4X89A

Navms voltage-gated sodium channal pore and c-terminal domain soaked with silver nitrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x89A00
1G4YB 2QTOA 2BOBC 2ITCC 3RW0A 4H33A 3T4ZA 5EBWC 4P30A 4P9PA 4RAIA 3FB5C 4PDVA 3K0GA 4R6ZA 2BOCC 4OXSA 4R8CA 1R3LC 4MSWC 5B1AC 3JYCA 3RVYA 4P9OA 3ABLC 5CBHA 4GX5A 5J9PC 2WLIA 3R65A 3KG2A 4KFMA 3AG1C 2ITDC 1KKDA 2WLHA 4PA3A 1R3KC 4PA7A 4MVQA 1V54C 2DWDC 2AHZA 4MTOA 2HVKC 4I9WA 2WLLA 1K4CC 3SPCA 3SPIA 2A79B 1M57C 3SYCA 2OCCC 3SYAA 3E83A 2EINC 4MVSA 4QNHB 3OUFA 4GX2A 3LDCA 3STLC 3E8GA 3TCUA 1JVMA 4PDLA 3E8BA 4RUFA 1S5HC 1BL8A 1OCRC 4RO2A 1M56C 3OGCC 4JTCB 3SPHA 5KUMA 2Q67A 4MVUA 4PDMA 3K06A 1XL6A 2A0LA 2ATKC 2ZD9A 4MVRA 3ASOC 3F5WC 3ASNC 2K1EA 3HPLC 3K08A 5E1AC 1XL4A 2NLJC 2HFEC 3AG2C 4CBCA 3E8FA 1V55C 3GB7C 3SPJA 3PJSK 1OCOC 3LNMB 2Q68A 2HG5C 2DWEC 2EIMC 2HVJC 2H8PC 1J95A 2WLKA 3OR6C 2JK5C 4PA9A 4MW3A 2AHYA 4TWKA 4XDJA 3K03A 5B3SC 1R3JC 2QKSA 4RUEA 4XDKA 1QLEC 3UKMA 1OCCC 2DYSC 4G27B 3K04A 3ABKC 3BEHA 3AG3C 3LUTB 3AG4C 3E86A 2Y69C 3OUSA 4H37A 4F4LA 3EFFK 4UUJC 1OCZC 2YEVA 4R50A 4XDLA 4WFHA 2P7TC 4X88A 1R3IC 2R9RB 3IGAC 4MTFA 5EBMC 4PA4A 1P7BA 2W0FC 3T2MA 4J9YB 2WLNA 3IFXA 5EBLC 2X6CA 4R7CA 3UM7A 3RBZA 4PA6A 4ZBMA 2EIKC 2WLMA 3SJQC 5CBGA 2DYRC 3E8HA 3TETA 5EK0A 4QE7A 4EKWA 2IH1C 4WFGA 4QE9A 5B1BC 4MVZA 4DXWA 4MVMA 2Q69A 3FB8C 3K0DA 2X6AA 3LDEA 3WG7C 1LNQA 4GX1A 3VOUA 5CBFA 3SPGA 3T1CA 1ZWIC 2Q6AA 2ZXWC 2EIJC 3RVZA 4MW8A 3ZRSA 4BW5A 2EILC 3FB6C 3E89A 4X8AA 3X2QC 3T4DA 3STZC 2WLIB 4GX0A 2X6BA 3F7VC 3F7YC 4WFFA 5IY5C 1K4DC 2KB1A 4G28B 2IH3C 4JTDB 4P2ZA 5BZBA 4HZ3A 4J9ZB 3FB7C 5EC2C 3SYQA 4PDRA 2A9HA 2HJFC 3OR7C 4MS2A 4MVOA 3ZJZA 1ORQC 4JTAB 4LCUC 4X89A 4LP8A 3ABMC 3LDDA 3SYOA 4HYOA 4MTGA 2WLJA 5EC1C 5KUKA 4LBEC 3SYPA 4WFEA 2WLLB
chains in the Genus database with same CATH superfamily
1G4YB 4GKJO 1YZBA 2OCCB 3CCRV 5KHJA 4JI7O 1N0NA 4PDVA 4DV4O 2QGNA 3UO2A 4R8CA 5C8YA 5KHKA 2UUCB 4IL6Z 4P9OA 5LYJA 4UVCA 4DUYB 4QJFB 3ASNB 5IDJA 4X1KA 2YIBD 2UXBO 4JPRA 2AW9A 4MTOA 2HVKC 4LF8B 3UO3A 4I9WA 3KZIZ 1VQMV 1J5EB 5CN0A 4I4TB 1BT8A 1JCHA 5B1NA 2BCCH 5FPOA 1TVKB 4PD4F 4X64O 1X59A 4OPHA 2KG7A 3TK1A 4X1IA 3K08A 4DV5B 4GZRB 4CBCA 3E22A 3SPJA 2ZIOA 1VQ4V 3TJTA 1K9MW 3FX7A 3AG7A 1VQ7V 3ZN0A 1R73A 4PA9A 2ZT9B 3I5DA 4Q6GA 4XDJA 3T1YO 4TV9A 2XASA 3U11A 1VQ9V 3ZX6A 2HHHO 1KC8W 3ZMZA 4R50A 3ZHRA 3CRMA 4LNUA 5ITZB 3O9OA 2PGGA 1Y66A 5EBMC 1GO3F 4D7SA 5L3CA 3W7SA 3OTFA 4FZ1A 4JI8O 2W0FC 4YJ3A 2ZDIC 3A0RA 1YXBA 5L3GA 4DV7O 2Q73A 2QWOB 5L3EA 1P84F 2P06A 2JVDA 2YUAA 2IH1C 3SJCC 4PI2A 2JS3A 1FKAO 2CE4A 4F6RB 2YXLA 2XT9A 2ZE5A 3ABLB 3C3SA 5F2VO 1UPGA 5IT9N 2ETNA 2Y0PA 3F7VC 5BZBA 2E74B 4CH3A 1V54B 1QR8A 1IXBA 1SS3A 1QVFU 1CXZB 1W2BU 1BHBA 3CCSV 5J2UA 2DYSB 4TV8A 2BOCC 3AG3B 2XTAA 3JSLA 1OZ0A 2Q7EA 1XMOO 4LF5B 5JJJB 1OCZB 4LF6B 3HKDB 4NXNO 4GLXA 2ZQMA 2XOKG 5D5QA 1BQ0A 3CE2A 1VQ6V 2EULA 2P6JA 5GTIZ 2EINC 4ZOLB 1MABG 4DR1B 1KUQA 3E8GA 1JVMA 2QR4A 2UXCB 2ZM6B 4RO2A 3ZBHA 3T1HB 1QHTA 3OE7G 4JI4O 3CSXA 3GVMA 4MVRA 2OIEA 1E1QG 2GDSA 3F5WC 3CMEV 4O4HA 3JD1A 1GM8A 1W0JG 5IYDO 2UUAB 1NKDA 5EZYB 1SA0B 3K9SA 2P22C 2WPDG 3CC7V 1URFA 1SESA 1Y67A 5LP6A 4G27B 1QBZA 3CCVV 3LUTB 3AG4C 1HR0O 3ETDA 3QVNA 2ZNIA 1Y74A 2LFSA 4MTFA 1G1XB 2WLNA 3IFXA 3RYFA 5J2TA 2YDEA 3ZHTA 4TT3G 4LFAO 3E8HA 4BW9A 1NZ6A 2D2CB 1U97A 1D5AA 4DV0B 2QWRB 1I5XA 1ZWIC 1WNSA 4DYLA 2WA4A 2WAMA 4A5UB 4GKKB 3F7YC 4D7TA 2LW7A 4J9ZB 2A9HA 1H8EG 2CDYA 2D3OW 4H0LB 3SYOA 2IJJA 5LHIA 3CJHA 2QTOA 2HJDA 1IXMA 5IWAB 3UQ8A 3M7MX 2ITCC 1GMGA 4J80A 5JH7B 3VQXA 1BMFG 1UFIA 5CA1B 5BXZA 3N2KB 1NS1A 5CMUA 5J9PC 3ABUA 2CH7B 2XAQA 3EXAA 3KG2A 1BE3H 2ITDC 3B77A 3UT5A 1CPYA 3Q4HA 3THOA 1EN5A 4HAMA 1THZA 3JCUZ 2LJ2A 3TCUA 3E8BA 3U10A 4WCEV 2EILB 3CD6V 1SQBH 1H2NA 2YS8A 1N8RW 4LH6A 3ZMVA 1GAXA 2KKWA 4IIJB 4FLXA 1PNMA 2EZPA 3EVKA 2H8PC 5GONB 3ZEDA 4J7JA 1H2MA 2JEXA 1M90W 2DMXA 2QKSA 5DM6V 4NXMO 4WFAV 2UU9B 1CP9A 1IURA 4UVBA 5KMGB 3JARA 2OTJV 1R3IC 4OX9O 3CYOA 1N0JA 2EX3A 4ZHQB 5B5EZ 3ZRWB 2QM8A 1Q82W 5E79Z 2PTMA 4QE9A 2QWQB 1AI6A 2H3OA 4UCOA 4IYIA 2ZXWC 3HKBA 4BW5A 3ZHUA 5DEDA 2WLIB 1XILA 2DE0X 2CTWA 1SQGA 4YY3O 1YJNV 3ZJZA 3CXHF 3ABMC 3LDDA 2ODMA 1NU1H 4QPKA 2XAHA 4FFBA 1I7FA 4BWAA 4JI5O 1WA8A 1VF6A 2OTLV 1XDCA 4O4JB 4U7OA 1SZXA 2BE3A 4CH6A 1RPOA 5KHIA 1JJ2U 2P5OA 3MD0A 2QEXV 3JD4A 1N33B 4B3MO 3CCUV 4WBNA 4ZIBA 2F43G 4O4LA 1N36O 3OFNG 4QNHB 4NTXA 2O57A 3G67A 1N34O 3DXRA 1KB9F 4RQEA 4N21A 1TAEA 4JTCB 4AQYB 4FLUA 4DR7B 2YC0A 4X62B 3K9AA 2ZR3A 2VQEB 3D3IA 4I50A 3WB2A 2FKXA 4DRXA 3OR6C 1VQLV 2XAJA 5A9GA 4E4EA 1GTOA 1FXHA 2JIZG 1XNQO 3K79A 5K1PA 4LFBB 3B2EE 2JJ2G 1PL0A 2Z3YA 4PA6A 3SJQC 4DV3B 2JGUA 2E5LB 2DYRC 3ZHSA 2Q69A 1VARA 1QU7A 2UUCO 1WP8A 3JAKB 2QKCA 2OWOA 4DUYO 2GUZB 1I0HA 2LGWA 4I9QA 1H2SB 4FLYA 1QLNA 1RSOA 3H01A 1VF5B 1VIBA 2B1IA 5D5PA 4EFBA 4LF8O 2RJZA 3HKEB 4DR3B 2RCVA 4DV2B 1L0NH 1AI5A 2CTQA 1J5EO 2M6YA 3C90A 4TUYB 4OXSA 4PJ0Z 4MSWC 5B1AC 4I5SA 3RFRA 2HKOA 3ETGA 5CBHA 4HNAA 1Y76B 4DV5O 1W59A 2WLHA 1BQZA 4X65B 4JYAB 4NR1A 4LF4B 1WPBA 3L73H 2E76B 2P4VA 4LF9B 1XHXA 1HNWB 4JF3A 1QLEB 1OCRC 1R1BA 3OGCC 4DV1O 2PY5A 5KA5A 3BAAA 4KL1A 3EHBB 5E1AC 1XL4A 5EYPB 3ZHQA 1OCOC 4NYKA 2Q68A 3A8TA 4NVPA 5LA6B 1K8AW 4O4IB 1HNXB 1FFXB 4I4TA 5B66Z 1TVKA 1PNKA 4UCSA 1B04A 4ICGA 5H5NA 4JAUA 2R9RB 2YIBA 4LWSB 4J9YB 3J7AU 4DR2B 3OM3B 2EIKC 1K92A 2RN9A 4UB6Z 3NXSA 5IJ0B 4DUZB 4LF5O 3SPGA 4LF6O 1XREA 3RWRD 2QDOA 3CCQV 5ITZA 1QQCA 4G28B 2LW1A 3OD4A 4GCZA 4JTAB 4MTGA 3A0HZ 3SYPA 4DR1O 1HDJA 4H33A 2DN9A 2UXCO 2ZM6O 3T1HO 2V4DA 5IYZB 1XMQB 4F6RA 4W4KA 4RQFA 3JYCA 1ZAUA 3LNNA 1QCEA 3AG1C 3QO5A 1H2GA 2UUAO 4KUMA 1Z2GA 1H8HG 2IM9A 3B8MA 1FJGB 5LXTB 4GT1A 2Q9LA 5LL6Y 1V9PA 2XAFA 1JFFB 4I7ZB 3BABA 3ZMSA 1KECA 4FIPC 4JYYA 2R72A 1GH6A 1OCCB 5EIBC 1SQFA 3ABKB 4Z1VA 5LOVB 5BR8B 4MVUA 1S3JA 3ASOC 3HKDA 1E1RG 3IC9A 3CHXA 1Q81W 1SZTA 3N2GB 5JJEB 4TOIA 2VS0A 2BTQB 4BIZA 3ABMB 3H1KH 4NTYA 1MMMA 3AK1A 2WLKA 2Y4TA 4ZOLA 4DV0O 5LP6C 1XQ8A 4FM1A 4RUEA 3EFFK 3WFVA 1YDXA 4U3JB 2YI9A 3ZS8C 3ETQA 3F5TA 1M4UA 3IGAC 2F23A 1GM9A 2GTAA 1Y6XA 4ZBMA 4QGPA 3FYIB 3S3XA 2K9PA 5EZYA 1SA0A 5IWAO 4QE7A 4B3SB 4JV5B 1SQVH 1SRYA 5B1BC 4KHPB 3FYEB 1G8MA 1O9GA 3LDEA 1VQ5V 4GX1A 4NB5A 2Q6AA 1P7GA 3X2QC 3T4DA 4KP4A 4Z2WA 4DW0A 2EJ7A 4B7EA 2LGQA 2RDCA 4K8ZA 5CA3A 2AZ0A 5HFMA 1F7YA 2LFRA 1Q6UA 3TGUH 4LFCB 2BOBC 4JI3B 5JVDB 3JD2A 4P30A 4P9PA 2JEUA 4DK1A 5LMUB 4KFMA 1US6A 3MHHC 1PP9H 3L9DA 2A06H 2DWDC 4I55B 1XNRB 1IBMB 1K4CC 1AVMA 1PKXA 5H6RA 4LF7B 1L1FA 5JH7A 5JJNB 1S5HC 2UU9O 3SPHA 3WB0A 1GN6A 3ZRVA 5CA1A 4JI6B 2A0LA 2ZD9A 3N2KA 2ZCEA 2CH7A 1IBKB 1NVPD 1TUEB 3DC6A 4X1YB 1COWG 1J95A 4EFEA 4YJ2B 4MW3A 1R3JC 1DGSA 4XDKA 3WG7B 2QJ1A 4GYCB 1GM7A 2EIJB 2R70A 1VQPV 3E86A 2Y69C 1ZTEA 3FKSG 1ZL8B 1AI4A 1YF2A 1NVPB 1FXKB 1K73W 2MW2B 1YJWV 1ZLZA 2PYJA 2AXTZ 2IU3A 2JGDB 4X20B 2QE7G 3JAWB 5BMVB 5GONA 2Q8VA 3P30A 1WB7A 2VWKA 1IVSA 5DECA 1AP6A 4K0KB 3RYCB 3T1CA 1K3EA 1FFTB 2QA4V 1RM1C 4X1IB 5IY5C 1W0KG 4IHJB 1N33O 5KMGA 4P2ZA 1YTFD 3FAVB 4FFKA 4MS2A 4ZHQA 1OCOB 3NR7A 4HYOA 5KUKA 4OGQB 3ZRWA 1NTMH 2ZE8A 4LR3A 4RAIA 1VF6C 1QVGU 1I94B 4R6ZA 3CRAA 4J10A 2BSKA 2IU0A 3CCLV 4FLVA 1M56B 4AQYO 1R3LC 4DR7O 4DR6B 4X62O 5JWPA 2WLIA 1P4RA 2C2AA 3GWKC 1KKDA 1YTFB 2VQEO 4FLWA 2NNUA 3VQYA 1RPRA 1MSWD 2XAGA 2HP8A 3A0BZ 3E35A 3J81N 4I0XB 1AJNA 1ZSPA 3DSQA 3JASB 3ZMUA 3RYIA 1P49A 4O4JA 3JALA 5H9CA 1PPJH 4EEQA 4LFBO 3J80N 3JAMN 1GKFA 4W4LA 2ZDIA 2IBZH 4DV3O 3AG2C 2E5LO 3JCZA 3CS5A 3SJBC 2EIMC 2UXDB 4NKGB 3ZN1A 1R6NA 2WWWA 3CCJV 3JSNA 1IBLB 2YI8A 3K58A 1MOFA 1UJWB 2E3CA 4IYHA 4IT5A 3M99B 2QSAA 2NN4A 3SJAC 4DR3O 5EBLC 1BS3A 4DV2O 1R6KA 1AROP 4X9QA 4EKWA 4DW1A 1PNLA 2R9IA 3RYHB 4TQFA 2LO1A 2FMLA 4UB8Z 2X6BA 4ZI7A 1B3QA 4HZ3A 5EC2C 3K57A 2HJFC 4JYAO 4DR5B 4MVOA 1EZVH 2Z5UA 4LP8A 4LF4O 3K5OA 1SQXH 3CRCA 4UFZA 4LF9O 1HNWO 1N32B 1M5IA 2PI4A 3T4ZA 5EBWC 1Q5OA 4UCVA 3OTOB 2Z0AA 2GUZA 1MA1A 5CA0B 3CB2A 1VP7A 2HR3A 2M7WA 2EJRA 4WF9V 4JAAA 1WN7A 1F4MA 5JCOA 4RWUA 2W6JG 3HKEA 1ZX3A 2Q4PA 2YXHA 1HNXO 5B1BB 2OCCC 4MVSA 4RUFA 2RNBA 1FPOA 4B08A 5KX5B 2YEVB 3ASNC 1Y76A 1I08A 4DR2O 2F95B 2CGNA 1V55C 4JZGA 5FNVB 3ZMTA 1TGOA 4DUZO 4JI0B 3CMAV 4FK5C 2GBOA 3JATA 3MDSA 3OUSA 2N74A 4DK0A 1JJOA 1WB8A 4XDLA 1HNZB 2P7TC 1XHZA 4Z1MG 1XEQA 3OMIB 2UXXA 2HLDG 3LSSA 3VQWA 1YIJV 1YVWA 2ZINA 1NT2B 5LA6A 1OV9A 5L3BA 5CB4B 4O4IA 3BPZA 4MTXA 4CH5A 1XMQO 4YXWG 2EZOA 1SC5B 3KCYA 3H1HH 3MHSC 3D3QA 3ZRSA 1S5LZ 2X0LA 5KAFZ 1BZKA 3A2FA 2IH3C 1NTKH 4LWSA 1FJGO 3TXQA 1EM1A 2OCHA 3G6BA 5LHHA 5C93A 2EINB 4GUNA 1NQTA 2QWPB 5BR8O 5IJ0A 4J7KA 4TSFG 3E2EA 2Y69B 3OW2U 3ABLC 1LR1A 1CEZA 1V54C 1JOYA 1S76D 3GWOA 4KXRA 3JD3A 1D2DA 3B8NA 2A79B 4GX2A 1Q3EA 5IYZA 3KCXA 3AG4B 2Q7GA 1VF7A 2ATKC 5IY5B 2KQXA 1AR1B 5KHGA 4BIOA 2K1EA 1RP3B 2PUSA 1JPXA 4O2AB 5JQGB 4B3SO 4JV5O 1O9HA 1TUBB 5LXTA 1JFFA 4JYCA 4KHPO 1FXVA 3APQA 5B3SC 3G6EV 4YHHB 1NH2D 2V7QG 2JJ1G 5LOVA 1AI7A 1YJ9V 5KA6A 4WFHA 4UCTA 3I55V 4B3TB 4X66B 4PA4A 3T2MA 5IYBO 3QNEA 4J11A 5L3FA 4LFCO 4JI3O 3O65A 3WB1A 3DXRB 2X6AA 1NH2B 1PV0A 2Q0AA 5LMUO 1PM9A 1M9NA 4J42A 2XHBA 4YIOA 3CPWU 2AZ2A 1WAZA 4U3JA 1MZEA 4FLTA 1XNRO 3CCMV 3QO7A 1IBMO 2P4KA 2F66C 4LBEC 4DRXB 2WLLB 2FYUH 4LF7O 4EB6B 4YIPA 3RW0A 5LMNB 2Q7HA 1XUQA 3FB5C 1EN6A 4JI6O 4FMTA 1IBKO 3R65A 1XBLA 3ICXA 3W7TA 1HWYA 3D36A 2NR5A 4CH4A 2GHYA 3BY6A 2Y4UA 3SYCA 3OEEG 4FM0A 1YI2V 5JVDA 1K33A 3BA8A 4PHZA 1HP8A 3L72H 1WPXA 3HPLC 1EBOA 3B40A 2QKAA 3W7UA 3BHPA 4I55A 3OEHG 1IX9A 2HVJC 1DTOA 1QR9A 5FL7G 4CS2A 4K0KO 3KKYA 5H6QA 1MSDA 3UKMA 4E2LA 3BEHA 3LSQA 2ZXWB 5H2FZ 4AI8A 4UUJC 1NTZH 2FTKA 2X6CA 4X1YA 3L74H 2GTSA 4UXNA 4U3FH 4JI1B 1I94O 2ZIMA 3FB8C 4YJ2A 4O2BB 2ZE7A 4FZ0A 4DR6O 4DR4B 3VOUA 2UUBB 4H44B 1AB3A 1NR7A 3FB6C 4GKKO 2A3QA 3STZC 2OIGA 1S77D 2KB1A 1ZL8A 3BRCA 3HKCB 1JA8A 2WSSG 1FXKA 1V55B 2WA3A 3QF7A 2KSDA 1BL8A 2JGDA 4JAVA 4X20A 4ABMA 3JAWA 3P32A 5BMVA 1GN4A 3RYCA 3P3NA 2BTOA 3K59A 1OJHA 4B3RB 3RN4A 2QWNB 4IHJA 4MT8A 4PA3A 3FAVA 2DQ0A 3HR0A 1GRJA 1VQOV 2PI5A 1L8DA 4UVAA 2UXDO 5A2QN 2DQ3A 3H9VA 3K5NA 3SYAA 2MK3A 1IBLO 1DLBA 5LGTA 1SETA 2YSUB 1VQ8V 4JI2B 4DV1B 4FJCC 4PI0A 3H1LH 1JX9A 1A32A 4B7KA 5IJ9B 1T5EA 2ILMA 2P67A 3G4SV 1FS0G 1OHHG 2DYRB 4I0XA 3B09A 1WP7A 3PN1A 5LGUA 2JK5C 3CC4V 3JASA 4BIUA 1S0VA 1SF9A 4XBFA 3K04A 2ZR2A 4FLZA 2CTPA 1ROPA 5FLXN 2B5UA 1DF5A 4DR5O 4X88A 4UV8A 2XUMA 1P7BA 1F51A 2WLMA 2F4VB 3MAQA 3BFRA 4DV6B 1N32O 2UXNA 3CEIA 5KLVH 1Z5VA 2ZKOA 3OTOO 2CUGA 5C8YB 4K35A 3RVZA 1Q43A 5B1AB 5LYJB 4K8XA 4FVMA 2QTSA 5KAIZ 3LSUA 1Q86W 4X1KB 4JTDB 1EFRG 2EBOA 1F23A 1K5QA 2OT5A 1AP5A 4IIJA 1K34A 3BCCH 4WFEA 1RFYA 1Q6IA 2FB5A 5B3SB 2L6LA 1VEWA 1KBHA 1EN4A 1VQKV 3RYHA 1OCRB 3RVYA 1SKVA 1K7DA 2KG7B 3G71V 4QPJA 1M1KW 3K3WA 2LP7A 1R3KC 3M8AA 4MVQA 3E22B 5JCOC 2AHZA 2VQFB 4K3AA 1SERA 1KU9A 4JI0O 4L87A 1B06A 1M57C 1AR4A 2H94A 3OUFA 4GKJB 1E79G 4TV9B 3LDCA 3STLC 3OAAG 4CZZA 4JI7B 3U0ZA 4DV4B 1S72V 3ABTA 4PDMA 1HNZO 5CA0A 3R66A 4LNUB 2IJKA 3G80A 3DGEA 4F6EA 4YJ3B 2NLJC 2HEPA 4AILC 2UXBB 3E8FA 4H13B 2EIKB 3PJSK 2VWJA 2DWEC 1D5NA 5LGNA 1NI8A 3OT7A 3K03A 3H1JH 1QLEC 2OYQA 2CK3G 4FPPA 5KX5A 2YEVA 2PF4E 4X64B 3SR2C 5AG2A 5LBQA 3DTUB 4R7CA 1I5YA 4L8JA 1MG1A 3AK3A 3TETA 5FNVA 4DO2A 2YICA 4DXWA 5J2UB 3APOA 1MZFA 3K0DA 3CRQA 4TV8B 5EIBD 1FYJA 1LNQA 3T1YB 2B9ZA 3IAYA 3VQVA 5GTHZ 4G2KA 2HHHB 3RGBA 1TA8A 2CAZC 3AG1B 1QNMA 3TXSA 3OR7C 1BHAA 3I56V 4X89A 4JI8B 2VRZA 1SQPH 4DV7B 3JD0A 2RMKB 5CB4A 3L71H 3BVOA 4LH7A 4ZKIA 3W7XA 4FM2A 1KD1W 4WFBV 1M93A 1S5JA 1AJPA 1K5SA 2ADQB 3ASOB 4O4HB 5IYCO 3D8CA 5IE9A 3CWBH 4X65O 3CXCU 1B6QA 3H1IH 2Q0OC 2F1MA 3SPIA 1LUWA 4YHHO 3OGIB 5LP6B 3BA9A 4UV9A 4PDLA 3JAKA 5KUMA 1VQNV 3K06A 3OMAB 3W7WA 1XMOB 1Y74B 1XI1A 4X66O 4B3TO 2P90A 2ZNJA 1BGYH 3AK2A 1DK1A 3RYFB 5J2TB 4NXNB 1WLEA 3SDLA 2HG5C 4BAYA 3QTCA 2BSKB 5FPRA 1OCCC 4JGSA 3ABKC 4TUYA 5K1XA 1Z5WA 3ETEA 4PV1B 3X2QB 4JI4B 2YIAA 4C7UA 2JS5A 4J7ZA 1HW7A 4O2AA 3RBZA 3SGIA 1KQSU 1H38A 5JQGA 1TUBA 3CJHB 4HBNA 5EK0A 5LMNO 1GN3A 1YCIA 3RYIB 1NR1A 1KP2A 3JALB 1AJQA 2G38A 4JZ2A 5GW7A 3E89A 4X8AA 4GX0A 4WFFA 1HR0B 1F4NA 3SYQA 1R6TA 2ZE6A 3UT5B 1YHQV 3ZIAG 1ORQC 1WJZA 4N23A 3UCSC 5EYPA 1MNGA 3Q4HB 4LFAB 1ENVA 2DW4A 2W0XA 2CTRA 3AEIA 1GN2A 1VMGA 3K5LA 1BSMA 1FFXA 2N04A 4U7NA 3WU2Z 4ASUG 2IJHA 2F93B 5HFLA 3D36C 3HB3B 3SPCA 2WLLA 3RT3C 3E83A 4EB6A 2DOSA 1YSCA 2QM4A 5BY1A 2Q67A 5LHGA 4ZI7B 3JARB 3ML0A 4CS3A 3K5MA 1SQQH 3OMNB 1H2LA 3QG5A 2A7WA 2IW5A 1AR5A 1U96A 4JI1O 3ZRXA 4DR4O 2UUBO 4TWKA 3QO8A 2DYSC 1Q8IA 3HKBB 3AG3C 4TQDA 4F4LA 2JDIG 1OCZC 1L0LH 1RM1B 1Y4MA 3CC2V 3UM7A 2B1GA 2FL4A 2X7RB 4FFBB 5L3DA 1M57B 2DJVA 3FD9A 1FD9A 4WFGA 4CS4A 1WA8B 4BR6A 1AILA 1IZ3A 3WG7C 2Y48A 4B3RO 5CBFA 1NJIW 1JR9A 2ADPA 2EIJC 4NXMB 4MW8A 2GSMB 1Q6HA 1K4DC 2YXYA 1BCCH 3FB7C 4WBNB 1FXKC 3N2GA 1KKCA 4OX9B 4LCUC 2BTQA 4JYBA 2W6IG 3IC7A 5EC1C 4O4LB 2HFEC 3S3WA 3CRRA 2LQTA 1X4TA 4O2BA 1KYOF 1KP3A 3JATB 3K0GA 2CGOA 2ARHA 2V1DA 4JI2O 4Q20A 2GV9A 4GX5A 3ZHVA 1H2KA 2R9AA 4J41A 4UCUA 1G6UA 1LUVA 3HKCA 4PA7A 1XOUA 5TISZ 3AG2B 3FFQA 4YY3B 4NTWA 4I50B 2EIMB 2E75B 1JQ0A 1EZJA 4JI5B 4CC5A 2AGAA 1M56C 1DF4A 3CX5F 4PELA 4JASA 1XL6A 2XNDG 4OPAA 5DN6G 1K97A 2PYLA 3N27A 1N4CA 4D6TH 2F4VO 4B3MB 3GB7C 4DV6O 3LNMB 2QM7A 3P3PA 1YEWA 3CCEV 4IGGA 1N36B 2AHYA 2RQ6A 1FAFA 1NBMG 2L35A 1N34B 3VBBA 2PZSA 4UCRA 4LC1A 3ZCCA 1RSOB 4AHCA 4H37A 3C3TA 3B4SA 2Y0IA 1GK9A 1IDSA 1PL4A 1YITV 2YIDA 5B1OA 5IJ9A 1KMIZ 4QIWF 5CBGA 4CC6A 2Q5ZA 1Q7YW 4MVZA 4MVMA 1JMKC 5KHHA 2N05A 3CP1A 3L75H 2EILC 4HNAB 1PD3A 3L70H 1XNQB 1Q90D 4PDRA 3IJ4A 3DC5A 2VQFO 2IJIA 2WLJA 1ZUQA 2JRIA
chains in the Genus database with same CATH topology
1G4YB 1AI5A 2OCCB 3CCRV 2PI4A 5B3SB 3T4ZA 5EBWC 4PDVA 1VQKV 4OXSA 1OCRB 4R8CA 4MSWC 5B1AC 3RVYA 4I5SA 4P9OA 2HKOA 4UVCA 3ETGA 1K7DA 4QJFB 5CBHA 3G71V 2HR3A 2M7WA 3ASNB 5IDJA 4QPJA 1M1KW 2WLHA 3K3WA 2EJRA 4WF9V 2LP7A 1R3KC 4MVQA 4JPRA 1F4MA 2AHZA 4MTOA 2W6JG 1SERA 2HVKC 4I9WA 4L87A 1M57C 5B1BB 2OCCC 2H94A 4MVSA 1VQMV 3OUFA 1E79G 5CN0A 3LDCA 3STLC 1JCHA 3OAAG 5B1NA 4JF3A 4CZZA 1QLEB 4RUFA 1OCRC 3OGCC 1S72V 3ABTA 4PDMA 5KA5A 2YEVB 2IJKA 3TK1A 3ASNC 3DGEA 3K08A 3EHBB 5E1AC 1XL4A 2NLJC 4CBCA 3E8FA 1V55C 3SPJA 2EIKB 3PJSK 1OCOC 1VQ4V 1K9MW 2Q68A 1K8AW 2DWEC 1VQ7V 5LGNA 3ZMTA 3ZN0A 1R73A 4PA9A 4XDJA 3CMAV 3K03A 4FK5C 2XASA 1QLEC 1VQ9V 2CK3G 1PNKA 4FPPA 1KC8W 3OUSA 2YEVA 3ZMZA 4R50A 4XDLA 4JAUA 2P7TC 4Z1MG 5LBQA 1Y66A 2R9RB 1GO3F 5EBMC 5L3CA 3W7SA 2W0FC 3DTUB 2ZDIC 3A0RA 3OMIB 2UXXA 4J9YB 4R7CA 3OM3B 1I5YA 5L3GA 2EIKC 2HLDG 3LSSA 5L3EA 1YIJV 1K92A 1MG1A 3TETA 2IH1C 4DO2A 5L3BA 4MTXA 4DXWA 4YXWG 3K0DA 2EZOA 3NXSA 3MHSC 1LNQA 3SPGA 3ZRSA 2X0LA 3ABLB 4G2KA 3CCQV 3F7VC 3AG1B 5BZBA 4G28B 2IH3C 3OR7C 4GCZA 1BHAA 1V54B 1QR8A 3I56V 4JTAB 4X89A 4MTGA 3SYPA 1QVFU 5LHHA 1W2BU 1BHBA 3CCSV 5C93A 3JD0A 2EINB 4H33A 1NQTA 2DYSB 4ZKIA 3W7XA 2BOCC 3AG3B 4TSFG 1OZ0A 4RQFA 3E2EA 2Y69B 3JYCA 4WFBV 1KD1W 3OW2U 1OCZB 3ABLC 1AJPA 1K5SA 3ASOB 1QCEA 5IYCO 3AG1C 3QO5A 1CEZA 1H2GA 4KUMA 2ZQMA 1B6QA 3CXCU 1H8HG 2XOKG 1V54C 1JOYA 3B8MA 1S76D 3GWOA 3JD3A 4GT1A 2XAFA 3SPIA 3B8NA 2A79B 1VQ6V 2P6JA 2EINC 1MABG 1KECA 3ZMSA 4FIPC 4GX2A 4UV9A 3E8GA 1JVMA 4PDLA 1OCCB 3ABKB 4RO2A 5KUMA 3OE7G 3AG4B 4MVUA 1VQNV 1S3JA 3K06A 2ATKC 4MVRA 3OMAB 5IY5B 1E1QG 3ASOC 3W7WA 3F5WC 3CMEV 1AR1B 2P90A 1E1RG 2K1EA 3JD1A 1GM8A 1Q81W 1SZTA 1W0JG 4BIZA 5IYDO 1JPXA 1WLEA 3ABMB 1NKDA 2HG5C 2WPDG 3CC7V 4JYCA 1FXVA 2WLKA 4BAYA 1SESA 5B3SC 3G6EV 4RUEA 1NH2D 1OCCC 2V7QG 4G27B 3ABKC 4JGSA 1QBZA 2JJ1G 3CCVV 3LUTB 3AG4C 1AI7A 3ETDA 3EFFK 3WFVA 1YJ9V 3ETEA 3X2QB 5KA6A 4WFHA 2LFSA 4MTFA 3I55V 3IGAC 4PA4A 3T2MA 2WLNA 3IFXA 1GM9A 3RBZA 5IYBO 4TT3G 4ZBMA 1KQSU 3QNEA 3FYIB 1H38A 5L3FA 3E8HA 5EK0A 4QE7A 1SRYA 5B1BC 3FYEB 1G8MA 1NR1A 2X6AA 3LDEA 1VQ5V 4GX1A 1NH2B 1KP2A 1I5XA 1AJQA 1ZWIC 2Q6AA 1M9NA 5GW7A 2WAMA 3E89A 4X8AA 3X2QC 3CPWU 3T4DA 4GX0A 4WFFA 3F7YC 1F4NA 4KP4A 4J9ZB 3SYQA 2A9HA 1H8EG 1YHQV 2D3OW 3CCMV 3ZIAG 1ORQC 3QO7A 4N23A 3SYOA 5CA3A 5HFMA 2IJJA 5LHIA 4LBEC 2WLLB 1ENVA 2LFRA 2DW4A 2QTOA 1IXMA 2BOBC 2ITCC 3AEIA 3RW0A 1GMGA 3JD2A 4P30A 4P9PA 3FB5C 2JEUA 1BMFG 4FMTA 4U7NA 5CMUA 5J9PC 3R65A 3ABUA 2XAQA 3KG2A 4KFMA 4ASUG 2IJHA 2ITDC 3MHHC 5HFLA 3B77A 3W7TA 1HWYA 3HB3B 3D36A 2GHYA 2DWDC 1CPYA 3BY6A 3SPCA 2WLLA 1K4CC 3OEEG 3SYCA 1PKXA 3E83A 1YI2V 4HAMA 1THZA 5H6RA 1K33A 1L1FA 1YSCA 3TCUA 3E8BA 1S5HC 4WCEV 3SPHA 2EILB 3ZRVA 2Q67A 5LHGA 3CD6V 2A0LA 2ZD9A 1WPXA 1N8RW 3ML0A 3HPLC 1NVPD 1EBOA 1TUEB 3OMNB 3ZMVA 3W7UA 2IW5A 1PNMA 2EZPA 3OEHG 2HVJC 1COWG 3ZRXA 2H8PC 1J95A 1DTOA 1QR9A 5FL7G 2JEXA 1M90W 4MW3A 4TWKA 3QO8A 1R3JC 2QKSA 5H6QA 4XDKA 3WG7B 3UKMA 5DM6V 2DYSC 4E2LA 3BEHA 3AG3C 1GM7A 2ZXWB 2EIJB 3LSQA 4WFAV 1VQPV 3E86A 2Y69C 4F4LA 2JDIG 4UUJC 1OCZC 1CP9A 1RM1B 3FKSG 4UVBA 1Y4MA 2OTJV 1R3IC 1AI4A 3CC2V 2FTKA 3CYOA 1NVPB 1FXKB 2X6CA 1K73W 3UM7A 2B1GA 1YJWV 2X7RB 3ZRWB 2QM8A 2IU3A 5L3DA 1M57B 2QE7G 4UXNA 1Q82W 4WFGA 4QE9A 3P30A 1AI6A 3FB8C 3WG7C 2Y48A 3VOUA 5CBFA 1NJIW 3T1CA 2ZXWC 2EIJC 1K3EA 4MW8A 1NR7A 2GSMB 4BW5A 1FFTB 2QA4V 3FB6C 1RM1C 3STZC 2WLIB 5IY5C 1W0KG 1K4DC 1S77D 2KB1A 4P2ZA 1YTFD 3FB7C 2WSSG 1FXKC 4MS2A 1FXKA 1YJNV 1V55B 3ZJZA 4LCUC 1OCOB 3ABMC 3LDDA 4JYBA 2W6IG 4HYOA 3IC7A 5EC1C 5KUKA 3ZRWA 4QPKA 2XAHA 2HFEC 1BL8A 4JAVA 3P32A 4RAIA 1KP3A 3K0GA 1QVGU 2OTLV 4R6ZA 2IU0A 2V1DA 4U7OA 3CCLV 1M56B 1R3LC 4Q20A 4GX5A 2WLIA 1P4RA 1RPOA 2C2AA 1JJ2U 3MD0A 2QEXV 3JD4A 4MT8A 1KKDA 1YTFB 4PA3A 3CCUV 2DQ0A 4PA7A 1VQOV 2PI5A 2F43G 3AG2B 2NNUA 1RPRA 4UVAA 1MSWD 2XAGA 3E35A 2DQ3A 1AJNA 2EIMB 3OFNG 3SYAA 1JQ0A 4QNHB 2MK3A 3ZMUA 1EZJA 4RQEA 1DLBA 5LGTA 1SETA 4N21A 1M56C 2YSUB 4JTCB 1DF4A 5H9CA 4PELA 4JASA 1XL6A 2XNDG 5DN6G 1VQ8V 4FJCC 1JX9A 1K97A 3K9AA 1GKFA 2ZDIA 3AG2C 2ZR3A 3GB7C 2P67A 3G4SV 1FS0G 3JCZA 3D3IA 3LNMB 1OHHG 2DYRB 2QM7A 2EIMC 3ZN1A 3CCEV 3OR6C 1R6NA 1VQLV 5LGUA 2XAJA 2JK5C 2WWWA 2AHYA 3CC4V 4BIUA 3CCJV 1S0VA 1NBMG 4XBFA 3K04A 2ZR2A 1GTOA 3VBBA 1FXHA 4LC1A 1MOFA 3ZCCA 2JIZG 1UJWB 4H37A 1ROPA 2B5UA 3K79A 1DF5A 3M99B 4X88A 4UV8A 1GK9A 1YITV 1P7BA 5B1OA 5EBLC 2JJ2G 1R6KA 1PL0A 2Z3YA 4PA6A 1F51A 2WLMA 3SJQC 4QIWF 5CBGA 2DYRC 1AROP 2UXNA 4EKWA 1Q7YW 4MVZA 4MVMA 2Q69A 1PNLA 2R9IA 3CP1A 3RVZA 5B1AB 2EILC 1QLNA 1PD3A 2X6BA 1Q86W 3H01A 4JTDB 4HZ3A 5EC2C 4PDRA 2HJFC 1EFRG 4MVOA 2B1IA 2Z5UA 2EBOA 1F23A 1K5QA 2OT5A 4LP8A 1K34A 2IJIA 2WLJA 4WFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4Y B;  2QTO A;  2BOB C;  2ITC C;  3RW0 A;  4H33 A;  3T4Z A;  5EBW C;  4P30 A;  4P9P A;  4RAI A;  3FB5 C;  4PDV A;  3K0G A;  4R6Z A;  2BOC C;  4OXS A;  4R8C A;  1R3L C;  4MSW C;  5B1A C;  3JYC A;  3RVY A;  4P9O A;  3ABL C;  5CBH A;  4GX5 A;  5J9P C;  2WLI A;  3R65 A;  3KG2 A;  4KFM A;  3AG1 C;  2ITD C;  1KKD A;  2WLH A;  4PA3 A;  1R3K C;  4PA7 A;  4MVQ A;  1V54 C;  2DWD C;  2AHZ A;  4MTO A;  2HVK C;  4I9W A;  2WLL A;  1K4C C;  3SPC A;  3SPI A;  2A79 B;  1M57 C;  3SYC A;  2OCC C;  3SYA A;  3E83 A;  2EIN C;  4MVS A;  4QNH B;  3OUF A;  4GX2 A;  3LDC A;  3STL C;  3E8G A;  3TCU A;  1JVM A;  4PDL A;  3E8B A;  4RUF A;  1S5H C;  1BL8 A;  1OCR C;  4RO2 A;  1M56 C;  3OGC C;  4JTC B;  3SPH A;  5KUM A;  2Q67 A;  4MVU A;  4PDM A;  3K06 A;  1XL6 A;  2A0L A;  2ATK C;  2ZD9 A;  4MVR A;  3ASO C;  3F5W C;  3ASN C;  2K1E A;  3HPL C;  3K08 A;  5E1A C;  1XL4 A;  2NLJ C;  2HFE C;  3AG2 C;  4CBC A;  3E8F A;  1V55 C;  3GB7 C;  3SPJ A;  3PJS K;  1OCO C;  3LNM B;  2Q68 A;  2HG5 C;  2DWE C;  2EIM C;  2HVJ C;  2H8P C;  1J95 A;  2WLK A;  3OR6 C;  2JK5 C;  4PA9 A;  4MW3 A;  2AHY A;  4TWK A;  4XDJ A;  3K03 A;  5B3S C;  1R3J C;  2QKS A;  4RUE A;  4XDK A;  1QLE C;  3UKM A;  1OCC C;  2DYS C;  4G27 B;  3K04 A;  3ABK C;  3BEH A;  3AG3 C;  3LUT B;  3AG4 C;  3E86 A;  2Y69 C;  3OUS A;  4H37 A;  4F4L A;  3EFF K;  4UUJ C;  1OCZ C;  2YEV A;  4R50 A;  4XDL A;  4WFH A;  2P7T C;  4X88 A;  1R3I C;  2R9R B;  3IGA C;  4MTF A;  5EBM C;  4PA4 A;  1P7B A;  2W0F C;  3T2M A;  4J9Y B;  2WLN A;  3IFX A;  5EBL C;  2X6C A;  4R7C A;  3UM7 A;  3RBZ A;  4PA6 A;  4ZBM A;  2EIK C;  2WLM A;  3SJQ C;  5CBG A;  2DYR C;  3E8H A;  3TET A;  5EK0 A;  4QE7 A;  4EKW A;  2IH1 C;  4WFG A;  4QE9 A;  5B1B C;  4MVZ A;  4DXW A;  4MVM A;  2Q69 A;  3FB8 C;  3K0D A;  2X6A A;  3LDE A;  3WG7 C;  1LNQ A;  4GX1 A;  3VOU A;  5CBF A;  3SPG A;  3T1C A;  1ZWI C;  2Q6A A;  2ZXW C;  2EIJ C;  3RVZ A;  4MW8 A;  3ZRS A;  4BW5 A;  2EIL C;  3FB6 C;  3E89 A;  4X8A A;  3X2Q C;  3T4D A;  3STZ C;  2WLI B;  4GX0 A;  2X6B A;  3F7V C;  3F7Y C;  4WFF A;  5IY5 C;  1K4D C;  2KB1 A;  4G28 B;  2IH3 C;  4JTD B;  4P2Z A;  5BZB A;  4HZ3 A;  4J9Z B;  3FB7 C;  5EC2 C;  3SYQ A;  4PDR A;  2A9H A;  2HJF C;  3OR7 C;  4MS2 A;  4MVO A;  3ZJZ A;  1ORQ C;  4JTA B;  4LCU C;  4X89 A;  4LP8 A;  3ABM C;  3LDD A;  3SYO A;  4HYO A;  4MTG A;  2WLJ A;  5EC1 C;  5KUK A;  4LBE C;  3SYP A;  4WFE A;  2WLL B; 
#chains in the Genus database with same CATH topology
 1G4Y B;  4GKJ O;  1YZB A;  2OCC B;  3CCR V;  5KHJ A;  4JI7 O;  1N0N A;  4PDV A;  4DV4 O;  2QGN A;  3UO2 A;  4R8C A;  5C8Y A;  5KHK A;  2UUC B;  4IL6 Z;  4P9O A;  5LYJ A;  4UVC A;  4DUY B;  4QJF B;  3ASN B;  5IDJ A;  4X1K A;  2YIB D;  2UXB O;  4JPR A;  2AW9 A;  4MTO A;  2HVK C;  4LF8 B;  3UO3 A;  4I9W A;  3KZI Z;  1VQM V;  1J5E B;  5CN0 A;  4I4T B;  1BT8 A;  1JCH A;  5B1N A;  2BCC H;  5FPO A;  1TVK B;  4PD4 F;  4X64 O;  1X59 A;  4OPH A;  2KG7 A;  3TK1 A;  4X1I A;  3K08 A;  4DV5 B;  4GZR B;  4CBC A;  3E22 A;  3SPJ A;  2ZIO A;  1VQ4 V;  3TJT A;  1K9M W;  3FX7 A;  3AG7 A;  1VQ7 V;  3ZN0 A;  1R73 A;  4PA9 A;  2ZT9 B;  3I5D A;  4Q6G A;  4XDJ A;  3T1Y O;  4TV9 A;  2XAS A;  3U11 A;  1VQ9 V;  3ZX6 A;  2HHH O;  1KC8 W;  3ZMZ A;  4R50 A;  3ZHR A;  3CRM A;  4LNU A;  5ITZ B;  3O9O A;  2PGG A;  1Y66 A;  5EBM C;  1GO3 F;  4D7S A;  5L3C A;  3W7S A;  3OTF A;  4FZ1 A;  4JI8 O;  2W0F C;  4YJ3 A;  2ZDI C;  3A0R A;  1YXB A;  5L3G A;  4DV7 O;  2Q73 A;  2QWO B;  5L3E A;  1P84 F;  2P06 A;  2JVD A;  2YUA A;  2IH1 C;  3SJC C;  4PI2 A;  2JS3 A;  1FKA O;  2CE4 A;  4F6R B;  2YXL A;  2XT9 A;  2ZE5 A;  3ABL B;  3C3S A;  5F2V O;  1UPG A;  5IT9 N;  2ETN A;  2Y0P A;  3F7V C;  5BZB A;  2E74 B;  4CH3 A;  1V54 B;  1QR8 A;  1IXB A;  1SS3 A;  1QVF U;  1CXZ B;  1W2B U;  1BHB A;  3CCS V;  5J2U A;  2DYS B;  4TV8 A;  2BOC C;  3AG3 B;  2XTA A;  3JSL A;  1OZ0 A;  2Q7E A;  1XMO O;  4LF5 B;  5JJJ B;  1OCZ B;  4LF6 B;  3HKD B;  4NXN O;  4GLX A;  2ZQM A;  2XOK G;  5D5Q A;  1BQ0 A;  3CE2 A;  1VQ6 V;  2EUL A;  2P6J A;  5GTI Z;  2EIN C;  4ZOL B;  1MAB G;  4DR1 B;  1KUQ A;  3E8G A;  1JVM A;  2QR4 A;  2UXC B;  2ZM6 B;  4RO2 A;  3ZBH A;  3T1H B;  1QHT A;  3OE7 G;  4JI4 O;  3CSX A;  3GVM A;  4MVR A;  2OIE A;  1E1Q G;  2GDS A;  3F5W C;  3CME V;  4O4H A;  3JD1 A;  1GM8 A;  1W0J G;  5IYD O;  2UUA B;  1NKD A;  5EZY B;  1SA0 B;  3K9S A;  2P22 C;  2WPD G;  3CC7 V;  1URF A;  1SES A;  1Y67 A;  5LP6 A;  4G27 B;  1QBZ A;  3CCV V;  3LUT B;  3AG4 C;  1HR0 O;  3ETD A;  3QVN A;  2ZNI A;  1Y74 A;  2LFS A;  4MTF A;  1G1X B;  2WLN A;  3IFX A;  3RYF A;  5J2T A;  2YDE A;  3ZHT A;  4TT3 G;  4LFA O;  3E8H A;  4BW9 A;  1NZ6 A;  2D2C B;  1U97 A;  1D5A A;  4DV0 B;  2QWR B;  1I5X A;  1ZWI C;  1WNS A;  4DYL A;  2WA4 A;  2WAM A;  4A5U B;  4GKK B;  3F7Y C;  4D7T A;  2LW7 A;  4J9Z B;  2A9H A;  1H8E G;  2CDY A;  2D3O W;  4H0L B;  3SYO A;  2IJJ A;  5LHI A;  3CJH A;  2QTO A;  2HJD A;  1IXM A;  5IWA B;  3UQ8 A;  3M7M X;  2ITC C;  1GMG A;  4J80 A;  5JH7 B;  3VQX A;  1BMF G;  1UFI A;  5CA1 B;  5BXZ A;  3N2K B;  1NS1 A;  5CMU A;  5J9P C;  3ABU A;  2CH7 B;  2XAQ A;  3EXA A;  3KG2 A;  1BE3 H;  2ITD C;  3B77 A;  3UT5 A;  1CPY A;  3Q4H A;  3THO A;  1EN5 A;  4HAM A;  1THZ A;  3JCU Z;  2LJ2 A;  3TCU A;  3E8B A;  3U10 A;  4WCE V;  2EIL B;  3CD6 V;  1SQB H;  1H2N A;  2YS8 A;  1N8R W;  4LH6 A;  3ZMV A;  1GAX A;  2KKW A;  4IIJ B;  4FLX A;  1PNM A;  2EZP A;  3EVK A;  2H8P C;  5GON B;  3ZED A;  4J7J A;  1H2M A;  2JEX A;  1M90 W;  2DMX A;  2QKS A;  5DM6 V;  4NXM O;  4WFA V;  2UU9 B;  1CP9 A;  1IUR A;  4UVB A;  5KMG B;  3JAR A;  2OTJ V;  1R3I C;  4OX9 O;  3CYO A;  1N0J A;  2EX3 A;  4ZHQ B;  5B5E Z;  3ZRW B;  2QM8 A;  1Q82 W;  5E79 Z;  2PTM A;  4QE9 A;  2QWQ B;  1AI6 A;  2H3O A;  4UCO A;  4IYI A;  2ZXW C;  3HKB A;  4BW5 A;  3ZHU A;  5DED A;  2WLI B;  1XIL A;  2DE0 X;  2CTW A;  1SQG A;  4YY3 O;  1YJN V;  3ZJZ A;  3CXH F;  3ABM C;  3LDD A;  2ODM A;  1NU1 H;  4QPK A;  2XAH A;  4FFB A;  1I7F A;  4BWA A;  4JI5 O;  1WA8 A;  1VF6 A;  2OTL V;  1XDC A;  4O4J B;  4U7O A;  1SZX A;  2BE3 A;  4CH6 A;  1RPO A;  5KHI A;  1JJ2 U;  2P5O A;  3MD0 A;  2QEX V;  3JD4 A;  1N33 B;  4B3M O;  3CCU V;  4WBN A;  4ZIB A;  2F43 G;  4O4L A;  1N36 O;  3OFN G;  4QNH B;  4NTX A;  2O57 A;  3G67 A;  1N34 O;  3DXR A;  1KB9 F;  4RQE A;  4N21 A;  1TAE A;  4JTC B;  4AQY B;  4FLU A;  4DR7 B;  2YC0 A;  4X62 B;  3K9A A;  2ZR3 A;  2VQE B;  3D3I A;  4I50 A;  3WB2 A;  2FKX A;  4DRX A;  3OR6 C;  1VQL V;  2XAJ A;  5A9G A;  4E4E A;  1GTO A;  1FXH A;  2JIZ G;  1XNQ O;  3K79 A;  5K1P A;  4LFB B;  3B2E E;  2JJ2 G;  1PL0 A;  2Z3Y A;  4PA6 A;  3SJQ C;  4DV3 B;  2JGU A;  2E5L B;  2DYR C;  3ZHS A;  2Q69 A;  1VAR A;  1QU7 A;  2UUC O;  1WP8 A;  3JAK B;  2QKC A;  2OWO A;  4DUY O;  2GUZ B;  1I0H A;  2LGW A;  4I9Q A;  1H2S B;  4FLY A;  1QLN A;  1RSO A;  3H01 A;  1VF5 B;  1VIB A;  2B1I A;  5D5P A;  4EFB A;  4LF8 O;  2RJZ A;  3HKE B;  4DR3 B;  2RCV A;  4DV2 B;  1L0N H;  1AI5 A;  2CTQ A;  1J5E O;  2M6Y A;  3C90 A;  4TUY B;  4OXS A;  4PJ0 Z;  4MSW C;  5B1A C;  4I5S A;  3RFR A;  2HKO A;  3ETG A;  5CBH A;  4HNA A;  1Y76 B;  4DV5 O;  1W59 A;  2WLH A;  1BQZ A;  4X65 B;  4JYA B;  4NR1 A;  4LF4 B;  1WPB A;  3L73 H;  2E76 B;  2P4V A;  4LF9 B;  1XHX A;  1HNW B;  4JF3 A;  1QLE B;  1OCR C;  1R1B A;  3OGC C;  4DV1 O;  2PY5 A;  5KA5 A;  3BAA A;  4KL1 A;  3EHB B;  5E1A C;  1XL4 A;  5EYP B;  3ZHQ A;  1OCO C;  4NYK A;  2Q68 A;  3A8T A;  4NVP A;  5LA6 B;  1K8A W;  4O4I B;  1HNX B;  1FFX B;  4I4T A;  5B66 Z;  1TVK A;  1PNK A;  4UCS A;  1B04 A;  4ICG A;  5H5N A;  4JAU A;  2R9R B;  2YIB A;  4LWS B;  4J9Y B;  3J7A U;  4DR2 B;  3OM3 B;  2EIK C;  1K92 A;  2RN9 A;  4UB6 Z;  3NXS A;  5IJ0 B;  4DUZ B;  4LF5 O;  3SPG A;  4LF6 O;  1XRE A;  3RWR D;  2QDO A;  3CCQ V;  5ITZ A;  1QQC A;  4G28 B;  2LW1 A;  3OD4 A;  4GCZ A;  4JTA B;  4MTG A;  3A0H Z;  3SYP A;  4DR1 O;  1HDJ A;  4H33 A;  2DN9 A;  2UXC O;  2ZM6 O;  3T1H O;  2V4D A;  5IYZ B;  1XMQ B;  4F6R A;  4W4K A;  4RQF A;  3JYC A;  1ZAU A;  3LNN A;  1QCE A;  3AG1 C;  3QO5 A;  1H2G A;  2UUA O;  4KUM A;  1Z2G A;  1H8H G;  2IM9 A;  3B8M A;  1FJG B;  5LXT B;  4GT1 A;  2Q9L A;  5LL6 Y;  1V9P A;  2XAF A;  1JFF B;  4I7Z B;  3BAB A;  3ZMS A;  1KEC A;  4FIP C;  4JYY A;  2R72 A;  1GH6 A;  1OCC B;  5EIB C;  1SQF A;  3ABK B;  4Z1V A;  5LOV B;  5BR8 B;  4MVU A;  1S3J A;  3ASO C;  3HKD A;  1E1R G;  3IC9 A;  3CHX A;  1Q81 W;  1SZT A;  3N2G B;  5JJE B;  4TOI A;  2VS0 A;  2BTQ B;  4BIZ A;  3ABM B;  3H1K H;  4NTY A;  1MMM A;  3AK1 A;  2WLK A;  2Y4T A;  4ZOL A;  4DV0 O;  5LP6 C;  1XQ8 A;  4FM1 A;  4RUE A;  3EFF K;  3WFV A;  1YDX A;  4U3J B;  2YI9 A;  3ZS8 C;  3ETQ A;  3F5T A;  1M4U A;  3IGA C;  2F23 A;  1GM9 A;  2GTA A;  1Y6X A;  4ZBM A;  4QGP A;  3FYI B;  3S3X A;  2K9P A;  5EZY A;  1SA0 A;  5IWA O;  4QE7 A;  4B3S B;  4JV5 B;  1SQV H;  1SRY A;  5B1B C;  4KHP B;  3FYE B;  1G8M A;  1O9G A;  3LDE A;  1VQ5 V;  4GX1 A;  4NB5 A;  2Q6A A;  1P7G A;  3X2Q C;  3T4D A;  4KP4 A;  4Z2W A;  4DW0 A;  2EJ7 A;  4B7E A;  2LGQ A;  2RDC A;  4K8Z A;  5CA3 A;  2AZ0 A;  5HFM A;  1F7Y A;  2LFR A;  1Q6U A;  3TGU H;  4LFC B;  2BOB C;  4JI3 B;  5JVD B;  3JD2 A;  4P30 A;  4P9P A;  2JEU A;  4DK1 A;  5LMU B;  4KFM A;  1US6 A;  3MHH C;  1PP9 H;  3L9D A;  2A06 H;  2DWD C;  4I55 B;  1XNR B;  1IBM B;  1K4C C;  1AVM A;  1PKX A;  5H6R A;  4LF7 B;  1L1F A;  5JH7 A;  5JJN B;  1S5H C;  2UU9 O;  3SPH A;  3WB0 A;  1GN6 A;  3ZRV A;  5CA1 A;  4JI6 B;  2A0L A;  2ZD9 A;  3N2K A;  2ZCE A;  2CH7 A;  1IBK B;  1NVP D;  1TUE B;  3DC6 A;  4X1Y B;  1COW G;  1J95 A;  4EFE A;  4YJ2 B;  4MW3 A;  1R3J C;  1DGS A;  4XDK A;  3WG7 B;  2QJ1 A;  4GYC B;  1GM7 A;  2EIJ B;  2R70 A;  1VQP V;  3E86 A;  2Y69 C;  1ZTE A;  3FKS G;  1ZL8 B;  1AI4 A;  1YF2 A;  1NVP B;  1FXK B;  1K73 W;  2MW2 B;  1YJW V;  1ZLZ A;  2PYJ A;  2AXT Z;  2IU3 A;  2JGD B;  4X20 B;  2QE7 G;  3JAW B;  5BMV B;  5GON A;  2Q8V A;  3P30 A;  1WB7 A;  2VWK A;  1IVS A;  5DEC A;  1AP6 A;  4K0K B;  3RYC B;  3T1C A;  1K3E A;  1FFT B;  2QA4 V;  1RM1 C;  4X1I B;  5IY5 C;  1W0K G;  4IHJ B;  1N33 O;  5KMG A;  4P2Z A;  1YTF D;  3FAV B;  4FFK A;  4MS2 A;  4ZHQ A;  1OCO B;  3NR7 A;  4HYO A;  5KUK A;  4OGQ B;  3ZRW A;  1NTM H;  2ZE8 A;  4LR3 A;  4RAI A;  1VF6 C;  1QVG U;  1I94 B;  4R6Z A;  3CRA A;  4J10 A;  2BSK A;  2IU0 A;  3CCL V;  4FLV A;  1M56 B;  4AQY O;  1R3L C;  4DR7 O;  4DR6 B;  4X62 O;  5JWP A;  2WLI A;  1P4R A;  2C2A A;  3GWK C;  1KKD A;  1YTF B;  2VQE O;  4FLW A;  2NNU A;  3VQY A;  1RPR A;  1MSW D;  2XAG A;  2HP8 A;  3A0B Z;  3E35 A;  3J81 N;  4I0X B;  1AJN A;  1ZSP A;  3DSQ A;  3JAS B;  3ZMU A;  3RYI A;  1P49 A;  4O4J A;  3JAL A;  5H9C A;  1PPJ H;  4EEQ A;  4LFB O;  3J80 N;  3JAM N;  1GKF A;  4W4L A;  2ZDI A;  2IBZ H;  4DV3 O;  3AG2 C;  2E5L O;  3JCZ A;  3CS5 A;  3SJB C;  2EIM C;  2UXD B;  4NKG B;  3ZN1 A;  1R6N A;  2WWW A;  3CCJ V;  3JSN A;  1IBL B;  2YI8 A;  3K58 A;  1MOF A;  1UJW B;  2E3C A;  4IYH A;  4IT5 A;  3M99 B;  2QSA A;  2NN4 A;  3SJA C;  4DR3 O;  5EBL C;  1BS3 A;  4DV2 O;  1R6K A;  1ARO P;  4X9Q A;  4EKW A;  4DW1 A;  1PNL A;  2R9I A;  3RYH B;  4TQF A;  2LO1 A;  2FML A;  4UB8 Z;  2X6B A;  4ZI7 A;  1B3Q A;  4HZ3 A;  5EC2 C;  3K57 A;  2HJF C;  4JYA O;  4DR5 B;  4MVO A;  1EZV H;  2Z5U A;  4LP8 A;  4LF4 O;  3K5O A;  1SQX H;  3CRC A;  4UFZ A;  4LF9 O;  1HNW O;  1N32 B;  1M5I A;  2PI4 A;  3T4Z A;  5EBW C;  1Q5O A;  4UCV A;  3OTO B;  2Z0A A;  2GUZ A;  1MA1 A;  5CA0 B;  3CB2 A;  1VP7 A;  2HR3 A;  2M7W A;  2EJR A;  4WF9 V;  4JAA A;  1WN7 A;  1F4M A;  5JCO A;  4RWU A;  2W6J G;  3HKE A;  1ZX3 A;  2Q4P A;  2YXH A;  1HNX O;  5B1B B;  2OCC C;  4MVS A;  4RUF A;  2RNB A;  1FPO A;  4B08 A;  5KX5 B;  2YEV B;  3ASN C;  1Y76 A;  1I08 A;  4DR2 O;  2F95 B;  2CGN A;  1V55 C;  4JZG A;  5FNV B;  3ZMT A;  1TGO A;  4DUZ O;  4JI0 B;  3CMA V;  4FK5 C;  2GBO A;  3JAT A;  3MDS A;  3OUS A;  2N74 A;  4DK0 A;  1JJO A;  1WB8 A;  4XDL A;  1HNZ B;  2P7T C;  1XHZ A;  4Z1M G;  1XEQ A;  3OMI B;  2UXX A;  2HLD G;  3LSS A;  3VQW A;  1YIJ V;  1YVW A;  2ZIN A;  1NT2 B;  5LA6 A;  1OV9 A;  5L3B A;  5CB4 B;  4O4I A;  3BPZ A;  4MTX A;  4CH5 A;  1XMQ O;  4YXW G;  2EZO A;  1SC5 B;  3KCY A;  3H1H H;  3MHS C;  3D3Q A;  3ZRS A;  1S5L Z;  2X0L A;  5KAF Z;  1BZK A;  3A2F A;  2IH3 C;  1NTK H;  4LWS A;  1FJG O;  3TXQ A;  1EM1 A;  2OCH A;  3G6B A;  5LHH A;  5C93 A;  2EIN B;  4GUN A;  1NQT A;  2QWP B;  5BR8 O;  5IJ0 A;  4J7K A;  4TSF G;  3E2E A;  2Y69 B;  3OW2 U;  3ABL C;  1LR1 A;  1CEZ A;  1V54 C;  1JOY A;  1S76 D;  3GWO A;  4KXR A;  3JD3 A;  1D2D A;  3B8N A;  2A79 B;  4GX2 A;  1Q3E A;  5IYZ A;  3KCX A;  3AG4 B;  2Q7G A;  1VF7 A;  2ATK C;  5IY5 B;  2KQX A;  1AR1 B;  5KHG A;  4BIO A;  2K1E A;  1RP3 B;  2PUS A;  1JPX A;  4O2A B;  5JQG B;  4B3S O;  4JV5 O;  1O9H A;  1TUB B;  5LXT A;  1JFF A;  4JYC A;  4KHP O;  1FXV A;  3APQ A;  5B3S C;  3G6E V;  4YHH B;  1NH2 D;  2V7Q G;  2JJ1 G;  5LOV A;  1AI7 A;  1YJ9 V;  5KA6 A;  4WFH A;  4UCT A;  3I55 V;  4B3T B;  4X66 B;  4PA4 A;  3T2M A;  5IYB O;  3QNE A;  4J11 A;  5L3F A;  4LFC O;  4JI3 O;  3O65 A;  3WB1 A;  3DXR B;  2X6A A;  1NH2 B;  1PV0 A;  2Q0A A;  5LMU O;  1PM9 A;  1M9N A;  4J42 A;  2XHB A;  4YIO A;  3CPW U;  2AZ2 A;  1WAZ A;  4U3J A;  1MZE A;  4FLT A;  1XNR O;  3CCM V;  3QO7 A;  1IBM O;  2P4K A;  2F66 C;  4LBE C;  4DRX B;  2WLL B;  2FYU H;  4LF7 O;  4EB6 B;  4YIP A;  3RW0 A;  5LMN B;  2Q7H A;  1XUQ A;  3FB5 C;  1EN6 A;  4JI6 O;  4FMT A;  1IBK O;  3R65 A;  1XBL A;  3ICX A;  3W7T A;  1HWY A;  3D36 A;  2NR5 A;  4CH4 A;  2GHY A;  3BY6 A;  2Y4U A;  3SYC A;  3OEE G;  4FM0 A;  1YI2 V;  5JVD A;  1K33 A;  3BA8 A;  4PHZ A;  1HP8 A;  3L72 H;  1WPX A;  3HPL C;  1EBO A;  3B40 A;  2QKA A;  3W7U A;  3BHP A;  4I55 A;  3OEH G;  1IX9 A;  2HVJ C;  1DTO A;  1QR9 A;  5FL7 G;  4CS2 A;  4K0K O;  3KKY A;  5H6Q A;  1MSD A;  3UKM A;  4E2L A;  3BEH A;  3LSQ A;  2ZXW B;  5H2F Z;  4AI8 A;  4UUJ C;  1NTZ H;  2FTK A;  2X6C A;  4X1Y A;  3L74 H;  2GTS A;  4UXN A;  4U3F H;  4JI1 B;  1I94 O;  2ZIM A;  3FB8 C;  4YJ2 A;  4O2B B;  2ZE7 A;  4FZ0 A;  4DR6 O;  4DR4 B;  3VOU A;  2UUB B;  4H44 B;  1AB3 A;  1NR7 A;  3FB6 C;  4GKK O;  2A3Q A;  3STZ C;  2OIG A;  1S77 D;  2KB1 A;  1ZL8 A;  3BRC A;  3HKC B;  1JA8 A;  2WSS G;  1FXK A;  1V55 B;  2WA3 A;  3QF7 A;  2KSD A;  1BL8 A;  2JGD A;  4JAV A;  4X20 A;  4ABM A;  3JAW A;  3P32 A;  5BMV A;  1GN4 A;  3RYC A;  3P3N A;  2BTO A;  3K59 A;  1OJH A;  4B3R B;  3RN4 A;  2QWN B;  4IHJ A;  4MT8 A;  4PA3 A;  3FAV A;  2DQ0 A;  3HR0 A;  1GRJ A;  1VQO V;  2PI5 A;  1L8D A;  4UVA A;  2UXD O;  5A2Q N;  2DQ3 A;  3H9V A;  3K5N A;  3SYA A;  2MK3 A;  1IBL O;  1DLB A;  5LGT A;  1SET A;  2YSU B;  1VQ8 V;  4JI2 B;  4DV1 B;  4FJC C;  4PI0 A;  3H1L H;  1JX9 A;  1A32 A;  4B7K A;  5IJ9 B;  1T5E A;  2ILM A;  2P67 A;  3G4S V;  1FS0 G;  1OHH G;  2DYR B;  4I0X A;  3B09 A;  1WP7 A;  3PN1 A;  5LGU A;  2JK5 C;  3CC4 V;  3JAS A;  4BIU A;  1S0V A;  1SF9 A;  4XBF A;  3K04 A;  2ZR2 A;  4FLZ A;  2CTP A;  1ROP A;  5FLX N;  2B5U A;  1DF5 A;  4DR5 O;  4X88 A;  4UV8 A;  2XUM A;  1P7B A;  1F51 A;  2WLM A;  2F4V B;  3MAQ A;  3BFR A;  4DV6 B;  1N32 O;  2UXN A;  3CEI A;  5KLV H;  1Z5V A;  2ZKO A;  3OTO O;  2CUG A;  5C8Y B;  4K35 A;  3RVZ A;  1Q43 A;  5B1A B;  5LYJ B;  4K8X A;  4FVM A;  2QTS A;  5KAI Z;  3LSU A;  1Q86 W;  4X1K B;  4JTD B;  1EFR G;  2EBO A;  1F23 A;  1K5Q A;  2OT5 A;  1AP5 A;  4IIJ A;  1K34 A;  3BCC H;  4WFE A;  1RFY A;  1Q6I A;  2FB5 A;  5B3S B;  2L6L A;  1VEW A;  1KBH A;  1EN4 A;  1VQK V;  3RYH A;  1OCR B;  3RVY A;  1SKV A;  1K7D A;  2KG7 B;  3G71 V;  4QPJ A;  1M1K W;  3K3W A;  2LP7 A;  1R3K C;  3M8A A;  4MVQ A;  3E22 B;  5JCO C;  2AHZ A;  2VQF B;  4K3A A;  1SER A;  1KU9 A;  4JI0 O;  4L87 A;  1B06 A;  1M57 C;  1AR4 A;  2H94 A;  3OUF A;  4GKJ B;  1E79 G;  4TV9 B;  3LDC A;  3STL C;  3OAA G;  4CZZ A;  4JI7 B;  3U0Z A;  4DV4 B;  1S72 V;  3ABT A;  4PDM A;  1HNZ O;  5CA0 A;  3R66 A;  4LNU B;  2IJK A;  3G80 A;  3DGE A;  4F6E A;  4YJ3 B;  2NLJ C;  2HEP A;  4AIL C;  2UXB B;  3E8F A;  4H13 B;  2EIK B;  3PJS K;  2VWJ A;  2DWE C;  1D5N A;  5LGN A;  1NI8 A;  3OT7 A;  3K03 A;  3H1J H;  1QLE C;  2OYQ A;  2CK3 G;  4FPP A;  5KX5 A;  2YEV A;  2PF4 E;  4X64 B;  3SR2 C;  5AG2 A;  5LBQ A;  3DTU B;  4R7C A;  1I5Y A;  4L8J A;  1MG1 A;  3AK3 A;  3TET A;  5FNV A;  4DO2 A;  2YIC A;  4DXW A;  5J2U B;  3APO A;  1MZF A;  3K0D A;  3CRQ A;  4TV8 B;  5EIB D;  1FYJ A;  1LNQ A;  3T1Y B;  2B9Z A;  3IAY A;  3VQV A;  5GTH Z;  4G2K A;  2HHH B;  3RGB A;  1TA8 A;  2CAZ C;  3AG1 B;  1QNM A;  3TXS A;  3OR7 C;  1BHA A;  3I56 V;  4X89 A;  4JI8 B;  2VRZ A;  1SQP H;  4DV7 B;  3JD0 A;  2RMK B;  5CB4 A;  3L71 H;  3BVO A;  4LH7 A;  4ZKI A;  3W7X A;  4FM2 A;  1KD1 W;  4WFB V;  1M93 A;  1S5J A;  1AJP A;  1K5S A;  2ADQ B;  3ASO B;  4O4H B;  5IYC O;  3D8C A;  5IE9 A;  3CWB H;  4X65 O;  3CXC U;  1B6Q A;  3H1I H;  2Q0O C;  2F1M A;  3SPI A;  1LUW A;  4YHH O;  3OGI B;  5LP6 B;  3BA9 A;  4UV9 A;  4PDL A;  3JAK A;  5KUM A;  1VQN V;  3K06 A;  3OMA B;  3W7W A;  1XMO B;  1Y74 B;  1XI1 A;  4X66 O;  4B3T O;  2P90 A;  2ZNJ A;  1BGY H;  3AK2 A;  1DK1 A;  3RYF B;  5J2T B;  4NXN B;  1WLE A;  3SDL A;  2HG5 C;  4BAY A;  3QTC A;  2BSK B;  5FPR A;  1OCC C;  4JGS A;  3ABK C;  4TUY A;  5K1X A;  1Z5W A;  3ETE A;  4PV1 B;  3X2Q B;  4JI4 B;  2YIA A;  4C7U A;  2JS5 A;  4J7Z A;  1HW7 A;  4O2A A;  3RBZ A;  3SGI A;  1KQS U;  1H38 A;  5JQG A;  1TUB A;  3CJH B;  4HBN A;  5EK0 A;  5LMN O;  1GN3 A;  1YCI A;  3RYI B;  1NR1 A;  1KP2 A;  3JAL B;  1AJQ A;  2G38 A;  4JZ2 A;  5GW7 A;  3E89 A;  4X8A A;  4GX0 A;  4WFF A;  1HR0 B;  1F4N A;  3SYQ A;  1R6T A;  2ZE6 A;  3UT5 B;  1YHQ V;  3ZIA G;  1ORQ C;  1WJZ A;  4N23 A;  3UCS C;  5EYP A;  1MNG A;  3Q4H B;  4LFA B;  1ENV A;  2DW4 A;  2W0X A;  2CTR A;  3AEI A;  1GN2 A;  1VMG A;  3K5L A;  1BSM A;  1FFX A;  2N04 A;  4U7N A;  3WU2 Z;  4ASU G;  2IJH A;  2F93 B;  5HFL A;  3D36 C;  3HB3 B;  3SPC A;  2WLL A;  3RT3 C;  3E83 A;  4EB6 A;  2DOS A;  1YSC A;  2QM4 A;  5BY1 A;  2Q67 A;  5LHG A;  4ZI7 B;  3JAR B;  3ML0 A;  4CS3 A;  3K5M A;  1SQQ H;  3OMN B;  1H2L A;  3QG5 A;  2A7W A;  2IW5 A;  1AR5 A;  1U96 A;  4JI1 O;  3ZRX A;  4DR4 O;  2UUB O;  4TWK A;  3QO8 A;  2DYS C;  1Q8I A;  3HKB B;  3AG3 C;  4TQD A;  4F4L A;  2JDI G;  1OCZ C;  1L0L H;  1RM1 B;  1Y4M A;  3CC2 V;  3UM7 A;  2B1G A;  2FL4 A;  2X7R B;  4FFB B;  5L3D A;  1M57 B;  2DJV A;  3FD9 A;  1FD9 A;  4WFG A;  4CS4 A;  1WA8 B;  4BR6 A;  1AIL A;  1IZ3 A;  3WG7 C;  2Y48 A;  4B3R O;  5CBF A;  1NJI W;  1JR9 A;  2ADP A;  2EIJ C;  4NXM B;  4MW8 A;  2GSM B;  1Q6H A;  1K4D C;  2YXY A;  1BCC H;  3FB7 C;  4WBN B;  1FXK C;  3N2G A;  1KKC A;  4OX9 B;  4LCU C;  2BTQ A;  4JYB A;  2W6I G;  3IC7 A;  5EC1 C;  4O4L B;  2HFE C;  3S3W A;  3CRR A;  2LQT A;  1X4T A;  4O2B A;  1KYO F;  1KP3 A;  3JAT B;  3K0G A;  2CGO A;  2ARH A;  2V1D A;  4JI2 O;  4Q20 A;  2GV9 A;  4GX5 A;  3ZHV A;  1H2K A;  2R9A A;  4J41 A;  4UCU A;  1G6U A;  1LUV A;  3HKC A;  4PA7 A;  1XOU A;  5TIS Z;  3AG2 B;  3FFQ A;  4YY3 B;  4NTW A;  4I50 B;  2EIM B;  2E75 B;  1JQ0 A;  1EZJ A;  4JI5 B;  4CC5 A;  2AGA A;  1M56 C;  1DF4 A;  3CX5 F;  4PEL A;  4JAS A;  1XL6 A;  2XND G;  4OPA A;  5DN6 G;  1K97 A;  2PYL A;  3N27 A;  1N4C A;  4D6T H;  2F4V O;  4B3M B;  3GB7 C;  4DV6 O;  3LNM B;  2QM7 A;  3P3P A;  1YEW A;  3CCE V;  4IGG A;  1N36 B;  2AHY A;  2RQ6 A;  1FAF A;  1NBM G;  2L35 A;  1N34 B;  3VBB A;  2PZS A;  4UCR A;  4LC1 A;  3ZCC A;  1RSO B;  4AHC A;  4H37 A;  3C3T A;  3B4S A;  2Y0I A;  1GK9 A;  1IDS A;  1PL4 A;  1YIT V;  2YID A;  5B1O A;  5IJ9 A;  1KMI Z;  4QIW F;  5CBG A;  4CC6 A;  2Q5Z A;  1Q7Y W;  4MVZ A;  4MVM A;  1JMK C;  5KHH A;  2N05 A;  3CP1 A;  3L75 H;  2EIL C;  4HNA B;  1PD3 A;  3L70 H;  1XNQ B;  1Q90 D;  4PDR A;  3IJ4 A;  3DC5 A;  2VQF O;  2IJI A;  2WLJ A;  1ZUQ A;  2JRI A; 
#chains in the Genus database with same CATH homology
 1G4Y B;  1AI5 A;  2OCC B;  3CCR V;  2PI4 A;  5B3S B;  3T4Z A;  5EBW C;  4PDV A;  1VQK V;  4OXS A;  1OCR B;  4R8C A;  4MSW C;  5B1A C;  3RVY A;  4I5S A;  4P9O A;  2HKO A;  4UVC A;  3ETG A;  1K7D A;  4QJF B;  5CBH A;  3G71 V;  2HR3 A;  2M7W A;  3ASN B;  5IDJ A;  4QPJ A;  1M1K W;  2WLH A;  3K3W A;  2EJR A;  4WF9 V;  2LP7 A;  1R3K C;  4MVQ A;  4JPR A;  1F4M A;  2AHZ A;  4MTO A;  2W6J G;  1SER A;  2HVK C;  4I9W A;  4L87 A;  1M57 C;  5B1B B;  2OCC C;  2H94 A;  4MVS A;  1VQM V;  3OUF A;  1E79 G;  5CN0 A;  3LDC A;  3STL C;  1JCH A;  3OAA G;  5B1N A;  4JF3 A;  4CZZ A;  1QLE B;  4RUF A;  1OCR C;  3OGC C;  1S72 V;  3ABT A;  4PDM A;  5KA5 A;  2YEV B;  2IJK A;  3TK1 A;  3ASN C;  3DGE A;  3K08 A;  3EHB B;  5E1A C;  1XL4 A;  2NLJ C;  4CBC A;  3E8F A;  1V55 C;  3SPJ A;  2EIK B;  3PJS K;  1OCO C;  1VQ4 V;  1K9M W;  2Q68 A;  1K8A W;  2DWE C;  1VQ7 V;  5LGN A;  3ZMT A;  3ZN0 A;  1R73 A;  4PA9 A;  4XDJ A;  3CMA V;  3K03 A;  4FK5 C;  2XAS A;  1QLE C;  1VQ9 V;  2CK3 G;  1PNK A;  4FPP A;  1KC8 W;  3OUS A;  2YEV A;  3ZMZ A;  4R50 A;  4XDL A;  4JAU A;  2P7T C;  4Z1M G;  5LBQ A;  1Y66 A;  2R9R B;  1GO3 F;  5EBM C;  5L3C A;  3W7S A;  2W0F C;  3DTU B;  2ZDI C;  3A0R A;  3OMI B;  2UXX A;  4J9Y B;  4R7C A;  3OM3 B;  1I5Y A;  5L3G A;  2EIK C;  2HLD G;  3LSS A;  5L3E A;  1YIJ V;  1K92 A;  1MG1 A;  3TET A;  2IH1 C;  4DO2 A;  5L3B A;  4MTX A;  4DXW A;  4YXW G;  3K0D A;  2EZO A;  3NXS A;  3MHS C;  1LNQ A;  3SPG A;  3ZRS A;  2X0L A;  3ABL B;  4G2K A;  3CCQ V;  3F7V C;  3AG1 B;  5BZB A;  4G28 B;  2IH3 C;  3OR7 C;  4GCZ A;  1BHA A;  1V54 B;  1QR8 A;  3I56 V;  4JTA B;  4X89 A;  4MTG A;  3SYP A;  1QVF U;  5LHH A;  1W2B U;  1BHB A;  3CCS V;  5C93 A;  3JD0 A;  2EIN B;  4H33 A;  1NQT A;  2DYS B;  4ZKI A;  3W7X A;  2BOC C;  3AG3 B;  4TSF G;  1OZ0 A;  4RQF A;  3E2E A;  2Y69 B;  3JYC A;  4WFB V;  1KD1 W;  3OW2 U;  1OCZ B;  3ABL C;  1AJP A;  1K5S A;  3ASO B;  1QCE A;  5IYC O;  3AG1 C;  3QO5 A;  1CEZ A;  1H2G A;  4KUM A;  2ZQM A;  1B6Q A;  3CXC U;  1H8H G;  2XOK G;  1V54 C;  1JOY A;  3B8M A;  1S76 D;  3GWO A;  3JD3 A;  4GT1 A;  2XAF A;  3SPI A;  3B8N A;  2A79 B;  1VQ6 V;  2P6J A;  2EIN C;  1MAB G;  1KEC A;  3ZMS A;  4FIP C;  4GX2 A;  4UV9 A;  3E8G A;  1JVM A;  4PDL A;  1OCC B;  3ABK B;  4RO2 A;  5KUM A;  3OE7 G;  3AG4 B;  4MVU A;  1VQN V;  1S3J A;  3K06 A;  2ATK C;  4MVR A;  3OMA B;  5IY5 B;  1E1Q G;  3ASO C;  3W7W A;  3F5W C;  3CME V;  1AR1 B;  2P90 A;  1E1R G;  2K1E A;  3JD1 A;  1GM8 A;  1Q81 W;  1SZT A;  1W0J G;  4BIZ A;  5IYD O;  1JPX A;  1WLE A;  3ABM B;  1NKD A;  2HG5 C;  2WPD G;  3CC7 V;  4JYC A;  1FXV A;  2WLK A;  4BAY A;  1SES A;  5B3S C;  3G6E V;  4RUE A;  1NH2 D;  1OCC C;  2V7Q G;  4G27 B;  3ABK C;  4JGS A;  1QBZ A;  2JJ1 G;  3CCV V;  3LUT B;  3AG4 C;  1AI7 A;  3ETD A;  3EFF K;  3WFV A;  1YJ9 V;  3ETE A;  3X2Q B;  5KA6 A;  4WFH A;  2LFS A;  4MTF A;  3I55 V;  3IGA C;  4PA4 A;  3T2M A;  2WLN A;  3IFX A;  1GM9 A;  3RBZ A;  5IYB O;  4TT3 G;  4ZBM A;  1KQS U;  3QNE A;  3FYI B;  1H38 A;  5L3F A;  3E8H A;  5EK0 A;  4QE7 A;  1SRY A;  5B1B C;  3FYE B;  1G8M A;  1NR1 A;  2X6A A;  3LDE A;  1VQ5 V;  4GX1 A;  1NH2 B;  1KP2 A;  1I5X A;  1AJQ A;  1ZWI C;  2Q6A A;  1M9N A;  5GW7 A;  2WAM A;  3E89 A;  4X8A A;  3X2Q C;  3CPW U;  3T4D A;  4GX0 A;  4WFF A;  3F7Y C;  1F4N A;  4KP4 A;  4J9Z B;  3SYQ A;  2A9H A;  1H8E G;  1YHQ V;  2D3O W;  3CCM V;  3ZIA G;  1ORQ C;  3QO7 A;  4N23 A;  3SYO A;  5CA3 A;  5HFM A;  2IJJ A;  5LHI A;  4LBE C;  2WLL B;  1ENV A;  2LFR A;  2DW4 A;  2QTO A;  1IXM A;  2BOB C;  2ITC C;  3AEI A;  3RW0 A;  1GMG A;  3JD2 A;  4P30 A;  4P9P A;  3FB5 C;  2JEU A;  1BMF G;  4FMT A;  4U7N A;  5CMU A;  5J9P C;  3R65 A;  3ABU A;  2XAQ A;  3KG2 A;  4KFM A;  4ASU G;  2IJH A;  2ITD C;  3MHH C;  5HFL A;  3B77 A;  3W7T A;  1HWY A;  3HB3 B;  3D36 A;  2GHY A;  2DWD C;  1CPY A;  3BY6 A;  3SPC A;  2WLL A;  1K4C C;  3OEE G;  3SYC A;  1PKX A;  3E83 A;  1YI2 V;  4HAM A;  1THZ A;  5H6R A;  1K33 A;  1L1F A;  1YSC A;  3TCU A;  3E8B A;  1S5H C;  4WCE V;  3SPH A;  2EIL B;  3ZRV A;  2Q67 A;  5LHG A;  3CD6 V;  2A0L A;  2ZD9 A;  1WPX A;  1N8R W;  3ML0 A;  3HPL C;  1NVP D;  1EBO A;  1TUE B;  3OMN B;  3ZMV A;  3W7U A;  2IW5 A;  1PNM A;  2EZP A;  3OEH G;  2HVJ C;  1COW G;  3ZRX A;  2H8P C;  1J95 A;  1DTO A;  1QR9 A;  5FL7 G;  2JEX A;  1M90 W;  4MW3 A;  4TWK A;  3QO8 A;  1R3J C;  2QKS A;  5H6Q A;  4XDK A;  3WG7 B;  3UKM A;  5DM6 V;  2DYS C;  4E2L A;  3BEH A;  3AG3 C;  1GM7 A;  2ZXW B;  2EIJ B;  3LSQ A;  4WFA V;  1VQP V;  3E86 A;  2Y69 C;  4F4L A;  2JDI G;  4UUJ C;  1OCZ C;  1CP9 A;  1RM1 B;  3FKS G;  4UVB A;  1Y4M A;  2OTJ V;  1R3I C;  1AI4 A;  3CC2 V;  2FTK A;  3CYO A;  1NVP B;  1FXK B;  2X6C A;  1K73 W;  3UM7 A;  2B1G A;  1YJW V;  2X7R B;  3ZRW B;  2QM8 A;  2IU3 A;  5L3D A;  1M57 B;  2QE7 G;  4UXN A;  1Q82 W;  4WFG A;  4QE9 A;  3P30 A;  1AI6 A;  3FB8 C;  3WG7 C;  2Y48 A;  3VOU A;  5CBF A;  1NJI W;  3T1C A;  2ZXW C;  2EIJ C;  1K3E A;  4MW8 A;  1NR7 A;  2GSM B;  4BW5 A;  1FFT B;  2QA4 V;  3FB6 C;  1RM1 C;  3STZ C;  2WLI B;  5IY5 C;  1W0K G;  1K4D C;  1S77 D;  2KB1 A;  4P2Z A;  1YTF D;  3FB7 C;  2WSS G;  1FXK C;  4MS2 A;  1FXK A;  1YJN V;  1V55 B;  3ZJZ A;  4LCU C;  1OCO B;  3ABM C;  3LDD A;  4JYB A;  2W6I G;  4HYO A;  3IC7 A;  5EC1 C;  5KUK A;  3ZRW A;  4QPK A;  2XAH A;  2HFE C;  1BL8 A;  4JAV A;  3P32 A;  4RAI A;  1KP3 A;  3K0G A;  1QVG U;  2OTL V;  4R6Z A;  2IU0 A;  2V1D A;  4U7O A;  3CCL V;  1M56 B;  1R3L C;  4Q20 A;  4GX5 A;  2WLI A;  1P4R A;  1RPO A;  2C2A A;  1JJ2 U;  3MD0 A;  2QEX V;  3JD4 A;  4MT8 A;  1KKD A;  1YTF B;  4PA3 A;  3CCU V;  2DQ0 A;  4PA7 A;  1VQO V;  2PI5 A;  2F43 G;  3AG2 B;  2NNU A;  1RPR A;  4UVA A;  1MSW D;  2XAG A;  3E35 A;  2DQ3 A;  1AJN A;  2EIM B;  3OFN G;  3SYA A;  1JQ0 A;  4QNH B;  2MK3 A;  3ZMU A;  1EZJ A;  4RQE A;  1DLB A;  5LGT A;  1SET A;  4N21 A;  1M56 C;  2YSU B;  4JTC B;  1DF4 A;  5H9C A;  4PEL A;  4JAS A;  1XL6 A;  2XND G;  5DN6 G;  1VQ8 V;  4FJC C;  1JX9 A;  1K97 A;  3K9A A;  1GKF A;  2ZDI A;  3AG2 C;  2ZR3 A;  3GB7 C;  2P67 A;  3G4S V;  1FS0 G;  3JCZ A;  3D3I A;  3LNM B;  1OHH G;  2DYR B;  2QM7 A;  2EIM C;  3ZN1 A;  3CCE V;  3OR6 C;  1R6N A;  1VQL V;  5LGU A;  2XAJ A;  2JK5 C;  2WWW A;  2AHY A;  3CC4 V;  4BIU A;  3CCJ V;  1S0V A;  1NBM G;  4XBF A;  3K04 A;  2ZR2 A;  1GTO A;  3VBB A;  1FXH A;  4LC1 A;  1MOF A;  3ZCC A;  2JIZ G;  1UJW B;  4H37 A;  1ROP A;  2B5U A;  3K79 A;  1DF5 A;  3M99 B;  4X88 A;  4UV8 A;  1GK9 A;  1YIT V;  1P7B A;  5B1O A;  5EBL C;  2JJ2 G;  1R6K A;  1PL0 A;  2Z3Y A;  4PA6 A;  1F51 A;  2WLM A;  3SJQ C;  4QIW F;  5CBG A;  2DYR C;  1ARO P;  2UXN A;  4EKW A;  1Q7Y W;  4MVZ A;  4MVM A;  2Q69 A;  1PNL A;  2R9I A;  3CP1 A;  3RVZ A;  5B1A B;  2EIL C;  1QLN A;  1PD3 A;  2X6B A;  1Q86 W;  3H01 A;  4JTD B;  4HZ3 A;  5EC2 C;  4PDR A;  2HJF C;  1EFR G;  4MVO A;  2B1I A;  2Z5U A;  2EBO A;  1F23 A;  1K5Q A;  2OT5 A;  4LP8 A;  1K34 A;  2IJI A;  2WLJ A;  4WFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...