4X89A

Navms voltage-gated sodium channal pore and c-terminal domain soaked with silver nitrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x89A00
5IY5C 4UUJC 1OCCC 3E83A 3PJSK 4J9ZB 2EIJC 2HG5C 5CBFA 4P9PA 5BZBA 4WFHA 4PDMA 2K1EA 2EINC 5CBHA 3ABMC 2Q68A 4R50A 4X89A 4PDLA 2NLJC 3OUFA 3HPLC 4JTDB 2A0LA 4MVZA 2QTOA 4PDVA 1XL6A 3SPGA 2EIKC 2JK5C 3GB7C 3SPJA 3UM7A 2WLLA 1XL4A 3K08A 4HZ3A 2DYSC 2EILC 1P7BA 4P30A 4X88A 3E8FA 3E8BA 3F5WC 2IH3C 3AG2C 2AHZA 3ZRSA 4JTAB 3X2QC 2IH1C 1LNQA 2X6AA 1ORQC 3RVZA 4QE7A 4MVMA 4QE9A 5EBMC 2EIMC 3FB8C 2ITCC 3RW0A 4QNHB 4WFFA 2WLHA 4MVSA 3E89A 4R7CA 5KUMA 1M57C 2Y69C 2ZD9A 2WLJA 2WLLB 3E8GA 4MW3A 3IGAC 2Q6AA 4GX0A 4MVOA 4MTFA 2WLKA 3SPCA 4G28B 3VOUA 3EFFK 3OR6C 2X6CA 4XDKA 3F7VC 3F7YC 3SPIA 4PA9A 1R3JC 5EC1C 4CBCA 4I9WA 3K0DA 3RVYA 2BOBC 4PA7A 1M56C 2DYRC 2WLNA 4MTOA 3T2MA 3T4DA 4BW5A 4MVRA 3OR7C 4PA4A 4WFEA 3SYQA 4PDRA 4MTGA 4MW8A 3AG4C 4DXWA 3KG2A 1OCZC 2WLMA 4WFGA 3T1CA 1K4DC 3LDDA 3LNMB 3ZJZA 3LDCA 3TETA 3SYAA 4F4LA 4KFMA 4RO2A 3IFXA 4R6ZA 5B1AC 3SJQC 1K4CC 3WG7C 2DWDC 1S5HC 1ZWIC 3K06A 5CBGA 2BOCC 1G4YB 4H33A 2WLIA 2A9HA 4G27B 3SYCA 4RUEA 2HVKC 4RUFA 2OCCC 4H37A 1R3IC 3TCUA 1BL8A 2Q67A 4GX2A 5B1BC 4RAIA 3FB6C 1R3LC 2Q69A 4P2ZA 3E86A 3SPHA 2W0FC 4P9OA 3RBZA 3STZC 2HFEC 3JYCA 5EBLC 1QLEC 2YEVA 3SYOA 5EC2C 2HVJC 3OUSA 2H8PC 3FB5C 3R65A 2WLIB 4LP8A 3STLC 2HJFC 5KUKA 4LBEC 5EBWC 1V54C 3K04A 2AHYA 5J9PC 4ZBMA 3K03A 2DWEC 4GX5A 5B3SC 5E1AC 4J9YB 4MVQA 3BEHA 4TWKA 1R3KC 4LCUC 4EKWA 2X6BA 2ITDC 1OCOC 3SYPA 2R9RB 3ABKC 3OGCC 1KKDA 4XDJA 3LUTB 4PA6A 4X8AA 3K0GA 3AG3C 3E8HA 4XDLA 1OCRC 2A79B 2ATKC 3ASOC 4GX1A 4MSWC 4PA3A 2KB1A 4HYOA 4OXSA 4MVUA 3T4ZA 4MS2A 3AG1C 2ZXWC 2QKSA 1V55C 3LDEA 4JTCB 5EK0A 1JVMA 2P7TC 3ASNC 4R8CA 3UKMA 3ABLC 3FB7C 1J95A
chains in the Genus database with same CATH superfamily
5LOVA 2V1DA 2OTLV 4WCEV 5LGTA 3G6BA 4TQDA 1WP8A 1WA8B 2ZIMA 2WWWA 3ETQA 4NVPA 3K79A 4O4JB 4K35A 1GN6A 2PTMA 2WLLA 2RDCA 3ASOB 4X1KA 5CA0A 4LH6A 2N74A 4X88A 1RFYA 1ORQC 5DECA 4FM0A 2GSMB 1Y76B 1JFFA 3ABLB 4FLXA 3CWBH 4R7CA 3L74H 1W0JG 3DXRA 3KCXA 3T1HO 1NJIW 1AR4A 3F7VC 2LP7A 1WN7A 4DV4O 3OTOB 3D3IA 2P90A 4TV9A 2Y0PA 3OTFA 2YIBD 3CD6V 3JARA 2JRIA 1Y4MA 2GTAA 2EULA 3K06A 4X1YA 2WSSG 4EB6A 4LFAO 1HNXO 3JASA 2FMLA 4O4IB 2D3OW 1VP7A 1GO3F 3RBZA 1PKXA 2BSKA 4DW1A 3OFNG 3ZRWB 3AG4B 2D2CB 2Q5ZA 2AHYA 3A0BZ 2IU0A 1FJGB 2E74B 2Y0IA 2Z3YA 1PNLA 1MZEA 2X0LA 1S72V 2YEVB 3E8HA 1HWYA 1WAZA 2OCCB 3WU2Z 2JS3A 3L9DA 1V55C 1COWG 1LUVA 1SQBH 3GWKC 5L3BA 4UV8A 1YTFB 3N2KA 4LWSA 1TGOA 1SQFA 4B3RB 3BA8A 4H0LB 2QM7A 4W4KA 1IZ3A 1SF9A 3OD4A 4LF7B 4QIWF 4JYBA 1WPXA 5LGUA 1FXHA 2A0LA 3M7MX 4X66B 4F6RA 2QM8A 3LNNA 3NR7A 1GN4A 3N2GB 3CRQA 2EX3A 1LNQA 2EIMC 2Y69C 4K8ZA 4BAYA 4JI2O 4XDKA 3FAVB 5LYJA 2OIEA 2BCCH 4MTOA 1VQ7V 3JCUZ 4X65O 1Q6IA 2LJ2A 3T1CA 3T1HB 4U3FH 3WFVA 2QE7G 1NQTA 4IHJA 4DV2O 4DV4B 2DOSA 2HKOA 2DW4A 1M57B 4FJCC 1VQ8V 5KAFZ 1R3IC 5JWPA 5B1OA 4DR7O 4GX2A 3JD0A 3TJTA 5IJ0B 4UCUA 1DTOA 2P67A 1EFRG 2H8PC 2ZDIA 4BW9A 2V4DA 4G2KA 4CH5A 2GBOA 2DQ3A 2Q8VA 4LF5B 3K03A 4LFAB 5E1AC 5KA5A 2QTSA 1VQLV 1BMFG 4B3MO 1HNXB 2EZOA 2CAZC 4JPRA 4YXWG 1YEWA 2R9IA 3CC7V 4IIJB 2ATKC 1SA0B 1R73A 5LXTB 1KUQA 4IGGA 5EK0A 4GLXA 3ASNC 3JALA 3SJQC 4LC1A 3L75H 3AK1A 3OEHG 4X9QA 3PJSK 3K58A 1V54B 1XNRO 4ASUG 3ICXA 3R66A 1BCCH 4JI3O 3RYHB 2Q7HA 3D3QA 1I08A 4JTDB 3SJAC 1QBZA 2LFRA 3OE7G 4FZ0A 4P30A 2QEXV 4O2BA 1F4NA 1TVKA 2DQ0A 1Q86W 1BHAA 2WLKA 3H1HH 2VQEB 3LSUA 3SPIA 4Q20A 5H6RA 4NXNO 4KL1A 4PA7A 4OPHA 1PD3A 4CS2A 1F4MA 5GONA 5IJ9B 2RN9A 3CPWU 5GTIZ 3J7AU 4JI2B 4YHHO 3G4SV 3CXHF 4HBNA 1PPJH 5B1AC 4RO2A 2DE0X 3SJBC 5C8YB 2X7RB 2AW9A 1O9GA 3QO8A 1M90W 2QDOA 4TQFA 4WBNB 1QQCA 2IJKA 4DV2B 1K8AW 3HKBA 3GWOA 4OX9O 2HJFC 1HR0O 2YI9A 3H9VA 1M9NA 4DR7B 4BIZA 1S5LZ 4O2AB 4X1IB 5LL6Y 4FVMA 5LA6A 2A7WA 1O9HA 5CA1B 1BZKA 1BQZA 4J7ZA 1GN3A 2QSAA 2KG7A 4B3MB 3OMAB 3QF7A 4AHCA 1N0NA 3BA9A 5K1PA 1Q6UA 2L6LA 4ZHQA 2CTWA 1J95A 1ZUQA 4F6EA 4ZI7B 5CBFA 3SR2C 2PI5A 2XNDG 1TUEB 3HKEA 4GKKO 1FYJA 4X89A 1MMMA 4GCZA 2UUBO 1CXZB 4NXMO 4YJ2A 3K08A 1XNRB 3E8BA 2HEPA 2PF4E 5EIBC 2N05A 3Q4HA 4JI5O 2CH7B 1H38A 1D5AA 3OMIB 1OHHG 5IY5B 1W0KG 3HR0A 1US6A 1Y74A 2EINB 3TK1A 1JR9A 1XOUA 3CRMA 2BOBC 4RQFA 2PUSA 2W0XA 3HKCA 4I5SA 1I5YA 3OMNB 5LMNO 4ZKIA 3IJ4A 4LR3A 4NXNB 1YJWV 2CTRA 2LQTA 4RUEA 1IURA 2WPDG 4YHHB 4ZOLB 4DW0A 2AZ0A 3K5OA 4I4TB 4CC6A 1XNQO 3RYFB 1MNGA 4UCSA 2HVJC 4C7UA 1JX9A 3W7TA 1YIJV 4NTWA 2L35A 3K04A 1AVMA 5BXZA 2QR4A 4MVQA 4I50B 2YDEA 4O4LA 4B3SO 4CS4A 4OX9B 3M99B 3DC6A 1HR0B 3G80A 1XHXA 2CTQA 4UCRA 3O9OA 3RYIB 4H44B 5HFMA 1QLEB 3MDSA 3J81N 1SKVA 1N8RW 2YICA 5LP6B 1M4UA 1FAFA 5BZBA 2VWJA 3CC2V 1ZL8A 1N36O 2EIKC 1HNWO 3GB7C 3SPJA 3ZRSA 1P4RA 3AEIA 3OEEG 2XAFA 4TUYA 4LH7A 2XAJA 4GKKB 2UXCO 3RW0A 2UUBB 4RQEA 4NXMB 3ABUA 3VQWA 3E22A 4PELA 1KBHA 4FFBA 3CP1A 3TGUH 4KXRA 4JI5B 4WFEA 1K9MW 4MT8A 4LFBO 4IYHA 2VRZA 4ICGA 3UO3A 2QKAA 1SESA 1FD9A 2EZPA 2O57A 2NNUA 5DN6G 5L3DA 1R6TA 2BOCC 2XAQA 4O4HB 3RWRD 2UXBO 4B08A 4HNAA 1HNZO 1KU9A 1VQ6V 3JSLA 1R3LC 2RCVA 5LMNB 3CJHB 2CE4A 2CUGA 5EC2C 5KMGA 2AGAA 2LGWA 1XILA 4EKWA 2ITDC 4QJFB 2R9RB 3GVMA 2F4VO 1J5EB 1NKDA 3ABKC 3DTUB 1N33O 1XNQB 3JAWB 3ABKB 3ETEA 3QTCA 2XUMA 4MSWC 2Q73A 5EZYA 3P32A 1FS0G 1S76D 1GMGA 2YS8A 4B3SB 5FNVA 2P7TC 1GN2A 3RYCA 3CB2A 3FKSG 3CEIA 4J7JA 3HB3B 1OCCC 2YI8A 2BTQB 1H8HG 5B3SB 4E4EA 1SETA 3QO7A 3THOA 2JGDB 4Z2WA 2PGGA 5BMVA 2JK5C 2XT9A 1YTFD 3K5MA 2F1MA 1GH6A 5LHGA 2QJ1A 4I55B 2B1IA 2JS5A 5EBMC 1MSDA 3K9SA 4LF6O 4DUZO 5ITZB 5J2UA 5CMUA 1N36B 1HNWB 3ZS8C 2LO1A 4JYYA 2WA4A 5CB4B 3LSQA 2IJHA 3RVYA 2UXCB 3CYOA 2AXTZ 4MVRA 2IM9A 1U97A 4PDRA 4MTGA 1B04A 1K34A 3AG7A 3TETA 1JJ2U 2GUZB 4D7TA 4R6ZA 2VS0A 4PD4F 2FTKA 2QGNA 1H8EG 1AI5A 1G4YB 4LF8O 3P30A 4LFBB 2FB5A 3TCUA 3E86A 4FIPC 3CRRA 1NR7A 4DYLA 3BRCA 4LBEC 4TT3G 5JVDA 2UXBB 1HNZB 2IW5A 3BEHA 2NN4A 1B06A 4LCUC 2X6BA 2PYLA 3BY6A 2P6JA 4CZZA 4X20A 4UV9A 5CA3A 3AG1C 1WA8A 3QO5A 2OWOA 5GTHZ 4O4JA 1N33B 4N23A 3ZN0A 4TV8B 4FLZA 4F6RB 1KP2A 2HG5C 1XI1A 2ZIOA 1AI6A 2YUAA 1THZA 1Y76A 1JCHA 2E5LO 3UM7A 4JAUA 1JQ0A 1P7BA 1FFXB 3E8FA 3F5WC 1IBMO 2QM4A 4GUNA 2AHZA 2MW2B 5EYPA 3X2QC 4I0XB 1V55B 3X2QB 3RGBA 1GKFA 1R6NA 2WLHA 5IYZB 1GTOA 1M5IA 2CGNA 4GX0A 3ZRVA 4FK5C 4JV5O 4CS3A 4DR4O 2CGOA 1R3JC 4CBCA 5GW7A 4PI0A 4DUZB 1T5EA 4U3JB 4IT5A 3CS5A 4O4IA 2QKCA 2B9ZA 3VBBA 2EIMB 3APQA 1OV9A 2LFSA 2ZDIC 2Y69B 3IC7A 4G27B 3SYCA 1QLNA 4N21A 1QR9A 3E35A 1NTZH 1G6UA 5KHIA 1MOFA 1SZXA 3CCRV 2YEVA 3OUSA 2WLIB 4LF8B 1E1QG 4GX5A 1AILA 3ZMTA 3H01A 1X4TA 3H1JH 3OGCC 1EN5A 2JJ2G 1L0NH 4PA6A 2FKXA 1KB9F 1OCRC 1OJHA 3ZHVA 1VF6A 1X59A 3CHXA 4MVUA 1JOYA 2YSUB 2VQFO 1XQ8A 3CCQV 3U0ZA 2EIJC 3N2GA 3C3SA 4J80A 1YJNV 1P49A 4HZ3A 5L3EA 5C93A 2ZE5A 2XOKG 1YITV 2DJVA 4JTAB 2IH1C 1WPBA 3FAVA 4KUMA 2LGQA 3ASNB 1MABG 1VQOV 2E5LB 1N34O 5J2TA 2BTOA 1WJZA 3VOUA 1IBMB 4UFZA 5IWAO 1R6KA 3W7XA 4BIOA 2YIBA 4TOIA 3EHBB 4FPPA 5EIBD 4MW8A 5BY1A 5A2QN 3CCUV 1DGSA 2C2AA 3LNMB 4JV5B 1YVWA 4KFMA 5IJ0A 1G1XB 1AI7A 2Y48A 4KHPO 4B7KA 1Q3EA 5LGNA 4DV7O 4DRXB 4UB6Z 4P2ZA 4DV3O 3B2EE 1YSCA 5CN0A 1SC5B 4P9OA 1MA1A 4LNUB 3OT7A 1DF5A 1KC8W 4IIJA 4QPJA 1Q90D 1TUBB 2YXYA 3BFRA 3OAAG 3ZRXA 5J9PC 4ZBMA 2QWRB 1SA0A 3W7UA 5LXTA 3O65A 1OCOC 3NXSA 4JYCA 1YCIA 5B1AB 1IDSA 1MSWD 1VQ5V 5LMUO 1OCOB 1ZLZA 4A5UB 1SZTA 3AG3C 4X65B 2P5OA 2YXHA 1GM9A 3AG3B 3CCSV 3T4ZA 2ZXWC 3RYHA 1AR5A 4UVAA 1JVMA 5JH7B 3E83A 3N27A 1VQKV 1NS1A 2YC0A 1K73W 4JI6O 3QVNA 1E79G 2VQFB 3M8AA 4ABMA 2NR5A 1R1BA 2ZCEA 1W2BU 5KAIZ 3EVKA 2IH3C 3AG2C 3ETDA 4UCOA 1K5QA 2ITCC 2P06A 3SGIA 2JJ1G 5IJ9A 3U10A 2KSDA 4DV1O 5EC1C 5IYCO 5KHKA 2DYRC 5C8YA 3T2MA 2DYRB 1N34B 1BHBA 1PP9H 3ZBHA 3ZMVA 1S77D 2Z0AA 1AB3A 4WBNA 2JIZG 3W7SA 4JI3B 1LUWA 2ETNA 3H1IH 5IYDO 5IWAB 1SRYA 3ZHQA 1AP6A 3ZHTA 1Q82W 5CBGA 1N0JA 1VF7A 3HKDB 1K33A 3DC5A 4LFCO 1S3JA 5JCOA 2RJZA 4DV6O 1CEZA 2Q0AA 3CMAV 4O2AA 4X1IA 5IDJA 4KHPB 3MHSC 3I5DA 3KZIZ 1QCEA 1AI4A 5CA1A 4DV7B 1ZX3A 1V9PA 4BWAA 1BT8A 3F5TA 2AZ2A 2Q7GA 1SERA 4UVBA 3U11A 3JAMN 4JZ2A 5B5EZ 1CP9A 4WFAV 4YJ3B 3K59A 1Y67A 2KB1A 3APOA 4HYOA 4ZI7A 3B8MA 1GM7A 2QWOB 1Q5OA 5KX5A 3CCLV 1FFTB 5LMUB 1JPXA 4AQYO 2IU3A 3UT5B 4HAMA 4UVCA 5KHGA 4FZ1A 5CBHA 2XTAA 3J80N 4PDLA 3OUFA 2CH7A 4PDVA 3RN4A 1Q81W 1L0LH 4JAAA 3B4SA 2XHBA 1HP8A 4JGSA 1B6QA 5B1NA 4JI6B 3S3XA 4QNHB 1QVGU 4QPKA 4WFFA 3E89A 4DR6O 2WLJA 4PJ0Z 1XDCA 3JD3A 3ZHUA 3RFRA 1Q8IA 2P4KA 1XMQO 3OR6C 3D36A 4IL6Z 4BR6A 2ZR3A 2IJIA 4YIPA 1HW7A 2ADPA 1SQPH 2EIKB 5JQGB 4FMTA 4DXWA 2UXDO 1I94O 1K4DC 4ZOLA 4DV1B 4I4TA 3ZMUA 1WLEA 3RYFA 1S5HC 1ZWIC 2HVKC 4Z1MG 2BE3A 1W59A 2EJRA 2ZKOA 4I50A 2ZNJA 4DR3O 3FB6C 2MK3A 3SPHA 2HFEC 3D8CA 1XMOO 1URFA 5D5QA 4LFCB 5K1XA 2RMKB 2ZINA 3LSSA 1U96A 1R3KC 4DV6B 3RYIA 1H2KA 2H94A 3JATB 3B40A 4X8AA 1Z2GA 2HJDA 3KCYA 3MAQA 4PI2A 1UPGA 5LP6A 4FLUA 3JAKB 4MS2A 3K5NA 2M6YA 4JTCB 3RVZA 4GKJO 3OTOO 4DR2O 4NB5A 1IBLO 4CH4A 4J10A 1RSOB 1XUQA 5E79Z 2JVDA 1AR1B 3CXCU 4PDMA 2JDIG 5DEDA 4R50A 1TA8A 2QWNB 2QTOA 5A9GA 5LOVB 4AQYB 3G71V 2DYSC 4DK1A 1RP3B 1NTKH 3CX5F 3QNEA 1H2LA 3BCCH 3TXSA 1WNSA 4GZRB 2UUAO 5D5PA 4B7EA 2WLLB 4MW3A 3H1KH 2Q6AA 4X1KB 1OCCB 5CA0B 2ARHA 4JZGA 1NTMH 5FL7G 3SJCC 3EFFK 4UXNA 1PL0A 3ZCCA 4YY3O 3VQYA 4CH6A 3ZX6A 3RT3C 2HP8A 2KQXA 2OIGA 3K0DA 1FXVA 1M56C 3UQ8A 1JFFB 4FM1A 4X64O 2ZT9B 4O4HA 3DXRB 4LF9O 5H9CA 1VMGA 1OCZC 1FXKA 2WLMA 3ZMSA 3CCEV 1XMQB 4OPAA 1E1RG 1YI2V 4UCVA 2P4VA 3CJHA 5LBQA 2CDYA 1K4CC 1BSMA 4UCTA 1I5XA 2EJ7A 4TV9B 2P22C 4H37A 2A06H 2UXDB 2CTPA 1I94B 2HR3A 1QVFU 1ZAUA 2Q69A 3JARB 3K3WA 4FFKA 3WB0A 4X1YB 3JAWA 2F23A 1JA8A 2DMXA 1Z5VA 2QA4V 2ZE7A 4EB6B 2E3CA 2DWEC 1A32A 3JASB 2XAGA 4DR3B 3C90A 1KKDA 4JI0O 1ZSPA 3LUTB 2BSKB 1XMOB 1H2GA 3ASOC 2VWKA 4IYIA 2BTQA 1PM9A 4I9QA 3JD4A 3T1YO 1AJPA 4X62O 3FB7C 4R8CA 2ZM6O 2JGDA 3ABLC 3G67A 1K97A 4JI4O 1AROP 1PL4A 3BAAA 2JEXA 4I55A 2M7WA 5EYPB 4PV1B 2NLJC 1I7FA 5ITZA 4GKJB 4DR2B 1XL6A 1YZBA 2QWPB 2RQ6A 3N2KB 4LWSB 1IBLB 2YIAA 1K5SA 5KHJA 2GTSA 3B8NA 3ZIAG 1SQVH 3AG1B 3CCMV 2F4VB 1WB8A 5CB4A 1DK1A 4FLVA 2GHYA 3ML0A 1AJQA 4LF5O 4UB8Z 3L73H 4FLTA 3F7YC 2GUZA 2ODMA 4OGQB 2UUAB 3BPZA 3I56V 4PA4A 2UU9O 4EFBA 4PHZA 4JAVA 1KMIZ 3AG4C 2Q7EA 4K0KO 1NZ6A 4YY3B 3LDCA 3I55V 5LYJB 3VQXA 2HLDG 1IX9A 3FYIB 1QU7A 1D2DA 4NYKA 4X64B 1BE3H 3ZEDA 4LF9B 1KYOF 2OCCC 1S5JA 4NTYA 3WB1A 2E76B 2WAMA 4LF6B 4IHJB 4GT1A 4TSFG 5KUKA 5EBWC 1VF6C 3P3NA 1GK9A 2Y4UA 1F51A 3L72H 4BIUA 2UXNA 1DLBA 1XREA 3ZRWA 3K0GA 4TV8A 4E2LA 2VQEO 3LDEA 1IXBA 1BQ0A 1VQ4V 1WB7A 4JI0B 4DR1O 1FFXA 4U7OA 1KKCA 5FPOA 3T1YB 1UFIA 3JCZA 2K1EA 4I0XA 1Y66A 4X62B 1VARA 1VQNV 5IE9A 3HPLC 3JALB 2ZM6B 5FLXN 2LW1A 3JSNA 5IYZA 4JI4B 3CC4V 2R70A 1OCRB 5J2TB 4J11A 4AILC 2X6AA 4MVMA 4YIOA 5KUMA 4DO2A 1M57C 4U3JA 3A0HZ 1H2SB 2EIJB 4G28B 2X6CA 1XEQA 1PNMA 4PA9A 3BABA 4JI1O 4O2BB 3QG5A 2OTJV 1RPRA 1KD1W 3T4DA 1TVKB 1L8DA 2LW7A 1L1FA 3B09A 3SYQA 4DK0A 5L3CA 4DUYO 4L87A 4DV5O 5JJJB 4WFGA 1EM1A 3IFXA 1EZJA 2DWDC 2IBZH 1N32O 2WLIA 3OGIB 2UU9B 5GONB 4K0KB 1BL8A 2Q67A 3H1LH 5F2VO 2GDSA 3FX7A 2FYUH 5HFLA 3JYCA 3SYOA 3FB5C 4LP8A 1FKAO 1NR1A 1P7GA 1V54C 1YHQV 4DR4B 4J9YB 3BVOA 1H2NA 1K3EA 2KKWA 2PZSA 1GAXA 2FL4A 4FLYA 4JASA 3IAYA 1NVPD 3HKBB 2F43G 1TAEA 2H3OA 4OXSA 2Y4TA 2QKSA 1MZFA 1PV0A 1NU1H 3UKMA 5LA6B 3A2FA 4JI7O 4UUJC 1OZ0A 1NH2D 1QR8A 4J9ZB 1G8MA 2OYQA 3JD2A 1ENVA 2KG7B 1NT2B 4P9PA 4WFHA 1F7YA 4B3TO 3K5LA 2R9AA 2OT5A 2YIDA 3ZN1A 1HDJA 3ABMC 4ZHQB 3ABTA 3ABMB 3SPGA 1VQPV 4DR1B 2EILC 1H2MA 2N04A 3IC9A 1CPYA 4QGPA 2EILB 2ZXWB 3HKEB 3B77A 2ZD9A 4YJ2B 1ROPA 4MTFA 4JI8O 2UXXA 4KP4A 3MHHC 2RNBA 1D5NA 4U7NA 3UO2A 3Q4HB 3P3PA 3ZHRA 4Z1VA 3OR7C 3CRAA 4JYAO 1BGYH 3KG2A 4DRXA 1DF4A 5JCOC 3FYEB 2HHHO 3AG2B 3ZJZA 4EEQA 3UCSC 1Y74B 4D6TH 4WF9V 2F93B 4JI1B 3CCJV 4LNUA 5JJEB 1F23A 1JJOA 1K92A 1NBMG 3HKCB 3OM3B 1TUBA 1JMKC 3ZMZA 4DUYB 4DV5B 1NI8A 5B1BC 4RAIA 3C3TA 2DN9A 2XASA 1AP5A 5B1BB 4DR5O 2B5UA 1FPOA 3AK3A 4NKGB 3OW2U 3K9AA 2QWQB 3R65A 3SDLA 1N32B 1EZVH 1BS3A 4FM2A 2UUCO 4TWKA 1KECA 5IT9N 5JJNB 5KX5B 4CH3A 3SYPA 5JH7A 1YF2A 1RPOA 3W7WA 3E2EA 4GX1A 1UJWB 1VQMV 2ZQMA 2CK3G 1NVPB 2E75B 4O4LB 5L3FA 2EBOA 2ZNIA 3JD1A 1EN6A 5IY5C 3FFQA 4I7ZB 3CCVV 2A3QA 1SQXH 4NTXA 2Z5UA 4DV3B 1VQ9V 2EINC 1NH2B 5FPRA 2ZE6A 2Q68A 1XBLA 4MVZA 5H2FZ 4AI8A 3PN1A 4JI7B 1XL4A 5KLVH 2XAHA 4J42A 3D36C 3CSXA 4B3TB 4NR1A 4LF4O 3FB8C 3EXAA 5KA6A 1ZL8B 1MG1A 4MVSA 1Y6XA 4XBFA 1GRJA 3SPCA 1VF5B 2W6JG 1LR1A 1YJ9V 5TISZ 3ETGA 4TUYB 1WP7A 3A0RA 4K3AA 1RM1C 1J5EO 4BW5A 1RM1B 3HKDA 5BR8O 3E22B 4JI8B 1B3QA 3LDDA 2Q9LA 4FFBB 5H6QA 3SYAA 4DV0O 1EBOA 3CE2A 4RUFA 2PI4A 4JYAB 1AJNA 2GV9A 1P84F 1ZTEA 2JEUA 2HHHB 2OCHA 5L3GA 3ZHSA 2W0FC 2PY5A 3MD0A 1QLEC 4FLWA 1Z5WA 4YJ3A 4HNAB 5LP6C 1VEWA 1IBKO 3L70H 4ZIBA 5LHIA 2ILMA 1EN4A 4DR5B 3A8TA 3K57A 4XDJA 5KMGB 4PA3A 3UT5A 2UUCB 5DM6V 1M93A 2IJJA 4CC5A 1Q7YW 3S3WA 1QNMA 4MTXA 5EZYB 1KP3A 4J41A 2YXLA 4H13B 5FNVB 3RYCB 5LHHA 1M1KW 1QHTA 1KQSU 2F66C 2WA3A 4Q6GA 5KHHA 4QE7A 4QE9A 5BMVB 1IVSA 4EFEA 3AK2A 3E8GA 1SS3A 3IGAC 1PNKA 4MVOA 5JQGA 2F95B 1FXKC 1YXBA 1FXKB 3DGEA 1K7DA 4I9WA 4LF4B 4WFBV 5J2UB 1Q6HA 2WLNA 2Q0OC 4JF3A 3TXQA 3DSQA 1SQGA 2DYSB 2V7QG 3KKYA 2ADQB 1XHZA 3CMEV 1IXMA 4F4LA 4K8XA 2ZR2A 1SQQH 3WG7C 2G38A 2B1GA 4W4LA 3WG7B 4H33A 2ZE8A 2A9HA 4RWUA 5BR8B 1N4CA 5H5NA 2PYJA 1FJGO 2Q4PA 2W6IG 4J7KA 3STZC 2R72A 5EBLC 3CRCA 1M56B 3JATA 4DV0B 4DR6B 2JGUA 1GM8A 3STLC 1OCZB 5B3SC 3JAKA 1YDXA 3G6EV 5IYBO 1Q43A 4L8JA 4B3RO 4XDLA 1RSOA 2A79B 1I0HA 1VIBA 5JVDB 3FD9A 4D7SA 1IBKB 4LF7O 5B66Z 3L71H 2K9PA 3VQVA 1S0VA 4GYCB 3WB2A 5AG2A 4X20B 4X66O 3BHPA
chains in the Genus database with same CATH topology
1QLEB 2V1DA 2OTLV 3E83A 4WCEV 1N8RW 5LGTA 1VQKV 4U7OA 5BZBA 3JCZA 2K1EA 1K73W 2WWWA 1Y66A 1VQNV 3HPLC 3K79A 1E79G 3CC2V 2EIKC 3GB7C 3SPJA 2WLLA 3CC4V 1OCRB 3ASOB 1W2BU 4X88A 2IH3C 3AG2C 1P4RA 3ETDA 3ZRSA 2X6AA 1ORQC 3AEIA 3OEEG 2XAFA 4MVMA 2GSMB 2XAJA 1K5QA 2ITCC 3RW0A 3ABLB 5KUMA 4R7CA 4DO2A 1M57C 4RQEA 3ABUA 1W0JG 4PELA 2JJ1G 2EIJB 1NJIW 4G28B 2X6CA 3F7VC 1PNMA 4PA9A 2LP7A 5EC1C 2OTJV 1RPRA 3CP1A 5IYCO 1KD1W 3D3IA 2DYRC 3T2MA 3T4DA 2P90A 4WFEA 1L1FA 1K9MW 2DYRB 3SYQA 4MT8A 5L3CA 1BHBA 3ZMVA 4L87A 1S77D 4WFGA 2JIZG 3W7SA 1SESA 2EZPA 5IYDO 1SRYA 3IFXA 3CD6V 2NNUA 1Y4MA 5DN6G 1EZJA 2DWDC 5L3DA 1Q82W 3K06A 5CBGA 2BOCC 2WSSG 2WLIA 2XAQA 1K33A 1S3JA 1BL8A 2Q67A 2D3OW 1VQ6V 1CEZA 1R3LC 3CMAV 1GO3F 5HFLA 3RBZA 3JYCA 5IDJA 1PKXA 3MHSC 3SYOA 5EC2C 1QCEA 1AI4A 3FB5C 3OFNG 4LP8A 3ZRWB 1NR1A 3AG4B 1V54C 1YHQV 2AHYA 4J9YB 1K3EA 2IU0A 4EKWA 1SERA 4UVBA 2ITDC 1PNLA 2Z3YA 4QJFB 2R9RB 2X0LA 1NKDA 3ABKC 3DTUB 4JASA 1S72V 1CP9A 1NVPD 2YEVB 4WFAV 3ABKB 2F43G 3E8HA 1HWYA 3ETEA 4MSWC 2KB1A 4HYOA 2OCCB 4OXSA 3B8MA 1GM7A 3P32A 3CCLV 1FS0G 1S76D 1GMGA 1FFTB 2QKSA 1V55C 1COWG 5L3BA 4UV8A 2P7TC 3UKMA 3FKSG 1YTFB 1JPXA 4UUJC 2IU3A 1OZ0A 1NH2D 3HB3B 1OCCC 1QR8A 4J9ZB 1G8MA 2QM7A 3JD2A 1ENVA 1H8HG 4P9PA 5B3SB 4WFHA 4HAMA 4UVCA 2OT5A 4QIWF 4JYBA 3ZN1A 5CBHA 3ABMC 1SETA 1WPXA 4PDLA 3ABTA 3OUFA 5LGUA 3QO7A 1FXHA 2A0LA 3ABMB 4PDVA 3SPGA 1Q81W 2JK5C 2QM8A 1VQPV 2EILC 1YTFD 1CPYA 2EILB 5LHGA 1LNQA 2ZXWB 4JGSA 2B1IA 5EBMC 1B6QA 2EIMC 5B1NA 3B77A 4QNHB 5CMUA 1QVGU 4QPKA 4WFFA 3E89A 2Y69C 2ZD9A 2WLJA 1ROPA 4MTFA 3JD3A 2UXXA 4BAYA 3OR6C 4KP4A 3MHHC 4XDKA 3D36A 4U7NA 3LSQA 2IJHA 2ZR3A 2IJIA 3RVYA 3CYOA 4MTOA 4MVRA 2EIKB 3OR7C 1VQ7V 4PDRA 4MTGA 4FMTA 4DXWA 3KG2A 1DF4A 1K34A 3FYEB 3T1CA 1K4DC 3AG2B 3ZJZA 3TETA 3WFVA 2QE7G 1JJ2U 1NQTA 4WF9V 4R6ZA 3ZMUA 3CCJV 1WLEA 1F23A 2HKOA 1S5HC 1ZWIC 2FTKA 1H8EG 1K92A 2DW4A 1AI5A 1G4YB 1M57B 1NBMG 3OM3B 3P30A 4FJCC 2HVKC 4Z1MG 1VQ8V 1R3IC 3ZMZA 5B1OA 2EJRA 4GX2A 3TCUA 5B1BC 4RAIA 3JD0A 2XASA 3FB6C 2MK3A 5B1BB 3E86A 3SPHA 2B5UA 4FIPC 2HFEC 1DTOA 3OW2U 2P67A 3K9AA 1EFRG 1NR7A 2H8PC 2ZDIA 3R65A 4G2KA 4LBEC 4TT3G 2DQ3A 3LSSA 3K03A 5E1AC 5KA5A 2IW5A 1BMFG 3BEHA 4TWKA 1VQLV 1R3KC 2EZOA 1KECA 4LCUC 2X6BA 4JPRA 3BY6A 2P6JA 4YXWG 3SYPA 4CZZA 2R9IA 1RPOA 2H94A 3W7WA 3CC7V 4X8AA 3E2EA 2ATKC 4GX1A 1UJWB 1VQMV 2ZQMA 2CK3G 4UV9A 1NVPB 1R73A 4MS2A 3AG1C 5CA3A 5EK0A 4JTCB 5L3FA 2EBOA 3QO5A 3ASNC 3RVZA 3JD1A 3SJQC 4N23A 4LC1A 3ZN0A 5IY5C 3OEHG 3PJSK 3CCVV 1V54B 1KP2A 2HG5C 4ASUG 1AI6A 2Z5UA 1AR1B 3CXCU 1VQ9V 4PDMA 2JDIG 2EINC 1NH2B 1THZA 2Q68A 4R50A 4JTDB 4MVZA 2QTOA 1JCHA 3UM7A 4JAUA 3G71V 1XL4A 1JQ0A 1QBZA 2DYSC 2LFRA 3OE7G 2XAHA 1P7BA 4P30A 2QEXV 3E8FA 3F5WC 2AHZA 3QNEA 3X2QC 1V55B 3X2QB 1F4NA 3FB8C 1GKFA 1R6NA 5KA6A 1MG1A 2WLHA 4MVSA 2DQ0A 1GTOA 2WLLB 4MW3A 4XBFA 2Q6AA 4GX0A 1Q86W 1BHAA 1OCCB 2WLKA 3SPCA 5FL7G 3ZCCA 3ZRVA 3EFFK 4UXNA 1PL0A 2W6JG 1YJ9V 4FK5C 3SPIA 3ETGA 4Q20A 1R3JC 5H6RA 4CBCA 3A0RA 5GW7A 3K0DA 1FXVA 4PA7A 1RM1C 1M56C 4BW5A 1RM1B 1PD3A 1F4MA 5H9CA 1OCZC 1FXKA 3CPWU 2WLMA 3ZMSA 3LDDA 3CCEV 3G4SV 5H6QA 3SYAA 1E1RG 1YI2V 5B1AC 4RO2A 3VBBA 5LBQA 2EIMB 1K4CC 1EBOA 2ZDIC 2Y69B 2LFSA 1I5XA 2X7RB 3IC7A 4G27B 3SYCA 4RUFA 3QO8A 2PI4A 1AJNA 1M90W 1QLNA 4H37A 2JEUA 4N21A 1QR9A 3E35A 2HR3A 1QVFU 2Q69A 5L3GA 2W0FC 2IJKA 3K3WA 1MOFA 3MD0A 3CCRV 1K8AW 1QLEC 2YEVA 3OUSA 3GWOA 2WLIB 2HJFC 2QA4V 1E1QG 4GX5A 2DWEC 1M9NA 3ZMTA 3H01A 5LHIA 2XAGA 4BIZA 3OGCC 2JJ2G 1KKDA 4XDJA 3LUTB 4PA6A 1OCRC 1H2GA 3ASOC 4PA3A 5DM6V 2IJJA 4MVUA 1JOYA 3JD4A 3OMAB 1AJPA 2YSUB 1Q7YW 4R8CA 3ABLC 1J95A 3CCQV 1K97A 1AROP 4MTXA 2EIJC 5CBFA 2PI5A 2XNDG 1KP3A 1TUEB 2JEXA 2M7WA 5HFMA 1YJNV 4X89A 2NLJC 4GCZA 1XL6A 5LHHA 1M1KW 3K08A 4HZ3A 1K5SA 5L3EA 5C93A 1KQSU 2XOKG 3E8BA 1YITV 3B8NA 4JTAB 3ZIAG 2IH1C 3AG1B 4KUMA 4QE7A 3CCMV 4QE9A 3ASNB 1MABG 1VQOV 1H38A 3OMIB 1OHHG 5IY5B 3E8GA 1W0KG 3IGAC 1PNKA 4MVOA 2GHYA 3ML0A 1AJQA 1FXKC 3VOUA 1FXKB 3DGEA 3F7YC 2EINB 3TK1A 1K7DA 4I9WA 4WFBV 1R6KA 2BOBC 2WLNA 4JF3A 4RQFA 3W7XA 3I56V 4PA4A 3EHBB 4FPPA 4JAVA 4MW8A 2DYSB 3AG4C 2V7QG 4I5SA 1I5YA 3CCUV 2C2AA 3LNMB 3LDCA 3I55V 3CMEV 1IXMA 3OMNB 4F4LA 2HLDG 4KFMA 4ZKIA 1AI7A 2ZR2A 2Y48A 3WG7C 1YJWV 3FYIB 2B1GA 5LGNA 3WG7B 4H33A 2A9HA 4RUEA 2OCCC 2WPDG 2WAMA 4P2ZA 2W6IG 1YSCA 5CN0A 4P9OA 4GT1A 3STZC 5EBLC 1M56B 1DF5A 1GM8A 2HVJC 4TSFG 1JX9A 1KC8W 3STLC 3W7TA 1YIJV 5KUKA 5EBWC 4QPJA 1OCZB 3K04A 3OAAG 3ZRXA 1GK9A 4ZBMA 5J9PC 5B3SC 1F51A 4MVQA 4BIUA 3W7UA 2UXNA 3G6EV 5IYBO 1OCOC 3NXSA 4JYCA 5B1AB 1MSWD 1VQ5V 1DLBA 1OCOB 3ZRWA 1SZTA 3K0GA 3AG3C 4XDLA 2A79B 1GM9A 3AG3B 3M99B 4E2LA 3CCSV 3T4ZA 2ZXWC 1S0VA 3LDEA 4UVAA 1JVMA 1VQ4V 3FB7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 C;  4UUJ C;  1OCC C;  3E83 A;  3PJS K;  4J9Z B;  2EIJ C;  2HG5 C;  5CBF A;  4P9P A;  5BZB A;  4WFH A;  4PDM A;  2K1E A;  2EIN C;  5CBH A;  3ABM C;  2Q68 A;  4R50 A;  4X89 A;  4PDL A;  2NLJ C;  3OUF A;  3HPL C;  4JTD B;  2A0L A;  4MVZ A;  2QTO A;  4PDV A;  1XL6 A;  3SPG A;  2EIK C;  2JK5 C;  3GB7 C;  3SPJ A;  3UM7 A;  2WLL A;  1XL4 A;  3K08 A;  4HZ3 A;  2DYS C;  2EIL C;  1P7B A;  4P30 A;  4X88 A;  3E8F A;  3E8B A;  3F5W C;  2IH3 C;  3AG2 C;  2AHZ A;  3ZRS A;  4JTA B;  3X2Q C;  2IH1 C;  1LNQ A;  2X6A A;  1ORQ C;  3RVZ A;  4QE7 A;  4MVM A;  4QE9 A;  5EBM C;  2EIM C;  3FB8 C;  2ITC C;  3RW0 A;  4QNH B;  4WFF A;  2WLH A;  4MVS A;  3E89 A;  4R7C A;  5KUM A;  1M57 C;  2Y69 C;  2ZD9 A;  2WLJ A;  2WLL B;  3E8G A;  4MW3 A;  3IGA C;  2Q6A A;  4GX0 A;  4MVO A;  4MTF A;  2WLK A;  3SPC A;  4G28 B;  3VOU A;  3EFF K;  3OR6 C;  2X6C A;  4XDK A;  3F7V C;  3F7Y C;  3SPI A;  4PA9 A;  1R3J C;  5EC1 C;  4CBC A;  4I9W A;  3K0D A;  3RVY A;  2BOB C;  4PA7 A;  1M56 C;  2DYR C;  2WLN A;  4MTO A;  3T2M A;  3T4D A;  4BW5 A;  4MVR A;  3OR7 C;  4PA4 A;  4WFE A;  3SYQ A;  4PDR A;  4MTG A;  4MW8 A;  3AG4 C;  4DXW A;  3KG2 A;  1OCZ C;  2WLM A;  4WFG A;  3T1C A;  1K4D C;  3LDD A;  3LNM B;  3ZJZ A;  3LDC A;  3TET A;  3SYA A;  4F4L A;  4KFM A;  4RO2 A;  3IFX A;  4R6Z A;  5B1A C;  3SJQ C;  1K4C C;  3WG7 C;  2DWD C;  1S5H C;  1ZWI C;  3K06 A;  5CBG A;  2BOC C;  1G4Y B;  4H33 A;  2WLI A;  2A9H A;  4G27 B;  3SYC A;  4RUE A;  2HVK C;  4RUF A;  2OCC C;  4H37 A;  1R3I C;  3TCU A;  1BL8 A;  2Q67 A;  4GX2 A;  5B1B C;  4RAI A;  3FB6 C;  1R3L C;  2Q69 A;  4P2Z A;  3E86 A;  3SPH A;  2W0F C;  4P9O A;  3RBZ A;  3STZ C;  2HFE C;  3JYC A;  5EBL C;  1QLE C;  2YEV A;  3SYO A;  5EC2 C;  2HVJ C;  3OUS A;  2H8P C;  3FB5 C;  3R65 A;  2WLI B;  4LP8 A;  3STL C;  2HJF C;  5KUK A;  4LBE C;  5EBW C;  1V54 C;  3K04 A;  2AHY A;  5J9P C;  4ZBM A;  3K03 A;  2DWE C;  4GX5 A;  5B3S C;  5E1A C;  4J9Y B;  4MVQ A;  3BEH A;  4TWK A;  1R3K C;  4LCU C;  4EKW A;  2X6B A;  2ITD C;  1OCO C;  3SYP A;  2R9R B;  3ABK C;  3OGC C;  1KKD A;  4XDJ A;  3LUT B;  4PA6 A;  4X8A A;  3K0G A;  3AG3 C;  3E8H A;  4XDL A;  1OCR C;  2A79 B;  2ATK C;  3ASO C;  4GX1 A;  4MSW C;  4PA3 A;  2KB1 A;  4HYO A;  4OXS A;  4MVU A;  3T4Z A;  4MS2 A;  3AG1 C;  2ZXW C;  2QKS A;  1V55 C;  3LDE A;  4JTC B;  5EK0 A;  1JVM A;  2P7T C;  3ASN C;  4R8C A;  3UKM A;  3ABL C;  3FB7 C;  1J95 A; 
#chains in the Genus database with same CATH topology
 5LOV A;  2V1D A;  2OTL V;  4WCE V;  5LGT A;  3G6B A;  4TQD A;  1WP8 A;  1WA8 B;  2ZIM A;  2WWW A;  3ETQ A;  4NVP A;  3K79 A;  4O4J B;  4K35 A;  1GN6 A;  2PTM A;  2WLL A;  2RDC A;  3ASO B;  4X1K A;  5CA0 A;  4LH6 A;  2N74 A;  4X88 A;  1RFY A;  1ORQ C;  5DEC A;  4FM0 A;  2GSM B;  1Y76 B;  1JFF A;  3ABL B;  4FLX A;  3CWB H;  4R7C A;  3L74 H;  1W0J G;  3DXR A;  3KCX A;  3T1H O;  1NJI W;  1AR4 A;  3F7V C;  2LP7 A;  1WN7 A;  4DV4 O;  3OTO B;  3D3I A;  2P90 A;  4TV9 A;  2Y0P A;  3OTF A;  2YIB D;  3CD6 V;  3JAR A;  2JRI A;  1Y4M A;  2GTA A;  2EUL A;  3K06 A;  4X1Y A;  2WSS G;  4EB6 A;  4LFA O;  1HNX O;  3JAS A;  2FML A;  4O4I B;  2D3O W;  1VP7 A;  1GO3 F;  3RBZ A;  1PKX A;  2BSK A;  4DW1 A;  3OFN G;  3ZRW B;  3AG4 B;  2D2C B;  2Q5Z A;  2AHY A;  3A0B Z;  2IU0 A;  1FJG B;  2E74 B;  2Y0I A;  2Z3Y A;  1PNL A;  1MZE A;  2X0L A;  1S72 V;  2YEV B;  3E8H A;  1HWY A;  1WAZ A;  2OCC B;  3WU2 Z;  2JS3 A;  3L9D A;  1V55 C;  1COW G;  1LUV A;  1SQB H;  3GWK C;  5L3B A;  4UV8 A;  1YTF B;  3N2K A;  4LWS A;  1TGO A;  1SQF A;  4B3R B;  3BA8 A;  4H0L B;  2QM7 A;  4W4K A;  1IZ3 A;  1SF9 A;  3OD4 A;  4LF7 B;  4QIW F;  4JYB A;  1WPX A;  5LGU A;  1FXH A;  2A0L A;  3M7M X;  4X66 B;  4F6R A;  2QM8 A;  3LNN A;  3NR7 A;  1GN4 A;  3N2G B;  3CRQ A;  2EX3 A;  1LNQ A;  2EIM C;  2Y69 C;  4K8Z A;  4BAY A;  4JI2 O;  4XDK A;  3FAV B;  5LYJ A;  2OIE A;  2BCC H;  4MTO A;  1VQ7 V;  3JCU Z;  4X65 O;  1Q6I A;  2LJ2 A;  3T1C A;  3T1H B;  4U3F H;  3WFV A;  2QE7 G;  1NQT A;  4IHJ A;  4DV2 O;  4DV4 B;  2DOS A;  2HKO A;  2DW4 A;  1M57 B;  4FJC C;  1VQ8 V;  5KAF Z;  1R3I C;  5JWP A;  5B1O A;  4DR7 O;  4GX2 A;  3JD0 A;  3TJT A;  5IJ0 B;  4UCU A;  1DTO A;  2P67 A;  1EFR G;  2H8P C;  2ZDI A;  4BW9 A;  2V4D A;  4G2K A;  4CH5 A;  2GBO A;  2DQ3 A;  2Q8V A;  4LF5 B;  3K03 A;  4LFA B;  5E1A C;  5KA5 A;  2QTS A;  1VQL V;  1BMF G;  4B3M O;  1HNX B;  2EZO A;  2CAZ C;  4JPR A;  4YXW G;  1YEW A;  2R9I A;  3CC7 V;  4IIJ B;  2ATK C;  1SA0 B;  1R73 A;  5LXT B;  1KUQ A;  4IGG A;  5EK0 A;  4GLX A;  3ASN C;  3JAL A;  3SJQ C;  4LC1 A;  3L75 H;  3AK1 A;  3OEH G;  4X9Q A;  3PJS K;  3K58 A;  1V54 B;  1XNR O;  4ASU G;  3ICX A;  3R66 A;  1BCC H;  4JI3 O;  3RYH B;  2Q7H A;  3D3Q A;  1I08 A;  4JTD B;  3SJA C;  1QBZ A;  2LFR A;  3OE7 G;  4FZ0 A;  4P30 A;  2QEX V;  4O2B A;  1F4N A;  1TVK A;  2DQ0 A;  1Q86 W;  1BHA A;  2WLK A;  3H1H H;  2VQE B;  3LSU A;  3SPI A;  4Q20 A;  5H6R A;  4NXN O;  4KL1 A;  4PA7 A;  4OPH A;  1PD3 A;  4CS2 A;  1F4M A;  5GON A;  5IJ9 B;  2RN9 A;  3CPW U;  5GTI Z;  3J7A U;  4JI2 B;  4YHH O;  3G4S V;  3CXH F;  4HBN A;  1PPJ H;  5B1A C;  4RO2 A;  2DE0 X;  3SJB C;  5C8Y B;  2X7R B;  2AW9 A;  1O9G A;  3QO8 A;  1M90 W;  2QDO A;  4TQF A;  4WBN B;  1QQC A;  2IJK A;  4DV2 B;  1K8A W;  3HKB A;  3GWO A;  4OX9 O;  2HJF C;  1HR0 O;  2YI9 A;  3H9V A;  1M9N A;  4DR7 B;  4BIZ A;  1S5L Z;  4O2A B;  4X1I B;  5LL6 Y;  4FVM A;  5LA6 A;  2A7W A;  1O9H A;  5CA1 B;  1BZK A;  1BQZ A;  4J7Z A;  1GN3 A;  2QSA A;  2KG7 A;  4B3M B;  3OMA B;  3QF7 A;  4AHC A;  1N0N A;  3BA9 A;  5K1P A;  1Q6U A;  2L6L A;  4ZHQ A;  2CTW A;  1J95 A;  1ZUQ A;  4F6E A;  4ZI7 B;  5CBF A;  3SR2 C;  2PI5 A;  2XND G;  1TUE B;  3HKE A;  4GKK O;  1FYJ A;  4X89 A;  1MMM A;  4GCZ A;  2UUB O;  1CXZ B;  4NXM O;  4YJ2 A;  3K08 A;  1XNR B;  3E8B A;  2HEP A;  2PF4 E;  5EIB C;  2N05 A;  3Q4H A;  4JI5 O;  2CH7 B;  1H38 A;  1D5A A;  3OMI B;  1OHH G;  5IY5 B;  1W0K G;  3HR0 A;  1US6 A;  1Y74 A;  2EIN B;  3TK1 A;  1JR9 A;  1XOU A;  3CRM A;  2BOB C;  4RQF A;  2PUS A;  2W0X A;  3HKC A;  4I5S A;  1I5Y A;  3OMN B;  5LMN O;  4ZKI A;  3IJ4 A;  4LR3 A;  4NXN B;  1YJW V;  2CTR A;  2LQT A;  4RUE A;  1IUR A;  2WPD G;  4YHH B;  4ZOL B;  4DW0 A;  2AZ0 A;  3K5O A;  4I4T B;  4CC6 A;  1XNQ O;  3RYF B;  1MNG A;  4UCS A;  2HVJ C;  4C7U A;  1JX9 A;  3W7T A;  1YIJ V;  4NTW A;  2L35 A;  3K04 A;  1AVM A;  5BXZ A;  2QR4 A;  4MVQ A;  4I50 B;  2YDE A;  4O4L A;  4B3S O;  4CS4 A;  4OX9 B;  3M99 B;  3DC6 A;  1HR0 B;  3G80 A;  1XHX A;  2CTQ A;  4UCR A;  3O9O A;  3RYI B;  4H44 B;  5HFM A;  1QLE B;  3MDS A;  3J81 N;  1SKV A;  1N8R W;  2YIC A;  5LP6 B;  1M4U A;  1FAF A;  5BZB A;  2VWJ A;  3CC2 V;  1ZL8 A;  1N36 O;  2EIK C;  1HNW O;  3GB7 C;  3SPJ A;  3ZRS A;  1P4R A;  3AEI A;  3OEE G;  2XAF A;  4TUY A;  4LH7 A;  2XAJ A;  4GKK B;  2UXC O;  3RW0 A;  2UUB B;  4RQE A;  4NXM B;  3ABU A;  3VQW A;  3E22 A;  4PEL A;  1KBH A;  4FFB A;  3CP1 A;  3TGU H;  4KXR A;  4JI5 B;  4WFE A;  1K9M W;  4MT8 A;  4LFB O;  4IYH A;  2VRZ A;  4ICG A;  3UO3 A;  2QKA A;  1SES A;  1FD9 A;  2EZP A;  2O57 A;  2NNU A;  5DN6 G;  5L3D A;  1R6T A;  2BOC C;  2XAQ A;  4O4H B;  3RWR D;  2UXB O;  4B08 A;  4HNA A;  1HNZ O;  1KU9 A;  1VQ6 V;  3JSL A;  1R3L C;  2RCV A;  5LMN B;  3CJH B;  2CE4 A;  2CUG A;  5EC2 C;  5KMG A;  2AGA A;  2LGW A;  1XIL A;  4EKW A;  2ITD C;  4QJF B;  2R9R B;  3GVM A;  2F4V O;  1J5E B;  1NKD A;  3ABK C;  3DTU B;  1N33 O;  1XNQ B;  3JAW B;  3ABK B;  3ETE A;  3QTC A;  2XUM A;  4MSW C;  2Q73 A;  5EZY A;  3P32 A;  1FS0 G;  1S76 D;  1GMG A;  2YS8 A;  4B3S B;  5FNV A;  2P7T C;  1GN2 A;  3RYC A;  3CB2 A;  3FKS G;  3CEI A;  4J7J A;  3HB3 B;  1OCC C;  2YI8 A;  2BTQ B;  1H8H G;  5B3S B;  4E4E A;  1SET A;  3QO7 A;  3THO A;  2JGD B;  4Z2W A;  2PGG A;  5BMV A;  2JK5 C;  2XT9 A;  1YTF D;  3K5M A;  2F1M A;  1GH6 A;  5LHG A;  2QJ1 A;  4I55 B;  2B1I A;  2JS5 A;  5EBM C;  1MSD A;  3K9S A;  4LF6 O;  4DUZ O;  5ITZ B;  5J2U A;  5CMU A;  1N36 B;  1HNW B;  3ZS8 C;  2LO1 A;  4JYY A;  2WA4 A;  5CB4 B;  3LSQ A;  2IJH A;  3RVY A;  2UXC B;  3CYO A;  2AXT Z;  4MVR A;  2IM9 A;  1U97 A;  4PDR A;  4MTG A;  1B04 A;  1K34 A;  3AG7 A;  3TET A;  1JJ2 U;  2GUZ B;  4D7T A;  4R6Z A;  2VS0 A;  4PD4 F;  2FTK A;  2QGN A;  1H8E G;  1AI5 A;  1G4Y B;  4LF8 O;  3P30 A;  4LFB B;  2FB5 A;  3TCU A;  3E86 A;  4FIP C;  3CRR A;  1NR7 A;  4DYL A;  3BRC A;  4LBE C;  4TT3 G;  5JVD A;  2UXB B;  1HNZ B;  2IW5 A;  3BEH A;  2NN4 A;  1B06 A;  4LCU C;  2X6B A;  2PYL A;  3BY6 A;  2P6J A;  4CZZ A;  4X20 A;  4UV9 A;  5CA3 A;  3AG1 C;  1WA8 A;  3QO5 A;  2OWO A;  5GTH Z;  4O4J A;  1N33 B;  4N23 A;  3ZN0 A;  4TV8 B;  4FLZ A;  4F6R B;  1KP2 A;  2HG5 C;  1XI1 A;  2ZIO A;  1AI6 A;  2YUA A;  1THZ A;  1Y76 A;  1JCH A;  2E5L O;  3UM7 A;  4JAU A;  1JQ0 A;  1P7B A;  1FFX B;  3E8F A;  3F5W C;  1IBM O;  2QM4 A;  4GUN A;  2AHZ A;  2MW2 B;  5EYP A;  3X2Q C;  4I0X B;  1V55 B;  3X2Q B;  3RGB A;  1GKF A;  1R6N A;  2WLH A;  5IYZ B;  1GTO A;  1M5I A;  2CGN A;  4GX0 A;  3ZRV A;  4FK5 C;  4JV5 O;  4CS3 A;  4DR4 O;  2CGO A;  1R3J C;  4CBC A;  5GW7 A;  4PI0 A;  4DUZ B;  1T5E A;  4U3J B;  4IT5 A;  3CS5 A;  4O4I A;  2QKC A;  2B9Z A;  3VBB A;  2EIM B;  3APQ A;  1OV9 A;  2LFS A;  2ZDI C;  2Y69 B;  3IC7 A;  4G27 B;  3SYC A;  1QLN A;  4N21 A;  1QR9 A;  3E35 A;  1NTZ H;  1G6U A;  5KHI A;  1MOF A;  1SZX A;  3CCR V;  2YEV A;  3OUS A;  2WLI B;  4LF8 B;  1E1Q G;  4GX5 A;  1AIL A;  3ZMT A;  3H01 A;  1X4T A;  3H1J H;  3OGC C;  1EN5 A;  2JJ2 G;  1L0N H;  4PA6 A;  2FKX A;  1KB9 F;  1OCR C;  1OJH A;  3ZHV A;  1VF6 A;  1X59 A;  3CHX A;  4MVU A;  1JOY A;  2YSU B;  2VQF O;  1XQ8 A;  3CCQ V;  3U0Z A;  2EIJ C;  3N2G A;  3C3S A;  4J80 A;  1YJN V;  1P49 A;  4HZ3 A;  5L3E A;  5C93 A;  2ZE5 A;  2XOK G;  1YIT V;  2DJV A;  4JTA B;  2IH1 C;  1WPB A;  3FAV A;  4KUM A;  2LGQ A;  3ASN B;  1MAB G;  1VQO V;  2E5L B;  1N34 O;  5J2T A;  2BTO A;  1WJZ A;  3VOU A;  1IBM B;  4UFZ A;  5IWA O;  1R6K A;  3W7X A;  4BIO A;  2YIB A;  4TOI A;  3EHB B;  4FPP A;  5EIB D;  4MW8 A;  5BY1 A;  5A2Q N;  3CCU V;  1DGS A;  2C2A A;  3LNM B;  4JV5 B;  1YVW A;  4KFM A;  5IJ0 A;  1G1X B;  1AI7 A;  2Y48 A;  4KHP O;  4B7K A;  1Q3E A;  5LGN A;  4DV7 O;  4DRX B;  4UB6 Z;  4P2Z A;  4DV3 O;  3B2E E;  1YSC A;  5CN0 A;  1SC5 B;  4P9O A;  1MA1 A;  4LNU B;  3OT7 A;  1DF5 A;  1KC8 W;  4IIJ A;  4QPJ A;  1Q90 D;  1TUB B;  2YXY A;  3BFR A;  3OAA G;  3ZRX A;  5J9P C;  4ZBM A;  2QWR B;  1SA0 A;  3W7U A;  5LXT A;  3O65 A;  1OCO C;  3NXS A;  4JYC A;  1YCI A;  5B1A B;  1IDS A;  1MSW D;  1VQ5 V;  5LMU O;  1OCO B;  1ZLZ A;  4A5U B;  1SZT A;  3AG3 C;  4X65 B;  2P5O A;  2YXH A;  1GM9 A;  3AG3 B;  3CCS V;  3T4Z A;  2ZXW C;  3RYH A;  1AR5 A;  4UVA A;  1JVM A;  5JH7 B;  3E83 A;  3N27 A;  1VQK V;  1NS1 A;  2YC0 A;  1K73 W;  4JI6 O;  3QVN A;  1E79 G;  2VQF B;  3M8A A;  4ABM A;  2NR5 A;  1R1B A;  2ZCE A;  1W2B U;  5KAI Z;  3EVK A;  2IH3 C;  3AG2 C;  3ETD A;  4UCO A;  1K5Q A;  2ITC C;  2P06 A;  3SGI A;  2JJ1 G;  5IJ9 A;  3U10 A;  2KSD A;  4DV1 O;  5EC1 C;  5IYC O;  5KHK A;  2DYR C;  5C8Y A;  3T2M A;  2DYR B;  1N34 B;  1BHB A;  1PP9 H;  3ZBH A;  3ZMV A;  1S77 D;  2Z0A A;  1AB3 A;  4WBN A;  2JIZ G;  3W7S A;  4JI3 B;  1LUW A;  2ETN A;  3H1I H;  5IYD O;  5IWA B;  1SRY A;  3ZHQ A;  1AP6 A;  3ZHT A;  1Q82 W;  5CBG A;  1N0J A;  1VF7 A;  3HKD B;  1K33 A;  3DC5 A;  4LFC O;  1S3J A;  5JCO A;  2RJZ A;  4DV6 O;  1CEZ A;  2Q0A A;  3CMA V;  4O2A A;  4X1I A;  5IDJ A;  4KHP B;  3MHS C;  3I5D A;  3KZI Z;  1QCE A;  1AI4 A;  5CA1 A;  4DV7 B;  1ZX3 A;  1V9P A;  4BWA A;  1BT8 A;  3F5T A;  2AZ2 A;  2Q7G A;  1SER A;  4UVB A;  3U11 A;  3JAM N;  4JZ2 A;  5B5E Z;  1CP9 A;  4WFA V;  4YJ3 B;  3K59 A;  1Y67 A;  2KB1 A;  3APO A;  4HYO A;  4ZI7 A;  3B8M A;  1GM7 A;  2QWO B;  1Q5O A;  5KX5 A;  3CCL V;  1FFT B;  5LMU B;  1JPX A;  4AQY O;  2IU3 A;  3UT5 B;  4HAM A;  4UVC A;  5KHG A;  4FZ1 A;  5CBH A;  2XTA A;  3J80 N;  4PDL A;  3OUF A;  2CH7 A;  4PDV A;  3RN4 A;  1Q81 W;  1L0L H;  4JAA A;  3B4S A;  2XHB A;  1HP8 A;  4JGS A;  1B6Q A;  5B1N A;  4JI6 B;  3S3X A;  4QNH B;  1QVG U;  4QPK A;  4WFF A;  3E89 A;  4DR6 O;  2WLJ A;  4PJ0 Z;  1XDC A;  3JD3 A;  3ZHU A;  3RFR A;  1Q8I A;  2P4K A;  1XMQ O;  3OR6 C;  3D36 A;  4IL6 Z;  4BR6 A;  2ZR3 A;  2IJI A;  4YIP A;  1HW7 A;  2ADP A;  1SQP H;  2EIK B;  5JQG B;  4FMT A;  4DXW A;  2UXD O;  1I94 O;  1K4D C;  4ZOL A;  4DV1 B;  4I4T A;  3ZMU A;  1WLE A;  3RYF A;  1S5H C;  1ZWI C;  2HVK C;  4Z1M G;  2BE3 A;  1W59 A;  2EJR A;  2ZKO A;  4I50 A;  2ZNJ A;  4DR3 O;  3FB6 C;  2MK3 A;  3SPH A;  2HFE C;  3D8C A;  1XMO O;  1URF A;  5D5Q A;  4LFC B;  5K1X A;  2RMK B;  2ZIN A;  3LSS A;  1U96 A;  1R3K C;  4DV6 B;  3RYI A;  1H2K A;  2H94 A;  3JAT B;  3B40 A;  4X8A A;  1Z2G A;  2HJD A;  3KCY A;  3MAQ A;  4PI2 A;  1UPG A;  5LP6 A;  4FLU A;  3JAK B;  4MS2 A;  3K5N A;  2M6Y A;  4JTC B;  3RVZ A;  4GKJ O;  3OTO O;  4DR2 O;  4NB5 A;  1IBL O;  4CH4 A;  4J10 A;  1RSO B;  1XUQ A;  5E79 Z;  2JVD A;  1AR1 B;  3CXC U;  4PDM A;  2JDI G;  5DED A;  4R50 A;  1TA8 A;  2QWN B;  2QTO A;  5A9G A;  5LOV B;  4AQY B;  3G71 V;  2DYS C;  4DK1 A;  1RP3 B;  1NTK H;  3CX5 F;  3QNE A;  1H2L A;  3BCC H;  3TXS A;  1WNS A;  4GZR B;  2UUA O;  5D5P A;  4B7E A;  2WLL B;  4MW3 A;  3H1K H;  2Q6A A;  4X1K B;  1OCC B;  5CA0 B;  2ARH A;  4JZG A;  1NTM H;  5FL7 G;  3SJC C;  3EFF K;  4UXN A;  1PL0 A;  3ZCC A;  4YY3 O;  3VQY A;  4CH6 A;  3ZX6 A;  3RT3 C;  2HP8 A;  2KQX A;  2OIG A;  3K0D A;  1FXV A;  1M56 C;  3UQ8 A;  1JFF B;  4FM1 A;  4X64 O;  2ZT9 B;  4O4H A;  3DXR B;  4LF9 O;  5H9C A;  1VMG A;  1OCZ C;  1FXK A;  2WLM A;  3ZMS A;  3CCE V;  1XMQ B;  4OPA A;  1E1R G;  1YI2 V;  4UCV A;  2P4V A;  3CJH A;  5LBQ A;  2CDY A;  1K4C C;  1BSM A;  4UCT A;  1I5X A;  2EJ7 A;  4TV9 B;  2P22 C;  4H37 A;  2A06 H;  2UXD B;  2CTP A;  1I94 B;  2HR3 A;  1QVF U;  1ZAU A;  2Q69 A;  3JAR B;  3K3W A;  4FFK A;  3WB0 A;  4X1Y B;  3JAW A;  2F23 A;  1JA8 A;  2DMX A;  1Z5V A;  2QA4 V;  2ZE7 A;  4EB6 B;  2E3C A;  2DWE C;  1A32 A;  3JAS B;  2XAG A;  4DR3 B;  3C90 A;  1KKD A;  4JI0 O;  1ZSP A;  3LUT B;  2BSK B;  1XMO B;  1H2G A;  3ASO C;  2VWK A;  4IYI A;  2BTQ A;  1PM9 A;  4I9Q A;  3JD4 A;  3T1Y O;  1AJP A;  4X62 O;  3FB7 C;  4R8C A;  2ZM6 O;  2JGD A;  3ABL C;  3G67 A;  1K97 A;  4JI4 O;  1ARO P;  1PL4 A;  3BAA A;  2JEX A;  4I55 A;  2M7W A;  5EYP B;  4PV1 B;  2NLJ C;  1I7F A;  5ITZ A;  4GKJ B;  4DR2 B;  1XL6 A;  1YZB A;  2QWP B;  2RQ6 A;  3N2K B;  4LWS B;  1IBL B;  2YIA A;  1K5S A;  5KHJ A;  2GTS A;  3B8N A;  3ZIA G;  1SQV H;  3AG1 B;  3CCM V;  2F4V B;  1WB8 A;  5CB4 A;  1DK1 A;  4FLV A;  2GHY A;  3ML0 A;  1AJQ A;  4LF5 O;  4UB8 Z;  3L73 H;  4FLT A;  3F7Y C;  2GUZ A;  2ODM A;  4OGQ B;  2UUA B;  3BPZ A;  3I56 V;  4PA4 A;  2UU9 O;  4EFB A;  4PHZ A;  4JAV A;  1KMI Z;  3AG4 C;  2Q7E A;  4K0K O;  1NZ6 A;  4YY3 B;  3LDC A;  3I55 V;  5LYJ B;  3VQX A;  2HLD G;  1IX9 A;  3FYI B;  1QU7 A;  1D2D A;  4NYK A;  4X64 B;  1BE3 H;  3ZED A;  4LF9 B;  1KYO F;  2OCC C;  1S5J A;  4NTY A;  3WB1 A;  2E76 B;  2WAM A;  4LF6 B;  4IHJ B;  4GT1 A;  4TSF G;  5KUK A;  5EBW C;  1VF6 C;  3P3N A;  1GK9 A;  2Y4U A;  1F51 A;  3L72 H;  4BIU A;  2UXN A;  1DLB A;  1XRE A;  3ZRW A;  3K0G A;  4TV8 A;  4E2L A;  2VQE O;  3LDE A;  1IXB A;  1BQ0 A;  1VQ4 V;  1WB7 A;  4JI0 B;  4DR1 O;  1FFX A;  4U7O A;  1KKC A;  5FPO A;  3T1Y B;  1UFI A;  3JCZ A;  2K1E A;  4I0X A;  1Y66 A;  4X62 B;  1VAR A;  1VQN V;  5IE9 A;  3HPL C;  3JAL B;  2ZM6 B;  5FLX N;  2LW1 A;  3JSN A;  5IYZ A;  4JI4 B;  3CC4 V;  2R70 A;  1OCR B;  5J2T B;  4J11 A;  4AIL C;  2X6A A;  4MVM A;  4YIO A;  5KUM A;  4DO2 A;  1M57 C;  4U3J A;  3A0H Z;  1H2S B;  2EIJ B;  4G28 B;  2X6C A;  1XEQ A;  1PNM A;  4PA9 A;  3BAB A;  4JI1 O;  4O2B B;  3QG5 A;  2OTJ V;  1RPR A;  1KD1 W;  3T4D A;  1TVK B;  1L8D A;  2LW7 A;  1L1F A;  3B09 A;  3SYQ A;  4DK0 A;  5L3C A;  4DUY O;  4L87 A;  4DV5 O;  5JJJ B;  4WFG A;  1EM1 A;  3IFX A;  1EZJ A;  2DWD C;  2IBZ H;  1N32 O;  2WLI A;  3OGI B;  2UU9 B;  5GON B;  4K0K B;  1BL8 A;  2Q67 A;  3H1L H;  5F2V O;  2GDS A;  3FX7 A;  2FYU H;  5HFL A;  3JYC A;  3SYO A;  3FB5 C;  4LP8 A;  1FKA O;  1NR1 A;  1P7G A;  1V54 C;  1YHQ V;  4DR4 B;  4J9Y B;  3BVO A;  1H2N A;  1K3E A;  2KKW A;  2PZS A;  1GAX A;  2FL4 A;  4FLY A;  4JAS A;  3IAY A;  1NVP D;  3HKB B;  2F43 G;  1TAE A;  2H3O A;  4OXS A;  2Y4T A;  2QKS A;  1MZF A;  1PV0 A;  1NU1 H;  3UKM A;  5LA6 B;  3A2F A;  4JI7 O;  4UUJ C;  1OZ0 A;  1NH2 D;  1QR8 A;  4J9Z B;  1G8M A;  2OYQ A;  3JD2 A;  1ENV A;  2KG7 B;  1NT2 B;  4P9P A;  4WFH A;  1F7Y A;  4B3T O;  3K5L A;  2R9A A;  2OT5 A;  2YID A;  3ZN1 A;  1HDJ A;  3ABM C;  4ZHQ B;  3ABT A;  3ABM B;  3SPG A;  1VQP V;  4DR1 B;  2EIL C;  1H2M A;  2N04 A;  3IC9 A;  1CPY A;  4QGP A;  2EIL B;  2ZXW B;  3HKE B;  3B77 A;  2ZD9 A;  4YJ2 B;  1ROP A;  4MTF A;  4JI8 O;  2UXX A;  4KP4 A;  3MHH C;  2RNB A;  1D5N A;  4U7N A;  3UO2 A;  3Q4H B;  3P3P A;  3ZHR A;  4Z1V A;  3OR7 C;  3CRA A;  4JYA O;  1BGY H;  3KG2 A;  4DRX A;  1DF4 A;  5JCO C;  3FYE B;  2HHH O;  3AG2 B;  3ZJZ A;  4EEQ A;  3UCS C;  1Y74 B;  4D6T H;  4WF9 V;  2F93 B;  4JI1 B;  3CCJ V;  4LNU A;  5JJE B;  1F23 A;  1JJO A;  1K92 A;  1NBM G;  3HKC B;  3OM3 B;  1TUB A;  1JMK C;  3ZMZ A;  4DUY B;  4DV5 B;  1NI8 A;  5B1B C;  4RAI A;  3C3T A;  2DN9 A;  2XAS A;  1AP5 A;  5B1B B;  4DR5 O;  2B5U A;  1FPO A;  3AK3 A;  4NKG B;  3OW2 U;  3K9A A;  2QWQ B;  3R65 A;  3SDL A;  1N32 B;  1EZV H;  1BS3 A;  4FM2 A;  2UUC O;  4TWK A;  1KEC A;  5IT9 N;  5JJN B;  5KX5 B;  4CH3 A;  3SYP A;  5JH7 A;  1YF2 A;  1RPO A;  3W7W A;  3E2E A;  4GX1 A;  1UJW B;  1VQM V;  2ZQM A;  2CK3 G;  1NVP B;  2E75 B;  4O4L B;  5L3F A;  2EBO A;  2ZNI A;  3JD1 A;  1EN6 A;  5IY5 C;  3FFQ A;  4I7Z B;  3CCV V;  2A3Q A;  1SQX H;  4NTX A;  2Z5U A;  4DV3 B;  1VQ9 V;  2EIN C;  1NH2 B;  5FPR A;  2ZE6 A;  2Q68 A;  1XBL A;  4MVZ A;  5H2F Z;  4AI8 A;  3PN1 A;  4JI7 B;  1XL4 A;  5KLV H;  2XAH A;  4J42 A;  3D36 C;  3CSX A;  4B3T B;  4NR1 A;  4LF4 O;  3FB8 C;  3EXA A;  5KA6 A;  1ZL8 B;  1MG1 A;  4MVS A;  1Y6X A;  4XBF A;  1GRJ A;  3SPC A;  1VF5 B;  2W6J G;  1LR1 A;  1YJ9 V;  5TIS Z;  3ETG A;  4TUY B;  1WP7 A;  3A0R A;  4K3A A;  1RM1 C;  1J5E O;  4BW5 A;  1RM1 B;  3HKD A;  5BR8 O;  3E22 B;  4JI8 B;  1B3Q A;  3LDD A;  2Q9L A;  4FFB B;  5H6Q A;  3SYA A;  4DV0 O;  1EBO A;  3CE2 A;  4RUF A;  2PI4 A;  4JYA B;  1AJN A;  2GV9 A;  1P84 F;  1ZTE A;  2JEU A;  2HHH B;  2OCH A;  5L3G A;  3ZHS A;  2W0F C;  2PY5 A;  3MD0 A;  1QLE C;  4FLW A;  1Z5W A;  4YJ3 A;  4HNA B;  5LP6 C;  1VEW A;  1IBK O;  3L70 H;  4ZIB A;  5LHI A;  2ILM A;  1EN4 A;  4DR5 B;  3A8T A;  3K57 A;  4XDJ A;  5KMG B;  4PA3 A;  3UT5 A;  2UUC B;  5DM6 V;  1M93 A;  2IJJ A;  4CC5 A;  1Q7Y W;  3S3W A;  1QNM A;  4MTX A;  5EZY B;  1KP3 A;  4J41 A;  2YXL A;  4H13 B;  5FNV B;  3RYC B;  5LHH A;  1M1K W;  1QHT A;  1KQS U;  2F66 C;  2WA3 A;  4Q6G A;  5KHH A;  4QE7 A;  4QE9 A;  5BMV B;  1IVS A;  4EFE A;  3AK2 A;  3E8G A;  1SS3 A;  3IGA C;  1PNK A;  4MVO A;  5JQG A;  2F95 B;  1FXK C;  1YXB A;  1FXK B;  3DGE A;  1K7D A;  4I9W A;  4LF4 B;  4WFB V;  5J2U B;  1Q6H A;  2WLN A;  2Q0O C;  4JF3 A;  3TXQ A;  3DSQ A;  1SQG A;  2DYS B;  2V7Q G;  3KKY A;  2ADQ B;  1XHZ A;  3CME V;  1IXM A;  4F4L A;  4K8X A;  2ZR2 A;  1SQQ H;  3WG7 C;  2G38 A;  2B1G A;  4W4L A;  3WG7 B;  4H33 A;  2ZE8 A;  2A9H A;  4RWU A;  5BR8 B;  1N4C A;  5H5N A;  2PYJ A;  1FJG O;  2Q4P A;  2W6I G;  4J7K A;  3STZ C;  2R72 A;  5EBL C;  3CRC A;  1M56 B;  3JAT A;  4DV0 B;  4DR6 B;  2JGU A;  1GM8 A;  3STL C;  1OCZ B;  5B3S C;  3JAK A;  1YDX A;  3G6E V;  5IYB O;  1Q43 A;  4L8J A;  4B3R O;  4XDL A;  1RSO A;  2A79 B;  1I0H A;  1VIB A;  5JVD B;  3FD9 A;  4D7S A;  1IBK B;  4LF7 O;  5B66 Z;  3L71 H;  2K9P A;  3VQV A;  1S0V A;  4GYC B;  3WB2 A;  5AG2 A;  4X20 B;  4X66 O;  3BHP A; 
#chains in the Genus database with same CATH homology
 1QLE B;  2V1D A;  2OTL V;  3E83 A;  4WCE V;  1N8R W;  5LGT A;  1VQK V;  4U7O A;  5BZB A;  3JCZ A;  2K1E A;  1K73 W;  2WWW A;  1Y66 A;  1VQN V;  3HPL C;  3K79 A;  1E79 G;  3CC2 V;  2EIK C;  3GB7 C;  3SPJ A;  2WLL A;  3CC4 V;  1OCR B;  3ASO B;  1W2B U;  4X88 A;  2IH3 C;  3AG2 C;  1P4R A;  3ETD A;  3ZRS A;  2X6A A;  1ORQ C;  3AEI A;  3OEE G;  2XAF A;  4MVM A;  2GSM B;  2XAJ A;  1K5Q A;  2ITC C;  3RW0 A;  3ABL B;  5KUM A;  4R7C A;  4DO2 A;  1M57 C;  4RQE A;  3ABU A;  1W0J G;  4PEL A;  2JJ1 G;  2EIJ B;  1NJI W;  4G28 B;  2X6C A;  3F7V C;  1PNM A;  4PA9 A;  2LP7 A;  5EC1 C;  2OTJ V;  1RPR A;  3CP1 A;  5IYC O;  1KD1 W;  3D3I A;  2DYR C;  3T2M A;  3T4D A;  2P90 A;  4WFE A;  1L1F A;  1K9M W;  2DYR B;  3SYQ A;  4MT8 A;  5L3C A;  1BHB A;  3ZMV A;  4L87 A;  1S77 D;  4WFG A;  2JIZ G;  3W7S A;  1SES A;  2EZP A;  5IYD O;  1SRY A;  3IFX A;  3CD6 V;  2NNU A;  1Y4M A;  5DN6 G;  1EZJ A;  2DWD C;  5L3D A;  1Q82 W;  3K06 A;  5CBG A;  2BOC C;  2WSS G;  2WLI A;  2XAQ A;  1K33 A;  1S3J A;  1BL8 A;  2Q67 A;  2D3O W;  1VQ6 V;  1CEZ A;  1R3L C;  3CMA V;  1GO3 F;  5HFL A;  3RBZ A;  3JYC A;  5IDJ A;  1PKX A;  3MHS C;  3SYO A;  5EC2 C;  1QCE A;  1AI4 A;  3FB5 C;  3OFN G;  4LP8 A;  3ZRW B;  1NR1 A;  3AG4 B;  1V54 C;  1YHQ V;  2AHY A;  4J9Y B;  1K3E A;  2IU0 A;  4EKW A;  1SER A;  4UVB A;  2ITD C;  1PNL A;  2Z3Y A;  4QJF B;  2R9R B;  2X0L A;  1NKD A;  3ABK C;  3DTU B;  4JAS A;  1S72 V;  1CP9 A;  1NVP D;  2YEV B;  4WFA V;  3ABK B;  2F43 G;  3E8H A;  1HWY A;  3ETE A;  4MSW C;  2KB1 A;  4HYO A;  2OCC B;  4OXS A;  3B8M A;  1GM7 A;  3P32 A;  3CCL V;  1FS0 G;  1S76 D;  1GMG A;  1FFT B;  2QKS A;  1V55 C;  1COW G;  5L3B A;  4UV8 A;  2P7T C;  3UKM A;  3FKS G;  1YTF B;  1JPX A;  4UUJ C;  2IU3 A;  1OZ0 A;  1NH2 D;  3HB3 B;  1OCC C;  1QR8 A;  4J9Z B;  1G8M A;  2QM7 A;  3JD2 A;  1ENV A;  1H8H G;  4P9P A;  5B3S B;  4WFH A;  4HAM A;  4UVC A;  2OT5 A;  4QIW F;  4JYB A;  3ZN1 A;  5CBH A;  3ABM C;  1SET A;  1WPX A;  4PDL A;  3ABT A;  3OUF A;  5LGU A;  3QO7 A;  1FXH A;  2A0L A;  3ABM B;  4PDV A;  3SPG A;  1Q81 W;  2JK5 C;  2QM8 A;  1VQP V;  2EIL C;  1YTF D;  1CPY A;  2EIL B;  5LHG A;  1LNQ A;  2ZXW B;  4JGS A;  2B1I A;  5EBM C;  1B6Q A;  2EIM C;  5B1N A;  3B77 A;  4QNH B;  5CMU A;  1QVG U;  4QPK A;  4WFF A;  3E89 A;  2Y69 C;  2ZD9 A;  2WLJ A;  1ROP A;  4MTF A;  3JD3 A;  2UXX A;  4BAY A;  3OR6 C;  4KP4 A;  3MHH C;  4XDK A;  3D36 A;  4U7N A;  3LSQ A;  2IJH A;  2ZR3 A;  2IJI A;  3RVY A;  3CYO A;  4MTO A;  4MVR A;  2EIK B;  3OR7 C;  1VQ7 V;  4PDR A;  4MTG A;  4FMT A;  4DXW A;  3KG2 A;  1DF4 A;  1K34 A;  3FYE B;  3T1C A;  1K4D C;  3AG2 B;  3ZJZ A;  3TET A;  3WFV A;  2QE7 G;  1JJ2 U;  1NQT A;  4WF9 V;  4R6Z A;  3ZMU A;  3CCJ V;  1WLE A;  1F23 A;  2HKO A;  1S5H C;  1ZWI C;  2FTK A;  1H8E G;  1K92 A;  2DW4 A;  1AI5 A;  1G4Y B;  1M57 B;  1NBM G;  3OM3 B;  3P30 A;  4FJC C;  2HVK C;  4Z1M G;  1VQ8 V;  1R3I C;  3ZMZ A;  5B1O A;  2EJR A;  4GX2 A;  3TCU A;  5B1B C;  4RAI A;  3JD0 A;  2XAS A;  3FB6 C;  2MK3 A;  5B1B B;  3E86 A;  3SPH A;  2B5U A;  4FIP C;  2HFE C;  1DTO A;  3OW2 U;  2P67 A;  3K9A A;  1EFR G;  1NR7 A;  2H8P C;  2ZDI A;  3R65 A;  4G2K A;  4LBE C;  4TT3 G;  2DQ3 A;  3LSS A;  3K03 A;  5E1A C;  5KA5 A;  2IW5 A;  1BMF G;  3BEH A;  4TWK A;  1VQL V;  1R3K C;  2EZO A;  1KEC A;  4LCU C;  2X6B A;  4JPR A;  3BY6 A;  2P6J A;  4YXW G;  3SYP A;  4CZZ A;  2R9I A;  1RPO A;  2H94 A;  3W7W A;  3CC7 V;  4X8A A;  3E2E A;  2ATK C;  4GX1 A;  1UJW B;  1VQM V;  2ZQM A;  2CK3 G;  4UV9 A;  1NVP B;  1R73 A;  4MS2 A;  3AG1 C;  5CA3 A;  5EK0 A;  4JTC B;  5L3F A;  2EBO A;  3QO5 A;  3ASN C;  3RVZ A;  3JD1 A;  3SJQ C;  4N23 A;  4LC1 A;  3ZN0 A;  5IY5 C;  3OEH G;  3PJS K;  3CCV V;  1V54 B;  1KP2 A;  2HG5 C;  4ASU G;  1AI6 A;  2Z5U A;  1AR1 B;  3CXC U;  1VQ9 V;  4PDM A;  2JDI G;  2EIN C;  1NH2 B;  1THZ A;  2Q68 A;  4R50 A;  4JTD B;  4MVZ A;  2QTO A;  1JCH A;  3UM7 A;  4JAU A;  3G71 V;  1XL4 A;  1JQ0 A;  1QBZ A;  2DYS C;  2LFR A;  3OE7 G;  2XAH A;  1P7B A;  4P30 A;  2QEX V;  3E8F A;  3F5W C;  2AHZ A;  3QNE A;  3X2Q C;  1V55 B;  3X2Q B;  1F4N A;  3FB8 C;  1GKF A;  1R6N A;  5KA6 A;  1MG1 A;  2WLH A;  4MVS A;  2DQ0 A;  1GTO A;  2WLL B;  4MW3 A;  4XBF A;  2Q6A A;  4GX0 A;  1Q86 W;  1BHA A;  1OCC B;  2WLK A;  3SPC A;  5FL7 G;  3ZCC A;  3ZRV A;  3EFF K;  4UXN A;  1PL0 A;  2W6J G;  1YJ9 V;  4FK5 C;  3SPI A;  3ETG A;  4Q20 A;  1R3J C;  5H6R A;  4CBC A;  3A0R A;  5GW7 A;  3K0D A;  1FXV A;  4PA7 A;  1RM1 C;  1M56 C;  4BW5 A;  1RM1 B;  1PD3 A;  1F4M A;  5H9C A;  1OCZ C;  1FXK A;  3CPW U;  2WLM A;  3ZMS A;  3LDD A;  3CCE V;  3G4S V;  5H6Q A;  3SYA A;  1E1R G;  1YI2 V;  5B1A C;  4RO2 A;  3VBB A;  5LBQ A;  2EIM B;  1K4C C;  1EBO A;  2ZDI C;  2Y69 B;  2LFS A;  1I5X A;  2X7R B;  3IC7 A;  4G27 B;  3SYC A;  4RUF A;  3QO8 A;  2PI4 A;  1AJN A;  1M90 W;  1QLN A;  4H37 A;  2JEU A;  4N21 A;  1QR9 A;  3E35 A;  2HR3 A;  1QVF U;  2Q69 A;  5L3G A;  2W0F C;  2IJK A;  3K3W A;  1MOF A;  3MD0 A;  3CCR V;  1K8A W;  1QLE C;  2YEV A;  3OUS A;  3GWO A;  2WLI B;  2HJF C;  2QA4 V;  1E1Q G;  4GX5 A;  2DWE C;  1M9N A;  3ZMT A;  3H01 A;  5LHI A;  2XAG A;  4BIZ A;  3OGC C;  2JJ2 G;  1KKD A;  4XDJ A;  3LUT B;  4PA6 A;  1OCR C;  1H2G A;  3ASO C;  4PA3 A;  5DM6 V;  2IJJ A;  4MVU A;  1JOY A;  3JD4 A;  3OMA B;  1AJP A;  2YSU B;  1Q7Y W;  4R8C A;  3ABL C;  1J95 A;  3CCQ V;  1K97 A;  1ARO P;  4MTX A;  2EIJ C;  5CBF A;  2PI5 A;  2XND G;  1KP3 A;  1TUE B;  2JEX A;  2M7W A;  5HFM A;  1YJN V;  4X89 A;  2NLJ C;  4GCZ A;  1XL6 A;  5LHH A;  1M1K W;  3K08 A;  4HZ3 A;  1K5S A;  5L3E A;  5C93 A;  1KQS U;  2XOK G;  3E8B A;  1YIT V;  3B8N A;  4JTA B;  3ZIA G;  2IH1 C;  3AG1 B;  4KUM A;  4QE7 A;  3CCM V;  4QE9 A;  3ASN B;  1MAB G;  1VQO V;  1H38 A;  3OMI B;  1OHH G;  5IY5 B;  3E8G A;  1W0K G;  3IGA C;  1PNK A;  4MVO A;  2GHY A;  3ML0 A;  1AJQ A;  1FXK C;  3VOU A;  1FXK B;  3DGE A;  3F7Y C;  2EIN B;  3TK1 A;  1K7D A;  4I9W A;  4WFB V;  1R6K A;  2BOB C;  2WLN A;  4JF3 A;  4RQF A;  3W7X A;  3I56 V;  4PA4 A;  3EHB B;  4FPP A;  4JAV A;  4MW8 A;  2DYS B;  3AG4 C;  2V7Q G;  4I5S A;  1I5Y A;  3CCU V;  2C2A A;  3LNM B;  3LDC A;  3I55 V;  3CME V;  1IXM A;  3OMN B;  4F4L A;  2HLD G;  4KFM A;  4ZKI A;  1AI7 A;  2ZR2 A;  2Y48 A;  3WG7 C;  1YJW V;  3FYI B;  2B1G A;  5LGN A;  3WG7 B;  4H33 A;  2A9H A;  4RUE A;  2OCC C;  2WPD G;  2WAM A;  4P2Z A;  2W6I G;  1YSC A;  5CN0 A;  4P9O A;  4GT1 A;  3STZ C;  5EBL C;  1M56 B;  1DF5 A;  1GM8 A;  2HVJ C;  4TSF G;  1JX9 A;  1KC8 W;  3STL C;  3W7T A;  1YIJ V;  5KUK A;  5EBW C;  4QPJ A;  1OCZ B;  3K04 A;  3OAA G;  3ZRX A;  1GK9 A;  4ZBM A;  5J9P C;  5B3S C;  1F51 A;  4MVQ A;  4BIU A;  3W7U A;  2UXN A;  3G6E V;  5IYB O;  1OCO C;  3NXS A;  4JYC A;  5B1A B;  1MSW D;  1VQ5 V;  1DLB A;  1OCO B;  3ZRW A;  1SZT A;  3K0G A;  3AG3 C;  4XDL A;  2A79 B;  1GM9 A;  3AG3 B;  3M99 B;  4E2L A;  3CCS V;  3T4Z A;  2ZXW C;  1S0V A;  3LDE A;  4UVA A;  1JVM A;  1VQ4 V;  3FB7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...