4LBEC

Structure of kcsa with r122a mutation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERAGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lbeC00
2ATKC 4PA9A 4GX2A 5KUKA 4JTAB 3SPHA 5EC2C 5EBLC 1R3LC 5B3SC 1OCCC 5KUMA 2WLLA 4LBEC 1R3JC 2BOCC 3SYCA 4MW3A 1M57C 2JK5C 3AG1C 2WLKA 4J9YB 3OUSA 3RBZA 1J95A 3IGAC 4G27B 2EIMC 3GB7C 1ORQC 3JYCA 4LCUC 4MVUA 4PA7A 3RVYA 3FB7C 2Q6AA 3T4DA 5EBMC 2EIKC 2Q67A 1ZWIC 4PA6A 3IFXA 3TCUA 4MVOA 2A0LA 4PA4A 2ITCC 4QE9A 4ZBMA 2EILC 1P7BA 4XDJA 2ZXWC 3FB8C 1XL6A 4CBCA 4RO2A 4JTDB 2H8PC 2EIJC 2Y69C 2DWEC 1K4CC 3E86A 2ZD9A 4GX5A 3E8GA 1JVMA 4I9WA 4MVRA 4JTCB 2WLIB 4UUJC 4F4LA 1OCZC 3FB6C 4MVMA 3STZC 3OUFA 1V55C 4GX1A 3SPCA 3FB5C 4HZ3A 2BOBC 3AG3C 3KG2A 2P7TC 3STLC 3HPLC 2X6BA 3PJSK 2HVKC 1K4DC 2KB1A 2YEVA 4XDKA 1OCOC 5CBFA 3ABMC 3RVZA 4J9ZB 2IH3C 3F7YC 2DYSC 4PDVA 3EFFK 3SPIA 1G4YB 2A79B 2K1EA 3ASNC 3E83A 3E8FA 4GX0A 2DYRC 2X6CA 4PDRA 3WG7C 2A9HA 3LDEA 1R3KC 2WLJA 3K04A 4WFHA 1BL8A 4MSWC 3T1CA 4WFFA 2WLHA 3AG4C 3ASOC 3K06A 4MVZA 2DWDC 4P9OA 4OXSA 1R3IC 4X88A 3OGCC 2IH1C 4MW8A 5CBHA 4H37A 2HJFC 3F7VC 3LDDA 4TWKA 3RW0A 4QE7A 3LNMB 4EKWA 2HVJC 2WLLB 3LDCA 3SYAA 4DXWA 4QNHB 1OCRC 4P9PA 1S5HC 1KKDA 4P30A 1M56C 4H33A 3VOUA 4RAIA 4MTFA 3SYQA 4LP8A 4MTGA 4PDLA 3OR6C 2ITDC 3TETA 4XDLA 4R50A 4RUFA 4WFEA 5IY5C 4X8AA 5CBGA 4BW5A 2HFEC 4R8CA 2WLIA 2AHYA 3E8BA 3R65A 3ABLC 4RUEA 3SJQC 3T2MA 3LUTB 3ZRSA 3ABKC 4P2ZA 5EBWC 4MTOA 5BZBA 4PDMA 5B1AC 5EC1C 4KFMA 3K03A 3SPJA 4MS2A 3K0GA 4R7CA 4HYOA 3X2QC 3E89A 3OR7C 5E1AC 3UKMA 3SYPA 5J9PC 4PA3A 1V54C 2AHZA 1QLEC 2QKSA 3K08A 4MVQA 2Q68A 2OCCC 2HG5C 2R9RB 3E8HA 5B1BC 3BEHA 3UM7A 3SYOA 2EINC 1LNQA 2Q69A 5EK0A 3ZJZA 2WLNA 2QTOA 4R6ZA 2X6AA 4G28B 1XL4A 2W0FC 2WLMA 3K0DA 4MVSA 3F5WC 2NLJC 4X89A 3T4ZA 3AG2C 3SPGA 4WFGA
chains in the Genus database with same CATH superfamily
1GO3F 4JI0O 4B08A 3C3SA 1RSOB 5LYJA 2BSKA 3CRMA 3QG5A 3RWRD 1O9GA 3ML0A 1VQOV 2EIMC 4FFKA 1Y4MA 4ZHQB 1FXKB 5FPOA 3IFXA 3E22B 4N21A 1KQSU 2ZE5A 2EULA 2ZD9A 1RM1B 3ETDA 3J81N 2ZE7A 4CC6A 2QE7G 3IAYA 2QGNA 1JFFB 1QCEA 3BABA 2F43G 3JARA 5J2UA 3D8CA 3CC4V 1K33A 4X20B 1S5JA 3SDLA 1HNZO 1BL8A 3EXAA 4DW0A 5BMVB 1RSOA 3APOA 5EIBC 4X1YB 1H2NA 3CJHB 1YVWA 3B4SA 4OXSA 4B3MO 1Q3EA 3UO2A 1DTOA 1HNWO 3W7WA 1NU1H 1ZSPA 1HNXB 2WAMA 3E22A 4PDLA 5E79Z 3I55V 3RGBA 1P49A 4WFAV 5IY5C 2KG7B 3R65A 5LP6A 3ABKC 2JVDA 1JFFA 4JYBA 3E2EA 4X20A 3NR7A 1VQ7V 1NI8A 2HR3A 5JH7A 2UXDB 4OPHA 1D2DA 4DR2O 3UM7A 2EINC 2W6IG 3FFQA 5C8YB 1KUQA 1YZBA 4X1YA 4B3RB 1FFXB 2CGOA 4LNUB 3RYHA 3O9OA 1RPRA 3SPHA 4CC5A 4BIZA 5IY5B 3OTOB 2YSUB 2BOCC 3AG2B 3L72H 3P3PA 5LOVB 1N0NA 3CRCA 3ABKB 3FB7C 2Q6AA 4TUYB 3T4DA 2E5LB 4U7NA 2KG7A 1TVKB 1P7GA 4DW1A 3B40A 4LR3A 4IIJB 1Z5VA 4NR1A 3W7XA 5GTIZ 3FB6C 5JWPA 4B3TB 2EINB 2UUBO 5GONA 5CBFA 3ABMC 1YSCA 2DYSC 3H9VA 3LSSA 3WB0A 1AILA 3LSQA 2AZ2A 1PV0A 4LNUA 2A7WA 3AG4C 4IT5A 1IBKO 5L3GA 1LR1A 4TWKA 2ADQB 4UB8Z 2DMXA 4P30A 4TUYA 1SQPH 3L71H 3VOUA 1TVKA 3H1HH 3VQYA 3B77A 1SQGA 4XDLA 4UVBA 2P4KA 4IIJA 3K9SA 1TUEB 4QJFB 4R8CA 1EM1A 3ABMB 1NJIW 2EZOA 2RDCA 2VQEO 5KAFZ 2EJ7A 4P2ZA 1QHTA 3H1KH 1Y74B 3JD1A 1F4MA 2WSSG 4NKGB 4MS2A 2N04A 3J80N 3AG4B 4YJ2B 1FXHA 4DV3O 2UUAO 2Q68A 2JGDA 3ABTA 4X62O 1Q8IA 5LGNA 2ZE8A 3JATB 1FAFA 2OCCB 4DV0B 2ATKC 1IBLO 1GN4A 1X59A 2UU9B 1EFRG 2IU3A 4LBEC 2DW4A 2Q5ZA 2P90A 4NYKA 2ZR2A 3RVYA 4LCUC 5IYCO 2VQFO 2YS8A 2XNDG 4JTDB 3E8GA 4CS2A 1Y74A 3UT5A 4ZKIA 2H94A 3ZN1A 3MHHC 3UCSC 3AK3A 1SESA 4YJ2A 2P7TC 3RYCA 1DLBA 2X6BA 4YJ3A 4XDKA 1K4DC 4Z1MG 2YXLA 4JI1B 2EX3A 5CA0B 4FM2A 3SJAC 4PDVA 3JATA 1S3JA 2C2AA 1X4TA 2R9AA 3RT3C 4HNAB 3CCRV 4UVAA 2OTJV 3DTUB 5CA3A 5IYDO 3K5NA 1S72V 2Z0AA 4DYLA 1AI7A 3MDSA 1JR9A 3P32A 1XDCA 4I55B 4YY3B 2ZINA 5CBGA 3P30A 4B3SO 4DV4O 2HLDG 4JPRA 2Q7GA 3ETEA 2QSAA 1TA8A 1WNSA 1Y6XA 5CA0A 1K34A 1WP8A 2QR4A 1XMOO 5KHHA 2MK3A 1LNQA 4TT3G 2IM9A 5B1NA 4K0KB 3O65A 2W0FC 1WB7A 2GDSA 2GTSA 3F5WC 4QIWF 2NLJC 4X89A 4FLXA 4XBFA 2YXHA 2JGUA 1VF5B 1ZLZA 1IURA 1WA8B 5B66Z 1R3JC 2EIKB 1H38A 1QQCA 1SS3A 1QR8A 5IE9A 2PF4E 1SF9A 4I55A 4IYHA 5L3CA 3JCUZ 3M7MX 2JJ2G 4LF4B 1AP6A 3UO3A 2FMLA 1URFA 4DK1A 3DGEA 3CYOA 1HR0B 4I9WA 1UJWB 3CHXA 3AEIA 3CCJV 3G6EV 1BHBA 4UVCA 1QNMA 4LFBB 4OX9B 3T1HO 4JI6O 3KG2A 4JV5B 1FKAO 4J10A 3ASNC 4LF5B 2OCHA 3LDEA 3I5DA 3ICXA 4BIUA 4UCOA 1WP7A 3KCXA 2DN9A 3CXCU 1TAEA 4X66B 1YCIA 3SR2C 3CRQA 1HNXO 2WLLB 4QNHB 3UQ8A 4B7KA 1K73W 1KU9A 1YJ9V 5LHHA 2XTAA 3THOA 2YICA 3A2FA 2D2CB 2QM7A 1BHAA 1ZUQA 2P67A 5KA5A 4ZOLA 2CTWA 3ASNB 1N32B 3K03A 2V7QG 2RMKB 3SPJA 2A3QA 2W6JG 1E1RG 3ABLB 2IU0A 2YIBA 3S3WA 3K5LA 2ZM6O 3WB1A 1K3EA 3ZCCA 2WLMA 1XMQB 4WFGA 1QBZA 1D5NA 4UCTA 1N36O 1TUBB 3PN1A 1NS1A 2WLLA 3Q4HB 4IGGA 1NR1A 4O2AB 1NT2B 3OUSA 3CD6V 3RBZA 2YC0A 1I08A 3JYCA 5CB4B 1G8MA 1R73A 1XNQO 3CCMV 2ITCC 1P7BA 2F23A 2DJVA 4UFZA 4B3TO 4GX5A 1F51A 4UCUA 3G67A 4QPJA 2BCCH 4NXMO 2Q9LA 2ARHA 5JQGA 2CH7A 4U3JB 4WBNB 2ZQMA 2YEVA 4CZZA 1OCOC 4DV6O 3ZMVA 4NTXA 2WPDG 3T1CA 3T1YB 3GWOA 1TUBA 5IJ0B 3Q4HA 4GKJO 1Q86W 2YIBD 4O2AA 4K35A 5A2QN 3R66A 5CB4A 1KKDA 4DUYO 4LF6B 3FAVA 4JI7O 3JAMN 2QJ1A 3JAKB 1ROPA 5LA6A 4WFBV 5TISZ 5LGUA 3T2MA 2V1DA 3LUTB 1W0JG 3A0HZ 4WBNA 1FYJA 4I50B 2KSDA 4KP4A 3QVNA 1MSDA 4DUZB 4OPAA 5H2FZ 4JYAO 1FPOA 4JI4O 2Q7HA 4DR7O 1VQ6V 1YF2A 3M8AA 3H01A 2QKCA 5IYBO 4MVSA 2UU9O 5IJ0A 1HP8A 3CS5A 5BR8B 3APQA 3OE7G 4UCVA 2LP7A 1FXKC 2Y4UA 3MD0A 4HBNA 3BAAA 1YEWA 3A8TA 4MVUA 5LXTA 4TSFG 1RM1C 1Y66A 2Q67A 4JASA 2N05A 2EILC 5L3BA 1K8AW 1K4CC 1NVPB 1PNMA 1EN4A 4DR5B 4ZI7B 1BZKA 4JI1O 2KQXA 4K3AA 3BHPA 2KB1A 1P4RA 4NTWA 1VQ8V 4NB5A 2BTQB 3SPIA 4DV2O 1BQ0A 1HWYA 5H5NA 1NQTA 4X1KB 2CK3G 5FLXN 2EJRA 2MW2B 3K04A 4GLXA 4JYYA 4LC1A 4DV7B 5L3DA 2DWDC 3WG7B 1FD9A 2LO1A 4TV9B 1Y67A 2EILB 4H37A 4GCZA 3LDDA 2HEPA 4EKWA 5IWAB 2P4VA 4LFCB 4DV1O 3BPZA 2AXTZ 4PV1B 1GRJA 2ILMA 1EN6A 3FX7A 3NXSA 2P06A 3ZHSA 4WF9V 5JJJB 4FLYA 3ZRSA 4PDMA 1UPGA 1AI6A 5J9PC 5C93A 3ZMSA 5H6RA 3QF7A 2Y0IA 1JOYA 2JEUA 2BTQA 4ZHQA 1FXKA 4X1KA 3BEHA 5IJ9B 2DOSA 2QWOB 2WLNA 4LFAO 5KX5B 2RN9A 3K0DA 5ITZB 3AG2C 3KCYA 3SPGA 2P5OA 2JS3A 4TV9A 5EBLC 5LMNO 2UXNA 3EVKA 2DE0X 2F66C 1YXBA 3CMAV 3CCVV 4JI5B 2Q8VA 1K5SA 3RN4A 1OCCB 3BA8A 1BQZA 1NTMH 4LH6A 5EBMC 1ZWIC 2NNUA 2KKWA 1HR0O 1H2GA 4PA4A 4LF9O 3AG1B 1MZEA 3CC7V 5BMVA 1SC5B 3E86A 3CJHA 1XHZA 1KP3A 4GX1A 3RYFB 5KHKA 3SPCA 3CP1A 3STLC 3HKBB 1SRYA 4W4LA 1UFIA 2A06H 1PKXA 4UB6Z 5J2TB 4DR1B 5IJ9A 3C3TA 1DF4A 1N33O 2IJJA 4X66O 1KB9F 3CCEV 1BS3A 2P6JA 4DR4B 1A32A 2ADPA 1PNLA 3CX5F 4FLZA 2UXBB 4I4TB 3F7VC 2IJHA 2Y0PA 2QWRB 1KYOF 1SETA 4H33A 4YHHB 1I94B 1XBLA 5C8YA 4BR6A 1AJPA 2HFEC 1FFXA 1J5EO 4BAYA 5KHGA 1V9PA 3LSUA 4UV8A 3RYFA 2ZDIC 5AG2A 1TGOA 3ZX6A 2Q0OC 4JI8O 2F4VO 1JQ0A 5LOVA 1V54C 3RFRA 4PELA 1VQ9V 3K9AA 4DR3B 2OCCC 2ZNJA 1AI5A 1AI4A 1MZFA 2PY5A 2YI9A 2VWKA 1PM9A 2YIDA 3L73H 1NZ6A 4I0XB 1Q6IA 1DGSA 2GBOA 4I4TA 4O2BB 4DV5B 3ZBHA 1OHHG 3HB3B 4JI2O 2ZR3A 4MW3A 2WLKA 2OIEA 5FL7G 3TK1A 2OIGA 4NXNB 4J41A 4DR6O 1Q81W 4PA6A 4O4JB 3ZIAG 4QE9A 1R6TA 4XDJA 1V54B 1VIBA 2ZXWC 3FB8C 3SGIA 1VQPV 2RCVA 4MVRA 4J7JA 1OCZC 3KZIZ 2QM8A 5D5PA 1H2KA 3L74H 1XNRB 2YDEA 3ZN0A 2FB5A 4QPKA 4J9ZB 3T1YO 4LF7B 1G4YB 1GM9A 4GX0A 5KAIZ 2WLJA 1BT8A 3F5TA 3E35A 3M99B 2IJKA 2WLHA 4I0XA 1QLNA 3OMIB 3JASB 3D3QA 1PL0A 4YIPA 2IH1C 1CEZA 2XT9A 2ZXWB 2CTPA 4QE7A 2LGWA 1N34B 2ZDIA 2Y48A 3DC6A 1JJ2U 4DK0A 1XREA 1OCZB 1VARA 4O4JA 1NH2B 2XOKG 3VQWA 3ZEDA 2UXCB 2E75B 5CA1B 4RUFA 3AK1A 1OCRB 4IL6Z 3W7SA 2XUMA 2UUCO 2ODMA 1R1BA 3JD0A 4I7ZB 3BCCH 5EC1C 4JI0B 4R7CA 4HAMA 5KA6A 2Q4PA 4DUZO 1XQ8A 5IT9N 2AHZA 4AHCA 4FVMA 5B1AB 4MVQA 2PYLA 2QWNB 1PL4A 3D3IA 3SYOA 1P84F 1ZX3A 5BR8O 1B06A 2IBZH 4ASUG 3CB2A 2EIKC 3T4ZA 3JASA 1CP9A 1OZ0A 4JAAA 1H2MA 2GV9A 2B9ZA 3CRAA 4K8XA 2M7WA 4J9YB 4LH7A 2ETNA 4PA7A 2YIAA 3VQVA 5CA1A 3ABUA 5GW7A 2F93B 4HNAA 1XHXA 2Y69C 3MHSC 3CEIA 4Z2WA 3KKYA 4MVMA 4PI2A 1SQBH 4FFBB 1M5IA 4J42A 4Q6GA 4B3MB 3HPLC 4AQYB 4U7OA 3SJCC 1GN2A 3N27A 3RVZA 2K1EA 2OWOA 4PDRA 4E2LA 2QEXV 5JCOC 3H1IH 4MSWC 1QVGU 2ZNIA 3OD4A 1MMMA 1YI2V 3FYIB 1AR1B 4QGPA 1Y76B 4MW8A 1EBOA 5IWAO 3HR0A 1EN5A 1PNKA 1ZAUA 3RW0A 2H3OA 2Y69B 4DXWA 5DN6G 1IXMA 3JSNA 3JCZA 1F23A 4KXRA 4FZ0A 2LQTA 2R72A 3OT7A 5DEDA 3ABLC 3JD4A 1OV9A 3BVOA 1WA8A 2DQ0A 4CH5A 3BRCA 4HYOA 1NH2D 4F6EA 5E1AC 4EFEA 1R6NA 2PZSA 1M1KW 3RYIB 2DQ3A 3X2QB 2G38A 2EZPA 3K5MA 1XL4A 2PI5A 4UCSA 1Y76A 4JTAB 1R3LC 3CXHF 2UXDO 5B3SB 2E74B 2UUBB 1AJQA 1G1XB 1Z5WA 1H8HG 4ZBMA 4FLTA 4B3RO 2JEXA 3G4SV 1BE3H 3FYEB 3OTOO 5JCOA 1IBKB 3FB5C 4HZ3A 3RYIA 2EIJB 2E5LO 2IH3C 3F7YC 1VQ5V 5K1XA 4DR4O 2V4DA 1ENVA 5LGTA 4WFHA 4GKKB 1NBMG 5KHJA 4CH4A 4MVZA 2AW9A 2UXBO 4JI3B 4GYCB 2DYRB 3QTCA 4EFBA 2VQEB 1R3IC 1HW7A 4J11A 3ASOB 1NKDA 3WB2A 4O4LB 4DV3B 3OR6C 1MA1A 3TJTA 5B5EZ 1GAXA 2VS0A 3JAWB 4X62B 4BW5A 1M56B 3U10A 3ZMUA 5F2VO 3HKEB 4EEQA 4MTOA 1EZJA 1IBLB 4LWSB 4MTXA 2FTKA 3E89A 1JJOA 3OR7C 1S77D 4DO2A 1M93A 3OMNB 5IYZB 2B5UA 1VQNV 1VF6C 2B1IA 1FXVA 5B1BC 3TXQA 3N2KB 5EK0A 4G28B 3ZRWB 3QNEA 1N4CA 2VQFB 2OTLV 4GX2A 1K9MW 3K58A 5EC2C 1FS0G 4U3JA 4IHJB 1BCCH 1AROP 4C7UA 5KLVH 3G80A 1ORQC 2Q0AA 1BMFG 1AR4A 3CSXA 1T5EA 3JAWA 5BXZA 2L6LA 4KHPB 2UXXA 4DV0O 4LF8B 5FNVB 2DWEC 1LUWA 3CE2A 3A0RA 5B1BB 2QKAA 2YXYA 2BSKB 1L0LH 4IYIA 3ZMTA 1SZTA 4PD4F 1XILA 3OFNG 2A79B 3ZRWA 3JAKA 3WG7C 4FPPA 1KBHA 1FJGB 1VP7A 3TGUH 2PTMA 2B1GA 3EHBB 3SJBC 3OW2U 4B3SB 2Q7EA 1GM8A 1N34O 1RP3B 4TV8B 1COWG 4RQFA 4I50A 1VMGA 1YITV 3LDCA 1JMKC 5A9GA 2IW5A 3TETA 2L35A 1VF6A 2PGGA 1H2LA 3BFRA 4PI0A 3IC9A 4RUEA 3JSLA 5KHIA 1WJZA 1SQQH 4PA3A 1KECA 1S76D 1JPXA 3VQXA 4YY3O 4YIOA 1SERA 2HG5C 2FKXA 3K5OA 3E8HA 1Q6UA 3JALB 1N0JA 3ZHRA 1K7DA 1I5YA 1IDSA 3K57A 4J7KA 4PA9A 1GKFA 5LP6B 1SKVA 4TV8A 1PP9H 4ZI7A 2CTRA 1OCCC 5LBQA 2LFRA 5KUMA 1MG1A 4ICGA 1IZ3A 1M57C 3T1HB 4JI6B 3AG1C 4CS3A 4G27B 5JH7B 4K0KO 1YDXA 4CS4A 1YTFB 4YXWG 2EIMB 4L8JA 4X88A 1JX9A 1KMIZ 4D7TA 2JRIA 3RYHB 4FM1A 4AQYO 4X65B 4G2KA 4TQFA 2GTAA 3K3WA 5EZYB 3B8MA 1AVMA 1E1QG 5DECA 3ZRVA 4LF4O 1BSMA 1IXBA 3JALA 2D3OW 2YI8A 3GWKC 3E83A 1US6A 5H6QA 1R3KC 1M57B 4L87A 4I9QA 3FKSG 4BWAA 3GVMA 2PYJA 4FK5C 2NR5A 4LFBO 4OX9O 4P9OA 4H0LB 1N8RW 2IJIA 4JV5O 3IC7A 1U97A 3CPWU 2HVJC 4P9PA 1YJWV 1S5HC 5GONB 1KC8W 4LF5O 1R6KA 3ZHQA 2OT5A 1L1FA 2ZM6B 1NVPD 5KX5A 4AILC 1K92A 4X8AA 5ITZA 1CPYA 2VRZA 1GMGA 1NR7A 5EBWC 5BZBA 3ETQA 1VQ4V 1RFYA 1GK9A 1FFTB 5EZYA 1N36B 3SYPA 1W0KG 2P22C 4O4HB 3IJ4A 3K08A 1JA8A 3G6BA 2QWPB 2R9RB 1O9HA 1L8DA 1GN6A 3ZJZA 1Q6HA 3HKDB 2QTOA 5LMUB 1XNQB 1N32O 3K79A 4GT1A 1KKCA 1ZTEA 2AGAA 5KUKA 3L9DA 2HJDA 4NXMB 3HKBA 4PHZA 4RQEA 3HKCB 2JK5C 3BY6A 5H9CA 2LFSA 2X0LA 2WA4A 3IGAC 3FD9A 5J2TA 2F1MA 1Q7YW 4DV6B 2JGDB 3OTFA 4UV9A 4MVOA 3TCUA 4CBCA 1XMQO 4RO2A 4F4LA 1JVMA 2ZT9B 1AP5A 4JTCB 2ZKOA 1OJHA 2WA3A 3AG3C 4GKJB 1M4UA 4O4HA 1F7YA 2HVKC 3QO7A 1YTFD 4JZGA 2XAHA 3U11A 3EFFK 4DUYB 4GKKO 3HKDA 4X64B 3B09A 4JI3O 4JI7B 5DM6V 2EBOA 3OAAG 2DYSB 3D36C 3UT5B 4GUNA 1LUVA 2QDOA 4RWUA 2LW7A 3CMEV 3BA9A 3HKCA 4BW9A 2HJFC 3W7UA 3ZHUA 4BIOA 3DC5A 1OCRC 4AI8A 3RYCB 4YJ3B 4H13B 3SYQA 1IBMB 4LP8A 1I7FA 2ITDC 3AG3B 1S0VA 4JYAB 2ZE6A 3CCUV 4JI4B 1WPBA 2QM4A 5JJNB 4DR7B 2AHYA 1KD1W 2Y4TA 3CRRA 4W4KA 5EIBD 4O2BA 4GZRB 5B1AC 5CN0A 1WN7A 4EB6B 3UKMA 4TQDA 2QA4V 4LF6O 1AB3A 5LHIA 1MOFA 4FLWA 1D5AA 1SQFA 1PPJH 2X7RB 1B3QA 2NN4A 5EYPB 2HHHB 4N23A 1QVFU 2FYUH 1H2SB 2XHBA 3JD2A 2M6YA 1GTOA 1DK1A 1E79G 1Q90D 2RQ6A 5LHGA 4KHPO 4LF8O 4FMTA 1KP2A 3ZRXA 2A0LA 1Q82W 4DV2B 1MNGA 1XL6A 1QU7A 2F95B 4UUJC 4EB6A 1B6QA 3STZC 3OUFA 1V55C 4JGSA 4JYCA 3CCLV 2CAZC 3H1LH 3ZS8C 1SQXH 2BOBC 3D36A 1VQMV 4UCRA 3QO5A 2CUGA 1QR9A 2JJ1G 1XUQA 1FJGO 4I5SA 2R70A 3OGIB 4DV1B 2X6CA 5EYPA 4WFFA 1HNZB 5L3FA 4DR5O 3DXRB 4Q20A 1HDJA 3OGCC 4B7EA 2CGNA 4NTYA 4J80A 3SYAA 4CH6A 1VQLV 4UXNA 2RJZA 2LW1A 1PD3A 1Q5OA 1Z2GA 1HNWB 1V55B 4X9QA 4MTGA 2XAJA 1F4NA 4WFEA 4DV7O 4O4IB 3AG7A 3G71V 3B8NA 1THZA 1GM7A 4LFAB 2W0XA 1AR5A 3OEHG 4MT8A 3X2QC 3K0GA 2E76B 3I56V 5LMNB 4LFCO 4ZIBA 2BTOA 1QLEC 1Q43A 2RNBA 4PJ0Z 2Q69A 4JZ2A 1DF5A 4X1IB 4DR2B 4LF9B 3DXRA 2QWQB 4FFBA 4ZOLB 5B3SC 1IX9A 5L3EA 3OEEG 4U3FH 3AK2A 1YIJV 3W7TA 1JCHA 2CTQA 4O4IA 1WLEA 2FL4A 2ZCEA 2XAGA 1QLEB 2EIJC 1N33B 4DRXB 4X65O 4D6TH 5HFLA 1AJNA 1ZL8B 5LL6Y 2BE3A 2JDIG 2XAFA 4FZ1A 4JI5O 2XAQA 2K9PA 3CC2V 1M9NA 3PJSK 4A5UB 1K97A 2R9IA 3L70H 3P3NA 1G6UA 2DYRC 2CE4A 4X1IA 1IVSA 5JJEB 3ASOC 3K06A 2HKOA 4F6RB 1J5EB 1SA0B 3B2EE 4FLVA 3L75H 3N2GB 5CBHA 2GSMB 3ZMZA 1WPXA 4JAVA 4JI8B 3TXSA 5JQGB 2F4VB 2CH7B 5HFMA 2HP8A 4ABMA 4DR1O 3CWBH 1XOUA 1M56C 2N74A 2YEVB 4FM0A 4RAIA 2LJ2A 2LGQA 4FIPC 5K1PA 3S3XA 2O57A 4DRXA 1YHQV 1I0HA 3E8BA 1ZL8A 1L0NH 3U0ZA 4CH3A 1XI1A 2GHYA 2QTSA 5JVDB 4KUMA 2ZIOA 4E4EA 2OYQA 1I5XA 1K5QA 2XASA 4YHHO 4JI2B 1I94O 2QKSA 3ETGA 3WU2Z 5LMUO 3FAVB 4OGQB 3ZHTA 2UUAB 1SZXA 1W2BU 4DR6B 4R6ZA 2X6AA 4F6RA 2GUZB 1YJNV 3OMAB 5LA6B 1SA0A 1GN3A 1NTKH 3N2GA 3J7AU 3SYCA 4DR3O 3OM3B 3A0BZ 1BGYH 1NTZH 1J95A 3GB7C 5KMGB 2Z5UA 4Z1VA 3CCSV 5IDJA 1WB8A 3JD3A 2H8PC 4DV5O 1B04A 1VF7A 2WLIB 1M90W 4NVPA 5JVDA 5D5QA 2CDYA 4K8ZA 4NXNO 3CCQV 4O4LA 4X64O 1VEWA 3E8FA 5LXTB 4TOIA 2PI4A 2A9HA 2GUZA 3WFVA 1OCOB 3HKEA 2JS5A 4JF3A 2Q73A 3ZHVA 2UUCB 4D7SA 4LWSA 2Z3YA 1WAZA 3K59A 1GH6A 4FJCC 3MAQA 5LYJB 5FPRA 1U96A 1XNRO 1RPOA 1MSWD 5IYZA 3LNMB 1IBMO 4H44B 1H8EG 5KMGA 4LF7O 1W59A 4MTFA 4WCEV 3C90A 1SQVH 3N2KA 3VBBA 3H1JH 5BY1A 4R50A 2ZIMA 2VWJA 1EZVH 1MABG 1CXZB 2WLIA 3LNNA 3DSQA 3SJQC 4J7ZA 1VQKV 4DV4B 4KFMA 1XEQA 4IHJA 2YUAA 2PUSA 2JIZG 1S5LZ 2UXCO 2E3CA 4JAUA 3JARB 5J2UB 5CMUA 1XMOB 4KL1A 5LP6C 2WWWA 2HHHO 5B1OA 4FLUA 5FNVA 5GTHZ 2AZ0A 3QO8A
chains in the Genus database with same CATH topology
4GT1A 1QBZA 1GO3F 1OZ0A 5KUKA 2WLLA 4RQEA 1NR1A 3ML0A 2JK5C 3BY6A 5H9CA 2M7WA 4J9YB 3OUSA 3CD6V 2LFSA 2X0LA 3RBZA 3IGAC 1VQOV 4PA7A 2EIMC 3JYCA 1Y4MA 3ABUA 1FXKB 1G8MA 1R73A 5GW7A 1Q7YW 3IFXA 4N21A 4UV9A 4MVOA 3TCUA 3CCMV 2ITCC 4CBCA 1KQSU 1P7BA 4RO2A 2Y69C 3MHSC 4GX5A 2ZD9A 1F51A 4F4LA 1JVMA 3ETDA 1RM1B 4JTCB 4QPJA 4MVMA 2QE7G 3AG3C 1QCEA 2ZQMA 3HPLC 4U7OA 2F43G 2HVKC 2YEVA 3QO7A 4CZZA 1OCOC 1YTFD 3CC4V 1K33A 3RVZA 2XAHA 3EFFK 2K1EA 4PDRA 4E2LA 3ZMVA 2QEXV 2WPDG 3T1CA 1BL8A 4MSWC 5DM6V 1QVGU 2EBOA 1YI2V 3GWOA 3OAAG 3FYIB 2DYSB 1AR1B 4OXSA 1Q86W 3CMEV 4MW8A 1EBOA 1DTOA 1PNKA 2HJFC 3W7UA 3RW0A 3W7WA 2Y69B 4DXWA 5DN6G 1OCRC 1KKDA 1IXMA 2WAMA 3JCZA 3SYQA 1F23A 4LP8A 4PDLA 2ITDC 3AG3B 3I55V 1S0VA 4WFAV 5IY5C 1ROPA 3CCUV 4WFBV 2AHYA 1KD1W 3R65A 3ABLC 5LGUA 3T2MA 3JD4A 2V1DA 3LUTB 1W0JG 3ABKC 2DQ0A 5B1AC 5CN0A 4JYBA 4HYOA 1NH2D 5E1AC 3UKMA 1R6NA 3E2EA 1M1KW 4KP4A 2QA4V 1VQ7V 2HR3A 2DQ3A 5LHIA 3X2QB 1MOFA 3UM7A 2EINC 2EZPA 2W6IG 1VQ6V 1XL4A 2PI5A 3H01A 5IYBO 4MVSA 2X7RB 4N23A 1QVFU 3OE7G 1RPRA 4JTAB 3SPHA 1R3LC 4BIZA 5IY5B 2LP7A 1FXKC 2YSUB 3MD0A 3JD2A 2BOCC 3AG2B 1GTOA 1E79G 3ABKB 5LHGA 4MVUA 5B3SB 1AJQA 2Q6AA 3FB7C 4TSFG 3T4DA 1Y66A 1RM1C 4U7NA 2Q67A 4FMTA 1KP2A 3ZRXA 1H8HG 4JASA 4ZBMA 2A0LA 2JEXA 1Q82W 2EILC 5L3BA 1XL6A 1K8AW 3G4SV 1K4CC 1NVPB 3W7XA 3FYEB 4UUJC 3FB6C 1PNMA 1B6QA 3STZC 3OUFA 1V55C 4JGSA 4JYCA 3CCLV 2EINB 3FB5C 4HZ3A 2BOBC 3D36A 2EIJB 1VQMV 3QO5A 3K79A 2KB1A 1QR9A 1P4RA 2JJ1G 5CBFA 3ABMC 1VQ8V 1YSCA 2IH3C 3F7YC 2DYSC 1VQ5V 4I5SA 3SPIA 3LSSA 1HWYA 2X6CA 1NQTA 2CK3G 2EJRA 3LSQA 1ENVA 3K04A 5LGTA 4WFHA 1NBMG 4LC1A 4WFFA 4MVZA 3AG4C 5L3DA 5L3FA 2DWDC 2DYRB 3WG7B 4Q20A 5L3GA 1R3IC 3OGCC 2EILB 4H37A 4GCZA 3LDDA 4TWKA 3ASOB 4EKWA 1NKDA 3SYAA 1VQLV 4UXNA 4P30A 1PD3A 3VOUA 1V55B 4MTGA 3OR6C 3B77A 2XAJA 4XDLA 1F4NA 3NXSA 4WFEA 4UVBA 4BW5A 1M56B 1TUEB 4QJFB 4R8CA 4WF9V 3B8NA 1THZA 3ZMUA 3ABMB 1GM7A 1NJIW 2EZOA 3ZRSA 4P2ZA 4MTOA 3OEHG 4PDMA 1EZJA 3JD1A 1F4MA 2WSSG 4MT8A 4MTXA 4MS2A 3K0GA 2FTKA 3X2QC 3E89A 1AI6A 3OR7C 3I56V 1S77D 5J9PC 5C93A 3ZMSA 3AG4B 3OMNB 5H6RA 4DO2A 1FXHA 2B5UA 1VQNV 1JOYA 1QLEC 2JEUA 2B1IA 2Q68A 1FXKA 3ABTA 1FXVA 5B1BC 3BEHA 2Q69A 5EK0A 5LGNA 2WLNA 1DF5A 4G28B 3ZRWB 3K0DA 3QNEA 2OCCB 3AG2C 3SPGA 2ATKC 2OTLV 4GX2A 1K9MW 5EC2C 5EBLC 5B3SC 5L3EA 3OEEG 2UXNA 1FS0G 1EFRG 2IU3A 4LBEC 3CMAV 2DW4A 3CCVV 1YIJV 1K5SA 2P90A 3W7TA 1AROP 1JCHA 2ZR2A 1OCCB 1ORQC 4LCUC 3RVYA 1BMFG 5EBMC 1ZWIC 2NNUA 1WLEA 5IYCO 1H2GA 4PA4A 3AG1B 2UXXA 3CC7V 2XAGA 1QLEB 2XNDG 4JTDB 2EIJC 3E86A 2DWEC 3E8GA 1KP3A 5HFLA 1AJNA 3A0RA 4ZKIA 5B1BB 2H94A 3ZN1A 3MHHC 4GX1A 2JDIG 2XAFA 3SPCA 2XAQA 1SESA 3CC2V 3CP1A 2P7TC 3STLC 1SRYA 1DLBA 1M9NA 2X6BA 3PJSK 4XDKA 1K4DC 3ZMTA 4Z1MG 1PKXA 1SZTA 1K97A 3OFNG 2R9IA 4PDVA 2A79B 2DYRC 3ZRWA 3WG7C 4FPPA 1S3JA 2C2AA 1DF4A 2IJJA 3CCRV 4UVAA 2OTJV 3CCEV 2B1GA 2P6JA 3ASOC 3K06A 3DTUB 3EHBB 2HKOA 3OW2U 5CA3A 5IYDO 1PNLA 1GM8A 1S72V 1COWG 2GSMB 5CBHA 3ZMZA 1WPXA 3F7VC 4RQFA 4JAVA 2IJHA 1YITV 3LDCA 5HFMA 1AI7A 1M56C 2YEVB 1SETA 4H33A 4RAIA 3P32A 4FIPC 2IW5A 3TETA 1AJPA 5CBGA 3P30A 2HFEC 2HLDG 4BAYA 3E8BA 4JPRA 1YHQV 4RUEA 3ETEA 4UV8A 2ZDIC 2GHYA 4KUMA 1JQ0A 1I5XA 4PA3A 1V54C 1K34A 1KECA 1S76D 1JPXA 1K5QA 2XASA 3K9AA 4PELA 1VQ9V 2QKSA 3ETGA 2OCCC 1SERA 2HG5C 1AI5A 3E8HA 2MK3A 1AI4A 1LNQA 4TT3G 1W2BU 5B1NA 4R6ZA 2X6AA 1K7DA 2W0FC 1I5YA 3F5WC 3OMAB 4QIWF 2NLJC 4X89A 1YJNV 4XBFA 4PA9A 1GKFA 3G71V 1OCCC 5LBQA 2LFRA 5KUMA 1OHHG 3HB3B 1MG1A 1R3JC 2EIKB 2ZR3A 3SYCA 1H38A 4MW3A 1M57C 3OM3B 1QR8A 3AG1C 2WLKA 5FL7G 1J95A 3TK1A 4G27B 3GB7C 5L3CA 1Q81W 2JJ2G 2Z5UA 4PA6A 3ZIAG 4QE9A 3CCSV 5IDJA 4XDJA 4YXWG 1V54B 2ZXWC 3CYOA 3DGEA 3FB8C 1VQPV 3JD3A 1YTFB 2EIMB 2H8PC 4X88A 1JX9A 4I9WA 4MVRA 1UJWB 2WLIB 1M90W 1OCZC 3AEIA 3CCJV 3G6EV 1BHBA 2QM8A 4UVCA 3KG2A 4G2KA 3K3WA 3CCQV 3B8MA 3ZN0A 1E1QG 3ZRVA 4QPKA 2D3OW 4J9ZB 1G4YB 1GM9A 3ASNC 3E83A 3E8FA 4GX0A 5H6QA 2PI4A 2A9HA 3LDEA 3WFVA 1R3KC 2WLJA 1M57B 3M99B 3E35A 4L87A 4BIUA 1OCOB 3FKSG 2IJKA 2WLHA 4FK5C 4JF3A 1QLNA 3CXCU 3OMIB 4P9OA 1PL0A 2Z3YA 4FJCC 1N8RW 2IH1C 1CEZA 2IJIA 2ZXWB 1MSWD 1RPOA 4QE7A 3IC7A 3CPWU 3LNMB 2HVJC 2WLLB 4QNHB 2ZDIA 2Y48A 4P9PA 1YJWV 1S5HC 1H8EG 1JJ2U 1K73W 1OCZB 1KC8W 1R6KA 1YJ9V 4MTFA 1NH2B 2OT5A 2XOKG 1L1FA 5LHHA 4WCEV 3VBBA 1NVPD 4R50A 4RUFA 1OCRB 1K92A 4X8AA 3W7SA 1MABG 2WLIA 2QM7A 1BHAA 1CPYA 2P67A 3JD0A 3SJQC 1GMGA 1NR7A 5EBWC 5BZBA 5KA5A 1VQKV 3ASNB 1VQ4V 5EC1C 4KFMA 3K03A 2V7QG 3SPJA 4R7CA 1GK9A 2W6JG 1FFTB 1E1RG 4HAMA 5KA6A 3SYPA 1W0KG 3ABLB 2IU0A 2AHZA 2JIZG 5B1AB 3K08A 4MVQA 4JAUA 5CMUA 2R9RB 1K3EA 3D3IA 3ZCCA 3SYOA 3ZJZA 2WWWA 2QTOA 5B1OA 4ASUG 2WLMA 2EIKC 3T4ZA 3QO8A 1CP9A 4WFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATK C;  4PA9 A;  4GX2 A;  5KUK A;  4JTA B;  3SPH A;  5EC2 C;  5EBL C;  1R3L C;  5B3S C;  1OCC C;  5KUM A;  2WLL A;  4LBE C;  1R3J C;  2BOC C;  3SYC A;  4MW3 A;  1M57 C;  2JK5 C;  3AG1 C;  2WLK A;  4J9Y B;  3OUS A;  3RBZ A;  1J95 A;  3IGA C;  4G27 B;  2EIM C;  3GB7 C;  1ORQ C;  3JYC A;  4LCU C;  4MVU A;  4PA7 A;  3RVY A;  3FB7 C;  2Q6A A;  3T4D A;  5EBM C;  2EIK C;  2Q67 A;  1ZWI C;  4PA6 A;  3IFX A;  3TCU A;  4MVO A;  2A0L A;  4PA4 A;  2ITC C;  4QE9 A;  4ZBM A;  2EIL C;  1P7B A;  4XDJ A;  2ZXW C;  3FB8 C;  1XL6 A;  4CBC A;  4RO2 A;  4JTD B;  2H8P C;  2EIJ C;  2Y69 C;  2DWE C;  1K4C C;  3E86 A;  2ZD9 A;  4GX5 A;  3E8G A;  1JVM A;  4I9W A;  4MVR A;  4JTC B;  2WLI B;  4UUJ C;  4F4L A;  1OCZ C;  3FB6 C;  4MVM A;  3STZ C;  3OUF A;  1V55 C;  4GX1 A;  3SPC A;  3FB5 C;  4HZ3 A;  2BOB C;  3AG3 C;  3KG2 A;  2P7T C;  3STL C;  3HPL C;  2X6B A;  3PJS K;  2HVK C;  1K4D C;  2KB1 A;  2YEV A;  4XDK A;  1OCO C;  5CBF A;  3ABM C;  3RVZ A;  4J9Z B;  2IH3 C;  3F7Y C;  2DYS C;  4PDV A;  3EFF K;  3SPI A;  1G4Y B;  2A79 B;  2K1E A;  3ASN C;  3E83 A;  3E8F A;  4GX0 A;  2DYR C;  2X6C A;  4PDR A;  3WG7 C;  2A9H A;  3LDE A;  1R3K C;  2WLJ A;  3K04 A;  4WFH A;  1BL8 A;  4MSW C;  3T1C A;  4WFF A;  2WLH A;  3AG4 C;  3ASO C;  3K06 A;  4MVZ A;  2DWD C;  4P9O A;  4OXS A;  1R3I C;  4X88 A;  3OGC C;  2IH1 C;  4MW8 A;  5CBH A;  4H37 A;  2HJF C;  3F7V C;  3LDD A;  4TWK A;  3RW0 A;  4QE7 A;  3LNM B;  4EKW A;  2HVJ C;  2WLL B;  3LDC A;  3SYA A;  4DXW A;  4QNH B;  1OCR C;  4P9P A;  1S5H C;  1KKD A;  4P30 A;  1M56 C;  4H33 A;  3VOU A;  4RAI A;  4MTF A;  3SYQ A;  4LP8 A;  4MTG A;  4PDL A;  3OR6 C;  2ITD C;  3TET A;  4XDL A;  4R50 A;  4RUF A;  4WFE A;  5IY5 C;  4X8A A;  5CBG A;  4BW5 A;  2HFE C;  4R8C A;  2WLI A;  2AHY A;  3E8B A;  3R65 A;  3ABL C;  4RUE A;  3SJQ C;  3T2M A;  3LUT B;  3ZRS A;  3ABK C;  4P2Z A;  5EBW C;  4MTO A;  5BZB A;  4PDM A;  5B1A C;  5EC1 C;  4KFM A;  3K03 A;  3SPJ A;  4MS2 A;  3K0G A;  4R7C A;  4HYO A;  3X2Q C;  3E89 A;  3OR7 C;  5E1A C;  3UKM A;  3SYP A;  5J9P C;  4PA3 A;  1V54 C;  2AHZ A;  1QLE C;  2QKS A;  3K08 A;  4MVQ A;  2Q68 A;  2OCC C;  2HG5 C;  2R9R B;  3E8H A;  5B1B C;  3BEH A;  3UM7 A;  3SYO A;  2EIN C;  1LNQ A;  2Q69 A;  5EK0 A;  3ZJZ A;  2WLN A;  2QTO A;  4R6Z A;  2X6A A;  4G28 B;  1XL4 A;  2W0F C;  2WLM A;  3K0D A;  4MVS A;  3F5W C;  2NLJ C;  4X89 A;  3T4Z A;  3AG2 C;  3SPG A;  4WFG A; 
#chains in the Genus database with same CATH topology
 1GO3 F;  4JI0 O;  4B08 A;  3C3S A;  1RSO B;  5LYJ A;  2BSK A;  3CRM A;  3QG5 A;  3RWR D;  1O9G A;  3ML0 A;  1VQO V;  2EIM C;  4FFK A;  1Y4M A;  4ZHQ B;  1FXK B;  5FPO A;  3IFX A;  3E22 B;  4N21 A;  1KQS U;  2ZE5 A;  2EUL A;  2ZD9 A;  1RM1 B;  3ETD A;  3J81 N;  2ZE7 A;  4CC6 A;  2QE7 G;  3IAY A;  2QGN A;  1JFF B;  1QCE A;  3BAB A;  2F43 G;  3JAR A;  5J2U A;  3D8C A;  3CC4 V;  1K33 A;  4X20 B;  1S5J A;  3SDL A;  1HNZ O;  1BL8 A;  3EXA A;  4DW0 A;  5BMV B;  1RSO A;  3APO A;  5EIB C;  4X1Y B;  1H2N A;  3CJH B;  1YVW A;  3B4S A;  4OXS A;  4B3M O;  1Q3E A;  3UO2 A;  1DTO A;  1HNW O;  3W7W A;  1NU1 H;  1ZSP A;  1HNX B;  2WAM A;  3E22 A;  4PDL A;  5E79 Z;  3I55 V;  3RGB A;  1P49 A;  4WFA V;  5IY5 C;  2KG7 B;  3R65 A;  5LP6 A;  3ABK C;  2JVD A;  1JFF A;  4JYB A;  3E2E A;  4X20 A;  3NR7 A;  1VQ7 V;  1NI8 A;  2HR3 A;  5JH7 A;  2UXD B;  4OPH A;  1D2D A;  4DR2 O;  3UM7 A;  2EIN C;  2W6I G;  3FFQ A;  5C8Y B;  1KUQ A;  1YZB A;  4X1Y A;  4B3R B;  1FFX B;  2CGO A;  4LNU B;  3RYH A;  3O9O A;  1RPR A;  3SPH A;  4CC5 A;  4BIZ A;  5IY5 B;  3OTO B;  2YSU B;  2BOC C;  3AG2 B;  3L72 H;  3P3P A;  5LOV B;  1N0N A;  3CRC A;  3ABK B;  3FB7 C;  2Q6A A;  4TUY B;  3T4D A;  2E5L B;  4U7N A;  2KG7 A;  1TVK B;  1P7G A;  4DW1 A;  3B40 A;  4LR3 A;  4IIJ B;  1Z5V A;  4NR1 A;  3W7X A;  5GTI Z;  3FB6 C;  5JWP A;  4B3T B;  2EIN B;  2UUB O;  5GON A;  5CBF A;  3ABM C;  1YSC A;  2DYS C;  3H9V A;  3LSS A;  3WB0 A;  1AIL A;  3LSQ A;  2AZ2 A;  1PV0 A;  4LNU A;  2A7W A;  3AG4 C;  4IT5 A;  1IBK O;  5L3G A;  1LR1 A;  4TWK A;  2ADQ B;  4UB8 Z;  2DMX A;  4P30 A;  4TUY A;  1SQP H;  3L71 H;  3VOU A;  1TVK A;  3H1H H;  3VQY A;  3B77 A;  1SQG A;  4XDL A;  4UVB A;  2P4K A;  4IIJ A;  3K9S A;  1TUE B;  4QJF B;  4R8C A;  1EM1 A;  3ABM B;  1NJI W;  2EZO A;  2RDC A;  2VQE O;  5KAF Z;  2EJ7 A;  4P2Z A;  1QHT A;  3H1K H;  1Y74 B;  3JD1 A;  1F4M A;  2WSS G;  4NKG B;  4MS2 A;  2N04 A;  3J80 N;  3AG4 B;  4YJ2 B;  1FXH A;  4DV3 O;  2UUA O;  2Q68 A;  2JGD A;  3ABT A;  4X62 O;  1Q8I A;  5LGN A;  2ZE8 A;  3JAT B;  1FAF A;  2OCC B;  4DV0 B;  2ATK C;  1IBL O;  1GN4 A;  1X59 A;  2UU9 B;  1EFR G;  2IU3 A;  4LBE C;  2DW4 A;  2Q5Z A;  2P90 A;  4NYK A;  2ZR2 A;  3RVY A;  4LCU C;  5IYC O;  2VQF O;  2YS8 A;  2XND G;  4JTD B;  3E8G A;  4CS2 A;  1Y74 A;  3UT5 A;  4ZKI A;  2H94 A;  3ZN1 A;  3MHH C;  3UCS C;  3AK3 A;  1SES A;  4YJ2 A;  2P7T C;  3RYC A;  1DLB A;  2X6B A;  4YJ3 A;  4XDK A;  1K4D C;  4Z1M G;  2YXL A;  4JI1 B;  2EX3 A;  5CA0 B;  4FM2 A;  3SJA C;  4PDV A;  3JAT A;  1S3J A;  2C2A A;  1X4T A;  2R9A A;  3RT3 C;  4HNA B;  3CCR V;  4UVA A;  2OTJ V;  3DTU B;  5CA3 A;  5IYD O;  3K5N A;  1S72 V;  2Z0A A;  4DYL A;  1AI7 A;  3MDS A;  1JR9 A;  3P32 A;  1XDC A;  4I55 B;  4YY3 B;  2ZIN A;  5CBG A;  3P30 A;  4B3S O;  4DV4 O;  2HLD G;  4JPR A;  2Q7G A;  3ETE A;  2QSA A;  1TA8 A;  1WNS A;  1Y6X A;  5CA0 A;  1K34 A;  1WP8 A;  2QR4 A;  1XMO O;  5KHH A;  2MK3 A;  1LNQ A;  4TT3 G;  2IM9 A;  5B1N A;  4K0K B;  3O65 A;  2W0F C;  1WB7 A;  2GDS A;  2GTS A;  3F5W C;  4QIW F;  2NLJ C;  4X89 A;  4FLX A;  4XBF A;  2YXH A;  2JGU A;  1VF5 B;  1ZLZ A;  1IUR A;  1WA8 B;  5B66 Z;  1R3J C;  2EIK B;  1H38 A;  1QQC A;  1SS3 A;  1QR8 A;  5IE9 A;  2PF4 E;  1SF9 A;  4I55 A;  4IYH A;  5L3C A;  3JCU Z;  3M7M X;  2JJ2 G;  4LF4 B;  1AP6 A;  3UO3 A;  2FML A;  1URF A;  4DK1 A;  3DGE A;  3CYO A;  1HR0 B;  4I9W A;  1UJW B;  3CHX A;  3AEI A;  3CCJ V;  3G6E V;  1BHB A;  4UVC A;  1QNM A;  4LFB B;  4OX9 B;  3T1H O;  4JI6 O;  3KG2 A;  4JV5 B;  1FKA O;  4J10 A;  3ASN C;  4LF5 B;  2OCH A;  3LDE A;  3I5D A;  3ICX A;  4BIU A;  4UCO A;  1WP7 A;  3KCX A;  2DN9 A;  3CXC U;  1TAE A;  4X66 B;  1YCI A;  3SR2 C;  3CRQ A;  1HNX O;  2WLL B;  4QNH B;  3UQ8 A;  4B7K A;  1K73 W;  1KU9 A;  1YJ9 V;  5LHH A;  2XTA A;  3THO A;  2YIC A;  3A2F A;  2D2C B;  2QM7 A;  1BHA A;  1ZUQ A;  2P67 A;  5KA5 A;  4ZOL A;  2CTW A;  3ASN B;  1N32 B;  3K03 A;  2V7Q G;  2RMK B;  3SPJ A;  2A3Q A;  2W6J G;  1E1R G;  3ABL B;  2IU0 A;  2YIB A;  3S3W A;  3K5L A;  2ZM6 O;  3WB1 A;  1K3E A;  3ZCC A;  2WLM A;  1XMQ B;  4WFG A;  1QBZ A;  1D5N A;  4UCT A;  1N36 O;  1TUB B;  3PN1 A;  1NS1 A;  2WLL A;  3Q4H B;  4IGG A;  1NR1 A;  4O2A B;  1NT2 B;  3OUS A;  3CD6 V;  3RBZ A;  2YC0 A;  1I08 A;  3JYC A;  5CB4 B;  1G8M A;  1R73 A;  1XNQ O;  3CCM V;  2ITC C;  1P7B A;  2F23 A;  2DJV A;  4UFZ A;  4B3T O;  4GX5 A;  1F51 A;  4UCU A;  3G67 A;  4QPJ A;  2BCC H;  4NXM O;  2Q9L A;  2ARH A;  5JQG A;  2CH7 A;  4U3J B;  4WBN B;  2ZQM A;  2YEV A;  4CZZ A;  1OCO C;  4DV6 O;  3ZMV A;  4NTX A;  2WPD G;  3T1C A;  3T1Y B;  3GWO A;  1TUB A;  5IJ0 B;  3Q4H A;  4GKJ O;  1Q86 W;  2YIB D;  4O2A A;  4K35 A;  5A2Q N;  3R66 A;  5CB4 A;  1KKD A;  4DUY O;  4LF6 B;  3FAV A;  4JI7 O;  3JAM N;  2QJ1 A;  3JAK B;  1ROP A;  5LA6 A;  4WFB V;  5TIS Z;  5LGU A;  3T2M A;  2V1D A;  3LUT B;  1W0J G;  3A0H Z;  4WBN A;  1FYJ A;  4I50 B;  2KSD A;  4KP4 A;  3QVN A;  1MSD A;  4DUZ B;  4OPA A;  5H2F Z;  4JYA O;  1FPO A;  4JI4 O;  2Q7H A;  4DR7 O;  1VQ6 V;  1YF2 A;  3M8A A;  3H01 A;  2QKC A;  5IYB O;  4MVS A;  2UU9 O;  5IJ0 A;  1HP8 A;  3CS5 A;  5BR8 B;  3APQ A;  3OE7 G;  4UCV A;  2LP7 A;  1FXK C;  2Y4U A;  3MD0 A;  4HBN A;  3BAA A;  1YEW A;  3A8T A;  4MVU A;  5LXT A;  4TSF G;  1RM1 C;  1Y66 A;  2Q67 A;  4JAS A;  2N05 A;  2EIL C;  5L3B A;  1K8A W;  1K4C C;  1NVP B;  1PNM A;  1EN4 A;  4DR5 B;  4ZI7 B;  1BZK A;  4JI1 O;  2KQX A;  4K3A A;  3BHP A;  2KB1 A;  1P4R A;  4NTW A;  1VQ8 V;  4NB5 A;  2BTQ B;  3SPI A;  4DV2 O;  1BQ0 A;  1HWY A;  5H5N A;  1NQT A;  4X1K B;  2CK3 G;  5FLX N;  2EJR A;  2MW2 B;  3K04 A;  4GLX A;  4JYY A;  4LC1 A;  4DV7 B;  5L3D A;  2DWD C;  3WG7 B;  1FD9 A;  2LO1 A;  4TV9 B;  1Y67 A;  2EIL B;  4H37 A;  4GCZ A;  3LDD A;  2HEP A;  4EKW A;  5IWA B;  2P4V A;  4LFC B;  4DV1 O;  3BPZ A;  2AXT Z;  4PV1 B;  1GRJ A;  2ILM A;  1EN6 A;  3FX7 A;  3NXS A;  2P06 A;  3ZHS A;  4WF9 V;  5JJJ B;  4FLY A;  3ZRS A;  4PDM A;  1UPG A;  1AI6 A;  5J9P C;  5C93 A;  3ZMS A;  5H6R A;  3QF7 A;  2Y0I A;  1JOY A;  2JEU A;  2BTQ A;  4ZHQ A;  1FXK A;  4X1K A;  3BEH A;  5IJ9 B;  2DOS A;  2QWO B;  2WLN A;  4LFA O;  5KX5 B;  2RN9 A;  3K0D A;  5ITZ B;  3AG2 C;  3KCY A;  3SPG A;  2P5O A;  2JS3 A;  4TV9 A;  5EBL C;  5LMN O;  2UXN A;  3EVK A;  2DE0 X;  2F66 C;  1YXB A;  3CMA V;  3CCV V;  4JI5 B;  2Q8V A;  1K5S A;  3RN4 A;  1OCC B;  3BA8 A;  1BQZ A;  1NTM H;  4LH6 A;  5EBM C;  1ZWI C;  2NNU A;  2KKW A;  1HR0 O;  1H2G A;  4PA4 A;  4LF9 O;  3AG1 B;  1MZE A;  3CC7 V;  5BMV A;  1SC5 B;  3E86 A;  3CJH A;  1XHZ A;  1KP3 A;  4GX1 A;  3RYF B;  5KHK A;  3SPC A;  3CP1 A;  3STL C;  3HKB B;  1SRY A;  4W4L A;  1UFI A;  2A06 H;  1PKX A;  4UB6 Z;  5J2T B;  4DR1 B;  5IJ9 A;  3C3T A;  1DF4 A;  1N33 O;  2IJJ A;  4X66 O;  1KB9 F;  3CCE V;  1BS3 A;  2P6J A;  4DR4 B;  1A32 A;  2ADP A;  1PNL A;  3CX5 F;  4FLZ A;  2UXB B;  4I4T B;  3F7V C;  2IJH A;  2Y0P A;  2QWR B;  1KYO F;  1SET A;  4H33 A;  4YHH B;  1I94 B;  1XBL A;  5C8Y A;  4BR6 A;  1AJP A;  2HFE C;  1FFX A;  1J5E O;  4BAY A;  5KHG A;  1V9P A;  3LSU A;  4UV8 A;  3RYF A;  2ZDI C;  5AG2 A;  1TGO A;  3ZX6 A;  2Q0O C;  4JI8 O;  2F4V O;  1JQ0 A;  5LOV A;  1V54 C;  3RFR A;  4PEL A;  1VQ9 V;  3K9A A;  4DR3 B;  2OCC C;  2ZNJ A;  1AI5 A;  1AI4 A;  1MZF A;  2PY5 A;  2YI9 A;  2VWK A;  1PM9 A;  2YID A;  3L73 H;  1NZ6 A;  4I0X B;  1Q6I A;  1DGS A;  2GBO A;  4I4T A;  4O2B B;  4DV5 B;  3ZBH A;  1OHH G;  3HB3 B;  4JI2 O;  2ZR3 A;  4MW3 A;  2WLK A;  2OIE A;  5FL7 G;  3TK1 A;  2OIG A;  4NXN B;  4J41 A;  4DR6 O;  1Q81 W;  4PA6 A;  4O4J B;  3ZIA G;  4QE9 A;  1R6T A;  4XDJ A;  1V54 B;  1VIB A;  2ZXW C;  3FB8 C;  3SGI A;  1VQP V;  2RCV A;  4MVR A;  4J7J A;  1OCZ C;  3KZI Z;  2QM8 A;  5D5P A;  1H2K A;  3L74 H;  1XNR B;  2YDE A;  3ZN0 A;  2FB5 A;  4QPK A;  4J9Z B;  3T1Y O;  4LF7 B;  1G4Y B;  1GM9 A;  4GX0 A;  5KAI Z;  2WLJ A;  1BT8 A;  3F5T A;  3E35 A;  3M99 B;  2IJK A;  2WLH A;  4I0X A;  1QLN A;  3OMI B;  3JAS B;  3D3Q A;  1PL0 A;  4YIP A;  2IH1 C;  1CEZ A;  2XT9 A;  2ZXW B;  2CTP A;  4QE7 A;  2LGW A;  1N34 B;  2ZDI A;  2Y48 A;  3DC6 A;  1JJ2 U;  4DK0 A;  1XRE A;  1OCZ B;  1VAR A;  4O4J A;  1NH2 B;  2XOK G;  3VQW A;  3ZED A;  2UXC B;  2E75 B;  5CA1 B;  4RUF A;  3AK1 A;  1OCR B;  4IL6 Z;  3W7S A;  2XUM A;  2UUC O;  2ODM A;  1R1B A;  3JD0 A;  4I7Z B;  3BCC H;  5EC1 C;  4JI0 B;  4R7C A;  4HAM A;  5KA6 A;  2Q4P A;  4DUZ O;  1XQ8 A;  5IT9 N;  2AHZ A;  4AHC A;  4FVM A;  5B1A B;  4MVQ A;  2PYL A;  2QWN B;  1PL4 A;  3D3I A;  3SYO A;  1P84 F;  1ZX3 A;  5BR8 O;  1B06 A;  2IBZ H;  4ASU G;  3CB2 A;  2EIK C;  3T4Z A;  3JAS A;  1CP9 A;  1OZ0 A;  4JAA A;  1H2M A;  2GV9 A;  2B9Z A;  3CRA A;  4K8X A;  2M7W A;  4J9Y B;  4LH7 A;  2ETN A;  4PA7 A;  2YIA A;  3VQV A;  5CA1 A;  3ABU A;  5GW7 A;  2F93 B;  4HNA A;  1XHX A;  2Y69 C;  3MHS C;  3CEI A;  4Z2W A;  3KKY A;  4MVM A;  4PI2 A;  1SQB H;  4FFB B;  1M5I A;  4J42 A;  4Q6G A;  4B3M B;  3HPL C;  4AQY B;  4U7O A;  3SJC C;  1GN2 A;  3N27 A;  3RVZ A;  2K1E A;  2OWO A;  4PDR A;  4E2L A;  2QEX V;  5JCO C;  3H1I H;  4MSW C;  1QVG U;  2ZNI A;  3OD4 A;  1MMM A;  1YI2 V;  3FYI B;  1AR1 B;  4QGP A;  1Y76 B;  4MW8 A;  1EBO A;  5IWA O;  3HR0 A;  1EN5 A;  1PNK A;  1ZAU A;  3RW0 A;  2H3O A;  2Y69 B;  4DXW A;  5DN6 G;  1IXM A;  3JSN A;  3JCZ A;  1F23 A;  4KXR A;  4FZ0 A;  2LQT A;  2R72 A;  3OT7 A;  5DED A;  3ABL C;  3JD4 A;  1OV9 A;  3BVO A;  1WA8 A;  2DQ0 A;  4CH5 A;  3BRC A;  4HYO A;  1NH2 D;  4F6E A;  5E1A C;  4EFE A;  1R6N A;  2PZS A;  1M1K W;  3RYI B;  2DQ3 A;  3X2Q B;  2G38 A;  2EZP A;  3K5M A;  1XL4 A;  2PI5 A;  4UCS A;  1Y76 A;  4JTA B;  1R3L C;  3CXH F;  2UXD O;  5B3S B;  2E74 B;  2UUB B;  1AJQ A;  1G1X B;  1Z5W A;  1H8H G;  4ZBM A;  4FLT A;  4B3R O;  2JEX A;  3G4S V;  1BE3 H;  3FYE B;  3OTO O;  5JCO A;  1IBK B;  3FB5 C;  4HZ3 A;  3RYI A;  2EIJ B;  2E5L O;  2IH3 C;  3F7Y C;  1VQ5 V;  5K1X A;  4DR4 O;  2V4D A;  1ENV A;  5LGT A;  4WFH A;  4GKK B;  1NBM G;  5KHJ A;  4CH4 A;  4MVZ A;  2AW9 A;  2UXB O;  4JI3 B;  4GYC B;  2DYR B;  3QTC A;  4EFB A;  2VQE B;  1R3I C;  1HW7 A;  4J11 A;  3ASO B;  1NKD A;  3WB2 A;  4O4L B;  4DV3 B;  3OR6 C;  1MA1 A;  3TJT A;  5B5E Z;  1GAX A;  2VS0 A;  3JAW B;  4X62 B;  4BW5 A;  1M56 B;  3U10 A;  3ZMU A;  5F2V O;  3HKE B;  4EEQ A;  4MTO A;  1EZJ A;  1IBL B;  4LWS B;  4MTX A;  2FTK A;  3E89 A;  1JJO A;  3OR7 C;  1S77 D;  4DO2 A;  1M93 A;  3OMN B;  5IYZ B;  2B5U A;  1VQN V;  1VF6 C;  2B1I A;  1FXV A;  5B1B C;  3TXQ A;  3N2K B;  5EK0 A;  4G28 B;  3ZRW B;  3QNE A;  1N4C A;  2VQF B;  2OTL V;  4GX2 A;  1K9M W;  3K58 A;  5EC2 C;  1FS0 G;  4U3J A;  4IHJ B;  1BCC H;  1ARO P;  4C7U A;  5KLV H;  3G80 A;  1ORQ C;  2Q0A A;  1BMF G;  1AR4 A;  3CSX A;  1T5E A;  3JAW A;  5BXZ A;  2L6L A;  4KHP B;  2UXX A;  4DV0 O;  4LF8 B;  5FNV B;  2DWE C;  1LUW A;  3CE2 A;  3A0R A;  5B1B B;  2QKA A;  2YXY A;  2BSK B;  1L0L H;  4IYI A;  3ZMT A;  1SZT A;  4PD4 F;  1XIL A;  3OFN G;  2A79 B;  3ZRW A;  3JAK A;  3WG7 C;  4FPP A;  1KBH A;  1FJG B;  1VP7 A;  3TGU H;  2PTM A;  2B1G A;  3EHB B;  3SJB C;  3OW2 U;  4B3S B;  2Q7E A;  1GM8 A;  1N34 O;  1RP3 B;  4TV8 B;  1COW G;  4RQF A;  4I50 A;  1VMG A;  1YIT V;  3LDC A;  1JMK C;  5A9G A;  2IW5 A;  3TET A;  2L35 A;  1VF6 A;  2PGG A;  1H2L A;  3BFR A;  4PI0 A;  3IC9 A;  4RUE A;  3JSL A;  5KHI A;  1WJZ A;  1SQQ H;  4PA3 A;  1KEC A;  1S76 D;  1JPX A;  3VQX A;  4YY3 O;  4YIO A;  1SER A;  2HG5 C;  2FKX A;  3K5O A;  3E8H A;  1Q6U A;  3JAL B;  1N0J A;  3ZHR A;  1K7D A;  1I5Y A;  1IDS A;  3K57 A;  4J7K A;  4PA9 A;  1GKF A;  5LP6 B;  1SKV A;  4TV8 A;  1PP9 H;  4ZI7 A;  2CTR A;  1OCC C;  5LBQ A;  2LFR A;  5KUM A;  1MG1 A;  4ICG A;  1IZ3 A;  1M57 C;  3T1H B;  4JI6 B;  3AG1 C;  4CS3 A;  4G27 B;  5JH7 B;  4K0K O;  1YDX A;  4CS4 A;  1YTF B;  4YXW G;  2EIM B;  4L8J A;  4X88 A;  1JX9 A;  1KMI Z;  4D7T A;  2JRI A;  3RYH B;  4FM1 A;  4AQY O;  4X65 B;  4G2K A;  4TQF A;  2GTA A;  3K3W A;  5EZY B;  3B8M A;  1AVM A;  1E1Q G;  5DEC A;  3ZRV A;  4LF4 O;  1BSM A;  1IXB A;  3JAL A;  2D3O W;  2YI8 A;  3GWK C;  3E83 A;  1US6 A;  5H6Q A;  1R3K C;  1M57 B;  4L87 A;  4I9Q A;  3FKS G;  4BWA A;  3GVM A;  2PYJ A;  4FK5 C;  2NR5 A;  4LFB O;  4OX9 O;  4P9O A;  4H0L B;  1N8R W;  2IJI A;  4JV5 O;  3IC7 A;  1U97 A;  3CPW U;  2HVJ C;  4P9P A;  1YJW V;  1S5H C;  5GON B;  1KC8 W;  4LF5 O;  1R6K A;  3ZHQ A;  2OT5 A;  1L1F A;  2ZM6 B;  1NVP D;  5KX5 A;  4AIL C;  1K92 A;  4X8A A;  5ITZ A;  1CPY A;  2VRZ A;  1GMG A;  1NR7 A;  5EBW C;  5BZB A;  3ETQ A;  1VQ4 V;  1RFY A;  1GK9 A;  1FFT B;  5EZY A;  1N36 B;  3SYP A;  1W0K G;  2P22 C;  4O4H B;  3IJ4 A;  3K08 A;  1JA8 A;  3G6B A;  2QWP B;  2R9R B;  1O9H A;  1L8D A;  1GN6 A;  3ZJZ A;  1Q6H A;  3HKD B;  2QTO A;  5LMU B;  1XNQ B;  1N32 O;  3K79 A;  4GT1 A;  1KKC A;  1ZTE A;  2AGA A;  5KUK A;  3L9D A;  2HJD A;  4NXM B;  3HKB A;  4PHZ A;  4RQE A;  3HKC B;  2JK5 C;  3BY6 A;  5H9C A;  2LFS A;  2X0L A;  2WA4 A;  3IGA C;  3FD9 A;  5J2T A;  2F1M A;  1Q7Y W;  4DV6 B;  2JGD B;  3OTF A;  4UV9 A;  4MVO A;  3TCU A;  4CBC A;  1XMQ O;  4RO2 A;  4F4L A;  1JVM A;  2ZT9 B;  1AP5 A;  4JTC B;  2ZKO A;  1OJH A;  2WA3 A;  3AG3 C;  4GKJ B;  1M4U A;  4O4H A;  1F7Y A;  2HVK C;  3QO7 A;  1YTF D;  4JZG A;  2XAH A;  3U11 A;  3EFF K;  4DUY B;  4GKK O;  3HKD A;  4X64 B;  3B09 A;  4JI3 O;  4JI7 B;  5DM6 V;  2EBO A;  3OAA G;  2DYS B;  3D36 C;  3UT5 B;  4GUN A;  1LUV A;  2QDO A;  4RWU A;  2LW7 A;  3CME V;  3BA9 A;  3HKC A;  4BW9 A;  2HJF C;  3W7U A;  3ZHU A;  4BIO A;  3DC5 A;  1OCR C;  4AI8 A;  3RYC B;  4YJ3 B;  4H13 B;  3SYQ A;  1IBM B;  4LP8 A;  1I7F A;  2ITD C;  3AG3 B;  1S0V A;  4JYA B;  2ZE6 A;  3CCU V;  4JI4 B;  1WPB A;  2QM4 A;  5JJN B;  4DR7 B;  2AHY A;  1KD1 W;  2Y4T A;  3CRR A;  4W4K A;  5EIB D;  4O2B A;  4GZR B;  5B1A C;  5CN0 A;  1WN7 A;  4EB6 B;  3UKM A;  4TQD A;  2QA4 V;  4LF6 O;  1AB3 A;  5LHI A;  1MOF A;  4FLW A;  1D5A A;  1SQF A;  1PPJ H;  2X7R B;  1B3Q A;  2NN4 A;  5EYP B;  2HHH B;  4N23 A;  1QVF U;  2FYU H;  1H2S B;  2XHB A;  3JD2 A;  2M6Y A;  1GTO A;  1DK1 A;  1E79 G;  1Q90 D;  2RQ6 A;  5LHG A;  4KHP O;  4LF8 O;  4FMT A;  1KP2 A;  3ZRX A;  2A0L A;  1Q82 W;  4DV2 B;  1MNG A;  1XL6 A;  1QU7 A;  2F95 B;  4UUJ C;  4EB6 A;  1B6Q A;  3STZ C;  3OUF A;  1V55 C;  4JGS A;  4JYC A;  3CCL V;  2CAZ C;  3H1L H;  3ZS8 C;  1SQX H;  2BOB C;  3D36 A;  1VQM V;  4UCR A;  3QO5 A;  2CUG A;  1QR9 A;  2JJ1 G;  1XUQ A;  1FJG O;  4I5S A;  2R70 A;  3OGI B;  4DV1 B;  2X6C A;  5EYP A;  4WFF A;  1HNZ B;  5L3F A;  4DR5 O;  3DXR B;  4Q20 A;  1HDJ A;  3OGC C;  4B7E A;  2CGN A;  4NTY A;  4J80 A;  3SYA A;  4CH6 A;  1VQL V;  4UXN A;  2RJZ A;  2LW1 A;  1PD3 A;  1Q5O A;  1Z2G A;  1HNW B;  1V55 B;  4X9Q A;  4MTG A;  2XAJ A;  1F4N A;  4WFE A;  4DV7 O;  4O4I B;  3AG7 A;  3G71 V;  3B8N A;  1THZ A;  1GM7 A;  4LFA B;  2W0X A;  1AR5 A;  3OEH G;  4MT8 A;  3X2Q C;  3K0G A;  2E76 B;  3I56 V;  5LMN B;  4LFC O;  4ZIB A;  2BTO A;  1QLE C;  1Q43 A;  2RNB A;  4PJ0 Z;  2Q69 A;  4JZ2 A;  1DF5 A;  4X1I B;  4DR2 B;  4LF9 B;  3DXR A;  2QWQ B;  4FFB A;  4ZOL B;  5B3S C;  1IX9 A;  5L3E A;  3OEE G;  4U3F H;  3AK2 A;  1YIJ V;  3W7T A;  1JCH A;  2CTQ A;  4O4I A;  1WLE A;  2FL4 A;  2ZCE A;  2XAG A;  1QLE B;  2EIJ C;  1N33 B;  4DRX B;  4X65 O;  4D6T H;  5HFL A;  1AJN A;  1ZL8 B;  5LL6 Y;  2BE3 A;  2JDI G;  2XAF A;  4FZ1 A;  4JI5 O;  2XAQ A;  2K9P A;  3CC2 V;  1M9N A;  3PJS K;  4A5U B;  1K97 A;  2R9I A;  3L70 H;  3P3N A;  1G6U A;  2DYR C;  2CE4 A;  4X1I A;  1IVS A;  5JJE B;  3ASO C;  3K06 A;  2HKO A;  4F6R B;  1J5E B;  1SA0 B;  3B2E E;  4FLV A;  3L75 H;  3N2G B;  5CBH A;  2GSM B;  3ZMZ A;  1WPX A;  4JAV A;  4JI8 B;  3TXS A;  5JQG B;  2F4V B;  2CH7 B;  5HFM A;  2HP8 A;  4ABM A;  4DR1 O;  3CWB H;  1XOU A;  1M56 C;  2N74 A;  2YEV B;  4FM0 A;  4RAI A;  2LJ2 A;  2LGQ A;  4FIP C;  5K1P A;  3S3X A;  2O57 A;  4DRX A;  1YHQ V;  1I0H A;  3E8B A;  1ZL8 A;  1L0N H;  3U0Z A;  4CH3 A;  1XI1 A;  2GHY A;  2QTS A;  5JVD B;  4KUM A;  2ZIO A;  4E4E A;  2OYQ A;  1I5X A;  1K5Q A;  2XAS A;  4YHH O;  4JI2 B;  1I94 O;  2QKS A;  3ETG A;  3WU2 Z;  5LMU O;  3FAV B;  4OGQ B;  3ZHT A;  2UUA B;  1SZX A;  1W2B U;  4DR6 B;  4R6Z A;  2X6A A;  4F6R A;  2GUZ B;  1YJN V;  3OMA B;  5LA6 B;  1SA0 A;  1GN3 A;  1NTK H;  3N2G A;  3J7A U;  3SYC A;  4DR3 O;  3OM3 B;  3A0B Z;  1BGY H;  1NTZ H;  1J95 A;  3GB7 C;  5KMG B;  2Z5U A;  4Z1V A;  3CCS V;  5IDJ A;  1WB8 A;  3JD3 A;  2H8P C;  4DV5 O;  1B04 A;  1VF7 A;  2WLI B;  1M90 W;  4NVP A;  5JVD A;  5D5Q A;  2CDY A;  4K8Z A;  4NXN O;  3CCQ V;  4O4L A;  4X64 O;  1VEW A;  3E8F A;  5LXT B;  4TOI A;  2PI4 A;  2A9H A;  2GUZ A;  3WFV A;  1OCO B;  3HKE A;  2JS5 A;  4JF3 A;  2Q73 A;  3ZHV A;  2UUC B;  4D7S A;  4LWS A;  2Z3Y A;  1WAZ A;  3K59 A;  1GH6 A;  4FJC C;  3MAQ A;  5LYJ B;  5FPR A;  1U96 A;  1XNR O;  1RPO A;  1MSW D;  5IYZ A;  3LNM B;  1IBM O;  4H44 B;  1H8E G;  5KMG A;  4LF7 O;  1W59 A;  4MTF A;  4WCE V;  3C90 A;  1SQV H;  3N2K A;  3VBB A;  3H1J H;  5BY1 A;  4R50 A;  2ZIM A;  2VWJ A;  1EZV H;  1MAB G;  1CXZ B;  2WLI A;  3LNN A;  3DSQ A;  3SJQ C;  4J7Z A;  1VQK V;  4DV4 B;  4KFM A;  1XEQ A;  4IHJ A;  2YUA A;  2PUS A;  2JIZ G;  1S5L Z;  2UXC O;  2E3C A;  4JAU A;  3JAR B;  5J2U B;  5CMU A;  1XMO B;  4KL1 A;  5LP6 C;  2WWW A;  2HHH O;  5B1O A;  4FLU A;  5FNV A;  5GTH Z;  2AZ0 A;  3QO8 A; 
#chains in the Genus database with same CATH homology
 4GT1 A;  1QBZ A;  1GO3 F;  1OZ0 A;  5KUK A;  2WLL A;  4RQE A;  1NR1 A;  3ML0 A;  2JK5 C;  3BY6 A;  5H9C A;  2M7W A;  4J9Y B;  3OUS A;  3CD6 V;  2LFS A;  2X0L A;  3RBZ A;  3IGA C;  1VQO V;  4PA7 A;  2EIM C;  3JYC A;  1Y4M A;  3ABU A;  1FXK B;  1G8M A;  1R73 A;  5GW7 A;  1Q7Y W;  3IFX A;  4N21 A;  4UV9 A;  4MVO A;  3TCU A;  3CCM V;  2ITC C;  4CBC A;  1KQS U;  1P7B A;  4RO2 A;  2Y69 C;  3MHS C;  4GX5 A;  2ZD9 A;  1F51 A;  4F4L A;  1JVM A;  3ETD A;  1RM1 B;  4JTC B;  4QPJ A;  4MVM A;  2QE7 G;  3AG3 C;  1QCE A;  2ZQM A;  3HPL C;  4U7O A;  2F43 G;  2HVK C;  2YEV A;  3QO7 A;  4CZZ A;  1OCO C;  1YTF D;  3CC4 V;  1K33 A;  3RVZ A;  2XAH A;  3EFF K;  2K1E A;  4PDR A;  4E2L A;  3ZMV A;  2QEX V;  2WPD G;  3T1C A;  1BL8 A;  4MSW C;  5DM6 V;  1QVG U;  2EBO A;  1YI2 V;  3GWO A;  3OAA G;  3FYI B;  2DYS B;  1AR1 B;  4OXS A;  1Q86 W;  3CME V;  4MW8 A;  1EBO A;  1DTO A;  1PNK A;  2HJF C;  3W7U A;  3RW0 A;  3W7W A;  2Y69 B;  4DXW A;  5DN6 G;  1OCR C;  1KKD A;  1IXM A;  2WAM A;  3JCZ A;  3SYQ A;  1F23 A;  4LP8 A;  4PDL A;  2ITD C;  3AG3 B;  3I55 V;  1S0V A;  4WFA V;  5IY5 C;  1ROP A;  3CCU V;  4WFB V;  2AHY A;  1KD1 W;  3R65 A;  3ABL C;  5LGU A;  3T2M A;  3JD4 A;  2V1D A;  3LUT B;  1W0J G;  3ABK C;  2DQ0 A;  5B1A C;  5CN0 A;  4JYB A;  4HYO A;  1NH2 D;  5E1A C;  3UKM A;  1R6N A;  3E2E A;  1M1K W;  4KP4 A;  2QA4 V;  1VQ7 V;  2HR3 A;  2DQ3 A;  5LHI A;  3X2Q B;  1MOF A;  3UM7 A;  2EIN C;  2EZP A;  2W6I G;  1VQ6 V;  1XL4 A;  2PI5 A;  3H01 A;  5IYB O;  4MVS A;  2X7R B;  4N23 A;  1QVF U;  3OE7 G;  1RPR A;  4JTA B;  3SPH A;  1R3L C;  4BIZ A;  5IY5 B;  2LP7 A;  1FXK C;  2YSU B;  3MD0 A;  3JD2 A;  2BOC C;  3AG2 B;  1GTO A;  1E79 G;  3ABK B;  5LHG A;  4MVU A;  5B3S B;  1AJQ A;  2Q6A A;  3FB7 C;  4TSF G;  3T4D A;  1Y66 A;  1RM1 C;  4U7N A;  2Q67 A;  4FMT A;  1KP2 A;  3ZRX A;  1H8H G;  4JAS A;  4ZBM A;  2A0L A;  2JEX A;  1Q82 W;  2EIL C;  5L3B A;  1XL6 A;  1K8A W;  3G4S V;  1K4C C;  1NVP B;  3W7X A;  3FYE B;  4UUJ C;  3FB6 C;  1PNM A;  1B6Q A;  3STZ C;  3OUF A;  1V55 C;  4JGS A;  4JYC A;  3CCL V;  2EIN B;  3FB5 C;  4HZ3 A;  2BOB C;  3D36 A;  2EIJ B;  1VQM V;  3QO5 A;  3K79 A;  2KB1 A;  1QR9 A;  1P4R A;  2JJ1 G;  5CBF A;  3ABM C;  1VQ8 V;  1YSC A;  2IH3 C;  3F7Y C;  2DYS C;  1VQ5 V;  4I5S A;  3SPI A;  3LSS A;  1HWY A;  2X6C A;  1NQT A;  2CK3 G;  2EJR A;  3LSQ A;  1ENV A;  3K04 A;  5LGT A;  4WFH A;  1NBM G;  4LC1 A;  4WFF A;  4MVZ A;  3AG4 C;  5L3D A;  5L3F A;  2DWD C;  2DYR B;  3WG7 B;  4Q20 A;  5L3G A;  1R3I C;  3OGC C;  2EIL B;  4H37 A;  4GCZ A;  3LDD A;  4TWK A;  3ASO B;  4EKW A;  1NKD A;  3SYA A;  1VQL V;  4UXN A;  4P30 A;  1PD3 A;  3VOU A;  1V55 B;  4MTG A;  3OR6 C;  3B77 A;  2XAJ A;  4XDL A;  1F4N A;  3NXS A;  4WFE A;  4UVB A;  4BW5 A;  1M56 B;  1TUE B;  4QJF B;  4R8C A;  4WF9 V;  3B8N A;  1THZ A;  3ZMU A;  3ABM B;  1GM7 A;  1NJI W;  2EZO A;  3ZRS A;  4P2Z A;  4MTO A;  3OEH G;  4PDM A;  1EZJ A;  3JD1 A;  1F4M A;  2WSS G;  4MT8 A;  4MTX A;  4MS2 A;  3K0G A;  2FTK A;  3X2Q C;  3E89 A;  1AI6 A;  3OR7 C;  3I56 V;  1S77 D;  5J9P C;  5C93 A;  3ZMS A;  3AG4 B;  3OMN B;  5H6R A;  4DO2 A;  1FXH A;  2B5U A;  1VQN V;  1JOY A;  1QLE C;  2JEU A;  2B1I A;  2Q68 A;  1FXK A;  3ABT A;  1FXV A;  5B1B C;  3BEH A;  2Q69 A;  5EK0 A;  5LGN A;  2WLN A;  1DF5 A;  4G28 B;  3ZRW B;  3K0D A;  3QNE A;  2OCC B;  3AG2 C;  3SPG A;  2ATK C;  2OTL V;  4GX2 A;  1K9M W;  5EC2 C;  5EBL C;  5B3S C;  5L3E A;  3OEE G;  2UXN A;  1FS0 G;  1EFR G;  2IU3 A;  4LBE C;  3CMA V;  2DW4 A;  3CCV V;  1YIJ V;  1K5S A;  2P90 A;  3W7T A;  1ARO P;  1JCH A;  2ZR2 A;  1OCC B;  1ORQ C;  4LCU C;  3RVY A;  1BMF G;  5EBM C;  1ZWI C;  2NNU A;  1WLE A;  5IYC O;  1H2G A;  4PA4 A;  3AG1 B;  2UXX A;  3CC7 V;  2XAG A;  1QLE B;  2XND G;  4JTD B;  2EIJ C;  3E86 A;  2DWE C;  3E8G A;  1KP3 A;  5HFL A;  1AJN A;  3A0R A;  4ZKI A;  5B1B B;  2H94 A;  3ZN1 A;  3MHH C;  4GX1 A;  2JDI G;  2XAF A;  3SPC A;  2XAQ A;  1SES A;  3CC2 V;  3CP1 A;  2P7T C;  3STL C;  1SRY A;  1DLB A;  1M9N A;  2X6B A;  3PJS K;  4XDK A;  1K4D C;  3ZMT A;  4Z1M G;  1PKX A;  1SZT A;  1K97 A;  3OFN G;  2R9I A;  4PDV A;  2A79 B;  2DYR C;  3ZRW A;  3WG7 C;  4FPP A;  1S3J A;  2C2A A;  1DF4 A;  2IJJ A;  3CCR V;  4UVA A;  2OTJ V;  3CCE V;  2B1G A;  2P6J A;  3ASO C;  3K06 A;  3DTU B;  3EHB B;  2HKO A;  3OW2 U;  5CA3 A;  5IYD O;  1PNL A;  1GM8 A;  1S72 V;  1COW G;  2GSM B;  5CBH A;  3ZMZ A;  1WPX A;  3F7V C;  4RQF A;  4JAV A;  2IJH A;  1YIT V;  3LDC A;  5HFM A;  1AI7 A;  1M56 C;  2YEV B;  1SET A;  4H33 A;  4RAI A;  3P32 A;  4FIP C;  2IW5 A;  3TET A;  1AJP A;  5CBG A;  3P30 A;  2HFE C;  2HLD G;  4BAY A;  3E8B A;  4JPR A;  1YHQ V;  4RUE A;  3ETE A;  4UV8 A;  2ZDI C;  2GHY A;  4KUM A;  1JQ0 A;  1I5X A;  4PA3 A;  1V54 C;  1K34 A;  1KEC A;  1S76 D;  1JPX A;  1K5Q A;  2XAS A;  3K9A A;  4PEL A;  1VQ9 V;  2QKS A;  3ETG A;  2OCC C;  1SER A;  2HG5 C;  1AI5 A;  3E8H A;  2MK3 A;  1AI4 A;  1LNQ A;  4TT3 G;  1W2B U;  5B1N A;  4R6Z A;  2X6A A;  1K7D A;  2W0F C;  1I5Y A;  3F5W C;  3OMA B;  4QIW F;  2NLJ C;  4X89 A;  1YJN V;  4XBF A;  4PA9 A;  1GKF A;  3G71 V;  1OCC C;  5LBQ A;  2LFR A;  5KUM A;  1OHH G;  3HB3 B;  1MG1 A;  1R3J C;  2EIK B;  2ZR3 A;  3SYC A;  1H38 A;  4MW3 A;  1M57 C;  3OM3 B;  1QR8 A;  3AG1 C;  2WLK A;  5FL7 G;  1J95 A;  3TK1 A;  4G27 B;  3GB7 C;  5L3C A;  1Q81 W;  2JJ2 G;  2Z5U A;  4PA6 A;  3ZIA G;  4QE9 A;  3CCS V;  5IDJ A;  4XDJ A;  4YXW G;  1V54 B;  2ZXW C;  3CYO A;  3DGE A;  3FB8 C;  1VQP V;  3JD3 A;  1YTF B;  2EIM B;  2H8P C;  4X88 A;  1JX9 A;  4I9W A;  4MVR A;  1UJW B;  2WLI B;  1M90 W;  1OCZ C;  3AEI A;  3CCJ V;  3G6E V;  1BHB A;  2QM8 A;  4UVC A;  3KG2 A;  4G2K A;  3K3W A;  3CCQ V;  3B8M A;  3ZN0 A;  1E1Q G;  3ZRV A;  4QPK A;  2D3O W;  4J9Z B;  1G4Y B;  1GM9 A;  3ASN C;  3E83 A;  3E8F A;  4GX0 A;  5H6Q A;  2PI4 A;  2A9H A;  3LDE A;  3WFV A;  1R3K C;  2WLJ A;  1M57 B;  3M99 B;  3E35 A;  4L87 A;  4BIU A;  1OCO B;  3FKS G;  2IJK A;  2WLH A;  4FK5 C;  4JF3 A;  1QLN A;  3CXC U;  3OMI B;  4P9O A;  1PL0 A;  2Z3Y A;  4FJC C;  1N8R W;  2IH1 C;  1CEZ A;  2IJI A;  2ZXW B;  1MSW D;  1RPO A;  4QE7 A;  3IC7 A;  3CPW U;  3LNM B;  2HVJ C;  2WLL B;  4QNH B;  2ZDI A;  2Y48 A;  4P9P A;  1YJW V;  1S5H C;  1H8E G;  1JJ2 U;  1K73 W;  1OCZ B;  1KC8 W;  1R6K A;  1YJ9 V;  4MTF A;  1NH2 B;  2OT5 A;  2XOK G;  1L1F A;  5LHH A;  4WCE V;  3VBB A;  1NVP D;  4R50 A;  4RUF A;  1OCR B;  1K92 A;  4X8A A;  3W7S A;  1MAB G;  2WLI A;  2QM7 A;  1BHA A;  1CPY A;  2P67 A;  3JD0 A;  3SJQ C;  1GMG A;  1NR7 A;  5EBW C;  5BZB A;  5KA5 A;  1VQK V;  3ASN B;  1VQ4 V;  5EC1 C;  4KFM A;  3K03 A;  2V7Q G;  3SPJ A;  4R7C A;  1GK9 A;  2W6J G;  1FFT B;  1E1R G;  4HAM A;  5KA6 A;  3SYP A;  1W0K G;  3ABL B;  2IU0 A;  2AHZ A;  2JIZ G;  5B1A B;  3K08 A;  4MVQ A;  4JAU A;  5CMU A;  2R9R B;  1K3E A;  3D3I A;  3ZCC A;  3SYO A;  3ZJZ A;  2WWW A;  2QTO A;  5B1O A;  4ASU G;  2WLM A;  2EIK C;  3T4Z A;  3QO8 A;  1CP9 A;  4WFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...