2N74A

Solution structure of the rna-binding domain of non-structural protein 1 from the 1918 h1n1 influenza virus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Non-structural protein 1
publication title Structural Basis for a Novel Interaction between the NS1 Protein Derived from the 1918 Influenza Virus and RIG-I.
pubmed doi rcsb
source organism Influenza a virus
total genus 21
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2n74A00
4DV0O 5LMNO 4DV7O 3O65A 3OTOO 4OPHA 4NXMO 1J5EO 4JV5O 4JI6O 1R6TA 4B3TO 4DV2O 4JYAO 4DV4O 2UXDO 4DR7O 3R66A 4LFCO 1N34O 3M8AA 1FJGO 1HNXO 4LFAO 2ZM6O 3T1HO 3T1YO 5FLXN 4DR1O 4JI2O 1DK1A 4X66O 4NXNO 1XMOO 4DR4O 5BY1A 4B3RO 5IWAO 1AB3A 4X62O 1IBLO 4OX9O 3JAMN 2ZKOA 2FKXA 4JI7O 4LF6O 4LFBO 2N74A 1N32O 2VQEO 1FKAO 4LF9O 4YHHO 4OPAA 2UU9O 4LF7O 3J80N 1N33O 4A5UB 4YY3O 4LF8O 4LF5O 3RT3C 2LW7A 4DR2O 2UXBO 5BXZA 5LL6Y 4DV5O 1N36O 1YZBA 4JI5O 2HHHO 1XNRO 1R1BA 1I94O 1X59A 5H5NA 4X65O 1KUQA 4KHPO 4B3SO 4DV3O 2VQFO 1HR0O 4DUYO 1XMQO 2DOSA 1XEQA 4LF4O 1FYJA 3SDLA 5IT9N 1D2DA 1IBMO 2E5LO 1HNWO 4X64O 2UUAO 2Z0AA 4B3MO 5LMUO 3F5TA 4JI1O 2UUBO 4JI4O 4DV6O 2DJVA 1NS1A 4DR6O 1G1XB 5BR8O 1F7YA 1AILA 2UXCO 5A2QN 4DV1O 3J7AU 4JI0O 1IBKO 4JI8O 4K0KO 2F4VO 3J81N 2AGAA 1A32A 2JRIA 4DR5O 4GKKO 1HNZO 4JI3O 4AQYO 4GKJO 1XNQO 2UUCO 4DUZO 4DR3O
chains in the Genus database with same CATH superfamily
5LMNO 3HKBA 5IY5C 5K1PA 4LC1A 1FXHA 1HWYA 2EIMC 4FM2A 1LNQA 1H8EG 4JYAO 1FXKC 2IU3A 1ZL8A 5JQGB 1WPBA 4I55A 4LNUA 2DW4A 3SGIA 1B04A 2C2AA 4TV8B 4N21A 3AG4C 3HKBB 3K5NA 3JASA 1IXMA 1XNQB 2FKXA 2B1GA 4LFBO 3VQVA 4JI7B 4QE9A 3CRMA 1R6NA 1ZL8B 2JGUA 5GONA 2ZCEA 2EJ7A 4I55B 3N2KA 4DR7B 2QSAA 3JASB 4O2BB 4FJCC 3A0BZ 4UB6Z 2WA3A 2PUSA 4DR4B 4I0XA 1Y76A 1K5SA 1IBLB 4YXWG 5D5QA 2JJ1G 3RYIA 1GK9A 3H1IH 3CCSV 3N2KB 5LOVA 2BOCC 3QVNA 1G6UA 2UUAO 4BIOA 1DF4A 2OCCC 1BZKA 4MW8A 4ZI7B 1I5YA 2WPDG 5CN0A 5C8YA 1Y76B 3CC7V 1KQSU 4CH3A 3EFFK 1SQFA 4RQEA 2LW1A 3ASNC 4IIJB 5B66Z 4X1KB 1U96A 1I08A 3G80A 4BAYA 1JPXA 2ZD9A 3ZN0A 3JSNA 5L3DA 1LR1A 2CTQA 3G67A 5C8YB 5FPOA 1IBMB 4TUYA 2HEPA 2H8PC 5GTHZ 3CCLV 1KYOF 4K8XA 1VQOV 2GBOA 1XNQO 4TQFA 2ATKC 2F95B 2GTSA 3OAAG 1GN3A 4LH6A 2QEXV 4QPJA 1SRYA 3ZHTA 1Y66A 1XI1A 3C3SA 1H2MA 2ZQMA 4N23A 4QE7A 2QKCA 3OMAB 2YXHA 4DR7O 1EZVH 1Y4MA 2M7WA 2MK3A 2AW9A 4K0KB 4NVPA 4DR4O 4YJ3B 3ZHQA 1IBLO 4GKJB 2EINB 3U0ZA 4ZOLB 2OWOA 4YJ2A 2ZKOA 1DF5A 5KAIZ 4FK5C 4WFEA 3ZRWB 3IAYA 1IXBA 3ZIAG 4OPAA 1H2LA 1M1KW 1NVPB 1Q6IA 1TUEB 4P2ZA 2R9RB 1JJ2U 1BL8A 3L74H 3BEHA 1FJGB 1TUBB 4JTDB 3T1HB 4JI2B 3CXHF 1L8DA 3IFXA 2XT9A 3A2FA 3UQ8A 5H2FZ 3JATA 2HVKC 1E79G 2B1IA 3ZJZA 1SKVA 4WFGA 1D5AA 3B77A 2YIAA 1M4UA 1IBMO 1R3JC 1Z5WA 2W0XA 4I50A 5KUKA 3CCQV 3K9SA 3JATB 2DJVA 2D3OW 2YEVB 5B1BC 3GWKC 1BHBA 5H6QA 5FPRA 5HFMA 4DUYB 2BSKB 4I50B 4K0KO 1VIBA 1TVKA 1NJIW 3OW2U 3ZHSA 4Q20A 4GKJO 1P49A 1I5XA 4I9WA 4UCTA 2Y0PA 4FZ0A 5LBQA 2ZDIC 3K5MA 3F7VC 1OCOB 2JGDA 3E89A 3D3QA 2WLLB 4AILC 2HR3A 3VOUA 3CRAA 2X6CA 3K5LA 4W4LA 1GO3F 1FJGO 1NKDA 1PNKA 1QCEA 3T1HO 4JI2O 1JFFA 2DYRB 1IURA 1RPRA 3OR7C 5E79Z 4JAUA 3EXAA 2Q7GA 3QO8A 4LBEC 3JD4A 2ZE8A 3FAVB 2KG7B 3L73H 2A06H 3TJTA 4J9YB 1YJ9V 1F23A 3J80N 2LQTA 3JD3A 3SYAA 3HKDB 2RCVA 3UM7A 4ICGA 4EKWA 4QGPA 5LL6Y 3L72H 1TAEA 1GN2A 2BTQA 2LFSA 3QTCA 1W59A 4G27B 3ZRVA 1N4CA 4J11A 4LP8A 4DUYO 4I9QA 2DOSA 3RVYA 1IVSA 1D2DA 2GSMB 3K5OA 3F7YC 1H8HG 3JAKA 3SR2C 1J95A 1Y6XA 2L35A 5EYPA 2PGGA 2BTQB 1JR9A 5L3CA 2YUAA 1TGOA 2ADQB 1ZLZA 5B1NA 1KC8W 5L3FA 1N8RW 3ABUA 1FPOA 3SJBC 4F6RB 1I94B 3JAKB 1SQBH 4J41A 2VQFB 1XMQB 1K97A 1Q5OA 1SETA 3LUTB 2X6AA 5K1XA 2QWQB 4FM1A 3QF7A 1AR1B 3CCVV 3G4SV 4JI4B 2HP8A 2RDCA 1MZFA 1E1RG 5B1AB 3RYFB 2CTWA 1SESA 4FFKA 1WP8A 1KU9A 4PD4F 4K35A 4DV1B 1OV9A 1B3QA 5LXTA 5KMGA 2QR4A 4JI8B 4JYYA 1WB8A 2WAMA 5FLXN 2XTAA 3LSSA 1O9GA 2F23A 2IJKA 4JI3B 4CH4A 1KP2A 4MT8A 3ETQA 5CB4A 2UUCB 4DUZB 3OD4A 4NKGB 4UCRA 5LXTB 4HZ3A 2Q9LA 4HBNA 1EFRG 2JIZG 3JARA 3GVMA 1EN4A 1SS3A 3K0DA 4JZ2A 1N34B 1AI4A 3RYCA 1ENVA 5CB4B 4PELA 4NXNB 4RAIA 2HKOA 3ETDA 1XQ8A 4MSWC 1FXKA 1I94O 3MHSC 4X62B 2YXYA 4BIZA 4OX9B 3ZX6A 2FB5A 3JD2A 5LP6B 3VQWA 2VQFO 1XMQO 4UCVA 5J2TA 4GLXA 1Q90D 5IY5B 3K06A 1XHZA 5IE9A 1SQQH 2EIMB 4J7ZA 5LYJB 1FXKB 2AZ2A 4JI4O 4D7TA 4FIPC 5JVDA 2HLDG 1OZ0A 1F4NA 1N36B 1XREA 5J2TB 3K9AA 2HVJC 3AG4B 3TXQA 3VQYA 4DV1O 4I5SA 3ZRXA 1V55C 1GN6A 1HR0B 3J7AU 2Y4TA 4JI8O 1GMGA 3OUFA 2DYRC 1ORQC 4PDLA 4JI3O 4U3JB 5JVDB 3WU2Z 2ADPA 2UUCO 4DUZO 4H0LB 2VS0A 3SPCA 2GUZB 2ZT9B 3SJAC 3HKCA 5KLVH 4O2AA 4ZKIA 1KBHA 2CH7A 1N34O 3IJ4A 5CBHA 1S77D 1NBMG 2W6JG 3OE7G 2IU0A 4NXNO 3E35A 2EIKB 4X62O 1H38A 3I56V 4OX9O 2OCCB 2AXTZ 4W4KA 1AJQA 3P3NA 1CEZA 4DR3B 2Y0IA 4HNAA 3LNMB 2IJHA 4AHCA 2VRZA 3APOA 2AZ0A 3ASNB 1QVGU 3CMAV 4X1IA 1CP9A 4KXRA 4H33A 1YIJV 2PYLA 1I7FA 1DLBA 2WLJA 4X1YB 2RJZA 1BMFG 3CE2A 3SYQA 1N36O 1WA8B 2XHBA 4DR1B 3JAWA 1ZX3A 2WSSG 3E86A 1HR0O 1B06A 1CPYA 4X1IB 3SDLA 2RMKB 1OCZC 2VWJA 1VF6C 3K59A 2QM7A 1US6A 1L1FA 3OGIB 4B3MB 1YHQV 1S72V 1MABG 1SC5B 2E3CA 2Q68A 4R7CA 4JPRA 4BW5A 3D3IA 1UJWB 1JMKC 3B8MA 3FD9A 1XNRB 1YF2A 2NNUA 1FAFA 2IBZH 4X20A 1GRJA 1QHTA 3JD1A 2EZPA 3SPGA 3LSQA 2UXNA 2Q8VA 1ZAUA 5LMUB 1GTOA 1XL4A 4UB8Z 2UUBB 1R73A 4DR3O 3CCJV 4NTWA 4I4TA 1AVMA 2IW5A 2N04A 2WLHA 1VMGA 2UXCB 4RUFA 4J7KA 1BHAA 1DGSA 2P7TC 5TISZ 4DR1O 4I4TB 1WJZA 5JQGA 3SYOA 1M93A 2YIBD 2YSUB 1ROPA 3DSQA 1COWG 3CSXA 4TV8A 4DV0B 3TXSA 1GM7A 1BT8A 1MZEA 2ZE6A 1R3KC 2WLKA 5EBWC 1NTZH 5B1BB 3ZMUA 2W6IG 4G2KA 3ZHVA 1BQ0A 4J42A 3JALB 4DV4B 5JJEB 2ZDIA 3CC2V 1MSDA 2XUMA 1XBLA 3T1YB 1NQTA 3PJSK 3TGUH 3FX7A 4O2BA 1XNRO 1X59A 5H5NA 5BMVB 1EM1A 5B1OA 3AG7A 3ASOC 1K33A 1K4DC 1M9NA 5EC2C 2VQEB 4F4LA 4MVQA 2JS3A 1YCIA 5LGUA 3CS5A 1SA0B 5LMUO 4J80A 2CTPA 2UUBO 3L71H 4WBNB 4H13B 2Q4PA 4FLWA 3ZHRA 4ZI7A 5IYZB 3OR6C 3H9VA 4JI5B 1F7YA 2UXCO 5BR8B 1AJPA 5KX5A 2JEXA 4X65B 3H1HH 1WP7A 4B3SB 4MTFA 4C7UA 3QNEA 3BA9A 5KHKA 1JCHA 2ODMA 4IIJA 4X1KA 4FM0A 1PL0A 3STLC 3E8GA 2EIKC 2LGWA 1UPGA 2ARHA 2ITCC 2Z5UA 1WB7A 2GTAA 5KA5A 1K34A 4CC6A 5CA3A 5KX5B 4DV0O 4RUEA 4CS4A 5KHHA 1AP5A 4J10A 1F51A 1LUVA 3ABLC 4DV4O 2QWPB 4L8JA 4BR6A 2QWOB 3M7MX 3PN1A 3T1YO 3ML0A 4DYLA 5DEDA 4ABMA 1NI8A 1M57B 3DC6A 1L0LH 4MTGA 4CC5A 3BA8A 1XOUA 4U3FH 4JI7O 4YJ3A 3E22B 2VQEO 4GX2A 2X6BA 3AK3A 1MMMA 1Z5VA 4ZOLA 4MVZA 3CRCA 5E1AC 4QPKA 3BVOA 4GX0A 3ZRWA 4IGGA 3E8FA 5LHGA 2H3OA 3RBZA 4JYCA 4UFZA 4DW0A 2DN9A 3CMEV 4JI5O 2YIBA 1L0NH 4X65O 1TUBA 3H01A 1QLEC 4B3SO 2PTMA 3AK2A 3N27A 5H9CA 1WAZA 4RO2A 3A8TA 4PA7A 4O4LB 1RPOA 4YHHB 4BWAA 2KB1A 3G6EV 1P7BA 2Y4UA 2ZNIA 3OT7A 2V7QG 2R70A 2H94A 4B7KA 1E1QG 3P3PA 2HHHB 1R3LC 1VF5B 3CJHA 1P84F 3U11A 4DV3B 1PM9A 2YEVA 2F66C 4IL6Z 2E5LB 3TK1A 3ABKB 2BSKA 4GKKB 2XAQA 1FFXB 1YVWA 3CJHB 4KFMA 5GW7A 4DV6B 4IT5A 4DR6B 3U10A 4MTOA 3T4DA 2OTLV 3VQXA 1D5NA 2GHYA 3O9OA 1VQMV 1V54B 2FL4A 2CDYA 2WLLA 4UVCA 3AG1B 4QJFB 2X7RB 3UO2A 3ZMZA 3H1KH 3WFVA 3E8HA 1Z2GA 2R9AA 3GWOA 5FL7G 3JYCA 2QGNA 3RFRA 2K9PA 3W7XA 3WG7C 2OIGA 2A0LA 2JK5C 3MD0A 4YHHO 3ETGA 1NTKH 1NZ6A 2A7WA 2G38A 3RWRD 3FAVA 4NXMB 2KG7A 3CCRV 1FFTB 1JJOA 4LFCB 1V55B 3JCZA 2A9HA 3HKDA 1RM1C 4TOIA 4X9QA 3W7UA 3CXCU 4PJ0Z 3FKSG 5EBMC 1VQKV 2HHHO 2DQ3A 4B3RB 2P22C 2BOBC 2ITDC 3QO7A 4DV3O 4LF6B 1Q6HA 1K5QA 3RVZA 3MDSA 1M56C 2E5LO 4JZGA 4U7NA 1ZSPA 3JD0A 1FS0G 5DM6V 1K4CC 1WLEA 3STZC 3I5DA 2IJJA 4DV6O 2EIJC 4DR6O 1G1XB 4L87A 1QLNA 3FFQA 3KCYA 3B8NA 1VP7A 1VQ9V 4FVMA 4EEQA 2Q0OC 4F6RA 2M6YA 1M57C 3HKEB 4CS2A 3I55V 1AI7A 1VQNV 5LHHA 1Q81W 1GM8A 1VF6A 3FB6C 2XAHA 4LH7A 4FFBB 4NXMO 1OCRB 2NR5A 1Q82W 3RYFA 1SQPH 4LFCO 5L3EA 2EILC 1DK1A 1OCZB 4B3RO 1M90W 3RYHB 4JASA 2FYUH 5FNVA 4LF6O 1OHHG 4X89A 4UV9A 2P06A 1ZUQA 1YJNV 3SJQC 3D36A 4GX1A 2DE0X 2P90A 4DV2B 1K9MW 2OT5A 2Q0AA 2UXDB 2AHYA 4IYIA 3BY6A 4LFAB 2HJFC 5FNVB 2P4KA 1XMOB 2P6JA 2ZE7A 1MNGA 5ITZB 5J9PC 1TA8A 3IC7A 1VEWA 5LGNA 1XILA 2JEUA 5EIBD 5IDJA 3RW0A 1N0JA 1VQ5V 3ABKC 4E2LA 5LP6A 4P30A 3P30A 1VQ8V 4WFFA 5IYDO 3UT5B 4ASUG 3P32A 3K57A 4DK0A 3CEIA 5DN6G 5LYJA 4FZ1A 2B5UA 5DECA 1QQCA 2L6LA 3ICXA 3FB7C 1RP3B 2QWNB 1V54C 1OCCB 4LF4B 3AG1C 3OM3B 1MOFA 2A79B 3C90A 5LGTA 4X64B 5CBFA 1H2KA 1N0NA 2YI9A 1H2GA 5JH7B 4U3JA 1HDJA 5LA6B 3TETA 2OYQA 5B3SC 2BCCH 3E8BA 2MW2B 2GUZA 4WFHA 3ABMB 3CRQA 4DV2O 3BPZA 1VQPV 2UXDO 3K58A 4DRXA 3M8AA 3CX5F 3T2MA 3ASOB 4GX5A 4JI0B 2F4VB 4LFAO 3ZEDA 1H2SB 1LUWA 2E76B 3E2EA 1XMOO 1HNZB 1XHXA 4UXNA 1S0VA 2QTSA 4FMTA 4J9ZB 4DRXB 3WB1A 1K7DA 4B3TB 3THOA 2A3QA 2B9ZA 3OFNG 3B09A 2E75B 1SZXA 1Q86W 3B4SA 2XOKG 1R1BA 4X1YA 5IWAB 3K08A 4QNHB 1KUQA 1WA8A 3BCCH 4EB6B 2WA4A 4H44B 2DMXA 5KAFZ 4LF4O 3OUSA 4PI0A 4GUNA 3OGCC 2ETNA 5D5PA 1QU7A 4Q6GA 4ZHQB 1WNSA 2ZE5A 3CC4V 4X64O 5KHJA 4WFAV 3F5WC 2FTKA 1N33B 1QNMA 3ABLB 4LWSB 4KL1A 3S3XA 4EFBA 2HJDA 3R65A 4G28B 3AG2C 1F4MA 1YITV 2UXBB 1NS1A 4DV5B 3A0RA 2FMLA 1OCRC 1XDCA 1AJNA 3FYEB 3LDCA 1OJHA 1PNLA 3QG5A 3MAQA 1KKCA 4TWKA 4JI0O 2F4VO 1A32A 2O57A 1HNZO 3OEEG 5KA6A 4IYHA 4LCUC 3H1JH 3HPLC 3CHXA 1KKDA 4XDJA 5IJ9A 4CZZA 4OPHA 5F2VO 4B3TO 1ZTEA 1IX9A 3N2GA 1Y74A 1QLEB 2YXLA 3S3WA 1KMIZ 1WPXA 3ZN1A 1AR4A 3W7WA 2Y48A 3DXRB 4DO2A 3H1LH 5IWAO 5IJ9B 5JWPA 4D6TH 1QVFU 3BAAA 3K04A 3N2GB 1Y74B 2BE3A 4O4IA 4JAAA 4A5UB 4FLTA 1N33O 4JV5B 1YEWA 3WB2A 1GM9A 3K3WA 3SJCC 1GH6A 2OCHA 2RNBA 2UXBO 5BXZA 2Y69C 4JGSA 2LJ2A 4DV5O 3JALA 1YZBA 2W0FC 1OCCC 1PPJH 4CBCA 2Q7HA 4O4IB 1PV0A 2Q73A 2JVDA 4CS3A 4UVAA 5BMVA 4FLVA 5IT9N 4LF9B 3OEHG 2UU9B 4LF7B 4RWUA 1JA8A 4B3MO 2F93B 4MVSA 2UUAB 1JVMA 3T4ZA 5CA0B 2WLIB 2XNDG 1SA0A 1EN6A 1XUQA 3Q4HB 2PZSA 4PA3A 3ABMC 4WBNA 4TV9B 2VWKA 1NTMH 5IYZA 4KHPB 1K8AW 1KECA 3J81N 3BHPA 4K3AA 3WG7B 2HFEC 4H37A 3ETEA 2ZXWB 4PA4A 2CUGA 4DXWA 3OMIB 3O65A 3NR7A 4U7OA 1RM1B 4X88A 5JJNB 4JV5O 1S76D 1MA1A 4LNUB 3RN4A 3A0HZ 4MS2A 4Z1MG 2EJRA 1M56B 1MG1A 1CXZB 4DR5B 2YC0A 4AQYB 1M5IA 4MVMA 2PI5A 1Q43A 3JAMN 2CK3G 3ZMSA 1SERA 5GONB 1BQZA 1FKAO 4LF9O 4UCOA 2EIJB 2UU9O 4LF7O 3E22A 4B08A 1PKXA 1PD3A 3T1CA 3VBBA 3ABTA 3CYOA 4I0XB 3RT3C 4MVOA 4MTXA 3AG3B 2ZM6B 1KB9F 3RYIB 2R9IA 4RQFA 1S3JA 1Q3EA 2LO1A 1AROP 3IC9A 5LOVB 4KHPO 3OTFA 4PI2A 5J2UA 5H6RA 4GT1A 2ZIOA 2DYSC 2QM8A 2YS8A 3HR0A 4PA9A 4FLZA 2LGQA 5EBLC 5JCOC 1T5EA 4YY3B 5EIBC 4O4LA 3L70H 4UCUA 1G8MA 1R3IC 5J2UB 5BR8O 3TCUA 2EILB 1X4TA 1AILA 1K92A 1VQ4V 3DGEA 4TUYB 3BABA 3WB0A 3KKYA 1U97A 4X8AA 2XAFA 2ZIMA 5L3GA 4DR5O 3IGAC 4PA6A 1SQXH 4AQYO 4JI1B 3X2QC 2Q5ZA 3W7SA 1FFXA 5IYBO 1QR8A 2ZINA 1H2NA 2YICA 2P67A 4O4JA 3HB3B 3BFRA 1AI5A 1VQ7V 4UCSA 2ZM6O 4Z1VA 2F43G 1GN4A 4YJ2B 5BY1A 1P7GA 3ZBHA 1W0JG 2Z3YA 4DW1A 2CGOA 3K0GA 3KZIZ 4O4JB 1EZJA 5JJJB 2ZR2A 2OIEA 2JJ2G 3OTOB 4YIOA 4YY3O 2IH1C 5GTIZ 2XASA 1PP9H 3B40A 5B5EZ 2R72A 2ZR3A 5KHIA 2LW7A 3K79A 3AK1A 1HNXB 2P5OA 2NN4A 2AHZA 1NU1H 2DWEC 4JTAB 4K8ZA 2RN9A 1SQVH 3KCXA 5A9GA 1GKFA 2XAJA 4GYCB 4PDVA 4OGQB 2E74B 2ZXWC 5B3SB 3CP1A 4ZIBA 4P9OA 4JI1O 1VQ6V 3LSUA 4LF5B 1W2BU 1IDSA 3SPIA 3ZRSA 4XDLA 2GV9A 1P4RA 1VQLV 1NT2B 1V9PA 1RFYA 1TVKB 3UCSC 3APQA 1ZWIC 1O9HA 4PDMA 2LP7A 2IH3C 4XDKA 1FXVA 5IJ0A 1HNWB 4YIPA 4GKKO 2QKSA 2JGDB 3HKEA 4J7JA 1AI6A 3L9DA 3OTOO 2WLNA 4GCZA 3FB5C 1MSWD 1VF7A 1NR7A 5IJ0B 4JTCB 1KD1W 4ZBMA 2KKWA 1JFFB 3AG3C 1PL4A 1JX9A 4AI8A 4FFBA 1IBKB 4UUJC 2RQ6A 1HNXO 4GZRB 4UV8A 3G6BA 1QBZA 2HG5C 5EK0A 4TQDA 5C93A 3AG2B 4DV7B 3RYHA 2YI8A 5HFLA 2X0LA 4Z2WA 3ZS8C 2QA4V 3CPWU 1BSMA 1GAXA 4FLUA 4LF5O 3ZMTA 5EC1C 2CGNA 1WN7A 2YDEA 3DC5A 4NR1A 3UKMA 3DTUB 4FLYA 1AP6A 2QKAA 2Q6AA 1Q6UA 5ITZA 2CAZC 2Q69A 1URFA 2KQXA 2QJ1A 3SYCA 1FYJA 5EYPB 2N05A 1UFIA 2Q67A 1RSOA 2XAGA 1HNWO 4NTYA 4O4HA 1R6KA 2EINC 3F5TA 4FPPA 4HAMA 2JS5A 3LDEA 2P4VA 3UT5A 4E4EA 3CRRA 3E83A 1RSOB 5CA1A 2YIDA 4CH6A 3W7TA 4O4HB 4JYBA 2QDOA 4OXSA 1IBKO 1JOYA 2AGAA 1HP8A 3JSLA 2JRIA 1YI2V 4WCEV 4I7ZB 4CH5A 1YTFD 3OMNB 1JQ0A 5KUMA 3K03A 1KP3A 5CA1B 4JF3A 1HW7A 4LR3A 4DV7O 5L3BA 2Y69B 5JH7A 5KMGB 2DWDC 1Q8IA 2CE4A 4TSFG 5EZYA 2WLMA 1R6TA 5LA6A 2Q7EA 1PNMA 3R66A 3SPHA 4R50A 2EULA 2EX3A 4FLXA 1AB3A 1QR9A 4UVBA 4R8CA 5EZYB 2EZOA 2N74A 3JARB 4NB5A 3B2EE 1SZTA 3EHBB 4BW9A 3BRCA 3RYCB 1J5EB 4JI6B 1W0KG 4JAVA 4PDRA 4P9PA 3JCUZ 1OCOC 4X66B 1NH2D 1VARA 4MVRA 2EBOA 1Y67A 2V4DA 1N32B 1DTOA 4NYKA 4EB6A 2Z0AA 3CCMV 1FD9A 4LF8B 2KSDA 1EBOA 4ZHQA 4HYOA 3RGBA 4B7EA 3D8CA 4DR2B 2F1MA 4LWSA 4WF9V 5IYCO 3CD6V 3UO3A 1K73W 3CCEV 5A2QN 5AG2A 2PYJA 2OTJV 3NXSA 3KG2A 1YJWV 3CWBH 2IJIA 3LNNA 4TT3G 1S5HC 2PF4E 3CB2A 4PHZA 5CMUA 1THZA 4DK1A 3HKCB 1SF9A 3AEIA 1NR1A 1BS3A 4O2AB 1YDXA 1S5JA 1BGYH 2CH7B 5JCOA 3QO5A 1J5EO 4JI6O 3ZHUA 1BCCH 3MHHC 4BIUA 1IZ3A 3L75H 1Q7YW 4X66O 3M99B 2ZNJA 2DYSB 4HNAB 1AR5A 1I0HA 3DXRA 3ZCCA 2WWWA 4PV1B 4QIWF 4MW3A 2LFRA 1N32O 2D2CB 5LMNB 4WFBV 4R6ZA 3CCUV 2QE7G 3GB7C 4LF8O 1YTFB 4JYAB 2QM4A 3JAWB 5CBGA 2K1EA 4DR2O 5B1AC 3EVKA 2PY5A 3ZMVA 4IHJA 2IM9A 2BTOA 2UXXA 4D7SA 1XEQA 4LFBB 3X2QB 3SYPA 2CTRA 1YXBA 2V1DA 4KP4A 1XL6A 5KHGA 4XBFA 2JDIG 4KUMA 3D36C 4F6EA 1YSCA 4IHJB 1S5LZ 2QTOA 5LHIA 1G4YB 3SPJA 2PI4A 5CA0A 2WLIA 4X20B 2ILMA 3Q4HA 4EFEA 3FYIB 1SQGA 1K3EA 2QWRB 3G71V 2NLJC 1EN5A 4MVUA 4TV9A 3FB8C 2GDSA 1NH2B 3LDDA 1NVPD 4NTXA 3C3TA 5LP6C 1BE3H 5BZBA 2DQ0A 1B6QA
chains in the Genus database with same CATH topology
4DV0O 5LMNO 4DV7O 3O65A 3OTOO 4OPHA 4NXMO 1J5EO 4JV5O 4JI6O 1R6TA 4B3TO 4DV2O 4JYAO 4DV4O 2UXDO 4DR7O 3R66A 4LFCO 1N34O 3M8AA 1FJGO 1HNXO 4LFAO 2ZM6O 3T1HO 3T1YO 5FLXN 4DR1O 4JI2O 1DK1A 4X66O 4NXNO 1XMOO 4DR4O 5BY1A 4B3RO 5IWAO 1AB3A 4X62O 1IBLO 4OX9O 3JAMN 2ZKOA 2FKXA 4JI7O 4LF6O 4LFBO 2N74A 1N32O 2VQEO 1FKAO 4LF9O 4YHHO 4OPAA 2UU9O 4LF7O 3J80N 1N33O 4A5UB 4YY3O 4LF8O 4LF5O 3RT3C 2LW7A 4DR2O 2UXBO 5BXZA 5LL6Y 4DV5O 1N36O 1YZBA 4JI5O 2HHHO 1XNRO 1R1BA 1I94O 1X59A 5H5NA 4X65O 1KUQA 4KHPO 4B3SO 4DV3O 2VQFO 1HR0O 4DUYO 1XMQO 2DOSA 1XEQA 4LF4O 1FYJA 3SDLA 5IT9N 1D2DA 1IBMO 2E5LO 1HNWO 4X64O 2UUAO 2Z0AA 4B3MO 5LMUO 3F5TA 4JI1O 2UUBO 4JI4O 4DV6O 2DJVA 1NS1A 4DR6O 1G1XB 5BR8O 1F7YA 1AILA 2UXCO 5A2QN 4DV1O 3J7AU 4JI0O 1IBKO 4JI8O 4K0KO 2F4VO 3J81N 2AGAA 1A32A 2JRIA 4DR5O 4GKKO 1HNZO 4JI3O 4AQYO 4GKJO 1XNQO 2UUCO 4DUZO 4DR3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 O;  5LMN O;  4DV7 O;  3O65 A;  3OTO O;  4OPH A;  4NXM O;  1J5E O;  4JV5 O;  4JI6 O;  1R6T A;  4B3T O;  4DV2 O;  4JYA O;  4DV4 O;  2UXD O;  4DR7 O;  3R66 A;  4LFC O;  1N34 O;  3M8A A;  1FJG O;  1HNX O;  4LFA O;  2ZM6 O;  3T1H O;  3T1Y O;  5FLX N;  4DR1 O;  4JI2 O;  1DK1 A;  4X66 O;  4NXN O;  1XMO O;  4DR4 O;  5BY1 A;  4B3R O;  5IWA O;  1AB3 A;  4X62 O;  1IBL O;  4OX9 O;  3JAM N;  2ZKO A;  2FKX A;  4JI7 O;  4LF6 O;  4LFB O;  2N74 A;  1N32 O;  2VQE O;  1FKA O;  4LF9 O;  4YHH O;  4OPA A;  2UU9 O;  4LF7 O;  3J80 N;  1N33 O;  4A5U B;  4YY3 O;  4LF8 O;  4LF5 O;  3RT3 C;  2LW7 A;  4DR2 O;  2UXB O;  5BXZ A;  5LL6 Y;  4DV5 O;  1N36 O;  1YZB A;  4JI5 O;  2HHH O;  1XNR O;  1R1B A;  1I94 O;  1X59 A;  5H5N A;  4X65 O;  1KUQ A;  4KHP O;  4B3S O;  4DV3 O;  2VQF O;  1HR0 O;  4DUY O;  1XMQ O;  2DOS A;  1XEQ A;  4LF4 O;  1FYJ A;  3SDL A;  5IT9 N;  1D2D A;  1IBM O;  2E5L O;  1HNW O;  4X64 O;  2UUA O;  2Z0A A;  4B3M O;  5LMU O;  3F5T A;  4JI1 O;  2UUB O;  4JI4 O;  4DV6 O;  2DJV A;  1NS1 A;  4DR6 O;  1G1X B;  5BR8 O;  1F7Y A;  1AIL A;  2UXC O;  5A2Q N;  4DV1 O;  3J7A U;  4JI0 O;  1IBK O;  4JI8 O;  4K0K O;  2F4V O;  3J81 N;  2AGA A;  1A32 A;  2JRI A;  4DR5 O;  4GKK O;  1HNZ O;  4JI3 O;  4AQY O;  4GKJ O;  1XNQ O;  2UUC O;  4DUZ O;  4DR3 O; 
#chains in the Genus database with same CATH topology
 5LMN O;  3HKB A;  5IY5 C;  5K1P A;  4LC1 A;  1FXH A;  1HWY A;  2EIM C;  4FM2 A;  1LNQ A;  1H8E G;  4JYA O;  1FXK C;  2IU3 A;  1ZL8 A;  5JQG B;  1WPB A;  4I55 A;  4LNU A;  2DW4 A;  3SGI A;  1B04 A;  2C2A A;  4TV8 B;  4N21 A;  3AG4 C;  3HKB B;  3K5N A;  3JAS A;  1IXM A;  1XNQ B;  2FKX A;  2B1G A;  4LFB O;  3VQV A;  4JI7 B;  4QE9 A;  3CRM A;  1R6N A;  1ZL8 B;  2JGU A;  5GON A;  2ZCE A;  2EJ7 A;  4I55 B;  3N2K A;  4DR7 B;  2QSA A;  3JAS B;  4O2B B;  4FJC C;  3A0B Z;  4UB6 Z;  2WA3 A;  2PUS A;  4DR4 B;  4I0X A;  1Y76 A;  1K5S A;  1IBL B;  4YXW G;  5D5Q A;  2JJ1 G;  3RYI A;  1GK9 A;  3H1I H;  3CCS V;  3N2K B;  5LOV A;  2BOC C;  3QVN A;  1G6U A;  2UUA O;  4BIO A;  1DF4 A;  2OCC C;  1BZK A;  4MW8 A;  4ZI7 B;  1I5Y A;  2WPD G;  5CN0 A;  5C8Y A;  1Y76 B;  3CC7 V;  1KQS U;  4CH3 A;  3EFF K;  1SQF A;  4RQE A;  2LW1 A;  3ASN C;  4IIJ B;  5B66 Z;  4X1K B;  1U96 A;  1I08 A;  3G80 A;  4BAY A;  1JPX A;  2ZD9 A;  3ZN0 A;  3JSN A;  5L3D A;  1LR1 A;  2CTQ A;  3G67 A;  5C8Y B;  5FPO A;  1IBM B;  4TUY A;  2HEP A;  2H8P C;  5GTH Z;  3CCL V;  1KYO F;  4K8X A;  1VQO V;  2GBO A;  1XNQ O;  4TQF A;  2ATK C;  2F95 B;  2GTS A;  3OAA G;  1GN3 A;  4LH6 A;  2QEX V;  4QPJ A;  1SRY A;  3ZHT A;  1Y66 A;  1XI1 A;  3C3S A;  1H2M A;  2ZQM A;  4N23 A;  4QE7 A;  2QKC A;  3OMA B;  2YXH A;  4DR7 O;  1EZV H;  1Y4M A;  2M7W A;  2MK3 A;  2AW9 A;  4K0K B;  4NVP A;  4DR4 O;  4YJ3 B;  3ZHQ A;  1IBL O;  4GKJ B;  2EIN B;  3U0Z A;  4ZOL B;  2OWO A;  4YJ2 A;  2ZKO A;  1DF5 A;  5KAI Z;  4FK5 C;  4WFE A;  3ZRW B;  3IAY A;  1IXB A;  3ZIA G;  4OPA A;  1H2L A;  1M1K W;  1NVP B;  1Q6I A;  1TUE B;  4P2Z A;  2R9R B;  1JJ2 U;  1BL8 A;  3L74 H;  3BEH A;  1FJG B;  1TUB B;  4JTD B;  3T1H B;  4JI2 B;  3CXH F;  1L8D A;  3IFX A;  2XT9 A;  3A2F A;  3UQ8 A;  5H2F Z;  3JAT A;  2HVK C;  1E79 G;  2B1I A;  3ZJZ A;  1SKV A;  4WFG A;  1D5A A;  3B77 A;  2YIA A;  1M4U A;  1IBM O;  1R3J C;  1Z5W A;  2W0X A;  4I50 A;  5KUK A;  3CCQ V;  3K9S A;  3JAT B;  2DJV A;  2D3O W;  2YEV B;  5B1B C;  3GWK C;  1BHB A;  5H6Q A;  5FPR A;  5HFM A;  4DUY B;  2BSK B;  4I50 B;  4K0K O;  1VIB A;  1TVK A;  1NJI W;  3OW2 U;  3ZHS A;  4Q20 A;  4GKJ O;  1P49 A;  1I5X A;  4I9W A;  4UCT A;  2Y0P A;  4FZ0 A;  5LBQ A;  2ZDI C;  3K5M A;  3F7V C;  1OCO B;  2JGD A;  3E89 A;  3D3Q A;  2WLL B;  4AIL C;  2HR3 A;  3VOU A;  3CRA A;  2X6C A;  3K5L A;  4W4L A;  1GO3 F;  1FJG O;  1NKD A;  1PNK A;  1QCE A;  3T1H O;  4JI2 O;  1JFF A;  2DYR B;  1IUR A;  1RPR A;  3OR7 C;  5E79 Z;  4JAU A;  3EXA A;  2Q7G A;  3QO8 A;  4LBE C;  3JD4 A;  2ZE8 A;  3FAV B;  2KG7 B;  3L73 H;  2A06 H;  3TJT A;  4J9Y B;  1YJ9 V;  1F23 A;  3J80 N;  2LQT A;  3JD3 A;  3SYA A;  3HKD B;  2RCV A;  3UM7 A;  4ICG A;  4EKW A;  4QGP A;  5LL6 Y;  3L72 H;  1TAE A;  1GN2 A;  2BTQ A;  2LFS A;  3QTC A;  1W59 A;  4G27 B;  3ZRV A;  1N4C A;  4J11 A;  4LP8 A;  4DUY O;  4I9Q A;  2DOS A;  3RVY A;  1IVS A;  1D2D A;  2GSM B;  3K5O A;  3F7Y C;  1H8H G;  3JAK A;  3SR2 C;  1J95 A;  1Y6X A;  2L35 A;  5EYP A;  2PGG A;  2BTQ B;  1JR9 A;  5L3C A;  2YUA A;  1TGO A;  2ADQ B;  1ZLZ A;  5B1N A;  1KC8 W;  5L3F A;  1N8R W;  3ABU A;  1FPO A;  3SJB C;  4F6R B;  1I94 B;  3JAK B;  1SQB H;  4J41 A;  2VQF B;  1XMQ B;  1K97 A;  1Q5O A;  1SET A;  3LUT B;  2X6A A;  5K1X A;  2QWQ B;  4FM1 A;  3QF7 A;  1AR1 B;  3CCV V;  3G4S V;  4JI4 B;  2HP8 A;  2RDC A;  1MZF A;  1E1R G;  5B1A B;  3RYF B;  2CTW A;  1SES A;  4FFK A;  1WP8 A;  1KU9 A;  4PD4 F;  4K35 A;  4DV1 B;  1OV9 A;  1B3Q A;  5LXT A;  5KMG A;  2QR4 A;  4JI8 B;  4JYY A;  1WB8 A;  2WAM A;  5FLX N;  2XTA A;  3LSS A;  1O9G A;  2F23 A;  2IJK A;  4JI3 B;  4CH4 A;  1KP2 A;  4MT8 A;  3ETQ A;  5CB4 A;  2UUC B;  4DUZ B;  3OD4 A;  4NKG B;  4UCR A;  5LXT B;  4HZ3 A;  2Q9L A;  4HBN A;  1EFR G;  2JIZ G;  3JAR A;  3GVM A;  1EN4 A;  1SS3 A;  3K0D A;  4JZ2 A;  1N34 B;  1AI4 A;  3RYC A;  1ENV A;  5CB4 B;  4PEL A;  4NXN B;  4RAI A;  2HKO A;  3ETD A;  1XQ8 A;  4MSW C;  1FXK A;  1I94 O;  3MHS C;  4X62 B;  2YXY A;  4BIZ A;  4OX9 B;  3ZX6 A;  2FB5 A;  3JD2 A;  5LP6 B;  3VQW A;  2VQF O;  1XMQ O;  4UCV A;  5J2T A;  4GLX A;  1Q90 D;  5IY5 B;  3K06 A;  1XHZ A;  5IE9 A;  1SQQ H;  2EIM B;  4J7Z A;  5LYJ B;  1FXK B;  2AZ2 A;  4JI4 O;  4D7T A;  4FIP C;  5JVD A;  2HLD G;  1OZ0 A;  1F4N A;  1N36 B;  1XRE A;  5J2T B;  3K9A A;  2HVJ C;  3AG4 B;  3TXQ A;  3VQY A;  4DV1 O;  4I5S A;  3ZRX A;  1V55 C;  1GN6 A;  1HR0 B;  3J7A U;  2Y4T A;  4JI8 O;  1GMG A;  3OUF A;  2DYR C;  1ORQ C;  4PDL A;  4JI3 O;  4U3J B;  5JVD B;  3WU2 Z;  2ADP A;  2UUC O;  4DUZ O;  4H0L B;  2VS0 A;  3SPC A;  2GUZ B;  2ZT9 B;  3SJA C;  3HKC A;  5KLV H;  4O2A A;  4ZKI A;  1KBH A;  2CH7 A;  1N34 O;  3IJ4 A;  5CBH A;  1S77 D;  1NBM G;  2W6J G;  3OE7 G;  2IU0 A;  4NXN O;  3E35 A;  2EIK B;  4X62 O;  1H38 A;  3I56 V;  4OX9 O;  2OCC B;  2AXT Z;  4W4K A;  1AJQ A;  3P3N A;  1CEZ A;  4DR3 B;  2Y0I A;  4HNA A;  3LNM B;  2IJH A;  4AHC A;  2VRZ A;  3APO A;  2AZ0 A;  3ASN B;  1QVG U;  3CMA V;  4X1I A;  1CP9 A;  4KXR A;  4H33 A;  1YIJ V;  2PYL A;  1I7F A;  1DLB A;  2WLJ A;  4X1Y B;  2RJZ A;  1BMF G;  3CE2 A;  3SYQ A;  1N36 O;  1WA8 B;  2XHB A;  4DR1 B;  3JAW A;  1ZX3 A;  2WSS G;  3E86 A;  1HR0 O;  1B06 A;  1CPY A;  4X1I B;  3SDL A;  2RMK B;  1OCZ C;  2VWJ A;  1VF6 C;  3K59 A;  2QM7 A;  1US6 A;  1L1F A;  3OGI B;  4B3M B;  1YHQ V;  1S72 V;  1MAB G;  1SC5 B;  2E3C A;  2Q68 A;  4R7C A;  4JPR A;  4BW5 A;  3D3I A;  1UJW B;  1JMK C;  3B8M A;  3FD9 A;  1XNR B;  1YF2 A;  2NNU A;  1FAF A;  2IBZ H;  4X20 A;  1GRJ A;  1QHT A;  3JD1 A;  2EZP A;  3SPG A;  3LSQ A;  2UXN A;  2Q8V A;  1ZAU A;  5LMU B;  1GTO A;  1XL4 A;  4UB8 Z;  2UUB B;  1R73 A;  4DR3 O;  3CCJ V;  4NTW A;  4I4T A;  1AVM A;  2IW5 A;  2N04 A;  2WLH A;  1VMG A;  2UXC B;  4RUF A;  4J7K A;  1BHA A;  1DGS A;  2P7T C;  5TIS Z;  4DR1 O;  4I4T B;  1WJZ A;  5JQG A;  3SYO A;  1M93 A;  2YIB D;  2YSU B;  1ROP A;  3DSQ A;  1COW G;  3CSX A;  4TV8 A;  4DV0 B;  3TXS A;  1GM7 A;  1BT8 A;  1MZE A;  2ZE6 A;  1R3K C;  2WLK A;  5EBW C;  1NTZ H;  5B1B B;  3ZMU A;  2W6I G;  4G2K A;  3ZHV A;  1BQ0 A;  4J42 A;  3JAL B;  4DV4 B;  5JJE B;  2ZDI A;  3CC2 V;  1MSD A;  2XUM A;  1XBL A;  3T1Y B;  1NQT A;  3PJS K;  3TGU H;  3FX7 A;  4O2B A;  1XNR O;  1X59 A;  5H5N A;  5BMV B;  1EM1 A;  5B1O A;  3AG7 A;  3ASO C;  1K33 A;  1K4D C;  1M9N A;  5EC2 C;  2VQE B;  4F4L A;  4MVQ A;  2JS3 A;  1YCI A;  5LGU A;  3CS5 A;  1SA0 B;  5LMU O;  4J80 A;  2CTP A;  2UUB O;  3L71 H;  4WBN B;  4H13 B;  2Q4P A;  4FLW A;  3ZHR A;  4ZI7 A;  5IYZ B;  3OR6 C;  3H9V A;  4JI5 B;  1F7Y A;  2UXC O;  5BR8 B;  1AJP A;  5KX5 A;  2JEX A;  4X65 B;  3H1H H;  1WP7 A;  4B3S B;  4MTF A;  4C7U A;  3QNE A;  3BA9 A;  5KHK A;  1JCH A;  2ODM A;  4IIJ A;  4X1K A;  4FM0 A;  1PL0 A;  3STL C;  3E8G A;  2EIK C;  2LGW A;  1UPG A;  2ARH A;  2ITC C;  2Z5U A;  1WB7 A;  2GTA A;  5KA5 A;  1K34 A;  4CC6 A;  5CA3 A;  5KX5 B;  4DV0 O;  4RUE A;  4CS4 A;  5KHH A;  1AP5 A;  4J10 A;  1F51 A;  1LUV A;  3ABL C;  4DV4 O;  2QWP B;  4L8J A;  4BR6 A;  2QWO B;  3M7M X;  3PN1 A;  3T1Y O;  3ML0 A;  4DYL A;  5DED A;  4ABM A;  1NI8 A;  1M57 B;  3DC6 A;  1L0L H;  4MTG A;  4CC5 A;  3BA8 A;  1XOU A;  4U3F H;  4JI7 O;  4YJ3 A;  3E22 B;  2VQE O;  4GX2 A;  2X6B A;  3AK3 A;  1MMM A;  1Z5V A;  4ZOL A;  4MVZ A;  3CRC A;  5E1A C;  4QPK A;  3BVO A;  4GX0 A;  3ZRW A;  4IGG A;  3E8F A;  5LHG A;  2H3O A;  3RBZ A;  4JYC A;  4UFZ A;  4DW0 A;  2DN9 A;  3CME V;  4JI5 O;  2YIB A;  1L0N H;  4X65 O;  1TUB A;  3H01 A;  1QLE C;  4B3S O;  2PTM A;  3AK2 A;  3N27 A;  5H9C A;  1WAZ A;  4RO2 A;  3A8T A;  4PA7 A;  4O4L B;  1RPO A;  4YHH B;  4BWA A;  2KB1 A;  3G6E V;  1P7B A;  2Y4U A;  2ZNI A;  3OT7 A;  2V7Q G;  2R70 A;  2H94 A;  4B7K A;  1E1Q G;  3P3P A;  2HHH B;  1R3L C;  1VF5 B;  3CJH A;  1P84 F;  3U11 A;  4DV3 B;  1PM9 A;  2YEV A;  2F66 C;  4IL6 Z;  2E5L B;  3TK1 A;  3ABK B;  2BSK A;  4GKK B;  2XAQ A;  1FFX B;  1YVW A;  3CJH B;  4KFM A;  5GW7 A;  4DV6 B;  4IT5 A;  4DR6 B;  3U10 A;  4MTO A;  3T4D A;  2OTL V;  3VQX A;  1D5N A;  2GHY A;  3O9O A;  1VQM V;  1V54 B;  2FL4 A;  2CDY A;  2WLL A;  4UVC A;  3AG1 B;  4QJF B;  2X7R B;  3UO2 A;  3ZMZ A;  3H1K H;  3WFV A;  3E8H A;  1Z2G A;  2R9A A;  3GWO A;  5FL7 G;  3JYC A;  2QGN A;  3RFR A;  2K9P A;  3W7X A;  3WG7 C;  2OIG A;  2A0L A;  2JK5 C;  3MD0 A;  4YHH O;  3ETG A;  1NTK H;  1NZ6 A;  2A7W A;  2G38 A;  3RWR D;  3FAV A;  4NXM B;  2KG7 A;  3CCR V;  1FFT B;  1JJO A;  4LFC B;  1V55 B;  3JCZ A;  2A9H A;  3HKD A;  1RM1 C;  4TOI A;  4X9Q A;  3W7U A;  3CXC U;  4PJ0 Z;  3FKS G;  5EBM C;  1VQK V;  2HHH O;  2DQ3 A;  4B3R B;  2P22 C;  2BOB C;  2ITD C;  3QO7 A;  4DV3 O;  4LF6 B;  1Q6H A;  1K5Q A;  3RVZ A;  3MDS A;  1M56 C;  2E5L O;  4JZG A;  4U7N A;  1ZSP A;  3JD0 A;  1FS0 G;  5DM6 V;  1K4C C;  1WLE A;  3STZ C;  3I5D A;  2IJJ A;  4DV6 O;  2EIJ C;  4DR6 O;  1G1X B;  4L87 A;  1QLN A;  3FFQ A;  3KCY A;  3B8N A;  1VP7 A;  1VQ9 V;  4FVM A;  4EEQ A;  2Q0O C;  4F6R A;  2M6Y A;  1M57 C;  3HKE B;  4CS2 A;  3I55 V;  1AI7 A;  1VQN V;  5LHH A;  1Q81 W;  1GM8 A;  1VF6 A;  3FB6 C;  2XAH A;  4LH7 A;  4FFB B;  4NXM O;  1OCR B;  2NR5 A;  1Q82 W;  3RYF A;  1SQP H;  4LFC O;  5L3E A;  2EIL C;  1DK1 A;  1OCZ B;  4B3R O;  1M90 W;  3RYH B;  4JAS A;  2FYU H;  5FNV A;  4LF6 O;  1OHH G;  4X89 A;  4UV9 A;  2P06 A;  1ZUQ A;  1YJN V;  3SJQ C;  3D36 A;  4GX1 A;  2DE0 X;  2P90 A;  4DV2 B;  1K9M W;  2OT5 A;  2Q0A A;  2UXD B;  2AHY A;  4IYI A;  3BY6 A;  4LFA B;  2HJF C;  5FNV B;  2P4K A;  1XMO B;  2P6J A;  2ZE7 A;  1MNG A;  5ITZ B;  5J9P C;  1TA8 A;  3IC7 A;  1VEW A;  5LGN A;  1XIL A;  2JEU A;  5EIB D;  5IDJ A;  3RW0 A;  1N0J A;  1VQ5 V;  3ABK C;  4E2L A;  5LP6 A;  4P30 A;  3P30 A;  1VQ8 V;  4WFF A;  5IYD O;  3UT5 B;  4ASU G;  3P32 A;  3K57 A;  4DK0 A;  3CEI A;  5DN6 G;  5LYJ A;  4FZ1 A;  2B5U A;  5DEC A;  1QQC A;  2L6L A;  3ICX A;  3FB7 C;  1RP3 B;  2QWN B;  1V54 C;  1OCC B;  4LF4 B;  3AG1 C;  3OM3 B;  1MOF A;  2A79 B;  3C90 A;  5LGT A;  4X64 B;  5CBF A;  1H2K A;  1N0N A;  2YI9 A;  1H2G A;  5JH7 B;  4U3J A;  1HDJ A;  5LA6 B;  3TET A;  2OYQ A;  5B3S C;  2BCC H;  3E8B A;  2MW2 B;  2GUZ A;  4WFH A;  3ABM B;  3CRQ A;  4DV2 O;  3BPZ A;  1VQP V;  2UXD O;  3K58 A;  4DRX A;  3M8A A;  3CX5 F;  3T2M A;  3ASO B;  4GX5 A;  4JI0 B;  2F4V B;  4LFA O;  3ZED A;  1H2S B;  1LUW A;  2E76 B;  3E2E A;  1XMO O;  1HNZ B;  1XHX A;  4UXN A;  1S0V A;  2QTS A;  4FMT A;  4J9Z B;  4DRX B;  3WB1 A;  1K7D A;  4B3T B;  3THO A;  2A3Q A;  2B9Z A;  3OFN G;  3B09 A;  2E75 B;  1SZX A;  1Q86 W;  3B4S A;  2XOK G;  1R1B A;  4X1Y A;  5IWA B;  3K08 A;  4QNH B;  1KUQ A;  1WA8 A;  3BCC H;  4EB6 B;  2WA4 A;  4H44 B;  2DMX A;  5KAF Z;  4LF4 O;  3OUS A;  4PI0 A;  4GUN A;  3OGC C;  2ETN A;  5D5P A;  1QU7 A;  4Q6G A;  4ZHQ B;  1WNS A;  2ZE5 A;  3CC4 V;  4X64 O;  5KHJ A;  4WFA V;  3F5W C;  2FTK A;  1N33 B;  1QNM A;  3ABL B;  4LWS B;  4KL1 A;  3S3X A;  4EFB A;  2HJD A;  3R65 A;  4G28 B;  3AG2 C;  1F4M A;  1YIT V;  2UXB B;  1NS1 A;  4DV5 B;  3A0R A;  2FML A;  1OCR C;  1XDC A;  1AJN A;  3FYE B;  3LDC A;  1OJH A;  1PNL A;  3QG5 A;  3MAQ A;  1KKC A;  4TWK A;  4JI0 O;  2F4V O;  1A32 A;  2O57 A;  1HNZ O;  3OEE G;  5KA6 A;  4IYH A;  4LCU C;  3H1J H;  3HPL C;  3CHX A;  1KKD A;  4XDJ A;  5IJ9 A;  4CZZ A;  4OPH A;  5F2V O;  4B3T O;  1ZTE A;  1IX9 A;  3N2G A;  1Y74 A;  1QLE B;  2YXL A;  3S3W A;  1KMI Z;  1WPX A;  3ZN1 A;  1AR4 A;  3W7W A;  2Y48 A;  3DXR B;  4DO2 A;  3H1L H;  5IWA O;  5IJ9 B;  5JWP A;  4D6T H;  1QVF U;  3BAA A;  3K04 A;  3N2G B;  1Y74 B;  2BE3 A;  4O4I A;  4JAA A;  4A5U B;  4FLT A;  1N33 O;  4JV5 B;  1YEW A;  3WB2 A;  1GM9 A;  3K3W A;  3SJC C;  1GH6 A;  2OCH A;  2RNB A;  2UXB O;  5BXZ A;  2Y69 C;  4JGS A;  2LJ2 A;  4DV5 O;  3JAL A;  1YZB A;  2W0F C;  1OCC C;  1PPJ H;  4CBC A;  2Q7H A;  4O4I B;  1PV0 A;  2Q73 A;  2JVD A;  4CS3 A;  4UVA A;  5BMV A;  4FLV A;  5IT9 N;  4LF9 B;  3OEH G;  2UU9 B;  4LF7 B;  4RWU A;  1JA8 A;  4B3M O;  2F93 B;  4MVS A;  2UUA B;  1JVM A;  3T4Z A;  5CA0 B;  2WLI B;  2XND G;  1SA0 A;  1EN6 A;  1XUQ A;  3Q4H B;  2PZS A;  4PA3 A;  3ABM C;  4WBN A;  4TV9 B;  2VWK A;  1NTM H;  5IYZ A;  4KHP B;  1K8A W;  1KEC A;  3J81 N;  3BHP A;  4K3A A;  3WG7 B;  2HFE C;  4H37 A;  3ETE A;  2ZXW B;  4PA4 A;  2CUG A;  4DXW A;  3OMI B;  3O65 A;  3NR7 A;  4U7O A;  1RM1 B;  4X88 A;  5JJN B;  4JV5 O;  1S76 D;  1MA1 A;  4LNU B;  3RN4 A;  3A0H Z;  4MS2 A;  4Z1M G;  2EJR A;  1M56 B;  1MG1 A;  1CXZ B;  4DR5 B;  2YC0 A;  4AQY B;  1M5I A;  4MVM A;  2PI5 A;  1Q43 A;  3JAM N;  2CK3 G;  3ZMS A;  1SER A;  5GON B;  1BQZ A;  1FKA O;  4LF9 O;  4UCO A;  2EIJ B;  2UU9 O;  4LF7 O;  3E22 A;  4B08 A;  1PKX A;  1PD3 A;  3T1C A;  3VBB A;  3ABT A;  3CYO A;  4I0X B;  3RT3 C;  4MVO A;  4MTX A;  3AG3 B;  2ZM6 B;  1KB9 F;  3RYI B;  2R9I A;  4RQF A;  1S3J A;  1Q3E A;  2LO1 A;  1ARO P;  3IC9 A;  5LOV B;  4KHP O;  3OTF A;  4PI2 A;  5J2U A;  5H6R A;  4GT1 A;  2ZIO A;  2DYS C;  2QM8 A;  2YS8 A;  3HR0 A;  4PA9 A;  4FLZ A;  2LGQ A;  5EBL C;  5JCO C;  1T5E A;  4YY3 B;  5EIB C;  4O4L A;  3L70 H;  4UCU A;  1G8M A;  1R3I C;  5J2U B;  5BR8 O;  3TCU A;  2EIL B;  1X4T A;  1AIL A;  1K92 A;  1VQ4 V;  3DGE A;  4TUY B;  3BAB A;  3WB0 A;  3KKY A;  1U97 A;  4X8A A;  2XAF A;  2ZIM A;  5L3G A;  4DR5 O;  3IGA C;  4PA6 A;  1SQX H;  4AQY O;  4JI1 B;  3X2Q C;  2Q5Z A;  3W7S A;  1FFX A;  5IYB O;  1QR8 A;  2ZIN A;  1H2N A;  2YIC A;  2P67 A;  4O4J A;  3HB3 B;  3BFR A;  1AI5 A;  1VQ7 V;  4UCS A;  2ZM6 O;  4Z1V A;  2F43 G;  1GN4 A;  4YJ2 B;  5BY1 A;  1P7G A;  3ZBH A;  1W0J G;  2Z3Y A;  4DW1 A;  2CGO A;  3K0G A;  3KZI Z;  4O4J B;  1EZJ A;  5JJJ B;  2ZR2 A;  2OIE A;  2JJ2 G;  3OTO B;  4YIO A;  4YY3 O;  2IH1 C;  5GTI Z;  2XAS A;  1PP9 H;  3B40 A;  5B5E Z;  2R72 A;  2ZR3 A;  5KHI A;  2LW7 A;  3K79 A;  3AK1 A;  1HNX B;  2P5O A;  2NN4 A;  2AHZ A;  1NU1 H;  2DWE C;  4JTA B;  4K8Z A;  2RN9 A;  1SQV H;  3KCX A;  5A9G A;  1GKF A;  2XAJ A;  4GYC B;  4PDV A;  4OGQ B;  2E74 B;  2ZXW C;  5B3S B;  3CP1 A;  4ZIB A;  4P9O A;  4JI1 O;  1VQ6 V;  3LSU A;  4LF5 B;  1W2B U;  1IDS A;  3SPI A;  3ZRS A;  4XDL A;  2GV9 A;  1P4R A;  1VQL V;  1NT2 B;  1V9P A;  1RFY A;  1TVK B;  3UCS C;  3APQ A;  1ZWI C;  1O9H A;  4PDM A;  2LP7 A;  2IH3 C;  4XDK A;  1FXV A;  5IJ0 A;  1HNW B;  4YIP A;  4GKK O;  2QKS A;  2JGD B;  3HKE A;  4J7J A;  1AI6 A;  3L9D A;  3OTO O;  2WLN A;  4GCZ A;  3FB5 C;  1MSW D;  1VF7 A;  1NR7 A;  5IJ0 B;  4JTC B;  1KD1 W;  4ZBM A;  2KKW A;  1JFF B;  3AG3 C;  1PL4 A;  1JX9 A;  4AI8 A;  4FFB A;  1IBK B;  4UUJ C;  2RQ6 A;  1HNX O;  4GZR B;  4UV8 A;  3G6B A;  1QBZ A;  2HG5 C;  5EK0 A;  4TQD A;  5C93 A;  3AG2 B;  4DV7 B;  3RYH A;  2YI8 A;  5HFL A;  2X0L A;  4Z2W A;  3ZS8 C;  2QA4 V;  3CPW U;  1BSM A;  1GAX A;  4FLU A;  4LF5 O;  3ZMT A;  5EC1 C;  2CGN A;  1WN7 A;  2YDE A;  3DC5 A;  4NR1 A;  3UKM A;  3DTU B;  4FLY A;  1AP6 A;  2QKA A;  2Q6A A;  1Q6U A;  5ITZ A;  2CAZ C;  2Q69 A;  1URF A;  2KQX A;  2QJ1 A;  3SYC A;  1FYJ A;  5EYP B;  2N05 A;  1UFI A;  2Q67 A;  1RSO A;  2XAG A;  1HNW O;  4NTY A;  4O4H A;  1R6K A;  2EIN C;  3F5T A;  4FPP A;  4HAM A;  2JS5 A;  3LDE A;  2P4V A;  3UT5 A;  4E4E A;  3CRR A;  3E83 A;  1RSO B;  5CA1 A;  2YID A;  4CH6 A;  3W7T A;  4O4H B;  4JYB A;  2QDO A;  4OXS A;  1IBK O;  1JOY A;  2AGA A;  1HP8 A;  3JSL A;  2JRI A;  1YI2 V;  4WCE V;  4I7Z B;  4CH5 A;  1YTF D;  3OMN B;  1JQ0 A;  5KUM A;  3K03 A;  1KP3 A;  5CA1 B;  4JF3 A;  1HW7 A;  4LR3 A;  4DV7 O;  5L3B A;  2Y69 B;  5JH7 A;  5KMG B;  2DWD C;  1Q8I A;  2CE4 A;  4TSF G;  5EZY A;  2WLM A;  1R6T A;  5LA6 A;  2Q7E A;  1PNM A;  3R66 A;  3SPH A;  4R50 A;  2EUL A;  2EX3 A;  4FLX A;  1AB3 A;  1QR9 A;  4UVB A;  4R8C A;  5EZY B;  2EZO A;  2N74 A;  3JAR B;  4NB5 A;  3B2E E;  1SZT A;  3EHB B;  4BW9 A;  3BRC A;  3RYC B;  1J5E B;  4JI6 B;  1W0K G;  4JAV A;  4PDR A;  4P9P A;  3JCU Z;  1OCO C;  4X66 B;  1NH2 D;  1VAR A;  4MVR A;  2EBO A;  1Y67 A;  2V4D A;  1N32 B;  1DTO A;  4NYK A;  4EB6 A;  2Z0A A;  3CCM V;  1FD9 A;  4LF8 B;  2KSD A;  1EBO A;  4ZHQ A;  4HYO A;  3RGB A;  4B7E A;  3D8C A;  4DR2 B;  2F1M A;  4LWS A;  4WF9 V;  5IYC O;  3CD6 V;  3UO3 A;  1K73 W;  3CCE V;  5A2Q N;  5AG2 A;  2PYJ A;  2OTJ V;  3NXS A;  3KG2 A;  1YJW V;  3CWB H;  2IJI A;  3LNN A;  4TT3 G;  1S5H C;  2PF4 E;  3CB2 A;  4PHZ A;  5CMU A;  1THZ A;  4DK1 A;  3HKC B;  1SF9 A;  3AEI A;  1NR1 A;  1BS3 A;  4O2A B;  1YDX A;  1S5J A;  1BGY H;  2CH7 B;  5JCO A;  3QO5 A;  1J5E O;  4JI6 O;  3ZHU A;  1BCC H;  3MHH C;  4BIU A;  1IZ3 A;  3L75 H;  1Q7Y W;  4X66 O;  3M99 B;  2ZNJ A;  2DYS B;  4HNA B;  1AR5 A;  1I0H A;  3DXR A;  3ZCC A;  2WWW A;  4PV1 B;  4QIW F;  4MW3 A;  2LFR A;  1N32 O;  2D2C B;  5LMN B;  4WFB V;  4R6Z A;  3CCU V;  2QE7 G;  3GB7 C;  4LF8 O;  1YTF B;  4JYA B;  2QM4 A;  3JAW B;  5CBG A;  2K1E A;  4DR2 O;  5B1A C;  3EVK A;  2PY5 A;  3ZMV A;  4IHJ A;  2IM9 A;  2BTO A;  2UXX A;  4D7S A;  1XEQ A;  4LFB B;  3X2Q B;  3SYP A;  2CTR A;  1YXB A;  2V1D A;  4KP4 A;  1XL6 A;  5KHG A;  4XBF A;  2JDI G;  4KUM A;  3D36 C;  4F6E A;  1YSC A;  4IHJ B;  1S5L Z;  2QTO A;  5LHI A;  1G4Y B;  3SPJ A;  2PI4 A;  5CA0 A;  2WLI A;  4X20 B;  2ILM A;  3Q4H A;  4EFE A;  3FYI B;  1SQG A;  1K3E A;  2QWR B;  3G71 V;  2NLJ C;  1EN5 A;  4MVU A;  4TV9 A;  3FB8 C;  2GDS A;  1NH2 B;  3LDD A;  1NVP D;  4NTX A;  3C3T A;  5LP6 C;  1BE3 H;  5BZB A;  2DQ0 A;  1B6Q A; 
#chains in the Genus database with same CATH homology
 4DV0 O;  5LMN O;  4DV7 O;  3O65 A;  3OTO O;  4OPH A;  4NXM O;  1J5E O;  4JV5 O;  4JI6 O;  1R6T A;  4B3T O;  4DV2 O;  4JYA O;  4DV4 O;  2UXD O;  4DR7 O;  3R66 A;  4LFC O;  1N34 O;  3M8A A;  1FJG O;  1HNX O;  4LFA O;  2ZM6 O;  3T1H O;  3T1Y O;  5FLX N;  4DR1 O;  4JI2 O;  1DK1 A;  4X66 O;  4NXN O;  1XMO O;  4DR4 O;  5BY1 A;  4B3R O;  5IWA O;  1AB3 A;  4X62 O;  1IBL O;  4OX9 O;  3JAM N;  2ZKO A;  2FKX A;  4JI7 O;  4LF6 O;  4LFB O;  2N74 A;  1N32 O;  2VQE O;  1FKA O;  4LF9 O;  4YHH O;  4OPA A;  2UU9 O;  4LF7 O;  3J80 N;  1N33 O;  4A5U B;  4YY3 O;  4LF8 O;  4LF5 O;  3RT3 C;  2LW7 A;  4DR2 O;  2UXB O;  5BXZ A;  5LL6 Y;  4DV5 O;  1N36 O;  1YZB A;  4JI5 O;  2HHH O;  1XNR O;  1R1B A;  1I94 O;  1X59 A;  5H5N A;  4X65 O;  1KUQ A;  4KHP O;  4B3S O;  4DV3 O;  2VQF O;  1HR0 O;  4DUY O;  1XMQ O;  2DOS A;  1XEQ A;  4LF4 O;  1FYJ A;  3SDL A;  5IT9 N;  1D2D A;  1IBM O;  2E5L O;  1HNW O;  4X64 O;  2UUA O;  2Z0A A;  4B3M O;  5LMU O;  3F5T A;  4JI1 O;  2UUB O;  4JI4 O;  4DV6 O;  2DJV A;  1NS1 A;  4DR6 O;  1G1X B;  5BR8 O;  1F7Y A;  1AIL A;  2UXC O;  5A2Q N;  4DV1 O;  3J7A U;  4JI0 O;  1IBK O;  4JI8 O;  4K0K O;  2F4V O;  3J81 N;  2AGA A;  1A32 A;  2JRI A;  4DR5 O;  4GKK O;  1HNZ O;  4JI3 O;  4AQY O;  4GKJ O;  1XNQ O;  2UUC O;  4DUZ O;  4DR3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...