4X89A

Navms voltage-gated sodium channal pore and c-terminal domain soaked with silver nitrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x89A00
3E83A 1OCRC 2AHZA 4PDLA 4X89A 1J95A 3E8HA 4WFHA 2K1EA 3RVZA 3UM7A 3SYQA 2A0LA 4OXSA 4DXWA 5KUMA 2ZD9A 3STLC 2DYSC 3TETA 2ITDC 4P30A 4MTOA 4QE7A 2IH1C 4MVRA 2HFEC 5EC2C 2BOCC 1R3IC 2EILC 3K04A 3ZRSA 5BZBA 3T1CA 4P9PA 2DWEC 1ZWIC 3VOUA 2A79B 4F4LA 3AG4C 1JVMA 4WFGA 4X8AA 4LBEC 3E8FA 4GX5A 3OUFA 4GX2A 4PA4A 4HZ3A 3FB7C 4HYOA 2WLLB 4MVUA 4PA9A 1R3JC 1OCCC 4RUEA 2H8PC 1G4YB 2ZXWC 4MS2A 2WLLA 4PA3A 4PDRA 2EIKC 3LDDA 1ORQC 4EKWA 3GB7C 4MVOA 1K4DC 4RAIA 1S5HC 2W0FC 2BOBC 3KG2A 4MVSA 4KFMA 5E1AC 3AG2C 4R6ZA 2WLHA 5IY5C 3SPGA 1LNQA 5B1BC 2ATKC 3E8GA 3LDCA 5KUKA 2HG5C 1OCZC 4J9ZB 3T4ZA 3AG3C 3HPLC 3ASNC 2Q69A 1R3KC 2Q67A 4RUFA 4RO2A 2HVJC 2YEVA 3SYCA 3E89A 3K0GA 2JK5C 4WFEA 3ZJZA 1KKDA 3RW0A 3K0DA 3K08A 3PJSK 4MTFA 3WG7C 3UKMA 3T4DA 4QNHB 2ITCC 3K06A 1QLEC 5EK0A 5EBMC 2DWDC 3SYOA 4UUJC 4MVMA 1V54C 2X6AA 4G28B 1P7BA 4MVQA 4TWKA 3EFFK 2IH3C 2WLJA 3LDEA 4PA7A 5EBLC 4GX0A 1XL6A 5CBFA 3LNMB 4R8CA 1M57C 2EIJC 1BL8A 3F7YC 4MTGA 4P9OA 3ABKC 3RVYA 1R3LC 3SYPA 3FB8C 2X6BA 4JTDB 1M56C 3F7VC 3R65A 2Y69C 3SJQC 2WLKA 1OCOC 2OCCC 3TCUA 5CBHA 4JTAB 3FB6C 3X2QC 3SPHA 5J9PC 3F5WC 4ZBMA 5CBGA 4MW3A 4H33A 2WLNA 2WLMA 3ABMC 3FB5C 3OGCC 1V55C 4P2ZA 3BEHA 4H37A 4JTCB 3ASOC 4LP8A 3IGAC 4X88A 3SPJA 3STZC 4WFFA 2Q6AA 4I9WA 4PA6A 2A9HA 2HJFC 4BW5A 3OR6C 4R50A 5EBWC 2DYRC 2EIMC 3LUTB 3ABLC 3SPIA 2WLIB 3RBZA 3E86A 4CBCA 1XL4A 2HVKC 2NLJC 4XDLA 2AHYA 3K03A 4XDKA 4GX1A 3AG1C 1K4CC 5B3SC 4LCUC 5B1AC 3IFXA 2WLIA 2EINC 2X6CA 3E8BA 3JYCA 4MW8A 4MVZA 3SPCA 3T2MA 4QE9A 3OR7C 3OUSA 4PDVA 4G27B 4PDMA 2R9RB 4J9YB 4MSWC 5EC1C 4R7CA 2Q68A 3SYAA 2KB1A 4XDJA 2QTOA 2QKSA 2P7TC
chains in the Genus database with same CATH superfamily
1X59A 1YEWA 3UM7A 3L9DA 3MD0A 2Y0IA 5H5NA 2A0LA 2EBOA 1I94O 5KMGA 4JI8B 1AP6A 2HFEC 3KCYA 4DV5O 2CE4A 4LH7A 2Q7EA 2UXDB 3ZRSA 4GLXA 4QPJA 1X4TA 2H94A 3D3QA 3OUFA 4B7KA 4IHJB 1QU7A 2HJDA 2PGGA 3B77A 1G4YB 2UXBB 3CCJV 1MABG 4FMTA 2LGWA 4MVOA 2LO1A 5CB4B 2QWOB 2JGDB 1AI5A 1H8EG 5KUKA 4K8XA 1US6A 3T4ZA 4JI8O 3QG5A 2UXDO 4UCUA 2UXNA 4O2BA 3N2GA 4UCTA 5GTHZ 1PP9H 3UKMA 1P7GA 1WN7A 3B2EE 4QNHB 4UUJC 5L3DA 2UXBO 1O9HA 3CEIA 1Z5WA 4LF6B 5LL6Y 5JH7A 5AG2A 2XAGA 3SYPA 2PUSA 2QM4A 3R65A 3AG2B 5H9CA 3MDSA 4LNUB 4DR3B 2RDCA 1I5YA 2IJHA 3ABMC 3FB5C 2YIBA 1B3QA 3ETEA 3IGAC 1K73W 3SJAC 2ZDIA 1HP8A 5B1OA 3I55V 5E79Z 4IIJA 1ZTEA 2CTWA 2DYRC 1MZEA 4LF6O 3QNEA 3QO5A 3APQA 3G4SV 5L3EA 2X0LA 3JYCA 5FNVB 3T2MA 1SQQH 4DR3O 3JAKA 2PTMA 2RQ6A 4NB5A 3M8AA 2ILMA 2QTOA 5B5EZ 3OAAG 4DRXB 3UO3A 2XUMA 4EB6B 2LFSA 1S77D 4MTOA 1MSDA 4NTYA 2DYSB 4J80A 4JI0B 1R6TA 1XBLA 2DWEC 1ZWIC 1Q6IA 4UB8Z 5KX5B 4TV8B 4HZ3A 5B3SB 1EFRG 1QR8A 5FNVA 3RYIB 5LYJA 2ZXWC 1R1BA 3UQ8A 1S0VA 3IAYA 4YHHB 3L74H 3KG2A 1GK9A 2F1MA 2IJKA 2ZKOA 1K3EA 2QM8A 2Q9LA 4LF4B 4J9ZB 4EB6A 4JI1B 2Q67A 4FM2A 4JZGA 4JI0O 3T1HB 4JI6B 2XAFA 2EILB 2JK5C 1S76D 1R6KA 5GONA 3JD0A 2AZ2A 3FAVB 4TV8A 4K0KB 3TXQA 4EFBA 5A9GA 4YHHO 3A2FA 5DN6G 2KSDA 4F6RB 1DF4A 3F7VC 1AI4A 5A2QN 3KKYA 4LF4O 1AJPA 1QVFU 4JI1O 2QWNB 3SPHA 4ZBMA 5CBGA 3T1HO 2B1GA 4JI6O 1TGOA 4CH6A 1P4RA 4C7UA 2ZNIA 4FM1A 1PPJH 2XAHA 1K9MW 4K0KO 2PF4E 1M5IA 4YXWG 2A9HA 2HJFC 3U11A 1TUEB 2EIMC 3G6BA 1GO3F 1K92A 1YHQV 3IFXA 2EINC 3CCLV 4PDVA 4PDMA 3HKCB 1PNMA 1GN3A 2QKSA 3E83A 1OCRC 3S3WA 3CYOA 1XQ8A 4TUYA 4TQFA 1GH6A 1FXKB 2EULA 3FYEB 1Q5OA 3TGUH 3B09A 4JV5B 2WAMA 2YS8A 1QQCA 4ASUG 5EZYA 2JS5A 4D6TH 3CCRV 5KHIA 2WA4A 3E8FA 1OZ0A 1SA0A 4GX2A 3FB7C 3C3SA 5B1AB 1PL0A 4GZRB 4PDRA 2OT5A 3E2EA 2GUZB 1XOUA 3ZX6A 5J2UA 3CPWU 1S5HC 2VWJA 4NXNB 3BA8A 2CAZC 4JV5O 2IBZH 1OCZC 1FXKA 3JAWB 3G80A 4X9QA 2P4KA 1F51A 1PV0A 4UXNA 3RYFA 1QBZA 4RQFA 2JVDA 3K0DA 1YITV 4HNAB 2BTQA 3OFNG 2R9AA 3SYOA 4JYAB 4MVQA 4ZIBA 3U0ZA 2CGNA 4NTXA 2GUZA 3FB8C 4NXNO 3S3XA 2X6BA 4JTDB 2ADQB 2ZIMA 3UCSC 1YI2V 3ZHSA 4OX9B 3FB6C 4CS2A 2IJIA 3OW2U 3OGCC 3W7TA 1PL4A 4DV4B 4P2ZA 5LOVB 2K9PA 3TJTA 3H1KH 4U7NA 3STZC 3WG7B 2CTRA 3ASOB 4JYAO 4HNAA 3DC5A 4KUMA 5EIBC 2FYUH 1R6NA 3SR2C 5BMVA 1VP7A 1VQ9V 1XL4A 5CA0B 4I0XA 1N32B 4OX9O 2LP7A 1SQFA 1MOFA 2E75B 1SC5B 1XMOB 1OCOB 2VWKA 4KL1A 2YUAA 3JD2A 4DV4O 3RYCA 4ZHQB 1J95A 1KU9A 1V55B 4TT3G 4LFBB 4LC1A 1IBKB 2VQFB 4FJCC 4LF5B 4P30A 1AVMA 3CCEV 1FAFA 1SRYA 5J2TB 2ARHA 1JVMA 2QTSA 1XMQB 2F95B 2D3OW 3BHPA 4WBNB 1W2BU 4FFBB 5IE9A 2AZ0A 5CA0A 4PA4A 1N32O 3FX7A 2FL4A 5K1XA 4UCVA 1DGSA 4L87A 1G1XB 4DV1B 1XMOO 4ZOLA 1K4DC 2L35A 3HB3B 2V7QG 1IXBA 3ZMTA 2FKXA 1Y74A 4LFBO 1I08A 2QWPB 1IBKO 2WLHA 2VQFO 4BIUA 1CPYA 2CTQA 4LF5O 2DQ0A 2Z5UA 4DV7B 1CP9A 3HPLC 3TK1A 3H01A 4JGSA 4X1IB 2HVJC 1Q8IA 1XEQA 1XMQO 1ROPA 5KAFZ 2WA3A 5LP6A 3ZIAG 1L0NH 3K06A 4DV1O 1V54C 5K1PA 4Q6GA 2IU0A 1H8HG 4PELA 5GW7A 2EIJB 3JD3A 4FVMA 1EZVH 5LA6A 4DV7O 1VIBA 5JCOC 4H33A 5HFMA 1ZL8B 3NR7A 4GUNA 2ZE8A 1RPRA 3RT3C 3CRRA 3GWKC 5IYDO 4I4TA 5LMNB 2W6JG 3BABA 1YJNV 3ZEDA 4CH4A 1LUVA 1EN5A 1SQBH 1W0JG 4TOIA 1WLEA 3CS5A 2ETNA 4NR1A 3RWRD 4MVZA 3JALA 3SJBC 1TUBB 1PNLA 2GHYA 5EC1C 1FXHA 4NXMB 2KB1A 4ZI7A 2R70A 4YJ2B 1N0JA 1S5LZ 2ZQMA 3ETGA 1IBLB 2L6LA 2XOKG 3JASA 2QKCA 3SYQA 3ICXA 2RMKB 1NTKH 5KUMA 3ZMSA 5LMNO 2UXCB 4WFAV 2IH1C 2A3QA 3W7XA 1XILA 4P9PA 1NVPB 3ABLB 1H2MA 2YIDA 3DXRB 1RFYA 2WLLB 2JEXA 1SERA 4I55A 3JD4A 4FM0A 4NXMO 2VS0A 1SQPH 4GT1A 1SS3A 3ZRWB 1IBLO 5E1AC 4CC5A 2BOBC 1H2GA 5IY5C 4Q20A 4GCZA 4LWSA 2UXCO 3AG3C 1F4MA 1KKCA 3ASNC 3TXSA 4O4HB 1BS3A 4FK5C 4WFEA 4FLUA 5JJJB 1FKAO 3RW0A 3UT5A 3AG4B 4X62B 4Z1VA 1K34A 2ITCC 3K9AA 2BTOA 4O2AB 2W6IG 2MK3A 1I0HA 2NN4A 4PA7A 1OCCB 3LDEA 1NQTA 1IXMA 4P9OA 1Q43A 1JX9A 2P90A 5CBHA 3WB1A 1SF9A 2D2CB 2WLNA 3BEHA 1B6QA 4X62O 4BW5A 2AW9A 3CCSV 2ZR2A 3RN4A 4J41A 3WFVA 4CBCA 3CC2V 2HVKC 5D5QA 3AG1C 2JEUA 3KCXA 2P5OA 2WLIA 4JF3A 3CXHF 3E22B 4JPRA 4PD4F 2RNBA 3L75H 2Y0PA 1N4CA 2VQEB 3ZHUA 1JPXA 2LW1A 1QLNA 1Y6XA 3CMAV 1F4NA 4X89A 3E8HA 2OCHA 5KMGB 1D2DA 1B06A 2XAQA 3T1CA 1FPOA 4X8AA 3QVNA 1JOYA 1QNMA 1JJ2U 1W0KG 1NR7A 4DK1A 2PYJA 1JFFB 4UVAA 2JJ1G 3CC4V 2VQEO 5IDJA 3JATB 2ZXWB 2UUAB 4YY3B 1N36B 1PKXA 1BT8A 2YXLA 2HG5C 3I56V 3K58A 3JSLA 5F2VO 2BSKA 4NVPA 4O2BB 4X64B 3N2GB 5LBQA 2IJJA 4O4LB 4MT8A 1Q86W 2FB5A 3ZJZA 1KKDA 1GN4A 3M99B 2OIGA 3EHBB 5KA5A 3CHXA 2Z0AA 3C90A 1SZTA 2DWDC 5JH7B 4YJ3A 4B3RB 1JFFA 2YXHA 2IW5A 3H1IH 2EIKB 5ITZB 2UUAO 1CXZB 3JATA 1DF5A 3ABKC 4YY3O 1N36O 4FPPA 2Q4PA 1BQZA 1KP2A 1AR4A 4X64O 1K8AW 1Q81W 2FTKA 4O4LA 4IIJB 1PD3A 1EZJA 1Q90D 1VQ5V 1W59A 4B3RO 1HNZB 1DK1A 2WSSG 1ZAUA 3D36C 4XDKA 5ITZA 3JAKB 4DR6B 4UCSA 1SQGA 3J7AU 2YI8A 3D3IA 3IC7A 4J9YB 1OHHG 1RM1B 4LH6A 3P32A 4JASA 2ZIOA 3STLC 4X1KA 3P30A 4QE7A 1KD1W 1HNZO 3K04A 2RCVA 4Z2WA 4HBNA 4DR6O 3K59A 1H38A 5LYJB 3BY6A 4HYOA 2V1DA 2XAJA 1FS0G 4U3JA 3VQXA 1NTZH 1JR9A 4RAIA 4E2LA 3CC7V 3VQVA 5L3GA 3SPGA 1YXBA 3LDCA 2DOSA 3ZMVA 1DLBA 2CTPA 1YVWA 2R72A 2GSMB 3BVOA 5GONB 3CJHB 4D7TA 4JZ2A 3CE2A 1QR9A 1KP3A 4YIPA 5KAIZ 2Q0OC 1IURA 1P7BA 2WWWA 1GM9A 5EBLC 2CDYA 4GX0A 4FLTA 1EM1A 1G6UA 1VQNV 1WB7A 1DTOA 3RYHB 5JJNB 1OV9A 4BR6A 2Y69C 1M9NA 4UB6Z 4B7EA 1YSCA 2PY5A 3HKDA 3OMAB 2PI5A 3CJHA 1H2LA 5TISZ 4IGGA 1K5SA 4J10A 1YTFB 3OR6C 3A0HZ 4KHPB 1VF6C 3RBZA 3JARA 3VQYA 1K4CC 3RYHA 4K3AA 3SPCA 5C93A 1FXVA 2F23A 4DR7B 4NKGB 4FZ0A 4O4JA 2EZPA 1WA8B 2Q68A 4TUYB 4J42A 4OXSA 5FLXN 5EZYB 1QVGU 4KHPO 2Q7GA 5GTIZ 5BZBA 1ZLZA 3EXAA 3VOUA 1SA0B 4U3FH 3PN1A 1GKFA 1NBMG 1Q6HA 1Y76A 1Q82W 1TA8A 2JDIG 5J2UB 3DC6A 3B8NA 3W7WA 4DR7O 4PA3A 3H1HH 1XI1A 4BAYA 5LGNA 1WA8A 2F4VB 3CWBH 3AG2C 1N0NA 1M1KW 2XT9A 1XREA 1FFXA 3UO2A 3RYFB 5CN0A 3HKEA 1URFA 4RUFA 2QDOA 2YEVA 2YIBD 4X66B 2BTQB 1MG1A 3JCUZ 3K9SA 3PJSK 2B9ZA 1QLEC 2XTAA 1ENVA 1M57C 1BCCH 1M90W 2F4VO 3CCUV 1NU1H 3QO8A 1P49A 1I5XA 1M56C 1QCEA 2YDEA 3FKSG 4PI2A 4A5UB 2Q8VA 1S72V 3OTOB 2JRIA 4X66O 2CK3G 2JJ2G 4XBFA 3SPJA 2LJ2A 5BMVB 5EBWC 4LR3A 3K5MA 3O9OA 1AI7A 3A0BZ 4I0XB 1R73A 2B1IA 4AILC 4QJFB 5B3SC 3CCQV 2OTLV 1ZUQA 2ZR3A 1L1FA 3FD9A 4L8JA 3RYCB 2WPDG 3X2QB 3OTOO 3L70H 2W0XA 2P7TC 3EVKA 5JCOA 5IJ0A 2C2AA 1JJOA 4QIWF 1XHXA 4I50B 1KYOF 1L8DA 1GM8A 1VARA 1J5EB 4BWAA 2EILC 1VQ7V 3ZHVA 5DECA 4TV9B 2QA4V 4U7OA 3BCCH 1AROP 3OMNB 4ZOLB 1SQVH 2E5LB 2CH7B 1Y74B 2QSAA 3OEEG 5LMUB 1N34B 5KLVH 4I50A 1J5EO 1TVKB 1NZ6A 5IY5B 1MNGA 2O57A 1FD9A 1R3KC 2OIEA 5IYCO 5LP6B 3CP1A 1HDJA 4B3SB 2P22C 5KHGA 4TV9A 1F7YA 2MW2B 3HR0A 3L73H 3JSNA 3I5DA 1VF7A 2BE3A 2E5LO 2UUBB 4MTXA 3AK2A 1XL6A 4R8CA 4X65B 5LMUO 2CH7A 1N34O 5LA6B 1YTFD 1GN6A 1R3LC 3AG7A 5B1BB 3BRCA 3CRQA 2E3CA 1TVKA 3H9VA 5BY1A 4I4TB 1KUQA 1NI8A 4B3SO 5JQGA 2ZINA 4I5SA 2DN9A 2ODMA 4I9WA 4K8ZA 2UUBO 1KMIZ 3APOA 3BFRA 2EX3A 2X7RB 3H1JH 3LUTB 4AHCA 4X65O 1M93A 3JALB 3P3PA 1VQPV 3MAQA 5B1AC 2GV9A 4IT5A 4I9QA 4ZI7B 4JYCA 3JASB 3ABUA 4PDLA 2N74A 4WFHA 4FZ1A 4DR1B 5IT9N 1MMMA 2KG7B 2QE7G 5H6RA 3GVMA 3ZHTA 1WP7A 4UVBA 1NT2B 1BE3H 4LF7B 2A79B 3DTUB 4I55B 1AI6A 2H3OA 3FYIB 3G6EV 2ZE7A 3K3WA 1SESA 4EEQA 4LWSB 4KFMA 4DR1O 1VQMV 1FJGB 5JJEB 4BW9A 3E8GA 4HAMA 2KG7A 1BHBA 5D5PA 3GWOA 2UUCB 4RO2A 4LF7O 3UT5B 1IZ3A 3K5NA 1E1RG 3E89A 3M7MX 3CB2A 4UV9A 5CA1A 3WG7C 3ZHQA 2DMXA 2XNDG 2DW4A 5LXTB 4MVMA 1Z2GA 2JIZG 3LNMB 1K5QA 1BQ0A 1YF2A 1FJGO 1G8MA 1JA8A 1IBMB 1OCOC 2F66C 2OCCC 1GRJA 2UUCO 1JCHA 4GKKB 1V55C 3Q4HA 5KHJA 3RGBA 4WFFA 1HW7A 3A8TA 4J11A 4LFAB 4X20B 3SGIA 1GMGA 5LXTA 3B4SA 2WLIB 2NLJC 1JMKC 4MW8A 2X6CA 3CXCU 2CUGA 4BIZA 1IBMO 5DM6V 4G27B 2LGQA 3QO7A 4GKKO 3CD6V 2DQ3A 5DEDA 3ZN1A 3ABMB 1BHAA 2Q5ZA 1M4UA 2AHZA 2ZD9A 4LFAO 3BPZA 4DV0B 3OMIB 4X20A 3CSXA 2DYRB 3K57A 4F4LA 1VQKV 3L72H 3OEHG 4WFGA 1I7FA 1XDCA 3LSSA 2Q73A 3D36A 5EYPB 3GB7C 2EJRA 1KECA 1NH2B 2BSKB 2YI9A 4RQEA 4O4IB 3OE7G 4DV0O 4NYKA 4K35A 2P67A 3OM3B 1LUWA 4DR2B 4PHZA 4N23A 4B3TB 2UXXA 3OD4A 4YJ3B 3SYAA 1NR1A 4IL6Z 2GTAA 1GTOA 5BR8B 5EYPA 1BL8A 1SZXA 1L0LH 3WU2Z 4J7ZA 4O4IA 2JGUA 5J9PC 3F5WC 2QJ1A 4UCOA 2Y69B 4OPAA 4DR2O 1H2SB 2GBOA 4B3TO 3CRMA 1WPBA 3ZS8C 1BSMA 2Q6AA 4KXRA 3AK3A 4BIOA 3ABLC 5BR8O 3SPIA 1JQ0A 4LFCB 3K03A 1K97A 1FFTB 5H2FZ 2IU3A 1BGYH 1TAEA 5JVDA 2E76B 5IJ9B 1ZSPA 2R9IA 1PM9A 1WB8A 4JAVA 2ZE5A 4X1KB 4FLWA 3DSQA 1S5JA 2Y4TA 4DXWA 2ITDC 3K5LA 2BOCC 1HR0B 2EIMB 4LFCO 3AG4C 4U3JB 2QGNA 2YIAA 1NVPD 1VF6A 4W4KA 2EINB 1OCCC 4RUEA 4IHJA 4DR4B 2V4DA 5IJ9A 3JCZA 4EKWA 4FLVA 2W0FC 4JI5B 4X1YB 2GDSA 1OCRB 4R6ZA 5CB4A 1XNQB 4FLZA 2JGDA 1YDXA 1HR0O 1AJNA 3O65A 2FMLA 3KZIZ 1IX9A 1SETA 1SQXH 3T4DA 3P3NA 1K33A 2OYQA 1Q3EA 2LQTA 4DK0A 4DR4O 3EFFK 2IH3C 2WLJA 3ZRVA 1QLEB 5CBFA 1YJWV 2AXTZ 3JD1A 4JYYA 1V9PA 3ZN0A 4JI5O 1M57B 4X1YA 1XNQO 1Y66A 1HWYA 2RN9A 4JTAB 3HKDB 1OCZB 1M56B 2WLMA 4LNUA 1RPOA 2HKOA 4CS4A 1NKDA 1VQOV 1BMFG 2HR3A 2LFRA 2NR5A 4JI7B 2Y4UA 3JARB 2EZOA 1UJWB 4QPKA 1SKVA 4IYHA 2AHYA 4LCUC 5KHKA 1VMGA 4O4JB 3OUSA 1BZKA 1D5NA 5JWPA 2N04A 3E35A 3VBBA 3RVZA 3R66A 3HKBB 3WB2A 1NJIW 2BCCH 3TETA 4JI7O 4DRXA 4H0LB 2QM7A 3ZBHA 1NH2D 2IM9A 2B5UA 1F23A 1Y76B 3THOA 4FLXA 4GX5A 1GM7A 1EN4A 1AP5A 1K7DA 2DJVA 5KX5A 4TQDA 4D7SA 3H1LH 4FFKA 4MS2A 2EIKC 2M6YA 3IC9A 2ZNJA 3RYIA 1AJQA 3ZMUA 4DV6B 5IYBO 4MVSA 1OJHA 1FFXB 3HKEB 3HKBA 3IJ4A 5B1NA 2YEVB 3WB0A 2ZDIC 1IVSA 4B3MB 3ETDA 5EBMC 3LSQA 4G28B 4B08A 3FAVA 5LHIA 3A0RA 2P06A 4DV6O 3RVYA 2QKAA 1VEWA 2KKWA 4F6RA 4CZZA 3BAAA 3J80N 1RM1C 4B3MO 2A7WA 2PYLA 1LR1A 4H37A 1EN6A 2YSUB 2PI4A 3ML0A 2M7WA 4RWUA 4G2KA 2Q0AA 1V54B 2LW7A 1THZA 1P84F 1HNWB 1H2KA 4QE9A 3K5OA 4H44B 1VQ6V 2HLDG 3BA9A 5IJ0B 2JS3A 4E4EA 4H13B 3HKCA 2K1EA 1FYJA 1MZFA 3FFQA 5CMUA 1KB9F 2DYSC 1D5AA 5LGUA 4JAUA 4MVRA 5EC2C 1R3IC 2E74B 2ZE6A 3U10A 1YIJV 5LHHA 2UU9B 4LBEC 4DUYB 1HNWO 5LHGA 3LDDA 1UFIA 1ORQC 1WP8A 2ATKC 4KP4A 1VQ4V 3SDLA 4FLYA 4YIOA 1UPGA 4PJ0Z 1QHTA 3SYCA 3T1YB 2CGOA 2A06H 1A32A 1IDSA 3JAWA 3K0GA 4GKJB 4PV1B 2UU9O 4DUYO 3K08A 3ZRXA 5C8YB 3CX5F 3B40A 4JI3B 4TWKA 4LF8B 5L3BA 3CMEV 3DGEA 4LF9B 1GAXA 3F7YC 2Z3YA 1KC8W 3ZCCA 4PI0A 3NXSA 2ZM6B 5FL7G 5JQGB 3AG3B 4JI2B 5KA6A 3ASNB 3T1YO 2OCCB 3G67A 2VRZA 4GKJO 1U97A 1Q6UA 2Q7HA 5IWAB 5LOVA 4OGQB 5C8YA 4PA6A 4JI3O 3B8MA 4LF8O 2ZCEA 3VQWA 3E86A 3JAMN 4LF9O 3L71H 5EIBD 4F6EA 4JI4B 1H2NA 1WNSA 4UFZA 2ZM6O 1PNKA 4J7JA 4JI2O 2R9RB 2OWOA 1FXKC 2DE0X 2EJ7A 5IWAO 3LNNA 4DR5B 4ZHQA 2QWRB 1B04A 4I7ZB 3N2KB 2YC0A 4WCEV 3CCVV 1VF5B 1GN2A 5J2TA 3AG1B 4JI4O 2NNUA 1WJZA 4WBNA 4MVUA 4FFBA 1R3JC 3CCMV 4N21A 4W4LA 2RJZA 2PZSA 1RSOB 1ZX3A 3OGIB 4DR5O 1N33B 5CA3A 4Z1MG 2Q69A 3D8CA 1Y67A 5CA1B 1U96A 4DV3B 4UVCA 4X1IA 3N2KA 4EFEA 4MTFA 1YCIA 5EK0A 4ZKIA 3ZHRA 4DW0A 1AILA 1Y4MA 1AR5A 4WF9V 4MTGA 3ZMZA 1NTMH 3W7SA 1N33O 1RSOA 4DV2B 2WLKA 4ABMA 4J7KA 4DYLA 3Q4HB 3X2QC 5LGTA 3OT7A 4DV3O 3AEIA 4CC6A 4GYCB 4JTCB 1ZL8A 3ASOC 4LP8A 4CS3A 1VQLV 1T5EA 4CH5A 1E1QG 2QWQB 4NTWA 4IYIA 1MSWD 5L3FA 3W7UA 3N27A 1KQSU 2HP8A 3E8BA 2HEPA 4DV2O 1Q7YW 3ABKB 4QGPA 3MHHC 2QR4A 4MSWC 2KQXA 1TUBA 4R7CA 3C3TA 4YJ2A 3ETQA 5LP6C 3LSUA 3F5TA 4DW1A 4UV8A 5L3CA 3RFRA 3K79A 1COWG 1O9GA 4TSFG 3SJCC 4AQYB 1YJ9V 4UCRA 4PA9A 2H8PC 3DXRA 2WLLA 5HFLA 1XNRB 2Y48A 1N8RW 3ABTA 2N05A 4WFBV 2ZT9B 2HHHB 1LNQA 5B1BC 3ZRWA 5FPRA 2XHBA 1E79G 5FPOA 4DUZB 1HNXB 4O4HA 5B66Z 5KHHA 2P4VA 3QF7A 1KBHA 3AK1A 4AQYO 3QTCA 2YXYA 1Z5VA 1AB3A 1XUQA 2X6AA 4OPHA 1XNRO 1AR1B 1VQ8V 1EBOA 4O2AA 2EIJC 2ADPA 5IYZB 3G71V 1CEZA 4AI8A 2HHHO 3SJQC 1NS1A 2QEXV 2OTJV 1YZBA 3TCUA 4JYBA 1WAZA 2GTSA 4FIPC 4MW3A 4DUZO 4CH3A 1HNXO 4X88A 2P6JA 2YICA 2AGAA 2F43G 1RP3B 4DO2A 1I94B 4R50A 3CRAA 1S3JA 1WPXA 4DV5B 2G38A 3J81N 2XASA 3OTFA 2F93B 5BXZA 4XDLA 3MHSC 4GX1A 5JVDB 5IYZA 5H6QA 3CRCA 1XHZA 1MA1A 3OR7C 4ICGA 4JAAA 3E22A 4XDJA
chains in the Genus database with same CATH topology
3E35A 3VBBA 3RVZA 3UM7A 3MD0A 2ZQMA 2C2AA 3ETGA 2XOKG 4QIWF 2A0LA 3SYQA 5KUMA 1NJIW 3ZMSA 3TETA 1GM8A 2EBOA 4WFAV 2IH1C 2HFEC 2QM7A 1NH2D 2B5UA 2EILC 3W7XA 1VQ7V 1F23A 3ZRSA 4P9PA 4QPJA 1NVPB 3ABLB 2QA4V 2H94A 4GX5A 3OUFA 4U7OA 1GM7A 1AROP 2WLLB 3OMNB 2JEXA 1SERA 1K7DA 3JD4A 3B77A 1G4YB 4MS2A 3CCJV 1MABG 2EIKC 4FMTA 3OEEG 4GT1A 4MVOA 1AJQA 3ZRWB 3ZMUA 5E1AC 5IYBO 2BOBC 4MVSA 1H2GA 5IY5C 1AI5A 1H8EG 4Q20A 4GCZA 5KUKA 5B1NA 2YEVB 3T4ZA 3AG3C 1F4MA 5IY5B 3ASNC 5IYCO 2ZDIC 1R3KC 3ETDA 4FK5C 3CP1A 2UXNA 4WFEA 3RW0A 3AG4B 3UKMA 1K34A 4QNHB 2ITCC 3K9AA 5EBMC 2W6IG 4UUJC 5L3DA 3LSQA 2MK3A 4G28B 1OCCB 3LDEA 4MTXA 1NQTA 3A0RA 4PA7A 5LHIA 1XL6A 1IXMA 4R8CA 1YTFD 2XAGA 4P9OA 3RVYA 3SYPA 1R3LC 1JX9A 3R65A 3AG2B 5H9CA 2P90A 5CBHA 5B1BB 4CZZA 1RM1C 1I5YA 2IJHA 2WLNA 3ABMC 3FB5C 3BEHA 4H37A 3ETEA 1B6QA 3IGAC 1K73W 2ZDIA 4I5SA 2YSUB 2PI4A 3ML0A 2M7WA 4G2KA 4I9WA 5B1OA 3I55V 4BW5A 2DYRC 2X7RB 3LUTB 3CCSV 2ZR2A 3QO5A 3QNEA 1V54B 3WFVA 4CBCA 3CC2V 2HVKC 3G4SV 5L3EA 3AG1C 1VQPV 2JEUA 2X0LA 5B1AC 1THZA 2WLIA 3JYCA 4JF3A 3T2MA 4QE9A 4JPRA 4JYCA 1VQ6V 2HLDG 3ABUA 1JPXA 2QTOA 1QLNA 3CMAV 1F4NA 4PDLA 3OAAG 4X89A 3E8HA 4WFHA 2K1EA 2QE7G 5H6RA 5CMUA 2DYSC 2LFSA 5LGUA 1S77D 4MTOA 4JAUA 4MVRA 5EC2C 2XAQA 1R3IC 2DYSB 4UVBA 3T1CA 2DWEC 1ZWIC 2A79B 3DTUB 1YIJV 4X8AA 5LHHA 1JOYA 4LBEC 1JJ2U 1W0KG 1AI6A 4HZ3A 3FYIB 5B3SB 3G6EV 1NR7A 1EFRG 1QR8A 3K3WA 5LHGA 4UVAA 1SESA 2JJ1G 2ZXWC 3CC4V 3LDDA 1ORQC 1S0VA 5IDJA 2ZXWB 3KG2A 4KFMA 1GK9A 1VQMV 2IJKA 2ATKC 1PKXA 3E8GA 4KP4A 1VQ4V 4HAMA 1K3EA 2HG5C 2QM8A 3I56V 4J9ZB 1BHBA 2Q67A 3GWOA 4RO2A 3SYCA 5LBQA 2IJJA 2XAFA 1E1RG 3E89A 2EILB 3K0GA 2JK5C 4MT8A 1Q86W 4UV9A 3ZJZA 1KKDA 1S76D 1R6KA 3K08A 3WG7C 3ZRXA 3JD0A 3M99B 3EHBB 5KA5A 2XNDG 2DW4A 1SZTA 2DWDC 4MVMA 4TWKA 2JIZG 5L3BA 2IW5A 3LNMB 3CMEV 2EIKB 1K5QA 3DGEA 5DN6G 3F7YC 1DF5A 3ABKC 2Z3YA 4FPPA 1KC8W 1DF4A 3ZCCA 3F7VC 1AI4A 1G8MA 1KP2A 1OCOC 2OCCC 1AJPA 1QVFU 3SPHA 3NXSA 4ZBMA 5CBGA 5FL7G 1K8AW 3AG3B 1JCHA 3ASNB 5KA6A 2B1GA 2OCCB 1V55C 1Q81W 2FTKA 1P4RA 1PD3A 2XAHA 4WFFA 1EZJA 1K9MW 1VQ5V 4YXWG 4PA6A 2A9HA 2HJFC 1GMGA 3B8MA 1TUEB 2EIMC 2WSSG 1GO3F 2WLIB 3E86A 1K92A 2NLJC 4XDKA 1YHQV 3IFXA 4MW8A 2EINC 2X6CA 3CXCU 4BIZA 5DM6V 3CCLV 4PDVA 4G27B 3D3IA 3QO7A 1PNKA 4PDMA 3IC7A 2R9RB 4J9YB 1OHHG 3CD6V 2DQ3A 1RM1B 1PNMA 3ZN1A 2QKSA 1FXKC 3ABMB 1BHAA 3E83A 1OCRC 2AHZA 3CYOA 3P32A 4JASA 1FXKB 2ZD9A 3FYEB 3STLC 2WAMA 3P30A 4QE7A 1KD1W 3OMIB 3K04A 4ASUG 2DYRB 4F4LA 1VQKV 3CCRV 4WCEV 3OEHG 4WFGA 3CCVV 3E8FA 3LSSA 1OZ0A 4GX2A 1H38A 3AG1B 3BY6A 3FB7C 4HYOA 2V1DA 2NNUA 2XAJA 5B1AB 1FS0G 1PL0A 4MVUA 1R3JC 3CCMV 3D36A 4N21A 4PDRA 2OT5A 3E2EA 3GB7C 4RAIA 3CPWU 2EJRA 1S5HC 4E2LA 3CC7V 1KECA 5L3GA 1NH2B 3SPGA 4RQEA 3LDCA 5CA3A 1OCZC 1FXKA 3OE7G 3ZMVA 4Z1MG 1DLBA 2Q69A 2P67A 2GSMB 3OM3B 1F51A 4UXNA 4UVCA 4N23A 1QBZA 4RQFA 3K0DA 1QR9A 4MTFA 1KP3A 2UXXA 1YITV 3OFNG 5EK0A 4ZKIA 3SYOA 4MVQA 3SYAA 1P7BA 2WWWA 1GM9A 1NR1A 5EBLC 4GX0A 1GTOA 1VQNV 1BL8A 1DTOA 1Y4MA 4WF9V 4MTGA 3ZMZA 3FB8C 3W7SA 2X6BA 4JTDB 1YI2V 2Y69C 2WLKA 1M9NA 3FB6C 3X2QC 5LGTA 5J9PC 3F5WC 1YSCA 2Y69B 2IJIA 3OW2U 3OGCC 3W7TA 4P2ZA 3AEIA 3OMAB 2PI5A 4JTCB 3ASOC 4LP8A 4U7NA 1VQLV 3STZC 1K5SA 3WG7B 2Q6AA 3ASOB 1YTFB 4KUMA 3OR6C 1E1QG 1R6NA 3ABLC 3SPIA 3RBZA 1VQ9V 1XL4A 1JQ0A 5L3FA 1MSWD 3W7UA 3K03A 1K97A 1K4CC 1FFTB 1KQSU 3E8BA 3SPCA 2IU3A 5C93A 3ABKB 1Q7YW 1FXVA 2LP7A 3MHHC 1MOFA 1OCOB 2EZPA 4MSWC 4R7CA 2Q68A 3JD2A 2R9IA 1J95A 1V55B 4JAVA 4TT3G 4LC1A 4OXSA 4DXWA 4FJCC 2ITDC 4P30A 1QVGU 3CCEV 2BOCC 1SRYA 5BZBA 2EIMB 3VOUA 3AG4C 1JVMA 2D3OW 1W2BU 1GKFA 4UV8A 1NBMG 5L3CA 3K79A 1COWG 1NVPD 4PA4A 1Q82W 1YJ9V 4TSFG 2JDIG 2EINB 4L87A 4PA9A 1OCCC 4RUEA 3B8NA 3W7WA 2H8PC 4PA3A 5HFLA 2WLLA 4BAYA 3JCZA 4EKWA 2Y48A 5LGNA 1K4DC 3HB3B 1N8RW 3ABTA 2V7QG 3ZMTA 2W0FC 3AG2C 4R6ZA 1OCRB 2WLHA 4WFBV 1M1KW 1LNQA 5B1BC 3ZRWA 4BIUA 1CPYA 1E79G 2DQ0A 2Z5UA 1CP9A 3HPLC 5CN0A 3TK1A 3H01A 4JGSA 1AJNA 4RUFA 2HVJC 2YEVA 1SETA 1ROPA 1MG1A 3PJSK 3T4DA 3ZIAG 1K33A 3K06A 1QLEC 1V54C 2X6AA 3EFFK 2IH3C 2WLJA 3ZRVA 1QLEB 5CBFA 1AR1B 1ENVA 1VQ8V 1EBOA 1M57C 2IU0A 2EIJC 3G71V 1YJWV 1M90W 3JD1A 1CEZA 3CCUV 3ZN0A 3QO8A 1H8HG 4PELA 1I5XA 1M57B 5GW7A 2EIJB 1M56C 3JD3A 1QCEA 1Y66A 3SJQC 2QEXV 2OTJV 3FKSG 3TCUA 1HWYA 4JYBA 4FIPC 4JTAB 1OCZB 1M56B 4MW3A 4H33A 5HFMA 1S72V 2WLMA 1RPOA 1RPRA 2CK3G 2HKOA 2JJ2G 1NKDA 4X88A 4XBFA 1BMFG 2HR3A 5IYDO 1VQOV 2P6JA 3SPJA 2F43G 2LFRA 4DO2A 2W6JG 1YJNV 4R50A 5EBWC 2EZOA 1S3JA 1WPXA 1W0JG 1UJWB 4QPKA 1AI7A 2XASA 1WLEA 4XDLA 1R73A 2B1IA 2AHYA 3MHSC 4QJFB 4GX1A 5H6QA 5B3SC 4LCUC 3CCQV 2OTLV 4MVZA 2ZR3A 3OR7C 3OUSA 1L1FA 1PNLA 2WPDG 2GHYA 5EC1C 1FXHA 3X2QB 2KB1A 4XDJA 2P7TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E83 A;  1OCR C;  2AHZ A;  4PDL A;  4X89 A;  1J95 A;  3E8H A;  4WFH A;  2K1E A;  3RVZ A;  3UM7 A;  3SYQ A;  2A0L A;  4OXS A;  4DXW A;  5KUM A;  2ZD9 A;  3STL C;  2DYS C;  3TET A;  2ITD C;  4P30 A;  4MTO A;  4QE7 A;  2IH1 C;  4MVR A;  2HFE C;  5EC2 C;  2BOC C;  1R3I C;  2EIL C;  3K04 A;  3ZRS A;  5BZB A;  3T1C A;  4P9P A;  2DWE C;  1ZWI C;  3VOU A;  2A79 B;  4F4L A;  3AG4 C;  1JVM A;  4WFG A;  4X8A A;  4LBE C;  3E8F A;  4GX5 A;  3OUF A;  4GX2 A;  4PA4 A;  4HZ3 A;  3FB7 C;  4HYO A;  2WLL B;  4MVU A;  4PA9 A;  1R3J C;  1OCC C;  4RUE A;  2H8P C;  1G4Y B;  2ZXW C;  4MS2 A;  2WLL A;  4PA3 A;  4PDR A;  2EIK C;  3LDD A;  1ORQ C;  4EKW A;  3GB7 C;  4MVO A;  1K4D C;  4RAI A;  1S5H C;  2W0F C;  2BOB C;  3KG2 A;  4MVS A;  4KFM A;  5E1A C;  3AG2 C;  4R6Z A;  2WLH A;  5IY5 C;  3SPG A;  1LNQ A;  5B1B C;  2ATK C;  3E8G A;  3LDC A;  5KUK A;  2HG5 C;  1OCZ C;  4J9Z B;  3T4Z A;  3AG3 C;  3HPL C;  3ASN C;  2Q69 A;  1R3K C;  2Q67 A;  4RUF A;  4RO2 A;  2HVJ C;  2YEV A;  3SYC A;  3E89 A;  3K0G A;  2JK5 C;  4WFE A;  3ZJZ A;  1KKD A;  3RW0 A;  3K0D A;  3K08 A;  3PJS K;  4MTF A;  3WG7 C;  3UKM A;  3T4D A;  4QNH B;  2ITC C;  3K06 A;  1QLE C;  5EK0 A;  5EBM C;  2DWD C;  3SYO A;  4UUJ C;  4MVM A;  1V54 C;  2X6A A;  4G28 B;  1P7B A;  4MVQ A;  4TWK A;  3EFF K;  2IH3 C;  2WLJ A;  3LDE A;  4PA7 A;  5EBL C;  4GX0 A;  1XL6 A;  5CBF A;  3LNM B;  4R8C A;  1M57 C;  2EIJ C;  1BL8 A;  3F7Y C;  4MTG A;  4P9O A;  3ABK C;  3RVY A;  1R3L C;  3SYP A;  3FB8 C;  2X6B A;  4JTD B;  1M56 C;  3F7V C;  3R65 A;  2Y69 C;  3SJQ C;  2WLK A;  1OCO C;  2OCC C;  3TCU A;  5CBH A;  4JTA B;  3FB6 C;  3X2Q C;  3SPH A;  5J9P C;  3F5W C;  4ZBM A;  5CBG A;  4MW3 A;  4H33 A;  2WLN A;  2WLM A;  3ABM C;  3FB5 C;  3OGC C;  1V55 C;  4P2Z A;  3BEH A;  4H37 A;  4JTC B;  3ASO C;  4LP8 A;  3IGA C;  4X88 A;  3SPJ A;  3STZ C;  4WFF A;  2Q6A A;  4I9W A;  4PA6 A;  2A9H A;  2HJF C;  4BW5 A;  3OR6 C;  4R50 A;  5EBW C;  2DYR C;  2EIM C;  3LUT B;  3ABL C;  3SPI A;  2WLI B;  3RBZ A;  3E86 A;  4CBC A;  1XL4 A;  2HVK C;  2NLJ C;  4XDL A;  2AHY A;  3K03 A;  4XDK A;  4GX1 A;  3AG1 C;  1K4C C;  5B3S C;  4LCU C;  5B1A C;  3IFX A;  2WLI A;  2EIN C;  2X6C A;  3E8B A;  3JYC A;  4MW8 A;  4MVZ A;  3SPC A;  3T2M A;  4QE9 A;  3OR7 C;  3OUS A;  4PDV A;  4G27 B;  4PDM A;  2R9R B;  4J9Y B;  4MSW C;  5EC1 C;  4R7C A;  2Q68 A;  3SYA A;  2KB1 A;  4XDJ A;  2QTO A;  2QKS A;  2P7T C; 
#chains in the Genus database with same CATH topology
 1X59 A;  1YEW A;  3UM7 A;  3L9D A;  3MD0 A;  2Y0I A;  5H5N A;  2A0L A;  2EBO A;  1I94 O;  5KMG A;  4JI8 B;  1AP6 A;  2HFE C;  3KCY A;  4DV5 O;  2CE4 A;  4LH7 A;  2Q7E A;  2UXD B;  3ZRS A;  4GLX A;  4QPJ A;  1X4T A;  2H94 A;  3D3Q A;  3OUF A;  4B7K A;  4IHJ B;  1QU7 A;  2HJD A;  2PGG A;  3B77 A;  1G4Y B;  2UXB B;  3CCJ V;  1MAB G;  4FMT A;  2LGW A;  4MVO A;  2LO1 A;  5CB4 B;  2QWO B;  2JGD B;  1AI5 A;  1H8E G;  5KUK A;  4K8X A;  1US6 A;  3T4Z A;  4JI8 O;  3QG5 A;  2UXD O;  4UCU A;  2UXN A;  4O2B A;  3N2G A;  4UCT A;  5GTH Z;  1PP9 H;  3UKM A;  1P7G A;  1WN7 A;  3B2E E;  4QNH B;  4UUJ C;  5L3D A;  2UXB O;  1O9H A;  3CEI A;  1Z5W A;  4LF6 B;  5LL6 Y;  5JH7 A;  5AG2 A;  2XAG A;  3SYP A;  2PUS A;  2QM4 A;  3R65 A;  3AG2 B;  5H9C A;  3MDS A;  4LNU B;  4DR3 B;  2RDC A;  1I5Y A;  2IJH A;  3ABM C;  3FB5 C;  2YIB A;  1B3Q A;  3ETE A;  3IGA C;  1K73 W;  3SJA C;  2ZDI A;  1HP8 A;  5B1O A;  3I55 V;  5E79 Z;  4IIJ A;  1ZTE A;  2CTW A;  2DYR C;  1MZE A;  4LF6 O;  3QNE A;  3QO5 A;  3APQ A;  3G4S V;  5L3E A;  2X0L A;  3JYC A;  5FNV B;  3T2M A;  1SQQ H;  4DR3 O;  3JAK A;  2PTM A;  2RQ6 A;  4NB5 A;  3M8A A;  2ILM A;  2QTO A;  5B5E Z;  3OAA G;  4DRX B;  3UO3 A;  2XUM A;  4EB6 B;  2LFS A;  1S77 D;  4MTO A;  1MSD A;  4NTY A;  2DYS B;  4J80 A;  4JI0 B;  1R6T A;  1XBL A;  2DWE C;  1ZWI C;  1Q6I A;  4UB8 Z;  5KX5 B;  4TV8 B;  4HZ3 A;  5B3S B;  1EFR G;  1QR8 A;  5FNV A;  3RYI B;  5LYJ A;  2ZXW C;  1R1B A;  3UQ8 A;  1S0V A;  3IAY A;  4YHH B;  3L74 H;  3KG2 A;  1GK9 A;  2F1M A;  2IJK A;  2ZKO A;  1K3E A;  2QM8 A;  2Q9L A;  4LF4 B;  4J9Z B;  4EB6 A;  4JI1 B;  2Q67 A;  4FM2 A;  4JZG A;  4JI0 O;  3T1H B;  4JI6 B;  2XAF A;  2EIL B;  2JK5 C;  1S76 D;  1R6K A;  5GON A;  3JD0 A;  2AZ2 A;  3FAV B;  4TV8 A;  4K0K B;  3TXQ A;  4EFB A;  5A9G A;  4YHH O;  3A2F A;  5DN6 G;  2KSD A;  4F6R B;  1DF4 A;  3F7V C;  1AI4 A;  5A2Q N;  3KKY A;  4LF4 O;  1AJP A;  1QVF U;  4JI1 O;  2QWN B;  3SPH A;  4ZBM A;  5CBG A;  3T1H O;  2B1G A;  4JI6 O;  1TGO A;  4CH6 A;  1P4R A;  4C7U A;  2ZNI A;  4FM1 A;  1PPJ H;  2XAH A;  1K9M W;  4K0K O;  2PF4 E;  1M5I A;  4YXW G;  2A9H A;  2HJF C;  3U11 A;  1TUE B;  2EIM C;  3G6B A;  1GO3 F;  1K92 A;  1YHQ V;  3IFX A;  2EIN C;  3CCL V;  4PDV A;  4PDM A;  3HKC B;  1PNM A;  1GN3 A;  2QKS A;  3E83 A;  1OCR C;  3S3W A;  3CYO A;  1XQ8 A;  4TUY A;  4TQF A;  1GH6 A;  1FXK B;  2EUL A;  3FYE B;  1Q5O A;  3TGU H;  3B09 A;  4JV5 B;  2WAM A;  2YS8 A;  1QQC A;  4ASU G;  5EZY A;  2JS5 A;  4D6T H;  3CCR V;  5KHI A;  2WA4 A;  3E8F A;  1OZ0 A;  1SA0 A;  4GX2 A;  3FB7 C;  3C3S A;  5B1A B;  1PL0 A;  4GZR B;  4PDR A;  2OT5 A;  3E2E A;  2GUZ B;  1XOU A;  3ZX6 A;  5J2U A;  3CPW U;  1S5H C;  2VWJ A;  4NXN B;  3BA8 A;  2CAZ C;  4JV5 O;  2IBZ H;  1OCZ C;  1FXK A;  3JAW B;  3G80 A;  4X9Q A;  2P4K A;  1F51 A;  1PV0 A;  4UXN A;  3RYF A;  1QBZ A;  4RQF A;  2JVD A;  3K0D A;  1YIT V;  4HNA B;  2BTQ A;  3OFN G;  2R9A A;  3SYO A;  4JYA B;  4MVQ A;  4ZIB A;  3U0Z A;  2CGN A;  4NTX A;  2GUZ A;  3FB8 C;  4NXN O;  3S3X A;  2X6B A;  4JTD B;  2ADQ B;  2ZIM A;  3UCS C;  1YI2 V;  3ZHS A;  4OX9 B;  3FB6 C;  4CS2 A;  2IJI A;  3OW2 U;  3OGC C;  3W7T A;  1PL4 A;  4DV4 B;  4P2Z A;  5LOV B;  2K9P A;  3TJT A;  3H1K H;  4U7N A;  3STZ C;  3WG7 B;  2CTR A;  3ASO B;  4JYA O;  4HNA A;  3DC5 A;  4KUM A;  5EIB C;  2FYU H;  1R6N A;  3SR2 C;  5BMV A;  1VP7 A;  1VQ9 V;  1XL4 A;  5CA0 B;  4I0X A;  1N32 B;  4OX9 O;  2LP7 A;  1SQF A;  1MOF A;  2E75 B;  1SC5 B;  1XMO B;  1OCO B;  2VWK A;  4KL1 A;  2YUA A;  3JD2 A;  4DV4 O;  3RYC A;  4ZHQ B;  1J95 A;  1KU9 A;  1V55 B;  4TT3 G;  4LFB B;  4LC1 A;  1IBK B;  2VQF B;  4FJC C;  4LF5 B;  4P30 A;  1AVM A;  3CCE V;  1FAF A;  1SRY A;  5J2T B;  2ARH A;  1JVM A;  2QTS A;  1XMQ B;  2F95 B;  2D3O W;  3BHP A;  4WBN B;  1W2B U;  4FFB B;  5IE9 A;  2AZ0 A;  5CA0 A;  4PA4 A;  1N32 O;  3FX7 A;  2FL4 A;  5K1X A;  4UCV A;  1DGS A;  4L87 A;  1G1X B;  4DV1 B;  1XMO O;  4ZOL A;  1K4D C;  2L35 A;  3HB3 B;  2V7Q G;  1IXB A;  3ZMT A;  2FKX A;  1Y74 A;  4LFB O;  1I08 A;  2QWP B;  1IBK O;  2WLH A;  2VQF O;  4BIU A;  1CPY A;  2CTQ A;  4LF5 O;  2DQ0 A;  2Z5U A;  4DV7 B;  1CP9 A;  3HPL C;  3TK1 A;  3H01 A;  4JGS A;  4X1I B;  2HVJ C;  1Q8I A;  1XEQ A;  1XMQ O;  1ROP A;  5KAF Z;  2WA3 A;  5LP6 A;  3ZIA G;  1L0N H;  3K06 A;  4DV1 O;  1V54 C;  5K1P A;  4Q6G A;  2IU0 A;  1H8H G;  4PEL A;  5GW7 A;  2EIJ B;  3JD3 A;  4FVM A;  1EZV H;  5LA6 A;  4DV7 O;  1VIB A;  5JCO C;  4H33 A;  5HFM A;  1ZL8 B;  3NR7 A;  4GUN A;  2ZE8 A;  1RPR A;  3RT3 C;  3CRR A;  3GWK C;  5IYD O;  4I4T A;  5LMN B;  2W6J G;  3BAB A;  1YJN V;  3ZED A;  4CH4 A;  1LUV A;  1EN5 A;  1SQB H;  1W0J G;  4TOI A;  1WLE A;  3CS5 A;  2ETN A;  4NR1 A;  3RWR D;  4MVZ A;  3JAL A;  3SJB C;  1TUB B;  1PNL A;  2GHY A;  5EC1 C;  1FXH A;  4NXM B;  2KB1 A;  4ZI7 A;  2R70 A;  4YJ2 B;  1N0J A;  1S5L Z;  2ZQM A;  3ETG A;  1IBL B;  2L6L A;  2XOK G;  3JAS A;  2QKC A;  3SYQ A;  3ICX A;  2RMK B;  1NTK H;  5KUM A;  3ZMS A;  5LMN O;  2UXC B;  4WFA V;  2IH1 C;  2A3Q A;  3W7X A;  1XIL A;  4P9P A;  1NVP B;  3ABL B;  1H2M A;  2YID A;  3DXR B;  1RFY A;  2WLL B;  2JEX A;  1SER A;  4I55 A;  3JD4 A;  4FM0 A;  4NXM O;  2VS0 A;  1SQP H;  4GT1 A;  1SS3 A;  3ZRW B;  1IBL O;  5E1A C;  4CC5 A;  2BOB C;  1H2G A;  5IY5 C;  4Q20 A;  4GCZ A;  4LWS A;  2UXC O;  3AG3 C;  1F4M A;  1KKC A;  3ASN C;  3TXS A;  4O4H B;  1BS3 A;  4FK5 C;  4WFE A;  4FLU A;  5JJJ B;  1FKA O;  3RW0 A;  3UT5 A;  3AG4 B;  4X62 B;  4Z1V A;  1K34 A;  2ITC C;  3K9A A;  2BTO A;  4O2A B;  2W6I G;  2MK3 A;  1I0H A;  2NN4 A;  4PA7 A;  1OCC B;  3LDE A;  1NQT A;  1IXM A;  4P9O A;  1Q43 A;  1JX9 A;  2P90 A;  5CBH A;  3WB1 A;  1SF9 A;  2D2C B;  2WLN A;  3BEH A;  1B6Q A;  4X62 O;  4BW5 A;  2AW9 A;  3CCS V;  2ZR2 A;  3RN4 A;  4J41 A;  3WFV A;  4CBC A;  3CC2 V;  2HVK C;  5D5Q A;  3AG1 C;  2JEU A;  3KCX A;  2P5O A;  2WLI A;  4JF3 A;  3CXH F;  3E22 B;  4JPR A;  4PD4 F;  2RNB A;  3L75 H;  2Y0P A;  1N4C A;  2VQE B;  3ZHU A;  1JPX A;  2LW1 A;  1QLN A;  1Y6X A;  3CMA V;  1F4N A;  4X89 A;  3E8H A;  2OCH A;  5KMG B;  1D2D A;  1B06 A;  2XAQ A;  3T1C A;  1FPO A;  4X8A A;  3QVN A;  1JOY A;  1QNM A;  1JJ2 U;  1W0K G;  1NR7 A;  4DK1 A;  2PYJ A;  1JFF B;  4UVA A;  2JJ1 G;  3CC4 V;  2VQE O;  5IDJ A;  3JAT B;  2ZXW B;  2UUA B;  4YY3 B;  1N36 B;  1PKX A;  1BT8 A;  2YXL A;  2HG5 C;  3I56 V;  3K58 A;  3JSL A;  5F2V O;  2BSK A;  4NVP A;  4O2B B;  4X64 B;  3N2G B;  5LBQ A;  2IJJ A;  4O4L B;  4MT8 A;  1Q86 W;  2FB5 A;  3ZJZ A;  1KKD A;  1GN4 A;  3M99 B;  2OIG A;  3EHB B;  5KA5 A;  3CHX A;  2Z0A A;  3C90 A;  1SZT A;  2DWD C;  5JH7 B;  4YJ3 A;  4B3R B;  1JFF A;  2YXH A;  2IW5 A;  3H1I H;  2EIK B;  5ITZ B;  2UUA O;  1CXZ B;  3JAT A;  1DF5 A;  3ABK C;  4YY3 O;  1N36 O;  4FPP A;  2Q4P A;  1BQZ A;  1KP2 A;  1AR4 A;  4X64 O;  1K8A W;  1Q81 W;  2FTK A;  4O4L A;  4IIJ B;  1PD3 A;  1EZJ A;  1Q90 D;  1VQ5 V;  1W59 A;  4B3R O;  1HNZ B;  1DK1 A;  2WSS G;  1ZAU A;  3D36 C;  4XDK A;  5ITZ A;  3JAK B;  4DR6 B;  4UCS A;  1SQG A;  3J7A U;  2YI8 A;  3D3I A;  3IC7 A;  4J9Y B;  1OHH G;  1RM1 B;  4LH6 A;  3P32 A;  4JAS A;  2ZIO A;  3STL C;  4X1K A;  3P30 A;  4QE7 A;  1KD1 W;  1HNZ O;  3K04 A;  2RCV A;  4Z2W A;  4HBN A;  4DR6 O;  3K59 A;  1H38 A;  5LYJ B;  3BY6 A;  4HYO A;  2V1D A;  2XAJ A;  1FS0 G;  4U3J A;  3VQX A;  1NTZ H;  1JR9 A;  4RAI A;  4E2L A;  3CC7 V;  3VQV A;  5L3G A;  3SPG A;  1YXB A;  3LDC A;  2DOS A;  3ZMV A;  1DLB A;  2CTP A;  1YVW A;  2R72 A;  2GSM B;  3BVO A;  5GON B;  3CJH B;  4D7T A;  4JZ2 A;  3CE2 A;  1QR9 A;  1KP3 A;  4YIP A;  5KAI Z;  2Q0O C;  1IUR A;  1P7B A;  2WWW A;  1GM9 A;  5EBL C;  2CDY A;  4GX0 A;  4FLT A;  1EM1 A;  1G6U A;  1VQN V;  1WB7 A;  1DTO A;  3RYH B;  5JJN B;  1OV9 A;  4BR6 A;  2Y69 C;  1M9N A;  4UB6 Z;  4B7E A;  1YSC A;  2PY5 A;  3HKD A;  3OMA B;  2PI5 A;  3CJH A;  1H2L A;  5TIS Z;  4IGG A;  1K5S A;  4J10 A;  1YTF B;  3OR6 C;  3A0H Z;  4KHP B;  1VF6 C;  3RBZ A;  3JAR A;  3VQY A;  1K4C C;  3RYH A;  4K3A A;  3SPC A;  5C93 A;  1FXV A;  2F23 A;  4DR7 B;  4NKG B;  4FZ0 A;  4O4J A;  2EZP A;  1WA8 B;  2Q68 A;  4TUY B;  4J42 A;  4OXS A;  5FLX N;  5EZY B;  1QVG U;  4KHP O;  2Q7G A;  5GTI Z;  5BZB A;  1ZLZ A;  3EXA A;  3VOU A;  1SA0 B;  4U3F H;  3PN1 A;  1GKF A;  1NBM G;  1Q6H A;  1Y76 A;  1Q82 W;  1TA8 A;  2JDI G;  5J2U B;  3DC6 A;  3B8N A;  3W7W A;  4DR7 O;  4PA3 A;  3H1H H;  1XI1 A;  4BAY A;  5LGN A;  1WA8 A;  2F4V B;  3CWB H;  3AG2 C;  1N0N A;  1M1K W;  2XT9 A;  1XRE A;  1FFX A;  3UO2 A;  3RYF B;  5CN0 A;  3HKE A;  1URF A;  4RUF A;  2QDO A;  2YEV A;  2YIB D;  4X66 B;  2BTQ B;  1MG1 A;  3JCU Z;  3K9S A;  3PJS K;  2B9Z A;  1QLE C;  2XTA A;  1ENV A;  1M57 C;  1BCC H;  1M90 W;  2F4V O;  3CCU V;  1NU1 H;  3QO8 A;  1P49 A;  1I5X A;  1M56 C;  1QCE A;  2YDE A;  3FKS G;  4PI2 A;  4A5U B;  2Q8V A;  1S72 V;  3OTO B;  2JRI A;  4X66 O;  2CK3 G;  2JJ2 G;  4XBF A;  3SPJ A;  2LJ2 A;  5BMV B;  5EBW C;  4LR3 A;  3K5M A;  3O9O A;  1AI7 A;  3A0B Z;  4I0X B;  1R73 A;  2B1I A;  4AIL C;  4QJF B;  5B3S C;  3CCQ V;  2OTL V;  1ZUQ A;  2ZR3 A;  1L1F A;  3FD9 A;  4L8J A;  3RYC B;  2WPD G;  3X2Q B;  3OTO O;  3L70 H;  2W0X A;  2P7T C;  3EVK A;  5JCO A;  5IJ0 A;  2C2A A;  1JJO A;  4QIW F;  1XHX A;  4I50 B;  1KYO F;  1L8D A;  1GM8 A;  1VAR A;  1J5E B;  4BWA A;  2EIL C;  1VQ7 V;  3ZHV A;  5DEC A;  4TV9 B;  2QA4 V;  4U7O A;  3BCC H;  1ARO P;  3OMN B;  4ZOL B;  1SQV H;  2E5L B;  2CH7 B;  1Y74 B;  2QSA A;  3OEE G;  5LMU B;  1N34 B;  5KLV H;  4I50 A;  1J5E O;  1TVK B;  1NZ6 A;  5IY5 B;  1MNG A;  2O57 A;  1FD9 A;  1R3K C;  2OIE A;  5IYC O;  5LP6 B;  3CP1 A;  1HDJ A;  4B3S B;  2P22 C;  5KHG A;  4TV9 A;  1F7Y A;  2MW2 B;  3HR0 A;  3L73 H;  3JSN A;  3I5D A;  1VF7 A;  2BE3 A;  2E5L O;  2UUB B;  4MTX A;  3AK2 A;  1XL6 A;  4R8C A;  4X65 B;  5LMU O;  2CH7 A;  1N34 O;  5LA6 B;  1YTF D;  1GN6 A;  1R3L C;  3AG7 A;  5B1B B;  3BRC A;  3CRQ A;  2E3C A;  1TVK A;  3H9V A;  5BY1 A;  4I4T B;  1KUQ A;  1NI8 A;  4B3S O;  5JQG A;  2ZIN A;  4I5S A;  2DN9 A;  2ODM A;  4I9W A;  4K8Z A;  2UUB O;  1KMI Z;  3APO A;  3BFR A;  2EX3 A;  2X7R B;  3H1J H;  3LUT B;  4AHC A;  4X65 O;  1M93 A;  3JAL B;  3P3P A;  1VQP V;  3MAQ A;  5B1A C;  2GV9 A;  4IT5 A;  4I9Q A;  4ZI7 B;  4JYC A;  3JAS B;  3ABU A;  4PDL A;  2N74 A;  4WFH A;  4FZ1 A;  4DR1 B;  5IT9 N;  1MMM A;  2KG7 B;  2QE7 G;  5H6R A;  3GVM A;  3ZHT A;  1WP7 A;  4UVB A;  1NT2 B;  1BE3 H;  4LF7 B;  2A79 B;  3DTU B;  4I55 B;  1AI6 A;  2H3O A;  3FYI B;  3G6E V;  2ZE7 A;  3K3W A;  1SES A;  4EEQ A;  4LWS B;  4KFM A;  4DR1 O;  1VQM V;  1FJG B;  5JJE B;  4BW9 A;  3E8G A;  4HAM A;  2KG7 A;  1BHB A;  5D5P A;  3GWO A;  2UUC B;  4RO2 A;  4LF7 O;  3UT5 B;  1IZ3 A;  3K5N A;  1E1R G;  3E89 A;  3M7M X;  3CB2 A;  4UV9 A;  5CA1 A;  3WG7 C;  3ZHQ A;  2DMX A;  2XND G;  2DW4 A;  5LXT B;  4MVM A;  1Z2G A;  2JIZ G;  3LNM B;  1K5Q A;  1BQ0 A;  1YF2 A;  1FJG O;  1G8M A;  1JA8 A;  1IBM B;  1OCO C;  2F66 C;  2OCC C;  1GRJ A;  2UUC O;  1JCH A;  4GKK B;  1V55 C;  3Q4H A;  5KHJ A;  3RGB A;  4WFF A;  1HW7 A;  3A8T A;  4J11 A;  4LFA B;  4X20 B;  3SGI A;  1GMG A;  5LXT A;  3B4S A;  2WLI B;  2NLJ C;  1JMK C;  4MW8 A;  2X6C A;  3CXC U;  2CUG A;  4BIZ A;  1IBM O;  5DM6 V;  4G27 B;  2LGQ A;  3QO7 A;  4GKK O;  3CD6 V;  2DQ3 A;  5DED A;  3ZN1 A;  3ABM B;  1BHA A;  2Q5Z A;  1M4U A;  2AHZ A;  2ZD9 A;  4LFA O;  3BPZ A;  4DV0 B;  3OMI B;  4X20 A;  3CSX A;  2DYR B;  3K57 A;  4F4L A;  1VQK V;  3L72 H;  3OEH G;  4WFG A;  1I7F A;  1XDC A;  3LSS A;  2Q73 A;  3D36 A;  5EYP B;  3GB7 C;  2EJR A;  1KEC A;  1NH2 B;  2BSK B;  2YI9 A;  4RQE A;  4O4I B;  3OE7 G;  4DV0 O;  4NYK A;  4K35 A;  2P67 A;  3OM3 B;  1LUW A;  4DR2 B;  4PHZ A;  4N23 A;  4B3T B;  2UXX A;  3OD4 A;  4YJ3 B;  3SYA A;  1NR1 A;  4IL6 Z;  2GTA A;  1GTO A;  5BR8 B;  5EYP A;  1BL8 A;  1SZX A;  1L0L H;  3WU2 Z;  4J7Z A;  4O4I A;  2JGU A;  5J9P C;  3F5W C;  2QJ1 A;  4UCO A;  2Y69 B;  4OPA A;  4DR2 O;  1H2S B;  2GBO A;  4B3T O;  3CRM A;  1WPB A;  3ZS8 C;  1BSM A;  2Q6A A;  4KXR A;  3AK3 A;  4BIO A;  3ABL C;  5BR8 O;  3SPI A;  1JQ0 A;  4LFC B;  3K03 A;  1K97 A;  1FFT B;  5H2F Z;  2IU3 A;  1BGY H;  1TAE A;  5JVD A;  2E76 B;  5IJ9 B;  1ZSP A;  2R9I A;  1PM9 A;  1WB8 A;  4JAV A;  2ZE5 A;  4X1K B;  4FLW A;  3DSQ A;  1S5J A;  2Y4T A;  4DXW A;  2ITD C;  3K5L A;  2BOC C;  1HR0 B;  2EIM B;  4LFC O;  3AG4 C;  4U3J B;  2QGN A;  2YIA A;  1NVP D;  1VF6 A;  4W4K A;  2EIN B;  1OCC C;  4RUE A;  4IHJ A;  4DR4 B;  2V4D A;  5IJ9 A;  3JCZ A;  4EKW A;  4FLV A;  2W0F C;  4JI5 B;  4X1Y B;  2GDS A;  1OCR B;  4R6Z A;  5CB4 A;  1XNQ B;  4FLZ A;  2JGD A;  1YDX A;  1HR0 O;  1AJN A;  3O65 A;  2FML A;  3KZI Z;  1IX9 A;  1SET A;  1SQX H;  3T4D A;  3P3N A;  1K33 A;  2OYQ A;  1Q3E A;  2LQT A;  4DK0 A;  4DR4 O;  3EFF K;  2IH3 C;  2WLJ A;  3ZRV A;  1QLE B;  5CBF A;  1YJW V;  2AXT Z;  3JD1 A;  4JYY A;  1V9P A;  3ZN0 A;  4JI5 O;  1M57 B;  4X1Y A;  1XNQ O;  1Y66 A;  1HWY A;  2RN9 A;  4JTA B;  3HKD B;  1OCZ B;  1M56 B;  2WLM A;  4LNU A;  1RPO A;  2HKO A;  4CS4 A;  1NKD A;  1VQO V;  1BMF G;  2HR3 A;  2LFR A;  2NR5 A;  4JI7 B;  2Y4U A;  3JAR B;  2EZO A;  1UJW B;  4QPK A;  1SKV A;  4IYH A;  2AHY A;  4LCU C;  5KHK A;  1VMG A;  4O4J B;  3OUS A;  1BZK A;  1D5N A;  5JWP A;  2N04 A;  3E35 A;  3VBB A;  3RVZ A;  3R66 A;  3HKB B;  3WB2 A;  1NJI W;  2BCC H;  3TET A;  4JI7 O;  4DRX A;  4H0L B;  2QM7 A;  3ZBH A;  1NH2 D;  2IM9 A;  2B5U A;  1F23 A;  1Y76 B;  3THO A;  4FLX A;  4GX5 A;  1GM7 A;  1EN4 A;  1AP5 A;  1K7D A;  2DJV A;  5KX5 A;  4TQD A;  4D7S A;  3H1L H;  4FFK A;  4MS2 A;  2EIK C;  2M6Y A;  3IC9 A;  2ZNJ A;  3RYI A;  1AJQ A;  3ZMU A;  4DV6 B;  5IYB O;  4MVS A;  1OJH A;  1FFX B;  3HKE B;  3HKB A;  3IJ4 A;  5B1N A;  2YEV B;  3WB0 A;  2ZDI C;  1IVS A;  4B3M B;  3ETD A;  5EBM C;  3LSQ A;  4G28 B;  4B08 A;  3FAV A;  5LHI A;  3A0R A;  2P06 A;  4DV6 O;  3RVY A;  2QKA A;  1VEW A;  2KKW A;  4F6R A;  4CZZ A;  3BAA A;  3J80 N;  1RM1 C;  4B3M O;  2A7W A;  2PYL A;  1LR1 A;  4H37 A;  1EN6 A;  2YSU B;  2PI4 A;  3ML0 A;  2M7W A;  4RWU A;  4G2K A;  2Q0A A;  1V54 B;  2LW7 A;  1THZ A;  1P84 F;  1HNW B;  1H2K A;  4QE9 A;  3K5O A;  4H44 B;  1VQ6 V;  2HLD G;  3BA9 A;  5IJ0 B;  2JS3 A;  4E4E A;  4H13 B;  3HKC A;  2K1E A;  1FYJ A;  1MZF A;  3FFQ A;  5CMU A;  1KB9 F;  2DYS C;  1D5A A;  5LGU A;  4JAU A;  4MVR A;  5EC2 C;  1R3I C;  2E74 B;  2ZE6 A;  3U10 A;  1YIJ V;  5LHH A;  2UU9 B;  4LBE C;  4DUY B;  1HNW O;  5LHG A;  3LDD A;  1UFI A;  1ORQ C;  1WP8 A;  2ATK C;  4KP4 A;  1VQ4 V;  3SDL A;  4FLY A;  4YIO A;  1UPG A;  4PJ0 Z;  1QHT A;  3SYC A;  3T1Y B;  2CGO A;  2A06 H;  1A32 A;  1IDS A;  3JAW A;  3K0G A;  4GKJ B;  4PV1 B;  2UU9 O;  4DUY O;  3K08 A;  3ZRX A;  5C8Y B;  3CX5 F;  3B40 A;  4JI3 B;  4TWK A;  4LF8 B;  5L3B A;  3CME V;  3DGE A;  4LF9 B;  1GAX A;  3F7Y C;  2Z3Y A;  1KC8 W;  3ZCC A;  4PI0 A;  3NXS A;  2ZM6 B;  5FL7 G;  5JQG B;  3AG3 B;  4JI2 B;  5KA6 A;  3ASN B;  3T1Y O;  2OCC B;  3G67 A;  2VRZ A;  4GKJ O;  1U97 A;  1Q6U A;  2Q7H A;  5IWA B;  5LOV A;  4OGQ B;  5C8Y A;  4PA6 A;  4JI3 O;  3B8M A;  4LF8 O;  2ZCE A;  3VQW A;  3E86 A;  3JAM N;  4LF9 O;  3L71 H;  5EIB D;  4F6E A;  4JI4 B;  1H2N A;  1WNS A;  4UFZ A;  2ZM6 O;  1PNK A;  4J7J A;  4JI2 O;  2R9R B;  2OWO A;  1FXK C;  2DE0 X;  2EJ7 A;  5IWA O;  3LNN A;  4DR5 B;  4ZHQ A;  2QWR B;  1B04 A;  4I7Z B;  3N2K B;  2YC0 A;  4WCE V;  3CCV V;  1VF5 B;  1GN2 A;  5J2T A;  3AG1 B;  4JI4 O;  2NNU A;  1WJZ A;  4WBN A;  4MVU A;  4FFB A;  1R3J C;  3CCM V;  4N21 A;  4W4L A;  2RJZ A;  2PZS A;  1RSO B;  1ZX3 A;  3OGI B;  4DR5 O;  1N33 B;  5CA3 A;  4Z1M G;  2Q69 A;  3D8C A;  1Y67 A;  5CA1 B;  1U96 A;  4DV3 B;  4UVC A;  4X1I A;  3N2K A;  4EFE A;  4MTF A;  1YCI A;  5EK0 A;  4ZKI A;  3ZHR A;  4DW0 A;  1AIL A;  1Y4M A;  1AR5 A;  4WF9 V;  4MTG A;  3ZMZ A;  1NTM H;  3W7S A;  1N33 O;  1RSO A;  4DV2 B;  2WLK A;  4ABM A;  4J7K A;  4DYL A;  3Q4H B;  3X2Q C;  5LGT A;  3OT7 A;  4DV3 O;  3AEI A;  4CC6 A;  4GYC B;  4JTC B;  1ZL8 A;  3ASO C;  4LP8 A;  4CS3 A;  1VQL V;  1T5E A;  4CH5 A;  1E1Q G;  2QWQ B;  4NTW A;  4IYI A;  1MSW D;  5L3F A;  3W7U A;  3N27 A;  1KQS U;  2HP8 A;  3E8B A;  2HEP A;  4DV2 O;  1Q7Y W;  3ABK B;  4QGP A;  3MHH C;  2QR4 A;  4MSW C;  2KQX A;  1TUB A;  4R7C A;  3C3T A;  4YJ2 A;  3ETQ A;  5LP6 C;  3LSU A;  3F5T A;  4DW1 A;  4UV8 A;  5L3C A;  3RFR A;  3K79 A;  1COW G;  1O9G A;  4TSF G;  3SJC C;  4AQY B;  1YJ9 V;  4UCR A;  4PA9 A;  2H8P C;  3DXR A;  2WLL A;  5HFL A;  1XNR B;  2Y48 A;  1N8R W;  3ABT A;  2N05 A;  4WFB V;  2ZT9 B;  2HHH B;  1LNQ A;  5B1B C;  3ZRW A;  5FPR A;  2XHB A;  1E79 G;  5FPO A;  4DUZ B;  1HNX B;  4O4H A;  5B66 Z;  5KHH A;  2P4V A;  3QF7 A;  1KBH A;  3AK1 A;  4AQY O;  3QTC A;  2YXY A;  1Z5V A;  1AB3 A;  1XUQ A;  2X6A A;  4OPH A;  1XNR O;  1AR1 B;  1VQ8 V;  1EBO A;  4O2A A;  2EIJ C;  2ADP A;  5IYZ B;  3G71 V;  1CEZ A;  4AI8 A;  2HHH O;  3SJQ C;  1NS1 A;  2QEX V;  2OTJ V;  1YZB A;  3TCU A;  4JYB A;  1WAZ A;  2GTS A;  4FIP C;  4MW3 A;  4DUZ O;  4CH3 A;  1HNX O;  4X88 A;  2P6J A;  2YIC A;  2AGA A;  2F43 G;  1RP3 B;  4DO2 A;  1I94 B;  4R50 A;  3CRA A;  1S3J A;  1WPX A;  4DV5 B;  2G38 A;  3J81 N;  2XAS A;  3OTF A;  2F93 B;  5BXZ A;  4XDL A;  3MHS C;  4GX1 A;  5JVD B;  5IYZ A;  5H6Q A;  3CRC A;  1XHZ A;  1MA1 A;  3OR7 C;  4ICG A;  4JAA A;  3E22 A;  4XDJ A; 
#chains in the Genus database with same CATH homology
 3E35 A;  3VBB A;  3RVZ A;  3UM7 A;  3MD0 A;  2ZQM A;  2C2A A;  3ETG A;  2XOK G;  4QIW F;  2A0L A;  3SYQ A;  5KUM A;  1NJI W;  3ZMS A;  3TET A;  1GM8 A;  2EBO A;  4WFA V;  2IH1 C;  2HFE C;  2QM7 A;  1NH2 D;  2B5U A;  2EIL C;  3W7X A;  1VQ7 V;  1F23 A;  3ZRS A;  4P9P A;  4QPJ A;  1NVP B;  3ABL B;  2QA4 V;  2H94 A;  4GX5 A;  3OUF A;  4U7O A;  1GM7 A;  1ARO P;  2WLL B;  3OMN B;  2JEX A;  1SER A;  1K7D A;  3JD4 A;  3B77 A;  1G4Y B;  4MS2 A;  3CCJ V;  1MAB G;  2EIK C;  4FMT A;  3OEE G;  4GT1 A;  4MVO A;  1AJQ A;  3ZRW B;  3ZMU A;  5E1A C;  5IYB O;  2BOB C;  4MVS A;  1H2G A;  5IY5 C;  1AI5 A;  1H8E G;  4Q20 A;  4GCZ A;  5KUK A;  5B1N A;  2YEV B;  3T4Z A;  3AG3 C;  1F4M A;  5IY5 B;  3ASN C;  5IYC O;  2ZDI C;  1R3K C;  3ETD A;  4FK5 C;  3CP1 A;  2UXN A;  4WFE A;  3RW0 A;  3AG4 B;  3UKM A;  1K34 A;  4QNH B;  2ITC C;  3K9A A;  5EBM C;  2W6I G;  4UUJ C;  5L3D A;  3LSQ A;  2MK3 A;  4G28 B;  1OCC B;  3LDE A;  4MTX A;  1NQT A;  3A0R A;  4PA7 A;  5LHI A;  1XL6 A;  1IXM A;  4R8C A;  1YTF D;  2XAG A;  4P9O A;  3RVY A;  3SYP A;  1R3L C;  1JX9 A;  3R65 A;  3AG2 B;  5H9C A;  2P90 A;  5CBH A;  5B1B B;  4CZZ A;  1RM1 C;  1I5Y A;  2IJH A;  2WLN A;  3ABM C;  3FB5 C;  3BEH A;  4H37 A;  3ETE A;  1B6Q A;  3IGA C;  1K73 W;  2ZDI A;  4I5S A;  2YSU B;  2PI4 A;  3ML0 A;  2M7W A;  4G2K A;  4I9W A;  5B1O A;  3I55 V;  4BW5 A;  2DYR C;  2X7R B;  3LUT B;  3CCS V;  2ZR2 A;  3QO5 A;  3QNE A;  1V54 B;  3WFV A;  4CBC A;  3CC2 V;  2HVK C;  3G4S V;  5L3E A;  3AG1 C;  1VQP V;  2JEU A;  2X0L A;  5B1A C;  1THZ A;  2WLI A;  3JYC A;  4JF3 A;  3T2M A;  4QE9 A;  4JPR A;  4JYC A;  1VQ6 V;  2HLD G;  3ABU A;  1JPX A;  2QTO A;  1QLN A;  3CMA V;  1F4N A;  4PDL A;  3OAA G;  4X89 A;  3E8H A;  4WFH A;  2K1E A;  2QE7 G;  5H6R A;  5CMU A;  2DYS C;  2LFS A;  5LGU A;  1S77 D;  4MTO A;  4JAU A;  4MVR A;  5EC2 C;  2XAQ A;  1R3I C;  2DYS B;  4UVB A;  3T1C A;  2DWE C;  1ZWI C;  2A79 B;  3DTU B;  1YIJ V;  4X8A A;  5LHH A;  1JOY A;  4LBE C;  1JJ2 U;  1W0K G;  1AI6 A;  4HZ3 A;  3FYI B;  5B3S B;  3G6E V;  1NR7 A;  1EFR G;  1QR8 A;  3K3W A;  5LHG A;  4UVA A;  1SES A;  2JJ1 G;  2ZXW C;  3CC4 V;  3LDD A;  1ORQ C;  1S0V A;  5IDJ A;  2ZXW B;  3KG2 A;  4KFM A;  1GK9 A;  1VQM V;  2IJK A;  2ATK C;  1PKX A;  3E8G A;  4KP4 A;  1VQ4 V;  4HAM A;  1K3E A;  2HG5 C;  2QM8 A;  3I56 V;  4J9Z B;  1BHB A;  2Q67 A;  3GWO A;  4RO2 A;  3SYC A;  5LBQ A;  2IJJ A;  2XAF A;  1E1R G;  3E89 A;  2EIL B;  3K0G A;  2JK5 C;  4MT8 A;  1Q86 W;  4UV9 A;  3ZJZ A;  1KKD A;  1S76 D;  1R6K A;  3K08 A;  3WG7 C;  3ZRX A;  3JD0 A;  3M99 B;  3EHB B;  5KA5 A;  2XND G;  2DW4 A;  1SZT A;  2DWD C;  4MVM A;  4TWK A;  2JIZ G;  5L3B A;  2IW5 A;  3LNM B;  3CME V;  2EIK B;  1K5Q A;  3DGE A;  5DN6 G;  3F7Y C;  1DF5 A;  3ABK C;  2Z3Y A;  4FPP A;  1KC8 W;  1DF4 A;  3ZCC A;  3F7V C;  1AI4 A;  1G8M A;  1KP2 A;  1OCO C;  2OCC C;  1AJP A;  1QVF U;  3SPH A;  3NXS A;  4ZBM A;  5CBG A;  5FL7 G;  1K8A W;  3AG3 B;  1JCH A;  3ASN B;  5KA6 A;  2B1G A;  2OCC B;  1V55 C;  1Q81 W;  2FTK A;  1P4R A;  1PD3 A;  2XAH A;  4WFF A;  1EZJ A;  1K9M W;  1VQ5 V;  4YXW G;  4PA6 A;  2A9H A;  2HJF C;  1GMG A;  3B8M A;  1TUE B;  2EIM C;  2WSS G;  1GO3 F;  2WLI B;  3E86 A;  1K92 A;  2NLJ C;  4XDK A;  1YHQ V;  3IFX A;  4MW8 A;  2EIN C;  2X6C A;  3CXC U;  4BIZ A;  5DM6 V;  3CCL V;  4PDV A;  4G27 B;  3D3I A;  3QO7 A;  1PNK A;  4PDM A;  3IC7 A;  2R9R B;  4J9Y B;  1OHH G;  3CD6 V;  2DQ3 A;  1RM1 B;  1PNM A;  3ZN1 A;  2QKS A;  1FXK C;  3ABM B;  1BHA A;  3E83 A;  1OCR C;  2AHZ A;  3CYO A;  3P32 A;  4JAS A;  1FXK B;  2ZD9 A;  3FYE B;  3STL C;  2WAM A;  3P30 A;  4QE7 A;  1KD1 W;  3OMI B;  3K04 A;  4ASU G;  2DYR B;  4F4L A;  1VQK V;  3CCR V;  4WCE V;  3OEH G;  4WFG A;  3CCV V;  3E8F A;  3LSS A;  1OZ0 A;  4GX2 A;  1H38 A;  3AG1 B;  3BY6 A;  3FB7 C;  4HYO A;  2V1D A;  2NNU A;  2XAJ A;  5B1A B;  1FS0 G;  1PL0 A;  4MVU A;  1R3J C;  3CCM V;  3D36 A;  4N21 A;  4PDR A;  2OT5 A;  3E2E A;  3GB7 C;  4RAI A;  3CPW U;  2EJR A;  1S5H C;  4E2L A;  3CC7 V;  1KEC A;  5L3G A;  1NH2 B;  3SPG A;  4RQE A;  3LDC A;  5CA3 A;  1OCZ C;  1FXK A;  3OE7 G;  3ZMV A;  4Z1M G;  1DLB A;  2Q69 A;  2P67 A;  2GSM B;  3OM3 B;  1F51 A;  4UXN A;  4UVC A;  4N23 A;  1QBZ A;  4RQF A;  3K0D A;  1QR9 A;  4MTF A;  1KP3 A;  2UXX A;  1YIT V;  3OFN G;  5EK0 A;  4ZKI A;  3SYO A;  4MVQ A;  3SYA A;  1P7B A;  2WWW A;  1GM9 A;  1NR1 A;  5EBL C;  4GX0 A;  1GTO A;  1VQN V;  1BL8 A;  1DTO A;  1Y4M A;  4WF9 V;  4MTG A;  3ZMZ A;  3FB8 C;  3W7S A;  2X6B A;  4JTD B;  1YI2 V;  2Y69 C;  2WLK A;  1M9N A;  3FB6 C;  3X2Q C;  5LGT A;  5J9P C;  3F5W C;  1YSC A;  2Y69 B;  2IJI A;  3OW2 U;  3OGC C;  3W7T A;  4P2Z A;  3AEI A;  3OMA B;  2PI5 A;  4JTC B;  3ASO C;  4LP8 A;  4U7N A;  1VQL V;  3STZ C;  1K5S A;  3WG7 B;  2Q6A A;  3ASO B;  1YTF B;  4KUM A;  3OR6 C;  1E1Q G;  1R6N A;  3ABL C;  3SPI A;  3RBZ A;  1VQ9 V;  1XL4 A;  1JQ0 A;  5L3F A;  1MSW D;  3W7U A;  3K03 A;  1K97 A;  1K4C C;  1FFT B;  1KQS U;  3E8B A;  3SPC A;  2IU3 A;  5C93 A;  3ABK B;  1Q7Y W;  1FXV A;  2LP7 A;  3MHH C;  1MOF A;  1OCO B;  2EZP A;  4MSW C;  4R7C A;  2Q68 A;  3JD2 A;  2R9I A;  1J95 A;  1V55 B;  4JAV A;  4TT3 G;  4LC1 A;  4OXS A;  4DXW A;  4FJC C;  2ITD C;  4P30 A;  1QVG U;  3CCE V;  2BOC C;  1SRY A;  5BZB A;  2EIM B;  3VOU A;  3AG4 C;  1JVM A;  2D3O W;  1W2B U;  1GKF A;  4UV8 A;  1NBM G;  5L3C A;  3K79 A;  1COW G;  1NVP D;  4PA4 A;  1Q82 W;  1YJ9 V;  4TSF G;  2JDI G;  2EIN B;  4L87 A;  4PA9 A;  1OCC C;  4RUE A;  3B8N A;  3W7W A;  2H8P C;  4PA3 A;  5HFL A;  2WLL A;  4BAY A;  3JCZ A;  4EKW A;  2Y48 A;  5LGN A;  1K4D C;  3HB3 B;  1N8R W;  3ABT A;  2V7Q G;  3ZMT A;  2W0F C;  3AG2 C;  4R6Z A;  1OCR B;  2WLH A;  4WFB V;  1M1K W;  1LNQ A;  5B1B C;  3ZRW A;  4BIU A;  1CPY A;  1E79 G;  2DQ0 A;  2Z5U A;  1CP9 A;  3HPL C;  5CN0 A;  3TK1 A;  3H01 A;  4JGS A;  1AJN A;  4RUF A;  2HVJ C;  2YEV A;  1SET A;  1ROP A;  1MG1 A;  3PJS K;  3T4D A;  3ZIA G;  1K33 A;  3K06 A;  1QLE C;  1V54 C;  2X6A A;  3EFF K;  2IH3 C;  2WLJ A;  3ZRV A;  1QLE B;  5CBF A;  1AR1 B;  1ENV A;  1VQ8 V;  1EBO A;  1M57 C;  2IU0 A;  2EIJ C;  3G71 V;  1YJW V;  1M90 W;  3JD1 A;  1CEZ A;  3CCU V;  3ZN0 A;  3QO8 A;  1H8H G;  4PEL A;  1I5X A;  1M57 B;  5GW7 A;  2EIJ B;  1M56 C;  3JD3 A;  1QCE A;  1Y66 A;  3SJQ C;  2QEX V;  2OTJ V;  3FKS G;  3TCU A;  1HWY A;  4JYB A;  4FIP C;  4JTA B;  1OCZ B;  1M56 B;  4MW3 A;  4H33 A;  5HFM A;  1S72 V;  2WLM A;  1RPO A;  1RPR A;  2CK3 G;  2HKO A;  2JJ2 G;  1NKD A;  4X88 A;  4XBF A;  1BMF G;  2HR3 A;  5IYD O;  1VQO V;  2P6J A;  3SPJ A;  2F43 G;  2LFR A;  4DO2 A;  2W6J G;  1YJN V;  4R50 A;  5EBW C;  2EZO A;  1S3J A;  1WPX A;  1W0J G;  1UJW B;  4QPK A;  1AI7 A;  2XAS A;  1WLE A;  4XDL A;  1R73 A;  2B1I A;  2AHY A;  3MHS C;  4QJF B;  4GX1 A;  5H6Q A;  5B3S C;  4LCU C;  3CCQ V;  2OTL V;  4MVZ A;  2ZR3 A;  3OR7 C;  3OUS A;  1L1F A;  1PNL A;  2WPD G;  2GHY A;  5EC1 C;  1FXH A;  3X2Q B;  2KB1 A;  4XDJ A;  2P7T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...