2N74A

Solution structure of the rna-binding domain of non-structural protein 1 from the 1918 h1n1 influenza virus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
b'MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural Basis for a Novel Interaction between the NS1 Protein Derived from the 1918 Influenza Virus and RIG-I.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 21
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2n74A00
5H5NA 4DV7O 2UUAO 4JI2O 2ZKOA 2N74A 1HNXO 1NS1A 4OPHA 4YY3O 2DJVA 4LF7O 1FYJA 2AGAA 4B3RO 4DV3O 3OTOO 1KUQA 5IT9N 4B3MO 4YHHO 4GKJO 1R1BA 1AB3A 4LFCO 1XMQO 5FLXN 2UUCO 1N36O 1N34O 3R66A 1FJGO 4DV0O 4DR5O 4B3SO 3J81N 4DR1O 5BXZA 4JI3O 4GKKO 4AQYO 4DR2O 4JI7O 4NXMO 1R6TA 2UXBO 4LF6O 2ZM6O 3SDLA 2LW7A 1XNQO 4JI1O 4DR6O 1IBLO 2Z0AA 4JI8O 5LMNO 4DV4O 4X66O 3O65A 1HNWO 4LF8O 3J7AU 4JI4O 4LF9O 4DR3O 2VQEO 1XMOO 4DR4O 5LL6Y 4JI6O 4K0KO 5LMUO 2FKXA 2UUBO 4OPAA 4JV5O 1I94O 2DOSA 4NXNO 1YZBA 2UXDO 3J80N 4X65O 4DV1O 4DV2O 2UXCO 2HHHO 4LF4O 5BR8O 5A2QN 2F4VO 4X62O 4DV5O 2UU9O 3RT3C 1D2DA 1J5EO 1N33O 5BY1A 4DV6O 3T1YO 3F5TA 3M8AA 3T1HO 1IBKO 1XNRO 1IBMO 4LF5O 4X64O 2JRIA 1N32O 4B3TO 4KHPO 1DK1A 5IWAO 4LFAO 4DR7O 1HR0O 4DUZO 1AILA 1A32A 2E5LO 1FKAO 1HNZO 1XEQA 4JI5O 2VQFO 1F7YA 4A5UB 1X59A 3JAMN 4JYAO 4LFBO 1G1XB 4DUYO 4JI0O 4OX9O
chains in the Genus database with same CATH superfamily
1QQCA 3B8NA 4DV7O 4DR2B 3SPHA 3C3SA 4Q20A 1NS1A 2OCCB 4DV1B 2HHHB 2QJ1A 1NBMG 1KUQA 1W0JG 3ZMUA 1KP3A 2F23A 2Y69C 2RQ6A 5FLXN 4IYIA 5EYPA 4U7NA 2AW9A 1HDJA 3T1HB 4H33A 3TK1A 1G6UA 1NT2B 2ZXWB 5EIBD 4O2BB 4DR6O 2YXYA 1AR1B 2XUMA 4JI8O 1SZTA 1Q6HA 1ZAUA 3BAAA 4F6EA 1KYOF 2EJ7A 4FZ0A 2OT5A 3A0RA 3TCUA 2FMLA 4EFBA 1IURA 3KCXA 5CN0A 3F7VC 5JVDB 2Q6AA 4FPPA 4MW8A 5BZBA 3Q4HA 2Q4PA 4FFBB 1FS0G 1VARA 2ADQB 1S72V 1M57C 4DV5O 2ATKC 3CWBH 4DV3B 1WA8A 3ABUA 3ZHSA 1SZXA 4JAUA 4XDJA 1AI5A 2ZE8A 4MS2A 5BY1A 3K0GA 3RYIB 3B4SA 2IJKA 2YEVA 1WP8A 1I7FA 1XREA 2UXBB 3W7WA 1OCCC 1VIBA 2VWKA 4L8JA 1YI2V 3TETA 2UUAB 3N2KB 3ZMTA 1H8HG 2P90A 4PELA 1XI1A 4G28B 1V55B 2BOBC 3K03A 4YY3B 2ODMA 1TVKA 2XASA 1AR5A 3AK3A 1M93A 4TWKA 1XL6A 1G1XB 2DQ3A 2E3CA 2KQXA 4TT3G 1VQ7V 2ZNJA 4NXNB 2ZM6B 1KB9F 2C2AA 2UXCB 1FYJA 5ITZB 4TV9B 4JPRA 3CCRV 4GKJO 2IH3C 5JVDA 4FMTA 1VQLV 4GX0A 3FKSG 4D7SA 2EIMB 4OGQB 3LNNA 5LHGA 2QKCA 4Z2WA 5FNVA 1QLEC 4ZBMA 5GONB 2L6LA 3QNEA 5JH7A 4QIWF 1H38A 3JCZA 3OMAB 2ZE6A 5LYJB 3RYIA 1M56B 3UQ8A 4J9YB 1AP5A 4X62B 4DR7B 4QPKA 1Y4MA 1AVMA 3DC5A 3N2KA 2UUBO 2P5OA 4LFBB 4OPAA 1SQPH 2DOSA 4BR6A 4NTXA 1P7BA 2XOKG 2D3OW 2CTPA 3CE2A 2HLDG 5A2QN 1ZSPA 2R72A 4KP4A 5EC1C 2WLNA 3GB7C 2EINB 4O4IB 4UFZA 4CH4A 1O9GA 4P9OA 2JS5A 3B77A 3CCEV 4Q6GA 1THZA 1LUVA 1TGOA 3RVZA 4DR1B 4TV9A 1MSWD 5CA3A 1JQ0A 1XDCA 1DF5A 2Z3YA 1S77D 4TV8A 2GV9A 4LFAO 2BTQA 1XOUA 1P49A 5KLVH 4PA9A 4U7OA 1P84F 3BEHA 2WLJA 2PF4E 3HKDA 1ZLZA 1VF5B 5LA6B 4RQEA 4B3SB 1YHQV 1QLNA 2CH7B 5CA1B 1VQKV 4GKKB 3K79A 4JI7B 2DYSB 3K5OA 4H37A 5EC2C 5KA6A 1HNXO 1XILA 2B5UA 3CRRA 5CMUA 1TAEA 3EFFK 5IT9N 5B1AC 3AG1B 4MVMA 1XQ8A 2RJZA 2F93B 1N36O 4FFKA 3VQXA 5GTHZ 4GZRB 4I55A 4MTFA 3ETGA 4WFFA 1NTZH 1JFFA 4PA3A 2JIZG 2X7RB 1VQ6V 4LBEC 4LF5B 5KUKA 5LGUA 4K8XA 4YJ3B 1BSMA 3E83A 3HKCA 2P7TC 2QTOA 1TUBB 3PN1A 1FD9A 1I5YA 5EZYB 1B3QA 1KU9A 3CCSV 1K4DC 4X64B 1Q82W 5LA6A 3ZHVA 5LOVB 1BZKA 2UXNA 2QWNB 1LUWA 3K59A 1D2DA 4YHHB 1CPYA 1N33O 1TA8A 1MNGA 1SC5B 3MHSC 1FAFA 1E1RG 1YJ9V 3H1JH 4MTXA 2JRIA 4PI2A 4TQDA 1GN4A 4KHPO 4KL1A 3SJQC 2Q67A 1GN2A 1K4CC 5JJNB 2YXLA 3BA9A 4WCEV 4JYAO 1GM9A 1LR1A 4DV0B 4DUYO 1RPRA 3T4DA 3K5MA 5CBHA 1IVSA 1GK9A 4O4LA 1TUBA 1Q43A 2CTRA 2IBZH 4OPHA 1XNQB 5EZYA 4B3RO 3FAVA 3AG2C 1F4NA 5LMNB 3W7TA 3L71H 5JCOC 3IJ4A 4LFCO 3UO3A 2GUZB 3N27A 3K5LA 1MA1A 4W4KA 4LF9B 3IAYA 3J81N 5GTIZ 4QE7A 3UM7A 3BHPA 2WLMA 1JR9A 1KC8W 3T1CA 2Z5UA 1K73W 2EIJB 3ICXA 1K5SA 4FM0A 4JI1O 4X65B 2XHBA 1R3LC 1SQGA 4NKGB 3JD2A 5KHGA 4I9QA 4F6RA 2Q0OC 5L3CA 2VQEO 4JI6O 4K0KO 3OMIB 4L87A 4ZHQA 5IDJA 3RYFB 2Y48A 2YUAA 4BIUA 4JV5O 1I94O 1FPOA 3JD3A 2EZPA 3RVYA 1G4YB 3GWOA 4LF4O 1XUQA 4JTDB 5IYDO 4IIJB 1SF9A 4ZI7B 3N2GB 4UV8A 3OTOB 1K8AW 5JJJB 3WG7B 1MSDA 1VP7A 3STLC 3ZHUA 3QTCA 2L35A 4JI5B 4BWAA 1PP9H 4TUYA 3DXRA 1M90W 2DN9A 2QGNA 3KCYA 3E22B 4FJCC 3IGAC 4B3TO 4WFAV 3I5DA 2OIGA 3BCCH 2GHYA 2E76B 2PTMA 1LNQA 4NB5A 5K1PA 5KHHA 4LNUA 1R3JC 4MVZA 4JYYA 2FTKA 1OCOB 3CCUV 2Y0IA 3ZBHA 4B3MO 3RYFA 4GYCB 1GTOA 1ORQC 3E2EA 2A9HA 4J11A 1K7DA 2ARHA 1VQ8V 4NXMO 4ZI7A 2NLJC 2Y69B 2K1EA 4EKWA 5JQGB 4N21A 1IBLO 3P32A 4J80A 3O65A 4R50A 2EULA 5LL6Y 5B3SC 1FXKA 3E22A 4YIOA 5GW7A 1NI8A 4PDVA 5LP6A 1PL0A 3ABLC 2BSKA 4HNAA 1MMMA 1EFRG 4DV7B 3AK1A 4DV2O 5H6QA 4X1YB 2W6IG 1VF6C 4G2KA 3W7SA 4RAIA 4QJFB 4CH5A 4RQFA 1N4CA 4BAYA 4UB6Z 3CMEV 5H6RA 1IXMA 5IJ9A 3ASOC 4PJ0Z 2B1GA 1M57B 4PDMA 2H3OA 1GN3A 2B1IA 1W0KG 4FZ1A 2GSMB 4YJ2B 2RCVA 3CC7V 1BE3H 1XHXA 3A0HZ 2Q69A 1Z5VA 1YIJV 2YIDA 1OCCB 3B8MA 1HNZO 2X6CA 2WA4A 3CEIA 5IYZB 5JQGA 1F7YA 1IX9A 1VQPV 1X59A 1S5JA 3G6BA 2A0LA 3E35A 2ZKOA 2ZD9A 1MOFA 1SERA 3D8CA 5J2UB 2QM8A 3JAKA 2Q7GA 3G6EV 1WPBA 1UJWB 4QE9A 3NR7A 3T2MA 2EZOA 2JK5C 2KKWA 4I9WA 3RYHA 4H44B 1K5QA 3ZRSA 1FFXA 2X0LA 4JI3O 4I4TB 1BMFG 3CD6V 3E8FA 5FPOA 2P67A 3KKYA 3JASB 2UXDB 4DK0A 5H9CA 2CUGA 2LFRA 3JAWB 2ITDC 2K9PA 4TOIA 3J7AU 1QLEB 4ZIBA 3ZRWB 1RM1C 2YIBA 4AI8A 1SA0B 4DW1A 2R9AA 4FLWA 2ZDIA 4IHJB 1VQMV 1ZL8B 1T5EA 2IH1C 4JF3A 5B66Z 4Z1MG 3W7XA 1XNRB 3CS5A 3H1HH 1AROP 5IYZA 2AZ2A 4CH3A 2F66C 1QVGU 4GKJB 4BIOA 3LSQA 4CC5A 3L75H 3T4ZA 3ABTA 4X1KA 4U3FH 5J2UA 2JS3A 4J10A 3C90A 1RP3B 2V4DA 2WA3A 4J9ZB 4WBNB 5IWAO 5A9GA 2WPDG 4I4TA 5DEDA 3K3WA 3C3TA 2A79B 5CBGA 3JSLA 5DN6G 4K3AA 4NVPA 2UUBB 3HKBB 3CC2V 5EBLC 1EN4A 3IC9A 5B1OA 4O4HB 2A3QA 2QM7A 3JCUZ 4TQFA 1PKXA 2M7WA 3K5NA 4LF7O 2Q7HA 4D7TA 1KP2A 3AG4B 1SQQH 5J2TB 4OXSA 4EB6B 3R65A 4PDLA 2HJDA 2UUCO 1N34O 1FJGO 2R9RB 1H2LA 2CK3G 4O2BA 2WLIB 2GDSA 2A06H 4DR2O 1R6TA 1QR9A 2ILMA 5B1AB 4FLXA 3RYCB 4QPJA 2LW7A 3QO8A 4WF9V 3FFQA 2LO1A 5LXTB 1TUEB 3M99B 2PY5A 1YDXA 4UCSA 1SRYA 4LFAB 1WJZA 2X6AA 1HNWO 2UU9B 1EM1A 3U0ZA 1VF7A 2N05A 3SGIA 4DW0A 4J42A 4PV1B 4FFBA 2P4VA 4WBNA 4DV6B 3VOUA 2DMXA 2G38A 3JARB 1F51A 4UUJC 1QCEA 3OEEG 1YCIA 2QM4A 4B7EA 1JVMA 3W7UA 4LH6A 4R8CA 4GT1A 3K57A 3DTUB 1R73A 2AZ0A 4P2ZA 1VMGA 3RGBA 3OEHG 3T1YO 4I5SA 2VWJA 2YI9A 1IBKO 4UVBA 3JD1A 2X6BA 4JYBA 4LR3A 5KHIA 5J2TA 3EVKA 2YC0A 5IYBO 3OR6C 2QWPB 2XAQA 2RN9A 5KX5B 1FKAO 1S3JA 4X88A 4MVOA 2EIKC 4PI0A 4CS3A 1NTKH 2W0XA 2Y4TA 5ITZA 3BPZA 1KKDA 2UUAO 1B06A 1B04A 2H94A 2PUSA 4YY3O 1JCHA 1E1QG 4X1IB 4MSWC 3RW0A 4MVRA 4J7KA 4X66B 4W4LA 3ZIAG 3JARA 4LF8B 5KUMA 5GONA 3FYEB 5JJEB 4IT5A 2XT9A 3E8GA 3AG2B 2LGWA 5LYJA 2PI4A 1Q81W 3AG4C 2ZM6O 2HJFC 1HP8A 3SDLA 3D36C 1U96A 4FLUA 1HWYA 3FX7A 3AEIA 3AG3C 4GX2A 1F23A 1IZ3A 1WB8A 2QR4A 4XDKA 2NR5A 2XAJA 3CRAA 3BA8A 1M5IA 1R6KA 3QG5A 4C7UA 5KX5A 3APQA 4LP8A 4O4IA 3RBZA 4GCZA 4CS4A 4X62O 2CTQA 1BL8A 2LFSA 1Z2GA 3RN4A 1PNLA 2IJHA 3DGEA 4LFCB 1J5EO 4WFEA 3QF7A 2EX3A 2JGUA 1QU7A 1I0HA 3SJAC 4CZZA 1YXBA 3FYIB 2WLKA 5DM6V 1Y76B 4JI2B 5FL7G 3VQYA 2F43G 1AI6A 1NJIW 3AG7A 1YJNV 3CX5F 2CH7A 5CA1A 5L3EA 1OHHG 4UCUA 2VQEB 1XMQB 2XAHA 4JI6B 1QHTA 1DTOA 1MG1A 4DR5B 3WB0A 1QBZA 4HZ3A 4JV5B 1RPOA 1I94B 2WSSG 2IW5A 2QWRB 4UCOA 1V9PA 3A0BZ 3ML0A 2HEPA 2XAFA 4X20B 4B3SO 4GKKO 1SETA 3ETQA 4AQYO 4JI7O 3KZIZ 2JDIG 3CJHB 3HR0A 3VBBA 4YJ3A 2HKOA 1EN6A 2W6JG 3CCJV 2AHZA 5IJ0B 1K3EA 3MD0A 1AR4A 3CHXA 3B09A 2JJ1G 4B3TB 1UPGA 4NTYA 3UO2A 2Q0AA 3L73H 3H1IH 3JATB 1Y76A 2N04A 5LOVA 3CYOA 2QWQB 2JEXA 5B3SB 1I08A 1AP6A 1D5AA 2GTSA 2YSUB 2P22C 3B40A 4P9PA 1OCRC 2NN4A 3ABLB 1VQNV 1H2GA 4B3MB 3RT3C 2E5LB 3P30A 5DECA 1E79G 1GM8A 4NXMB 4OX9B 3OT7A 3IC7A 2IJJA 4X64O 3JALB 5CB4B 2XNDG 1MABG 2PYLA 1YEWA 1P4RA 3ASOB 1NH2B 3ASNC 1HR0O 2PI5A 2DWDC 4DUZO 1FFTB 4JTCB 1VEWA 4JZGA 1G8MA 4I50B 2IJIA 3OD4A 4UVAA 1JJOA 5IJ0A 1BQZA 2ZE5A 3UKMA 2KG7B 2H8PC 1YVWA 4LF6B 1H2MA 4IL6Z 4CS2A 1K34A 5CA0B 3QO7A 2GUZA 2OIEA 2EILC 2AGAA 3ZHRA 4CC6A 1S5LZ 4DYLA 1NU1H 5C8YB 4DV0O 1EZJA 4HBNA 2VRZA 3PJSK 3SR2C 5KA5A 2F95B 3ABKC 3O9OA 1R6NA 4FM1A 1VQ9V 1XNQO 4RO2A 5E1AC 3JD0A 5F2VO 1GH6A 4JZ2A 5LMNO 4MTGA 5BR8B 4DV4O 5D5QA 4JI4O 4LF9O 4O4JB 1QVFU 1HW7A 3LDEA 4U3JB 3JALA 3ZMZA 1V54C 1HNZB 5CB4A 1KMIZ 1AI4A 2FL4A 4J7JA 3H1KH 1OJHA 3CXHF 1DGSA 3BY6A 2E74B 4IIJA 1PM9A 5L3DA 1NR7A 2JGDB 3N2GA 1RM1B 1P7GA 4X65O 2LGQA 4I50A 1WP7A 4P30A 4MVQA 3GWKC 2YS8A 5IY5C 1M1KW 3DSQA 3ZMVA 4RUFA 3M8AA 1S76D 1CXZB 3CPWU 2VQFB 2ADPA 4JI3B 4DRXB 1Q6IA 3JD4A 4AILC 1N32O 1MZEA 3S3WA 2PZSA 4UCRA 5FPRA 4GX5A 2DE0X 3OGCC 2ITCC 3WB1A 4H13B 4JI5O 5BMVB 3U11A 5EBMC 2QWOB 4YIPA 4B7KA 1K33A 1I5XA 1X4TA 4Z1VA 4DR6B 4TSFG 4JI8B 3QO5A 3MHHC 1XBLA 3OM3B 4FK5C 2RDCA 5KMGB 2R9IA 1GO3F 3M7MX 4UCVA 2Z0AA 3G71V 1QNMA 3SYQA 5LGNA 2V7QG 2DWEC 5IWAB 1Q90D 1NH2D 2OCHA 4DV5B 3OTFA 1SESA 4JTAB 4DR3O 1J95A 1FXKC 1XMOO 4DR4O 2ZQMA 3VQWA 3CXCU 2FKXA 2ZIOA 2P06A 3LDDA 5LP6C 4X1YA 3FB8C 3FD9A 4WFBV 4D6TH 2Y0PA 4K35A 4FVMA 2RMKB 3ZN0A 3ZHQA 2F4VO 1M4UA 3MDSA 4LF7B 5L3BA 4RUEA 5EIBC 3CB2A 3SPIA 2JEUA 3MAQA 4X89A 1Q8IA 1PD3A 2IU3A 3K0DA 2CDYA 4ASUG 5L3FA 1PNMA 4ZKIA 4YJ2A 2QKSA 3VQVA 2ZIMA 2BE3A 1ZTEA 4PA6A 5HFMA 4KUMA 1IBMO 1WAZA 1ZUQA 2YEVB 1H2SB 1EN5A 1WNSA 2Q73A 2YICA 3THOA 3K58A 1KD1W 2LJ2A 3ZMSA 1HNWB 4EFEA 5KMGA 4X9QA 3CC4V 1YSCA 3JYCA 1XEQA 2QSAA 4J7ZA 3CCLV 3AK2A 1JMKC 3FB6C 1ENVA 4O2AB 4JI0O 1TVKB 3L74H 3LSUA 3IFXA 5H5NA 2EBOA 5KAFZ 4HYOA 2EIKB 5J9PC 5LGTA 5IYCO 3H1LH 1KKCA 3ABMC 1H2KA 3OUFA 1WB7A 1ZX3A 2MW2B 1BGYH 3X2QC 1WLEA 3T1YB 3JASA 3ZRXA 1IBKB 3JAWA 2Q8VA 3GVMA 1NTMH 3CMAV 3ZRWA 3CCMV 1Y66A 3HKEB 5FNVB 1M9NA 1SA0A 4ICGA 4IHJA 5JH7B 1U97A 1BT8A 1ZL8A 1Q7YW 1MZFA 5D5PA 2ZDIC 2KB1A 4DXWA 5LMUO 4XDLA 3AG3B 3STZC 3QVNA 3APOA 5AG2A 1YZBA 2UXDO 2PGGA 4DV1O 2HHHO 2UXXA 3LNMB 1DF4A 2JJ2G 5E79Z 1Q86W 2WAMA 4O2AA 2QTSA 1US6A 3ZCCA 5KHKA 4E4EA 1FXHA 2AXTZ 3SJBC 3T1HO 3WB2A 1DLBA 1ZWIC 1Z5WA 1XNRO 3OW2U 3H01A 3CRMA 1L8DA 4PA7A 4PDRA 3I55V 2YDEA 1YF2A 2YIBD 5B1BC 2VS0A 3ZHTA 1W2BU 1L0NH 1HNXB 1DK1A 3ZX6A 2DYRC 5KHJA 5HFLA 3HKBA 4NTWA 4MTOA 2OCCC 4O4HA 4TV8B 1N36B 2DQ0A 3JAMN 4HAMA 2BTQB 3TGUH 3HKEA 1K97A 3OUSA 3K9AA 4PD4F 3BRCA 4EB6A 3HKDB 3D36A 1BS3A 3OMNB 2WLIA 2ZCEA 4NYKA 4DV3O 1VQ4V 3OE7G 2JVDA 1R1BA 3EHBB 5KAIZ 2ZXWC 1N8RW 4UCTA 3R66A 2MK3A 3RYCA 2AHYA 4MT8A 1YJWV 1J5EB 5LXTA 4JGSA 3K04A 2CGOA 2UXBO 4I55B 3BVOA 3TXSA 1JFFB 3H9VA 1BQ0A 1F4MA 3CRCA 2BOCC 4H0LB 4FLYA 1SQFA 4I7ZB 5B5EZ 3S3XA 1N33B 5CBFA 3HKCB 3CP1A 4PA4A 4NXNO 1BHBA 1H2NA 3CSXA 2UXCO 3FB5C 1L0LH 2Q7EA 2CTWA 2UU9O 4KHPB 2B9ZA 1JOYA 3LUTB 2LQTA 3F5WC 4UV9A 1JPXA 3LDCA 4DV6O 3F5TA 2ZE7A 1V55C 1SQVH 1QR8A 4UXNA 4JYAB 4AQYB 1OCRB 2ZR3A 4GUNA 2QA4V 2WWWA 4DUYB 1KQSU 1N0NA 4LH7A 2YXHA 4IGGA 4DR7O 2F1MA 2V1DA 4B3RB 1OV9A 2HVJC 4QGPA 1K9MW 1NZ6A 3SPJA 4LFBO 3ZRVA 3ASNB 3SJCC 4GX1A 4X1IA 1K92A 2ZINA 3ZJZA 3K9SA 2EIMC 2YIAA 4JI1B 2XTAA 4FM2A 4O4LB 5JCOA 3FAVB 2M6YA 2EILB 5EBWC 4DR1O 4K0KB 1Q5OA 1M56C 4MW3A 2Q68A 2GTAA 3UT5B 4F4LA 4FLVA 1KBHA 3DC6A 3B2EE 4FIPC 4LF4B 2ZT9B 3CRQA 4X66O 4FLTA 3D3IA 3ABKB 4QNHB 1HR0B 2ZNIA 4KXRA 4ZOLB 4DUZB 4LF8O 2OWOA 4EEQA 2IM9A 2CGNA 2PYJA 5LBQA 4F6RB 3HPLC 4LCUC 4CBCA 3NXSA 3ETEA 5IE9A 3SYOA 2EINC 3OR7C 2BTOA 3OFNG 3SPGA 1PL4A 1V54B 4ZHQB 3U10A 1WPXA 4X8AA 3EXAA 4B08A 2ZR2A 1GAXA 1GN6A 2QDOA 1EBOA 2Y4UA 1PV0A 3OGIB 2CE4A 3SYAA 2A7WA 1GMGA 4LF5O 5IY5B 4G27B 3WFVA 2OYQA 2WLLB 1N0JA 1OCZB 5TISZ 4UB8Z 1JX9A 1AILA 4TUYB 4DV4B 3DXRB 1AJQA 2DYSC 1XL4A 1NQTA 4JI4B 3UT5A 4CH6A 1Y74B 1OZ0A 4BW5A 1JA8A 3D3QA 3AG1C 3JSNA 4ZOLA 4JI2O 4NR1A 2N74A 3RWRD 2DJVA 3BABA 4LNUB 4X20A 5K1XA 1IBLB 1YTFB 4PHZA 4YHHO 2BCCH 4GLXA 1AB3A 5C93A 1JJ2U 1XMQO 1IXBA 3CJHA 4R7CA 1AJNA 3K06A 4BIZA 4DR5O 3L70H 2DW4A 3I56V 3UCSC 3P3PA 1Y6XA 2O57A 2KSDA 1NVPB 1NR1A 2QE7G 4DV2B 1N32B 3JATA 4J41A 1GRJA 3SPCA 3LSSA 3FB7C 1SQBH 3P3NA 1AI7A 4YXWG 1KECA 3CCVV 2WLLA 2P6JA 2R70A 4WFGA 4ABMA 1D5NA 1FXKB 1FXVA 3ZEDA 4K8ZA 1Y74A 3G80A 1NKDA 5H2FZ 5LP6B 1UFIA 2BSKB 4HNAB 1VF6A 1CP9A 3TJTA 3BFRA 1L1FA 1RSOB 4DO2A 3L9DA 3A8TA 1PPJH 2CAZC 3K08A 1BHAA 1B6QA 1PNKA 2OTLV 4LWSB 5IJ9B 4E2LA 5LHIA 2FYUH 2IU0A 2RNBA 4UVCA 1A32A 2E5LO 2KG7A 3F7YC 2W0FC 5L3GA 4AHCA 4JAAA 4DR3B 1XMOB 4DR4B 4N23A 5CA0A 1AJPA 4A5UB 2FB5A 1Q3EA 1OCZC 1WN7A 2OTJV 4OX9O 3E86A 5LHHA 4I0XB 4DK1A 3E8BA 2LW1A 1R3KC 1IDSA 3KG2A 4MVUA 5C8YA 2F4VB 4MVSA 3OTOO 1GKFA 1O9HA 2EIJC 1BCCH 1URFA 4LC1A 3G4SV 2GBOA 3JAKB 1S5HC 3WU2Z 5BXZA 3ABMB 1H8EG 4LF6O 1RFYA 4RWUA 1ROPA 3RYHB 2Q5ZA 1IBMB 1FFXB 4O4JA 5EK0A 3X2QB 1RSOA 2HR3A 2NNUA 3E89A 4U3JA 3TXQA 3ZN1A 4FLZA 4JASA 3E8HA 2LP7A 2JGDA 4LWSA 1SQXH 1Q6UA 1XHZA 2WLHA 4JI0B 3WG7C 3J80N 1COWG 5EYPB 5BR8O 1S0VA 2D2CB 3ZS8C 2HVKC 1VQ5V 3SYCA 1YTFD 4I0XA 4DRXA 2XAGA 3RFRA 2YI8A 2E75B 3HB3B 3OAAG 1SKVA 2HP8A 2P4KA 2HG5C 1W59A 1VQOV 1R3IC 3ETDA 3SYPA 4XBFA 2QKAA 3A2FA 2HFEC 4X1KB 1NVPD 3L72H 4R6ZA 1EZVH 2EJRA 4IYHA 2ETNA 4JAVA 5BMVA 5JWPA 4KFMA 1SS3A 2QEXV 1Y67A 3Q4HB 5B1BB 1GM7A 4WFHA 5B1NA 3CCQV 2UUCB 1N34B 2VQFO 1FJGB 1YITV 2Q9LA 5LMUB 2DYRB 1CEZA 3G67A 4BW9A 1OCOC 4JYCA 1WA8B
chains in the Genus database with same CATH topology
5H5NA 4DV7O 2UUAO 4JI2O 2ZKOA 2N74A 1HNXO 1NS1A 4OPHA 4YY3O 2DJVA 4LF7O 1FYJA 2AGAA 4B3RO 4DV3O 3OTOO 1KUQA 5IT9N 4B3MO 4YHHO 4GKJO 1R1BA 1AB3A 4LFCO 1XMQO 5FLXN 2UUCO 1N36O 1N34O 3R66A 1FJGO 4DV0O 4DR5O 4B3SO 3J81N 4DR1O 5BXZA 4JI3O 4GKKO 4AQYO 4DR2O 4JI7O 4NXMO 1R6TA 2UXBO 4LF6O 2ZM6O 3SDLA 2LW7A 1XNQO 4JI1O 4DR6O 1IBLO 2Z0AA 4JI8O 5LMNO 4DV4O 4X66O 3O65A 1HNWO 4LF8O 3J7AU 4JI4O 4LF9O 4DR3O 2VQEO 1XMOO 4DR4O 5LL6Y 4JI6O 4K0KO 5LMUO 2FKXA 2UUBO 4OPAA 4JV5O 1I94O 2DOSA 4NXNO 1YZBA 2UXDO 3J80N 4X65O 4DV1O 4DV2O 2UXCO 2HHHO 4LF4O 5BR8O 5A2QN 2F4VO 4X62O 4DV5O 2UU9O 3RT3C 1D2DA 1J5EO 1N33O 5BY1A 4DV6O 3T1YO 3F5TA 3M8AA 3T1HO 1IBKO 1XNRO 1IBMO 4LF5O 4X64O 2JRIA 1N32O 4B3TO 4KHPO 1DK1A 5IWAO 4LFAO 4DR7O 1HR0O 4DUZO 1AILA 1A32A 2E5LO 1FKAO 1HNZO 1XEQA 4JI5O 2VQFO 1F7YA 4A5UB 1X59A 3JAMN 4JYAO 4LFBO 1G1XB 4DUYO 4JI0O 4OX9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5N A;  4DV7 O;  2UUA O;  4JI2 O;  2ZKO A;  2N74 A;  1HNX O;  1NS1 A;  4OPH A;  4YY3 O;  2DJV A;  4LF7 O;  1FYJ A;  2AGA A;  4B3R O;  4DV3 O;  3OTO O;  1KUQ A;  5IT9 N;  4B3M O;  4YHH O;  4GKJ O;  1R1B A;  1AB3 A;  4LFC O;  1XMQ O;  5FLX N;  2UUC O;  1N36 O;  1N34 O;  3R66 A;  1FJG O;  4DV0 O;  4DR5 O;  4B3S O;  3J81 N;  4DR1 O;  5BXZ A;  4JI3 O;  4GKK O;  4AQY O;  4DR2 O;  4JI7 O;  4NXM O;  1R6T A;  2UXB O;  4LF6 O;  2ZM6 O;  3SDL A;  2LW7 A;  1XNQ O;  4JI1 O;  4DR6 O;  1IBL O;  2Z0A A;  4JI8 O;  5LMN O;  4DV4 O;  4X66 O;  3O65 A;  1HNW O;  4LF8 O;  3J7A U;  4JI4 O;  4LF9 O;  4DR3 O;  2VQE O;  1XMO O;  4DR4 O;  5LL6 Y;  4JI6 O;  4K0K O;  5LMU O;  2FKX A;  2UUB O;  4OPA A;  4JV5 O;  1I94 O;  2DOS A;  4NXN O;  1YZB A;  2UXD O;  3J80 N;  4X65 O;  4DV1 O;  4DV2 O;  2UXC O;  2HHH O;  4LF4 O;  5BR8 O;  5A2Q N;  2F4V O;  4X62 O;  4DV5 O;  2UU9 O;  3RT3 C;  1D2D A;  1J5E O;  1N33 O;  5BY1 A;  4DV6 O;  3T1Y O;  3F5T A;  3M8A A;  3T1H O;  1IBK O;  1XNR O;  1IBM O;  4LF5 O;  4X64 O;  2JRI A;  1N32 O;  4B3T O;  4KHP O;  1DK1 A;  5IWA O;  4LFA O;  4DR7 O;  1HR0 O;  4DUZ O;  1AIL A;  1A32 A;  2E5L O;  1FKA O;  1HNZ O;  1XEQ A;  4JI5 O;  2VQF O;  1F7Y A;  4A5U B;  1X59 A;  3JAM N;  4JYA O;  4LFB O;  1G1X B;  4DUY O;  4JI0 O;  4OX9 O; 
#chains in the Genus database with same CATH topology
 1QQC A;  3B8N A;  4DV7 O;  4DR2 B;  3SPH A;  3C3S A;  4Q20 A;  1NS1 A;  2OCC B;  4DV1 B;  2HHH B;  2QJ1 A;  1NBM G;  1KUQ A;  1W0J G;  3ZMU A;  1KP3 A;  2F23 A;  2Y69 C;  2RQ6 A;  5FLX N;  4IYI A;  5EYP A;  4U7N A;  2AW9 A;  1HDJ A;  3T1H B;  4H33 A;  3TK1 A;  1G6U A;  1NT2 B;  2ZXW B;  5EIB D;  4O2B B;  4DR6 O;  2YXY A;  1AR1 B;  2XUM A;  4JI8 O;  1SZT A;  1Q6H A;  1ZAU A;  3BAA A;  4F6E A;  1KYO F;  2EJ7 A;  4FZ0 A;  2OT5 A;  3A0R A;  3TCU A;  2FML A;  4EFB A;  1IUR A;  3KCX A;  5CN0 A;  3F7V C;  5JVD B;  2Q6A A;  4FPP A;  4MW8 A;  5BZB A;  3Q4H A;  2Q4P A;  4FFB B;  1FS0 G;  1VAR A;  2ADQ B;  1S72 V;  1M57 C;  4DV5 O;  2ATK C;  3CWB H;  4DV3 B;  1WA8 A;  3ABU A;  3ZHS A;  1SZX A;  4JAU A;  4XDJ A;  1AI5 A;  2ZE8 A;  4MS2 A;  5BY1 A;  3K0G A;  3RYI B;  3B4S A;  2IJK A;  2YEV A;  1WP8 A;  1I7F A;  1XRE A;  2UXB B;  3W7W A;  1OCC C;  1VIB A;  2VWK A;  4L8J A;  1YI2 V;  3TET A;  2UUA B;  3N2K B;  3ZMT A;  1H8H G;  2P90 A;  4PEL A;  1XI1 A;  4G28 B;  1V55 B;  2BOB C;  3K03 A;  4YY3 B;  2ODM A;  1TVK A;  2XAS A;  1AR5 A;  3AK3 A;  1M93 A;  4TWK A;  1XL6 A;  1G1X B;  2DQ3 A;  2E3C A;  2KQX A;  4TT3 G;  1VQ7 V;  2ZNJ A;  4NXN B;  2ZM6 B;  1KB9 F;  2C2A A;  2UXC B;  1FYJ A;  5ITZ B;  4TV9 B;  4JPR A;  3CCR V;  4GKJ O;  2IH3 C;  5JVD A;  4FMT A;  1VQL V;  4GX0 A;  3FKS G;  4D7S A;  2EIM B;  4OGQ B;  3LNN A;  5LHG A;  2QKC A;  4Z2W A;  5FNV A;  1QLE C;  4ZBM A;  5GON B;  2L6L A;  3QNE A;  5JH7 A;  4QIW F;  1H38 A;  3JCZ A;  3OMA B;  2ZE6 A;  5LYJ B;  3RYI A;  1M56 B;  3UQ8 A;  4J9Y B;  1AP5 A;  4X62 B;  4DR7 B;  4QPK A;  1Y4M A;  1AVM A;  3DC5 A;  3N2K A;  2UUB O;  2P5O A;  4LFB B;  4OPA A;  1SQP H;  2DOS A;  4BR6 A;  4NTX A;  1P7B A;  2XOK G;  2D3O W;  2CTP A;  3CE2 A;  2HLD G;  5A2Q N;  1ZSP A;  2R72 A;  4KP4 A;  5EC1 C;  2WLN A;  3GB7 C;  2EIN B;  4O4I B;  4UFZ A;  4CH4 A;  1O9G A;  4P9O A;  2JS5 A;  3B77 A;  3CCE V;  4Q6G A;  1THZ A;  1LUV A;  1TGO A;  3RVZ A;  4DR1 B;  4TV9 A;  1MSW D;  5CA3 A;  1JQ0 A;  1XDC A;  1DF5 A;  2Z3Y A;  1S77 D;  4TV8 A;  2GV9 A;  4LFA O;  2BTQ A;  1XOU A;  1P49 A;  5KLV H;  4PA9 A;  4U7O A;  1P84 F;  3BEH A;  2WLJ A;  2PF4 E;  3HKD A;  1ZLZ A;  1VF5 B;  5LA6 B;  4RQE A;  4B3S B;  1YHQ V;  1QLN A;  2CH7 B;  5CA1 B;  1VQK V;  4GKK B;  3K79 A;  4JI7 B;  2DYS B;  3K5O A;  4H37 A;  5EC2 C;  5KA6 A;  1HNX O;  1XIL A;  2B5U A;  3CRR A;  5CMU A;  1TAE A;  3EFF K;  5IT9 N;  5B1A C;  3AG1 B;  4MVM A;  1XQ8 A;  2RJZ A;  2F93 B;  1N36 O;  4FFK A;  3VQX A;  5GTH Z;  4GZR B;  4I55 A;  4MTF A;  3ETG A;  4WFF A;  1NTZ H;  1JFF A;  4PA3 A;  2JIZ G;  2X7R B;  1VQ6 V;  4LBE C;  4LF5 B;  5KUK A;  5LGU A;  4K8X A;  4YJ3 B;  1BSM A;  3E83 A;  3HKC A;  2P7T C;  2QTO A;  1TUB B;  3PN1 A;  1FD9 A;  1I5Y A;  5EZY B;  1B3Q A;  1KU9 A;  3CCS V;  1K4D C;  4X64 B;  1Q82 W;  5LA6 A;  3ZHV A;  5LOV B;  1BZK A;  2UXN A;  2QWN B;  1LUW A;  3K59 A;  1D2D A;  4YHH B;  1CPY A;  1N33 O;  1TA8 A;  1MNG A;  1SC5 B;  3MHS C;  1FAF A;  1E1R G;  1YJ9 V;  3H1J H;  4MTX A;  2JRI A;  4PI2 A;  4TQD A;  1GN4 A;  4KHP O;  4KL1 A;  3SJQ C;  2Q67 A;  1GN2 A;  1K4C C;  5JJN B;  2YXL A;  3BA9 A;  4WCE V;  4JYA O;  1GM9 A;  1LR1 A;  4DV0 B;  4DUY O;  1RPR A;  3T4D A;  3K5M A;  5CBH A;  1IVS A;  1GK9 A;  4O4L A;  1TUB A;  1Q43 A;  2CTR A;  2IBZ H;  4OPH A;  1XNQ B;  5EZY A;  4B3R O;  3FAV A;  3AG2 C;  1F4N A;  5LMN B;  3W7T A;  3L71 H;  5JCO C;  3IJ4 A;  4LFC O;  3UO3 A;  2GUZ B;  3N27 A;  3K5L A;  1MA1 A;  4W4K A;  4LF9 B;  3IAY A;  3J81 N;  5GTI Z;  4QE7 A;  3UM7 A;  3BHP A;  2WLM A;  1JR9 A;  1KC8 W;  3T1C A;  2Z5U A;  1K73 W;  2EIJ B;  3ICX A;  1K5S A;  4FM0 A;  4JI1 O;  4X65 B;  2XHB A;  1R3L C;  1SQG A;  4NKG B;  3JD2 A;  5KHG A;  4I9Q A;  4F6R A;  2Q0O C;  5L3C A;  2VQE O;  4JI6 O;  4K0K O;  3OMI B;  4L87 A;  4ZHQ A;  5IDJ A;  3RYF B;  2Y48 A;  2YUA A;  4BIU A;  4JV5 O;  1I94 O;  1FPO A;  3JD3 A;  2EZP A;  3RVY A;  1G4Y B;  3GWO A;  4LF4 O;  1XUQ A;  4JTD B;  5IYD O;  4IIJ B;  1SF9 A;  4ZI7 B;  3N2G B;  4UV8 A;  3OTO B;  1K8A W;  5JJJ B;  3WG7 B;  1MSD A;  1VP7 A;  3STL C;  3ZHU A;  3QTC A;  2L35 A;  4JI5 B;  4BWA A;  1PP9 H;  4TUY A;  3DXR A;  1M90 W;  2DN9 A;  2QGN A;  3KCY A;  3E22 B;  4FJC C;  3IGA C;  4B3T O;  4WFA V;  3I5D A;  2OIG A;  3BCC H;  2GHY A;  2E76 B;  2PTM A;  1LNQ A;  4NB5 A;  5K1P A;  5KHH A;  4LNU A;  1R3J C;  4MVZ A;  4JYY A;  2FTK A;  1OCO B;  3CCU V;  2Y0I A;  3ZBH A;  4B3M O;  3RYF A;  4GYC B;  1GTO A;  1ORQ C;  3E2E A;  2A9H A;  4J11 A;  1K7D A;  2ARH A;  1VQ8 V;  4NXM O;  4ZI7 A;  2NLJ C;  2Y69 B;  2K1E A;  4EKW A;  5JQG B;  4N21 A;  1IBL O;  3P32 A;  4J80 A;  3O65 A;  4R50 A;  2EUL A;  5LL6 Y;  5B3S C;  1FXK A;  3E22 A;  4YIO A;  5GW7 A;  1NI8 A;  4PDV A;  5LP6 A;  1PL0 A;  3ABL C;  2BSK A;  4HNA A;  1MMM A;  1EFR G;  4DV7 B;  3AK1 A;  4DV2 O;  5H6Q A;  4X1Y B;  2W6I G;  1VF6 C;  4G2K A;  3W7S A;  4RAI A;  4QJF B;  4CH5 A;  4RQF A;  1N4C A;  4BAY A;  4UB6 Z;  3CME V;  5H6R A;  1IXM A;  5IJ9 A;  3ASO C;  4PJ0 Z;  2B1G A;  1M57 B;  4PDM A;  2H3O A;  1GN3 A;  2B1I A;  1W0K G;  4FZ1 A;  2GSM B;  4YJ2 B;  2RCV A;  3CC7 V;  1BE3 H;  1XHX A;  3A0H Z;  2Q69 A;  1Z5V A;  1YIJ V;  2YID A;  1OCC B;  3B8M A;  1HNZ O;  2X6C A;  2WA4 A;  3CEI A;  5IYZ B;  5JQG A;  1F7Y A;  1IX9 A;  1VQP V;  1X59 A;  1S5J A;  3G6B A;  2A0L A;  3E35 A;  2ZKO A;  2ZD9 A;  1MOF A;  1SER A;  3D8C A;  5J2U B;  2QM8 A;  3JAK A;  2Q7G A;  3G6E V;  1WPB A;  1UJW B;  4QE9 A;  3NR7 A;  3T2M A;  2EZO A;  2JK5 C;  2KKW A;  4I9W A;  3RYH A;  4H44 B;  1K5Q A;  3ZRS A;  1FFX A;  2X0L A;  4JI3 O;  4I4T B;  1BMF G;  3CD6 V;  3E8F A;  5FPO A;  2P67 A;  3KKY A;  3JAS B;  2UXD B;  4DK0 A;  5H9C A;  2CUG A;  2LFR A;  3JAW B;  2ITD C;  2K9P A;  4TOI A;  3J7A U;  1QLE B;  4ZIB A;  3ZRW B;  1RM1 C;  2YIB A;  4AI8 A;  1SA0 B;  4DW1 A;  2R9A A;  4FLW A;  2ZDI A;  4IHJ B;  1VQM V;  1ZL8 B;  1T5E A;  2IH1 C;  4JF3 A;  5B66 Z;  4Z1M G;  3W7X A;  1XNR B;  3CS5 A;  3H1H H;  1ARO P;  5IYZ A;  2AZ2 A;  4CH3 A;  2F66 C;  1QVG U;  4GKJ B;  4BIO A;  3LSQ A;  4CC5 A;  3L75 H;  3T4Z A;  3ABT A;  4X1K A;  4U3F H;  5J2U A;  2JS3 A;  4J10 A;  3C90 A;  1RP3 B;  2V4D A;  2WA3 A;  4J9Z B;  4WBN B;  5IWA O;  5A9G A;  2WPD G;  4I4T A;  5DED A;  3K3W A;  3C3T A;  2A79 B;  5CBG A;  3JSL A;  5DN6 G;  4K3A A;  4NVP A;  2UUB B;  3HKB B;  3CC2 V;  5EBL C;  1EN4 A;  3IC9 A;  5B1O A;  4O4H B;  2A3Q A;  2QM7 A;  3JCU Z;  4TQF A;  1PKX A;  2M7W A;  3K5N A;  4LF7 O;  2Q7H A;  4D7T A;  1KP2 A;  3AG4 B;  1SQQ H;  5J2T B;  4OXS A;  4EB6 B;  3R65 A;  4PDL A;  2HJD A;  2UUC O;  1N34 O;  1FJG O;  2R9R B;  1H2L A;  2CK3 G;  4O2B A;  2WLI B;  2GDS A;  2A06 H;  4DR2 O;  1R6T A;  1QR9 A;  2ILM A;  5B1A B;  4FLX A;  3RYC B;  4QPJ A;  2LW7 A;  3QO8 A;  4WF9 V;  3FFQ A;  2LO1 A;  5LXT B;  1TUE B;  3M99 B;  2PY5 A;  1YDX A;  4UCS A;  1SRY A;  4LFA B;  1WJZ A;  2X6A A;  1HNW O;  2UU9 B;  1EM1 A;  3U0Z A;  1VF7 A;  2N05 A;  3SGI A;  4DW0 A;  4J42 A;  4PV1 B;  4FFB A;  2P4V A;  4WBN A;  4DV6 B;  3VOU A;  2DMX A;  2G38 A;  3JAR B;  1F51 A;  4UUJ C;  1QCE A;  3OEE G;  1YCI A;  2QM4 A;  4B7E A;  1JVM A;  3W7U A;  4LH6 A;  4R8C A;  4GT1 A;  3K57 A;  3DTU B;  1R73 A;  2AZ0 A;  4P2Z A;  1VMG A;  3RGB A;  3OEH G;  3T1Y O;  4I5S A;  2VWJ A;  2YI9 A;  1IBK O;  4UVB A;  3JD1 A;  2X6B A;  4JYB A;  4LR3 A;  5KHI A;  5J2T A;  3EVK A;  2YC0 A;  5IYB O;  3OR6 C;  2QWP B;  2XAQ A;  2RN9 A;  5KX5 B;  1FKA O;  1S3J A;  4X88 A;  4MVO A;  2EIK C;  4PI0 A;  4CS3 A;  1NTK H;  2W0X A;  2Y4T A;  5ITZ A;  3BPZ A;  1KKD A;  2UUA O;  1B06 A;  1B04 A;  2H94 A;  2PUS A;  4YY3 O;  1JCH A;  1E1Q G;  4X1I B;  4MSW C;  3RW0 A;  4MVR A;  4J7K A;  4X66 B;  4W4L A;  3ZIA G;  3JAR A;  4LF8 B;  5KUM A;  5GON A;  3FYE B;  5JJE B;  4IT5 A;  2XT9 A;  3E8G A;  3AG2 B;  2LGW A;  5LYJ A;  2PI4 A;  1Q81 W;  3AG4 C;  2ZM6 O;  2HJF C;  1HP8 A;  3SDL A;  3D36 C;  1U96 A;  4FLU A;  1HWY A;  3FX7 A;  3AEI A;  3AG3 C;  4GX2 A;  1F23 A;  1IZ3 A;  1WB8 A;  2QR4 A;  4XDK A;  2NR5 A;  2XAJ A;  3CRA A;  3BA8 A;  1M5I A;  1R6K A;  3QG5 A;  4C7U A;  5KX5 A;  3APQ A;  4LP8 A;  4O4I A;  3RBZ A;  4GCZ A;  4CS4 A;  4X62 O;  2CTQ A;  1BL8 A;  2LFS A;  1Z2G A;  3RN4 A;  1PNL A;  2IJH A;  3DGE A;  4LFC B;  1J5E O;  4WFE A;  3QF7 A;  2EX3 A;  2JGU A;  1QU7 A;  1I0H A;  3SJA C;  4CZZ A;  1YXB A;  3FYI B;  2WLK A;  5DM6 V;  1Y76 B;  4JI2 B;  5FL7 G;  3VQY A;  2F43 G;  1AI6 A;  1NJI W;  3AG7 A;  1YJN V;  3CX5 F;  2CH7 A;  5CA1 A;  5L3E A;  1OHH G;  4UCU A;  2VQE B;  1XMQ B;  2XAH A;  4JI6 B;  1QHT A;  1DTO A;  1MG1 A;  4DR5 B;  3WB0 A;  1QBZ A;  4HZ3 A;  4JV5 B;  1RPO A;  1I94 B;  2WSS G;  2IW5 A;  2QWR B;  4UCO A;  1V9P A;  3A0B Z;  3ML0 A;  2HEP A;  2XAF A;  4X20 B;  4B3S O;  4GKK O;  1SET A;  3ETQ A;  4AQY O;  4JI7 O;  3KZI Z;  2JDI G;  3CJH B;  3HR0 A;  3VBB A;  4YJ3 A;  2HKO A;  1EN6 A;  2W6J G;  3CCJ V;  2AHZ A;  5IJ0 B;  1K3E A;  3MD0 A;  1AR4 A;  3CHX A;  3B09 A;  2JJ1 G;  4B3T B;  1UPG A;  4NTY A;  3UO2 A;  2Q0A A;  3L73 H;  3H1I H;  3JAT B;  1Y76 A;  2N04 A;  5LOV A;  3CYO A;  2QWQ B;  2JEX A;  5B3S B;  1I08 A;  1AP6 A;  1D5A A;  2GTS A;  2YSU B;  2P22 C;  3B40 A;  4P9P A;  1OCR C;  2NN4 A;  3ABL B;  1VQN V;  1H2G A;  4B3M B;  3RT3 C;  2E5L B;  3P30 A;  5DEC A;  1E79 G;  1GM8 A;  4NXM B;  4OX9 B;  3OT7 A;  3IC7 A;  2IJJ A;  4X64 O;  3JAL B;  5CB4 B;  2XND G;  1MAB G;  2PYL A;  1YEW A;  1P4R A;  3ASO B;  1NH2 B;  3ASN C;  1HR0 O;  2PI5 A;  2DWD C;  4DUZ O;  1FFT B;  4JTC B;  1VEW A;  4JZG A;  1G8M A;  4I50 B;  2IJI A;  3OD4 A;  4UVA A;  1JJO A;  5IJ0 A;  1BQZ A;  2ZE5 A;  3UKM A;  2KG7 B;  2H8P C;  1YVW A;  4LF6 B;  1H2M A;  4IL6 Z;  4CS2 A;  1K34 A;  5CA0 B;  3QO7 A;  2GUZ A;  2OIE A;  2EIL C;  2AGA A;  3ZHR A;  4CC6 A;  1S5L Z;  4DYL A;  1NU1 H;  5C8Y B;  4DV0 O;  1EZJ A;  4HBN A;  2VRZ A;  3PJS K;  3SR2 C;  5KA5 A;  2F95 B;  3ABK C;  3O9O A;  1R6N A;  4FM1 A;  1VQ9 V;  1XNQ O;  4RO2 A;  5E1A C;  3JD0 A;  5F2V O;  1GH6 A;  4JZ2 A;  5LMN O;  4MTG A;  5BR8 B;  4DV4 O;  5D5Q A;  4JI4 O;  4LF9 O;  4O4J B;  1QVF U;  1HW7 A;  3LDE A;  4U3J B;  3JAL A;  3ZMZ A;  1V54 C;  1HNZ B;  5CB4 A;  1KMI Z;  1AI4 A;  2FL4 A;  4J7J A;  3H1K H;  1OJH A;  3CXH F;  1DGS A;  3BY6 A;  2E74 B;  4IIJ A;  1PM9 A;  5L3D A;  1NR7 A;  2JGD B;  3N2G A;  1RM1 B;  1P7G A;  4X65 O;  2LGQ A;  4I50 A;  1WP7 A;  4P30 A;  4MVQ A;  3GWK C;  2YS8 A;  5IY5 C;  1M1K W;  3DSQ A;  3ZMV A;  4RUF A;  3M8A A;  1S76 D;  1CXZ B;  3CPW U;  2VQF B;  2ADP A;  4JI3 B;  4DRX B;  1Q6I A;  3JD4 A;  4AIL C;  1N32 O;  1MZE A;  3S3W A;  2PZS A;  4UCR A;  5FPR A;  4GX5 A;  2DE0 X;  3OGC C;  2ITC C;  3WB1 A;  4H13 B;  4JI5 O;  5BMV B;  3U11 A;  5EBM C;  2QWO B;  4YIP A;  4B7K A;  1K33 A;  1I5X A;  1X4T A;  4Z1V A;  4DR6 B;  4TSF G;  4JI8 B;  3QO5 A;  3MHH C;  1XBL A;  3OM3 B;  4FK5 C;  2RDC A;  5KMG B;  2R9I A;  1GO3 F;  3M7M X;  4UCV A;  2Z0A A;  3G71 V;  1QNM A;  3SYQ A;  5LGN A;  2V7Q G;  2DWE C;  5IWA B;  1Q90 D;  1NH2 D;  2OCH A;  4DV5 B;  3OTF A;  1SES A;  4JTA B;  4DR3 O;  1J95 A;  1FXK C;  1XMO O;  4DR4 O;  2ZQM A;  3VQW A;  3CXC U;  2FKX A;  2ZIO A;  2P06 A;  3LDD A;  5LP6 C;  4X1Y A;  3FB8 C;  3FD9 A;  4WFB V;  4D6T H;  2Y0P A;  4K35 A;  4FVM A;  2RMK B;  3ZN0 A;  3ZHQ A;  2F4V O;  1M4U A;  3MDS A;  4LF7 B;  5L3B A;  4RUE A;  5EIB C;  3CB2 A;  3SPI A;  2JEU A;  3MAQ A;  4X89 A;  1Q8I A;  1PD3 A;  2IU3 A;  3K0D A;  2CDY A;  4ASU G;  5L3F A;  1PNM A;  4ZKI A;  4YJ2 A;  2QKS A;  3VQV A;  2ZIM A;  2BE3 A;  1ZTE A;  4PA6 A;  5HFM A;  4KUM A;  1IBM O;  1WAZ A;  1ZUQ A;  2YEV B;  1H2S B;  1EN5 A;  1WNS A;  2Q73 A;  2YIC A;  3THO A;  3K58 A;  1KD1 W;  2LJ2 A;  3ZMS A;  1HNW B;  4EFE A;  5KMG A;  4X9Q A;  3CC4 V;  1YSC A;  3JYC A;  1XEQ A;  2QSA A;  4J7Z A;  3CCL V;  3AK2 A;  1JMK C;  3FB6 C;  1ENV A;  4O2A B;  4JI0 O;  1TVK B;  3L74 H;  3LSU A;  3IFX A;  5H5N A;  2EBO A;  5KAF Z;  4HYO A;  2EIK B;  5J9P C;  5LGT A;  5IYC O;  3H1L H;  1KKC A;  3ABM C;  1H2K A;  3OUF A;  1WB7 A;  1ZX3 A;  2MW2 B;  1BGY H;  3X2Q C;  1WLE A;  3T1Y B;  3JAS A;  3ZRX A;  1IBK B;  3JAW A;  2Q8V A;  3GVM A;  1NTM H;  3CMA V;  3ZRW A;  3CCM V;  1Y66 A;  3HKE B;  5FNV B;  1M9N A;  1SA0 A;  4ICG A;  4IHJ A;  5JH7 B;  1U97 A;  1BT8 A;  1ZL8 A;  1Q7Y W;  1MZF A;  5D5P A;  2ZDI C;  2KB1 A;  4DXW A;  5LMU O;  4XDL A;  3AG3 B;  3STZ C;  3QVN A;  3APO A;  5AG2 A;  1YZB A;  2UXD O;  2PGG A;  4DV1 O;  2HHH O;  2UXX A;  3LNM B;  1DF4 A;  2JJ2 G;  5E79 Z;  1Q86 W;  2WAM A;  4O2A A;  2QTS A;  1US6 A;  3ZCC A;  5KHK A;  4E4E A;  1FXH A;  2AXT Z;  3SJB C;  3T1H O;  3WB2 A;  1DLB A;  1ZWI C;  1Z5W A;  1XNR O;  3OW2 U;  3H01 A;  3CRM A;  1L8D A;  4PA7 A;  4PDR A;  3I55 V;  2YDE A;  1YF2 A;  2YIB D;  5B1B C;  2VS0 A;  3ZHT A;  1W2B U;  1L0N H;  1HNX B;  1DK1 A;  3ZX6 A;  2DYR C;  5KHJ A;  5HFL A;  3HKB A;  4NTW A;  4MTO A;  2OCC C;  4O4H A;  4TV8 B;  1N36 B;  2DQ0 A;  3JAM N;  4HAM A;  2BTQ B;  3TGU H;  3HKE A;  1K97 A;  3OUS A;  3K9A A;  4PD4 F;  3BRC A;  4EB6 A;  3HKD B;  3D36 A;  1BS3 A;  3OMN B;  2WLI A;  2ZCE A;  4NYK A;  4DV3 O;  1VQ4 V;  3OE7 G;  2JVD A;  1R1B A;  3EHB B;  5KAI Z;  2ZXW C;  1N8R W;  4UCT A;  3R66 A;  2MK3 A;  3RYC A;  2AHY A;  4MT8 A;  1YJW V;  1J5E B;  5LXT A;  4JGS A;  3K04 A;  2CGO A;  2UXB O;  4I55 B;  3BVO A;  3TXS A;  1JFF B;  3H9V A;  1BQ0 A;  1F4M A;  3CRC A;  2BOC C;  4H0L B;  4FLY A;  1SQF A;  4I7Z B;  5B5E Z;  3S3X A;  1N33 B;  5CBF A;  3HKC B;  3CP1 A;  4PA4 A;  4NXN O;  1BHB A;  1H2N A;  3CSX A;  2UXC O;  3FB5 C;  1L0L H;  2Q7E A;  2CTW A;  2UU9 O;  4KHP B;  2B9Z A;  1JOY A;  3LUT B;  2LQT A;  3F5W C;  4UV9 A;  1JPX A;  3LDC A;  4DV6 O;  3F5T A;  2ZE7 A;  1V55 C;  1SQV H;  1QR8 A;  4UXN A;  4JYA B;  4AQY B;  1OCR B;  2ZR3 A;  4GUN A;  2QA4 V;  2WWW A;  4DUY B;  1KQS U;  1N0N A;  4LH7 A;  2YXH A;  4IGG A;  4DR7 O;  2F1M A;  2V1D A;  4B3R B;  1OV9 A;  2HVJ C;  4QGP A;  1K9M W;  1NZ6 A;  3SPJ A;  4LFB O;  3ZRV A;  3ASN B;  3SJC C;  4GX1 A;  4X1I A;  1K92 A;  2ZIN A;  3ZJZ A;  3K9S A;  2EIM C;  2YIA A;  4JI1 B;  2XTA A;  4FM2 A;  4O4L B;  5JCO A;  3FAV B;  2M6Y A;  2EIL B;  5EBW C;  4DR1 O;  4K0K B;  1Q5O A;  1M56 C;  4MW3 A;  2Q68 A;  2GTA A;  3UT5 B;  4F4L A;  4FLV A;  1KBH A;  3DC6 A;  3B2E E;  4FIP C;  4LF4 B;  2ZT9 B;  3CRQ A;  4X66 O;  4FLT A;  3D3I A;  3ABK B;  4QNH B;  1HR0 B;  2ZNI A;  4KXR A;  4ZOL B;  4DUZ B;  4LF8 O;  2OWO A;  4EEQ A;  2IM9 A;  2CGN A;  2PYJ A;  5LBQ A;  4F6R B;  3HPL C;  4LCU C;  4CBC A;  3NXS A;  3ETE A;  5IE9 A;  3SYO A;  2EIN C;  3OR7 C;  2BTO A;  3OFN G;  3SPG A;  1PL4 A;  1V54 B;  4ZHQ B;  3U10 A;  1WPX A;  4X8A A;  3EXA A;  4B08 A;  2ZR2 A;  1GAX A;  1GN6 A;  2QDO A;  1EBO A;  2Y4U A;  1PV0 A;  3OGI B;  2CE4 A;  3SYA A;  2A7W A;  1GMG A;  4LF5 O;  5IY5 B;  4G27 B;  3WFV A;  2OYQ A;  2WLL B;  1N0J A;  1OCZ B;  5TIS Z;  4UB8 Z;  1JX9 A;  1AIL A;  4TUY B;  4DV4 B;  3DXR B;  1AJQ A;  2DYS C;  1XL4 A;  1NQT A;  4JI4 B;  3UT5 A;  4CH6 A;  1Y74 B;  1OZ0 A;  4BW5 A;  1JA8 A;  3D3Q A;  3AG1 C;  3JSN A;  4ZOL A;  4JI2 O;  4NR1 A;  2N74 A;  3RWR D;  2DJV A;  3BAB A;  4LNU B;  4X20 A;  5K1X A;  1IBL B;  1YTF B;  4PHZ A;  4YHH O;  2BCC H;  4GLX A;  1AB3 A;  5C93 A;  1JJ2 U;  1XMQ O;  1IXB A;  3CJH A;  4R7C A;  1AJN A;  3K06 A;  4BIZ A;  4DR5 O;  3L70 H;  2DW4 A;  3I56 V;  3UCS C;  3P3P A;  1Y6X A;  2O57 A;  2KSD A;  1NVP B;  1NR1 A;  2QE7 G;  4DV2 B;  1N32 B;  3JAT A;  4J41 A;  1GRJ A;  3SPC A;  3LSS A;  3FB7 C;  1SQB H;  3P3N A;  1AI7 A;  4YXW G;  1KEC A;  3CCV V;  2WLL A;  2P6J A;  2R70 A;  4WFG A;  4ABM A;  1D5N A;  1FXK B;  1FXV A;  3ZED A;  4K8Z A;  1Y74 A;  3G80 A;  1NKD A;  5H2F Z;  5LP6 B;  1UFI A;  2BSK B;  4HNA B;  1VF6 A;  1CP9 A;  3TJT A;  3BFR A;  1L1F A;  1RSO B;  4DO2 A;  3L9D A;  3A8T A;  1PPJ H;  2CAZ C;  3K08 A;  1BHA A;  1B6Q A;  1PNK A;  2OTL V;  4LWS B;  5IJ9 B;  4E2L A;  5LHI A;  2FYU H;  2IU0 A;  2RNB A;  4UVC A;  1A32 A;  2E5L O;  2KG7 A;  3F7Y C;  2W0F C;  5L3G A;  4AHC A;  4JAA A;  4DR3 B;  1XMO B;  4DR4 B;  4N23 A;  5CA0 A;  1AJP A;  4A5U B;  2FB5 A;  1Q3E A;  1OCZ C;  1WN7 A;  2OTJ V;  4OX9 O;  3E86 A;  5LHH A;  4I0X B;  4DK1 A;  3E8B A;  2LW1 A;  1R3K C;  1IDS A;  3KG2 A;  4MVU A;  5C8Y A;  2F4V B;  4MVS A;  3OTO O;  1GKF A;  1O9H A;  2EIJ C;  1BCC H;  1URF A;  4LC1 A;  3G4S V;  2GBO A;  3JAK B;  1S5H C;  3WU2 Z;  5BXZ A;  3ABM B;  1H8E G;  4LF6 O;  1RFY A;  4RWU A;  1ROP A;  3RYH B;  2Q5Z A;  1IBM B;  1FFX B;  4O4J A;  5EK0 A;  3X2Q B;  1RSO A;  2HR3 A;  2NNU A;  3E89 A;  4U3J A;  3TXQ A;  3ZN1 A;  4FLZ A;  4JAS A;  3E8H A;  2LP7 A;  2JGD A;  4LWS A;  1SQX H;  1Q6U A;  1XHZ A;  2WLH A;  4JI0 B;  3WG7 C;  3J80 N;  1COW G;  5EYP B;  5BR8 O;  1S0V A;  2D2C B;  3ZS8 C;  2HVK C;  1VQ5 V;  3SYC A;  1YTF D;  4I0X A;  4DRX A;  2XAG A;  3RFR A;  2YI8 A;  2E75 B;  3HB3 B;  3OAA G;  1SKV A;  2HP8 A;  2P4K A;  2HG5 C;  1W59 A;  1VQO V;  1R3I C;  3ETD A;  3SYP A;  4XBF A;  2QKA A;  3A2F A;  2HFE C;  4X1K B;  1NVP D;  3L72 H;  4R6Z A;  1EZV H;  2EJR A;  4IYH A;  2ETN A;  4JAV A;  5BMV A;  5JWP A;  4KFM A;  1SS3 A;  2QEX V;  1Y67 A;  3Q4H B;  5B1B B;  1GM7 A;  4WFH A;  5B1N A;  3CCQ V;  2UUC B;  1N34 B;  2VQF O;  1FJG B;  1YIT V;  2Q9L A;  5LMU B;  2DYR B;  1CEZ A;  3G67 A;  4BW9 A;  1OCO C;  4JYC A;  1WA8 B; 
#chains in the Genus database with same CATH homology
 5H5N A;  4DV7 O;  2UUA O;  4JI2 O;  2ZKO A;  2N74 A;  1HNX O;  1NS1 A;  4OPH A;  4YY3 O;  2DJV A;  4LF7 O;  1FYJ A;  2AGA A;  4B3R O;  4DV3 O;  3OTO O;  1KUQ A;  5IT9 N;  4B3M O;  4YHH O;  4GKJ O;  1R1B A;  1AB3 A;  4LFC O;  1XMQ O;  5FLX N;  2UUC O;  1N36 O;  1N34 O;  3R66 A;  1FJG O;  4DV0 O;  4DR5 O;  4B3S O;  3J81 N;  4DR1 O;  5BXZ A;  4JI3 O;  4GKK O;  4AQY O;  4DR2 O;  4JI7 O;  4NXM O;  1R6T A;  2UXB O;  4LF6 O;  2ZM6 O;  3SDL A;  2LW7 A;  1XNQ O;  4JI1 O;  4DR6 O;  1IBL O;  2Z0A A;  4JI8 O;  5LMN O;  4DV4 O;  4X66 O;  3O65 A;  1HNW O;  4LF8 O;  3J7A U;  4JI4 O;  4LF9 O;  4DR3 O;  2VQE O;  1XMO O;  4DR4 O;  5LL6 Y;  4JI6 O;  4K0K O;  5LMU O;  2FKX A;  2UUB O;  4OPA A;  4JV5 O;  1I94 O;  2DOS A;  4NXN O;  1YZB A;  2UXD O;  3J80 N;  4X65 O;  4DV1 O;  4DV2 O;  2UXC O;  2HHH O;  4LF4 O;  5BR8 O;  5A2Q N;  2F4V O;  4X62 O;  4DV5 O;  2UU9 O;  3RT3 C;  1D2D A;  1J5E O;  1N33 O;  5BY1 A;  4DV6 O;  3T1Y O;  3F5T A;  3M8A A;  3T1H O;  1IBK O;  1XNR O;  1IBM O;  4LF5 O;  4X64 O;  2JRI A;  1N32 O;  4B3T O;  4KHP O;  1DK1 A;  5IWA O;  4LFA O;  4DR7 O;  1HR0 O;  4DUZ O;  1AIL A;  1A32 A;  2E5L O;  1FKA O;  1HNZ O;  1XEQ A;  4JI5 O;  2VQF O;  1F7Y A;  4A5U B;  1X59 A;  3JAM N;  4JYA O;  4LFB O;  1G1X B;  4DUY O;  4JI0 O;  4OX9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...