4TOIA

Crystal structure of e.coli ribosomal protein s2 in complex with n-terminal domain of s1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
310
structure length
307
Chain Sequence
ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESLYFQGESFAQLFEESLKEIETRIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S2,Ribosomal protein S1
publication title Structural basis for the interaction of protein S1 with the Escherichia coli ribosome.
pubmed doi rcsb
source organism Escherichia coli
total genus 104
structure length 307
sequence length 310
ec nomenclature
pdb deposition date 2014-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4toiA02
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 4toiA01
5LMNB 4LF4B 2CXPA 4NXNB 4OX9B 4AMVA 4DR5B 2UUAB 3J7AC 3QKIA 4DV4B 5IT9A 4DV0B 4B3RB 3FJ1A 1JIQA 1XNRB 1DQRA 2X3YA 4LH6A 3JSLA 2PUVA 4JYAB 3BCHA 1N33B 2PUWA 4DR6B 1J5XA 4U6NA 1DGSA 1X92A 4CC6A 4JI1B 4JI8B 4LF9B 1VIMA 4UFZA 5FPRA 2UUCB 1NUHA 1TZBA 2O2CA 1XNQB 4DR1B 3Q88A 3Q7IA 3JSNA 4LFCB 3T1HB 1TAEA 1B04A 1N8TA 3NBUA 3BABA 4JI4B 2J6HA 4DUZB 4X65B 2CXTA 2I22A 1ZAUA 4NXMB 1X9HA 4X64B 2DF8A 3BAAA 1VIVA 2PGIA 1MORA 1TZCA 2XBLA 4K0KB 1N34B 3BJZA 1X9IA 4B3SB 1N32B 4X62B 1C7RA 1IBKB 3TRJA 2Q8NA 2CXSA 4GLXA 3PR3A 3OOJA 2E5FA 2YVAA 2OWOA 4JV5B 3FXAA 4DR2B 3KNZA 4KHPB 1M3SA 5LL6P 3SHOA 3PN1A 5FPOA 3BA9A 2ZJ3A 3SGIA 1JEOA 1XTBA 1HNZB 4JI7B 1U0FA 4EEQA 5A2QA 4LZJA 5FLXA 1IRIA 1MOSA 3G68A 4JI2B 2ZJ4A 2HHHB 3FF1A 2V4MA 4JI5B 2ZM6B 4LF5B 3UQ8A 4LF7B 4DV2B 4DV6B 4DV7B 4B3TB 2A3NA 3IFSA 4EM6A 1T10A 1NRIA 2XHZA 1V9PA 3J80A 1ZZGA 2VQEB 1N36B 1JXAA 1VI5A 1J5EB 2CXNA 2O2DA 1HR0B 1GZVA 4S1WA 4DV5B 1JLHA 2I2WA 4DR7B 4TOIA 1TA8A 4DV3B 2UUBB 2E5LB 5I01A 3BA8A 1FJGB 4LF8B 3ODPA 4CC5A 3EUAA 2UXBB 2CXUA 5BY2A 4GKKB 4DUYB 5LMUB 5BR8B 4YY3B 4B3MB 1X94A 1KOJA 4JI0B 1Q50A 3C3JA 1U0GA 3I0ZA 3HBAA 4UCOA 2F4VB 4DR3B 1HNXB 3M5PA 1G98A 2VF5X 1XMQB 4YHHB 1HOXA 1B0ZA 2UU9B 2DECA 1GZDA 2CB0A 3HJBA 2CXQA 2CVPA 1TK9A 1MOQA 4DV1B 2UXCB 4IVNA 4EFEA 4UCUA 4AQYB 4UCSA 3OTOB 3T1YB 2AMLA 4JI3B 2VF4X 3LJKA 4EFBA 4LF6B 3TBFA 4UCVA 3J81A 3FKJA 4UCTA 2WU8A 1IBLB 2POCA 2VQFB 1U0EA 4X66B 4UCRA 2CXOA 3UJHA 1XMOB 1IBMB 1C7QA 4GKJB 4S12A 3JAMA 1HNWB 4LFBB 1VI6A 2PUTA 4LH7A 2CXRA 3CVJA 4DR4B 4JI6B 4LFAB 2UXDB 1HM5A 3JX9A 1WIWA 1I94B 4M0DA 5IWAB 3ETNA 1IATA
chains in the Genus database with same CATH superfamily
2QP9X 4AYTA 5M04A 1HEUA 2GBFA 3Q3CA 1QE3A 4ZQBA 5JLAA 5CTJA 3E8FA 3VDMA 3T4EA 4EKGA 1UEXC 1V1MB 3AHGA 5THKA 1APBA 2C9YA 4XGKA 1VQLV 1OZFA 1U28A 3FDZB 2HV9A 3VDNB 5SZJA 5KYUB 5C3UA 1TW2A 2ZUEA 3PF8A 3K05A 3HB1A 4DTCA 2QN7A 1Q92A 4BNLA 2ZM6B 1JEYB 2GFHA 1R9JA 4J16C 821PA 2ID4A 1YR7A 4MAFA 4QRHA 1YR6A 2VJPA 1A98A 1JCHA 3W05A 2MSCB 2ZIEA 4AB1A 3EAQA 1Q1AA 1KEEA 1K73W 2WZCA 4B3XA 2DECA 5KREA 1QIDA 4M2LA 1FSPA 5E2AA 1UAAA 2AD1A 1RYMA 4Q66C 2EKQA 3BERA 1G21E 2Z3WA 1XJQA 3W5BA 3RASA 1XGKA 4HPWA 4TL8A 3G2KA 2RJNA 1V54C 2RCYA 1WXQA 2JA2A 3U7JA 1ZU4A 1GH6A 3AR6A 3DO8A 3GA0A 5JISA 3CEAA 4IFTA 4DJEC 4NXNB 3FB4A 2BISA 3G2OA 1U8YA 2OKCA 2RGGA 1UMDB 4DR6B 1XKXA 4K5QA 1F51E 4AZWA 4EKNB 3KUUA 4YJ2A 3P4XA 2FLVA 4L9WA 1E58A 1H66A 5H4GA 2ZWAA 2YYAA 1M90W 4ETMA 2VJYA 4EUHA 3DBHA 1O9HA 1K8RA 4L16A 4CMKA 3AHJA 1TUGA 1N1EA 1QYXA 1V6AA 1K9SA 4WQMA 4KUHA 5DSTA 4RVGA 4BTEA 1P0MA 5TXGA 2GK4A 5KQRA 3TW0A 2OZEA 1MJGM 2Q5QA 5FTNA 3ZE9A 3DDOA 2PBRA 5AKXA 1PWHA 4GKAA 3QE9Y 2PEYA 1UIMA 1W4ZA 3QXCA 4F6RB 3FFQA 2OCDA 2EBHX 1CIJA 2FAXA 4JI2O 3EIWA 2AX4A 2DWCA 3UH1A 1OX6A 3WZMA 2PT9A 3IODA 4KE8A 4KACA 1KDZA 4WA7A 4DQ0A 4F6CA 3AQIA 4RNDB 3H6KA 1Q5PA 1KQNA 1VKJA 4OXQA 1DTWB 2GF9A 1L8LA 2O5CA 2W42A 3EZLA 3ZU2A 4MR7B 2QIPA 5LLSA 4CEHB 1VZ3A 4PV1B 5DLYA 3HKCA 4ESHA 5LYJA 2R65A 1Q1ZA 2CUKA 2B8EA 4EEKA 3LBHA 3AI2A 3X1XA 4EZBA 2CYAA 5JSUA 4EEQA 4RHFA 2FRDA 1YB2A 4ASUA 4CKWA 4DV6B 1FXKA 3GX1A 1ODTC 4M99A 2GSWA 3H8VA 3CISA 1T9BA 3I1FA 5F2KA 5A3VA 5FV4A 2WB2A 2DQ0A 2ZBGA 3DDWA 3IEKA 3OJEA 4ITRC 3IAAA 2HKIA 3SE0A 2E7ZA 3F3SA 5HIMA 4DR4B 3ORRA 3TL3A 2Q2QA 3U4QB 1ESNA 1ONBA 4DV0B 3UUGA 1SOAA 4D9HA 3QELA 1RHMA 5IKMA 5CYPA 2OZLA 2HWWA 3FAVB 3ZDBA 1M2GA 2NXEA 5HIIA 2IYPA 1H6BA 1MN6A 5C7YA 5I4KA 2UYOA 3OCJA 3P0JA 5I3CA 2IPOA 2RK4A 2ADOA 2YNMA 2FZCA 2R8BA 4M3NA 3J7AU 3ZI4A 5LQKA 2WAAA 2BR4A 5GAJA 1QZXA 4NNJA 3C3JA 4Q47A 3FUUA 4M0FA 4I08A 3QWIA 1FVFA 3VZQA 2OM2A 2P6NA 3ZMZA 2I7VA 3F7YC 1CT9A 5JWRA 4YIHA 3DUWA 5DEIA 3RS7A 3B5IA 5LC1A 3FUVA 3Q6IA 4YV0A 3BMOB 3KCXA 3IIKA 4QO8A 3SDBA 1UXIA 4EOGA 1ZUQA 1YR2A 5AW5A 5KQMA 1V1MA 121PA 3ZR4B 4V0MA 1OH6A 1SG6A 2I1VB 3FDZA 3KYIB 1A8HA 2H0AA 4N47A 3REFA 5KYUA 3DTUB 3WYBA 5CUQA 4EFLA 4U9UA 5BWOA 5HZMA 2XWPA 1C7EA 2VIIA 1ACMA 5F3DA 4D43A 2IDZA 4OI1A 4H33A 5IC5A 1JEYA 1M8GA 1U0JA 3IT0A 3BA9A 4BTVA 4K3UA 5EXXA 4HQOA 1J5PA 2YI8A 1CDZA 3U81A 2XECA 2ATVA 2XT6A 4JAVA 3GF4A 2ERYA 3HJHA 2XOEA 3G8CA 2D8MA 2O07A 2XMDA 3ICOA 4FXPA 2BHRA 2R9AA 1UPCA 5J63A 1C81A 4RSRA 2D0PB 3G0DA 4GRIA 1TCBA 4PGGA 1P9LA 3FZEA 5BYJA 3K5LA 1MFPA 1AJQA 2B83A 1A9OA 1UMDA 1ZD4A 3H6HA 2HMVA 3LIPA 1XD2B 3QHPA 5GM2A 2FW6A 2R86A 4WFEA 4C7VA 4JI1B 1PIWA 2M6LA 3D3QA 4D4MA 1RE0A 3DZDA 1M0WA 4EJSB 2BFAA 5LJLA 2HRBA 3COVA 4NXMB 1UF9A 1IXZA 4INPA 3UXEA 3DNPA 4MVJE 1VSUA 3ZZMA 2HWXA 1O08A 1A2QA 5K01A 4FFLA 2BFFB 5BN5B 3W8NA 4KO8A 2A6PA 2G4LA 1QVZA 3U6BA 4PN3A 5KVSA 4BV3A 4XA8A 4ZTBA 4MVJD 2WSLA 3HHPA 4V03A 3CJTA 3AGPA 1FU8A 4GE3A 4F6RA 3KSDO 4COOA 1A8QA 1QNLA 2BYTA 4RSMA 4BASA 1GSAA 4ZOLF 2JH3A 3HL4A 3EF1A 2YC4C 1M8PA 4YDSA 2HFJA 1L5MA 3N2EA 2OB1A 1JT9A 1WMAA 4B87A 2ITCC 3B9PA 1D2CA 1RJWA 4ZGGA 3GLQA 5GONB 4HY3A 4UM7A 1BGWA 2JLRA 3P27A 3STZC 3ZLJA 1NPTO 1DTWA 3T5MA 3P0IA 1Z5NA 2OK8A 3O1JC 5M34A 4LYYA 4LDPA 3T12A 4JC0A 5IC6A 1VGRA 5EIAA 3MGGA 4P5PA 4CEHA 1YQXA 4GLJA 1QV6A 1MQAA 5YASA 2ENUA 2K2QB 4L0QA 2NV0A 3D6FA 5DVZA 4FE7A 3KTFA 5CEEA 2BM8A 3OJFA 3SS8A 1JA0A 3D7RA 3MAJA 3TLYA 1SXJE 2QIOA 4H15A 4QG3A 5CH3A 2BFBB 4WOKA 3M6XA 2XCRB 2QI9F 4JP8A 2QLFA 2JIQA 3C6XA 2DKFA 3RRFA 4E5KA 2DR2A 5FWXB 1GAEO 1UCFA 1Y5IA 2CFCA 2IOHA 2MJLA 3QUAA 2B5WA 4RLFA 3RKUA 1SUDA 1PBTA 4G67A 3DLPX 3HCNA 2WYUA 2VXBA 4XCXA 4Y1RB 2GJAA 3O2JA 4MS2A 4MKXA 4H3VA 4DC9A 4HNQA 2PF4E 3U4QA 1GILA 4AY2A 1R3LC 1Q11A 3K2BA 4M22A 3OIFA 4RX1A 3QX8A 4GS5A 1DP4A 4HHEA 1EP2B 2X7RB 3MMNA 3JZAA 1XCBA 1AGNA 4G0WA 4YHHO 4QBGB 4AFNA 3FAVA 4YP5A 3DYIA 1ECLA 2X0EA 1E7WA 4A2CA 4FN4A 1GZ5A 3ELYA 1KYOF 3N74A 1Y66A 2XTJA 4IUBS 4GX0A 3M34A 1O94A 2A0UA 5AUPB 1LFDB 4ETNA 1PP4A 1W47A 5ESDA 2QX8A 5JJKA 3O92A 3ESAA 2G63A 1WXWA 3I2FA 5LP6C 2EZUA 2N75A 2QKAA 1L4EA 3WYNA 3MTEA 1NE2A 2C5SA 1J95A 5I7AA 1CVRA 3ABKB 1G5QA 2OM6A 4RKQA 1UBNA 1KRWA 1U7PA 2QLJA 2FPLA 2JJ1G 4KX5A 3LV8A 3TQIA 1DEXA 3BMOA 3SF0A 3Q2IA 1C8KA 5LZ9A 1IBLB 2GB4A 2XDAA 4XARA 1P4RA 5IM5A 1M6NA 5DH9A 3Q9LA 1AMNA 1AQUA 1O95A 3FKSA 2JW5A 4DK1A 4WZ6A 4R81A 3ZHTA 2I87A 5CDTA 2VTKA 4WGGA 2F9LA 5F33A 4WY2A 4ER0A 5DCUA 2BMAA 4XRGA 1SERA 4Y0AA 3G1TA 3UG7A 1H0HA 2KM1A 1L1RA 3R3ZA 4IKPA 1Y80A 1TYCA 2CVFA 1UWKA 2FSPA 2WP0A 4KIUA 4J7UA 2GMWA 3ORSA 2QUIA 1U99A 3M7IA 2D1YA 2QRJA 1AJPA 3JQDA 4F4LA 3QTBA 4OJQA 1S72V 3ZUGA 4ZCPA 1TU4A 3KKPA 4GMGA 5IEBA 2CBXA 1K5SA 3LVBA 5LPNA 1PWEA 1T4GA 5B7QA 1QS0A 1Y63A 2CLHB 4RK5A 1RXWA 3LUPA 1G5PA 3W5JA 3S2SA 1L7VC 4ZZIA 3ZDRA 4PXSA 3OQ6A 1TGYA 2ZI5A 1KI2A 1XD2A 3DTYA 1F6BA 4IDEA 5BSRA 2GERA 3C43A 4R05A 1FLDA 2Q5CA 4EJSA 1FLAA 2PI5A 5EYPB 4EW1A 1R8QA 5EWLB 1KXZA 1F5SA 2PGOA 4RFSB 2WIGA 5FO1A 5GJWC 4LWZA 2DUNA 3P94A 5E4TA 4PBSA 5AJZA 5ULLA 2BFFA 5BN5A 2B2NA 1TCUA 3T2MA 4ZAYA 3BH6A 2IWRA 2XUZA 3RWRD 1WDTA 4X64O 2IC5A 3I0MA 4C0JA 2VDKB 5LMNO 1IZ9A 1MUUA 2L35A 1EG7A 5FV7A 4BS9A 2C7PA 3K9FC 2VNSA 5AVSA 1QRSA 1D1QA 2J7PD 2PXHA 3UWMA 4CT4B 3FAKA 3RIXA 3F98A 4HNVA 5ALXA 3CZQA 3CR7A 5GONA 3LYHA 3U3OA 2CFTA 4XCQA 2RAUA 2D1SA 3NBMA 4IXWA 3FPHA 4DCOA 2BC9A 1XEWX 3SYLA 5EK0A 4FIDA 1EFCA 1Q2UA 3OFVA 4BN4A 1RLOA 2FY8A 5LXTB 4FYIA 3UOAB 3BRQA 2XMZA 2J48A 2WJGA 4UHCA 1UBLS 2B6HA 4MQUA 5E1MA 2BFBA 2QTCA 2XW6A 3I5MA 3QOYA 4WDQA 3QYFA 1W0JG 1SHLA 4NPCA 5FWXA 5E38A 3NHYA 3TCKA 5L53A 3CLHA 5BV0A 2HJVA 4NONA 3ZN1A 4O4HF 4GO1A 4BZQA 1AKUA 2I4LA 3S27A 4ZXPA 1B42A 3GUYA 1PJ8A 1Q43A 3E89A 3V7UA 2R8PA 4CBVA 1XTTA 4Y1RA 2P62A 1NVBA 5C53B 1CQZA 1KTIA 1W5EA 3W1WA 3ZZNA 1N4CA 1YIJV 1K7SN 5JJJB 4NZ9A 3LA8A 1LQTA 5AH0A 1NNUA 1W4RA 3L71H 2IJKA 2OQ2A 3OX3A 3EOZA 2MSKA 4US2R 1WCV1 4W99A 1GN4A 2EHDA 5E7MA 4FC6A 4DR5B 1JVBA 3FF4A 4L8FA 2H07A 2EFYA 2GA8A 3ZTTA 3NC0C 3B38A 2VFAA 1VQMV 2E75B 4XGIA 3R9KA 1DAKA 4GWKA 1KNXA 3JQ9C 4M88A 4ILEA 2JJYA 3UK6A 2DFTA 3NDJA 4U8GA 1ITZA 3LUJA 4AP6A 4P3OA 1VECA 4YMIA 3R7WB 5TEWA 4MVQA 4PYJA 4U9HS 1NMZA 2JRIA 3CTPA 1B73A 4MIOA 3H5IA 5A9RA 4EG5A 2IJGX 4UHFA 3U37A 2QRNA 4EVSA 5H83A 4NH0A 3PP8A 2H1OA 3LK6A 3VU9B 4YYZA 1X8JA 2AG5A 4UBMA 1HP8A 4B3MO 4FVMA 1Y7HA 1L7EA 1U0EA 4KRGA 1PGQA 4RVOA 2DG2A 3LA6A 4YROA 3DEIA 4KP7A 2ZI9A 3G6BA 3T1NA 1FMCA 1TNDA 4JY7A 3PPWA 1WDKA 1T2AA 3IUMA 3PC2A 5JAUA 1YS9A 4L72A 4JC5A 5E4YA 4ONEA 5DN6G 3QOXA 3PCXA 2FDXA 4S2EA 2Q4EA 1P7BA 5AKLA 1BQZA 2D5BA 5IT9N 1EUYA 4XB1A 1FJ2A 4JI7B 3EOAI 1OCZB 5KCZA 4HOYA 3Q4GA 3TQOA 1R6XA 3OR7C 1R4NB 5DJ5A 1TU3A 4P9NA 4YBRA 1GN3A 1DAGA 1JJOA 3EVEA 2AN4A 1BTOA 4JASB 2HPZA 2YIMA 1JI0A 1K8XB 3S3XA 4MDFA 1KO1A 3VR5D 2PQ6A 1CLEA 1I1NA 2TMDA 3LSSA 1U9CA 4NTZA 3PITA 2EDAA 2WVGA 1S02A 4OD0A 2Q5EA 4PLFA 1HFJA 5EYPA 1UUFA 1TL7C 2MSNA 1PWZA 3A9UA 5EWLA 4E3WA 5MF6A 4RFSA 4OHKA 2WLJA 4EMTA 3WWCA 4L8GA 3ON5A 1YRBA 2I71A 1GV1A 1U7DA 5KWJA 4JUIA 4U2BA 3EN0A 4Q00A 3N5CA 5FD8A 2JHCA 5JC1A 1P2VA 4MUFA 3UT5B 1GGVA 2BGJA 2P5YA 4ZT2A 2O7QA 3D59A 3G68A 3V2UA 1FS5A 5AXBA 5HIKA 2Q0OC 1AO0A 3P9SA 5AK5A 2ECKA 2IOFA 4MPRA 1V45E 4G0YA 4QOJA 3FPFA 4JP5A 3H13A 1FYVA 3PJFA 1R37A 1J90A 1WHSB 2IRWA 1FNDA 2QMEA 2GKOA 1X14A 2O7RA 2FW1A 5AP9A 1MAAA 2CWWA 4KXWA 1DX6A 4BO6A 1VF7A 4P34A 4U7NA 1N4DA 3VZBA 2PZMA 1PJ4A 2JCXA 2V7PA 4YLEA 3GRPA 4R0NA 2BIFA 5LXTA 3FCEA 3BGDA 2WSSA 3LZ6A 3NS7A 4FYKA 4Y7CA 1UKZA 3P5BA 4HH3C 2IBMA 4Q7JB 1WMEA 1QK4A 4OK6A 3PX2A 4UTXA 1MW9X 1IXRC 2EHJA 1PJTA 1FUUA 2HREA 3I5UA 3S5UA 1QO0D 3GLFB 1GTSA 1GOTA 5JC8A 3CCQV 1VIVA 5KTYA 2XMCA 3CBQA 4YMGA 2JB9A 4FFOA 3WK9A 3TZHA 3O8LA 2CMDA 4PLZA 1CJSA 1UXGA 1XTPA 4TKVB 4QJ3A 5ETJA 1YGYA 2AK3A 4FGJA 4G8DA 1LI4A 2ZDHA 1EVIA 2AJ8A 4XSHA 3E22B 3T5DA 3P1JA 3CS3A 1K34A 3H4TA 3LKVA 4WKGA 1L4UA 2C5AA 3QVKA 1V54B 1UDXA 3EGEA 3FNHA 4KI7A 4PPNA 2QEXV 1BE8A 3K20A 2WJJA 3TSOA 1DF4A 1UJCA 3CSUA 4B5KA 5ECDA 4RUEA 3VO2A 1XL0A 2CZGA 2HSDA 5B36A 5D2CA 4DIUA 1VA5A 3LCJA 3LPCA 3URMA 4C3VA 2UUAB 1RS0A 3HI6A 3A8TA 1J00A 2H31A 1TZKA 2QN8A 1YQ9A 5A71A 5HXAA 1XWWA 1PZEA 2PDAA 3FWYA 1AF7A 4BWFB 4YLYA 4YUYA 2FQWA 2ZCEA 2DF8A 3DEKA 3E82A 4HCJA 3R7WA 1E5DA 5K8LA 2FFRA 4H18A 2Q8NA 1XLUA 2W2LA 4HV4A 1H4QA 1OBOA 1I0HA 2H06A 4HQFA 2PH3A 3HWRA 1ZI9A 3CP1A 1SY7A 4I19A 5DGIA 4G07A 4WKOA 4AF6A 3VU9A 1BXRB 2EX3A 4UU0A 1R10A 2Q99A 3Q85A 1KHTA 1XRLA 2I1QA 3T1QA 2ZGVA 5B37A 4F04A 3MAGA 1U1EA 2PQ0A 2FZWA 2FP4B 3P32A 2X0DA 2ZQZA 3WV5A 5GV8A 4DA8A 3Q10A 1NMXA 3FPJA 1XHZA 4LWQA 2QTLA 4QNRA 1RBYA 4PDMA 1GR0A 1BFKA 1NOIA 1W2HA 3KEMA 2Q07A 1RKBA 4GOXA 3IPCA 2ZAOA 3IVAA 3OLQA 1U0NA 3BZWA 4ZJYA 3EQ2A 1KETA 2QZPA 1EJBA 2D7DA 3R0VA 4O5OA 1P2UA 1T4CB 4IIGA 4MZDA 5IH7A 3K59A 1EUDB 1SQGA 3TQHA 4D0GA 4M7RA 4ZCLA 5FF9A 2OV6A 2GTPA 2YVKA 1VOTA 4E5SA 1P2FA 3DVAB 1R4NA 3CCVV 5BRNA 4UVDA 5C18A 5EJEA 1Y1RA 4ZI7B 1QYIA 1Z38A 4U7PB 3DW1X 4JASA 2L42A 3OMAB 5D6NA 3GUZA 2JKYA 5DSZA 4IFIA 2ZXUA 2I8LA 1GRCA 4GXRA 3E18A 3MTAA 4C7BA 5TR9A 3WYGA 3U4HA 2OZPA 1K7EB 2JHAA 4OQZA 1SQQH 4TQFA 2AMYA 1L5OA 3SQDA 4Q01A 3QVXA 3H8SA 1L5FA 1ZH4A 1OOEA 1ENOA 5BMVF 2J3LA 1KBHA 1DPFA 13PKA 3M4YA 3WLEA 5ISMA 3F3KA 3DEFA 2PT7A 3ZLVA 3QYJA 4U6NA 2PRZA 3MCZA 1FBNA 4TTPA 1JLRA 2XUJA 3GDOA 3UT5A 2C9OA 3AB3A 3TR6A 2CSUA 2CL6X 5HKBA 1YB7A 1HZJA 4LBZA 3GJRA 4R8MA 4NZPA 3A36A 4S0ZA 3GFTA 2WT4A 4FDMA 4F60A 1LF0A 1JA8A 1VBKA 3OWHA 1QONA 4K86A 1WHSA 4CNBA 2BI8A 2RBGA 3NO4A 3F2IA 2WWWA 2QG9A 3ML0A 4ZEXA 3H1GA 3ZJYA 3E61A 3SYQA 3TRIA 4LEIA 4GOOD 4S05A 4RMIA 3I23A 1A7AA 1R6VA 3RIMA 3LRTA 5JCJD 4FGLA 3LAWA 3QEKA 3CS5A 2A5JA 4G3XA 5LKAA 3ZOKA 2IYEA 4M9RA 2FSUA 2X9GA 4TXMA 1PT6A 5KYYB 2YYZA 5JUWA 3MJ4A 2FZ5A 1L5HB 3S8MA 1SMKA 2ZCUA 4RKYA 1DV2A 2XTMA 5BW4A 3IKJA 3MF4A 3BHPA 4KGVA 3ZJTA 4EYKA 1YDXA 2YY6A 4I81A 3K3PA 3GLFA 1XRPA 1Y7PA 4J16A 5C37A 1CHDA 4TKVA 1L7PA 4ICIA 4LJ5A 1B3QA 1SCDA 4LXHA 2C82A 2JLSA 1E6UA 2EILC 3CH4B 5CT5A 1PS9A 4JTAB 3E22A 1YS7A 1NT4A 2AR7A 4L02A 2FNAA 4HS9A 2OXIA 2CTRA 1KD1W 2OIEA 2FE4A 3DVSX 1ZITA 4FLUA 3K9AA 3ABQB 4HFRA 4GI1A 4C7KA 2RMKB 2R5NA 1DCMA 1KDYA 3DB1A 4KN5A 2VF4X 1KZGB 4JA0A 3GFFA 4GKBA 1I5EA 4DRZA 3WXMA 1D2EA 1Y7LA 2FEAA 1QLJA 2P2SA 1PCXA 3HNOA 4IJKA 3OUSA 4FNAA 3MLBA 5DM0A 4J3NA 3IX7A 2GSMB 2GETA 1SZPA 4C03A 1AXGA 5J5CA 1XMJA 2C3PA 3DXXA 4G56A 5BN3B 1SCQA 3JD3A 3OJOA 2FK8A 5B1OA 3UCSC 4EZIA 1BXRA 2ZJ7A 3K94A 2BMWA 3HLYA 4GH5A 1L3CA 3C3KA 3WKDA 3USCS 3H8WA 1P77A 1RAHA 4JDUA 5F2NA 4ZAWA 2FP4A 3DDCA 4MYUA 4EF6A 3KZIZ 2E18A 2C8JA 2H7CA 3MOSA 3IILA 5ED0A 3TTXA 4OH1A 1JQ0A 4BZZA 1YVWA 1I3NA 4BJ3A 3EUWA 3N2LA 5LQJA 4R8VA 3H18A 1V6CA 1JXMA 1BD3A 4DRXB 1Z2CA 1T4CA 3QYAA 5G4KA 4NE7A 1R5OA 1UC5B 1L4FA 1H2HA 4AHCA 1E0KA 3C3CA 5KNBH 1XDCA 2PX8A 3SZRA 1T0JB 5KYKA 1EUDA 2R6CA 3RFXA 3IOMA 2HTFA 1NM5C 1G3UA 2I29A 4LR3A 3DVAA 1WXFA 3RWMB 4URZR 2V6JA 5NULA 1US8B 3OTIA 4ZI7A 4EY7A 4R1MA 3D8CA 2GZ3A 3V97A 1D1PA 2NP7A 2IJHA 4MKFA 4JJ8A 2LBPA 4BX2A 1BEZA 3UHJA 1IUKA 4TRNA 3EXG1 1JR3D 2VDQB 3N0WA 4WERA 4G9BA 1SIBE 1LTKA 3L5KA 1Q12A 5IYDO 3AFMA 3CC4V 3RUFA 1I4LD 5LBUA 1Y34E 1XCPA 1YZUA 2HWKA 4D46A 5B1EA 1IY8A 2H9IA 2XQFA 4XD2A 5HK9A 1HDRA 3U7FB 4RADA 3AK2A 4QE9A 4O02B 2ZSIA 1R4ZA 3AJ9A 4PA7A 1CY1A 4KDCA 3OA0A 4BFUA 4O4IF 4JBGA 5L3DA 2ENWA 3CD6V 1JFLA 2IELA 4MGYR 1SVUA 4N6OA 2WHRA 3GRRA 1MO3A 4J0CA 3EY4A 4FS8A 1YACA 5TS2A 3ZWKA 3HDHA 3P2YA 3IAXA 4H7PA 3U31A 2AG1A 4N39A 2I1LA 5LP6B 3A11A 4Z4IA 1NKSA 3FYSA 3B60A 3RC2A 5BYKA 1YQGA 1NW7A 4GYYA 3QU9A 3SX2A 4N8DA 2HO5A 3IUNA 5AW0A 4MDYA 1AKEA 4I55F 4P2ZA 2DW4A 2IS6A 3W2GA 4LYDA 4BMZA 5KYYA 5DRTA 1DRWA 1GTZA 4GKKO 1GZDA 3IUPA 1L5HA 2OL4A 1ZRMA 4MI1A 5EA2A 1GZUA 2DBVO 4FP9A 2ZROA 3QIVA 2DLNA 2FWBA 3HQ4O 3E7XA 3VH2A 4RQUA 1ONOA 4HC4A 4JELA 1CXZB 4TMZA 2QSYA 5C5IA 1QGOA 2HWUA 4INOA 3U3ZA 1S4QA 3KB6A 4B31A 3I9KA 3JVVA 1T0IA 4BPBA 3KU4A 1QZUA 1IXMA 1GPMA 1NNI1 3D36C 5DNAA 4CV1A 3HUUA 3SC6A 2ZYTX 2LGWA 1KEZA 4P3XA 1CEQA 2YOHA 1Y81A 1FFHA 5JDCA 4JUAA 2REXB 2FN7A 1N34O 2BFCB 3L7CA 4CM6A 3BA6A 1GU7A 2PT6A 4MDHA 2HJRA 2D0OB 2QMHA 1ZDMA 2ZSHA 4OJMX 1V3QE 2RMKA 3CPEA 1J99A 4G5RA 3FFBA 3CRCA 1XQ6A 2FWRA 4XRRA 2PVCA 4KOAA 1XAHA 3KD3A 4G2NA 2ST1A 1VP7A 1JDPA 1UDBA 5JIBA 1QF7A 3LSQA 4OKIA 4V3BA 1E2GA 5KNDA 1F4PA 1CJMA 3B52X 3AONB 1CJKC 1PSDA 3AG6A 3D5EA 3CNLA 5LDHA 4BNHA 2OAEA 4ZT7A 3I5AA 4GM4A 2ZVJA 5BN3A 1NSFA 3MMPA 4TWIA 1ZX3A 4YUWA 1VGQA 2X86A 3A1DA 3TOSA 1QO7A 1B0PA 3L8DA 4CLOB 1M73E 4X7RA 2X6TA 2M9MA 1D0SA 4RCYA 4LQDA 4I1SA 2CN1A 4P6VF 1MOSA 4F9EA 3VBCA 4Z2YA 3LBNA 3WRVA 1Z0UA 4HLUC 1CUHA 4QXOA 1OB5A 2ZRCA 1KP9A 2VQEO 4TN5A 5EI5A 3NHAA 2VXCA 3HV2A 1IJBA 1JHYA 1XX6A 2GZ1A 4AG5A 5BR8O 1MEJA 1DAHA 3WMGA 3MJDA 4PDVA 5KTMA 3B1FA 2HRDA 4GBMA 4ZU1X 6AT1A 3KHTA 2J07A 1NATA 4DRXA 3FNFA 4NP6A 2AW9A 1ZNYA 2Z57A 1FS4A 4B84A 3SSMA 4AZTA 4R83A 2Y1KA 3RS8A 5FAKA 3IBFA 1JJ7A 1EINA 3RC3A 4GEKA 5HKKA 3DWEX 4JB8A 1QKJA 4MW7A 3BGIA 2P41A 1US8A 2J9RA 4DYLA 1AU9A 2DLDA 1URPA 4NBKA 3QKUA 4K9NA 1NBMG 3CW9A 5I8WA 1V39A 1X77A 2YZNA 1RZ3A 4X65O 1KERA 3RYTC 3EIEA 4XLTA 1VE6A 4TS1A 3FPLA 3KQYA 1PO7A 1HRKA 2VZLA 4KQXA 2RHGB 4WK2B 2QRZA 3RW0A 1PK7A 5DYNA 3REOA 2P6JA 1NV9A 221PA 4CJXA 2OD2A 3Q0IA 4P22A 4UTZA 1MNGA 4MAAA 5IABA 4ZODA 2Q9AA 4GOJA 1SH7A 4B4WA 3K30A 3AM5A 2CB0A 5I4BA 4JR2A 3OJ0A 4BO5A 1WN7A 4E5MA 4I1IA 5LGUA 3PDWA 2W8BB 3ZTWA 1AXRA 3FDFA 4PNPA 1NH2B 4LVOA 4G65A 3SPIA 1QVRA 4B75A 4FI3F 1GTMA 3B53X 3LXUX 4JLSA 4HFMA 4KH1A 4GOKA 2F8LA 3A3NA 4QPDA 4DHEA 3NWBA 2GN1A 3N0TA 1OV4A 3AR7A 4XLZA 5LP6A 1NXSA 3MYYA 1PT8A 1OXKB 3BE4A 3ORYA 1P5FA 1U0TA 4PDRA 2HHJA 3EIFA 1UFRA 4KTTE 1UBJS 1Q21A 1X7WB 5J9PC 1KDVA 2HCJB 2WT9A 2JJ2G 4EW2A 2IY9A 1THTA 5E6RB 3NYIA 1LLDA 4DDWA 5U4QA 2WKSA 4M1ZA 2ZKOA 3QEOA 5KUTA 4QU0A 1Y8QB 3CX4A 4YMHA 2HNAA 3GA7A 1VKZA 3NCTA 3B2QA 2W6QA 5AVYA 3T7KA 2O8CB 4YV7A 4DV1B 4QUIA 1CXZA 1GT6A 3FJOA 3CC7V 5BWBA 3ECAA 3AHEA 3CEJA 2X5XA 1JDJA 5FR1A 3PEUA 4GKVA 1XQYA 5LCXA 3OTWA 1L5WA 3OFND 3P9PA 1YTFD 4R51A 2ZB3A 4DABA 4TLBA 4KQWA 4CR8A 3PI7A 1CC1S 1JEEA 5KTKA 2IX3A 1YTUA 1E4EB 3HLTA 2CL0X 1Z08A 4PLWA 2ERXA 2I6GA 2GBOA 2ZYGA 2ZBQA 2E4AA 1GAQA 3LLMA 3RSFA 4QJFB 1GNVA 4HMPA 2ZWMA 3R0QA 2R8OA 4Z4HA 3ITDA 3R3JA 4FINA 4NWIA 1PFQA 3JQAB 1XF9A 1Z34A 2GZAA 5E0KB 5DTJA 4BN0A 3KQUA 4V0RA 1JLSA 3S3WA 5G0WA 4FFNA 1XDUA 3TZ6A 3IJEB 4HZ3A 4MUHA 4MKZA 2AKYA 3S8YA 2YJ4A 1SKAA 1PQUA 1AI5A 1XUQA 3N58A 4TMVA 1J0BA 2GPWA 2OE2A 1A8PA 5JWPA 1Y0BA 4RTSA 2PX5A 3HJRA 3WDKA 2VJMB 1NMYA 5KINB 4XB2A 1SVSA 1GM5A 1F20A 4QGGA 1I7NA 2AF4C 4DR1B 4R8SA 1HRDA 2I4TA 3WIDA 4R1QA 2HBZA 4HAUA 4CLOA 2VP0A 1P2TA 1GFWA 3L7BA 3SKYA 2JVJA 2WU1A 2P3LA 4QPPA 2WSBA 4N3GA 4DBZA 2PD4A 4O0MA 3WLAA 2V5AA 3E2PA 4ZTZB 1FFTB 1Y3BE 4H77A 5FUMA 3L8YA 2PMWB 3UTDA 3B8EA 4ZAXA 4JLAA 621PA 2YHUA 3LFUA 5LQCA 1EWYA 3DZKA 2YQZA 4RD2A 3MM4A 3L06A 5F76A 5A7FA 4EKYA 2WPDA 1I01A 1CNEA 3V7FA 1WQ3A 2DWEC 2IZ0A 1LK0A 1VI2A 4O5AA 1ESDA 1CJVC 3I34X 2GAFA 1FFDA 3TVYA 3QPAA 5A4IS 4I7EA 1WY7A 4W5QA 4I7ZB 2B78A 4IO0A 3CFYA 3FUTA 2CZQA 2RDCA 4LV8B 1XN1A 3CZRA 3PQ7A 2LO1A 2VA9A 2QLLA 5HM8A 5C7IO 2X3YA 3H87A 1V1JA 1G55A 4GI5A 2REOA 3R6DA 1FZTA 1C3OB 4HP8A 1CK4A 4UEJA 4AS1A 4WLVA 1E6LA 1H5UA 5IYCO 3H5LA 2JGDB 1ZGZA 4I4TB 4NVPA 3TX6A 5C4MA 3MSXA 4HLDA 4HPJB 1GCAA 3AFIA 4IDBA 4BNWA 5DM2A 3GFVA 3C1UA 3HJFA 3T5AA 5IDWA 3Q8KA 2G5PA 1WTAA 3VNUA 3IP6A 3DCJA 2NQTA 3FUXA 3LYLA 4FEEA 1JHUA 1X8KA 3TECE 5DNEA 1GZVA 3LE8A 3TM5A 4HLNA 1Z6QA 5LQAA 5FWYB 3NEYA 2W8BA 4HK4A 4NU0A 2PZBA 5JPCA 4AG6A 3N2GB 3BHIA 1QRAA 1YZKA 5BXZA 1RI2A 4C5BA 3I04A 1CZHA 2QV7A 4QPKA 1JQKA 1E2EA 2ZEJA 5LQRA 4MJ7A 3X2FA 1XTVA 1E6MA 2J6HA 3SYMA 4FCVA 2NPOA 1X7WA 1KU6A 1KYVA 3BVPA 1S8OA 5IM4F 4K46A 1I0IA 5E6RA 4YGYA 3M6WA 5CB0A 3HVRA 1HNZB 5HK8A 3UJDA 3CCSV 5HDQA 2AB0A 2OB2A 1FPOA 2HV8A 1NC3A 1UPFA 3DMNA 4WWHA 1Y8QA 1EZZA 4LP8A 4KR7A 4QUEA 2E85A 2QLMA 1N36B 4LJ7A 4W5JA 1ID1A 1KMMA 2LCQA 1ZK2A 4TOIA 4UARA 4HFNA 4YRNA 2O8CA 2ZU6A 4GBED 4ER7A 1DIHA 2POQX 5HE8A 1Z45A 1VCIA 3LOQA 1ICEA 1TEZA 3AUJB 4Q48A 3ZGVA 1IOLA 5DHAA 3U49A 2XUOA 1TE2A 5IDQA 4PVCA 1MZFA 4EBBA 1Y42X 3I09A 3QQPA 4QJ4A 4K9QA 3WB2A 3AVOA 2OCKA 1CZRA 3NM6B 1G6OA 2FEWB 3IALA 1E4EA 3IQIX 5AW2A 2B1IA 3WRYC 2JI8A 4WNIA 3TL6A 1A82A 3L70H 1K8AW 4BGDA 2NO7A 3OIWA 5JYDA 1FUEA 1A9RA 5J1SB 3JQAA 5DYWA 4BBZA 2KW5A 1GNSA 1UZLA 1OI3A 4G0MA 3QXSA 1RRVA 4BLOA 4TZKA 1CEZA 3WU2Z 3C85A 4URYR 4WVLA 3Q15C 3C98A 2VPQA 2ZQMA 3T3MB 1N0UA 3C7AA 2H5JA 2ZCVA 3ILXA 4KC0A 2XTNA 2FWIA 2PUGA 1O03A 3G9XA 3RJMA 2VJMA 5LFAA 2OENG 2DJVA 4WXYB 5FFNA 4NL4H 3TQTA 4GRAA 4MICA 5G0TA 5ADHA 3Q3HA 3SKXA 4FYMA 1DTEA 2V7UA 2AJDA 4GUNA 4ZN6A 1G2IA 4NF2A 2OYQA 4YREA 3NWOA 5ILOA 2IHTA 5IAAA 1XPJA 1M57B 4P7FA 3K58A 3OF2A 3I61A 1ZR4A 1R00A 1KSJA 5ESRA 4EX7A 3L8EA 4F8EA 3A26A 3C3WA 2QSAA 1T4DA 2H18A 2AN5A 1SU8A 4B7EA 5I9LA 3KQHA 3EG9B 3OO1A 4ESEA 1NJ1A 4OJTA 2NNLD 3NNNA 3Q5GA 3RRZA 3L0CA 3SQLA 5IP5A 2IOQA 2FH5B 2YV4A 5GIOE 5F52A 3WHKA 5HTKA 3QNWA 1MX9A 1UDAA 3JQQA 3H99A 3HE3A 3MLAA 3EPPA 3ZXIA 2PX2A 2TMGA 1M2KA 3EVCA 4JOCA 4RVNA 2HHAA 1C3OA 3AJDA 5M2QA 3WP0A 2JGDA 1MIOB 5JPIA 3K79A 4I4TA 3KJQA 1KJWA 5FQNA 2LWIA 3KTDA 2OQVA 4R2WA 4LGYA 4I8XA 2EW1A 3TPCA 4XUEA 1E5TA 1FZQA 2AE1A 5ANRB 4MRVA 4K0KB 2AV6A 3N7UA 2CJWB 4ND7A 5K3FB 4UZFA 4W1QA 3O84A 3Q8MA 1AZLA 1WP9A 4RMJA 4H7EA 4FU0A 3KO8A 1WB6A 3CX6A 5FKJA 1KFBB 2JEYA 5FWYA 1QVVA 2AC4A 2AXQA 4HG2A 1ODIA 3P2EA 3E05A 1RW4A 1P6XA 1H2RS 1AKYA 3BA8A 4KFRA 4HZGA 1JBKA 4G0XA 3TD6A 5DSXA 3UFBA 1XCMA 3N2GA 1WO8A 2A8YA 4LF8O 1ZVVA 3WB9A 3LTNC 3KQTA 4MR7A 4Z4EA 1PLLA 1FXWA 2P3QA 2IA5A 1HF3A 4HGPA 5K9ZA 1GGMA 4LKRA 1I4EB 3TEFA 3HGTA 4X6XA 4RY8A 3ZJ5A 2CLSA 3EIQA 5J5VA 1TMGE 3PYLA 3EEOA 1JWLA 3S7ZA 4BUZA 1PEYA 1E61A 2I3GA 2ATKC 2Q5HA 1ISIA 4BYGA 3TJZA 5F1OA 1GZHB 2W2QA 2PLFA 1OBCA 3PDUA 3EEQA 4GBJA 4XSGA 5ELMA 1SZJG 2O59A 3TXQA 2QVGA 1JG6A 3CKMA 2RCNA 3PSAA 3LI2A 4WADA 5L3SB 4WZBB 4F2DA 3KOMA 1ST3A 1SK9A 2GFQA 3ISVA 2I3ZA 1LDGA 1BKDR 3O6VA 2I9KA 1C7JA 1QOQB 4MX8A 5AG2A 2DH6A 2ADMA 3J81A 4DL9A 1EWRA 1UT5A 4JSTA 3G17A 4OI4A 2J31A 3R0XA 4OAQA 1B7GO 4FIPC 1T8PA 1D2HA 4B09A 4IRMA 1R8YA 3MTDA 3JCUZ 1OCEA 1UXKA 2OV4A 2JLBA 4W8OA 1W87A 5CK4A 3WIBA 1C9DB 3E3LA 4CL0A 5KMGB 4MT8A 1LBTA 4R1LA 4M9CA 4OP1A 4Z53A 4YCAA 5EE0A 4HDCA 2OFFA 3U09A 4JR0A 4CCSA 4Z99A 1YR1A 2DYKA 1M8FA 4ETWA 2WOJA 4GL2A 2WK1A 4XUCA 2C59A 5CG1A 3LT5A 1G2OA 2FW0A 1C9NA 1U0HC 2VUIB 1I3MA 1UJNA 4CC5A 2WTAA 3V8RA 4DADA 1GG9A 1P2SA 3HCWA 3LRPA 3U7GA 2NYRA 4YRLA 5EKUA 1RHUA 3FCSB 1EFVB 4A2PA 2JFYA 2O8NA 3IDQA 4YECA 2GPYA 3JQCA 1OXMA 5E4JA 2H7VA 3CNBA 1VXRA 2MWMA 1Q17A 4QZVA 4PZYA 5COBA 2A5LA 3OSZA 1SKBA 4M89A 1QM5A 1P7YA 2EGHA 1DRVA 5EPOA 4EDFA 3AVTA 2JA1A 1NUQA 5AVVA 1DO0A 4Z4CA 1D7OA 4CN9A 2O8VA 4GECA 2JI9A 3WNBA 1RQPA 4TSFD 1KJYA 1Z4PX 3WDLA 3EG9A 4Y1EA 1ECJA 3IAFA 1AKVA 3B70A 1AB6A 3VPAA 3FMPB 4G5GA 5TGTA 1E5VA 2AZMA 5DNVA 5TS3A 2OHFA 1JKMA 4FX5A 2XAGA 3RK0A 5JBIA 4RVSA 4F0JA 1QH8B 1TF2A 2XJ9A 3USES 2B30A 3AF2A 1KQSU 1LEHA 2WQ6A 3CCCA 4ARUA 1ELOA 5FDFA 5AKHA 4R2XA 1PFYA 1PZXA 2R6FA 1L3IA 1CF9A 4X66O 1IATA 1VE7A 5AQ1A 5F98A 2AUNA 4P3NA 4KXRA 4W82A 1EBBA 1X1DA 4EPYA 1SRRA 5TEVA 4FHCA 3ZLBA 1P5ZB 3RWOA 2CJWA 4KQ6A 3G0IA 5KSZA 1UK9A 5K3FA 4IH4A 4CQJA 3K6KA 4H60A 2M32A 1X0XA 4OLHA 5ELLA 5JALA 1LV8A 1V0JA 2Q4DA 1NHGA 1W4CA 4A92A 4AN0A 5THXA 1Q7CA 5EJMA 3U7IA 3QE0A 1QH1B 2QM7A 4FLEA 3GZTB 2CSXA 2DKNA 3U48A 2EAUA 1U5CA 1R74A 1YUBA 1Y6QA 4MCJA 5DOZA 1BIFA 3ZNNA 4XJSA 2I4MA 5J1TB 1ZUIA 1LPAB 3E48A 3L7IA 3UPTA 4XGNA 4MUGA 4DPLA 1M56C 3G5UA 3ZV5A 5K45A 4UVCA 3X1MA 4GRDA 2R751 3SQNA 1L4MA 1MSDA 3NDPA 4ALJA 3R3WA 2YASA 3KHUA 2FW8A 2O8BB 4TKMA 3BK2A 2ZUVA 1Y9AA 1VARA 2WU3A 1WV0A 1ILWA 1D8TA 4QLAA 3INYA 2AXNA 5L3SA 3CLSD 1R8JA 1IXSB 3P2IA 1SB8A 2HRCA 1AHNA 2CDBA 2IY7A 3CHYA 3WGZA 1VZ2A 1LPPA 2Q6AA 1RBZA 1Q0HA 4TX1A 3R3UA 3FTCA 3TLKA 4CG3A 4WOBA 2GO1A 1U8XX 4OP2A 3PNLA 4DREA 2ASVA 5DOVA 1NM5A 2O5EA 4B3TO 4UVEA 2IYAA 3KT3A 4RA9B 3A58B 3WB1A 3FR7A 1BDMA 3AF0A 3LY9A 2H1VA 1ROPA 4RCVA 1U7WA 5KMGA 4OFXA 2ROQA 3W2EA 3PTZA 5JMOA 1FKAO 1MEEA 3KZNA 3ZE6A 1TGOA 3H3JA 3TKAA 5HYVA 3UAVA 2J46A 1YF2A 4L3WA 5B7NA 3W1VA 3CCBA 2W48A 2X7XA 1S96A 4C7JA 4F6EA 2PQMA 3NT4A 3I12A 3T41A 5IDJA 3JY6A 4R8KA 4UPVA 3SQMA 4YAUA 1GG5A 5KAMA 3W90A 1H42A 3YASA 1STOA 1CJTC 3EY9A 3K8QA 3GC6A 4GZ6A 1H1DA 4M6WB 1KJQA 2FN9A 3STVA 1XRJA 4C0LA 3RTDA 2E0IA 4LOKA 3W77A 1BOOA 1V9SA 3HCFA 1RP7A 4DW8A 3O31A 3PNOA 3T1YO 5AMXA 4WUTA 5G0VA 1ISGA 3I04M 3G8YA 1H2MA 1S8AA 3TOVA 4BVEA 1KFEB 2ANBA 4REMA 1ZIDA 4CKZA 3V1YA 3DOHA 3AY3A 2OV1A 4C1NA 2BHLA 5IKEA 1NW9B 3P0EA 5JVDF 5FBWB 3L92A 3ZK7A 4LYAA 3I6IA 2G83A 3KLOA 1W1WA 3AP3A 3FYUB 4QBHA 2AGAA 3VGPA 5IVHA 4A5UB 5JROA 5K0GA 1XZDA 5DYYA 4JROA 3VKUA 5AQEA 1I1QB 4FD3A 3T5BA 2GLTA 4UNQA 1QH8A 2EGUA 5J2UF 3AP1A 3V5NA 2LP7A 1F1BA 3ISJA 2B5OA 4NFLA 2IHJA 1W19A 4ZP1A 2R8ZA 3VPXA 4PNZA 5L8VA 2DETA 2OBBA 2OGUA 1DX9A 1BMQA 4CF6A 1SFRA 3P3NA 3D36A 3N3AC 3SYRA 3KOUA 3TUZC 3OWOA 3GIDA 4X94A 1F38A 2FK7A 3H5VA 3LIIA 3ETNA 4U6QA 4J10A 1E1DA 1YQDA 3KJGA 3KT8A 5T67A 3AESB 1LRKA 4Y6SA 1Z2AA 4KW7A 3UJBA 2KB1A 2P9EA 5TT1A 2X5KO 3L1KA 5CA0F 1NXPA 4XKJA 3EH1A 1HZZC 3NEPX 3P5SA 5BW5A 1NUSA 3OHPA 4PQFA 3MT7A 2IS2A 4XOUA 3PQEA 5EUQB 1L4YA 3EZYA 2WD8A 2II6A 3P7MA 4EX6A 1QH1A 3RS3A 3KSAC 1Y5NA 4XM1A 3L74H 4K9MA 4RDCA 1H8HA 5BY1A 2R8YA 3VKVA 1GU1A 2PZEA 3EULA 4DFDA 3UENA 1NVTA 3THOA 1OCRC 3X0DA 3S44A 2YIDA 3AIKA 4CFZA 2UZ3A 3I0ZA 4DRYA 3EUFA 4NZYA 4I5SA 3GFOA 1CB7A 1OZGA 2H29A 3WDMA 3WL7A 3ZS8C 4R54A 1XQWA 4N1AA 1XMOB 4DIOA 1ZN7A 4PCLA 4BNUA 3RSOA 2VQFO 4HUQB 4EHKA 3H3FA 4JWKA 3QKIA 5BO5A 4DEVA 2WAYA 3QBVA 3WNCA 2O8BA 2WLMA 4B3RO 2P9QA 2FI1A 4DQVA 3K16A 4MKRA 2VK4A 2WHPB 4OQQA 4XDYA 1KI4A 4R98A 1T5EA 1X1BA 4NEGA 1RLJA 2MMGA 2WILA 2QLBA 3PCTA 2JANA 3NOVA 2BL4A 3ILSA 1MB0A 4HYTA 1N2HA 1BQ0A 4NH4A 3B9QA 3G7NA 1E8MA 4DR7O 2AT1A 1N32O 2XKAA 4NSNA 1GA6A 4ZBMA 1XYVA 3PL5A 1W2BU 3VYVA 4RA6B 3T4XA 1KDRA 1P60A 1TI7A 4RA9A 3ZJZA 4IYIA 5IBPA 1JSRA 4JEHA 3DBRB 1N3YA 3SEZA 2OBNA 2W7TA 4LG1A 2W4QA 3OE5A 3U9LA 1GKKA 2A0YA 1VPVA 2QN3A 2PZGA 4RQTA 1FSGA 3X2SA 4DYDA 3U1VA 1L4HA 1Q57A 3V8NA 3RO7A 4GLOA 3OM0A 1U1DA 1GM9A 1EXVA 3ZNPA 3I2YX 3UATA 4MLPA 1ZAYA 3S1SA 3SIPA 2O7NA 3FIJA 1NKTA 1NW5A 2CBZA 2P9ZA 2QWRB 4YR9A 1D6JA 3EYAA 3RU9A 3OD1A 1JNYA 3CLTD 3H1IH 3NYWA 4D8VA 2FLWA 1OLSB 2Z2IA 2W6NA 8ATCA 4KXVA 4BNJA 3VJMA 1ZMBA 2JI4A 2NZ2A 4M6WA 2ZR3A 3DOCA 3RBAA 1E2FA 5DI3B 1PTJC 3BXGA 4NCNA 5AHOA 4ENRA 4WLOA 4UDYX 2J30A 2R70A 4EHIA 2YDEA 4ZAZA 1ZOLA 1QTIA 2X7JA 5A9SB 5CJ2A 2JATA 3NW9A 3QW4B 2FWMX 1PWXA 3UT6A 5F7ZA 4K35A 2PX4A 1WM1A 2HPHA 1O97D 3OE7A 4OXNA 5DEDA 3FYUA 3EQ7A 3D3WB 5C4GB 2EIHA 3T34A 4QOIA 2X0NA 3FUCA 2J3IA 5BQ5A 4KPUB 1GQRA 5AI0A 4F2GA 4LYGA 2G5CA 3IBTA 1DU4A 4DV2B 1H2GA 4PC7A 1FYWA 4JOQA 2H92A 2JD0A 2BGRA 3SKVA 1KJ9A 5AJYA 4QX6A 1J56A 3HYSA 3QU7A 3QLEA 4DLBA 1ZHHA 3E9YA 2H9YA 2Q73A 1T9HA 2H1CA 4I4LA 2JDIA 4IFEA 3MCAA 1MG5A 1KVUA 1THMA 4AJPA 1IZ3A 3SHTA 1KGSA 4QRDA 1UC8A 4ESVA 4D8TA 2FDRA 4JJ7A 1XMQO 1GADO 1LWNA 4MYSA 5GZ1A 2NR5A 3UO2A 2LPMA 2WU8A 1CETA 4WRRA 3UJHA 1Q0UA 2GEFA 1A72A 5IF9A 1Y8ZA 3AESA 2QW1A 1DC8A 4OJYA 4OHRA 3IAYA 4TLDA 4GMKA 2HWYA 3T4ZA 5DU2A 3PLNA 1XYYA 1S2IA 2WLHA 4C3OB 5CBPB 1K9MW 1GPJA 1GCUA 2CJPA 2EEPA 3MRSA 3RRXA 1X7HA 1IPFA 1SK8A 3A9RA 4N41A 3AHDA 2OA0A 2HCTA 3WHLA 2HCFA 1XD8A 1LPSA 5A4JA 2YRFA 2TSYB 1QQTA 1SBZA 1BMFG 4NDZA 3E3NA 4C4ZA 1LJLA 2E2WA 3ZUPA 3MT8A 5BSVA 1W0KD 1FF9A 4C2UA 2YZKA 2N74A 4LV6A 4AIIA 1KC1A 1EX7A 5M5BA 4R2IA 2Z30A 4IG9A 2CD9A 3VMFA 4J91A 3R7DA 2JAUA 1EFPB 3THXB 4J0KA 3GWKC 3A3KA 3C48A 1H1LB 1AGXA 5KHLB 1XCJA 3VO9A 3HJBA 4B0OA 1E64A 4FJ2A 2G1PA 1COWD 1NA5A 2XYRA 1TQDA 3PHGA 3TGUH 4HUQA 1NC1A 2O7VA 1HE4A 4UMFA 2F95B 1S8NA 3A9VA 4PQYA 1C1XB 1INLA 3KP1A 1MA0A 3DMGA 3KAPA 3ISTA 2ZVPX 4RD1A 2WHPA 4QGAA 1JEAA 1P39A 1MC5A 3N2ZB 3HVIA 5AD1A 4LSGA 5F51A 2ZG6A 1IL0A 1DIGA 5A4AA 4U7DA 4WH0A 1AROP 1I2MA 2WV9A 3WL8A 3PUKA 5T4EA 3EJWA 4PPGA 4KQJA 4LZAA 4ZEOA 4AS3A 1XOIA 4QE3A 3O3OB 4OSOA 4MUNA 4ZO8A 2AI3A 1VCNA 3P2OA 4JYMA 4MRPA 4RA6A 1A32A 3SYOA 4NCAA 2MHCA 5FL7A 1EQ2A 3GVCA 3DBRA 2Z95A 2ZJ6A 2NIPA 4O1IA 2RHWA 4DLNA 1C29B 2IHZA 1C4WA 3I42A 1W96A 3BKXA 4ZVLA 3LQYA 1V3TA 4WGFA 3TNDA 4AQYO 4J75A 1YZTA 3ZKAA 4BEVA 1F3LA 2QG6A 3HU1A 1DC4A 2IFTA 2X0RA 4KN9S 3ETQA 1K6XA 1FQJA 1IE3A 1K1EA 5ALNA 1CUIA 3VVCA 1GQSA 3KHKA 3GUVA 4I9HA 2ABWA 1MV8A 5TIIA 4JYPA 4UEWA 2ZWPA 2IYQA 2QMZA 1YA6A 2K9PA 2Z3YA 1E89A 2PL5A 1OLSA 3IDZA 3QUTA 2XNDA 3A2NA 4R71A 4Q1DA 5KWSA 2Z5VA 5DI3A 3CB2A 3WJ7A 4LV5B 3I76A 1VE3A 1JR9A 3QWAA 3FWKA 4OFWA 5KSOA 2ZJBA 3AFNA 1LV7A 2P4KA 4BJ5A 5GJBA 1GITA 1ACJA 5CLLA 2QJRA 4X5OA 3LCCA 2A84A 2PT5A 4ENQA 2ZIXB 5A9SA 2FSGA 3ZBHA 4BIMA 3BBPA 4BU0A 3Q8LA 1ORIA 3FHCB 1WY5A 2G38A 4EA7A 1SAYA 3RSLA 1WOMA 1QGZA 2R44A 1X2EA 3LO5A 1CZLA 2H8PC 1WG8A 4DCPA 1JR3E 4LBEC 5FFFA 3TGWA 1SG9A 3CJRA 4CODB 3X1WA 2XOKG 4R31A 1ATIA 4FJCC 3PKJA 3BAAA 3E4DA 4KPUA 3VR2D 5AVUA 1OWLA 4A2QA 3F7VC 3M9WA 3T7TA 5JASA 3KTAB 2BGNA 2FN8A 5AW9A 4FYWA 3V2GA 1NXXA 3R3YA 2XVZA 4B6GA 3OMNB 1L2TA 3LCMA 3EPHA 4QDUA 2P67A 3GJ6A 3B51X 2GN9A 2BEWB 1PUJA 5KYVA 2JIZG 1T10A 2Y68A 2HJSA 4Y9RA 2IF0A 3U5ZB 4UDOA 3PFHA 4YAKA 2EULA 4DPMA 2QRGA 2VCHA 3IAS6 3VMMA 4QWMA 4X7MA 1O1YA 3I01A 3EIUA 2ITDC 3QM1A 1C80A 2ZXFA 4CLDA 4I6GA 3BMQB 5T6MA 5EP4A 2VKQA 4R6WA 2OV2A 3D3NA 1FBTA 2G17A 4MWOA 3HB3B 1P29A 3WRYA 2QTAA 5JXGA 3S2IA 2X1HA 1XJCA 5CBPA 3NFRA 1EPUA 2D1QA 5IMBA 1YQQA 5ALPA 1UJ6A 2OBXA 1OJ7A 3SM3A 3ZBQA 1O6BA 2NN4A 1TAHA 3RGWS 1B1AA 4OKSA 3PVCA 4QQRA 5K0FA 2GBGA 2ZR9A 2IH4A 1EVZA 5ARDA 3NTXA 4O2RA 4DM3A 2EJCA 2YCLA 3NTQA 2QTTA 2CF5A 4M0KA 4CMEC 4DSUA 5EP3A 2LV8A 1IBSA 1X80B 3JWEA 3D1LA 4G27B 1EFPA 3FRIA 3THXA 2C7GA 1UK8A 1H1LA 4PHTA 4RPHA 1TYDE 1L8XA 3KOZA 4K9RA 4UPEA 1ZH6A 2EINC 3IS3A 3CVWA 3ZMTA 3HXMA 4IWNA 1H2XA 2QI9C 1RXIA 5DGXA 4MUJA 1RTTA 4X89A 4POOA 5DXAA 1C1XA 4W9NC 3AR8A 2KSQA 2EF0A 1TJ3A 2BUBA 2CLLB 2JFOA 2NW6A 5G41A 4MWDA 5J4LA 2O3JA 9LDBA 3SYAA 1KI8A 4RENA 5DWDA 3U3XA 1JS1X 4MUXA 4YT4A 4NAVA 4IEEA 3NHFA 4OQFA 4N01A 2LCIA 4ZT6A 1FRVA 3FVTA 3UMVA 1H8EG 4RQAA 1TADA 2ZJ8A 1OWNA 1H93A 3AWDA 3CZPA 2VWQA 3MCUA 5AICA 4OL0A 4HRAA 1OLUB 5JNRA 1GZ6A 4CUKA 4CGZA 1KYXA 3OAAA 3LP5A 3ER9A 5BR7A 1QGED 1YVPA 1GARA 3H83A 1MO4A 5I7OA 4G36A 3BWVA 1FFAA 3W5IA 3ZCXA 1JDZA 2VYCA 2HDHA 5KOYA 1I7QB 4S1VA 1R1DA 1G9XA 3TPZA 1K3FA 4JYYA 3RAPR 3L8FA 4O8CA 3CXRA 4Y2VA 3CVOA 3B3AA 5ER6A 3DNFA 2NX2A 4ND1A 5GZ6A 1EWTA 3OY7A 4QXMA 3S2GA 4JIGA 3DWIA 4BQFA 1OI2A 5AI6A 3HJTA 3C1AA 4MB2A 2K6GA 3HVJA 5AM5A 1UH5A 2PUFA 5ARCA 1G3MA 2D2FA 3PR3A 5KX5B 1TU0A 3E70C 1PS8A 3I4LA 4DA0A 1N5RA 3HABA 4F12A 1BDJA 1TYBE 1YIDA 2G9RA 3F78A 1ILEA 3MMXA 4DNFA 2G1AA 5A6SB 5AXDA 3KUDA 1M0TA 1E18A 3EXHC 5HCIA 2C5BA 3Q7QA 2ZVQX 3FLBA 3BGSA 4Q5IA 3AEQB 3UAOA 2ZIXA 4G4GA 2XVAA 4R8RA 1W4BA 1M56B 4DVJA 2BEKA 1GDDA 2HA6A 1MOQA 3KZKA 2C9ZA 3PGLA 3R23A 2D06A 1OR8A 3KBBA 4AC9A 1RXSA 4L74A 5LU8A 1BWRA 4P53A 2I7XA 1HT3A 3IRVA 4I5IA 5D84A 2EFCB 3GARA 4AW9A 3L4EA 3HB0A 4DV4O 3GK3A 1Z0KA 4EYSA 3KTAA 2OP0A 4TWZA 1OVGA 1ZGGA 2EGGA 3DQZA 5HPYB 2Q6TA 1SQVH 1N6LA 4A0HA 3M8KA 4BKUA 3KVYA 2BBWA 4ND8B 2BEWA 2HDNB 3OWXA 3PJRA 2LDBA 3MXTA 5IASA 2V03A 4Z0HO 1SXIA 2QYTA 5F7OA 1LQ2A 2LXNA 5AUNB 1OF1A 2CVOA 1YGPA 3VDRA 1KE1A 1ZUHA 3KUXA 1Z6TA 3BMQA 5IY5C 4EUNA 4JQYA 4D79A 1UPTA 1V3UA 2GBCA 1DG1G 3KSRA 3BMNB 1VPEA 1C9JA 2P91A 2QWNB 1YHZA 2ZTUA 4PAMA 1Y76B 4IAOA 4OMFG 2FN3A 3ZNOA 4KRFA 1C7FA 5LQUA 2QTHA 3WSTA 1V9LA 2AYYA 3T1CA 4ZVQA 4H1TA 2WTMA 3O4JA 4E7PA 3VQXA 1JHZA 2HDWA 1H4TA 4RIGA 1NJ6A 1F60A 2JNWA 2FG6C 4KXUA 1SKVA 1U8EA 2PD3A 3ZIAD 2C1EA 2BZ0A 1HSZA 3LZDA 1Q0ZA 1OXUA 2YFHA 5GIPE 4AMYA 1I80A 3H0EA 3UWDA 3OOJA 2CMGA 1C9EA 1POXA 1X80A 2ZT6A 2ZT8A 1KVRA 3V3TA 2PL9A 4D8YA 1GQ2A 3HRKA 3ROGA 3UJNA 1BKSB 4MO2A 5DBEX 1LJ8A 6ADHA 1VQNV 2ILVA 4EG4A 2VAVA 4M1OA 1S7GA 2HMSA 3HB5X 3SMVA 2ZI7A 2VNJA 1PHPA 4ZK6A 5HVNA 1Z5GA 5CCDA 2ET6A 2YWCA 4ME6A 3W6OA 8GPBA 5JSQA 3ANMA 4KNVA 1SQFA 1K7FB 3PFNA 2BFCA 1QRTA 3PFWO 3J7TA 1KAEA 5IBQA 2X8JB 2Y0BA 4OLJA 2HNBA 4XBFA 5EIOA 2GPSA 3NASA 3FNBA 1OLUA 2B7BA 4BIIA 1RI5A 3AVQA 1VQ6V 1DUVG 2CHUA 5DXFA 1DIOB 4XXHA 3BKWA 4M53A 1EMDA 4JSYA 1AUXA 4QUAA 1JALA 4LQ4A 1PV1A 2CKMA 4EENA 1MJFA 3EK2A 4BYMA 5C34B 3NDIA 4J9UE 4YWHA 1F8FA 4JOBA 1H5NA 1SO8A 4WKCA 2O0MA 1K98A 3E2IA 1S2NA 3GJ4A 4X1OA 5FLXN 2F55A 1R0CA 4HTFB 3OICA 3C7TA 1IHDA 1X42A 1WUTA 3HJUA 5IBCA 5ITVA 3CV3A 2ZUWA 3FLEA 4ARVA 2BFOA 3IR6A 1X0VA 3T9AA 2PMDA 4FHEA 2QE7A 2VS0A 2O1WA 1I51A 3MCTA 1ZD1A 5HQJA 4Y2UA 5KIAA 3EODA 4C22A 1Z6YA 5KX5A 4UBNA 4HGRA 1SWWA 2GPAA 2ZKIA 1VJCA 4UUBA 1PTKA 2Z58A 4YRZA 1NBAA 1WBDA 4IX1A 4URUR 1U6JA 1SQBH 3RVPA 3M6UA 4BY9E 4AP9A 4D7TA 2ZSJA 3AEQA 4PYQA 3M33A 2ZB2A 3PPYA 4RMHA 4ZEVA 5ICGA 2Q28A 5T6BA 3KKZA 2ONYA 2OHVA 1CUUA 3JWJA 5C8XA 2WF9A 1ADBA 5EIHA 4YONB 1HTWA 1Q19A 3QEAZ 3PKZA 3ZY3A 5AKYA 4IDNA 3WGOA 1VE5A 1Y9EA 7MHTA 1Q7TA 2NXWA 2OCLA 3A4IA 2GWRA 3OJXA 1ONNA 4G5XA 1C7ZA 5EZ6B 1Y4ZA 3CCLV 3UGQA 1VMEA 1H0RA 4O59O 1YDHA 1XVLA 5FORA 5BSGA 1VL1A 1JJBA 1XK7A 4ND8A 2BGKA 4JX9A 3AY6A 4A8PA 1OKKD 3GHYA 4FMPA 4XGQA 2KYRA 4PJ0Z 3OEHG 4EY5A 1EEHA 2Q29A 1JZQA 2GXQA 2VT3A 4KXYA 4AKGA 4I9QA 2P27A 3H0KA 3VOBA 5JNUA 2RB4A 3C70A 3BMNA 4WESB 4IIDA 4RHYA 4NNOA 4YRDA 2WABA 3JQ9A 4DUYB 1Y76A 3MIZA 4PBTA 5HFAA 3G7SA 2BMVA 2V7GA 5J40A 1SXGA 2P7IA 1U4SA 4MYHA 2ONJA 4QYMA 3AKEA 2WTNA 5I3ZA 3TJMA 5TPZD 2VJDA 4RWUA 4B6JA 2BUAA 2C2WA 4IQ4A 3WK4A 4YT8A 3MWEB 1KQOA 2FPUA 3AHCA 3OLWA 4UKDA 3N1UA 5ERYA 2FPKA 1AGPA 4P35A 1L7NA 1FP4B 1AIPA 1NJ5A 1X7ZB 1YE3A 1PF7E 4NG5A 3LMKA 5B1IA 1Z37A 2O5RA 4RKRA 1QAMA 4JJZA 3NHKA 4F4CA 5H3CA 1YL7A 3JQ8B 4AZSA 4DQDA 3GD7A 1JJVA 1JSXA 3RS5A 4EPWA 1ZISA 5D1NA 4RMGA 3B8HA 1Y5MA 2QNIA 1DRKA 1K3UB 1T5DX 5CBHA 1F14A 1VQ8V 4YH1A 3HSSA 5EHQA 2VXYA 3CCEV 3X1JA 1HX7A 3JRNA 3UC5A 4BNKA 4WHMA 2C7VA 5B3AA 1ODKA 4U2DA 4ZQIA 3RWBA 2UUBO 3KXDA 1YKFA 2X8JA 2IF2A 4AI6A 4E3ZA 3J7AC 5JSZB 3RNOA 1GPBA 1K08A 2IYRA 2P1ZA 1OI7A 1E3LA 5H80A 3STWA 1K9VF 2XQJA 4LCUC 1L5QA 3GNLA 2A58A 3G2LA 4M37A 4EGQA 2Q27A 4DSAA 3DSRA 4CG1A 3CVYA 1QWOA 1L4BA 2G6BA 4F86A 5EGNA 3EC1A 2AYXA 4Q24A 1U0FA 5ICCA 1W94A 4P5EA 4LZLA 4A36A 2JJ8A 2DPHA 3TSYA 5EERA 1RMYA 2BCEA 1DV1A 2A59A 3DLIA 3VC2A 5JZ9A 4U3JB 5EY5B 3I01M 5CXXA 4BV8A 1B00A 4HTFA 5CAEB 3N70A 4BKOA 2D3OW 4GLLA 1Q7YW 2G77B 3M6FA 2EJTA 1LBEA 2IZ6A 3KWFA 2UXCB 3Q1LA 2Y6VA 4QL3A 4HN2A 2W37A 2Z1DA 4GAEA 4CZZA 1KBOA 3UBTA 5I8PA 1HZZA 3C87A 3H5NA 1HMYA 3NKFA 2O6LA 3T9EA 5T4HA 4URHA 1I4WA 4YRPA 2W0MA 2JI6A 2H4ZA 3HK2A 5B1DA 1BN6A 4DWOA 2ZJOA 4BBAA 5FCDA 4C01A 2I7TA 4M9UA 3DOUA 3I4CA 2OORC 3KQPA 4AJNA 1Q3HA 4B3SB 3O93A 2X3FA 4HNUA 1ZUD1 4FFKA 4KREA 2ZE8A 3MJFA 1EBFA 3T15A 4C30A 3ROPA 1PD3A 5CH5A 3ZS8A 4L8LA 1FTSA 3F97A 3N86A 5JH7F 2ECQA 2AR0A 2ODQA 4HX9A 4Q93A 2IXFA 3TMKA 1UQTA 1XEXB 3DEZA 4CU2A 3NETA 1Z22A 2OESA 2Y4UA 3IV9A 5KQGA 2IW3A 4TMYA 3RSSA 4EVQA 4R3UC 2P6RA 1XVIA 3LQFA 3K0CC 4OQDA 4QC2A 1ZIPA 4YMWA 3EPKA 4B7UA 2EILB 1J2TA 3ANNA 5JG7A 2XB8A 4BP9A 4Q7LA 5SZHB 4RTRA 1FMTA 1K88A 4W1SA 2B4AA 1YE8A 4MLCA 5EN4A 1Z6XA 1KIMA 4BMCA 1DO8A 1E3TA 1TVEA 2J0SA 1UANA 1W93A 5C9ZA 1XILA 1L8DA 4NEHB 3VPGA 4RTJA 5F9FA 4AECA 1C3EA 5ER9A 2EZ4A 3PT5A 3MD9A 4M1YA 3LSYA 1FUIA 4WESA 4PNHA 5FUQA 2ACVA 4UNPA 5LIRA 5KNBA 4NG4A 2OPHA 5MN6A 1LDEA 1I1HA 2XI4A 4QA9A 3KZXA 1T9DA 3QLUC 5I7HA 3LYUA 3E9RA 3I2GA 2EP5A 3WGTA 1LVHA 2EQ5A 4BIZA 3KRTA 1P7WA 3NHRA 1BCRB 4QDOA 3RAEC 2QWXA 1TM2A 4M0LA 3IUSA 4DXAA 4O29A 4ZVVA 1CD5A 1ORTA 2QRQA 3C5EA 3EB9A 4ASUD 2FPRA 4Y1GA 4AJ4A 3OU2A 2Q7HA 3EMBA 1Q22A 3MWEA 4CF3A 4JL8A 3EVKA 5ILQA 3SLGA 1BMTA 4NR0A 4TTRA 1FP4A 2C4WA 2C78A 5BQXA 3AUXA 5JCOC 1X7ZA 4FXOA 4UOEA 4DEXA 3NVAA 2B3DA 1RPNA 2GUZB 1CNMA 1ZM4A 3JQ8A 3ZH9B 2AFIB 4EO7A 4TMTA 2XE6A 3BWXA 2ZETA 5KEIA 3B82A 4K2AA 1DIRA 2GVZC 2OV3A 3BD7A 4HJRA 5A3SA 3BWDD 1N8RW 2F4VB 1SC4A 5ALTA 5BNIA 2OO5C 1DEOA 1UEIA 1BKYA 1YZLA 1FVXA 1PJAA 4S2UA 1OV6A 3LUDA 2BBSA 3PA6A 3HU3A 5JSZA 2GD0A 4PANA 1OU4A 1C1HA 1P5HA 3AG7A 5H8WA 4LYEA 4Z8XA 3R40A 2WYHA 4G1CA 4KNWA 2VT6A 4BNFA 2QZ9A 3E1SA 1NQVA 1X7XB 2FHSA 4FBGA 2XUHA 1C1YA 5JMPA 2RHCA 1V3VA 2UYHA 4BB6A 2AX3A 2ZR0A 3FBGA 1W36C 2A14A 3JAKB 3VUFA 1MCZA 1PFGA 3O74A 2W6MA 2Q2NA 1V11B 4ECEA 4U3JA 2FVYA 3W8EA 4D25A 5CAEA 4WXEA 4OLAA 2DP4E 1YI0A 3QKSB 3HXTA 3JYHA 4C07A 1KOJA 5F5NA 4ZCIA 1FFXB 2P0EA 4E1VA 2QW8A 2Z6AA 3X43A 1VDZA 4G86A 4WECA 1JHMA 1SVMA 3VOAA 1E79G 3TBFA 3HMQA 4MQFB 3LU1A 3N6XA 2YV5A 3GP8A 3QVVA 2Z83A 3JAMA 3ERCA 2IU0A 4ZOLB 2NO1A 3FWHA 4CV2A 1IHOA 3CLUD 2NSLA 3IERA 3Q9UA 1YH3A 3OM8A 3OX4A 5EIBD 4BFWA 5FIUA 2F3QA 1M7HA 4EL5A 1V71A 3D6HA 2G09A 3IO3A 3H2ZA 3TDMA 1M5UA 1N7HA 4AZ3B 3A27A 4KQ9A 1TYAE 1B04A 4BFVA 1G9SA 1NU1H 3CUEF 2PAFA 1RLMA 4G1VA 5KTTA 4A0RA 2ARHA 5EE9A 4DJTA 5F1YA 1KY3A 2Y66A 1E4YA 5C8VA 2UAGA 1XEXA 3SEQA 4WN3A 1VB5A 2XBMA 2EINB 4JA2A 2AMVA 4WNCA 1Z8HA 1C30B 4EJ0A 1OFHA 1JIIA 1SC1A 1SBNE 2R0QC 1MIOA 4RFVA 1G98A 2GDSA 1FNBA 4JI0O 4WLUA 3NAQA 3WK5A 3TIGA 3ZWYA 3FOBA 3FUWA 3IEUA 4D3YA 1IB0A 1B6RA 2FMLA 3NAZA 4B8ZA 1DSSG 4U2FA 4TQAA 4UC0A 3EWNA 3RKSA 5C81A 1QKIA 1YJNV 4QDJA 2QJ1A 3ZD9A 2R4UA 2BHNA 3I58A 3MJTA 4LVUA 5KTNA 4CKEB 2QU8A 3CH7A 4WSOA 1ISJA 1IM8A 3BORA 3UJ8A 5DHFA 3OA2A 2CCKA 1ZPDA 4X62O 2EYQA 2F1IA 1II8B 3SNHA 2WG1A 1Z4NA 1XZQA 4Q1AA 2ZBVA 1F6WA 1SA0B 1IOZA 5EC2C 3H04A 2Y99A 4UB6Z 5LZ4A 2GM5A 1XO1A 1XTIA 5DZSA 1BCRA 4E94A 4YJGB 4IS2A 4EAQA 5F78A 1YOBA 3SBOA 1SUFA 2YWGA 1TEVA 3BF7A 3KPWA 1MZPA 1FFCA 3AERB 2VT2A 4DQKA 1DL5A 5BWNA 4DDMA 3DT8A 3UUWA 1L1QA 4PS0A 5CR9A 2WT8A 5EJ2A 3I2JA 2YC0A 5JMWA 2XD4A 5A4DA 5L3RA 4LF9B 3NVKI 3OQJA 2GUZA 2QYHA 4WZBA 3HBMA 3IGAC 1O77A 5LZ8A 3D54D 1P7PA 1V96A 3TKYA 4TT8A 1LSSA 4UD2A 2AFIA 3LUTB 3G9ZA 4IS3A 4MW9A 4WZAB 2FHPA 2F23A 4MZXA 1ZC3A 5BSKA 1FRZA 1YDGA 2WHEA 4J0EA 3CZMA 1C0IA 4IEFB 2V7XA 3TS1A 3B3FA 1IB6A 4BO8A 2FRVA 2BONA 2H1IA 1O94D 4LTNA 4PYRA 1DCTA 1WW2A 4DSTA 2PXXA 1YITV 1KEPA 2VDRB 2FG5A 3OBIA 1TA9A 4LZPA 3DMHA 2RKWA 2VBCA 5BPFA 3A6EA 3HUFA 1DQZA 4GDMA 2BEUB 1X7XA 2R5FA 1E6KA 3PTLA 1NDUA 1XA4A 4KO2S 2PY6A 4OQPA 3NXKA 1ZN2A 3A05A 1QYCA 3JAKA 4E22A 1RKUA 5EIEA 2QMYA 3TSWA 2J4FA 2TS1A 3EF0A 2OHHA 3UMMA 3JQFC 1V11A 2XB6A 3RS9A 3AR9A 2FR8C 1CP9A 4YRAA 5IY5B 5AUOB 3BDAA 1L7BA 5JS8A 4BHTA 1EFVA 4URFA 1O95D 4FM2A 2QZJA 2RARA 4BTLA 5AW3A 4GZLA 3IQHX 3QKSA 8LDHA 2K7ZA 3PQCA 5LQMA 1ISMA 3MAAC 3OPNA 1NASA 4N65A 1FFXA 1KEKA 5JEEA 2EWMA 1SZDA 1EWVA 2H94A 1MOZA 1NPYA 3IP1A 2VUSA 2XUGA 5JBQA 4MQFA 1SULA 4DQLA 3BFXA 4ZOLA 4NBWA 2MT9A 4WZZA 2H5EA 1LSOA 1GTOA 2QWPB 3P97A 1WU8A 5IU6A 3MTJA 2GD6A 1LRLA 2JI7A 3GJ0A 2ZRDA 1BA2A 4AZ3A 4L6AA 1RI1A 2O19A 4CMEA 4UXHA 4MK4A 3R74A 4PGMA 4J9YB 1EB9A 2VCEA 3GLGB 5G40A 1RCUA 3LFHA 4RK6A 4OHXA 2EZTA 3M4ZA 2NSHA 3ESBA 3FMGA 2GPBA 4Z4GA 3AU8A 3PSHA 3TE6A 2ZVDA 1C30A 3EHDA 3KQNA 3VNRA 4KK4A 2DWUA 3OZRA 4OQLA 3VTKA 1YHQV 1CSEE 1ZM2A 1JJ2U 4PY2A 5HF9A 2ZRGA 4YJ3F 4X1KB 2R85A 3O9ZA 1O9GA 1Z13A 3KEGA 3GFPA 4Y6OA 4KVZA 4WK6A 2VHVA 4MOWA 3THYB 2ON6A 4BO1A 1QQCA 4JUBA 2WD7B 3TZCA 2P5OA 2JEXA 3BZBA 4JBHA 1G20E 3QKTA 3TJTA 1AKWA 4MVWA 5BUZA 2Q2WA 2HZBA 2IBZH 1AKTA 5HS6A 3RHTA 3QE2A 4P81A 5B30A 4LX8A 1ZWKA 3VAZA 3ZHZA 5DHSA 1II9A 5KAIZ 1GPNA 3V8VA 3LS2A 5CLJA 1YS6A 2XX3A 3H1TA 2RG7A 4PFSA 5L6MB 4B2YA 5K3EA 2BV3A 4WE3A 2HU7A 1XMXA 2HGZA 4KTVE 4X64B 1UT8A 3I9V1 4L5BA 4FI3C 5CITA 1JU9A 1II8A 3RJZA 4MINA 1CE8B 4B17A 4ROSA 3EDMA 2P35A 4OLBA 3IE2A 1SA0A 4G5FA 1XEAA 3KS9A 3ADCA 4KQ2A 4WFBV 2BKVA 2CV2A 2GXSA 2XA9A 4DW1A 4YJGA 3C39A 2C9BA 1WXXA 4TYMA 4ZV9A 4II7A 3LQQA 3G88A 3ABRB 2PJZA 3AERA 4UOQA 3PQFA 2XE7A 1Z7GA 1KSHA 4UCSA 1JF8A 2C00A 3AG3C 1JJFA 4U39A 3PWZA 3W1EA 4QPZA 3C6MA 4MQ5A 1OSNA 1FVHA 1XL6A 4HLUA 5IVDA 2PS3A 3WJAA 2E87A 1SF9A 4X7BA 1Y6RA 3ZV3A 4ZYTA 2DEUA 4PHHA 1JRLA 2XBUA 3FSRA 4FHFA 2CL7X 4BNMA 3EW9A 1ORDA 1M1YB 4WZAA 2RK3A 1LUWA 3B1KA 3GLRA 1C7IA 1YZ3A 4GYWA 1J49A 4LYHA 2AG8A 4RSGA 2WWVD 5ADVA 3ETGA 5EE5B 3E9MA 1NTRA 1V9CA 3IQEA 5K8TA 3UWPA 1C2YA 3S1AB 3QP9A 2F1OA 1EH5A 5K3SA 1JR4A 1PR4A 3IIEA 1WZCA 1N0JA 1IFXA 4F92B 2Z5FA 4G85A 3VNSA 2Y1LA 4H3HB 3GBVA 4J7KA 4ZYWA 4B3GA 2DBRA 3EOBI 1EA7A 1J97A 4FM0A 3MGAA 1W1UA 3FPCA 2BEUA 2VSNA 1D09A 2X8LA 1VKRA 4JUDX 5CB8A 2QRPA 1NX6A 4TTSA 1NJ8A 4DWWA 1AT1A 1J24A 3GJXC 3RTCA 4H44B 4AULA 5FNZA 1N7GA 3VR4H 2NXCA 4IIJB 2ZIOA 3CN7A 1P49A 2AG6A 3Q7PA 4JUFA 1E1CB 2ODMA 5JW6A 1IZYA 4JNCA 4QO7A 1IZ7A 3P30A 3OLVA 3GT3A 3V2IA 3PEEA 2IUEA 1W52X 1A27A 2NTYC 1RRCA 5KNCH 3HCBA 4N18A 3PPIA 1Z7EA 3UW3A 3KL2A 1M6EX 1QOZA 1DT5A 3JWIA 4AJJA 4BDSA 2BGWA 1RM5A 5JJIA 3RRYA 2RHJA 1BCCH 1VQ9V 1AZWA 4B3MB 1VXOA 3F7OA 3LUFA 4L9AA 4HGNA 3ZDEA 5LMZA 3PWSA 3EDCA 5JYCA 1GR1A 1A1SA 3GFSA 2FPPB 4GM0A 5EP1A 3FJ1A 3GLGA 1CF2O 3WLMA 3ZHVA 2ZIAA 3SHFA 3UT0A 4JBIA 2HLDA 1EE9A 3GY0A 4Z7OB 2EXXA 4A8TA 4KR0A 4OG2A 5CA1F 2QPTA 4ZYZA 3RJ9A 2C77A 2D5AA 1JHRA 2F64A 4XDGA 4MGHA 4RPGA 1QP4A 4CT0A 4X1KA 2FXIA 4NMWA 1CUZA 4EYOA 3GEEA 1WB9A 4RTKA 4E5UA 3ABUA 3THYA 5DTEA 3UB3A 4D81A 3J80A 2PRIA 3RADC 4DA7A 2WD7A 3OQBA 3PDIB 4LSZA 3RT9A 1R3UA 2WHQA 1QIEA 2F1HA 3F47A 3SDSA 1Y1TA 4QGBA 1GYRA 2EG9A 3ZDFA 3GJ8A 2C2YA 1T0UA 4DUGA 4LYFA 4AKHA 3KYCB 2Y1OA 3O8QB 4U9IS 2OZKA 1XZEA 1PFWA 3PNBA 1RJ9B 3N7AA 4EEXA 2VJQA 3VYRB 3TQCA 2PV7A 3L5OA 3FFWA 3F90A 3M1YA 1CE8A 2CNOA 1E2PA 5C7OO 3KEFA 1QB8A 5TGZA 2ZI3A 3OO0A 1KK3A 3Q0TA 5K1ZA 4TS4A 4MVJG 2WSSD 2CHEA 2H2DA 5AI5A 1IHXA 4K9LA 3RHFA 3OZEA 1SCNE 5KHAA 4Q82A 3EXFB 4ON9A 1NVFA 5IEJA 4HUTA 5IULC 4BVGA 1UMCB 4Z1MG 3AUKA 5ESWA 5SYNA 1JZSA 1C8BA 1A95A 4YS6A 5J2TB 2ODPA 2O4UX 1V8BA 1OV9A 3CE9A 4TWBA 2P0YA 1O6FA 4TTAA 4C2BA 1O57A 4I1YA 2SKDA 2J85A 3IKTA 1U04A 3OPYI 2XCIA 3LHIA 4S1TA 4HAZA 5EC8A 2PBZA 3C4VA 1O5IA 1M1YA 3U7HB 4AMGA 4OQ4A 2B25A 2VRBA 4OV6B 2JBAB 1G1MA 1KI7A 1UBTS 3V00A 3VJKA 1SUAA 1PJRA 3RHSA 2O0KA 4LNUB 3S1AA 4HL6A 3BTSA 4JITA 5CNMA 4PSVA 2EKDA 4GGMX 3T3NA 3O38A 3CLKA 1H0SA 2O3TA 2A67A 2AZXA 3KKMA 4KFTA 2NNWB 5CBKA 2VDJA 4DZRA 2QTZA 4R7CA 3K9QO 4GHWA 1FX0B 1GGHA 1EK1A 1JHQA 1L0LH 2W2LD 4MRNA 3O8CA 4IVPA 1X39A 3OTOB 3AC0A 1T6YA 4TLLB 4CMGA 3U11A 4JI5O 4UBIA 2VN8A 3IT1A 3GEBA 4IIJA 1RLUA 3A10A 4TROA 4PA3A 3CRAA 1NXTA 4JODA 1E1CA 1PDWA 1XFDA 1PT5A 3HP4A 3AMVA 4I5GA 4Y2GA 4UMEA 1X3SA 2AHOA 2OFOA 2AKEA 5BMVB 1J7KA 5EJGA 1EJ2A 2F93B 3OC0A 3KZOA 1L1EA 5DWVA 1LY1A 4WEQA 1JDBC 4G4SO 2W6IA 4AMUA 1M9NA 2WIAA 3WAGA 1NQAO 1N2CE 4KO1S 3WQQA 3HKEB 1DEHA 1OFTA 4DSZA 3Q9NA 4PS1A 5CRIA 3SFZA 4W5HA 5J43A 3QI2A 2QRVB 2EJ7A 2V0NA 4MW3A 4JZYA 1NVDA 7ADHA 4AIRA 2J5BA 2AEFA 5JTTA 3G3EA 1YKSA 1L8OA 3LKBA 4MQ4A 2KLBA 4G26A 3UAYA 4GCZA 2X3UA 3TIFA 2X9QA 1KYZA 1Z8NA 2I66A 3QXGA 3BIOA 1IN8A 3CRVA 3FMFA 3D3WA 2FPPA 5AUQA 4LVCA 4YDRA 4JT4A 1T8TA 3IURA 1EQUA 2A33A 2OHIA