3CSXA

Structural characterization of a protein in the duf683 family- crystal structure of cce_0567 from the cyanobacterium cyanothece 51142.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the protein cce_0567 from Cyanothece 51142, a metalloprotein associated with nitrogen fixation in the DUF683 family.
pubmed doi rcsb
source organism Cyanothece
molecule tags Metal binding protein,unknown function
molecule keywords Putative uncharacterized protein
total genus 24
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05082 Rop-like Rop-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3csxA00
3ICXA 1NT2B 3ZS8C 2CAZC 2P22C 3QF7A 3CSXA 3QG5A 3SJAC 3SJCC 2F66C 2JS5A 3SJBC 1X4TA 3THOA 3B2EE 1SKVA
chains in the Genus database with same CATH superfamily
2QR4A 3THOA 2EJRA 4TV8B 1SESA 3CJHA 5EIBD 2YXHA 5LA6B 4KFMA 2BTQB 1BZKA 4U3FH 1SQQH 5CB4A 2Q0OC 3RYFA 3K9AA 1S72V 2Y4TA 4LFCB 3Q4HA 2W6IG 3CX5F 2W0FC 4O2AB 5BMVA 3QO8A 2F95B 3JASA 1Q8IA 4BW9A 1GAXA 4W4LA 3W7TA 4DV0B 1TVKB 5KHJA 4RQEA 1IBMO 4I55A 1RSOB 5C8YA 1SZXA 4DO2A 2MK3A 2ZIOA 3E22B 5KUMA 3TCUA 1QLNA 1XMQO 3OTFA 5J2UB 3AG3B 5LGNA 3ASOC 4P2ZA 3OEEG 5B3SC 5GTHZ 2HVKC 3ML0A 2VWKA 1EFRG 2E74B 2H3OA 4B3RO 2D3OW 5KX5A 3G80A 1AB3A 2IU0A 2QWNB 2IH3C 4TV8A 3RWRD 3P3PA 1D2DA 2YEVB 3LNMB 2EILB 3K59A 5J2UA 1Q6UA 3T4ZA 4K0KO 1GTOA 1XDCA 2HVJC 5IYDO 2XOKG 2XAFA 3K08A 2WA3A 1NI8A 3SJQC 2AZ0A 1YZBA 4X8AA 4DR7B 2CE4A 4MW8A 2DYSC 4PD4F 1MNGA 2OIEA 4I50B 3STLC 1DF4A 3FAVA 4X20B 4E2LA 2ZINA 5EBWC 3ZJZA 3K9SA 3CRAA 2EBOA 4FM2A 1GMGA 5KA6A 2Q68A 3T2MA 2Z3YA 5CMUA 2VS0A 2ZD9A 4O4JB 4FZ1A 4DXWA 3T1YB 4UVAA 3JD0A 1N33O 4JV5B 1FJGO 4LNUB 3RVYA 4D6TH 2ZT9B 3D3IA 1IVSA 5EBLC 1BHAA 2KB1A 2RDCA 1Y76A 4KP4A 1QVGU 3BY6A 2LW1A 1PPJH 1IBLB 1Y67A 2LP7A 4TQDA 5KAIZ 5B1BC 1VQ5V 1VF6A 2C2AA 4X9QA 5J2TB 3WG7B 3CC4V 3JD2A 3FB6C 1S5JA 1V54C 1OCRB 1WLEA 5KHHA 3C3SA 2DMXA 1JMKC 3JALB 1VQMV 1G4YB 4DV6O 2CDYA 4KHPB 3OTOO 4QE7A 3T4DA 2E5LO 5KHGA 4PA3A 1FJGB 1H8HG 4YXWG 1DGSA 3TGUH 5CBFA 3OD4A 2ITCC 4N23A 1NT2B 5ITZB 3ABKB 5IWAB 3JAWA 1AP5A 2A06H 5L3FA 1M4UA 2WLIA 2Q67A 2VWJA 2OIGA 2EIJB 4WFGA 2LGWA 1Q82W 2OTLV 3MAQA 4DUYO 5J2TA 3JATB 4CH5A 1PV0A 2N04A 4UCVA 2QE7G 4DR4B 1Q81W 3F5WC 1WP7A 2QTSA 5B1NA 4FVMA 1JR9A 3L9DA 2UXDO 3NR7A 2ZR2A 4I5SA 1BCCH 1E79G 1IBKB 3CHXA 2AHYA 4PELA 1VQ4V 2WLKA 3LSUA 4WBNA 4KL1A 2PTMA 3DXRB 3D3QA 3JD1A 5EYPB 4I9WA 4BIOA 4GKKO 5ITZA 4YY3B 2DOSA 5JJEB 2KQXA 1NU1H 1GO3F 2WLNA 1PD3A 4Q6GA 1NZ6A 1MSWD 1PNLA 2BOBC 4JI8O 1ZAUA 2Y4UA 1KBHA 4TSFG 4B3SO 5D5PA 2ODMA 5JH7A 2YI9A 2ZDIC 1NR7A 1LUVA 4JI4O 1MZEA 2KG7A 4O4IB 1GM7A 1L8DA 4IGGA 1QNMA 3T1YO 1VF7A 3LNNA 3CXHF 3A2FA 4JAVA 1RPOA 3WFVA 5EYPA 4XBFA 4GX2A 1JX9A 5AG2A 1Q3EA 1RP3B 2VQFO 3T1HO 3CCSV 2QGNA 3FD9A 5JVDB 2QM7A 1IBLO 5DM6V 3H1LH 4R6ZA 4PA6A 2DE0X 4LP8A 3UQ8A 3AK3A 1HNZB 2IBZH 3QG5A 5LOVA 1YIJV 2DQ0A 2QKAA 1ZUQA 4J80A 1IDSA 1PKXA 4NYKA 4WFEA 4KUMA 1QR8A 2CTWA 4LF4B 1K4DC 4BAYA 2KKWA 1YTFD 2A79B 3CD6V 5JJNB 2M7WA 4DW0A 3A0BZ 5LMNO 2GTAA 4KXRA 5B1AC 1K3EA 2ITDC 4PA4A 1ZSPA 2GHYA 2NN4A 2XTAA 4NTXA 4LH6A 1L0NH 4EB6A 3IC7A 4PDVA 4X64B 1SETA 2X6AA 1MA1A 2YXYA 3B40A 2OCCB 5KA5A 3K5LA 4BWAA 2F93B 4X1YA 5E1AC 4J41A 4ZIBA 4X88A 1XNQO 4YY3O 5CA0B 2ILMA 3CSXA 1XL6A 3AEIA 2ZE6A 2B9ZA 2ATKC 4MTOA 5IJ9A 2UUAB 4ZHQB 1BE3H 5CA1A 5JCOC 3OTOB 4FLWA 4JGSA 1QU7A 3ZHUA 2P67A 5LOVB 2Q73A 5KHIA 4L87A 4LF5O 2GTSA 2QSAA 3ZRWB 4WCEV 5H5NA 3M7MX 4TUYB 4J9YB 2UUCO 4DR1O 2X7RB 4K8XA 4JASA 2IJJA 4XDJA 5K1XA 4ABMA 2QJ1A 3EHBB 2FB5A 3CWBH 1G8MA 2IJKA 3CE2A 1N32O 4DRXA 1PL0A 1OZ0A 1BQ0A 1YJNV 5LXTA 1GN6A 4LCUC 1G1XB 2HJFC 4LF6O 4OX9O 3K06A 4MTFA 4YJ2A 1RFYA 3SYOA 3M99B 3ZMTA 4KHPO 1VQOV 3J81N 3CCEV 3JASB 3EVKA 4JTCB 4UXNA 1OCZB 4B3TO 4JYAO 3EFFK 4LWSA 3AG2B 1K34A 4JI6B 4YIPA 2L6LA 5LP6A 4LF9B 2ZQMA 1YEWA 4CZZA 3W7UA 3AG4B 1ZL8A 1XHXA 5LA6A 3JATA 2XT9A 4X1KB 4JI7B 3G4SV 2EZOA 4FLXA 3ETDA 4GCZA 4TWKA 4DV7B 1KKDA 1AR1B 1SQGA 1V55B 5BR8O 3ZHVA 3I5DA 2QWRB 3ZN1A 4A5UB 2V1DA 5LP6C 1R6TA 1AROP 4JI7O 2B5UA 5B1OA 5IJ0A 2GV9A 1SQFA 4D7TA 4LF9O 4CC5A 1AJQA 2QWOB 2ZXWB 2VQFB 5KAFZ 4GZRB 1S77D 3H9VA 3OT7A 2W6JG 1OCOC 3F7YC 2A3QA 3RN4A 3W7XA 4U7OA 3HKBB 1JJOA 1LNQA 2VQEB 4MVZA 2FL4A 4UCTA 3IJ4A 1FS0G 3G6BA 2Y0PA 4X1IA 1S5HC 4DV4O 2EIKB 3OGCC 3E8BA 3WU2Z 4F6EA 4EKWA 3ZRSA 1N32B 4RUFA 1TGOA 1X4TA 3N2GA 2PZSA 2OTJV 3UM7A 2UUCB 3PJSK 2ZE5A 1TUBA 3OEHG 1BT8A 3TETA 3E22A 3CYOA 1GN2A 2KSDA 4I55B 3GWOA 3ZS8C 1S3JA 1R3KC 5H2FZ 1FFTB 2ZIMA 4UVBA 3E83A 2V7QG 3OUSA 4GT1A 4W4KA 5LBQA 1I5YA 4LF8O 3DXRA 3DC6A 5GW7A 1WB7A 2EILC 3L75H 3VQVA 1OJHA 1OCRC 4Q20A 4JAAA 1QBZA 2YI8A 4JYAB 3AG1C 3WG7C 2DYRC 2NLJC 3VOUA 1YVWA 5FPRA 3LSQA 2JGUA 2R72A 3SR2C 1OCCC 1BS3A 2CH7A 1H2NA 4GX1A 1ENVA 2X6BA 1FFXB 5B3SB 2RN9A 1EM1A 1FPOA 2F4VO 1W0JG 1CPYA 3W7SA 4JYCA 2Q9LA 4O4JA 4BW5A 1R3IC 1BQZA 4FFBA 2PF4E 3SGIA 3RYFB 3E35A 1K97A 4ASUG 4FLVA 3AG4C 2Q7GA 1SKVA 3WB0A 1VIBA 1FAFA 1P49A 5LHGA 3KG2A 4I50A 2DWDC 1HWYA 1ZLZA 4BIZA 3E8FA 1YTFB 2R70A 3JARB 4RWUA 1E1RG 3RW0A 3QTCA 2CTQA 1NQTA 5CA1B 3L73H 3DGEA 4H13B 3EXAA 4FMTA 4NTYA 5KLVH 5E79Z 4IT5A 4PV1B 5BXZA 2PY5A 2UUBB 1EN4A 2HHHB 4MVUA 1UPGA 2YUAA 4DV2O 1AR5A 4EEQA 4DV4B 2AW9A 5JWPA 4FM1A 4LH7A 4JTDB 1QLEC 3JCUZ 3UO2A 5IYBO 4PI2A 2O57A 3ZIAG 2UU9B 3RYHA 4LWSB 4MT8A 1NTMH 3A8TA 4G27B 1O9HA 4NXNB 3IC9A 1VMGA 3ABKC 4X66B 4J42A 4MS2A 2DN9A 4GX0A 1GK9A 4HAMA 1AI5A 1GKFA 2Q8VA 2JEXA 3VQYA 5L3BA 3ETEA 2Z5UA 3K5NA 3FB7C 3CP1A 4LF4O 1I5XA 4UB8Z 3K3WA 1QLEB 3ASNC 1Z5WA 3AG1B 3UKMA 3JAMN 4DV7O 5IYZB 2ARHA 4K0KB 4GKKB 1KQSU 1VEWA 4ZOLA 3ETGA 3GVMA 3CCRV 3ZRXA 4O4HA 1K5SA 2QDOA 3CRRA 2JK5C 4JZ2A 3OAAG 4JI3B 1HNWO 4IIJB 3E89A 1XNRO 3LSSA 3SYAA 1JA8A 3K79A 3C3TA 1JVMA 1MMMA 1DLBA 4QIWF 2ADPA 3BCCH 3RYIA 2EIJC 3OMNB 2X0LA 2CK3G 1R6NA 4MVQA 4TV9B 4O4IA 1XMOB 1J95A 3TXQA 4O4LB 4GKJO 3LDEA 3JSLA 1GM9A 1XMQB 3SJAC 3HKBA 2GBOA 3SPHA 5HFMA 3OR7C 1FD9A 3QF7A 3JSNA 3SJBC 3A0HZ 4DW1A 4DR2O 2P22C 1O9GA 4NTWA 2F23A 5EZYB 1H2LA 3BVOA 1BGYH 5A2QN 1Y6XA 1Q5OA 5KX5B 3MD0A 3OMAB 2CAZC 2CTPA 4K3AA 4YJ3B 4J7KA 3CEIA 4X1IB 4NKGB 2AGAA 2IH1C 1Y76B 3K03A 3K57A 3ZHTA 3DC5A 4ZI7A 3JARA 3S3XA 4DK0A 4WF9V 5IJ0B 1SQXH 4HYOA 4OGQB 5JVDA 3BFRA 4GUNA 4D7SA 1DK1A 3L70H 1R3JC 4ZOLB 4IYIA 4CBCA 1MZFA 2F1MA 2ETNA 4DV3B 5A9GA 5TISZ 5EZYA 3ZMVA 2L35A 4LNUA 3ABLC 2DQ3A 3GWKC 1F4NA 1EBOA 1XOUA 3CRMA 2BCCH 3JALA 3N2KA 2RJZA 3FFQA 3FX7A 2NR5A 3UT5B 1KB9F 2QM4A 3SJCC 1L1FA 3B4SA 2LW7A 5CBHA 2UXCO 1XNQB 4JI8B 3BHPA 1J5EO 4FFKA 2N74A 1Z5VA 1BHBA 4X65O 2QKCA 3RYCA 1GN3A 1P4RA 2Y0IA 3BPZA 4LF7B 3IFXA 1HR0B 3O9OA 2HR3A 2JRIA 1ZWIC 4ZI7B 2XASA 5IWAO 1Q7YW 3B77A 1MG1A 3S3WA 3K58A 2R9AA 5LMNB 3APQA 2JJ2G 2ZXWC 2LQTA 5IY5C 1VARA 3X2QC 4B3MO 1JFFB 1KECA 4XDLA 5JQGA 4DV6B 2K9PA 1NH2D 3SPGA 1T5EA 4DV5B 5IJ9B 4DR1B 2Q7EA 5J9PC 4GYCB 2UXXA 1EN6A 1B6QA 4K35A 4NXMB 1GM8A 1PL4A 4O4HB 4B3RB 2HG5C 1SZTA 1QCEA 4UV8A 1KD1W 2EX3A 1CP9A 1Y4MA 3Q4HB 2Q4PA 2PGGA 1KC8W 3RYHB 4B7EA 3ZX6A 1PP9H 1WJZA 2CUGA 2EJ7A 3F5TA 3UT5A 1TVKA 1Q90D 1JCHA 2RCVA 2YSUB 3DSQA 4R50A 1VQ7V 2XUMA 3G71V 4HBNA 4Z1MG 3I55V 2OCHA 4LFAB 2FKXA 4TT3G 2EIMB 4UUJC 1XMOO 2M6YA 1JJ2U 5D5QA 4UCSA 4RQFA 4DV2B 2JIZG 4H37A 3E86A 2YIBD 3H1HH 3ZCCA 3JD4A 4CH6A 2CTRA 1XNRB 4LBEC 1SA0B 2JEUA 3FYIB 4DV3O 4CH4A 3RVZA 1LUWA 2Q6AA 1Z2GA 1SQVH 4DUZB 4F6RA 3ABTA 4X20A 3G67A 3E8HA 3QO5A 4CH3A 1K73W 5GONB 5LL6Y 1XI1A 3G6EV 1M1KW 2ZE8A 2Q69A 1VQKV 3OGIB 4PA9A 3R66A 5LGUA 4QGPA 3MDSA 1XBLA 2E76B 5FNVA 1VQLV 4DR4O 4NXNO 3J7AU 1WPXA 2Z0AA 2B1GA 1OCOB 2ZNJA 1P84F 3JYCA 1VQ6V 1W0KG 3D36C 4IHJA 1R1BA 4HZ3A 4DV0O 4JZGA 1WAZA 4NR1A 3K04A 4H44B 4P9OA 2HKOA 4DR5O 5DECA 5EC1C 2IM9A 4F4LA 1B06A 3BABA 2PYJA 1SQBH 1FXHA 4NB5A 3N27A 4O2BA 4WFAV 2EZPA 3RYIB 1AP6A 3AG3C 3AK2A 1M5IA 3OM3B 3CRCA 3O65A 4FIPC 5LHHA 3K0GA 2KG7B 4LF5B 2G38A 4R7CA 2YC0A 4U7NA 4AQYB 1FYJA 2LJ2A 3TJTA 3ZN0A 4TOIA 3ZHSA 5IYCO 1Y74B 2PI4A 1XL4A 1D5AA 3FKSG 1KP3A 3R65A 2EIKC 3F7VC 2DW4A 4IIJA 3I56V 3JAKB 3KZIZ 2XAHA 1WP8A 1ZL8B 4IYHA 3RYCB 1VQPV 3SPIA 2OYQA 4WFFA 2CH7B 3L71H 2JGDB 5FNVB 3OMIB 2K1EA 3KKYA 1N36O 3SPJA 1HR0O 2VQEO 4X64O 1CEZA 1R73A 4QPJA 4RO2A 4YJ3A 3CCQV 1Q86W 3UCSC 3ZEDA 4DUYB 5CBGA 3OE7G 1J5EB 3MHHC 1WA8A 4NVPA 4UFZA 2ZKOA 2YEVA 4JI5B 4YJ2B 1BMFG 4FFBB 1NH2B 4ZKIA 3J80N 5BMVB 4MTXA 1AI4A 4LF8B 2YDEA 5LP6B 2AXTZ 1MABG 1P7BA 3BA8A 3HKCB 4TQFA 3ZMSA 1KU9A 3K5MA 4MVOA 1V9PA 2YIAA 1K92A 3OW2U 3BA9A 1NJIW 1VP7A 2QTOA 3HB3B 3SYPA 1US6A 3HKEB 3VQXA 2XAGA 2A9HA 2UUBO 2VRZA 4FJCC 2FMLA 2LGQA 2DYRB 2UXNA 3RFRA 1JFFA 2QM8A 4J7ZA 4E4EA 1H2SB 2WAMA 4HNAB 3WB1A 2UXBO 2ZE7A 4B7KA 4X66O 4FPPA 4Z1VA 2ZNIA 3ZHQA 4DR2B 4LR3A 2DWEC 3DTUB 3KCXA 3FB8C 5IE9A 4J11A 2MW2B 4X65B 2XHBA 1H2GA 1Q6HA 1VF6C 3E8GA 1NTZH 3C90A 2JDIG 2JGDA 4IHJB 2QEXV 5H9CA 4Z2WA 3RGBA 1YJWV 3LDCA 4CS2A 1N0JA 3B8MA 1IBMB 2QWQB 5FPOA 3CB2A 3SYCA 3ABLB 3CMAV 1NBMG 2HLDG 2QKSA 1VF5B 5DEDA 4GLXA 1YJ9V 3JD3A 1FXKA 2PI5A 5L3CA 2UXBB 2WA4A 3LDDA 4L8JA 2EULA 3AK1A 2DJVA 2Y69C 4RAIA 3LUTB 3H01A 4CC6A 2AHZA 1IBKO 4DV1B 3CC2V 1EZVH 1OCCB 4F6RB 1NKDA 3NXSA 5GONA 3BAAA 4QE9A 3L74H 3ASNB 3H1JH 2JS3A 2ZM6O 4JI5O 2ADQB 1AI6A 4MVMA 4MW3A 4UCUA 4YHHB 5LMUO 4LF6B 4G28B 1W2BU 2HP8A 1W59A 1FFXA 1F23A 2IJIA 3B2EE 2E75B 4JI4B 1KKCA 1A32A 3HR0A 4J9ZB 3IGAC 1F4MA 1Q6IA 5HFLA 1JQ0A 4JYBA 1BL8A 2WSSG 4QJFB 3W7WA 1RPRA 3AG2C 1I94B 1I0HA 2HJDA 4EFEA 2E5LB 1K7DA 1ROPA 2YIBA 4NXMO 2NNUA 3TK1A 4J10A 3ZHRA 5L3GA 1M57B 4B08A 1QQCA 2LFRA 3HKCA 3M8AA 2Q0AA 4JI3O 2ZCEA 1ORQC 2WLLB 1ZTEA 1HNXB 3A0RA 1AI7A 2UUAO 2LFSA 4DYLA 1YXBA 3HKDB 2BSKB 1H38A 5BR8B 5FLXN 2YS8A 2WLHA 2P6JA 4JI2B 4PDMA 1R6KA 1K9MW 1N4CA 2PYLA 1F51A 1VQ8V 2LO1A 4DR5B 3D8CA 2BE3A 2RMKB 1MOFA 1N34O 5KHKA 4JAUA 4X89A 4LFBB 3ZBHA 3N2KB 4I0XB 4LF7O 2P4VA 5CN0A 1B04A 2Q5ZA 2QWPB 4B3TB 1I08A 4ZHQA 4MVRA 1XQ8A 4PDLA 1Y66A 2JS5A 1F7YA 3OUFA 1S76D 2UXCB 2OT5A 1N8RW 1KYOF 4B3SB 1GH6A 1XEQA 5JH7B 4BIUA 1FKAO 4PI0A 4LFBO 4FK5C 3PN1A 4X62O 5KMGB 1N0NA 5BY1A 3APOA 2CGOA 2WLLA 4MTGA 1KP2A 1IZ3A 3L72H 4BR6A 4PDRA 2IW5A 1N36B 1YCIA 2OCCC 1GRJA 1PNMA 1TAEA 1YF2A 3VQWA 1PM9A 2W0XA 2HHHO 4QPKA 5JQGB 4DUZO 2ZR3A 1OV9A 4UVCA 4U3JA 1SQPH 2H94A 3HKDA 1K8AW 3H1KH 2BTOA 4I4TA 1EZJA 1M57C 3P32A 1AR4A 1CXZB 4DR3O 1WNSA 1ZX3A 1YI2V 2WLJA 3P3NA 2EINB 4PA7A 2A7WA 3OR6C 2Q7HA 3E2EA 3ICXA 3ZRWA 2RNBA 3CJHB 4IL6Z 2N05A 2YIDA 3ZMZA 4X62B 2EINC 1MSDA 1HW7A 2UXDB 1FXVA 2Y48A 1SERA 2AZ2A 3MHSC 3CCMV 2A0LA 3IAYA 4X1YB 2P90A 2R9IA 3ZRVA 4C7UA 1BSMA 1FXKB 1M56B 1K33A 1SRYA 3ABMB 5JJJB 1KMIZ 2WLIB 5LXTB 4FLZA 5CA0A 3CXCU 3HKEA 4WBNB 5CB4B 1N34B 2H8PC 1HNWB 3BEHA 3AG7A 1RM1B 2JJ1G 4YHHO 5LMUB 1IXBA 2IJHA 5B1BB 2YXLA 2IU3A 4DV5O 2F66C 4JI1B 4ZBMA 2P5OA 5GTIZ 1YITV 4U3JB 4R8CA 3ABMC 4G2KA 1XUQA 4ICGA 1FXKC 1M56C 5B1AB 1IXMA 3STZC 1M9NA 3VBBA 1YSCA 1DTOA 1UJWB 4JV5O 1N33B 4CS4A 1HNXO 4H33A 4XDKA 1PNKA 3T1HB 1HNZO 1YDXA 4UV9A 5IYZA 4HNAA 4FZ0A 3X2QB 4DR6B 5IDJA 4OPAA 1M93A 4MVSA 5K1PA 1X59A 4H0LB 2GSMB 4P9PA 3JCZA 3UO3A 4JTAB 2D2CB 2P4KA 2WPDG 4X1KA 3B09A 5C8YB 3SPCA 1H8EG 2HEPA 2XNDG 1M90W 2B1IA 5EIBC 1H2KA 2FTKA 1GN4A 1NR1A 3OFNG 4N21A 3H1IH 2EIMC 3FB5C 4LC1A 5H6RA 5CA3A 3U10A 3K0DA 4J7JA 1XHZA 2R9RB 4DR6O 3CS5A 1COWG 1EN5A 3GB7C 1DF5A 4DK1A 4DR7O 3WB2A 4OPHA 1K4CC 3K5OA 2BOCC 2XAJA 3QNEA 2PUSA 2V4DA 4YIOA 1AJNA 5EBMC 3ASOB 1QVFU 1LR1A 4DR3B 1V55C 3CRQA 5C93A 4JI2O 2P7TC 1SF9A 2X6CA 4I4TB 1NVPB 4JI1O 1AJPA 2E3CA 1VQNV 5DN6G 3CC7V 4UCOA 1WN7A 1Q43A 4RUEA 2XAQA 4UB6Z 1G6UA 5LHIA 3CCUV 1IURA 1K5QA 3HPLC 4EB6B 1TUEB 5KUKA 1OCZC 1URFA 3KCYA 4AILC 1THZA 4FLUA 3BRCA 1RSOA 3RBZA 2HFEC 4AHCA 4OX9B 1WPBA 1VQ9V 2CGNA 4I9QA 1E1QG 1R3LC 2Y69B 5KMGA 4LFAO 3ABUA 4P30A 3ZMUA 1D5NA 1L0LH 2FYUH 1JPXA 2BSKA 3P30A 4LFCO 4WFBV 4JI0B 3SDLA 3ETQA 4CS3A 1TUBB 4JPRA 2BTQA 5IT9N 1JOYA 1S5LZ 1HDJA 4OXSA 3FAVB 2F43G 3U11A 4TV9A 4DV1O 1U96A 3QVNA 3CMEV 3CCLV 4JYYA 1KUQA 2YICA 1SA0A 2P06A 4AQYO 1SC5B 4I0XA 2WLMA 4O4LA 1NVPD 1NS1A 4WFHA 2DYSB 2OWOA 3B8NA 3JAKA 5B66Z 1B3QA 4EFBA 3RT3C 3TXSA 4B3MB 3SYQA 5BZBA 1YHQV 1I94O 5JCOA 5B5EZ 3QO7A 1UFIA 5LYJB 4K8ZA 4JI0O 3N2GB 2QA4V 1I7FA 1OHHG 2JVDA 1V54B 1AVMA 2GUZA 5EC2C 4O2AA 5EK0A 1H2MA 1QR9A 1WA8B 4FLYA 4GX5A 2RQ6A 2GDSA 1RM1C 4PHZA 2UU9O 1AILA 1Y74A 5FL7G 3U0ZA 3CCVV 5H6QA 1S0VA 1QHTA 3JAWB 5LGTA 5L3DA 4JI6O 4I7ZB 1XREA 4JF3A 4QNHB 1TA8A 4DRXB 2F4VB 1XILA 1NTKH 4GKJB 1U97A 4FM0A 2WWWA 4FLTA 5LYJA 4AI8A 5F2VO 5L3EA 3CCJV 3CPWU 2GUZB 4UCRA 4MSWC 1HP8A 2ZDIA 4TUYA 4PJ0Z 3T1CA 1WB8A 1IX9A 2ZM6B 3D36A 3FYEB 1P7GA 1SS3A 5IY5B 4O2BB
chains in the Genus database with same CATH topology
4JI8B 2QJ1A 3BHPA 3THOA 4TV8B 4B08A 1QQCA 1Z5VA 3HKCA 2Q0AA 5EIBD 3RYCA 5LA6B 4DRXA 3BPZA 4LF7B 1HR0B 2ZCEA 4ZI7B 5LXTA 1HNXB 2BTQB 5CB4A 3RYFA 3HKDB 4LFCB 4YJ2A 5BR8B 3K58A 4O2AB 5BMVA 2R9AA 2F95B 5LMNB 3JASA 4JI2B 3JASB 1Q8IA 4BW9A 2PYLA 4DV0B 1TVKB 5KHJA 1JFFB 5JQGA 4DR5B 4DV6B 1T5EA 5KHKA 4DV5B 4JI6B 5IJ9B 4DR1B 4I55A 2Q7EA 5LP6A 5C8YA 4GYCB 4LF9B 1YEWA 2ZIOA 4LFBB 3E22B 3N2KB 4NXMB 1XHXA 5LA6A 1B04A 4O4HB 3JATA 3OTFA 4X1KB 5J2UB 4JI7B 4B3RB 4B3TB 4ZHQA 4FLXA 1XQ8A 4DV7B 2JS5A 2UXCB 2EX3A 1SQGA 4B3SB 5JH7B 2PGGA 4PI0A 3RYHB 3PN1A 5LP6C 5KMGB 2VWKA 3UT5A 1TVKA 3DSQA 5KX5A 1N36B 5IJ0A 2GV9A 1SQFA 4D7TA 4CC5A 4TV8A 4HBNA 2VQFB 4LFAB 1TAEA 3RWRD 3VQWA 3K59A 5JQGB 5J2UA 5D5QA 4UCSA 3HKBB 4DV2B 1JJOA 4U3JA 2YIBD 2VQEB 3HKDA 4CH6A 1XNRB 2BTOA 4I4TA 4UCTA 1SA0B 4X1IA 4DR7B 4CH4A 1WNSA 4DUZB 4F6RA 1N32B 4I50B 4X20A 4X20B 1TGOA 1X4TA 3N2GA 2PZSA 2UUCB 2Q7HA 3ICXA 2ZINA 4FM2A 1TUBA 3E22A 4X62B 1HW7A 4CH3A 2UXDB 4I55B 4O4JB 5GONB 3ZS8C 1XI1A 3IAYA 4X1YB 3T1YB 4JV5B 4LNUB 2ZIMA 5JJJB 1KMIZ 5FNVA 5LXTB 4FLZA 5CA0A 3HKEA 4WBNB 3VQVA 5CB4B 2ZNJA 1N34B 4IHJA 2YI8A 1IBLB 1HNWB 4TQDA 4JYAB 5LMUB 5FPRA 5J2TB 2YXLA 2JGUA 2R72A 3SR2C 1S5JA 2F66C 4JI1B 5KHHA 2IM9A 2P5OA 1JMKC 3JALB 1FFXB 3BABA 2PYJA 4U3JB 4KHPB 5KHGA 4O2BA 1FJGB 1DGSA 3RYIB 4O4JA 1M5IA 1NT2B 4FFBA 3SGIA 3RYFB 5ITZB 4FLVA 4LF5B 2Q7GA 1SKVA 1N33B 4CS4A 3WB0A 1P49A 5IWAB 4AQYB 3JAWA 3T1HB 4I50A 1M4UA 4TOIA 5IYZA 4HNAA 1D5AA 4DR6B 2R70A 3JARB 2VWJA 1M93A 3QTCA 5K1PA 4IIJA 3MAQA 3JAKB 5CA1B 5J2TA 3JATB 4CH5A 3RYCB 4UCVA 2OYQA 4DR4B 4X1KA 5FNVB 5C8YB 2HEPA 2PY5A 4FVMA 2UUBB 2HHHB 5EIBC 4YJ3A 3ZEDA 1IBKB 3CHXA 4DUYB 4EEQA 3U10A 1J5EB 4DV4B 4WBNA 4NVPA 4KL1A 2PTMA 4FM1A 4UFZA 4LH7A 1XHZA 5EYPB 4JI5B 4YJ2B 4FFBB 4PI2A 5ITZA 4YY3B 2UU9B 5BMVB 3RYHA 4DK1A 3WB2A 5JJEB 1O9HA 3K5OA 4LF8B 4NXNB 5LP6B 2PUSA 2V4DA 4X66B 4Q6GA 3BA8A 3HKCB 4DR3B 4TQFA 1ZAUA 3VQYA 1KU9A 3K5MA 4I4TB 3K5NA 5D5PA 1V9PA 5JH7A 2YIAA 2E3CA 2YI9A 3BA9A 4UCOA 1WN7A 1Q43A 1G6UA 4O4IB 3HKEB 4EB6B 3VQXA 1L8DA 1VF7A 1Z5WA 3LNNA 4AILC 4FLUA 3BRCA 5IYZB 1RSOA 4K0KB 4GKKB 4ZOLA 3A2FA 3RFRA 1JFFA 4AHCA 4OX9B 1H2SB 4HNAB 1WPBA 5EYPA 3WB1A 4I9QA 4O4HA 1Q3EA 5KMGA 2ZNIA 4DR2B 4JI3B 4LR3A 5JVDB 4IIJB 4O2BB 4X65B 4JI0B 2XHBA 3ETQA 3UQ8A 1HNZB 4CS3A 3QG5A 5LOVA 1TUBB 2BTQA 3RYIA 4IHJB 3U11A 4TV9A 4TV9B 4O4IA 1XMOB 3RGBA 4LF4B 1SA0A 4CS2A 1IBMB 2KKWA 4O4LA 4O4LB 3CB2A 5FPOA 3JSLA 5JJNB 2OWOA 1XMQB 3SJAC 4GLXA 3JAKA 3HKBA 4EFBA 2UXBB 3QF7A 4B3MB 4L8JA 3JSNA 3SJBC 5JCOA 2P22C 1O9GA 5EZYB 5LYJB 4CC6A 4K8ZA 1Q5OA 5KX5B 4LH6A 3N2GB 4DV1B 2CAZC 1I7FA 4EB6A 2JVDA 4X64B 4F6RB 5GONA 4O2AA 4YJ3B 4BWAA 3K5LA 2F93B 3BAAA 4FLYA 4X1YA 4X1IB 4ZIBA 2RQ6A 4PHZA 5CA0B 3K57A 3CSXA 3U0ZA 4ZI7A 3JARA 4DK0A 5IJ0B 4UCUA 5IJ9A 4YHHB 2UUAB 4LF6B 1QHTA 3JAWB 4ZHQB 5CA1A 5JCOC 5JVDA 1FFXA 1TA8A 4D7SA 4DRXB 3OTOB 2F4VB 4FLWA 4ZOLB 3B2EE 4GKJB 4FM0A 4JI4B 2F1MA 5LOVB 4DV3B 4FLTA 5EZYA 5LYJA 5KHIA 4LNUA 4UCRA 3M7MX 3JALA 4TUYA 4TUYB 3N2KA 2RJZA 3FFQA 3UT5B 1I94B 2ZM6B 4K8XA 2QM4A 4EFEA 3SJCC 2E5LB 5K1XA 2YIBA 1XNQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ICX A;  1NT2 B;  3ZS8 C;  2CAZ C;  2P22 C;  3QF7 A;  3CSX A;  3QG5 A;  3SJA C;  3SJC C;  2F66 C;  2JS5 A;  3SJB C;  1X4T A;  3THO A;  3B2E E;  1SKV A; 
#chains in the Genus database with same CATH topology
 2QR4 A;  3THO A;  2EJR A;  4TV8 B;  1SES A;  3CJH A;  5EIB D;  2YXH A;  5LA6 B;  4KFM A;  2BTQ B;  1BZK A;  4U3F H;  1SQQ H;  5CB4 A;  2Q0O C;  3RYF A;  3K9A A;  1S72 V;  2Y4T A;  4LFC B;  3Q4H A;  2W6I G;  3CX5 F;  2W0F C;  4O2A B;  5BMV A;  3QO8 A;  2F95 B;  3JAS A;  1Q8I A;  4BW9 A;  1GAX A;  4W4L A;  3W7T A;  4DV0 B;  1TVK B;  5KHJ A;  4RQE A;  1IBM O;  4I55 A;  1RSO B;  5C8Y A;  1SZX A;  4DO2 A;  2MK3 A;  2ZIO A;  3E22 B;  5KUM A;  3TCU A;  1QLN A;  1XMQ O;  3OTF A;  5J2U B;  3AG3 B;  5LGN A;  3ASO C;  4P2Z A;  3OEE G;  5B3S C;  5GTH Z;  2HVK C;  3ML0 A;  2VWK A;  1EFR G;  2E74 B;  2H3O A;  4B3R O;  2D3O W;  5KX5 A;  3G80 A;  1AB3 A;  2IU0 A;  2QWN B;  2IH3 C;  4TV8 A;  3RWR D;  3P3P A;  1D2D A;  2YEV B;  3LNM B;  2EIL B;  3K59 A;  5J2U A;  1Q6U A;  3T4Z A;  4K0K O;  1GTO A;  1XDC A;  2HVJ C;  5IYD O;  2XOK G;  2XAF A;  3K08 A;  2WA3 A;  1NI8 A;  3SJQ C;  2AZ0 A;  1YZB A;  4X8A A;  4DR7 B;  2CE4 A;  4MW8 A;  2DYS C;  4PD4 F;  1MNG A;  2OIE A;  4I50 B;  3STL C;  1DF4 A;  3FAV A;  4X20 B;  4E2L A;  2ZIN A;  5EBW C;  3ZJZ A;  3K9S A;  3CRA A;  2EBO A;  4FM2 A;  1GMG A;  5KA6 A;  2Q68 A;  3T2M A;  2Z3Y A;  5CMU A;  2VS0 A;  2ZD9 A;  4O4J B;  4FZ1 A;  4DXW A;  3T1Y B;  4UVA A;  3JD0 A;  1N33 O;  4JV5 B;  1FJG O;  4LNU B;  3RVY A;  4D6T H;  2ZT9 B;  3D3I A;  1IVS A;  5EBL C;  1BHA A;  2KB1 A;  2RDC A;  1Y76 A;  4KP4 A;  1QVG U;  3BY6 A;  2LW1 A;  1PPJ H;  1IBL B;  1Y67 A;  2LP7 A;  4TQD A;  5KAI Z;  5B1B C;  1VQ5 V;  1VF6 A;  2C2A A;  4X9Q A;  5J2T B;  3WG7 B;  3CC4 V;  3JD2 A;  3FB6 C;  1S5J A;  1V54 C;  1OCR B;  1WLE A;  5KHH A;  3C3S A;  2DMX A;  1JMK C;  3JAL B;  1VQM V;  1G4Y B;  4DV6 O;  2CDY A;  4KHP B;  3OTO O;  4QE7 A;  3T4D A;  2E5L O;  5KHG A;  4PA3 A;  1FJG B;  1H8H G;  4YXW G;  1DGS A;  3TGU H;  5CBF A;  3OD4 A;  2ITC C;  4N23 A;  1NT2 B;  5ITZ B;  3ABK B;  5IWA B;  3JAW A;  1AP5 A;  2A06 H;  5L3F A;  1M4U A;  2WLI A;  2Q67 A;  2VWJ A;  2OIG A;  2EIJ B;  4WFG A;  2LGW A;  1Q82 W;  2OTL V;  3MAQ A;  4DUY O;  5J2T A;  3JAT B;  4CH5 A;  1PV0 A;  2N04 A;  4UCV A;  2QE7 G;  4DR4 B;  1Q81 W;  3F5W C;  1WP7 A;  2QTS A;  5B1N A;  4FVM A;  1JR9 A;  3L9D A;  2UXD O;  3NR7 A;  2ZR2 A;  4I5S A;  1BCC H;  1E79 G;  1IBK B;  3CHX A;  2AHY A;  4PEL A;  1VQ4 V;  2WLK A;  3LSU A;  4WBN A;  4KL1 A;  2PTM A;  3DXR B;  3D3Q A;  3JD1 A;  5EYP B;  4I9W A;  4BIO A;  4GKK O;  5ITZ A;  4YY3 B;  2DOS A;  5JJE B;  2KQX A;  1NU1 H;  1GO3 F;  2WLN A;  1PD3 A;  4Q6G A;  1NZ6 A;  1MSW D;  1PNL A;  2BOB C;  4JI8 O;  1ZAU A;  2Y4U A;  1KBH A;  4TSF G;  4B3S O;  5D5P A;  2ODM A;  5JH7 A;  2YI9 A;  2ZDI C;  1NR7 A;  1LUV A;  4JI4 O;  1MZE A;  2KG7 A;  4O4I B;  1GM7 A;  1L8D A;  4IGG A;  1QNM A;  3T1Y O;  1VF7 A;  3LNN A;  3CXH F;  3A2F A;  4JAV A;  1RPO A;  3WFV A;  5EYP A;  4XBF A;  4GX2 A;  1JX9 A;  5AG2 A;  1Q3E A;  1RP3 B;  2VQF O;  3T1H O;  3CCS V;  2QGN A;  3FD9 A;  5JVD B;  2QM7 A;  1IBL O;  5DM6 V;  3H1L H;  4R6Z A;  4PA6 A;  2DE0 X;  4LP8 A;  3UQ8 A;  3AK3 A;  1HNZ B;  2IBZ H;  3QG5 A;  5LOV A;  1YIJ V;  2DQ0 A;  2QKA A;  1ZUQ A;  4J80 A;  1IDS A;  1PKX A;  4NYK A;  4WFE A;  4KUM A;  1QR8 A;  2CTW A;  4LF4 B;  1K4D C;  4BAY A;  2KKW A;  1YTF D;  2A79 B;  3CD6 V;  5JJN B;  2M7W A;  4DW0 A;  3A0B Z;  5LMN O;  2GTA A;  4KXR A;  5B1A C;  1K3E A;  2ITD C;  4PA4 A;  1ZSP A;  2GHY A;  2NN4 A;  2XTA A;  4NTX A;  4LH6 A;  1L0N H;  4EB6 A;  3IC7 A;  4PDV A;  4X64 B;  1SET A;  2X6A A;  1MA1 A;  2YXY A;  3B40 A;  2OCC B;  5KA5 A;  3K5L A;  4BWA A;  2F93 B;  4X1Y A;  5E1A C;  4J41 A;  4ZIB A;  4X88 A;  1XNQ O;  4YY3 O;  5CA0 B;  2ILM A;  3CSX A;  1XL6 A;  3AEI A;  2ZE6 A;  2B9Z A;  2ATK C;  4MTO A;  5IJ9 A;  2UUA B;  4ZHQ B;  1BE3 H;  5CA1 A;  5JCO C;  3OTO B;  4FLW A;  4JGS A;  1QU7 A;  3ZHU A;  2P67 A;  5LOV B;  2Q73 A;  5KHI A;  4L87 A;  4LF5 O;  2GTS A;  2QSA A;  3ZRW B;  4WCE V;  5H5N A;  3M7M X;  4TUY B;  4J9Y B;  2UUC O;  4DR1 O;  2X7R B;  4K8X A;  4JAS A;  2IJJ A;  4XDJ A;  5K1X A;  4ABM A;  2QJ1 A;  3EHB B;  2FB5 A;  3CWB H;  1G8M A;  2IJK A;  3CE2 A;  1N32 O;  4DRX A;  1PL0 A;  1OZ0 A;  1BQ0 A;  1YJN V;  5LXT A;  1GN6 A;  4LCU C;  1G1X B;  2HJF C;  4LF6 O;  4OX9 O;  3K06 A;  4MTF A;  4YJ2 A;  1RFY A;  3SYO A;  3M99 B;  3ZMT A;  4KHP O;  1VQO V;  3J81 N;  3CCE V;  3JAS B;  3EVK A;  4JTC B;  4UXN A;  1OCZ B;  4B3T O;  4JYA O;  3EFF K;  4LWS A;  3AG2 B;  1K34 A;  4JI6 B;  4YIP A;  2L6L A;  5LP6 A;  4LF9 B;  2ZQM A;  1YEW A;  4CZZ A;  3W7U A;  3AG4 B;  1ZL8 A;  1XHX A;  5LA6 A;  3JAT A;  2XT9 A;  4X1K B;  4JI7 B;  3G4S V;  2EZO A;  4FLX A;  3ETD A;  4GCZ A;  4TWK A;  4DV7 B;  1KKD A;  1AR1 B;  1SQG A;  1V55 B;  5BR8 O;  3ZHV A;  3I5D A;  2QWR B;  3ZN1 A;  4A5U B;  2V1D A;  5LP6 C;  1R6T A;  1ARO P;  4JI7 O;  2B5U A;  5B1O A;  5IJ0 A;  2GV9 A;  1SQF A;  4D7T A;  4LF9 O;  4CC5 A;  1AJQ A;  2QWO B;  2ZXW B;  2VQF B;  5KAF Z;  4GZR B;  1S77 D;  3H9V A;  3OT7 A;  2W6J G;  1OCO C;  3F7Y C;  2A3Q A;  3RN4 A;  3W7X A;  4U7O A;  3HKB B;  1JJO A;  1LNQ A;  2VQE B;  4MVZ A;  2FL4 A;  4UCT A;  3IJ4 A;  1FS0 G;  3G6B A;  2Y0P A;  4X1I A;  1S5H C;  4DV4 O;  2EIK B;  3OGC C;  3E8B A;  3WU2 Z;  4F6E A;  4EKW A;  3ZRS A;  1N32 B;  4RUF A;  1TGO A;  1X4T A;  3N2G A;  2PZS A;  2OTJ V;  3UM7 A;  2UUC B;  3PJS K;  2ZE5 A;  1TUB A;  3OEH G;  1BT8 A;  3TET A;  3E22 A;  3CYO A;  1GN2 A;  2KSD A;  4I55 B;  3GWO A;  3ZS8 C;  1S3J A;  1R3K C;  5H2F Z;  1FFT B;  2ZIM A;  4UVB A;  3E83 A;  2V7Q G;  3OUS A;  4GT1 A;  4W4K A;  5LBQ A;  1I5Y A;  4LF8 O;  3DXR A;  3DC6 A;  5GW7 A;  1WB7 A;  2EIL C;  3L75 H;  3VQV A;  1OJH A;  1OCR C;  4Q20 A;  4JAA A;  1QBZ A;  2YI8 A;  4JYA B;  3AG1 C;  3WG7 C;  2DYR C;  2NLJ C;  3VOU A;  1YVW A;  5FPR A;  3LSQ A;  2JGU A;  2R72 A;  3SR2 C;  1OCC C;  1BS3 A;  2CH7 A;  1H2N A;  4GX1 A;  1ENV A;  2X6B A;  1FFX B;  5B3S B;  2RN9 A;  1EM1 A;  1FPO A;  2F4V O;  1W0J G;  1CPY A;  3W7S A;  4JYC A;  2Q9L A;  4O4J A;  4BW5 A;  1R3I C;  1BQZ A;  4FFB A;  2PF4 E;  3SGI A;  3RYF B;  3E35 A;  1K97 A;  4ASU G;  4FLV A;  3AG4 C;  2Q7G A;  1SKV A;  3WB0 A;  1VIB A;  1FAF A;  1P49 A;  5LHG A;  3KG2 A;  4I50 A;  2DWD C;  1HWY A;  1ZLZ A;  4BIZ A;  3E8F A;  1YTF B;  2R70 A;  3JAR B;  4RWU A;  1E1R G;  3RW0 A;  3QTC A;  2CTQ A;  1NQT A;  5CA1 B;  3L73 H;  3DGE A;  4H13 B;  3EXA A;  4FMT A;  4NTY A;  5KLV H;  5E79 Z;  4IT5 A;  4PV1 B;  5BXZ A;  2PY5 A;  2UUB B;  1EN4 A;  2HHH B;  4MVU A;  1UPG A;  2YUA A;  4DV2 O;  1AR5 A;  4EEQ A;  4DV4 B;  2AW9 A;  5JWP A;  4FM1 A;  4LH7 A;  4JTD B;  1QLE C;  3JCU Z;  3UO2 A;  5IYB O;  4PI2 A;  2O57 A;  3ZIA G;  2UU9 B;  3RYH A;  4LWS B;  4MT8 A;  1NTM H;  3A8T A;  4G27 B;  1O9H A;  4NXN B;  3IC9 A;  1VMG A;  3ABK C;  4X66 B;  4J42 A;  4MS2 A;  2DN9 A;  4GX0 A;  1GK9 A;  4HAM A;  1AI5 A;  1GKF A;  2Q8V A;  2JEX A;  3VQY A;  5L3B A;  3ETE A;  2Z5U A;  3K5N A;  3FB7 C;  3CP1 A;  4LF4 O;  1I5X A;  4UB8 Z;  3K3W A;  1QLE B;  3ASN C;  1Z5W A;  3AG1 B;  3UKM A;  3JAM N;  4DV7 O;  5IYZ B;  2ARH A;  4K0K B;  4GKK B;  1KQS U;  1VEW A;  4ZOL A;  3ETG A;  3GVM A;  3CCR V;  3ZRX A;  4O4H A;  1K5S A;  2QDO A;  3CRR A;  2JK5 C;  4JZ2 A;  3OAA G;  4JI3 B;  1HNW O;  4IIJ B;  3E89 A;  1XNR O;  3LSS A;  3SYA A;  1JA8 A;  3K79 A;  3C3T A;  1JVM A;  1MMM A;  1DLB A;  4QIW F;  2ADP A;  3BCC H;  3RYI A;  2EIJ C;  3OMN B;  2X0L A;  2CK3 G;  1R6N A;  4MVQ A;  4TV9 B;  4O4I A;  1XMO B;  1J95 A;  3TXQ A;  4O4L B;  4GKJ O;  3LDE A;  3JSL A;  1GM9 A;  1XMQ B;  3SJA C;  3HKB A;  2GBO A;  3SPH A;  5HFM A;  3OR7 C;  1FD9 A;  3QF7 A;  3JSN A;  3SJB C;  3A0H Z;  4DW1 A;  4DR2 O;  2P22 C;  1O9G A;  4NTW A;  2F23 A;  5EZY B;  1H2L A;  3BVO A;  1BGY H;  5A2Q N;  1Y6X A;  1Q5O A;  5KX5 B;  3MD0 A;  3OMA B;  2CAZ C;  2CTP A;  4K3A A;  4YJ3 B;  4J7K A;  3CEI A;  4X1I B;  4NKG B;  2AGA A;  2IH1 C;  1Y76 B;  3K03 A;  3K57 A;  3ZHT A;  3DC5 A;  4ZI7 A;  3JAR A;  3S3X A;  4DK0 A;  4WF9 V;  5IJ0 B;  1SQX H;  4HYO A;  4OGQ B;  5JVD A;  3BFR A;  4GUN A;  4D7S A;  1DK1 A;  3L70 H;  1R3J C;  4ZOL B;  4IYI A;  4CBC A;  1MZF A;  2F1M A;  2ETN A;  4DV3 B;  5A9G A;  5TIS Z;  5EZY A;  3ZMV A;  2L35 A;  4LNU A;  3ABL C;  2DQ3 A;  3GWK C;  1F4N A;  1EBO A;  1XOU A;  3CRM A;  2BCC H;  3JAL A;  3N2K A;  2RJZ A;  3FFQ A;  3FX7 A;  2NR5 A;  3UT5 B;  1KB9 F;  2QM4 A;  3SJC C;  1L1F A;  3B4S A;  2LW7 A;  5CBH A;  2UXC O;  1XNQ B;  4JI8 B;  3BHP A;  1J5E O;  4FFK A;  2N74 A;  1Z5V A;  1BHB A;  4X65 O;  2QKC A;  3RYC A;  1GN3 A;  1P4R A;  2Y0I A;  3BPZ A;  4LF7 B;  3IFX A;  1HR0 B;  3O9O A;  2HR3 A;  2JRI A;  1ZWI C;  4ZI7 B;  2XAS A;  5IWA O;  1Q7Y W;  3B77 A;  1MG1 A;  3S3W A;  3K58 A;  2R9A A;  5LMN B;  3APQ A;  2JJ2 G;  2ZXW C;  2LQT A;  5IY5 C;  1VAR A;  3X2Q C;  4B3M O;  1JFF B;  1KEC A;  4XDL A;  5JQG A;  4DV6 B;  2K9P A;  1NH2 D;  3SPG A;  1T5E A;  4DV5 B;  5IJ9 B;  4DR1 B;  2Q7E A;  5J9P C;  4GYC B;  2UXX A;  1EN6 A;  1B6Q A;  4K35 A;  4NXM B;  1GM8 A;  1PL4 A;  4O4H B;  4B3R B;  2HG5 C;  1SZT A;  1QCE A;  4UV8 A;  1KD1 W;  2EX3 A;  1CP9 A;  1Y4M A;  3Q4H B;  2Q4P A;  2PGG A;  1KC8 W;  3RYH B;  4B7E A;  3ZX6 A;  1PP9 H;  1WJZ A;  2CUG A;  2EJ7 A;  3F5T A;  3UT5 A;  1TVK A;  1Q90 D;  1JCH A;  2RCV A;  2YSU B;  3DSQ A;  4R50 A;  1VQ7 V;  2XUM A;  3G71 V;  4HBN A;  4Z1M G;  3I55 V;  2OCH A;  4LFA B;  2FKX A;  4TT3 G;  2EIM B;  4UUJ C;  1XMO O;  2M6Y A;  1JJ2 U;  5D5Q A;  4UCS A;  4RQF A;  4DV2 B;  2JIZ G;  4H37 A;  3E86 A;  2YIB D;  3H1H H;  3ZCC A;  3JD4 A;  4CH6 A;  2CTR A;  1XNR B;  4LBE C;  1SA0 B;  2JEU A;  3FYI B;  4DV3 O;  4CH4 A;  3RVZ A;  1LUW A;  2Q6A A;  1Z2G A;  1SQV H;  4DUZ B;  4F6R A;  3ABT A;  4X20 A;  3G67 A;  3E8H A;  3QO5 A;  4CH3 A;  1K73 W;  5GON B;  5LL6 Y;  1XI1 A;  3G6E V;  1M1K W;  2ZE8 A;  2Q69 A;  1VQK V;  3OGI B;  4PA9 A;  3R66 A;  5LGU A;  4QGP A;  3MDS A;  1XBL A;  2E76 B;  5FNV A;  1VQL V;  4DR4 O;  4NXN O;  3J7A U;  1WPX A;  2Z0A A;  2B1G A;  1OCO B;  2ZNJ A;  1P84 F;  3JYC A;  1VQ6 V;  1W0K G;  3D36 C;  4IHJ A;  1R1B A;  4HZ3 A;  4DV0 O;  4JZG A;  1WAZ A;  4NR1 A;  3K04 A;  4H44 B;  4P9O A;  2HKO A;  4DR5 O;  5DEC A;  5EC1 C;  2IM9 A;  4F4L A;  1B06 A;  3BAB A;  2PYJ A;  1SQB H;  1FXH A;  4NB5 A;  3N27 A;  4O2B A;  4WFA V;  2EZP A;  3RYI B;  1AP6 A;  3AG3 C;  3AK2 A;  1M5I A;  3OM3 B;  3CRC A;  3O65 A;  4FIP C;  5LHH A;  3K0G A;  2KG7 B;  4LF5 B;  2G38 A;  4R7C A;  2YC0 A;  4U7N A;  4AQY B;  1FYJ A;  2LJ2 A;  3TJT A;  3ZN0 A;  4TOI A;  3ZHS A;  5IYC O;  1Y74 B;  2PI4 A;  1XL4 A;  1D5A A;  3FKS G;  1KP3 A;  3R65 A;  2EIK C;  3F7V C;  2DW4 A;  4IIJ A;  3I56 V;  3JAK B;  3KZI Z;  2XAH A;  1WP8 A;  1ZL8 B;  4IYH A;  3RYC B;  1VQP V;  3SPI A;  2OYQ A;  4WFF A;  2CH7 B;  3L71 H;  2JGD B;  5FNV B;  3OMI B;  2K1E A;  3KKY A;  1N36 O;  3SPJ A;  1HR0 O;  2VQE O;  4X64 O;  1CEZ A;  1R73 A;  4QPJ A;  4RO2 A;  4YJ3 A;  3CCQ V;  1Q86 W;  3UCS C;  3ZED A;  4DUY B;  5CBG A;  3OE7 G;  1J5E B;  3MHH C;  1WA8 A;  4NVP A;  4UFZ A;  2ZKO A;  2YEV A;  4JI5 B;  4YJ2 B;  1BMF G;  4FFB B;  1NH2 B;  4ZKI A;  3J80 N;  5BMV B;  4MTX A;  1AI4 A;  4LF8 B;  2YDE A;  5LP6 B;  2AXT Z;  1MAB G;  1P7B A;  3BA8 A;  3HKC B;  4TQF A;  3ZMS A;  1KU9 A;  3K5M A;  4MVO A;  1V9P A;  2YIA A;  1K92 A;  3OW2 U;  3BA9 A;  1NJI W;  1VP7 A;  2QTO A;  3HB3 B;  3SYP A;  1US6 A;  3HKE B;  3VQX A;  2XAG A;  2A9H A;  2UUB O;  2VRZ A;  4FJC C;  2FML A;  2LGQ A;  2DYR B;  2UXN A;  3RFR A;  1JFF A;  2QM8 A;  4J7Z A;  4E4E A;  1H2S B;  2WAM A;  4HNA B;  3WB1 A;  2UXB O;  2ZE7 A;  4B7K A;  4X66 O;  4FPP A;  4Z1V A;  2ZNI A;  3ZHQ A;  4DR2 B;  4LR3 A;  2DWE C;  3DTU B;  3KCX A;  3FB8 C;  5IE9 A;  4J11 A;  2MW2 B;  4X65 B;  2XHB A;  1H2G A;  1Q6H A;  1VF6 C;  3E8G A;  1NTZ H;  3C90 A;  2JDI G;  2JGD A;  4IHJ B;  2QEX V;  5H9C A;  4Z2W A;  3RGB A;  1YJW V;  3LDC A;  4CS2 A;  1N0J A;  3B8M A;  1IBM B;  2QWQ B;  5FPO A;  3CB2 A;  3SYC A;  3ABL B;  3CMA V;  1NBM G;  2HLD G;  2QKS A;  1VF5 B;  5DED A;  4GLX A;  1YJ9 V;  3JD3 A;  1FXK A;  2PI5 A;  5L3C A;  2UXB B;  2WA4 A;  3LDD A;  4L8J A;  2EUL A;  3AK1 A;  2DJV A;  2Y69 C;  4RAI A;  3LUT B;  3H01 A;  4CC6 A;  2AHZ A;  1IBK O;  4DV1 B;  3CC2 V;  1EZV H;  1OCC B;  4F6R B;  1NKD A;  3NXS A;  5GON A;  3BAA A;  4QE9 A;  3L74 H;  3ASN B;  3H1J H;  2JS3 A;  2ZM6 O;  4JI5 O;  2ADQ B;  1AI6 A;  4MVM A;  4MW3 A;  4UCU A;  4YHH B;  5LMU O;  4LF6 B;  4G28 B;  1W2B U;  2HP8 A;  1W59 A;  1FFX A;  1F23 A;  2IJI A;  3B2E E;  2E75 B;  4JI4 B;  1KKC A;  1A32 A;  3HR0 A;  4J9Z B;  3IGA C;  1F4M A;  1Q6I A;  5HFL A;  1JQ0 A;  4JYB A;  1BL8 A;  2WSS G;  4QJF B;  3W7W A;  1RPR A;  3AG2 C;  1I94 B;  1I0H A;  2HJD A;  4EFE A;  2E5L B;  1K7D A;  1ROP A;  2YIB A;  4NXM O;  2NNU A;  3TK1 A;  4J10 A;  3ZHR A;  5L3G A;  1M57 B;  4B08 A;  1QQC A;  2LFR A;  3HKC A;  3M8A A;  2Q0A A;  4JI3 O;  2ZCE A;  1ORQ C;  2WLL B;  1ZTE A;  1HNX B;  3A0R A;  1AI7 A;  2UUA O;  2LFS A;  4DYL A;  1YXB A;  3HKD B;  2BSK B;  1H38 A;  5BR8 B;  5FLX N;  2YS8 A;  2WLH A;  2P6J A;  4JI2 B;  4PDM A;  1R6K A;  1K9M W;  1N4C A;  2PYL A;  1F51 A;  1VQ8 V;  2LO1 A;  4DR5 B;  3D8C A;  2BE3 A;  2RMK B;  1MOF A;  1N34 O;  5KHK A;  4JAU A;  4X89 A;  4LFB B;  3ZBH A;  3N2K B;  4I0X B;  4LF7 O;  2P4V A;  5CN0 A;  1B04 A;  2Q5Z A;  2QWP B;  4B3T B;  1I08 A;  4ZHQ A;  4MVR A;  1XQ8 A;  4PDL A;  1Y66 A;  2JS5 A;  1F7Y A;  3OUF A;  1S76 D;  2UXC B;  2OT5 A;  1N8R W;  1KYO F;  4B3S B;  1GH6 A;  1XEQ A;  5JH7 B;  4BIU A;  1FKA O;  4PI0 A;  4LFB O;  4FK5 C;  3PN1 A;  4X62 O;  5KMG B;  1N0N A;  5BY1 A;  3APO A;  2CGO A;  2WLL A;  4MTG A;  1KP2 A;  1IZ3 A;  3L72 H;  4BR6 A;  4PDR A;  2IW5 A;  1N36 B;  1YCI A;  2OCC C;  1GRJ A;  1PNM A;  1TAE A;  1YF2 A;  3VQW A;  1PM9 A;  2W0X A;  2HHH O;  4QPK A;  5JQG B;  4DUZ O;  2ZR3 A;  1OV9 A;  4UVC A;  4U3J A;  1SQP H;  2H94 A;  3HKD A;  1K8A W;  3H1K H;  2BTO A;  4I4T A;  1EZJ A;  1M57 C;  3P32 A;  1AR4 A;  1CXZ B;  4DR3 O;  1WNS A;  1ZX3 A;  1YI2 V;  2WLJ A;  3P3N A;  2EIN B;  4PA7 A;  2A7W A;  3OR6 C;  2Q7H A;  3E2E A;  3ICX A;  3ZRW A;  2RNB A;  3CJH B;  4IL6 Z;  2N05 A;  2YID A;  3ZMZ A;  4X62 B;  2EIN C;  1MSD A;  1HW7 A;  2UXD B;  1FXV A;  2Y48 A;  1SER A;  2AZ2 A;  3MHS C;  3CCM V;  2A0L A;  3IAY A;  4X1Y B;  2P90 A;  2R9I A;  3ZRV A;  4C7U A;  1BSM A;  1FXK B;  1M56 B;  1K33 A;  1SRY A;  3ABM B;  5JJJ B;  1KMI Z;  2WLI B;  5LXT B;  4FLZ A;  5CA0 A;  3CXC U;  3HKE A;  4WBN B;  5CB4 B;  1N34 B;  2H8P C;  1HNW B;  3BEH A;  3AG7 A;  1RM1 B;  2JJ1 G;  4YHH O;  5LMU B;  1IXB A;  2IJH A;  5B1B B;  2YXL A;  2IU3 A;  4DV5 O;  2F66 C;  4JI1 B;  4ZBM A;  2P5O A;  5GTI Z;  1YIT V;  4U3J B;  4R8C A;  3ABM C;  4G2K A;  1XUQ A;  4ICG A;  1FXK C;  1M56 C;  5B1A B;  1IXM A;  3STZ C;  1M9N A;  3VBB A;  1YSC A;  1DTO A;  1UJW B;  4JV5 O;  1N33 B;  4CS4 A;  1HNX O;  4H33 A;  4XDK A;  1PNK A;  3T1H B;  1HNZ O;  1YDX A;  4UV9 A;  5IYZ A;  4HNA A;  4FZ0 A;  3X2Q B;  4DR6 B;  5IDJ A;  4OPA A;  1M93 A;  4MVS A;  5K1P A;  1X59 A;  4H0L B;  2GSM B;  4P9P A;  3JCZ A;  3UO3 A;  4JTA B;  2D2C B;  2P4K A;  2WPD G;  4X1K A;  3B09 A;  5C8Y B;  3SPC A;  1H8E G;  2HEP A;  2XND G;  1M90 W;  2B1I A;  5EIB C;  1H2K A;  2FTK A;  1GN4 A;  1NR1 A;  3OFN G;  4N21 A;  3H1I H;  2EIM C;  3FB5 C;  4LC1 A;  5H6R A;  5CA3 A;  3U10 A;  3K0D A;  4J7J A;  1XHZ A;  2R9R B;  4DR6 O;  3CS5 A;  1COW G;  1EN5 A;  3GB7 C;  1DF5 A;  4DK1 A;  4DR7 O;  3WB2 A;  4OPH A;  1K4C C;  3K5O A;  2BOC C;  2XAJ A;  3QNE A;  2PUS A;  2V4D A;  4YIO A;  1AJN A;  5EBM C;  3ASO B;  1QVF U;  1LR1 A;  4DR3 B;  1V55 C;  3CRQ A;  5C93 A;  4JI2 O;  2P7T C;  1SF9 A;  2X6C A;  4I4T B;  1NVP B;  4JI1 O;  1AJP A;  2E3C A;  1VQN V;  5DN6 G;  3CC7 V;  4UCO A;  1WN7 A;  1Q43 A;  4RUE A;  2XAQ A;  4UB6 Z;  1G6U A;  5LHI A;  3CCU V;  1IUR A;  1K5Q A;  3HPL C;  4EB6 B;  1TUE B;  5KUK A;  1OCZ C;  1URF A;  3KCY A;  4AIL C;  1THZ A;  4FLU A;  3BRC A;  1RSO A;  3RBZ A;  2HFE C;  4AHC A;  4OX9 B;  1WPB A;  1VQ9 V;  2CGN A;  4I9Q A;  1E1Q G;  1R3L C;  2Y69 B;  5KMG A;  4LFA O;  3ABU A;  4P30 A;  3ZMU A;  1D5N A;  1L0L H;  2FYU H;  1JPX A;  2BSK A;  3P30 A;  4LFC O;  4WFB V;  4JI0 B;  3SDL A;  3ETQ A;  4CS3 A;  1TUB B;  4JPR A;  2BTQ A;  5IT9 N;  1JOY A;  1S5L Z;  1HDJ A;  4OXS A;  3FAV B;  2F43 G;  3U11 A;  4TV9 A;  4DV1 O;  1U96 A;  3QVN A;  3CME V;  3CCL V;  4JYY A;  1KUQ A;  2YIC A;  1SA0 A;  2P06 A;  4AQY O;  1SC5 B;  4I0X A;  2WLM A;  4O4L A;  1NVP D;  1NS1 A;  4WFH A;  2DYS B;  2OWO A;  3B8N A;  3JAK A;  5B66 Z;  1B3Q A;  4EFB A;  3RT3 C;  3TXS A;  4B3M B;  3SYQ A;  5BZB A;  1YHQ V;  1I94 O;  5JCO A;  5B5E Z;  3QO7 A;  1UFI A;  5LYJ B;  4K8Z A;  4JI0 O;  3N2G B;  2QA4 V;  1I7F A;  1OHH G;  2JVD A;  1V54 B;  1AVM A;  2GUZ A;  5EC2 C;  4O2A A;  5EK0 A;  1H2M A;  1QR9 A;  1WA8 B;  4FLY A;  4GX5 A;  2RQ6 A;  2GDS A;  1RM1 C;  4PHZ A;  2UU9 O;  1AIL A;  1Y74 A;  5FL7 G;  3U0Z A;  3CCV V;  5H6Q A;  1S0V A;  1QHT A;  3JAW B;  5LGT A;  5L3D A;  4JI6 O;  4I7Z B;  1XRE A;  4JF3 A;  4QNH B;  1TA8 A;  4DRX B;  2F4V B;  1XIL A;  1NTK H;  4GKJ B;  1U97 A;  4FM0 A;  2WWW A;  4FLT A;  5LYJ A;  4AI8 A;  5F2V O;  5L3E A;  3CCJ V;  3CPW U;  2GUZ B;  4UCR A;  4MSW C;  1HP8 A;  2ZDI A;  4TUY A;  4PJ0 Z;  3T1C A;  1WB8 A;  1IX9 A;  2ZM6 B;  3D36 A;  3FYE B;  1P7G A;  1SS3 A;  5IY5 B;  4O2B B; 
#chains in the Genus database with same CATH homology
 4JI8 B;  2QJ1 A;  3BHP A;  3THO A;  4TV8 B;  4B08 A;  1QQC A;  1Z5V A;  3HKC A;  2Q0A A;  5EIB D;  3RYC A;  5LA6 B;  4DRX A;  3BPZ A;  4LF7 B;  1HR0 B;  2ZCE A;  4ZI7 B;  5LXT A;  1HNX B;  2BTQ B;  5CB4 A;  3RYF A;  3HKD B;  4LFC B;  4YJ2 A;  5BR8 B;  3K58 A;  4O2A B;  5BMV A;  2R9A A;  2F95 B;  5LMN B;  3JAS A;  4JI2 B;  3JAS B;  1Q8I A;  4BW9 A;  2PYL A;  4DV0 B;  1TVK B;  5KHJ A;  1JFF B;  5JQG A;  4DR5 B;  4DV6 B;  1T5E A;  5KHK A;  4DV5 B;  4JI6 B;  5IJ9 B;  4DR1 B;  4I55 A;  2Q7E A;  5LP6 A;  5C8Y A;  4GYC B;  4LF9 B;  1YEW A;  2ZIO A;  4LFB B;  3E22 B;  3N2K B;  4NXM B;  1XHX A;  5LA6 A;  1B04 A;  4O4H B;  3JAT A;  3OTF A;  4X1K B;  5J2U B;  4JI7 B;  4B3R B;  4B3T B;  4ZHQ A;  4FLX A;  1XQ8 A;  4DV7 B;  2JS5 A;  2UXC B;  2EX3 A;  1SQG A;  4B3S B;  5JH7 B;  2PGG A;  4PI0 A;  3RYH B;  3PN1 A;  5LP6 C;  5KMG B;  2VWK A;  3UT5 A;  1TVK A;  3DSQ A;  5KX5 A;  1N36 B;  5IJ0 A;  2GV9 A;  1SQF A;  4D7T A;  4CC5 A;  4TV8 A;  4HBN A;  2VQF B;  4LFA B;  1TAE A;  3RWR D;  3VQW A;  3K59 A;  5JQG B;  5J2U A;  5D5Q A;  4UCS A;  3HKB B;  4DV2 B;  1JJO A;  4U3J A;  2YIB D;  2VQE B;  3HKD A;  4CH6 A;  1XNR B;  2BTO A;  4I4T A;  4UCT A;  1SA0 B;  4X1I A;  4DR7 B;  4CH4 A;  1WNS A;  4DUZ B;  4F6R A;  1N32 B;  4I50 B;  4X20 A;  4X20 B;  1TGO A;  1X4T A;  3N2G A;  2PZS A;  2UUC B;  2Q7H A;  3ICX A;  2ZIN A;  4FM2 A;  1TUB A;  3E22 A;  4X62 B;  1HW7 A;  4CH3 A;  2UXD B;  4I55 B;  4O4J B;  5GON B;  3ZS8 C;  1XI1 A;  3IAY A;  4X1Y B;  3T1Y B;  4JV5 B;  4LNU B;  2ZIM A;  5JJJ B;  1KMI Z;  5FNV A;  5LXT B;  4FLZ A;  5CA0 A;  3HKE A;  4WBN B;  3VQV A;  5CB4 B;  2ZNJ A;  1N34 B;  4IHJ A;  2YI8 A;  1IBL B;  1HNW B;  4TQD A;  4JYA B;  5LMU B;  5FPR A;  5J2T B;  2YXL A;  2JGU A;  2R72 A;  3SR2 C;  1S5J A;  2F66 C;  4JI1 B;  5KHH A;  2IM9 A;  2P5O A;  1JMK C;  3JAL B;  1FFX B;  3BAB A;  2PYJ A;  4U3J B;  4KHP B;  5KHG A;  4O2B A;  1FJG B;  1DGS A;  3RYI B;  4O4J A;  1M5I A;  1NT2 B;  4FFB A;  3SGI A;  3RYF B;  5ITZ B;  4FLV A;  4LF5 B;  2Q7G A;  1SKV A;  1N33 B;  4CS4 A;  3WB0 A;  1P49 A;  5IWA B;  4AQY B;  3JAW A;  3T1H B;  4I50 A;  1M4U A;  4TOI A;  5IYZ A;  4HNA A;  1D5A A;  4DR6 B;  2R70 A;  3JAR B;  2VWJ A;  1M93 A;  3QTC A;  5K1P A;  4IIJ A;  3MAQ A;  3JAK B;  5CA1 B;  5J2T A;  3JAT B;  4CH5 A;  3RYC B;  4UCV A;  2OYQ A;  4DR4 B;  4X1K A;  5FNV B;  5C8Y B;  2HEP A;  2PY5 A;  4FVM A;  2UUB B;  2HHH B;  5EIB C;  4YJ3 A;  3ZED A;  1IBK B;  3CHX A;  4DUY B;  4EEQ A;  3U10 A;  1J5E B;  4DV4 B;  4WBN A;  4NVP A;  4KL1 A;  2PTM A;  4FM1 A;  4UFZ A;  4LH7 A;  1XHZ A;  5EYP B;  4JI5 B;  4YJ2 B;  4FFB B;  4PI2 A;  5ITZ A;  4YY3 B;  2UU9 B;  5BMV B;  3RYH A;  4DK1 A;  3WB2 A;  5JJE B;  1O9H A;  3K5O A;  4LF8 B;  4NXN B;  5LP6 B;  2PUS A;  2V4D A;  4X66 B;  4Q6G A;  3BA8 A;  3HKC B;  4DR3 B;  4TQF A;  1ZAU A;  3VQY A;  1KU9 A;  3K5M A;  4I4T B;  3K5N A;  5D5P A;  1V9P A;  5JH7 A;  2YIA A;  2E3C A;  2YI9 A;  3BA9 A;  4UCO A;  1WN7 A;  1Q43 A;  1G6U A;  4O4I B;  3HKE B;  4EB6 B;  3VQX A;  1L8D A;  1VF7 A;  1Z5W A;  3LNN A;  4AIL C;  4FLU A;  3BRC A;  5IYZ B;  1RSO A;  4K0K B;  4GKK B;  4ZOL A;  3A2F A;  3RFR A;  1JFF A;  4AHC A;  4OX9 B;  1H2S B;  4HNA B;  1WPB A;  5EYP A;  3WB1 A;  4I9Q A;  4O4H A;  1Q3E A;  5KMG A;  2ZNI A;  4DR2 B;  4JI3 B;  4LR3 A;  5JVD B;  4IIJ B;  4O2B B;  4X65 B;  4JI0 B;  2XHB A;  3ETQ A;  3UQ8 A;  1HNZ B;  4CS3 A;  3QG5 A;  5LOV A;  1TUB B;  2BTQ A;  3RYI A;  4IHJ B;  3U11 A;  4TV9 A;  4TV9 B;  4O4I A;  1XMO B;  3RGB A;  4LF4 B;  1SA0 A;  4CS2 A;  1IBM B;  2KKW A;  4O4L A;  4O4L B;  3CB2 A;  5FPO A;  3JSL A;  5JJN B;  2OWO A;  1XMQ B;  3SJA C;  4GLX A;  3JAK A;  3HKB A;  4EFB A;  2UXB B;  3QF7 A;  4B3M B;  4L8J A;  3JSN A;  3SJB C;  5JCO A;  2P22 C;  1O9G A;  5EZY B;  5LYJ B;  4CC6 A;  4K8Z A;  1Q5O A;  5KX5 B;  4LH6 A;  3N2G B;  4DV1 B;  2CAZ C;  1I7F A;  4EB6 A;  2JVD A;  4X64 B;  4F6R B;  5GON A;  4O2A A;  4YJ3 B;  4BWA A;  3K5L A;  2F93 B;  3BAA A;  4FLY A;  4X1Y A;  4X1I B;  4ZIB A;  2RQ6 A;  4PHZ A;  5CA0 B;  3K57 A;  3CSX A;  3U0Z A;  4ZI7 A;  3JAR A;  4DK0 A;  5IJ0 B;  4UCU A;  5IJ9 A;  4YHH B;  2UUA B;  4LF6 B;  1QHT A;  3JAW B;  4ZHQ B;  5CA1 A;  5JCO C;  5JVD A;  1FFX A;  1TA8 A;  4D7S A;  4DRX B;  3OTO B;  2F4V B;  4FLW A;  4ZOL B;  3B2E E;  4GKJ B;  4FM0 A;  4JI4 B;  2F1M A;  5LOV B;  4DV3 B;  4FLT A;  5EZY A;  5LYJ A;  5KHI A;  4LNU A;  4UCR A;  3M7M X;  3JAL A;  4TUY A;  4TUY B;  3N2K A;  2RJZ A;  3FFQ A;  3UT5 B;  1I94 B;  2ZM6 B;  4K8X A;  2QM4 A;  4EFE A;  3SJC C;  2E5L B;  5K1X A;  2YIB A;  1XNQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...