2G38A

A pe/ppe protein complex from mycobacterium tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
77
Chain Sequence
PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PE FAMILY PROTEIN
publication title Toward the structural genomics of complexes: Crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 33
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 2g38A00
4W4LA 4IYHA 3FX7A 4J42A 4J11A 4IYIA 4J7JA 4J41A 2GTSA 2G38A 4J7KA 4KXRA 4J10A 4W4KA
chains in the Genus database with same CATH superfamily
1NVPD 4KHPO 1SZTA 1FFXA 4JI5B 4X1YB 4U3JB 5B3SB 4JYCA 5LA6A 3LDCA 2Q8VA 4O2AB 2K9PA 3OEEG 1VQMV 4IHJA 3LDDA 1Y74B 2KB1A 3TCUA 5JCOC 2PYJA 2Q69A 1Y4MA 3IGAC 2ZM6O 4JF3A 1IBMO 4IIJB 4JGSA 2GDSA 1XUQA 2ARHA 4FIPC 1GN4A 2QM7A 2ZT9B 3BAAA 3SPIA 1R3KC 1GM7A 2ITDC 3B4SA 1URFA 2DYRB 1B04A 2W0FC 1XNRB 1H8HG 3M99B 1QLNA 4JAUA 5JJNB 3CRAA 3QVNA 3PJSK 2Y0PA 4DV0B 3MHSC 4I5SA 4DR2B 4FJCC 4FFBB 3K5OA 5H2FZ 3RYCB 5CA1B 1SQGA 3RYIB 5H5NA 5A2QN 2DW4A 1SKVA 4WBNB 3CB2A 2VWJA 1XMOB 2HJFC 2QM4A 3A8TA 2F23A 4JASA 4U7OA 4W4LA 4YIPA 2DQ3A 1FXKB 4PDLA 3G6BA 1F4NA 1FYJA 3ETQA 1N0NA 4X1KA 1K7DA 1NR7A 1G4YB 4FM2A 2XUMA 1D2DA 3AK1A 2EJRA 4NTWA 4X66B 5EZYB 4PA6A 4RQEA 2JIZG 5JH7B 1MABG 4O4HB 4LF5B 4IL6Z 2OCHA 1VF6C 3R65A 5DEDA 5EIBC 3TGUH 2DOSA 1BSMA 1K5QA 2PGGA 3G71V 3ABUA 2XAHA 4DV5O 3OGIB 3N27A 4DR4O 2YSUB 2YI9A 3VQVA 4HNAB 1WA8B 3JARB 2YXHA 3CJHB 4YHHO 2E5LB 2HLDG 4J7ZA 2Y0IA 3K57A 2Q4PA 3SYQA 1TUBA 5CB4A 1GRJA 1QLEB 4K8XA 4BIOA 2OT5A 2ETNA 2WLNA 3UQ8A 1UJWB 2WA3A 4LFAO 4ZI7B 2JK5C 2LFSA 3Q4HB 3OAAG 4JTDB 3B8MA 3CRCA 5J2UB 4MVOA 1ORQC 1YJWV 3L75H 1EM1A 4X1YA 1DTOA 5CBGA 1AI6A 3KCYA 5LGUA 1YJ9V 4O2AA 2N74A 2Q73A 1Q6HA 5H9CA 1YTFB 2HKOA 1Y74A 1R3IC 1UPGA 3FX7A 4B3MO 2A3QA 5L3FA 2ZXWC 3W7XA 4IIJA 2UU9O 2EX3A 4JTAB 4B08A 2QE7G 4J41A 4B3RB 3RYHB 4GX2A 3SPGA 2Z3YA 1B06A 1PNMA 2ITCC 4UB6Z 3L71H 4JAAA 3CCRV 5KA6A 2CTRA 2ZE5A 2YC0A 3TETA 4A5UB 4FFKA 3CCUV 2WWWA 2EZPA 5IJ9B 1ZL8B 4UV8A 3CEIA 5DM6V 1ZTEA 4DR1O 2YXYA 2EILC 4FFBA 4JI0O 3RYCA 3OT7A 5CA1A 3RYIA 3SR2C 2IJHA 4WBNA 2DYSC 4JYAO 3BRCA 2NLJC 3E8GA 2LO1A 3UO2A 3E8HA 1AJQA 2UXBB 2OWOA 1NU1H 5L3EA 4DO2A 4TQDA 3ZMTA 1PNKA 1IBLB 3H01A 1NTZH 1M93A 1GN6A 3DTUB 3C3TA 4DV4O 1KQSU 3BA8A 1IBKB 3SJBC 4JYBA 3L73H 5EZYA 1IZ3A 4MVSA 3CC2V 3ZRVA 4CH4A 5JH7A 4GLXA 5BMVB 4O4HA 1U96A 4GKKB 5JCOA 1MZFA 3J81N 1K73W 5GTIZ 2Y4TA 2QA4V 2F93B 4PA3A 3OR6C 4MW3A 4HNAA 1WA8A 3JARA 1KU9A 3CJHA 1J5EB 3HKBB 5LYJB 2XHBA 4WFEA 4MTOA 4BIZA 1QNMA 1JVMA 1N4CA 4LH7A 4YXWG 4P30A 3SDLA 4KHPB 2A0LA 4DR6O 4ZI7A 2OYQA 3Q4HA 3P3PA 2EILB 2HVKC 1TA8A 5J2UA 2QTOA 5FNVB 3ZJZA 3IC9A 2JGDB 4UB8Z 4K0KO 3DSQA 3STLC 2ZCEA 3SYPA 4JV5O 3OE7G 3CRRA 4WFBV 2ZM6B 5C93A 1IBMB 2JEXA 4Z2WA 3CCEV 3GB7C 1R3LC 3FAVB 3DGEA 4BR6A 1HR0O 1I0HA 2YIDA 5KHHA 5JQGB 5GW7A 5B1OA 2NNUA 4PA4A 3RYHA 1EN4A 2IM9A 1XILA 4DK0A 3CCLV 1YIJV 3FKSG 3UCSC 3ABMC 1VF6A 5LXTB 1Q3EA 1H2GA 1L8DA 4TQFA 3SGIA 1SC5B 2BOCC 5IJ9A 1ZL8A 4OX9O 1NVPB 3AG2C 2Y4UA 4PJ0Z 3HKEB 4NTXA 4WF9V 5HFMA 2AW9A 2LGQA 1KECA 4FM1A 3QNEA 4U3FH 2VWKA 5FPOA 2WLKA 1LR1A 3LNNA 1EZVH 3ZX6A 3BABA 4RQFA 4OPHA 5LMUO 2E76B 3H1JH 3PN1A 4TSFG 1QCEA 3JCZA 1L1FA 3NXSA 2PI4A 3EFFK 2XASA 3BFRA 4GT1A 3SYOA 2Y69C 2EIKC 2Q67A 3K04A 4L87A 1SZXA 5BMVA 2X6AA 4DV5B 1BMFG 1R73A 4DR4B 3VQYA 2EINC 1EN6A 2RN9A 3ZHTA 2CTWA 3QO5A 4YHHB 2OTLV 3GWKC 1NTMH 2Q0AA 3HKBA 4I9WA 5LYJA 3RFRA 3FB5C 4LFAB 1ZAUA 4GX1A 2ZE7A 1XL4A 2P5OA 1YITV 1PV0A 1OCRC 3LUTB 1ZWIC 3CRQA 4NR1A 5B1BB 1FJGO 3JD3A 3ZHRA 2FYUH 1Q6UA 1AJPA 5FNVA 2HHHO 2XAFA 1WNSA 3S3WA 1FS0G 2P67A 3K08A 1F51A 2V1DA 4ZBMA 2ZKOA 2QWRB 4R7CA 4B3MB 2UU9B 2P4KA 1K3EA 3FAVA 2AXTZ 1D5AA 4D6TH 4NXMO 2ATKC 3QO8A 5JQGA 3L74H 4MVRA 2JDIG 2L35A 3SYCA 2HVJC 4EB6B 2EIKB 1S5HC 4E2LA 1DF4A 5LXTA 1VIBA 5DECA 4DR1B 4FLYA 4H13B 2F43G 5J9PC 1NTKH 4JYAB 4KP4A 3HKEA 2AGAA 4UCUA 3JD1A 2UUCO 3EXAA 1AVMA 3VQWA 3ZN0A 1MSDA 1OCOC 1IBKO 3KKYA 1M9NA 2RMKB 2IU3A 1SQVH 1QVFU 1OCRB 2D2CB 2W6IG 3K5LA 2P22C 1Q7YW 1VARA 4DV4B 4O4JB 2OCCC 2X6BA 2IU0A 1WP7A 4K35A 4LF8B 3LSUA 3E22B 4UCVA 3F5WC 3CPWU 2Q7HA 3B77A 2AZ2A 3K5NA 1KKDA 2RDCA 4DV2O 2ZR3A 1PKXA 5GTHZ 1VQNV 3H1HH 3F7VC 3APOA 4DV7O 4DV1O 5KLVH 3WFVA 1G8MA 4MT8A 4B7EA 2Q7GA 1GAXA 1Q8IA 3K06A 1GN3A 3OFNG 1JX9A 5AG2A 4U7NA 4Q20A 4ASUG 1N34O 2CUGA 3ZEDA 4I0XB 2AHZA 3CC7V 1AI4A 4PI2A 1SQXH 1P49A 5C8YB 4DR6B 2GHYA 4JI3O 3ETGA 2WLJA 4NTYA 1EFRG 2JGUA 2DWDC 3K03A 4ICGA 4K0KB 1A32A 2PTMA 3ZIAG 3CMEV 4P9OA 5CA0B 4JV5B 1NH2D 1HNZO 1MOFA 3CC4V 3K79A 3WU2Z 5F2VO 2MW2B 3APQA 4N23A 1Q43A 1HR0B 5GONB 1SF9A 5D5QA 2JJ2G 1ZX3A 1E79G 2OCCB 3M8AA 4B3SO 3DC5A 5B1AC 4E4EA 5LGNA 1COWG 1AB3A 3G4SV 3T1HO 2QJ1A 4H44B 2IBZH 4EB6A 3RVZA 2DQ0A 2XAJA 1Y76A 4WFAV 5JJJB 1GO3F 3ZMVA 2ADQB 1KMIZ 2IJIA 4OX9B 3VQXA 1R1BA 3A2FA 1VEWA 3P3NA 1RM1C 1JJOA 5JVDB 1K4DC 1TVKB 2Q0OC 4LF4O 1P4RA 5LHGA 3WB0A 3JAMN 1PL0A 1IDSA 3CCQV 2P90A 4TV8B 4ZOLB 3E35A 1F23A 2GSMB 1CP9A 1I5YA 1XL6A 2F95B 4JYYA 5IYCO 3A0RA 3RT3C 3D36C 5LMUB 4BW5A 3BY6A 1W59A 1HDJA 2IJKA 1RSOB 5D5PA 2CH7B 3AEIA 1QVGU 1VQLV 2LW7A 4I50B 4CS4A 4O4JA 3CCJV 2WLHA 4JZGA 4X62O 4X89A 1XREA 4G27B 3E22A 1EN5A 1BL8A 4QPJA 2E3CA 2JS3A 2BCCH 5J2TB 3LSQA 2QWOB 2WLLB 1YSCA 4AQYO 1KYOF 1AI7A 4FVMA 2HJDA 1PL4A 5E79Z 5B1AB 2LGWA 2IJJA 4CH6A 1CEZA 5EBLC 1AJNA 2UUBO 3C3SA 1S72V 3AG4C 3RW0A 3F5TA 3SJQC 2E75B 1YHQV 4LFBO 4U3JA 4CC6A 4XDJA 1ROPA 2UUAO 1YJNV 4I0XA 1HW7A 4FMTA 2QWNB 2DE0X 3CCVV 5C8YA 3CX5F 3KZIZ 4UVBA 1FJGB 1RM1B 2QDOA 2HHHB 2IH3C 3K0GA 4QJFB 2P06A 3FB6C 2NN4A 2FTKA 2E74B 3BEHA 5CA0A 5KUKA 4UV9A 3JAKB 3K58A 4FLVA 2PF4E 1IXBA 1XQ8A 2CGOA 5LGTA 1WN7A 2ZIMA 1Q81W 1K92A 1US6A 2NR5A 4FZ1A 4B7KA 5B1NA 5GONA 1DLBA 1BCCH 1L0NH 4NXMB 1TGOA 2HEPA 2B1IA 4MVZA 2F66C 4MVMA 4KFMA 4DR5O 2QKSA 4LR3A 4CS2A 2YDEA 3N2KB 1SS3A 2IW5A 2JEUA 5KAIZ 2H8PC 2A7WA 2WAMA 5BR8O 4JI2O 2A06H 3E83A 3MAQA 3VOUA 4H0LB 4F6RB 5LP6C 1FXKA 5LOVB 4OGQB 1SA0B 1E1QG 3VBBA 4MVUA 1TVKA 4ZKIA 2UUCB 1Z2GA 2B9ZA 2CTPA 4TV8A 4TOIA 4LF8O 3H1LH 4ZOLA 1R6NA 3L9DA 1THZA 2ADPA 2ZIOA 2BOBC 2R9RB 4EFEA 4B3TO 2YEVB 3LSSA 1XI1A 4DW1A 2V4DA 1RSOA 2ZXWB 2CH7A 1T5EA 3H1IH 4EEQA 4I50A 3GVMA 1BHAA 1Z5VA 1Q6IA 3ZRXA 1YCIA 4DV2B 3HR0A 3STZC 1H2KA 3T1CA 2UXCO 4LH6A 5K1XA 4DV7B 5J2TA 1BE3H 4R8CA 4H33A 4PDMA 4DV1B 1H8EG 3J7AU 5FL7G 2WLLA 4MW8A 4WCEV 5L3GA 2CGNA 3WG7C 4N21A 2GBOA 1W2BU 4GCZA 1M5IA 2GUZB 2JS5A 1N34B 4IYIA 4D7SA 1JR9A 1XBLA 2WLMA 1ZLZA 5LHIA 3ZHUA 2DYSB 2UXXA 5IDJA 2R9IA 3D3IA 3ML0A 1Q82W 2LW1A 4JI3B 3IC7A 3ABLC 3D3QA 5LP6B 3ZHSA 1SQBH 2MK3A 2WLIB 2L6LA 4L8JA 3L70H 1GM9A 2VRZA 4NXNO 4X8AA 1EZJA 1HNZB 1QR8A 2QR4A 3FYIB 5EC1C 2RQ6A 1YDXA 4Q6GA 1AR4A 4MTFA 4OXSA 3S3XA 3JAKA 1M56C 4X1IB 2OIGA 3D36A 3ZRSA 2ILMA 4HAMA 2N04A 4B3SB 3HKDB 3BPZA 4CC5A 1YEWA 5E1AC 4O4LB 4UFZA 2YUAA 3G80A 2Q9LA 3T1HB 3CWBH 1Q90D 4LF7O 3N2KA 3SPJA 2X6CA 4WFHA 1WB8A 4Z1MG 3UO3A 1JJ2U 3OTFA 5LHHA 4I7ZB 3JAWB 2GV9A 2Y48A 1RFYA 3WG7B 2DN9A 1H38A 1S3JA 2ZNIA 1S5LZ 1WJZA 4F6RA 4LF4B 5LOVA 3HKCB 3TJTA 3SPHA 1SA0A 3ASNC 1SETA 2W0XA 4QE7A 1GH6A 4DXWA 1N0JA 2FMLA 4QIWF 4LBEC 3LDEA 1YTFD 4P2ZA 3OEHG 2EJ7A 3JCUZ 4LC1A 2JJ1G 2F4VB 3ABLB 3M7MX 4O4IB 2LJ2A 5BZBA 1S76D 1LNQA 4XBFA 5LBQA 2QWQB 2ZE6A 4LWSB 4H37A 4D7TA 1K5SA 2YEVA 2RCVA 4X62B 1SQQH 1X4TA 1PD3A 2ZD9A 1VF5B 3JALB 3GWOA 3ZHQA 1XMQO 1VQOV 3AK3A 1RP3B 1WB7A 1KUQA 5CN0A 4KL1A 5EIBD 1KP3A 1M56B 1VQPV 4AQYB 5IY5C 2M7WA 3JSLA 2CDYA 3ABMB 1TUEB 2YICA 1AR5A 3E8FA 2K1EA 3JD2A 5EBMC 2UUBB 1V55C 1JMKC 1BT8A 5EBWC 4OPAA 1HNXO 4LFBB 4DV6B 3AG2B 3TXQA 3THOA 4RAIA 2GUZA 3QF7A 2UUAB 1QHTA 4J9ZB 2AZ0A 3ZHVA 1FAFA 2JGDA 5A9GA 1GK9A 3X2QC 4YJ2B 1PNLA 3DXRB 4R50A 1CPYA 3H9VA 5LP6A 5CBFA 1XDCA 4DR7O 2PYLA 2GTAA 3G6EV 2X7RB 3ASNB 1BQ0A 1DK1A 5JWPA 1PM9A 2A79B 4X65O 2ODMA 4ZIBA 3ABKC 3MD0A 4LCUC 1BS3A 2Y69B 4F4LA 1EBOA 3C90A 3JASB 1FXVA 5IE9A 4FZ0A 3RGBA 4RWUA 5IWAO 2W6JG 2H3OA 5FLXN 2YIBA 3HKDA 2XNDG 4DR5B 2EINB 3W7UA 1W0KG 5LMNO 2DMXA 4O4LA 4NB5A 5IYZB 3A0BZ 5BR8B 1R6KA 4JI2B 3ZBHA 4RUEA 2LQTA 2FB5A 2YXLA 5IY5B 4FLXA 3A0HZ 3CHXA 3ABTA 1KD1W 3P32A 4JI7O 1AILA 4JI4O 3JYCA 1JQ0A 1PPJH 2R9AA 2YIAA 1H2SB 1V55B 1YVWA 4BW9A 5ITZB 3RVYA 1HWYA 3E8BA 4X88A 3HKCA 2F1MA 1N36O 1S77D 1CXZB 4NKGB 5EC2C 3CMAV 4NVPA 3CRMA 2Q68A 3ZN1A 1BGYH 3OW2U 3X2QB 4B3TB 1RPRA 2V7QG 4FPPA 3B40A 4LWSA 2HR3A 1S5JA 4JAVA 4I9QA 3B09A 2UXCB 3JALA 3CCMV 1YXBA 1AI5A 1Q5OA 4PDRA 1HNWO 4C7UA 1G6UA 3ABKB 1VMGA 1JOYA 5KA5A 1M57C 5IYDO 3T2MA 3SJCC 1KB9F 1QQCA 1Y6XA 2CAZC 1Q86W 2B5UA 1NKDA 4TV9B 4RO2A 1I94B 2EBOA 4HZ3A 3ZMUA 3FB8C 2XTAA 3E2EA 1M1KW 1ZUQA 1VQ9V 1BQZA 3DC6A 3HPLC 3AG3C 4GYCB 3RBZA 3K9SA 1OCOB 2FKXA 5KMGB 4LFCO 2ZINA 4YJ2A 3DXRA 4DV3O 3SPCA 4NXNB 5TISZ 3CS5A 3HB3B 1I5XA 4RUFA 2BTQB 1KC8W 4QE9A 3ZS8C 1FD9A 1WLEA 2Z0AA 1GKFA 1VQ5V 3FFQA 1V9PA 4TUYB 2HG5C 2Z5UA 2RNBA 4DR3B 1VQ4V 4TT3G 1QLEC 3QG5A 2BE3A 2JVDA 2BSKB 4JI1O 3JASA 5KHKA 4K8ZA 4DK1A 3CSXA 1QU7A 1F7YA 2ZQMA 1DF5A 1P7GA 3RYFB 4UUJC 4LF7B 1J95A 1MMMA 3RWRD 4ZHQB 1UFIA 3G67A 5IYZA 4AILC 3CCSV 4PD4F 1M57B 2QSAA 5KX5B 3U0ZA 5H6QA 4YIOA 2KKWA 4WFFA 3K59A 1SQFA 1O9GA 2CE4A 3I56V 2LFRA 1Y67A 3JSNA 3T4DA 1NJIW 1TAEA 2RJZA 4J7KA 5BY1A 4J10A 3BA9A 3FB7C 4G2KA 2F4VO 4JI6O 3K0DA 4LP8A 2DWEC 1QR9A 5ITZA 4IT5A 1XOUA 3CE2A 4UCRA 2OIEA 2HP8A 3OMIB 5L3CA 4F6EA 3AG3B 4BIUA 4JI8O 3I5DA 1H2NA 1NZ6A 2HFEC 1VQ7V 2QGNA 3FYEB 1F4MA 1B3QA 2CK3G 1LUWA 3OTOO 4JTCB 3IAYA 5KAFZ 1XMQB 5IJ0B 3O9OA 1GM8A 2EIMC 5BXZA 4DRXB 3FD9A 1Y66A 2CTQA 4DV6O 4J11A 1NBMG 4FLTA 1N8RW 1MSWD 1OCCC 2UXNA 5KUMA 2QTSA 2KSDA 1O9HA 1HNXB 4TV9A 3N2GB 4GZRB 4FK5C 5DN6G 4EKWA 1VQ8V 4LF6O 2LP7A 2N05A 3OUSA 4DYLA 5H6RA 3E86A 3TK1A 3TXSA 3ZCCA 1GTOA 2UXDO 5KMGA 4DR7B 2KG7B 4HBNA 4X20B 3SJAC 1S0VA 3K9AA 4I55B 1N32O 4LF9B 2BTQA 1VQ6V 3B8NA 1VF7A 1R6TA 4X65B 2BTOA 2IH1C 3I55V 4GX0A 3ICXA 1N33O 2VQEO 5KHJA 4PDVA 4TUYA 3WB1A 2P6JA 5IWAB 3EVKA 1SESA 5LMNB 3ZRWB 2BSKA 3ETEA 1B6QA 3H1KH 4X64O 4ABMA 1M90W 1AP6A 3RYFA 4CH5A 1YZBA 5JVDA 3AG4B 2EIMB 4ZHQA 3BHPA 1K4CC 4JI7B 3T1YO 5KX5A 3E89A 1OCCB 4JI4B 4DUZO 1G1XB 2WA4A 4GKJO 2YI8A 3J80N 4DUYO 3UT5B 4JZ2A 4AI8A 3U11A 2AHYA 1N36B 3WB2A 4K3AA 4DW0A 2B1GA 1MG1A 1P84F 1OHHG 1X59A 3AK2A 1U97A 1HP8A 4YY3O 1XNQO 4X9QA 1Z5WA 5CMUA 3BVOA 2O57A 2ZNJA 4GUNA 3OMNB 3QTCA 1D5NA 2VQFO 1IVSA 4GX5A 4UCSA 3OMAB 1HNWB 1I08A 4I4TB 5IJ0A 1I94O 1OJHA 4JI5O 4FLZA 4YJ3B 1FFTB 4KXRA 4CH3A 4DRXA 1NQTA 1NR1A 5B5EZ 3NR7A 4LNUB 4UVAA 2Q5ZA 3KCXA 4AHCA 1DGSA 2QKAA 2ZDIC 2OTJV 3N2GA 2FL4A 4QPKA 3SYAA 1KKCA 3JATB 4J7JA 2GTSA 4O2BB 1SRYA 3AG1C 3CXCU 4NYKA 4LFCB 1BHBA 3EHBB 1AR1B 4DV3B 4WFGA 3O65A 4J80A 5EYPB 4DR3O 1XNRO 2KG7A 1V54C 3CD6V 2VS0A 3ASOC 4KUMA 4X20A 2QWPB 4I55A 4HYOA 4J9YB 1VP7A 5FPRA 4DV0O 1W0JG 4Z1VA 1JA8A 4R6ZA 4DR2O 5K1PA 1WAZA 3R66A 4JI1B 3P30A 3QO7A 2XOKG 5IT9N 1XMOO 1K97A 1WPBA 3ZRWA 5JJEB 3D8CA 3K5MA 4PELA 4PA9A 4CS3A 2PI5A 1ENVA 5B1BC 1I7FA 1RPOA 3AG7A 1WP8A 3UM7A 3LNMB 2D3OW 1H2MA 2EIJC 4FM0A 4MS2A 4TWKA 4X66O 1NH2B 5L3DA 4J42A 4PHZA 5CA3A 1K9MW 4JI6B 5KHGA 4MVQA 3UT5A 4PI0A 2R70A 1XHZA 4LF5O 1JFFB 1XHXA 2M6YA 3OGCC 1PP9H 1NI8A 1LUVA 4JI8B 3AG1B 1OCZC 2E5LO 2P4VA 3RN4A 1MNGA 3KG2A 3CYOA 2EZOA 5LL6Y 3IFXA 1FPOA 3JD0A 4JPRA 3OTOB 1V54B 1SQPH 3ASOB 3JD4A 4XDKA 1FFXB 3U10A 5CBHA 1VQKV 3T4ZA 4EFBA 4I4TA 5LA6B 2DJVA 4YJ3A 1AROP 2QEXV 2JRIA 1OZ0A 4IHJB 3OD4A 3ZMZA 5EK0A 3OUFA 1WPXA 4LNUA 4MTXA 1FKAO 2KQXA 4BAYA 1GN2A 4LF6B 2PY5A 1K34A 2WLIA 1K33A 4UCTA 3OR7C 3JATA 2XAGA 2R72A 4LF9O 4P9PA 4W4KA 1P7BA 1OV9A 2EIJB 4O2BA 1L0LH 1SERA 4B3RO 2X0LA 2UXDB 1BZKA 1NS1A 3UKMA 2ZR2A 4UCOA 2C2AA 4MSWC 1N32B 4X1IA 5EYPA 4IYHA 4CBCA 2ZE8A 5KHIA 3ZMSA 1AP5A 2H94A 1IX9A 1N33B 5IYBO 2Q6AA 2VQEB 1KP2A 5B3SC 4IGGA 1OCZB 4MTGA 1IURA 2QKCA 4FLUA 1Y76B 1H2LA 3L72H 1YI2V 4PA7A 2XAQA 4X64B 3BCCH 5HFLA 2Q7EA 1IXMA 3JAWA 4JI0B 4X1KB 2UXBO 1YF2A 2G38A 4G28B 1JPXA 4FLWA 3MDSA 2EULA 1QBZA 1IBLO 3T1YB 3MHHC 1GMGA 3F7YC 4QNHB 2P7TC 2WPDG 2XT9A 4DUZB 2WSSG 4GKJB 4DUYB 2DYRC 4PV1B 4BWAA 3CP1A 1MZEA 1JCHA 1MA1A 1NT2B 4QGPA 4O4IA 3K3WA 2ZDIA 4XDLA 4GKKO 5L3BA 4UVCA 1JFFA 1KBHA 4CZZA 4UXNA 4YY3B 3CXHF 3ETDA 1XNQB 1FXHA 1TUBB 2PZSA 3W7TA 5CB4B 2A9HA 1XEQA 1J5EO 1M4UA 2YIBD 3IJ4A 5B66Z 3W7WA 1K8AW 3OM3B 1E1RG 2PUSA 2VQFB 2QM8A 1ZSPA 1FXKC 3B2EE 3W7SA 2YS8A 1R3JC
chains in the Genus database with same CATH topology
4W4LA 4IYHA 3FX7A 4J42A 4J11A 4IYIA 4J7JA 4J41A 2GTSA 2G38A 4J7KA 4KXRA 4J10A 4W4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4L A;  4IYH A;  3FX7 A;  4J42 A;  4J11 A;  4IYI A;  4J7J A;  4J41 A;  2GTS A;  2G38 A;  4J7K A;  4KXR A;  4J10 A;  4W4K A; 
#chains in the Genus database with same CATH topology
 1NVP D;  4KHP O;  1SZT A;  1FFX A;  4JI5 B;  4X1Y B;  4U3J B;  5B3S B;  4JYC A;  5LA6 A;  3LDC A;  2Q8V A;  4O2A B;  2K9P A;  3OEE G;  1VQM V;  4IHJ A;  3LDD A;  1Y74 B;  2KB1 A;  3TCU A;  5JCO C;  2PYJ A;  2Q69 A;  1Y4M A;  3IGA C;  2ZM6 O;  4JF3 A;  1IBM O;  4IIJ B;  4JGS A;  2GDS A;  1XUQ A;  2ARH A;  4FIP C;  1GN4 A;  2QM7 A;  2ZT9 B;  3BAA A;  3SPI A;  1R3K C;  1GM7 A;  2ITD C;  3B4S A;  1URF A;  2DYR B;  1B04 A;  2W0F C;  1XNR B;  1H8H G;  3M99 B;  1QLN A;  4JAU A;  5JJN B;  3CRA A;  3QVN A;  3PJS K;  2Y0P A;  4DV0 B;  3MHS C;  4I5S A;  4DR2 B;  4FJC C;  4FFB B;  3K5O A;  5H2F Z;  3RYC B;  5CA1 B;  1SQG A;  3RYI B;  5H5N A;  5A2Q N;  2DW4 A;  1SKV A;  4WBN B;  3CB2 A;  2VWJ A;  1XMO B;  2HJF C;  2QM4 A;  3A8T A;  2F23 A;  4JAS A;  4U7O A;  4W4L A;  4YIP A;  2DQ3 A;  1FXK B;  4PDL A;  3G6B A;  1F4N A;  1FYJ A;  3ETQ A;  1N0N A;  4X1K A;  1K7D A;  1NR7 A;  1G4Y B;  4FM2 A;  2XUM A;  1D2D A;  3AK1 A;  2EJR A;  4NTW A;  4X66 B;  5EZY B;  4PA6 A;  4RQE A;  2JIZ G;  5JH7 B;  1MAB G;  4O4H B;  4LF5 B;  4IL6 Z;  2OCH A;  1VF6 C;  3R65 A;  5DED A;  5EIB C;  3TGU H;  2DOS A;  1BSM A;  1K5Q A;  2PGG A;  3G71 V;  3ABU A;  2XAH A;  4DV5 O;  3OGI B;  3N27 A;  4DR4 O;  2YSU B;  2YI9 A;  3VQV A;  4HNA B;  1WA8 B;  3JAR B;  2YXH A;  3CJH B;  4YHH O;  2E5L B;  2HLD G;  4J7Z A;  2Y0I A;  3K57 A;  2Q4P A;  3SYQ A;  1TUB A;  5CB4 A;  1GRJ A;  1QLE B;  4K8X A;  4BIO A;  2OT5 A;  2ETN A;  2WLN A;  3UQ8 A;  1UJW B;  2WA3 A;  4LFA O;  4ZI7 B;  2JK5 C;  2LFS A;  3Q4H B;  3OAA G;  4JTD B;  3B8M A;  3CRC A;  5J2U B;  4MVO A;  1ORQ C;  1YJW V;  3L75 H;  1EM1 A;  4X1Y A;  1DTO A;  5CBG A;  1AI6 A;  3KCY A;  5LGU A;  1YJ9 V;  4O2A A;  2N74 A;  2Q73 A;  1Q6H A;  5H9C A;  1YTF B;  2HKO A;  1Y74 A;  1R3I C;  1UPG A;  3FX7 A;  4B3M O;  2A3Q A;  5L3F A;  2ZXW C;  3W7X A;  4IIJ A;  2UU9 O;  2EX3 A;  4JTA B;  4B08 A;  2QE7 G;  4J41 A;  4B3R B;  3RYH B;  4GX2 A;  3SPG A;  2Z3Y A;  1B06 A;  1PNM A;  2ITC C;  4UB6 Z;  3L71 H;  4JAA A;  3CCR V;  5KA6 A;  2CTR A;  2ZE5 A;  2YC0 A;  3TET A;  4A5U B;  4FFK A;  3CCU V;  2WWW A;  2EZP A;  5IJ9 B;  1ZL8 B;  4UV8 A;  3CEI A;  5DM6 V;  1ZTE A;  4DR1 O;  2YXY A;  2EIL C;  4FFB A;  4JI0 O;  3RYC A;  3OT7 A;  5CA1 A;  3RYI A;  3SR2 C;  2IJH A;  4WBN A;  2DYS C;  4JYA O;  3BRC A;  2NLJ C;  3E8G A;  2LO1 A;  3UO2 A;  3E8H A;  1AJQ A;  2UXB B;  2OWO A;  1NU1 H;  5L3E A;  4DO2 A;  4TQD A;  3ZMT A;  1PNK A;  1IBL B;  3H01 A;  1NTZ H;  1M93 A;  1GN6 A;  3DTU B;  3C3T A;  4DV4 O;  1KQS U;  3BA8 A;  1IBK B;  3SJB C;  4JYB A;  3L73 H;  5EZY A;  1IZ3 A;  4MVS A;  3CC2 V;  3ZRV A;  4CH4 A;  5JH7 A;  4GLX A;  5BMV B;  4O4H A;  1U96 A;  4GKK B;  5JCO A;  1MZF A;  3J81 N;  1K73 W;  5GTI Z;  2Y4T A;  2QA4 V;  2F93 B;  4PA3 A;  3OR6 C;  4MW3 A;  4HNA A;  1WA8 A;  3JAR A;  1KU9 A;  3CJH A;  1J5E B;  3HKB B;  5LYJ B;  2XHB A;  4WFE A;  4MTO A;  4BIZ A;  1QNM A;  1JVM A;  1N4C A;  4LH7 A;  4YXW G;  4P30 A;  3SDL A;  4KHP B;  2A0L A;  4DR6 O;  4ZI7 A;  2OYQ A;  3Q4H A;  3P3P A;  2EIL B;  2HVK C;  1TA8 A;  5J2U A;  2QTO A;  5FNV B;  3ZJZ A;  3IC9 A;  2JGD B;  4UB8 Z;  4K0K O;  3DSQ A;  3STL C;  2ZCE A;  3SYP A;  4JV5 O;  3OE7 G;  3CRR A;  4WFB V;  2ZM6 B;  5C93 A;  1IBM B;  2JEX A;  4Z2W A;  3CCE V;  3GB7 C;  1R3L C;  3FAV B;  3DGE A;  4BR6 A;  1HR0 O;  1I0H A;  2YID A;  5KHH A;  5JQG B;  5GW7 A;  5B1O A;  2NNU A;  4PA4 A;  3RYH A;  1EN4 A;  2IM9 A;  1XIL A;  4DK0 A;  3CCL V;  1YIJ V;  3FKS G;  3UCS C;  3ABM C;  1VF6 A;  5LXT B;  1Q3E A;  1H2G A;  1L8D A;  4TQF A;  3SGI A;  1SC5 B;  2BOC C;  5IJ9 A;  1ZL8 A;  4OX9 O;  1NVP B;  3AG2 C;  2Y4U A;  4PJ0 Z;  3HKE B;  4NTX A;  4WF9 V;  5HFM A;  2AW9 A;  2LGQ A;  1KEC A;  4FM1 A;  3QNE A;  4U3F H;  2VWK A;  5FPO A;  2WLK A;  1LR1 A;  3LNN A;  1EZV H;  3ZX6 A;  3BAB A;  4RQF A;  4OPH A;  5LMU O;  2E76 B;  3H1J H;  3PN1 A;  4TSF G;  1QCE A;  3JCZ A;  1L1F A;  3NXS A;  2PI4 A;  3EFF K;  2XAS A;  3BFR A;  4GT1 A;  3SYO A;  2Y69 C;  2EIK C;  2Q67 A;  3K04 A;  4L87 A;  1SZX A;  5BMV A;  2X6A A;  4DV5 B;  1BMF G;  1R73 A;  4DR4 B;  3VQY A;  2EIN C;  1EN6 A;  2RN9 A;  3ZHT A;  2CTW A;  3QO5 A;  4YHH B;  2OTL V;  3GWK C;  1NTM H;  2Q0A A;  3HKB A;  4I9W A;  5LYJ A;  3RFR A;  3FB5 C;  4LFA B;  1ZAU A;  4GX1 A;  2ZE7 A;  1XL4 A;  2P5O A;  1YIT V;  1PV0 A;  1OCR C;  3LUT B;  1ZWI C;  3CRQ A;  4NR1 A;  5B1B B;  1FJG O;  3JD3 A;  3ZHR A;  2FYU H;  1Q6U A;  1AJP A;  5FNV A;  2HHH O;  2XAF A;  1WNS A;  3S3W A;  1FS0 G;  2P67 A;  3K08 A;  1F51 A;  2V1D A;  4ZBM A;  2ZKO A;  2QWR B;  4R7C A;  4B3M B;  2UU9 B;  2P4K A;  1K3E A;  3FAV A;  2AXT Z;  1D5A A;  4D6T H;  4NXM O;  2ATK C;  3QO8 A;  5JQG A;  3L74 H;  4MVR A;  2JDI G;  2L35 A;  3SYC A;  2HVJ C;  4EB6 B;  2EIK B;  1S5H C;  4E2L A;  1DF4 A;  5LXT A;  1VIB A;  5DEC A;  4DR1 B;  4FLY A;  4H13 B;  2F43 G;  5J9P C;  1NTK H;  4JYA B;  4KP4 A;  3HKE A;  2AGA A;  4UCU A;  3JD1 A;  2UUC O;  3EXA A;  1AVM A;  3VQW A;  3ZN0 A;  1MSD A;  1OCO C;  1IBK O;  3KKY A;  1M9N A;  2RMK B;  2IU3 A;  1SQV H;  1QVF U;  1OCR B;  2D2C B;  2W6I G;  3K5L A;  2P22 C;  1Q7Y W;  1VAR A;  4DV4 B;  4O4J B;  2OCC C;  2X6B A;  2IU0 A;  1WP7 A;  4K35 A;  4LF8 B;  3LSU A;  3E22 B;  4UCV A;  3F5W C;  3CPW U;  2Q7H A;  3B77 A;  2AZ2 A;  3K5N A;  1KKD A;  2RDC A;  4DV2 O;  2ZR3 A;  1PKX A;  5GTH Z;  1VQN V;  3H1H H;  3F7V C;  3APO A;  4DV7 O;  4DV1 O;  5KLV H;  3WFV A;  1G8M A;  4MT8 A;  4B7E A;  2Q7G A;  1GAX A;  1Q8I A;  3K06 A;  1GN3 A;  3OFN G;  1JX9 A;  5AG2 A;  4U7N A;  4Q20 A;  4ASU G;  1N34 O;  2CUG A;  3ZED A;  4I0X B;  2AHZ A;  3CC7 V;  1AI4 A;  4PI2 A;  1SQX H;  1P49 A;  5C8Y B;  4DR6 B;  2GHY A;  4JI3 O;  3ETG A;  2WLJ A;  4NTY A;  1EFR G;  2JGU A;  2DWD C;  3K03 A;  4ICG A;  4K0K B;  1A32 A;  2PTM A;  3ZIA G;  3CME V;  4P9O A;  5CA0 B;  4JV5 B;  1NH2 D;  1HNZ O;  1MOF A;  3CC4 V;  3K79 A;  3WU2 Z;  5F2V O;  2MW2 B;  3APQ A;  4N23 A;  1Q43 A;  1HR0 B;  5GON B;  1SF9 A;  5D5Q A;  2JJ2 G;  1ZX3 A;  1E79 G;  2OCC B;  3M8A A;  4B3S O;  3DC5 A;  5B1A C;  4E4E A;  5LGN A;  1COW G;  1AB3 A;  3G4S V;  3T1H O;  2QJ1 A;  4H44 B;  2IBZ H;  4EB6 A;  3RVZ A;  2DQ0 A;  2XAJ A;  1Y76 A;  4WFA V;  5JJJ B;  1GO3 F;  3ZMV A;  2ADQ B;  1KMI Z;  2IJI A;  4OX9 B;  3VQX A;  1R1B A;  3A2F A;  1VEW A;  3P3N A;  1RM1 C;  1JJO A;  5JVD B;  1K4D C;  1TVK B;  2Q0O C;  4LF4 O;  1P4R A;  5LHG A;  3WB0 A;  3JAM N;  1PL0 A;  1IDS A;  3CCQ V;  2P90 A;  4TV8 B;  4ZOL B;  3E35 A;  1F23 A;  2GSM B;  1CP9 A;  1I5Y A;  1XL6 A;  2F95 B;  4JYY A;  5IYC O;  3A0R A;  3RT3 C;  3D36 C;  5LMU B;  4BW5 A;  3BY6 A;  1W59 A;  1HDJ A;  2IJK A;  1RSO B;  5D5P A;  2CH7 B;  3AEI A;  1QVG U;  1VQL V;  2LW7 A;  4I50 B;  4CS4 A;  4O4J A;  3CCJ V;  2WLH A;  4JZG A;  4X62 O;  4X89 A;  1XRE A;  4G27 B;  3E22 A;  1EN5 A;  1BL8 A;  4QPJ A;  2E3C A;  2JS3 A;  2BCC H;  5J2T B;  3LSQ A;  2QWO B;  2WLL B;  1YSC A;  4AQY O;  1KYO F;  1AI7 A;  4FVM A;  2HJD A;  1PL4 A;  5E79 Z;  5B1A B;  2LGW A;  2IJJ A;  4CH6 A;  1CEZ A;  5EBL C;  1AJN A;  2UUB O;  3C3S A;  1S72 V;  3AG4 C;  3RW0 A;  3F5T A;  3SJQ C;  2E75 B;  1YHQ V;  4LFB O;  4U3J A;  4CC6 A;  4XDJ A;  1ROP A;  2UUA O;  1YJN V;  4I0X A;  1HW7 A;  4FMT A;  2QWN B;  2DE0 X;  3CCV V;  5C8Y A;  3CX5 F;  3KZI Z;  4UVB A;  1FJG B;  1RM1 B;  2QDO A;  2HHH B;  2IH3 C;  3K0G A;  4QJF B;  2P06 A;  3FB6 C;  2NN4 A;  2FTK A;  2E74 B;  3BEH A;  5CA0 A;  5KUK A;  4UV9 A;  3JAK B;  3K58 A;  4FLV A;  2PF4 E;  1IXB A;  1XQ8 A;  2CGO A;  5LGT A;  1WN7 A;  2ZIM A;  1Q81 W;  1K92 A;  1US6 A;  2NR5 A;  4FZ1 A;  4B7K A;  5B1N A;  5GON A;  1DLB A;  1BCC H;  1L0N H;  4NXM B;  1TGO A;  2HEP A;  2B1I A;  4MVZ A;  2F66 C;  4MVM A;  4KFM A;  4DR5 O;  2QKS A;  4LR3 A;  4CS2 A;  2YDE A;  3N2K B;  1SS3 A;  2IW5 A;  2JEU A;  5KAI Z;  2H8P C;  2A7W A;  2WAM A;  5BR8 O;  4JI2 O;  2A06 H;  3E83 A;  3MAQ A;  3VOU A;  4H0L B;  4F6R B;  5LP6 C;  1FXK A;  5LOV B;  4OGQ B;  1SA0 B;  1E1Q G;  3VBB A;  4MVU A;  1TVK A;  4ZKI A;  2UUC B;  1Z2G A;  2B9Z A;  2CTP A;  4TV8 A;  4TOI A;  4LF8 O;  3H1L H;  4ZOL A;  1R6N A;  3L9D A;  1THZ A;  2ADP A;  2ZIO A;  2BOB C;  2R9R B;  4EFE A;  4B3T O;  2YEV B;  3LSS A;  1XI1 A;  4DW1 A;  2V4D A;  1RSO A;  2ZXW B;  2CH7 A;  1T5E A;  3H1I H;  4EEQ A;  4I50 A;  3GVM A;  1BHA A;  1Z5V A;  1Q6I A;  3ZRX A;  1YCI A;  4DV2 B;  3HR0 A;  3STZ C;  1H2K A;  3T1C A;  2UXC O;  4LH6 A;  5K1X A;  4DV7 B;  5J2T A;  1BE3 H;  4R8C A;  4H33 A;  4PDM A;  4DV1 B;  1H8E G;  3J7A U;  5FL7 G;  2WLL A;  4MW8 A;  4WCE V;  5L3G A;  2CGN A;  3WG7 C;  4N21 A;  2GBO A;  1W2B U;  4GCZ A;  1M5I A;  2GUZ B;  2JS5 A;  1N34 B;  4IYI A;  4D7S A;  1JR9 A;  1XBL A;  2WLM A;  1ZLZ A;  5LHI A;  3ZHU A;  2DYS B;  2UXX A;  5IDJ A;  2R9I A;  3D3I A;  3ML0 A;  1Q82 W;  2LW1 A;  4JI3 B;  3IC7 A;  3ABL C;  3D3Q A;  5LP6 B;  3ZHS A;  1SQB H;  2MK3 A;  2WLI B;  2L6L A;  4L8J A;  3L70 H;  1GM9 A;  2VRZ A;  4NXN O;  4X8A A;  1EZJ A;  1HNZ B;  1QR8 A;  2QR4 A;  3FYI B;  5EC1 C;  2RQ6 A;  1YDX A;  4Q6G A;  1AR4 A;  4MTF A;  4OXS A;  3S3X A;  3JAK A;  1M56 C;  4X1I B;  2OIG A;  3D36 A;  3ZRS A;  2ILM A;  4HAM A;  2N04 A;  4B3S B;  3HKD B;  3BPZ A;  4CC5 A;  1YEW A;  5E1A C;  4O4L B;  4UFZ A;  2YUA A;  3G80 A;  2Q9L A;  3T1H B;  3CWB H;  1Q90 D;  4LF7 O;  3N2K A;  3SPJ A;  2X6C A;  4WFH A;  1WB8 A;  4Z1M G;  3UO3 A;  1JJ2 U;  3OTF A;  5LHH A;  4I7Z B;  3JAW B;  2GV9 A;  2Y48 A;  1RFY A;  3WG7 B;  2DN9 A;  1H38 A;  1S3J A;  2ZNI A;  1S5L Z;  1WJZ A;  4F6R A;  4LF4 B;  5LOV A;  3HKC B;  3TJT A;  3SPH A;  1SA0 A;  3ASN C;  1SET A;  2W0X A;  4QE7 A;  1GH6 A;  4DXW A;  1N0J A;  2FML A;  4QIW F;  4LBE C;  3LDE A;  1YTF D;  4P2Z A;  3OEH G;  2EJ7 A;  3JCU Z;  4LC1 A;  2JJ1 G;  2F4V B;  3ABL B;  3M7M X;  4O4I B;  2LJ2 A;  5BZB A;  1S76 D;  1LNQ A;  4XBF A;  5LBQ A;  2QWQ B;  2ZE6 A;  4LWS B;  4H37 A;  4D7T A;  1K5S A;  2YEV A;  2RCV A;  4X62 B;  1SQQ H;  1X4T A;  1PD3 A;  2ZD9 A;  1VF5 B;  3JAL B;  3GWO A;  3ZHQ A;  1XMQ O;  1VQO V;  3AK3 A;  1RP3 B;  1WB7 A;  1KUQ A;  5CN0 A;  4KL1 A;  5EIB D;  1KP3 A;  1M56 B;  1VQP V;  4AQY B;  5IY5 C;  2M7W A;  3JSL A;  2CDY A;  3ABM B;  1TUE B;  2YIC A;  1AR5 A;  3E8F A;  2K1E A;  3JD2 A;  5EBM C;  2UUB B;  1V55 C;  1JMK C;  1BT8 A;  5EBW C;  4OPA A;  1HNX O;  4LFB B;  4DV6 B;  3AG2 B;  3TXQ A;  3THO A;  4RAI A;  2GUZ A;  3QF7 A;  2UUA B;  1QHT A;  4J9Z B;  2AZ0 A;  3ZHV A;  1FAF A;  2JGD A;  5A9G A;  1GK9 A;  3X2Q C;  4YJ2 B;  1PNL A;  3DXR B;  4R50 A;  1CPY A;  3H9V A;  5LP6 A;  5CBF A;  1XDC A;  4DR7 O;  2PYL A;  2GTA A;  3G6E V;  2X7R B;  3ASN B;  1BQ0 A;  1DK1 A;  5JWP A;  1PM9 A;  2A79 B;  4X65 O;  2ODM A;  4ZIB A;  3ABK C;  3MD0 A;  4LCU C;  1BS3 A;  2Y69 B;  4F4L A;  1EBO A;  3C90 A;  3JAS B;  1FXV A;  5IE9 A;  4FZ0 A;  3RGB A;  4RWU A;  5IWA O;  2W6J G;  2H3O A;  5FLX N;  2YIB A;  3HKD A;  2XND G;  4DR5 B;  2EIN B;  3W7U A;  1W0K G;  5LMN O;  2DMX A;  4O4L A;  4NB5 A;  5IYZ B;  3A0B Z;  5BR8 B;  1R6K A;  4JI2 B;  3ZBH A;  4RUE A;  2LQT A;  2FB5 A;  2YXL A;  5IY5 B;  4FLX A;  3A0H Z;  3CHX A;  3ABT A;  1KD1 W;  3P32 A;  4JI7 O;  1AIL A;  4JI4 O;  3JYC A;  1JQ0 A;  1PPJ H;  2R9A A;  2YIA A;  1H2S B;  1V55 B;  1YVW A;  4BW9 A;  5ITZ B;  3RVY A;  1HWY A;  3E8B A;  4X88 A;  3HKC A;  2F1M A;  1N36 O;  1S77 D;  1CXZ B;  4NKG B;  5EC2 C;  3CMA V;  4NVP A;  3CRM A;  2Q68 A;  3ZN1 A;  1BGY H;  3OW2 U;  3X2Q B;  4B3T B;  1RPR A;  2V7Q G;  4FPP A;  3B40 A;  4LWS A;  2HR3 A;  1S5J A;  4JAV A;  4I9Q A;  3B09 A;  2UXC B;  3JAL A;  3CCM V;  1YXB A;  1AI5 A;  1Q5O A;  4PDR A;  1HNW O;  4C7U A;  1G6U A;  3ABK B;  1VMG A;  1JOY A;  5KA5 A;  1M57 C;  5IYD O;  3T2M A;  3SJC C;  1KB9 F;  1QQC A;  1Y6X A;  2CAZ C;  1Q86 W;  2B5U A;  1NKD A;  4TV9 B;  4RO2 A;  1I94 B;  2EBO A;  4HZ3 A;  3ZMU A;  3FB8 C;  2XTA A;  3E2E A;  1M1K W;  1ZUQ A;  1VQ9 V;  1BQZ A;  3DC6 A;  3HPL C;  3AG3 C;  4GYC B;  3RBZ A;  3K9S A;  1OCO B;  2FKX A;  5KMG B;  4LFC O;  2ZIN A;  4YJ2 A;  3DXR A;  4DV3 O;  3SPC A;  4NXN B;  5TIS Z;  3CS5 A;  3HB3 B;  1I5X A;  4RUF A;  2BTQ B;  1KC8 W;  4QE9 A;  3ZS8 C;  1FD9 A;  1WLE A;  2Z0A A;  1GKF A;  1VQ5 V;  3FFQ A;  1V9P A;  4TUY B;  2HG5 C;  2Z5U A;  2RNB A;  4DR3 B;  1VQ4 V;  4TT3 G;  1QLE C;  3QG5 A;  2BE3 A;  2JVD A;  2BSK B;  4JI1 O;  3JAS A;  5KHK A;  4K8Z A;  4DK1 A;  3CSX A;  1QU7 A;  1F7Y A;  2ZQM A;  1DF5 A;  1P7G A;  3RYF B;  4UUJ C;  4LF7 B;  1J95 A;  1MMM A;  3RWR D;  4ZHQ B;  1UFI A;  3G67 A;  5IYZ A;  4AIL C;  3CCS V;  4PD4 F;  1M57 B;  2QSA A;  5KX5 B;  3U0Z A;  5H6Q A;  4YIO A;  2KKW A;  4WFF A;  3K59 A;  1SQF A;  1O9G A;  2CE4 A;  3I56 V;  2LFR A;  1Y67 A;  3JSN A;  3T4D A;  1NJI W;  1TAE A;  2RJZ A;  4J7K A;  5BY1 A;  4J10 A;  3BA9 A;  3FB7 C;  4G2K A;  2F4V O;  4JI6 O;  3K0D A;  4LP8 A;  2DWE C;  1QR9 A;  5ITZ A;  4IT5 A;  1XOU A;  3CE2 A;  4UCR A;  2OIE A;  2HP8 A;  3OMI B;  5L3C A;  4F6E A;  3AG3 B;  4BIU A;  4JI8 O;  3I5D A;  1H2N A;  1NZ6 A;  2HFE C;  1VQ7 V;  2QGN A;  3FYE B;  1F4M A;  1B3Q A;  2CK3 G;  1LUW A;  3OTO O;  4JTC B;  3IAY A;  5KAF Z;  1XMQ B;  5IJ0 B;  3O9O A;  1GM8 A;  2EIM C;  5BXZ A;  4DRX B;  3FD9 A;  1Y66 A;  2CTQ A;  4DV6 O;  4J11 A;  1NBM G;  4FLT A;  1N8R W;  1MSW D;  1OCC C;  2UXN A;  5KUM A;  2QTS A;  2KSD A;  1O9H A;  1HNX B;  4TV9 A;  3N2G B;  4GZR B;  4FK5 C;  5DN6 G;  4EKW A;  1VQ8 V;  4LF6 O;  2LP7 A;  2N05 A;  3OUS A;  4DYL A;  5H6R A;  3E86 A;  3TK1 A;  3TXS A;  3ZCC A;  1GTO A;  2UXD O;  5KMG A;  4DR7 B;  2KG7 B;  4HBN A;  4X20 B;  3SJA C;  1S0V A;  3K9A A;  4I55 B;  1N32 O;  4LF9 B;  2BTQ A;  1VQ6 V;  3B8N A;  1VF7 A;  1R6T A;  4X65 B;  2BTO A;  2IH1 C;  3I55 V;  4GX0 A;  3ICX A;  1N33 O;  2VQE O;  5KHJ A;  4PDV A;  4TUY A;  3WB1 A;  2P6J A;  5IWA B;  3EVK A;  1SES A;  5LMN B;  3ZRW B;  2BSK A;  3ETE A;  1B6Q A;  3H1K H;  4X64 O;  4ABM A;  1M90 W;  1AP6 A;  3RYF A;  4CH5 A;  1YZB A;  5JVD A;  3AG4 B;  2EIM B;  4ZHQ A;  3BHP A;  1K4C C;  4JI7 B;  3T1Y O;  5KX5 A;  3E89 A;  1OCC B;  4JI4 B;  4DUZ O;  1G1X B;  2WA4 A;  4GKJ O;  2YI8 A;  3J80 N;  4DUY O;  3UT5 B;  4JZ2 A;  4AI8 A;  3U11 A;  2AHY A;  1N36 B;  3WB2 A;  4K3A A;  4DW0 A;  2B1G A;  1MG1 A;  1P84 F;  1OHH G;  1X59 A;  3AK2 A;  1U97 A;  1HP8 A;  4YY3 O;  1XNQ O;  4X9Q A;  1Z5W A;  5CMU A;  3BVO A;  2O57 A;  2ZNJ A;  4GUN A;  3OMN B;  3QTC A;  1D5N A;  2VQF O;  1IVS A;  4GX5 A;  4UCS A;  3OMA B;  1HNW B;  1I08 A;  4I4T B;  5IJ0 A;  1I94 O;  1OJH A;  4JI5 O;  4FLZ A;  4YJ3 B;  1FFT B;  4KXR A;  4CH3 A;  4DRX A;  1NQT A;  1NR1 A;  5B5E Z;  3NR7 A;  4LNU B;  4UVA A;  2Q5Z A;  3KCX A;  4AHC A;  1DGS A;  2QKA A;  2ZDI C;  2OTJ V;  3N2G A;  2FL4 A;  4QPK A;  3SYA A;  1KKC A;  3JAT B;  4J7J A;  2GTS A;  4O2B B;  1SRY A;  3AG1 C;  3CXC U;  4NYK A;  4LFC B;  1BHB A;  3EHB B;  1AR1 B;  4DV3 B;  4WFG A;  3O65 A;  4J80 A;  5EYP B;  4DR3 O;  1XNR O;  2KG7 A;  1V54 C;  3CD6 V;  2VS0 A;  3ASO C;  4KUM A;  4X20 A;  2QWP B;  4I55 A;  4HYO A;  4J9Y B;  1VP7 A;  5FPR A;  4DV0 O;  1W0J G;  4Z1V A;  1JA8 A;  4R6Z A;  4DR2 O;  5K1P A;  1WAZ A;  3R66 A;  4JI1 B;  3P30 A;  3QO7 A;  2XOK G;  5IT9 N;  1XMO O;  1K97 A;  1WPB A;  3ZRW A;  5JJE B;  3D8C A;  3K5M A;  4PEL A;  4PA9 A;  4CS3 A;  2PI5 A;  1ENV A;  5B1B C;  1I7F A;  1RPO A;  3AG7 A;  1WP8 A;  3UM7 A;  3LNM B;  2D3O W;  1H2M A;  2EIJ C;  4FM0 A;  4MS2 A;  4TWK A;  4X66 O;  1NH2 B;  5L3D A;  4J42 A;  4PHZ A;  5CA3 A;  1K9M W;  4JI6 B;  5KHG A;  4MVQ A;  3UT5 A;  4PI0 A;  2R70 A;  1XHZ A;  4LF5 O;  1JFF B;  1XHX A;  2M6Y A;  3OGC C;  1PP9 H;  1NI8 A;  1LUV A;  4JI8 B;  3AG1 B;  1OCZ C;  2E5L O;  2P4V A;  3RN4 A;  1MNG A;  3KG2 A;  3CYO A;  2EZO A;  5LL6 Y;  3IFX A;  1FPO A;  3JD0 A;  4JPR A;  3OTO B;  1V54 B;  1SQP H;  3ASO B;  3JD4 A;  4XDK A;  1FFX B;  3U10 A;  5CBH A;  1VQK V;  3T4Z A;  4EFB A;  4I4T A;  5LA6 B;  2DJV A;  4YJ3 A;  1ARO P;  2QEX V;  2JRI A;  1OZ0 A;  4IHJ B;  3OD4 A;  3ZMZ A;  5EK0 A;  3OUF A;  1WPX A;  4LNU A;  4MTX A;  1FKA O;  2KQX A;  4BAY A;  1GN2 A;  4LF6 B;  2PY5 A;  1K34 A;  2WLI A;  1K33 A;  4UCT A;  3OR7 C;  3JAT A;  2XAG A;  2R72 A;  4LF9 O;  4P9P A;  4W4K A;  1P7B A;  1OV9 A;  2EIJ B;  4O2B A;  1L0L H;  1SER A;  4B3R O;  2X0L A;  2UXD B;  1BZK A;  1NS1 A;  3UKM A;  2ZR2 A;  4UCO A;  2C2A A;  4MSW C;  1N32 B;  4X1I A;  5EYP A;  4IYH A;  4CBC A;  2ZE8 A;  5KHI A;  3ZMS A;  1AP5 A;  2H94 A;  1IX9 A;  1N33 B;  5IYB O;  2Q6A A;  2VQE B;  1KP2 A;  5B3S C;  4IGG A;  1OCZ B;  4MTG A;  1IUR A;  2QKC A;  4FLU A;  1Y76 B;  1H2L A;  3L72 H;  1YI2 V;  4PA7 A;  2XAQ A;  4X64 B;  3BCC H;  5HFL A;  2Q7E A;  1IXM A;  3JAW A;  4JI0 B;  4X1K B;  2UXB O;  1YF2 A;  2G38 A;  4G28 B;  1JPX A;  4FLW A;  3MDS A;  2EUL A;  1QBZ A;  1IBL O;  3T1Y B;  3MHH C;  1GMG A;  3F7Y C;  4QNH B;  2P7T C;  2WPD G;  2XT9 A;  4DUZ B;  2WSS G;  4GKJ B;  4DUY B;  2DYR C;  4PV1 B;  4BWA A;  3CP1 A;  1MZE A;  1JCH A;  1MA1 A;  1NT2 B;  4QGP A;  4O4I A;  3K3W A;  2ZDI A;  4XDL A;  4GKK O;  5L3B A;  4UVC A;  1JFF A;  1KBH A;  4CZZ A;  4UXN A;  4YY3 B;  3CXH F;  3ETD A;  1XNQ B;  1FXH A;  1TUB B;  2PZS A;  3W7T A;  5CB4 B;  2A9H A;  1XEQ A;  1J5E O;  1M4U A;  2YIB D;  3IJ4 A;  5B66 Z;  3W7W A;  1K8A W;  3OM3 B;  1E1R G;  2PUS A;  2VQF B;  2QM8 A;  1ZSP A;  1FXK C;  3B2E E;  3W7S A;  2YS8 A;  1R3J C; 
#chains in the Genus database with same CATH homology
 4W4L A;  4IYH A;  3FX7 A;  4J42 A;  4J11 A;  4IYI A;  4J7J A;  4J41 A;  2GTS A;  2G38 A;  4J7K A;  4KXR A;  4J10 A;  4W4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...