4LBEC

Structure of kcsa with r122a mutation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERAGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lbeC00
2ITDC 3E8HA 4PA3A 3SPJA 3LDEA 4X88A 3SPHA 1J95A 3F5WC 3E8GA 3OGCC 3SYAA 4GX2A 5E1AC 2Q69A 5EC2C 4PDRA 2WLMA 5J9PC 4TWKA 2AHYA 2WLNA 4XDKA 5B1BC 4QNHB 3EFFK 4MTOA 2QTOA 3R65A 5CBHA 4MW8A 4RUFA 2R9RB 3AG1C 3FB7C 2A79B 3UKMA 4LBEC 1XL4A 3AG2C 2EIJC 5IY5C 4GX0A 4GX1A 3ABMC 2HFEC 3AG3C 2X6CA 1JVMA 3T2MA 3RBZA 2ITCC 3SJQC 2DWEC 4X89A 4QE7A 3UM7A 1R3JC 2BOBC 1OCOC 3HPLC 4MS2A 1P7BA 2IH3C 2A0LA 3K0DA 4H33A 3T4ZA 4BW5A 2EIMC 4MTFA 2P7TC 3IGAC 4LCUC 3RW0A 5EC1C 3SPIA 4R8CA 2DYRC 4X8AA 4MW3A 3TETA 2HJFC 3OUSA 5EBWC 1OCCC 3K04A 1G4YB 4KFMA 4HZ3A 3ABLC 5B3SC 5EK0A 4OXSA 2ZD9A 2JK5C 4GX5A 2Q68A 2DYSC 2ATKC 3LDDA 3FB6C 4RUEA 3WG7C 2WLHA 4PA6A 1ZWIC 4PDLA 5KUKA 3E83A 4R6ZA 4H37A 2EILC 2YEVA 3SPGA 1LNQA 2EINC 4J9YB 3K0GA 4MVMA 4QE9A 1OCZC 3SPCA 3VOUA 4JTDB 4RO2A 5EBMC 2EIKC 2A9HA 2Q67A 4PDMA 2HG5C 3F7YC 1OCRC 4R7CA 4MTGA 4HYOA 4WFFA 4XDJA 3ABKC 4G28B 4G27B 3SYCA 1S5HC 4F4LA 4P9PA 2K1EA 3ZJZA 2IH1C 3GB7C 2Q6AA 2WLJA 4UUJC 2W0FC 3KG2A 2HVKC 1K4CC 3AG4C 3ASOC 5KUMA 5B1AC 5BZBA 4JTAB 3K03A 3E89A 4R50A 4JTCB 5CBGA 2ZXWC 4LP8A 1XL6A 2HVJC 4MVZA 2QKSA 4EKWA 4WFEA 1ORQC 3RVYA 2OCCC 4MVOA 1M57C 3JYCA 4PA7A 2WLIA 4WFGA 4RAIA 3X2QC 2Y69C 3E8FA 3E8BA 3IFXA 4WFHA 3LNMB 1K4DC 2NLJC 1R3LC 3ASNC 4J9ZB 4MVRA 4PA9A 3SYOA 4CBCA 3SYPA 4ZBMA 1BL8A 3BEHA 3FB8C 3STLC 3E86A 3K08A 4P9OA 3T1CA 5CBFA 2WLLA 5EBLC 3SYQA 4I9WA 1KKDA 3K06A 2X6BA 1V54C 2X6AA 3ZRSA 3OUFA 1QLEC 4MSWC 4P30A 4XDLA 2DWDC 4P2ZA 3LUTB 3OR7C 2WLIB 2KB1A 3RVZA 4MVQA 1R3KC 1M56C 2WLKA 4MVUA 4PA4A 2BOCC 3F7VC 4DXWA 2H8PC 3TCUA 3T4DA 3FB5C 1V55C 3LDCA 3OR6C 2AHZA 3PJSK 2WLLB 4PDVA 4MVSA 1R3IC 3STZC
chains in the Genus database with same CATH superfamily
1IBKB 3THOA 2CTQA 3CWBH 1G8MA 2OT5A 5J9PC 1CP9A 1FXKC 1RSOA 5LP6B 4FIPC 1Q7YW 2QEXV 3AG2C 1WB7A 3OTOB 2YIBA 4DV7B 3QF7A 4X89A 2YXHA 2BOBC 3D3QA 1P7BA 4BW5A 1VF6A 3CMEV 4LCUC 1SS3A 1AJNA 1S5JA 3FX7A 2GTSA 3HKBA 1SQPH 2H94A 2AXTZ 1FXHA 2JK5C 1KMIZ 2IU3A 4JF3A 5KUKA 3CC2V 1KBHA 4X1IB 4PELA 1I94B 3FAVB 1S0VA 3RYIB 3JCUZ 1QU7A 1GN4A 2DYSB 1AJQA 1FFTB 2ZE6A 1S5HC 4P9PA 3UO3A 1X59A 3OEHG 3CRRA 3P30A 4BIZA 3P3PA 5FLXN 1XL6A 5C93A 3K3WA 1COWG 5IJ0B 4LF5O 3ASOB 3CCUV 5CA1B 1VQPV 1JFFA 4F6RA 1NTZH 1O9GA 4DR3O 2IBZH 1KKDA 2OCCB 1L1FA 4UVCA 4XDLA 2GBOA 1Z2GA 3OE7G 4JI3O 4DR6O 4JAUA 4LF8O 1K34A 1N34O 2VS0A 2QKCA 3QG5A 2KKWA 4AQYO 1BHBA 4NB5A 4X20A 3ZN0A 1FJGO 3E22B 1YXBA 1EFRG 4I9QA 1M56B 3G4SV 3JSLA 3H9VA 5B1BC 4B3TO 5EYPA 4IIJB 5KA5A 5H5NA 4CH6A 2RDCA 3B40A 1G6UA 4QE7A 5LHIA 2DW4A 4I5SA 4AI8A 2Y0PA 4B3MB 1YVWA 4DV6B 1SETA 3AEIA 4J7KA 5BMVB 4TUYB 1J5EO 3G6BA 2BTOA 1NT2B 5LXTB 5B3SC 4OXSA 3JD2A 3W7WA 3D36C 4GX5A 2Q68A 2CTWA 2DYRB 3LSQA 4X65B 1Y4MA 3A0HZ 5CMUA 1BCCH 3P32A 5JCOA 1NI8A 4J42A 4YJ2A 1BGYH 2ZINA 3CCRV 1E79G 3MD0A 2GUZB 4WFFA 4FJCC 2D3OW 1Q90D 1A32A 2BSKB 1SQXH 1K73W 3GB7C 1AB3A 5IJ9B 4FLXA 1JA8A 1WA8B 4NYKA 3CCMV 1Y67A 2W0XA 3L71H 4JI7B 5GONA 2QKSA 1E1RG 5C8YB 1NR1A 1M57C 4NXNO 1D5AA 2XAHA 4DR5B 1KU9A 3CMAV 1FYJA 1PPJH 5IYCO 5CA0B 4DV5O 1MABG 3T1YB 2LO1A 3ETGA 1QQCA 2VRZA 2F66C 2Q0OC 3Q4HB 3DC5A 3TGUH 2ZKOA 2UUAB 4MVUA 1IBMB 4DV0O 1H2LA 4K8ZA 4JI8B 2YSUB 5FPRA 3JCZA 4K8XA 1HWYA 2DOSA 3LDEA 3HKCB 3K9SA 4FLUA 1PNLA 2AHYA 4LH6A 3ZIAG 4DUZO 3JARB 1KQSU 4IYHA 4FLVA 3FB7C 4YY3B 2UXCO 4GX1A 4B08A 2RNBA 2Z0AA 1JVMA 4N23A 1YIJV 5LHHA 3N2KA 2LJ2A 3CPWU 1QVGU 3TJTA 1SKVA 4PI0A 5EC1C 3B77A 2PF4E 1YCIA 3I55V 1HR0O 1B3QA 4TOIA 4MW3A 3TXQA 3TETA 3OUSA 3FFQA 2XAGA 2YIBD 4GLXA 3WB1A 3FB6C 4RUEA 2WLHA 4O4IA 2UU9B 1WJZA 3JAKB 2AZ2A 3OW2U 2LQTA 4I0XB 4UB6Z 1GRJA 1NH2B 3B8NA 4MTGA 4LFCB 2QWNB 2Y4UA 1ROPA 2F43G 1ZL8A 1EM1A 2IH1C 2EILB 1B06A 3C90A 4FFKA 3AG4C 1PD3A 4JTAB 3CC4V 2Q7GA 1NBMG 4X62O 5J2TB 1VMGA 4D7SA 3JYCA 2YC0A 2OWOA 4QGPA 2KG7A 1MG1A 2PZSA 3BEHA 4DRXB 5LGTA 3K06A 2OCHA 5L3CA 2XOKG 2PUSA 3G71V 3L70H 4B3SO 3B4SA 3CJHB 2ZE8A 5K1XA 2XUMA 1KC8W 5JVDB 3BY6A 1N32B 3BA9A 1W59A 4BWAA 4JYYA 3TK1A 3JAWB 3CRQA 4ABMA 3K5MA 3SPJA 5DEDA 3D3IA 4O2BA 4X1IA 5EZYB 2XAFA 3ML0A 3UQ8A 4PDRA 2WLNA 1IZ3A 2P06A 4L8JA 2L6LA 2QTOA 4RUFA 1XL4A 2EIJC 3OTOO 1OV9A 2XAJA 1TGOA 4DV7O 2LW7A 3BABA 4H33A 3GWOA 2LGQA 1FFXA 4O4JB 2YDEA 4JI1O 1HW7A 1H2GA 4C7UA 5IJ0A 1VARA 1FD9A 4OGQB 4TV9B 1IBLB 4JZ2A 4AILC 2X0LA 5E79Z 2MW2B 3WG7C 2A3QA 1GM7A 1I94O 2Q8VA 3HR0A 1WP8A 3ICXA 1QHTA 4PDMA 5AG2A 5JCOC 2QR4A 4G27B 3KG2A 2ZM6B 3A0BZ 1MOFA 5BZBA 4LWSB 1BQ0A 3E89A 2VQFB 1OCRB 1SZTA 3K9AA 2EJRA 4U3JA 1XNQB 3FD9A 1GH6A 3ETDA 4MVOA 3H1JH 1AR5A 2ZCEA 3KKYA 1K4DC 1SQGA 3DXRA 4GKJB 4JI4B 3SDLA 4Z1VA 1I08A 5H6RA 4K3AA 3CXCU 4WFBV 3OUFA 4MSWC 2NNUA 2ODMA 1Y74A 2ZT9B 2HP8A 3CEIA 3OR6C 4I4TA 3UO2A 1R3IC 3F5TA 4WF9V 2DJVA 1J95A 3SPHA 4NXNB 2QGNA 1PV0A 4CS2A 3O65A 1KECA 1NU1H 1RPRA 2V4DA 5D5QA 4BIOA 3TXSA 1NVPB 3ZCCA 1KUQA 3IJ4A 5GTHZ 3AG3C 5IJ9A 1P7GA 5IT9N 2F4VB 3VQXA 1OCOC 4DV0B 4B3MO 4DV6O 4MTFA 3AG1B 3MHSC 3CRCA 1F7YA 1K97A 4JYAB 5EBWC 2QWRB 5EIBC 3K04A 2JGDB 4HZ3A 2EIMB 1PL0A 1XEQA 1Y76B 3RYFB 4X65O 5LYJA 4LH7A 5A9GA 2LFRA 3K57A 5EIBD 4QE9A 2OIEA 3VOUA 4JTDB 2L35A 3K5OA 3M99B 1KP2A 1OZ0A 4XDJA 4YJ3A 4F4LA 4DK1A 1WB8A 2QTSA 3HKEA 1YEWA 1XILA 1YTFD 2Q6AA 2WLJA 1DK1A 5IYZB 3BVOA 4JI7O 1I0HA 2IJKA 4FZ1A 3ABKB 2WWWA 2HVJC 4FLYA 4JI0B 4DR5O 4WFGA 3RYCB 2LP7A 3E8BA 5B1AB 4IYIA 1S3JA 1S5LZ 4DYLA 5KHJA 1F23A 3FB8C 3T1CA 3K5NA 2IU0A 3T1YO 5CB4B 3SYQA 5J2UA 4CH5A 4LNUA 2Q5ZA 4NKGB 2DWDC 2Y69B 1I7FA 4P2ZA 2WLIB 4X1YA 2KB1A 2UUAO 3CCSV 3CE2A 3VQYA 2BOCC 1JOYA 3RYHA 2WSSG 3LDCA 4JI8O 3AK3A 3ZRWA 1NTKH 4X66O 2PY5A 1YJWV 3E35A 1SZXA 4PI2A 5LGUA 1N8RW 4JAAA 2XTAA 4DR1B 1W0JG 2D2CB 2YXLA 4MTOA 3ZHTA 4YY3O 5H2FZ 2A79B 3UKMA 4O4HB 2BE3A 1TUBB 3RBZA 1XDCA 4I50A 3A8TA 1JJ2U 1US6A 1P49A 5IY5B 2ZR2A 2EZOA 3QVNA 4X8AA 1OCCC 2FKXA 5B1OA 2HHHB 5KAFZ 2QM7A 3L75H 1S77D 2WAMA 4DRXA 5FNVA 1VQ5V 5LGNA 4K35A 2UU9O 1M4UA 2Y0IA 2YIDA 1VQ4V 5LL6Y 1YF2A 4DV2B 2CH7A 3ABLB 1R73A 1SQQH 1K7DA 2EIKC 4LFCO 2UXDB 5JVDA 4G28B 4JI1B 3ZEDA 4UUJC 2JS3A 1L0NH 2CGOA 1F4MA 2EINB 3W7TA 2Q9LA 1HNZB 3G67A 1UPGA 4MVZA 4OPHA 3IC7A 4J41A 1M5IA 3I5DA 1Q6IA 1VQKV 4B7KA 3X2QC 3IFXA 5JWPA 4TV8A 4X1KA 5BXZA 3JD3A 2OTLV 1VQ9V 3E86A 5FPOA 2WLLA 1V54C 2GHYA 4P30A 2AGAA 2QM8A 4IHJB 1S76D 3JASA 1KD1W 5D5PA 1BT8A 4ZI7B 1N32O 5JH7B 1QR9A 4MVSA 4BR6A 4EB6A 1IVSA 2IJJA 2Q0AA 3IAYA 1NR7A 5LOVA 4FMTA 3E8GA 3OGCC 1LR1A 1TVKB 4QPJA 3RFRA 1FS0G 3CRAA 3JD1A 2QSAA 3WFVA 5DM6V 3UT5A 1Z5WA 2FMLA 3ABMC 2X6CA 5FL7G 3SJQC 3W7SA 5ITZB 4UVAA 1RFYA 1FXKB 1EN6A 2HKOA 3HKDB 4UVBA 2ZIOA 2ADQB 3AG2B 4R8CA 4FFBB 3LSSA 4WBNB 2V7QG 3GWKC 4I55B 1IBLO 4GKKB 2CGNA 1R6TA 3CHXA 5KX5B 2CAZC 3OT7A 2X7RB 2IJHA 3LDDA 4PA6A 3CX5F 4HNAA 3JALB 2CK3G 2YEVA 4DUYB 4O4LA 4DR7B 3QO5A 4IGGA 1PNMA 3DTUB 4R7CA 4PHZA 1SA0A 2OYQA 2QWPB 2B1GA 1YDXA 4TSFG 1GM8A 4JASA 2ZM6O 1B6QA 5KUMA 4LF6O 3G80A 2MK3A 2VQFO 5JQGB 4R50A 3ETQA 1XNQO 3K59A 4O2AB 3OD4A 1SRYA 2ARHA 3CCVV 1F4NA 4JI4O 3ASNC 4GKJO 1URFA 3P3NA 1BL8A 3EXAA 1RM1C 3D8CA 4JAVA 2FYUH 1IDSA 1QLEC 3N2GB 2P90A 4YXWG 2WLKA 3ZX6A 3OMIB 1D5NA 2YI9A 2Z3YA 3FB5C 4UCRA 3BCCH 1AP5A 2M7WA 3UCSC 1IXMA 3RYFA 2E76B 2QWOB 3ZHUA 3L9DA 4YIPA 1GKFA 3DSQA 1H2SB 1MSDA 3W7UA 5JJNB 4XDKA 4JI6B 3JATA 4HBNA 3QNEA 2DQ0A 3S3WA 2QJ1A 1H8EG 1D2DA 2HFEC 3T2MA 1XMQO 2F4VO 1XQ8A 1AI4A 2ITCC 5IYZA 4ZOLA 3RT3C 4CS3A 1I5XA 5B1BB 3NXSA 2A0LA 4GYCB 4KXRA 2P7TC 1YI2V 3BFRA 1ZAUA 4Z2WA 4X66B 1XOUA 4JYAO 3ZS8C 3K58A 3DC6A 3M7MX 2UUCB 4TQDA 1SF9A 4H0LB 2QM4A 3E83A 3I56V 4H37A 4JV5B 4ZHQB 1N0NA 4LF4B 3K0GA 5B3SB 3H01A 2HG5C 4UV9A 1VF6C 2BTQB 1AP6A 4GT1A 5DN6G 5LMNO 1K8AW 2HVKC 3SGIA 5LA6B 5CBGA 2ZE5A 1PL4A 3QTCA 2ZNJA 4JI0O 3U10A 1GK9A 4E2LA 2G38A 4PA7A 4PA9A 2PI5A 3SYOA 3A2FA 3U0ZA 1VQ8V 2F23A 2X6AA 1M57B 4JI5B 3F7VC 1JR9A 5LP6A 2DMXA 2N04A 3ZMZA 2RN9A 2WA4A 4DV3B 2IJIA 2LGWA 2ZDIA 5EC2C 4DR1O 2JEUA 2Y48A 4GCZA 3EFFK 1JJOA 1L8DA 2KQXA 1RP3B 1GMGA 5HFLA 1VQOV 1H2NA 1V9PA 2EBOA 4AHCA 2EZPA 2H3OA 1RSOB 1E1QG 1Y6XA 2O57A 3FAVA 3RYIA 2HHHO 2Z5UA 3H1LH 4FM2A 1KYOF 4KFMA 2R70A 3ABTA 4U7NA 2KSDA 4CZZA 1EBOA 2ATKC 2NN4A 2ADPA 1NZ6A 3ZHRA 3DGEA 4DV2O 2E3CA 4LFBB 1LNQA 1XHZA 5TISZ 3HKBB 2UXDO 4DR4B 5HFMA 1XHXA 1VIBA 5CA1A 1HNZO 2PI4A 1EN4A 4L87A 1TA8A 3K03A 4NTYA 4LC1A 1TAEA 2YI8A 2HLDG 4J11A 3RVYA 1CEZA 5BR8B 3AG4B 2P67A 1WAZA 3APQA 4WFHA 1QVFU 1OHHG 4CBCA 4ZBMA 4Q20A 5CBFA 2IW5A 4FLWA 1MZFA 5EBLC 4JYBA 3E22A 1GN3A 1AR4A 3OR7C 1JQ0A 1NVPD 4WBNA 4LF6B 1YSCA 1Q43A 1JFFB 1XBLA 4F6RB 3R66A 5KX5A 1V55C 4K0KB 3PJSK 1QBZA 3STZC 1K33A 4IIJA 2ITDC 1T5EA 4UCVA 3JALA 4EFEA 1XI1A 3OGIB 1VQLV 4QIWF 3F5WC 4H44B 3CC7V 4PJ0Z 4KUMA 2ZXWB 2WLMA 1R6KA 4FZ0A 5JJEB 5KMGB 5CBHA 1EZJA 4X20B 3ZMVA 5BMVA 3L72H 4TUYA 1QNMA 5B66Z 5LXTA 3HPLC 2YICA 3K0DA 4JYCA 3T4ZA 1OJHA 2GDSA 5EYPB 4MT8A 3E2EA 2EIJB 4RWUA 5L3FA 3OFNG 4GKKO 2VQEB 2HEPA 2GUZA 2B5UA 2BSKA 1YHQV 4DUYO 4DR7O 2JRIA 2QWQB 1XMQB 1WA8A 2FL4A 4U3FH 4CC5A 1OCZC 3SPCA 2Y4TA 2CTPA 3F7YC 3WG7B 5C8YA 1G1XB 3SYCA 2JJ1G 2YIAA 5GW7A 4KL1A 1K4CC 3QO7A 1DF4A 5CA0A 1LUWA 3KCXA 3ZBHA 4YJ2B 1S72V 2PTMA 4EKWA 3H1KH 5LMUB 1N36B 3Q4HA 1YJ9V 4RAIA 1M93A 1NS1A 5IYDO 3OTFA 5IWAB 3STLC 1XUQA 1P4RA 3K08A 4LFAB 4XBFA 4I9WA 5GONB 5LMNB 3LUTB 3HKCA 4OX9B 3IC9A 4A5UB 3ZMUA 2H8PC 3TCUA 4Q6GA 3ETEA 3BAAA 4DO2A 1KKCA 3CCEV 3JARA 2LFSA 5LP6C 2QE7G 2E5LB 4GUNA 2N05A 3SYAA 2ETNA 2ZDIC 4JI6O 4LR3A 2F1MA 5LHGA 1CXZB 3U11A 3R65A 4DK0A 2BCCH 4YIOA 4OPAA 2FB5A 5KAIZ 2DWEC 5L3DA 3UM7A 1F51A 3KZIZ 4MS2A 4MTXA 2QDOA 3SJCC 1AI6A 4FVMA 4X64B 1AILA 3AG3B 3JAKA 3EVKA 2HJFC 4I0XA 1OCOB 3J7AU 3N2KB 2VWJA 5EK0A 4PD4F 1WNSA 2UUCO 4UB8Z 4DV1B 2DYSC 3VQVA 1ZWIC 1U97A 2UXBB 4JV5O 1HDJA 1VF7A 4LF4O 3SPGA 1W2BU 2IM9A 1NKDA 2Q73A 3CXHF 1AJPA 4RO2A 5EBMC 3WU2Z 2F93B 1HP8A 5J2TA 1HNWB 1YTFB 5BY1A 5F2VO 5L3EA 1JCHA 2YXYA 2N74A 1N0JA 4O4IB 4Z1MG 3ASOC 2Q7HA 2ILMA 2B1IA 1WP7A 2ZE7A 1DGSA 4EFBA 1MZEA 1Q5OA 3ABUA 4UV8A 1ORQC 2OCCC 1ZL8B 2GV9A 4JI2B 4BW9A 1PNKA 3SJAC 1N33B 1K5QA 3CJHA 3SJBC 5K1PA 3FYEB 3JAWA 1THZA 1XREA 1Q8IA 4JI5O 1CPYA 3WB2A 5EZYA 3RVZA 2A7WA 4DXWA 1M56C 2KG7B 3AK1A 4ZKIA 1U96A 2ZQMA 4PV1B 2AHZA 2P5OA 1KB9F 4UFZA 5KLVH 4DV3O 1L0LH 2YS8A 1GN6A 4X88A 4J10A 3CD6V 1QR8A 1ZX3A 3LSUA 4O4JA 2HR3A 3K79A 3PN1A 2QKAA 5A2QN 3FYIB 1PM9A 4O2BB 3JSNA 2ZIMA 2JS5A 4TV9A 1M1KW 1Q6UA 1KP3A 3IGAC 4WCEV 3SPIA 4J80A 2DYRC 1WLEA 2ZR3A 1JPXA 4RQFA 3CYOA 2B9ZA 2PYLA 3N27A 1FFXB 4NXMB 4LFBO 4R6ZA 1OCCB 1FPOA 5IYBO 1IURA 4LWSA 1ZSPA 4J7JA 4DR4O 2A9HA 4DR2O 4JGSA 3ZRXA 4YHHB 1K92A 3OAAG 3B2EE 1SC5B 2EIKB 2XHBA 3CRMA 1QCEA 1HNXO 3T1HO 2JGUA 5KMGA 3QO8A 4WFEA 2OTJV 5BR8O 2UXNA 4NTWA 1NJIW 3RWRD 3E8FA 1XMOB 1X4TA 4B3RB 4P9OA 3EHBB 3OMNB 1Z5VA 2FTKA 3MAQA 4CS4A 4U3JB 2AW9A 2CUGA 3X2QB 1AROP 1TUEB 2JDIG 4FPPA 3DXRB 5CN0A 4K0KO 1GO3F 1IX9A 1V54B 1WPXA 4X9QA 2OIGA 1R6NA 1Y74B 3JD4A 5GTIZ 2GSMB 3OM3B 3AK2A 2R9IA 1K9MW 4I4TB 4KHPB 3K5LA 4LBEC 4QJFB 2K9PA 2WPDG 3C3TA 2JGDA 4DV4B 1MNGA 1Y76A 1ZLZA 1ZUQA 1VP7A 4U7OA 3ABMB 2CDYA 4ZIBA 2VQEO 1SQBH 4FLTA 2XASA 2LW1A 5B5EZ 4TQFA 4UXNA 4PDLA 3VBBA 2RJZA 2EILC 1Q81W 2R72A 2F95B 3H1IH 4MVMA 1DTOA 2VWKA 1NH2D 4FK5C 3FKSG 4HYOA 4BAYA 1ENVA 3ZJZA 2GTAA 3ZN1A 3RYCA 4H13B 4CH3A 4QPKA 5LYJB 4DW0A 4DW1A 1VEWA 2UUBB 3B09A 2EJ7A 2R9AA 4J7ZA 3HB3B 1BMFG 3MDSA 2Q7EA 5CB4A 5LMUO 1N36O 4YJ3B 4WFAV 3HKEB 2WLIA 5KHIA 2YUAA 5IWAO 1H2MA 3SYPA 4LFAO 4LF7B 3ZMSA 4ASUG 2X6BA 4OX9O 1NTMH 3ASNB 1ZTEA 2W6JG 1RM1B 5L3BA 2CE4A 5KA6A 2RQ6A 1QLEB 2E5LO 1AI5A 4O4HA 5J2UB 4LF9B 4LNUB 1TUBA 1YJNV 1GM9A 4TT3G 4X1YB 2Q69A 4TWKA 3RYHB 1SQVH 4QNHB 4MW8A 3ZRWB 1XNRO 4GX0A 2XT9A 1AI7A 5CA3A 3BPZA 1R3JC 1FKAO 1EN5A 4UCUA 4IT5A 2HJDA 4X64O 3S3XA 1H38A 4I50B 1G4YB 3BA8A 1PP9H 4DV1O 2ZD9A 2DQ3A 2UXBO 1IXBA 4N21A 1WPBA 2AZ0A 3ZHSA 1MA1A 1HNWO 1AR1B 1OCRC 5FNVB 5KHGA 4I7ZB 3ZHQA 2NR5A 3CCLV 4GZRB 2CH7B 1YITV 2ZXWC 1SERA 4G2KA 1IBKO 4JI2O 4IHJA 1N33O 1Q6HA 3ZRVA 4LF5B 4UCSA 4MVRA 4ZI7A 5JH7A 3BRCA 3CCJV 4DR2B 4DR3B 2JIZG 1BHAA 2JJ2G 4F6EA 2DN9A 3A0RA 1TVKA 4DR6B 1LUVA 4MVQA 4JI3B 2PYJA 4TV8B 4LF8B 4X1KB 1N34B 1B04A 3AG7A 4CC6A 1HNXB 1BQZA 1H2KA 3T1HB 2WLLB 4PDVA 4AQYB 3M8AA 4ICGA 3G6EV 1FJGB 4FM1A 4PA3A 3RGBA 2P22C 1VQNV 5ITZA 5IDJA 3JASB 5E1AC 1MSWD 1FXKA 3HKDA 4BIUA 1NQTA 5IE9A 4B3TB 4FFBA 4EB6B 3AG1C 1I5YA 2E74B 5LOVB 4I55A 4E4EA 1P84F 1Q82W 2EIMC 1Y66A 3RW0A 3UT5B 3CP1A 2RMKB 3CS5A 3JAMN 3ZHVA 4W4LA 1J5EB 1GTOA 3J81N 2EULA 4NXMO 3VQWA 3SR2C 1M9NA 2P4KA 4J9YB 3ZMTA 2Q4PA 5JQGA 3KCYA 2P4VA 4RQEA 2Q67A 1SESA 3ABKC 3OMAB 4O2AA 2K1EA 4YHHO 4HNAB 2W0FC 2YEVB 4O4LB 1BS3A 5B1AC 1SQFA 1RPOA 4JTCB 4LP8A 2DE0X 1SA0B 2A06H 1VQ6V 3N2GA 1FAFA 3C3SA 4D7TA 1K5SA 2RCVA 1UJWB 2C2AA 1XMOO 4W4KA 2Y69C 1FXVA 4J9ZB 1R3LC 1BSMA 4B3RO 3W7XA 4DV5B 3L74H 3ZRSA 1AVMA 4FLZA 5DECA 1R3KC 4PA4A 5JJJB 2M6YA 3OEEG 3RN4A 3O9OA 1O9HA 3WB0A 4CH4A 5KHKA 1VQ7V 1EZVH 1YZBA 1VQMV 1VF5B 1DF5A 3E8HA 3B8MA 4UCTA 4GX2A 1V55B 1BE3H 4B7EA 4KHPO 1W0KG 1JX9A 4EEQA 3GVMA 4DUZB 2R9RB 3NR7A 5IY5C 2PGGA 4NVPA 4DV4O 2UXCB 1GAXA 1K3EA 5B1NA 2IH3C 1UFIA 1M90W 3MHHC 3L73H 2P6JA 4UCOA 2EX3A 3CSXA 3JATB 1Q86W 1WN7A 4HAMA 1BZKA 5LBQA 4ZHQA 1HR0B 4FM0A 5H9CA 5H6QA 2XAQA 4ZOLB 3D36A 3ABLC 2BTQA 1PKXA 4IL6Z 1XNRB 3BHPA 4NR1A 2EINC 5LA6A 3LNNA 4JZGA 3J80N 2QA4V 2W6IG 1MMMA 1OCZB 2UUBO 2XNDG 1R1BA 1IBMO 2WA3A 1N4CA 5KHHA 4X62B 3CB2A 1QLNA 2JVDA 2E75B 3CCQV 2ZNIA 3LNMB 2NLJC 3APOA 4LF7O 4D6TH 1DLBA 4JPRA 2UXXA 4KP4A 1H8HG 2V1DA 1JMKC 2CTRA 4NTXA 3H1HH 5L3GA 4B3SB 3T4DA 1GN2A 2JEXA 1Q3EA 3JD0A 4LF9O
chains in the Genus database with same CATH topology
4WF9V 2IJIA 3SPHA 1J95A 1R6NA 2ZDIA 1G8MA 2OT5A 3JD4A 1KECA 2GSMB 5EC2C 1RPRA 5J9PC 1CP9A 2JEUA 2Y48A 1FXKC 3OM3B 4GCZA 2R9IA 3EFFK 1K9MW 1NVPB 3ZCCA 4FIPC 1Q7YW 2QEXV 4LBEC 3AG2C 1GMGA 4QJFB 5HFLA 2WPDG 3AG3C 4X89A 2BOBC 1VQOV 1OCOC 2EBOA 1P7BA 2EZPA 4BW5A 3CMEV 4MTFA 4LCUC 3AG1B 3MHSC 1E1QG 1AJNA 4U7OA 3ABMB 1K97A 5EBWC 2Z5UA 3K04A 4KFMA 3ABTA 4HZ3A 4U7NA 2EIMB 2H94A 1PL0A 2XASA 1FXHA 2JK5C 4CZZA 2IU3A 4JF3A 1EBOA 2ATKC 4UXNA 4PDLA 5KUKA 3CC2V 3DGEA 3VBBA 2EILC 4PELA 1Q81W 1LNQA 1S0VA 2LFRA 4MVMA 1DTOA 4QE9A 3VOUA 4JTDB 3M99B 2DYSB 1NH2D 1KP2A 4FK5C 1AJQA 3FKSG 4HYOA 1FFTB 1OZ0A 4XDJA 4BAYA 4F4LA 1ENVA 1S5HC 4P9PA 3ZJZA 5HFMA 3ZN1A 1YTFD 2Q6AA 2WLJA 4QPKA 3OEHG 2PI4A 4L87A 3K03A 2IJKA 3P30A 4BIZA 3HB3B 1BMFG 4LC1A 3ABKB 2WWWA 1XL6A 2HVJC 2HLDG 5C93A 3K3WA 3RVYA 1COWG 4WFAV 1CEZA 4WFGA 2WLIA 3AG4B 3ASOB 2P67A 2LP7A 3CCUV 3E8BA 4WFHA 5B1AB 1VQPV 1QVFU 1OHHG 1S3JA 4CBCA 3SYPA 1F23A 4ZBMA 4Q20A 5CBFA 3FB8C 3T1CA 2IW5A 5EBLC 2IU0A 3ZMSA 4JYBA 3SYQA 4ASUG 1KKDA 2OCCB 2X6BA 1L1FA 4UVCA 4XDLA 2DWDC 2Y69B 4P2ZA 3OE7G 3OR7C 1JQ0A 2WLIB 1NVPD 2KB1A 3ASNB 4JAUA 1K34A 1YSCA 3CCSV 2W6JG 2BOCC 1JOYA 1RM1B 5L3BA 2WSSG 1V55C 3LDCA 5KA6A 3PJSK 1BHBA 1QBZA 3STZC 3ZN0A 1K33A 3ZRWA 1QLEB 2ITDC 1AI5A 1YJNV 1YJWV 1EFRG 3E35A 1VQLV 4QIWF 3F5WC 1GM9A 4TT3G 1M56B 3CC7V 4KUMA 2ZXWB 3G4SV 2Q69A 5LGUA 1N8RW 2WLMA 1R6KA 4TWKA 5B1BC 4QNHB 1W0JG 4MTOA 5CBHA 1EZJA 4MW8A 3ZRWB 3ZMVA 2A79B 3UKMA 5KA5A 4GX0A 3RBZA 1AI7A 5CA3A 4QE7A 5LHIA 2DW4A 1JJ2U 1R3JC 3HPLC 3K0DA 4I5SA 4JYCA 3T4ZA 4MT8A 3E2EA 1SETA 5IY5B 2EIJB 2ZR2A 3AEIA 2EZOA 5L3FA 3OFNG 1H38A 4X8AA 1OCCC 1G4YB 5B1OA 5B3SC 2QM7A 1S77D 2WAMA 3JD2A 4OXSA 3W7WA 2ZD9A 2B5UA 4GX5A 2Q68A 1VQ5V 5LGNA 2DQ3A 2DYRB 3LSQA 1YHQV 4N21A 1Y4MA 1VQ4V 5CMUA 3P32A 1OCZC 3ABLB 1R73A 3SPCA 1K7DA 2EIKC 3F7YC 1OCRC 1E79G 3MD0A 3WG7B 1AR1B 4WFFA 3CCRV 4FJCC 2D3OW 4G28B 3SYCA 2JJ1G 1K73W 3GB7C 4UUJC 5GW7A 1F4MA 2EINB 3W7TA 1K4CC 3QO7A 3CCLV 1DF4A 3CCMV 1YITV 2ZXWC 1S72V 4MVZA 2QKSA 4EKWA 1E1RG 1SERA 3IC7A 4G2KA 1NR1A 1M57C 1VQKV 1YJ9V 4RAIA 3X2QC 2XAHA 3IFXA 3ZRVA 3CMAV 5IYDO 4MVRA 3JD3A 5IYCO 3STLC 1VQ9V 3E86A 1P4RA 3K08A 3CCJV 2OTLV 1MABG 2WLLA 4XBFA 4I9WA 2JIZG 1V54C 3ETGA 1BHAA 2JJ2G 2GHYA 4P30A 2QM8A 3LUTB 1S76D 3A0RA 1KD1W 4MVQA 4MVUA 3ZMUA 2H8PC 3TCUA 3ETEA 1QR9A 4DO2A 3CCEV 2WLLB 4PDVA 4MVSA 2LFSA 2YSUB 2IJJA 3JCZA 3G6EV 2QE7G 1HWYA 1NR7A 4PA3A 1VQNV 3LDEA 4FMTA 3E8GA 3OGCC 3SYAA 5IDJA 4QPJA 5E1AC 1MSWD 1FS0G 1FXKA 2ZDIC 3JD1A 1PNLA 2AHYA 4BIUA 5LHGA 1NQTA 3WFVA 5DM6V 3ZIAG 3R65A 1KQSU 3AG1C 3FB7C 1I5YA 4GX1A 3ABMC 2X6CA 1JVMA 4N23A 5FL7G 3SJQC 1YIJV 3W7SA 1Q82W 2DWEC 5LHHA 4UVAA 5L3DA 3UM7A 3CPWU 1QVGU 1F51A 1FXKB 2HKOA 4MS2A 4MTXA 2EIMC 1Y66A 4UVBA 1AI6A 3RW0A 5EC1C 3B77A 3AG2B 3CP1A 4R8CA 3I55V 3AG3B 3LSSA 4MW3A 3TETA 2HJFC 3OUSA 2V7QG 1GTOA 1OCOB 2XAGA 5EK0A 2X7RB 2DYSC 2IJHA 3LDDA 3FB6C 4RUEA 2WLHA 4PA6A 1ZWIC 2CK3G 2YEVA 1M9NA 3SPGA 1W2BU 3QO5A 4J9YB 1NKDA 3ZMTA 3OW2U 1AJPA 4RO2A 5EBMC 1NH2B 4RQEA 2Q67A 1PNMA 3DTUB 4R7CA 3B8NA 1SESA 4MTGA 1ROPA 3ABKC 3OMAB 2F43G 1YTFB 5L3EA 2K1EA 2B1GA 1JCHA 2IH1C 2EILB 1GM8A 4TSFG 4JASA 2W0FC 1B6QA 3AG4C 2YEVB 3ASOC 5KUMA 1PD3A 2MK3A 4Z1MG 5B1AC 4JTAB 1RPOA 2B1IA 4R50A 4JTCB 3CC4V 1NBMG 4LP8A 3ABUA 4UV8A 1VQ6V 1ORQC 2OCCC 1K5SA 1UJWB 3JYCA 2C2AA 1SRYA 2Y69C 1PNKA 3CCVV 1F4NA 1K5QA 1FXVA 3ASNC 1R3LC 4J9ZB 1MG1A 1BL8A 3BEHA 1RM1C 3W7XA 3FYEB 5LGTA 3K06A 4JAVA 3ZRSA 1THZA 5L3CA 2XOKG 1QLEC 1CPYA 3G71V 3RVZA 2P90A 1R3KC 1M56C 2WLKA 4PA4A 4YXWG 3OMIB 4DXWA 1KC8W 2Z3YA 4ZKIA 3FB5C 2ZQMA 3BY6A 3OEEG 2AHZA 2M7WA 1VQ7V 1IXMA 3TK1A 1VQMV 1DF5A 3E8HA 3SPJA 3B8MA 4X88A 3D3IA 4GX2A 2XAFA 3ML0A 3CD6V 1GKFA 1QR8A 3W7UA 1V55B 4PDRA 2WLNA 4XDKA 1W0KG 2QTOA 3QNEA 2DQ0A 2HR3A 1JX9A 4RUFA 2R9RB 3K79A 1XL4A 1H8EG 2EIJC 5IY5C 2XAJA 2HFEC 3T2MA 3FYIB 2ITCC 1AI4A 1K3EA 1I5XA 5B1BB 5B1NA 3NXSA 1M1KW 2IH3C 2A0LA 4H33A 1M90W 3GWOA 3MHHC 2P6JA 1KP3A 2P7TC 3IGAC 4WCEV 1YI2V 3SPIA 4HAMA 1Q86W 1H2GA 2DYRC 1WLEA 5LBQA 2ZR3A 1JPXA 4RQFA 5H9CA 3CYOA 5H6QA 2XAQA 3D36A 3ABLC 2X0LA 1PKXA 3WG7C 1GM7A 3E83A 4R6ZA 3I56V 4H37A 1OCCB 5IYBO 2EINC 3K0GA 5B3SB 3H01A 2A9HA 4PDMA 2HG5C 4UV9A 4G27B 4JGSA 2QA4V 2W6IG 4GT1A 3ZRXA 5DN6G 1K92A 3KG2A 3OAAG 1K8AW 2HVKC 1OCZB 1MOFA 2XNDG 5BZBA 2EIKB 3E89A 1QCEA 1OCRB 1SZTA 5CBGA 3K9AA 2EJRA 3QO8A 4WFEA 2OTJV 1QLNA 1GK9A 3ETDA 4E2LA 2UXNA 4MVOA 4PA7A 1NJIW 3E8FA 3CCQV 3LNMB 1K4DC 2NLJC 4PA9A 2PI5A 3SYOA 4P9OA 1VQ8V 1DLBA 3EHBB 3OMNB 4JPRA 5H6RA 2FTKA 2X6AA 1M57B 3CXCU 4WFBV 3OUFA 4MSWC 2NNUA 2UXXA 3X2QB 1AROP 1TUEB 1H8HG 2JDIG 2V1DA 4KP4A 4FPPA 3F7VC 5L3GA 5CN0A 3T4DA 1GO3F 3OR6C 2JEXA 3JD0A 1V54B 1WPXA 1R3IC 3ZMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITD C;  3E8H A;  4PA3 A;  3SPJ A;  3LDE A;  4X88 A;  3SPH A;  1J95 A;  3F5W C;  3E8G A;  3OGC C;  3SYA A;  4GX2 A;  5E1A C;  2Q69 A;  5EC2 C;  4PDR A;  2WLM A;  5J9P C;  4TWK A;  2AHY A;  2WLN A;  4XDK A;  5B1B C;  4QNH B;  3EFF K;  4MTO A;  2QTO A;  3R65 A;  5CBH A;  4MW8 A;  4RUF A;  2R9R B;  3AG1 C;  3FB7 C;  2A79 B;  3UKM A;  4LBE C;  1XL4 A;  3AG2 C;  2EIJ C;  5IY5 C;  4GX0 A;  4GX1 A;  3ABM C;  2HFE C;  3AG3 C;  2X6C A;  1JVM A;  3T2M A;  3RBZ A;  2ITC C;  3SJQ C;  2DWE C;  4X89 A;  4QE7 A;  3UM7 A;  1R3J C;  2BOB C;  1OCO C;  3HPL C;  4MS2 A;  1P7B A;  2IH3 C;  2A0L A;  3K0D A;  4H33 A;  3T4Z A;  4BW5 A;  2EIM C;  4MTF A;  2P7T C;  3IGA C;  4LCU C;  3RW0 A;  5EC1 C;  3SPI A;  4R8C A;  2DYR C;  4X8A A;  4MW3 A;  3TET A;  2HJF C;  3OUS A;  5EBW C;  1OCC C;  3K04 A;  1G4Y B;  4KFM A;  4HZ3 A;  3ABL C;  5B3S C;  5EK0 A;  4OXS A;  2ZD9 A;  2JK5 C;  4GX5 A;  2Q68 A;  2DYS C;  2ATK C;  3LDD A;  3FB6 C;  4RUE A;  3WG7 C;  2WLH A;  4PA6 A;  1ZWI C;  4PDL A;  5KUK A;  3E83 A;  4R6Z A;  4H37 A;  2EIL C;  2YEV A;  3SPG A;  1LNQ A;  2EIN C;  4J9Y B;  3K0G A;  4MVM A;  4QE9 A;  1OCZ C;  3SPC A;  3VOU A;  4JTD B;  4RO2 A;  5EBM C;  2EIK C;  2A9H A;  2Q67 A;  4PDM A;  2HG5 C;  3F7Y C;  1OCR C;  4R7C A;  4MTG A;  4HYO A;  4WFF A;  4XDJ A;  3ABK C;  4G28 B;  4G27 B;  3SYC A;  1S5H C;  4F4L A;  4P9P A;  2K1E A;  3ZJZ A;  2IH1 C;  3GB7 C;  2Q6A A;  2WLJ A;  4UUJ C;  2W0F C;  3KG2 A;  2HVK C;  1K4C C;  3AG4 C;  3ASO C;  5KUM A;  5B1A C;  5BZB A;  4JTA B;  3K03 A;  3E89 A;  4R50 A;  4JTC B;  5CBG A;  2ZXW C;  4LP8 A;  1XL6 A;  2HVJ C;  4MVZ A;  2QKS A;  4EKW A;  4WFE A;  1ORQ C;  3RVY A;  2OCC C;  4MVO A;  1M57 C;  3JYC A;  4PA7 A;  2WLI A;  4WFG A;  4RAI A;  3X2Q C;  2Y69 C;  3E8F A;  3E8B A;  3IFX A;  4WFH A;  3LNM B;  1K4D C;  2NLJ C;  1R3L C;  3ASN C;  4J9Z B;  4MVR A;  4PA9 A;  3SYO A;  4CBC A;  3SYP A;  4ZBM A;  1BL8 A;  3BEH A;  3FB8 C;  3STL C;  3E86 A;  3K08 A;  4P9O A;  3T1C A;  5CBF A;  2WLL A;  5EBL C;  3SYQ A;  4I9W A;  1KKD A;  3K06 A;  2X6B A;  1V54 C;  2X6A A;  3ZRS A;  3OUF A;  1QLE C;  4MSW C;  4P30 A;  4XDL A;  2DWD C;  4P2Z A;  3LUT B;  3OR7 C;  2WLI B;  2KB1 A;  3RVZ A;  4MVQ A;  1R3K C;  1M56 C;  2WLK A;  4MVU A;  4PA4 A;  2BOC C;  3F7V C;  4DXW A;  2H8P C;  3TCU A;  3T4D A;  3FB5 C;  1V55 C;  3LDC A;  3OR6 C;  2AHZ A;  3PJS K;  2WLL B;  4PDV A;  4MVS A;  1R3I C;  3STZ C; 
#chains in the Genus database with same CATH topology
 1IBK B;  3THO A;  2CTQ A;  3CWB H;  1G8M A;  2OT5 A;  5J9P C;  1CP9 A;  1FXK C;  1RSO A;  5LP6 B;  4FIP C;  1Q7Y W;  2QEX V;  3AG2 C;  1WB7 A;  3OTO B;  2YIB A;  4DV7 B;  3QF7 A;  4X89 A;  2YXH A;  2BOB C;  3D3Q A;  1P7B A;  4BW5 A;  1VF6 A;  3CME V;  4LCU C;  1SS3 A;  1AJN A;  1S5J A;  3FX7 A;  2GTS A;  3HKB A;  1SQP H;  2H94 A;  2AXT Z;  1FXH A;  2JK5 C;  1KMI Z;  2IU3 A;  4JF3 A;  5KUK A;  3CC2 V;  1KBH A;  4X1I B;  4PEL A;  1I94 B;  3FAV B;  1S0V A;  3RYI B;  3JCU Z;  1QU7 A;  1GN4 A;  2DYS B;  1AJQ A;  1FFT B;  2ZE6 A;  1S5H C;  4P9P A;  3UO3 A;  1X59 A;  3OEH G;  3CRR A;  3P30 A;  4BIZ A;  3P3P A;  5FLX N;  1XL6 A;  5C93 A;  3K3W A;  1COW G;  5IJ0 B;  4LF5 O;  3ASO B;  3CCU V;  5CA1 B;  1VQP V;  1JFF A;  4F6R A;  1NTZ H;  1O9G A;  4DR3 O;  2IBZ H;  1KKD A;  2OCC B;  1L1F A;  4UVC A;  4XDL A;  2GBO A;  1Z2G A;  3OE7 G;  4JI3 O;  4DR6 O;  4JAU A;  4LF8 O;  1K34 A;  1N34 O;  2VS0 A;  2QKC A;  3QG5 A;  2KKW A;  4AQY O;  1BHB A;  4NB5 A;  4X20 A;  3ZN0 A;  1FJG O;  3E22 B;  1YXB A;  1EFR G;  4I9Q A;  1M56 B;  3G4S V;  3JSL A;  3H9V A;  5B1B C;  4B3T O;  5EYP A;  4IIJ B;  5KA5 A;  5H5N A;  4CH6 A;  2RDC A;  3B40 A;  1G6U A;  4QE7 A;  5LHI A;  2DW4 A;  4I5S A;  4AI8 A;  2Y0P A;  4B3M B;  1YVW A;  4DV6 B;  1SET A;  3AEI A;  4J7K A;  5BMV B;  4TUY B;  1J5E O;  3G6B A;  2BTO A;  1NT2 B;  5LXT B;  5B3S C;  4OXS A;  3JD2 A;  3W7W A;  3D36 C;  4GX5 A;  2Q68 A;  2CTW A;  2DYR B;  3LSQ A;  4X65 B;  1Y4M A;  3A0H Z;  5CMU A;  1BCC H;  3P32 A;  5JCO A;  1NI8 A;  4J42 A;  4YJ2 A;  1BGY H;  2ZIN A;  3CCR V;  1E79 G;  3MD0 A;  2GUZ B;  4WFF A;  4FJC C;  2D3O W;  1Q90 D;  1A32 A;  2BSK B;  1SQX H;  1K73 W;  3GB7 C;  1AB3 A;  5IJ9 B;  4FLX A;  1JA8 A;  1WA8 B;  4NYK A;  3CCM V;  1Y67 A;  2W0X A;  3L71 H;  4JI7 B;  5GON A;  2QKS A;  1E1R G;  5C8Y B;  1NR1 A;  1M57 C;  4NXN O;  1D5A A;  2XAH A;  4DR5 B;  1KU9 A;  3CMA V;  1FYJ A;  1PPJ H;  5IYC O;  5CA0 B;  4DV5 O;  1MAB G;  3T1Y B;  2LO1 A;  3ETG A;  1QQC A;  2VRZ A;  2F66 C;  2Q0O C;  3Q4H B;  3DC5 A;  3TGU H;  2ZKO A;  2UUA B;  4MVU A;  1IBM B;  4DV0 O;  1H2L A;  4K8Z A;  4JI8 B;  2YSU B;  5FPR A;  3JCZ A;  4K8X A;  1HWY A;  2DOS A;  3LDE A;  3HKC B;  3K9S A;  4FLU A;  1PNL A;  2AHY A;  4LH6 A;  3ZIA G;  4DUZ O;  3JAR B;  1KQS U;  4IYH A;  4FLV A;  3FB7 C;  4YY3 B;  2UXC O;  4GX1 A;  4B08 A;  2RNB A;  2Z0A A;  1JVM A;  4N23 A;  1YIJ V;  5LHH A;  3N2K A;  2LJ2 A;  3CPW U;  1QVG U;  3TJT A;  1SKV A;  4PI0 A;  5EC1 C;  3B77 A;  2PF4 E;  1YCI A;  3I55 V;  1HR0 O;  1B3Q A;  4TOI A;  4MW3 A;  3TXQ A;  3TET A;  3OUS A;  3FFQ A;  2XAG A;  2YIB D;  4GLX A;  3WB1 A;  3FB6 C;  4RUE A;  2WLH A;  4O4I A;  2UU9 B;  1WJZ A;  3JAK B;  2AZ2 A;  3OW2 U;  2LQT A;  4I0X B;  4UB6 Z;  1GRJ A;  1NH2 B;  3B8N A;  4MTG A;  4LFC B;  2QWN B;  2Y4U A;  1ROP A;  2F43 G;  1ZL8 A;  1EM1 A;  2IH1 C;  2EIL B;  1B06 A;  3C90 A;  4FFK A;  3AG4 C;  1PD3 A;  4JTA B;  3CC4 V;  2Q7G A;  1NBM G;  4X62 O;  5J2T B;  1VMG A;  4D7S A;  3JYC A;  2YC0 A;  2OWO A;  4QGP A;  2KG7 A;  1MG1 A;  2PZS A;  3BEH A;  4DRX B;  5LGT A;  3K06 A;  2OCH A;  5L3C A;  2XOK G;  2PUS A;  3G71 V;  3L70 H;  4B3S O;  3B4S A;  3CJH B;  2ZE8 A;  5K1X A;  2XUM A;  1KC8 W;  5JVD B;  3BY6 A;  1N32 B;  3BA9 A;  1W59 A;  4BWA A;  4JYY A;  3TK1 A;  3JAW B;  3CRQ A;  4ABM A;  3K5M A;  3SPJ A;  5DED A;  3D3I A;  4O2B A;  4X1I A;  5EZY B;  2XAF A;  3ML0 A;  3UQ8 A;  4PDR A;  2WLN A;  1IZ3 A;  2P06 A;  4L8J A;  2L6L A;  2QTO A;  4RUF A;  1XL4 A;  2EIJ C;  3OTO O;  1OV9 A;  2XAJ A;  1TGO A;  4DV7 O;  2LW7 A;  3BAB A;  4H33 A;  3GWO A;  2LGQ A;  1FFX A;  4O4J B;  2YDE A;  4JI1 O;  1HW7 A;  1H2G A;  4C7U A;  5IJ0 A;  1VAR A;  1FD9 A;  4OGQ B;  4TV9 B;  1IBL B;  4JZ2 A;  4AIL C;  2X0L A;  5E79 Z;  2MW2 B;  3WG7 C;  2A3Q A;  1GM7 A;  1I94 O;  2Q8V A;  3HR0 A;  1WP8 A;  3ICX A;  1QHT A;  4PDM A;  5AG2 A;  5JCO C;  2QR4 A;  4G27 B;  3KG2 A;  2ZM6 B;  3A0B Z;  1MOF A;  5BZB A;  4LWS B;  1BQ0 A;  3E89 A;  2VQF B;  1OCR B;  1SZT A;  3K9A A;  2EJR A;  4U3J A;  1XNQ B;  3FD9 A;  1GH6 A;  3ETD A;  4MVO A;  3H1J H;  1AR5 A;  2ZCE A;  3KKY A;  1K4D C;  1SQG A;  3DXR A;  4GKJ B;  4JI4 B;  3SDL A;  4Z1V A;  1I08 A;  5H6R A;  4K3A A;  3CXC U;  4WFB V;  3OUF A;  4MSW C;  2NNU A;  2ODM A;  1Y74 A;  2ZT9 B;  2HP8 A;  3CEI A;  3OR6 C;  4I4T A;  3UO2 A;  1R3I C;  3F5T A;  4WF9 V;  2DJV A;  1J95 A;  3SPH A;  4NXN B;  2QGN A;  1PV0 A;  4CS2 A;  3O65 A;  1KEC A;  1NU1 H;  1RPR A;  2V4D A;  5D5Q A;  4BIO A;  3TXS A;  1NVP B;  3ZCC A;  1KUQ A;  3IJ4 A;  5GTH Z;  3AG3 C;  5IJ9 A;  1P7G A;  5IT9 N;  2F4V B;  3VQX A;  1OCO C;  4DV0 B;  4B3M O;  4DV6 O;  4MTF A;  3AG1 B;  3MHS C;  3CRC A;  1F7Y A;  1K97 A;  4JYA B;  5EBW C;  2QWR B;  5EIB C;  3K04 A;  2JGD B;  4HZ3 A;  2EIM B;  1PL0 A;  1XEQ A;  1Y76 B;  3RYF B;  4X65 O;  5LYJ A;  4LH7 A;  5A9G A;  2LFR A;  3K57 A;  5EIB D;  4QE9 A;  2OIE A;  3VOU A;  4JTD B;  2L35 A;  3K5O A;  3M99 B;  1KP2 A;  1OZ0 A;  4XDJ A;  4YJ3 A;  4F4L A;  4DK1 A;  1WB8 A;  2QTS A;  3HKE A;  1YEW A;  1XIL A;  1YTF D;  2Q6A A;  2WLJ A;  1DK1 A;  5IYZ B;  3BVO A;  4JI7 O;  1I0H A;  2IJK A;  4FZ1 A;  3ABK B;  2WWW A;  2HVJ C;  4FLY A;  4JI0 B;  4DR5 O;  4WFG A;  3RYC B;  2LP7 A;  3E8B A;  5B1A B;  4IYI A;  1S3J A;  1S5L Z;  4DYL A;  5KHJ A;  1F23 A;  3FB8 C;  3T1C A;  3K5N A;  2IU0 A;  3T1Y O;  5CB4 B;  3SYQ A;  5J2U A;  4CH5 A;  4LNU A;  2Q5Z A;  4NKG B;  2DWD C;  2Y69 B;  1I7F A;  4P2Z A;  2WLI B;  4X1Y A;  2KB1 A;  2UUA O;  3CCS V;  3CE2 A;  3VQY A;  2BOC C;  1JOY A;  3RYH A;  2WSS G;  3LDC A;  4JI8 O;  3AK3 A;  3ZRW A;  1NTK H;  4X66 O;  2PY5 A;  1YJW V;  3E35 A;  1SZX A;  4PI2 A;  5LGU A;  1N8R W;  4JAA A;  2XTA A;  4DR1 B;  1W0J G;  2D2C B;  2YXL A;  4MTO A;  3ZHT A;  4YY3 O;  5H2F Z;  2A79 B;  3UKM A;  4O4H B;  2BE3 A;  1TUB B;  3RBZ A;  1XDC A;  4I50 A;  3A8T A;  1JJ2 U;  1US6 A;  1P49 A;  5IY5 B;  2ZR2 A;  2EZO A;  3QVN A;  4X8A A;  1OCC C;  2FKX A;  5B1O A;  2HHH B;  5KAF Z;  2QM7 A;  3L75 H;  1S77 D;  2WAM A;  4DRX A;  5FNV A;  1VQ5 V;  5LGN A;  4K35 A;  2UU9 O;  1M4U A;  2Y0I A;  2YID A;  1VQ4 V;  5LL6 Y;  1YF2 A;  4DV2 B;  2CH7 A;  3ABL B;  1R73 A;  1SQQ H;  1K7D A;  2EIK C;  4LFC O;  2UXD B;  5JVD A;  4G28 B;  4JI1 B;  3ZED A;  4UUJ C;  2JS3 A;  1L0N H;  2CGO A;  1F4M A;  2EIN B;  3W7T A;  2Q9L A;  1HNZ B;  3G67 A;  1UPG A;  4MVZ A;  4OPH A;  3IC7 A;  4J41 A;  1M5I A;  3I5D A;  1Q6I A;  1VQK V;  4B7K A;  3X2Q C;  3IFX A;  5JWP A;  4TV8 A;  4X1K A;  5BXZ A;  3JD3 A;  2OTL V;  1VQ9 V;  3E86 A;  5FPO A;  2WLL A;  1V54 C;  2GHY A;  4P30 A;  2AGA A;  2QM8 A;  4IHJ B;  1S76 D;  3JAS A;  1KD1 W;  5D5P A;  1BT8 A;  4ZI7 B;  1N32 O;  5JH7 B;  1QR9 A;  4MVS A;  4BR6 A;  4EB6 A;  1IVS A;  2IJJ A;  2Q0A A;  3IAY A;  1NR7 A;  5LOV A;  4FMT A;  3E8G A;  3OGC C;  1LR1 A;  1TVK B;  4QPJ A;  3RFR A;  1FS0 G;  3CRA A;  3JD1 A;  2QSA A;  3WFV A;  5DM6 V;  3UT5 A;  1Z5W A;  2FML A;  3ABM C;  2X6C A;  5FL7 G;  3SJQ C;  3W7S A;  5ITZ B;  4UVA A;  1RFY A;  1FXK B;  1EN6 A;  2HKO A;  3HKD B;  4UVB A;  2ZIO A;  2ADQ B;  3AG2 B;  4R8C A;  4FFB B;  3LSS A;  4WBN B;  2V7Q G;  3GWK C;  4I55 B;  1IBL O;  4GKK B;  2CGN A;  1R6T A;  3CHX A;  5KX5 B;  2CAZ C;  3OT7 A;  2X7R B;  2IJH A;  3LDD A;  4PA6 A;  3CX5 F;  4HNA A;  3JAL B;  2CK3 G;  2YEV A;  4DUY B;  4O4L A;  4DR7 B;  3QO5 A;  4IGG A;  1PNM A;  3DTU B;  4R7C A;  4PHZ A;  1SA0 A;  2OYQ A;  2QWP B;  2B1G A;  1YDX A;  4TSF G;  1GM8 A;  4JAS A;  2ZM6 O;  1B6Q A;  5KUM A;  4LF6 O;  3G80 A;  2MK3 A;  2VQF O;  5JQG B;  4R50 A;  3ETQ A;  1XNQ O;  3K59 A;  4O2A B;  3OD4 A;  1SRY A;  2ARH A;  3CCV V;  1F4N A;  4JI4 O;  3ASN C;  4GKJ O;  1URF A;  3P3N A;  1BL8 A;  3EXA A;  1RM1 C;  3D8C A;  4JAV A;  2FYU H;  1IDS A;  1QLE C;  3N2G B;  2P90 A;  4YXW G;  2WLK A;  3ZX6 A;  3OMI B;  1D5N A;  2YI9 A;  2Z3Y A;  3FB5 C;  4UCR A;  3BCC H;  1AP5 A;  2M7W A;  3UCS C;  1IXM A;  3RYF A;  2E76 B;  2QWO B;  3ZHU A;  3L9D A;  4YIP A;  1GKF A;  3DSQ A;  1H2S B;  1MSD A;  3W7U A;  5JJN B;  4XDK A;  4JI6 B;  3JAT A;  4HBN A;  3QNE A;  2DQ0 A;  3S3W A;  2QJ1 A;  1H8E G;  1D2D A;  2HFE C;  3T2M A;  1XMQ O;  2F4V O;  1XQ8 A;  1AI4 A;  2ITC C;  5IYZ A;  4ZOL A;  3RT3 C;  4CS3 A;  1I5X A;  5B1B B;  3NXS A;  2A0L A;  4GYC B;  4KXR A;  2P7T C;  1YI2 V;  3BFR A;  1ZAU A;  4Z2W A;  4X66 B;  1XOU A;  4JYA O;  3ZS8 C;  3K58 A;  3DC6 A;  3M7M X;  2UUC B;  4TQD A;  1SF9 A;  4H0L B;  2QM4 A;  3E83 A;  3I56 V;  4H37 A;  4JV5 B;  4ZHQ B;  1N0N A;  4LF4 B;  3K0G A;  5B3S B;  3H01 A;  2HG5 C;  4UV9 A;  1VF6 C;  2BTQ B;  1AP6 A;  4GT1 A;  5DN6 G;  5LMN O;  1K8A W;  2HVK C;  3SGI A;  5LA6 B;  5CBG A;  2ZE5 A;  1PL4 A;  3QTC A;  2ZNJ A;  4JI0 O;  3U10 A;  1GK9 A;  4E2L A;  2G38 A;  4PA7 A;  4PA9 A;  2PI5 A;  3SYO A;  3A2F A;  3U0Z A;  1VQ8 V;  2F23 A;  2X6A A;  1M57 B;  4JI5 B;  3F7V C;  1JR9 A;  5LP6 A;  2DMX A;  2N04 A;  3ZMZ A;  2RN9 A;  2WA4 A;  4DV3 B;  2IJI A;  2LGW A;  2ZDI A;  5EC2 C;  4DR1 O;  2JEU A;  2Y48 A;  4GCZ A;  3EFF K;  1JJO A;  1L8D A;  2KQX A;  1RP3 B;  1GMG A;  5HFL A;  1VQO V;  1H2N A;  1V9P A;  2EBO A;  4AHC A;  2EZP A;  2H3O A;  1RSO B;  1E1Q G;  1Y6X A;  2O57 A;  3FAV A;  3RYI A;  2HHH O;  2Z5U A;  3H1L H;  4FM2 A;  1KYO F;  4KFM A;  2R70 A;  3ABT A;  4U7N A;  2KSD A;  4CZZ A;  1EBO A;  2ATK C;  2NN4 A;  2ADP A;  1NZ6 A;  3ZHR A;  3DGE A;  4DV2 O;  2E3C A;  4LFB B;  1LNQ A;  1XHZ A;  5TIS Z;  3HKB B;  2UXD O;  4DR4 B;  5HFM A;  1XHX A;  1VIB A;  5CA1 A;  1HNZ O;  2PI4 A;  1EN4 A;  4L87 A;  1TA8 A;  3K03 A;  4NTY A;  4LC1 A;  1TAE A;  2YI8 A;  2HLD G;  4J11 A;  3RVY A;  1CEZ A;  5BR8 B;  3AG4 B;  2P67 A;  1WAZ A;  3APQ A;  4WFH A;  1QVF U;  1OHH G;  4CBC A;  4ZBM A;  4Q20 A;  5CBF A;  2IW5 A;  4FLW A;  1MZF A;  5EBL C;  4JYB A;  3E22 A;  1GN3 A;  1AR4 A;  3OR7 C;  1JQ0 A;  1NVP D;  4WBN A;  4LF6 B;  1YSC A;  1Q43 A;  1JFF B;  1XBL A;  4F6R B;  3R66 A;  5KX5 A;  1V55 C;  4K0K B;  3PJS K;  1QBZ A;  3STZ C;  1K33 A;  4IIJ A;  2ITD C;  1T5E A;  4UCV A;  3JAL A;  4EFE A;  1XI1 A;  3OGI B;  1VQL V;  4QIW F;  3F5W C;  4H44 B;  3CC7 V;  4PJ0 Z;  4KUM A;  2ZXW B;  2WLM A;  1R6K A;  4FZ0 A;  5JJE B;  5KMG B;  5CBH A;  1EZJ A;  4X20 B;  3ZMV A;  5BMV A;  3L72 H;  4TUY A;  1QNM A;  5B66 Z;  5LXT A;  3HPL C;  2YIC A;  3K0D A;  4JYC A;  3T4Z A;  1OJH A;  2GDS A;  5EYP B;  4MT8 A;  3E2E A;  2EIJ B;  4RWU A;  5L3F A;  3OFN G;  4GKK O;  2VQE B;  2HEP A;  2GUZ A;  2B5U A;  2BSK A;  1YHQ V;  4DUY O;  4DR7 O;  2JRI A;  2QWQ B;  1XMQ B;  1WA8 A;  2FL4 A;  4U3F H;  4CC5 A;  1OCZ C;  3SPC A;  2Y4T A;  2CTP A;  3F7Y C;  3WG7 B;  5C8Y A;  1G1X B;  3SYC A;  2JJ1 G;  2YIA A;  5GW7 A;  4KL1 A;  1K4C C;  3QO7 A;  1DF4 A;  5CA0 A;  1LUW A;  3KCX A;  3ZBH A;  4YJ2 B;  1S72 V;  2PTM A;  4EKW A;  3H1K H;  5LMU B;  1N36 B;  3Q4H A;  1YJ9 V;  4RAI A;  1M93 A;  1NS1 A;  5IYD O;  3OTF A;  5IWA B;  3STL C;  1XUQ A;  1P4R A;  3K08 A;  4LFA B;  4XBF A;  4I9W A;  5GON B;  5LMN B;  3LUT B;  3HKC A;  4OX9 B;  3IC9 A;  4A5U B;  3ZMU A;  2H8P C;  3TCU A;  4Q6G A;  3ETE A;  3BAA A;  4DO2 A;  1KKC A;  3CCE V;  3JAR A;  2LFS A;  5LP6 C;  2QE7 G;  2E5L B;  4GUN A;  2N05 A;  3SYA A;  2ETN A;  2ZDI C;  4JI6 O;  4LR3 A;  2F1M A;  5LHG A;  1CXZ B;  3U11 A;  3R65 A;  4DK0 A;  2BCC H;  4YIO A;  4OPA A;  2FB5 A;  5KAI Z;  2DWE C;  5L3D A;  3UM7 A;  1F51 A;  3KZI Z;  4MS2 A;  4MTX A;  2QDO A;  3SJC C;  1AI6 A;  4FVM A;  4X64 B;  1AIL A;  3AG3 B;  3JAK A;  3EVK A;  2HJF C;  4I0X A;  1OCO B;  3J7A U;  3N2K B;  2VWJ A;  5EK0 A;  4PD4 F;  1WNS A;  2UUC O;  4UB8 Z;  4DV1 B;  2DYS C;  3VQV A;  1ZWI C;  1U97 A;  2UXB B;  4JV5 O;  1HDJ A;  1VF7 A;  4LF4 O;  3SPG A;  1W2B U;  2IM9 A;  1NKD A;  2Q73 A;  3CXH F;  1AJP A;  4RO2 A;  5EBM C;  3WU2 Z;  2F93 B;  1HP8 A;  5J2T A;  1HNW B;  1YTF B;  5BY1 A;  5F2V O;  5L3E A;  1JCH A;  2YXY A;  2N74 A;  1N0J A;  4O4I B;  4Z1M G;  3ASO C;  2Q7H A;  2ILM A;  2B1I A;  1WP7 A;  2ZE7 A;  1DGS A;  4EFB A;  1MZE A;  1Q5O A;  3ABU A;  4UV8 A;  1ORQ C;  2OCC C;  1ZL8 B;  2GV9 A;  4JI2 B;  4BW9 A;  1PNK A;  3SJA C;  1N33 B;  1K5Q A;  3CJH A;  3SJB C;  5K1P A;  3FYE B;  3JAW A;  1THZ A;  1XRE A;  1Q8I A;  4JI5 O;  1CPY A;  3WB2 A;  5EZY A;  3RVZ A;  2A7W A;  4DXW A;  1M56 C;  2KG7 B;  3AK1 A;  4ZKI A;  1U96 A;  2ZQM A;  4PV1 B;  2AHZ A;  2P5O A;  1KB9 F;  4UFZ A;  5KLV H;  4DV3 O;  1L0L H;  2YS8 A;  1GN6 A;  4X88 A;  4J10 A;  3CD6 V;  1QR8 A;  1ZX3 A;  3LSU A;  4O4J A;  2HR3 A;  3K79 A;  3PN1 A;  2QKA A;  5A2Q N;  3FYI B;  1PM9 A;  4O2B B;  3JSN A;  2ZIM A;  2JS5 A;  4TV9 A;  1M1K W;  1Q6U A;  1KP3 A;  3IGA C;  4WCE V;  3SPI A;  4J80 A;  2DYR C;  1WLE A;  2ZR3 A;  1JPX A;  4RQF A;  3CYO A;  2B9Z A;  2PYL A;  3N27 A;  1FFX B;  4NXM B;  4LFB O;  4R6Z A;  1OCC B;  1FPO A;  5IYB O;  1IUR A;  4LWS A;  1ZSP A;  4J7J A;  4DR4 O;  2A9H A;  4DR2 O;  4JGS A;  3ZRX A;  4YHH B;  1K92 A;  3OAA G;  3B2E E;  1SC5 B;  2EIK B;  2XHB A;  3CRM A;  1QCE A;  1HNX O;  3T1H O;  2JGU A;  5KMG A;  3QO8 A;  4WFE A;  2OTJ V;  5BR8 O;  2UXN A;  4NTW A;  1NJI W;  3RWR D;  3E8F A;  1XMO B;  1X4T A;  4B3R B;  4P9O A;  3EHB B;  3OMN B;  1Z5V A;  2FTK A;  3MAQ A;  4CS4 A;  4U3J B;  2AW9 A;  2CUG A;  3X2Q B;  1ARO P;  1TUE B;  2JDI G;  4FPP A;  3DXR B;  5CN0 A;  4K0K O;  1GO3 F;  1IX9 A;  1V54 B;  1WPX A;  4X9Q A;  2OIG A;  1R6N A;  1Y74 B;  3JD4 A;  5GTI Z;  2GSM B;  3OM3 B;  3AK2 A;  2R9I A;  1K9M W;  4I4T B;  4KHP B;  3K5L A;  4LBE C;  4QJF B;  2K9P A;  2WPD G;  3C3T A;  2JGD A;  4DV4 B;  1MNG A;  1Y76 A;  1ZLZ A;  1ZUQ A;  1VP7 A;  4U7O A;  3ABM B;  2CDY A;  4ZIB A;  2VQE O;  1SQB H;  4FLT A;  2XAS A;  2LW1 A;  5B5E Z;  4TQF A;  4UXN A;  4PDL A;  3VBB A;  2RJZ A;  2EIL C;  1Q81 W;  2R72 A;  2F95 B;  3H1I H;  4MVM A;  1DTO A;  2VWK A;  1NH2 D;  4FK5 C;  3FKS G;  4HYO A;  4BAY A;  1ENV A;  3ZJZ A;  2GTA A;  3ZN1 A;  3RYC A;  4H13 B;  4CH3 A;  4QPK A;  5LYJ B;  4DW0 A;  4DW1 A;  1VEW A;  2UUB B;  3B09 A;  2EJ7 A;  2R9A A;  4J7Z A;  3HB3 B;  1BMF G;  3MDS A;  2Q7E A;  5CB4 A;  5LMU O;  1N36 O;  4YJ3 B;  4WFA V;  3HKE B;  2WLI A;  5KHI A;  2YUA A;  5IWA O;  1H2M A;  3SYP A;  4LFA O;  4LF7 B;  3ZMS A;  4ASU G;  2X6B A;  4OX9 O;  1NTM H;  3ASN B;  1ZTE A;  2W6J G;  1RM1 B;  5L3B A;  2CE4 A;  5KA6 A;  2RQ6 A;  1QLE B;  2E5L O;  1AI5 A;  4O4H A;  5J2U B;  4LF9 B;  4LNU B;  1TUB A;  1YJN V;  1GM9 A;  4TT3 G;  4X1Y B;  2Q69 A;  4TWK A;  3RYH B;  1SQV H;  4QNH B;  4MW8 A;  3ZRW B;  1XNR O;  4GX0 A;  2XT9 A;  1AI7 A;  5CA3 A;  3BPZ A;  1R3J C;  1FKA O;  1EN5 A;  4UCU A;  4IT5 A;  2HJD A;  4X64 O;  3S3X A;  1H38 A;  4I50 B;  1G4Y B;  3BA8 A;  1PP9 H;  4DV1 O;  2ZD9 A;  2DQ3 A;  2UXB O;  1IXB A;  4N21 A;  1WPB A;  2AZ0 A;  3ZHS A;  1MA1 A;  1HNW O;  1AR1 B;  1OCR C;  5FNV B;  5KHG A;  4I7Z B;  3ZHQ A;  2NR5 A;  3CCL V;  4GZR B;  2CH7 B;  1YIT V;  2ZXW C;  1SER A;  4G2K A;  1IBK O;  4JI2 O;  4IHJ A;  1N33 O;  1Q6H A;  3ZRV A;  4LF5 B;  4UCS A;  4MVR A;  4ZI7 A;  5JH7 A;  3BRC A;  3CCJ V;  4DR2 B;  4DR3 B;  2JIZ G;  1BHA A;  2JJ2 G;  4F6E A;  2DN9 A;  3A0R A;  1TVK A;  4DR6 B;  1LUV A;  4MVQ A;  4JI3 B;  2PYJ A;  4TV8 B;  4LF8 B;  4X1K B;  1N34 B;  1B04 A;  3AG7 A;  4CC6 A;  1HNX B;  1BQZ A;  1H2K A;  3T1H B;  2WLL B;  4PDV A;  4AQY B;  3M8A A;  4ICG A;  3G6E V;  1FJG B;  4FM1 A;  4PA3 A;  3RGB A;  2P22 C;  1VQN V;  5ITZ A;  5IDJ A;  3JAS B;  5E1A C;  1MSW D;  1FXK A;  3HKD A;  4BIU A;  1NQT A;  5IE9 A;  4B3T B;  4FFB A;  4EB6 B;  3AG1 C;  1I5Y A;  2E74 B;  5LOV B;  4I55 A;  4E4E A;  1P84 F;  1Q82 W;  2EIM C;  1Y66 A;  3RW0 A;  3UT5 B;  3CP1 A;  2RMK B;  3CS5 A;  3JAM N;  3ZHV A;  4W4L A;  1J5E B;  1GTO A;  3J81 N;  2EUL A;  4NXM O;  3VQW A;  3SR2 C;  1M9N A;  2P4K A;  4J9Y B;  3ZMT A;  2Q4P A;  5JQG A;  3KCY A;  2P4V A;  4RQE A;  2Q67 A;  1SES A;  3ABK C;  3OMA B;  4O2A A;  2K1E A;  4YHH O;  4HNA B;  2W0F C;  2YEV B;  4O4L B;  1BS3 A;  5B1A C;  1SQF A;  1RPO A;  4JTC B;  4LP8 A;  2DE0 X;  1SA0 B;  2A06 H;  1VQ6 V;  3N2G A;  1FAF A;  3C3S A;  4D7T A;  1K5S A;  2RCV A;  1UJW B;  2C2A A;  1XMO O;  4W4K A;  2Y69 C;  1FXV A;  4J9Z B;  1R3L C;  1BSM A;  4B3R O;  3W7X A;  4DV5 B;  3L74 H;  3ZRS A;  1AVM A;  4FLZ A;  5DEC A;  1R3K C;  4PA4 A;  5JJJ B;  2M6Y A;  3OEE G;  3RN4 A;  3O9O A;  1O9H A;  3WB0 A;  4CH4 A;  5KHK A;  1VQ7 V;  1EZV H;  1YZB A;  1VQM V;  1VF5 B;  1DF5 A;  3E8H A;  3B8M A;  4UCT A;  4GX2 A;  1V55 B;  1BE3 H;  4B7E A;  4KHP O;  1W0K G;  1JX9 A;  4EEQ A;  3GVM A;  4DUZ B;  2R9R B;  3NR7 A;  5IY5 C;  2PGG A;  4NVP A;  4DV4 O;  2UXC B;  1GAX A;  1K3E A;  5B1N A;  2IH3 C;  1UFI A;  1M90 W;  3MHH C;  3L73 H;  2P6J A;  4UCO A;  2EX3 A;  3CSX A;  3JAT B;  1Q86 W;  1WN7 A;  4HAM A;  1BZK A;  5LBQ A;  4ZHQ A;  1HR0 B;  4FM0 A;  5H9C A;  5H6Q A;  2XAQ A;  4ZOL B;  3D36 A;  3ABL C;  2BTQ A;  1PKX A;  4IL6 Z;  1XNR B;  3BHP A;  4NR1 A;  2EIN C;  5LA6 A;  3LNN A;  4JZG A;  3J80 N;  2QA4 V;  2W6I G;  1MMM A;  1OCZ B;  2UUB O;  2XND G;  1R1B A;  1IBM O;  2WA3 A;  1N4C A;  5KHH A;  4X62 B;  3CB2 A;  1QLN A;  2JVD A;  2E75 B;  3CCQ V;  2ZNI A;  3LNM B;  2NLJ C;  3APO A;  4LF7 O;  4D6T H;  1DLB A;  4JPR A;  2UXX A;  4KP4 A;  1H8H G;  2V1D A;  1JMK C;  2CTR A;  4NTX A;  3H1H H;  5L3G A;  4B3S B;  3T4D A;  1GN2 A;  2JEX A;  1Q3E A;  3JD0 A;  4LF9 O; 
#chains in the Genus database with same CATH homology
 4WF9 V;  2IJI A;  3SPH A;  1J95 A;  1R6N A;  2ZDI A;  1G8M A;  2OT5 A;  3JD4 A;  1KEC A;  2GSM B;  5EC2 C;  1RPR A;  5J9P C;  1CP9 A;  2JEU A;  2Y48 A;  1FXK C;  3OM3 B;  4GCZ A;  2R9I A;  3EFF K;  1K9M W;  1NVP B;  3ZCC A;  4FIP C;  1Q7Y W;  2QEX V;  4LBE C;  3AG2 C;  1GMG A;  4QJF B;  5HFL A;  2WPD G;  3AG3 C;  4X89 A;  2BOB C;  1VQO V;  1OCO C;  2EBO A;  1P7B A;  2EZP A;  4BW5 A;  3CME V;  4MTF A;  4LCU C;  3AG1 B;  3MHS C;  1E1Q G;  1AJN A;  4U7O A;  3ABM B;  1K97 A;  5EBW C;  2Z5U A;  3K04 A;  4KFM A;  3ABT A;  4HZ3 A;  4U7N A;  2EIM B;  2H94 A;  1PL0 A;  2XAS A;  1FXH A;  2JK5 C;  4CZZ A;  2IU3 A;  4JF3 A;  1EBO A;  2ATK C;  4UXN A;  4PDL A;  5KUK A;  3CC2 V;  3DGE A;  3VBB A;  2EIL C;  4PEL A;  1Q81 W;  1LNQ A;  1S0V A;  2LFR A;  4MVM A;  1DTO A;  4QE9 A;  3VOU A;  4JTD B;  3M99 B;  2DYS B;  1NH2 D;  1KP2 A;  4FK5 C;  1AJQ A;  3FKS G;  4HYO A;  1FFT B;  1OZ0 A;  4XDJ A;  4BAY A;  4F4L A;  1ENV A;  1S5H C;  4P9P A;  3ZJZ A;  5HFM A;  3ZN1 A;  1YTF D;  2Q6A A;  2WLJ A;  4QPK A;  3OEH G;  2PI4 A;  4L87 A;  3K03 A;  2IJK A;  3P30 A;  4BIZ A;  3HB3 B;  1BMF G;  4LC1 A;  3ABK B;  2WWW A;  1XL6 A;  2HVJ C;  2HLD G;  5C93 A;  3K3W A;  3RVY A;  1COW G;  4WFA V;  1CEZ A;  4WFG A;  2WLI A;  3AG4 B;  3ASO B;  2P67 A;  2LP7 A;  3CCU V;  3E8B A;  4WFH A;  5B1A B;  1VQP V;  1QVF U;  1OHH G;  1S3J A;  4CBC A;  3SYP A;  1F23 A;  4ZBM A;  4Q20 A;  5CBF A;  3FB8 C;  3T1C A;  2IW5 A;  5EBL C;  2IU0 A;  3ZMS A;  4JYB A;  3SYQ A;  4ASU G;  1KKD A;  2OCC B;  2X6B A;  1L1F A;  4UVC A;  4XDL A;  2DWD C;  2Y69 B;  4P2Z A;  3OE7 G;  3OR7 C;  1JQ0 A;  2WLI B;  1NVP D;  2KB1 A;  3ASN B;  4JAU A;  1K34 A;  1YSC A;  3CCS V;  2W6J G;  2BOC C;  1JOY A;  1RM1 B;  5L3B A;  2WSS G;  1V55 C;  3LDC A;  5KA6 A;  3PJS K;  1BHB A;  1QBZ A;  3STZ C;  3ZN0 A;  1K33 A;  3ZRW A;  1QLE B;  2ITD C;  1AI5 A;  1YJN V;  1YJW V;  1EFR G;  3E35 A;  1VQL V;  4QIW F;  3F5W C;  1GM9 A;  4TT3 G;  1M56 B;  3CC7 V;  4KUM A;  2ZXW B;  3G4S V;  2Q69 A;  5LGU A;  1N8R W;  2WLM A;  1R6K A;  4TWK A;  5B1B C;  4QNH B;  1W0J G;  4MTO A;  5CBH A;  1EZJ A;  4MW8 A;  3ZRW B;  3ZMV A;  2A79 B;  3UKM A;  5KA5 A;  4GX0 A;  3RBZ A;  1AI7 A;  5CA3 A;  4QE7 A;  5LHI A;  2DW4 A;  1JJ2 U;  1R3J C;  3HPL C;  3K0D A;  4I5S A;  4JYC A;  3T4Z A;  4MT8 A;  3E2E A;  1SET A;  5IY5 B;  2EIJ B;  2ZR2 A;  3AEI A;  2EZO A;  5L3F A;  3OFN G;  1H38 A;  4X8A A;  1OCC C;  1G4Y B;  5B1O A;  5B3S C;  2QM7 A;  1S77 D;  2WAM A;  3JD2 A;  4OXS A;  3W7W A;  2ZD9 A;  2B5U A;  4GX5 A;  2Q68 A;  1VQ5 V;  5LGN A;  2DQ3 A;  2DYR B;  3LSQ A;  1YHQ V;  4N21 A;  1Y4M A;  1VQ4 V;  5CMU A;  3P32 A;  1OCZ C;  3ABL B;  1R73 A;  3SPC A;  1K7D A;  2EIK C;  3F7Y C;  1OCR C;  1E79 G;  3MD0 A;  3WG7 B;  1AR1 B;  4WFF A;  3CCR V;  4FJC C;  2D3O W;  4G28 B;  3SYC A;  2JJ1 G;  1K73 W;  3GB7 C;  4UUJ C;  5GW7 A;  1F4M A;  2EIN B;  3W7T A;  1K4C C;  3QO7 A;  3CCL V;  1DF4 A;  3CCM V;  1YIT V;  2ZXW C;  1S72 V;  4MVZ A;  2QKS A;  4EKW A;  1E1R G;  1SER A;  3IC7 A;  4G2K A;  1NR1 A;  1M57 C;  1VQK V;  1YJ9 V;  4RAI A;  3X2Q C;  2XAH A;  3IFX A;  3ZRV A;  3CMA V;  5IYD O;  4MVR A;  3JD3 A;  5IYC O;  3STL C;  1VQ9 V;  3E86 A;  1P4R A;  3K08 A;  3CCJ V;  2OTL V;  1MAB G;  2WLL A;  4XBF A;  4I9W A;  2JIZ G;  1V54 C;  3ETG A;  1BHA A;  2JJ2 G;  2GHY A;  4P30 A;  2QM8 A;  3LUT B;  1S76 D;  3A0R A;  1KD1 W;  4MVQ A;  4MVU A;  3ZMU A;  2H8P C;  3TCU A;  3ETE A;  1QR9 A;  4DO2 A;  3CCE V;  2WLL B;  4PDV A;  4MVS A;  2LFS A;  2YSU B;  2IJJ A;  3JCZ A;  3G6E V;  2QE7 G;  1HWY A;  1NR7 A;  4PA3 A;  1VQN V;  3LDE A;  4FMT A;  3E8G A;  3OGC C;  3SYA A;  5IDJ A;  4QPJ A;  5E1A C;  1MSW D;  1FS0 G;  1FXK A;  2ZDI C;  3JD1 A;  1PNL A;  2AHY A;  4BIU A;  5LHG A;  1NQT A;  3WFV A;  5DM6 V;  3ZIA G;  3R65 A;  1KQS U;  3AG1 C;  3FB7 C;  1I5Y A;  4GX1 A;  3ABM C;  2X6C A;  1JVM A;  4N23 A;  5FL7 G;  3SJQ C;  1YIJ V;  3W7S A;  1Q82 W;  2DWE C;  5LHH A;  4UVA A;  5L3D A;  3UM7 A;  3CPW U;  1QVG U;  1F51 A;  1FXK B;  2HKO A;  4MS2 A;  4MTX A;  2EIM C;  1Y66 A;  4UVB A;  1AI6 A;  3RW0 A;  5EC1 C;  3B77 A;  3AG2 B;  3CP1 A;  4R8C A;  3I55 V;  3AG3 B;  3LSS A;  4MW3 A;  3TET A;  2HJF C;  3OUS A;  2V7Q G;  1GTO A;  1OCO B;  2XAG A;  5EK0 A;  2X7R B;  2DYS C;  2IJH A;  3LDD A;  3FB6 C;  4RUE A;  2WLH A;  4PA6 A;  1ZWI C;  2CK3 G;  2YEV A;  1M9N A;  3SPG A;  1W2B U;  3QO5 A;  4J9Y B;  1NKD A;  3ZMT A;  3OW2 U;  1AJP A;  4RO2 A;  5EBM C;  1NH2 B;  4RQE A;  2Q67 A;  1PNM A;  3DTU B;  4R7C A;  3B8N A;  1SES A;  4MTG A;  1ROP A;  3ABK C;  3OMA B;  2F43 G;  1YTF B;  5L3E A;  2K1E A;  2B1G A;  1JCH A;  2IH1 C;  2EIL B;  1GM8 A;  4TSF G;  4JAS A;  2W0F C;  1B6Q A;  3AG4 C;  2YEV B;  3ASO C;  5KUM A;  1PD3 A;  2MK3 A;  4Z1M G;  5B1A C;  4JTA B;  1RPO A;  2B1I A;  4R50 A;  4JTC B;  3CC4 V;  1NBM G;  4LP8 A;  3ABU A;  4UV8 A;  1VQ6 V;  1ORQ C;  2OCC C;  1K5S A;  1UJW B;  3JYC A;  2C2A A;  1SRY A;  2Y69 C;  1PNK A;  3CCV V;  1F4N A;  1K5Q A;  1FXV A;  3ASN C;  1R3L C;  4J9Z B;  1MG1 A;  1BL8 A;  3BEH A;  1RM1 C;  3W7X A;  3FYE B;  5LGT A;  3K06 A;  4JAV A;  3ZRS A;  1THZ A;  5L3C A;  2XOK G;  1QLE C;  1CPY A;  3G71 V;  3RVZ A;  2P90 A;  1R3K C;  1M56 C;  2WLK A;  4PA4 A;  4YXW G;  3OMI B;  4DXW A;  1KC8 W;  2Z3Y A;  4ZKI A;  3FB5 C;  2ZQM A;  3BY6 A;  3OEE G;  2AHZ A;  2M7W A;  1VQ7 V;  1IXM A;  3TK1 A;  1VQM V;  1DF5 A;  3E8H A;  3SPJ A;  3B8M A;  4X88 A;  3D3I A;  4GX2 A;  2XAF A;  3ML0 A;  3CD6 V;  1GKF A;  1QR8 A;  3W7U A;  1V55 B;  4PDR A;  2WLN A;  4XDK A;  1W0K G;  2QTO A;  3QNE A;  2DQ0 A;  2HR3 A;  1JX9 A;  4RUF A;  2R9R B;  3K79 A;  1XL4 A;  1H8E G;  2EIJ C;  5IY5 C;  2XAJ A;  2HFE C;  3T2M A;  3FYI B;  2ITC C;  1AI4 A;  1K3E A;  1I5X A;  5B1B B;  5B1N A;  3NXS A;  1M1K W;  2IH3 C;  2A0L A;  4H33 A;  1M90 W;  3GWO A;  3MHH C;  2P6J A;  1KP3 A;  2P7T C;  3IGA C;  4WCE V;  1YI2 V;  3SPI A;  4HAM A;  1Q86 W;  1H2G A;  2DYR C;  1WLE A;  5LBQ A;  2ZR3 A;  1JPX A;  4RQF A;  5H9C A;  3CYO A;  5H6Q A;  2XAQ A;  3D36 A;  3ABL C;  2X0L A;  1PKX A;  3WG7 C;  1GM7 A;  3E83 A;  4R6Z A;  3I56 V;  4H37 A;  1OCC B;  5IYB O;  2EIN C;  3K0G A;  5B3S B;  3H01 A;  2A9H A;  4PDM A;  2HG5 C;  4UV9 A;  4G27 B;  4JGS A;  2QA4 V;  2W6I G;  4GT1 A;  3ZRX A;  5DN6 G;  1K92 A;  3KG2 A;  3OAA G;  1K8A W;  2HVK C;  1OCZ B;  1MOF A;  2XND G;  5BZB A;  2EIK B;  3E89 A;  1QCE A;  1OCR B;  1SZT A;  5CBG A;  3K9A A;  2EJR A;  3QO8 A;  4WFE A;  2OTJ V;  1QLN A;  1GK9 A;  3ETD A;  4E2L A;  2UXN A;  4MVO A;  4PA7 A;  1NJI W;  3E8F A;  3CCQ V;  3LNM B;  1K4D C;  2NLJ C;  4PA9 A;  2PI5 A;  3SYO A;  4P9O A;  1VQ8 V;  1DLB A;  3EHB B;  3OMN B;  4JPR A;  5H6R A;  2FTK A;  2X6A A;  1M57 B;  3CXC U;  4WFB V;  3OUF A;  4MSW C;  2NNU A;  2UXX A;  3X2Q B;  1ARO P;  1TUE B;  1H8H G;  2JDI G;  2V1D A;  4KP4 A;  4FPP A;  3F7V C;  5L3G A;  5CN0 A;  3T4D A;  1GO3 F;  3OR6 C;  2JEX A;  3JD0 A;  1V54 B;  1WPX A;  1R3I C;  3ZMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...