2N74A

Solution structure of the rna-binding domain of non-structural protein 1 from the 1918 h1n1 influenza virus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural Basis for a Novel Interaction between the NS1 Protein Derived from the 1918 Influenza Virus and RIG-I.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 21
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2n74A00
4AQYO 2UXBO 1F7YA 1N36O 4JI3O 1DK1A 3J80N 4DV0O 1IBMO 4LF7O 4DUYO 2VQFO 1AB3A 4DV3O 4DR2O 4OPHA 4DR1O 2UUCO 2UUBO 4YHHO 4JI4O 1HNWO 1FJGO 4JI6O 4B3MO 2DOSA 4LFBO 1N32O 1AILA 4X62O 2Z0AA 2FKXA 3J81N 1G1XB 1HR0O 5LMUO 4KHPO 2N74A 4DR3O 4DV6O 5BR8O 5FLXN 2UXDO 1FKAO 5LL6Y 4JI5O 3F5TA 4LFCO 3JAMN 2JRIA 4X66O 1XNQO 2HHHO 4DV2O 3SDLA 3OTOO 4DV5O 4JI1O 4B3SO 1HNXO 2E5LO 4B3RO 3J7AU 4DR6O 4LF8O 1FYJA 1D2DA 1IBKO 4DV7O 2VQEO 5BXZA 5A2QN 5LMNO 4LF6O 4LF5O 1J5EO 1HNZO 2ZM6O 2AGAA 2UUAO 5H5NA 5IWAO 4OPAA 4DUZO 5BY1A 4NXMO 4DR7O 1X59A 3O65A 4K0KO 4A5UB 4X65O 4JI0O 3T1HO 1XMQO 1YZBA 2LW7A 1IBLO 4GKJO 3R66A 4DR4O 1NS1A 2UXCO 4B3TO 4DV1O 4GKKO 1XMOO 2DJVA 4JYAO 4LFAO 4JV5O 4LF4O 4YY3O 1I94O 4X64O 4DR5O 2F4VO 3RT3C 1R1BA 1N33O 4DV4O 1R6TA 2ZKOA 4LF9O 4NXNO 5IT9N 4JI7O 1KUQA 3M8AA 1A32A 4JI2O 1XEQA 3T1YO 2UU9O 4JI8O 1N34O 1XNRO 4OX9O
chains in the Genus database with same CATH superfamily
4AQYO 2Q0OC 3P30A 3AG1B 3ZHTA 4DW1A 3CC2V 5JVDA 1AB3A 1NH2B 1VQ6V 3SYAA 3SPCA 4I0XA 3LUTB 1NTKH 1RM1B 3E89A 3CWBH 1SKVA 4AQYB 3ZMUA 1HR0B 1G1XB 4CH3A 3B2EE 3OTFA 1JVMA 5IDJA 1YITV 1KP2A 4ZI7A 5L3EA 2LGQA 3RYHB 4JPRA 4LFCO 5GONA 1PL0A 1FFXB 4DYLA 2LP7A 4U3JB 1S5LZ 3KCYA 4I7ZB 3IFXA 3J7AU 4RQFA 1Q90D 4LF5B 4MS2A 1KB9F 4IL6Z 4TUYB 2HLDG 4OPAA 5CN0A 4ZHQB 4X65O 3ZMVA 1ORQC 1IBLO 2HEPA 1J95A 1YTFD 2H8PC 1SF9A 5JH7A 2ZINA 3K0DA 5EBLC 1B04A 3PN1A 1H8EG 3E86A 1L8DA 4GZRB 1FPOA 1L0NH 1PV0A 4LNUA 4NKGB 3LNMB 2ZKOA 5EC2C 1IBLB 2H94A 3UM7A 5LHIA 4W4KA 2QM4A 4U7OA 1A32A 3ZEDA 3G6BA 4DR6O 1S3JA 2Q5ZA 1GKFA 3HB3B 1YHQV 4U7NA 4Q6GA 1W2BU 4DUYO 1JPXA 4PELA 5BMVA 3E22B 4DW0A 2UUCO 1IX9A 2ZR2A 4K3AA 1WN7A 2AZ0A 4CS4A 4H44B 4DR6B 4JAVA 1GAXA 1P7BA 2Z0AA 4X8AA 1XHXA 2VWKA 5GTHZ 2BOBC 2WLHA 4DUYB 4FLWA 4G27B 5BR8O 2W6JG 2HP8A 3W7SA 4MW8A 4IYHA 4WFGA 4DV2O 1QCEA 3FB5C 4R50A 4P2ZA 4CC5A 4Z2WA 2E5LO 1S5HC 1M56B 4HBNA 1SQGA 3W7TA 2P5OA 4KXRA 1GN3A 5BR8B 3RVYA 1EFRG 3CC4V 3IJ4A 5J2TB 2JJ1G 3ETQA 3QO5A 3HR0A 3BAAA 2DWEC 2ZDIA 3C90A 3N27A 4DV2B 5EC1C 1SA0A 4J11A 2ZE6A 5JQGA 5L3CA 3JARB 1YZBA 2E5LB 4O2BB 4MTXA 2Q73A 5EZYB 2HVKC 3JAKA 1VQ4V 1BSMA 1SC5B 3FYIB 1TUBB 3S3XA 3WB1A 1KQSU 2JIZG 1MZEA 1AJPA 2RDCA 3SPHA 2EIMC 5LA6A 3FKSG 1H2GA 1XREA 5KLVH 1PNMA 2FB5A 3CRQA 1V55C 3U0ZA 3LSUA 1EZJA 4ABMA 1SQBH 2GDSA 3K08A 3IC9A 4XBFA 3MHHC 1AI4A 3RYIB 1VARA 1HWYA 3K79A 4LWSB 2K9PA 2X7RB 1WA8A 5JVDB 3SJQC 3ZBHA 3ZHRA 2B1GA 2RQ6A 4JAUA 5CMUA 4HZ3A 1QLEB 5E79Z 4YHHO 1TVKB 2F93B 4UXNA 5B5EZ 3R65A 1ZX3A 5LOVB 5LYJB 3QF7A 2WA4A 2JK5C 1HDJA 3VQVA 5LMUO 4KHPO 1YF2A 4YIPA 2ZXWB 4FLZA 1SQVH 4NYKA 1DF4A 3UT5B 4MVZA 4JI5O 2B5UA 1N4CA 4JTCB 3HKBB 4YHHB 2DN9A 2FMLA 5JJJB 2A7WA 4FFBB 2YEVA 3AK2A 4JI1O 2EBOA 1HNXO 1S76D 4X20A 1S5JA 1E1QG 3IC7A 1PD3A 5LMUB 4KHPB 2CGNA 2Y4TA 1H2SB 4JTDB 4LF6O 5D5QA 1NTZH 5DECA 5FNVB 3FB7C 4I50B 4JI5B 5H5NA 1IXMA 1VQ8V 4I9QA 3CS5A 4NXMO 3O65A 4C7UA 4JI1B 5KMGA 3BHPA 5CBFA 2W0XA 4MVQA 3RVZA 4B3TO 1R73A 2XHBA 5LBQA 1WB7A 4JF3A 4LF6B 4I55B 4DO2A 1XUQA 1H2LA 3EHBB 1RPOA 2KG7A 3RBZA 4NXMB 1JFFA 1N0NA 4DV4O 1AJQA 3HKCB 4UB6Z 1AI6A 4LF9O 1GK9A 1M57B 4B3TB 2UU9B 5IYZB 1YEWA 5TISZ 5J2UA 2KSDA 4QIWF 1R3JC 3APOA 3T1YO 2CH7A 3L9DA 3OUSA 3KG2A 3L71H 5KHHA 1GN4A 3LDDA 2QTSA 2YIBA 4DV4B 1DGSA 3ABLB 2VQFO 3SYOA 4LF9B 3DXRB 4O4HB 4OPHA 4O2AA 1S72V 2UUBO 1KKDA 2WA3A 5ITZB 4PA9A 3T1YB 5EYPA 4O4LA 5CA1A 4KUMA 3P3NA 3Q4HB 4RWUA 1LNQA 3ZRSA 4XDKA 1AJNA 2VQFB 1NR1A 4PA4A 4J41A 1EN4A 4X9QA 3UKMA 2UUBB 2QWQB 5KUKA 1PNKA 4NTWA 2PYLA 1SS3A 1QHTA 3MHSC 4RQEA 2JVDA 3ZHQA 1K73W 1IBKB 4B3SO 1F4MA 1D5AA 3E2EA 3E8GA 3RYCB 3CJHB 3AK1A 2E75B 2Y0IA 2Y69B 4IT5A 4YXWG 2HVJC 2QDOA 4DR7O 3RYHA 1KKCA 3N2GB 2OTJV 4B3SB 2JJ2G 1XL4A 3CD6V 4U3JA 3SJBC 3KZIZ 2F66C 4DV1O 1L1FA 1R3KC 5KA6A 5LP6B 4JV5O 1KP3A 1H2KA 2WLLA 2F23A 4GCZA 4DR5O 4TUYA 4P9OA 3QTCA 1CPYA 2ATKC 4DR7B 4KP4A 4F4LA 3T4DA 3CCQV 4AILC 4ZHQA 1V54B 2IJHA 5IT9N 4Z1VA 1ENVA 4MW3A 3KKYA 4DV1B 3ZRWB 1PM9A 3CXCU 4FPPA 1WAZA 3AG1C 3K5LA 2OIEA 1M93A 1XNRO 4OX9O 2Q68A 4DR5B 2OTLV 1WJZA 3K9AA 4JYYA 1R3IC 3QVNA 1AVMA 2BTQA 1DF5A 3NXSA 1ZLZA 2YIDA 4LBEC 4D7TA 1RM1C 3JD2A 4LC1A 4OXSA 1XNRB 1EZVH 2P67A 2WSSG 4OX9B 2YSUB 4P30A 3JD0A 1SQQH 4WBNA 3JCUZ 2XNDG 4TV9B 1OCZB 2ZNIA 2HG5C 2XAFA 3F5WC 3F5TA 4O4IB 1FXKB 3K59A 3FB8C 1Z5VA 4CC6A 1LUVA 4FM1A 3I56V 4DV7O 4O4JB 4PJ0Z 1JMKC 3ZJZA 5LMNO 2QWPB 1VQ7V 1XL6A 1VF7A 3ABMB 2RN9A 3CCLV 4G2KA 2QE7G 1AR1B 2WLMA 1SZTA 4GKJO 4JAAA 2ZD9A 2PI5A 2P4VA 1BQZA 2DE0X 4DV7B 1MG1A 2QTOA 2A9HA 5LMNB 4LF4O 4HYOA 4XDLA 3STZC 4FLXA 5J2TA 4L87A 4K8ZA 4IGGA 2AHYA 2EIJB 3JARA 4PHZA 4O2BA 3VQYA 3OFNG 2DQ0A 4J9YB 5EZYA 4LF4B 1Z2GA 3CCRV 3H9VA 2R9IA 4UCRA 2PGGA 3TXQA 1TUBA 1YJNV 3J80N 3B8MA 2BTOA 1NZ6A 4J9ZB 4H13B 1GN6A 1O9GA 1YJ9V 4GT1A 1FJGO 3JATA 1Y74A 4O4LB 4LFBO 2Q4PA 4MVSA 4UCSA 2Q7EA 5CA1B 4PDMA 1JQ0A 3DC6A 4LP8A 2Q69A 3ASOB 5DM6V 3A2FA 4FM2A 3RYIA 4UV8A 4CH4A 1HR0O 1N0JA 3K04A 4BIUA 4LWSA 1DLBA 1QNMA 4WFEA 3UO2A 2IBZH 4TV8B 1WLEA 5LL6Y 2M6YA 1M56C 4LH6A 2JRIA 1ZL8B 3BCCH 1FJGB 3BRCA 2X6CA 1XI1A 4LFBB 1TVKA 2IW5A 1WP7A 3L72H 5LOVA 5LYJA 3FFQA 2FTKA 2EZPA 4LF5O 2YDEA 1HNZO 5B1NA 3OW2U 4D7SA 2VWJA 3BPZA 3UT5A 5BY1A 3CCVV 1X59A 3HKBA 4ZBMA 3TETA 3H1KH 4FFBA 1QLNA 4JYAB 1F51A 1S77D 1Q8IA 5IYBO 3W7UA 2QWRB 1K92A 3G6EV 1HNZB 4X64O 1VQPV 3ZMTA 2WLLB 2ETNA 1Q6UA 2ARHA 2AHZA 2Q67A 5FNVA 4I50A 2P22C 4QNHB 3BABA 5H6RA 1L0LH 3N2KB 5CBHA 5C8YB 2DMXA 3CHXA 1M5IA 4JGSA 3DTUB 2WLIB 1VMGA 2ZE7A 4X64B 5B3SB 2UXBO 4MVRA 4I55A 1N36O 5IE9A 4FLUA 3G71V 4H37A 2KKWA 5CA3A 1QLEC 2BTQB 4DV3O 2N04A 2ITDC 5CB4B 3HKCA 1G6UA 3SPGA 1FS0G 3BFRA 4GLXA 1OCOB 1LUWA 5IYZA 4I9WA 5H9CA 1OCRB 3FX7A 2UXBB 3GB7C 1N36B 2ZXWC 3VOUA 3ABKB 4WBNB 2DYRB 2JDIG 1R6KA 4DRXB 2IH3C 1OV9A 2L6LA 4DV3B 4WCEV 2V1DA 4IHJB 4X89A 4YJ2B 3WU2Z 2GUZB 3P32A 3OMIB 3DXRA 4O4HA 2E3CA 1RSOB 1R6NA 3ZIAG 1VF6A 5ITZA 1K97A 1IXBA 5JCOA 3B09A 2IU3A 5D5PA 3Q4HA 1VQMV 1FYJA 1FAFA 3B77A 5BXZA 2A3QA 3WG7B 2YXYA 2ZR3A 3T1CA 5L3BA 4JYBA 2QKSA 3FAVB 1XHZA 5JJEB 1GRJA 3JCZA 5IY5B 3UQ8A 2FYUH 5KX5B 2DWDC 5EBWC 3ZHVA 2O57A 3VBBA 3JASB 3K5OA 1Y66A 1Q6HA 2XAHA 3RYCA 3CJHA 3AG2B 1M57C 1FFTB 3N2GA 1GMGA 2QEXV 1SESA 3CE2A 2R9RB 2W6IG 5JJNB 4NB5A 3BVOA 1M9NA 2D2CB 5LP6A 4TT3G 2XT9A 3DC5A 3L70H 3ABLC 4TOIA 4WF9V 2PYJA 2CDYA 2CUGA 1US6A 4FJCC 3SYCA 5JCOC 1EM1A 2PF4E 3CSXA 4EFBA 1NI8A 4JI4O 1HNWO 3HPLC 3JATB 2BSKB 1Y74B 3ZRWA 2P06A 1QVFU 4PDVA 1F23A 2L35A 3D3IA 2BE3A 1VEWA 2UXDO 2MW2B 5B1BB 4JI4B 1HNWB 1ZTEA 3JD4A 1TUEB 3OMNB 1YI2V 1P49A 3UCSC 3K03A 1NVPB 2E76B 4B3RO 1AROP 3MD0A 1MSDA 2Y69C 4E4EA 2ZDIC 4JYCA 1K8AW 1J5EO 2UXDB 5GW7A 4DUZB 5FPRA 1P7GA 4TV9A 2UXNA 4FFKA 4JI0B 4JASA 2LQTA 1FXKA 4O4IA 4CH5A 2LW7A 5LP6C 4B3RB 1GM8A 3RYFB 5B1OA 2QM8A 1GM7A 4GX2A 2OCHA 2WLKA 1CXZB 5J9PC 5HFMA 1ZWIC 3CX5F 4O4JA 1J5EB 2A79B 1V54C 2N05A 5B66Z 3K57A 3GWOA 4EB6B 1K5QA 2UXXA 3CRMA 3JD1A 2JGUA 1M90W 4NXNO 3ZN0A 1MNGA 1X4TA 2UU9O 1N34O 2QM7A 1B3QA 4DV0B 1OJHA 2ILMA 4D6TH 3ZS8C 1IBMO 3ZHUA 1H2NA 5IYDO 3OGCC 1WNSA 4NXNB 1NQTA 4DR1O 3QO7A 3ABTA 1TAEA 2OT5A 4I4TB 2ITCC 4BIZA 1B6QA 2X6BA 1NJIW 4J80A 4JI6O 4B3MO 3CMEV 2QKAA 1N34B 1OCCB 2FKXA 1OCZC 1IBMB 5LHHA 5LHGA 5EK0A 2LFRA 2N74A 2VS0A 4B08A 2YIBD 4DR1B 1P4RA 5B1AB 1COWG 4XDJA 3L75H 3OR7C 2A0LA 3DGEA 2HHHO 5H2FZ 3I5DA 4JI6B 1OZ0A 5KHKA 4B3MB 3HKDB 1NU1H 1PNLA 3X2QB 3FYEB 4H0LB 3ASNB 2GBOA 2WLNA 3ABMC 1IBKO 1UJWB 3SR2C 1QR9A 1PKXA 1K34A 4FVMA 3EVKA 3OEEG 4TV8A 4B7EA 2HHHB 1KU9A 1ZL8A 4A5UB 1YSCA 1E1RG 3L73H 4BW9A 1NH2D 1BL8A 4GKKB 4UVCA 2OYQA 4PV1B 4FM0A 1Q7YW 2DJVA 1H8HG 4WFAV 2DW4A 2EILB 2EINB 4FK5C 1EN6A 2HJFC 1R1BA 2EIJC 3AK3A 1ZAUA 2NR5A 1GN2A 1IVSA 4NTYA 1R6TA 3EXAA 2XASA 2QWNB 3G4SV 2JGDB 2EJRA 4K8XA 1I7FA 3WB2A 1QVGU 2OWOA 1MA1A 4UCVA 4GX5A 4TSFG 2HFEC 3OEHG 4K35A 4YIOA 1JA8A 3OT7A 3N2KA 4GUNA 3CCJV 4CZZA 5C8YA 3AG4B 3ASOC 4DXWA 1RPRA 3TXSA 3ZCCA 2WLIA 1WB8A 4GYCB 4ZOLB 5CA0A 3K58A 3ETEA 3BY6A 4DK0A 2GTAA 1K5SA 4DV6O 1FKAO 4U3FH 5CB4A 1XBLA 4JZGA 1W59A 2NN4A 1H38A 2BOCC 4DV6B 1GO3F 4TQFA 1MMMA 3ZRVA 4DRXA 2WAMA 1GM9A 3LDCA 2UUAO 4IHJA 3F7YC 4YJ2A 2GUZA 5IWAO 4PDRA 5L3GA 5HFLA 2NNUA 2WWWA 2WPDG 3DSQA 1RSOA 3H1HH 3C3SA 4TQDA 3CC7V 5K1XA 1XOUA 3CCEV 1CEZA 1FD9A 1B06A 2EJ7A 4J7JA 2UUAB 1IZ3A 2AZ2A 5IWAB 1BMFG 2DYSB 3CCUV 3FAVA 1KC8W 4N23A 3MDSA 5B3SC 5KX5A 2ZT9B 2AW9A 3I55V 1ROPA 3JASA 4I5SA 4JI8O 1U97A 5DEDA 4MVOA 4JTAB 3E8FA 1YVWA 4JZ2A 3RGBA 4QPKA 2Y4UA 4ZKIA 1KMIZ 1ZSPA 4LF7O 3BA9A 2CTPA 2XAQA 2GTSA 1OCOC 1AI5A 4MTFA 3SPIA 2F95B 1OCRC 2FL4A 1IURA 1UPGA 1VQKV 4J7ZA 4N21A 3T2MA 3ABKC 4JI8B 1BZKA 2DYRC 1AILA 2LFSA 1YCIA 4LF7B 4CBCA 4DR3O 2GHYA 1VQNV 1EBOA 2QA4V 1AI7A 5IJ9B 3SDLA 2PI4A 4F6EA 1SETA 2RJZA 3U11A 2M7WA 3SGIA 2R72A 2BSKA 3WG7C 4KFMA 4TWKA 1JR9A 1VF5B 5A2QN 4UVBA 1SERA 3JSLA 4DR3B 2ODMA 2YI9A 1QQCA 3JALB 2AGAA 5IY5C 3AEIA 3RN4A 4K0KO 3U10A 2JEUA 1W0JG 1BQ0A 3B40A 2QWOB 4KL1A 3W7XA 3THOA 3CXHF 1NVPD 4JYAO 3VQWA 3AG2C 5KAIZ 3AG3B 3LDEA 3D8CA 2F4VO 1BHAA 3ETGA 2Z3YA 1NKDA 4MTGA 4FZ1A 3CP1A 4K0KB 1K4DC 1QBZA 3H01A 3H1LH 4X1KB 2JS3A 3TCUA 3RYFA 5FL7G 3CMAV 4JI2O 4DK1A 2F4VB 2BCCH 3HKEB 3LNNA 3AG7A 1F7YA 1VQ9V 4JI3O 2G38A 3FD9A 2K1EA 4IIJA 4EB6A 1VQ5V 4J10A 3GWKC 4AI8A 2Q8VA 4QGPA 3OMAB 4JI2B 4RO2A 2DOSA 4JI3B 2IH1C 5CA0B 1YXBA 1YDXA 2QJ1A 2RCVA 5B1BC 2ZIMA 2EIKB 3APQA 5EIBD 4LFCB 3ZMSA 2ADQB 4PDLA 4X1YB 1XNQO 4X66O 5L3DA 4I4TA 1Y76B 1AR5A 4WFBV 3OTOO 2W0FC 2LW1A 3M99B 4QE7A 3K5MA 1JX9A 2A06H 2OCCB 2XAJA 1V9PA 1KECA 3ICXA 2PUSA 1G4YB 4X65B 1XNQB 4X66B 2F43G 5LGUA 3ZN1A 3OTOB 2YS8A 4R8CA 1KD1W 3HKDA 2AXTZ 1JJ2U 3LSSA 3CPWU 3GVMA 5C93A 2RNBA 2CTRA 3K0GA 2P4KA 2ZIOA 4YY3O 2JEXA 1FXVA 2Q9LA 4MVUA 4PA7A 4HNAB 2ZCEA 4R7CA 3K5NA 1SQXH 1Z5WA 2B1IA 3KCXA 1O9HA 2YXLA 2IJIA 3PJSK 2EX3A 2YI8A 4ICGA 1K7DA 3K06A 1BS3A 5EIBC 4YY3B 3O9OA 3QNEA 4UCOA 1K9MW 3OM3B 3UO3A 2UUCB 4IYIA 2QGNA 1LR1A 1THZA 1OCCC 3CYOA 1T5EA 3K9SA 4J7KA 5LXTB 3F7VC 4B7KA 1MABG 3G80A 3A0RA 1JOYA 2JGDA 3JAWB 4GX0A 1RP3B 3BA8A 5B1AC 3CRAA 2EULA 1XQ8A 1YJWV 3E8BA 4W4LA 1VQLV 1Q6IA 3X2QC 4FLTA 1VF6C 3ASNC 3JAMN 4UV9A 3QG5A 4BIOA 4CS3A 1KBHA 3CB2A 4G28B 1NT2B 1PPJH 3CRCA 1N8RW 4LF8O 2LGWA 5K1PA 2CTQA 4ZOLA 1PP9H 2VQEO 4PI2A 5IJ0B 1RFYA 1I0HA 2ADPA 4DUZO 3IAYA 1WP8A 1IDSA 4JI0O 2KB1A 3SJCC 4LF8B 2ZE8A 3P3PA 2EILC 4NR1A 1NS1A 3LSQA 3FB6C 2EINC 4MVMA 2XAGA 2VQEB 1XMOO 4MTOA 5A9GA 2ZNJA 2CAZC 4L8JA 2CK3G 1VIBA 5KAFZ 2XOKG 2EZOA 1YIJV 2Y48A 4EKWA 4UB8Z 3WFVA 3ZMZA 3RW0A 4I0XB 4J42A 1MZFA 3M8AA 3E83A 1XMOB 2KQXA 2IJKA 3SJAC 4EEQA 5EBMC 3CRRA 2QR4A 1Y67A 2YUAA 2E74B 3SPJA 5L3FA 4FLYA 4DV0O 4QPJA 4X88A 3H1IH 4ZI7B 4IIJB 3AG4C 1AP6A 1Y4MA 3VQXA 1NR7A 5GONB 4FLVA 2F1MA 4NVPA 1E79G 3JYCA 1N32O 2YXHA 3ML0A 1Q3EA 3RWRD 4UCTA 2V7QG 3H1JH 4F6RA 3OGIB 3L74H 3OUFA 2XTAA 5E1AC 3K3WA 4FMTA 1HNXB 1YTFB 2YICA 1N32B 3A0HZ 5JH7B 3TJTA 5LGTA 5KHGA 2X0LA 1D2DA 2MK3A 5KA5A 2P6JA 1EN5A 4YJ3A 2CTWA 3ZRXA 1R3LC 1FXKC 3STLC 2ZQMA 4LNUB 2Q7GA 2V4DA 5KUMA 2HKOA 1URFA 5IJ9A 5KHJA 2DQ3A 3W7WA 5F2VO 4DR4O 2QKCA 1WPXA 1M1KW 4X1IA 4PD4F 2GV9A 2B9ZA 4GKKO 5JWPA 3A8TA 2DYSC 2R9AA 3RT3C 1TA8A 3JALA 1F4NA 5BMVB 2PY5A 4LR3A 3EFFK 4WFHA 3SYQA 2RMKB 4DR4B 1S0VA 2EIMB 1JJOA 1XEQA 3JD3A 3TGUH 1V55B 4MSWC 1XILA 3B8NA 2IM9A 5H6QA 3OAAG 3S3WA 4FIPC 3ZHSA 4E2LA 2Q6AA 1U96A 4DR2O 4QJFB 2YIAA 3QO8A 1Q43A 4X1KA 1VQOV 3E8HA 4PA3A 4ASUG 3B4SA 4RAIA 1NBMG 1Q81W 3ZX6A 3JSNA 4X62O 1GH6A 2HJDA 3ETDA 4UVAA 3J81N 3HKEA 1VP7A 4BAYA 4DR2B 1PL4A 5FLXN 3ABUA 1K4CC 2Q0AA 1SA0B 4QE9A 3E35A 5JQGB 1FFXA 4EFEA 5IYCO 2Z5UA 2VRZA 5LGNA 4X62B 2LO1A 4UCUA 3CCSV 3JAKB 1JCHA 1HW7A 2X6AA 1GTOA 4GX1A 1BT8A 1UFIA 2PTMA 2P90A 1KYOF 2PZSA 4AHCA 5BZBA 1I5XA 4PI0A 4LCUC 1CP9A 5LA6B 4X1YA 1AP5A 3T1HO 1Y76A 2LJ2A 4RUEA 5GTIZ 3R66A 1AR4A 3AG3C 4JV5B 3D36A 1SZXA 3BEHA 2HR3A 4HAMA 4LFAO 1I94O 3TK1A 1ZUQA 1BHBA 1WA8B 1SRYA 4UFZA 1N33O 4NTXA 2NLJC 3D3QA 3T1HB 1M4UA 3SYPA 1KUQA 2XUMA 4Q20A 4Z1MG 1XDCA 1P84F 2IU0A 1QU7A 1WPBA 3RFRA 4LFAB 1G8MA 4JI7O 1I94B 4LH7A 3T4ZA 5DN6G 1DK1A 1Q86W 3G67A 1N33B 3E22A 1W0KG 1NTMH 4HNAA 3MAQA 1FXHA 2JS5A 1K3EA 4OGQB 3A0BZ 2Q7HA 4FZ0A 2YEVB 2D3OW 4JI7B 1K33A 4CS2A 4X20B 1Q82W 2EIKC 1QR8A 4F6RB 2GSMB 1BE3H 2ZE5A 2IJJA 4BW5A 2CE4A 2YC0A 3D36C 3OD4A 5LXTA 3C3TA 5KMGB 4WFFA 4DV5O 3IGAC 3JAWA 1Q5OA 2OCCC 4RUFA 1I08A 5CBGA 2P7TC 4UUJC 1I5YA 2C2AA 3CEIA 4YJ3B 1SQFA 2ZM6O 2KG7B 1MSWD 1JFFB 2Y0PA 4MT8A 1TGOA 3M7MX 4CH6A 3OR6C 4R6ZA 4GKJB 4ZIBA 4DV5B 2QSAA 1XMQO 5AG2A 5KHIA 5J2UB 2UXCO 4X1IB 4PA6A 3OE7G 1HP8A 2CGOA 4BR6A 2CH7B 4H33A 1BGYH 2ZM6B 3CCMV 1D5NA 5IJ0A 1MOFA 1DTOA 1XMQB 5FPOA 2OIGA 2WLJA 1Y6XA 4O2AB 3NR7A 1H2MA 3WB0A 2UXCB 1BCCH 5EYPB 4P9PA 1SQPH 2R70A 4BWAA 2H3OA 1OHHG
chains in the Genus database with same CATH topology
4AQYO 2UXBO 1F7YA 1N36O 4JI3O 1DK1A 3J80N 4DV0O 1IBMO 4LF7O 4DUYO 2VQFO 1AB3A 4DV3O 4DR2O 4OPHA 4DR1O 2UUCO 2UUBO 4YHHO 4JI4O 1HNWO 1FJGO 4JI6O 4B3MO 2DOSA 4LFBO 1N32O 1AILA 4X62O 2Z0AA 2FKXA 3J81N 1G1XB 1HR0O 5LMUO 4KHPO 2N74A 4DR3O 4DV6O 5BR8O 5FLXN 2UXDO 1FKAO 5LL6Y 4JI5O 3F5TA 4LFCO 3JAMN 2JRIA 4X66O 1XNQO 2HHHO 4DV2O 3SDLA 3OTOO 4DV5O 4JI1O 4B3SO 1HNXO 2E5LO 4B3RO 3J7AU 4DR6O 4LF8O 1FYJA 1D2DA 1IBKO 4DV7O 2VQEO 5BXZA 5A2QN 5LMNO 4LF6O 4LF5O 1J5EO 1HNZO 2ZM6O 2AGAA 2UUAO 5H5NA 5IWAO 4OPAA 4DUZO 5BY1A 4NXMO 4DR7O 1X59A 3O65A 4K0KO 4A5UB 4X65O 4JI0O 3T1HO 1XMQO 1YZBA 2LW7A 1IBLO 4GKJO 3R66A 4DR4O 1NS1A 2UXCO 4B3TO 4DV1O 4GKKO 1XMOO 2DJVA 4JYAO 4LFAO 4JV5O 4LF4O 4YY3O 1I94O 4X64O 4DR5O 2F4VO 3RT3C 1R1BA 1N33O 4DV4O 1R6TA 2ZKOA 4LF9O 4NXNO 5IT9N 4JI7O 1KUQA 3M8AA 1A32A 4JI2O 1XEQA 3T1YO 2UU9O 4JI8O 1N34O 1XNRO 4OX9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  2UXB O;  1F7Y A;  1N36 O;  4JI3 O;  1DK1 A;  3J80 N;  4DV0 O;  1IBM O;  4LF7 O;  4DUY O;  2VQF O;  1AB3 A;  4DV3 O;  4DR2 O;  4OPH A;  4DR1 O;  2UUC O;  2UUB O;  4YHH O;  4JI4 O;  1HNW O;  1FJG O;  4JI6 O;  4B3M O;  2DOS A;  4LFB O;  1N32 O;  1AIL A;  4X62 O;  2Z0A A;  2FKX A;  3J81 N;  1G1X B;  1HR0 O;  5LMU O;  4KHP O;  2N74 A;  4DR3 O;  4DV6 O;  5BR8 O;  5FLX N;  2UXD O;  1FKA O;  5LL6 Y;  4JI5 O;  3F5T A;  4LFC O;  3JAM N;  2JRI A;  4X66 O;  1XNQ O;  2HHH O;  4DV2 O;  3SDL A;  3OTO O;  4DV5 O;  4JI1 O;  4B3S O;  1HNX O;  2E5L O;  4B3R O;  3J7A U;  4DR6 O;  4LF8 O;  1FYJ A;  1D2D A;  1IBK O;  4DV7 O;  2VQE O;  5BXZ A;  5A2Q N;  5LMN O;  4LF6 O;  4LF5 O;  1J5E O;  1HNZ O;  2ZM6 O;  2AGA A;  2UUA O;  5H5N A;  5IWA O;  4OPA A;  4DUZ O;  5BY1 A;  4NXM O;  4DR7 O;  1X59 A;  3O65 A;  4K0K O;  4A5U B;  4X65 O;  4JI0 O;  3T1H O;  1XMQ O;  1YZB A;  2LW7 A;  1IBL O;  4GKJ O;  3R66 A;  4DR4 O;  1NS1 A;  2UXC O;  4B3T O;  4DV1 O;  4GKK O;  1XMO O;  2DJV A;  4JYA O;  4LFA O;  4JV5 O;  4LF4 O;  4YY3 O;  1I94 O;  4X64 O;  4DR5 O;  2F4V O;  3RT3 C;  1R1B A;  1N33 O;  4DV4 O;  1R6T A;  2ZKO A;  4LF9 O;  4NXN O;  5IT9 N;  4JI7 O;  1KUQ A;  3M8A A;  1A32 A;  4JI2 O;  1XEQ A;  3T1Y O;  2UU9 O;  4JI8 O;  1N34 O;  1XNR O;  4OX9 O; 
#chains in the Genus database with same CATH topology
 4AQY O;  2Q0O C;  3P30 A;  3AG1 B;  3ZHT A;  4DW1 A;  3CC2 V;  5JVD A;  1AB3 A;  1NH2 B;  1VQ6 V;  3SYA A;  3SPC A;  4I0X A;  3LUT B;  1NTK H;  1RM1 B;  3E89 A;  3CWB H;  1SKV A;  4AQY B;  3ZMU A;  1HR0 B;  1G1X B;  4CH3 A;  3B2E E;  3OTF A;  1JVM A;  5IDJ A;  1YIT V;  1KP2 A;  4ZI7 A;  5L3E A;  2LGQ A;  3RYH B;  4JPR A;  4LFC O;  5GON A;  1PL0 A;  1FFX B;  4DYL A;  2LP7 A;  4U3J B;  1S5L Z;  3KCY A;  4I7Z B;  3IFX A;  3J7A U;  4RQF A;  1Q90 D;  4LF5 B;  4MS2 A;  1KB9 F;  4IL6 Z;  4TUY B;  2HLD G;  4OPA A;  5CN0 A;  4ZHQ B;  4X65 O;  3ZMV A;  1ORQ C;  1IBL O;  2HEP A;  1J95 A;  1YTF D;  2H8P C;  1SF9 A;  5JH7 A;  2ZIN A;  3K0D A;  5EBL C;  1B04 A;  3PN1 A;  1H8E G;  3E86 A;  1L8D A;  4GZR B;  1FPO A;  1L0N H;  1PV0 A;  4LNU A;  4NKG B;  3LNM B;  2ZKO A;  5EC2 C;  1IBL B;  2H94 A;  3UM7 A;  5LHI A;  4W4K A;  2QM4 A;  4U7O A;  1A32 A;  3ZED A;  3G6B A;  4DR6 O;  1S3J A;  2Q5Z A;  1GKF A;  3HB3 B;  1YHQ V;  4U7N A;  4Q6G A;  1W2B U;  4DUY O;  1JPX A;  4PEL A;  5BMV A;  3E22 B;  4DW0 A;  2UUC O;  1IX9 A;  2ZR2 A;  4K3A A;  1WN7 A;  2AZ0 A;  4CS4 A;  4H44 B;  4DR6 B;  4JAV A;  1GAX A;  1P7B A;  2Z0A A;  4X8A A;  1XHX A;  2VWK A;  5GTH Z;  2BOB C;  2WLH A;  4DUY B;  4FLW A;  4G27 B;  5BR8 O;  2W6J G;  2HP8 A;  3W7S A;  4MW8 A;  4IYH A;  4WFG A;  4DV2 O;  1QCE A;  3FB5 C;  4R50 A;  4P2Z A;  4CC5 A;  4Z2W A;  2E5L O;  1S5H C;  1M56 B;  4HBN A;  1SQG A;  3W7T A;  2P5O A;  4KXR A;  1GN3 A;  5BR8 B;  3RVY A;  1EFR G;  3CC4 V;  3IJ4 A;  5J2T B;  2JJ1 G;  3ETQ A;  3QO5 A;  3HR0 A;  3BAA A;  2DWE C;  2ZDI A;  3C90 A;  3N27 A;  4DV2 B;  5EC1 C;  1SA0 A;  4J11 A;  2ZE6 A;  5JQG A;  5L3C A;  3JAR B;  1YZB A;  2E5L B;  4O2B B;  4MTX A;  2Q73 A;  5EZY B;  2HVK C;  3JAK A;  1VQ4 V;  1BSM A;  1SC5 B;  3FYI B;  1TUB B;  3S3X A;  3WB1 A;  1KQS U;  2JIZ G;  1MZE A;  1AJP A;  2RDC A;  3SPH A;  2EIM C;  5LA6 A;  3FKS G;  1H2G A;  1XRE A;  5KLV H;  1PNM A;  2FB5 A;  3CRQ A;  1V55 C;  3U0Z A;  3LSU A;  1EZJ A;  4ABM A;  1SQB H;  2GDS A;  3K08 A;  3IC9 A;  4XBF A;  3MHH C;  1AI4 A;  3RYI B;  1VAR A;  1HWY A;  3K79 A;  4LWS B;  2K9P A;  2X7R B;  1WA8 A;  5JVD B;  3SJQ C;  3ZBH A;  3ZHR A;  2B1G A;  2RQ6 A;  4JAU A;  5CMU A;  4HZ3 A;  1QLE B;  5E79 Z;  4YHH O;  1TVK B;  2F93 B;  4UXN A;  5B5E Z;  3R65 A;  1ZX3 A;  5LOV B;  5LYJ B;  3QF7 A;  2WA4 A;  2JK5 C;  1HDJ A;  3VQV A;  5LMU O;  4KHP O;  1YF2 A;  4YIP A;  2ZXW B;  4FLZ A;  1SQV H;  4NYK A;  1DF4 A;  3UT5 B;  4MVZ A;  4JI5 O;  2B5U A;  1N4C A;  4JTC B;  3HKB B;  4YHH B;  2DN9 A;  2FML A;  5JJJ B;  2A7W A;  4FFB B;  2YEV A;  3AK2 A;  4JI1 O;  2EBO A;  1HNX O;  1S76 D;  4X20 A;  1S5J A;  1E1Q G;  3IC7 A;  1PD3 A;  5LMU B;  4KHP B;  2CGN A;  2Y4T A;  1H2S B;  4JTD B;  4LF6 O;  5D5Q A;  1NTZ H;  5DEC A;  5FNV B;  3FB7 C;  4I50 B;  4JI5 B;  5H5N A;  1IXM A;  1VQ8 V;  4I9Q A;  3CS5 A;  4NXM O;  3O65 A;  4C7U A;  4JI1 B;  5KMG A;  3BHP A;  5CBF A;  2W0X A;  4MVQ A;  3RVZ A;  4B3T O;  1R73 A;  2XHB A;  5LBQ A;  1WB7 A;  4JF3 A;  4LF6 B;  4I55 B;  4DO2 A;  1XUQ A;  1H2L A;  3EHB B;  1RPO A;  2KG7 A;  3RBZ A;  4NXM B;  1JFF A;  1N0N A;  4DV4 O;  1AJQ A;  3HKC B;  4UB6 Z;  1AI6 A;  4LF9 O;  1GK9 A;  1M57 B;  4B3T B;  2UU9 B;  5IYZ B;  1YEW A;  5TIS Z;  5J2U A;  2KSD A;  4QIW F;  1R3J C;  3APO A;  3T1Y O;  2CH7 A;  3L9D A;  3OUS A;  3KG2 A;  3L71 H;  5KHH A;  1GN4 A;  3LDD A;  2QTS A;  2YIB A;  4DV4 B;  1DGS A;  3ABL B;  2VQF O;  3SYO A;  4LF9 B;  3DXR B;  4O4H B;  4OPH A;  4O2A A;  1S72 V;  2UUB O;  1KKD A;  2WA3 A;  5ITZ B;  4PA9 A;  3T1Y B;  5EYP A;  4O4L A;  5CA1 A;  4KUM A;  3P3N A;  3Q4H B;  4RWU A;  1LNQ A;  3ZRS A;  4XDK A;  1AJN A;  2VQF B;  1NR1 A;  4PA4 A;  4J41 A;  1EN4 A;  4X9Q A;  3UKM A;  2UUB B;  2QWQ B;  5KUK A;  1PNK A;  4NTW A;  2PYL A;  1SS3 A;  1QHT A;  3MHS C;  4RQE A;  2JVD A;  3ZHQ A;  1K73 W;  1IBK B;  4B3S O;  1F4M A;  1D5A A;  3E2E A;  3E8G A;  3RYC B;  3CJH B;  3AK1 A;  2E75 B;  2Y0I A;  2Y69 B;  4IT5 A;  4YXW G;  2HVJ C;  2QDO A;  4DR7 O;  3RYH A;  1KKC A;  3N2G B;  2OTJ V;  4B3S B;  2JJ2 G;  1XL4 A;  3CD6 V;  4U3J A;  3SJB C;  3KZI Z;  2F66 C;  4DV1 O;  1L1F A;  1R3K C;  5KA6 A;  5LP6 B;  4JV5 O;  1KP3 A;  1H2K A;  2WLL A;  2F23 A;  4GCZ A;  4DR5 O;  4TUY A;  4P9O A;  3QTC A;  1CPY A;  2ATK C;  4DR7 B;  4KP4 A;  4F4L A;  3T4D A;  3CCQ V;  4AIL C;  4ZHQ A;  1V54 B;  2IJH A;  5IT9 N;  4Z1V A;  1ENV A;  4MW3 A;  3KKY A;  4DV1 B;  3ZRW B;  1PM9 A;  3CXC U;  4FPP A;  1WAZ A;  3AG1 C;  3K5L A;  2OIE A;  1M93 A;  1XNR O;  4OX9 O;  2Q68 A;  4DR5 B;  2OTL V;  1WJZ A;  3K9A A;  4JYY A;  1R3I C;  3QVN A;  1AVM A;  2BTQ A;  1DF5 A;  3NXS A;  1ZLZ A;  2YID A;  4LBE C;  4D7T A;  1RM1 C;  3JD2 A;  4LC1 A;  4OXS A;  1XNR B;  1EZV H;  2P67 A;  2WSS G;  4OX9 B;  2YSU B;  4P30 A;  3JD0 A;  1SQQ H;  4WBN A;  3JCU Z;  2XND G;  4TV9 B;  1OCZ B;  2ZNI A;  2HG5 C;  2XAF A;  3F5W C;  3F5T A;  4O4I B;  1FXK B;  3K59 A;  3FB8 C;  1Z5V A;  4CC6 A;  1LUV A;  4FM1 A;  3I56 V;  4DV7 O;  4O4J B;  4PJ0 Z;  1JMK C;  3ZJZ A;  5LMN O;  2QWP B;  1VQ7 V;  1XL6 A;  1VF7 A;  3ABM B;  2RN9 A;  3CCL V;  4G2K A;  2QE7 G;  1AR1 B;  2WLM A;  1SZT A;  4GKJ O;  4JAA A;  2ZD9 A;  2PI5 A;  2P4V A;  1BQZ A;  2DE0 X;  4DV7 B;  1MG1 A;  2QTO A;  2A9H A;  5LMN B;  4LF4 O;  4HYO A;  4XDL A;  3STZ C;  4FLX A;  5J2T A;  4L87 A;  4K8Z A;  4IGG A;  2AHY A;  2EIJ B;  3JAR A;  4PHZ A;  4O2B A;  3VQY A;  3OFN G;  2DQ0 A;  4J9Y B;  5EZY A;  4LF4 B;  1Z2G A;  3CCR V;  3H9V A;  2R9I A;  4UCR A;  2PGG A;  3TXQ A;  1TUB A;  1YJN V;  3J80 N;  3B8M A;  2BTO A;  1NZ6 A;  4J9Z B;  4H13 B;  1GN6 A;  1O9G A;  1YJ9 V;  4GT1 A;  1FJG O;  3JAT A;  1Y74 A;  4O4L B;  4LFB O;  2Q4P A;  4MVS A;  4UCS A;  2Q7E A;  5CA1 B;  4PDM A;  1JQ0 A;  3DC6 A;  4LP8 A;  2Q69 A;  3ASO B;  5DM6 V;  3A2F A;  4FM2 A;  3RYI A;  4UV8 A;  4CH4 A;  1HR0 O;  1N0J A;  3K04 A;  4BIU A;  4LWS A;  1DLB A;  1QNM A;  4WFE A;  3UO2 A;  2IBZ H;  4TV8 B;  1WLE A;  5LL6 Y;  2M6Y A;  1M56 C;  4LH6 A;  2JRI A;  1ZL8 B;  3BCC H;  1FJG B;  3BRC A;  2X6C A;  1XI1 A;  4LFB B;  1TVK A;  2IW5 A;  1WP7 A;  3L72 H;  5LOV A;  5LYJ A;  3FFQ A;  2FTK A;  2EZP A;  4LF5 O;  2YDE A;  1HNZ O;  5B1N A;  3OW2 U;  4D7S A;  2VWJ A;  3BPZ A;  3UT5 A;  5BY1 A;  3CCV V;  1X59 A;  3HKB A;  4ZBM A;  3TET A;  3H1K H;  4FFB A;  1QLN A;  4JYA B;  1F51 A;  1S77 D;  1Q8I A;  5IYB O;  3W7U A;  2QWR B;  1K92 A;  3G6E V;  1HNZ B;  4X64 O;  1VQP V;  3ZMT A;  2WLL B;  2ETN A;  1Q6U A;  2ARH A;  2AHZ A;  2Q67 A;  5FNV A;  4I50 A;  2P22 C;  4QNH B;  3BAB A;  5H6R A;  1L0L H;  3N2K B;  5CBH A;  5C8Y B;  2DMX A;  3CHX A;  1M5I A;  4JGS A;  3DTU B;  2WLI B;  1VMG A;  2ZE7 A;  4X64 B;  5B3S B;  2UXB O;  4MVR A;  4I55 A;  1N36 O;  5IE9 A;  4FLU A;  3G71 V;  4H37 A;  2KKW A;  5CA3 A;  1QLE C;  2BTQ B;  4DV3 O;  2N04 A;  2ITD C;  5CB4 B;  3HKC A;  1G6U A;  3SPG A;  1FS0 G;  3BFR A;  4GLX A;  1OCO B;  1LUW A;  5IYZ A;  4I9W A;  5H9C A;  1OCR B;  3FX7 A;  2UXB B;  3GB7 C;  1N36 B;  2ZXW C;  3VOU A;  3ABK B;  4WBN B;  2DYR B;  2JDI G;  1R6K A;  4DRX B;  2IH3 C;  1OV9 A;  2L6L A;  4DV3 B;  4WCE V;  2V1D A;  4IHJ B;  4X89 A;  4YJ2 B;  3WU2 Z;  2GUZ B;  3P32 A;  3OMI B;  3DXR A;  4O4H A;  2E3C A;  1RSO B;  1R6N A;  3ZIA G;  1VF6 A;  5ITZ A;  1K97 A;  1IXB A;  5JCO A;  3B09 A;  2IU3 A;  5D5P A;  3Q4H A;  1VQM V;  1FYJ A;  1FAF A;  3B77 A;  5BXZ A;  2A3Q A;  3WG7 B;  2YXY A;  2ZR3 A;  3T1C A;  5L3B A;  4JYB A;  2QKS A;  3FAV B;  1XHZ A;  5JJE B;  1GRJ A;  3JCZ A;  5IY5 B;  3UQ8 A;  2FYU H;  5KX5 B;  2DWD C;  5EBW C;  3ZHV A;  2O57 A;  3VBB A;  3JAS B;  3K5O A;  1Y66 A;  1Q6H A;  2XAH A;  3RYC A;  3CJH A;  3AG2 B;  1M57 C;  1FFT B;  3N2G A;  1GMG A;  2QEX V;  1SES A;  3CE2 A;  2R9R B;  2W6I G;  5JJN B;  4NB5 A;  3BVO A;  1M9N A;  2D2C B;  5LP6 A;  4TT3 G;  2XT9 A;  3DC5 A;  3L70 H;  3ABL C;  4TOI A;  4WF9 V;  2PYJ A;  2CDY A;  2CUG A;  1US6 A;  4FJC C;  3SYC A;  5JCO C;  1EM1 A;  2PF4 E;  3CSX A;  4EFB A;  1NI8 A;  4JI4 O;  1HNW O;  3HPL C;  3JAT B;  2BSK B;  1Y74 B;  3ZRW A;  2P06 A;  1QVF U;  4PDV A;  1F23 A;  2L35 A;  3D3I A;  2BE3 A;  1VEW A;  2UXD O;  2MW2 B;  5B1B B;  4JI4 B;  1HNW B;  1ZTE A;  3JD4 A;  1TUE B;  3OMN B;  1YI2 V;  1P49 A;  3UCS C;  3K03 A;  1NVP B;  2E76 B;  4B3R O;  1ARO P;  3MD0 A;  1MSD A;  2Y69 C;  4E4E A;  2ZDI C;  4JYC A;  1K8A W;  1J5E O;  2UXD B;  5GW7 A;  4DUZ B;  5FPR A;  1P7G A;  4TV9 A;  2UXN A;  4FFK A;  4JI0 B;  4JAS A;  2LQT A;  1FXK A;  4O4I A;  4CH5 A;  2LW7 A;  5LP6 C;  4B3R B;  1GM8 A;  3RYF B;  5B1O A;  2QM8 A;  1GM7 A;  4GX2 A;  2OCH A;  2WLK A;  1CXZ B;  5J9P C;  5HFM A;  1ZWI C;  3CX5 F;  4O4J A;  1J5E B;  2A79 B;  1V54 C;  2N05 A;  5B66 Z;  3K57 A;  3GWO A;  4EB6 B;  1K5Q A;  2UXX A;  3CRM A;  3JD1 A;  2JGU A;  1M90 W;  4NXN O;  3ZN0 A;  1MNG A;  1X4T A;  2UU9 O;  1N34 O;  2QM7 A;  1B3Q A;  4DV0 B;  1OJH A;  2ILM A;  4D6T H;  3ZS8 C;  1IBM O;  3ZHU A;  1H2N A;  5IYD O;  3OGC C;  1WNS A;  4NXN B;  1NQT A;  4DR1 O;  3QO7 A;  3ABT A;  1TAE A;  2OT5 A;  4I4T B;  2ITC C;  4BIZ A;  1B6Q A;  2X6B A;  1NJI W;  4J80 A;  4JI6 O;  4B3M O;  3CME V;  2QKA A;  1N34 B;  1OCC B;  2FKX A;  1OCZ C;  1IBM B;  5LHH A;  5LHG A;  5EK0 A;  2LFR A;  2N74 A;  2VS0 A;  4B08 A;  2YIB D;  4DR1 B;  1P4R A;  5B1A B;  1COW G;  4XDJ A;  3L75 H;  3OR7 C;  2A0L A;  3DGE A;  2HHH O;  5H2F Z;  3I5D A;  4JI6 B;  1OZ0 A;  5KHK A;  4B3M B;  3HKD B;  1NU1 H;  1PNL A;  3X2Q B;  3FYE B;  4H0L B;  3ASN B;  2GBO A;  2WLN A;  3ABM C;  1IBK O;  1UJW B;  3SR2 C;  1QR9 A;  1PKX A;  1K34 A;  4FVM A;  3EVK A;  3OEE G;  4TV8 A;  4B7E A;  2HHH B;  1KU9 A;  1ZL8 A;  4A5U B;  1YSC A;  1E1R G;  3L73 H;  4BW9 A;  1NH2 D;  1BL8 A;  4GKK B;  4UVC A;  2OYQ A;  4PV1 B;  4FM0 A;  1Q7Y W;  2DJV A;  1H8H G;  4WFA V;  2DW4 A;  2EIL B;  2EIN B;  4FK5 C;  1EN6 A;  2HJF C;  1R1B A;  2EIJ C;  3AK3 A;  1ZAU A;  2NR5 A;  1GN2 A;  1IVS A;  4NTY A;  1R6T A;  3EXA A;  2XAS A;  2QWN B;  3G4S V;  2JGD B;  2EJR A;  4K8X A;  1I7F A;  3WB2 A;  1QVG U;  2OWO A;  1MA1 A;  4UCV A;  4GX5 A;  4TSF G;  2HFE C;  3OEH G;  4K35 A;  4YIO A;  1JA8 A;  3OT7 A;  3N2K A;  4GUN A;  3CCJ V;  4CZZ A;  5C8Y A;  3AG4 B;  3ASO C;  4DXW A;  1RPR A;  3TXS A;  3ZCC A;  2WLI A;  1WB8 A;  4GYC B;  4ZOL B;  5CA0 A;  3K58 A;  3ETE A;  3BY6 A;  4DK0 A;  2GTA A;  1K5S A;  4DV6 O;  1FKA O;  4U3F H;  5CB4 A;  1XBL A;  4JZG A;  1W59 A;  2NN4 A;  1H38 A;  2BOC C;  4DV6 B;  1GO3 F;  4TQF A;  1MMM A;  3ZRV A;  4DRX A;  2WAM A;  1GM9 A;  3LDC A;  2UUA O;  4IHJ A;  3F7Y C;  4YJ2 A;  2GUZ A;  5IWA O;  4PDR A;  5L3G A;  5HFL A;  2NNU A;  2WWW A;  2WPD G;  3DSQ A;  1RSO A;  3H1H H;  3C3S A;  4TQD A;  3CC7 V;  5K1X A;  1XOU A;  3CCE V;  1CEZ A;  1FD9 A;  1B06 A;  2EJ7 A;  4J7J A;  2UUA B;  1IZ3 A;  2AZ2 A;  5IWA B;  1BMF G;  2DYS B;  3CCU V;  3FAV A;  1KC8 W;  4N23 A;  3MDS A;  5B3S C;  5KX5 A;  2ZT9 B;  2AW9 A;  3I55 V;  1ROP A;  3JAS A;  4I5S A;  4JI8 O;  1U97 A;  5DED A;  4MVO A;  4JTA B;  3E8F A;  1YVW A;  4JZ2 A;  3RGB A;  4QPK A;  2Y4U A;  4ZKI A;  1KMI Z;  1ZSP A;  4LF7 O;  3BA9 A;  2CTP A;  2XAQ A;  2GTS A;  1OCO C;  1AI5 A;  4MTF A;  3SPI A;  2F95 B;  1OCR C;  2FL4 A;  1IUR A;  1UPG A;  1VQK V;  4J7Z A;  4N21 A;  3T2M A;  3ABK C;  4JI8 B;  1BZK A;  2DYR C;  1AIL A;  2LFS A;  1YCI A;  4LF7 B;  4CBC A;  4DR3 O;  2GHY A;  1VQN V;  1EBO A;  2QA4 V;  1AI7 A;  5IJ9 B;  3SDL A;  2PI4 A;  4F6E A;  1SET A;  2RJZ A;  3U11 A;  2M7W A;  3SGI A;  2R72 A;  2BSK A;  3WG7 C;  4KFM A;  4TWK A;  1JR9 A;  1VF5 B;  5A2Q N;  4UVB A;  1SER A;  3JSL A;  4DR3 B;  2ODM A;  2YI9 A;  1QQC A;  3JAL B;  2AGA A;  5IY5 C;  3AEI A;  3RN4 A;  4K0K O;  3U10 A;  2JEU A;  1W0J G;  1BQ0 A;  3B40 A;  2QWO B;  4KL1 A;  3W7X A;  3THO A;  3CXH F;  1NVP D;  4JYA O;  3VQW A;  3AG2 C;  5KAI Z;  3AG3 B;  3LDE A;  3D8C A;  2F4V O;  1BHA A;  3ETG A;  2Z3Y A;  1NKD A;  4MTG A;  4FZ1 A;  3CP1 A;  4K0K B;  1K4D C;  1QBZ A;  3H01 A;  3H1L H;  4X1K B;  2JS3 A;  3TCU A;  3RYF A;  5FL7 G;  3CMA V;  4JI2 O;  4DK1 A;  2F4V B;  2BCC H;  3HKE B;  3LNN A;  3AG7 A;  1F7Y A;  1VQ9 V;  4JI3 O;  2G38 A;  3FD9 A;  2K1E A;  4IIJ A;  4EB6 A;  1VQ5 V;  4J10 A;  3GWK C;  4AI8 A;  2Q8V A;  4QGP A;  3OMA B;  4JI2 B;  4RO2 A;  2DOS A;  4JI3 B;  2IH1 C;  5CA0 B;  1YXB A;  1YDX A;  2QJ1 A;  2RCV A;  5B1B C;  2ZIM A;  2EIK B;  3APQ A;  5EIB D;  4LFC B;  3ZMS A;  2ADQ B;  4PDL A;  4X1Y B;  1XNQ O;  4X66 O;  5L3D A;  4I4T A;  1Y76 B;  1AR5 A;  4WFB V;  3OTO O;  2W0F C;  2LW1 A;  3M99 B;  4QE7 A;  3K5M A;  1JX9 A;  2A06 H;  2OCC B;  2XAJ A;  1V9P A;  1KEC A;  3ICX A;  2PUS A;  1G4Y B;  4X65 B;  1XNQ B;  4X66 B;  2F43 G;  5LGU A;  3ZN1 A;  3OTO B;  2YS8 A;  4R8C A;  1KD1 W;  3HKD A;  2AXT Z;  1JJ2 U;  3LSS A;  3CPW U;  3GVM A;  5C93 A;  2RNB A;  2CTR A;  3K0G A;  2P4K A;  2ZIO A;  4YY3 O;  2JEX A;  1FXV A;  2Q9L A;  4MVU A;  4PA7 A;  4HNA B;  2ZCE A;  4R7C A;  3K5N A;  1SQX H;  1Z5W A;  2B1I A;  3KCX A;  1O9H A;  2YXL A;  2IJI A;  3PJS K;  2EX3 A;  2YI8 A;  4ICG A;  1K7D A;  3K06 A;  1BS3 A;  5EIB C;  4YY3 B;  3O9O A;  3QNE A;  4UCO A;  1K9M W;  3OM3 B;  3UO3 A;  2UUC B;  4IYI A;  2QGN A;  1LR1 A;  1THZ A;  1OCC C;  3CYO A;  1T5E A;  3K9S A;  4J7K A;  5LXT B;  3F7V C;  4B7K A;  1MAB G;  3G80 A;  3A0R A;  1JOY A;  2JGD A;  3JAW B;  4GX0 A;  1RP3 B;  3BA8 A;  5B1A C;  3CRA A;  2EUL A;  1XQ8 A;  1YJW V;  3E8B A;  4W4L A;  1VQL V;  1Q6I A;  3X2Q C;  4FLT A;  1VF6 C;  3ASN C;  3JAM N;  4UV9 A;  3QG5 A;  4BIO A;  4CS3 A;  1KBH A;  3CB2 A;  4G28 B;  1NT2 B;  1PPJ H;  3CRC A;  1N8R W;  4LF8 O;  2LGW A;  5K1P A;  2CTQ A;  4ZOL A;  1PP9 H;  2VQE O;  4PI2 A;  5IJ0 B;  1RFY A;  1I0H A;  2ADP A;  4DUZ O;  3IAY A;  1WP8 A;  1IDS A;  4JI0 O;  2KB1 A;  3SJC C;  4LF8 B;  2ZE8 A;  3P3P A;  2EIL C;  4NR1 A;  1NS1 A;  3LSQ A;  3FB6 C;  2EIN C;  4MVM A;  2XAG A;  2VQE B;  1XMO O;  4MTO A;  5A9G A;  2ZNJ A;  2CAZ C;  4L8J A;  2CK3 G;  1VIB A;  5KAF Z;  2XOK G;  2EZO A;  1YIJ V;  2Y48 A;  4EKW A;  4UB8 Z;  3WFV A;  3ZMZ A;  3RW0 A;  4I0X B;  4J42 A;  1MZF A;  3M8A A;  3E83 A;  1XMO B;  2KQX A;  2IJK A;  3SJA C;  4EEQ A;  5EBM C;  3CRR A;  2QR4 A;  1Y67 A;  2YUA A;  2E74 B;  3SPJ A;  5L3F A;  4FLY A;  4DV0 O;  4QPJ A;  4X88 A;  3H1I H;  4ZI7 B;  4IIJ B;  3AG4 C;  1AP6 A;  1Y4M A;  3VQX A;  1NR7 A;  5GON B;  4FLV A;  2F1M A;  4NVP A;  1E79 G;  3JYC A;  1N32 O;  2YXH A;  3ML0 A;  1Q3E A;  3RWR D;  4UCT A;  2V7Q G;  3H1J H;  4F6R A;  3OGI B;  3L74 H;  3OUF A;  2XTA A;  5E1A C;  3K3W A;  4FMT A;  1HNX B;  1YTF B;  2YIC A;  1N32 B;  3A0H Z;  5JH7 B;  3TJT A;  5LGT A;  5KHG A;  2X0L A;  1D2D A;  2MK3 A;  5KA5 A;  2P6J A;  1EN5 A;  4YJ3 A;  2CTW A;  3ZRX A;  1R3L C;  1FXK C;  3STL C;  2ZQM A;  4LNU B;  2Q7G A;  2V4D A;  5KUM A;  2HKO A;  1URF A;  5IJ9 A;  5KHJ A;  2DQ3 A;  3W7W A;  5F2V O;  4DR4 O;  2QKC A;  1WPX A;  1M1K W;  4X1I A;  4PD4 F;  2GV9 A;  2B9Z A;  4GKK O;  5JWP A;  3A8T A;  2DYS C;  2R9A A;  3RT3 C;  1TA8 A;  3JAL A;  1F4N A;  5BMV B;  2PY5 A;  4LR3 A;  3EFF K;  4WFH A;  3SYQ A;  2RMK B;  4DR4 B;  1S0V A;  2EIM B;  1JJO A;  1XEQ A;  3JD3 A;  3TGU H;  1V55 B;  4MSW C;  1XIL A;  3B8N A;  2IM9 A;  5H6Q A;  3OAA G;  3S3W A;  4FIP C;  3ZHS A;  4E2L A;  2Q6A A;  1U96 A;  4DR2 O;  4QJF B;  2YIA A;  3QO8 A;  1Q43 A;  4X1K A;  1VQO V;  3E8H A;  4PA3 A;  4ASU G;  3B4S A;  4RAI A;  1NBM G;  1Q81 W;  3ZX6 A;  3JSN A;  4X62 O;  1GH6 A;  2HJD A;  3ETD A;  4UVA A;  3J81 N;  3HKE A;  1VP7 A;  4BAY A;  4DR2 B;  1PL4 A;  5FLX N;  3ABU A;  1K4C C;  2Q0A A;  1SA0 B;  4QE9 A;  3E35 A;  5JQG B;  1FFX A;  4EFE A;  5IYC O;  2Z5U A;  2VRZ A;  5LGN A;  4X62 B;  2LO1 A;  4UCU A;  3CCS V;  3JAK B;  1JCH A;  1HW7 A;  2X6A A;  1GTO A;  4GX1 A;  1BT8 A;  1UFI A;  2PTM A;  2P90 A;  1KYO F;  2PZS A;  4AHC A;  5BZB A;  1I5X A;  4PI0 A;  4LCU C;  1CP9 A;  5LA6 B;  4X1Y A;  1AP5 A;  3T1H O;  1Y76 A;  2LJ2 A;  4RUE A;  5GTI Z;  3R66 A;  1AR4 A;  3AG3 C;  4JV5 B;  3D36 A;  1SZX A;  3BEH A;  2HR3 A;  4HAM A;  4LFA O;  1I94 O;  3TK1 A;  1ZUQ A;  1BHB A;  1WA8 B;  1SRY A;  4UFZ A;  1N33 O;  4NTX A;  2NLJ C;  3D3Q A;  3T1H B;  1M4U A;  3SYP A;  1KUQ A;  2XUM A;  4Q20 A;  4Z1M G;  1XDC A;  1P84 F;  2IU0 A;  1QU7 A;  1WPB A;  3RFR A;  4LFA B;  1G8M A;  4JI7 O;  1I94 B;  4LH7 A;  3T4Z A;  5DN6 G;  1DK1 A;  1Q86 W;  3G67 A;  1N33 B;  3E22 A;  1W0K G;  1NTM H;  4HNA A;  3MAQ A;  1FXH A;  2JS5 A;  1K3E A;  4OGQ B;  3A0B Z;  2Q7H A;  4FZ0 A;  2YEV B;  2D3O W;  4JI7 B;  1K33 A;  4CS2 A;  4X20 B;  1Q82 W;  2EIK C;  1QR8 A;  4F6R B;  2GSM B;  1BE3 H;  2ZE5 A;  2IJJ A;  4BW5 A;  2CE4 A;  2YC0 A;  3D36 C;  3OD4 A;  5LXT A;  3C3T A;  5KMG B;  4WFF A;  4DV5 O;  3IGA C;  3JAW A;  1Q5O A;  2OCC C;  4RUF A;  1I08 A;  5CBG A;  2P7T C;  4UUJ C;  1I5Y A;  2C2A A;  3CEI A;  4YJ3 B;  1SQF A;  2ZM6 O;  2KG7 B;  1MSW D;  1JFF B;  2Y0P A;  4MT8 A;  1TGO A;  3M7M X;  4CH6 A;  3OR6 C;  4R6Z A;  4GKJ B;  4ZIB A;  4DV5 B;  2QSA A;  1XMQ O;  5AG2 A;  5KHI A;  5J2U B;  2UXC O;  4X1I B;  4PA6 A;  3OE7 G;  1HP8 A;  2CGO A;  4BR6 A;  2CH7 B;  4H33 A;  1BGY H;  2ZM6 B;  3CCM V;  1D5N A;  5IJ0 A;  1MOF A;  1DTO A;  1XMQ B;  5FPO A;  2OIG A;  2WLJ A;  1Y6X A;  4O2A B;  3NR7 A;  1H2M A;  3WB0 A;  2UXC B;  1BCC H;  5EYP B;  4P9P A;  1SQP H;  2R70 A;  4BWA A;  2H3O A;  1OHH G; 
#chains in the Genus database with same CATH homology
 4AQY O;  2UXB O;  1F7Y A;  1N36 O;  4JI3 O;  1DK1 A;  3J80 N;  4DV0 O;  1IBM O;  4LF7 O;  4DUY O;  2VQF O;  1AB3 A;  4DV3 O;  4DR2 O;  4OPH A;  4DR1 O;  2UUC O;  2UUB O;  4YHH O;  4JI4 O;  1HNW O;  1FJG O;  4JI6 O;  4B3M O;  2DOS A;  4LFB O;  1N32 O;  1AIL A;  4X62 O;  2Z0A A;  2FKX A;  3J81 N;  1G1X B;  1HR0 O;  5LMU O;  4KHP O;  2N74 A;  4DR3 O;  4DV6 O;  5BR8 O;  5FLX N;  2UXD O;  1FKA O;  5LL6 Y;  4JI5 O;  3F5T A;  4LFC O;  3JAM N;  2JRI A;  4X66 O;  1XNQ O;  2HHH O;  4DV2 O;  3SDL A;  3OTO O;  4DV5 O;  4JI1 O;  4B3S O;  1HNX O;  2E5L O;  4B3R O;  3J7A U;  4DR6 O;  4LF8 O;  1FYJ A;  1D2D A;  1IBK O;  4DV7 O;  2VQE O;  5BXZ A;  5A2Q N;  5LMN O;  4LF6 O;  4LF5 O;  1J5E O;  1HNZ O;  2ZM6 O;  2AGA A;  2UUA O;  5H5N A;  5IWA O;  4OPA A;  4DUZ O;  5BY1 A;  4NXM O;  4DR7 O;  1X59 A;  3O65 A;  4K0K O;  4A5U B;  4X65 O;  4JI0 O;  3T1H O;  1XMQ O;  1YZB A;  2LW7 A;  1IBL O;  4GKJ O;  3R66 A;  4DR4 O;  1NS1 A;  2UXC O;  4B3T O;  4DV1 O;  4GKK O;  1XMO O;  2DJV A;  4JYA O;  4LFA O;  4JV5 O;  4LF4 O;  4YY3 O;  1I94 O;  4X64 O;  4DR5 O;  2F4V O;  3RT3 C;  1R1B A;  1N33 O;  4DV4 O;  1R6T A;  2ZKO A;  4LF9 O;  4NXN O;  5IT9 N;  4JI7 O;  1KUQ A;  3M8A A;  1A32 A;  4JI2 O;  1XEQ A;  3T1Y O;  2UU9 O;  4JI8 O;  1N34 O;  1XNR O;  4OX9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...