3CSXA

Structural characterization of a protein in the duf683 family- crystal structure of cce_0567 from the cyanobacterium cyanothece 51142.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural characterization of the protein cce_0567 from Cyanothece 51142, a metalloprotein associated with nitrogen fixation in the DUF683 family.
pubmed doi rcsb
source organism Cyanothece
molecule tags Metal binding protein,unknown function
total genus 24
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05082 Rop-like Rop-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3csxA00
3QG5A 1NT2B 2CAZC 1X4TA 2JS5A 2P22C 3ICXA 3QF7A 3SJBC 3SJAC 3SJCC 3CSXA 2F66C 3THOA 3B2EE 1SKVA 3ZS8C
chains in the Genus database with same CATH superfamily
4ZOLB 4B3MB 1K3EA 3A2FA 1H8HG 4IIJA 1VQPV 4BIZA 4TV8A 5B1AC 2ZXWB 2E5LB 3ABUA 1N34B 4J11A 1WPBA 2GUZB 1Q43A 5BMVB 3UCSC 2KG7A 3S3XA 1H2SB 1BCCH 2HP8A 4BAYA 2UXDO 4TUYA 3ZMSA 1QR9A 2ZM6B 1ZUQA 3JARA 3K06A 1MZFA 2LFRA 4CZZA 3RYIB 3K5MA 4MVQA 2OT5A 4W4KA 3CRCA 3L70H 3VQYA 5CB4B 4L8JA 3N2GB 5L3BA 2JGDB 3CEIA 1ZL8A 2N04A 3J80N 4IYIA 4JTDB 1MSDA 4FLZA 1N36O 3CCEV 4LP8A 1NTMH 2ITCC 3K04A 1N36B 3ZRVA 1VQNV 3ZHTA 2ZIOA 4P9OA 2R72A 1P84F 4X88A 1F4NA 2OTJV 3MHSC 2P90A 3CSXA 4JI6O 4I7ZB 4FM2A 3JD1A 1VIBA 4HNAB 4UB8Z 2OCHA 1R3KC 1MG1A 5A9GA 4BW5A 3HKDB 5BR8O 5LP6C 2L35A 2P06A 1PNLA 1Y66A 4TQDA 2YXYA 3VQVA 1SA0A 2EBOA 4X1IA 1YZBA 1FYJA 1JR9A 2CE4A 2GTSA 5IWAO 2R9RB 1G8MA 3E8BA 5IWAB 1W2BU 1AR1B 1XMQO 5B66Z 4CS4A 4X1YB 2DWDC 4PELA 2BOBC 4KHPB 5B1NA 1RPOA 4P9PA 4TV9B 3RT3C 4EFBA 3LSQA 4JPRA 4MW3A 5CA0A 4DV6B 4YJ2A 2EIKB 3SYQA 3APQA 4GX1A 1YEWA 4K0KB 5LMNB 2CH7A 1OCZB 4YXWG 4WF9V 4X65O 3ASOB 1YI2V 2DJVA 2CAZC 1M1KW 3ETQA 3U0ZA 5E79Z 4X65B 1N32O 4WFBV 1QU7A 5LOVB 1BHBA 4PA3A 3N27A 1K33A 3JD0A 3D3QA 3K58A 2ZE5A 3CJHB 3I56V 2QJ1A 1I5YA 4I4TB 2A7WA 4K8ZA 3AG1B 2PZSA 3ZRXA 3OEEG 3IC9A 2Y69C 1F23A 4ZHQA 4G27B 4TT3G 3A8TA 2A3QA 5GONA 4LF6B 3ZRWA 4UCOA 2OCCC 2B9ZA 1H2GA 5TISZ 1K73W 1QLEB 1M4UA 5J2TA 2EIMB 1F51A 5KX5A 4OXSA 4UB6Z 1R6NA 3SJCC 1AJNA 3AG4B 1R3LC 4GZRB 2HLDG 1YJWV 3WB0A 4YHHO 2UUCO 1V54C 4LNUB 1JOYA 4BIOA 3RFRA 3DC6A 1IX9A 1MSWD 5B5EZ 2Z3YA 4JI3O 4JAAA 4O4IA 5KHIA 5L3EA 4JI3B 2XAGA 4NYKA 3R65A 4I0XB 3ZHVA 4IYHA 3LDCA 2E74B 4DXWA 1J95A 2WLHA 1RSOA 2JGUA 4UV9A 1XI1A 4DK0A 2GSMB 2UXNA 1Q6UA 5FNVB 3JAKB 2QTSA 4LFBO 1OCCB 1H2MA 3ZS8C 2FL4A 3L74H 1XL4A 1XHZA 1ROPA 5LXTB 4MSWC 4LF9B 3H1HH 4DV2O 2CGOA 3HKCB 5K1PA 1OV9A 4LFCB 4DR4O 2F93B 5JH7A 3TXSA 4DV2B 2R9AA 5EBLC 2DYRB 2B5UA 1IBKO 4LF7B 2ADQB 3A0HZ 4IHJA 3EVKA 1KBHA 3OMAB 4N21A 2P5OA 2IJKA 1AI5A 1IBKB 2BE3A 2DYSC 4AQYB 3OW2U 1EN5A 1VARA 4LWSA 4YY3O 5CBFA 4NKGB 4GX2A 3MHHC 5GTHZ 1FS0G 4QPJA 2HHHO 1WB7A 4YY3B 3ABLC 2UXBO 2RN9A 2IBZH 4YIPA 5CA1B 2CDYA 4GYCB 5A2QN 2JRIA 4O2BB 2UXBB 1XDCA 4TOIA 3W7SA 2C2AA 2CTWA 1TUBA 4JGSA 1HR0B 5L3FA 4O4JB 4U3FH 5JJNB 1KB9F 3PN1A 2EZOA 2LW7A 5LHGA 4IIJB 3CC4V 4Q20A 4TV8B 4LF5B 1SQXH 1QVFU 4QE9A 3FB6C 3SDLA 4FJCC 2KG7B 3LSUA 4GLXA 3FB5C 5LP6A 3T1YO 2Q6AA 5BY1A 1Q81W 4TUYB 2RJZA 4K8XA 1THZA 4FVMA 4F6RA 3JARB 1KUQA 2QSAA 1K97A 1KD1W 1AB3A 1K9MW 1VMGA 1M5IA 3CCVV 4XDJA 2X7RB 1JFFA 4FLWA 4EKWA 1ZL8B 1DF4A 1WAZA 1EN4A 1BL8A 3BEHA 4ASUG 1V55B 3OTFA 1PL4A 1ZAUA 4JV5O 3WB1A 4PDMA 1GN6A 1AP5A 2WLLB 4X62B 4ZBMA 2Z5UA 3E8FA 3FYEB 4DO2A 3L71H 1SF9A 3CRRA 3CS5A 3G6BA 3DC5A 4DR1B 2RNBA 3SYAA 3W7TA 4JI1B 3I5DA 4WFAV 1SA0B 1ZX3A 1JQ0A 4X1IB 3H01A 1A32A 3THOA 2MK3A 3EXAA 5LBQA 4RO2A 2XAHA 4BW9A 1PKXA 5EK0A 2ZNIA 4UVBA 3T4ZA 4JAUA 4N23A 3E8HA 1Q3EA 1EBOA 1VQLV 5CA0B 2YUAA 2Q7HA 4YJ2B 4JI8O 4X64B 1M56B 1VEWA 3FB7C 2Y4TA 4IL6Z 3L72H 1GM8A 4FLYA 2VQEB 1GN2A 2WLNA 3B09A 2CH7B 3O9OA 4TSFG 3RYFA 3CX5F 1O9HA 3K0GA 1VQ9V 1V55C 3CHXA 1PL0A 1UFIA 4MW8A 2LO1A 1NT2B 3AK2A 1ZSPA 3KZIZ 4FK5C 2AHYA 3OAAG 1Y74A 3A0BZ 1I94B 3IAYA 4GCZA 1XREA 2YC0A 2XUMA 2F43G 2N74A 2IJHA 4JTAB 1SC5B 1JJOA 3TXQA 3CCQV 4DR7B 2IJIA 4DV0O 4UV8A 4UCVA 5GONB 3ZX6A 3T4DA 3ZRWB 2JS3A 4DV0B 4JI0B 2F1MA 5J2TB 5EC1C 2EINB 1KQSU 4DV3O 2HG5C 5F2VO 5KX5B 3TGUH 4DV3B 3OR7C 2NNUA 4CH4A 3AG3B 2F4VO 3CCLV 2RDCA 3ABKC 1FPOA 3QG5A 2F4VB 1S76D 2P4KA 3F5TA 4GKJO 1IXMA 4WFFA 2CK3G 4GKJB 1EZJA 1XBLA 3CXHF 1G1XB 5CA3A 4BR6A 5KMGA 4DUZO 1RM1B 2UUAO 3HKEA 1OJHA 2VWKA 4DUZB 3E22A 4O4IB 4PDLA 1YJNV 2PYLA 5LMUO 1P4RA 3OUFA 4B3SB 2B1GA 1QVGU 3E83A 3JASA 2PY5A 5LMUB 3ZN0A 4RQEA 4MTGA 3G80A 2AHZA 1RSOB 4JF3A 1W0KG 3ZCCA 1NR7A 3JAMN 3D36C 2WLMA 3AK3A 3QO5A 4DK1A 2UXXA 4AILC 4J7ZA 1YITV 1GRJA 2QR4A 5LGTA 1JA8A 3U10A 5JVDA 4OPAA 1NR1A 2PTMA 1NQTA 4C7UA 3T1CA 3ZMZA 4IHJB 1NH2D 3W7UA 4QNHB 4ZI7A 4RUEA 1XEQA 4LWSB 1TUEB 2G38A 2LP7A 2QWNB 1X59A 2P6JA 2ZIMA 1MOFA 2OIGA 3BHPA 2WPDG 1TUBB 2LW1A 3L75H 1YHQV 4UCUA 4WCEV 1VQ8V 1K5QA 4TWKA 4UUJC 2YXHA 5KLVH 4J9ZB 1DTOA 5KHGA 1XMOO 3KG2A 5LHHA 2XAJA 1YF2A 4NVPA 4OGQB 1XMOB 4JI2B 5EZYA 4FM1A 3JCZA 3CC2V 4DR3O 4RQFA 4B3RB 2VWJA 4DR3B 5LP6B 4DV1O 2ADPA 4I55A 1NI8A 4CS2A 4X66O 4FM0A 3UM7A 2YSUB 3IJ4A 2XT9A 4F6RB 5C8YA 4EEQA 3SJBC 3ASNC 2VQFO 3MAQA 4HAMA 1J5EO 1JFFB 3CMEV 4QGPA 1H8EG 5GTIZ 2UXDB 3CRAA 4J7KA 4LF4O 1OCOC 2IU0A 4LF4B 1Q7YW 1VF6C 2NLJC 1VF5B 4GX0A 4DV5O 4UFZA 4LBEC 4MT8A 3CP1A 4QIWF 3DGEA 1LUVA 1VQ5V 3E8GA 4MVSA 3H1JH 4Z1VA 2OTLV 1SZXA 4IT5A 4PD4F 1R6KA 4Z1MG 3OGIB 2DWEC 4LH6A 5EC2C 2AGAA 3T2MA 4WFEA 1VQ7V 3UQ8A 2BOCC 2WLLA 1Z5VA 3QF7A 5CN0A 4JI6B 2JIZG 3RBZA 5EIBD 1NH2B 2LQTA 4FPPA 5BR8B 4ICGA 5HFMA 2ZE6A 3I55V 2Y69B 4MVRA 4GKKO 1IBMO 3FD9A 4PI0A 1BE3H 5JCOC 2OCCB 1IBMB 1ZTEA 4YIOA 4YJ3A 1GAXA 2UXCO 2FMLA 5H5NA 3WG7C 2XAQA 4FLXA 1XMQB 1SESA 1AJQA 2FB5A 2P4VA 1QCEA 3C3SA 3RYFB 3ABMC 1V54B 2H94A 3SYPA 1I5XA 2WWWA 1Q5OA 4UCSA 1B04A 1Y74B 4LFAO 1K7DA 3Q4HA 3SJAC 1QQCA 2ZINA 5JQGA 1IVSA 4TQFA 4R6ZA 2UU9O 4CC5A 3CC7V 1N32B 1HP8A 2K9PA 1KYOF 4O4LA 2MW2B 3D36A 1OCRC 4GT1A 1VF7A 1H2KA 1S5HC 1NTZH 2M6YA 2LFSA 2GDSA 1K8AW 2X0LA 1NU1H 2ARHA 5GW7A 4D7TA 4I50A 5IYCO 3OD4A 3PJSK 4H0LB 1NS1A 1FFTB 4WFHA 5KMGB 2X6AA 4PA7A 4X1KA 4DR2O 2DYSB 3HKEB 1GO3F 3E22B 1V9PA 4DR2B 1O9GA 3JATA 3BY6A 3JASB 4YHHB 2UUCB 3RVYA 4FLTA 3ABLB 1VP7A 5B1OA 1S0VA 1YSCA 3G67A 3OR6C 3KKYA 4R50A 4HBNA 2H3OA 5LHIA 2OYQA 5CBGA 2HEPA 4DRXA 1RP3B 2YEVA 3BPZA 5J2UA 2DQ3A 4KL1A 4H37A 3FFQA 4ABMA 2OWOA 3G6EV 1GM7A 5JVDB 2JEUA 4JI4O 2DW4A 1U97A 2W0XA 3STLC 4JI4B 4H33A 2QM4A 3LUTB 4LFBB 4G2KA 3K9AA 5HFLA 1HNWO 4OX9O 2IW5A 4ZI7B 3ZIAG 2M7WA 4NR1A 3T1HO 1N8RW 4DR4B 3F7VC 1VQKV 1MZEA 4CS3A 1PD3A 2ILMA 1UJWB 3C90A 4I9WA 1US6A 4MVMA 1AVMA 1WB8A 3ZMVA 3FX7A 1NZ6A 2DN9A 1WPXA 4DYLA 1LUWA 2HHHB 1R73A 1K5SA 1KU9A 2XTAA 4J7JA 5H6QA 1VF6A 3FYIB 5EIBC 5B3SC 2WA3A 3ZEDA 3ETEA 3WU2Z 4JYCA 5EZYB 2EJRA 2JJ1G 4H44B 3ETGA 3E89A 4PA9A 1IURA 2V1DA 2QKCA 3KCXA 4DR6O 3BCCH 3J81N 4I55B 1QNMA 5ITZA 4JZ2A 4DR6B 3QTCA 1DGSA 1S72V 2ZT9B 3B77A 4EB6B 4HYOA 4AI8A 5FL7G 1SZTA 5C8YB 1S5JA 2VRZA 1D5NA 1N33O 4I5SA 2V7QG 4F6EA 1PP9H 4RWUA 5IY5C 2K1EA 1BS3A 3T1YB 1WA8A 2XOKG 3QO8A 2Y48A 1MA1A 4JTCB 2F66C 4PDRA 3NR7A 3G4SV 4DR5O 4JI7O 5DN6G 3OMIB 3CRQA 5L3DA 4DR5B 5H2FZ 1Q90D 3G71V 3ZBHA 1E79G 2KB1A 4MVZA 3LNMB 3UO2A 1SQFA 4GUNA 2OIEA 4JV5B 1R6TA 3RGBA 3SPCA 3W7WA 1GMGA 1QLNA 5KA6A 4JAVA 5B1BC 2RCVA 4FLUA 1S5LZ 3CCJV 1XNRO 5KHKA 1XOUA 3C3TA 3FKSG 1FD9A 2JDIG 1R3JC 1Y67A 3M99B 4MVOA 4W4LA 4ZIBA 4HZ3A 3ZHSA 3BA9A 4B7KA 4YJ3B 2Z0AA 2R70A 4J10A 1Y4MA 2CTRA 1Q82W 2ZE8A 4JYBA 2WLIA 3WFVA 3QNEA 3E86A 4NTYA 4LF8O 2FYUH 3P3PA 3QVNA 1Q6HA 4LC1A 4LF8B 2A9HA 3ABKB 3IFXA 3SYOA 1LNQA 4P30A 4JI8B 2ZNJA 2LGQA 2E3CA 2XAFA 3Q4HB 1WP7A 2Q0AA 5L3CA 5LA6A 4DUYO 3CCMV 4JI5O 2QTOA 5JQGB 2UUBO 3FB8C 4DUYB 3UT5A 4O4HA 4NXMO 2UUBB 3APOA 2EILC 4I9QA 4O4LB 1GKFA 2P67A 3JAWA 1K92A 3SPIA 2HVKC 3BRCA 1YVWA 5BZBA 4FMTA 1BGYH 2HVJC 4QPKA 1BMFG 2AZ2A 5KHJA 1ZWIC 1U96A 3H9VA 2ZR3A 1BZKA 4I50B 1CEZA 1FXKC 3MD0A 1AI6A 3OEHG 3AG7A 4X1KB 1KKDA 2ZR2A 2ZCEA 4RUFA 2ATKC 4XDKA 3JATB 1HDJA 1T5EA 2QWOB 1QBZA 1S3JA 1CP9A 3CE2A 4K35A 3VOUA 3F7YC 4Z2WA 4L87A 2UUAB 4PV1B 4BIUA 1B6QA 2W6JG 3S3WA 2DMXA 2PGGA 1M90W 3P3NA 2WLJA 2V4DA 2LJ2A 1GH6A 4DRXB 3L9DA 1FFXA 2R9IA 5IYZB 2YEVB 5J2UB 1GN3A 2EZPA 1KECA 4DW0A 3EFFK 3KCYA 1SS3A 4B08A 2XASA 4KXRA 5JJJB 2HJFC 3ZHUA 1B3QA 2PI4A 1PNMA 2YIAA 2B1IA 3IC7A 3DXRB 5DM6V 2KKWA 1Z2GA 2Q68A 3CCUV 2Q7GA 3FAVA 4J9YB 3SPGA 3ASNB 5DEDA 1P7GA 3K5LA 3B8NA 2LGWA 4MTXA 1ZLZA 1ORQC 2YI8A 5FPOA 1X4TA 1XHXA 1BHAA 3B8MA 3CB2A 3U11A 4GX5A 1OCOB 3HKBA 2YIBA 3CD6V 3K59A 4DV4O 1EFRG 1VQMV 1HW7A 3RWRD 4WBNA 1KMIZ 2ZKOA 3IGAC 3WB2A 1Z5WA 1G4YB 4DV7O 3JD2A 3B40A 3H1IH 2FKXA 4DV7B 3OMNB 5ITZB 1YCIA 2BCCH 2PI5A 4O2AA 5H6RA 2KQXA 4FFBA 3LNNA 1M57C 1H2LA 3AG2C 1GTOA 3P30A 4Q6GA 4DV1B 2DE0X 1WA8B 4U3JA 3TJTA 4EB6A 2IH1C 1BT8A 3A0RA 4X66B 4PDVA 3GVMA 4B3MO 2F23A 5D5QA 3WG7B 1MNGA 1VQ6V 3GWKC 1FXVA 4FIPC 2VQFB 3CCRV 2Q5ZA 1J5EB 1BSMA 2BSKA 2ZE7A 1Y6XA 2E5LO 1N34O 1S77D 4FFKA 3AEIA 3OE7G 5KUKA 3TCUA 5KAIZ 1YJ9V 2JS5A 3ABMB 3CWBH 1TA8A 3L73H 1FJGO 4NTWA 3TETA 3BABA 2ZM6O 4QJFB 1G6UA 1FJGB 3K3WA 4DV5B 2Q8VA 3K03A 3ABTA 2WLKA 2YS8A 2GBOA 1Q8IA 4R7CA 3R66A 5KAFZ 5CBHA 2E76B 1QHTA 3VQXA 5LYJA 4CH3A 1AR5A 4MTFA 3ZMUA 3RYHB 1FXHA 3X2QC 2QA4V 3DSQA 3E35A 2QKAA 1OCRB 3GWOA 4FZ0A 4UCRA 4U7OA 3ZMTA 2ZQMA 3D3IA 2WLIB 2WSSG 2H8PC 2ETNA 1NVPD 4GKKB 4B3TO 3CPWU 4BWAA 2EJ7A 1NBMG 4B3TB 2YXLA 3JALA 1IDSA 2UXCB 1FXKA 2GV9A 4U7NA 1H2NA 1K4DC 1E1QG 2HJDA 2ZXWC 1YDXA 4AHCA 1ENVA 3OTOO 5LA6B 2ODMA 2YIDA 4CH6A 2E75B 1AJPA 2QWPB 1AI4A 1EN6A 3OTOB 1SRYA 1SQPH 3UT5B 4O4HB 2IH3C 2CUGA 1P7BA 1SQGA 1DF5A 4KHPO 2PUSA 3CRMA 4LFAB 3OT7A 3RN4A 2YIBD 3CYOA 4DV6O 5IT9N 3JAWB 2ZDIC 3JCUZ 4QE7A 4K0KO 2UU9B 5LMNO 2Y0PA 4PJ0Z 1KKCA 1L0NH 1NTKH 2EIJB 1XILA 1HWYA 1JX9A 4MS2A 2HR3A 4IGGA 1KP2A 4OPHA 3EHBB 1N0NA 5IYDO 3AK1A 3BA8A 1JVMA 3BVOA 1VQOV 2AW9A 3JYCA 4LF6O 1TVKA 3ZRSA 1M93A 2Q73A 3H1KH 4MTOA 3UO3A 4E2LA 1M9NA 3SR2C 4CH5A 3K57A 1FKAO 2JEXA 2QDOA 3K5NA 2CGNA 1FFXB 1K34A 4DW1A 2FTKA 2Q9LA 5B3SB 2QEXV 4NXNO 2A0LA 4ZKIA 1WNSA 5KA5A 3HPLC 2EIKC 4NXNB 3W7XA 3VBBA 1NVPB 1PPJH 4JYYA 5JJEB 5IYZA 5H9CA 4LR3A 1MMMA 1PNKA 2EIJC 3RVZA 1OCZC 3ASOC 3BFRA 4A5UB 1AR4A 1HNZO 1Y76A 2ZD9A 1W0JG 1SQQH 3N2KA 1HNZB 3NXSA 5IJ0B 3FAVB 2W0FC 3DXRA 2W6IG 4JZGA 4F4LA 5IY5B 5CMUA 2QGNA 2A79B 2BTQA 1KC8W 1HNWB 4OX9B 2PF4E 3AG1C 1XNQO 1UPGA 3T1HB 2YI9A 1JJ2U 3CXCU 1XNQB 5IDJA 5IE9A 4CBCA 3HKBB 3B4SA 2A06H 4LF9O 3RYCA 2DOSA 4LFCO 1QLEC 3LDEA 4WBNB 4LF7O 2EIMC 5D5PA 3VQWA 1IZ3A 2RMKB 4AQYO 4KUMA 3AG4C 1AP6A 1I0HA 1TGOA 1NKDA 1COWG 1NJIW 4O2AB 2EULA 2JJ2G 4MVUA 3MDSA 1VQ4V 4FFBB 1F4MA 5B1BB 1XL6A 3CMAV 2JK5C 2KSDA 4FZ1A 1D5AA 3ML0A 4J42A 4JYAO 2YDEA 1HR0O 5IJ9A 4U3JB 3E2EA 4JYAB 5EBWC 2N05A 4X20A 3ETDA 1W59A 2IJJA 1N33B 3K9SA 5EYPA 4UVAA 3JD4A 3UKMA 4LF5O 1AROP 5JCOA 2BSKB 1OZ0A 2QKSA 1FAFA 4X9QA 4ZOLA 1OCCC 1TAEA 3OUSA 2Y0IA 3K5OA 4B7EA 1PV0A 5LGNA 4JI7B 3LDDA 4EFEA 4KFMA 3JD3A 1WLEA 2DQ0A 2DYRC 2GUZA 1R1BA 3ICXA 5BMVA 4R8CA 4X89A 1WN7A 5LYJB 2CTPA 1B06A 1R3IC 2EILB 1AI7A 2VS0A 3RYIA 3H1LH 5C93A 3OM3B 2ZDIA 3J7AU 1AILA 4UVCA 3STZC 2X6CA 5CB4A 3N2GA 2JGDA 3RYHA 1XNRB 5IYBO 2WAMA 1EZVH 2GHYA 2Q7EA 2CTQA 1YXBA 4X62O 4X8AA 3D8CA 3SYCA 2QM7A 2Q69A 1HNXO 3JALB 4DR1O 2XHBA 1FXKB 4UCTA 1HNXB 4RAIA 2AXTZ 4JI1O 4K3AA 2JVDA 2YICA 3TK1A 3ZHRA 4HNAA 5FLXN 3K08A 2D3OW 3HKDA 1WP8A 1JCHA 4FLVA 2ITDC 2XNDG 3M8AA 4J80A 1CXZB 1F7YA 3HB3B 4X64O 4KP4A 1IXBA 4NTXA 4JI5B 1XQ8A 4X1YA 2VQEO 4PHZA 4NXMB 3B2EE 1GN4A 1GM9A 2QM8A 3O65A 1WJZA 4TV9A 1SERA 3ZHQA 3RW0A 1Q6IA 1SETA 4G28B 4WFGA 1N0JA 1YIJV 1I94O 3M7MX 5DECA 1IBLO 1IBLB 1SQVH 1XUQA 1EM1A 1OHHG 1SKVA 4P2ZA 4DR7O 5KUMA 5LOVA 5KHHA 4LCUC 1YTFD 1TVKB 4ZHQB 3SPJA 1JPXA 2BTOA 3CJHA 3CCSV 4JI0O 4CC6A 2D2CB 4I4TA 5JWPA 1N4CA 1Q86W 4PI2A 2Q4PA 1P49A 2PYJA 4J41A 2HFEC 3SGIA 2EX3A 4PA4A 3SPHA 1BQ0A 1M56C 2WA4A 3HR0A 1I08A 1L0LH 2HKOA 1K4CC 4UXNA 1JMKC 1CPYA 1GK9A 4B3SO 3P32A 3LSSA 4LNUA 1Y76B 3N2KB 1M57B 1PM9A 1L1FA 3AG2B 3F5WC 2RQ6A 1URFA 4I0XA 2BTQB 2L6LA 5L3GA 2F95B 5IJ0A 3SJQC 3QO7A 2P22C 3BAAA 4D7SA 3ZJZA 3RYCB 4LH7A 3K79A 1SQBH 2NN4A 2IM9A 5FNVA 3JAKA 5E1AC 4E4EA 1E1RG 5B1AB 2EINC 2NR5A 5JH7B 1DLBA 5LL6Y 5J9PC 2P7TC 1KP3A 1L8DA 5EBMC 2AZ0A 1RPRA 3OGCC 1H38A 3AG3C 1BQZA 5LXTA 2QE7G 3HKCA 5FPRA 4DV4B 5K1XA 1D2DA 4XDLA 1QR8A 2GTAA 1RM1C 5LGUA 4JASA 2Y4UA 3K0DA 3JSLA 5IJ9B 5BXZA 5AG2A 1RFYA 2QWQB 4H13B 4PA6A 4XBFA 3X2QB 1YTFB 5CA1A 4X20B 4O2BA 2X6BA 3ZN1A 1I7FA 2IU3A 4JI2O 1MABG 5EYPB 3GB7C 2O57A 1LR1A 4NB5A 3OFNG 2Q67A 1DK1A 3DTUB 4O4JA 4D6TH 2QWRB 4B3RO 2Q0OC 3JSNA
chains in the Genus database with same CATH topology
4ZOLB 4B3MB 4DV0B 4JI0B 3A2FA 4IIJA 3T1YB 2F1MA 5J2TB 4TV8A 5KX5B 1TVKA 1M93A 2E5LB 4DV3B 1N34B 1WPBA 1Q43A 4CH4A 5BMVB 2F66C 1H2SB 3SR2C 4CH5A 3QG5A 2F4VB 3K57A 4TUYA 4DR5B 2ZM6B 4GKJB 3JARA 5KMGA 3HKEA 2VWKA 3RYIB 3K5NA 1FFXB 3K5MA 4DUZB 3E22A 4O4IB 2PYLA 4B3SB 1WNSA 3JASA 3VQYA 5CB4B 4L8JA 3N2GB 2PY5A 5LMUB 1SQFA 4NXNB 4JV5B 3RGBA 5JJEB 4FLZA 5IYZA 4LR3A 4FLUA 1N36B 2ZIOA 5KHKA 2R72A 3N2KA 4DK1A 1HNZB 3CSXA 4FM2A 5IJ0B 4HNAB 4ZIBA 4AILC 3BA9A 3HKDB 4YJ3B 2R70A 3U10A 5LP6C 2BTQA 1HNWB 5JVDA 4OX9B 4TQDA 2PTMA 3T1HB 3VQVA 1SA0A 2YI9A 4X1IA 1XNQB 4IHJB 3HKBB 4LF8B 3RYCA 4ZI7A 5IWAB 4WBNB 4JI8B 5D5PA 4CS4A 2ZNJA 3VQWA 4X1YB 2E3CA 2Q0AA 2ZIMA 4KHPB 5LA6A 4EFBA 4TV9B 3BHPA 5JQGB 5CA0A 1TGOA 4YJ2A 4DV6B 4DUYB 3UT5A 4O4HA 1TUBB 1YEWA 2UUBB 4UCUA 4O2AB 4K0KB 4FFBB 5LMNB 4I9QA 4O4LB 2CAZC 5KHGA 3ETQA 3JAWA 1D5AA 3U0ZA 4X65B 4NVPA 5IJ9A 3BRCA 4U3JB 1XMOB 4JI2B 5EZYA 4FM1A 5LOVB 4JYAB 4X20A 3K58A 4B3RB 2VWJA 4DR3B 1N33B 5KHJA 5LP6B 2QJ1A 4I55A 5EYPA 4I4TB 4K8ZA 4I50B 2PZSA 4CS2A 4FM0A 5JCOA 4F6RB 4ZHQA 5C8YA 5GONA 4LF6B 4EEQA 4ZOLA 4X1KB 4UCOA 1TAEA 3SJBC 3MAQA 2ZCEA 1M4UA 1JFFB 5J2TA 3K5OA 3JATB 4JI7B 1T5EA 2UXDB 4EFEA 5KX5A 5BMVA 3ICXA 3SJCC 2UUAB 4LF4B 3WB0A 2PGGA 1WN7A 4LNUB 4UFZA 2V4DA 5LYJB 3RFRA 4DRXB 3RYIA 1FFXA 5IYZB 4O4IA 5KHIA 5J2UB 4JI3B 4LH6A 5CB4A 3N2GA 3RYHA 1XNRB 2Q7EA 4B08A 3UQ8A 5JJJB 1Z5VA 3QF7A 1RSOA 2JGUA 4JI6B 2YIAA 5EIBD 1XI1A 4DK0A 2KKWA 3JALB 5BR8B 2XHBA 4UCTA 5FNVB 1HNXB 3JAKB 2JVDA 2Q7GA 4PI0A 4HNAA 5JCOC 3ZS8C 1IBMB 3K5LA 3HKDA 4YJ3A 1XHZA 5LXTB 4LF9B 2YI8A 3HKCB 5K1PA 4LFCB 2F93B 5JH7A 4FLVA 5FPOA 4DV2B 2R9AA 4FLXA 1XMQB 1X4TA 1XHXA 4LF7B 3CB2A 3U11A 4IHJA 3HKBA 2P5OA 2YIBA 3RYFB 1IBKB 4AQYB 3K59A 1HW7A 3RWRD 4JI5B 4WBNA 1KMIZ 1XQ8A 4X1YA 1Q5OA 3WB2A 4YY3B 1Z5WA 4PHZA 1B04A 4UCSA 4NXMB 3B2EE 5CA1B 4GYCB 3SJAC 4O2BB 1QQCA 2UXBB 4TV9A 2ZINA 5JQGA 4TQFA 4TOIA 4DV7B 5ITZB 4CC5A 1N32B 1TUBA 1HR0B 4O2AA 4FFBA 3M7MX 3LNNA 4O4JB 5JJNB 4O4LA 3PN1A 1IBLB 1VF7A 4IIJB 4Q6GA 4DV1B 4U3JA 1SKVA 4EB6A 5LOVA 4TV8B 4X66B 5KHHA 4LF5B 1TVKB 4ZHQB 2BTOA 4D7TA 4GLXA 4CC6A 5LP6A 5D5QA 4I4TA 4I50A 2VQFB 4TUYB 2RJZA 4PI2A 1J5EB 4K8XA 4FVMA 4F6RA 3JARB 1P49A 5KMGB 2PYJA 4X1KA 3SGIA 3HKEB 2JS5A 1TA8A 1M5IA 3E22B 1V9PA 4DR2B 1JFFA 4FLWA 1O9GA 3BABA 3JATA 2EX3A 3JASB 1G6UA 4YHHB 2UUCB 1FJGB 4FLTA 4DV5B 1Q8IA 1JMKC 3OTFA 4LNUA 1QHTA 1ZAUA 3VQXA 4HBNA 3WB1A 5LYJA 4CH3A 3RYHB 2OYQA 3N2KB 2HEPA 4DRXA 3DSQA 4X62B 3BPZA 5J2UA 4KL1A 4UCRA 2RQ6A 3FFQA 2OWOA 2BTQB 4DR1B 5JVDB 2F95B 5IJ0A 4JI1B 1SA0B 4GKKB 2P22C 4X1IB 4BWAA 3BAAA 4D7SA 4JI4B 2QM4A 3THOA 4LFBB 4B3TB 2YXLA 3RYCB 3JALA 4LH7A 2UXCB 4ZI7B 2IM9A 2GV9A 4BW9A 5FNVA 3JAKA 5JH7B 2ZNIA 4DR4B 1L8DA 4AHCA 4CS3A 1Q3EA 5LXTA 5LA6B 4CH6A 3HKCA 5FPRA 5CA0B 2Q7HA 4YJ2B 4DV4B 4X64B 3OTOB 5K1XA 3UT5B 4O4HB 2HHHB 1SQGA 4FLYA 2VQEB 1KU9A 2PUSA 4LFAB 3RYFA 2YIBD 5EIBC 1O9HA 3JAWB 3CHXA 3ZEDA 3JSLA 5IJ9B 1NT2B 5EZYB 2UU9B 3BA8A 5CA1A 1I94B 3IAYA 4X20B 4O2BA 1I7FA 4I55B 5EYPB 5ITZA 4DR6B 1JJOA 1DGSA 3QTCA 4DR7B 4EB6B 4O4JA 5C8YB 1S5JA 4UCVA 5GONB 3JSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QG5 A;  1NT2 B;  2CAZ C;  1X4T A;  2JS5 A;  2P22 C;  3ICX A;  3QF7 A;  3SJB C;  3SJA C;  3SJC C;  3CSX A;  2F66 C;  3THO A;  3B2E E;  1SKV A;  3ZS8 C; 
#chains in the Genus database with same CATH topology
 4ZOL B;  4B3M B;  1K3E A;  3A2F A;  1H8H G;  4IIJ A;  1VQP V;  4BIZ A;  4TV8 A;  5B1A C;  2ZXW B;  2E5L B;  3ABU A;  1N34 B;  4J11 A;  1WPB A;  2GUZ B;  1Q43 A;  5BMV B;  3UCS C;  2KG7 A;  3S3X A;  1H2S B;  1BCC H;  2HP8 A;  4BAY A;  2UXD O;  4TUY A;  3ZMS A;  1QR9 A;  2ZM6 B;  1ZUQ A;  3JAR A;  3K06 A;  1MZF A;  2LFR A;  4CZZ A;  3RYI B;  3K5M A;  4MVQ A;  2OT5 A;  4W4K A;  3CRC A;  3L70 H;  3VQY A;  5CB4 B;  4L8J A;  3N2G B;  5L3B A;  2JGD B;  3CEI A;  1ZL8 A;  2N04 A;  3J80 N;  4IYI A;  4JTD B;  1MSD A;  4FLZ A;  1N36 O;  3CCE V;  4LP8 A;  1NTM H;  2ITC C;  3K04 A;  1N36 B;  3ZRV A;  1VQN V;  3ZHT A;  2ZIO A;  4P9O A;  2R72 A;  1P84 F;  4X88 A;  1F4N A;  2OTJ V;  3MHS C;  2P90 A;  3CSX A;  4JI6 O;  4I7Z B;  4FM2 A;  3JD1 A;  1VIB A;  4HNA B;  4UB8 Z;  2OCH A;  1R3K C;  1MG1 A;  5A9G A;  4BW5 A;  3HKD B;  5BR8 O;  5LP6 C;  2L35 A;  2P06 A;  1PNL A;  1Y66 A;  4TQD A;  2YXY A;  3VQV A;  1SA0 A;  2EBO A;  4X1I A;  1YZB A;  1FYJ A;  1JR9 A;  2CE4 A;  2GTS A;  5IWA O;  2R9R B;  1G8M A;  3E8B A;  5IWA B;  1W2B U;  1AR1 B;  1XMQ O;  5B66 Z;  4CS4 A;  4X1Y B;  2DWD C;  4PEL A;  2BOB C;  4KHP B;  5B1N A;  1RPO A;  4P9P A;  4TV9 B;  3RT3 C;  4EFB A;  3LSQ A;  4JPR A;  4MW3 A;  5CA0 A;  4DV6 B;  4YJ2 A;  2EIK B;  3SYQ A;  3APQ A;  4GX1 A;  1YEW A;  4K0K B;  5LMN B;  2CH7 A;  1OCZ B;  4YXW G;  4WF9 V;  4X65 O;  3ASO B;  1YI2 V;  2DJV A;  2CAZ C;  1M1K W;  3ETQ A;  3U0Z A;  5E79 Z;  4X65 B;  1N32 O;  4WFB V;  1QU7 A;  5LOV B;  1BHB A;  4PA3 A;  3N27 A;  1K33 A;  3JD0 A;  3D3Q A;  3K58 A;  2ZE5 A;  3CJH B;  3I56 V;  2QJ1 A;  1I5Y A;  4I4T B;  2A7W A;  4K8Z A;  3AG1 B;  2PZS A;  3ZRX A;  3OEE G;  3IC9 A;  2Y69 C;  1F23 A;  4ZHQ A;  4G27 B;  4TT3 G;  3A8T A;  2A3Q A;  5GON A;  4LF6 B;  3ZRW A;  4UCO A;  2OCC C;  2B9Z A;  1H2G A;  5TIS Z;  1K73 W;  1QLE B;  1M4U A;  5J2T A;  2EIM B;  1F51 A;  5KX5 A;  4OXS A;  4UB6 Z;  1R6N A;  3SJC C;  1AJN A;  3AG4 B;  1R3L C;  4GZR B;  2HLD G;  1YJW V;  3WB0 A;  4YHH O;  2UUC O;  1V54 C;  4LNU B;  1JOY A;  4BIO A;  3RFR A;  3DC6 A;  1IX9 A;  1MSW D;  5B5E Z;  2Z3Y A;  4JI3 O;  4JAA A;  4O4I A;  5KHI A;  5L3E A;  4JI3 B;  2XAG A;  4NYK A;  3R65 A;  4I0X B;  3ZHV A;  4IYH A;  3LDC A;  2E74 B;  4DXW A;  1J95 A;  2WLH A;  1RSO A;  2JGU A;  4UV9 A;  1XI1 A;  4DK0 A;  2GSM B;  2UXN A;  1Q6U A;  5FNV B;  3JAK B;  2QTS A;  4LFB O;  1OCC B;  1H2M A;  3ZS8 C;  2FL4 A;  3L74 H;  1XL4 A;  1XHZ A;  1ROP A;  5LXT B;  4MSW C;  4LF9 B;  3H1H H;  4DV2 O;  2CGO A;  3HKC B;  5K1P A;  1OV9 A;  4LFC B;  4DR4 O;  2F93 B;  5JH7 A;  3TXS A;  4DV2 B;  2R9A A;  5EBL C;  2DYR B;  2B5U A;  1IBK O;  4LF7 B;  2ADQ B;  3A0H Z;  4IHJ A;  3EVK A;  1KBH A;  3OMA B;  4N21 A;  2P5O A;  2IJK A;  1AI5 A;  1IBK B;  2BE3 A;  2DYS C;  4AQY B;  3OW2 U;  1EN5 A;  1VAR A;  4LWS A;  4YY3 O;  5CBF A;  4NKG B;  4GX2 A;  3MHH C;  5GTH Z;  1FS0 G;  4QPJ A;  2HHH O;  1WB7 A;  4YY3 B;  3ABL C;  2UXB O;  2RN9 A;  2IBZ H;  4YIP A;  5CA1 B;  2CDY A;  4GYC B;  5A2Q N;  2JRI A;  4O2B B;  2UXB B;  1XDC A;  4TOI A;  3W7S A;  2C2A A;  2CTW A;  1TUB A;  4JGS A;  1HR0 B;  5L3F A;  4O4J B;  4U3F H;  5JJN B;  1KB9 F;  3PN1 A;  2EZO A;  2LW7 A;  5LHG A;  4IIJ B;  3CC4 V;  4Q20 A;  4TV8 B;  4LF5 B;  1SQX H;  1QVF U;  4QE9 A;  3FB6 C;  3SDL A;  4FJC C;  2KG7 B;  3LSU A;  4GLX A;  3FB5 C;  5LP6 A;  3T1Y O;  2Q6A A;  5BY1 A;  1Q81 W;  4TUY B;  2RJZ A;  4K8X A;  1THZ A;  4FVM A;  4F6R A;  3JAR B;  1KUQ A;  2QSA A;  1K97 A;  1KD1 W;  1AB3 A;  1K9M W;  1VMG A;  1M5I A;  3CCV V;  4XDJ A;  2X7R B;  1JFF A;  4FLW A;  4EKW A;  1ZL8 B;  1DF4 A;  1WAZ A;  1EN4 A;  1BL8 A;  3BEH A;  4ASU G;  1V55 B;  3OTF A;  1PL4 A;  1ZAU A;  4JV5 O;  3WB1 A;  4PDM A;  1GN6 A;  1AP5 A;  2WLL B;  4X62 B;  4ZBM A;  2Z5U A;  3E8F A;  3FYE B;  4DO2 A;  3L71 H;  1SF9 A;  3CRR A;  3CS5 A;  3G6B A;  3DC5 A;  4DR1 B;  2RNB A;  3SYA A;  3W7T A;  4JI1 B;  3I5D A;  4WFA V;  1SA0 B;  1ZX3 A;  1JQ0 A;  4X1I B;  3H01 A;  1A32 A;  3THO A;  2MK3 A;  3EXA A;  5LBQ A;  4RO2 A;  2XAH A;  4BW9 A;  1PKX A;  5EK0 A;  2ZNI A;  4UVB A;  3T4Z A;  4JAU A;  4N23 A;  3E8H A;  1Q3E A;  1EBO A;  1VQL V;  5CA0 B;  2YUA A;  2Q7H A;  4YJ2 B;  4JI8 O;  4X64 B;  1M56 B;  1VEW A;  3FB7 C;  2Y4T A;  4IL6 Z;  3L72 H;  1GM8 A;  4FLY A;  2VQE B;  1GN2 A;  2WLN A;  3B09 A;  2CH7 B;  3O9O A;  4TSF G;  3RYF A;  3CX5 F;  1O9H A;  3K0G A;  1VQ9 V;  1V55 C;  3CHX A;  1PL0 A;  1UFI A;  4MW8 A;  2LO1 A;  1NT2 B;  3AK2 A;  1ZSP A;  3KZI Z;  4FK5 C;  2AHY A;  3OAA G;  1Y74 A;  3A0B Z;  1I94 B;  3IAY A;  4GCZ A;  1XRE A;  2YC0 A;  2XUM A;  2F43 G;  2N74 A;  2IJH A;  4JTA B;  1SC5 B;  1JJO A;  3TXQ A;  3CCQ V;  4DR7 B;  2IJI A;  4DV0 O;  4UV8 A;  4UCV A;  5GON B;  3ZX6 A;  3T4D A;  3ZRW B;  2JS3 A;  4DV0 B;  4JI0 B;  2F1M A;  5J2T B;  5EC1 C;  2EIN B;  1KQS U;  4DV3 O;  2HG5 C;  5F2V O;  5KX5 B;  3TGU H;  4DV3 B;  3OR7 C;  2NNU A;  4CH4 A;  3AG3 B;  2F4V O;  3CCL V;  2RDC A;  3ABK C;  1FPO A;  3QG5 A;  2F4V B;  1S76 D;  2P4K A;  3F5T A;  4GKJ O;  1IXM A;  4WFF A;  2CK3 G;  4GKJ B;  1EZJ A;  1XBL A;  3CXH F;  1G1X B;  5CA3 A;  4BR6 A;  5KMG A;  4DUZ O;  1RM1 B;  2UUA O;  3HKE A;  1OJH A;  2VWK A;  4DUZ B;  3E22 A;  4O4I B;  4PDL A;  1YJN V;  2PYL A;  5LMU O;  1P4R A;  3OUF A;  4B3S B;  2B1G A;  1QVG U;  3E83 A;  3JAS A;  2PY5 A;  5LMU B;  3ZN0 A;  4RQE A;  4MTG A;  3G80 A;  2AHZ A;  1RSO B;  4JF3 A;  1W0K G;  3ZCC A;  1NR7 A;  3JAM N;  3D36 C;  2WLM A;  3AK3 A;  3QO5 A;  4DK1 A;  2UXX A;  4AIL C;  4J7Z A;  1YIT V;  1GRJ A;  2QR4 A;  5LGT A;  1JA8 A;  3U10 A;  5JVD A;  4OPA A;  1NR1 A;  2PTM A;  1NQT A;  4C7U A;  3T1C A;  3ZMZ A;  4IHJ B;  1NH2 D;  3W7U A;  4QNH B;  4ZI7 A;  4RUE A;  1XEQ A;  4LWS B;  1TUE B;  2G38 A;  2LP7 A;  2QWN B;  1X59 A;  2P6J A;  2ZIM A;  1MOF A;  2OIG A;  3BHP A;  2WPD G;  1TUB B;  2LW1 A;  3L75 H;  1YHQ V;  4UCU A;  4WCE V;  1VQ8 V;  1K5Q A;  4TWK A;  4UUJ C;  2YXH A;  5KLV H;  4J9Z B;  1DTO A;  5KHG A;  1XMO O;  3KG2 A;  5LHH A;  2XAJ A;  1YF2 A;  4NVP A;  4OGQ B;  1XMO B;  4JI2 B;  5EZY A;  4FM1 A;  3JCZ A;  3CC2 V;  4DR3 O;  4RQF A;  4B3R B;  2VWJ A;  4DR3 B;  5LP6 B;  4DV1 O;  2ADP A;  4I55 A;  1NI8 A;  4CS2 A;  4X66 O;  4FM0 A;  3UM7 A;  2YSU B;  3IJ4 A;  2XT9 A;  4F6R B;  5C8Y A;  4EEQ A;  3SJB C;  3ASN C;  2VQF O;  3MAQ A;  4HAM A;  1J5E O;  1JFF B;  3CME V;  4QGP A;  1H8E G;  5GTI Z;  2UXD B;  3CRA A;  4J7K A;  4LF4 O;  1OCO C;  2IU0 A;  4LF4 B;  1Q7Y W;  1VF6 C;  2NLJ C;  1VF5 B;  4GX0 A;  4DV5 O;  4UFZ A;  4LBE C;  4MT8 A;  3CP1 A;  4QIW F;  3DGE A;  1LUV A;  1VQ5 V;  3E8G A;  4MVS A;  3H1J H;  4Z1V A;  2OTL V;  1SZX A;  4IT5 A;  4PD4 F;  1R6K A;  4Z1M G;  3OGI B;  2DWE C;  4LH6 A;  5EC2 C;  2AGA A;  3T2M A;  4WFE A;  1VQ7 V;  3UQ8 A;  2BOC C;  2WLL A;  1Z5V A;  3QF7 A;  5CN0 A;  4JI6 B;  2JIZ G;  3RBZ A;  5EIB D;  1NH2 B;  2LQT A;  4FPP A;  5BR8 B;  4ICG A;  5HFM A;  2ZE6 A;  3I55 V;  2Y69 B;  4MVR A;  4GKK O;  1IBM O;  3FD9 A;  4PI0 A;  1BE3 H;  5JCO C;  2OCC B;  1IBM B;  1ZTE A;  4YIO A;  4YJ3 A;  1GAX A;  2UXC O;  2FML A;  5H5N A;  3WG7 C;  2XAQ A;  4FLX A;  1XMQ B;  1SES A;  1AJQ A;  2FB5 A;  2P4V A;  1QCE A;  3C3S A;  3RYF B;  3ABM C;  1V54 B;  2H94 A;  3SYP A;  1I5X A;  2WWW A;  1Q5O A;  4UCS A;  1B04 A;  1Y74 B;  4LFA O;  1K7D A;  3Q4H A;  3SJA C;  1QQC A;  2ZIN A;  5JQG A;  1IVS A;  4TQF A;  4R6Z A;  2UU9 O;  4CC5 A;  3CC7 V;  1N32 B;  1HP8 A;  2K9P A;  1KYO F;  4O4L A;  2MW2 B;  3D36 A;  1OCR C;  4GT1 A;  1VF7 A;  1H2K A;  1S5H C;  1NTZ H;  2M6Y A;  2LFS A;  2GDS A;  1K8A W;  2X0L A;  1NU1 H;  2ARH A;  5GW7 A;  4D7T A;  4I50 A;  5IYC O;  3OD4 A;  3PJS K;  4H0L B;  1NS1 A;  1FFT B;  4WFH A;  5KMG B;  2X6A A;  4PA7 A;  4X1K A;  4DR2 O;  2DYS B;  3HKE B;  1GO3 F;  3E22 B;  1V9P A;  4DR2 B;  1O9G A;  3JAT A;  3BY6 A;  3JAS B;  4YHH B;  2UUC B;  3RVY A;  4FLT A;  3ABL B;  1VP7 A;  5B1O A;  1S0V A;  1YSC A;  3G67 A;  3OR6 C;  3KKY A;  4R50 A;  4HBN A;  2H3O A;  5LHI A;  2OYQ A;  5CBG A;  2HEP A;  4DRX A;  1RP3 B;  2YEV A;  3BPZ A;  5J2U A;  2DQ3 A;  4KL1 A;  4H37 A;  3FFQ A;  4ABM A;  2OWO A;  3G6E V;  1GM7 A;  5JVD B;  2JEU A;  4JI4 O;  2DW4 A;  1U97 A;  2W0X A;  3STL C;  4JI4 B;  4H33 A;  2QM4 A;  3LUT B;  4LFB B;  4G2K A;  3K9A A;  5HFL A;  1HNW O;  4OX9 O;  2IW5 A;  4ZI7 B;  3ZIA G;  2M7W A;  4NR1 A;  3T1H O;  1N8R W;  4DR4 B;  3F7V C;  1VQK V;  1MZE A;  4CS3 A;  1PD3 A;  2ILM A;  1UJW B;  3C90 A;  4I9W A;  1US6 A;  4MVM A;  1AVM A;  1WB8 A;  3ZMV A;  3FX7 A;  1NZ6 A;  2DN9 A;  1WPX A;  4DYL A;  1LUW A;  2HHH B;  1R73 A;  1K5S A;  1KU9 A;  2XTA A;  4J7J A;  5H6Q A;  1VF6 A;  3FYI B;  5EIB C;  5B3S C;  2WA3 A;  3ZED A;  3ETE A;  3WU2 Z;  4JYC A;  5EZY B;  2EJR A;  2JJ1 G;  4H44 B;  3ETG A;  3E89 A;  4PA9 A;  1IUR A;  2V1D A;  2QKC A;  3KCX A;  4DR6 O;  3BCC H;  3J81 N;  4I55 B;  1QNM A;  5ITZ A;  4JZ2 A;  4DR6 B;  3QTC A;  1DGS A;  1S72 V;  2ZT9 B;  3B77 A;  4EB6 B;  4HYO A;  4AI8 A;  5FL7 G;  1SZT A;  5C8Y B;  1S5J A;  2VRZ A;  1D5N A;  1N33 O;  4I5S A;  2V7Q G;  4F6E A;  1PP9 H;  4RWU A;  5IY5 C;  2K1E A;  1BS3 A;  3T1Y B;  1WA8 A;  2XOK G;  3QO8 A;  2Y48 A;  1MA1 A;  4JTC B;  2F66 C;  4PDR A;  3NR7 A;  3G4S V;  4DR5 O;  4JI7 O;  5DN6 G;  3OMI B;  3CRQ A;  5L3D A;  4DR5 B;  5H2F Z;  1Q90 D;  3G71 V;  3ZBH A;  1E79 G;  2KB1 A;  4MVZ A;  3LNM B;  3UO2 A;  1SQF A;  4GUN A;  2OIE A;  4JV5 B;  1R6T A;  3RGB A;  3SPC A;  3W7W A;  1GMG A;  1QLN A;  5KA6 A;  4JAV A;  5B1B C;  2RCV A;  4FLU A;  1S5L Z;  3CCJ V;  1XNR O;  5KHK A;  1XOU A;  3C3T A;  3FKS G;  1FD9 A;  2JDI G;  1R3J C;  1Y67 A;  3M99 B;  4MVO A;  4W4L A;  4ZIB A;  4HZ3 A;  3ZHS A;  3BA9 A;  4B7K A;  4YJ3 B;  2Z0A A;  2R70 A;  4J10 A;  1Y4M A;  2CTR A;  1Q82 W;  2ZE8 A;  4JYB A;  2WLI A;  3WFV A;  3QNE A;  3E86 A;  4NTY A;  4LF8 O;  2FYU H;  3P3P A;  3QVN A;  1Q6H A;  4LC1 A;  4LF8 B;  2A9H A;  3ABK B;  3IFX A;  3SYO A;  1LNQ A;  4P30 A;  4JI8 B;  2ZNJ A;  2LGQ A;  2E3C A;  2XAF A;  3Q4H B;  1WP7 A;  2Q0A A;  5L3C A;  5LA6 A;  4DUY O;  3CCM V;  4JI5 O;  2QTO A;  5JQG B;  2UUB O;  3FB8 C;  4DUY B;  3UT5 A;  4O4H A;  4NXM O;  2UUB B;  3APO A;  2EIL C;  4I9Q A;  4O4L B;  1GKF A;  2P67 A;  3JAW A;  1K92 A;  3SPI A;  2HVK C;  3BRC A;  1YVW A;  5BZB A;  4FMT A;  1BGY H;  2HVJ C;  4QPK A;  1BMF G;  2AZ2 A;  5KHJ A;  1ZWI C;  1U96 A;  3H9V A;  2ZR3 A;  1BZK A;  4I50 B;  1CEZ A;  1FXK C;  3MD0 A;  1AI6 A;  3OEH G;  3AG7 A;  4X1K B;  1KKD A;  2ZR2 A;  2ZCE A;  4RUF A;  2ATK C;  4XDK A;  3JAT B;  1HDJ A;  1T5E A;  2QWO B;  1QBZ A;  1S3J A;  1CP9 A;  3CE2 A;  4K35 A;  3VOU A;  3F7Y C;  4Z2W A;  4L87 A;  2UUA B;  4PV1 B;  4BIU A;  1B6Q A;  2W6J G;  3S3W A;  2DMX A;  2PGG A;  1M90 W;  3P3N A;  2WLJ A;  2V4D A;  2LJ2 A;  1GH6 A;  4DRX B;  3L9D A;  1FFX A;  2R9I A;  5IYZ B;  2YEV B;  5J2U B;  1GN3 A;  2EZP A;  1KEC A;  4DW0 A;  3EFF K;  3KCY A;  1SS3 A;  4B08 A;  2XAS A;  4KXR A;  5JJJ B;  2HJF C;  3ZHU A;  1B3Q A;  2PI4 A;  1PNM A;  2YIA A;  2B1I A;  3IC7 A;  3DXR B;  5DM6 V;  2KKW A;  1Z2G A;  2Q68 A;  3CCU V;  2Q7G A;  3FAV A;  4J9Y B;  3SPG A;  3ASN B;  5DED A;  1P7G A;  3K5L A;  3B8N A;  2LGW A;  4MTX A;  1ZLZ A;  1ORQ C;  2YI8 A;  5FPO A;  1X4T A;  1XHX A;  1BHA A;  3B8M A;  3CB2 A;  3U11 A;  4GX5 A;  1OCO B;  3HKB A;  2YIB A;  3CD6 V;  3K59 A;  4DV4 O;  1EFR G;  1VQM V;  1HW7 A;  3RWR D;  4WBN A;  1KMI Z;  2ZKO A;  3IGA C;  3WB2 A;  1Z5W A;  1G4Y B;  4DV7 O;  3JD2 A;  3B40 A;  3H1I H;  2FKX A;  4DV7 B;  3OMN B;  5ITZ B;  1YCI A;  2BCC H;  2PI5 A;  4O2A A;  5H6R A;  2KQX A;  4FFB A;  3LNN A;  1M57 C;  1H2L A;  3AG2 C;  1GTO A;  3P30 A;  4Q6G A;  4DV1 B;  2DE0 X;  1WA8 B;  4U3J A;  3TJT A;  4EB6 A;  2IH1 C;  1BT8 A;  3A0R A;  4X66 B;  4PDV A;  3GVM A;  4B3M O;  2F23 A;  5D5Q A;  3WG7 B;  1MNG A;  1VQ6 V;  3GWK C;  1FXV A;  4FIP C;  2VQF B;  3CCR V;  2Q5Z A;  1J5E B;  1BSM A;  2BSK A;  2ZE7 A;  1Y6X A;  2E5L O;  1N34 O;  1S77 D;  4FFK A;  3AEI A;  3OE7 G;  5KUK A;  3TCU A;  5KAI Z;  1YJ9 V;  2JS5 A;  3ABM B;  3CWB H;  1TA8 A;  3L73 H;  1FJG O;  4NTW A;  3TET A;  3BAB A;  2ZM6 O;  4QJF B;  1G6U A;  1FJG B;  3K3W A;  4DV5 B;  2Q8V A;  3K03 A;  3ABT A;  2WLK A;  2YS8 A;  2GBO A;  1Q8I A;  4R7C A;  3R66 A;  5KAF Z;  5CBH A;  2E76 B;  1QHT A;  3VQX A;  5LYJ A;  4CH3 A;  1AR5 A;  4MTF A;  3ZMU A;  3RYH B;  1FXH A;  3X2Q C;  2QA4 V;  3DSQ A;  3E35 A;  2QKA A;  1OCR B;  3GWO A;  4FZ0 A;  4UCR A;  4U7O A;  3ZMT A;  2ZQM A;  3D3I A;  2WLI B;  2WSS G;  2H8P C;  2ETN A;  1NVP D;  4GKK B;  4B3T O;  3CPW U;  4BWA A;  2EJ7 A;  1NBM G;  4B3T B;  2YXL A;  3JAL A;  1IDS A;  2UXC B;  1FXK A;  2GV9 A;  4U7N A;  1H2N A;  1K4D C;  1E1Q G;  2HJD A;  2ZXW C;  1YDX A;  4AHC A;  1ENV A;  3OTO O;  5LA6 B;  2ODM A;  2YID A;  4CH6 A;  2E75 B;  1AJP A;  2QWP B;  1AI4 A;  1EN6 A;  3OTO B;  1SRY A;  1SQP H;  3UT5 B;  4O4H B;  2IH3 C;  2CUG A;  1P7B A;  1SQG A;  1DF5 A;  4KHP O;  2PUS A;  3CRM A;  4LFA B;  3OT7 A;  3RN4 A;  2YIB D;  3CYO A;  4DV6 O;  5IT9 N;  3JAW B;  2ZDI C;  3JCU Z;  4QE7 A;  4K0K O;  2UU9 B;  5LMN O;  2Y0P A;  4PJ0 Z;  1KKC A;  1L0N H;  1NTK H;  2EIJ B;  1XIL A;  1HWY A;  1JX9 A;  4MS2 A;  2HR3 A;  4IGG A;  1KP2 A;  4OPH A;  3EHB B;  1N0N A;  5IYD O;  3AK1 A;  3BA8 A;  1JVM A;  3BVO A;  1VQO V;  2AW9 A;  3JYC A;  4LF6 O;  1TVK A;  3ZRS A;  1M93 A;  2Q73 A;  3H1K H;  4MTO A;  3UO3 A;  4E2L A;  1M9N A;  3SR2 C;  4CH5 A;  3K57 A;  1FKA O;  2JEX A;  2QDO A;  3K5N A;  2CGN A;  1FFX B;  1K34 A;  4DW1 A;  2FTK A;  2Q9L A;  5B3S B;  2QEX V;  4NXN O;  2A0L A;  4ZKI A;  1WNS A;  5KA5 A;  3HPL C;  2EIK C;  4NXN B;  3W7X A;  3VBB A;  1NVP B;  1PPJ H;  4JYY A;  5JJE B;  5IYZ A;  5H9C A;  4LR3 A;  1MMM A;  1PNK A;  2EIJ C;  3RVZ A;  1OCZ C;  3ASO C;  3BFR A;  4A5U B;  1AR4 A;  1HNZ O;  1Y76 A;  2ZD9 A;  1W0J G;  1SQQ H;  3N2K A;  1HNZ B;  3NXS A;  5IJ0 B;  3FAV B;  2W0F C;  3DXR A;  2W6I G;  4JZG A;  4F4L A;  5IY5 B;  5CMU A;  2QGN A;  2A79 B;  2BTQ A;  1KC8 W;  1HNW B;  4OX9 B;  2PF4 E;  3AG1 C;  1XNQ O;  1UPG A;  3T1H B;  2YI9 A;  1JJ2 U;  3CXC U;  1XNQ B;  5IDJ A;  5IE9 A;  4CBC A;  3HKB B;  3B4S A;  2A06 H;  4LF9 O;  3RYC A;  2DOS A;  4LFC O;  1QLE C;  3LDE A;  4WBN B;  4LF7 O;  2EIM C;  5D5P A;  3VQW A;  1IZ3 A;  2RMK B;  4AQY O;  4KUM A;  3AG4 C;  1AP6 A;  1I0H A;  1TGO A;  1NKD A;  1COW G;  1NJI W;  4O2A B;  2EUL A;  2JJ2 G;  4MVU A;  3MDS A;  1VQ4 V;  4FFB B;  1F4M A;  5B1B B;  1XL6 A;  3CMA V;  2JK5 C;  2KSD A;  4FZ1 A;  1D5A A;  3ML0 A;  4J42 A;  4JYA O;  2YDE A;  1HR0 O;  5IJ9 A;  4U3J B;  3E2E A;  4JYA B;  5EBW C;  2N05 A;  4X20 A;  3ETD A;  1W59 A;  2IJJ A;  1N33 B;  3K9S A;  5EYP A;  4UVA A;  3JD4 A;  3UKM A;  4LF5 O;  1ARO P;  5JCO A;  2BSK B;  1OZ0 A;  2QKS A;  1FAF A;  4X9Q A;  4ZOL A;  1OCC C;  1TAE A;  3OUS A;  2Y0I A;  3K5O A;  4B7E A;  1PV0 A;  5LGN A;  4JI7 B;  3LDD A;  4EFE A;  4KFM A;  3JD3 A;  1WLE A;  2DQ0 A;  2DYR C;  2GUZ A;  1R1B A;  3ICX A;  5BMV A;  4R8C A;  4X89 A;  1WN7 A;  5LYJ B;  2CTP A;  1B06 A;  1R3I C;  2EIL B;  1AI7 A;  2VS0 A;  3RYI A;  3H1L H;  5C93 A;  3OM3 B;  2ZDI A;  3J7A U;  1AIL A;  4UVC A;  3STZ C;  2X6C A;  5CB4 A;  3N2G A;  2JGD A;  3RYH A;  1XNR B;  5IYB O;  2WAM A;  1EZV H;  2GHY A;  2Q7E A;  2CTQ A;  1YXB A;  4X62 O;  4X8A A;  3D8C A;  3SYC A;  2QM7 A;  2Q69 A;  1HNX O;  3JAL B;  4DR1 O;  2XHB A;  1FXK B;  4UCT A;  1HNX B;  4RAI A;  2AXT Z;  4JI1 O;  4K3A A;  2JVD A;  2YIC A;  3TK1 A;  3ZHR A;  4HNA A;  5FLX N;  3K08 A;  2D3O W;  3HKD A;  1WP8 A;  1JCH A;  4FLV A;  2ITD C;  2XND G;  3M8A A;  4J80 A;  1CXZ B;  1F7Y A;  3HB3 B;  4X64 O;  4KP4 A;  1IXB A;  4NTX A;  4JI5 B;  1XQ8 A;  4X1Y A;  2VQE O;  4PHZ A;  4NXM B;  3B2E E;  1GN4 A;  1GM9 A;  2QM8 A;  3O65 A;  1WJZ A;  4TV9 A;  1SER A;  3ZHQ A;  3RW0 A;  1Q6I A;  1SET A;  4G28 B;  4WFG A;  1N0J A;  1YIJ V;  1I94 O;  3M7M X;  5DEC A;  1IBL O;  1IBL B;  1SQV H;  1XUQ A;  1EM1 A;  1OHH G;  1SKV A;  4P2Z A;  4DR7 O;  5KUM A;  5LOV A;  5KHH A;  4LCU C;  1YTF D;  1TVK B;  4ZHQ B;  3SPJ A;  1JPX A;  2BTO A;  3CJH A;  3CCS V;  4JI0 O;  4CC6 A;  2D2C B;  4I4T A;  5JWP A;  1N4C A;  1Q86 W;  4PI2 A;  2Q4P A;  1P49 A;  2PYJ A;  4J41 A;  2HFE C;  3SGI A;  2EX3 A;  4PA4 A;  3SPH A;  1BQ0 A;  1M56 C;  2WA4 A;  3HR0 A;  1I08 A;  1L0L H;  2HKO A;  1K4C C;  4UXN A;  1JMK C;  1CPY A;  1GK9 A;  4B3S O;  3P32 A;  3LSS A;  4LNU A;  1Y76 B;  3N2K B;  1M57 B;  1PM9 A;  1L1F A;  3AG2 B;  3F5W C;  2RQ6 A;  1URF A;  4I0X A;  2BTQ B;  2L6L A;  5L3G A;  2F95 B;  5IJ0 A;  3SJQ C;  3QO7 A;  2P22 C;  3BAA A;  4D7S A;  3ZJZ A;  3RYC B;  4LH7 A;  3K79 A;  1SQB H;  2NN4 A;  2IM9 A;  5FNV A;  3JAK A;  5E1A C;  4E4E A;  1E1R G;  5B1A B;  2EIN C;  2NR5 A;  5JH7 B;  1DLB A;  5LL6 Y;  5J9P C;  2P7T C;  1KP3 A;  1L8D A;  5EBM C;  2AZ0 A;  1RPR A;  3OGC C;  1H38 A;  3AG3 C;  1BQZ A;  5LXT A;  2QE7 G;  3HKC A;  5FPR A;  4DV4 B;  5K1X A;  1D2D A;  4XDL A;  1QR8 A;  2GTA A;  1RM1 C;  5LGU A;  4JAS A;  2Y4U A;  3K0D A;  3JSL A;  5IJ9 B;  5BXZ A;  5AG2 A;  1RFY A;  2QWQ B;  4H13 B;  4PA6 A;  4XBF A;  3X2Q B;  1YTF B;  5CA1 A;  4X20 B;  4O2B A;  2X6B A;  3ZN1 A;  1I7F A;  2IU3 A;  4JI2 O;  1MAB G;  5EYP B;  3GB7 C;  2O57 A;  1LR1 A;  4NB5 A;  3OFN G;  2Q67 A;  1DK1 A;  3DTU B;  4O4J A;  4D6T H;  2QWR B;  4B3R O;  2Q0O C;  3JSN A; 
#chains in the Genus database with same CATH homology
 4ZOL B;  4B3M B;  4DV0 B;  4JI0 B;  3A2F A;  4IIJ A;  3T1Y B;  2F1M A;  5J2T B;  4TV8 A;  5KX5 B;  1TVK A;  1M93 A;  2E5L B;  4DV3 B;  1N34 B;  1WPB A;  1Q43 A;  4CH4 A;  5BMV B;  2F66 C;  1H2S B;  3SR2 C;  4CH5 A;  3QG5 A;  2F4V B;  3K57 A;  4TUY A;  4DR5 B;  2ZM6 B;  4GKJ B;  3JAR A;  5KMG A;  3HKE A;  2VWK A;  3RYI B;  3K5N A;  1FFX B;  3K5M A;  4DUZ B;  3E22 A;  4O4I B;  2PYL A;  4B3S B;  1WNS A;  3JAS A;  3VQY A;  5CB4 B;  4L8J A;  3N2G B;  2PY5 A;  5LMU B;  1SQF A;  4NXN B;  4JV5 B;  3RGB A;  5JJE B;  4FLZ A;  5IYZ A;  4LR3 A;  4FLU A;  1N36 B;  2ZIO A;  5KHK A;  2R72 A;  3N2K A;  4DK1 A;  1HNZ B;  3CSX A;  4FM2 A;  5IJ0 B;  4HNA B;  4ZIB A;  4AIL C;  3BA9 A;  3HKD B;  4YJ3 B;  2R70 A;  3U10 A;  5LP6 C;  2BTQ A;  1HNW B;  5JVD A;  4OX9 B;  4TQD A;  2PTM A;  3T1H B;  3VQV A;  1SA0 A;  2YI9 A;  4X1I A;  1XNQ B;  4IHJ B;  3HKB B;  4LF8 B;  3RYC A;  4ZI7 A;  5IWA B;  4WBN B;  4JI8 B;  5D5P A;  4CS4 A;  2ZNJ A;  3VQW A;  4X1Y B;  2E3C A;  2Q0A A;  2ZIM A;  4KHP B;  5LA6 A;  4EFB A;  4TV9 B;  3BHP A;  5JQG B;  5CA0 A;  1TGO A;  4YJ2 A;  4DV6 B;  4DUY B;  3UT5 A;  4O4H A;  1TUB B;  1YEW A;  2UUB B;  4UCU A;  4O2A B;  4K0K B;  4FFB B;  5LMN B;  4I9Q A;  4O4L B;  2CAZ C;  5KHG A;  3ETQ A;  3JAW A;  1D5A A;  3U0Z A;  4X65 B;  4NVP A;  5IJ9 A;  3BRC A;  4U3J B;  1XMO B;  4JI2 B;  5EZY A;  4FM1 A;  5LOV B;  4JYA B;  4X20 A;  3K58 A;  4B3R B;  2VWJ A;  4DR3 B;  1N33 B;  5KHJ A;  5LP6 B;  2QJ1 A;  4I55 A;  5EYP A;  4I4T B;  4K8Z A;  4I50 B;  2PZS A;  4CS2 A;  4FM0 A;  5JCO A;  4F6R B;  4ZHQ A;  5C8Y A;  5GON A;  4LF6 B;  4EEQ A;  4ZOL A;  4X1K B;  4UCO A;  1TAE A;  3SJB C;  3MAQ A;  2ZCE A;  1M4U A;  1JFF B;  5J2T A;  3K5O A;  3JAT B;  4JI7 B;  1T5E A;  2UXD B;  4EFE A;  5KX5 A;  5BMV A;  3ICX A;  3SJC C;  2UUA B;  4LF4 B;  3WB0 A;  2PGG A;  1WN7 A;  4LNU B;  4UFZ A;  2V4D A;  5LYJ B;  3RFR A;  4DRX B;  3RYI A;  1FFX A;  5IYZ B;  4O4I A;  5KHI A;  5J2U B;  4JI3 B;  4LH6 A;  5CB4 A;  3N2G A;  3RYH A;  1XNR B;  2Q7E A;  4B08 A;  3UQ8 A;  5JJJ B;  1Z5V A;  3QF7 A;  1RSO A;  2JGU A;  4JI6 B;  2YIA A;  5EIB D;  1XI1 A;  4DK0 A;  2KKW A;  3JAL B;  5BR8 B;  2XHB A;  4UCT A;  5FNV B;  1HNX B;  3JAK B;  2JVD A;  2Q7G A;  4PI0 A;  4HNA A;  5JCO C;  3ZS8 C;  1IBM B;  3K5L A;  3HKD A;  4YJ3 A;  1XHZ A;  5LXT B;  4LF9 B;  2YI8 A;  3HKC B;  5K1P A;  4LFC B;  2F93 B;  5JH7 A;  4FLV A;  5FPO A;  4DV2 B;  2R9A A;  4FLX A;  1XMQ B;  1X4T A;  1XHX A;  4LF7 B;  3CB2 A;  3U11 A;  4IHJ A;  3HKB A;  2P5O A;  2YIB A;  3RYF B;  1IBK B;  4AQY B;  3K59 A;  1HW7 A;  3RWR D;  4JI5 B;  4WBN A;  1KMI Z;  1XQ8 A;  4X1Y A;  1Q5O A;  3WB2 A;  4YY3 B;  1Z5W A;  4PHZ A;  1B04 A;  4UCS A;  4NXM B;  3B2E E;  5CA1 B;  4GYC B;  3SJA C;  4O2B B;  1QQC A;  2UXB B;  4TV9 A;  2ZIN A;  5JQG A;  4TQF A;  4TOI A;  4DV7 B;  5ITZ B;  4CC5 A;  1N32 B;  1TUB A;  1HR0 B;  4O2A A;  4FFB A;  3M7M X;  3LNN A;  4O4J B;  5JJN B;  4O4L A;  3PN1 A;  1IBL B;  1VF7 A;  4IIJ B;  4Q6G A;  4DV1 B;  4U3J A;  1SKV A;  4EB6 A;  5LOV A;  4TV8 B;  4X66 B;  5KHH A;  4LF5 B;  1TVK B;  4ZHQ B;  2BTO A;  4D7T A;  4GLX A;  4CC6 A;  5LP6 A;  5D5Q A;  4I4T A;  4I50 A;  2VQF B;  4TUY B;  2RJZ A;  4PI2 A;  1J5E B;  4K8X A;  4FVM A;  4F6R A;  3JAR B;  1P49 A;  5KMG B;  2PYJ A;  4X1K A;  3SGI A;  3HKE B;  2JS5 A;  1TA8 A;  1M5I A;  3E22 B;  1V9P A;  4DR2 B;  1JFF A;  4FLW A;  1O9G A;  3BAB A;  3JAT A;  2EX3 A;  3JAS B;  1G6U A;  4YHH B;  2UUC B;  1FJG B;  4FLT A;  4DV5 B;  1Q8I A;  1JMK C;  3OTF A;  4LNU A;  1QHT A;  1ZAU A;  3VQX A;  4HBN A;  3WB1 A;  5LYJ A;  4CH3 A;  3RYH B;  2OYQ A;  3N2K B;  2HEP A;  4DRX A;  3DSQ A;  4X62 B;  3BPZ A;  5J2U A;  4KL1 A;  4UCR A;  2RQ6 A;  3FFQ A;  2OWO A;  2BTQ B;  4DR1 B;  5JVD B;  2F95 B;  5IJ0 A;  4JI1 B;  1SA0 B;  4GKK B;  2P22 C;  4X1I B;  4BWA A;  3BAA A;  4D7S A;  4JI4 B;  2QM4 A;  3THO A;  4LFB B;  4B3T B;  2YXL A;  3RYC B;  3JAL A;  4LH7 A;  2UXC B;  4ZI7 B;  2IM9 A;  2GV9 A;  4BW9 A;  5FNV A;  3JAK A;  5JH7 B;  2ZNI A;  4DR4 B;  1L8D A;  4AHC A;  4CS3 A;  1Q3E A;  5LXT A;  5LA6 B;  4CH6 A;  3HKC A;  5FPR A;  5CA0 B;  2Q7H A;  4YJ2 B;  4DV4 B;  4X64 B;  3OTO B;  5K1X A;  3UT5 B;  4O4H B;  2HHH B;  1SQG A;  4FLY A;  2VQE B;  1KU9 A;  2PUS A;  4LFA B;  3RYF A;  2YIB D;  5EIB C;  1O9H A;  3JAW B;  3CHX A;  3ZED A;  3JSL A;  5IJ9 B;  1NT2 B;  5EZY B;  2UU9 B;  3BA8 A;  5CA1 A;  1I94 B;  3IAY A;  4X20 B;  4O2B A;  1I7F A;  4I55 B;  5EYP B;  5ITZ A;  4DR6 B;  1JJO A;  1DGS A;  3QTC A;  4DR7 B;  4EB6 B;  4O4J A;  5C8Y B;  1S5J A;  4UCV A;  5GON B;  3JSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...