;  4D7S A;  4JPR A;  4JAA A;  4JI6 B;  2AGA A;  3RYC B;  3CCJ V;  1XIL A;  5KHI A;  2ZNJ A;  4FFK A;  3HKE A;  1KBH A;  4DV3 O;  1M9N A;  4IL6 Z;  4UVA A;  4EB6 B;  4QE9 A;  4YJ3 A;  2YIC A;  5CA1 A;  4DV1 B;  3RT3 C;  3CC4 V;  4I7Z B;  3O65 A;  5CN0 A;  4YIO A;  5KA6 A;  1H8H G;  5B5E Z;  2QKC A;  3M8A A;  3BEH A;  2YEV B;  5H2F Z;  1NR1 A;  1P49 A;  2JVD A;  1Y67 A;  1WAZ A;  1SQX H;  5C8Y A;  2QSA A;  3SJA C;  1SQV H;  2X7R B;  5LP6 A;  3CCL V;  1JCH A;  3DC5 A;  3CB2 A;  2A9H A;  2YIA A;  2JK5 C;  4LP8 A;  1Z5W A;  2LO1 A;  1AI7 A;  4MS2 A;  1EBO A;  5IT9 N;  4JI6 O;  4TT3 G;  3QF7 A;  4I0X B;  1VF7 A;  2WLH A;  2ZE6 A;  5JH7 B;  1YJW V;  3M7M X;  3K04 A;  3TJT A;  4R6Z A;  4H37 A;  3KZI Z;  5B3S B;  4QGP A;  3HKD B;  1AJN A;  2LFR A;  1FXH A;  2E5L O;  2KSD A;  4X1Y A;  4TV8 A;  4DV1 O;  1H2S B;  2UXB B;  1LR1 A;  4FVM A;  1YIJ V;  2LJ2 A;  1YTF D;  2C2A A;  2W6I G;  4FK5 C;  4BW9 A;  2ZCE A;  2HR3 A;  4PA7 A;  3ZIA G;  2AHZ A;  1E79 G;  4LBE C;  1B3Q A;  1OCZ B;  2EIM B;  4IHJ A;  3RYI B;  1Q3E A;  1PD3 A;  2WA3 A;  2ZIN A;  2OYQ A;  2V1D A;  4MTG A;  1N0J A;  5B1A C;  4GKK B;  3H1H H;  5J2T B;  2ZQM A;  3EFF K;  1HNX B;  1FXK A;  1BGY H;  4ICG A;  1KEC A;  1TUB B;  1R6T A;  4JYC A;  3JSN A;  1XNR B;  4RAI A;  5LL6 Y;  4DW1 A;  1R6K A;  5IDJ A;  5EK0 A;  4D6T H;  5BMV B;  1ZTE A;  3WFV A;  4TV9 A;  2PI5 A;  4HBN A;  2EIN C;  2YDE A;  3BPZ A;  2F93 B;  5KUM A;  4B3T O;  2GV9 A;  1FD9 A;  3JAW B;  3RYH B;  2QTS A;  4NTX A;  4HNA B;  2QKA A;  4B3M B;  1RPO A;  3B09 A;  1SQG A;  1OCO C;  3C3T A;  1Q6U A;  3ABM B;  1D5N A;  4KUM A;  2WA4 A;  1AI5 A;  3UCS C;  3L74 H;  1R3I C;  3QVN A;  2HVK C;  2UXB O;  2OCC B;  3BAB A;  4B3R B;  3OTF A;  4UXN A;  1KP3 A;  2B1I A;  2MK3 A;  3N2G A;  4R8C A;  5LXT A;  4B08 A;  4RUF A;  5EZY A;  3E22 B;  2RN9 A;  1TVK B;  1Q86 W;  2KG7 A;  5B1N A;  1MSW D;  5KHK A;  5GTI Z;  4QJF B;  1PPJ H;  3CXH F;  2PY5 A;  4UVB A;  1I08 A;  2QWQ B;  4EFB A;  3F7Y C;  4JGS A;  4DUY B;  4GKK O;  1HNX O;  1JA8 A;  1GAX A;  3CP1 A;  3UQ8 A;  1XNR O;  5D5P A;  2DE0 X;  5E1A C;  4X89 A;  1VQ5 V;  4FLU A;  4WFH A;  5FNV B;  3SPH A;  2Q6A A;  1I5Y A;  2WPD G;  3ZHU A;  4DV6 B;  4U3F H;  1SF9 A;  1UPG A;  2VWJ A;  4LH7 A;  4B3M O;  1M57 B;  5AG2 A;  2WLI B;  4CS2 A;  1X59 A;  1JX9 A;  3UO3 A;  2Y0I A;  3CCM V;  3K57 A;  3D8C A;  3JAS A;  4MT8 A;  3FYI B;  1GN6 A;  2LFS A;  1FJG B;  1R73 A;  3BA8 A;  5EYP A;  5LOV A;  2FYU H;  3AG2 C;  1Z2G A;  3RBZ A;  3C90 A;  2CTP A;  2Z3Y A;  3G67 A;  2QEX V; 
#chains in the Genus database with same CATH homology
 2BTQ B;  2RQ6 A;  4UCO A;  3K5M A;  5J2T A;  1I94 B;  4WBN A;  4PHZ A;  4DV2 B;  2R70 A;  3LNN A;  1TUB A;  4UCU A;  1WPB A;  2PGG A;  3CHX A;  3CSX A;  2UUC B;  5BMV A;  2R9A A;  3HKB A;  5GON B;  2YIB D;  3SJB C;  4X20 A;  5KHG A;  3JAK B;  3JAW A;  4JI7 B;  4FLV A;  1QQC A;  3RYH A;  1XHZ A;  4HNA A;  4YJ2 B;  4O4J B;  3WB2 A;  4IIJ A;  4DRX B;  3BRC A;  3RWR D;  2HHH B;  1N33 B;  5IJ0 B;  1O9G A;  5ITZ B;  4UCT A;  4JI2 B;  4I9Q A;  4EB6 A;  1FFX A;  4LF7 B;  5K1P A;  3THO A;  5FPR A;  1TGO A;  4I4T B;  4TUY A;  4DK1 A;  4KHP B;  3E22 A;  1TVK A;  4NXN B;  4JV5 B;  3JAR A;  4CC5 A;  2UUB B;  3K5N A;  2CAZ C;  2Q7E A;  2ZNI A;  2QM4 A;  1XQ8 A;  4X66 B;  4DR7 B;  3HKC A;  2UXC B;  1KMI Z;  2RJZ A;  4TV9 B;  3K5L A;  5LYJ A;  4O2B B;  1HR0 B;  2KKW A;  4LNU A;  4AHC A;  4DR2 B;  3BA9 A;  3RYF A;  1N32 B;  5FNV A;  4O4L A;  2E5L B;  3FFQ A;  5JCO C;  3HKE B;  5CA0 A;  4JI0 B;  4CS4 A;  1RSO A;  4GKJ B;  4DK0 A;  1TAE A;  5JQG A;  2UUA B;  4O2A A;  3OTO B;  2JS5 A;  4U3J A;  4YJ3 B;  4X1I B;  1SA0 B;  1HW7 A;  3UT5 B;  5CA1 B;  2VWK A;  4FFB B;  1S5J A;  4X1K B;  3ICX A;  4JI8 B;  5JCO A;  5LA6 B;  4JYA B;  4LF6 B;  2VQF B;  2Q0A A;  4DV0 B;  3T1H B;  3VQW A;  4ZI7 A;  2XHB A;  2BTQ A;  5IYZ B;  4FM2 A;  2PZS A;  2IM9 A;  1KU9 A;  4CH5 A;  5C8Y B;  2UXD B;  2JGU A;  1WN7 A;  5LP6 B;  4CH6 A;  4LF4 B;  4B3T B;  4UFZ A;  4JI5 B;  1B04 A;  4CH4 A;  1NT2 B;  2EX3 A;  5GON A;  4JI4 B;  2Q7G A;  5BR8 B;  1YEW A;  3JSL A;  4NVP A;  4O4I B;  3JAK A;  4DR1 B;  4DV3 B;  4LFC B;  4O4H B;  4F6R B;  2Q7H A;  1JJO A;  3ETQ A;  4YJ2 A;  3IAY A;  4O4J A;  4TQF A;  5IJ0 A;  4I55 B;  5JVD B;  5ITZ A;  4ZIB A;  4JI1 B;  1L8D A;  3JAT B;  4DV5 B;  4K8Z A;  4X1Y B;  4TV8 B;  4FLW A;  3K58 A;  3N2K B;  4I4T A;  4LR3 A;  5KHH A;  1DGS A;  3QG5 A;  1IBM B;  5CB4 A;  3WB1 A;  2QJ1 A;  2OWO A;  3QTC A;  4IHJ B;  4Q6G A;  3VQX A;  1TA8 A;  1Q43 A;  2F95 B;  3SR2 C;  2HEP A;  5J2U B;  4D7S A;  4EEQ A;  5IJ9 B;  2YI8 A;  5JJJ B;  4NXM B;  4O2B A;  4YHH B;  1XNQ B;  1N36 B;  1JFF B;  3RFR A;  1XHX A;  5EIB C;  1XMO B;  4JI6 B;  3K5O A;  3RYC B;  1SQF A;  2PTM A;  5KHI A;  4PI0 A;  2ZNJ A;  4DV4 B;  3HKE A;  4ZHQ B;  4JI3 B;  1M4U A;  3ZS8 C;  4LFA B;  2P5O A;  3U11 A;  4EB6 B;  4YJ3 A;  5JJE B;  4X1I A;  1SA0 A;  1N34 B;  2V4D A;  1IBK B;  3UT5 A;  5CA1 A;  4DV1 B;  1Q5O A;  4FFB A;  5LP6 C;  4FLX A;  4X1K A;  1HNZ B;  1Q8I A;  5LA6 A;  4UCR A;  4AQY B;  4LH6 A;  3N2G B;  5KX5 B;  1JMK C;  5LXT B;  1P49 A;  5EZY B;  2JVD A;  5IYZ A;  4L8J A;  5LMN B;  2UU9 B;  4DR5 B;  4ZOL B;  5C8Y A;  2ZIO A;  3SJA C;  2ZIM A;  2YIB A;  5LP6 A;  1ZAU A;  1WNS A;  2F1M A;  3PN1 A;  3CB2 A;  4LFB B;  4TOI A;  2YIA A;  1Z5W A;  1M93 A;  1V9P A;  2P22 C;  3QF7 A;  4O2A B;  4O4H A;  1VF7 A;  4F6R A;  5JH7 B;  3T1Y B;  4KL1 A;  2R72 A;  3M7M X;  5IWA B;  2F4V B;  4DV7 B;  4I55 A;  5JVD A;  3HKD B;  4GLX A;  3JAL B;  4X1Y A;  4BWA A;  4TV8 A;  3RGB A;  1H2S B;  2UXB B;  4DRX A;  3N2K A;  4FVM A;  4EFE A;  1T5E A;  4I50 B;  4BW9 A;  2ZCE A;  1Z5V A;  5LMU B;  4X64 B;  3JAS B;  1SKV A;  4D7T A;  2PYJ A;  4TQD A;  5EYP B;  3ZED A;  4IHJ A;  3RYI B;  1QHT A;  5KMG B;  1Q3E A;  5LOV B;  1D5A A;  1IBL B;  2ZIN A;  2ZM6 B;  2OYQ A;  2PYL A;  5J2U A;  4GKK B;  5J2T B;  5IJ9 A;  4WBN B;  1HNX B;  3DSQ A;  1JFF A;  3BAA A;  5D5Q A;  1TUB B;  3K59 A;  3B2E E;  3JSN A;  1XNR B;  4DUZ B;  3RYC A;  5BMV B;  3U10 A;  3HKB B;  4TV9 A;  4HBN A;  4FM1 A;  4ZHQ A;  4X20 B;  4DR6 B;  3BPZ A;  2F93 B;  5FPO A;  2GV9 A;  4AIL C;  3JAW B;  3MAQ A;  3RYH B;  3U0Z A;  4YY3 B;  4LF9 B;  4HNA B;  4B3M B;  4K0K B;  4GYC B;  5KHJ A;  4DR4 B;  1SQG A;  4IIJ B;  2BTO A;  1O9H A;  1XI1 A;  1X4T A;  5CB4 B;  3BAB A;  1FFX B;  4B3R B;  4B3S B;  3OTF A;  3N2G A;  5KX5 A;  4CH3 A;  4TUY B;  5LXT A;  3VQY A;  4B08 A;  5EZY A;  3E22 B;  1TVK B;  4ZOL A;  4FLY A;  5KHK A;  3JAR B;  1HNW B;  3WB0 A;  2PY5 A;  1J5E B;  2PUS A;  4EFB A;  4LF8 B;  4DUY B;  4LF5 B;  2E3C A;  4X62 B;  3HKC B;  1I7F A;  2F66 C;  4UCS A;  2YXL A;  3BHP A;  3UQ8 A;  4FM0 A;  5LYJ B;  5D5P A;  3SGI A;  5K1X A;  4CC6 A;  4LNU B;  4X65 B;  4FLU A;  3A2F A;  4PI2 A;  3RYF B;  5JH7 A;  5FNV B;  4O4L B;  5CA0 B;  2VQE B;  4DV6 B;  5JQG B;  4O4I A;  2VWJ A;  2YI9 A;  3HKD A;  4LH7 A;  4U3J B;  3JAL A;  4CS2 A;  3SJC C;  5JJN B;  4K8X A;  1G6U A;  4OX9 B;  4CS3 A;  1M5I A;  4I50 A;  3K57 A;  1XMQ B;  4DR3 B;  3JAT A;  3JAS A;  1FJG B;  4FLZ A;  5EYP A;  3BA8 A;  3RYI A;  5KMG A;  5LOV A;  5EIB D;  3VQV A;  4UCV A;  4FLT A;  4ZI7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...