4LBEC

Structure of kcsa with r122a mutation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERAGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lbeC00
2ITDC 3E8HA 4MS2A 3ASOC 4EKWA 2EIJC 4QNHB 3SYPA 2NLJC 4RUFA 3K06A 4DXWA 2WLIA 4G28B 3FB6C 5CBGA 5CBFA 5BZBA 5CBHA 4XDLA 4WFFA 1J95A 2ZD9A 3ABKC 1V55C 1OCZC 4MVSA 4P30A 1V54C 2EILC 4JTAB 3LDCA 4X8AA 2DWDC 2Q6AA 1R3IC 4QE7A 2EIKC 5J9PC 3TETA 3AG2C 4MVUA 5KUMA 2WLLA 3SYOA 4MSWC 4MVOA 3BEHA 3OGCC 4MVRA 4PDLA 5EBLC 2ATKC 1OCRC 2HJFC 4R50A 2HVJC 4R8CA 3E8BA 5B3SC 5IY5C 2KB1A 2EINC 4PA6A 2QTOA 3K08A 3LDEA 4LBEC 3T4ZA 4RAIA 4MTGA 4JTCB 4KFMA 3RBZA 2X6AA 3UM7A 1BL8A 1S5HC 1OCCC 2Q68A 4HZ3A 3GB7C 3K0DA 3AG1C 3F7VC 2ITCC 3SPJA 3JYCA 3T2MA 3IFXA 3LNMB 3LDDA 1QLEC 4ZBMA 2BOCC 1G4YB 2WLJA 4LCUC 3ABLC 3AG3C 1P7BA 2HFEC 5EC1C 3SPHA 4P9PA 1M57C 4GX5A 3TCUA 4QE9A 1R3KC 1M56C 4H33A 1ORQC 2W0FC 2QKSA 4PA9A 3E86A 4H37A 3F5WC 3X2QC 4PDRA 2HG5C 2X6BA 3SYQA 3F7YC 4GX0A 4CBCA 3K03A 3ZRSA 3LUTB 3OUFA 4X89A 2OCCC 1XL6A 2BOBC 3AG4C 4HYOA 3IGAC 3SYAA 2A79B 3R65A 5B1BC 3OR6C 2A9HA 1R3LC 4G27B 3UKMA 2Y69C 3K04A 4XDJA 4MVZA 4R6ZA 4RO2A 2IH3C 4LP8A 4UUJC 4BW5A 4MVQA 2K1EA 3ASNC 3T4DA 5EK0A 2DYRC 2Q67A 4OXSA 3E83A 4PA4A 2AHYA 2IH1C 4I9WA 1ZWIC 4PDMA 4P9OA 3PJSK 5EC2C 1JVMA 2DYSC 1KKDA 4MVMA 3SJQC 2YEVA 3SYCA 2A0LA 4GX2A 4P2ZA 3KG2A 3HPLC 5EBMC 4J9YB 4XDKA 3T1CA 1K4DC 3ZJZA 3E89A 3SPCA 4MW3A 2WLHA 3FB7C 3VOUA 4GX1A 2HVKC 4PA3A 3ABMC 4MTOA 2R9RB 2ZXWC 3RW0A 4X88A 4MW8A 3RVZA 2WLIB 5B1AC 3FB8C 4WFGA 3OR7C 2DWEC 4J9ZB 3E8FA 3STZC 4F4LA 4MTFA 2WLKA 2WLMA 3SPGA 1OCOC 1R3JC 4JTDB 2P7TC 4PDVA 4WFEA 3STLC 3EFFK 4R7CA 2AHZA 2JK5C 1K4CC 1LNQA 2H8PC 3K0GA 4PA7A 2WLLB 4WFHA 5EBWC 4RUEA 5E1AC 1XL4A 3WG7C 5KUKA 3RVYA 3FB5C 2WLNA 2X6CA 3SPIA 2Q69A 3OUSA 2EIMC 4TWKA 3E8GA
chains in the Genus database with same CATH superfamily
2XAJA 4BIUA 5CB4B 1BHBA 4YIPA 4LC1A 4WF9V 3G80A 2DYSB 2Q73A 1PL0A 3BFRA 4EB6A 3CRRA 5KUMA 4J11A 1NQTA 4JI3B 4EFEA 4YHHB 1N34B 4F6RB 4B3MB 1SERA 3AK2A 1K97A 2EINC 1Y6XA 2QTOA 4LBEC 4YHHO 1BZKA 3ZMSA 1N8RW 1AILA 4GKKB 2ZE6A 2OWOA 4PD4F 1XHXA 3JALA 1XMQB 1F4NA 3NR7A 4GKKO 2HFEC 1Q8IA 4H44B 1Y74B 1XMOB 1SQQH 1MG1A 4YJ3A 1KYOF 2YEVB 2X7RB 1FYJA 4IIJB 2IU3A 5B5EZ 5ITZB 2N04A 3IGAC 3UKMA 3L9DA 3JASB 2GUZB 2QWNB 2XAFA 3T4DA 2AXTZ 2ZE8A 1YSCA 4JV5O 1EZVH 4TUYB 1OJHA 3K58A 2W6JG 4I9WA 3ZMZA 2JDIG 1XHZA 4GKJB 3BVOA 1W0KG 3B8NA 3S3XA 2XHBA 4MW3A 1M9NA 2V1DA 4LH6A 4PA3A 2HR3A 5LMNB 4GKJO 1M56B 5B1AC 4GCZA 3JAWB 5LMNO 5JCOC 5JJNB 1K4CC 2QWQB 3LSSA 3SPIA 2QM8A 4KXRA 2Y69B 2E5LB 1Z5WA 3J81N 5B66Z 2DYRB 2UUCB 1CXZB 3SYPA 4LF5O 4O4LB 4UVAA 4DV1B 5CBHA 2UUCO 4FLTA 4DUYB 2WLLA 4JASA 4DV2B 3VQVA 1LR1A 1T5EA 3CP1A 4LNUA 1R1BA 4DUYO 2DW4A 3JCUZ 4YJ2B 1S5JA 1GRJA 5CB4A 1K33A 4JTCB 3CB2A 4BIZA 2Q5ZA 1WA8B 3UQ8A 1M5IA 3LNMB 2PZSA 1EN6A 4B3RO 2EIMB 5B3SB 2UUBO 3HKCB 3ABLC 3AG3C 1EBOA 2ZIOA 5LP6C 1N32B 4H37A 3ZMTA 4F6RA 1IBLO 1KUQA 1I5YA 4FM0A 3OD4A 3K9SA 1N32O 3OUFA 4K35A 2RMKB 5B1BC 5C8YB 3DTUB 3K9AA 3TJTA 1IBKB 4LP8A 4O2AB 4LWSB 4B7EA 2FL4A 1EM1A 1TA8A 1Y74A 4WFBV 4JI7O 4K0KB 3CC4V 3QF7A 3GWOA 2A3QA 2QM4A 2YEVA 4E2LA 4TOIA 4LFCO 4K0KO 4IIJA 5ITZA 2RDCA 3D36C 3ABMC 3SJCC 2R9RB 1SF9A 1XOUA 3CS5A 4X65B 3JASA 2GUZA 1SQVH 4FLYA 2QM7A 4LH7A 3JD1A 3B8MA 4X1IB 2NNUA 4DV4B 4TUYA 1KB9F 4X65O 1BCCH 2ZXWB 2Q7GA 4TT3G 4DV4O 4Z1VA 5FL7G 3JAKB 3L73H 3U11A 3K5OA 3ASOC 5CMUA 2QDOA 4WBNB 5L3BA 1IBMB 2BTOA 4BAYA 2A06H 2IJJA 2JGDB 3JAWA 2ZDIA 2YI9A 2QKCA 1M4UA 2Q6AA 5LMUB 5LYJB 3OMNB 1VQMV 2KG7B 4IGGA 2XUMA 5LHHA 1E1QG 3BRCA 1GO3F 4UB8Z 4PA6A 2F66C 2LFSA 3E35A 4O4LA 4DR7O 1KBHA 2JS3A 2H94A 3CCLV 3CRCA 1JX9A 5EC1C 3P3NA 3CCMV 1VQKV 4FVMA 5D5QA 1N0JA 4PDRA 4X9QA 1PNMA 3WFVA 2HG5C 4DR6B 4LFBB 3KZIZ 4YJ2A 3BY6A 2EILB 1M93A 2EIKB 1OV9A 1XL6A 3AEIA 5CN0A 4I4TB 4LFBO 1WA8A 1R3LC 2BSKB 3A0BZ 4DV5B 4XDJA 3SR2C 5DN6G 1D5AA 3CCQV 4TQDA 1OCRB 4MVQA 2K1EA 1IXMA 3HKCA 2ZM6B 2GTAA 5DM6V 1PKXA 4AILC 3T1HO 5KHIA 4E4EA 1UFIA 1AJQA 2UXBB 3E22B 4JAAA 1VF7A 4QPKA 4MTOA 5C8YA 1QHTA 1QBZA 3OW2U 4A5UB 4LFAB 4O2AA 1OCOC 4WFEA 4LWSA 2EJRA 4LF4O 5IDJA 4J41A 5KUKA 1YJ9V 3ML0A 2VQFB 1H2KA 5HFLA 4CH3A 5LGNA 3RYIB 5KHGA 4ZOLA 2VQFO 5FNVB 5J2TB 5EYPB 2YIDA 3ABKC 2FKXA 4O2BB 1W2BU 4QPJA 3SYOA 3G4SV 1PP9H 2JGUA 2Y0PA 2YUAA 1B06A 1JPXA 5L3DA 4WBNA 3G6EV 4JYAB 4DR1O 2OIEA 2X6AA 3WG7B 2CGNA 4DR2B 1K8AW 1I08A 3ZHTA 3WB0A 4JYAO 2YXLA 4NKGB 1WN7A 1DF5A 1DGSA 2WLJA 1HWYA 2LGWA 5LYJA 1VQLV 3UO2A 3K79A 2KG7A 4DR2O 2XAGA 4P9PA 1GKFA 2EIJB 5HFMA 1G8MA 1PV0A 3X2QC 1OHHG 4U7NA 3F7YC 1XNRB 3AG3B 1EZJA 3CXHF 3W7SA 4I50B 4DUZO 4FM1A 2E76B 4G27B 2Q67A 1TGOA 1FXKB 1ZAUA 2B1IA 1SQFA 2IH1C 1W59A 5B1BB 1OCCB 4JYBA 3SYCA 3RFRA 1RFYA 3ZJZA 4YIOA 1CP9A 3CCRV 1H2LA 3RYHB 4I4TA 1N36B 3B40A 1JA8A 2BSKA 2DWEC 3B77A 2RN9A 1GN3A 1N36O 4PDVA 4R7CA 2JK5C 4CH5A 4NTXA 3ABMB 3VQYA 2L6LA 3J7AU 4TWKA 3E8HA 3O65A 3E22A 5EZYB 5GTIZ 2JRIA 3WU2Z 4RUFA 2Y48A 1KQSU 4X64B 4TV8B 1QR9A 2Z5UA 1Y66A 1SZTA 3BPZA 4X8AA 2GV9A 1PNKA 4GLXA 4NXMO 2CDYA 3OGCC 4PDLA 4RWUA 3D3IA 1M1KW 3RYIA 4R50A 2K9PA 1R6KA 1PM9A 3DXRB 2Q0AA 4J80A 5IJ0B 5FNVA 3GB7C 3THOA 5J2TA 2F4VO 5EYPA 1RM1B 2XTAA 2EZOA 4LCUC 2KKWA 1QLNA 4O2BA 4CZZA 2PYLA 3N2KB 3P30A 4UCSA 3ZN1A 2IU0A 3CX5F 4H33A 4PA9A 1HNZB 4J7JA 1TAEA 2GTSA 4FZ1A 2PF4E 4F6EA 3OMAB 1V54B 1HNZO 3ZRSA 1K3EA 4X89A 4DO2A 4LR3A 4JI2O 4FFBB 5KMGA 1HR0O 2H3OA 1U96A 2V7QG 1QQCA 1LUVA 4LF8B 2C2AA 3CRAA 1NTMH 4BIOA 4PDMA 3CJHB 4DR5O 5B1NA 2A7WA 3ETDA 4I55B 2HVKC 4I50A 1GAXA 3ZHQA 2ZCEA 3FYEB 4YXWG 1FXKA 2PGGA 3TXSA 3WB1A 4ZHQB 2Q69A 1AJNA 2QA4V 4DV3O 4DV7B 3B2EE 3F5TA 3CE2A 3RYHA 4JI6B 4K8ZA 3ZMUA 2CTPA 1Q90D 4NXNB 5KX5B 4MVSA 1OCZC 4KHPO 2CAZC 1GTOA 4CS2A 1BGYH 4HAMA 4U7OA 2PI4A 3APQA 4NXNO 5C93A 1XNQB 4MSWC 2XAHA 4MVRA 4UCUA 3GWKC 1Q5OA 5EZYA 5IY5C 1XNQO 3K08A 3T4ZA 1BL8A 2CTRA 3AG1C 3F7VC 5CA1B 4TV8A 3H1IH 4ZBMA 2WWWA 4DRXB 4RQEA 3C3TA 1COWG 1M90W 2UXDB 4PJ0Z 3KCXA 1TUBB 4OX9B 1GN6A 4KL1A 5A2QN 4FMTA 2R9IA 1YCIA 3I55V 3A0RA 3CMAV 2QWPB 3DXRA 4YY3B 3TGUH 3K03A 4JI3O 4B3TB 3AG4C 1VF6C 1N34O 1SKVA 3FYIB 4B3MO 4O4JB 3X2QB 4MVZA 4R6ZA 2HLDG 2VQEB 3WB2A 2HP8A 2BE3A 3N2KA 1VQPV 1AB3A 3HKEB 3SJAC 1ZWIC 4P9OA 3SGIA 4QIWF 2VQEO 2LFRA 2OCHA 1XMQO 4Q20A 2QEXV 4FJCC 1WPBA 1FXHA 1XMOO 4LF6B 2ODMA 1MSDA 3VOUA 3W7WA 2YIBA 3FKSG 4FFBA 5IYBO 4X66B 2JS5A 3RVZA 3B4SA 5AG2A 1QR8A 4LF6O 3A2FA 2CTWA 3H1LH 2JVDA 3CJHA 5E1AC 1XL4A 1MOFA 4GUNA 2P67A 1FAFA 2QE7G 1NVPB 4DR3B 3A0HZ 1BSMA 2F93B 4I55A 2P4VA 2UU9B 2NLJC 5IWAB 5CBGA 5LL6Y 3G67A 2AZ0A 5L3GA 2UU9O 3R66A 3CEIA 4JZGA 4ZIBA 2ATKC 2N05A 4NVPA 3ZIAG 2AZ2A 4X20B 2NR5A 4RAIA 1VQOV 1G1XB 4KFMA 3ZHVA 1NU1H 4CS4A 2CTQA 4AHCA 5L3FA 2E5LO 2OYQA 4NB5A 4AI8A 5KX5A 1Q6UA 4EFBA 2IM9A 2G38A 1V9PA 4WFAV 4DV1O 4B7KA 2FB5A 2YIBD 3KCYA 2N74A 1Y4MA 1WB8A 3SYQA 3CXCU 4DV2O 1IXBA 1B3QA 2BOBC 5CA1A 4OPHA 2ARHA 4QJFB 1S72V 1AI4A 3IJ4A 2EZPA 4DRXA 3ASNC 3VQXA 5KHJA 1TUBA 3M7MX 2AHYA 2E74B 4D7TA 1I94B 1Q86W 4X62B 1JOYA 1YJNV 2F43G 1I94O 3CHXA 3N27A 4O4JA 2JJ2G 3MHSC 1FFTB 2YXHA 2UXCB 3HKEA 4WFHA 5H5NA 1DF4A 1FPOA 4I0XB 1IBKO 1MZFA 4ZKIA 2UXCO 1LUWA 4IHJB 4QNHB 2GSMB 3K06A 1XQ8A 2IJKA 3K57A 1JJ2U 4D6TH 3JSNA 4DR4B 1NR7A 4O4IB 2ZIMA 4DR4O 1YIJV 2HEPA 4FPPA 5KAIZ 3AK3A 1S5HC 2Q68A 3OEHG 3ZRWB 2WA4A 1NR1A 3T2MA 3ABTA 3LDDA 1IBMO 5IJ9B 3EXAA 3I5DA 1A32A 5H2FZ 2PI5A 4QE9A 4K3AA 1ORQC 3UT5B 3APOA 1K9MW 5LMUO 3JAMN 1YXBA 3HB3B 3NXSA 1MNGA 3MAQA 4CH6A 4JF3A 3OR6C 1K5SA 1XEQA 1UPGA 1P84F 1AVMA 1S3JA 1U97A 2YC0A 2EINB 1GM7A 4MT8A 2Q7HA 4IL6Z 2WLHA 1H8HG 2PTMA 4DR6O 2L35A 4WFGA 3OR7C 1SQGA 2ZT9B 3SJBC 1NVPD 2P22C 3BA8A 3CD6V 3K0GA 2RCVA 4DV5O 1NTZH 2AGAA 1Z2GA 2ZM6O 1Y76B 2IW5A 2B5UA 4BR6A 2YSUB 3CCUV 4DV6B 3N2GB 5K1PA 1WNSA 1Z5VA 4ZI7B 3JARB 1I7FA 4B3SB 2UXBO 2ZD9A 1XILA 3EHBB 4JTAB 3JD2A 3LDCA 1PPJH 3M8AA 2QSAA 4L8JA 4MVUA 1OZ0A 4LFAO 2Z3YA 4I0XA 5B1AB 3BABA 2VWJA 2KSDA 5LHIA 4IHJA 4DK1A 2KB1A 4TV9B 3CYOA 3JD0A 4UB6Z 4W4LA 1QLEC 3M99B 1VQ5V 4AQYB 3BHPA 2YXYA 3QO7A 4X1IA 1P7BA 2ZQMA 3H1JH 2ILMA 1BT8A 3D8CA 4IYHA 4AQYO 2QWOB 3OM3B 1F7YA 3JAKA 4GX0A 3O9OA 4H0LB 1AJPA 1J5EB 1IZ3A 2OCCC 3SYAA 2A79B 3ZRWA 2ZINA 3W7TA 2ZE7A 4OPAA 4X1YB 2JGDA 2QKAA 2IH3C 1Y67A 4J7KA 5IJ9A 1URFA 4JZ2A 3CMEV 1QCEA 3VQWA 3T1YB 3L74H 1L0LH 1QVGU 1VP7A 5JVDB 3UT5A 2UUAB 2DYSC 1NT2B 1XUQA 1QU7A 1WAZA 2A0LA 3T1YO 3HPLC 5H9CA 1BMFG 1K4DC 3ABLB 2QGNA 3JATB 3FB8C 5LP6B 4J9ZB 1XNRO 4N21A 1ROPA 2WLKA 4JTDB 1XREA 1BHAA 3ZS8C 4PA7A 5EBWC 3ZX6A 3AK1A 4TQFA 3QG5A 3L72H 3ETGA 2F1MA 3MHHC 3JD4A 1JQ0A 1IURA 5KA5A 1AROP 2Q0OC 1RSOB 4GYCB 1MSWD 1Q81W 5TISZ 2GHYA 3CC2V 1Y76A 1GN4A 2ZR2A 1NTKH 3CCSV 5KLVH 1G6UA 3N2GA 3ETEA 2DN9A 1L1FA 1NBMG 3UM7A 3K5NA 4HZ3A 4ZI7A 3JARA 1PL4A 5LBQA 2LO1A 2LW1A 2OTLV 1YF2A 3ASOB 4X64O 1Q3EA 1M56C 5L3CA 2LP7A 2QKSA 3E86A 4HNAB 3F5WC 1K73W 3BA9A 1H2SB 3L71H 5LXTB 2ZDIC 2BCCH 3H1HH 1Q82W 1K92A 5JCOA 4PV1B 4UVCA 3DC5A 4UV8A 2Y69C 1TUEB 1NH2B 4RO2A 3ZRXA 3LSQA 4UUJC 3RYFB 5EK0A 2DYRC 1CPYA 1YVWA 2HHHB 3SJQC 3ZHSA 4XDKA 1H2MA 4FM2A 2W6IG 2M7WA 4DW1A 4X1YA 1VEWA 2Q7EA 3STLC 1KMIZ 1K34A 3QO8A 3S3WA 5JVDA 3BAAA 4LF8O 3C90A 4JYYA 4JPRA 1KP3A 2EIMC 3OUSA 3E8GA 3OTOB 2F23A 4NR1A 3OE7G 1WLEA 3JATA 4I5SA 5LP6A 3CCEV 2VRZA 1DTOA 1SQPH 4WFFA 2DOSA 4DV0B 5KAFZ 2P5OA 2PY5A 3H01A 3AG2C 2IBZH 1NJIW 1YTFB 1WP8A 3QO5A 2JIZG 4DV0O 4FZ0A 1ZL8B 2HJFC 3E8BA 1OCOB 1L8DA 4D7SA 3RBZA 3JCZA 4DV7O 1H2NA 1ZUQA 3K0DA 5KHKA 3IFXA 3C3SA 1NI8A 5FLXN 4JI6O 2DMXA 4JGSA 3D36A 1SZXA 1SQXH 5BY1A 4WCEV 1AR4A 2R9AA 3DGEA 1KC8W 4NTYA 3ABKB 5LGUA 2ADPA 4JI1B 5IT9N 4HYOA 3LSUA 1O9HA 2JEUA 1KP2A 3Q4HB 4JI1O 1SRYA 4JYCA 1K5QA 3ZEDA 3CCJV 4FLWA 1JR9A 1QNMA 2X0LA 4HNAA 1JVMA 5LXTA 2UXDO 4OX9O 4DYLA 1US6A 2LJ2A 3E89A 5GONB 4J42A 2QTSA 1P4RA 4FIPC 2WPDG 5IJ0A 5IE9A 1YJWV 2WLIB 4U3FH 3QNEA 4YY3O 4H13B 3RYFA 3VBBA 2P7TC 4B3TO 1RP3B 4OGQB 3RVYA 1SESA 4JI0B 1ZLZA 1Q7YW 2YICA 5IYZB 1D5NA 3UO3A 4JI0O 4U3JB 1AR5A 1EFRG 5BMVB 3ABUA 3L70H 5B1OA 2EILC 2DWDC 1R3IC 2OIGA 2EIKC 4X66O 4JAUA 2XAQA 1K7DA 2CK3G 1RPOA 4FLXA 1OCRC 2HVJC 2P4KA 1BQZA 2P6JA 2E3CA 1MMMA 1YITV 4JV5B 4G2KA 3SPJA 4DR3O 3ZBHA 3ZCCA 3J80N 2BOCC 1VQ8V 5IWAO 1GM8A 3K59A 1GN2A 1ZL8A 2WAMA 4ZHQA 1QVFU 2FYUH 1NH2D 1AP5A 1EN5A 3H1KH 4RQFA 2LQTA 2IJIA 4CBCA 1GM9A 4QGPA 4FLVA 3L75H 2PUSA 3OT7A 1AI6A 1KU9A 3K04A 1DLBA 4DK0A 4EEQA 1AP6A 3CC7V 1E79G 4OXSA 4CC6A 3ETQA 3OEEG 5LA6B 4LF5B 2PYJA 2GDSA 3KG2A 3W7XA 2M6YA 5CA0B 3T1CA 3LNNA 5L3EA 1ZX3A 5EIBC 4ABMA 1YI2V 2UXXA 3QTCA 2NN4A 2CE4A 3Q4HA 2EBOA 3ZMVA 1SETA 3B09A 1XDCA 1DK1A 1BQ0A 4RUEA 3WG7C 2X6CA 2O57A 4N23A 1HP8A 5GONA 4B3RB 2EIJC 2UUBB 1IVSA 5K1XA 4X62O 4DXWA 2WLIA 1YTFD 1D2DA 2F95B 1SA0B 4XDLA 4KUMA 1J95A 1V55C 4P30A 4X1KB 1IBLB 3TETA 3OAAG 2MK3A 1VARA 4MVOA 1VQ4V 2ZR3A 1BE3H 2W0XA 5IYZA 2R70A 1YHQV 1FXKC 3AG2B 4U3JA 1OCCC 2E75B 5JQGB 1N0NA 4JI7B 5BMVA 1SQBH 4KP4A 1RPRA 2WSSG 1AR1B 4GZRB 4LFCB 1P49A 1MZEA 3IC9A 1R3KC 2Y4UA 1XBLA 4C7UA 5D5PA 3P3PA 4ZOLB 3U10A 1YDXA 1OCZB 2RJZA 4J7ZA 1PNLA 3R65A 2YIAA 5F2VO 4UCTA 4IYIA 2EX3A 5A9GA 5IY5B 1SS3A 2YI8A 1R6NA 3CSXA 4HBNA 2Z0AA 5LHGA 1VIBA 5EC2C 1YZBA 3AG1B 4P2ZA 2QWRB 1JJOA 1FFXB 4X20A 3RT3C 2B1GA 2MW2B 3SPCA 3I56V 1E1RG 1GK9A 3RW0A 4X88A 5IYDO 2XNDG 3E2EA 2UXNA 2WLMA 3CRQA 3EFFK 4I9QA 3FAVB 2FTKA 3AG4B 5LA6A 1RM1C 3RYCB 1ZSPA 1AI7A 2ETNA 4O4HB 4DR7B 1WJZA 5CA0A 1F4MA 5CA3A 2CGOA 3PN1A 3BCCH 1MABG 2B9ZA 3CWBH 3H9VA 2XT9A 2V4DA 2JJ1G 1P7GA 2Q8VA 4DW0A 1V54C 3ZHUA 1S5LZ 5J9PC 5DECA 1S77D 1Q43A 2QR4A 3SDLA 5EBLC 2ZKOA 4JI4B 1HW7A 2GBOA 3EVKA 4NYKA 1CEZA 4JI4O 2ITCC 3JYCA 3T1HB 1SA0A 4UCOA 3U0ZA 1JFFB 4DV6O 4X1KA 5GTHZ 2DQ3A 3FFQA 1M57C 3TCUA 4FLZA 1MA1A 4B3SO 3ZN0A 1Q6HA 4Z1MG 1N33B 3FD9A 1O9GA 1H2GA 4ICGA 2OTJV 1Q6IA 3HKDB 3OMIB 4JAVA 1N33O 3LUTB 4JI5B 5H6RA 4LF4B 5JQGA 4TSFG 2XOKG 3RGBA 2CH7B 4JI5O 2BTQB 3OTFA 4K8XA 4GT1A 1KKDA 4O4IA 2XASA 4CS3A 3TK1A 1FKAO 1KD1W 5EBMC 2LGQA 1VMGA 4I7ZB 1F23A 1NKDA 3AG7A 4MTFA 3SPGA 1J5EO 4PELA 1FJGB 1KKCA 4NTWA 2H8PC 3ZRVA 4DR1B 5JJJB 1FJGO 3DC6A 3K3WA 3MDSA 5FPOA 1KECA 1FFXA 4EKWA 3ASNB 3CRMA 2UUAO 1ZTEA 1R73A 1IX9A 1FXVA 4G28B 5KMGB 3FB6C 5LOVB 2Q9LA 4FFKA 5DEDA 4UFZA 4UVBA 4L87A 3FAVA 4LF7B 1F51A 4FK5C 1B6QA 1S0VA 2FMLA 1VF6A 3RYCA 4LF7O 4DUZB 4O4HA 1V55B 2DQ0A 5KHHA 5H6QA 3LDEA 4MTGA 5E79Z 3TXQA 1NZ6A 2P90A 4Z2WA 1G4YB 3IAYA 2D2CB 2DJVA 5BR8B 1W0JG 5KA6A 4ASUG 1I0HA 3IC7A 3W7UA 1R6TA 1VQ9V 4J10A 2X6BA 5BR8O 4Q6GA 1WP7A 2Y4TA 5JH7B 1JCHA 3JSLA 3OGIB 1XI1A 1VF5B 2OT5A 3D3QA 3OFNG 3RN4A 1JFFA 5J2UB 2EJ7A 4JI8B 1TVKB 3GVMA 1HNWB 3HKBB 2VS0A 2AW9A 4PI2A 3E83A 3DSQA 4PA4A 2ZNJA 4JI8O 4MVMA 1HNWO 4GX2A 3HKDA 4J9YB 3ZHRA 3FB7C 4TV9A 2Q4PA 1YEWA 1FD9A 3G6BA 4MW8A 1GH6A 2LW7A 4NXMB 3STZC 3KKYA 4PHZA 2CH7A 1EN4A 1I5XA 4EB6B 1PD3A 2BTQA 1SC5B 2ZE5A 2RNBA 3P32A 3FX7A 2CUGA 1X59A 2ZNIA 1R3JC 3G71V 2F4VB 2ITDC 4MS2A 4XBFA 2HHHO 4LF9B 1VQ7V 5GW7A 5CBFA 2WA3A 5BZBA 3QVNA 3A8TA 3CPWU 3JALB 4LF9O 1UJWB 4QE7A 4CH4A 2ADQB 1N4CA 1JMKC 1FS0G 3BEHA 4UCRA 1WPXA 1ENVA 4YJ3B 4JI2B 4R8CA 1HR0B 5BXZA 4BWAA 5B3SC 1HDJA 2RQ6A 4B08A 3HR0A 4W4KA 4UCVA 5LOVA 2Y0IA 4IT5A 3OTOO 1GMGA 4DR5B 2HJDA 2IJHA 3SPHA 4GX5A 2W0FC 4FLUA 3UCSC 1H8EG 3K5LA 5FPRA 3MD0A 1M57B 4CC5A 2YDEA 2JEXA 2A9HA 2YS8A 1BS3A 3CCVV 4BW5A 2P06A 4DV3B 2KQXA 5LGTA 1VQNV 1H38A 4MTXA 1X4TA 1RSOA 1HNXB 1B04A 4BW9A 4PI0A 3PJSK 3ICXA 1S76D 1WB7A 2QJ1A 2VWKA 1NS1A 1HNXO 1QLEB 4UV9A 5JH7A 2D3OW 4KHPB 4GX1A 1L0NH 2ZXWC 5EIBD 5JWPA 4F4LA 3E8FA 2DE0X 1IDSA 5J2UA 1TVKA 5JJEB 3RWRD 3HKBA 2AHZA 1LNQA 3K5MA 5IYCO 2HKOA 2WLLB 2OCCB 4UXNA 2R72A 2EULA 3FB5C 2WLNA 1AI5A 4LNUB 1VQ6V 1THZA 3JD3A
chains in the Genus database with same CATH topology
2XAJA 3E8HA 4N23A 4BIUA 2YSUB 3CCUV 1BHBA 2EIJC 4LC1A 4RUFA 2Y48A 1KQSU 4DXWA 2WLIA 1YTFD 4WF9V 1QR9A 2DYSB 2Z5UA 4XDLA 1Y66A 1PL0A 4KUMA 1J95A 2ZD9A 1SZTA 3EHBB 1V55C 4P30A 4X8AA 4JTAB 3JD2A 3LDCA 1PNKA 3TETA 3OAAG 4MVUA 5KUMA 1OZ0A 2MK3A 1NQTA 2Z3YA 4MVOA 1VQ4V 2ZR3A 3OGCC 4PDLA 1M1KW 3D3IA 5B1AB 4R50A 1SERA 5LHIA 1K97A 1R6KA 2KB1A 2EINC 1YHQV 2QTOA 1FXKC 4LBEC 3AG2B 3ZMSA 3CYOA 1OCCC 1N8RW 3GB7C 3JD0A 1RM1B 4KP4A 1QLEC 1RPRA 3M99B 1VQ5V 2WSSG 1F4NA 1AR1B 2EZOA 4LCUC 1QLNA 3QO7A 4CZZA 1P7BA 2HFEC 2ZQMA 3ZN1A 3P30A 2IU0A 1R3KC 4H33A 4PA9A 1MG1A 2YEVB 2X7RB 3OM3B 3OMAB 4GX0A 2IU3A 1OCZB 1V54B 3ZRSA 1AJPA 1K3EA 2OCCC 4X89A 4DO2A 1PNLA 3IGAC 3SYAA 2A79B 3R65A 3ZRWA 3W7TA 3UKMA 2V7QG 2IH3C 2XAFA 2C2AA 3CMEV 3T4DA 5IY5B 1QCEA 1YSCA 1R6NA 2W6JG 4I9WA 3ZMZA 4PDMA 1QVGU 2JDIG 5LHGA 5EC2C 2DYSC 5B1NA 3AG1B 2A0LA 4P2ZA 3HPLC 1W0KG 3B8NA 3ETDA 5H9CA 1BMFG 1K4DC 2B1GA 3SPCA 4MW3A 3I56V 3ABLB 1M9NA 2V1DA 1E1RG 2HVKC 4PA3A 2HR3A 1GK9A 3RW0A 1M56B 4X88A 5IYDO 2XNDG 5B1AC 3FB8C 4GCZA 3E2EA 4J9ZB 4N21A 1ROPA 2UXNA 2WLKA 2WLMA 3FYEB 4JTDB 1BHAA 4YXWG 3EFFK 1K4CC 1FXKA 2FTKA 4PA7A 5EBWC 3LSSA 3AG4B 1RM1C 3SPIA 2QM8A 2Q69A 1AJNA 2QA4V 2Y69B 1AI7A 1F4MA 5CA3A 2DYRB 3ETGA 3MHHC 3ZMUA 3JD4A 1JQ0A 3SYPA 1MABG 4UVAA 5KA5A 5CBHA 2JJ1G 4MVSA 1OCZC 1V54C 1GTOA 5J9PC 1AROP 1S77D 2WLLA 4HAMA 4JASA 4U7OA 2PI4A 1MSWD 5C93A 1Q81W 4MSWC 2XAHA 2GHYA 5EBLC 3CP1A 4MVRA 3CC2V 2ZR2A 2DW4A 5IY5C 3CCSV 3K08A 3T4ZA 1K33A 3ETEA 4JTCB 1L1FA 3UM7A 1BL8A 1NBMG 4HZ3A 4BIZA 1CEZA 3AG1C 3F7VC 2ITCC 3JYCA 5LBQA 3LNMB 4ZBMA 2WWWA 2EIMB 4RQEA 5B3SB 1COWG 1M90W 3ABLC 2OTLV 3AG3C 3ASOB 2DQ3A 1EBOA 1M57C 3TCUA 1M56C 4FMTA 5L3CA 2LP7A 2QKSA 2R9IA 3ZN0A 4Z1MG 3E86A 4H37A 3ZMTA 3F5WC 3I55V 1K73W 3A0RA 3CMAV 2ZDIC 1H2GA 1I5YA 2OTJV 1Q82W 1K92A 3K03A 3OMIB 4JAVA 3LUTB 3OUFA 3AG4C 4UVCA 5H6RA 5B1BC 3DTUB 3FYIB 3K9AA 4TSFG 4UV8A 2Y69C 1TUEB 1NH2B 3X2QB 4MVZA 4R6ZA 2XOKG 4RO2A 3ZRXA 3LSQA 2HLDG 4LP8A 4UUJC 5EK0A 2DYRC 1CPYA 1VQPV 4WFBV 1ZWIC 4P9OA 3CC4V 4QIWF 4GT1A 3GWOA 2LFRA 1KKDA 4Q20A 3SJQC 2XASA 2YEVA 2QEXV 4E2LA 3TK1A 1KD1W 5EBMC 4XDKA 4FJCC 1FXHA 3VOUA 3W7WA 3FKSG 3ABMC 2W6IG 5IYBO 2R9RB 2M7WA 3RVZA 1F23A 1NKDA 1QR8A 2QM7A 4MTFA 3SPGA 3JD1A 4PELA 3B8MA 3STLC 2NNUA 1K34A 2H8PC 3QO8A 3ZRVA 5E1AC 1XL4A 1MOFA 2ZXWB 3K3WA 2P67A 4TT3G 4JPRA 1KP3A 2EIMC 3OUSA 2QE7G 1NVPB 3E8GA 1KECA 5FL7G 3ASOC 4EKWA 3ASNB 5CMUA 5L3BA 3OE7G 1WLEA 1R73A 2NLJC 4BAYA 4G28B 1FXVA 4I5SA 3FB6C 5CBGA 2IJJA 3CCEV 1DTOA 4WFFA 2ZDIA 5L3GA 4UVBA 4L87A 2Q6AA 3H01A 3AG2C 1F51A 3OMNB 1VQMV 1NJIW 1YTFB 4FK5C 3QO5A 1B6QA 2JIZG 1S0VA 5LHHA 1E1QG 2ATKC 3ZIAG 2HJFC 3E8BA 1V55B 2DQ0A 1GO3F 1OCOB 4PA6A 5H6QA 3LDEA 4RAIA 4MTGA 1VQOV 4KFMA 3RBZA 2LFSA 3JCZA 3E35A 5L3FA 3K0DA 2P90A 3IFXA 2H94A 3CCLV 1G4YB 1JX9A 5EC1C 4WFAV 3CCMV 1VQKV 1W0JG 5KA6A 4JGSA 3D36A 4ASUG 3IC7A 4WCEV 3W7UA 3DGEA 4PDRA 1KC8W 1PNMA 1VQ9V 3WFVA 2HG5C 2X6BA 1Y4MA 3SYQA 3CXCU 3ABKB 5LGUA 3BY6A 2EILB 1JCHA 2EIKB 3AEIA 1XL6A 2BOBC 5CN0A 4HYOA 2OT5A 1R3LC 2JEUA 3OFNG 1KP2A 4XDJA 1S72V 4QJFB 3CCQV 1AI4A 5DN6G 1SRYA 2EZPA 4JYCA 1OCRB 4MVQA 1K5QA 1IXMA 2K1EA 3ASNC 3CCJV 5DM6V 1PKXA 3E83A 4PA4A 2AHYA 2X0LA 1Q86W 1JVMA 4MVMA 1JOYA 4GX2A 1AJQA 1YJNV 4J9YB 2F43G 3E89A 4QPKA 3FB7C 1P4RA 4FIPC 2WPDG 4MTOA 1QBZA 4MW8A 3OW2U 2WLIB 1YJWV 3QNEA 3STZC 2JJ2G 3MHSC 1I5XA 1FFTB 1OCOC 1PD3A 2P7TC 4WFEA 3VBBA 2EJRA 5IDJA 4WFHA 1DF4A 3P32A 5KUKA 3RVYA 1YJ9V 1SESA 3ML0A 5HFLA 1Q7YW 1R3JC 4ZKIA 3G71V 5LGNA 2ITDC 4MS2A 4XBFA 4QNHB 2GSMB 1VQ7V 3K06A 5GW7A 2IJKA 1EFRG 5CBFA 1JJ2U 5BZBA 3ABUA 5B1OA 3ABKC 3CPWU 2EILC 1UJWB 2DWDC 1R3IC 4QE7A 2EIKC 1NR7A 4JAUA 1W2BU 4QPJA 1FS0G 2XAQA 3SYOA 3G4SV 1K7DA 2CK3G 3BEHA 1WPXA 1ENVA 1RPOA 1OCRC 1YIJV 4R8CA 2HVJC 1JPXA 5B3SC 4FPPA 5L3DA 3G6EV 2P6JA 2X6AA 1S5HC 2Q68A 1YITV 3OEHG 3ZRWB 4G2KA 3WG7B 1K8AW 3SPJA 1NR1A 3T2MA 3ZCCA 3ABTA 3LDDA 1GMGA 2BOCC 1DF5A 2WLJA 2IJHA 1HWYA 1VQLV 1VQ8V 3K79A 3SPHA 2XAGA 4P9PA 1GM8A 1GKFA 4GX5A 2EIJB 4QE9A 5HFMA 2PI5A 1G8MA 1ORQC 2W0FC 2WAMA 1QVFU 3X2QC 1OHHG 4U7NA 1K9MW 1H8EG 1NH2D 3HB3B 4RQFA 3NXSA 3F7YC 2IJIA 4CBCA 1GM9A 3MD0A 3AG3B 1EZJA 1M57B 3W7SA 4JF3A 2JEXA 3OR6C 2A9HA 1K5SA 4G27B 1AI6A 3K04A 1DLBA 3CCVV 4BW5A 1S3JA 5LGTA 3CC7V 1VQNV 1H38A 2Q67A 1E79G 2EINB 4MTXA 1GM7A 4OXSA 4MT8A 1FXKB 2B1IA 2IH1C 5B1BB 3OEEG 3PJSK 1OCCB 4JYBA 1S76D 3SYCA 3W7XA 3KG2A 1QLEB 3T1CA 4UV9A 3ZJZA 5L3EA 2WLHA 1CP9A 2D3OW 3CCRV 4GX1A 1H8HG 1YI2V 2ZXWC 2UXXA 3ZMVA 2EBOA 4WFGA 3OR7C 1SETA 2DWEC 3E8FA 4F4LA 3B77A 4PDVA 1NVPD 4R7CA 2AHZA 2JK5C 1LNQA 3CD6V 5IYCO 3K0GA 2HKOA 2WLLB 2OCCB 4UXNA 3ABMB 4RUEA 3WG7C 3FB5C 2WLNA 2X6CA 1AI5A 2IW5A 1VQ6V 1THZA 4TWKA 3JD3A 2B5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITD C;  3E8H A;  4MS2 A;  3ASO C;  4EKW A;  2EIJ C;  4QNH B;  3SYP A;  2NLJ C;  4RUF A;  3K06 A;  4DXW A;  2WLI A;  4G28 B;  3FB6 C;  5CBG A;  5CBF A;  5BZB A;  5CBH A;  4XDL A;  4WFF A;  1J95 A;  2ZD9 A;  3ABK C;  1V55 C;  1OCZ C;  4MVS A;  4P30 A;  1V54 C;  2EIL C;  4JTA B;  3LDC A;  4X8A A;  2DWD C;  2Q6A A;  1R3I C;  4QE7 A;  2EIK C;  5J9P C;  3TET A;  3AG2 C;  4MVU A;  5KUM A;  2WLL A;  3SYO A;  4MSW C;  4MVO A;  3BEH A;  3OGC C;  4MVR A;  4PDL A;  5EBL C;  2ATK C;  1OCR C;  2HJF C;  4R50 A;  2HVJ C;  4R8C A;  3E8B A;  5B3S C;  5IY5 C;  2KB1 A;  2EIN C;  4PA6 A;  2QTO A;  3K08 A;  3LDE A;  4LBE C;  3T4Z A;  4RAI A;  4MTG A;  4JTC B;  4KFM A;  3RBZ A;  2X6A A;  3UM7 A;  1BL8 A;  1S5H C;  1OCC C;  2Q68 A;  4HZ3 A;  3GB7 C;  3K0D A;  3AG1 C;  3F7V C;  2ITC C;  3SPJ A;  3JYC A;  3T2M A;  3IFX A;  3LNM B;  3LDD A;  1QLE C;  4ZBM A;  2BOC C;  1G4Y B;  2WLJ A;  4LCU C;  3ABL C;  3AG3 C;  1P7B A;  2HFE C;  5EC1 C;  3SPH A;  4P9P A;  1M57 C;  4GX5 A;  3TCU A;  4QE9 A;  1R3K C;  1M56 C;  4H33 A;  1ORQ C;  2W0F C;  2QKS A;  4PA9 A;  3E86 A;  4H37 A;  3F5W C;  3X2Q C;  4PDR A;  2HG5 C;  2X6B A;  3SYQ A;  3F7Y C;  4GX0 A;  4CBC A;  3K03 A;  3ZRS A;  3LUT B;  3OUF A;  4X89 A;  2OCC C;  1XL6 A;  2BOB C;  3AG4 C;  4HYO A;  3IGA C;  3SYA A;  2A79 B;  3R65 A;  5B1B C;  3OR6 C;  2A9H A;  1R3L C;  4G27 B;  3UKM A;  2Y69 C;  3K04 A;  4XDJ A;  4MVZ A;  4R6Z A;  4RO2 A;  2IH3 C;  4LP8 A;  4UUJ C;  4BW5 A;  4MVQ A;  2K1E A;  3ASN C;  3T4D A;  5EK0 A;  2DYR C;  2Q67 A;  4OXS A;  3E83 A;  4PA4 A;  2AHY A;  2IH1 C;  4I9W A;  1ZWI C;  4PDM A;  4P9O A;  3PJS K;  5EC2 C;  1JVM A;  2DYS C;  1KKD A;  4MVM A;  3SJQ C;  2YEV A;  3SYC A;  2A0L A;  4GX2 A;  4P2Z A;  3KG2 A;  3HPL C;  5EBM C;  4J9Y B;  4XDK A;  3T1C A;  1K4D C;  3ZJZ A;  3E89 A;  3SPC A;  4MW3 A;  2WLH A;  3FB7 C;  3VOU A;  4GX1 A;  2HVK C;  4PA3 A;  3ABM C;  4MTO A;  2R9R B;  2ZXW C;  3RW0 A;  4X88 A;  4MW8 A;  3RVZ A;  2WLI B;  5B1A C;  3FB8 C;  4WFG A;  3OR7 C;  2DWE C;  4J9Z B;  3E8F A;  3STZ C;  4F4L A;  4MTF A;  2WLK A;  2WLM A;  3SPG A;  1OCO C;  1R3J C;  4JTD B;  2P7T C;  4PDV A;  4WFE A;  3STL C;  3EFF K;  4R7C A;  2AHZ A;  2JK5 C;  1K4C C;  1LNQ A;  2H8P C;  3K0G A;  4PA7 A;  2WLL B;  4WFH A;  5EBW C;  4RUE A;  5E1A C;  1XL4 A;  3WG7 C;  5KUK A;  3RVY A;  3FB5 C;  2WLN A;  2X6C A;  3SPI A;  2Q69 A;  3OUS A;  2EIM C;  4TWK A;  3E8G A; 
#chains in the Genus database with same CATH topology
 2XAJ A;  4BIU A;  5CB4 B;  1BHB A;  4YIP A;  4LC1 A;  4WF9 V;  3G80 A;  2DYS B;  2Q73 A;  1PL0 A;  3BFR A;  4EB6 A;  3CRR A;  5KUM A;  4J11 A;  1NQT A;  4JI3 B;  4EFE A;  4YHH B;  1N34 B;  4F6R B;  4B3M B;  1SER A;  3AK2 A;  1K97 A;  2EIN C;  1Y6X A;  2QTO A;  4LBE C;  4YHH O;  1BZK A;  3ZMS A;  1N8R W;  1AIL A;  4GKK B;  2ZE6 A;  2OWO A;  4PD4 F;  1XHX A;  3JAL A;  1XMQ B;  1F4N A;  3NR7 A;  4GKK O;  2HFE C;  1Q8I A;  4H44 B;  1Y74 B;  1XMO B;  1SQQ H;  1MG1 A;  4YJ3 A;  1KYO F;  2YEV B;  2X7R B;  1FYJ A;  4IIJ B;  2IU3 A;  5B5E Z;  5ITZ B;  2N04 A;  3IGA C;  3UKM A;  3L9D A;  3JAS B;  2GUZ B;  2QWN B;  2XAF A;  3T4D A;  2AXT Z;  2ZE8 A;  1YSC A;  4JV5 O;  1EZV H;  4TUY B;  1OJH A;  3K58 A;  2W6J G;  4I9W A;  3ZMZ A;  2JDI G;  1XHZ A;  4GKJ B;  3BVO A;  1W0K G;  3B8N A;  3S3X A;  2XHB A;  4MW3 A;  1M9N A;  2V1D A;  4LH6 A;  4PA3 A;  2HR3 A;  5LMN B;  4GKJ O;  1M56 B;  5B1A C;  4GCZ A;  3JAW B;  5LMN O;  5JCO C;  5JJN B;  1K4C C;  2QWQ B;  3LSS A;  3SPI A;  2QM8 A;  4KXR A;  2Y69 B;  2E5L B;  1Z5W A;  3J81 N;  5B66 Z;  2DYR B;  2UUC B;  1CXZ B;  3SYP A;  4LF5 O;  4O4L B;  4UVA A;  4DV1 B;  5CBH A;  2UUC O;  4FLT A;  4DUY B;  2WLL A;  4JAS A;  4DV2 B;  3VQV A;  1LR1 A;  1T5E A;  3CP1 A;  4LNU A;  1R1B A;  4DUY O;  2DW4 A;  3JCU Z;  4YJ2 B;  1S5J A;  1GRJ A;  5CB4 A;  1K33 A;  4JTC B;  3CB2 A;  4BIZ A;  2Q5Z A;  1WA8 B;  3UQ8 A;  1M5I A;  3LNM B;  2PZS A;  1EN6 A;  4B3R O;  2EIM B;  5B3S B;  2UUB O;  3HKC B;  3ABL C;  3AG3 C;  1EBO A;  2ZIO A;  5LP6 C;  1N32 B;  4H37 A;  3ZMT A;  4F6R A;  1IBL O;  1KUQ A;  1I5Y A;  4FM0 A;  3OD4 A;  3K9S A;  1N32 O;  3OUF A;  4K35 A;  2RMK B;  5B1B C;  5C8Y B;  3DTU B;  3K9A A;  3TJT A;  1IBK B;  4LP8 A;  4O2A B;  4LWS B;  4B7E A;  2FL4 A;  1EM1 A;  1TA8 A;  1Y74 A;  4WFB V;  4JI7 O;  4K0K B;  3CC4 V;  3QF7 A;  3GWO A;  2A3Q A;  2QM4 A;  2YEV A;  4E2L A;  4TOI A;  4LFC O;  4K0K O;  4IIJ A;  5ITZ A;  2RDC A;  3D36 C;  3ABM C;  3SJC C;  2R9R B;  1SF9 A;  1XOU A;  3CS5 A;  4X65 B;  3JAS A;  2GUZ A;  1SQV H;  4FLY A;  2QM7 A;  4LH7 A;  3JD1 A;  3B8M A;  4X1I B;  2NNU A;  4DV4 B;  4TUY A;  1KB9 F;  4X65 O;  1BCC H;  2ZXW B;  2Q7G A;  4TT3 G;  4DV4 O;  4Z1V A;  5FL7 G;  3JAK B;  3L73 H;  3U11 A;  3K5O A;  3ASO C;  5CMU A;  2QDO A;  4WBN B;  5L3B A;  1IBM B;  2BTO A;  4BAY A;  2A06 H;  2IJJ A;  2JGD B;  3JAW A;  2ZDI A;  2YI9 A;  2QKC A;  1M4U A;  2Q6A A;  5LMU B;  5LYJ B;  3OMN B;  1VQM V;  2KG7 B;  4IGG A;  2XUM A;  5LHH A;  1E1Q G;  3BRC A;  1GO3 F;  4UB8 Z;  4PA6 A;  2F66 C;  2LFS A;  3E35 A;  4O4L A;  4DR7 O;  1KBH A;  2JS3 A;  2H94 A;  3CCL V;  3CRC A;  1JX9 A;  5EC1 C;  3P3N A;  3CCM V;  1VQK V;  4FVM A;  5D5Q A;  1N0J A;  4PDR A;  4X9Q A;  1PNM A;  3WFV A;  2HG5 C;  4DR6 B;  4LFB B;  3KZI Z;  4YJ2 A;  3BY6 A;  2EIL B;  1M93 A;  2EIK B;  1OV9 A;  1XL6 A;  3AEI A;  5CN0 A;  4I4T B;  4LFB O;  1WA8 A;  1R3L C;  2BSK B;  3A0B Z;  4DV5 B;  4XDJ A;  3SR2 C;  5DN6 G;  1D5A A;  3CCQ V;  4TQD A;  1OCR B;  4MVQ A;  2K1E A;  1IXM A;  3HKC A;  2ZM6 B;  2GTA A;  5DM6 V;  1PKX A;  4AIL C;  3T1H O;  5KHI A;  4E4E A;  1UFI A;  1AJQ A;  2UXB B;  3E22 B;  4JAA A;  1VF7 A;  4QPK A;  4MTO A;  5C8Y A;  1QHT A;  1QBZ A;  3OW2 U;  4A5U B;  4LFA B;  4O2A A;  1OCO C;  4WFE A;  4LWS A;  2EJR A;  4LF4 O;  5IDJ A;  4J41 A;  5KUK A;  1YJ9 V;  3ML0 A;  2VQF B;  1H2K A;  5HFL A;  4CH3 A;  5LGN A;  3RYI B;  5KHG A;  4ZOL A;  2VQF O;  5FNV B;  5J2T B;  5EYP B;  2YID A;  3ABK C;  2FKX A;  4O2B B;  1W2B U;  4QPJ A;  3SYO A;  3G4S V;  1PP9 H;  2JGU A;  2Y0P A;  2YUA A;  1B06 A;  1JPX A;  5L3D A;  4WBN A;  3G6E V;  4JYA B;  4DR1 O;  2OIE A;  2X6A A;  3WG7 B;  2CGN A;  4DR2 B;  1K8A W;  1I08 A;  3ZHT A;  3WB0 A;  4JYA O;  2YXL A;  4NKG B;  1WN7 A;  1DF5 A;  1DGS A;  2WLJ A;  1HWY A;  2LGW A;  5LYJ A;  1VQL V;  3UO2 A;  3K79 A;  2KG7 A;  4DR2 O;  2XAG A;  4P9P A;  1GKF A;  2EIJ B;  5HFM A;  1G8M A;  1PV0 A;  3X2Q C;  1OHH G;  4U7N A;  3F7Y C;  1XNR B;  3AG3 B;  1EZJ A;  3CXH F;  3W7S A;  4I50 B;  4DUZ O;  4FM1 A;  2E76 B;  4G27 B;  2Q67 A;  1TGO A;  1FXK B;  1ZAU A;  2B1I A;  1SQF A;  2IH1 C;  1W59 A;  5B1B B;  1OCC B;  4JYB A;  3SYC A;  3RFR A;  1RFY A;  3ZJZ A;  4YIO A;  1CP9 A;  3CCR V;  1H2L A;  3RYH B;  4I4T A;  1N36 B;  3B40 A;  1JA8 A;  2BSK A;  2DWE C;  3B77 A;  2RN9 A;  1GN3 A;  1N36 O;  4PDV A;  4R7C A;  2JK5 C;  4CH5 A;  4NTX A;  3ABM B;  3VQY A;  2L6L A;  3J7A U;  4TWK A;  3E8H A;  3O65 A;  3E22 A;  5EZY B;  5GTI Z;  2JRI A;  3WU2 Z;  4RUF A;  2Y48 A;  1KQS U;  4X64 B;  4TV8 B;  1QR9 A;  2Z5U A;  1Y66 A;  1SZT A;  3BPZ A;  4X8A A;  2GV9 A;  1PNK A;  4GLX A;  4NXM O;  2CDY A;  3OGC C;  4PDL A;  4RWU A;  3D3I A;  1M1K W;  3RYI A;  4R50 A;  2K9P A;  1R6K A;  1PM9 A;  3DXR B;  2Q0A A;  4J80 A;  5IJ0 B;  5FNV A;  3GB7 C;  3THO A;  5J2T A;  2F4V O;  5EYP A;  1RM1 B;  2XTA A;  2EZO A;  4LCU C;  2KKW A;  1QLN A;  4O2B A;  4CZZ A;  2PYL A;  3N2K B;  3P30 A;  4UCS A;  3ZN1 A;  2IU0 A;  3CX5 F;  4H33 A;  4PA9 A;  1HNZ B;  4J7J A;  1TAE A;  2GTS A;  4FZ1 A;  2PF4 E;  4F6E A;  3OMA B;  1V54 B;  1HNZ O;  3ZRS A;  1K3E A;  4X89 A;  4DO2 A;  4LR3 A;  4JI2 O;  4FFB B;  5KMG A;  1HR0 O;  2H3O A;  1U96 A;  2V7Q G;  1QQC A;  1LUV A;  4LF8 B;  2C2A A;  3CRA A;  1NTM H;  4BIO A;  4PDM A;  3CJH B;  4DR5 O;  5B1N A;  2A7W A;  3ETD A;  4I55 B;  2HVK C;  4I50 A;  1GAX A;  3ZHQ A;  2ZCE A;  3FYE B;  4YXW G;  1FXK A;  2PGG A;  3TXS A;  3WB1 A;  4ZHQ B;  2Q69 A;  1AJN A;  2QA4 V;  4DV3 O;  4DV7 B;  3B2E E;  3F5T A;  3CE2 A;  3RYH A;  4JI6 B;  4K8Z A;  3ZMU A;  2CTP A;  1Q90 D;  4NXN B;  5KX5 B;  4MVS A;  1OCZ C;  4KHP O;  2CAZ C;  1GTO A;  4CS2 A;  1BGY H;  4HAM A;  4U7O A;  2PI4 A;  3APQ A;  4NXN O;  5C93 A;  1XNQ B;  4MSW C;  2XAH A;  4MVR A;  4UCU A;  3GWK C;  1Q5O A;  5EZY A;  5IY5 C;  1XNQ O;  3K08 A;  3T4Z A;  1BL8 A;  2CTR A;  3AG1 C;  3F7V C;  5CA1 B;  4TV8 A;  3H1I H;  4ZBM A;  2WWW A;  4DRX B;  4RQE A;  3C3T A;  1COW G;  1M90 W;  2UXD B;  4PJ0 Z;  3KCX A;  1TUB B;  4OX9 B;  1GN6 A;  4KL1 A;  5A2Q N;  4FMT A;  2R9I A;  1YCI A;  3I55 V;  3A0R A;  3CMA V;  2QWP B;  3DXR A;  4YY3 B;  3TGU H;  3K03 A;  4JI3 O;  4B3T B;  3AG4 C;  1VF6 C;  1N34 O;  1SKV A;  3FYI B;  4B3M O;  4O4J B;  3X2Q B;  4MVZ A;  4R6Z A;  2HLD G;  2VQE B;  3WB2 A;  2HP8 A;  2BE3 A;  3N2K A;  1VQP V;  1AB3 A;  3HKE B;  3SJA C;  1ZWI C;  4P9O A;  3SGI A;  4QIW F;  2VQE O;  2LFR A;  2OCH A;  1XMQ O;  4Q20 A;  2QEX V;  4FJC C;  1WPB A;  1FXH A;  1XMO O;  4LF6 B;  2ODM A;  1MSD A;  3VOU A;  3W7W A;  2YIB A;  3FKS G;  4FFB A;  5IYB O;  4X66 B;  2JS5 A;  3RVZ A;  3B4S A;  5AG2 A;  1QR8 A;  4LF6 O;  3A2F A;  2CTW A;  3H1L H;  2JVD A;  3CJH A;  5E1A C;  1XL4 A;  1MOF A;  4GUN A;  2P67 A;  1FAF A;  2QE7 G;  1NVP B;  4DR3 B;  3A0H Z;  1BSM A;  2F93 B;  4I55 A;  2P4V A;  2UU9 B;  2NLJ C;  5IWA B;  5CBG A;  5LL6 Y;  3G67 A;  2AZ0 A;  5L3G A;  2UU9 O;  3R66 A;  3CEI A;  4JZG A;  4ZIB A;  2ATK C;  2N05 A;  4NVP A;  3ZIA G;  2AZ2 A;  4X20 B;  2NR5 A;  4RAI A;  1VQO V;  1G1X B;  4KFM A;  3ZHV A;  1NU1 H;  4CS4 A;  2CTQ A;  4AHC A;  5L3F A;  2E5L O;  2OYQ A;  4NB5 A;  4AI8 A;  5KX5 A;  1Q6U A;  4EFB A;  2IM9 A;  2G38 A;  1V9P A;  4WFA V;  4DV1 O;  4B7K A;  2FB5 A;  2YIB D;  3KCY A;  2N74 A;  1Y4M A;  1WB8 A;  3SYQ A;  3CXC U;  4DV2 O;  1IXB A;  1B3Q A;  2BOB C;  5CA1 A;  4OPH A;  2ARH A;  4QJF B;  1S72 V;  1AI4 A;  3IJ4 A;  2EZP A;  4DRX A;  3ASN C;  3VQX A;  5KHJ A;  1TUB A;  3M7M X;  2AHY A;  2E74 B;  4D7T A;  1I94 B;  1Q86 W;  4X62 B;  1JOY A;  1YJN V;  2F43 G;  1I94 O;  3CHX A;  3N27 A;  4O4J A;  2JJ2 G;  3MHS C;  1FFT B;  2YXH A;  2UXC B;  3HKE A;  4WFH A;  5H5N A;  1DF4 A;  1FPO A;  4I0X B;  1IBK O;  1MZF A;  4ZKI A;  2UXC O;  1LUW A;  4IHJ B;  4QNH B;  2GSM B;  3K06 A;  1XQ8 A;  2IJK A;  3K57 A;  1JJ2 U;  4D6T H;  3JSN A;  4DR4 B;  1NR7 A;  4O4I B;  2ZIM A;  4DR4 O;  1YIJ V;  2HEP A;  4FPP A;  5KAI Z;  3AK3 A;  1S5H C;  2Q68 A;  3OEH G;  3ZRW B;  2WA4 A;  1NR1 A;  3T2M A;  3ABT A;  3LDD A;  1IBM O;  5IJ9 B;  3EXA A;  3I5D A;  1A32 A;  5H2F Z;  2PI5 A;  4QE9 A;  4K3A A;  1ORQ C;  3UT5 B;  3APO A;  1K9M W;  5LMU O;  3JAM N;  1YXB A;  3HB3 B;  3NXS A;  1MNG A;  3MAQ A;  4CH6 A;  4JF3 A;  3OR6 C;  1K5S A;  1XEQ A;  1UPG A;  1P84 F;  1AVM A;  1S3J A;  1U97 A;  2YC0 A;  2EIN B;  1GM7 A;  4MT8 A;  2Q7H A;  4IL6 Z;  2WLH A;  1H8H G;  2PTM A;  4DR6 O;  2L35 A;  4WFG A;  3OR7 C;  1SQG A;  2ZT9 B;  3SJB C;  1NVP D;  2P22 C;  3BA8 A;  3CD6 V;  3K0G A;  2RCV A;  4DV5 O;  1NTZ H;  2AGA A;  1Z2G A;  2ZM6 O;  1Y76 B;  2IW5 A;  2B5U A;  4BR6 A;  2YSU B;  3CCU V;  4DV6 B;  3N2G B;  5K1P A;  1WNS A;  1Z5V A;  4ZI7 B;  3JAR B;  1I7F A;  4B3S B;  2UXB O;  2ZD9 A;  1XIL A;  3EHB B;  4JTA B;  3JD2 A;  3LDC A;  1PPJ H;  3M8A A;  2QSA A;  4L8J A;  4MVU A;  1OZ0 A;  4LFA O;  2Z3Y A;  4I0X A;  5B1A B;  3BAB A;  2VWJ A;  2KSD A;  5LHI A;  4IHJ A;  4DK1 A;  2KB1 A;  4TV9 B;  3CYO A;  3JD0 A;  4UB6 Z;  4W4L A;  1QLE C;  3M99 B;  1VQ5 V;  4AQY B;  3BHP A;  2YXY A;  3QO7 A;  4X1I A;  1P7B A;  2ZQM A;  3H1J H;  2ILM A;  1BT8 A;  3D8C A;  4IYH A;  4AQY O;  2QWO B;  3OM3 B;  1F7Y A;  3JAK A;  4GX0 A;  3O9O A;  4H0L B;  1AJP A;  1J5E B;  1IZ3 A;  2OCC C;  3SYA A;  2A79 B;  3ZRW A;  2ZIN A;  3W7T A;  2ZE7 A;  4OPA A;  4X1Y B;  2JGD A;  2QKA A;  2IH3 C;  1Y67 A;  4J7K A;  5IJ9 A;  1URF A;  4JZ2 A;  3CME V;  1QCE A;  3VQW A;  3T1Y B;  3L74 H;  1L0L H;  1QVG U;  1VP7 A;  5JVD B;  3UT5 A;  2UUA B;  2DYS C;  1NT2 B;  1XUQ A;  1QU7 A;  1WAZ A;  2A0L A;  3T1Y O;  3HPL C;  5H9C A;  1BMF G;  1K4D C;  3ABL B;  2QGN A;  3JAT B;  3FB8 C;  5LP6 B;  4J9Z B;  1XNR O;  4N21 A;  1ROP A;  2WLK A;  4JTD B;  1XRE A;  1BHA A;  3ZS8 C;  4PA7 A;  5EBW C;  3ZX6 A;  3AK1 A;  4TQF A;  3QG5 A;  3L72 H;  3ETG A;  2F1M A;  3MHH C;  3JD4 A;  1JQ0 A;  1IUR A;  5KA5 A;  1ARO P;  2Q0O C;  1RSO B;  4GYC B;  1MSW D;  1Q81 W;  5TIS Z;  2GHY A;  3CC2 V;  1Y76 A;  1GN4 A;  2ZR2 A;  1NTK H;  3CCS V;  5KLV H;  1G6U A;  3N2G A;  3ETE A;  2DN9 A;  1L1F A;  1NBM G;  3UM7 A;  3K5N A;  4HZ3 A;  4ZI7 A;  3JAR A;  1PL4 A;  5LBQ A;  2LO1 A;  2LW1 A;  2OTL V;  1YF2 A;  3ASO B;  4X64 O;  1Q3E A;  1M56 C;  5L3C A;  2LP7 A;  2QKS A;  3E86 A;  4HNA B;  3F5W C;  1K73 W;  3BA9 A;  1H2S B;  3L71 H;  5LXT B;  2ZDI C;  2BCC H;  3H1H H;  1Q82 W;  1K92 A;  5JCO A;  4PV1 B;  4UVC A;  3DC5 A;  4UV8 A;  2Y69 C;  1TUE B;  1NH2 B;  4RO2 A;  3ZRX A;  3LSQ A;  4UUJ C;  3RYF B;  5EK0 A;  2DYR C;  1CPY A;  1YVW A;  2HHH B;  3SJQ C;  3ZHS A;  4XDK A;  1H2M A;  4FM2 A;  2W6I G;  2M7W A;  4DW1 A;  4X1Y A;  1VEW A;  2Q7E A;  3STL C;  1KMI Z;  1K34 A;  3QO8 A;  3S3W A;  5JVD A;  3BAA A;  4LF8 O;  3C90 A;  4JYY A;  4JPR A;  1KP3 A;  2EIM C;  3OUS A;  3E8G A;  3OTO B;  2F23 A;  4NR1 A;  3OE7 G;  1WLE A;  3JAT A;  4I5S A;  5LP6 A;  3CCE V;  2VRZ A;  1DTO A;  1SQP H;  4WFF A;  2DOS A;  4DV0 B;  5KAF Z;  2P5O A;  2PY5 A;  3H01 A;  3AG2 C;  2IBZ H;  1NJI W;  1YTF B;  1WP8 A;  3QO5 A;  2JIZ G;  4DV0 O;  4FZ0 A;  1ZL8 B;  2HJF C;  3E8B A;  1OCO B;  1L8D A;  4D7S A;  3RBZ A;  3JCZ A;  4DV7 O;  1H2N A;  1ZUQ A;  3K0D A;  5KHK A;  3IFX A;  3C3S A;  1NI8 A;  5FLX N;  4JI6 O;  2DMX A;  4JGS A;  3D36 A;  1SZX A;  1SQX H;  5BY1 A;  4WCE V;  1AR4 A;  2R9A A;  3DGE A;  1KC8 W;  4NTY A;  3ABK B;  5LGU A;  2ADP A;  4JI1 B;  5IT9 N;  4HYO A;  3LSU A;  1O9H A;  2JEU A;  1KP2 A;  3Q4H B;  4JI1 O;  1SRY A;  4JYC A;  1K5Q A;  3ZED A;  3CCJ V;  4FLW A;  1JR9 A;  1QNM A;  2X0L A;  4HNA A;  1JVM A;  5LXT A;  2UXD O;  4OX9 O;  4DYL A;  1US6 A;  2LJ2 A;  3E89 A;  5GON B;  4J42 A;  2QTS A;  1P4R A;  4FIP C;  2WPD G;  5IJ0 A;  5IE9 A;  1YJW V;  2WLI B;  4U3F H;  3QNE A;  4YY3 O;  4H13 B;  3RYF A;  3VBB A;  2P7T C;  4B3T O;  1RP3 B;  4OGQ B;  3RVY A;  1SES A;  4JI0 B;  1ZLZ A;  1Q7Y W;  2YIC A;  5IYZ B;  1D5N A;  3UO3 A;  4JI0 O;  4U3J B;  1AR5 A;  1EFR G;  5BMV B;  3ABU A;  3L70 H;  5B1O A;  2EIL C;  2DWD C;  1R3I C;  2OIG A;  2EIK C;  4X66 O;  4JAU A;  2XAQ A;  1K7D A;  2CK3 G;  1RPO A;  4FLX A;  1OCR C;  2HVJ C;  2P4K A;  1BQZ A;  2P6J A;  2E3C A;  1MMM A;  1YIT V;  4JV5 B;  4G2K A;  3SPJ A;  4DR3 O;  3ZBH A;  3ZCC A;  3J80 N;  2BOC C;  1VQ8 V;  5IWA O;  1GM8 A;  3K59 A;  1GN2 A;  1ZL8 A;  2WAM A;  4ZHQ A;  1QVF U;  2FYU H;  1NH2 D;  1AP5 A;  1EN5 A;  3H1K H;  4RQF A;  2LQT A;  2IJI A;  4CBC A;  1GM9 A;  4QGP A;  4FLV A;  3L75 H;  2PUS A;  3OT7 A;  1AI6 A;  1KU9 A;  3K04 A;  1DLB A;  4DK0 A;  4EEQ A;  1AP6 A;  3CC7 V;  1E79 G;  4OXS A;  4CC6 A;  3ETQ A;  3OEE G;  5LA6 B;  4LF5 B;  2PYJ A;  2GDS A;  3KG2 A;  3W7X A;  2M6Y A;  5CA0 B;  3T1C A;  3LNN A;  5L3E A;  1ZX3 A;  5EIB C;  4ABM A;  1YI2 V;  2UXX A;  3QTC A;  2NN4 A;  2CE4 A;  3Q4H A;  2EBO A;  3ZMV A;  1SET A;  3B09 A;  1XDC A;  1DK1 A;  1BQ0 A;  4RUE A;  3WG7 C;  2X6C A;  2O57 A;  4N23 A;  1HP8 A;  5GON A;  4B3R B;  2EIJ C;  2UUB B;  1IVS A;  5K1X A;  4X62 O;  4DXW A;  2WLI A;  1YTF D;  1D2D A;  2F95 B;  1SA0 B;  4XDL A;  4KUM A;  1J95 A;  1V55 C;  4P30 A;  4X1K B;  1IBL B;  3TET A;  3OAA G;  2MK3 A;  1VAR A;  4MVO A;  1VQ4 V;  2ZR3 A;  1BE3 H;  2W0X A;  5IYZ A;  2R70 A;  1YHQ V;  1FXK C;  3AG2 B;  4U3J A;  1OCC C;  2E75 B;  5JQG B;  1N0N A;  4JI7 B;  5BMV A;  1SQB H;  4KP4 A;  1RPR A;  2WSS G;  1AR1 B;  4GZR B;  4LFC B;  1P49 A;  1MZE A;  3IC9 A;  1R3K C;  2Y4U A;  1XBL A;  4C7U A;  5D5P A;  3P3P A;  4ZOL B;  3U10 A;  1YDX A;  1OCZ B;  2RJZ A;  4J7Z A;  1PNL A;  3R65 A;  2YIA A;  5F2V O;  4UCT A;  4IYI A;  2EX3 A;  5A9G A;  5IY5 B;  1SS3 A;  2YI8 A;  1R6N A;  3CSX A;  4HBN A;  2Z0A A;  5LHG A;  1VIB A;  5EC2 C;  1YZB A;  3AG1 B;  4P2Z A;  2QWR B;  1JJO A;  1FFX B;  4X20 A;  3RT3 C;  2B1G A;  2MW2 B;  3SPC A;  3I56 V;  1E1R G;  1GK9 A;  3RW0 A;  4X88 A;  5IYD O;  2XND G;  3E2E A;  2UXN A;  2WLM A;  3CRQ A;  3EFF K;  4I9Q A;  3FAV B;  2FTK A;  3AG4 B;  5LA6 A;  1RM1 C;  3RYC B;  1ZSP A;  1AI7 A;  2ETN A;  4O4H B;  4DR7 B;  1WJZ A;  5CA0 A;  1F4M A;  5CA3 A;  2CGO A;  3PN1 A;  3BCC H;  1MAB G;  2B9Z A;  3CWB H;  3H9V A;  2XT9 A;  2V4D A;  2JJ1 G;  1P7G A;  2Q8V A;  4DW0 A;  1V54 C;  3ZHU A;  1S5L Z;  5J9P C;  5DEC A;  1S77 D;  1Q43 A;  2QR4 A;  3SDL A;  5EBL C;  2ZKO A;  4JI4 B;  1HW7 A;  2GBO A;  3EVK A;  4NYK A;  1CEZ A;  4JI4 O;  2ITC C;  3JYC A;  3T1H B;  1SA0 A;  4UCO A;  3U0Z A;  1JFF B;  4DV6 O;  4X1K A;  5GTH Z;  2DQ3 A;  3FFQ A;  1M57 C;  3TCU A;  4FLZ A;  1MA1 A;  4B3S O;  3ZN0 A;  1Q6H A;  4Z1M G;  1N33 B;  3FD9 A;  1O9G A;  1H2G A;  4ICG A;  2OTJ V;  1Q6I A;  3HKD B;  3OMI B;  4JAV A;  1N33 O;  3LUT B;  4JI5 B;  5H6R A;  4LF4 B;  5JQG A;  4TSF G;  2XOK G;  3RGB A;  2CH7 B;  4JI5 O;  2BTQ B;  3OTF A;  4K8X A;  4GT1 A;  1KKD A;  4O4I A;  2XAS A;  4CS3 A;  3TK1 A;  1FKA O;  1KD1 W;  5EBM C;  2LGQ A;  1VMG A;  4I7Z B;  1F23 A;  1NKD A;  3AG7 A;  4MTF A;  3SPG A;  1J5E O;  4PEL A;  1FJG B;  1KKC A;  4NTW A;  2H8P C;  3ZRV A;  4DR1 B;  5JJJ B;  1FJG O;  3DC6 A;  3K3W A;  3MDS A;  5FPO A;  1KEC A;  1FFX A;  4EKW A;  3ASN B;  3CRM A;  2UUA O;  1ZTE A;  1R73 A;  1IX9 A;  1FXV A;  4G28 B;  5KMG B;  3FB6 C;  5LOV B;  2Q9L A;  4FFK A;  5DED A;  4UFZ A;  4UVB A;  4L87 A;  3FAV A;  4LF7 B;  1F51 A;  4FK5 C;  1B6Q A;  1S0V A;  2FML A;  1VF6 A;  3RYC A;  4LF7 O;  4DUZ B;  4O4H A;  1V55 B;  2DQ0 A;  5KHH A;  5H6Q A;  3LDE A;  4MTG A;  5E79 Z;  3TXQ A;  1NZ6 A;  2P90 A;  4Z2W A;  1G4Y B;  3IAY A;  2D2C B;  2DJV A;  5BR8 B;  1W0J G;  5KA6 A;  4ASU G;  1I0H A;  3IC7 A;  3W7U A;  1R6T A;  1VQ9 V;  4J10 A;  2X6B A;  5BR8 O;  4Q6G A;  1WP7 A;  2Y4T A;  5JH7 B;  1JCH A;  3JSL A;  3OGI B;  1XI1 A;  1VF5 B;  2OT5 A;  3D3Q A;  3OFN G;  3RN4 A;  1JFF A;  5J2U B;  2EJ7 A;  4JI8 B;  1TVK B;  3GVM A;  1HNW B;  3HKB B;  2VS0 A;  2AW9 A;  4PI2 A;  3E83 A;  3DSQ A;  4PA4 A;  2ZNJ A;  4JI8 O;  4MVM A;  1HNW O;  4GX2 A;  3HKD A;  4J9Y B;  3ZHR A;  3FB7 C;  4TV9 A;  2Q4P A;  1YEW A;  1FD9 A;  3G6B A;  4MW8 A;  1GH6 A;  2LW7 A;  4NXM B;  3STZ C;  3KKY A;  4PHZ A;  2CH7 A;  1EN4 A;  1I5X A;  4EB6 B;  1PD3 A;  2BTQ A;  1SC5 B;  2ZE5 A;  2RNB A;  3P32 A;  3FX7 A;  2CUG A;  1X59 A;  2ZNI A;  1R3J C;  3G71 V;  2F4V B;  2ITD C;  4MS2 A;  4XBF A;  2HHH O;  4LF9 B;  1VQ7 V;  5GW7 A;  5CBF A;  2WA3 A;  5BZB A;  3QVN A;  3A8T A;  3CPW U;  3JAL B;  4LF9 O;  1UJW B;  4QE7 A;  4CH4 A;  2ADQ B;  1N4C A;  1JMK C;  1FS0 G;  3BEH A;  4UCR A;  1WPX A;  1ENV A;  4YJ3 B;  4JI2 B;  4R8C A;  1HR0 B;  5BXZ A;  4BWA A;  5B3S C;  1HDJ A;  2RQ6 A;  4B08 A;  3HR0 A;  4W4K A;  4UCV A;  5LOV A;  2Y0I A;  4IT5 A;  3OTO O;  1GMG A;  4DR5 B;  2HJD A;  2IJH A;  3SPH A;  4GX5 A;  2W0F C;  4FLU A;  3UCS C;  1H8E G;  3K5L A;  5FPR A;  3MD0 A;  1M57 B;  4CC5 A;  2YDE A;  2JEX A;  2A9H A;  2YS8 A;  1BS3 A;  3CCV V;  4BW5 A;  2P06 A;  4DV3 B;  2KQX A;  5LGT A;  1VQN V;  1H38 A;  4MTX A;  1X4T A;  1RSO A;  1HNX B;  1B04 A;  4BW9 A;  4PI0 A;  3PJS K;  3ICX A;  1S76 D;  1WB7 A;  2QJ1 A;  2VWK A;  1NS1 A;  1HNX O;  1QLE B;  4UV9 A;  5JH7 A;  2D3O W;  4KHP B;  4GX1 A;  1L0N H;  2ZXW C;  5EIB D;  5JWP A;  4F4L A;  3E8F A;  2DE0 X;  1IDS A;  5J2U A;  1TVK A;  5JJE B;  3RWR D;  3HKB A;  2AHZ A;  1LNQ A;  3K5M A;  5IYC O;  2HKO A;  2WLL B;  2OCC B;  4UXN A;  2R72 A;  2EUL A;  3FB5 C;  2WLN A;  1AI5 A;  4LNU B;  1VQ6 V;  1THZ A;  3JD3 A; 
#chains in the Genus database with same CATH homology
 2XAJ A;  3E8H A;  4N23 A;  4BIU A;  2YSU B;  3CCU V;  1BHB A;  2EIJ C;  4LC1 A;  4RUF A;  2Y48 A;  1KQS U;  4DXW A;  2WLI A;  1YTF D;  4WF9 V;  1QR9 A;  2DYS B;  2Z5U A;  4XDL A;  1Y66 A;  1PL0 A;  4KUM A;  1J95 A;  2ZD9 A;  1SZT A;  3EHB B;  1V55 C;  4P30 A;  4X8A A;  4JTA B;  3JD2 A;  3LDC A;  1PNK A;  3TET A;  3OAA G;  4MVU A;  5KUM A;  1OZ0 A;  2MK3 A;  1NQT A;  2Z3Y A;  4MVO A;  1VQ4 V;  2ZR3 A;  3OGC C;  4PDL A;  1M1K W;  3D3I A;  5B1A B;  4R50 A;  1SER A;  5LHI A;  1K97 A;  1R6K A;  2KB1 A;  2EIN C;  1YHQ V;  2QTO A;  1FXK C;  4LBE C;  3AG2 B;  3ZMS A;  3CYO A;  1OCC C;  1N8R W;  3GB7 C;  3JD0 A;  1RM1 B;  4KP4 A;  1QLE C;  1RPR A;  3M99 B;  1VQ5 V;  2WSS G;  1F4N A;  1AR1 B;  2EZO A;  4LCU C;  1QLN A;  3QO7 A;  4CZZ A;  1P7B A;  2HFE C;  2ZQM A;  3ZN1 A;  3P30 A;  2IU0 A;  1R3K C;  4H33 A;  4PA9 A;  1MG1 A;  2YEV B;  2X7R B;  3OM3 B;  3OMA B;  4GX0 A;  2IU3 A;  1OCZ B;  1V54 B;  3ZRS A;  1AJP A;  1K3E A;  2OCC C;  4X89 A;  4DO2 A;  1PNL A;  3IGA C;  3SYA A;  2A79 B;  3R65 A;  3ZRW A;  3W7T A;  3UKM A;  2V7Q G;  2IH3 C;  2XAF A;  2C2A A;  3CME V;  3T4D A;  5IY5 B;  1QCE A;  1YSC A;  1R6N A;  2W6J G;  4I9W A;  3ZMZ A;  4PDM A;  1QVG U;  2JDI G;  5LHG A;  5EC2 C;  2DYS C;  5B1N A;  3AG1 B;  2A0L A;  4P2Z A;  3HPL C;  1W0K G;  3B8N A;  3ETD A;  5H9C A;  1BMF G;  1K4D C;  2B1G A;  3SPC A;  4MW3 A;  3I56 V;  3ABL B;  1M9N A;  2V1D A;  1E1R G;  2HVK C;  4PA3 A;  2HR3 A;  1GK9 A;  3RW0 A;  1M56 B;  4X88 A;  5IYD O;  2XND G;  5B1A C;  3FB8 C;  4GCZ A;  3E2E A;  4J9Z B;  4N21 A;  1ROP A;  2UXN A;  2WLK A;  2WLM A;  3FYE B;  4JTD B;  1BHA A;  4YXW G;  3EFF K;  1K4C C;  1FXK A;  2FTK A;  4PA7 A;  5EBW C;  3LSS A;  3AG4 B;  1RM1 C;  3SPI A;  2QM8 A;  2Q69 A;  1AJN A;  2QA4 V;  2Y69 B;  1AI7 A;  1F4M A;  5CA3 A;  2DYR B;  3ETG A;  3MHH C;  3ZMU A;  3JD4 A;  1JQ0 A;  3SYP A;  1MAB G;  4UVA A;  5KA5 A;  5CBH A;  2JJ1 G;  4MVS A;  1OCZ C;  1V54 C;  1GTO A;  5J9P C;  1ARO P;  1S77 D;  2WLL A;  4HAM A;  4JAS A;  4U7O A;  2PI4 A;  1MSW D;  5C93 A;  1Q81 W;  4MSW C;  2XAH A;  2GHY A;  5EBL C;  3CP1 A;  4MVR A;  3CC2 V;  2ZR2 A;  2DW4 A;  5IY5 C;  3CCS V;  3K08 A;  3T4Z A;  1K33 A;  3ETE A;  4JTC B;  1L1F A;  3UM7 A;  1BL8 A;  1NBM G;  4HZ3 A;  4BIZ A;  1CEZ A;  3AG1 C;  3F7V C;  2ITC C;  3JYC A;  5LBQ A;  3LNM B;  4ZBM A;  2WWW A;  2EIM B;  4RQE A;  5B3S B;  1COW G;  1M90 W;  3ABL C;  2OTL V;  3AG3 C;  3ASO B;  2DQ3 A;  1EBO A;  1M57 C;  3TCU A;  1M56 C;  4FMT A;  5L3C A;  2LP7 A;  2QKS A;  2R9I A;  3ZN0 A;  4Z1M G;  3E86 A;  4H37 A;  3ZMT A;  3F5W C;  3I55 V;  1K73 W;  3A0R A;  3CMA V;  2ZDI C;  1H2G A;  1I5Y A;  2OTJ V;  1Q82 W;  1K92 A;  3K03 A;  3OMI B;  4JAV A;  3LUT B;  3OUF A;  3AG4 C;  4UVC A;  5H6R A;  5B1B C;  3DTU B;  3FYI B;  3K9A A;  4TSF G;  4UV8 A;  2Y69 C;  1TUE B;  1NH2 B;  3X2Q B;  4MVZ A;  4R6Z A;  2XOK G;  4RO2 A;  3ZRX A;  3LSQ A;  2HLD G;  4LP8 A;  4UUJ C;  5EK0 A;  2DYR C;  1CPY A;  1VQP V;  4WFB V;  1ZWI C;  4P9O A;  3CC4 V;  4QIW F;  4GT1 A;  3GWO A;  2LFR A;  1KKD A;  4Q20 A;  3SJQ C;  2XAS A;  2YEV A;  2QEX V;  4E2L A;  3TK1 A;  1KD1 W;  5EBM C;  4XDK A;  4FJC C;  1FXH A;  3VOU A;  3W7W A;  3FKS G;  3ABM C;  2W6I G;  5IYB O;  2R9R B;  2M7W A;  3RVZ A;  1F23 A;  1NKD A;  1QR8 A;  2QM7 A;  4MTF A;  3SPG A;  3JD1 A;  4PEL A;  3B8M A;  3STL C;  2NNU A;  1K34 A;  2H8P C;  3QO8 A;  3ZRV A;  5E1A C;  1XL4 A;  1MOF A;  2ZXW B;  3K3W A;  2P67 A;  4TT3 G;  4JPR A;  1KP3 A;  2EIM C;  3OUS A;  2QE7 G;  1NVP B;  3E8G A;  1KEC A;  5FL7 G;  3ASO C;  4EKW A;  3ASN B;  5CMU A;  5L3B A;  3OE7 G;  1WLE A;  1R73 A;  2NLJ C;  4BAY A;  4G28 B;  1FXV A;  4I5S A;  3FB6 C;  5CBG A;  2IJJ A;  3CCE V;  1DTO A;  4WFF A;  2ZDI A;  5L3G A;  4UVB A;  4L87 A;  2Q6A A;  3H01 A;  3AG2 C;  1F51 A;  3OMN B;  1VQM V;  1NJI W;  1YTF B;  4FK5 C;  3QO5 A;  1B6Q A;  2JIZ G;  1S0V A;  5LHH A;  1E1Q G;  2ATK C;  3ZIA G;  2HJF C;  3E8B A;  1V55 B;  2DQ0 A;  1GO3 F;  1OCO B;  4PA6 A;  5H6Q A;  3LDE A;  4RAI A;  4MTG A;  1VQO V;  4KFM A;  3RBZ A;  2LFS A;  3JCZ A;  3E35 A;  5L3F A;  3K0D A;  2P90 A;  3IFX A;  2H94 A;  3CCL V;  1G4Y B;  1JX9 A;  5EC1 C;  4WFA V;  3CCM V;  1VQK V;  1W0J G;  5KA6 A;  4JGS A;  3D36 A;  4ASU G;  3IC7 A;  4WCE V;  3W7U A;  3DGE A;  4PDR A;  1KC8 W;  1PNM A;  1VQ9 V;  3WFV A;  2HG5 C;  2X6B A;  1Y4M A;  3SYQ A;  3CXC U;  3ABK B;  5LGU A;  3BY6 A;  2EIL B;  1JCH A;  2EIK B;  3AEI A;  1XL6 A;  2BOB C;  5CN0 A;  4HYO A;  2OT5 A;  1R3L C;  2JEU A;  3OFN G;  1KP2 A;  4XDJ A;  1S72 V;  4QJF B;  3CCQ V;  1AI4 A;  5DN6 G;  1SRY A;  2EZP A;  4JYC A;  1OCR B;  4MVQ A;  1K5Q A;  1IXM A;  2K1E A;  3ASN C;  3CCJ V;  5DM6 V;  1PKX A;  3E83 A;  4PA4 A;  2AHY A;  2X0L A;  1Q86 W;  1JVM A;  4MVM A;  1JOY A;  4GX2 A;  1AJQ A;  1YJN V;  4J9Y B;  2F43 G;  3E89 A;  4QPK A;  3FB7 C;  1P4R A;  4FIP C;  2WPD G;  4MTO A;  1QBZ A;  4MW8 A;  3OW2 U;  2WLI B;  1YJW V;  3QNE A;  3STZ C;  2JJ2 G;  3MHS C;  1I5X A;  1FFT B;  1OCO C;  1PD3 A;  2P7T C;  4WFE A;  3VBB A;  2EJR A;  5IDJ A;  4WFH A;  1DF4 A;  3P32 A;  5KUK A;  3RVY A;  1YJ9 V;  1SES A;  3ML0 A;  5HFL A;  1Q7Y W;  1R3J C;  4ZKI A;  3G71 V;  5LGN A;  2ITD C;  4MS2 A;  4XBF A;  4QNH B;  2GSM B;  1VQ7 V;  3K06 A;  5GW7 A;  2IJK A;  1EFR G;  5CBF A;  1JJ2 U;  5BZB A;  3ABU A;  5B1O A;  3ABK C;  3CPW U;  2EIL C;  1UJW B;  2DWD C;  1R3I C;  4QE7 A;  2EIK C;  1NR7 A;  4JAU A;  1W2B U;  4QPJ A;  1FS0 G;  2XAQ A;  3SYO A;  3G4S V;  1K7D A;  2CK3 G;  3BEH A;  1WPX A;  1ENV A;  1RPO A;  1OCR C;  1YIJ V;  4R8C A;  2HVJ C;  1JPX A;  5B3S C;  4FPP A;  5L3D A;  3G6E V;  2P6J A;  2X6A A;  1S5H C;  2Q68 A;  1YIT V;  3OEH G;  3ZRW B;  4G2K A;  3WG7 B;  1K8A W;  3SPJ A;  1NR1 A;  3T2M A;  3ZCC A;  3ABT A;  3LDD A;  1GMG A;  2BOC C;  1DF5 A;  2WLJ A;  2IJH A;  1HWY A;  1VQL V;  1VQ8 V;  3K79 A;  3SPH A;  2XAG A;  4P9P A;  1GM8 A;  1GKF A;  4GX5 A;  2EIJ B;  4QE9 A;  5HFM A;  2PI5 A;  1G8M A;  1ORQ C;  2W0F C;  2WAM A;  1QVF U;  3X2Q C;  1OHH G;  4U7N A;  1K9M W;  1H8E G;  1NH2 D;  3HB3 B;  4RQF A;  3NXS A;  3F7Y C;  2IJI A;  4CBC A;  1GM9 A;  3MD0 A;  3AG3 B;  1EZJ A;  1M57 B;  3W7S A;  4JF3 A;  2JEX A;  3OR6 C;  2A9H A;  1K5S A;  4G27 B;  1AI6 A;  3K04 A;  1DLB A;  3CCV V;  4BW5 A;  1S3J A;  5LGT A;  3CC7 V;  1VQN V;  1H38 A;  2Q67 A;  1E79 G;  2EIN B;  4MTX A;  1GM7 A;  4OXS A;  4MT8 A;  1FXK B;  2B1I A;  2IH1 C;  5B1B B;  3OEE G;  3PJS K;  1OCC B;  4JYB A;  1S76 D;  3SYC A;  3W7X A;  3KG2 A;  1QLE B;  3T1C A;  4UV9 A;  3ZJZ A;  5L3E A;  2WLH A;  1CP9 A;  2D3O W;  3CCR V;  4GX1 A;  1H8H G;  1YI2 V;  2ZXW C;  2UXX A;  3ZMV A;  2EBO A;  4WFG A;  3OR7 C;  1SET A;  2DWE C;  3E8F A;  4F4L A;  3B77 A;  4PDV A;  1NVP D;  4R7C A;  2AHZ A;  2JK5 C;  1LNQ A;  3CD6 V;  5IYC O;  3K0G A;  2HKO A;  2WLL B;  2OCC B;  4UXN A;  3ABM B;  4RUE A;  3WG7 C;  3FB5 C;  2WLN A;  2X6C A;  1AI5 A;  2IW5 A;  1VQ6 V;  1THZ A;  4TWK A;  3JD3 A;  2B5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...