4X89A

Navms voltage-gated sodium channal pore and c-terminal domain soaked with silver nitrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x89A00
5KUMA 3VOUA 3AG1C 3ZJZA 1K4CC 3RW0A 4RO2A 3SYOA 3E83A 2IH3C 3K0DA 1KKDA 3ABMC 4P30A 4PA4A 4PDMA 2EIJC 1R3JC 3LNMB 1R3IC 2Q67A 4QE7A 4WFHA 3K0GA 2A0LA 1OCZC 4WFFA 2IH1C 4OXSA 3SPHA 3RVYA 2ITCC 3WG7C 3FB5C 2WLMA 5IY5C 1M56C 4WFGA 2ZD9A 3OR6C 4TWKA 5CBGA 3T4ZA 3K03A 3E8FA 4HZ3A 2WLKA 4J9ZB 4RUEA 4R7CA 4GX5A 5EK0A 3X2QC 2NLJC 3ASOC 3E8GA 3F7YC 3SYQA 3TETA 2HVKC 4I9WA 3E8HA 4PDLA 1JVMA 4P9PA 2HFEC 4LBEC 1LNQA 3AG4C 4G27B 3T4DA 4MTGA 2X6BA 2P7TC 1R3LC 5CBFA 4BW5A 4QNHB 1G4YB 4GX2A 4XDJA 2K1EA 2WLLB 4ZBMA 3TCUA 4MVZA 3SYAA 3T1CA 4PA3A 2R9RB 3EFFK 3FB6C 3BEHA 2ATKC 4PA9A 4R6ZA 2WLJA 3SPIA 3LDDA 5CBHA 2HVJC 1V54C 4H33A 4PDRA 4WFEA 2BOCC 2QTOA 3RBZA 1XL4A 4MVUA 4MSWC 3LDEA 2WLLA 2EILC 4LCUC 3UKMA 4MS2A 3FB7C 5B1AC 1QLEC 4HYOA 4MVSA 2Q68A 3K08A 3FB8C 4X8AA 1M57C 1OCCC 1OCRC 5BZBA 3AG3C 3LDCA 2BOBC 4MW3A 2WLIA 4P2ZA 2KB1A 2X6AA 5J9PC 5EBLC 4GX0A 3STZC 3GB7C 3ZRSA 4X89A 2EIMC 2ITDC 4PDVA 4P9OA 2EIKC 3SPCA 3OUFA 2X6CA 2ZXWC 5B1BC 3K06A 2DYSC 4QE9A 3SYPA 2DYRC 2Q69A 4H37A 4MVQA 4EKWA 4KFMA 3E89A 5EBWC 1ZWIC 3STLC 3HPLC 3E86A 2WLNA 3AG2C 3T2MA 3UM7A 2JK5C 5EC2C 3SJQC 2A79B 3E8BA 1OCOC 1ORQC 4X88A 3SPGA 2HG5C 4R8CA 2Q6AA 3OUSA 3R65A 2WLHA 4MVMA 4PA6A 4G28B 4XDKA 4F4LA 2OCCC 2EINC 1S5HC 2YEVA 3RVZA 5E1AC 2Y69C 3IFXA 3JYCA 4UUJC 3ABKC 2DWDC 3SYCA 4DXWA 3F5WC 4MVRA 2A9HA 1J95A 3K04A 4MTOA 2AHYA 4MW8A 4CBCA 4R50A 5KUKA 1K4DC 2AHZA 1BL8A 3KG2A 5EC1C 1V55C 2W0FC 4MTFA 4GX1A 4LP8A 2H8PC 2DWEC 5B3SC 3IGAC 1R3KC 3F7VC 4PA7A 4J9YB 3ABLC 4JTAB 2HJFC 3PJSK 3ASNC 4JTDB 4RAIA 1P7BA 3SPJA 4RUFA 2WLIB 4MVOA 5EBMC 4JTCB 3OR7C 4XDLA 3LUTB 3OGCC 2QKSA 1XL6A
chains in the Genus database with same CATH superfamily
1HDJA 1XNRO 1IBKO 1YHQV 1SKVA 1PL4A 4H0LB 4TV9A 1AILA 1OCZC 2IH1C 4I50B 5LHIA 3A0RA 1N4CA 1N0NA 1GN2A 2LO1A 4TV9B 1K8AW 3CD6V 3OW2U 1Z5VA 3BY6A 1S76D 4NYKA 2ZQMA 3NR7A 1CEZA 4EFEA 1COWG 2ZINA 2Z3YA 1N33B 1SQBH 2ATKC 4LFCB 1VEWA 1ZLZA 4PELA 4DUYB 5JQGA 2P4VA 3K5OA 4FK5C 1XL4A 1XMOO 2YDEA 3THOA 3M7MX 4CC5A 3E2EA 3BHPA 1E1QG 3JD0A 2N05A 4CH4A 2OCHA 1EN5A 2EIKC 3VQYA 4DR3B 3QVNA 4H37A 4FLYA 4DV0B 3ETEA 2E74B 3OM3B 3AG2C 1JQ0A 3LSQA 1K92A 1DF4A 4I0XB 1N32O 1ZSPA 2RCVA 4O4JB 4BAYA 2E3CA 4UFZA 1D5AA 1OV9A 4LFAO 1M57B 1VQ4V 2A9HA 4TT3G 2AHYA 5CA0B 3OMAB 1MZFA 5IYCO 1AI5A 2ZT9B 1YSCA 2E5LO 1BHAA 4PJ0Z 1Y66A 3K59A 1AP5A 4E4EA 2CE4A 3W7SA 4JTCB 1MMMA 3I56V 1XNQB 5IWAO 1GK9A 5KHGA 3K0DA 3ZHRA 2A3QA 1VQ8V 4FLZA 4B3RB 4LNUB 4JI8O 1KB9F 1M56C 2ZD9A 1EN4A 2WLKA 3CCVV 3H1IH 1QNMA 2CTRA 4BR6A 3ZMUA 5A2QN 2QDOA 4U3FH 2ZE5A 3AG3B 3TGUH 4UVCA 4GLXA 3BEHA 1FJGO 4DYLA 3BABA 3OTFA 3BPZA 3TXQA 1JA8A 3C90A 4MSWC 4OX9B 4LH6A 4KXRA 3DTUB 5H5NA 4LF5O 5LP6C 4JZGA 1NVPD 1B06A 1MABG 3K08A 1FXKB 4W4LA 4DK0A 1XNRB 1WLEA 1VQ6V 3A0BZ 3OT7A 2ITDC 1YJNV 2ZXWC 1URFA 1XILA 1KKCA 1ROPA 3HKBB 1CP9A 1YCIA 5CMUA 1WA8A 1NBMG 3CSXA 1BZKA 2R72A 2VQEB 4F6RB 1NKDA 4JYAO 1FXVA 4D7SA 1WJZA 2DOSA 1S5HC 3H1JH 2YXLA 5TISZ 3RYHB 2IJJA 4YIPA 2ZKOA 5KUKA 1AJNA 5B1NA 3ZMSA 5GTIZ 3CYOA 4DV4O 1IZ3A 1SA0A 3KCXA 3B8MA 3ASNC 4N23A 1AR1B 1G6UA 2ZNJA 1Y4MA 2ZDIC 3FD9A 1US6A 1OCOB 1AI4A 2M7WA 4JI4O 2DE0X 2E76B 3ASOB 3QO8A 2QTSA 4WFGA 1SZTA 5LOVA 4RUEA 4GKKO 2YIBA 1RSOB 5LGNA 1F4MA 1YEWA 3MHSC 4G27B 3OMNB 4LF9O 5KX5B 3U0ZA 1RSOA 5JWPA 3CJHA 1ZL8A 2LW1A 4LF4O 3SYAA 1PL0A 1X4TA 1OJHA 2CTWA 3UO2A 5C8YB 3AK2A 4RQFA 4IGGA 4TOIA 2UUBO 1EN6A 3MHHC 1GAXA 2FYUH 4DUZO 4FMTA 2GTSA 2JEXA 4K35A 4K0KO 3CPWU 4LFAB 3OGIB 4NTWA 1N33O 1WPBA 4PDVA 3TJTA 5B66Z 1JFFB 3CCJV 5D5QA 5J2TB 2XTAA 2LFSA 4DRXA 4BW9A 2QWNB 3E86A 3T2MA 1YIJV 2ETNA 1JFFA 4U7OA 3UM7A 1WB8A 4YHHB 1SQPH 4F4LA 4PA6A 2WLHA 3ETDA 4X1KA 2OCCC 4ZI7A 4IYHA 5AG2A 3JALA 5D5PA 2DN9A 4JASA 4DV7O 2AHZA 1XMQB 3EXAA 2W0FC 4UV8A 3IGAC 1KQSU 3QNEA 1P7BA 4TUYA 2RQ6A 2V7QG 5IYZA 4Z1MG 2RMKB 5LA6A 1VIBA 2XNDG 4RO2A 3SYOA 2JS3A 4PDMA 2EIJC 5IJ9A 3CS5A 3RVYA 2QWQB 3JAKA 2WSSG 3E8FA 2YI8A 4NVPA 2BTOA 1Q82W 4HNAB 4P9PA 2X6BA 3G4SV 3L72H 3AG1B 1D2DA 5FNVA 2IM9A 2NN4A 3T1YO 3EFFK 4FFBA 1HW7A 3SGIA 1E1RG 3W7UA 1W59A 5IJ0B 3DC6A 5IJ9B 3P3NA 1MSDA 2Z5UA 4OPHA 4PI0A 2OCCB 3CJHB 3SJAC 4CC6A 4TV8A 2FL4A 1IDSA 3LDCA 3WG7B 4YY3B 5HFLA 2JS5A 1PPJH 2HKOA 3OAAG 2DYRC 2Z0AA 1TUBA 1GM9A 1Z5WA 4EKWA 4JAUA 2QA4V 3UO3A 1IX9A 3DXRB 3ZHQA 4JPRA 2QE7G 4B3SO 4LF5B 2JVDA 4QPJA 3B4SA 1H38A 3ABKC 3IJ4A 4U3JA 4MVRA 1PNMA 5LXTA 1DF5A 3JAMN 1V55C 3GWOA 2OIGA 3JAWB 4B7KA 3L73H 2ZR2A 1ZUQA 1NJIW 4DV4B 1K4CC 3HKBA 4D7TA 2YXHA 3N2KB 3CWBH 3AEIA 4UVAA 1R3JC 3P3PA 1R3IC 4ZHQA 2EJ7A 1VQKV 2RDCA 2WLMA 3IAYA 1NT2B 3BRCA 4GX5A 4LF4B 4JI4B 1R6TA 3F7YC 5KHJA 2HVKC 4JI6O 2EZOA 2P7TC 3WU2Z 5CBFA 3CCUV 1Y74B 3OEEG 4WCEV 4JI7B 1NQTA 1QVGU 4N21A 3SPIA 4J80A 4IIJA 4J42A 4ZHQB 1FS0G 2NNUA 2E75B 3DGEA 5LYJB 1KECA 3RYCA 2QSAA 2QM8A 2DYRB 1OCCC 3JASB 4JV5B 1KUQA 1M56B 2WLIA 2Q0OC 2B1GA 4DUZB 5L3BA 2PYJA 2UXBB 1HNXB 4O4LA 1QVFU 3DXRA 1ZWIC 1QBZA 4IIJB 5LP6A 2A79B 5LMNO 4FLWA 3I55V 3APOA 5KX5A 1Q6IA 2ZNIA 3ZMZA 2EIJB 5CA3A 5LP6B 5JH7B 3N27A 1YJ9V 1U97A 4EB6B 2OTJV 2JJ1G 2EINB 3ZN1A 3CXCU 1YF2A 3BA8A 1X59A 5L3CA 3OTOB 1S0VA 2PI5A 2H94A 2HJFC 4KUMA 3AG4B 1MA1A 2Q7EA 2BTQA 4RQEA 1NTKH 5KHIA 5IY5C 1LUVA 3CMAV 1N8RW 4Z1VA 3RW0A 2YI9A 4DV6B 4NXNO 5GTHZ 1Y6XA 4WFFA 1IBMB 3ABMB 4OXSA 3VBBA 3WG7C 5J2UB 2A06H 4B3TB 3S3WA 3S3XA 2HP8A 2WPDG 4I9WA 3A2FA 4B3SB 5J2UA 4LBEC 2XAJA 4LWSB 5F2VO 3CX5F 4GX2A 2B5UA 4FJCC 1N34O 2R9RB 4JI0B 2F1MA 1MNGA 5HFMA 2R9IA 2EILC 2W0XA 1EM1A 1QLEC 3RYFA 4HYOA 3VQXA 3G6BA 3ZMTA 1S3JA 4O2BA 3E22B 4UCSA 1SERA 3CCLV 4MW3A 1SZXA 2F4VO 4X89A 3K79A 4X62B 4QGPA 1LR1A 5JQGB 3K06A 4NR1A 4ZKIA 4E2LA 4YXWG 1E79G 2PGGA 5LHHA 2ARHA 4O4JA 4CS2A 5KMGB 2EINC 1UFIA 2KSDA 1JX9A 3ZX6A 4G2KA 1IBLO 3JCUZ 2DWDC 1JJOA 1LUWA 2Y48A 2PTMA 1DGSA 4FLVA 3CE2A 4GKJB 1VQPV 1K4DC 1SA0B 1J5EB 4MTFA 1W0JG 1XHZA 4L8JA 2OIEA 1XQ8A 2XT9A 4JI6B 3OR6C 2W6IG 4IYIA 1O9GA 3BVOA 4LC1A 2AZ0A 1U96A 2DW4A 3CRMA 1QLNA 4DUYO 1TUBB 3CB2A 4X65B 1FFXB 3W7WA 2ADQB 3J80N 1YTFB 2B1IA 4JYBA 5JVDB 1SETA 1OCRB 2QKCA 1Q7YW 2NR5A 3CHXA 1R3LC 4JI8B 1GKFA 5LXTB 3TCUA 5KA5A 1HR0O 3FFQA 3CCQV 4DV0O 2JDIG 1SF9A 3RYFB 3CCEV 3DSQA 5B1AC 2XUMA 2VWKA 1FJGB 4CH3A 4OGQB 3VQVA 2Q73A 1BMFG 3CC2V 2CDYA 4YIOA 3SR2C 1Q86W 3SYPA 1BE3H 1Q3EA 2KKWA 1KC8W 1SQXH 2YICA 2UUCO 3SJQC 1GM8A 3ASNB 3PN1A 1VQMV 1GH6A 2L35A 1KBHA 4X64O 1K33A 4UB6Z 1QQCA 2VWJA 3QF7A 1BL8A 1WA8B 5EC1C 1YTFD 1I08A 4BWAA 3UT5B 2P6JA 1GMGA 4RAIA 3FAVA 2RN9A 1O9HA 2WLIB 2K9PA 3TK1A 3JASA 2QKSA 1M1KW 1XL6A 2YIAA 3AG1C 1K9MW 3D36A 2QR4A 2LJ2A 3K5LA 4PA4A 4X62O 5ITZA 1RFYA 3ETQA 1JR9A 3HKDA 2VS0A 4X9QA 3B8NA 2Y0PA 1FFXA 4YJ3A 2IU3A 3H1LH 1FXKC 5EK0A 2NLJC 1N36B 4MT8A 1H2SB 4AI8A 4JYAB 1H8HG 3HR0A 3AG7A 4JYCA 1T5EA 4ZOLB 3U11A 4GUNA 3T1HO 1QLEB 1WAZA 2PI4A 4XDJA 2GHYA 3QTCA 1GN3A 2X0LA 5EYPB 1J5EO 4PDRA 1IBMO 2QGNA 2HLDG 1B6QA 3HKDB 2F66C 2JIZG 3FX7A 1VQLV 4UCUA 1K3EA 2WLLA 2E5LB 2VQEO 3AG2B 2KG7B 3SJCC 3JATA 1KMIZ 3KZIZ 2X7RB 3K5MA 1XDCA 2X6AA 2HEPA 4KHPO 4UCVA 2XAHA 4IHJB 4P9OA 2OWOA 2RJZA 3RWRD 4MVQA 4DRXB 5LA6B 3ZS8C 4RWUA 1PNLA 3FYIB 4GKKB 1Y76A 4U3JB 3WB0A 1WPXA 5IE9A 1BHBA 1IXMA 3JYCA 2JGDB 4FM0A 4C7UA 2P06A 1OZ0A 2LGWA 1J95A 4CBCA 3C3SA 2GDSA 3KG2A 5H2FZ 1H2KA 1NVPB 1CXZB 5GW7A 2Q7GA 3JARA 2XAGA 4PA7A 1DTOA 1I7FA 2LQTA 5KAIZ 1N0JA 5FL7G 5KUMA 2PY5A 2ZM6B 2Q8VA 2F23A 1M5IA 3MDSA 1GO3F 4JZ2A 2P90A 4P30A 2QWOB 4UVBA 2Y4UA 3O65A 4DV3O 3K0GA 4LFBO 5LBQA 1H2MA 3C3TA 2EILB 4R7CA 1P49A 1AVMA 2UXCB 1WB7A 2P4KA 1AROP 4LH7A 2OTLV 3T4DA 5FNVB 1IBLB 1VF6A 5IY5B 4W4KA 4JI1B 2K1EA 3H1KH 1L8DA 2ZIOA 5H9CA 1JPXA 4I4TA 2GV9A 2JGUA 1XMQO 2PZSA 2OYQA 1WP8A 1EZJA 1JCHA 4UV9A 1TGOA 1FKAO 2RNBA 5IDJA 1MOFA 3K9AA 2R70A 3ZHTA 4ZOLA 2VQFO 5FPRA 4EB6A 3O9OA 2BE3A 4X1YB 4NTXA 5J9PC 3GB7C 3ZRWA 4L87A 3A8TA 2Y4TA 4I4TB 1NS1A 5EBWC 1NTZH 1VP7A 1VF5B 5KLVH 4ABMA 4K8XA 3OFNG 2D3OW 5JVDA 2Q5ZA 4FM2A 4G28B 1VF6C 1TVKB 1ZL8B 4FFKA 3J7AU 1BCCH 4MW8A 2OT5A 4Q20A 4X1YA 1SC5B 1NR7A 1KD1W 4I55A 4GCZA 5B3SB 4JTDB 2UUAB 2M6YA 2F43G 2ZXWB 3LUTB 2KQXA 3L71H 2KG7A 4KHPB 1N36O 2EZPA 3W7TA 4JYYA 4DV7B 4XBFA 2Q9LA 4FM1A 2A0LA 3K03A 1EZVH 4LF7O 2YXYA 2ZM6O 4FLXA 3B40A 3E8GA 3E8HA 4I55B 3CCRV 4LR3A 4LF6O 1BSMA 3IC7A 5LGTA 1VMGA 1XEQA 3G80A 4JF3A 1ZX3A 3VQWA 4HNAA 4R6ZA 4PA9A 1Q43A 2WLJA 3ETGA 1I94B 1XREA 1YVWA 3ABUA 4O2BB 5IYZB 1HNWO 4H13B 1NH2B 2ZE7A 3D3QA 1M57C 4TSFG 1OCRC 3AG3C 1K34A 4YJ3B 5DM6V 2EIMC 4MTXA 5ITZB 3K57A 2IJKA 4TV8B 1AJPA 3KKYA 5LL6Y 2ILMA 1IVSA 2WLNA 4YY3O 5CB4B 1H8EG 2HG5C 3L70H 3OUSA 4NKGB 5JH7A 1AP6A 2A7WA 1S5LZ 1B3QA 2FKXA 3ZRWB 3SYCA 1PV0A 4YJ2A 1EFRG 2GSMB 2JJ2G 2EJRA 2UXDB 2D2CB 3IC9A 5L3EA 2XAFA 1ZAUA 4QJFB 4YJ2B 1FD9A 2DQ3A 5IJ0A 2BSKB 2MW2B 1PNKA 3F7VC 3HKCB 2YSUB 3ZHUA 3JATB 3D3IA 2ZIMA 4H44B 5JCOA 4UCRA 5GONB 4MVOA 5CB4A 1Y67A 3OGCC 4TQFA 2GUZA 5LMUB 1JMKC 3B2EE 2XAQA 2EX3A 1CPYA 2CTQA 1W0KG 2IH3C 2O57A 3BFRA 4UB8Z 5L3DA 4AILC 4DR1O 4J10A 4WFHA 4FZ1A 4ICGA 1KP3A 4DV1B 2ITCC 1A32A 5IWAB 3T1HB 2PUSA 4KL1A 1SRYA 4JI3B 4DR6B 1IBKB 4JI2B 3SYQA 3OE7G 5BMVA 3AG4C 3H9VA 4Z2WA 5L3FA 4LFBB 4QIWF 2EIKB 2ADPA 4DV2O 4HBNA 1HNZO 3D36C 2XHBA 3BA9A 1L1FA 4HAMA 5BMVB 1PM9A 1WNSA 2F93B 2UXXA 1PP9H 2UXBO 5KHKA 5CBHA 1AI6A 1FYJA 2HVJC 1Q6UA 4WFEA 2BOCC 2UXNA 3BAAA 1L0NH 4I9QA 1MZEA 3WFVA 1F7YA 4J11A 4LWSA 4UCTA 2Q68A 4CH6A 1QR9A 1MG1A 1Q81W 1AJQA 2GTAA 5EBLC 2YIBD 4JAVA 2QWPB 2ZE8A 1NR1A 3P30A 4DV3B 2DYSC 2R9AA 3ZRXA 2QEXV 3E89A 4NB5A 3OTOO 3ZN0A 3HPLC 1AR5A 4X66O 2YS8A 1OCCB 2F4VB 2UUAO 3ICXA 1D5NA 3SPGA 3E35A 2PF4E 3KCYA 3JCZA 4J41A 1G8MA 1TAEA 1YXBA 3SDLA 2YEVA 5E1AC 2Y69C 4DR4B 5E79Z 2EULA 2HR3A 4K3AA 4BIZA 3CRQA 5IT9N 1FXHA 4DV6O 3EHBB 3U10A 1ENVA 1K5QA 3RT3C 4FPPA 1HNXO 1R73A 2LP7A 3RFRA 2H8PC 2Y69B 4I50A 3ABLC 4GT1A 2LGQA 5LYJA 5KMGA 3L75H 2LFRA 3SPJA 2UXDO 1HNWB 1OCZB 1S72V 2PYLA 3X2QB 3ZJZA 4LF7B 3JSLA 1I5XA 2P22C 3E83A 3FKSG 4J7JA 4O2AB 1R6KA 4DR3O 4D6TH 1RM1B 5LMUO 4EFBA 4HZ3A 4J9ZB 4KP4A 1V9PA 4JI7O 3X2QC 3ASOC 5LGUA 5LMNB 3OD4A 5EIBC 2ZDIA 1N32B 2YIDA 5EZYB 1M90W 3CEIA 4B3TO 4X20B 4QNHB 4DR7O 3JD3A 3RYHA 3H1HH 1V55B 4WBNB 3G71V 1Q5OA 4O2AA 4ZI7B 4LF9B 4JV5O 4O4HB 4LCUC 2HJDA 1GN6A 2CGNA 1V54B 3QG5A 1R1BA 4IHJA 1IXBA 1I5YA 1NTMH 4X8AA 3LNNA 5BZBA 2Q0AA 5CA1B 1OHHG 2IW5A 4P2ZA 1RP3B 4EEQA 4PI2A 4DK1A 4WFAV 1H2GA 1IURA 1MSWD 4F6RA 2X6CA 5BY1A 3JARB 3TXSA 4NXMB 1FXKA 1I94O 3CC4V 1YJWV 1XBLA 2AGAA 2EBOA 5L3GA 4I0XA 4MVMA 4FLTA 4JAAA 3JAKB 4PV1B 1JJ2U 1NI8A 3CXHF 4R50A 1TUEB 3LSSA 2WA3A 3G67A 2WAMA 2JEUA 1SQGA 4DR5O 2IJIA 1DK1A 2CH7A 4AQYO 2FB5A 1H2LA 1WN7A 2ODMA 4DR2O 3CCMV 3VOUA 5B1OA 3K5NA 4NTYA 4JI2O 2WWWA 1Q8IA 3MD0A 4OPAA 3RYIB 3SPHA 5K1PA 3CCSV 3UT5A 3ZMVA 3FB5C 1BS3A 3T4ZA 3FAVB 4CZZA 4JI5O 4X66B 3AK1A 2XASA 2IJHA 3TETA 1QR8A 1JVMA 1LNQA 3ZEDA 4ASUG 2QM7A 5LHGA 4BW5A 3Q4HA 1HWYA 2CK3G 4PA3A 5EYPA 4FVMA 1V54C 4DV1O 2BTQB 3RBZA 3L9DA 3LDEA 3T1YB 4QPKA 1WP7A 5GONA 4TUYB 1AB3A 1K97A 2KB1A 5IYDO 3SPCA 1GM7A 3OUFA 3Q4HB 1SQFA 3JSNA 1YI2V 4X1KB 3NXSA 1I0HA 3STLC 2EIMB 2DQ0A 2QWRB 4I5SA 1Y76B 5EC2C 4GKJO 1RM1C 1GN4A 1K5SA 1M4UA 5J2TA 1HNZB 3GVMA 5B1AB 4B08A 3ZCCA 5A9GA 1SS3A 5BR8O 1PKXA 4GX1A 1YZBA 2LW7A 3N2GA 4JGSA 1VQNV 2IBZH 3QO5A 3ML0A 1FFTB 1PD3A 3J81N 2QJ1A 5EBMC 3OR7C 3ZBHA 2HHHO 4K0KB 4Q6GA 2FTKA 4DR4O 3GWKC 2IU0A 3RYCB 3ABMC 3LNMB 1YITV 4NXMO 1TA8A 2WA4A 2YUAA 5DECA 5B5EZ 3OEHG 4TWKA 4FZ0A 4K8ZA 5JCOC 2FMLA 3N2GB 4PDLA 2HFEC 5B1BB 3M8AA 4X64B 1BT8A 5C93A 3CP1A 1L0LH 1QCEA 1K73W 2WLLB 4ZBMA 2ZE6A 3EVKA 4B3MB 1ZTEA 3CMEV 2AXTZ 5KAFZ 3WB1A 5BXZA 4JI1O 3FB7C 1XHXA 4WFBV 1VQ5V 2CH7B 3H01A 5FLXN 1H2NA 4DR2B 3FB8C 2CUGA 4UCOA 4DV5B 2DYSB 3CRCA 3DC5A 4AHCA 2UUCB 1S5JA 3ZIAG 1UPGA 4YHHO 1XMOB 3HB3B 4DW1A 5B1BC 4DR5B 4O4IA 1BQ0A 2VRZA 3CRAA 1OCOC 4X88A 1FAFA 1M9NA 2GUZB 3JD4A 1Z2GA 2BCCH 4ZIBA 2QKAA 1RPRA 4X20A 4UUJC 2V4DA 1S77D 1NZ6A 4GYCB 3K58A 3F5WC 4DR7B 4WBNA 1GRJA 3K04A 3RGBA 3HKCA 5JJEB 1R3KC 2CAZC 4J7ZA 3WB2A 4X1IA 2N04A 4LF8O 1TVKA 3K9SA 4CH5A 4CS4A 5CA1A 3JAWA 2JRIA 1QHTA 4BIOA 4CS3A 3A0HZ 2Q4PA 1KKDA 2N74A 1F51A 2Q67A 4QE7A 4BIUA 1XNQO 4O4LB 5CBGA 3JD1A 4FFBB 3OMIB 5KHHA 1QU7A 4GZRB 4NXNB 1P4RA 3HKEA 2QM4A 4B7EA 1XOUA 2UU9O 4MTGA 1VQOV 1KYOF 1M93A 2XOKG 2JGDA 1G1XB 3JD2A 3I5DA 3CRRA 3T1CA 1R6NA 4LF6B 1GTOA 4DO2A 4MVUA 1YDXA 5JJJB 4MS2A 4FLUA 3F5TA 3L74H 4IL6Z 1DLBA 4I7ZB 5CN0A 3STZC 2Y0IA 1B04A 2CGOA 1P7GA 4LFCO 1Q6HA 4QE9A 2DJVA 1VQ9V 1KU9A 4KFMA 4LNUA 4A5UB 4DV5O 3D8CA 1EBOA 2UXCO 2C2AA 1BQZA 2YEVB 3W7XA 1ORQC 3APQA 2VQFB 2HHHB 3RVZA 2ZR3A 4AQYB 3IFXA 1SQQH 1NH2D 3ZHSA 5EIBD 4O4IB 1RPOA 4B3MO 5KA6A 3SJBC 3ZHVA 1NU1H 4LP8A 2DWEC 3AK3A 5B3SC 3LSUA 4IT5A 5H6RA 4JTAB 1F23A 1VARA 1THZA 2G38A 1SESA 2ZCEA 2W6JG 3K3WA 3G6EV 3E22A 4JI5B 4TQDA 1JOYA 3B77A 3N2KA 5IYBO 3JALB 3UQ8A 4X1IB 2Q7HA 4OX9O 1FPOA 4WF9V 1HP8A 2AW9A 5H6QA 4X65O 2V1DA 2AZ2A 4PHZA 3BCCH 1AI7A 4J7KA 1VQ7V 1UJWB 1G4YB 1XUQA 4JI3O 4DR6O 5DEDA 1Q90D 4MVZA 3FB6C 4DW0A 2P67A 4O4HA 3CC7V 3LDDA 3MAQA 4H33A 4B3RO 2UU9B 2QTOA 3R66A 3FYEB 3UKMA 3HKEB 1N34B 2P5OA 3ABKB 3UCSC 3RN4A 1W2BU 4MVSA 5DN6G 1HR0B 5FPOA 2BOBC 2UUBB 4GX0A 3ZRSA 2B9ZA 3P32A 2Q69A 3ABTA 4U7NA 5K1XA 2L6LA 2CTPA 3ABLB 4F6EA 2JK5C 1Y74A 1F4NA 3E8BA 5BR8B 4LF8B 2GBOA 4R8CA 2Q6AA 3R65A 5LOVB 4XDKA 2F95B 4DXWA 3RYIA 1VF7A 4UXNA 5JJNB 2MK3A 4MTOA 1K7DA 4JI0O 5EZYA 5CA0A 1XI1A 2DMXA 5C8YA 3ZRVA 2YC0A 1SQVH 3B09A 4PD4F 3QO7A 4J9YB 1AR4A 1KP2A 3PJSK 4FIPC 1BGYH 2H3OA 4DR1B 4XDLA 1P84F 4DV2B 4RUFA 2BSKA 3M99B
chains in the Genus database with same CATH topology
5KUMA 3VOUA 5B1OA 1K4CC 1GO3F 2P90A 2WWWA 3AEIA 4P30A 4UVAA 3MD0A 4UVBA 1R3JC 1YHQV 1R3IC 1VQKV 3K0GA 1OCZC 3SPHA 2IH1C 3CCSV 3ZMVA 3FB5C 2WLMA 3A0RA 5LHIA 5LBQA 2EILB 3T4ZA 4CZZA 4R7CA 4GX5A 2XASA 1AROP 2IJHA 3F7YC 3TETA 2HVKC 1K8AW 2OTLV 3OW2U 3CD6V 1QR8A 3BY6A 1S76D 1JVMA 1LNQA 2ZQMA 3T4DA 4ASUG 1CEZA 2EZOA 2P7TC 2QM7A 5LHGA 5CBFA 3CCUV 5IY5B 4BW5A 1COWG 2Z3YA 3OEEG 2K1EA 4WCEV 1HWYA 1NQTA 5H9CA 2CK3G 4PA3A 1QVGU 2ATKC 1JPXA 4PELA 4N21A 3SPIA 1V54C 3RBZA 1FS0G 4FK5C 1XL4A 2NNUA 3LDEA 1EZJA 1JCHA 4UV9A 3DGEA 5IDJA 1MOFA 3K9AA 4QPKA 1KECA 3E2EA 1E1QG 2QM8A 2DYRB 1OCCC 1K97A 3JD0A 1M56B 2WLIA 2KB1A 5J9PC 5IYDO 3GB7C 2B1GA 3ZRWA 2EIKC 1GM7A 3OUFA 4L87A 3SPCA 5L3BA 4H37A 1QVFU 1YI2V 3NXSA 3ETEA 1ZWIC 5EBWC 3STLC 2EIMB 1QBZA 2DQ0A 3OM3B 3AG2C 4I5SA 3OFNG 5EC2C 2A79B 1JQ0A 2D3OW 3LSQA 1RM1C 1K92A 1DF4A 1K5SA 3I55V 4BAYA 4G28B 3ZMZA 2EIJB 5CA3A 5B1AB 1M57B 1YJ9V 2OTJV 1VQ4V 2A9HA 4TT3G 3ZCCA 2AHYA 2OT5A 2JJ1G 4MW8A 3OMAB 4Q20A 2EINB 3ZN1A 3CXCU 1PKXA 5IYCO 5L3CA 1S0VA 4GX1A 1NR7A 2PI5A 1AI5A 1KD1W 2H94A 1YSCA 4JGSA 1VQNV 3QO5A 4GCZA 3ML0A 5B3SB 1FFTB 1BHAA 2HJFC 1Y66A 4JTDB 1PD3A 4KUMA 3AG4B 3W7SA 2F43G 5EBMC 2ZXWB 4JTCB 3OR7C 4RQEA 3I56V 3LUTB 5IY5C 2FTKA 1GK9A 2IU0A 3CMAV 1N8RW 3RW0A 2EZPA 3K0DA 3ABMC 3W7TA 3LNMB 4XBFA 1VQ8V 1YITV 2A0LA 4WFFA 3ABMB 4OXSA 3VBBA 3WG7C 1M56C 2ZD9A 3OEHG 4TWKA 3K03A 2WLKA 3CCVV 2WPDG 3E8GA 4I9WA 3E8HA 4PDLA 3CCRV 2HFEC 4LBEC 3ZMUA 5B1BB 2XAJA 3IC7A 5LGTA 5C93A 3CP1A 1QCEA 4GX2A 3AG3B 2B5UA 4JF3A 1K73W 2WLLB 4ZBMA 4FJCC 4UVCA 4R6ZA 2R9RB 3BEHA 4PA9A 2WLJA 3ETGA 3CMEV 3ABUA 4MSWC 5HFMA 2R9IA 2EILC 3FB7C 1QLEC 3DTUB 4HYOA 4WFBV 1NVPD 1VQ5V 3H01A 3ZMTA 3K08A 1MABG 1S3JA 1NH2B 3FB8C 1FXKB 1SERA 1M57C 4TSFG 3CCLV 1OCRC 2DYSB 3AG3C 4MW3A 1K34A 1WLEA 1VQ6V 3ZIAG 4X89A 5DM6V 2EIMC 3K79A 4MTXA 1YJNV 2ITDC 3HB3B 2ZXWC 5B1BC 3K06A 2IJKA 4ZKIA 1AJPA 1ROPA 1CP9A 4E2LA 5CMUA 1NBMG 2WLNA 4YXWG 1E79G 5LHHA 1NKDA 1H8EG 1OCOC 4X88A 1M9NA 1FXVA 2HG5C 3JD4A 3OUSA 2EINC 1S5HC 1JX9A 4G2KA 1RPRA 4UUJC 1S77D 2DWDC 3ZRWB 3SYCA 2Y48A 3F5WC 2IJJA 3K04A 1EFRG 5KUKA 2GSMB 1AJNA 2JJ2G 2EJRA 1K4DC 1VQPV 5B1NA 5L3EA 2XAFA 3ZMSA 4QJFB 4MTFA 2DQ3A 3CYOA 1PNKA 1R3KC 3F7VC 2YSUB 1W0JG 3B8MA 3ASNC 4N23A 3D3IA 1AR1B 1Y4MA 4MVOA 2ZDIC 3OGCC 3OR6C 2W6IG 2XAQA 1OCOB 1AI4A 2M7WA 1CPYA 4LC1A 1W0KG 2DW4A 2IH3C 1KKDA 5L3DA 1QLNA 1F51A 2Q67A 3ASOB 4QE7A 4WFHA 4BIUA 1KP3A 3QO8A 2ITCC 4WFGA 1SZTA 5CBGA 3JD1A 4RUEA 3OMIB 1SRYA 3W7WA 5LGNA 1F4MA 3SYQA 1YTFB 3MHSC 2B1IA 4JYBA 1P4RA 1SETA 1OCRB 3OE7G 3AG4C 5L3FA 4G27B 3OMNB 4QIWF 4MTGA 1VQOV 2EIKB 1Q7YW 1R3LC 2XOKG 3JD2A 1GKFA 1L1FA 4HAMA 3TCUA 3T1CA 3SYAA 2UXXA 1R6NA 1PL0A 5CBHA 1AI6A 2HVJC 5KA5A 4WFEA 1GTOA 2BOCC 3CCQV 2JDIG 2UXNA 4RQFA 4DO2A 4MVUA 4MS2A 3MHHC 3CCEV 5B1AC 3WFVA 4FMTA 2Q68A 2JEXA 3M99B 1MG1A 1Q81W 3CPWU 1DLBA 1AJQA 5CN0A 1BMFG 5EBLC 3STZC 3CC2V 4JAVA 4PDVA 1NR1A 3P30A 2DYSC 4QE9A 3ZRXA 3CCJV 1Q86W 3SYPA 1VQ9V 2QEXV 4KFMA 3E89A 2LFSA 1EBOA 3ZN0A 3HPLC 3E86A 1KC8W 3T2MA 1YIJV 2C2AA 4U7OA 3UM7A 2YEVB 1OCCB 3SJQC 3W7XA 1ORQC 3SPGA 3E35A 1GM8A 4F4LA 2WLHA 3ASNB 3ETDA 3JCZA 4PA6A 1VQMV 1G8MA 2OCCC 2YEVA 3RVZA 2ZR3A 5E1AC 2Y69C 1K33A 3IFXA 1NH2D 2HR3A 4BIZA 1FXHA 1RPOA 3EHBB 1ENVA 4JASA 1K5QA 5KA6A 2AHZA 1BL8A 4FPPA 5EC1C 1YTFD 2W0FC 4UV8A 1R73A 2LP7A 4LP8A 2H8PC 2DWEC 5B3SC 2Y69B 3IGAC 5H6RA 3ABLC 4GT1A 4JTAB 2P6JA 1KQSU 1GMGA 3QNEA 1F23A 4RAIA 1P7BA 2LFRA 1THZA 3SPJA 1SESA 2WLIB 2V7QG 2W6JG 3K3WA 4Z1MG 3TK1A 3G6EV 2QKSA 1OCZB 1M1KW 1XL6A 1S72V 3AG1C 3X2QB 3ZJZA 2XNDG 1K9MW 3D36A 1I5XA 4RO2A 3SYOA 3E83A 3FKSG 3B77A 1JOYA 4PA4A 1R6KA 2EIJC 4PDMA 5IYBO 3B8NA 1RM1B 3RVYA 2IU3A 4HZ3A 2WSSG 3E8FA 4J9ZB 4KP4A 1FXKC 5EK0A 3X2QC 2NLJC 3ASOC 5LGUA 1Q82W 4MT8A 4WF9V 2ZDIA 4P9PA 1H8HG 5H6QA 2V1DA 1M90W 2X6BA 1AI7A 3G4SV 4JYCA 3AG1B 1VQ7V 1QLEB 4QNHB 1UJWB 1G4YB 2PI4A 4XDJA 2GHYA 3JD3A 4MVZA 1V55B 3FB6C 3EFFK 2P67A 2X0LA 3G71V 3CC7V 3LDDA 4PDRA 4H33A 2QTOA 1E1RG 2HLDG 3W7UA 1B6QA 2JIZG 1VQLV 1K3EA 2WLLA 3FYEB 4LCUC 3UKMA 3ABKB 2Z5UA 3AG2B 1W2BU 1V54B 4MVSA 2OCCB 5DN6G 1I5YA 4X8AA 5BZBA 2X7RB 1OHHG 2IW5A 3LDCA 2BOBC 4P2ZA 2X6AA 3WG7B 4WFAV 4GX0A 5HFLA 1H2GA 2XAHA 3ZRSA 4P9OA 1MSWD 3P32A 2HKOA 2X6CA 3OAAG 1FXKA 2DYRC 2Q69A 4MVQA 3CC4V 1GM9A 4EKWA 1YJWV 3ABTA 4JAUA 4U7NA 2QA4V 3ABLB 1PNLA 3FYIB 4JPRA 2JK5C 2QE7G 1F4NA 3E8BA 2EBOA 5L3GA 1WPXA 2Q6AA 4MVMA 3R65A 4R8CA 4XDKA 4QPJA 1BHBA 1IXMA 1H38A 3JYCA 3ABKC 1JJ2U 4DXWA 1OZ0A 4MVRA 1PNMA 4UXNA 1J95A 2MK3A 4MTOA 4CBCA 1K7DA 4R50A 1DF5A 1TUEB 3LSSA 3KG2A 2WAMA 1V55C 2JEUA 1NVPB 2IJIA 3GWOA 5GW7A 3ZRVA 2XAGA 4PA7A 3QO7A 4J9YB 1KP2A 3PJSK 4FIPC 1DTOA 4XDLA 2ZR2A 3CCMV 1NJIW 4RUFA 5FL7G 1QR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KUM A;  3VOU A;  3AG1 C;  3ZJZ A;  1K4C C;  3RW0 A;  4RO2 A;  3SYO A;  3E83 A;  2IH3 C;  3K0D A;  1KKD A;  3ABM C;  4P30 A;  4PA4 A;  4PDM A;  2EIJ C;  1R3J C;  3LNM B;  1R3I C;  2Q67 A;  4QE7 A;  4WFH A;  3K0G A;  2A0L A;  1OCZ C;  4WFF A;  2IH1 C;  4OXS A;  3SPH A;  3RVY A;  2ITC C;  3WG7 C;  3FB5 C;  2WLM A;  5IY5 C;  1M56 C;  4WFG A;  2ZD9 A;  3OR6 C;  4TWK A;  5CBG A;  3T4Z A;  3K03 A;  3E8F A;  4HZ3 A;  2WLK A;  4J9Z B;  4RUE A;  4R7C A;  4GX5 A;  5EK0 A;  3X2Q C;  2NLJ C;  3ASO C;  3E8G A;  3F7Y C;  3SYQ A;  3TET A;  2HVK C;  4I9W A;  3E8H A;  4PDL A;  1JVM A;  4P9P A;  2HFE C;  4LBE C;  1LNQ A;  3AG4 C;  4G27 B;  3T4D A;  4MTG A;  2X6B A;  2P7T C;  1R3L C;  5CBF A;  4BW5 A;  4QNH B;  1G4Y B;  4GX2 A;  4XDJ A;  2K1E A;  2WLL B;  4ZBM A;  3TCU A;  4MVZ A;  3SYA A;  3T1C A;  4PA3 A;  2R9R B;  3EFF K;  3FB6 C;  3BEH A;  2ATK C;  4PA9 A;  4R6Z A;  2WLJ A;  3SPI A;  3LDD A;  5CBH A;  2HVJ C;  1V54 C;  4H33 A;  4PDR A;  4WFE A;  2BOC C;  2QTO A;  3RBZ A;  1XL4 A;  4MVU A;  4MSW C;  3LDE A;  2WLL A;  2EIL C;  4LCU C;  3UKM A;  4MS2 A;  3FB7 C;  5B1A C;  1QLE C;  4HYO A;  4MVS A;  2Q68 A;  3K08 A;  3FB8 C;  4X8A A;  1M57 C;  1OCC C;  1OCR C;  5BZB A;  3AG3 C;  3LDC A;  2BOB C;  4MW3 A;  2WLI A;  4P2Z A;  2KB1 A;  2X6A A;  5J9P C;  5EBL C;  4GX0 A;  3STZ C;  3GB7 C;  3ZRS A;  4X89 A;  2EIM C;  2ITD C;  4PDV A;  4P9O A;  2EIK C;  3SPC A;  3OUF A;  2X6C A;  2ZXW C;  5B1B C;  3K06 A;  2DYS C;  4QE9 A;  3SYP A;  2DYR C;  2Q69 A;  4H37 A;  4MVQ A;  4EKW A;  4KFM A;  3E89 A;  5EBW C;  1ZWI C;  3STL C;  3HPL C;  3E86 A;  2WLN A;  3AG2 C;  3T2M A;  3UM7 A;  2JK5 C;  5EC2 C;  3SJQ C;  2A79 B;  3E8B A;  1OCO C;  1ORQ C;  4X88 A;  3SPG A;  2HG5 C;  4R8C A;  2Q6A A;  3OUS A;  3R65 A;  2WLH A;  4MVM A;  4PA6 A;  4G28 B;  4XDK A;  4F4L A;  2OCC C;  2EIN C;  1S5H C;  2YEV A;  3RVZ A;  5E1A C;  2Y69 C;  3IFX A;  3JYC A;  4UUJ C;  3ABK C;  2DWD C;  3SYC A;  4DXW A;  3F5W C;  4MVR A;  2A9H A;  1J95 A;  3K04 A;  4MTO A;  2AHY A;  4MW8 A;  4CBC A;  4R50 A;  5KUK A;  1K4D C;  2AHZ A;  1BL8 A;  3KG2 A;  5EC1 C;  1V55 C;  2W0F C;  4MTF A;  4GX1 A;  4LP8 A;  2H8P C;  2DWE C;  5B3S C;  3IGA C;  1R3K C;  3F7V C;  4PA7 A;  4J9Y B;  3ABL C;  4JTA B;  2HJF C;  3PJS K;  3ASN C;  4JTD B;  4RAI A;  1P7B A;  3SPJ A;  4RUF A;  2WLI B;  4MVO A;  5EBM C;  4JTC B;  3OR7 C;  4XDL A;  3LUT B;  3OGC C;  2QKS A;  1XL6 A; 
#chains in the Genus database with same CATH topology
 1HDJ A;  1XNR O;  1IBK O;  1YHQ V;  1SKV A;  1PL4 A;  4H0L B;  4TV9 A;  1AIL A;  1OCZ C;  2IH1 C;  4I50 B;  5LHI A;  3A0R A;  1N4C A;  1N0N A;  1GN2 A;  2LO1 A;  4TV9 B;  1K8A W;  3CD6 V;  3OW2 U;  1Z5V A;  3BY6 A;  1S76 D;  4NYK A;  2ZQM A;  3NR7 A;  1CEZ A;  4EFE A;  1COW G;  2ZIN A;  2Z3Y A;  1N33 B;  1SQB H;  2ATK C;  4LFC B;  1VEW A;  1ZLZ A;  4PEL A;  4DUY B;  5JQG A;  2P4V A;  3K5O A;  4FK5 C;  1XL4 A;  1XMO O;  2YDE A;  3THO A;  3M7M X;  4CC5 A;  3E2E A;  3BHP A;  1E1Q G;  3JD0 A;  2N05 A;  4CH4 A;  2OCH A;  1EN5 A;  2EIK C;  3VQY A;  4DR3 B;  3QVN A;  4H37 A;  4FLY A;  4DV0 B;  3ETE A;  2E74 B;  3OM3 B;  3AG2 C;  1JQ0 A;  3LSQ A;  1K92 A;  1DF4 A;  4I0X B;  1N32 O;  1ZSP A;  2RCV A;  4O4J B;  4BAY A;  2E3C A;  4UFZ A;  1D5A A;  1OV9 A;  4LFA O;  1M57 B;  1VQ4 V;  2A9H A;  4TT3 G;  2AHY A;  5CA0 B;  3OMA B;  1MZF A;  5IYC O;  1AI5 A;  2ZT9 B;  1YSC A;  2E5L O;  1BHA A;  4PJ0 Z;  1Y66 A;  3K59 A;  1AP5 A;  4E4E A;  2CE4 A;  3W7S A;  4JTC B;  1MMM A;  3I56 V;  1XNQ B;  5IWA O;  1GK9 A;  5KHG A;  3K0D A;  3ZHR A;  2A3Q A;  1VQ8 V;  4FLZ A;  4B3R B;  4LNU B;  4JI8 O;  1KB9 F;  1M56 C;  2ZD9 A;  1EN4 A;  2WLK A;  3CCV V;  3H1I H;  1QNM A;  2CTR A;  4BR6 A;  3ZMU A;  5A2Q N;  2QDO A;  4U3F H;  2ZE5 A;  3AG3 B;  3TGU H;  4UVC A;  4GLX A;  3BEH A;  1FJG O;  4DYL A;  3BAB A;  3OTF A;  3BPZ A;  3TXQ A;  1JA8 A;  3C90 A;  4MSW C;  4OX9 B;  4LH6 A;  4KXR A;  3DTU B;  5H5N A;  4LF5 O;  5LP6 C;  4JZG A;  1NVP D;  1B06 A;  1MAB G;  3K08 A;  1FXK B;  4W4L A;  4DK0 A;  1XNR B;  1WLE A;  1VQ6 V;  3A0B Z;  3OT7 A;  2ITD C;  1YJN V;  2ZXW C;  1URF A;  1XIL A;  1KKC A;  1ROP A;  3HKB B;  1CP9 A;  1YCI A;  5CMU A;  1WA8 A;  1NBM G;  3CSX A;  1BZK A;  2R72 A;  2VQE B;  4F6R B;  1NKD A;  4JYA O;  1FXV A;  4D7S A;  1WJZ A;  2DOS A;  1S5H C;  3H1J H;  2YXL A;  5TIS Z;  3RYH B;  2IJJ A;  4YIP A;  2ZKO A;  5KUK A;  1AJN A;  5B1N A;  3ZMS A;  5GTI Z;  3CYO A;  4DV4 O;  1IZ3 A;  1SA0 A;  3KCX A;  3B8M A;  3ASN C;  4N23 A;  1AR1 B;  1G6U A;  2ZNJ A;  1Y4M A;  2ZDI C;  3FD9 A;  1US6 A;  1OCO B;  1AI4 A;  2M7W A;  4JI4 O;  2DE0 X;  2E76 B;  3ASO B;  3QO8 A;  2QTS A;  4WFG A;  1SZT A;  5LOV A;  4RUE A;  4GKK O;  2YIB A;  1RSO B;  5LGN A;  1F4M A;  1YEW A;  3MHS C;  4G27 B;  3OMN B;  4LF9 O;  5KX5 B;  3U0Z A;  1RSO A;  5JWP A;  3CJH A;  1ZL8 A;  2LW1 A;  4LF4 O;  3SYA A;  1PL0 A;  1X4T A;  1OJH A;  2CTW A;  3UO2 A;  5C8Y B;  3AK2 A;  4RQF A;  4IGG A;  4TOI A;  2UUB O;  1EN6 A;  3MHH C;  1GAX A;  2FYU H;  4DUZ O;  4FMT A;  2GTS A;  2JEX A;  4K35 A;  4K0K O;  3CPW U;  4LFA B;  3OGI B;  4NTW A;  1N33 O;  1WPB A;  4PDV A;  3TJT A;  5B66 Z;  1JFF B;  3CCJ V;  5D5Q A;  5J2T B;  2XTA A;  2LFS A;  4DRX A;  4BW9 A;  2QWN B;  3E86 A;  3T2M A;  1YIJ V;  2ETN A;  1JFF A;  4U7O A;  3UM7 A;  1WB8 A;  4YHH B;  1SQP H;  4F4L A;  4PA6 A;  2WLH A;  3ETD A;  4X1K A;  2OCC C;  4ZI7 A;  4IYH A;  5AG2 A;  3JAL A;  5D5P A;  2DN9 A;  4JAS A;  4DV7 O;  2AHZ A;  1XMQ B;  3EXA A;  2W0F C;  4UV8 A;  3IGA C;  1KQS U;  3QNE A;  1P7B A;  4TUY A;  2RQ6 A;  2V7Q G;  5IYZ A;  4Z1M G;  2RMK B;  5LA6 A;  1VIB A;  2XND G;  4RO2 A;  3SYO A;  2JS3 A;  4PDM A;  2EIJ C;  5IJ9 A;  3CS5 A;  3RVY A;  2QWQ B;  3JAK A;  2WSS G;  3E8F A;  2YI8 A;  4NVP A;  2BTO A;  1Q82 W;  4HNA B;  4P9P A;  2X6B A;  3G4S V;  3L72 H;  3AG1 B;  1D2D A;  5FNV A;  2IM9 A;  2NN4 A;  3T1Y O;  3EFF K;  4FFB A;  1HW7 A;  3SGI A;  1E1R G;  3W7U A;  1W59 A;  5IJ0 B;  3DC6 A;  5IJ9 B;  3P3N A;  1MSD A;  2Z5U A;  4OPH A;  4PI0 A;  2OCC B;  3CJH B;  3SJA C;  4CC6 A;  4TV8 A;  2FL4 A;  1IDS A;  3LDC A;  3WG7 B;  4YY3 B;  5HFL A;  2JS5 A;  1PPJ H;  2HKO A;  3OAA G;  2DYR C;  2Z0A A;  1TUB A;  1GM9 A;  1Z5W A;  4EKW A;  4JAU A;  2QA4 V;  3UO3 A;  1IX9 A;  3DXR B;  3ZHQ A;  4JPR A;  2QE7 G;  4B3S O;  4LF5 B;  2JVD A;  4QPJ A;  3B4S A;  1H38 A;  3ABK C;  3IJ4 A;  4U3J A;  4MVR A;  1PNM A;  5LXT A;  1DF5 A;  3JAM N;  1V55 C;  3GWO A;  2OIG A;  3JAW B;  4B7K A;  3L73 H;  2ZR2 A;  1ZUQ A;  1NJI W;  4DV4 B;  1K4C C;  3HKB A;  4D7T A;  2YXH A;  3N2K B;  3CWB H;  3AEI A;  4UVA A;  1R3J C;  3P3P A;  1R3I C;  4ZHQ A;  2EJ7 A;  1VQK V;  2RDC A;  2WLM A;  3IAY A;  1NT2 B;  3BRC A;  4GX5 A;  4LF4 B;  4JI4 B;  1R6T A;  3F7Y C;  5KHJ A;  2HVK C;  4JI6 O;  2EZO A;  2P7T C;  3WU2 Z;  5CBF A;  3CCU V;  1Y74 B;  3OEE G;  4WCE V;  4JI7 B;  1NQT A;  1QVG U;  4N21 A;  3SPI A;  4J80 A;  4IIJ A;  4J42 A;  4ZHQ B;  1FS0 G;  2NNU A;  2E75 B;  3DGE A;  5LYJ B;  1KEC A;  3RYC A;  2QSA A;  2QM8 A;  2DYR B;  1OCC C;  3JAS B;  4JV5 B;  1KUQ A;  1M56 B;  2WLI A;  2Q0O C;  2B1G A;  4DUZ B;  5L3B A;  2PYJ A;  2UXB B;  1HNX B;  4O4L A;  1QVF U;  3DXR A;  1ZWI C;  1QBZ A;  4IIJ B;  5LP6 A;  2A79 B;  5LMN O;  4FLW A;  3I55 V;  3APO A;  5KX5 A;  1Q6I A;  2ZNI A;  3ZMZ A;  2EIJ B;  5CA3 A;  5LP6 B;  5JH7 B;  3N27 A;  1YJ9 V;  1U97 A;  4EB6 B;  2OTJ V;  2JJ1 G;  2EIN B;  3ZN1 A;  3CXC U;  1YF2 A;  3BA8 A;  1X59 A;  5L3C A;  3OTO B;  1S0V A;  2PI5 A;  2H94 A;  2HJF C;  4KUM A;  3AG4 B;  1MA1 A;  2Q7E A;  2BTQ A;  4RQE A;  1NTK H;  5KHI A;  5IY5 C;  1LUV A;  3CMA V;  1N8R W;  4Z1V A;  3RW0 A;  2YI9 A;  4DV6 B;  4NXN O;  5GTH Z;  1Y6X A;  4WFF A;  1IBM B;  3ABM B;  4OXS A;  3VBB A;  3WG7 C;  5J2U B;  2A06 H;  4B3T B;  3S3W A;  3S3X A;  2HP8 A;  2WPD G;  4I9W A;  3A2F A;  4B3S B;  5J2U A;  4LBE C;  2XAJ A;  4LWS B;  5F2V O;  3CX5 F;  4GX2 A;  2B5U A;  4FJC C;  1N34 O;  2R9R B;  4JI0 B;  2F1M A;  1MNG A;  5HFM A;  2R9I A;  2EIL C;  2W0X A;  1EM1 A;  1QLE C;  3RYF A;  4HYO A;  3VQX A;  3G6B A;  3ZMT A;  1S3J A;  4O2B A;  3E22 B;  4UCS A;  1SER A;  3CCL V;  4MW3 A;  1SZX A;  2F4V O;  4X89 A;  3K79 A;  4X62 B;  4QGP A;  1LR1 A;  5JQG B;  3K06 A;  4NR1 A;  4ZKI A;  4E2L A;  4YXW G;  1E79 G;  2PGG A;  5LHH A;  2ARH A;  4O4J A;  4CS2 A;  5KMG B;  2EIN C;  1UFI A;  2KSD A;  1JX9 A;  3ZX6 A;  4G2K A;  1IBL O;  3JCU Z;  2DWD C;  1JJO A;  1LUW A;  2Y48 A;  2PTM A;  1DGS A;  4FLV A;  3CE2 A;  4GKJ B;  1VQP V;  1K4D C;  1SA0 B;  1J5E B;  4MTF A;  1W0J G;  1XHZ A;  4L8J A;  2OIE A;  1XQ8 A;  2XT9 A;  4JI6 B;  3OR6 C;  2W6I G;  4IYI A;  1O9G A;  3BVO A;  4LC1 A;  2AZ0 A;  1U96 A;  2DW4 A;  3CRM A;  1QLN A;  4DUY O;  1TUB B;  3CB2 A;  4X65 B;  1FFX B;  3W7W A;  2ADQ B;  3J80 N;  1YTF B;  2B1I A;  4JYB A;  5JVD B;  1SET A;  1OCR B;  2QKC A;  1Q7Y W;  2NR5 A;  3CHX A;  1R3L C;  4JI8 B;  1GKF A;  5LXT B;  3TCU A;  5KA5 A;  1HR0 O;  3FFQ A;  3CCQ V;  4DV0 O;  2JDI G;  1SF9 A;  3RYF B;  3CCE V;  3DSQ A;  5B1A C;  2XUM A;  2VWK A;  1FJG B;  4CH3 A;  4OGQ B;  3VQV A;  2Q73 A;  1BMF G;  3CC2 V;  2CDY A;  4YIO A;  3SR2 C;  1Q86 W;  3SYP A;  1BE3 H;  1Q3E A;  2KKW A;  1KC8 W;  1SQX H;  2YIC A;  2UUC O;  3SJQ C;  1GM8 A;  3ASN B;  3PN1 A;  1VQM V;  1GH6 A;  2L35 A;  1KBH A;  4X64 O;  1K33 A;  4UB6 Z;  1QQC A;  2VWJ A;  3QF7 A;  1BL8 A;  1WA8 B;  5EC1 C;  1YTF D;  1I08 A;  4BWA A;  3UT5 B;  2P6J A;  1GMG A;  4RAI A;  3FAV A;  2RN9 A;  1O9H A;  2WLI B;  2K9P A;  3TK1 A;  3JAS A;  2QKS A;  1M1K W;  1XL6 A;  2YIA A;  3AG1 C;  1K9M W;  3D36 A;  2QR4 A;  2LJ2 A;  3K5L A;  4PA4 A;  4X62 O;  5ITZ A;  1RFY A;  3ETQ A;  1JR9 A;  3HKD A;  2VS0 A;  4X9Q A;  3B8N A;  2Y0P A;  1FFX A;  4YJ3 A;  2IU3 A;  3H1L H;  1FXK C;  5EK0 A;  2NLJ C;  1N36 B;  4MT8 A;  1H2S B;  4AI8 A;  4JYA B;  1H8H G;  3HR0 A;  3AG7 A;  4JYC A;  1T5E A;  4ZOL B;  3U11 A;  4GUN A;  3T1H O;  1QLE B;  1WAZ A;  2PI4 A;  4XDJ A;  2GHY A;  3QTC A;  1GN3 A;  2X0L A;  5EYP B;  1J5E O;  4PDR A;  1IBM O;  2QGN A;  2HLD G;  1B6Q A;  3HKD B;  2F66 C;  2JIZ G;  3FX7 A;  1VQL V;  4UCU A;  1K3E A;  2WLL A;  2E5L B;  2VQE O;  3AG2 B;  2KG7 B;  3SJC C;  3JAT A;  1KMI Z;  3KZI Z;  2X7R B;  3K5M A;  1XDC A;  2X6A A;  2HEP A;  4KHP O;  4UCV A;  2XAH A;  4IHJ B;  4P9O A;  2OWO A;  2RJZ A;  3RWR D;  4MVQ A;  4DRX B;  5LA6 B;  3ZS8 C;  4RWU A;  1PNL A;  3FYI B;  4GKK B;  1Y76 A;  4U3J B;  3WB0 A;  1WPX A;  5IE9 A;  1BHB A;  1IXM A;  3JYC A;  2JGD B;  4FM0 A;  4C7U A;  2P06 A;  1OZ0 A;  2LGW A;  1J95 A;  4CBC A;  3C3S A;  2GDS A;  3KG2 A;  5H2F Z;  1H2K A;  1NVP B;  1CXZ B;  5GW7 A;  2Q7G A;  3JAR A;  2XAG A;  4PA7 A;  1DTO A;  1I7F A;  2LQT A;  5KAI Z;  1N0J A;  5FL7 G;  5KUM A;  2PY5 A;  2ZM6 B;  2Q8V A;  2F23 A;  1M5I A;  3MDS A;  1GO3 F;  4JZ2 A;  2P90 A;  4P30 A;  2QWO B;  4UVB A;  2Y4U A;  3O65 A;  4DV3 O;  3K0G A;  4LFB O;  5LBQ A;  1H2M A;  3C3T A;  2EIL B;  4R7C A;  1P49 A;  1AVM A;  2UXC B;  1WB7 A;  2P4K A;  1ARO P;  4LH7 A;  2OTL V;  3T4D A;  5FNV B;  1IBL B;  1VF6 A;  5IY5 B;  4W4K A;  4JI1 B;  2K1E A;  3H1K H;  1L8D A;  2ZIO A;  5H9C A;  1JPX A;  4I4T A;  2GV9 A;  2JGU A;  1XMQ O;  2PZS A;  2OYQ A;  1WP8 A;  1EZJ A;  1JCH A;  4UV9 A;  1TGO A;  1FKA O;  2RNB A;  5IDJ A;  1MOF A;  3K9A A;  2R70 A;  3ZHT A;  4ZOL A;  2VQF O;  5FPR A;  4EB6 A;  3O9O A;  2BE3 A;  4X1Y B;  4NTX A;  5J9P C;  3GB7 C;  3ZRW A;  4L87 A;  3A8T A;  2Y4T A;  4I4T B;  1NS1 A;  5EBW C;  1NTZ H;  1VP7 A;  1VF5 B;  5KLV H;  4ABM A;  4K8X A;  3OFN G;  2D3O W;  5JVD A;  2Q5Z A;  4FM2 A;  4G28 B;  1VF6 C;  1TVK B;  1ZL8 B;  4FFK A;  3J7A U;  1BCC H;  4MW8 A;  2OT5 A;  4Q20 A;  4X1Y A;  1SC5 B;  1NR7 A;  1KD1 W;  4I55 A;  4GCZ A;  5B3S B;  4JTD B;  2UUA B;  2M6Y A;  2F43 G;  2ZXW B;  3LUT B;  2KQX A;  3L71 H;  2KG7 A;  4KHP B;  1N36 O;  2EZP A;  3W7T A;  4JYY A;  4DV7 B;  4XBF A;  2Q9L A;  4FM1 A;  2A0L A;  3K03 A;  1EZV H;  4LF7 O;  2YXY A;  2ZM6 O;  4FLX A;  3B40 A;  3E8G A;  3E8H A;  4I55 B;  3CCR V;  4LR3 A;  4LF6 O;  1BSM A;  3IC7 A;  5LGT A;  1VMG A;  1XEQ A;  3G80 A;  4JF3 A;  1ZX3 A;  3VQW A;  4HNA A;  4R6Z A;  4PA9 A;  1Q43 A;  2WLJ A;  3ETG A;  1I94 B;  1XRE A;  1YVW A;  3ABU A;  4O2B B;  5IYZ B;  1HNW O;  4H13 B;  1NH2 B;  2ZE7 A;  3D3Q A;  1M57 C;  4TSF G;  1OCR C;  3AG3 C;  1K34 A;  4YJ3 B;  5DM6 V;  2EIM C;  4MTX A;  5ITZ B;  3K57 A;  2IJK A;  4TV8 B;  1AJP A;  3KKY A;  5LL6 Y;  2ILM A;  1IVS A;  2WLN A;  4YY3 O;  5CB4 B;  1H8E G;  2HG5 C;  3L70 H;  3OUS A;  4NKG B;  5JH7 A;  1AP6 A;  2A7W A;  1S5L Z;  1B3Q A;  2FKX A;  3ZRW B;  3SYC A;  1PV0 A;  4YJ2 A;  1EFR G;  2GSM B;  2JJ2 G;  2EJR A;  2UXD B;  2D2C B;  3IC9 A;  5L3E A;  2XAF A;  1ZAU A;  4QJF B;  4YJ2 B;  1FD9 A;  2DQ3 A;  5IJ0 A;  2BSK B;  2MW2 B;  1PNK A;  3F7V C;  3HKC B;  2YSU B;  3ZHU A;  3JAT B;  3D3I A;  2ZIM A;  4H44 B;  5JCO A;  4UCR A;  5GON B;  4MVO A;  5CB4 A;  1Y67 A;  3OGC C;  4TQF A;  2GUZ A;  5LMU B;  1JMK C;  3B2E E;  2XAQ A;  2EX3 A;  1CPY A;  2CTQ A;  1W0K G;  2IH3 C;  2O57 A;  3BFR A;  4UB8 Z;  5L3D A;  4AIL C;  4DR1 O;  4J10 A;  4WFH A;  4FZ1 A;  4ICG A;  1KP3 A;  4DV1 B;  2ITC C;  1A32 A;  5IWA B;  3T1H B;  2PUS A;  4KL1 A;  1SRY A;  4JI3 B;  4DR6 B;  1IBK B;  4JI2 B;  3SYQ A;  3OE7 G;  5BMV A;  3AG4 C;  3H9V A;  4Z2W A;  5L3F A;  4LFB B;  4QIW F;  2EIK B;  2ADP A;  4DV2 O;  4HBN A;  1HNZ O;  3D36 C;  2XHB A;  3BA9 A;  1L1F A;  4HAM A;  5BMV B;  1PM9 A;  1WNS A;  2F93 B;  2UXX A;  1PP9 H;  2UXB O;  5KHK A;  5CBH A;  1AI6 A;  1FYJ A;  2HVJ C;  1Q6U A;  4WFE A;  2BOC C;  2UXN A;  3BAA A;  1L0N H;  4I9Q A;  1MZE A;  3WFV A;  1F7Y A;  4J11 A;  4LWS A;  4UCT A;  2Q68 A;  4CH6 A;  1QR9 A;  1MG1 A;  1Q81 W;  1AJQ A;  2GTA A;  5EBL C;  2YIB D;  4JAV A;  2QWP B;  2ZE8 A;  1NR1 A;  3P30 A;  4DV3 B;  2DYS C;  2R9A A;  3ZRX A;  2QEX V;  3E89 A;  4NB5 A;  3OTO O;  3ZN0 A;  3HPL C;  1AR5 A;  4X66 O;  2YS8 A;  1OCC B;  2F4V B;  2UUA O;  3ICX A;  1D5N A;  3SPG A;  3E35 A;  2PF4 E;  3KCY A;  3JCZ A;  4J41 A;  1G8M A;  1TAE A;  1YXB A;  3SDL A;  2YEV A;  5E1A C;  2Y69 C;  4DR4 B;  5E79 Z;  2EUL A;  2HR3 A;  4K3A A;  4BIZ A;  3CRQ A;  5IT9 N;  1FXH A;  4DV6 O;  3EHB B;  3U10 A;  1ENV A;  1K5Q A;  3RT3 C;  4FPP A;  1HNX O;  1R73 A;  2LP7 A;  3RFR A;  2H8P C;  2Y69 B;  4I50 A;  3ABL C;  4GT1 A;  2LGQ A;  5LYJ A;  5KMG A;  3L75 H;  2LFR A;  3SPJ A;  2UXD O;  1HNW B;  1OCZ B;  1S72 V;  2PYL A;  3X2Q B;  3ZJZ A;  4LF7 B;  3JSL A;  1I5X A;  2P22 C;  3E83 A;  3FKS G;  4J7J A;  4O2A B;  1R6K A;  4DR3 O;  4D6T H;  1RM1 B;  5LMU O;  4EFB A;  4HZ3 A;  4J9Z B;  4KP4 A;  1V9P A;  4JI7 O;  3X2Q C;  3ASO C;  5LGU A;  5LMN B;  3OD4 A;  5EIB C;  2ZDI A;  1N32 B;  2YID A;  5EZY B;  1M90 W;  3CEI A;  4B3T O;  4X20 B;  4QNH B;  4DR7 O;  3JD3 A;  3RYH A;  3H1H H;  1V55 B;  4WBN B;  3G71 V;  1Q5O A;  4O2A A;  4ZI7 B;  4LF9 B;  4JV5 O;  4O4H B;  4LCU C;  2HJD A;  1GN6 A;  2CGN A;  1V54 B;  3QG5 A;  1R1B A;  4IHJ A;  1IXB A;  1I5Y A;  1NTM H;  4X8A A;  3LNN A;  5BZB A;  2Q0A A;  5CA1 B;  1OHH G;  2IW5 A;  4P2Z A;  1RP3 B;  4EEQ A;  4PI2 A;  4DK1 A;  4WFA V;  1H2G A;  1IUR A;  1MSW D;  4F6R A;  2X6C A;  5BY1 A;  3JAR B;  3TXS A;  4NXM B;  1FXK A;  1I94 O;  3CC4 V;  1YJW V;  1XBL A;  2AGA A;  2EBO A;  5L3G A;  4I0X A;  4MVM A;  4FLT A;  4JAA A;  3JAK B;  4PV1 B;  1JJ2 U;  1NI8 A;  3CXH F;  4R50 A;  1TUE B;  3LSS A;  2WA3 A;  3G67 A;  2WAM A;  2JEU A;  1SQG A;  4DR5 O;  2IJI A;  1DK1 A;  2CH7 A;  4AQY O;  2FB5 A;  1H2L A;  1WN7 A;  2ODM A;  4DR2 O;  3CCM V;  3VOU A;  5B1O A;  3K5N A;  4NTY A;  4JI2 O;  2WWW A;  1Q8I A;  3MD0 A;  4OPA A;  3RYI B;  3SPH A;  5K1P A;  3CCS V;  3UT5 A;  3ZMV A;  3FB5 C;  1BS3 A;  3T4Z A;  3FAV B;  4CZZ A;  4JI5 O;  4X66 B;  3AK1 A;  2XAS A;  2IJH A;  3TET A;  1QR8 A;  1JVM A;  1LNQ A;  3ZED A;  4ASU G;  2QM7 A;  5LHG A;  4BW5 A;  3Q4H A;  1HWY A;  2CK3 G;  4PA3 A;  5EYP A;  4FVM A;  1V54 C;  4DV1 O;  2BTQ B;  3RBZ A;  3L9D A;  3LDE A;  3T1Y B;  4QPK A;  1WP7 A;  5GON A;  4TUY B;  1AB3 A;  1K97 A;  2KB1 A;  5IYD O;  3SPC A;  1GM7 A;  3OUF A;  3Q4H B;  1SQF A;  3JSN A;  1YI2 V;  4X1K B;  3NXS A;  1I0H A;  3STL C;  2EIM B;  2DQ0 A;  2QWR B;  4I5S A;  1Y76 B;  5EC2 C;  4GKJ O;  1RM1 C;  1GN4 A;  1K5S A;  1M4U A;  5J2T A;  1HNZ B;  3GVM A;  5B1A B;  4B08 A;  3ZCC A;  5A9G A;  1SS3 A;  5BR8 O;  1PKX A;  4GX1 A;  1YZB A;  2LW7 A;  3N2G A;  4JGS A;  1VQN V;  2IBZ H;  3QO5 A;  3ML0 A;  1FFT B;  1PD3 A;  3J81 N;  2QJ1 A;  5EBM C;  3OR7 C;  3ZBH A;  2HHH O;  4K0K B;  4Q6G A;  2FTK A;  4DR4 O;  3GWK C;  2IU0 A;  3RYC B;  3ABM C;  3LNM B;  1YIT V;  4NXM O;  1TA8 A;  2WA4 A;  2YUA A;  5DEC A;  5B5E Z;  3OEH G;  4TWK A;  4FZ0 A;  4K8Z A;  5JCO C;  2FML A;  3N2G B;  4PDL A;  2HFE C;  5B1B B;  3M8A A;  4X64 B;  1BT8 A;  5C93 A;  3CP1 A;  1L0L H;  1QCE A;  1K73 W;  2WLL B;  4ZBM A;  2ZE6 A;  3EVK A;  4B3M B;  1ZTE A;  3CME V;  2AXT Z;  5KAF Z;  3WB1 A;  5BXZ A;  4JI1 O;  3FB7 C;  1XHX A;  4WFB V;  1VQ5 V;  2CH7 B;  3H01 A;  5FLX N;  1H2N A;  4DR2 B;  3FB8 C;  2CUG A;  4UCO A;  4DV5 B;  2DYS B;  3CRC A;  3DC5 A;  4AHC A;  2UUC B;  1S5J A;  3ZIA G;  1UPG A;  4YHH O;  1XMO B;  3HB3 B;  4DW1 A;  5B1B C;  4DR5 B;  4O4I A;  1BQ0 A;  2VRZ A;  3CRA A;  1OCO C;  4X88 A;  1FAF A;  1M9N A;  2GUZ B;  3JD4 A;  1Z2G A;  2BCC H;  4ZIB A;  2QKA A;  1RPR A;  4X20 A;  4UUJ C;  2V4D A;  1S77 D;  1NZ6 A;  4GYC B;  3K58 A;  3F5W C;  4DR7 B;  4WBN A;  1GRJ A;  3K04 A;  3RGB A;  3HKC A;  5JJE B;  1R3K C;  2CAZ C;  4J7Z A;  3WB2 A;  4X1I A;  2N04 A;  4LF8 O;  1TVK A;  3K9S A;  4CH5 A;  4CS4 A;  5CA1 A;  3JAW A;  2JRI A;  1QHT A;  4BIO A;  4CS3 A;  3A0H Z;  2Q4P A;  1KKD A;  2N74 A;  1F51 A;  2Q67 A;  4QE7 A;  4BIU A;  1XNQ O;  4O4L B;  5CBG A;  3JD1 A;  4FFB B;  3OMI B;  5KHH A;  1QU7 A;  4GZR B;  4NXN B;  1P4R A;  3HKE A;  2QM4 A;  4B7E A;  1XOU A;  2UU9 O;  4MTG A;  1VQO V;  1KYO F;  1M93 A;  2XOK G;  2JGD A;  1G1X B;  3JD2 A;  3I5D A;  3CRR A;  3T1C A;  1R6N A;  4LF6 B;  1GTO A;  4DO2 A;  4MVU A;  1YDX A;  5JJJ B;  4MS2 A;  4FLU A;  3F5T A;  3L74 H;  4IL6 Z;  1DLB A;  4I7Z B;  5CN0 A;  3STZ C;  2Y0I A;  1B04 A;  2CGO A;  1P7G A;  4LFC O;  1Q6H A;  4QE9 A;  2DJV A;  1VQ9 V;  1KU9 A;  4KFM A;  4LNU A;  4A5U B;  4DV5 O;  3D8C A;  1EBO A;  2UXC O;  2C2A A;  1BQZ A;  2YEV B;  3W7X A;  1ORQ C;  3APQ A;  2VQF B;  2HHH B;  3RVZ A;  2ZR3 A;  4AQY B;  3IFX A;  1SQQ H;  1NH2 D;  3ZHS A;  5EIB D;  4O4I B;  1RPO A;  4B3M O;  5KA6 A;  3SJB C;  3ZHV A;  1NU1 H;  4LP8 A;  2DWE C;  3AK3 A;  5B3S C;  3LSU A;  4IT5 A;  5H6R A;  4JTA B;  1F23 A;  1VAR A;  1THZ A;  2G38 A;  1SES A;  2ZCE A;  2W6J G;  3K3W A;  3G6E V;  3E22 A;  4JI5 B;  4TQD A;  1JOY A;  3B77 A;  3N2K A;  5IYB O;  3JAL B;  3UQ8 A;  4X1I B;  2Q7H A;  4OX9 O;  1FPO A;  4WF9 V;  1HP8 A;  2AW9 A;  5H6Q A;  4X65 O;  2V1D A;  2AZ2 A;  4PHZ A;  3BCC H;  1AI7 A;  4J7K A;  1VQ7 V;  1UJW B;  1G4Y B;  1XUQ A;  4JI3 O;  4DR6 O;  5DED A;  1Q90 D;  4MVZ A;  3FB6 C;  4DW0 A;  2P67 A;  4O4H A;  3CC7 V;  3LDD A;  3MAQ A;  4H33 A;  4B3R O;  2UU9 B;  2QTO A;  3R66 A;  3FYE B;  3UKM A;  3HKE B;  1N34 B;  2P5O A;  3ABK B;  3UCS C;  3RN4 A;  1W2B U;  4MVS A;  5DN6 G;  1HR0 B;  5FPO A;  2BOB C;  2UUB B;  4GX0 A;  3ZRS A;  2B9Z A;  3P32 A;  2Q69 A;  3ABT A;  4U7N A;  5K1X A;  2L6L A;  2CTP A;  3ABL B;  4F6E A;  2JK5 C;  1Y74 A;  1F4N A;  3E8B A;  5BR8 B;  4LF8 B;  2GBO A;  4R8C A;  2Q6A A;  3R65 A;  5LOV B;  4XDK A;  2F95 B;  4DXW A;  3RYI A;  1VF7 A;  4UXN A;  5JJN B;  2MK3 A;  4MTO A;  1K7D A;  4JI0 O;  5EZY A;  5CA0 A;  1XI1 A;  2DMX A;  5C8Y A;  3ZRV A;  2YC0 A;  1SQV H;  3B09 A;  4PD4 F;  3QO7 A;  4J9Y B;  1AR4 A;  1KP2 A;  3PJS K;  4FIP C;  1BGY H;  2H3O A;  4DR1 B;  4XDL A;  1P84 F;  4DV2 B;  4RUF A;  2BSK A;  3M99 B; 
#chains in the Genus database with same CATH homology
 5KUM A;  3VOU A;  5B1O A;  1K4C C;  1GO3 F;  2P90 A;  2WWW A;  3AEI A;  4P30 A;  4UVA A;  3MD0 A;  4UVB A;  1R3J C;  1YHQ V;  1R3I C;  1VQK V;  3K0G A;  1OCZ C;  3SPH A;  2IH1 C;  3CCS V;  3ZMV A;  3FB5 C;  2WLM A;  3A0R A;  5LHI A;  5LBQ A;  2EIL B;  3T4Z A;  4CZZ A;  4R7C A;  4GX5 A;  2XAS A;  1ARO P;  2IJH A;  3F7Y C;  3TET A;  2HVK C;  1K8A W;  2OTL V;  3OW2 U;  3CD6 V;  1QR8 A;  3BY6 A;  1S76 D;  1JVM A;  1LNQ A;  2ZQM A;  3T4D A;  4ASU G;  1CEZ A;  2EZO A;  2P7T C;  2QM7 A;  5LHG A;  5CBF A;  3CCU V;  5IY5 B;  4BW5 A;  1COW G;  2Z3Y A;  3OEE G;  2K1E A;  4WCE V;  1HWY A;  1NQT A;  5H9C A;  2CK3 G;  4PA3 A;  1QVG U;  2ATK C;  1JPX A;  4PEL A;  4N21 A;  3SPI A;  1V54 C;  3RBZ A;  1FS0 G;  4FK5 C;  1XL4 A;  2NNU A;  3LDE A;  1EZJ A;  1JCH A;  4UV9 A;  3DGE A;  5IDJ A;  1MOF A;  3K9A A;  4QPK A;  1KEC A;  3E2E A;  1E1Q G;  2QM8 A;  2DYR B;  1OCC C;  1K97 A;  3JD0 A;  1M56 B;  2WLI A;  2KB1 A;  5J9P C;  5IYD O;  3GB7 C;  2B1G A;  3ZRW A;  2EIK C;  1GM7 A;  3OUF A;  4L87 A;  3SPC A;  5L3B A;  4H37 A;  1QVF U;  1YI2 V;  3NXS A;  3ETE A;  1ZWI C;  5EBW C;  3STL C;  2EIM B;  1QBZ A;  2DQ0 A;  3OM3 B;  3AG2 C;  4I5S A;  3OFN G;  5EC2 C;  2A79 B;  1JQ0 A;  2D3O W;  3LSQ A;  1RM1 C;  1K92 A;  1DF4 A;  1K5S A;  3I55 V;  4BAY A;  4G28 B;  3ZMZ A;  2EIJ B;  5CA3 A;  5B1A B;  1M57 B;  1YJ9 V;  2OTJ V;  1VQ4 V;  2A9H A;  4TT3 G;  3ZCC A;  2AHY A;  2OT5 A;  2JJ1 G;  4MW8 A;  3OMA B;  4Q20 A;  2EIN B;  3ZN1 A;  3CXC U;  1PKX A;  5IYC O;  5L3C A;  1S0V A;  4GX1 A;  1NR7 A;  2PI5 A;  1AI5 A;  1KD1 W;  2H94 A;  1YSC A;  4JGS A;  1VQN V;  3QO5 A;  4GCZ A;  3ML0 A;  5B3S B;  1FFT B;  1BHA A;  2HJF C;  1Y66 A;  4JTD B;  1PD3 A;  4KUM A;  3AG4 B;  3W7S A;  2F43 G;  5EBM C;  2ZXW B;  4JTC B;  3OR7 C;  4RQE A;  3I56 V;  3LUT B;  5IY5 C;  2FTK A;  1GK9 A;  2IU0 A;  3CMA V;  1N8R W;  3RW0 A;  2EZP A;  3K0D A;  3ABM C;  3W7T A;  3LNM B;  4XBF A;  1VQ8 V;  1YIT V;  2A0L A;  4WFF A;  3ABM B;  4OXS A;  3VBB A;  3WG7 C;  1M56 C;  2ZD9 A;  3OEH G;  4TWK A;  3K03 A;  2WLK A;  3CCV V;  2WPD G;  3E8G A;  4I9W A;  3E8H A;  4PDL A;  3CCR V;  2HFE C;  4LBE C;  3ZMU A;  5B1B B;  2XAJ A;  3IC7 A;  5LGT A;  5C93 A;  3CP1 A;  1QCE A;  4GX2 A;  3AG3 B;  2B5U A;  4JF3 A;  1K73 W;  2WLL B;  4ZBM A;  4FJC C;  4UVC A;  4R6Z A;  2R9R B;  3BEH A;  4PA9 A;  2WLJ A;  3ETG A;  3CME V;  3ABU A;  4MSW C;  5HFM A;  2R9I A;  2EIL C;  3FB7 C;  1QLE C;  3DTU B;  4HYO A;  4WFB V;  1NVP D;  1VQ5 V;  3H01 A;  3ZMT A;  3K08 A;  1MAB G;  1S3J A;  1NH2 B;  3FB8 C;  1FXK B;  1SER A;  1M57 C;  4TSF G;  3CCL V;  1OCR C;  2DYS B;  3AG3 C;  4MW3 A;  1K34 A;  1WLE A;  1VQ6 V;  3ZIA G;  4X89 A;  5DM6 V;  2EIM C;  3K79 A;  4MTX A;  1YJN V;  2ITD C;  3HB3 B;  2ZXW C;  5B1B C;  3K06 A;  2IJK A;  4ZKI A;  1AJP A;  1ROP A;  1CP9 A;  4E2L A;  5CMU A;  1NBM G;  2WLN A;  4YXW G;  1E79 G;  5LHH A;  1NKD A;  1H8E G;  1OCO C;  4X88 A;  1M9N A;  1FXV A;  2HG5 C;  3JD4 A;  3OUS A;  2EIN C;  1S5H C;  1JX9 A;  4G2K A;  1RPR A;  4UUJ C;  1S77 D;  2DWD C;  3ZRW B;  3SYC A;  2Y48 A;  3F5W C;  2IJJ A;  3K04 A;  1EFR G;  5KUK A;  2GSM B;  1AJN A;  2JJ2 G;  2EJR A;  1K4D C;  1VQP V;  5B1N A;  5L3E A;  2XAF A;  3ZMS A;  4QJF B;  4MTF A;  2DQ3 A;  3CYO A;  1PNK A;  1R3K C;  3F7V C;  2YSU B;  1W0J G;  3B8M A;  3ASN C;  4N23 A;  3D3I A;  1AR1 B;  1Y4M A;  4MVO A;  2ZDI C;  3OGC C;  3OR6 C;  2W6I G;  2XAQ A;  1OCO B;  1AI4 A;  2M7W A;  1CPY A;  4LC1 A;  1W0K G;  2DW4 A;  2IH3 C;  1KKD A;  5L3D A;  1QLN A;  1F51 A;  2Q67 A;  3ASO B;  4QE7 A;  4WFH A;  4BIU A;  1KP3 A;  3QO8 A;  2ITC C;  4WFG A;  1SZT A;  5CBG A;  3JD1 A;  4RUE A;  3OMI B;  1SRY A;  3W7W A;  5LGN A;  1F4M A;  3SYQ A;  1YTF B;  3MHS C;  2B1I A;  4JYB A;  1P4R A;  1SET A;  1OCR B;  3OE7 G;  3AG4 C;  5L3F A;  4G27 B;  3OMN B;  4QIW F;  4MTG A;  1VQO V;  2EIK B;  1Q7Y W;  1R3L C;  2XOK G;  3JD2 A;  1GKF A;  1L1F A;  4HAM A;  3TCU A;  3T1C A;  3SYA A;  2UXX A;  1R6N A;  1PL0 A;  5CBH A;  1AI6 A;  2HVJ C;  5KA5 A;  4WFE A;  1GTO A;  2BOC C;  3CCQ V;  2JDI G;  2UXN A;  4RQF A;  4DO2 A;  4MVU A;  4MS2 A;  3MHH C;  3CCE V;  5B1A C;  3WFV A;  4FMT A;  2Q68 A;  2JEX A;  3M99 B;  1MG1 A;  1Q81 W;  3CPW U;  1DLB A;  1AJQ A;  5CN0 A;  1BMF G;  5EBL C;  3STZ C;  3CC2 V;  4JAV A;  4PDV A;  1NR1 A;  3P30 A;  2DYS C;  4QE9 A;  3ZRX A;  3CCJ V;  1Q86 W;  3SYP A;  1VQ9 V;  2QEX V;  4KFM A;  3E89 A;  2LFS A;  1EBO A;  3ZN0 A;  3HPL C;  3E86 A;  1KC8 W;  3T2M A;  1YIJ V;  2C2A A;  4U7O A;  3UM7 A;  2YEV B;  1OCC B;  3SJQ C;  3W7X A;  1ORQ C;  3SPG A;  3E35 A;  1GM8 A;  4F4L A;  2WLH A;  3ASN B;  3ETD A;  3JCZ A;  4PA6 A;  1VQM V;  1G8M A;  2OCC C;  2YEV A;  3RVZ A;  2ZR3 A;  5E1A C;  2Y69 C;  1K33 A;  3IFX A;  1NH2 D;  2HR3 A;  4BIZ A;  1FXH A;  1RPO A;  3EHB B;  1ENV A;  4JAS A;  1K5Q A;  5KA6 A;  2AHZ A;  1BL8 A;  4FPP A;  5EC1 C;  1YTF D;  2W0F C;  4UV8 A;  1R73 A;  2LP7 A;  4LP8 A;  2H8P C;  2DWE C;  5B3S C;  2Y69 B;  3IGA C;  5H6R A;  3ABL C;  4GT1 A;  4JTA B;  2P6J A;  1KQS U;  1GMG A;  3QNE A;  1F23 A;  4RAI A;  1P7B A;  2LFR A;  1THZ A;  3SPJ A;  1SES A;  2WLI B;  2V7Q G;  2W6J G;  3K3W A;  4Z1M G;  3TK1 A;  3G6E V;  2QKS A;  1OCZ B;  1M1K W;  1XL6 A;  1S72 V;  3AG1 C;  3X2Q B;  3ZJZ A;  2XND G;  1K9M W;  3D36 A;  1I5X A;  4RO2 A;  3SYO A;  3E83 A;  3FKS G;  3B77 A;  1JOY A;  4PA4 A;  1R6K A;  2EIJ C;  4PDM A;  5IYB O;  3B8N A;  1RM1 B;  3RVY A;  2IU3 A;  4HZ3 A;  2WSS G;  3E8F A;  4J9Z B;  4KP4 A;  1FXK C;  5EK0 A;  3X2Q C;  2NLJ C;  3ASO C;  5LGU A;  1Q82 W;  4MT8 A;  4WF9 V;  2ZDI A;  4P9P A;  1H8H G;  5H6Q A;  2V1D A;  1M90 W;  2X6B A;  1AI7 A;  3G4S V;  4JYC A;  3AG1 B;  1VQ7 V;  1QLE B;  4QNH B;  1UJW B;  1G4Y B;  2PI4 A;  4XDJ A;  2GHY A;  3JD3 A;  4MVZ A;  1V55 B;  3FB6 C;  3EFF K;  2P67 A;  2X0L A;  3G71 V;  3CC7 V;  3LDD A;  4PDR A;  4H33 A;  2QTO A;  1E1R G;  2HLD G;  3W7U A;  1B6Q A;  2JIZ G;  1VQL V;  1K3E A;  2WLL A;  3FYE B;  4LCU C;  3UKM A;  3ABK B;  2Z5U A;  3AG2 B;  1W2B U;  1V54 B;  4MVS A;  2OCC B;  5DN6 G;  1I5Y A;  4X8A A;  5BZB A;  2X7R B;  1OHH G;  2IW5 A;  3LDC A;  2BOB C;  4P2Z A;  2X6A A;  3WG7 B;  4WFA V;  4GX0 A;  5HFL A;  1H2G A;  2XAH A;  3ZRS A;  4P9O A;  1MSW D;  3P32 A;  2HKO A;  2X6C A;  3OAA G;  1FXK A;  2DYR C;  2Q69 A;  4MVQ A;  3CC4 V;  1GM9 A;  4EKW A;  1YJW V;  3ABT A;  4JAU A;  4U7N A;  2QA4 V;  3ABL B;  1PNL A;  3FYI B;  4JPR A;  2JK5 C;  2QE7 G;  1F4N A;  3E8B A;  2EBO A;  5L3G A;  1WPX A;  2Q6A A;  4MVM A;  3R65 A;  4R8C A;  4XDK A;  4QPJ A;  1BHB A;  1IXM A;  1H38 A;  3JYC A;  3ABK C;  1JJ2 U;  4DXW A;  1OZ0 A;  4MVR A;  1PNM A;  4UXN A;  1J95 A;  2MK3 A;  4MTO A;  4CBC A;  1K7D A;  4R50 A;  1DF5 A;  1TUE B;  3LSS A;  3KG2 A;  2WAM A;  1V55 C;  2JEU A;  1NVP B;  2IJI A;  3GWO A;  5GW7 A;  3ZRV A;  2XAG A;  4PA7 A;  3QO7 A;  4J9Y B;  1KP2 A;  3PJS K;  4FIP C;  1DTO A;  4XDL A;  2ZR2 A;  3CCM V;  1NJI W;  4RUF A;  5FL7 G;  1QR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...