2G38A

A pe/ppe protein complex from mycobacterium tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
77
Chain Sequence
PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PE FAMILY PROTEIN
publication title Toward the structural genomics of complexes: Crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 33
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 2g38A00
4J7JA 2G38A 4W4KA 4J7KA 4IYIA 4KXRA 4J10A 4J41A 4W4LA 4J42A 4IYHA 4J11A 3FX7A 2GTSA
chains in the Genus database with same CATH superfamily
1RPOA 3APOA 1ORQC 5EZYA 2UU9B 4LFAO 4B3TB 1F51A 1M90W 5E1AC 2WAMA 5LXTB 1URFA 5IE9A 3EHBB 2N04A 2M6YA 3ZHVA 5L3FA 3JAWB 3K9SA 1YXBA 3WU2Z 3Q4HA 1Q3EA 2CGOA 2KG7B 2LO1A 3OM3B 4UV9A 2UU9O 4C7UA 4B3TO 1Q90D 1ZTEA 1WPXA 4EB6A 1CP9A 1K8AW 5JJEB 3IFXA 1BQZA 3ZHRA 1SQVH 2QE7G 2ADQB 2IJJA 4J9YB 4NVPA 3ZHUA 2Q0OC 2ZR2A 4MW3A 2JK5C 3OMAB 4E4EA 3SJCC 2JVDA 3ABLB 4DUYO 4FVMA 3DGEA 1MABG 2IBZH 1YEWA 2ILMA 1K9MW 2LQTA 4NXNB 1Y66A 1KYOF 2LGQA 2A7WA 2HJDA 3K0DA 2UXBB 4PELA 3JALA 5LHIA 2CDYA 2DMXA 1SETA 1H2NA 3DC6A 2BTOA 3E8FA 3R66A 2GHYA 4FFKA 3KG2A 2HR3A 2F95B 1K97A 4I9WA 2AHZA 1YHQV 4K8XA 1SESA 4CH6A 1KC8W 3ZCCA 4PA9A 3SYOA 3JSNA 1I5XA 2RN9A 1U96A 3VBBA 5JVDB 3CC2V 4UVCA 4U7NA 3T4DA 1Q43A 3ZN1A 3S3WA 1E1QG 4NXNO 1R73A 2Q8VA 5K1PA 4CH5A 1GM8A 2Y4TA 2Q4PA 3SGIA 4EFEA 1KKDA 1XEQA 4UCRA 3H1JH 4P9OA 4UVBA 4X65O 1WB7A 2OCCB 4TSFG 3ETDA 4PA7A 4OPHA 2JEXA 2DQ3A 3AG1C 3TETA 2WPDG 5JCOA 3ZMSA 3CEIA 3VQYA 3C90A 5D5QA 1F4MA 1BL8A 1FD9A 3AG3B 4AILC 3HKEA 2B5UA 5FNVB 4TUYB 3LDCA 1ENVA 2WSSG 2R9IA 2FKXA 1K5SA 5CA0B 1D5NA 1QLEC 3I5DA 2YSUB 2LW7A 3CCUV 4I9QA 2A3QA 3TCUA 3QVNA 1TA8A 1M5IA 2W6IG 3MHSC 1TUEB 3HKCB 2Q69A 3SR2C 1R6KA 5CN0A 1PNKA 4TV8B 4X1YA 1FFXA 3FD9A 5TISZ 5B3SC 2X0LA 3B8NA 3N27A 4TQDA 2F4VO 1H2MA 4MVMA 3PN1A 1YJ9V 5GONA 3CE2A 1Y6XA 1GH6A 4P30A 4DW1A 3E83A 2IH3C 1OCCB 4ZIBA 4ABMA 1PD3A 4JZGA 2N74A 3CRQA 4IIJA 3SYPA 5JQGB 1YVWA 3FB5C 1SF9A 1Z5WA 4N21A 2YS8A 3E2EA 3THOA 2HKOA 2VQFO 1WAZA 3LNNA 3ABMB 4BR6A 2JS5A 4FFBB 3JD4A 3L74H 1VQ7V 3D8CA 2X6AA 1XBLA 2BOCC 3UCSC 3L75H 5IYBO 1IDSA 4BW9A 3KCXA 2P4KA 4DR3B 2CAZC 4J7JA 1YTFB 2RCVA 1WNSA 3ZN0A 3FB8C 4AHCA 5ITZB 4UV8A 2LP7A 4NTXA 2CUGA 4F4LA 2LJ2A 3RYFA 1XL6A 5LXTA 3RYIB 4JI5B 3OW2U 1SQQH 2JEUA 2GSMB 2OIGA 1FKAO 5BY1A 5B1OA 1FYJA 2QSAA 1NS1A 1GN3A 5KA6A 3K57A 2HEPA 1N34O 2BSKB 4LR3A 3B77A 1E1RG 1WLEA 1JPXA 4LF6B 2ZE6A 4ICGA 4JI0B 1MNGA 2KG7A 3BY6A 2ITDC 4DR3O 3ABLC 2FTKA 3F7YC 3N2GB 2EULA 2FYUH 3KZIZ 3IC9A 3LUTB 1K4DC 1I08A 5KHKA 3D36A 2UXXA 2EINC 2EJ7A 3K5OA 3K59A 2RQ6A 2IJIA 1S76D 2A0LA 1K33A 3CCRV 4MVSA 4JI5O 2JGUA 1AJNA 1OCZB 1DLBA 1Q7YW 1E79G 2D3OW 4HBNA 2ZE5A 2OYQA 3JCZA 4J41A 1FXKB 5C8YB 2QTSA 1DK1A 3DXRB 4LF6O 3T1HO 4JI0O 3DSQA 2XASA 2VWJA 4GKJB 3TK1A 2K1EA 1BT8A 4GX5A 1N0JA 4Z1VA 3H1HH 1SA0B 1IZ3A 1I94B 1W2BU 4X88A 1ZL8B 2M7WA 1NJIW 1NZ6A 3JARB 4UB8Z 1DF4A 1QHTA 4JAAA 4FLWA 5EYPA 4YXWG 2QKCA 1H2SB 5KLVH 4R8CA 3AG4C 4I0XB 3ABTA 2OCCC 2FL4A 4KHPB 3O65A 3U0ZA 1Q81W 3RYHB 1V55C 2ATKC 1AI4A 3SYQA 3UT5A 1HW7A 1OCRB 3PJSK 4GKJO 4BAYA 5F2VO 4IHJB 3WB0A 2ODMA 1VQ8V 1AI6A 1T5EA 4JF3A 3AK3A 4DRXB 1AI5A 3H1LH 1BQ0A 1AI7A 1A32A 3SDLA 4F6RB 3APQA 5IWAO 5B5EZ 3HKBB 1MMMA 4KHPO 1FPOA 2UUCB 4JTAB 3CXHF 3ZMVA 2DYRB 1IBKO 4N23A 4FM0A 3QNEA 4ZOLB 5FNVA 1EFRG 4FJCC 5H6RA 1V54B 4TUYA 2X6BA 4LP8A 1S72V 2JJ1G 3CC7V 4H13B 4KL1A 3TJTA 2OTJV 2PY5A 2AGAA 2YEVB 5K1XA 1NVPD 2VRZA 3K9AA 1VF6C 4DR7B 1AJPA 3ETEA 4JI6B 3HKCA 3ZBHA 2JJ2G 1VQOV 1QVFU 3ABMC 4KP4A 1N4CA 3EFFK 4J9ZB 2F1MA 3SJBC 3D3IA 4TQFA 5LYJB 1NBMG 4RQFA 4TV9B 3ZRWB 4B3SB 1NVPB 4UFZA 5EBMC 2YXYA 4B7KA 4DV5B 4CH4A 4GX2A 2YXHA 4DR4B 4OPAA 2E76B 1SS3A 1XILA 5JQGA 4DR7O 1LR1A 4JI6O 1YSCA 1G8MA 1JMKC 2ETNA 4DW0A 3F7VC 1H8EG 2P67A 2VS0A 5CB4B 2Q68A 5LGTA 2QEXV 5IJ0B 4B7EA 3JD1A 3RVZA 4B3SO 3VQWA 5B1NA 1WJZA 1KP3A 2XAFA 1YZBA 3K03A 4PA6A 4CS4A 4WFAV 4B3MO 1WA8B 4HZ3A 1I0HA 5CBHA 1NKDA 1YIJV 3I55V 1COWG 3H01A 4DR4O 5ITZA 2PYLA 1VF5B 1AP6A 4QIWF 1HNWB 4ZHQA 4DV6B 4FLYA 5J2UB 1Q82W 3BRCA 3SPCA 3RYIA 4PA4A 5L3CA 1F23A 1G6UA 1L1FA 3JATB 2GUZB 4UCSA 4X20A 1MSWD 4CC5A 2CTQA 2QM4A 1OCZC 4LF4B 1M4UA 2R72A 2BSKA 5L3EA 2HP8A 2H3OA 2WLNA 2BOBC 3T1YO 1FXKC 1J95A 4KUMA 4MSWC 2MK3A 1XMOB 3N2GA 4JI3B 3AG2B 1VF7A 3W7SA 3CPWU 4UVAA 4LWSB 5LGUA 4RO2A 1PL0A 3UKMA 3SPGA 1QBZA 1HNWO 4P2ZA 1RSOB 1KECA 3RWRD 4DV6O 2R9AA 1QCEA 3R65A 3BAAA 5KA5A 3RGBA 2ZDIC 2E74B 1B04A 2B1IA 3BPZA 1PPJH 3L71H 3HR0A 4LF4O 3W7WA 1W59A 5KX5A 1PNMA 3OMNB 4DUYB 2E75B 1FAFA 5HFMA 5H9CA 3L72H 4TOIA 1RFYA 1XMOO 1X59A 4JI3O 3OTFA 1OCRC 1VQLV 4X8AA 4X64O 1W0KG 1U97A 3JYCA 2P7TC 3S3XA 3CC4V 5IJ9B 3AK1A 4PDRA 5LOVB 5B1AB 5JJJB 3JARA 1WN7A 3BCCH 3ZX6A 5LHGA 1MSDA 1SRYA 4I0XA 2Y48A 1AR4A 4NKGB 3CHXA 3SJQC 3LSQA 2DW4A 4MVUA 3CRMA 3W7TA 1N36B 4BW5A 3OUFA 3RYHA 4FM2A 1THZA 4FK5C 2DYRC 2XOKG 3F5TA 2XUMA 3H1IH 1O9GA 1S5HC 1V54C 3K5MA 4DK1A 2CTRA 2WA3A 1RM1B 4GYCB 2EINB 4H0LB 1N8RW 1PNLA 5CMUA 5AG2A 2HJFC 1M9NA 4GLXA 4QPKA 2YDEA 2BTQB 2Y4UA 2IU0A 4X65B 4F6RA 1N33O 3C3SA 1Q8IA 1MZEA 4Z1MG 3G80A 1ZUQA 4I55B 1XDCA 5IT9N 2Q0AA 3G4SV 1N36O 2Q67A 2QM8A 1KBHA 1K7DA 2LFSA 2QKSA 2P6JA 4ZOLA 3K3WA 1VIBA 1KP2A 3JD2A 1SQXH 2XAGA 1Q6HA 3KCYA 3E8BA 4L8JA 1H38A 5D5PA 3J7AU 1N32B 4UCTA 3CJHB 4I4TB 4CC6A 3H9VA 1TUBA 1HNXB 3UO3A 2KB1A 2HLDG 5KHGA 4JI2O 3AG4B 4UB6Z 5FLXN 2ZIMA 1P7BA 3OGCC 3CCSV 3IAYA 4U7OA 5LYJA 1Q86W 1V55B 2Z5UA 4TV9A 4WBNB 3QO8A 4NTYA 2F4VB 1RP3B 1QVGU 1AR5A 2GTAA 2CH7A 2JDIG 4X1KB 2ZNIA 1EN4A 3ETQA 3K58A 5FPRA 4O2AA 3FAVA 1ZWIC 3BA8A 1Y67A 2EIKB 1N32O 4DV1O 3UO2A 4DV2B 3CSXA 2PI5A 1VMGA 3RYCB 4GUNA 1DGSA 4PV1B 1L0LH 1FS0G 5LMUB 4WFEA 1HNXO 3CMAV 2QJ1A 1R1BA 3SPIA 2IW5A 3C3TA 2VQFB 1P84F 4PA3A 2JRIA 3I56V 4UCUA 4MTFA 2PGGA 4I7ZB 2RNBA 2F43G 4O4LB 3ZS8C 5EK0A 4KFMA 2DOSA 4X62O 2DN9A 1WA8A 1BHAA 3RW0A 4W4LA 5BMVB 3AG2C 4FIPC 4CH3A 4EFBA 3ZIAG 4H44B 1YI2V 3NXSA 4DV2O 5J2UA 4UCVA 4QJFB 2BCCH 1NT2B 1YTFD 5LMUO 4PD4F 4X1IA 1SQGA 2P90A 1DF5A 4DO2A 4JZ2A 2XT9A 1GTOA 4DV4B 3AK2A 4O2BB 4LF7B 1ZSPA 2EX3A 1N34B 1Z5VA 4PDMA 4UUJC 5A9GA 4NR1A 4E2LA 3BA9A 2ARHA 2W0FC 4U3JB 1Y4MA 5DEDA 4G28B 1R3JC 3BEHA 4DV7B 2PF4E 1Y74B 4MVQA 4B3RB 4CZZA 1Q6IA 3IGAC 4CS3A 3M99B 3HB3B 1DTOA 5EBLC 1MA1A 1RSOA 3EXAA 3CS5A 1D5AA 3HKDB 2JS3A 2WLLB 3VQXA 5B1AC 5B1BC 3CCEV 2UXDB 1SZXA 2QGNA 4FZ1A 1JX9A 4LBEC 3U11A 1WP7A 1XNQO 4DV4O 2DQ0A 4LF7O 5DN6G 4BIZA 5BZBA 1I7FA 4MVOA 3JAWA 3B8MA 3D3QA 3ETGA 3T1HB 1LUVA 1OHHG 3G67A 5GTIZ 4PHZA 1S0VA 4O4HB 4JI1B 4JGSA 4DV7O 2DWDC 4WFFA 4B3RO 1VQNV 5IJ9A 4GKKB 1RM1C 2WWWA 5KHHA 1EN6A 4EKWA 3CP1A 3ICXA 2UXDO 4LFBB 3CX5F 4FLXA 3E8HA 2L35A 2YI9A 3LSUA 3M7MX 2CTWA 3T1CA 4DR1B 1P4RA 1XMQO 4PJ0Z 3IC7A 5J2TB 3A0BZ 2FB5A 1IBMB 1GKFA 2QWNB 4AQYB 4JI1O 4BIUA 1I5YA 2Q9LA 2CK3G 2CE4A 2IJHA 1KQSU 4O4IB 4XBFA 3SYAA 4GKKO 1KMIZ 5H5NA 1J5EB 1H2LA 3A0HZ 3FYEB 5LL6Y 4DK0A 2BTQA 4I5SA 3K5NA 3Q4HB 1SC5B 2XHBA 4LFBO 1R3IC 2KKWA 2LGWA 1IVSA 2Q73A 5IWAB 1MZFA 2LW1A 4I55A 5IDJA 3FFQA 1ZAUA 4Q6GA 3BABA 2RDCA 4DR1O 2Q7EA 1IBKB 4EB6B 2A06H 1AP5A 4QE7A 1F4NA 5JVDA 3A2FA 1IBMO 4AQYO 1UPGA 1K34A 4FZ0A 3GWKC 2ZXWC 1QU7A 1BGYH 3CJHA 2EIKC 4X66O 1WPBA 1J5EO 2A79B 3ZMUA 4JAUA 4BIOA 3E89A 4D6TH 2EJRA 2B9ZA 1GN2A 3B40A 1NTMH 4WFHA 4WBNA 4G27B 1JFFB 4LC1A 3ZJZA 3CCJV 3JALB 3OTOO 1G4YB 1O9HA 3E35A 3K5LA 4XDJA 2PZSA 3F5WC 5GTHZ 5CA0A 1IBLB 2QWOB 2E5LB 5E79Z 3RN4A 4WCEV 3RYCA 3WFVA 4LCUC 3K08A 2K9PA 1HWYA 4WFGA 2F23A 4DUZO 4TV8A 1HDJA 5FL7G 3CCLV 1JJOA 2NNUA 4RAIA 1YCIA 3L70H 2G38A 3UQ8A 4NB5A 1VQ9V 4BWAA 4O4LA 4PDLA 3J81N 3LDDA 4IGGA 4O4JB 1Z2GA 3OT7A 2UUBO 4EEQA 4B3MB 2X6CA 4JI7O 5IYZB 2LFRA 2PYJA 1GO3F 4FPPA 1B06A 4Z2WA 1IBLO 1VF6A 2B1GA 4F6EA 2E5LO 2XAHA 3B09A 5KUKA 1B3QA 1QR8A 1FXVA 1XQ8A 2QKAA 1KB9F 1CEZA 4FFBA 1PL4A 3JAMN 3WB1A 1GRJA 1XI1A 2PTMA 1WB8A 3T1YB 3ZHQA 1VQ5V 1H2GA 4OGQB 3JD3A 4U3JA 4MS2A 4YIOA 3X2QC 2UXNA 3RBZA 2QR4A 3OE7G 1Y74A 1NR7A 4LH6A 1JCHA 1K5QA 3ASOC 3H1KH 3RT3C 5LA6B 3CRAA 1XREA 2ZQMA 3ML0A 5GONB 3JCUZ 4JTDB 1SKVA 2V1DA 2BE3A 1BCCH 2WLHA 2XTAA 3BVOA 2QA4V 2KQXA 4DR5O 4B08A 5H2FZ 3AEIA 1MG1A 4PDVA 1JVMA 5IYCO 1VQ4V 4IIJB 2OWOA 4O4HA 4YHHO 3FKSG 1WP8A 5JWPA 1YDXA 3WG7B 1SQFA 1UFIA 3LNMB 4X64B 4A5UB 3ZMTA 1NTKH 4DR2B 2Y69B 2O57A 1V9PA 5BXZA 5EIBC 4K0KO 2GV9A 3ASNC 3OEHG 2JIZG 2ZE7A 4NXMB 3TGUH 2UUAB 1JJ2U 3G6EV 5IY5C 4R6ZA 1HR0B 3RFRA 1FXKA 5C8YA 5B66Z 1GK9A 3DXRA 5J2TA 2CGNA 3RYFB 4JV5O 4DV0O 1N0NA 5LMNO 2ZCEA 1SA0A 3EVKA 4O4IA 4XDLA 4DR2O 1US6A 2F66C 3T4ZA 2QWRB 4ZI7B 4J80A 1ZL8A 2XAQA 5B1BB 3MAQA 2VWKA 2IH1C 2Q7GA 2ZDIA 4MTXA 4NXMO 1N33B 2ZD9A 1K4CC 4JTCB 3JASB 4AI8A 5CA1B 3E22B 2UUAO 2EBOA 1M57C 2WLIB 2VQEB 4DYLA 1VP7A 2H8PC 1HR0O 3CCMV 2C2AA 1FJGB 2DE0X 1HP8A 5C93A 3JD0A 2GDSA 3K04A 3B2EE 1QNMA 4IHJA 5LBQA 1QLNA 1SQBH 2Q7HA 1EN5A 4JYCA 4RWUA 4DRXA 2Y0PA 1GAXA 3CXCU 4JI2B 5BR8B 1KD1W 4GX0A 4U3FH 3BFRA 3HKBA 2EILB 4LH7A 4H37A 2VQEO 1JFFA 2RMKB 1FFTB 2Y0IA 4TWKA 2OCHA 1FJGO 2WLKA 2NLJC 3BHPA 2QTOA 2ZKOA 1VARA 1ZX3A 5KUMA 5EYPB 1AB3A 5KHIA 3FB7C 3MHHC 1KKCA 2XNDG 3OR6C 3GB7C 5DM6V 4DV1B 2YEVA 4D7SA 1M56C 2OIEA 3OAAG 1PKXA 4LFCB 4YJ3B 5JCOC 1EZJA 3LDEA 3UT5B 2EZPA 4QPJA 4IT5A 2IJKA 5BR8O 4JYAB 3OR7C 3E86A 1GM7A 1R6TA 1L8DA 5L3BA 1K92A 4FLZA 5JJNB 3E8GA 2JGDB 3ZRWA 1BMFG 4LF5B 4O4JA 4CS2A 2UXBO 4HAMA 4NYKA 4FLUA 4X62B 2ZNJA 5IYZA 2WLMA 2ZXWB 3A0RA 1IX9A 5KMGB 1YF2A 3P3NA 5A2QN 3U10A 3N2KB 4GX1A 1KU9A 3AG7A 2AHYA 1TVKB 4LFCO 1LNQA 1PM9A 1R3LC 2ITCC 4UCOA 2NN4A 2HVKC 4JYAO 5EC2C 3CCQV 5CB4A 1S5JA 3ZHTA 4FLVA 4JYYA 4PI2A 1UJWB 5IJ0A 2DYSB 2DWEC 3J80N 4GCZA 3ABKB 1AILA 2HVJC 4JI4B 1IURA 4LF5O 2D2CB 4TT3G 4YY3B 1JQ0A 5DECA 2P5OA 2ZE8A 3P32A 1ZLZA 3WG7C 4MW8A 5FPOA 4DXWA 2EIMB 4QNHB 4FMTA 2Y69C 5LA6A 1X4TA 4LNUB 1QR9A 2ZIOA 3JATA 2E3CA 1XOUA 4L87A 3ZMZA 2GUZA 4MVZA 2ZINA 2YIBD 1XNQB 1TAEA 4RUEA 3JAKB 1YJWV 3SJAC 4JI4O 5KAIZ 2EIJB 4X9QA 4YJ2B 1JA8A 1IXMA 1NU1H 4YY3O 1EM1A 1IXBA 3B4SA 4LWSA 4K8ZA 3W7XA 1KUQA 5HFLA 1VQKV 5L3DA 4UXNA 4JASA 2YC0A 2DJVA 2ZR3A 3QO5A 1R3KC 2P4VA 3TXSA 2YXLA 4NTWA 2YICA 2PI4A 2UXCB 4P9PA 2P22C 4CBCA 3L73H 3ZRVA 2F93B 5KAFZ 1YITV 1XNRB 2FMLA 4XDKA 1VQMV 4I50B 5JH7B 1XMQB 2YI8A 2HHHB 4ZHQB 3X2QB 4X89A 3D36C 2QDOA 4LF8B 2ADPA 3WB2A 3FB6C 3ZEDA 1EBOA 3JSLA 2YIDA 3ASOB 1FXHA 1Q6UA 3UM7A 2RJZA 4HNAB 1Y76B 4X20B 4ZI7A 4JPRA 5LOVA 3P3PA 2Z0AA 1G1XB 5EC1C 5LP6B 1SQPH 2R9RB 3DTUB 4IYIA 4MTGA 3JASA 1BHBA 5CA1A 3E22A 4J11A 1P49A 2UXCO 1MOFA 2WLIA 5EIBD 1VEWA 4K35A 5EZYB 5J9PC 2EILC 1OV9A 1QQCA 1XNRO 5GW7A 2IU3A 3KKYA 2HHHO 4H33A 4IL6Z 1YJNV 3SPJA 4LF8O 1OCOB 2QWPB 3QO7A 1F7YA 3OUSA 1W0JG 3T2MA 4JYBA 1H8HG 4QGPA 3ASNB 4X66B 1NQTA 5KX5B 3CWBH 1AVMA 3OGIB 4IYHA 2V7QG 2WA4A 2HFEC 3O9OA 5CA3A 3OFNG 1JOYA 1SERA 5IY5B 2XAJA 3CMEV 1VQPV 4FLTA 3OD4A 1XHZA 5LHHA 3QTCA 3L9DA 4MT8A 1LUWA 3OTOB 1SZTA 3FYIB 4Q20A 1OZ0A 5CBFA 5EBWC 1XUQA 4J7ZA 1HNZB 4DV3B 4J42A 3DC5A 4J7KA 3K79A 4I4TA 4RQEA 1GN6A 4W4KA 4YJ3A 1NH2D 3ABUA 2OT5A 3AG3C 1AJQA 3STLC 4DUZB 1M57B 1VQ6V 2WLJA 2X7RB 4ZBMA 1I94O 1S5LZ 2ZM6B 2JGDA 3CCVV 4JI8B 4HYOA 3IJ4A 2GBOA 5KHJA 2MW2B 3RVYA 5CBGA 2DYSC 3ABKC 1CPYA 4X1KA 1NH2B 2UUBB 2HG5C 4JI7B 3SPHA 3TXQA 1HNZO 4DV3O 3VOUA 1OJHA 5KMGA 1M1KW 3CRCA 3A8TA 3N2KA 3ZRXA 1TVKA 2EIMC 4DR6B 2NR5A 2V4DA 1L0NH 1JR9A 1K73W 2PUSA 2L6LA 2H94A 3SYCA 4JAVA 1PP9H 4WF9V 2YUAA 1M93A 1BS3A 2ZM6O 1BSMA 5L3GA 4JI8O 1OCCC 4OXSA 1XHXA 3STZC 4KXRA 1TUBB 4FM1A 1K3EA 2Q6AA 2EIJC 3CRRA 1NR1A 2YIAA 5BMVA 4PI0A 2R70A 1M56B 4G2KA 2AXTZ 3K0GA 1EZVH 2Q5ZA 3LSSA 1S77D 2UUCO 4LNUA 1GN4A 4DR6O 2EZOA 5IYDO 5H6QA 1XL4A 3HKEB 3K06A 2CH7B 2P06A 1B6QA 3FX7A 4O2BA 4R50A 4O2AB 3CB2A 4DR5B 1BE3H 3FAVB 4MTOA 1AROP 3JAKA 1D2DA 1RPRA 4RUFA 3MDSA 3G71V 3HPLC 4ASUG 4YJ2A 3OEEG 4R7CA 3ZRSA 2N05A 3CYOA 4YHHB 4QE9A 1H2KA 4OX9B 3CD6V 2QWQB 3AG1B 4X1YB 1FFXB 2YIBA 4LF9B 4GT1A 1NTZH 3HKDA 2WLLA 3P30A 4K0KB 2ZT9B 4MVRA 4DV5O 5LP6C 1ROPA 1PV0A 2OTLV 1S3JA 1GM9A 3OMIB 4K3AA 1QLEB 4LFAB 4YIPA 3QG5A 4I50A 5JH7A 4D7TA 2GTSA 1GMGA 1TGOA 2AZ0A 4JV5B 1Q5OA 3GWOA 4DV0B 2IM9A 2Z3YA 2KSDA 2W6JG 3NR7A 4OX9O 1R6NA 5LMNB 1CXZB 4ZKIA 4X1IB 5B3SB 5LGNA 2CTPA 3QF7A 1OCOC 4HNAA 1Y76A 2QM7A 4WFBV 1BZKA 4J10A 4GZRB 4LF9O 2AZ2A 1P7GA 3W7UA 3GVMA 3VQVA 1NI8A 2W0XA 5LP6A 3M8AA 1AR1B 3G6BA 2AW9A 3MD0A 2A9HA 3ZHSA
chains in the Genus database with same CATH topology
4J7JA 2G38A 4W4KA 4J7KA 4IYIA 4KXRA 4J10A 4J41A 4W4LA 4J42A 4IYHA 4J11A 3FX7A 2GTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7J A;  2G38 A;  4W4K A;  4J7K A;  4IYI A;  4KXR A;  4J10 A;  4J41 A;  4W4L A;  4J42 A;  4IYH A;  4J11 A;  3FX7 A;  2GTS A; 
#chains in the Genus database with same CATH topology
 1RPO A;  3APO A;  1ORQ C;  5EZY A;  2UU9 B;  4LFA O;  4B3T B;  1F51 A;  1M90 W;  5E1A C;  2WAM A;  5LXT B;  1URF A;  5IE9 A;  3EHB B;  2N04 A;  2M6Y A;  3ZHV A;  5L3F A;  3JAW B;  3K9S A;  1YXB A;  3WU2 Z;  3Q4H A;  1Q3E A;  2CGO A;  2KG7 B;  2LO1 A;  3OM3 B;  4UV9 A;  2UU9 O;  4C7U A;  4B3T O;  1Q90 D;  1ZTE A;  1WPX A;  4EB6 A;  1CP9 A;  1K8A W;  5JJE B;  3IFX A;  1BQZ A;  3ZHR A;  1SQV H;  2QE7 G;  2ADQ B;  2IJJ A;  4J9Y B;  4NVP A;  3ZHU A;  2Q0O C;  2ZR2 A;  4MW3 A;  2JK5 C;  3OMA B;  4E4E A;  3SJC C;  2JVD A;  3ABL B;  4DUY O;  4FVM A;  3DGE A;  1MAB G;  2IBZ H;  1YEW A;  2ILM A;  1K9M W;  2LQT A;  4NXN B;  1Y66 A;  1KYO F;  2LGQ A;  2A7W A;  2HJD A;  3K0D A;  2UXB B;  4PEL A;  3JAL A;  5LHI A;  2CDY A;  2DMX A;  1SET A;  1H2N A;  3DC6 A;  2BTO A;  3E8F A;  3R66 A;  2GHY A;  4FFK A;  3KG2 A;  2HR3 A;  2F95 B;  1K97 A;  4I9W A;  2AHZ A;  1YHQ V;  4K8X A;  1SES A;  4CH6 A;  1KC8 W;  3ZCC A;  4PA9 A;  3SYO A;  3JSN A;  1I5X A;  2RN9 A;  1U96 A;  3VBB A;  5JVD B;  3CC2 V;  4UVC A;  4U7N A;  3T4D A;  1Q43 A;  3ZN1 A;  3S3W A;  1E1Q G;  4NXN O;  1R73 A;  2Q8V A;  5K1P A;  4CH5 A;  1GM8 A;  2Y4T A;  2Q4P A;  3SGI A;  4EFE A;  1KKD A;  1XEQ A;  4UCR A;  3H1J H;  4P9O A;  4UVB A;  4X65 O;  1WB7 A;  2OCC B;  4TSF G;  3ETD A;  4PA7 A;  4OPH A;  2JEX A;  2DQ3 A;  3AG1 C;  3TET A;  2WPD G;  5JCO A;  3ZMS A;  3CEI A;  3VQY A;  3C90 A;  5D5Q A;  1F4M A;  1BL8 A;  1FD9 A;  3AG3 B;  4AIL C;  3HKE A;  2B5U A;  5FNV B;  4TUY B;  3LDC A;  1ENV A;  2WSS G;  2R9I A;  2FKX A;  1K5S A;  5CA0 B;  1D5N A;  1QLE C;  3I5D A;  2YSU B;  2LW7 A;  3CCU V;  4I9Q A;  2A3Q A;  3TCU A;  3QVN A;  1TA8 A;  1M5I A;  2W6I G;  3MHS C;  1TUE B;  3HKC B;  2Q69 A;  3SR2 C;  1R6K A;  5CN0 A;  1PNK A;  4TV8 B;  4X1Y A;  1FFX A;  3FD9 A;  5TIS Z;  5B3S C;  2X0L A;  3B8N A;  3N27 A;  4TQD A;  2F4V O;  1H2M A;  4MVM A;  3PN1 A;  1YJ9 V;  5GON A;  3CE2 A;  1Y6X A;  1GH6 A;  4P30 A;  4DW1 A;  3E83 A;  2IH3 C;  1OCC B;  4ZIB A;  4ABM A;  1PD3 A;  4JZG A;  2N74 A;  3CRQ A;  4IIJ A;  3SYP A;  5JQG B;  1YVW A;  3FB5 C;  1SF9 A;  1Z5W A;  4N21 A;  2YS8 A;  3E2E A;  3THO A;  2HKO A;  2VQF O;  1WAZ A;  3LNN A;  3ABM B;  4BR6 A;  2JS5 A;  4FFB B;  3JD4 A;  3L74 H;  1VQ7 V;  3D8C A;  2X6A A;  1XBL A;  2BOC C;  3UCS C;  3L75 H;  5IYB O;  1IDS A;  4BW9 A;  3KCX A;  2P4K A;  4DR3 B;  2CAZ C;  4J7J A;  1YTF B;  2RCV A;  1WNS A;  3ZN0 A;  3FB8 C;  4AHC A;  5ITZ B;  4UV8 A;  2LP7 A;  4NTX A;  2CUG A;  4F4L A;  2LJ2 A;  3RYF A;  1XL6 A;  5LXT A;  3RYI B;  4JI5 B;  3OW2 U;  1SQQ H;  2JEU A;  2GSM B;  2OIG A;  1FKA O;  5BY1 A;  5B1O A;  1FYJ A;  2QSA A;  1NS1 A;  1GN3 A;  5KA6 A;  3K57 A;  2HEP A;  1N34 O;  2BSK B;  4LR3 A;  3B77 A;  1E1R G;  1WLE A;  1JPX A;  4LF6 B;  2ZE6 A;  4ICG A;  4JI0 B;  1MNG A;  2KG7 A;  3BY6 A;  2ITD C;  4DR3 O;  3ABL C;  2FTK A;  3F7Y C;  3N2G B;  2EUL A;  2FYU H;  3KZI Z;  3IC9 A;  3LUT B;  1K4D C;  1I08 A;  5KHK A;  3D36 A;  2UXX A;  2EIN C;  2EJ7 A;  3K5O A;  3K59 A;  2RQ6 A;  2IJI A;  1S76 D;  2A0L A;  1K33 A;  3CCR V;  4MVS A;  4JI5 O;  2JGU A;  1AJN A;  1OCZ B;  1DLB A;  1Q7Y W;  1E79 G;  2D3O W;  4HBN A;  2ZE5 A;  2OYQ A;  3JCZ A;  4J41 A;  1FXK B;  5C8Y B;  2QTS A;  1DK1 A;  3DXR B;  4LF6 O;  3T1H O;  4JI0 O;  3DSQ A;  2XAS A;  2VWJ A;  4GKJ B;  3TK1 A;  2K1E A;  1BT8 A;  4GX5 A;  1N0J A;  4Z1V A;  3H1H H;  1SA0 B;  1IZ3 A;  1I94 B;  1W2B U;  4X88 A;  1ZL8 B;  2M7W A;  1NJI W;  1NZ6 A;  3JAR B;  4UB8 Z;  1DF4 A;  1QHT A;  4JAA A;  4FLW A;  5EYP A;  4YXW G;  2QKC A;  1H2S B;  5KLV H;  4R8C A;  3AG4 C;  4I0X B;  3ABT A;  2OCC C;  2FL4 A;  4KHP B;  3O65 A;  3U0Z A;  1Q81 W;  3RYH B;  1V55 C;  2ATK C;  1AI4 A;  3SYQ A;  3UT5 A;  1HW7 A;  1OCR B;  3PJS K;  4GKJ O;  4BAY A;  5F2V O;  4IHJ B;  3WB0 A;  2ODM A;  1VQ8 V;  1AI6 A;  1T5E A;  4JF3 A;  3AK3 A;  4DRX B;  1AI5 A;  3H1L H;  1BQ0 A;  1AI7 A;  1A32 A;  3SDL A;  4F6R B;  3APQ A;  5IWA O;  5B5E Z;  3HKB B;  1MMM A;  4KHP O;  1FPO A;  2UUC B;  4JTA B;  3CXH F;  3ZMV A;  2DYR B;  1IBK O;  4N23 A;  4FM0 A;  3QNE A;  4ZOL B;  5FNV A;  1EFR G;  4FJC C;  5H6R A;  1V54 B;  4TUY A;  2X6B A;  4LP8 A;  1S72 V;  2JJ1 G;  3CC7 V;  4H13 B;  4KL1 A;  3TJT A;  2OTJ V;  2PY5 A;  2AGA A;  2YEV B;  5K1X A;  1NVP D;  2VRZ A;  3K9A A;  1VF6 C;  4DR7 B;  1AJP A;  3ETE A;  4JI6 B;  3HKC A;  3ZBH A;  2JJ2 G;  1VQO V;  1QVF U;  3ABM C;  4KP4 A;  1N4C A;  3EFF K;  4J9Z B;  2F1M A;  3SJB C;  3D3I A;  4TQF A;  5LYJ B;  1NBM G;  4RQF A;  4TV9 B;  3ZRW B;  4B3S B;  1NVP B;  4UFZ A;  5EBM C;  2YXY A;  4B7K A;  4DV5 B;  4CH4 A;  4GX2 A;  2YXH A;  4DR4 B;  4OPA A;  2E76 B;  1SS3 A;  1XIL A;  5JQG A;  4DR7 O;  1LR1 A;  4JI6 O;  1YSC A;  1G8M A;  1JMK C;  2ETN A;  4DW0 A;  3F7V C;  1H8E G;  2P67 A;  2VS0 A;  5CB4 B;  2Q68 A;  5LGT A;  2QEX V;  5IJ0 B;  4B7E A;  3JD1 A;  3RVZ A;  4B3S O;  3VQW A;  5B1N A;  1WJZ A;  1KP3 A;  2XAF A;  1YZB A;  3K03 A;  4PA6 A;  4CS4 A;  4WFA V;  4B3M O;  1WA8 B;  4HZ3 A;  1I0H A;  5CBH A;  1NKD A;  1YIJ V;  3I55 V;  1COW G;  3H01 A;  4DR4 O;  5ITZ A;  2PYL A;  1VF5 B;  1AP6 A;  4QIW F;  1HNW B;  4ZHQ A;  4DV6 B;  4FLY A;  5J2U B;  1Q82 W;  3BRC A;  3SPC A;  3RYI A;  4PA4 A;  5L3C A;  1F23 A;  1G6U A;  1L1F A;  3JAT B;  2GUZ B;  4UCS A;  4X20 A;  1MSW D;  4CC5 A;  2CTQ A;  2QM4 A;  1OCZ C;  4LF4 B;  1M4U A;  2R72 A;  2BSK A;  5L3E A;  2HP8 A;  2H3O A;  2WLN A;  2BOB C;  3T1Y O;  1FXK C;  1J95 A;  4KUM A;  4MSW C;  2MK3 A;  1XMO B;  3N2G A;  4JI3 B;  3AG2 B;  1VF7 A;  3W7S A;  3CPW U;  4UVA A;  4LWS B;  5LGU A;  4RO2 A;  1PL0 A;  3UKM A;  3SPG A;  1QBZ A;  1HNW O;  4P2Z A;  1RSO B;  1KEC A;  3RWR D;  4DV6 O;  2R9A A;  1QCE A;  3R65 A;  3BAA A;  5KA5 A;  3RGB A;  2ZDI C;  2E74 B;  1B04 A;  2B1I A;  3BPZ A;  1PPJ H;  3L71 H;  3HR0 A;  4LF4 O;  3W7W A;  1W59 A;  5KX5 A;  1PNM A;  3OMN B;  4DUY B;  2E75 B;  1FAF A;  5HFM A;  5H9C A;  3L72 H;  4TOI A;  1RFY A;  1XMO O;  1X59 A;  4JI3 O;  3OTF A;  1OCR C;  1VQL V;  4X8A A;  4X64 O;  1W0K G;  1U97 A;  3JYC A;  2P7T C;  3S3X A;  3CC4 V;  5IJ9 B;  3AK1 A;  4PDR A;  5LOV B;  5B1A B;  5JJJ B;  3JAR A;  1WN7 A;  3BCC H;  3ZX6 A;  5LHG A;  1MSD A;  1SRY A;  4I0X A;  2Y48 A;  1AR4 A;  4NKG B;  3CHX A;  3SJQ C;  3LSQ A;  2DW4 A;  4MVU A;  3CRM A;  3W7T A;  1N36 B;  4BW5 A;  3OUF A;  3RYH A;  4FM2 A;  1THZ A;  4FK5 C;  2DYR C;  2XOK G;  3F5T A;  2XUM A;  3H1I H;  1O9G A;  1S5H C;  1V54 C;  3K5M A;  4DK1 A;  2CTR A;  2WA3 A;  1RM1 B;  4GYC B;  2EIN B;  4H0L B;  1N8R W;  1PNL A;  5CMU A;  5AG2 A;  2HJF C;  1M9N A;  4GLX A;  4QPK A;  2YDE A;  2BTQ B;  2Y4U A;  2IU0 A;  4X65 B;  4F6R A;  1N33 O;  3C3S A;  1Q8I A;  1MZE A;  4Z1M G;  3G80 A;  1ZUQ A;  4I55 B;  1XDC A;  5IT9 N;  2Q0A A;  3G4S V;  1N36 O;  2Q67 A;  2QM8 A;  1KBH A;  1K7D A;  2LFS A;  2QKS A;  2P6J A;  4ZOL A;  3K3W A;  1VIB A;  1KP2 A;  3JD2 A;  1SQX H;  2XAG A;  1Q6H A;  3KCY A;  3E8B A;  4L8J A;  1H38 A;  5D5P A;  3J7A U;  1N32 B;  4UCT A;  3CJH B;  4I4T B;  4CC6 A;  3H9V A;  1TUB A;  1HNX B;  3UO3 A;  2KB1 A;  2HLD G;  5KHG A;  4JI2 O;  3AG4 B;  4UB6 Z;  5FLX N;  2ZIM A;  1P7B A;  3OGC C;  3CCS V;  3IAY A;  4U7O A;  5LYJ A;  1Q86 W;  1V55 B;  2Z5U A;  4TV9 A;  4WBN B;  3QO8 A;  4NTY A;  2F4V B;  1RP3 B;  1QVG U;  1AR5 A;  2GTA A;  2CH7 A;  2JDI G;  4X1K B;  2ZNI A;  1EN4 A;  3ETQ A;  3K58 A;  5FPR A;  4O2A A;  3FAV A;  1ZWI C;  3BA8 A;  1Y67 A;  2EIK B;  1N32 O;  4DV1 O;  3UO2 A;  4DV2 B;  3CSX A;  2PI5 A;  1VMG A;  3RYC B;  4GUN A;  1DGS A;  4PV1 B;  1L0L H;  1FS0 G;  5LMU B;  4WFE A;  1HNX O;  3CMA V;  2QJ1 A;  1R1B A;  3SPI A;  2IW5 A;  3C3T A;  2VQF B;  1P84 F;  4PA3 A;  2JRI A;  3I56 V;  4UCU A;  4MTF A;  2PGG A;  4I7Z B;  2RNB A;  2F43 G;  4O4L B;  3ZS8 C;  5EK0 A;  4KFM A;  2DOS A;  4X62 O;  2DN9 A;  1WA8 A;  1BHA A;  3RW0 A;  4W4L A;  5BMV B;  3AG2 C;  4FIP C;  4CH3 A;  4EFB A;  3ZIA G;  4H44 B;  1YI2 V;  3NXS A;  4DV2 O;  5J2U A;  4UCV A;  4QJF B;  2BCC H;  1NT2 B;  1YTF D;  5LMU O;  4PD4 F;  4X1I A;  1SQG A;  2P90 A;  1DF5 A;  4DO2 A;  4JZ2 A;  2XT9 A;  1GTO A;  4DV4 B;  3AK2 A;  4O2B B;  4LF7 B;  1ZSP A;  2EX3 A;  1N34 B;  1Z5V A;  4PDM A;  4UUJ C;  5A9G A;  4NR1 A;  4E2L A;  3BA9 A;  2ARH A;  2W0F C;  4U3J B;  1Y4M A;  5DED A;  4G28 B;  1R3J C;  3BEH A;  4DV7 B;  2PF4 E;  1Y74 B;  4MVQ A;  4B3R B;  4CZZ A;  1Q6I A;  3IGA C;  4CS3 A;  3M99 B;  3HB3 B;  1DTO A;  5EBL C;  1MA1 A;  1RSO A;  3EXA A;  3CS5 A;  1D5A A;  3HKD B;  2JS3 A;  2WLL B;  3VQX A;  5B1A C;  5B1B C;  3CCE V;  2UXD B;  1SZX A;  2QGN A;  4FZ1 A;  1JX9 A;  4LBE C;  3U11 A;  1WP7 A;  1XNQ O;  4DV4 O;  2DQ0 A;  4LF7 O;  5DN6 G;  4BIZ A;  5BZB A;  1I7F A;  4MVO A;  3JAW A;  3B8M A;  3D3Q A;  3ETG A;  3T1H B;  1LUV A;  1OHH G;  3G67 A;  5GTI Z;  4PHZ A;  1S0V A;  4O4H B;  4JI1 B;  4JGS A;  4DV7 O;  2DWD C;  4WFF A;  4B3R O;  1VQN V;  5IJ9 A;  4GKK B;  1RM1 C;  2WWW A;  5KHH A;  1EN6 A;  4EKW A;  3CP1 A;  3ICX A;  2UXD O;  4LFB B;  3CX5 F;  4FLX A;  3E8H A;  2L35 A;  2YI9 A;  3LSU A;  3M7M X;  2CTW A;  3T1C A;  4DR1 B;  1P4R A;  1XMQ O;  4PJ0 Z;  3IC7 A;  5J2T B;  3A0B Z;  2FB5 A;  1IBM B;  1GKF A;  2QWN B;  4AQY B;  4JI1 O;  4BIU A;  1I5Y A;  2Q9L A;  2CK3 G;  2CE4 A;  2IJH A;  1KQS U;  4O4I B;  4XBF A;  3SYA A;  4GKK O;  1KMI Z;  5H5N A;  1J5E B;  1H2L A;  3A0H Z;  3FYE B;  5LL6 Y;  4DK0 A;  2BTQ A;  4I5S A;  3K5N A;  3Q4H B;  1SC5 B;  2XHB A;  4LFB O;  1R3I C;  2KKW A;  2LGW A;  1IVS A;  2Q73 A;  5IWA B;  1MZF A;  2LW1 A;  4I55 A;  5IDJ A;  3FFQ A;  1ZAU A;  4Q6G A;  3BAB A;  2RDC A;  4DR1 O;  2Q7E A;  1IBK B;  4EB6 B;  2A06 H;  1AP5 A;  4QE7 A;  1F4N A;  5JVD A;  3A2F A;  1IBM O;  4AQY O;  1UPG A;  1K34 A;  4FZ0 A;  3GWK C;  2ZXW C;  1QU7 A;  1BGY H;  3CJH A;  2EIK C;  4X66 O;  1WPB A;  1J5E O;  2A79 B;  3ZMU A;  4JAU A;  4BIO A;  3E89 A;  4D6T H;  2EJR A;  2B9Z A;  1GN2 A;  3B40 A;  1NTM H;  4WFH A;  4WBN A;  4G27 B;  1JFF B;  4LC1 A;  3ZJZ A;  3CCJ V;  3JAL B;  3OTO O;  1G4Y B;  1O9H A;  3E35 A;  3K5L A;  4XDJ A;  2PZS A;  3F5W C;  5GTH Z;  5CA0 A;  1IBL B;  2QWO B;  2E5L B;  5E79 Z;  3RN4 A;  4WCE V;  3RYC A;  3WFV A;  4LCU C;  3K08 A;  2K9P A;  1HWY A;  4WFG A;  2F23 A;  4DUZ O;  4TV8 A;  1HDJ A;  5FL7 G;  3CCL V;  1JJO A;  2NNU A;  4RAI A;  1YCI A;  3L70 H;  2G38 A;  3UQ8 A;  4NB5 A;  1VQ9 V;  4BWA A;  4O4L A;  4PDL A;  3J81 N;  3LDD A;  4IGG A;  4O4J B;  1Z2G A;  3OT7 A;  2UUB O;  4EEQ A;  4B3M B;  2X6C A;  4JI7 O;  5IYZ B;  2LFR A;  2PYJ A;  1GO3 F;  4FPP A;  1B06 A;  4Z2W A;  1IBL O;  1VF6 A;  2B1G A;  4F6E A;  2E5L O;  2XAH A;  3B09 A;  5KUK A;  1B3Q A;  1QR8 A;  1FXV A;  1XQ8 A;  2QKA A;  1KB9 F;  1CEZ A;  4FFB A;  1PL4 A;  3JAM N;  3WB1 A;  1GRJ A;  1XI1 A;  2PTM A;  1WB8 A;  3T1Y B;  3ZHQ A;  1VQ5 V;  1H2G A;  4OGQ B;  3JD3 A;  4U3J A;  4MS2 A;  4YIO A;  3X2Q C;  2UXN A;  3RBZ A;  2QR4 A;  3OE7 G;  1Y74 A;  1NR7 A;  4LH6 A;  1JCH A;  1K5Q A;  3ASO C;  3H1K H;  3RT3 C;  5LA6 B;  3CRA A;  1XRE A;  2ZQM A;  3ML0 A;  5GON B;  3JCU Z;  4JTD B;  1SKV A;  2V1D A;  2BE3 A;  1BCC H;  2WLH A;  2XTA A;  3BVO A;  2QA4 V;  2KQX A;  4DR5 O;  4B08 A;  5H2F Z;  3AEI A;  1MG1 A;  4PDV A;  1JVM A;  5IYC O;  1VQ4 V;  4IIJ B;  2OWO A;  4O4H A;  4YHH O;  3FKS G;  1WP8 A;  5JWP A;  1YDX A;  3WG7 B;  1SQF A;  1UFI A;  3LNM B;  4X64 B;  4A5U B;  3ZMT A;  1NTK H;  4DR2 B;  2Y69 B;  2O57 A;  1V9P A;  5BXZ A;  5EIB C;  4K0K O;  2GV9 A;  3ASN C;  3OEH G;  2JIZ G;  2ZE7 A;  4NXM B;  3TGU H;  2UUA B;  1JJ2 U;  3G6E V;  5IY5 C;  4R6Z A;  1HR0 B;  3RFR A;  1FXK A;  5C8Y A;  5B66 Z;  1GK9 A;  3DXR A;  5J2T A;  2CGN A;  3RYF B;  4JV5 O;  4DV0 O;  1N0N A;  5LMN O;  2ZCE A;  1SA0 A;  3EVK A;  4O4I A;  4XDL A;  4DR2 O;  1US6 A;  2F66 C;  3T4Z A;  2QWR B;  4ZI7 B;  4J80 A;  1ZL8 A;  2XAQ A;  5B1B B;  3MAQ A;  2VWK A;  2IH1 C;  2Q7G A;  2ZDI A;  4MTX A;  4NXM O;  1N33 B;  2ZD9 A;  1K4C C;  4JTC B;  3JAS B;  4AI8 A;  5CA1 B;  3E22 B;  2UUA O;  2EBO A;  1M57 C;  2WLI B;  2VQE B;  4DYL A;  1VP7 A;  2H8P C;  1HR0 O;  3CCM V;  2C2A A;  1FJG B;  2DE0 X;  1HP8 A;  5C93 A;  3JD0 A;  2GDS A;  3K04 A;  3B2E E;  1QNM A;  4IHJ A;  5LBQ A;  1QLN A;  1SQB H;  2Q7H A;  1EN5 A;  4JYC A;  4RWU A;  4DRX A;  2Y0P A;  1GAX A;  3CXC U;  4JI2 B;  5BR8 B;  1KD1 W;  4GX0 A;  4U3F H;  3BFR A;  3HKB A;  2EIL B;  4LH7 A;  4H37 A;  2VQE O;  1JFF A;  2RMK B;  1FFT B;  2Y0I A;  4TWK A;  2OCH A;  1FJG O;  2WLK A;  2NLJ C;  3BHP A;  2QTO A;  2ZKO A;  1VAR A;  1ZX3 A;  5KUM A;  5EYP B;  1AB3 A;  5KHI A;  3FB7 C;  3MHH C;  1KKC A;  2XND G;  3OR6 C;  3GB7 C;  5DM6 V;  4DV1 B;  2YEV A;  4D7S A;  1M56 C;  2OIE A;  3OAA G;  1PKX A;  4LFC B;  4YJ3 B;  5JCO C;  1EZJ A;  3LDE A;  3UT5 B;  2EZP A;  4QPJ A;  4IT5 A;  2IJK A;  5BR8 O;  4JYA B;  3OR7 C;  3E86 A;  1GM7 A;  1R6T A;  1L8D A;  5L3B A;  1K92 A;  4FLZ A;  5JJN B;  3E8G A;  2JGD B;  3ZRW A;  1BMF G;  4LF5 B;  4O4J A;  4CS2 A;  2UXB O;  4HAM A;  4NYK A;  4FLU A;  4X62 B;  2ZNJ A;  5IYZ A;  2WLM A;  2ZXW B;  3A0R A;  1IX9 A;  5KMG B;  1YF2 A;  3P3N A;  5A2Q N;  3U10 A;  3N2K B;  4GX1 A;  1KU9 A;  3AG7 A;  2AHY A;  1TVK B;  4LFC O;  1LNQ A;  1PM9 A;  1R3L C;  2ITC C;  4UCO A;  2NN4 A;  2HVK C;  4JYA O;  5EC2 C;  3CCQ V;  5CB4 A;  1S5J A;  3ZHT A;  4FLV A;  4JYY A;  4PI2 A;  1UJW B;  5IJ0 A;  2DYS B;  2DWE C;  3J80 N;  4GCZ A;  3ABK B;  1AIL A;  2HVJ C;  4JI4 B;  1IUR A;  4LF5 O;  2D2C B;  4TT3 G;  4YY3 B;  1JQ0 A;  5DEC A;  2P5O A;  2ZE8 A;  3P32 A;  1ZLZ A;  3WG7 C;  4MW8 A;  5FPO A;  4DXW A;  2EIM B;  4QNH B;  4FMT A;  2Y69 C;  5LA6 A;  1X4T A;  4LNU B;  1QR9 A;  2ZIO A;  3JAT A;  2E3C A;  1XOU A;  4L87 A;  3ZMZ A;  2GUZ A;  4MVZ A;  2ZIN A;  2YIB D;  1XNQ B;  1TAE A;  4RUE A;  3JAK B;  1YJW V;  3SJA C;  4JI4 O;  5KAI Z;  2EIJ B;  4X9Q A;  4YJ2 B;  1JA8 A;  1IXM A;  1NU1 H;  4YY3 O;  1EM1 A;  1IXB A;  3B4S A;  4LWS A;  4K8Z A;  3W7X A;  1KUQ A;  5HFL A;  1VQK V;  5L3D A;  4UXN A;  4JAS A;  2YC0 A;  2DJV A;  2ZR3 A;  3QO5 A;  1R3K C;  2P4V A;  3TXS A;  2YXL A;  4NTW A;  2YIC A;  2PI4 A;  2UXC B;  4P9P A;  2P22 C;  4CBC A;  3L73 H;  3ZRV A;  2F93 B;  5KAF Z;  1YIT V;  1XNR B;  2FML A;  4XDK A;  1VQM V;  4I50 B;  5JH7 B;  1XMQ B;  2YI8 A;  2HHH B;  4ZHQ B;  3X2Q B;  4X89 A;  3D36 C;  2QDO A;  4LF8 B;  2ADP A;  3WB2 A;  3FB6 C;  3ZED A;  1EBO A;  3JSL A;  2YID A;  3ASO B;  1FXH A;  1Q6U A;  3UM7 A;  2RJZ A;  4HNA B;  1Y76 B;  4X20 B;  4ZI7 A;  4JPR A;  5LOV A;  3P3P A;  2Z0A A;  1G1X B;  5EC1 C;  5LP6 B;  1SQP H;  2R9R B;  3DTU B;  4IYI A;  4MTG A;  3JAS A;  1BHB A;  5CA1 A;  3E22 A;  4J11 A;  1P49 A;  2UXC O;  1MOF A;  2WLI A;  5EIB D;  1VEW A;  4K35 A;  5EZY B;  5J9P C;  2EIL C;  1OV9 A;  1QQC A;  1XNR O;  5GW7 A;  2IU3 A;  3KKY A;  2HHH O;  4H33 A;  4IL6 Z;  1YJN V;  3SPJ A;  4LF8 O;  1OCO B;  2QWP B;  3QO7 A;  1F7Y A;  3OUS A;  1W0J G;  3T2M A;  4JYB A;  1H8H G;  4QGP A;  3ASN B;  4X66 B;  1NQT A;  5KX5 B;  3CWB H;  1AVM A;  3OGI B;  4IYH A;  2V7Q G;  2WA4 A;  2HFE C;  3O9O A;  5CA3 A;  3OFN G;  1JOY A;  1SER A;  5IY5 B;  2XAJ A;  3CME V;  1VQP V;  4FLT A;  3OD4 A;  1XHZ A;  5LHH A;  3QTC A;  3L9D A;  4MT8 A;  1LUW A;  3OTO B;  1SZT A;  3FYI B;  4Q20 A;  1OZ0 A;  5CBF A;  5EBW C;  1XUQ A;  4J7Z A;  1HNZ B;  4DV3 B;  4J42 A;  3DC5 A;  4J7K A;  3K79 A;  4I4T A;  4RQE A;  1GN6 A;  4W4K A;  4YJ3 A;  1NH2 D;  3ABU A;  2OT5 A;  3AG3 C;  1AJQ A;  3STL C;  4DUZ B;  1M57 B;  1VQ6 V;  2WLJ A;  2X7R B;  4ZBM A;  1I94 O;  1S5L Z;  2ZM6 B;  2JGD A;  3CCV V;  4JI8 B;  4HYO A;  3IJ4 A;  2GBO A;  5KHJ A;  2MW2 B;  3RVY A;  5CBG A;  2DYS C;  3ABK C;  1CPY A;  4X1K A;  1NH2 B;  2UUB B;  2HG5 C;  4JI7 B;  3SPH A;  3TXQ A;  1HNZ O;  4DV3 O;  3VOU A;  1OJH A;  5KMG A;  1M1K W;  3CRC A;  3A8T A;  3N2K A;  3ZRX A;  1TVK A;  2EIM C;  4DR6 B;  2NR5 A;  2V4D A;  1L0N H;  1JR9 A;  1K73 W;  2PUS A;  2L6L A;  2H94 A;  3SYC A;  4JAV A;  1PP9 H;  4WF9 V;  2YUA A;  1M93 A;  1BS3 A;  2ZM6 O;  1BSM A;  5L3G A;  4JI8 O;  1OCC C;  4OXS A;  1XHX A;  3STZ C;  4KXR A;  1TUB B;  4FM1 A;  1K3E A;  2Q6A A;  2EIJ C;  3CRR A;  1NR1 A;  2YIA A;  5BMV A;  4PI0 A;  2R70 A;  1M56 B;  4G2K A;  2AXT Z;  3K0G A;  1EZV H;  2Q5Z A;  3LSS A;  1S77 D;  2UUC O;  4LNU A;  1GN4 A;  4DR6 O;  2EZO A;  5IYD O;  5H6Q A;  1XL4 A;  3HKE B;  3K06 A;  2CH7 B;  2P06 A;  1B6Q A;  3FX7 A;  4O2B A;  4R50 A;  4O2A B;  3CB2 A;  4DR5 B;  1BE3 H;  3FAV B;  4MTO A;  1ARO P;  3JAK A;  1D2D A;  1RPR A;  4RUF A;  3MDS A;  3G71 V;  3HPL C;  4ASU G;  4YJ2 A;  3OEE G;  4R7C A;  3ZRS A;  2N05 A;  3CYO A;  4YHH B;  4QE9 A;  1H2K A;  4OX9 B;  3CD6 V;  2QWQ B;  3AG1 B;  4X1Y B;  1FFX B;  2YIB A;  4LF9 B;  4GT1 A;  1NTZ H;  3HKD A;  2WLL A;  3P30 A;  4K0K B;  2ZT9 B;  4MVR A;  4DV5 O;  5LP6 C;  1ROP A;  1PV0 A;  2OTL V;  1S3J A;  1GM9 A;  3OMI B;  4K3A A;  1QLE B;  4LFA B;  4YIP A;  3QG5 A;  4I50 A;  5JH7 A;  4D7T A;  2GTS A;  1GMG A;  1TGO A;  2AZ0 A;  4JV5 B;  1Q5O A;  3GWO A;  4DV0 B;  2IM9 A;  2Z3Y A;  2KSD A;  2W6J G;  3NR7 A;  4OX9 O;  1R6N A;  5LMN B;  1CXZ B;  4ZKI A;  4X1I B;  5B3S B;  5LGN A;  2CTP A;  3QF7 A;  1OCO C;  4HNA A;  1Y76 A;  2QM7 A;  4WFB V;  1BZK A;  4J10 A;  4GZR B;  4LF9 O;  2AZ2 A;  1P7G A;  3W7U A;  3GVM A;  3VQV A;  1NI8 A;  2W0X A;  5LP6 A;  3M8A A;  1AR1 B;  3G6B A;  2AW9 A;  3MD0 A;  2A9H A;  3ZHS A; 
#chains in the Genus database with same CATH homology
 4J7J A;  2G38 A;  4W4K A;  4J7K A;  4IYI A;  4KXR A;  4J10 A;  4J41 A;  4W4L A;  4J42 A;  4IYH A;  4J11 A;  3FX7 A;  2GTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...