4TOIA

Crystal structure of e.coli ribosomal protein s2 in complex with n-terminal domain of s1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
310
structure length
307
Chain Sequence
b'ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESLYFQGESFAQLFEESLKEIETRIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2,Ribosomal protein S1
publication title Structural basis for the interaction of protein S1 with the Escherichia coli ribosome.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
total genus 104
structure length 307
sequence length 310
ec nomenclature
pdb deposition date 2014-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4toiA02
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 4toiA01
4DV1B 4CC6A 3OTOB 4S1WA 5IT9A 5BY2A 5BR8B 5IWAB 4KHPB 1ZZGA 1TAEA 2HHHB 4LFBB 1DQRA 2CXPA 2CXSA 3PR3A 3PN1A 1V9PA 1HR0B 1XNRB 1X92A 1IATA 3TRJA 2CB0A 3JAMA 3BABA 1TK9A 4LF5B 2O2DA 4S12A 4DV4B 4IVNA 1GZVA 3Q88A 4DR2B 4JI7B 2A3NA 3QKIA 5FLXA 4GKJB 3UQ8A 1HM5A 1X9IA 2CXTA 3ETNA 3JX9A 3J80A 2O2CA 1J5XA 4DR1B 3EUAA 2J6HA 3JSNA 2VQEB 1HNWB 1X9HA 1VIVA 4X64B 1C7QA 4K0KB 4YY3B 1TA8A 1XTBA 2UUBB 1N32B 2CXRA 2PUVA 1VI5A 4CC5A 3T1HB 4JI5B 3BAAA 1M3SA 4UCSA 4DUYB 4DV2B 2YVAA 1XNQB 1TZBA 2UUAB 2F4VB 4DV3B 5FPRA 1J5EB 5A2QA 1IBMB 2UUCB 4LF4B 4B3RB 4JI0B 2AMLA 4TOIA 3G68A 4LFCB 2XHZA 3NBUA 1JXAA 3IFSA 3T1YB 4LF7B 1IBKB 1DGSA 1N34B 1HNZB 4UCRA 1XMOB 2UU9B 4LF9B 1VI6A 4U6NA 1U0EA 1VIMA 1MOSA 4LF8B 4JYAB 4B3TB 2V4MA 4EFEA 4DUZB 2OWOA 2DF8A 4UFZA 4X66B 5LL6P 1XMQB 3HBAA 4DV6B 1T10A 2E5FA 2PUTA 3FJ1A 4DR5B 4EEQA 1WIWA 2I22A 3SGIA 1TZCA 2CVPA 4AQYB 4DV5B 1U0FA 3CVJA 1IBLB 2POCA 2ZJ3A 1HNXB 3SHOA 3J7AC 2I2WA 4JI6B 1MOQA 2VQFB 3HJBA 4LH7A 4X65B 4JI3B 2UXCB 2DECA 3BA8A 2WU8A 3C3JA 5I01A 1FJGB 4JV5B 3J81A 4JI2B 2CXUA 2VF5X 2UXBB 2CXOA 3FF1A 1JEOA 2ZJ4A 1Q50A 4LH6A 4UCUA 3M5PA 4EFBA 3LJKA 3UJHA 2CXQA 3KNZA 2E5LB 4NXNB 3Q7IA 4X62B 4EM6A 1NUHA 4UCVA 4DR3B 2PGIA 4YHHB 4DV0B 4M0DA 4LZJA 5FPOA 2ZM6B 1I94B 1B04A 4GLXA 2VF4X 1JLHA 1X94A 1U0GA 3BCHA 4LF6B 3I0ZA 4GKKB 4B3SB 1JIQA 4UCOA 2CXNA 4JI1B 4AMVA 1GZDA 4DR7B 4JI4B 4NXMB 1KOJA 3ODPA 4LFAB 3BA9A 5LMNB 3TBFA 1ZAUA 2Q8NA 3FKJA 4DV7B 3BJZA 4JI8B 1HOXA 2X3YA 1NRIA 3FXAA 4DR6B 4B3MB 2UXDB 1N8TA 3JSLA 1N36B 1MORA 4UCTA 1C7RA 2PUWA 1IRIA 2XBLA 3OOJA 5LMUB 4DR4B 1B0ZA 4OX9B 1G98A 1N33B
chains in the Genus database with same CATH superfamily
3T15A 3FDXA 5CYFA 1N7IA 1YQWA 2I76A 4H15A 5CLQA 3CA8A 1RTTA 3EXEB 3GLIA 3TRHA 2ETVA 3FOWA 4AF8A 4DBLE 1WD5A 3F6PA 1JVMA 1XWFA 3LX8A 4A03A 2QJFA 5A5DA 5HKBA 1WF3A 1VP3A 1IVYA 4UPEA 2X0IA 2OPHA 3IR6A 1YR7A 4AO7A 2IF2A 5TPWA 1U97A 5ALRA 3OP4A 1RAFA 5DPMA 3FBTA 3R3SA 3PD0A 4TKUB 4LH6A 2WY2D 2RHOA 3A31A 3SSNA 4GSYA 2JLXA 5FHRA 5JANA 3A6DA 2NU8A 5KVCA 1U8FO 4ABTA 4B33A 2HQBA 4H7FA 3DOJA 2FRDC 2B6HA 4GUDA 1EM1A 5FV4A 1DTWB 1Z06A 3CPSA 4KQCA 1XQVA 4OK5A 4R7TA 4UMFA 2H2GA 4PYMA 2VLIA 2X86A 3QVWA 1XEQA 4AQDA 5J5CA 1MG0A 3AL3A 2JGKA 2O8FA 3VR3D 1TA0A 5C8YF 2WM2A 1JA9A 1KPHA 1E5XA 5B1IA 1EXNA 4I4IA 5MFPA 2I34A 4BNXA 1ZD9A 2W6PA 3LG2A 5LQDA 3PF8A 4WDRA 1YTLA 4LV8B 2Y1DA 5EERA 1DKNA 1QMPA 4LE1A 4JZYA 4KLRA 4QWWA 2Z83A 4C0BA 3L06A 1Q92A 2R1ZA 1E4VA 1KQGA 1N7HA 5EESA 3I39X 5DEDA 3IT0A 1M2HA 3WP1B 2D5CA 3TOVA 1AV6A 2KX7A 2HHLA 4EFDA 2WWFA 2G7MC 3WADA 5LXTB 1RRPA 2WYVA 4BVLA 4UZFA 3TRDA 4MR9A 4NJEB 2HCFA 3U3ZA 3DOIA 5HZHA 3N2GB 1C8BA 4FVTA 2V5AA 3OQPA 4BQNA 3B1ZA 4QZVA 5C35A 5EIWA 1SVSA 3HO8A 3KSRA 3ANNA 2EJVA 3OZTA 3QLEA 3WLTA 2FMLA 4BYMA 2HB6A 4QQNA 2GVDC 3KB2A 3WNZA 4BLPA 4FGZA 4EB8A 4NU5A 4PYNA 4U2EA 4NFSA 4RVCA 1ECGA 5AT1A 5AP9A 5BQPA 2QN9A 4UU1A 5CGZA 2YN0A 2QI9C 3P0FA 5BYAA 5JSZA 2QY9A 1SPXA 3W7WA 3CUKA 4J7XA 4Q34A 2D1TA 3DOUA 3IAUA 1RYFA 3SC4A 1I01A 1BWRA 2F9LA 2PI4A 2AN5A 2Z9BA 3QOWA 2WYUA 4RVSA 3N2KB 2E9SA 3I1IA 3PFCA 5ALMA 1BOOA 3CZRA 1S5LZ 4LF9O 3VVCA 1N2SA 4WESA 4K3AA 1TVCA 3TOCA 4YLEA 3ZCQA 1AK1A 3S2SA 3D4PA 1O1YA 2ITCC 5FTNA 2VRCD 3OTFA 1J1ZA 5EE3A 3VJRA 4IVNA 1Z7GA 1ULAA 1XTSA 3ZWNA 4WJLA 4EG5A 2UZ3A 2FQXA 1H66A 4ZCMA 4ZK2A 5ADHA 2BGKA 1R3LC 1CDOA 4F9TA 2VWJA 1EN5A 4EGQA 3NPMA 3PQ2A 5KJCA 3LXXA 4X65O 1RC8A 3H9GA 3H4VA 5C0OE 3NEAA 3C1AA 2YFKA 5DTJA 3NBFA 1M1YB 1XMVA 5BUSA 1L7EA 1FTSA 5AK6A 1GYRA 2RI6A 1WEKA 2PLRA 4IUDS 2UZIR 3LQ4A 4D4HA 5IAOA 1KO7A 4HEHA 4YCDA 4X6YA 1G4HA 5JRJA 2P3SA 1XZPA 1Q7YW 4CCAA 2I91A 2OL4A 3K6SA 3P96A 1P44A 1KK3A 5K45A 2FP4A 1TOAA 4TV8A 2WWHA 2I1QA 3DPSA 3F74A 1I7PA 4ZBMA 3RE1A 2LGJA 2PT6A 3BN3A 1SA0A 2CFOA 2P4EA 3C6XA 3KTFA 1ECJA 2C7PA 1JFFB 4UXNA 3N59A 2LO1A 3D31A 4DC0A 5L3DA 3LVBA 1M1NA 4XGIA 4RKEA 2M6RA 5EE9A 2ZRMA 1DMSA 4A1FA 2CNBA 1KI8A 1GY8A 1K0FA 4MPPA 3BK1A 1Y9ZA 3HHEA 3BIOA 4OQQA 1YL5A 1F60A 3ABMB 1P2GA 3F3YA 4FIPC 2VNHA 2IH2A 2B2CA 2HBRA 1GQOA 3GUUA 2Z9CA 2C94A 2IY9A 1SGWA 3VVLA 2ETNA 5KAFZ 1NYLA 3DNMA 2K5UA 3U7QA 1H0KA 4LHSA 3PUYA 2RGRA 1I0HA 2EZ4A 4H3SA 4XQGA 3RYFB 3HNPA 2HCJB 2GPSA 1EAMA 1DLIA 2KSQA 2V7VA 3HUFA 4TMWA 4V0RA 4Q93A 4BCCA 3UBMA 2I8AA 1L3BA 1TPZA 2A2ZA 3E4CA 4H16A 4D43A 4UMDA 3B7GA 4M36A 2DWDC 2IDZA 3OSUA 3ZX4A 5IC4A 3AW8A 1F8XA 4PHHA 5DP2A 1YU6A 5H9VA 1H5NA 4X93A 1CUDA 2WFZA 3IXLA 3RYTC 1JLLB 3GPDG 2G1UA 3SEFA 3I1YA 1U6KA 5KOHB 3TZLA 2CZGA 1UJMA 5LIRA 5KYUA 1OZFA 4MUIA 3TXQA 4AO8A 3LCRA 5KYYA 2VDLB 1KOJA 3IIIA 3LS2A 2MK3A 2OIGA 3VDNB 1GSAA 5KTTA 3M3PA 3E9NA 3EUEA 4UUMA 4FW8A 1IXRC 3EVDA 1DKPA 1NI4B 3VM6A 4E70A 4LSGA 5DP1A 3QKIA 5ETJA 1F2UB 3RRXA 1S0UA 4V1CI 2HWXA 5DH9A 1QTQA 4Y6PA 3DBHA 4OV6B 3DD5A 1FYXA 4NZ9A 4KQGA 1EIWA 4JJZA 3EOAI 1ZBQA 2OSBA 2HBQA 5JTUA 2BGJA 2RH8A 3ZEDA 4F8EA 4TZ6A 5CT9A 1O9GA 4G25A 1YJ8A 3EC2A 4NJMA 1KI1A 4TROA 3HP7A 3CRZA 4JGSA 1XEWY 4LYGA 4CH3A 1FIUA 1CEYA 4F1KA 2C7RA 1KY4A 4KE6A 1GLVA 3U7JA 1IHYA 3DYIA 4DUYO 4G23A 2Q9LA 4R1TA 4AUNA 1STOA 2YWHA 3W1WA 3I6ZA 5EE0A 4KWTA 2FP3A 3HN2A 2OV3A 4JLMA 2CE4A 4NTYA 5B3LA 3VNBA 1WUKS 3QJYA 3KEQA 3I2FA 5DX8A 2ZBGA 4YUAA 3I04A 1NOIA 1ZN9A 3EVKA 1KQNA 1X1CA 4IJQA 3C24A 1N34B 3HB4X 3KKKA 1C9DB 2EBFX 5B4TA 3ZE7A 4DHWA 2DM6A 2EZPA 4P93A 5A7HA 3S8YA 1AUXA 3EW7A 2GJ9A 1PG2A 2DBZA 3CCQV 3GLGA 4JT9A 3W7AA 2VHWA 4ZAWA 5AVJA 3W6UA 2ZAGA 4MUKA 2Y4UA 1R4MB 3TLJA 4FMPA 1U7OA 1K5PA 2P35A 4U2KA 1TAGA 1R0YA 4R8CA 2UUCO 4I5FA 4YPOA 1G4AE 5ICCA 3E18A 2ZIXB 5F52A 3DB1A 3S3TA 4GBMA 4UB8Z 2ZIFA 4IIJF 3CUEF 4X8MA 2PZKA 5BY2A 3KT3A 2I87A 2XNDG 4I1YA 1E3EA 4K9DA 1OT5A 4W5QA 3MHHC 3JSNA 1M2FA 2PSHA 1M8JA 1G38A 4I55F 1N6OA 2FP4B 1JYSA 3RAPR 3UOWA 2KQUA 2HT1A 1Y6FA 3Q3EA 1A0OA 3GLTA 2VJYA 1SA0B 3GY0A 4LDJA 4OGFA 3PCXA 4K3UA 4YRJA 1E6CA 1N2OA 4O1IA 1C8LA 4NNOA 3OTHA 1T24A 2C61A 2IYNA 3PGVA 4RETA 3RBXA 3DBRA 4Q39A 4URHA 3A6PC 1M1NB 2JHAA 4AURA 3RF7A 4OI2A 1W88A 4A23A 2WNIA 3ETDA 3UWMA 4HT3B 5EHIA 1CUUA 1E6KA 1E0SA 3AM1A 2EFEB 3AG2B 5BV8A 2XOXA 5HRCA 4B31A 4J1QA 4BGVA 4NBRA 5EBWC 1VLZA 5DI3B 2EZUA 5DYNA 4HCJA 3J81k 1DXHA 2YFHA 1Z6TA 1TM2A 1A4XA 4DQLA 3WSWA 2R1VB 1VTKA 3FCEA 4MX8A 3SVTA 5DF1A 1QH9A 2JA1A 2R6CA 2XOKA 4ZD6A 1XVTA 4ESEA 4A0RA 5FF9A 2VK4A 1UR5A 1ZLXA 2IBMA 2VJNA 4HNGA 2EWWA 1IB0A 3Q40A 4TRNA 3RBVA 1T2AA 1NR1A 2C2AA 2R48A 1SUDA 3OOWA 4FFSA 3CSUA 1EFPB 1S2IA 2QRZA 2HA5A 3GH3A 5DM1A 2CVZA 2HJVA 3R9WA 1XFDA 2WPDA 4AM8A 2O1SA 2YZMA 3RYIB 1M34E 4YCLA 3K4PA 4Z7NB 2HMVA 2WABA 2AFRA 4YTEA 1RQRA 1KIMA 1IOLA 4AL4A 5ITZA 5HTOA 4J9ZB 5ICFA 1MO5A 5E7MA 4RCZA 3IL2A 1H2LA 3KPUA 4LZPA 3K9WA 4CGZA 1QHYA 1Y1RA 2XQJA 3WK4A 3B85A 3NGMA 4YJ3A 4EK9A 1TZCA 4BZPA 3K2IA 1X3LA 2WUVA 4ZYWA 4JV5B 3HCNA 2NZWA 1OKKD 5I6DA 2ESRA 5C4GB 1SCIA 1JP7A 4MRNA 2Z09A 1W75A 3Q3JB 4EYSA 4ZHQF 1M10A 4YJFA 5F9FA 3QWHA 1KTIA 5E6UA 4DN6A 1T15A 4COKA 3Q8WA 1JG6A 1G19A 1N2XA 3PX7A 2D4AA 4OI1A 3R5SA 3HDVA 1TZKA 3E2EA 2PX0A 3E7FA 3KSAC 1DWQA 3MBOA 5B1BC 3X1JA 2Z1DA 1QH8B 4PZ9A 5P21A 3K32A 4JGBA 1FFGA 3IQFA 2DY1A 5A3SA 1IHOA 4U9UA 4EPTA 2ZYWX 5IVKA 3U62A 3ZH9B 1ZD3A 4EHAA 3A27A 3VH3A 2D1YA 3QVUA 3W2GA 2GM3A 4MS3A 3FCSB 2I03A 4BVHA 3TCKA 2PKEA 1ZL0A 5IDJA 2MWMA 1S02A 3E3AA 1VRWA 4WZZA 3X3HA 1MOQA 4ZWNA 1MD9A 5J5VA 3L8DA 4E6EA 2JZOA 4JLVA 1G8SA 5DHFA 3X2QC 1SC1A 1D07A 1DEAA 5EZYB 1BS9A 2DFPA 4GMGA 1O0BA 2WZQA 2V9ZA 4CWAA 1M2OB 4JI8B 1T1SA 5TMDA 1I14A 2P9YA 1U4OA 4MDEA 1PZMA 5EXTA 1XDSA 2BKEA 1MLDA 2OHGA 4XIYA 1KP3A 1TAEA 4C2AA 2QWQB 4TMFA 4YDHB 2P9HA 1JLKA 1GXSB 3JYHA 3RT1A 3WMRA 4BBPA 3GLGB 1P1BA 1EUCA 1A8HA 2V6JA 2A9QA 2CE2X 4NU6A 1ZM3A 1MZVA 3CXHF 1WB4A 1PEAA 1YHNA 4C08A 3EIQA 4QFDA 2PBLA 4BVGA 5DYTA 4EW1A 3U1VA 2RI1A 2Q0AA 1EINA 3VNQA 5KQSA 4UCQA 4K40A 4DQVA 4P3NA 3PTLA 2Q6AA 3WK6A 4H3VA 4HS9A 2JGUA 3MF4A 2OV2A 3RVLA 4BKMA 4QFMA 5I7VA 5KNBD 1RZVA 1LI5A 1U2TA 1HDEA 3TQHA 4U7TB 4IINA 1M8FA 1U0GA 4HDNA 3I61A 2O06A 4LI0A 1WJZA 1XDGA 1G2PA 1XI1A 1N2HA 3GFRA 3DAPA 3U44A 4Z9YA 2IPOA 4EF6A 3WYDA 4BEWA 2ZIEA 1UMDA 3CCFA 3KKPA 1ECPA 2D5BA 7ABPA 1P4AA 1AKMA 3Q4HA 1UBUS 1W0JA 3WGHA 4HDRB 3E89A 1GGJA 5ISMA 3JARA 3MELA 4LN1A 1LSSA 2W0MA 2WJZB 5FLYA 4EOGA 1W93A 2JLZA 3S2UA 4YHHO 1QZXA 1VZ3A 3DBRB 4V2IA 3UAOA 4LXYA 5JSKA 4HYQA 4GFDA 3FTNA 4X8AA 2CLSA 4X7BA 1MGOA 1ZM2A 4RTLA 2EQAA 1RP1A 3S2YA 2CLCX 1UPBA 1P9RA 2M6SA 3AF1A 3DWGA 3FPFA 3SZGA 3SVLA 4QLAA 5CEEA 1RAEA 1ZRHA 4NDZA 2C9OA 1QHHB 4II7A 3NBZC 3NASA 5EYPB 2R60A 4TMVA 1ODTC 3H05A 4V0KA 4FONA 1R37A 4KO3S 4OXRA 4GLBA 4ZCTA 2GPTA 4ZYUA 3C7AA 3VISA 2RC6A 3V46A 3NUGA 3MTQA 2J5XA 2X6TA 2FSUA 3EFBA 3S28A 4XSHA 1TGOA 3QX3A 2ZJZA 1UK7A 5KHJA 1NI8A 3NNNA 1SCBA 1SKMA 4HL6A 5K51A 1M2JA 2YJ6A 2RC5A 4D82A 3AH8A 3FW1A 1GCIA 3LU1A 3E05A 3L77A 2ZJ3A 5JJIA 1GEGA 1NVVR 4JUFA 1NG9A 3T5CA 3K0CC 4IIVA 1U9JA 2RGDA 3R8FA 2ZS8A 1BCCH 1PL4A 1WXFA 1H2XA 2H0RA 3GOHA 1R9GA 4I4LA 2VAPA 2GVZC 3JQFA 5ALPA 3B1JA 1VB5A 2PKCA 2JFGA 4CTNA 5K3AA 5EE5B 3FZEA 2D8MA 1W2HA 4ER0A 5HF9A 2ILMA 3IHKA 2IYRA 1TAHA 3LCMA 3EQ6A 1FVHA 3GCGA 1SY7A 1G7SA 3O3NB 4QHTA 4ENUA 1E9EA 2LWIA 3A1TA 4MQEB 1JSXA 2H1CA 4GD3Q 4O25A 3HEAA 3TK1A 1UFOA 4BY9E 5F1KA 1BEUB 1O96A 3AKDA 4GQBA 2MSCB 3OQVA 3GGDA 2MR5A 4HVAA 3WSTA 4HDSB 4MDHA 5LU9A 4Z8YA 3MT0A 1H9AA 3OE4A 4D0SA 1U7TA 5DO9A 1ICIA 5M2QA 2VNJA 1QFMA 4U7DA 1NNEA 4FYJA 1RWQA 3H8WA 4JAVC 3CX5F 5G1NA 1UZAA 2VF5X 3OLQA 3OKCA 4JKOA 1NNUA 3F49S 5EUMA 1R64A 3CIFA 1BU8A 2QQGA 4ISCA 1DRJA 2F62A 4TWIA 1ZSYA 1TT7A 1WZCA 4MS3B 2XNDD 4LS3A 4G1VA 1Q6YA 2XYRA 4PYLA 5JG7A 3LUJA 4C4YA 3WWZA 2A0XA 4LHYA 2II6A 2QM0A 5A4FS 4I99A 2V8OA 1IN7A 1ZGHA 2Q49A 1UEXC 3QWIA 3DCNA 1AZSC 4G0OA 1EUYA 1H23A 4F9FA 2BZ0A 5IVDA 4R7GA 1CS0A 1C2TA 2JEZA 1O94C 3IEXA 2CL6X 3STYA 4D6XA 5TC4A 1A69A 2WNHA 1VQPV 4G0PA 1MO6A 2GEJA 2JIQA 1YA6A 2G28A 1FU8A 3K04A 3PYMA 4XARA 1L5GB 2YZ7A 2GLXA 1QG0A 2NP7A 5IM5A 1EQAA 4E08A 1A8SA 1A5SB 4I1PA 2AG5A 3MGAA 2XBMA 2ADQB 2I62A 4GMKA 4W9RA 2VPYA 4R69A 5K8CA 1APBA 1OZGA 3B70A 1I3MA 1E2KA 4JJ4A 1CVLA 4W7HA 1HFWA 2Z08A 2XOEA 4C6TB 3DVQX 4CLOA 4YRLA 5F77A 2ZVDA 4RELA 2X4GA 1A77A 4CL3A 4NBSA 2QS9A 3I92A 1VMKA 2ACWA 3E9DA 4IEEA 4ZANA 1OU0A 3OE5A 3CF0A 2XWBF 4BVEA 1H2MA 5T4FA 4ANFA 1FTGA 3VDRA 1QF7A 1GQSA 1SERA 1VIVA 1W5EA 3VHLB 1NW6A 2BE3A 3UZUA 1EJ0A 2FPIA 1GUDA 2O2SA 1US8A 2GASA 4OXIA 3I58A 5DNYB 3GZJA 5KQGA 4UVIA 3H2GA 5DBIA 1NSTA 3CNQS 4O8ZA 3VO9A 2WF8A 4IJWA 2WAAA 1JR6A 1E3SA 3C3JA 5GOTA 3WKDA 2ZT6A 3EA5A 2R00A 3VU9B 3BMQB 1VBMA 3KPJA 4BCDA 1RDFA 2JIBA 1Q50A 1S3GA 4UBLA 3D0OA 1KQ3A 1MJGM 3NHRA 2ZWPA 4D4LA 4MEBA 4MAMA 3WFVA 2EGGA 2D54A 3LP8A 3JQ6A 5A05A 3MTBA 1DQSA 4WVFA 4INJA 2VCYA 3FXAA 4PYKA 3AKCA 2OCBA 2L82A 1E3LA 1KZ4A 4Q47A 4NX2A 4MUJA 1KMHA 4B71A 2QZSA 3V4RA 3PC4A 2XTAA 2JFYA 4NOLA 2Z3WA 3IESA 3HLKA 3ETNA 2QPLA 1IYZA 1WBBA 1D5AA 2AN9A 2V1DA 4GMXA 4MDFA 3OQJA 5IM4A 2VAMA 5ALYA 3SQOA 2PV7A 3A11A 2YNMA 3NRBA 4XSVA 1Z0KA 3K94A 4C78A 4BAYA 5KCZA 2H92A 1NMZA 5A6SA 3IQWA 1SU8A 1C29B 4N7BA 1EFHA 3WTCA 5K0SA 5FPQA 1AO0A 2VHEA 4DLKA 5CXQA 3ML0A 2VQ3A 2BKLA 2W2KB 2VWGA 3G79A 4PANA 2RIRA 2AWOA 3H2YA 1GH6A 4BO6A 2UZAA 4DUZO 1IBRA 1XMQO 2DERA 1XRLA 5E1OA 2BCEA 4UM8B 3UPDA 4ESOA 1Q8IA 1GN3A 3R24A 1ZH6A 1P9WA 1YB2A 1SVIA 5JDCA 3H6HA 4FBLA 4PAOA 1JBKA 1V9CA 2ILVA 2CLOB 4A6XA 4F3CA 1P5ZB 2NQTA 1EM8A 1EPUA 3CH7A 3L8EA 4MA0A 2FMUA 4J7JA 4PPYA 1BW9B 1P0CA 4HGRA 1I5EA 3URKA 3N28A 5F33A 3E6AA 2YX1A 3JQ8B 3IUJA 2IJGX 4I8XA 4RF5A 5BRNA 1FPOA 3M6WA 2ONJA 2PYIA 4NMWA 2QNRA 4XUCA 1JMYA 1JIJA 3V42A 5HS6A 4WCEV 1O96B 2Q7GA 5TV2A 4B73A 1RKUA 4MPTA 5JISA 1CF9A 1KRWA 2GUGA 1B1CA 1D0VA 3GEDA 4YV0A 1HURA 3HM2A 4PPNA 3A37A 5IZ4A 1HR0B 3T4XA 1RM3A 1CY8A 4YCCA 2G3YA 2HD4A 3N3BC 2B4KA 4Y6GB 1XELA 3PQEA 5CLHA 1PP4A 3B8HA 3CLKA 2RAFA 2YJZA 2PQ2A 1X8KA 5AK5A 4Q9HA 2QWOB 5CM8B 1LC3A 4TL9A 2GJSA 4JV5O 5LHIA 2Y4NA 1SHKA 3ZEAA 2OBNA 3TG2A 3FWKA 2AI3A 3VAAA 4KU4A 2PMKA 4BJ5A 3E2IA 3PD7A 2XEXA 2Q21A 721PA 4DL9A 3C1TA 2VG8A 3RJ5A 3VR4D 3I42A 5IKOA 1ZGGA 5ANRB 1RIIA 4DRYA 1X7ZB 4EF5A 1F0KA 3EXFA 2ZNIA 4WV3A 4D81A 2P79A 2JCBA 3RWRD 3FNGA 5HF6A 1L5NA 5ALTA 1EESA 1IZ8A 2JIOA 3TYXA 3TTSA 4NY1A 3BXXA 3DF7A 2ODNA 4PAWA 5K8JB 1N36B 3GCWA 3Q87B 4ZCRA 1LH0A 3JQBC 4IOLA 3I2HA 1YAJA 3VR2A 2A4KA 1RRMA 1I4OA 1VLMA 3QEJA 3I6BA 5BPFA 1SBYA 4QDTA 4UJ5A 3T5MA 4V1CA 1IIBA 3ABMC 2FW1A 4EG7A 4CQLB 2BFNA 5JNSA 4LVNA 4TMYA 3ZY4A 4BFLA 3VU3A 2IUTA 3UB2A 2ZE6A 2QRQA 3GFFA 4EZEA 4GE3A 3TVDA 1MKYA 4AICA 4C29A 3K0AA 4UFPA 1E1CA 2Q0XA 2VJKA 2BL4A 4R2XA 5FL7G 1PV0A 4FLUA 4FCCA 4LY6A 3TCNA 4IDCA 2ZSHA 1O3YA 2R47A 2FRXA 2VS0A 3EDCA 5KQMA 1G8KA 3N8NA 5EFZA 5AI0A 5HFMA 3DE4X 3T5TA 1XZIA 4HGZA 4MKZA 1XMSA 5KTPA 3I8XA 5JYDA 2GX6A 2BRUC 1V5GA 4N65A 5EZ5A 1AUOA 3RS8A 3GWOA 1L6IA 3Q88A 4A16A 3L72H 1JH9A 4RXUA 4JENA 4GR9A 4RESA 1U7PA 3AKEA 5T7BA 1RAAA 1X39A 3K5WA 1U8XX 1PX2A 4RF4A 5GZ1A 1US6A 5KUKA 1X0XA 3L1HA 2X5XA 3DDHA 4YAGA 3NHMA 2IRWA 3R41A 4BN4A 5AI5A 3DV0A 4CTOA 3P5BA 4AX4A 2DCUA 2W6QA 4TWZA 4B2LA 3X2EA 3LE8A 2H57A 1MC5A 1U3DA 3BE4A 3T7CA 1NWHA 2JLBA 5IKXA 4J16C 1P0QA 3COVA 3STHA 2D5LA 5EXSA 4EX7A 3FFXA 2RGGA 4MWDA 4FNMA 1JVSA 1OYYA 3KZKA 1PS0A 2LBPA 2H1OA 4OHVA 3IAHA 1LU9A 1GNSA 1NASA 2ZOSA 2C1XA 2EATA 4N49A 5JSYA 1J0BA 5AWFC 1N7GA 1JLRA 1MGPA 2WJ4A 2GNOA 4ZVUA 4B6PA 4A3SA 3UFBA 5A6SB 1YFJA 1QJCA 3ZGXA 2WU1A 1SM4A 1EK2A 3NWEA 4M8KA 2ODQA 1XK7A 2AJBA 2RGNC 3A2KA 1OYVA 2XGGA 3O6VA 2GXSA 4ROTA 4DG8A 4RIGA 1G63A 2NSLA 2BEKA 4B4UA 1J2UA 2EF1A 4QVKA 3H2SA 3LUBA 2H7VA 3L4BC 1NF8A 1GV0A 3FBGA 3HRHA 1A72A 3PFBA 3WOHA 4YA6A 2H4XA 2OESA 2G1AA 1KZYC 2W83A 4FW9A 3EE6A 1TXGA 4KQ1A 2ISQA 1NUHA 3KKLA 4C7OA 1RFYA 4K1XA 1H69A 4BXOB 2Z5VA 4B79A 3VYUB 5FDFA 3DOHA 2P0AA 1U3GA 2D2VA 1C4WA 4G0UA 2O4CA 3FYTA 2XD4A 4BFYA 2BFBA 1NNSA 2C9CA 3MLEA 3BQMB 4YXFA 3G0IA 4C07A 1XHFA 4MJ3A 3JXEA 4IIHA 1XTVA 3CEPB 4KYTA 3M6XA 3TF5A 3V9AA 2X7HA 4ZFNA 1MOSA 4ZJZA 2R9AA 2C88A 3DT6A 2WFMA 4KQEA 3VU1A 3ACDA 4CG0A 4Z4HA 2JF0A 4BP8A 3FETA 4FFVA 3FFBA 4FFWA 1A27A 4JASB 5FOWA 3T1NA 3ROXA 2QRJA 1OFTA 2I1LA 1G5PA 1EZZA 5IK2A 3G5AA 4UHFA 2OGZA 4NMXB 3ONDA 4Y3UA 3L7BA 4V3CA 2XH8A 5B6PA 1B8PA 4U2BA 1S6YA 2P1RA 3C2QA 3RS4A 5GINE 4H35A 3EASA 1PZHA 3RVQA 2XTNA 4CHGA 3QPDA 2HJRA 2P9FA 2GMWA 4TWBA 5DHAA 3CEIA 4PC3A 4XTRA 2IHUA 1VI5A 2E37A 4KO8A 3DE2X 1GCGA 2WUGA 1VSVA 2ZYRA 1X1DA 3KUKA 4YJGA 3WYNA 2X0FA 3F4BA 4M86A 3UJDA 3QYAA 2BHSA 4U6NA 3I4CA 4CN9A 4RKYA 5E7QA 1RI3A 4I9GA 4ITRC 1L5HA 4NYMR 3ZXYA 5DDIP 4AQYB 1FQJA 3O3OB 2R9RB 1UMKA 1V26A 4PX3A 5AOVA 3T3OA 5CEFA 3AG3B 1XEWX 3AG2C 4RD6A 3W2FA 1ATZA 2FUEA 1PRYA 3Q0TA 1S8OA 3ZU4A 4DR7B 4F84A 4NONA 5H59A 3JSLA 1AQJA 3WJAA 2R6FA 3QIAA 1GKFA 3FB4A 1V9LA 5JH7A 5EWLA 2OT5A 1Y42X 1SF9A 1XI2A 5D3MA 4D80A 3W5IA 5B3JC 3AX6A 3LNTA 4RVHA 4BC0A 2FB9A 3SK0A 3TAXA 1TL7C 1T9DA 2WVGA 5FPRA 3SF8A 1EX1A 1R50A 4Q9DA 2EQ5A 4NBTA 4YIOA 2AT1A 2RHTA 1N2GA 1P7ZA 3EF0A 3E3OA 1JDTA 3NP9A 5DN6A 4DR6O 3KOOA 2J9GA 3FY4A 4OGWA 4NI5A 1UXKA 4AC9A 4Q4DA 4CKWB 4OF4A 4OJYA 1CY1A 2F3TA 3F5MA 4RZSA 5DM70 3D3JA 1ANKA 1QDEA 1CXZB 4U0JA 5DNVA 2NZXA 3LGAA 4S1PA 1XKQA 1FDSA 4TUYA 3FTDA 3ZS8A 4AS2A 1LK5A 5NLLA 4AKHA 3R0VA 1BXGA 3JR3A 1QONA 4O33A 5BSGA 5IXYA 2X6AA 3Q6IA 1HUQA 1VC2A 3LMKA 2IBZH 3MPUA 3WGKA 1QOZA 5C1OA 2JHFA 4DXDA 3RAJA 4MIKA 4ZV9A 1WUJS 3R5JA 1QLJA 4MAFA 2B7LA 3OX4A 4KPUB 3A7EA 2V0GA 2FRVA 3EVTA 1KRHA 2GCIA 1NRWA 2Q50A 3WFIA 2QSYA 2WSYB 1L7AA 5C1BA 1J2RA 2DYKA 4QOEA 5E38A 4IXTA 1E8NA 4ZAYA 2RCNA 1ZY2A 3DTVD 2NLOA 4C4PA 1QTRA 4NEGA 2QRKA 1Z9BA 4I66A 4MOWA 3T7SA 1IY9A 1GU0A 1M7BA 3GUCA 1EK5A 1U90A 3C3BA 1II9A 2WLNA 1GG5A 2QYSA 1FTYA 5E9JA 3WLMA 3GA0A 2BGGA 3TLGB 2PX2A 3FYUC 4LWSA 2R1UA 5BNIA 4A5OA 2GD6A 4IX1A 1VQ5V 1U2GC 2Q8QA 1G5IA 3TR0A 2PFKA 4QD3A 1TZJA 5H82A 2PMDA 1SNYA 3VDQA 4C7OB 2IKSA 3FTCA 4B8YA 2FG5A 3SF0A 2EJTA 4YASA 3AHFA 1FQKA 1ZH0A 3ID6C 2BEJA 2Z0MA 4CNBA 4WZBB 1RD4A 3SSAA 3W6NA 3OPVA 3WB1A 1H2ZA 1KL7A 1XIVA 3RSQA 4CLRA 1L9KA 3MOIA 1JMVA 2CLIB 2PXAA 1KHHA 5KAMA 2P22C 3IFXA 1T2NA 1OCRC 3VNAA 1PKEA 5K4GA 5EMJA 4YLGA 3KKEA 1SQBH 5CNMA 3HWWA 4YRQA 5GTIZ 3WG9A 3ITKA 3UGTA 3K8YA 4MRAA 4WFBV 1SXJA 4JXKA 3JD1A 2CE7A 4XLTA 2JHPA 1NBOA 3RUAA 1BS3A 1Y7IA 4E30A 3GLRA 2OBFA 4EKEA 4G85A 1ELOA 2Q1WA 3CT4A 3C7KA 1W5AA 4LZZA 5ITVA 3WKAA 2CBXA 3BILA 3V7NA 4GKJB 2RDCA 4CS3A 1YBHA 3E8BA 5HQ3A 4PD4F 5AG2A 5FB3A 4BAZA 4XVQA 1XEXA 3K1YA 1E0DA 3JQGA 4LSWA 5LFAA 4YRDA 3H1BA 3BIWA 2JH8A 5ELXA 5FL7D 2GAOA 2P2GA 4KR2A 4R83A 1EZ4A 1WIWA 1GM5A 3SZ3A 1XJCA 3LX4A 3CKKA 5T64A 4LV6A 2QXTA 1D4FA 4NENB 5SYNA 1I6WA 1MR3F 4KIUA 3RTAA 3WNBA 1QVRA 2BJHA 1UANA 2IXEA 2XA9A 5LD2B 1DJLA 4BNIA 4Q3DA 1WXIA 1GM9A 3STWA 4GOOD 3MD9A 4GZ6A 4YJGB 3PZBA 1DC8A 4LJ5A 3FFTA 1YR3A 3OA0A 1O6CA 3FNQA 1H2GA 2Y92A 1E79G 3CZQA 2R2GA 3MBKA 2IIQA 1RBMA 3K1TA 5H4HA 3FG9A 2Y69B 1AKEA 3DS8A 3ROKA 1A5ZA 1C0KA 3F96A 2W8ZA 1FDVA 3D64A 3HYRA 1Z45A 4HAVA 5EC1C 4QTXA 1KYYA 1ZJJA 4MLCA 1NUSA 4GAEA 4RPJA 2OFPA 4XDHA 1PN3A 1TCUA 1FD9A 2P40A 5KSPA 1J00A 5ARDA 2YOGA 3A4IA 2ZSBA 1T6XA 2FGJA 4LMBA 1R0RE 1FC0A 5JH7B 1C1XA 3SPHA 5G0TA 3HN7A 2FSIA 2WLJA 2NPFA 1HL7A 1WVGA 4OQLA 4DR2O 3EVZA 2FPXA 4AN0A 1UPAA 1BX3A 4D41A 2VCHA 4QGBA 2UV8A 1T2DA 3GT4A 4D02A 4DRXB 2XA1A 2PH1A 4UKDA 4MKFA 2LUOA 5IAJA 2GZSA 3FPBA 1MVNA 1VL1A 4I2VA 3AFNA 3RSFA 3VPHA 4OH1A 1LVUA 2O2YA 3OPYA 2GD2A 2Q3LA 1TVMA 1WCWA 1N0HA 3AK2A 2AE2A 4AVYA 2W00A 4L0MA 1K63A 3F7NA 3SYOA 1VHTA 3PFHA 2ONKA 1BXGB 4OQ4A 1BXRA 4BB6A 4LF7B 2MOKA 5F78A 2FTKE 3GLIB 1XJ5A 2JH9A 2COKA 4P4NA 1SWVA 2EFHB 1MN6A 3AM5A 1P0PA 1QNLA 2C3MA 1GNRA 1JXQA 3CCSV 3UB3A 1ZHFA 5H5NA 1E9BA 1MHTA 2VBFA 3JSXA 2VH1A 5A4AA 2C59A 2C9BA 4EYEA 4CMAA 5A06A 1PVOA 4WFIA 5TPWB 5T57A 3MAGA 4J03A 4PSKA 5LWQA 3B1VA 2QU7A 4NZZA 3A3PA 1F20A 2Y9PB 2NU8B 1HY3A 3IAAA 4J0KA 3T52A 3ICPA 3P26A 1G20A 4AF6A 2GAJA 3BB1A 4QEDA 2CFCA 1E9RA 1Z62A 4FZJA 2Y1EA 4QYWA 3U37A 4V0SA 1Z88A 4OP3A 3RC3A 3TCXB 2BBTA 4FFMA 1L9XA 2VPWA 4N7RA 1EP9A 5FR1A 4YV7A 3A6EA 2O8FB 2JIZG 2BEWA 4NECA 1Q86W 3V1MA 4FSHA 1AUPA 1J9GA 1CC1S 1P17A 3NZEA 3EMKA 2R7MA 1XN1A 1ZHHA 4K81B 5J4HA 2F23A 4IS2A 1HLDA 3SYCA 2M1ZA 4KQKA 1RHKA 1XNGA 3WFJA 2UZ1A 1XDWA 4W8HA 5G2OA 3TEMA 1DV1A 1V2HE 5E8JA 2XWPA 4QPZA 3R7NA 2P2ZA 3RASA 5BQFA 4MVJA 4H17A 5DHUA 1RI4A 2M9MA 3AK3A 1ZLZA 3OMXA 4XX1A 1JEDA 4WASA 5CFOA 4HWKA 3EPJA 4WEOA 4HBNA 3GJ4A 3ZJ5A 2V6MA 2JAHA 3ZI0A 3MWJA 1PFWA 5FWNA 2ZI5A 4Q1BA 4N5NA 3L82B 3GJSA 3DDNA 1GARA 4MR9B 2VDOB 4IMIB 2UUAB 3DKVA 5EIHA 2UU9B 4Q15A 2Q9BA 3DQZA 2YIBA 2WJ6A 1A9QA 3VHQA 4KXXA 1JEAA 2BCJQ 1XLTC 4WEQA 4UHCA 5BSTA 3GVMA 1XALA 2FPRA 3UMSA 3ZBHA 5IHXA 4B7XA 3KV3O 2QI9F 2XADA 4UBOA 4QICA 2BHRA 3KM0A 3HKDA 3L7KA 1ESDA 1YHQV 4FNAA 2FHSA 4RIFA 2HF2A 4J10A 2F3UA 4FZRA 2Z56A 3JQGB 3AQ4A 3FH0A 2PRJA 5JSZB 3STVA 2OMEA 3UJ3X 2W2LD 4K88A 2QNBA 1A98A 4ZT3A 2OFXA 4X95A 4AX8A 2IZ6A 4H31A 5H1YA 2E3CA 2WKQA 4A0QA 1UXIA 3KQYA 4WESB 2VJMA 2WT9A 2CTPA 4PNPA 2QRPA 1F5NA 1FXHA 2QN6A 2H08A 3CF4A 4WJZA 3OAAG 2VYND 1Z6YA 2FXVA 4LFAO 4X45A 3VSCA 2ZCEA 1X1QA 3KQSA 3SX4A 3Q7PA 4URYR 2QTBA 4FFKA 5BV2P 4BFZA 3H1HH 1AHPA 4GPZA 3OSZA 4GI1A 1LBHA 1CP3A 3ODGA 1D2DA 4H4CA 4R3WA 5ERGB 1V5IA 5FPTA 1P4RA 2A9FA 3LIPA 2J0QA 2MSWA 3GT0A 4AKTA 3HACA 1I3OA 4AIRA 3L71H 1E3TA 4TYMA 3M5WA 3RTCA 3K6SB 3PC8A 3I9OA 2QMEA 4Z3OA 1XPJA 1J8QA 4FJ2A 4TV8B 2P7IA 3EJ6A 1W73A 2Y9MB 1DADA 4AW9A 1LDBA 2NYUA 2KE5A 2A0YA 4R16A 2QB5A 1RQGA 2GZHA 2W8BA 4PQYA 2HLDG 3SOZA 1J70A 1YUBA 1O5OA 3BMXA 4RTJA 5DCWA 1RWPA 2BMDA 1UBNA 3CYFA 5BQOA 4BW9A 3DEJA 3N2ZB 1T3HA 5DCLA 1LK7A 4DR7O 3M5PA 1QU7A 4R9SA 4D96A 1V8OA 4CLDA 1M5RA 1NTRA 1EI9A 2EWMA 1H2AS 3WU2Z 5MF6A 1A2QA 3E9RA 5E9AA 4XGQA 1IUPA 3ZCPA 1PJ8A 4E1AA 5LM3A 2IT1A 2YHIA 2IXFA 1JR9A 2RIPA 1H6BA 1AUQA 3VI4B 4KKVA 1JZTA 4IL6Z 2KM1A 3A2FA 1U2DA 1M2KA 1XHEA 3RGBA 4F4FA 1KFBB 1M0WA 1BFDA 3UHAA 3U7QB 1PL7A 3T1HB 1Y8RA 4G36A 4MS4A 3UKOA 3CVWA 1PJZA 4I2NA 1J07A 2N47A 4B4VA 1J24A 2MSDB 3HVUA 3RVOA 1UT5A 2EEPA 2ZG6A 1Q0HA 4I9UA 2BFCA 5IBPA 1TEVA 4XDGA 2ZDIC 2Z0AA 1QYVA 4QNMA 2HEPA 3E0XA 2W98A 2ZR9A 5AVQA 5AVYA 2JFXA 3G2PA 3LGSA 5DV9A 3O3CA 2QA5A 4LYYA 4P7BA 4W5NA 3CCCA 2ZT8A 1J2TA 3DEFA 2IIBA 5IYZF 1D2RA 2YCBA 3DEIA 4RWZA 2RHGB 3OCYA 1UFKA 4ZVKA 3VR5D 3MXOA 5KYUB 2P91A 3P0EA 1RWOA 2J0VA 3L1UA 3E4DA 5KYYB 2PGXA 5F1YA 3TZEA 3KCXA 1M33A 3PENA 2UVDA 3B3FA 4QHYA 1I36A 4ETNA 5E9WA 1U0OC 4DSOA 3PFNA 1OFHA 3CZPA 1C7QA 1XQYA 4GZ5A 1DAGA 2XRZA 2UZ1B 1RI2A 2ZBVA 4HFJA 2ID7A 1DOHA 1OJHA 2QVZX 3DBHB 2GZAA 2PUTA 2Q4EA 5DNDA 1JW9B 3GB7C 3UHOA 2QRUA 1DEOA 3ZLVA 3U61B 1U2SA 4M1EA 3K0DA 5I9IA 2WB2A 3FB6C 3T0IA 1EK0A 1SHJA 3V8QA 1I3CA 1E79D 3R3WA 4XQ0A 2P9EA 5C5CA 3ASZA 3K7EA 2QDOA 4NJMB 1Z5NA 2BHNA 3NM6B 4X6LA 3TUJC 4PZ0A 3F78A 1JEEA 3EIWA 3LLCA 3V1NA 3DPUA 3LZ6A 2Q7XA 5CA0F 3W3AH 5KJ1A 1DQZA 2E18A 5EQFA 3GUZA 3TXSA 1USKA 1VGVA 1W581 4X1KA 1ZI9A 1V6CA 4J2HA 1X6VA 4NPAA 4C4ZA 5DXFA 3K20A 3NT4A 4KAFA 3IIMA 4L74A 2B61A 1PFVA 4RXMA 4EG4A 4CLXA 5F7XA 3WISA 3JTMA 5LQAA 1IWOA 3MILA 5AW2A 1Y6QA 2IH1C 2AI1A 5ADVA 3ESYA 1Y89A 1YCIA 1P4GA 1EBUA 5I9NA 1KR5A 4J1TA 1JIKA 4TKZA 4FDUA 5ALSA 2FDRA 2ZB7A 1YBFA 1X94A 4W63A 4LQDA 1W1IA 1F9EA 1AR4A 3BDVA 1K9SA 1P77A 4QUIA 1J33A 4FGSA 4KSYA 2YH2A 1KFEB 3C3YA 3B3GA 2ZJ6A 1E2IA 3G1WA 5TRTA 2EGUA 3EMDA 2Q5EA 1YONA 3JY6A 5JBIA 3GJ0A 1DJOA 2VSNA 4ZOLA 2YWXA 2GTIA 3BZUA 2J6HA 1ZP6A 5A7GA 4TTQA 4YCJA 3CCJV 4A6EA 2YS8A 4ZAFA 5HR5A 1U0SY 1G21A 2BT4A 2AMVA 1Y7LA 1SZCA 4DMHA 3CG0A 1NLUA 1VEWA 4E11A 1ZKDA 1DG9A 3QWFA 3J7AC 1T8YA 1H2NA 1S4MA 4KPEC 5BSWA 1ODLA 1JSRA 2C9DA 5DX0A 3SDZA 2WV7A 4BRZA 3TXAA 3K03A 2ZAOA 1NXOA 4J29A 3DKRA 2X7RB 3IIJA 1YT5A 3C3WA 2OTLV 1GSHA 2C1EA 3D36A 2J07A 4EABA 3SXPA 2IU6A 5AJHA 3CWQA 1J0CA 5AVSA 4DYVA 4PZZA 5K8LA 3RVZA 2FFRA 2MCFA 4RPGA 5CRIA 4IXMA 3SIPA 3B89A 3UPUA 4N6NA 1VYHA 2X19A 1EAYA 5JJJB 4WA7A 4L16A 2JIZD 3ENKA 2FWMX 1W88B 1BH6A 3UMMA 5BOSA 3TNDA 3QU4A 3LT5A 5FTMA 1GKIA 3N2NA 5EMMA 1YS2X 4J9VA 1A9SA 1D03A 4ENSA 4P7GA 3OKPA 2ODBA 4BJHB 2JAXA 2Q6VA 4GZ3A 4RF3A 1OHHD 2WU0A 3O82A 4IF6A 5JWRA 5LMCA 3QJGA 1FZQA 2YSUB 4ZVRA 1FDTA 3PR2B 1L5VA 5CJJA 2ARHA 3D8BA 5HJ2A 9LDBA 4RSRA 4HR7A 1FFBA 2BMAA 3ZVRA 4ZVQA 1RQ2A 2H07A 2XKAA 3TJZA 1T5IA 2P4KA 3HI6A 5CCBA 1HWYA 3BGIA 1UDXA 4M1QA 4BQFA 3D7LA 3MMXA 4D46A 3LUPA 3WV5A 2H94A 3PNKA 4PLHA 4PYIA 4LCUC 2HWUA 1PJ3A 4M0FA 1RP3B 1C14A 4ZARA 3DVLA 3MWLA 5FQOA 3ZD6A 1TMGE 1IZ0A 3NR7A 1GG2A 3OGCC 2BFCB 4RTPA 1ZCBA 1YQ9A 1ZGAA 4D9GA 4NE9A 2CXTA 3FCYA 3BYZA 6LDHA 3C39A 4K7JA 2OYSA 2RD2A 4MUAA 5ITZB 3FHOA 1XL1A 3KYCA 1FS6A 4RL4A 3HJHA 1KYZA 2ZI7A 2G0TA 4W1SA 1R6NA 1CG6A 3UUGA 3GBSA 1D7AA 1IJBA 1XP8A 1XO1A 1X7YA 5HGXA 2HXYA 3HKEA 4OHWA 1U1EA 2X5KO 4YCMA 1LQUA 3IEUA 4YV1A 2HH9A 4YJ3B 1FFXA 1HOTA 4ZI5A 3BE5A 3LUDA 5HM6A 2X40A 3ZBTA 1G8GA 4CL0A 3GDGA 3N2EA 3R7BA 1XLWA 3T9BA 3FUCA 2JFFA 4BMDA 2O3TA 4GT1A 3UK6A 5L3SA 3DMTA 4YJFB 1JQ0A 2L2QA 2VXOA 5E6UB 1H2SB 3AETA 3OAAD 4NBLA 4PW0A 4JR0A 2YUAA 3MA0A 3AG3C 2FV8A 4FFLA 1P2SA 1OAOC 1E2EA 1E2BA 2D2FA 1KNXA 2CXXA 5I7WA 1HI9A 1OPXA 3RRNA 4B48A 1LTQA 3OZDA 4PE5B 3WGIA 2WZCA 4NMLA 3QF4A 1X2EA 4RGQA 2QR4A 1WF6A 1TE2A 3E22A 3PC6A 2YDXA 2BELA 5HW0A 1F48A 5DIFA 3RBAA 4MICA 3G5TA 3ROFA 1FAFA 1GU7A 3LNCA 5FNZA 1ISSA 1PD0A 5HILA 3CNHA 3RADC 4R81A 1RYNA 3H5TA 2SKDA 1N2ZA 3K6KA 2W6OA 3V5NA 1R0SA 1JEYA 4KLAA 1GGNA 1R0LA 4B3DA 5H8WA 2HJGA 3G23A 3GRVA 4E46A 2H8GA 1G3RA 1B16A 2YXBA 3L8YA 2UUAO 1ULBA 3CGWA 3GH1A 4BMPB 2Q3FA 3K6RA 2HLDD 4O4HA 5G0SA 1N3YA 5K3OA 2UU9O 4I6JA 2X6RA 5L3GA 3AYXB 1J0EA 5CT6A 3DCYA 4GF5A 2M32A 4DUGD 4OH7A 2JKZA 1F51E 1QPZA 4RPLA 5BW6B 2ZETA 3ILSA 1EUCB 5D00A 1RJDA 3EVNA 1X59A 6GPBA 4MWTA 1PS9A 4JUDX 4YGYA 1MQSA 1CP9A 1UP6A 4TS3A 1XILA 5AHRA 4QYTA 4DW8A 1ISFA 4C1BA 4OYLA 2CVHA 1N0IA 4ZOLB 4Z7QB 3U4IA 4R9VA 3TRKA 2X13A 3KELA 5IG2A 3KQKA 4N3AA 4JLDA 1VMDA 4Z3KA 3GELA 4DCVA 1TGYA 1RTKA 3RANA 2ZUBA 4WPGA 3PHLA 2ACEA 2FA9A 2DQZA 5LMZA 3FKJA 2YIVX 4H7IA 1N34O 5DWVA 3AEXA 1QV9A 2NXJA 5M34A 3N3AC 2JIDA 3MYYA 3CUSA 3BGWA 4HDNB 2X1MA 4KLCA 1FFCA 1RCTE 4ZO6A 3RH0A 4L50A 1H2FA 2BR5A 4CIAA 2IKQA 3KDPA 3ZVMA 3U44B 2LDBA 3W6OA 1E1KA 1YRLA 1UMDB 4Q3AA 4QTUB 3Q4HB 1B6RA 4Y9SA 3TX6A 3JARB 2VEDA 2WD7A 4WZAA 1VA5A 1ACJA 2REOA 1PHRA 2CD9A 4ALJA 1HMYA 3U13A 5IAKA 3PJGA 3SKXA 2FUCA 4GPBA 3B12A 1QHEA 2CSXA 3SDLA 3JCZA 4Z1MA 3KRTA 1WB5A 5K0JA 5ICEA 5BOSB 1DUSA 4P4TA 3BUSA 4BJ6A 3PJEA 1YITV 4FM9A 2ECFA 5I3ZA 3HR0A 2PA3A 1MJGA 2PIDA 5BWNA 4NV3A 4P53A 3DO8A 1R6TA 1PPJH 2X2EA 3UMGA 3L0YA 3CPEA 2VA8A 3D02A 4B47A 1IULA 2V58A 1IEXA 2LW7A 1OLSA 3JAMN 2CDCA 4D3DA 2AEEA 1G42A 4Q1VA 1KSGA 4LF8B 3EYAA 3GRKA 1NBAA 5DHPA 1YVEI 1EE9A 5KDOA 4B3CA 4MUXA 3LQYA 4TQUS 1ZH8A 1NZJA 1ONNA 1XE3A 2KBEA 2XUAA 1HRDA 1YTFB 2BF7A 5J2TF 1J9ZA 4MYDA 1PK7A 1T1IA 1BGVA 3EEQA 2YJ3A 4JBGA 1IY8A 3FCXA 1I32A 1HW7A 3C8UA 4ER6A 3FSJX 4AJ1A 3AK4A 3IRVA 3F6SA 2JJMA 2WHXA 3A0BZ 4QUEA 3TIFA 1ZIXA 5C8XA 2ZWAA 2ORED 2ONCA 4NKGB 5FI3A 4ZT2A 1AJNA 3WBJA 4IIBA 3HV2A 1X7YB 2E76B 3T1HO 2QTLA 3DOCA 5TQ0A 3T0GA 3SJCA 1U28C 5A1TA 4FK8A 5JO9A 1VG0B 1H0SA 2E87A 5K0FA 2M2IA 1YS4A 1N3BA 1PDOA 1D1TA 1VIBA 5KNCH 2C5FA 1MA0A 5REQA 1CSEE 1N5DA 1GCUA 2BTEA 1NUTA 2I4MA 3DE5X 3O73A 1N6PA 4TQGA 4H6WA 4QULA 4FB4A 3BC1A 3AB7A 1OWPA 1K98A 5B58T 2RBKA 5CFMA 2RGWA 4ARSA 1OB5A 16PKA 4HAIA 4KXWA 3GJQA 5AI4A 1VPTA 4NK4A 4C76A 3PFIA 2PGAA 4JQYA 4ZOAA 4KUMA 2ORVA 1GQYA 4TVBA 1HQDA 4M1ZA 2HOQA 1P29A 4FHZA 3HJUA 1PGJA 3ET5A 1XJ0A 5IT5A 1CJKC 3A0UA 5H6RA 4W1PA 3CXUA 3FZYA 3DAOA 2ZR7A 2BV3A 4DA8A 4IZIA 4KP7A 2WSBA 1FSFA 1GAWA 3AUUA 1PGPA 1CS0B 2HWYA 3HBAA 3M1IA 2VHJA 1CNMA 1ZPDA 5JXHA 1Y3BE 3LAWA 1JBEA 5LIPA 1POWA 1L4GA 1L5QA 3EEYA 2QRMA 3M6UA 3ZUPA 1XTUA 4K8XA 2ZZNA 1CIJA 4KMRA 1XTPA 5L3CA 2VN8A 2AXTZ 4U3FH 4DK0A 3N8IA 4D98A 4B9AA 1HTTA 2LJ2A 1BD4A 2BFDA 4DXWA 1WKVA 1A1SA 2OTCA 5AI9A 5IBRA 4PZLA 4PA7A 1NKSA 3O4JA 1RW4A 2WKRA 4BQSA 2CXPA 4IP0A 4CLOB 3OPNA 1X7HA 2AZXA 3K31A 5BNWA 4G1BA 4MUHA 1N1MA 2W48A 3AW9A 3RIYA 4L5AA 4ZIRA 3HCCA 4YAWA 5B4VA 5KX5A 1TM3E 3HVKA 2H3HA 4MP6A 2WP0A 3RIHA 1CETA 1BN6A 4URWR 4D57A 1N8NA 2ZS9A 1OROA 3EA0A 5CCEA 1JV2B 4ZVSA 2XHZA 5E3JA 1NH2B 3BH6A 2ERXA 1IPFA 1VJ0A 4JI8O 3MQFA 5BYJA 1R2QA 1NG1A 1LWOA 2FPIB 1MB4A 1US8B 3VO1A 3HDTA 3GBPA 2PZGA 2O2XA 3C7TA 2XGMA 2X0NA 3LA6A 2YASA 4OTZA 1WE2A 3NHKA 2JI4A 3K15A 4JMLA 2TS1A 3H4MA 4C7MA 4WCFA 3PKJA 1CB0A 5CW2A 1W76A 3AJAA 1EDZA 1CYDA 5DZSA 3Q5GA 1SVNA 4WZAB 4Y2YA 4NYJQ 4JWTA 2ZXEA 5K3DA 3I73A 1C1DA 4G01B 1KMHB 3UCEA 3D3KA 4LBVA 3SR0A 3Q7TA 2V3WA 2FZGA 4HWSA 4X88A 4H6VA 4D97A 3VJKA 3PTAA 4DV6B 1RE1A 1OR8A 4J6EA 5BO5A 1T6YA 1PNQA 4A82A 1IHDA 2A7WA 5LXTF 4AKSA 3WLHA 1FP4A 8LDHA 4H27A 4GR4A 4JI2B 2O05A 5CD1A 4ZTBA 3L4EA 3H9CA 3OO1A 1S8NA 3OD4A 2CNOA 1DTOA 1Q11A 4GYKA 4I5GA 1RRFA 1M7GA 4L9AA 2JFOA 1E0AA 5BQXA 2AUTA 3TETA 5LSAA 5BMOA 3B60A 1XEAA 3JS5A 4S1VA 4KBFA 5KQPA 2FSPA 2Q46A 4EJMA 1TIBA 4QARA 2VPTA 5KJEA 2X4IA 4OPMA 1R0CA 2ECPA 1Y9EA 4LXTA 2F64A 1CFJA 2ZXUA 4ZDKA 2ZEJA 1RWKA 3RLIA 2C5HA 2C2YA 1U65A 2NSDA 2KQXA 3MMNA 1YZKA 5FUXA 2R751 1OXTA 3AF5A 4RVGA 1X42A 3WSVA 1SVOA 1GM8A 1PD3A 4KE8A 4DLBA 4TLBA 2VDMB 5JVDA 3T35A 2HU5A 2OGUA 3QH4A 3UJ7A 2C2HA 4EEKA 1WDMA 4D1YA 3HGMA 5LU8A 1EM8B 2AFIE 2VIIA 3ZNOA 5LQNA 2F95B 1S8FA 3CFYA 1UH5A 3OUTA 3IJEB 4YVFA 2BSXA 2TECE 1N1DA 1MAAA 2W2PA 3H5LA 4TQDA 5REQB 1E2DA 4TVKA 4XDLA 5FWYA 3OZSA 2R5NA 5JFTA 1NU1H 2C2MA 2LVBA 1A9YA 1PSDA 3HWRA 3C74A 4Q4HA 3TOXA 4BIMA 4ZDJA 1RQXA 1YJAA 4NV1A 3N27A 1QV7A 3KXIA 1ZX1A 2AHZA 3O3MB 1L8OA 3WQRA 2FSVA 3KTDA 4IZHA 2RFLA 4DG9A 1CUIA 1M6HA 2XQVA 3AESA 3OA2A 1XVAA 4RJKA 2NZVG 3EWNA 4HQFA 2AMLA 3LZCA 1SBIA 4E07A 3P9PA 5WRFA 1XZGA 2P5YA 3A32A 2ID8A 4GCZA 4EL0A 1J2EA 2W6IA 1NN1A 1ZNWA 3CB4A 1W9MA 3RFXA 1VPEA 3LY5A 2YOHA 4OQXA 2PYDA 5KYXA 3CVXA 4DJAA 1W19A 2R8OA 1G7CA 4TN1A 4JEHA 2XIJA 3ZU6A 1Z2GA 3D2LA 4Q4LA 1CD5A 5J1TB 2NU9A 2BONA 1XZQA 5JMPA 4OFZA 4FOLA 4IDNA 3UJBA 2DUWA 3EXFB 5EOVA 1ZYUA 4C0AC 1CERA 1CLEA 4M8LA 1GGKA 3DR3A 2A0WA 1CWUA 1UBRS 2GXAA 5LJLA 4NDAA 5T6BA 4E22A 2G9VA 1V41E 3C1UA 1VSUA 5DI9A 2XCTB 3NTLA 4MIOA 1YZVA 5EBMC 4PTZA 2MT9A 3N70A 2H6EA 1IH8A 5D8DA 5I7RA 1K7SN 1PFYA 4GIBA 1BDHA 2CZCA 2HHAA 4B84A 2QDXA 2X8AA 4HQ0A 3PXAA 3UHPA 1N2EA 4E5NA 4V1CB 1I4WA 4D7SA 4W5TA 5C80A 4FXOA 4YRRA 5C9ZA 3KYDA 2WF9A 3OVMA 3GMDA 4NZYA 3G2NA 3TQOA 1NHGA 3IJ5A 1PZGA 3G85A 1BAPA 3IUMA 3K0AB 1E1CB 2AR7A 1IM5A 5HFJA 1K97A 1ZH4A 1UKZA 2VF2A 1JR3E 1P7WA 4AMBA 1MA1A 2B5VA 2RB4A 4E5YA 2JK1A 2Z8YM 3BWXA 5JHGB 1AROP 3CP1A 2XB9A 4E31A 2ZKIA 3W5UA 4FYMA 3C5CA 3LKBA 2D74A 2HPVA 2JGLA 1TMOA 4RK7A 2CLKB 2GSMB 4KIWA 3DDCA 1GVNB 3OZBA 3SE7A 4HNTA 4TTRA 1VLQA 4JTAB 2D06A 3W34A 4TL7A 2XMPA 5TGTA 3KVNA 3EZ9A 3CRRA 2NOAA 1Y6RA 5MN6A 5A2GA 1ZD8A 4QPJA 1QK4A 2F1KA 2UXXA 1DAKA 5J58A 3DV0B 4AJ2A 4G5FA 4HX9A 3H3FA 5FWXA 4FGUA 2WWGA 3O2SB 3RYCA 5TE9A 1L1EA 3T5GA 2F43A 2IJHA 2VF8A 4YRTA 5ERXA 4OX9B 4FI3C 5ALQA 1KF0A 5B1SA 4ESHA 1QH1A 3UIEA 1U2RA 1LDEA 4JYBA 4GGPA 3IC7A 4CF4A 2ONYA 3ER9A 1VL0A 1ZG3A 4UAUA 2P6NA 2JFUA 1Z3IX 4Y2QA 1T36A 4KUEA 5DGDA 1GQQA 4YMUA 4MA4A 2CVPA 2FNAA 3T3IA 4XGRA 3MT8A 1KYXA 3RS7A 2D59A 2G1PA 4HVTA 5KA6A 3KPYA 2B4QA 3KLPX 3TGLA 3KR2A 4D42A 3PKZA 3NV7A 1Q6HA 2QLFA 1E1RG 4P9OA 3BM5A 1Z7WA 2P9QA 3VOSA 2YWBA 1RC0A 1E59A 3CMAV 1F12A 2AS0A 3VR6H 1SO8A 3HJTA 3TSWA 1RAGA 3B2EA 3HBJA 1RXEA 3WGYA 4EI9A 2WVHA 3OZGA 3DE0X 3CM0A 1JN0A 5JVDB 4YP0A 1KVRA 3ANTA 1QS0A 4RA9A 4LXUA 3HXLA 2Q6TA 3RU2A 4C20A 1L4UA 1I80A 2BFBB 4PR3A 4ND5A 5JPCA 3L9DA 4OI4A 5BSVA 2C3UA 4BBJA 2BE7A 2PY6A 1ZRSA 2PPVA 3S99A 2BBWA 2A7QA 3HQ4O 4DIEA 3QMPA 2P41A 4CMHA 4MVWA 3EX7C 5AW6A 2GM9A 1K6IA 2PWZA 1YMUA 1O95A 2LPMA 4JI3B 3LP5A 2QSAA 3BTUA 3RREA 2CGEA 3V2GA 2XB8A 2IDMA 4L8FA 5JCOA 1T3TA 2XUOA 4XPZA 2A88A 4HAXA 4JBHA 1ZSNA 4NH0A 4RABA 4W9MC 1XRPA 1RLUA 4QBTA 1R27A 3AESB 3L6RA 1ZC4A 3IOEA 4XDKA 2YKGA 2NXCA 3QPBA 2WT8A 3CZ5A 4EYGA 1RYDA 4IYHA 1E6MA 2W6JA 2X2OA 1K7EB 1H2WA 3O2NA 3ZE6A 2E1RA 3BJRA 1TAUA 2J3DA 5HCNA 2ZPTX 1F7UA 1KBQA 1C0PA 4M37A 4F5EA 4H3KB 5H2FZ 4F4HA 5FPYA 1SQQH 4AJ9A 4DWVA 3GR6A 2J6BA 3ZY2A 3D0QA 1HDXA 4HNSA 4LDZA 3VPDA 2H1WA 3U39A 3CUWA 2BSAA 3GD7A 5CPBA 2ZLBA 4XWTA 1VBNA 3QNMA 1HR0O 521PA 2NW6A 4I9HA 1L5HB 3QBJA 1OC4A 3BCCH 3EZNA 4NC9A 4ISBA 4KUHA 3ZU2A 2M98A 1ISHA 2O54A 2BVNA 2EZ8A 2Z04A 1U5AA 3C3EA 1V4BA 5T41A 4FS8A 2IHNA 2QUZA 5A71A 3VTZA 1OFUX 4BU1A 3DP9A 2PFSA 1EXWA 2GUZA 2GLUA 2G82A 3CH5A 3KYDB 1QPGA 2O2JA 1ZUHA 2LRHA 3H11A 4MZDA 3NPAA 2XGOA 2OEPA 4CIXA 3PG5A 3PRJA 4KREA 4ICGA 3VR3A 2YS6A 5EWLB 3GWZA 2IHZA 1QVZA 3LUTB 4CM7A 4O4JA 5D3MB 2VYVD 3E9ZA 3GIWA 2YOFA 4AD8A 2Y05A 1ZUWA 1E5DA 2Q5JA 2WAOA 3PJRA 2YUIA 3UGJA 1N36O 4OQDA 5F35A 3CRVA 4J0JA 5IJWA 2KB0A 2L17A 4KQIA 3SF8B 3BFKA 1PD1A 5KSZA 2WA2A 5AKEA 1CLUA 2HLNA 1R6AA 5KKAA 2ODPA 2Q9AA 4R9UC 2WBLC 1WCV1 1GZ5A 5K0CA 1GFIA 3OETA 4HYYA 4RA6A 4FFNA 4A8PA 1PYOA 4TUYB 1FNBA 2A94A 2ZUFA 1UBSB 4M4SA 1YDFA 3OEYA 3MRVA 3ZHTA 2JKYA 4FUQA 4J7UA 3TLXA 4Q3OA 1NX6A 3HB7A 1TADA 1T29A 2GN0A 3ES9A 4CMEA 4YLYA 4REOA 2F1HA 1BH2A 4X1IA 5LGTA 1JU9A 2I0FA 2NADA 1TU3A 4QGPA 4RVDA 1W48A 1SBNE 5EMKA 5BRAA 1CZOA 1JHMA 4FI3F 2ZSJA 3OWHA 2XD9A 1V43A 3A1SA 2GBFA 2JHCA 4RK5A 5J2UA 2ALJA 3GK3A 2NSHA 1X80A 2FWAA 3AUYA 1BE8A 3TL3A 3OJ0A 1AY0A 2QX9A 4DEYA 5EIXA 3WLFA 3SLRA 3W5DA 4AB1A 5B3KA 3CONA 3BK7A 4TZ0A 1SQSA 2DWQA 5KKCA 4CODB 3W7TA 4JQSA 1Z83A 1Q57A 1WA8A 1FSGA 2OCIA 4ZQEA 3VPCA 3PQ8A 1U8EA 4MINA 1U0NA 2PGJA 2JI9A 4ILEA 5AW4A 2BI4A 3LTEA 1OPRA 1MVOA 4BBAA 4DT1A 5EJAA 4BTEA 1QG4A 3I62A 1L4KA 2XMRA 3THSA 3DLAA 3CLTD 3ZI7A 1MP0A 1R16A 1PM9A 4OOFA 2V0NA 1RPZA 2YI9A 3A05A 2VRCA 2CVOA 1EYZA 2JEUA 2X4LA 3WNQA 4PLFA 4DV6O 4LWSB 3D4LA 3KPVA 1GVHA 3CLVA 1P9LA 3DONA 5EZYF 2P9TA 2HQSA 1E7RA 2P30A 1OHHG 4JI2O 1G2OA 4OFWA 5FBHA 3WLAA 2FQ1A 1BT8A 3NGXA 5B6JA 4FE7A 4IDFA 4OLHA 3ERCA 4FM1A 4IWNA 3TB6A 5A9GA 3S7ZA 2ZPUA 1IUOA 1I7SB 2Z5UA 2IK8A 1M0TA 2NMVA 2GS9A 3R7LA 4M0DA 1GZ7A 2JCGA 2PR7A 4CLRB 3V4LA 1ZEJA 4GYJA 1MZEA 1NW7A 2ZU0C 4WTOA 4LBEC 4S1NA 2XW6A 1W5SA 4IWXA 4IL5A 1NX9A 3M7MX 3IP6A 2CUTA 3HDHA 3OF2A 2ENWA 5LGUA 1SXJB 2XJ4A 4K9LA 1G2IA 2ZRNA 4FCVA 3VU8A 2J5RA 3MHTA 2EFDB 3JZMA 3JYCA 5LYYA 5E1AC 1G8PA 1B7GO 1BHSA 4AKIA 3BD9A 3NHPA 1HV8A 4QRIA 3SYRA 3D0KA 5U1PA 3HK2A 2FN7A 1JJ7A 2OYQA 1Y66A 5HQ3B 1XEXB 3I3OA 4N5HX 3TS1A 4GDFA 1IDN1 2PAFA 3OR6C 3TRIA 3LO5A 1YR8A 1BX0A 3PXUA 4FEYA 3KUCA 1EVQA 4LGVA 2Z3YA 1DDOA 4LJAA 1BCRA 5DSZA 5I8WA 1QYRA 5LHHA 3COPA 1RLMA 5EJ5A 1NVKA 3K8QA 3L02A 3MMZA 2B99A 1Y9JA 1XV5A 4MRPA 4J3NA 4BUCA 2O1XA 1BJKA 1YJCA 3AWDA 3FCAA 1XZLA 4TSKA 3ZU3A 3SYTA 4RGBA 4ZO7A 1P19A 4GP9A 1AR5A 2O8BA 1HXHA 2JCXA 1VE7A 1YZFA 2WVAA 3CLSD 4CM5A 3DSRA 1SC3A 5MN5A 4JB0A 2AGVA 3QWAA 5LZ8A 3E9QA 1YRBA 2QN8A 3OM0A 2OHHA 1KWGA 1ACLA 1NW4A 1GZ6A 4HH1A 3H42B 3S2FA 4KSCA 4R51A 1GL3A 5KHIA 1BDIA 2W6NA 1XZMA 2PT9A 3C8ZA 3MWFA 3OURA 3M5CA 3FF1A 3H11B 4LY9A 1V3VA 3UM9A 3PFKA 8ATCA 1IJKA 1XD8A 4WN9A 2ZBDA 3LL7A 1Y4SA 4ZP1A 4A10A 1VF7A 1C1XB 3REFA 5KTNA 4R1OA 3CKLA 4O4JB 2PAAA 3T54A 4EVSA 4F2PA 1OZHA 5KCMA 4PGGA 5KNDD 4QPNA 1Y5MA 2TMYA 2X9LA 5LLTA 5I9LA 5C8DA 4GQAA 5EXEA 4L7VA 4UVAA 5EKXA 4NQZA 1LTHR 2OBBA 4AQYO 4DM3A 2HVKC 5B1AB 3MAJA 1B8OA 2F3SA 3B40A 5E9QA 2CDYA 1OC2A 3HNRA 1VG8A 3OPYB 3I2JA 2Q5OA 1GZSA 1DBQA 2AQ8A 5TJ9A 4YPFA 3VZCA 1ST2A 2W2MA 3GPIA 3BAFA 4BWYA 3F8TA 3OE1A 4B74A 1E1RD 2DW4A 2FZKA 3ZDFA 3BXOA 1BXRB 2XMBA 1B6SA 3SLGA 2I7VA 1ZL8A 1AA6A 3VC7A 1P1KA 4X60A 4DMKA 4JT8A 5KYWA 4FFRA 5FUYA 4PA9A 2BEUA 2DC1A 4EBBA 3N5KA 4XFDA 4GVLA 4P86A 2PY5A 1YZLA 4RDHA 3JYLA 2CT8A 1K3TA 1UOQA 2XKBA 3LBNA 2X3UA 3O4IA 3LDEA 3F5DA 4X90A 4CG3A 1XSEA 2QV7A 1DCMA 2OCHA 4P7FA 5JFGA 4DDMA 5LB4A 3OU2A 2O57A 3ZDCA 4MMZB 5CGQB 4HH0A 3S2GA 1X1RA 3B1FA 4O5OA 1JZSA 4PN7A 4Z4QA 5BN4A 3INGA 1R9JA 3FOCA 1G20B 2JK0A 4S0ZA 2VCEA 1FF9A 3G68A 1JIXA 1O97D 3WK5A 3RK0A 4JGIA 3RARA 3IEMA 2PG3A 3VBBA 3NYWA 1VECA 5DKFA 5U4XA 1TMYA 4O0MA 2LTAA 1IONA 2DLDA 3ZHZA 4NCBA 2HCBA 5ECDA 3RT7A 1G6Q1 2C3YA 2BEWB 4KWHA 2O2EA 3W4JA 4I4TA 2XUMA 4IIXA 3G59A 4EEXA 3DWFA 4K9MA 3FTQA 1Z0AA 1G8HA 4OX9O 2AX4A 3SPGA 2E1PA 4YT4A 2GHQA 1SZTA 3X2FA 4C7JA 2X0KA 4P3PA 4EVIA 5GM1A 4BIZA 3OJEA 1EWYA 2EJCA 2ZSAA 1BWQA 2QGNA 3BKWA 5E4FA 4LMPA 4KACA 3G8BA 2RAPA 5JEEA 1CJBA 2FFJA 2FX5A 3G6KA 3TINA 3U9TA 3I9FA 4N8SA 2ITDC 1DVRA 4OFBA 4ZT5A 4JUAA 4UCFA 3F5FA 5D1NA 4JI0B 2Q0QA 1HNZB 3DHWC 3T1QA 4JY7A 4HYEA 1VMAA 4QEZA 5K1ZA 7REQA 4PBRA 1XPRA 2J30A 1AGPA 2WTXA 1YZQA 4MAAA 1MJ5A 2Z4TA 1PO7A 4DBZA 4G4GA 3UV3A 1A9RA 421PA 1ENZA 1GPDG 4WOPA 3ENVA 1ZLYA 5LBIA 1LB1B 4B4KA 3ZLBA 1EDDA 3FCOA 4CDRA 3GYGA 1X7WA 1UBJS 1AKUA 3OY7A 5I4CA 2N1BA 3M0EA 4N1AA 3CCRV 4FYXA 4TVSA 3HKDB 1TRHA 4PDRA 2HXSA 4J0QA 1MT0A 2EFCB 2BGLA 4QTYA 4V3BA 3FRHA 2BKXA 2W4IA 3GEGA 4PC2A 2A9RA 1BCRB 1JR4A 1MJFA 3T4ZA 1SQFA 2HDOA 3D54D 1UWCA 4JI3O 1LLCA 1KJZA 2A78A 1UPUA 2FPLA 3PIRA 4X20A 4GSKA 2OXEA 2VJMB 4KN9S 3WAJA 4CS4A 4JF3A 1BMFG 1TD9A 1DAFA 2A7XA 2DECA 4NDNE 3ZJZA 5AJUA 4R2LA 2RQ6A 4ZQBA 3GD5A 2JGAA 1JTVA 3TD2A 1O6BA 1XRJA 4RK1A 2ZSEA 4GKJO 2KJQA 2PZJA 1VF5B 3MWYW 4ZZ1A 4Z53A 1QP7A 5FBLB 3ZDDA 3IV9A 1UAAA 3CNLA 4F93B 2D3TA 1B74A 3CNOA 5A4IS 2BEVA 3BJZA 4B82A 3S27A 3RK4A 5FTKA 1E1QG 2FLVA 1V6SA 4ASUG 2ZT9B 2HHHB 3BT7A 2IXAA 1KVQA 5D5QA 3UC5A 1QG6A 3I53A 2B6NA 3P94A 1HGXA 1F3LA 3PL1A 2FPGA 2FEXA 5ES3A 5I9MA 4PPQA 2IOQA 2K87A 3HR4A 2PUGA 1K5SA 4FOOA 5IXSA 2PNFA 3B2NA 2CN1A 4ZOQI 2JFZA 3F5SA 2NYRA 1Y5RA 1NBIA 3ZVNA 2J4FA 1X87A 1CY0A 3MYRA 4NICA 1HZZC 2W8BB 1DEKA 1YRWA 3FAVA 1OKKA 3EULA 2GNPA 2AZDA 2F6RA 4IOJA 3BH0A 4QDUA 5LOVA 2G5GX 1CYEA 3P27A 3H1TA 5B2FA 5IANA 3BEOA 1YDEA 4HXYA 2OK7A 3IMGA 2R1TA 4ZYTA 2JJQA 1MORA 3ZVKA 5HCIA 3Q2KA 1GM7A 4ZI3A 2PS3A 2Q1YA 4A0FA 4DARA 1RPOA 5HIAA 3LLUA 3ORYA 1HQKA 1QIGA 3JD3A 2HIHA 2YHIB 4LVUA 3K5MA 4ID3A 4B3RB 3P3NA 4MV9A 3GRFA 3CCBA 2HIMA 3VO2A 2HSGA 4MI9A 3X0DA 5CEJA 1H1LA 3AOEA 1DWOA 4LQ4A 2C2KA 3QQ5A 1NIPA 1Y8RB 1QX3A 3SHOA 4MS4B 4H1UA 1TLTA 5HA5A 3UHJA 3W79A 2QHXA 2JLSA 1AGYA 2ZYTX 3V7FA 2FAXA 4HTFA 1SG0A 3VQXA 1NQUA 4UFOA 5HP4A 3VSBA 4G0YA 1BS2A 2B1RA 4LF7O 1JBQA 3GC6A 3DMFA 4JR1A 3WLPA 1YSCA 4A27A 3AHDA 5SV2A 2DH5A 4F12A 1YI2V 2IYLD 3GLKA 5BR8B 2O8EA 1QHXA 3PC3A 4C1NA 1RVV1 3D7SA 2PUJA 4H6XA 2RKBA 3T9EA 4NESA 3NVDA 1EFVA 1JPVA 4OXYA 3CVVA 1XKTA 2HU2A 1J7KA 2I99A 1QKJA 2FOLA 4DG5A 2ECOA 1N8KA 3KHTA 3NBUA 4YT5A 3CBGA 1TGVA 4G9GA 2OOSA 2YHAA 3ZIUA 4E14A 4KXYA 3GB9A 2G77B 3AG4B 1YE3A 4US0R 1FUYB 1SHZA 2Z6QA 3A4MA 1GJRA 1S2GA 3SCZA 1UFRA 1PCXA 3C48A 4H9GA 3R09A 3BBPA 1BWPA 2V59A 5JSQA 3FMIA 1TQHA 3WS7A 2H2IA 2QZ9A 1NV8A 5JR3A 1O57A 1NU6A 5KNBA 1I2ZA 2IV2X 1QBKC 3JQAD 4DQXA 2UDPA 5HKKD 3R9XA 4BO7A 4QGGA 1U6JA 1AVMA 4BVAA 2XAFA 3HPRA 1U3CA 1ZM7A 2P8SA 3EH1A 2NV0A 3B1KA 5K8UA 1GRNA 4AN4A 5BVGA 4UD6A 5PGMA 3U0BA 2DHQA 2VK2A 4ENWA 1QZZA 3K09A 5JD4A 1GFWA 3RR2A 2C0PA 2XCOA 2CKMA 1T0IA 2PYZA 5F1PA 4GL4A 1CT9A 4DNPA 4X1KB 1U3FA 2HRZA 3U31A 4B8ZA 3ESQA 5FFMA 3SR3A 2UXNA 2V7GA 1TX4B 2WYHA 2XB2A 3SSOA 4LNUA 3PHJA 4MVYA 3AG5A 4M8SA 3H0KA 3G2OA 1BE6A 2B83A 4CT4B 3HCAA 4LJ7A 5K3CA 3FLAA 4B3SB 4IJ5A 1AJQA 4F0JA 1PWYE 4KQ6A 2DFDA 4Q4JA 5EVCA 3F2VA 5ESXA 3IKTA 4D7AA 1UJBA 4ETIA 1NYTA 1QIDA 4WX2B 3CX8A 3GCDA 3JASA 3WLNA 4GZLA 1Z7EA 2YMQA 1LX7A 4GM1A 3RTEA 3F8SA 3L0CA 3PJFA 4RD0A 3NBKA 3WYFA 1MAVA 3ED5A 4C03A 5CX1A 4OMCA 2WWIA 3P7MA 5FBRB 4UQOA 3I6MA 2WW8A 1P7GA 2EIMB 3OFND 3OZIA 1AZTA 1PTJC 3B3QA 1G21B 2YIAA 4KO4S 3B8MA 2W6MA 6Q21A 1JAIA 3SMVA 3EDRA 3MLBA 3EH2A 4EZBA 1U5CA 4AP9A 1Q6ZA 2ICAA 2CWWA 3ED1A 5BT8A 4MYTA 2P75A 3AINA 3OM3B 3WLOA 4B08A 1D5WA 1X77A 4Y0VA 2CNKA 5IAGA 5ENVA 2BM9A 1NXTA 3DOEA 3R74A 4ZRDA 4R1LA 4ZCIA 1PT5A 5EJ2A 3TAUA 5HKAA 3NDPA 4D9JA 3RUDA 3QQPA 2V9PA 2A9HA 1XTQA 1JKMA 2GM4A 4I1VA 4F60A 3Q98A 1V4NA 1ZVQA 2CAZC 1HORA 3RG2A 4O0LA 4TTAA 3O4HA 4N3GA 2Q1TA 4C2TA 2CJWA 3PFGA 3UJAA 2JHGA 5DM6V 3OOYA 1N1EA 4OLFA 1BRTA 5CMLA 4R8MA 3QF7A 3M9LA 2KPOA 3SHWA 1WZEA 1MEEA 2JZNA 2DRIA 4LJLA 3ESXA 3NYQA 5E6SA 3IVRA 4PU0A 3U3KA 1Z75A 1ZL2A 3VYSB 2PKRA 3C7CB 2G04A 3GEHA 1ZGCA 1WU8A 2GV9A 2QLMA 3HRIA 3T61A 4XYGA 1SD5A 3VZPA 1ZA1A 3OFJA 2XNDA 5HQTA 2PNJA 2AFHE 2QD3A 5L53A 2WG2A 3HJRA 5K9ZA 1XDDA 3EFEA 2X22A 4P54A 2HREA 2CV1A 1EHCA 2NUTA 1SBQA 2FHPA 3GVPA 3SJZA 1SCJA 1YNSA 2OPBA 4CCYA 3TZBA 2IU0A 1PQUA 1TA8A 1FS4A 5FRDA 4M76B 3N2IA 1JJ2U 1VQLV 1P7PA 5ELMA 3G7SA 3IJ4A 2O5VA 2JCVA 1J9EA 3K5LA 8GPBA 2VNKA 1XDCA 4D3XA 5E8RA 4MGYR 1QZ3A 2C8VA 3KP1A 5HGJA 3DZDA 1RXSA 3QO5A 3KYCB 1UFIA 1NBMG 4BNFA 4C87A 1OILA 1UMBA 2DEUA 5F9HA 4KIFA 3KNZA 5KWEA 3MSXA 1DO8A 1NVPB 4ZYYA 2G5PA 3ACCA 1HEIA 4IO0A 1B43A 4LYAA 4RTNA 1MEOA 3HKEB 3D6HA 1QHNA 3DLBA 3RS5A 2YXLA 3VPGA 1QE5A 2WM3A 1FFXB 5LD2C 4HUJA 5LA6A 3UKMA 2YRFA 3WK8A 3ZGNA 5HE8A 1EKXA 4HNUA 3AR2A 2VK8A 4ZDWA 3RO7A 5L3SB 3FRJA 4FD2A 3V3KA 1EXVA 1BMFD 3EG9A 2Q9CA 3AETB 3KZXA 3ZZUA 3OOHA 4NARA 2B1GA 4E03A 2Y69C 1QORA 2WMYA 1BA3A 1AM4D 2IJIA 4DR5B 4K8OA 3DXXA 2VJCA 2BGIA 3ACBA 4JT2A 3OM9A 4MROA 1JEJA 2R6JA 4HFNA 1M8PA 2N74A 3V55A 3MWKA 5BNTA 1JHOA 3RVKA 3QF4B 3FPAA 4ZODA 1FNCA 3OCWA 3K9AA 1E1QD 1ZFNA 1EBFA 2J9ZB 2QW0X 3T34A 4ASUD 2OAQ1 3E22B 1MT3A 2QE6A 2QVXX 3VGJA 4N01A 3AF0A 3AG7A 1E58A 2KKWA 4C88A 3G9ZA 5DHRA 1E1NA 4L08A 3EFOA 1JFVA 1JJVA 2PRZA 4JBXA 1I3KA 4TVOA 2N0SA 4JELA 5EQJB 3HXTA 1JEYB 2WA4A 5AESA 1HNZO 3JVUA 2IJJA 2PKQP 3A1FA 3LIIA 3S70A 1UEJA 4RYDA 4OHFA 2C2WA 4EHIA 5H5JA 1JX6A 2Z4SA 4L8VA 1GMGA 4QNNA 1JTEA 5HKOA 2XF8A 2QG6A 1OT3A 4TQFA 1FY2A 4O4HB 4KQHA 3CBQA 3F5WC 1V8DA 2GHYA 4C6HA 4NCIA 5DBFA 2GBGA 2I8CA 5K0TA 1LPOA 2FWIA 3N75A 3GLUA 1SULA 1TK2A 2GBIA 1S2DA 2XAHA 4P92A 5C7LO 4QDKA 4Q7EA 3HDJA 1KK0A 1ISGA 3MGGA 1E9DA 1XN4A 1AGRA 4GMHA 2MTBA 3CRNA 3M82A 5CX1B 4ZTZB 3M6FA 1NY6A 4X9XA 2PS9A 4WKOA 3KAPA 4OQZA 2WE7A 3CY6A 4QJIA 4WK4B 2IBTA 1VBKA 1WQ4A 2Q6IA 1A5AB 3EVBA 4Q4CA 1GUAA 4D5GA 3ZWXA 3RTDA 4JEMA 2OKCA 2I6XA 3A2MA 3TSCA 3TW8A 3GGPA 1LF0A 3BL6A 4IIUA 4L87A 2XMCA 3Q6MA 2JGRA 1E20A 3A6FA 2P3LA 3ZMVA 2FYUH 1U5BA 4BE9A 3H7IA 5JECA 5AUNB 2GN6A 4Q66C 5TGDA 2ZRLA 4HWTA 2OLJA 2WTAA 3V7WA 5L4SA 2GN4A 3N6XA 5ALEA 2WD7B 3F71A 4HEJA 4FWTA 1A7UA 3RUCA 5K2OA 1A88A 1ORDA 3I12A 2VTEA 5JAIA 2V0CA 4RHTA 4DZRA 1AN0A 3ZDBA 5CH5A 4J7ZA 1CUAA 1XXHE 1VIDA 3PHIA 3ICXA 5IRCD 2VPQA 5GVRA 1MTZA 3TXYA 5C46F 4QNRA 3KVOA 5KVVA 5BQ3A 3RIMA 3T4UA 3M4JA 4V0ME 3GT7A 5CVCA 2NR5A 2AHYA 2YWDA 4PLTA 1U0EA 4R4JA 4ES6A 4AKGA 2ZS7A 1OLSB 4IEIA 4C2UA 4QA9A 3QVLA 3LVRE 4JK3A 3D6VA 2HSDA 1G41A 1SXJC 3LJKA 5J9FA 1GADO 2FWBA 4DYDA 3VR4A 1KAHA 2G17A 3BVOA 1UJWB 1GPLA 3CCUV 2J4DA 2XVAA 3T0FA 1ORTA 3WK9A 2XZOA 9GPBA 2AA3A 5FQNA 4BE4A 4WADA 4YMVA 4EI8A 4EJ6A 4QJFB 4P2GA 4