The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
104
|
sequence length |
310
|
structure length |
307
|
Chain Sequence |
ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESLYFQGESFAQLFEESLKEIETRIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVAL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
30S ribosomal protein S2,Ribosomal protein S1
|
publication title |
Structural basis for the interaction of protein S1 with the Escherichia coli ribosome.
pubmed doi rcsb |
source organism |
Escherichia coli
|
molecule tags |
Ribosomal protein
|
total genus |
104
|
structure length |
307
|
sequence length |
310
|
ec nomenclature | |
pdb deposition date | 2014-06-05 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix hairpin bin | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Glucose-6-phosphate isomerase like protein; domain 1 |