3CSXA

Structural characterization of a protein in the duf683 family- crystal structure of cce_0567 from the cyanobacterium cyanothece 51142.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
b'ADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Metal binding protein,unknown function
source organism Cyanothece
publication title Structural characterization of the protein cce_0567 from Cyanothece 51142, a metalloprotein associated with nitrogen fixation in the DUF683 family.
pubmed doi rcsb
total genus 24
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05082 Rop-like Rop-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3csxA00
3SJAC 3B2EE 3CSXA 1SKVA 1X4TA 3ICXA 2F66C 3QG5A 1NT2B 3SJBC 3SJCC 2P22C 3THOA 3ZS8C 2CAZC 3QF7A 2JS5A
chains in the Genus database with same CATH superfamily
1PL0A 3ZBHA 1VP7A 1OCOC 3K59A 2LP7A 1K9MW 1D5AA 2RQ6A 4YJ2A 2Y69B 4EFEA 1S3JA 3JASA 4DR4O 2Y4UA 2W6IG 4H0LB 5KHGA 5JH7B 1K34A 5CA3A 3J80N 4CS2A 5IY5C 4R6ZA 2XAQA 3CXCU 4UCOA 5E1AC 4X1YB 2ZDIA 3UKMA 1IBMB 4U7OA 1X59A 1YITV 4X66B 4X64O 1XL4A 4WFFA 1B3QA 4WFBV 2QEXV 2UXXA 4JTCB 3ABTA 3WB1A 2VWKA 4C7UA 4JI5B 2PUSA 3ZRWB 3CB2A 1JPXA 2GDSA 2GUZB 5K1PA 1S5HC 3C90A 4DR3B 2LJ2A 1WNSA 4IHJA 3MHSC 1XREA 1IX9A 1HNXO 3K03A 2R9RB 1W2BU 4F6RB 3ZHUA 5C93A 1LUWA 1R6NA 2X6BA 4I9WA 3ZN0A 4LF9B 4LFAB 5BZBA 3L73H 5DECA 1PNKA 1T5EA 2RN9A 2ZNJA 4G27B 4B7KA 3OD4A 1DF5A 3APOA 4CS3A 1NVPD 4EKWA 1GRJA 2PF4E 3ASNB 4UB6Z 1XOUA 1Q6HA 3FFQA 1K33A 3CRRA 2UXDO 1XDCA 2ZM6O 1ZL8B 1HW7A 3BA9A 3OFNG 1BT8A 4NXNB 3K9AA 2GTAA 3JD1A 3T1HO 4QPKA 4BW5A 1BE3H 3L74H 3ZX6A 3H1JH 1KMIZ 2ZIMA 4TUYA 5JVDA 1I94O 4ZHQA 1Y66A 1QQCA 4LF4O 3CYOA 1VQLV 4KXRA 5LHGA 2AXTZ 1YJWV 4FVMA 1R3IC 4DV0O 2Z3YA 5FPOA 2GSMB 5IE9A 2LFSA 3N2GA 2X6CA 4X1IA 5BMVB 1P4RA 2JVDA 4O4JB 2A0LA 1BS3A 2OTLV 2QR4A 4PI0A 4FLWA 3FD9A 4JTDB 4GCZA 1IZ3A 1PV0A 4MVSA 1NTMH 2P4KA 2YUAA 1EZVH 1FXHA 1SRYA 1HWYA 5L3EA 1MZFA 4ICGA 3QO7A 1FFXB 1DF4A 3G71V 4DR1B 1YCIA 2A3QA 4YJ3B 1NH2D 4RWUA 5LP6B 3BEHA 4IGGA 1Q90D 2HVKC 1R3KC 3HR0A 4O4LB 3TK1A 5LHHA 5J2TB 1BHBA 5KAFZ 1KYOF 5GTIZ 1XUQA 4K0KB 2P5OA 3VBBA 1XNRO 2JEXA 2WLHA 2QTSA 2F93B 4QGPA 2UXBO 5JJJB 2OIGA 1BSMA 4TV8A 2JS5A 3OR7C 1PM9A 3MD0A 1MZEA 4IYHA 3AG3C 3VOUA 1L0NH 4XDKA 4DV7B 1KB9F 2IJIA 3FYIB 3EVKA 5LYJA 1XMQB 3ZEDA 1OCRC 1WPBA 4JF3A 4WBNB 3OGIB 3G80A 4JAVA 3D36A 4DV6O 2XUMA 5CBGA 4X1KA 1RSOA 2CUGA 1VF7A 4PELA 2UUAO 3SPGA 4P9PA 3B8NA 1QLNA 2KG7B 5FNVB 5IYDO 3RN4A 4F6RA 4EFBA 1OV9A 2EX3A 1BQZA 3Q4HB 3WFVA 2YIAA 2R70A 4O2AA 4YJ2B 3I5DA 2PY5A 3ZCCA 1N4CA 3E35A 1EN6A 3CXHF 2JJ2G 2Q9LA 4K8XA 4MVOA 4NTYA 3SJQC 2HEPA 3WG7C 4ZI7B 4WCEV 4DV6B 5B5EZ 4LP8A 3ZRVA 3OTOO 3NR7A 2LW1A 2JGDB 1FFXA 3PN1A 1Q5OA 4I7ZB 2B9ZA 2M7WA 5JWPA 4X8AA 5LHIA 4DR7B 3JARA 5K1XA 3E8BA 4KP4A 1WPXA 2PTMA 4FM2A 2EINC 4JI1B 2DJVA 1FKAO 1XHZA 2WLKA 4GX1A 2ADPA 4I5SA 2CH7A 3TCUA 1XNQB 4H13B 2AW9A 4CC5A 1I7FA 1WA8B 4FMTA 2V4DA 1IXBA 4DUYB 4DR2O 1R3LC 1WB7A 3JCZA 2EIJC 2PGGA 4BW9A 1AJQA 5CA0B 3T2MA 3L9DA 4TV9A 1YEWA 4X65O 4B3TB 1EBOA 3WG7B 1EZJA 3OMNB 1XMQO 1Q6IA 2ZCEA 3SYOA 5CB4B 3K5LA 3GWOA 2DN9A 4HNAB 1ZUQA 1SQFA 2QM7A 3OEEG 3RWRD 1R6KA 4OPHA 2KG7A 1ZWIC 3JATA 4DXWA 4O2BA 1AI7A 2CTQA 3W7WA 3DXRA 2FYUH 4QJFB 1S76D 3X2QB 4YY3B 1VQ4V 3JALB 5KX5A 2EIJB 3ETEA 2UXBB 2RJZA 2IU0A 1N34O 1K4DC 3ZMSA 2HG5C 3L70H 2WLNA 3DC5A 2QTOA 4PV1B 4G28B 2WA4A 5LMNO 2WAMA 5BXZA 4MW3A 1WP8A 1GN2A 4X20B 3AEIA 1XNRB 3HKDA 2L35A 4GX2A 2ZM6B 2YIBD 1OCOB 3IGAC 4JI6O 2KQXA 3UO2A 4X88A 2YIBA 4LF7O 4J80A 2QWRB 4J7JA 4N21A 1S0VA 3CJHB 2Y0PA 3ZRSA 2O57A 1SQVH 4DR5B 1J5EO 4MSWC 2CTWA 1QNMA 4QNHB 3C3SA 3T4DA 4NYKA 2UXNA 4XBFA 3KZIZ 3M7MX 3AG2C 1S72V 3MDSA 1O9HA 4TUYB 4U3JA 3RYCA 4Q6GA 2Q69A 2YDEA 2DW4A 1FS0G 3W7SA 2H3OA 1QLEB 3KCYA 3ZIAG 2OT5A 3JASB 1PPJH 3AG4B 3APQA 3ETQA 4X64B 3FX7A 2W0FC 1N33B 4ZKIA 2AZ0A 2ADQB 4PI2A 4FIPC 3RFRA 1F51A 4JI2B 4JI0O 1NR7A 1P84F 4MTFA 3GVMA 1G4YB 4QPJA 1THZA 2C2AA 5LMNB 4J7ZA 3TXSA 4NXNO 3P3PA 1SA0B 2XHBA 4LFCB 3GB7C 2Q0AA 2PI5A 1A32A 1I94B 3SPHA 1GTOA 4O4LA 4JI7O 1AR5A 2JGUA 4DV2O 3E86A 2UU9O 3JAMN 4UCUA 4HZ3A 1SA0A 4I55B 4UVCA 1P7BA 2E5LB 3AG7A 2F66C 3C3TA 3ASNC 3WB0A 5KLVH 4CS4A 1Q43A 3SYCA 4B3TO 4GX5A 4DR6O 2YXLA 2E76B 5B1BB 1TGOA 1P49A 3K04A 2EIMB 1I5XA 4JI3B 1DGSA 2YI8A 3RVYA 1Q81W 4P30A 3CMAV 1JQ0A 2XOKG 3N2KA 4JI5O 2PZSA 4FM1A 2P6JA 1MA1A 2BTQA 1BQ0A 4JI7B 2HVJC 3DC6A 4ZHQB 2XAJA 4LF6B 1GM7A 1YDXA 2Q5ZA 4UCVA 2BCCH 3JD2A 3UO3A 1M57C 3N2KB 3HKEB 5EBMC 4X1IB 5KUMA 3F5TA 1XEQA 3WU2Z 2ARHA 1QU7A 5B3SC 1B06A 4O2AB 4B3MB 2ITDC 1NS1A 2QGNA 3RGBA 2BOBC 4QIWF 3ETGA 1W0JG 5LP6C 2JGDA 3I56V 2ATKC 4J10A 3CMEV 5ITZA 4PD4F 1VF6C 4JI4B 3TJTA 2NLJC 3LNNA 4R8CA 1AI5A 4ASUG 2P4VA 4F4LA 2V1DA 5F2VO 1ZL8A 2N04A 3ZMUA 2NNUA 3ICXA 1JA8A 1HNZO 1FXKA 4GKKO 4WFHA 1IVSA 4MTOA 2OWOA 1S77D 1V55C 2DQ0A 2CTPA 1TVKB 1BZKA 1Z2GA 2WLIB 4X9QA 4Z1VA 5J2UB 3HKDB 1N34B 4I50A 2CE4A 1K4CC 2W6JG 4JI2O 1LNQA 4B3RO 4CC6A 3FAVA 3O9OA 1KQSU 2JJ1G 1MNGA 2YEVA 1N33O 3OM3B 1BMFG 5HFMA 1QVFU 2QWPB 2B1IA 1VARA 2GBOA 2Q7EA 5L3FA 3JD4A 1N0NA 3JATB 4UVAA 4MVMA 4NXMO 3IJ4A 3G6EV 4ZIBA 1TUBA 4CBCA 1NU1H 4B3SB 2UUCO 4DUYO 2Q68A 1Q82W 1W59A 1YI2V 3CRAA 3HKCB 5IWAB 5EIBC 4JYAB 4GYCB 1K5QA 3K3WA 5B1AB 3AK3A 1R1BA 3R65A 1L1FA 2Q7HA 4H33A 4IYIA 3CCJV 2NR5A 4FZ0A 2ZQMA 3AG1C 2DWEC 3RYHB 4JYAO 4JYCA 2IH1C 3BFRA 4DR7O 2YC0A 2ZKOA 3F7VC 2UUCB 4PA3A 3CRQA 2Q67A 3E22B 3W7TA 2BSKA 1FXKC 2A7WA 3CC7V 2R9IA 4WFAV 4U7NA 2JRIA 4U3FH 3K5OA 5B1AC 3OTOB 3K0DA 4P9OA 4J41A 1TA8A 4BIUA 4L8JA 1PNLA 4J42A 1KD1W 3SDLA 2D2CB 2QKSA 3THOA 1GMGA 4BR6A 1COWG 5JJNB 3RT3C 3B8MA 3ZN1A 4LH7A 3CC4V 2FB5A 2HR3A 1VF5B 2F4VB 4PDMA 1OZ0A 1SQXH 2HLDG 1TUEB 3IC9A 4EB6B 1VMGA 1LUVA 3QF7A 2IH3C 2P7TC 3ZJZA 4AILC 3B4SA 4FLVA 4NTWA 2LO1A 2HJFC 4QE7A 2MK3A 3F7YC 5LMUO 1M5IA 4LF5O 4LF8B 1KU9A 4H37A 4LC1A 5ITZB 1DLBA 1PP9H 4TV8B 4TSFG 4GKKB 2HP8A 2B5UA 1OCZB 1AP5A 3H1LH 5IT9N 5L3GA 4TWKA 3MAQA 4I9QA 3H1HH 4RUEA 4PA7A 1E1RG 4DR3O 3FKSG 1K7DA 3K79A 4MW8A 3UT5B 5KHJA 4X1KB 2RNBA 3OGCC 2A9HA 3CHXA 2CK3G 3CCLV 3IC7A 1N8RW 3CSXA 2E75B 1ENVA 1H2SB 1NQTA 3RYHA 2WA3A 4YHHB 1AI6A 2ZE7A 5EIBD 1AJPA 1EFRG 3CS5A 4CH4A 4JI0B 2CGNA 3E8FA 3QTCA 1NI8A 3ABUA 3H1IH 1S5JA 1XQ8A 5DM6V 1G8MA 3EXAA 1U96A 4LFBB 1US6A 4RQEA 1K97A 1FXKB 2R72A 1JFFA 1BL8A 3E89A 3D3QA 4OX9B 4OGQB 3W7XA 1I08A 3T1YB 1IBLB 1OCZC 3ZMTA 1SC5B 5B66Z 5GONB 1WN7A 4UFZA 3M8AA 1UPGA 2AHYA 3BVOA 2FTKA 1MOFA 1AILA 2IM9A 4DV3B 4JI3O 2QA4V 5IDJA 3OT7A 1Y67A 1Z5VA 1HNWO 1XI1A 3FAVB 2YICA 3ZS8C 2DYRC 1UFIA 1ZAUA 3VQWA 1Y76A 1YTFD 3CE2A 4LFCO 2FKXA 5DEDA 1WP7A 4GKJO 2QKCA 3LDCA 3ZHQA 3KCXA 2XNDG 2E5LO 2IBZH 2AHZA 4DRXB 2Y0IA 5FNVA 1FXVA 2X6AA 2X7RB 3ASOC 4FPPA 2UXDB 3ML0A 4IIJA 3NXSA 3DSQA 4KFMA 3SJBC 1SQGA 2H8PC 2P67A 5KMGB 4DV4O 3STZC 3BRCA 4K35A 3A2FA 3VQVA 4GKJB 1Y4MA 2EILB 4FLTA 3ZMVA 4J9ZB 2VQFO 1H38A 1OCRB 3STLC 5IJ9B 1RPRA 5LA6A 5CA1A 3U10A 5KX5B 4X62O 3P32A 4R50A 1JVMA 4LF9O 2RMKB 3DXRB 4DV3O 3J7AU 4X1YA 2DE0X 4GLXA 4JAUA 5EC1C 1IBLO 1G1XB 4MT8A 1SQBH 1M1KW 3K58A 5EK0A 3OMIB 3I55V 2Q4PA 4R7CA 1JFFB 1NTKH 1SZTA 1J95A 4FK5C 5B3SB 1B6QA 3RBZA 4HAMA 1OJHA 2VWJA 3RYIA 1HNWB 5IJ0A 4DR2B 5C8YB 2WSSG 3CC2V 4B3MO 2QSAA 5H6RA 2E74B 4X62B 4LFBO 3CP1A 5CMUA 3CCQV 1XILA 4WFGA 5JQGB 4KHPB 1NTZH 1AJNA 3L75H 2QWQB 4OXSA 3H01A 4J11A 1Y6XA 4DR5O 2BTQB 2F43G 3ABMC 2FL4A 1VQNV 4MVZA 4LF6O 2ETNA 1KUQA 3N2GB 4JTAB 4FLYA 5EYPA 1AROP 2DMXA 1IBKB 1BCCH 3OUSA 2P90A 2DYRB 4LNUB 2PYJA 2YXYA 4I0XA 1Q86W 4YHHO 2GV9A 5D5QA 1ZLZA 2CGOA 5JVDB 1AI4A 5LXTA 1JX9A 1FPOA 4JZGA 2F1MA 1SS3A 4DYLA 5JCOA 2AZ2A 3FB8C 2V7QG 4OPAA 4X89A 4MVUA 4I0XB 3CPWU 3B77A 2DOSA 4JV5O 2OTJV 2RCVA 3QG5A 2OYQA 1K8AW 4JPRA 2LFRA 1K73W 2KSDA 2R9AA 1SKVA 4ZOLB 2IW5A 1H2GA 3G4SV 3CCUV 2EILC 3LDDA 4UV9A 3ABLC 4UUJC 3SPCA 2RDCA 2Q7GA 3JAKA 2QWNB 2HFEC 4TOIA 4JI1O 5H2FZ 1H2KA 4MVRA 5LOVA 1R3JC 1V54C 2X0LA 2H94A 4D6TH 2QM8A 2HJDA 4CZZA 4LF8O 3K06A 1AVMA 2QDOA 3K5NA 1MMMA 5BY1A 3D3IA 1CXZB 2EZPA 2OIEA 3N27A 4J7KA 5IY5B 1H2MA 4GZRB 2ZINA 4TT3G 5J2TA 3K5MA 5GTHZ 1V9PA 5FLXN 1E79G 3T1CA 1N32B 3HKBB 5LGTA 3AG3B 5EBLC 5KHIA 1GO3F 3CD6V 1GKFA 4ZBMA 5IJ9A 1I0HA 5IYZA 3ABMB 1GAXA 2ZXWB 1TAEA 1D5NA 4PA9A 5CB4A 2DQ3A 3CCSV 3J81N 2KB1A 2VQEO 2EBOA 3PJSK 1J5EB 1QR9A 4PJ0Z 4DV5O 1RSOB 5LMUB 1VQ5V 3SJCC 3FB7C 4L87A 1M57B 1RPOA 3ABLB 3UM7A 1O9GA 3K0GA 3SPJA 4FFKA 2BTOA 5BR8O 4JI8O 5EBWC 2G38A 3TXQA 4JZ2A 4YIOA 3JALA 2HHHO 3BA8A 1YF2A 3TGUH 3P3NA 4I50B 1XMOB 1VQ6V 1N32O 4UCSA 1S5LZ 2Q8VA 2ZIOA 5A9GA 1GN3A 1Q6UA 3K9SA 1NZ6A 3AG1B 1M4UA 1FD9A 5BR8B 4FLUA 3DTUB 3ZHRA 2IJKA 4J9YB 3G6BA 4GX0A 4WFEA 1JR9A 4AQYO 1HNZB 3FYEB 5B1OA 2HHHB 1F23A 4DR1O 1VQOV 1YSCA 4HBNA 1PNMA 1VF6A 1SQQH 3E2EA 1V55B 2Y69C 1SESA 3D8CA 3HKEA 1KKDA 2ZXWC 3SPIA 4K0KO 1BHAA 4K8ZA 2EJRA 5JQGA 1Z5WA 4PDRA 4I4TA 2P06A 3LNMB 3LUTB 4UCRA 5H9CA 4DV5B 4QE9A 2EINB 2CH7B 3UT5A 1RFYA 2ZE6A 1HR0B 2WPDG 1MABG 5GW7A 4PDLA 3E83A 3F5WC 2ODMA 4JI4O 1QCEA 1XL6A 4LF4B 2LGWA 3HKCA 3CCEV 3LSSA 4MS2A 5JJEB 1M93A 3AK1A 2Z0AA 5IYCO 2B1GA 1IBKO 4UCTA 4B3RB 4ZI7A 2W0XA 4AI8A 2EJ7A 4ABMA 3ZHSA 4JAAA 5EZYA 4EB6A 5KHKA 3K57A 3BHPA 4IIJB 4JYYA 4AHCA 1M90W 1L8DA 1YIJV 3T4ZA 1H2LA 2DWDC 4X20A 2JEUA 3OR6C 1W0KG 2QKAA 4PA4A 3O65A 5LOVB 3FB6C 1D2DA 2BE3A 2QJ1A 1JCHA 2F23A 5L3DA 2EZOA 2Z5UA 3A0HZ 2IJJA 3BAAA 3OW2U 4DUZB 2QWOB 3JYCA 3HPLC 1Y76B 3CRMA 1LR1A 4B08A 4O4HB 1MSWD 2EIKC 3HKBA 1I5YA 3CRCA 1FAFA 5C8YA 3CCRV 4DV7O 1YXBA 3JSNA 4HYOA 3RYFB 2UUBO 2PYLA 3KG2A 1QBZA 4U3JB 3QO8A 1FYJA 2IU3A 2GTSA 1ZX3A 4RAIA 5JH7A 4DR4B 5AG2A 1NKDA 2NN4A 4WBNA 4DV2B 1PKXA 5KAIZ 4DRXA 4X66O 4XDJA 1E1QG 4MVQA 3L72H 3G67A 1XBLA 1IXMA 1YJ9V 2CAZC 3BPZA 5EYPB 4YJ3A 1QLEC 4N23A 1R6TA 3A0RA 1BGYH 3ASOB 1M56B 5EZYB 3M99B 4XDLA 4BAYA 4E2LA 3S3WA 1U97A 3JAKB 1RM1C 2IJHA 2DYSC 2CDYA 2JDIG 3D36C 2LGQA 3JAWB 3OUFA 1GM8A 4NTXA 3CCMV 2A06H 3ZHTA 4DR6B 1N0JA 1GN6A 2QE7G 5L3CA 1HR0O 1DTOA 3ETDA 4PHZA 4H44B 1CPYA 1NBMG 1SF9A 3RYIB 3S3XA 2ZDIC 1AR1B 3FB5C 1N36B 4UXNA 4D7TA 2YIDA 1F4MA 1TVKA 1GK9A 4LWSB 4OX9O 4DK0A 1K5SA 2L6LA 2YS8A 5IJ0B 3LSUA 2UU9B 2ZE8A 4O4IA 5FL7G 5B1BC 4UV8A 3P30A 3WB2A 2DYSB 4NB5A 1FJGB 4DV0B 1KP2A 2VQFB 4EEQA 3RVZA 1AR4A 1OCCB 4BWAA 4LF7B 2M6YA 3TETA 2YEVB 4GT1A 3UQ8A 5D5PA 1VQKV 1MSDA 1H2NA 1Y74B 4TQFA 4DV4B 5LXTB 4TQDA 3Q4HA 3DGEA 3BABA 2Q6AA 3W7UA 3MHHC 4TV9B 1TUBB 5H5NA 4P2ZA 2ZE5A 2Y4TA 3SGIA 1KP3A 2XAHA 4FFBA 1SERA 3JD0A 3JCUZ 1PD3A 1Y74A 1JJOA 2WLMA 3VQXA 4DW0A 2BOCC 2JIZG 2YI9A 3L71H 1ZSPA 1CP9A 1GH6A 4RO2A 4W4LA 1NVPB 1HNXB 2VS0A 3JAWA 1OHHG 3CX5F 5KMGA 3R66A 4MTGA 3ZHVA 4Z2WA 2OCHA 2VQEB 4FJCC 1GM9A 5EC2C 4FM0A 2XASA 1WB8A 2ILMA 4NR1A 3X2QC 3LDEA 3GWKC 4X65B 5HFLA 5LA6B 5CA1B 2XAGA 2UXCO 4JI6B 3T1YO 2JK5C 1SZXA 2BSKB 2LW7A 1HDJA 3AG2B 1R73A 3BCCH 4F6EA 4LH6A 4WF9V 3A8TA 2HKOA 2YXHA 2F95B 2Q0OC 3U11A 1F7YA 1VQPV 1JMKC 4LNUA 1KECA 4JASA 1EM1A 1VEWA 2ZR3A 2LQTA 2AGAA 2XAFA 3QO5A 2UUBB 5CA0A 1NJIW 5FPRA 3SYQA 2ITCC 2A79B 4YY3O 2ZD9A 2K1EA 2D3OW 2YSUB 1RM1B 3OAAG 4IL6Z 3EFFK 3RYCB 2EULA 3AK2A 4MTXA 4UB8Z 3SYPA 1YTFB 1K92A 3OMAB 4CH5A 5KHHA 2WLJA 4DUZO 4PA6A 2XTAA 1RP3B 4DW1A 1AP6A 1PL4A 1NH2B 3CWBH 3BY6A 5LP6A 1KBHA 4NKGB 4YXWG 2K9PA 2ZT9B 3SJAC 1G6UA 1VQMV 3RYFA 1URFA 1VIBA 5IWAO 2N74A 1QR8A 4NVPA 1KC8W 2VRZA 3E22A 1IURA 4KUMA 3ZRWA 1HP8A 3A0BZ 3OEHG 1XNQO 2OCCB 2Y48A 4LF5B 4NXMB 4DV1O 4CH3A 1SQPH 1YHQV 2F4VO 3ZRXA 1K3EA 5TISZ 3U0ZA 4ZOLA 2QM4A 2WLLA 2WLIA 3H1KH 1FFTB 3EHBB 1V54B 4UVBA 4AQYB 1NT2B 4FZ1A 2GHYA 3IAYA 2EIMC 3ABKB 5CBFA 2KKWA 1VQ7V 1XHXA 4W4KA 4JI8B 3JD3A 1AB3A 1NR1A 1DK1A 4DK1A 1JOYA 1VQ8V 1Q8IA 3LSQA 3E8HA 4D7SA 3AG4C 4CH6A 1ORQC 5JCOC 3QVNA 5CN0A 4KHPO 4B7EA 2GUZA 1FJGO 4FLXA 1ROPA 4I4TB 4O4IB 1L0LH 1UJWB 4LR3A 5CBHA 1CEZA 1WLEA 3B09A 5KA5A 3QNEA 1WA8A 2EIKB 3ABKC 1N36O 2UXCB 2FMLA 1QHTA 5DN6G 3RW0A 3CCVV 5KA6A 1VQ9V 4RUFA 2JS3A 4O4JA 4O2BB 2UUAB 2XT9A 5BMVA 1B04A 1WJZA 5E79Z 2WWWA 2PI4A 4Z1MG 4K3AA 3KKYA 4HNAA 1EN5A 3B40A 1GN4A 1SETA 4B3SO 1H8HG 5LGUA 5IYZB 2ZR2A 1Q7YW 4E4EA 1P7GA 1F4NA 3JSLA 3OTFA 4I55A 3VQYA 4O4HA 1MG1A 5IYBO 4YIPA 2WLLB 1ZTEA 1YJNV 4PDVA 1QVGU 2ZNIA 5B1NA 3HB3B 4RQFA 1Q3EA 1XMOO 4GUNA 4DO2A 4IT5A 2MW2B 3CJHA 4DV1B 3E8GA 5J9PC 3H9VA 1YVWA 2N05A 5KUKA 4LWSA 3T1HB 3K08A 4IHJB 4FLZA 5L3BA 1H8EG 5H6QA 4JV5B 2E3CA 5LL6Y 4BIZA 5J2UA 1JJ2U 3JARB 3OE7G 4LFAO 4Q20A 3UCSC 1M56C 5A2QN 4LCUC 1KKCA 2CTRA 4JYBA 2OCCC 3ZMZA 5LYJB 4KL1A 4LBEC 1X4TA 1OCCC 1M9NA 3SR2C 4G2KA 3B2EE 5LGNA 3SYAA 1IBMO 1YZBA 3CEIA 2P22C 1IDSA 1WAZA 4FFBB 4BIOA 1EN4A 2Q73A 4JGSA 4A5UB 3IFXA 5GONA 5LBQA
chains in the Genus database with same CATH topology
4DRXB 2PYLA 1N33B 5FNVA 3K59A 1D5AA 4U3JB 2RQ6A 4YJ2A 4PI2A 4EFEA 4DR4B 5JH7A 3JASA 4WBNA 3RFRA 5KHGA 4DV2B 2UXDB 5JH7B 4JI2B 4CS2A 4DRXA 4IIJA 3DSQA 3SJBC 1SQGA 5LMNB 5KMGB 3BRCA 3VQVA 3A2FA 4GKJB 4UCOA 1SA0B 4X1YB 4LFCB 2XHBA 2CAZC 3BPZA 2Q0AA 5EYPB 4YJ3A 1IBMB 1I94B 4FLTA 5EZYB 4X66B 4O4LA 5IJ9B 5LA6A 5CA1A 3U10A 2JGUA 5KX5B 3JAKB 3WB1A 2VWKA 4UCUA 4JI5B 2PUSA 3CB2A 1SA0A 4X1YA 4I55B 5K1PA 4DR3B 4GLXA 1WNSA 3JAWB 4IHJA 2E5LB 2F66C 4DR6B 4F6RB 3WB0A 3K58A 4PHZA 4CS4A 1JFFB 1Q43A 4LF9B 4LFAB 2YXLA 3RYIB 2VWJA 1N36B 1T5EA 4D7TA 1TGOA 3RYIA 1TVKA 2ZNJA 1HNWB 5IJ0A 1P49A 4DK0A 4CS3A 5IJ0B 4DR2B 5C8YB 4JI3B 1DGSA 2UU9B 4O4IA 2YI8A 4X62B 3WB2A 1FJGB 4DV0B 2VQFB 3FFQA 5JQGB 4KHPB 4EEQA 3N2KA 2PZSA 1HW7A 2BTQB 4FM1A 3BA9A 4NXNB 4BWAA 2BTQA 4JI7B 4LF7B 4ZHQB 4LF6B 1KMIZ 2ZIMA 4TUYA 3N2GB 5JVDA 4ZHQA 4FLYA 4UCVA 3UQ8A 1QQCA 5D5PA 5EYPA 1IBKB 3N2KB 3HKEB 4TQFA 4LNUB 2PYJA 4DV4B 4X1IB 5LXTB 4TQDA 3BABA 4FVMA 4TV9B 1TUBB 5FPOA 2GV9A 5D5QA 3SGIA 4O2AB 3N2GA 5JVDB 4B3MB 4FFBA 4X1IA 5LXTA 5BMVB 2JVDA 4O4JB 3RGBA 1JJOA 2F1MA 3VQXA 5JCOA 5LP6C 4PI0A 4FLWA 2YI9A 3QG5A 2OYQA 5ITZA 1HNXB 4JI4B 3JAWA 2R9AA 1SKVA 4ZOLB 3LNNA 5KMGA 2VQEB 1FFXB 4FM0A 4DR1B 4YJ3B 2Q7GA 5LP6B 3JAKA 3ICXA 4X65B 4TOIA 5LA6B 5CA1B 2OWOA 4O4LB 5J2TB 5LOVA 4JI6B 1TVKB 4K0KB 2P5OA 5J2UB 3K5NA 3HKDB 4LH6A 1N34B 2F95B 2F93B 3U11A 4I50A 1JMKC 5JJJB 4LNUA 4CC6A 4TV8A 2JS5A 2ZINA 2UUBB 5J2TA 5CA0A 3K5MA 5FPRA 1V9PA 4DV7B 1N32B 5LYJA 2Q7EA 3HKBB 1XMQB 3ZEDA 5KHIA 1WPBA 3RYCB 4WBNB 3JATB 5IJ9A 4CH5A 5KHHA 5IYZA 4X1KA 1RSOA 4ZIBA 1TAEA 1TUBA 1VF7A 5CB4A 4B3SB 5LP6A 3HKCB 5FNVB 5IWAB 5EIBC 3SJAC 4JYAB 1G6UA 4GYCB 4F6RA 4EFBA 3RYFA 2EX3A 1J5EB 2YIAA 4NVPA 2R70A 2Q7HA 4O2AA 4YJ2B 5LMUB 2PY5A 3SJCC 3E22A 1O9GA 2BTOA 4K8XA 3RYHB 4DV6B 2HEPA 4LF5B 4ZI7B 4NXMB 4CH3A 3JALA 3BA8A 4I50B 2UUCB 1XMOB 3E22B 1FFXA 4UCSA 3U0ZA 3PN1A 1Q5OA 4ZOLA 2QM4A 2ZIOA 3K5OA 3OTOB 4DR7B 4AQYB 1NT2B 1TA8A 3JARA 5K1XA 4L8JA 3IAYA 1M4UA 2KKWA 1XHXA 3THOA 4JI8B 2PTMA 5BR8B 4FLUA 5JJNB 4FM2A 4LH7A 4DK1A 2F4VB 4JI1B 1HNZB 1Q8IA 1XHZA 4D7SA 2HHHB 4CH6A 4EB6B 5JCOC 3QF7A 4HBNA 1XNQB 4AILC 4CC5A 4FLVA 1I7FA 2V4DA 3HKEA 4FLXA 4O4IB 4I4TB 1M5IA 4DUYB 4LR3A 4LF8B 1KU9A 2PGGA 4BW9A 4K8ZA 5CA0B 5ITZB 4TV8B 5JQGA 1Z5WA 2UXCB 1QHTA 4GKKB 4TV9A 1YEWA 4I4TA 4B3TB 4UCRA 4DV5B 4O4JA 4O2BB 3UT5A 2UUAB 1HR0B 2ZCEA 5BMVA 5CB4B 3K5LA 1B04A 3MAQA 4I9QA 4HNAB 1SQFA 3RWRD 4HNAA 3JATA 4O2BA 3UT5B 5KHJA 4LF4B 4X1KB 5IYZB 3CHXA 3HKCA 4YY3B 3JALB 5JJEB 5KX5A 1M93A 2UXBB 3JSLA 2RJZA 3CSXA 3OTFA 4I55A 3VQYA 4O4HA 1H2SB 3RYHA 2ZNIA 4UCTA 4B3RB 4YHHB 4ZI7A 5EIBD 1Q3EA 5EZYA 4CH4A 4JI0B 4X20B 4EB6A 1XNRB 3HKDA 2ZM6B 3QTCA 5KHKA 4DV1B 2YIBD 3K57A 3BHPA 4IIJB 1S5JA 1XQ8A 4AHCA 2YIBA 3T1HB 4LFBB 4IHJB 1L8DA 4FLZA 2R72A 1JFFA 4DR5B 4X20A 4OX9B 4JV5B 3T1YB 2E3CA 1IBLB 5LOVB 5GONB 1WN7A 3M7MX 4UFZA 2QJ1A 5J2UA 1O9HA 4TUYB 3JARB 2IM9A 4DV3B 4U3JA 3RYCA 3BAAA 4Q6GA 1Z5VA 4DUZB 5LYJB 1XI1A 4KL1A 1X4TA 3ZS8C 3SR2C 3B2EE 1ZAUA 3VQWA 4B08A 4O4HB 2P22C 3HKBA 4FFBB 3JASB 5C8YA 3JSNA 3ETQA 5GONA 4X64B 3RYFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJA C;  3B2E E;  3CSX A;  1SKV A;  1X4T A;  3ICX A;  2F66 C;  3QG5 A;  1NT2 B;  3SJB C;  3SJC C;  2P22 C;  3THO A;  3ZS8 C;  2CAZ C;  3QF7 A;  2JS5 A; 
#chains in the Genus database with same CATH topology
 1PL0 A;  3ZBH A;  1VP7 A;  1OCO C;  3K59 A;  2LP7 A;  1K9M W;  1D5A A;  2RQ6 A;  4YJ2 A;  2Y69 B;  4EFE A;  1S3J A;  3JAS A;  4DR4 O;  2Y4U A;  2W6I G;  4H0L B;  5KHG A;  5JH7 B;  1K34 A;  5CA3 A;  3J80 N;  4CS2 A;  5IY5 C;  4R6Z A;  2XAQ A;  3CXC U;  4UCO A;  5E1A C;  4X1Y B;  2ZDI A;  3UKM A;  1IBM B;  4U7O A;  1X59 A;  1YIT V;  4X66 B;  4X64 O;  1XL4 A;  4WFF A;  1B3Q A;  4WFB V;  2QEX V;  2UXX A;  4JTC B;  3ABT A;  3WB1 A;  2VWK A;  4C7U A;  4JI5 B;  2PUS A;  3ZRW B;  3CB2 A;  1JPX A;  2GDS A;  2GUZ B;  5K1P A;  1S5H C;  3C90 A;  4DR3 B;  2LJ2 A;  1WNS A;  4IHJ A;  3MHS C;  1XRE A;  1IX9 A;  1HNX O;  3K03 A;  2R9R B;  1W2B U;  4F6R B;  3ZHU A;  5C93 A;  1LUW A;  1R6N A;  2X6B A;  4I9W A;  3ZN0 A;  4LF9 B;  4LFA B;  5BZB A;  3L73 H;  5DEC A;  1PNK A;  1T5E A;  2RN9 A;  2ZNJ A;  4G27 B;  4B7K A;  3OD4 A;  1DF5 A;  3APO A;  4CS3 A;  1NVP D;  4EKW A;  1GRJ A;  2PF4 E;  3ASN B;  4UB6 Z;  1XOU A;  1Q6H A;  3FFQ A;  1K33 A;  3CRR A;  2UXD O;  1XDC A;  2ZM6 O;  1ZL8 B;  1HW7 A;  3BA9 A;  3OFN G;  1BT8 A;  4NXN B;  3K9A A;  2GTA A;  3JD1 A;  3T1H O;  4QPK A;  4BW5 A;  1BE3 H;  3L74 H;  3ZX6 A;  3H1J H;  1KMI Z;  2ZIM A;  4TUY A;  5JVD A;  1I94 O;  4ZHQ A;  1Y66 A;  1QQC A;  4LF4 O;  3CYO A;  1VQL V;  4KXR A;  5LHG A;  2AXT Z;  1YJW V;  4FVM A;  1R3I C;  4DV0 O;  2Z3Y A;  5FPO A;  2GSM B;  5IE9 A;  2LFS A;  3N2G A;  2X6C A;  4X1I A;  5BMV B;  1P4R A;  2JVD A;  4O4J B;  2A0L A;  1BS3 A;  2OTL V;  2QR4 A;  4PI0 A;  4FLW A;  3FD9 A;  4JTD B;  4GCZ A;  1IZ3 A;  1PV0 A;  4MVS A;  1NTM H;  2P4K A;  2YUA A;  1EZV H;  1FXH A;  1SRY A;  1HWY A;  5L3E A;  1MZF A;  4ICG A;  3QO7 A;  1FFX B;  1DF4 A;  3G71 V;  4DR1 B;  1YCI A;  2A3Q A;  4YJ3 B;  1NH2 D;  4RWU A;  5LP6 B;  3BEH A;  4IGG A;  1Q90 D;  2HVK C;  1R3K C;  3HR0 A;  4O4L B;  3TK1 A;  5LHH A;  5J2T B;  1BHB A;  5KAF Z;  1KYO F;  5GTI Z;  1XUQ A;  4K0K B;  2P5O A;  3VBB A;  1XNR O;  2JEX A;  2WLH A;  2QTS A;  2F93 B;  4QGP A;  2UXB O;  5JJJ B;  2OIG A;  1BSM A;  4TV8 A;  2JS5 A;  3OR7 C;  1PM9 A;  3MD0 A;  1MZE A;  4IYH A;  3AG3 C;  3VOU A;  1L0N H;  4XDK A;  4DV7 B;  1KB9 F;  2IJI A;  3FYI B;  3EVK A;  5LYJ A;  1XMQ B;  3ZED A;  1OCR C;  1WPB A;  4JF3 A;  4WBN B;  3OGI B;  3G80 A;  4JAV A;  3D36 A;  4DV6 O;  2XUM A;  5CBG A;  4X1K A;  1RSO A;  2CUG A;  1VF7 A;  4PEL A;  2UUA O;  3SPG A;  4P9P A;  3B8N A;  1QLN A;  2KG7 B;  5FNV B;  5IYD O;  3RN4 A;  4F6R A;  4EFB A;  1OV9 A;  2EX3 A;  1BQZ A;  3Q4H B;  3WFV A;  2YIA A;  2R70 A;  4O2A A;  4YJ2 B;  3I5D A;  2PY5 A;  3ZCC A;  1N4C A;  3E35 A;  1EN6 A;  3CXH F;  2JJ2 G;  2Q9L A;  4K8X A;  4MVO A;  4NTY A;  3SJQ C;  2HEP A;  3WG7 C;  4ZI7 B;  4WCE V;  4DV6 B;  5B5E Z;  4LP8 A;  3ZRV A;  3OTO O;  3NR7 A;  2LW1 A;  2JGD B;  1FFX A;  3PN1 A;  1Q5O A;  4I7Z B;  2B9Z A;  2M7W A;  5JWP A;  4X8A A;  5LHI A;  4DR7 B;  3JAR A;  5K1X A;  3E8B A;  4KP4 A;  1WPX A;  2PTM A;  4FM2 A;  2EIN C;  4JI1 B;  2DJV A;  1FKA O;  1XHZ A;  2WLK A;  4GX1 A;  2ADP A;  4I5S A;  2CH7 A;  3TCU A;  1XNQ B;  4H13 B;  2AW9 A;  4CC5 A;  1I7F A;  1WA8 B;  4FMT A;  2V4D A;  1IXB A;  4DUY B;  4DR2 O;  1R3L C;  1WB7 A;  3JCZ A;  2EIJ C;  2PGG A;  4BW9 A;  1AJQ A;  5CA0 B;  3T2M A;  3L9D A;  4TV9 A;  1YEW A;  4X65 O;  4B3T B;  1EBO A;  3WG7 B;  1EZJ A;  3OMN B;  1XMQ O;  1Q6I A;  2ZCE A;  3SYO A;  5CB4 B;  3K5L A;  3GWO A;  2DN9 A;  4HNA B;  1ZUQ A;  1SQF A;  2QM7 A;  3OEE G;  3RWR D;  1R6K A;  4OPH A;  2KG7 A;  1ZWI C;  3JAT A;  4DXW A;  4O2B A;  1AI7 A;  2CTQ A;  3W7W A;  3DXR A;  2FYU H;  4QJF B;  1S76 D;  3X2Q B;  4YY3 B;  1VQ4 V;  3JAL B;  5KX5 A;  2EIJ B;  3ETE A;  2UXB B;  2RJZ A;  2IU0 A;  1N34 O;  1K4D C;  3ZMS A;  2HG5 C;  3L70 H;  2WLN A;  3DC5 A;  2QTO A;  4PV1 B;  4G28 B;  2WA4 A;  5LMN O;  2WAM A;  5BXZ A;  4MW3 A;  1WP8 A;  1GN2 A;  4X20 B;  3AEI A;  1XNR B;  3HKD A;  2L35 A;  4GX2 A;  2ZM6 B;  2YIB D;  1OCO B;  3IGA C;  4JI6 O;  2KQX A;  3UO2 A;  4X88 A;  2YIB A;  4LF7 O;  4J80 A;  2QWR B;  4J7J A;  4N21 A;  1S0V A;  3CJH B;  2Y0P A;  3ZRS A;  2O57 A;  1SQV H;  4DR5 B;  1J5E O;  4MSW C;  2CTW A;  1QNM A;  4QNH B;  3C3S A;  3T4D A;  4NYK A;  2UXN A;  4XBF A;  3KZI Z;  3M7M X;  3AG2 C;  1S72 V;  3MDS A;  1O9H A;  4TUY B;  4U3J A;  3RYC A;  4Q6G A;  2Q69 A;  2YDE A;  2DW4 A;  1FS0 G;  3W7S A;  2H3O A;  1QLE B;  3KCY A;  3ZIA G;  2OT5 A;  3JAS B;  1PPJ H;  3AG4 B;  3APQ A;  3ETQ A;  4X64 B;  3FX7 A;  2W0F C;  1N33 B;  4ZKI A;  2AZ0 A;  2ADQ B;  4PI2 A;  4FIP C;  3RFR A;  1F51 A;  4JI2 B;  4JI0 O;  1NR7 A;  1P84 F;  4MTF A;  3GVM A;  1G4Y B;  4QPJ A;  1THZ A;  2C2A A;  5LMN B;  4J7Z A;  3TXS A;  4NXN O;  3P3P A;  1SA0 B;  2XHB A;  4LFC B;  3GB7 C;  2Q0A A;  2PI5 A;  1A32 A;  1I94 B;  3SPH A;  1GTO A;  4O4L A;  4JI7 O;  1AR5 A;  2JGU A;  4DV2 O;  3E86 A;  2UU9 O;  3JAM N;  4UCU A;  4HZ3 A;  1SA0 A;  4I55 B;  4UVC A;  1P7B A;  2E5L B;  3AG7 A;  2F66 C;  3C3T A;  3ASN C;  3WB0 A;  5KLV H;  4CS4 A;  1Q43 A;  3SYC A;  4B3T O;  4GX5 A;  4DR6 O;  2YXL A;  2E76 B;  5B1B B;  1TGO A;  1P49 A;  3K04 A;  2EIM B;  1I5X A;  4JI3 B;  1DGS A;  2YI8 A;  3RVY A;  1Q81 W;  4P30 A;  3CMA V;  1JQ0 A;  2XOK G;  3N2K A;  4JI5 O;  2PZS A;  4FM1 A;  2P6J A;  1MA1 A;  2BTQ A;  1BQ0 A;  4JI7 B;  2HVJ C;  3DC6 A;  4ZHQ B;  2XAJ A;  4LF6 B;  1GM7 A;  1YDX A;  2Q5Z A;  4UCV A;  2BCC H;  3JD2 A;  3UO3 A;  1M57 C;  3N2K B;  3HKE B;  5EBM C;  4X1I B;  5KUM A;  3F5T A;  1XEQ A;  3WU2 Z;  2ARH A;  1QU7 A;  5B3S C;  1B06 A;  4O2A B;  4B3M B;  2ITD C;  1NS1 A;  2QGN A;  3RGB A;  2BOB C;  4QIW F;  3ETG A;  1W0J G;  5LP6 C;  2JGD A;  3I56 V;  2ATK C;  4J10 A;  3CME V;  5ITZ A;  4PD4 F;  1VF6 C;  4JI4 B;  3TJT A;  2NLJ C;  3LNN A;  4R8C A;  1AI5 A;  4ASU G;  2P4V A;  4F4L A;  2V1D A;  5F2V O;  1ZL8 A;  2N04 A;  3ZMU A;  2NNU A;  3ICX A;  1JA8 A;  1HNZ O;  1FXK A;  4GKK O;  4WFH A;  1IVS A;  4MTO A;  2OWO A;  1S77 D;  1V55 C;  2DQ0 A;  2CTP A;  1TVK B;  1BZK A;  1Z2G A;  2WLI B;  4X9Q A;  4Z1V A;  5J2U B;  3HKD B;  1N34 B;  4I50 A;  2CE4 A;  1K4C C;  2W6J G;  4JI2 O;  1LNQ A;  4B3R O;  4CC6 A;  3FAV A;  3O9O A;  1KQS U;  2JJ1 G;  1MNG A;  2YEV A;  1N33 O;  3OM3 B;  1BMF G;  5HFM A;  1QVF U;  2QWP B;  2B1I A;  1VAR A;  2GBO A;  2Q7E A;  5L3F A;  3JD4 A;  1N0N A;  3JAT B;  4UVA A;  4MVM A;  4NXM O;  3IJ4 A;  3G6E V;  4ZIB A;  1TUB A;  4CBC A;  1NU1 H;  4B3S B;  2UUC O;  4DUY O;  2Q68 A;  1Q82 W;  1W59 A;  1YI2 V;  3CRA A;  3HKC B;  5IWA B;  5EIB C;  4JYA B;  4GYC B;  1K5Q A;  3K3W A;  5B1A B;  3AK3 A;  1R1B A;  3R65 A;  1L1F A;  2Q7H A;  4H33 A;  4IYI A;  3CCJ V;  2NR5 A;  4FZ0 A;  2ZQM A;  3AG1 C;  2DWE C;  3RYH B;  4JYA O;  4JYC A;  2IH1 C;  3BFR A;  4DR7 O;  2YC0 A;  2ZKO A;  3F7V C;  2UUC B;  4PA3 A;  3CRQ A;  2Q67 A;  3E22 B;  3W7T A;  2BSK A;  1FXK C;  2A7W A;  3CC7 V;  2R9I A;  4WFA V;  4U7N A;  2JRI A;  4U3F H;  3K5O A;  5B1A C;  3OTO B;  3K0D A;  4P9O A;  4J41 A;  1TA8 A;  4BIU A;  4L8J A;  1PNL A;  4J42 A;  1KD1 W;  3SDL A;  2D2C B;  2QKS A;  3THO A;  1GMG A;  4BR6 A;  1COW G;  5JJN B;  3RT3 C;  3B8M A;  3ZN1 A;  4LH7 A;  3CC4 V;  2FB5 A;  2HR3 A;  1VF5 B;  2F4V B;  4PDM A;  1OZ0 A;  1SQX H;  2HLD G;  1TUE B;  3IC9 A;  4EB6 B;  1VMG A;  1LUV A;  3QF7 A;  2IH3 C;  2P7T C;  3ZJZ A;  4AIL C;  3B4S A;  4FLV A;  4NTW A;  2LO1 A;  2HJF C;  4QE7 A;  2MK3 A;  3F7Y C;  5LMU O;  1M5I A;  4LF5 O;  4LF8 B;  1KU9 A;  4H37 A;  4LC1 A;  5ITZ B;  1DLB A;  1PP9 H;  4TV8 B;  4TSF G;  4GKK B;  2HP8 A;  2B5U A;  1OCZ B;  1AP5 A;  3H1L H;  5IT9 N;  5L3G A;  4TWK A;  3MAQ A;  4I9Q A;  3H1H H;  4RUE A;  4PA7 A;  1E1R G;  4DR3 O;  3FKS G;  1K7D A;  3K79 A;  4MW8 A;  3UT5 B;  5KHJ A;  4X1K B;  2RNB A;  3OGC C;  2A9H A;  3CHX A;  2CK3 G;  3CCL V;  3IC7 A;  1N8R W;  3CSX A;  2E75 B;  1ENV A;  1H2S B;  1NQT A;  3RYH A;  2WA3 A;  4YHH B;  1AI6 A;  2ZE7 A;  5EIB D;  1AJP A;  1EFR G;  3CS5 A;  4CH4 A;  4JI0 B;  2CGN A;  3E8F A;  3QTC A;  1NI8 A;  3ABU A;  3H1I H;  1S5J A;  1XQ8 A;  5DM6 V;  1G8M A;  3EXA A;  1U96 A;  4LFB B;  1US6 A;  4RQE A;  1K97 A;  1FXK B;  2R72 A;  1JFF A;  1BL8 A;  3E89 A;  3D3Q A;  4OX9 B;  4OGQ B;  3W7X A;  1I08 A;  3T1Y B;  1IBL B;  1OCZ C;  3ZMT A;  1SC5 B;  5B66 Z;  5GON B;  1WN7 A;  4UFZ A;  3M8A A;  1UPG A;  2AHY A;  3BVO A;  2FTK A;  1MOF A;  1AIL A;  2IM9 A;  4DV3 B;  4JI3 O;  2QA4 V;  5IDJ A;  3OT7 A;  1Y67 A;  1Z5V A;  1HNW O;  1XI1 A;  3FAV B;  2YIC A;  3ZS8 C;  2DYR C;  1UFI A;  1ZAU A;  3VQW A;  1Y76 A;  1YTF D;  3CE2 A;  4LFC O;  2FKX A;  5DED A;  1WP7 A;  4GKJ O;  2QKC A;  3LDC A;  3ZHQ A;  3KCX A;  2XND G;  2E5L O;  2IBZ H;  2AHZ A;  4DRX B;  2Y0I A;  5FNV A;  1FXV A;  2X6A A;  2X7R B;  3ASO C;  4FPP A;  2UXD B;  3ML0 A;  4IIJ A;  3NXS A;  3DSQ A;  4KFM A;  3SJB C;  1SQG A;  2H8P C;  2P67 A;  5KMG B;  4DV4 O;  3STZ C;  3BRC A;  4K35 A;  3A2F A;  3VQV A;  4GKJ B;  1Y4M A;  2EIL B;  4FLT A;  3ZMV A;  4J9Z B;  2VQF O;  1H38 A;  1OCR B;  3STL C;  5IJ9 B;  1RPR A;  5LA6 A;  5CA1 A;  3U10 A;  5KX5 B;  4X62 O;  3P32 A;  4R50 A;  1JVM A;  4LF9 O;  2RMK B;  3DXR B;  4DV3 O;  3J7A U;  4X1Y A;  2DE0 X;  4GLX A;  4JAU A;  5EC1 C;  1IBL O;  1G1X B;  4MT8 A;  1SQB H;  1M1K W;  3K58 A;  5EK0 A;  3OMI B;  3I55 V;  2Q4P A;  4R7C A;  1JFF B;  1NTK H;  1SZT A;  1J95 A;  4FK5 C;  5B3S B;  1B6Q A;  3RBZ A;  4HAM A;  1OJH A;  2VWJ A;  3RYI A;  1HNW B;  5IJ0 A;  4DR2 B;  5C8Y B;  2WSS G;  3CC2 V;  4B3M O;  2QSA A;  5H6R A;  2E74 B;  4X62 B;  4LFB O;  3CP1 A;  5CMU A;  3CCQ V;  1XIL A;  4WFG A;  5JQG B;  4KHP B;  1NTZ H;  1AJN A;  3L75 H;  2QWQ B;  4OXS A;  3H01 A;  4J11 A;  1Y6X A;  4DR5 O;  2BTQ B;  2F43 G;  3ABM C;  2FL4 A;  1VQN V;  4MVZ A;  4LF6 O;  2ETN A;  1KUQ A;  3N2G B;  4JTA B;  4FLY A;  5EYP A;  1ARO P;  2DMX A;  1IBK B;  1BCC H;  3OUS A;  2P90 A;  2DYR B;  4LNU B;  2PYJ A;  2YXY A;  4I0X A;  1Q86 W;  4YHH O;  2GV9 A;  5D5Q A;  1ZLZ A;  2CGO A;  5JVD B;  1AI4 A;  5LXT A;  1JX9 A;  1FPO A;  4JZG A;  2F1M A;  1SS3 A;  4DYL A;  5JCO A;  2AZ2 A;  3FB8 C;  2V7Q G;  4OPA A;  4X89 A;  4MVU A;  4I0X B;  3CPW U;  3B77 A;  2DOS A;  4JV5 O;  2OTJ V;  2RCV A;  3QG5 A;  2OYQ A;  1K8A W;  4JPR A;  2LFR A;  1K73 W;  2KSD A;  2R9A A;  1SKV A;  4ZOL B;  2IW5 A;  1H2G A;  3G4S V;  3CCU V;  2EIL C;  3LDD A;  4UV9 A;  3ABL C;  4UUJ C;  3SPC A;  2RDC A;  2Q7G A;  3JAK A;  2QWN B;  2HFE C;  4TOI A;  4JI1 O;  5H2F Z;  1H2K A;  4MVR A;  5LOV A;  1R3J C;  1V54 C;  2X0L A;  2H94 A;  4D6T H;  2QM8 A;  2HJD A;  4CZZ A;  4LF8 O;  3K06 A;  1AVM A;  2QDO A;  3K5N A;  1MMM A;  5BY1 A;  3D3I A;  1CXZ B;  2EZP A;  2OIE A;  3N27 A;  4J7K A;  5IY5 B;  1H2M A;  4GZR B;  2ZIN A;  4TT3 G;  5J2T A;  3K5M A;  5GTH Z;  1V9P A;  5FLX N;  1E79 G;  3T1C A;  1N32 B;  3HKB B;  5LGT A;  3AG3 B;  5EBL C;  5KHI A;  1GO3 F;  3CD6 V;  1GKF A;  4ZBM A;  5IJ9 A;  1I0H A;  5IYZ A;  3ABM B;  1GAX A;  2ZXW B;  1TAE A;  1D5N A;  4PA9 A;  5CB4 A;  2DQ3 A;  3CCS V;  3J81 N;  2KB1 A;  2VQE O;  2EBO A;  3PJS K;  1J5E B;  1QR9 A;  4PJ0 Z;  4DV5 O;  1RSO B;  5LMU B;  1VQ5 V;  3SJC C;  3FB7 C;  4L87 A;  1M57 B;  1RPO A;  3ABL B;  3UM7 A;  1O9G A;  3K0G A;  3SPJ A;  4FFK A;  2BTO A;  5BR8 O;  4JI8 O;  5EBW C;  2G38 A;  3TXQ A;  4JZ2 A;  4YIO A;  3JAL A;  2HHH O;  3BA8 A;  1YF2 A;  3TGU H;  3P3N A;  4I50 B;  1XMO B;  1VQ6 V;  1N32 O;  4UCS A;  1S5L Z;  2Q8V A;  2ZIO A;  5A9G A;  1GN3 A;  1Q6U A;  3K9S A;  1NZ6 A;  3AG1 B;  1M4U A;  1FD9 A;  5BR8 B;  4FLU A;  3DTU B;  3ZHR A;  2IJK A;  4J9Y B;  3G6B A;  4GX0 A;  4WFE A;  1JR9 A;  4AQY O;  1HNZ B;  3FYE B;  5B1O A;  2HHH B;  1F23 A;  4DR1 O;  1VQO V;  1YSC A;  4HBN A;  1PNM A;  1VF6 A;  1SQQ H;  3E2E A;  1V55 B;  2Y69 C;  1SES A;  3D8C A;  3HKE A;  1KKD A;  2ZXW C;  3SPI A;  4K0K O;  1BHA A;  4K8Z A;  2EJR A;  5JQG A;  1Z5W A;  4PDR A;  4I4T A;  2P06 A;  3LNM B;  3LUT B;  4UCR A;  5H9C A;  4DV5 B;  4QE9 A;  2EIN B;  2CH7 B;  3UT5 A;  1RFY A;  2ZE6 A;  1HR0 B;  2WPD G;  1MAB G;  5GW7 A;  4PDL A;  3E83 A;  3F5W C;  2ODM A;  4JI4 O;  1QCE A;  1XL6 A;  4LF4 B;  2LGW A;  3HKC A;  3CCE V;  3LSS A;  4MS2 A;  5JJE B;  1M93 A;  3AK1 A;  2Z0A A;  5IYC O;  2B1G A;  1IBK O;  4UCT A;  4B3R B;  4ZI7 A;  2W0X A;  4AI8 A;  2EJ7 A;  4ABM A;  3ZHS A;  4JAA A;  5EZY A;  4EB6 A;  5KHK A;  3K57 A;  3BHP A;  4IIJ B;  4JYY A;  4AHC A;  1M90 W;  1L8D A;  1YIJ V;  3T4Z A;  1H2L A;  2DWD C;  4X20 A;  2JEU A;  3OR6 C;  1W0K G;  2QKA A;  4PA4 A;  3O65 A;  5LOV B;  3FB6 C;  1D2D A;  2BE3 A;  2QJ1 A;  1JCH A;  2F23 A;  5L3D A;  2EZO A;  2Z5U A;  3A0H Z;  2IJJ A;  3BAA A;  3OW2 U;  4DUZ B;  2QWO B;  3JYC A;  3HPL C;  1Y76 B;  3CRM A;  1LR1 A;  4B08 A;  4O4H B;  1MSW D;  2EIK C;  3HKB A;  1I5Y A;  3CRC A;  1FAF A;  5C8Y A;  3CCR V;  4DV7 O;  1YXB A;  3JSN A;  4HYO A;  3RYF B;  2UUB O;  2PYL A;  3KG2 A;  1QBZ A;  4U3J B;  3QO8 A;  1FYJ A;  2IU3 A;  2GTS A;  1ZX3 A;  4RAI A;  5JH7 A;  4DR4 B;  5AG2 A;  1NKD A;  2NN4 A;  4WBN A;  4DV2 B;  1PKX A;  5KAI Z;  4DRX A;  4X66 O;  4XDJ A;  1E1Q G;  4MVQ A;  3L72 H;  3G67 A;  1XBL A;  1IXM A;  1YJ9 V;  2CAZ C;  3BPZ A;  5EYP B;  4YJ3 A;  1QLE C;  4N23 A;  1R6T A;  3A0R A;  1BGY H;  3ASO B;  1M56 B;  5EZY B;  3M99 B;  4XDL A;  4BAY A;  4E2L A;  3S3W A;  1U97 A;  3JAK B;  1RM1 C;  2IJH A;  2DYS C;  2CDY A;  2JDI G;  3D36 C;  2LGQ A;  3JAW B;  3OUF A;  1GM8 A;  4NTX A;  3CCM V;  2A06 H;  3ZHT A;  4DR6 B;  1N0J A;  1GN6 A;  2QE7 G;  5L3C A;  1HR0 O;  1DTO A;  3ETD A;  4PHZ A;  4H44 B;  1CPY A;  1NBM G;  1SF9 A;  3RYI B;  3S3X A;  2ZDI C;  1AR1 B;  3FB5 C;  1N36 B;  4UXN A;  4D7T A;  2YID A;  1F4M A;  1TVK A;  1GK9 A;  4LWS B;  4OX9 O;  4DK0 A;  1K5S A;  2L6L A;  2YS8 A;  5IJ0 B;  3LSU A;  2UU9 B;  2ZE8 A;  4O4I A;  5FL7 G;  5B1B C;  4UV8 A;  3P30 A;  3WB2 A;  2DYS B;  4NB5 A;  1FJG B;  4DV0 B;  1KP2 A;  2VQF B;  4EEQ A;  3RVZ A;  1AR4 A;  1OCC B;  4BWA A;  4LF7 B;  2M6Y A;  3TET A;  2YEV B;  4GT1 A;  3UQ8 A;  5D5P A;  1VQK V;  1MSD A;  1H2N A;  1Y74 B;  4TQF A;  4DV4 B;  5LXT B;  4TQD A;  3Q4H A;  3DGE A;  3BAB A;  2Q6A A;  3W7U A;  3MHH C;  4TV9 B;  1TUB B;  5H5N A;  4P2Z A;  2ZE5 A;  2Y4T A;  3SGI A;  1KP3 A;  2XAH A;  4FFB A;  1SER A;  3JD0 A;  3JCU Z;  1PD3 A;  1Y74 A;  1JJO A;  2WLM A;  3VQX A;  4DW0 A;  2BOC C;  2JIZ G;  2YI9 A;  3L71 H;  1ZSP A;  1CP9 A;  1GH6 A;  4RO2 A;  4W4L A;  1NVP B;  1HNX B;  2VS0 A;  3JAW A;  1OHH G;  3CX5 F;  5KMG A;  3R66 A;  4MTG A;  3ZHV A;  4Z2W A;  2OCH A;  2VQE B;  4FJC C;  1GM9 A;  5EC2 C;  4FM0 A;  2XAS A;  1WB8 A;  2ILM A;  4NR1 A;  3X2Q C;  3LDE A;  3GWK C;  4X65 B;  5HFL A;  5LA6 B;  5CA1 B;  2XAG A;  2UXC O;  4JI6 B;  3T1Y O;  2JK5 C;  1SZX A;  2BSK B;  2LW7 A;  1HDJ A;  3AG2 B;  1R73 A;  3BCC H;  4F6E A;  4LH6 A;  4WF9 V;  3A8T A;  2HKO A;  2YXH A;  2F95 B;  2Q0O C;  3U11 A;  1F7Y A;  1VQP V;  1JMK C;  4LNU A;  1KEC A;  4JAS A;  1EM1 A;  1VEW A;  2ZR3 A;  2LQT A;  2AGA A;  2XAF A;  3QO5 A;  2UUB B;  5CA0 A;  1NJI W;  5FPR A;  3SYQ A;  2ITC C;  2A79 B;  4YY3 O;  2ZD9 A;  2K1E A;  2D3O W;  2YSU B;  1RM1 B;  3OAA G;  4IL6 Z;  3EFF K;  3RYC B;  2EUL A;  3AK2 A;  4MTX A;  4UB8 Z;  3SYP A;  1YTF B;  1K92 A;  3OMA B;  4CH5 A;  5KHH A;  2WLJ A;  4DUZ O;  4PA6 A;  2XTA A;  1RP3 B;  4DW1 A;  1AP6 A;  1PL4 A;  1NH2 B;  3CWB H;  3BY6 A;  5LP6 A;  1KBH A;  4NKG B;  4YXW G;  2K9P A;  2ZT9 B;  3SJA C;  1G6U A;  1VQM V;  3RYF A;  1URF A;  1VIB A;  5IWA O;  2N74 A;  1QR8 A;  4NVP A;  1KC8 W;  2VRZ A;  3E22 A;  1IUR A;  4KUM A;  3ZRW A;  1HP8 A;  3A0B Z;  3OEH G;  1XNQ O;  2OCC B;  2Y48 A;  4LF5 B;  4NXM B;  4DV1 O;  4CH3 A;  1SQP H;  1YHQ V;  2F4V O;  3ZRX A;  1K3E A;  5TIS Z;  3U0Z A;  4ZOL A;  2QM4 A;  2WLL A;  2WLI A;  3H1K H;  1FFT B;  3EHB B;  1V54 B;  4UVB A;  4AQY B;  1NT2 B;  4FZ1 A;  2GHY A;  3IAY A;  2EIM C;  3ABK B;  5CBF A;  2KKW A;  1VQ7 V;  1XHX A;  4W4K A;  4JI8 B;  3JD3 A;  1AB3 A;  1NR1 A;  1DK1 A;  4DK1 A;  1JOY A;  1VQ8 V;  1Q8I A;  3LSQ A;  3E8H A;  4D7S A;  3AG4 C;  4CH6 A;  1ORQ C;  5JCO C;  3QVN A;  5CN0 A;  4KHP O;  4B7E A;  2GUZ A;  1FJG O;  4FLX A;  1ROP A;  4I4T B;  4O4I B;  1L0L H;  1UJW B;  4LR3 A;  5CBH A;  1CEZ A;  1WLE A;  3B09 A;  5KA5 A;  3QNE A;  1WA8 A;  2EIK B;  3ABK C;  1N36 O;  2UXC B;  2FML A;  1QHT A;  5DN6 G;  3RW0 A;  3CCV V;  5KA6 A;  1VQ9 V;  4RUF A;  2JS3 A;  4O4J A;  4O2B B;  2UUA B;  2XT9 A;  5BMV A;  1B04 A;  1WJZ A;  5E79 Z;  2WWW A;  2PI4 A;  4Z1M G;  4K3A A;  3KKY A;  4HNA A;  1EN5 A;  3B40 A;  1GN4 A;  1SET A;  4B3S O;  1H8H G;  5LGU A;  5IYZ B;  2ZR2 A;  1Q7Y W;  4E4E A;  1P7G A;  1F4N A;  3JSL A;  3OTF A;  4I55 A;  3VQY A;  4O4H A;  1MG1 A;  5IYB O;  4YIP A;  2WLL B;  1ZTE A;  1YJN V;  4PDV A;  1QVG U;  2ZNI A;  5B1N A;  3HB3 B;  4RQF A;  1Q3E A;  1XMO O;  4GUN A;  4DO2 A;  4IT5 A;  2MW2 B;  3CJH A;  4DV1 B;  3E8G A;  5J9P C;  3H9V A;  1YVW A;  2N05 A;  5KUK A;  4LWS A;  3T1H B;  3K08 A;  4IHJ B;  4FLZ A;  5L3B A;  1H8E G;  5H6Q A;  4JV5 B;  2E3C A;  5LL6 Y;  4BIZ A;  5J2U A;  1JJ2 U;  3JAR B;  3OE7 G;  4LFA O;  4Q20 A;  3UCS C;  1M56 C;  5A2Q N;  4LCU C;  1KKC A;  2CTR A;  4JYB A;  2OCC C;  3ZMZ A;  5LYJ B;  4KL1 A;  4LBE C;  1X4T A;  1OCC C;  1M9N A;  3SR2 C;  4G2K A;  3B2E E;  5LGN A;  3SYA A;  1IBM O;  1YZB A;  3CEI A;  2P22 C;  1IDS A;  1WAZ A;  4FFB B;  4BIO A;  1EN4 A;  2Q73 A;  4JGS A;  4A5U B;  3IFX A;  5GON A;  5LBQ A; 
#chains in the Genus database with same CATH homology
 4DRX B;  2PYL A;  1N33 B;  5FNV A;  3K59 A;  1D5A A;  4U3J B;  2RQ6 A;  4YJ2 A;  4PI2 A;  4EFE A;  4DR4 B;  5JH7 A;  3JAS A;  4WBN A;  3RFR A;  5KHG A;  4DV2 B;  2UXD B;  5JH7 B;  4JI2 B;  4CS2 A;  4DRX A;  4IIJ A;  3DSQ A;  3SJB C;  1SQG A;  5LMN B;  5KMG B;  3BRC A;  3VQV A;  3A2F A;  4GKJ B;  4UCO A;  1SA0 B;  4X1Y B;  4LFC B;  2XHB A;  2CAZ C;  3BPZ A;  2Q0A A;  5EYP B;  4YJ3 A;  1IBM B;  1I94 B;  4FLT A;  5EZY B;  4X66 B;  4O4L A;  5IJ9 B;  5LA6 A;  5CA1 A;  3U10 A;  2JGU A;  5KX5 B;  3JAK B;  3WB1 A;  2VWK A;  4UCU A;  4JI5 B;  2PUS A;  3CB2 A;  1SA0 A;  4X1Y A;  4I55 B;  5K1P A;  4DR3 B;  4GLX A;  1WNS A;  3JAW B;  4IHJ A;  2E5L B;  2F66 C;  4DR6 B;  4F6R B;  3WB0 A;  3K58 A;  4PHZ A;  4CS4 A;  1JFF B;  1Q43 A;  4LF9 B;  4LFA B;  2YXL A;  3RYI B;  2VWJ A;  1N36 B;  1T5E A;  4D7T A;  1TGO A;  3RYI A;  1TVK A;  2ZNJ A;  1HNW B;  5IJ0 A;  1P49 A;  4DK0 A;  4CS3 A;  5IJ0 B;  4DR2 B;  5C8Y B;  4JI3 B;  1DGS A;  2UU9 B;  4O4I A;  2YI8 A;  4X62 B;  3WB2 A;  1FJG B;  4DV0 B;  2VQF B;  3FFQ A;  5JQG B;  4KHP B;  4EEQ A;  3N2K A;  2PZS A;  1HW7 A;  2BTQ B;  4FM1 A;  3BA9 A;  4NXN B;  4BWA A;  2BTQ A;  4JI7 B;  4LF7 B;  4ZHQ B;  4LF6 B;  1KMI Z;  2ZIM A;  4TUY A;  3N2G B;  5JVD A;  4ZHQ A;  4FLY A;  4UCV A;  3UQ8 A;  1QQC A;  5D5P A;  5EYP A;  1IBK B;  3N2K B;  3HKE B;  4TQF A;  4LNU B;  2PYJ A;  4DV4 B;  4X1I B;  5LXT B;  4TQD A;  3BAB A;  4FVM A;  4TV9 B;  1TUB B;  5FPO A;  2GV9 A;  5D5Q A;  3SGI A;  4O2A B;  3N2G A;  5JVD B;  4B3M B;  4FFB A;  4X1I A;  5LXT A;  5BMV B;  2JVD A;  4O4J B;  3RGB A;  1JJO A;  2F1M A;  3VQX A;  5JCO A;  5LP6 C;  4PI0 A;  4FLW A;  2YI9 A;  3QG5 A;  2OYQ A;  5ITZ A;  1HNX B;  4JI4 B;  3JAW A;  2R9A A;  1SKV A;  4ZOL B;  3LNN A;  5KMG A;  2VQE B;  1FFX B;  4FM0 A;  4DR1 B;  4YJ3 B;  2Q7G A;  5LP6 B;  3JAK A;  3ICX A;  4X65 B;  4TOI A;  5LA6 B;  5CA1 B;  2OWO A;  4O4L B;  5J2T B;  5LOV A;  4JI6 B;  1TVK B;  4K0K B;  2P5O A;  5J2U B;  3K5N A;  3HKD B;  4LH6 A;  1N34 B;  2F95 B;  2F93 B;  3U11 A;  4I50 A;  1JMK C;  5JJJ B;  4LNU A;  4CC6 A;  4TV8 A;  2JS5 A;  2ZIN A;  2UUB B;  5J2T A;  5CA0 A;  3K5M A;  5FPR A;  1V9P A;  4DV7 B;  1N32 B;  5LYJ A;  2Q7E A;  3HKB B;  1XMQ B;  3ZED A;  5KHI A;  1WPB A;  3RYC B;  4WBN B;  3JAT B;  5IJ9 A;  4CH5 A;  5KHH A;  5IYZ A;  4X1K A;  1RSO A;  4ZIB A;  1TAE A;  1TUB A;  1VF7 A;  5CB4 A;  4B3S B;  5LP6 A;  3HKC B;  5FNV B;  5IWA B;  5EIB C;  3SJA C;  4JYA B;  1G6U A;  4GYC B;  4F6R A;  4EFB A;  3RYF A;  2EX3 A;  1J5E B;  2YIA A;  4NVP A;  2R70 A;  2Q7H A;  4O2A A;  4YJ2 B;  5LMU B;  2PY5 A;  3SJC C;  3E22 A;  1O9G A;  2BTO A;  4K8X A;  3RYH B;  4DV6 B;  2HEP A;  4LF5 B;  4ZI7 B;  4NXM B;  4CH3 A;  3JAL A;  3BA8 A;  4I50 B;  2UUC B;  1XMO B;  3E22 B;  1FFX A;  4UCS A;  3U0Z A;  3PN1 A;  1Q5O A;  4ZOL A;  2QM4 A;  2ZIO A;  3K5O A;  3OTO B;  4DR7 B;  4AQY B;  1NT2 B;  1TA8 A;  3JAR A;  5K1X A;  4L8J A;  3IAY A;  1M4U A;  2KKW A;  1XHX A;  3THO A;  4JI8 B;  2PTM A;  5BR8 B;  4FLU A;  5JJN B;  4FM2 A;  4LH7 A;  4DK1 A;  2F4V B;  4JI1 B;  1HNZ B;  1Q8I A;  1XHZ A;  4D7S A;  2HHH B;  4CH6 A;  4EB6 B;  5JCO C;  3QF7 A;  4HBN A;  1XNQ B;  4AIL C;  4CC5 A;  4FLV A;  1I7F A;  2V4D A;  3HKE A;  4FLX A;  4O4I B;  4I4T B;  1M5I A;  4DUY B;  4LR3 A;  4LF8 B;  1KU9 A;  2PGG A;  4BW9 A;  4K8Z A;  5CA0 B;  5ITZ B;  4TV8 B;  5JQG A;  1Z5W A;  2UXC B;  1QHT A;  4GKK B;  4TV9 A;  1YEW A;  4I4T A;  4B3T B;  4UCR A;  4DV5 B;  4O4J A;  4O2B B;  3UT5 A;  2UUA B;  1HR0 B;  2ZCE A;  5BMV A;  5CB4 B;  3K5L A;  1B04 A;  3MAQ A;  4I9Q A;  4HNA B;  1SQF A;  3RWR D;  4HNA A;  3JAT A;  4O2B A;  3UT5 B;  5KHJ A;  4LF4 B;  4X1K B;  5IYZ B;  3CHX A;  3HKC A;  4YY3 B;  3JAL B;  5JJE B;  5KX5 A;  1M93 A;  2UXB B;  3JSL A;  2RJZ A;  3CSX A;  3OTF A;  4I55 A;  3VQY A;  4O4H A;  1H2S B;  3RYH A;  2ZNI A;  4UCT A;  4B3R B;  4YHH B;  4ZI7 A;  5EIB D;  1Q3E A;  5EZY A;  4CH4 A;  4JI0 B;  4X20 B;  4EB6 A;  1XNR B;  3HKD A;  2ZM6 B;  3QTC A;  5KHK A;  4DV1 B;  2YIB D;  3K57 A;  3BHP A;  4IIJ B;  1S5J A;  1XQ8 A;  4AHC A;  2YIB A;  3T1H B;  4LFB B;  4IHJ B;  1L8D A;  4FLZ A;  2R72 A;  1JFF A;  4DR5 B;  4X20 A;  4OX9 B;  4JV5 B;  3T1Y B;  2E3C A;  1IBL B;  5LOV B;  5GON B;  1WN7 A;  3M7M X;  4UFZ A;  2QJ1 A;  5J2U A;  1O9H A;  4TUY B;  3JAR B;  2IM9 A;  4DV3 B;  4U3J A;  3RYC A;  3BAA A;  4Q6G A;  1Z5V A;  4DUZ B;  5LYJ B;  1XI1 A;  4KL1 A;  1X4T A;  3ZS8 C;  3SR2 C;  3B2E E;  1ZAU A;  3VQW A;  4B08 A;  4O4H B;  2P22 C;  3HKB A;  4FFB B;  3JAS B;  5C8Y A;  3JSN A;  3ETQ A;  5GON A;  4X64 B;  3RYF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...