4TOIA

Crystal structure of e.coli ribosomal protein s2 in complex with n-terminal domain of s1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
310
structure length
307
Chain Sequence
ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESLYFQGESFAQLFEESLKEIETRIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the interaction of protein S1 with the Escherichia coli ribosome.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S2,Ribosomal protein S1
total genus 104
structure length 307
sequence length 310
ec nomenclature
pdb deposition date 2014-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4toiA02
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 4toiA01
1GZDA 2CXPA 4JI4B 3ODPA 2UUBB 1IATA 3I0ZA 5IT9A 4LF9B 4NXMB 4AMVA 4NXNB 1HNZB 4KHPB 5LMUB 1TAEA 4JI3B 3KNZA 1X94A 3IFSA 1N34B 2YVAA 4UCRA 2AMLA 2HHHB 4JI8B 1N33B 5IWAB 1XNQB 2F4VB 5LL6P 5FLXA 1XMOB 1JXAA 3ETNA 5LMNB 2VF4X 1JLHA 3LJKA 2E5LB 3FXAA 2O2DA 1HOXA 2ZM6B 2UUCB 2PUTA 3QKIA 4JI6B 3PR3A 2O2CA 3FKJA 2VQFB 4B3SB 1FJGB 3BAAA 4JI0B 4JV5B 1MOQA 5BR8B 1M3SA 1X9IA 2V4MA 2ZJ3A 4X66B 1ZAUA 4EEQA 2CXSA 3SGIA 1VIVA 4DV7B 4S12A 1KOJA 4LH6A 1MORA 2UU9B 1J5XA 2CB0A 4LFBB 1HR0B 4LF7B 4DR1B 4CC5A 3PN1A 1U0GA 1TK9A 4B3RB 4DV4B 4DV5B 2CXUA 2XHZA 1XTBA 4U6NA 3TBFA 1TA8A 4LF4B 4JI5B 3Q88A 1G98A 4DR3B 2DECA 3T1YB 4DR5B 1MOSA 1B0ZA 3CVJA 3TRJA 4EFEA 1WIWA 2PGIA 4EM6A 4TOIA 4K0KB 2CXTA 4GLXA 2UXBB 1IRIA 2POCA 2XBLA 4LZJA 4DV3B 4IVNA 3C3JA 5I01A 1JIQA 3Q7IA 2DF8A 1B04A 3OTOB 2UXCB 5FPOA 3NBUA 4OX9B 1X9HA 4M0DA 1DQRA 2WU8A 3FF1A 2A3NA 4JI7B 1Q50A 4AQYB 3JSNA 5BY2A 3J7AC 2OWOA 1HNWB 3EUAA 3UQ8A 1U0FA 1HNXB 2CXRA 2PUWA 3HBAA 4X62B 3G68A 3T1HB 1U0EA 4DV1B 1VI6A 3M5PA 1XMQB 2ZJ4A 1N36B 4YY3B 1X92A 3OOJA 1HM5A 1TZCA 4X64B 4X65B 1IBKB 1NRIA 4JI2B 4LF6B 1IBMB 3J81A 1N8TA 3BA8A 4UCVA 4DV2B 3BJZA 2CXNA 2PUVA 1GZVA 4LF8B 1IBLB 4UCTA 1NUHA 4DV6B 2I22A 4GKKB 4JYAB 3JX9A 4CC6A 4DV0B 1N32B 2UXDB 3JSLA 4UCUA 1JEOA 4YHHB 4DUYB 3FJ1A 2CXOA 4UFZA 5A2QA 4LH7A 3UJHA 4UCOA 4LFCB 1XNRB 2CVPA 4DUZB 1VI5A 1ZZGA 2Q8NA 4S1WA 4DR7B 1T10A 3JAMA 4GKJB 2UUAB 1I94B 4B3TB 1TZBA 2CXQA 2E5FA 2I2WA 3SHOA 5FPRA 4EFBA 4DR6B 3BCHA 1J5EB 4DR4B 1C7RA 3J80A 4LFAB 1V9PA 4JI1B 4LF5B 4DR2B 2VF5X 3HJBA 1C7QA 3BA9A 3BABA 1DGSA 2X3YA 2J6HA 1VIMA 4B3MB 4UCSA 2VQEB
chains in the Genus database with same CATH superfamily
1OU0A 2YN4A 1SHLA 4C43A 1XX6A 4FHDA 2DSTA 2WJIA 4PHCA 4RADA 4W7IA 3SBXA 3H1JH 1RSOA 1Q2XA 5KJEA 5GIPE 3BREA 3WGJA 4V0MA 3LUCA 3LNCA 3I61A 2VRZA 3G6KA 5CNMA 2IHVA 1GAQA 1QNFA 2WUVA 2PGOA 3L7AA 5EKDA 1GPNA 3OLCX 5IM4A 4J4BA 1OXUA 3IBFA 1QR2A 3OGCC 3E15A 3ZE2B 1JFTA 2HBYA 3AJAA 4TV8B 1KK0A 3CRVA 3IV7A 4M0FA 1THGA 2Y1EA 3ABMC 3DYVA 1Q82W 4IVPA 4PNZA 4TLBA 2D4AA 3U4CA 4F2PA 1IOLA 2FEMA 3CCRV 2ACKA 2OSVA 2DPXA 4MLPA 3E7FA 4J9VA 5C1DA 3K16A 4AMUA 3ZCRA 3EEFA 5BUQA 4J1QA 3VZDA 1M6YA 4YIKA 1IHOA 1QHYA 3HJUA 4H6VA 4YTEA 4DARA 6REQB 4RCVA 1Z25A 3UEOA 2Y05A 2H4XA 1NNI1 3FLAA 4MHSA 3T9AA 4AFNA 1XA4A 3SGIA 4AROA 4L4SA 4CUKA 2XH8A 2G80A 3VR4A 1XQWA 2FB9A 2GJ8A 5DMHA 1VYUA 4ZT3A 5IN5A 3SEZA 1T6XA 5FUBA 1T43A 2VYCA 4GC9A 1P84F 2Z3YA 1T8RA 2A9OA 4UXJA 4YI3A 3H9QA 3J7TA 5JWHA 1NZFA 4B3RB 3T8YA 3KM0A 1EVKA 3A4MA 3K1AA 2HAEA 2WLLA 3GFPA 3LY9A 3Q88A 4DZZA 2XCUA 2R8OA 4XSGA 1CHNA 4RWZA 4FZ3A 4FBMA 3GGJA 3COPA 4L4ZA 2XE8A 2QWQB 4Z4HA 1JHYA 3NHUA 2X23A 3MT7A 4XFJA 1GUBA 3R5HA 4IQ8A 3P2OA 5F73A 1B8UA 5H7XA 3WFIA 1FRVA 1RCFA 3TNDA 1J0XO 2RI0A 1UBMS 3B9QA 3Q8WA 4C0JA 1XCJA 3QVWA 3SYCA 4ARSA 3LBNA 1I4DD 3H8VA 3ETHA 2DC1A 3TS1A 4BMOB 4DMHA 3O8OB 3HYLA 1P1RA 1XZEA 1ABEA 3OF2A 5IMBA 1U7XA 1PGJA 3VA7A 3UXHA 1SPBS 4N0DA 1EXMA 2XLCA 5DSTA 4CLRB 1E98A 3WP1B 2IHBA 2GUGA 1P1HA 2GB4A 5IDJA 3GYGA 4LI3X 2QORA 2ATKC 1M2OB 4XYMA 2QY9A 4DLLA 1BH6A 8GPBA 5FYQA 1SZCA 2HIMA 1ATZA 1BOOA 1YB2A 2BFEA 2I2XB 4TV9F 4G2TA 4MITA 2ZITA 1F2TB 1EWTA 1QNLA 2NSYA 1LDGA 4L8FA 5T67A 3VDNB 4B3XA 1HL3A 4IW3B 4I6GA 3RVQA 5P21A 2HEPA 2PF4E 1K33A 1GWNA 2F43A 2Z04A 1CRWG 4PTZA 3EFOB 3RS4A 1ODTC 3D6MA 3ZCSA 5CA3A 4QM6A 2WLMA 4PU0A 1CJVC 2VRCD 4G2KA 4BAYA 3GJ3A 4H1HA 5G3ZA 4XCQA 1M83A 3SC4A 5KYTA 4Q4AB 3OMWA 3L7CA 4QLBA 4RPIA 1GGFA 1IC6A 3MWKA 2CE7A 2BJHA 1UP7A 5BMVF 3NYWA 2ZTUA 1R37A 2A0LA 1SULA 5H6RA 2V7VA 1A9PA 1Y1PA 2CL0X 3R0QA 4FNOA 5TF0A 4ZHQA 5IBRA 4ESEA 4LECA 4DADA 1FXHA 3U3MA 5IJAA 2B4TO 3HUUA 1ZVJA 3AHFA 4RQAA 3WADA 1NW9B 3DBVO 4DSAA 3D9QX 4CV1A 2QT0A 1YCIA 3MHSC 3C1AA 5KNCD 5AVOA 2FWIA 2I67A 5HM8A 3AVWA 1PZXA 4D99A 4Z4FA 4QQKA 2IVFA 4MAFA 1IM2A 4MAAA 1DU4A 3VHRA 4WJLA 4DV5O 3WBBA 2JLYA 5LZ7A 1NJ8A 3DLTA 1XZCA 1NY5A 3NAGA 5KO2A 2X3YA 1X13A 3HJBA 4OY3A 5H0IA 3DAYA 3QUAA 3OZDA 5JE8A 4OHPA 2C2AA 4WASA 4MYHA 4Q6GA 1QYCA 1UMDB 1XZHA 1LEHA 4NXNB 1QRAA 1OCCC 1EAYA 1OBOA 2GI4A 2A1IA 3ZU6A 3NJ8A 2ZYIA 2WV9A 1VM6A 4HUQB 2DXIA 1CZNA 4BGIA 4HZUB 4BX0A 1G7SA 4RU1A 3HVHA 4C14A 1DKRA 2Q8VA 3Q7TA 2YX1A 2OMKA 3BFRA 2PN1A 4ILEA 1FLNA 2XQIA 2ZRAA 2QE7A 3MOGA 5KX5B 1NXVA 3E53A 4LXGA 3RH0A 4OXNA 3L8HA 2IUYA 3AK3A 5J2TA 2O3SA 1GRJA 5GTIZ 1C1DA 1TYBE 4G4SP 1CK4A 3C3EA 2B20A 2XRMA 1Q74A 9ABPA 4PDLA 5LL6Y 4FMCF 4ZDJA 5C8VA 1XEAA 3AF4A 4M8KA 2DX7A 1SBQA 2NUAA 5EZYF 5JZMA 2OHHA 2J0VA 3F9IA 3MQ2A 5LZ8A 3S3XA 4Z4CA 1GPKA 2BKAA 1KI4A 2Q1YA 3H2BA 4FYKA 4D0GA 2HT1A 2GN2A 4WFAV 3IE2A 4IMRA 2OFXA 4V3BA 4WEOA 3B48A 1BMFD 4A8TA 3A2KA 3D8HA 5MFZA 2FEAA 3CQ9A 3NHMA 2H06A 4OHRA 4F8JA 4ZEXA 4F3TA 1N2GA 1Q44A 3DLPX 4I19A 4UCFA 1KEPA 1M6HA 2P5YA 1EE9A 3SBEA 3T95A 3VDMA 3K70D 1OJ7A 4KP7A 2FX5A 3VU8A 3CCLV 3RIHA 3D0KA 3NHSA 1KO5A 1AROP 3MBKA 4AB1A 1ZVQA 3AF5A 2L17A 1QKJA 4Y6OA 5B3JC 2D54A 3BTUA 3F3KA 1AZLA 4DREA 2JLVA 3W5UA 5T3YA 2Q3FA 2ZRGA 3LAWA 1NW3A 2OFFA 3I72A 1N5LA 1O97D 1WX1A 2PUSA 3HKBA 1ODIA 3RK4A 5HUQA 3VHLB 5IS2A 2FSFA 2WKSA 4MQEA 2NU8B 3UQ8A 3L1KA 4EIWA 1RPZA 1QRRA 3HKBB 3L1UA 4N3NA 3AX6A 5C8YA 4HGPA 2Y1OA 2F3RA 4N0QA 4TXHA 4Y1RA 3SC3A 4E07A 4NB5A 3EWIA 4R51A 5IUJC 3KB2A 3R7FA 4PSVA 3A36A 3GMTA 4M9ZA 5FPQA 4H31A 2EYUA 4NCIA 3TGUH 3IJ5A 1HE5A 4EMTA 3KXIA 4ZALA 3A6ZA 4ZBMA 4DCOA 2ZJ8A 5K3CA 3MTDA 4WTOA 2E4WA 2IWHA 4QPJA 3FI9A 3EIQA 2AUNA 1Z6QA 3L2OB 2EJRA 3O2JA 4IFBA 3VR6D 2BEJA 3UXEA 1LI4A 1XVTA 1K97A 1QO0D 2I7TA 3PQ4A 3G2KA 4B2YA 3U11A 2AZTA 4AXXA 3RN4A 1QH9A 1U1IA 5JJCA 1H66A 2R72A 2CLSA 4AJ9A 3TCKA 1Z6XA 2Q8NA 4N9WA 3HVIA 5E6RB 2GJ4A 2UUAB 1SU6A 3DXXA 4NYMR 1P1CA 2ODQA 1HTWA 4YT8A 1DTOA 2X0JA 4B3CA 1GKLA 1Y3IA 1NJ5A 1EP2B 4MKXA 2K87A 4ND8A 1IH8A 1T3SA 2C83A 2XVXA 1C41A 3SOPA 4UUAA 3ZHSA 1WNTA 2C4TA 1LB1B 4ENSA 3GELA 3PQ7A 1SUEA 2GLXA 5EBMC 3R24A 4QTYA 4W7HA 2D00A 1QCZA 2K2WA 3L75H 3WG7B 3N86A 4QYIB 1QV9A 4KWIA 3IPYA 3RSFA 4DA7A 5JATA 3FKSA 1XJ0A 3FTNA 5JOQA 5JMTA 2DY1A 1DRKA 1ORDA 5TJHA 4CMEA 3GQBA 1VQ5V 2CL7X 4LXQA 4OP3A 5LFAA 3CLTC 2WM9B 5DYTA 2FPSA 3PDJA 3STZC 5HCIA 4JU8A 1GCGA 3IPAA 3RG2A 2BMVA 3QUSA 2XGSA 4I9UA 3MJSA 4RTPA 1T9BA 1ATIA 1W34A 3CKLA 4O29A 3AG7A 4UBLA 2VF8A 1SQVH 2CEKA 3PNPA 1CETA 4QXOA 4US2R 2EZ8A 2NIPA 4WXPA 1Y66A 2RSLA 1KR5A 1U5CA 2Q3CA 1DG3A 2VJCA 4ZI3A 3N0RA 1YJ5A 1NW7A 2VNAA 2P5SA 3QOYA 4HPWA 1OI2A 4MW3A 4O63O 3TI9A 3OA2A 2XE4A 5B2EA 5KQGA 3WLSA 1EXDA 2R3SA 5JXIA 3K57A 3PGJA 5J43A 2YR0A 4WD3A 3STUA 5A4FS 1YIDA 2FZLA 2AHZA 2V7UA 1E9DA 1O8CA 2C1EA 2Y27A 3H1EA 1R8XA 2X7HA 3AP3A 1E2FA 4OAQA 4TSFA 3FDXA 5K0EA 1T5BA 1XL0A 4F2DA 2W0XA 1VL8A 1IN5A 2QMQA 4IJKA 5JAHA 4TRNA 1N7GA 3EXHC 1LPMA 2EILB 1A8SA 3DW1X 1JPNA 2N46A 1D4FA 1U8EA 3WYEA 5BWOA 3JD3A 1HFEL 1MOSA 4YRCA 3CUUA 1EVZA 2PYJA 4MR8A 1M2VB 4MTXA 1ULTA 3HEBA 4LOLA 3AFMA 4LVCA 1G5FA 4E30A 4ZZ1A 5A7FA 3LIIA 4QHSA 4PHHA 3HXLA 4AS3A 1OB5A 3KEQA 1TK3A 2J32A 3O93A 1IXYA 4FTWA 4PAMA 5LGNA 3EWSA 5EWLB 2R85A 1YZTA 3W5JA 2AF3C 1QRUA 1HG0A 3CXRA 3RODA 4F1KA 2Q69A 1BQ3A 1FXVA 1GIAA 2E48A 1NQXA 1KMHA 2HBZA 2HK8A 2P9CA 1NULA 2J67A 3RK1A 4GOOD 3TSOA 4A03A 3R75A 4NE2A 3E5HA 3KIPA 1H2NA 4RK1A 1ABFA 1NMXA 1ZRSA 3ANTA 2RJZA 3H3XA 3N6RA 1X3LA 3OE7A 3P0HA 4FFOA 4FGWA 4EPRA 3CC4V 1FQKA 2YJTD 3NIBA 1ZNXA 2DY0A 3KXDA 3PI7A 2XMBA 5ADHA 3TEJA 1YRWA 3FCEA 4OXSA 3LFTA 4PAQA 5FI3A 2XLBA 4Z3DA 1OLOA 2EJUA 4CM6A 2H1OA 4KGVA 1FDRA 3E89A 3WNVA 4BQQA 5IULC 4XUDA 4CMKA 5KYKA 5IJ0B 3OLWA 3RROA 1Y8ZA 1TF2A 1GLVA 2BKLA 4OU5A 4J3FA 5JHHB 2QL9A 1HQDA 4B3RO 2EZUA 2L69A 2Z1NA 4X97A 3AUUA 2JDID 5JI3E 2HB6A 1YDGA 3L6EA 4IOMA 3LDCA 1V3QE 2D59A 4IICA 4OK6A 5JJJB 1E3TA 5AKHA 2ORIA 3ZQJA 4YPOA 1B76A 1IRXA 2EQBA 1C0LA 2HRBA 2VCEA 3DMYA 4KK3A 4ADSG 1EFRG 2Q0AA 3W7XA 2I2WA 5SYAA 3AG4B 5IKPA 1NI4B 3TO5A 2W8ZA 4OBBA 1WPXA 4DDWA 4EW3A 2Q50A 3TUJC 2D8AA 4KI7A 4E08A 2FCRA 1LFAA 2O5CA 1Z7GA 4JGBA 4Z49A 3OG9A 1P6XA 1ZVKA 3DFIA 4MW4A 3HI6A 2VYQA 1AF7A 3T9FA 3HJAA 3ZE8A 3OJOA 4YS6A 3QRWA 3H2YA 3ZC3A 1TJ4A 1XF1A 4GQAA 3S44A 4BEJA 4J3NA 5LB4A 1PEYA 5BQFA 2TMKA 3TDMA 4PA7A 4AMVA 2NZVG 3F3YA 1XMJA 1HQCA 2YIVX 4IM7A 3GNTA 4MJ3A 5IZ4A 4BTEA 4FN5A 1LFDB 2W2LA 2Q62A 5H70A 5CDFA 3R3XA 1IG3A 2IUTA 2YW9A 4FYWA 2X1HA 2P11A 4PPFA 1CUAA 4U9HS 4OX9O 1AR1B 2V4DA 4WXEA 2NTEA 3BKXA 3LVBA 4OHMA 5AJHA 1X42A 1TTPB 4TUYF 4C3ZA 5HWSA 1ZR4A 1J39A 2AN9A 4MIKA 5COBA 2B4QA 5BP7A 2ABWA 3MRXA 4Y30A 1ZNZA 2F17A 1AK2A 3AW8A 2CYAA 3QXXA 1AT1A 2NQ8A 5H59A 1K4YA 3SXPA 3EBLA 1OGJA 3KPYA 1P91A 4WZBA 1H2WA 1SQFA 1T6YA 1GNRA 1S4QA 1VMAA 2BHRA 5CXSA 1MDFA 4LOKA 4PBTA 4X6XA 3BMNB 2QMZA 1E9VA 3NG1A 4ISBA 5CT9A 1CY1A 3RAGA 4WVFA 1YFKA 3O4FA 5DTRA 1A9RA 2QP4A 1XRPA 2BVNA 5A6VA 1KQPA 1XZNA 3OIDA 3QLUA 1EVYA 3WBFA 4B79A 2IYFA 1XAJA 1J2JA 4FINA 1QGAA 2BMWA 4R2IA 3HVRA 2BGTA 3LVRE 1L3IA 4CEJA 4FOPA 4QU8A 2JIBA 1AS2A 5FOTA 4TKMA 5F52A 1WP8A 3K9AA 4O2BA 3OC0A 1C8KA 2FG6C 4I5GA 1UOOA 3I9OA 1D0VA 4WOJA 4E5YA 3EISA 1NNUA 1ZUD1 1TVKB 2RARA 3HJRA 1Z68A 1H8HG 1LXCA 1WIWA 5BN3B 1A8QA 4W9RA 1X8LA 5AESA 2XASA 6AT1A 2PUBA 2NXWA 4JXZA 3Q85A 3EZGA 3K05A 2YNMD 4LW8A 1FSSA 3PA6A 1Q0QA 2JJ1A 3N2IA 2DCUA 3UJ7A 2FPRA 1FDVA 1W581 3QWFA 4FIZA 2B7LA 1AN9A 4IVNA 5A5EA 1DINA 2R97A 4R2LA 2Y69C 1WUHS 4E22A 2CLHB 3ZV5A 4IDAA 4QEKA 3JQCA 3RTBA 2OQ2A 1FMFA 1KRWA 1ODLA 1RJWA 3RVRA 3FHCB 2XGGA 1XD8A 3I76A 5FWAA 5GZ1A 5K03A 2SECE 3W1WA 1GR0A 1U7DA 4GZMA 1KKDA 3IBGA 4X62B 4NFHA 1FFGA 5CPFA 2ZDIA 5EFZA 3TLXA 3K2IA 3NXKA 2RHDA 2RAFA 1VARA 5KDDA 2YJ6A 3DGEC 3PUJA 4ZOLF 4JT2A 4JVLA 3EB9A 3FOBA 4MUYA 3V4FA 2P9JA 1ZNQO 2YYZA 4N3AA 3VZRA 6PFKA 3FZGA 1JIXA 1P3DA 4G0UA 2PGXA 3KK0A 2ERYA 1KBZA 2OYCA 3WKEA 4JCOA 3WB1A 4XIIA 4K40A 4G1MB 1C4OA 4UM8B 1YTFD 2NACA 3RFVA 1MFPA 2GYVA 3DE6X 1NDQA 3I1JA 3T3DA 3ABTA 2LKDA 5C8YF 1KB9F 3QOWA 1KDOA 3FYEB 2YWGA 3DBLA 2DTEA 3HY3A 1NU8A 4MGEA 5FXMA 5CA1F 2LCQA 2FEWB 1KS2A 3TF5A 4JU9A 4JR0A 3IEMA 1U9JA 4GNRA 5KOJB 1WHSA 1Y6QA 1U1CA 5FTJA 1BHAA 2IHZA 3HDYA 5BRAA 1ZK2A 2BI7A 1R3KC 3U5ZB 1X7ZB 1EFVA 1JH8A 1G5RA 1XTIA 3IJEB 3NHLA 3D2AA 1C1DB 4HV4A 2DUJA 3N8GA 5D84A 4MOWA 2B78A 1Q7YW 1NMZA 1J9ZA 4FHFA 4TKUB 1T9HA 2X6TA 3QP9A 1E99A 5HMLA 4JLOA 3CBGA 3IDAA 4X62O 4LRQA 4MUHA 1SIWA 3AHCA 3BK7A 4QPJC 4YJHA 4RS4A 1UEJA 4A27A 2P41A 2W0MA 5KSOA 4JI4B 2P4KA 1KGSA 1IATA 2MMGA 2BFMA 3F3MA 3GX1A 3I04M 1O94A 3KQWA 5DKFA 3BIJA 2VUSA 1CDEA 1F4MA 1G7CA 3W2IA 1G8YA 3NBMA 3BL6A 4ALJA 1OYOA 2XODA 1TC1A 4ZZ0A 2XADA 3NV7A 4GVPA 3UC9A 2OUKA 1ACJA 1SIUA 2WD8A 4O4JB 1C0EA 4O08A 1JKIA 3LJKA 3LUGA 5CIWA 3KQKA 3N2KA 3AONB 1QO0A 2FSGA 2QQ0A 3DLCA 4R3NA 4RHEA 4YBZA 5HRAA 5HGXA 1YQDA 3LBHA 2AF4C 1RBZA 1W96A 1JQEA 3BWBA 1V54B 1TEZA 5GJBA 4KFMA 3BF7A 5H1YA 4C88A 1NV8A 1F4VA 2ZB2A 4CDNA 5HKKA 4RH1A 5AJTA 1VE3A 3U81A 3LU1A 3LQ1A 3EW9A 3SQXA 1YQEA 5FHRA 1NF8A 3AR3A 3PE3A 5HX7A 2R7LA 1F3OA 2O1EA 3L0ZA 1TM3E 2XAGA 4H0NA 2XECA 3R6WA 4N47A 5EIOA 4BNXA 4D3DA 4D3SA 5JTTA 1N36O 1HFWA 1KO8A 2Q27A 3TMAA 4A92A 4H3VA 5IKEA 3KL2A 3MTIA 3VC7A 4HQ0A 4AUMA 4EWLA 1NLMA 2QW0X 1GAJA 3V1UA 1IBLO 3G5UA 3LKDA 1WW8A 4GE0A 5ALOA 5LQKA 3NB0A 2O8DB 2BM1A 2ONYA 3H87A 2E2WA 2VQ3A 3WGVA 5IJ9A 1NFFA 2GJSA 4LF4B 1FFSA 2YWHA 3HA5A 3RIXA 5CDYA 2CSXA 4JZGA 1CG6A 3CZ9A 1BE1A 4BVAA 1U0HC 5GJWC 1CDDA 5IK2A 4TS3A 3ZE6A 2VDMB 3VSDA 1DMSA 2RNBA 1KJNA 2R1TB 5ALMA 3F49S 5B6JA 2M2IA 3AK1A 1OVGA 4PO1A 1C4WA 3WO1A 2Y4TA 3CSDA 1AV6A 3URMA 2P77A 3EVZA 3DA8A 4TYPA 3OEHG 2CCKA 3AG2B 1GUAA 1OT3A 4H37A 4H18A 4LTDA 2HQOA 4BX3A 4MW7A 3TLAA 3QPWA 2VLBA 3EC2A 2CDCA 3G5TA 3KHTA 2YEVB 4WZAB 4FZ5A 3TX6A 3SVTA 3T5MA 4JMPA 3CV3A 3ZNOA 5JQGF 1EIWA 4FI3F 2J48A 4MKIA 2IF0A 1J23A 1FNNA 1YGYA 2NU6A 4GWLA 1U3TA 4X93A 1XD9A 2GCPA 5CVJA 3NM4A 3HKDB 3N27A 1RHMA 2ZPUA 4UCXA 4IGAA 4UOZA 2VA8A 4BEWA 3QE9Y 1N36B 4J16A 3GRKA 4YJGA 2ZSUA 4CLOA 1YA6A 1GSOA 2FF7A 4NBNA 3U31A 3A0BZ 2AJTA 2CJWB 5I8ZA 4MDFA 3ICPA 3EDYA 4E1AA 5JPIA 1YIJV 4DIMA 1W5BA 1JLLA 3CVVA 3OIWA 1TXGA 1Q14A 4LV6A 1RS0A 3JYHA 3K8OE 3ND8A 3SYMA 1YA8A 3K2BA 1DIGA 3L6CA 3IUPA 3WR5A 4AO6A 1XOUA 4EYOA 4BBPA 3DL2A 3UJHA 1RPTA 4ZO9A 5JPCA 2V6IA 4H77A 4HYQA 2IIPA 3CPSA 3ECSA 4M98A 3TGWA 1JR6A 3NVAA 1W4AA 5EE1A 1CJKC 3F74A 3Q4HB 2ZWPA 3EWAA 2HWKA 1Z16A 4WZAA 4ZQBA 2E74B 4FD2A 1X7YA 3HCPA 4K6HA 1AKVA 4DR6B 2E3JA 3DQZA 5TQVA 4PX3A 1R0RE 2B30A 3TPFA 3D6JA 3UO8B 1TIBA 4KR0A 3O1HB 6REQA 4QPDA 3LTNC 3E22B 3L01A 2QKAA 1SIOA 1NYRA 2ANBA 2HF2A 1CE8A 3CBQA 4FKBA 2A86A 4JNKA 4K05A 4K9KA 1GXSA 1X1QA 4X85A 4LYHA 1CUCA 2JIQA 2CVFA 2ZIAA 3UENA 3RYHA 3VQXA 1A96A 2NSLA 4C2UA 2GAOA 4NXMB 1N2JA 1X7ZA 4FHCA 4JXKA 4QYSA 4XEUA 2CVQA 1B43A 3EGWA 3PQFA 4Y3UA 3HKCB 2YIBA 2QNBA 3AXTA 1GZ7A 4BFUA 4BDSA 4CKCB 1TEXA 3GA7A 4F6RB 2OCLA 3QVXA 1XNGA 1XC7A 4ZVMA 3LF1A 1W6RA 3IB6A 4EG6A 2VRNA 3KDPA 4RF5A 5TMPA 1EBFA 1O95C 3AVPA 1RSOB 3PQ5A 5E7JA 4OJTA 3UKMA 1S72V 2FPMA 1QO7A 2IRWA 4NFLA 3EQ2A 3G5AA 4MS2A 1NUQA 4FM1A 1M66A 1L7RA 1D4OA 3C43A 1Q1QA 2FXIA 1MC5A 2NO4A 4P38A 3GIWA 2HCRA 3R44A 3SFVA 3WYNA 5KJ6A 5ICSA 1NZ6A 3CEAA 5BR8B 3NT5A 4P80A 3TFWA 4AJOA 4EHHA 4JP5A 4U39A 3ABUA 4BMPB 2RHGB 3RIYA 1J6UA 2FRXA 2G9RA 4MMXB 1YZFA 3G2LA 1JOYA 4YXWG 1QZ3A 1RP1A 4CKXA 3CHXA 1KYVA 5BN4A 3L9DA 2PDAA 3KB6A 3PFNA 5BVHB 3DZGA 1PFUA 5FFMA 2OHXA 4RIIA 3I6BA 2VPXA 1D1PA 4ID3A 4ZGBA 1JSRA 4JVMA 2XNDD 5EMMA 1WMFA 2WLKA 3T1YB 2I62A 3CUWA 1P2FA 3FZYA 3W2HA 1FQWA 1NT2B 1XN1A 4I1OA 4HDSB 1JDJA 4QL3A 4OQMA 3SPHA 2GEUA 5DP1A 3GR6A 4YRZA 3AIKA 3SGLA 2DG2A 2PQMA 4JJ4A 5HOEA 1V6AA 2C7BA 1QTNA 2YV1A 3NAMA 2VAXA 1SOMA 3AB7A 5BN3A 1EP9A 4UVAA 2R11A 2W11A 2X0IA 2G04A 3NH6A 2BLLA 4C4ZA 2NO7A 4OX9B 1FLVA 1X8JA 3L4SO 3L7BA 3WB9A 1ADBA 2GCOA 3DLBA 1PBNA 3L4EA 3GK3A 3HU3A 5KOJA 4UNSA 4IJQA 4FXOA 3U44A 3VOAA 2TS1A 2O5VA 5SZJA 3DMNA 2Q2NA 3TM4A 2QU8A 4M1QA 1QLEC 1C50A 2LUOA 3F96A 4LNHA 5FBKA 3MSCA 3UKJA 5B3KA 3GJ4A 3V6MA 2N1MA 4K9RA 3K6SB 2NLOA 1L5LA 5HIMA 2B2CA 3JPYA 3AVVA 2P3OA 3PA8A 3EMVA 2EZOA 3PHIA 2ZXWC 4G8CA 4H7PA 4D9GA 3JAKA 1DXHA 4DCSA 3C3SA 4WX2B 1B3BA 1IY9A 2WLHA 1PL4A 5BY1A 1NOJA 1EAMA 2PG3A 1CEQA 4OHFA 5L7YA 5JYCA 5JS1A 5IAAA 2QI9C 1KSJA 5H2FZ 2EIMC 5KDLA 4FR2A 1RM0A 5A62A 3GDGA 4Y18A 5JS8A 2FETA 3K0SA 4B3IA 1OBHA 4AI6A 4Q9HA 4GM1A 1SC1A 1JKJA 3U0ZA 5TRTA 1DE0A 1U9IC 3QFCA 3IDOA 4MVJI 1PAUA 1S02A 1D6JA 2J7PD 3HNPA 4JA2A 4BASA 5IFKA 1SQPH 3F90A 1SESA 2E1RA 4H27A 2O8BA 3I4CA 2D1QA 2OVFA 2UZAA 3KVNA 2Z9BA 4LJ9A 4B09A 1IWBB 1J2EA 3LBAA 1YEWA 4R8RA 3TZHA 1ZMOA 2C3UA 2KHZA 5JEEA 5ITWA 1MGOA 3F7OA 3TJRA 3QPCA 3GT4A 4RAQA 4QDZA 3BGSA 1A5TA 1DIOB 1FYWA 1PW7A 1HTTA 3JQ7A 3TRKA 4MVUA 4B7AA 4CEIB 1K3EA 1CW2B 2OOKA 4N82A 1USIA 3E1GA 2O9JA 1PNMA 3STXA 4CKWA 2GCEA 3U4QA 1IUPA 4MCIA 1UAYA 3T7KA 2OFPA 4DM7A 4BLVA 2VQDA 2LIVA 5F2EA 1J25A 2FP4A 4X7RA 5HBGA 3SHTA 1SVOA 1HOXA 2O2DA 3MT9A 4N3GA 3OTOO 3O3NB 3N0VA 3O9ZA 4FQ5A 3PR3A 1BYUA 3JCUZ 2MYTA 5CYGA 3O47A 2KB0A 2C8KA 4AL4A 2X2EA 5DB4A 2HZ7A 4JV5B 5DW0A 3FPSA 4QYXA 3PBKA 4X3CA 4MH0R 3W5VA 1SHTX 4QGFA 2R1VB 1YXBA 1EGAA 2WFZA 3G2PA 3I5UA 1P7BA 1FZQA 2BTQA 2AHRA 3LUDA 4N5MA 1WE2A 2GEBA 4Q7EA 4QBIA 5ALPA 2V6BA 4B74A 5IT9A 2LTAA 2Q2QA 1EM8A 2XCRB 3CS3A 3EVEA 4PELA 3ANMA 4IHJA 4BNVA 1L4EA 2D74A 4P2BA 2EJWA 2GCOB 2J41A 3F8SA 3QLTA 4RH0A 5TXGA 2VO1A 4I9NA 4AYTA 4B73A 4Z1MD 1E20A 4QTTB 4IEFB 1PYDA 2IEIA 4EI2A 2QNIA 1J4AA 4RXMA 2J3MA 5F9MA 1NY6A 2PQ2A 1FXSA 2IHJA 1SCKA 4QXQA 5KCMA 2DH5A 4ZO6A 1ISSA 1UBFA 5I01A 1QKIA 3MEQA 4FILA 4RORA 3AL2A 1CVLA 1OXBB 2AA3A 3K4PA 4PGFA 3V8EA 1UPUA 3CH7A 4M89A 4RAOA 2Y0EA 2X8AA 1K5GA 3FTQA 4HFRA 4U2EA 5E6UA 1RXYA 2ZTVA 5FL7A 4MROA 1B6RA 5C5EA 1ORIA 2R00A 4DXAA 1LZKA 5ALSA 5CLLA 1OAOA 1FLDA 1E58A 1Y3DE 2Q6LA 2OCHA 1OV4A 5B1OA 1PS0A 2VK4A 3BUSA 3N8DA 4OAPA 3ZXUB 3A3PA 4ZICA 1E3DA 1Z6ZA 5DHRA 2M7WA 4NMLA 2X7JA 3IC7A 3KCNA 3KQQA 4G4SO 4NE7A 1EP3B 1CJBA 2HWUA 2X8BA 5C18A 2BGJA 1RE1A 2LIPA 2QN9A 1QQCA 4OB6A 4Q48A 1RYMA 3NTLA 4C1NA 4ISCA 5IT5A 2GAJA 5JCJD 5MF6A 1ISRA 1U94A 3DFMA 3A9WA 3OJEA 4UHCA 1D2AA 3RFUA 1E61A 1R1DA 1EFRD 4GLJA 3CD6V 3AEQB 2QE7G 2A5LA 1DOAA 2Q7XA 1YVWA 2QTRA 3QFTA 3VHQA 2TSYB 3DTNA 3A2NA 3FJYA 5K7SA 4BV2A 5EYPB 1O03A 2QN6A 4C20A 4P7JA 5EINA 1JAIA 5DK4A 3GFQA 2JDIG 4NECA 5JAMA 2OHFA 5DXJA 1ADCA 2AG8A 2ZTHA 2UVPB 5LQDA 2NO9A 1P4RA 3C5HA 3FVWA 3TSWA 1UFKA 3I32A 1NTOA 4OLFA 1I6LA 4E31A 3SJCC 1YDHA 2H4WA 3VBEA 2EVWX 4FSHA 1JMVA 2WWXA 3PD1A 2OCPA 4NPAA 4BFSA 3NBXX 4DLUA 2DQSA 3QJ5A 3PCXA 2VQFB 3I55V 1DWPA 2CYBA 4INOA 4LRXA 4N41A 3W5AA 3LQKA 3ORRA 3CRCA 3TD9A 3TOVA 1KI6B 2PBLA 1DRWA 1KNXA 3L0SA 4KGXA 3R66A 4PCLA 4KHPB 3U7JA 1W36C 1D5NA 1ZLZA 3AEYA 3K09A 4K6GA 1X7HA 2XDWA 5CHYA 3C7TA 3ZDQA 1W85A 4NX2A 4A2WA 2H08A 4BFVA 5IT4A 3B8NA 4RD3A 3GVPA 4B6RA 3HXOA 2GPWA 2HO4A 3E4CA 2TECE 4IV8A 3A25A 3NIWA 2P79A 1RWMA 4TKVA 1I24A 3FUXA 4X91A 5FA6A 1COWG 2C9ZA 2LR0A 5C46F 1VQKV 3CMCO 4WA8A 1D3AA 4MPRA 2XBUA 1P4HA 2WG1A 4R98A 1Z63A 3IAYA 1CZUA 2VCYA 4EG4A 1JMKC 1SERA 1EXVA 1REQA 1BS3A 4LSMA 1PSZA 1G0NA 2WOOA 2IUSA 3K5LA 4W5WA 3Q5GA 1AK9A 3THYA 1G8HA 3A6DA 2UU9B 1W29A 4OJKA 5EP2A 4FHZA 4JBWA 3MRSA 1VPDA 1QBGA 2CDNA 2H17A 1P9LA 2P69A 3EGDA 4G0PA 4KXQA 4ZARA 3SZMA 2XEDA 4KYTA 3CFYA 4BAZA 3GD5A 2BIFA 5IAOA 3UZUA 1O7JA 3ZBHA 4KWHA 4QECA 5TPZD 3BGOS 4FDTA 5HZHA 5EA2A 4OHKA 1G8GA 2J3QA 4CM1A 4V1CA 1XLUA 3OBIA 5IC6A 1ZRNA 3FRIA 2AGAA 2EBWA 5IASA 2B94A 5BV7A 5LOVF 1ZIOA 1GYQA 1VQ6V 3DOEA 1ECPA 3E3LA 4OGWA 4UARA 2H1HA 3TIGA 1L8DA 3C3JA 3TE7A 9ATCA 1V4VA 2ZSAA 4QJBA 3D4IA 1I5YA 3IA7A 3GLGE 1I3MA 4FCCA 3WTBA 2WLSA 2QBYB 4N7MA 2JFOA 1BEZA 2PQ6A 4LCJA 1XZDA 3ZHTA 4A26A 1EBOA 3CJHB 1IBRA 1TZ2A 4OD0A 4LFAO 4YY3O 3N74A 5G02A 4DQXA 3KOXA 5DHQA 3GV0A 3V34A 4AJ2A 1FDUA 3G5LA 3G89A 3JQAB 5CEFA 1VZ2A 3ASZA 2Q99A 3PCTA 1ZHOA 4LJYA 4I1IA 1BJRE 1ODCA 4LC1A 3KT0A 1N6NA 1KJQA 1ZMXA 2HYDA 2EZ9A 3M4ZA 3FTDA 3ZRSA 3N59A 2P6OA 4HXFB 2VJOA 3AM3A 2FWPA 1XO1A 1R0BA 3B6EA 4QT0A 4BFWA 3ZHXA 1Z5PA 5FBQB 4EQZA 3LGXA 2EEZA 1IMJA 2V74B 5J2TB 1SQ6A 1CP3A 3ELYA 2A58A 3Q72A 3QBTA 2DZDA 2XCTB 1ORTA 1HNWO 4EUFA 1TRHA 2NADA 3TTWA 2P22C 2MSEB 2UZ3A 3EHEA 4B71A 4EA8A 2I78A 1UBOS 2YZ7A 3X1XA 1EDBA 4GEKA 4QSHA 3CCBA 5EJIA 4BB5A 1IDN1 4LZOA 2FW1A 2V98A 1M34A 3CKYA 2OBFA 4RHUA 1SUIA 2HF8A 2G28A 1YS4A 1Z2DA 4Z9YA 1DKUA 2CVHA 1QRTA 2D0OB 2BONA 2I91A 4DUZB 3OZSA 4JI0O 3QPVA 4F2HA 4ENRA 5BRNA 5JNTA 1NQTA 2CDBA 2HV8A 5GP1A 3V42A 4X3PA 1V1RA 4NXMO 2P4UA 1XRLA 2ZRIA 1C7RA 1JZSA 3FR8A 4QDTA 3QU4A 4GM0A 4HDMA 4LFAB 5H3LA 2R8XA 1YE8A 2VBFA 3REGA 3W06A 3ZU4A 3ZZTA 1U0LA 3FNFA 3BIFA 4J16C 3W9SA 3TNJA 3LXMA 4LF7O 2JKVA 4URHA 1Z22A 5CA0A 1SCBA 4N54A 1P39A 4YB8A 3MWGA 3T7AA 3TXXA 3WJ7A 3GEPA 5L53A 3A1EA 1IEWA 3O9OA 2QRJA 5ED4A 3MCWA 2PS3A 4M8NE 2QTTA 3TX2A 4QPKA 2QUJA 3O83A 1V7PC 4Y2UA 3EMKA 1A04A 3N6XA 3MJTA 3QFHA 3TYXA 4AKIA 2FQYA 3GZTB 3C6KA 4UJ3A 2Z5UA 1ESZA 4BB6A 3VQYA 3I73A 1VSUA 1Z3CA 2C3YA 4JWTA 4F4UA 2R5NA 5C1PA 3KEOA 1PD3A 3E61A 4AJLA 1OU4A 4AN4A 1G3MA 4HPXB 4TMFA 5FFFA 1G59A 2ZBQA 4QASA 2HA3A 2LGQA 1TIKA 3FGNA 4KIUA 4UMVA 3IKVA 2GKSA 2UAGA 5JWOA 1WLEA 4KXUA 3EA5A 3WGQA 2J4CA 1Q3HA 1Q6HA 1T1EA 1JYEA 1MOQA 3QITA 2I2BA 1V3VA 2QZSA 2V7XA 2ZJ3A 2A30A 4GICA 1ICEA 1G21A 4HLQB 4BMVA 4OGQB 3RI3A 3KUDA 3ZQ4A 4RMHA 4D81A 2EFDB 5TPWA 4CL8A 1TJ3A 3IO5A 3OZUA 4N12A 1SQGA 2I2AA 4OQDA 5CW1A 3B51X 1FAFA 2G5GX 4XWKA 1A8PA 1DJOA 2WKQA 3FYIB 2E4YA 1QTIA 1SCUA 1VMGA 1K5DA 1OSNA 2AE2A 3BJMA 5EHIA 4YMLA 1WABA 2YUTA 2OCYC 2X5OA 2UZ4A 3B3GA 2FTKE 1UMDA 1J20A 1E6UA 5FA8A 2JS5A 2QI9F 2IYWA 2YY7A 4D8YA 5KVSA 1XCBA 2W8BA 3LBYA 2JLWA 2R751 5AYVA 1TU0A 5GONA 2WYUA 4DIKA 2CLEB 2F1OA 2QTFA 4HDKA 3VJLA 3AGQA 3VFDA 3E86A 1MH9A 1EHYA 1QX4A 2N75A 3FTEA 5FPOA 4XWOA 2VJYA 4R2JA 1QSGA 1I80A 2G9QA 3OD1A 5DWDA 4O2BB 1WHSB 2HU8A 3K59A 4ZXFA 3RF6A 1JQKA 1RBQA 5BMVA 4BPBA 1A0OA 5ADWA 3P7MA 2B9ZA 1PNQA 3H3FA 1AA6A 1P6QA 2QUIA 1RKXA 3EXG2 3B9BA 3CR3C 1PJZA 1Z06A 3FFAA 1Z2NX 1LSUA 2ZIVB 3PSHA 4WERA 2N42A 2PKYX 3S99A 1EN5A 3VX3A 4ALKA 5JXWA 3N1UA 2GARA 4G5HA 4N5LA 4D4HA 3T2MA 1Z8HA 3DPIA 3IEPA 2QKYA 3HY6A 1YD7A 4D26A 1SHKA 4OOEA 1J33A 2B34A 2Z2JA 2H3OA 3D3KA 1WG8A 4MS1B 4YCDA 2ZRMA 1VRCA 1ZL2A 3FCCA 5D5PA 4DO2A 4UU1A 1OWNA 4R1OA 3H1PA 4FD3A 5A03A 1PUIA 2Z4TA 3RW9A 3D3JA 4ILKA 1J70A 1GUFA 1Y98A 2EDCA 2ID8A 2R8EA 2IU6A 1DQYA 4IGEA 1DAFA 2VF7A 4ODIA 1KF0A 2ZS8A 2BH9A 3BFKA 4PQEA 3U7QB 2WJ6A 4K9MA 2AZ4A 1MQ9A 2W2TA 3BWYA 4N7BA 2WVAA 3RW0A 1M10A 1Y8AA 4LA4A 2Q7EA 4HWPA 4N40A 4P92A 1S2OA 1RZUA 4PV7A 4ZVRA 3HR4A 1R6UA 3NOOA 4HNAA 1JEEA 2N0SA 2QTHA 4IINA 4MX8A 1PNKA 3BXGA 4BNIA 2B82A 1PG2A 2DBRA 2QHXA 3HZOA 4I5EA 4J90A 1EJBA 3LKVA 3DXFA 3RYCA 3DXRA 1NJSA 2PGJA 1I4EB 2RGUA 4N1AA 4CYMA 2QS9A 4IG4A 5IANA 4TT3G 4JN6B 5DGXA 2GHTA 1Y42X 1GZDA 1S2LA 1ZMBA 3GFGA 3BGDA 4QXMA 4FKZA 4LF9B 2OORA 3WQQA 2OLJA 2QUBA 3K1AB 5K0TA 2BGGA 2BSKB 1OLUA 3O1LA 3TLJA 2C0QA 2B69A 4HT3B 3ZWXA 3HN6A 2JJQA 3HB0A 3QVOA 3G0OA 2RK6A 3RT1A 3IV6A 3CE2A 1JAHA 3D8CA 1IOVA 1I2DA 1Z4IA 5G1NA 4UPEA 1HZJA 1XB2A 3HYSA 4NLLA 5JG7A 2PUTA 3I28A 3RAEC 3ETEA 3B1XA 3WX0A 5K8VA 1NXOA 1NHGA 2ZM5A 2VK8A 4F9GA 1O9BA 3SPCA 5LMNO 5IJ0A 5J4YA 3S70A 2LJ2A 3RJMA 3OFND 4D3ZA 5CT5A 4YV7A 1U99A 4W4KA 1CF2O 1NKTA 1X80A 4MRRA 3BMOA 5KPJA 1J8YF 3TFOA 1LY1A 4MVRA 4MV9A 4NQZA 1W4RA 4UQOA 1FFEA 2DLNA 5IJZA 2G8LA 3GPBA 2JLXA 1IURA 2H7CA 3AFHA 1GFSA 3G88A 4JEHA 4MV7A 1KK2A 3WK6A 1VJTA 1S8OA 4CC5A 3P9PA 1VIDA 3HJGA 2ZNJA 5HXAA 4DB4A 1UPCA 1E9SA 2FR8C 3N5CA 4HQOA 4PIPA 1SK9A 3DBHB 3AJ8A 1JZQA 2RN9A 4CT5A 4EF4A 5CFZA 4D9HA 4IMJB 4RPHA 5E4TA 3RUFA 1HSOA 2QX9A 3DE0X 3BRQA 4UHKA 3CEIA 2NZXA 4EUNA 3T38A 2C2OA 4BBJA 4K0KB 2MSKA 2F95B 2F4VO 1WXXA 5DSZA 7ADHA 5BQ5A 1WKCA 1RHRA 3C1TA 2R1ZA 2ZEJA 3L5KA 5FFNA 1B04A 1MIOB 1O9HA 4JQOA 1XLWA 4BKQA 3NJRA 5AW8A 1BZYA 3WYBA 4E33A 2IH5A 3ER6A 4KBFA 5CK4A 1JDVA 3NYIA 2AG0A 2CK3G 3H6GA 5ENVA 3EASA 5F78A 3KV3O 5DEIA 2ZJZA 2APJA 3EUEA 2WMDA 5BUSA 1SG9A 3PUXA 2A9KA 1YVRA 3H0KA 1H2LA 1P74A 3HDGA 4MS3B 1LLUA 1JIKA 3K53A 4RS3A 1KSGA 3RARA 4C03A 1LBTA 3OAAG 2OOSA 3DCNA 1KZYC 3Q2OA 1LJ8A 1PG0A 2WR8A 4IXTA 4EB6A 1HM5A 2X9LA 4JC0A 4MWEA 3ODGA 3UYLA 2IUFA 1YAJA 2H94A 1GZ4A 3FZQA 2OV8A 4ZIBA 1WXIA 2PSSA 3LQRA 1Q0SA 3BIXA 2DWUA 3RJ9A 4ZI7B 5LMZA 5MHTA 1JF8A 3FCOA 5I5GA 1M57B 1YTFB 3DTTA 1VMKA 3F6BX 1C7EA 2M6KA 4DV0B 5KYVA 5BWLA 1Y5IA 4MVOA 4XDZA 1MVOA 2X22A 3DP9A 4FPPA 3O4JA 1DK1A 3AI2A 1RVV1 2B92A 1DJLA 4H7DA 4MNTA 3S27A 2OC4A 3W7WA 2FFBA 2UV8A 1G41A 3FFTA 1A9ZA 3OU6A 4B2IA 2A78A 4QNNA 5H81A 4I55B 4AICA 2QRHA 2WI8A 3BQNB 4A8JC 4GLBA 2O7VA 5FWYA 3AILA 4G86A 3SP1A 3ESBA 4Q7QA 5JLAA 3V3TA 1VYVA 4OOFA 3TCXB 5CN0A 4AVYA 1L5RA 1M74A 2QG6A 4QATA 4XDGA 3WDSA 1T0JB 4PVDA 3EEBA 4MJXA 2O20A 4V0QA 3CF4G 1QCYA 3IALA 2C4NA 4HLUC 2HHHO 1P5RA 4TVKA 5BSHA 5LQJA 4TUYB 5K3SA 2IA5A 2X6CA 3X44A 1Q7GA 3HB4X 1GR1A 2LPMA 4WT7A 1JI0A 1Y80A 3R6GA 4K9QA 3S2FA 3K9SA 1G20E 1L4FA 3R5FA 3GLIB 4NCJA 4QNRA 4JPRA 3KAKA 4MGYR 4UBMA 2JFXA 4GX2A 1S3JA 3FUVA 3A4LA 1ZMTA 2GLUA 1ANKA 5DNCA 1TYDE 3O1JC 1QS0B 2VRWA 4EG3A 2QVZX 1URFA 2PK3A 1CJCA 1PL8A 5AVXA 3TGPA 1Q1AA 4WRRA 1AC5A 4FYIA 3PLNA 3DTVA 3DZIA 4GEGA 1NONA 4KTTE 4LJ4A 3MAJA 2H8GA 1QDLB 5DHTA 5AVQA 2RHOA 2IV2X 3QQ5A 3Q5DA 4D9KA 4CL2A 2VKTA 4XUCA 1VRVA 2GVDC 3LPMA 3VR6H 3TQOA 4REQB 1O77A 4QUIA 3A2FA 4TYNA 4ZC8A 2FDCA 4PZEA 3DXRB 1FY2A 1G4AE 1BEUB 2GGSA 2F3UA 4DVJA 1JLSA 1PV2A 3QMWA 4DC0A 1WSDA 3KKMA 2JH9A 4CM8A 3ZS8A 4A8JB 3GNLA 4NTXA 4Z86A 2WAOA 1KDTA 2ATIA 4LZAA 1HYQA 3HB5X 4CG2A 1ITZA 4HGNA 4E7PA 5AW6A 3F5MA 2PJUA 4WESA 3SZ3A 2YOFA 1YB4A 1QQBA 3TBFA 1MX1A 1CZLA 1XTBA 3OCZA 1AUOA 3VGJA 2FPXA 3NDRA 4FFBB 4KUHA 1IIBA 3M99B 2AMFA 2IP1A 5DHFA 1VC2A 2XUHA 3LT5A 4ZDKA 2RGAA 3F0TA 1YK0A 3AFIA 3RSZA 4C2BA 1V1MB 1DC8A 3JD0A 5EZSA 1OPRA 2A94A 2CJYA 3P71T 2QTOA 1PZGA 4WSOA 5LYYA 3KHKA 4Z3OA 1L4BA 1ZH4A 3HVUA 3H5TA 1AV7A 1V9CA 3EVGA 4Q1DA 5FH9A 4YMIA 3RVLA 2P0YA 5KTMA 1D2HA 4QFMA 5KQSA 2NZYA 3FDZA 3QELA 3I9LA 3ESYA 1FUUA 2YQ5A 3L04A 1NF9A 3FF4A 3QELB 1W2HA 3HI4A 2FPIB 5C34B 3CRNA 5LM3A 1EJ2A 1M8KA 2QX8A 1POXA 3PVSA 3A1UA 4JLVA 3STTA 3QM1A 1PEKE 2OHGA 4F0JA 5K0FA 2YMLA 4YJ2B 2HA7A 5JO0A 4MPPA 4XTCS 5A7HA 3ADOA 3D0OA 3ZZUA 2A8YA 4FJ1A 4HDKB 4R1UA 4UTPA 3OUSA 2XUQA 1BC5A 3LY8A 3NGLA 1PFGA 1TEVA 3T3OA 4FE3A 2PU7A 1KNQA 1ADYA 1UKZA 4G9GA 4HDSA 2EYQA 2N3ZA 3UGJA 5A4JA 1G2OA 2ERCA 1R3IC 3MDSA 5BW8A 4MICA 4W7SA 2P2NA 4YT2A 3GLIE 2C98A 1N0IA 2DBZA 2VDOB 3EGDB 1IPEA 3OEHD 1CZRA 1G3QA 2GRUA 1OUMA 3M6LA 3PDCA 1CLUA 3D6TB 5B37A 4ZT4A 3ZVRA 3C24A 4N21A 1EEHA 1ENZA 1O95A 1WCWA 2HL6A 3LDGA 5AKKA 5LJIA 1R6DA 2DPLA 2YN2A 4FFKA 1DS6A 2IELA 3C8DA 4LJ7A 5TPWB 4FGKA 3ND7A 5HG0A 1SA0B 4IIEA 4O4JF 1XCPA 2WT9A 4IDGA 3J80A 3UANA 3B82A 1TUEA 1ZEJA 1UQTA 3H84A 3KDSE 5JSKA 1H23A 2XCIA 3HM2A 1PYOA 3C14C 3KYIB 1PQUA 1KWGA 1SF9A 5C52B 4JD5A 4Y1EA 4FMDB 2QTNA 3E4DA 4BNDA 1OKKA 2I34A 4MKGA 1WB5A 4UV8A 1YR9A 3D3WA 2IYNA 2G5CA 4M8SA 5CAEB 5KI6A 2IBZH 3BN3A 4HS9A 5D87A 5AK3A 2G0TA 3K0FA 4O3MA 3LE8A 5FTLA 1BD3A 1P31A 1F17A 2GBLC 2HQBA 3K9LA 4TRJA 1UR5A 1F7UA 3T1QA 1N33B 4R3WA 5DTEA 3L02A 1G3UA 4Z5XA 1AX9A 4YRBA 1I1HA 2A3RA 2V7QA 3OZ7A 5HNKA 3D6VA 3ID6C 4DRXB 3KTAB 2I1LA 3B6IA 1GCIA 5C1BA 4LF8O 4QPCA 3ZHZA 5L3QB 4EGAA 3OD4A 5CGZA 2Y1XA 4JYAO 1JMYA 2ZYWX 5K3BA 1ETUA 3VPDA 3WLAA 4KSBA 4FQ8A 3K2QA 2AVNA 5BUZA 4KJXA 1M3SA 1WVGA 1ZAYA 1Z5ZA 4UVCA 4HN4B 5AKIA 5K05A 2XB2A 4MP3A 2JLSA 5EN4A 3F6SA 3H5LA 2EIXA 5EKUA 2A4KA 4BV8A 3KCQA 4NZPA 4KHZA 2DU8A 4XRGA 3UCSC 4K88A 1QJ4A 1AQYA 4QO7A 4XQGA 4KREA 4D6TH 3BCSA 3QVJA 4U5XA 1WRBA 5NULA 1ZOIA 2G38A 3IOCA 1ZDMA 4JIMA 2HIGA 2IQIA 1JPVA 3OKPA 3W9BA 3WJAA 3GVXA 2VP4A 1YHNA 5DU2A 4BNTA 3WB0A 2F55A 1AP5A 3T5DA 1JHPA 1XZKA 7AT1A 2WJVA 3OUZA 4Q5IA 1JLLB 1MO4A 1R5JA 4HO1X 5KS2A 1I9CA 3MAAC 2UUAO 1KVQA 2OBXA 1L4NA 4P86A 5TEWA 3K20A 5FOXA 4D3FA 4R71A 4EB6B 2B5WA 3EFEA 3VR2A 5KNDA 4DEXA 3LVQE 1ZRMA 4EZEA 1GNPA 4L0CA 2FSIA 5KMGA 4W8GA 3KC2A 4XPZA 3CB4A 1HMYA 4GSYA 2XB4A 5J5AA 1U6JA 2WPNA 3A6GA 2Q3MA 1B16A 1WP4A 2P78A 1XUQA 3ZH2A 5BURA 5J2UF 1JG2A 3JQAA 1N4AA 3EE6A 5TC4A 3PUIA 2JRIA 3F5QA 5ITSA 3OF5A 1E32A 4FZRA 5F4ZA 1YR7A 4HP8A 1T0IA 4ZVSA 4CJXA 5BOSB 3NWPA 4V0OA 2FN7A 4Q16A 5CXQA 4R8SA 2GK3A 4OG2A 4EFDA 9MHTA 5CX1B 3FRHA 1NRIA 3GVMA 1DHTA 4DIFA 4ZOQI 4Q3CA 3BHPA 3CPEA 1HQYE 3FMOB 4W1PA 5C7IO 1PLJA 1N5JA 2YHUA 4YRPA 4B83A 2C94A 1A76A 1M1YB 5BYAA 2ZIWB 3SYAA 4BKMA 2C9OA 4V38A 3TOSA 2NUTA 3IEVA 3FY4A 3O03A 1B6TA 4TXNA 5DBHX 4DC9A 5HQ3A 2VPIA 4GQBA 3T4EA 2IV3A 5FD8A 2QSYA 3OTWA 1JR9A 4N6GA 1G4HA 5DM70 4CE6A 4G0ZA 2E87A 3DT9A 4J7UA 2OVBA 3FHLA 4DA0A 3P4YA 2Q2OA 1LH0A 2IY9A 2P7IA 4KYIB 4UEOA 4QFBA 2RBEA 3ZHCA 2JATA 3DSRA 3LC0A 3OTIA 3AUJB 5L4SA 2KJQA 2XYRA 3W7BA 1AZSC 3LQYA 3U2QA 3VR5A 3I2HA 2QRVA 3QIAA 4IQ0A 1IYZA 3DKKA 2XOKA 1ZUQA 3W5HA 2ZCJA 4LQCA 1ECBA 1EFLA 3BABA 4WCVA 2LE0A 1U3WA 3O4HA 5L95A 3QXJA 4YJFB 1FFCA 1CFZA 5EIAA 1SUWA 5C5CA 1ZINA 1DWOA 3KFLA 2PRIA 5AVZA 3U13A 3V7NA 2YFYA 1TAEA 2AXEA 4MW8A 4EQ6A 3T1TA 3C3YA 5GWXA 1IZ7A 4Q21A 2KG7A 2H52A 4KFSA 5JS7A 4LWSB 1CBUA 1E9AA 2PT5A 3TQCA 3VSBA 2GJAA 2WYHA 5F2KA 3TQRA 4PZCA 1T2CA 4KYUA 1JFVA 1BDBA 2JFHA 3MAGA 4ZRDA 1FEZA 2HRQA 4LQDA 4UNQA 4WCEV 3TVTA 5CLHA 4K9OA 2A5JA 1NBEA 2HSGA 3C6QA 3ME5A 3QKRA 1MV5A 4M22A 1W46A 1W4ZA 4P5DA 4RPJA 1U3VA 1C3VA 1L5HB 5CX4A 4Z9FA 2WJJA 3K70C 2QP3A 1UBSB 1KMMA 3BYZA 3AY6A 5CH8A 3NLLA 2FPGB 3D0RA 4H3KB 1V6CA 4CV2A 1FUYB 1T24A 3D64A 3KOYA 4IXMA 2AEJA 4ZCRA 1CUXA 1MHPA 3ASNC 1JHMA 2X7XA 4OHCA 2LCIA 1R64A 4K2HA 2IOFK 1JKJB 1HGXA 4WZAE 3DGEA 2FW6A 1OE0A 4A23A 4D9FA 1U5BA 3FLEA 3UICA 3DHYA 2W2LD 3VR3D 2AEEA 3X1ZA 4TXLA 2ZDIC 1VQPV 2ZLBA 5DHSA 2C5HA 4JZ2A 1F0NA 2HQ1A 5DW3A 3DBRB 1W88A 1B0ZA 1SXJC 1FTWA 3CZPA 4KRYA 2WVGA 3M8KA 2OECA 1O96A 1XLTC 2GN9A 3H86A 3A0RA 1LWNA 1LTHR 3O26A 3P9CA 4GWGA 4KO4S 4PSCA 1XGKA 2VWGA 1SBNE 2JGAA 1THZA 3BOSA 2R87A 1P7ZA 2GD0A 1P8AA 2JIZD 3P1JA 4HB3A 3EK2A 4L9WA 1Z08A 4MPDA 3OTOB 1DX6A 2ZJAA 2EWVA 1UFQA 1HY3A 4IEEA 3A06A 4Q7KA 1O95D 3UIEA 4KQ9A 3TJTA 1S8FA 1V1JA 2NO1A 3A9SA 1K4MA 5HMMA 1Q11A 2D3WA 4EO4A 3LGAA 3W9UA 1A27A 3OEHA 3DE5X 2C0CA 3LBIA 3WV4A 4J9ZB 3G68A 3PD7A 4KX3A 4ONEA 1C0KA 4Y2RA 4AF7A 3Q3JB 4REOA 3RSQA 3QLVA 4EVSA 4K5QA 2ZYVX 1TAUA 2VZ8A 4Z1VA 3FFBA 2A5FA 2BYTA 3CCSV 3MHPA 4J7XA 4X00A 5JTUA 4LX8A 3BJZA 1EFDN 1NVPB 2HRCA 2YWJA 2QSAA 3RFFA 2PX0A 4IUCS 4PSUA 1LC0A 1JP7A 3PC4A 4R31A 2P9TA 1DOZA 1I0LA 5CFRA 1U2ZA 5FADA 3MGKA 1MAAA 1FOEB 3NHWA 4Z8YA 1SCUB 1I7FA 5LBQA 4U0JA 4IT5A 1MBZA 4D4IA 2ZVJA 4AJNA 1J95A 4M9CA 2X0RA 2H6EA 4EQ6B 2H2DA 3WSTA 1KJ9A 1LV7A 1C9KA 2OCXA 3DV0B 1I4LD 1UDXA 1RRKA 1ULHA 1P5ZB 3MJEA 3URKA 4A16A 1CUZA 1SB9A 3DMGA 2O8EB 1SZTA 2W2KB 5AI0A 4B7XA 5F3DA 4YQEA 1IVYA 3IYLW 1JR3A 1UJMA 3PUHA 5FO0A 2Q6VA 3T7EA 3ZWAA 1H2RS 2QTLA 5DN6A 3UJPA 4C7OA 1GPDG 3GLHE 4BIUA 3CNQS 2Z2XA 1NE2A 4E4YA 3SZGA 4CR6A 3T3GA 1EZ1A 1ZMRA 1YS1X 4WCFA 2E82A 1XL1A 2HGZA 2V0GA 3T3PB 1EFKA 3U1BA 1SQQH 3FX2A 2W4QA 4IIVA 2PPLA 3PGA1 2NTYC 5LDDC 1DG9A 1M8PA 2VBIA 1MO5A 1BDIA 4MUEA 4FLXA 1CP2A 1RJ9A 4C08A 3V33A 4P35A 3IVMA 2NSDA 2WNSA 3TRDA 1L5FA 1F2DA 2BCEA 2DQZA 2VUHB 2Z30A 3IKMB 1FYDA 5AW3A 1TTTA 2JLRA 3BIWA 3O8BA 3I01A 1RYNA 1JNYA 3W2TA 5D1HA 5T57A 4YPVA 4J7ZA 2WYOA 3B7PA 3MWJA 4HDMB 1WXHA 5KJ1A 1C1XA 3WAGA 1X1DA 1UF9A 2J5KA 3L4BC 1LSOA 1N6PA 3PNYA 1NNEA 1KP9A 1NMYA 4X95A 4G6ZA 1DAIA 4MVJF 2IYQA 2XUOA 2XT0A 3T41A 4LH6A 1DAKA 2C4HA 3I05A 3L8EA 4HWRA 1GTRA 4BB9A 2VPWA 2F3TA 4H4DA 1CRZA 2OBBA 4DTCA 3A3NA 3OP4A 1KTIA 3OQMA 3BXOA 1ZL8B 2PX6A 4ND6A 3W5BA 1BH2A 3O5AA 1TA8A 1BYIA 1IHPA 3GGGA 2AR0A 2ZXEA 1OAKA 3MF4A 3QUQA 4GOXA 1AKYA 4DR5B 2DTXA 2JLQA 1VP7A 4JOQA 1S2GA 2K7ZA 2QM7A 4FS8A 1T9ZA 2XOXA 1ZM4A 1J1ZA 4DK0A 2ZB3A 3OCVA 4N49A 2PVSA 4BLUA 2JNWA 3H4VA 1QU3A 2CL6X 3NBFA 2BEVB 2CN1A 1AO0A 1Y1TA 2D06A 1JDBC 2XE7A 4IQFA 4IGGA 3DCJA 2ET6A 4JLAA 2E9SA 3NZEA 1JFRA 1ST3A 2Z3WA 3E9EA 4N39A 4TQ9A 2J4DA 3R76A 3ZDFA 3LHDA 4E6PA 1VSBA 2QE6A 3TG8A 3H1HH 1AOXA 3DEYX 4NMWA 1PWZA 5JSZA 3U0VA 1JE0A 1VJ0A 3WL5A 2CFTA 2I6QA 1EBBA 5BNZA 1X4TA 1C8BA 4FOSA 1GTZA 2JJ1G 4GG1A 4MQ4A 1HLPA 1OZFA 1Q7BA 2JRLA 5E2AA 5BSRA 1ZK1A 3TLBA 3U9LA 1L7NA 4NMXB 5KYGA 4X84A 4EHDA 1IM5A 4EMBA 2GILA 3Q10A 1IONA 3RS5A 3AW9A 3G0DA 4ARAA 4NK5A 3RK0A 3TEMA 1I0IA 1RC0A 1IHYA 2YY5A 2KSDA 2X13A 4P30A 1QOQB 1R4NB 3OPMA 4WVLA 1CR2A 3PFHA 1BGXT 1TMGE 1H1LB 1D1TA 1P7CA 2ASEA 2Z8ZA 3DBIA 4G9BA 2O2ZA 4D02A 4DR6O 2O0LA 3MS7A 4GBED 1FSFA 4HMQA 4HDCA 4BNNA 3T5CA 2E75B 3ESQA 2GQ0A 3X1MA 1GPWB 3LSYA 1EFHA 4EARA 3JAWA 2WWYA 1NXWA 5JBNA 3S6JA 5CNIA 2MYNA 2BFWA 1Y4UA 4NKGB 1EFUA 4NOLA 1N57A 1A5ZA 3IVRA 5KHGA 1IY0A 4MGZR 4DKJA 1XDGA 4RD2A 3T7DA 4E2LA 1KY5A 2NPOA 3NGXA 2Q07A 1F4LA 3HL0A 3C6XA 3Q1KA 4P34A 4R9VA 1XAHA 1UINA 1CUIA 3EAGA 4G65A 2FUG1 5TDHA 1N2SA 1P2BA 4LRUA 1XMIA 3PN1A 1JEDA 1EA7A 2H1IA 3AM4A 1S0VA 1CWUA 1H0HA 4TKVB 3HEMA 4U2BA 2C7RA 4LV8B 1WDWB 1MB9A 2WHPA 2ZXUA 3BL8A 3HM9A 4P4LA 1DIAA 2Z3VA 4M9SA 1CX9B 1UOQA 1Z33A 4PBRA 4QBFA 2VN8A 1ZH0A 4KQCA 4LUCA 4UASA 3WTCA 5B57C 1AXEA 2OK8A 4WOKA 2WWFA 5AW9A 4Z2WA 1TX4B 3NJ4A 1WHTA 2HK9A 2ODPA 4M8IA 4PG4A 1QF7A 5E4JA 2ZYSA 3OQBA 1AMNA 1HYEA 1L9KA 2C2YA 2PFKA 1SBHA 3FVVA 4M55A 5FORA 3PDIA 2QGNA 2EIHA 5FUMA 2HTEA 4OHVA 4F2GA 1F7YA 3RBAA 4AECA 1AHNA 4UVIA 2ONKA 4YRRA 2Y6UA 3HPRA 3B6JA 3FB7C 5JJNB 2P75A 3PJDA 1P4SA 4K6MA 5CRIA 5EE3A 1NI5A 4JI0B 3AQIA 4DY4A 3WNZA 1BO6A 4DR1O 1RJEA 1BT8A 2OHIA 4QDOA 1FFBA 4LK3A 4HWKA 1U65A 3OMXA 1PX0A 3CW9A 3C3WA 4JYYA 3E3NA 4XYBA 5BT8A 4I08A 5LYJF 3ROEA 2J5QA 4LSWA 2H7YA 2NTVA 2ZE7A 4NWIA 4PXSA 1O6GA 2AWNA 4J10A 4LF7B 4IKPA 5E6RA 5GV8A 2RGNC 3DVLA 3VOSA 4BWFB 1WB7A 3QX8A 5EQJB 1TMOA 1LK0A 4FEAA 4FUTA 4PLZA 1XELA 3AI3A 3P9KA 1PS8A 1HRDA 2YIMA 3WLOA 3B2EA 4E5PA 2CGOA 4UNRA 4E6EA 1CUBA 2FJUA 3LS2A 4IFEA 4DCTA 4HRYA 3IA2A 3LSQA 4ZAYA 3H5AA 3EVDA 4DIUA 4H0CA 4YFYA 1GN4A 2CNWD 3A6KA 1LNSA 4N01A 2X77A 1M72A 3HU1A 3O73A 2XOKG 4DN6A 4TL8A 3GLGB 3AI1A 2GEJA 2ODNA 3ICCA 2R96A 4YJGB 1P9OA 2WJPA 3BCCH 1NM5C 1TCVA 2F9FA 3H04A 3OQ1A 3REQB 4EHIA 1BD4A 2OZPA 3EIXA 1JSCA 3GA5A 2Q5ZA 2XVYA 1YZHA 4QG7A 5G2OA 1QH8B 5K0LA 4AKTA 1V45E 2NWQA 1VCOA 3QXCA 1W30A 2XIJA 3WKDA 5I9SA 5H8WA 1YQ9A 1V55B 4P3OA 3SF8B 4ENWA 5L51A 4RMIA 4FE7A 4IX9A 2PE5A 3BHNA 2P2GA 5BT9A 5A9GA 3FUWA 1HDJA 3NDJA 3KBBA 4GF5A 4I2VA 4F5DA 2DJ5A 3A05A 1KFEB 5BN1A 1S5LZ 1F20A 3LKZA 1VIYA 1H2BA 3RFCA 4UHBA 2C4UA 2K7FA 1BE0A 3EDRA 1VHWA 1B14A 4LF6B 3I9JA 4CF4A 1QP7A 1QR6A 1F06A 4EGSA 1WJZA 4TL7A 5JAUA 1Y5MA 1P17A 2VZEA 2WUWE 3DFUA 3M6WA 3NHKA 4PWYA 3TNLA 4C2TA 4GR9A 4GRDA 5ALYA 1KS9A 4JYAB 1GVHA 4KQKA 4JKOA 1XA3A 4E4TA 1MVLA 5JNSA 1FLAA 3E0QA 4DKXA 1WS6A 1RMQA 3BICA 3ILVA 5BR8O 4PLCA 2CBGA 2HF9A 3THXA 2C1XA 2J9YB 3MIZA 4G5XA 5FV7A 1ZD2P 4QUEA 1YRYE 1NI8A 1LJUA 1VMIA 1R0KA 4M8LA 4C1BA 4WEQA 3AUAA 3GJZA 1E96A 2QDOA 4BYMA 5CDGA 1K4CC 4V24A 3SAJA 4BTVA 4DLBA 2C2BA 4DXHA 4BOYA 1DBIA 2I65A 4AJHA 3UPDA 1OGYA 4EYQA 4CCWA 5K6RA 4DCJA 2VS1A 3UV7A 4XWWA 2I4TA 3C45A 5KTTA 5DASA 2QPLA 1K4KA 5ALWA 3RU3A 4IVRA 4XR4A 4XWGA 1GL3A 4NEQA 5KX5A 3MRVA 2TYSB 3TG2A 3K7EA 4GZLA 4GI1A 4ZP1A 4I55F 4TVSA 1L1RA 2QRPA 2HRRA 4TKZA 1IN4A 3SPIA 4F46A 3UAVA 4JC4A 2ZRBA 3VVBA 4A36A 4O4JA 2SKDA 2V3VA 3KSUA 4I5IA 2L82A 4UD6A 3PJFA 4CKWB 3UJNA 5F5LA 2F4VB 1T5EA 3H2IA 4MQMA 4DNXA 4E11A 4EW1A 5LL6P 1FXWF 1SCIA 1A8IA 4QUDA 5FPHA 1E9CA 3GFVA 4Q37A 1X87A 5E6SA 1BKSB 1GKIA 1A71A 1XF9A 1Q1BA 3DEHA 4AZVA 2JIOA 1L5YA 1FMJA 1E2BA 1Z2AA 3ML1A 1RI5A 5G4KA 3U4GA 1K9MW 4C4RA 2JD1A 4RULA 3YASA 3VX4A 2N74A 3IR7A 1FX0B 4JP8A 3GAZA 3L3BA 4P6VF 2YXEA 3NPMA 4NAHA 4QJIA 4MTGA 1H4SA 1SXQA 2DWQA 2GBFA 3ROMA 1B06A 1CV2A 3KR9A 1T8WA 5K5EA 2OZKA 1YFJA 1ZAUA 5SY9A 1ZBQA 1QX3A 1ZLYA 1XPOA 4KL8S 3WDMA 1EUYA 3IQZA 3H1TA 1QGOA 3QVKA 2BHNA 2QTCA 3LM8A 3M8AA 2I4RA 4FYMA 1JA8A 1BQ0A 4BQRA 4RKFA 1MA0A 3OJ0A 3KYCB 4PLGA 4JGSA 5SV2A 3B5EA 4CKYA 4WFHA 1GZ5A 5CA1A 3I23A 3OIVA 5J40A 3ZG6A 2VVTA 3NCHA 2B7CA 3R5KA 2PLAA 1F6WA 3WGYA 3ZXSA 4AW9A 1GDHA 2R47A 1G3RA 1XYVA 3V46A 5CVTA 1USGA 4R1LA 5AVTA 4GLOA 1PQPA 3ZNPA 4L7QA 1Q19A 2W2MA 3OIYA 5FV4A 3T5PA 2FVYA 2BC9A 4ZCPA 2HNAA 2I80A 1PKXA 3Q7RA 3SYNA 1ZI9A 3RRJA 5K8UA 3F4LA 2ZIOA 1N92A 3DBRA 4NBLA 3UFBA 1OA0A 1F6BA 1XDWA 4MIYA 3CZQA 3K1TA 4KMMA 2JI9A 3BCRA 4KL1A 1T6NA 3DDCA 3EZYA 1FJGO 3T9BA 1TO6A 2Q46A 2J3KA 1Y63A 4IY1A 3IP5A 5TARA 1GQ2A 2VYVD 4YDHB 1N25A 1Q6YA 3TDKA 3KHUA 1VLZA 2QLNA 4NDNE 3WHPA 4GU5A 3L41A 2MSNA 2HJVA 4YXFA 2CDYA 2AYYA 3VH4A 2R79A 3F97A 3CJTA 4YNBA 1KP3A 1Z6AA 2HNKA 3RWRD 1QLWA 2Y92A 2GXUA 2VRBA 2P8SA 3B12A 2CKMA 1F1JA 3EDOA 3QKRB 3QYFA 2AOWA 2B83A 4O0MA 3RU9A 3ZLJA 4C4PA 3MMNA 1N78A 2XQGA 3JSLA 3QY0A 1DRVA 4G36A 4QRIA 5LBTA 4WKPA 3VYRB 3FJ1A 2WIAA 4PW0A 5JD5A 2X5XA 4XX1A 3TIFA 5CVCA 3IV9A 4Y9TA 3LUJA 4U63A 1ILEA 4X60A 5GM2A 1TA0A 2VH5R 3DWEX 4BGVA 2FLKA 1I5RA 2OD7A 3H1IH 3IFXA 3AP1A 4YONB 3EGOA 2AJCA 4JNCA 1RR6A 1PK9A 2OSBA 2WOJA 3M5CA 5TSDA 3MXOA 4ZIRB 4YC7A 3RRNA 4NV0A 4YCBA 3FKQA 3V9PA 4H16A 1XEXB 2WEKA 1HFJA 1Y37A 4HN9A 1O96B 2I7DA 4BL5A 1JQ5A 2ZTLA 4TZTA 1NGSA 4A0QA 5IXSA 5H9CA 1EQAA 3FCYA 2OD2A 4GYJA 2QMEA 3TLYA 2YV5A 4A4DA 4G01B 5KTNA 3A6PC 1UJ2A 3K3PA 4FCTA 1GZ6A 1YO6A 2ODMA 1UDBA 3BMQA 3KAPA 4C7JA 5C5DA 2A0FA 5B36A 2Z3ZA 2YJ5A 3A9CA 3KR0A 4RLFA 1ZJJA 1J00A 1X7WA 4K1XA 4E46A 4EBFA 4FIDA 3C7KA 1Z62A 4GMKA 1OB2A 2GHIA 3JARA 3LT1A 5CHEA 3BMOB 4DVGA 4MUMA 2O7SA 1V41E 2UU9O 2B4RO 2Z57A 3H18A 1A5AB 2DBYA 1R4ZA 3PT9A 2OG2A 5ALDA 1JJ7A 1KK1A 1ULSA 2JGRA 3DYBA 3IXMA 2OXEA 3UXMA 1P62B 1R3DA 1QFMA 2XAQA 4JQYA 3TRIA 4E15A 5JPDA 3E5MA 4FKMA 4II2A 4PY2A 2XMCA 1QTQA 1QAMA 2H2AA 1W19A 1CUEA 1ZUNA 5K8LA 3R6LA 1MSDA 1G5HA 5J9FA 1EE2A 2IS4A 1VKJA 1WXGA 4UPVA 3LHSA 1JJBA 2BELA 3DOCA 3PICA 1PTJC 3ZMZA 2R4TA 3QWIA 5FULA 5THKA 3TQSA 4IIXA 3WMFA 1C1HA 3A1TA 2H2FA 4C06A 2WFAA 4B6JA 2WD7B 3G8BA 1H2AS 3B1WA 3KJXA 4E88A 1OFTA 2OTLV 2HFEC 1HOTA 2NZUG 3LW8A 5CPBA 5ENZA 1ZONA 3MGBA 4C21A 1O6BA 1CS4C 1LPBB 2H31A 1XD2B 3LT4A 2HJRA 3UYKA 2D7DA 5DBFA 4ERXA 3K72B 4B3BA 2ZSFA 1WAZA 3ECCA 1SCAA 4NFSA 3UNXA 5JH7F 4PPNA 5KTYA 4UB8Z 3HDTA 2GSWA 4WFEA 2A0WA 2QVXX 1WF6A 5BSEA 4X9XA 1RM3A 1RLOA 3V2UA 1JAXA 1RSZA 5IU6A 1KOLA 3VM6A 4JI7B 3ZGVA 1IZYA 4MQEB 4JBLA 3RVYA 1RZVA 2J4FA 3O94A 5DNUA 1HNWB 1U8XX 2AN1A 3FGOA 4NYIQ 1YR8A 4OK3A 2OCDA 1Q7CA 1IOZA 5CLGA 1ONSA 2NM0A 4YO8A 5AIAA 5JS6A 3PF8A 1SXIA 2CMHA 3ZHOA 2NUTB 1NR1A 3ON5A 2BE3A 2EKBA 1R0WA 1AM4D 1JR2A 1Y3HA 1QFJA 3BFPA 3GP8A 2QTWB 5FT9A 1R5BA 1IIRA 3O8LA 2IJGX 4QNHB 1EFPA 3GDOA 4QG3A 4BUJA 3G49A 1B3QA 2H65A 4XGKA 1ZKMA 4BVJA 3CNEA 3U60B 1BMDA 4EYSA 1LRJA 1KZ6A 2J85A 4CR8A 2QM3A 2OAP1 4G8DA 1M56B 1DAGA 2GNOA 3M5WA 4MUFA 5J2UB 3GXOA 4EVRA 4LJLA 4EHFA 5JISA 3S7TA 2WP8J 2PX4A 5FKJA 2EF1A 3N9IA 3ZI4A 1IK4A 2YCLA 3NTOA 1WSWA 3VXKA 2PL9A 821PA 2CDRA 2F2TA 7YASA 3ZDDA 3R3VA 2WD9A 4QIHA 5I7UA 2E5FA 4KDFA 2ZRJA 4KUEA 2WTAA 3GZNA 2Y99A 1HDRA 3KKPA 1HP8A 3L1IA 4Q1AA 2P8JA 4DUGA 1FU7A 5FUQA 3EFFK 4JI1B 4HQKA 4QGAA 4XJXA 2DFDA 1LQ2A 2NG1A 1ZP6A 2OESA 3PIIA 3CIFA 4QPPA 1S6YA 3R9KA 3P52A 5DN9A 4RUEA 1Y8CA 1G6UA 1NLUA 2J3HA 3FB1A 1FRNA 4GMFA 3V2HA 4D4KA 3C3BA 3Q8MA 3WWDA 3RABA 1B8OA 2PVPA 2BEWA 3BH6A 3JWHA 3U39A 4PONA 2FX2A 1NUAA 1ZM9A 2D1RA 3JQ6A 4WFIA 5FI5A 1AURA 2CXXA 2J9RA 4B6FA 3TK1A 2ISSD 2Q0SA 2YJZA 3AOEA 1H5UA 1LK5A 3CX8A 4G1VA 2OM6A 4OP1A 3MGAA 4ED9A 1M1NB 4L6AA 1RBMA 3LHKA 3ZHYA 2XYHA 1OY1A 2DBQA 5IDVA 1M34B 2GZ1A 2IYPA 1K1EA 4PI2A 2HJGA 2VHQA 2WHQA 3D7KA 4FMPA 4O5OA 2O5EA 2G9NA 1B8VA 2NZJA 3IURA 1K75A 3QKIA 4NZZA 5AUQA 2JASA 5SZKB 1UMCA 1FS0G 4X3OA 1T9AA 3JRXA 3ASOC 4A8PA 4LZLA 4XSHA 3DC5A 5BXYA 4WJKB 5BXZA 2W6IA 1C30A 1XKQA 3HLKA 2E4AA 3DR3A 4X66B 5AK4A 3HWWA 4IIHA 3AK2A 1K6MA 4DMGA 1Y8QA 1XTSA 1A97A 1YJCA 3USCS 5LN1A 1F3LA 3GZJA 1QGUB 2J0EA 3N7TA 4ZIRA 1YS9A 1Z9BA 3PUWA 4ZHQB 1Z83A 2ZRCA 3AG3C 4XD7D 3ZRWA 2IJHA 1W59A 1EJ0A 2IGTA 4U7WA 4XB1A 1QCEA 1PF7E 1VG0B 3TZKA 3VJRA 3T0FA 2QT1A 3CJRA 3NIFB 4H1UA 3EGXB 4NABA 1FW6A 1D1SA 1U3DA 3NC4A 3R20A 4TQAA 4V0LA 3HCDA 4ENUA 2AOUA 1J2YA 3UAOA 1Z6YA 2AN4A 4AHCA 4OQZA 3DB1A 1RBYA 4QPZA 4Q7JB 4DCMA 1F8GA 1IM8A 2GDJA 4OGKA 2P4EA 2QMOA 3DSQA 2V58A 3F46A 3V2GA 4ZN6A 1I1NA 2BI4A 1KSFX 2EBHX 3IAS1 2BM8A 3LZDA 4FDMA 5I51A 1XU4A 1QQTA 1SAYA 4FGSA 4M0DA 4FIPC 5SY4A 4Z7OB 2BFFB 2I54A 3BAZA 2XTJA 1P7YA 1VHJA 4P2ZA 3GLHA 4PGHA 4D9BA 1L5ZA 1YMVA 4PAGA 1RJFA 3BEOA 2JEYA 5K1ZA 2P35A 1YBFA 3LY5A 2KQXA 2R8YA 2ZI4A 3B1VA 3QYAA 5ARCA 1TEHA 2INGX 5J63A 3WSWA 4B4WA 4JL6A 3OOJA 1YDXA 1T2EA 3ZN0A 1P81A 3JQ8B 5FL7G 2LP7A 3EQ6A 3PU6A 1TECE 2DN9A 3BGIA 3QV1A 4HSGA 5T8KA 4BZWA 4DCCA 1XD2A 5BV8A 2XT9A 3N28A 2ETVA 3R41A 1NVPD 3HU2A 3GLFE 4RK7A 4YACA 1Q90D 1PQWA 3WWEA 2AD1A 2C9YA 3GCGA 3HB1A 2PKRA 4PZDA 2EARA 1PGQA 1E8NA 3TL2A 3W8RA 5CH5A 5CITA 3THWA 4HYOA 1XFAA 4CLEA 1O4VA 2GUZA 5KWSA 4CEJB 1WWKA 4ZWNA 2IC5A 3PEVA 5LZ2A 5EIWA 1RFYA 1XBLA 2XT6A 1SU7A 3QF7A 1OCEA 2QVYX 4BCCA 5DEOA 2IYYA 2AXQA 1F60A 1WOMA 4FLVA 2XCLA 3CLUC 1E0SA 4RHTA 5CNJA 4DSTA 4MQFB 4G4IA 3L6DA 4QD3A 3MFQA 1VLHA 4QREA 5M29A 4IZIA 1J5EB 3OEWA 4DA4A 5EZYA 4Y7CA 5E4FA 1YT5A 2V5AA 2Q5LA 1U2SA 1M5IA 4D92A 4J7JA 4CNQA 4P0PB 3GFTA 1P2DA 3GPLA 4MS4B 2P0EA 1MENA 3AHJA 4RVNA 4R1SA 1VP3A 1N2OA 1J9EA 3LF2A 1YZUA 2XNDA 1LVHA 3ZV7A 1D03A 1B2RA 1O1YA 2G1JA 4KXVA 5K0JA 2FWJA 3VNSA 4IH9A 4N48A 1T0PA 1XZGA 1KL7A 4TXMA 1QZZA 2LV8A 1YDWA 1Z88A 3HSKA 3W3AH 3DTYA 5KQRA 1JEJA 2YRXA 3BWEA 3GXBA 5IN4A 2AI2A 1QB8A 1MCZA 1AXGA 4U7PB 3FIJA 4ZMBA 3VKGA 5U1PA 4O2AB 3HJHA 2FZKA 2ZCVA 2EIKB 2O2CA 5EHGA 1YTUA 4CODB 1NC3A 1J8FA 2VYFA 3K4HA 2C97A 4NENA 4B17A 2ZSHA 4G85A 4WXYB 3L4KA 1VBNA 4QJ5A 2DLCX 3CN7A 2ZBVA 3U7IA 3ZE1B 2O7NA 2FUG6 1YSCA 4QTZA 4RQBA 3TEFA 2PANA 2WE8A 4N7JA 2HDHA 3QVGB 4GI7A 1NIPA 3T9DA 4MJ7A 1XZLA 3R5JA 1XCGB 5L45A 2YXNA 3T9EA 1FMLA 1YDMA 4LBYA 3DXZA 1NFQA 1UODA 4J91A 1F2VA 1UQRA 3G0IA 5IABA 2YUAA 3LWZA 1F1BA 1QNMA 2JGLA 2FCAA 2GNAA 4TM8A 4DCGA 2PZFA 1GG5A 4ZD6A 1DBRA 4WF9V 4W8HA 4WWHA 5TE9A 4HAZA 3BSYA 4HOYA 3SJCA 3GLVA 1QLEB 1MQ8B 2OHJA 1A9XA 1KPIA 1L7OA 1UH5A 3C3KA 1R6AA 3ETCA 4CIYA 3TLZA 1QV7A 1S76D 3FOAA 2VSNA 1XEQA 2FGKA 2OKGA 2PIAA 3Q7IA 4YAKA 1TLFA 1OPXA 1Y3AA 5CIQA 4DLVA 4ZK2A 3R9WA 1L6RA 2HR3A 1YAHA 2I29A 4OUDB 5FOUA 5LD2B 3IP3A 1TQ8A 3WB2A 1HG1A 4BRUA 2EIMB 1ORVA 1IBKO 4OKIA 4UTNA 4XGNA 3K9FC 2F1HA 5KQPA 1X39A 2CCGA 1V47A 4CIBA 3ABLB 1FMCA 2GEDA 4NZNA 4WKBA 3JQPA 2IZZA 4FCWA 2OZEA 4OPMA 4QFCA 2XI4A 4CL3A 4KVAA 1YQWA 1SCNE 4CQLA 1UZUA 3ROQA 4GMGA 4F5EA 1PJAA 1PVOA 1E8MA 2VHCA 1DWQA 1H2HA 3JWJA 5K51A 3NAZA 1RWXA 4OREX 3CLRD 3K9BA 2XTNA 2R6GA 3ANLA 3QVUA 4P3XA 4B45A 4BXOB 1MRZA 2VZ0A 3IELA 2D5AA 3QTBA 4P4TA 2R68A 2XR1A 4ALIA 1C29B 1QWOA 2QJOA 1CRPA 1V11B 5B6PA 4AZ3B 4XX0A 4OXKA 1TD9A