2G38A

A pe/ppe protein complex from mycobacterium tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
77
Chain Sequence
b'PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PE FAMILY PROTEIN
publication title Toward the structural genomics of complexes: Crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 33
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 2g38A00
4J11A 4J7JA 4W4LA 3FX7A 2G38A 4J10A 4J41A 4J42A 2GTSA 4IYHA 4J7KA 4KXRA 4IYIA 4W4KA
chains in the Genus database with same CATH superfamily
2M7WA 3W7TA 1QLEC 5ITZB 4X66O 2Z0AA 4FJCC 4FLZA 4P2ZA 4JYYA 2UXCB 1J95A 2UUAO 3BVOA 5LGUA 1FXKC 1OHHG 4YHHO 3BRCA 2Y4UA 4GKJO 1KKDA 1Q86W 3K0GA 1W0KG 2X6BA 3OTOB 1YITV 2EIKB 4DR7B 2XUMA 3WG7C 3O9OA 3H1HH 3CD6V 4BW9A 1CEZA 4EB6A 1X4TA 5B5EZ 1NI8A 2YI8A 3WB2A 3B8NA 5IYCO 1UFIA 4AQYO 2F23A 4I50B 2Z5UA 5KX5A 4DR6O 2P06A 1WP8A 3OMAB 2L6LA 3CCMV 2UU9B 4KUMA 1AR5A 4X65B 2N74A 3PJSK 1KC8W 1AI6A 1LR1A 2AZ0A 4KP4A 4QNHB 3MAQA 2PY5A 3ASOB 1VQOV 1K92A 1XEQA 2LFRA 5KA6A 4NXNB 2Q5ZA 2VS0A 1FFTB 3U10A 3L75H 4UVBA 1P7GA 3RT3C 5KHHA 1RSOB 5AG2A 1HNWB 2YEVA 2Q0OC 1VQMV 1VQ4V 3AK3A 1FPOA 3K06A 2B1IA 4PI0A 3DSQA 4JI7O 4PHZA 3JAWA 1CXZB 2QSAA 2QTSA 1XI1A 1Y66A 2Q68A 1GAXA 1BS3A 2Z3YA 3SDLA 1OJHA 5IJ9A 3T1YO 4B7EA 3LSQA 4PA3A 2UXDO 3B40A 2UXXA 1I94B 1TGOA 2W0FC 1ZWIC 4IYHA 2E3CA 3RN4A 2RN9A 3G67A 1Q90D 1XDCA 4JGSA 1VQPV 1XMOO 3B09A 4ZOLA 2JS5A 2E74B 1VQ7V 1H2LA 4YJ3A 4JI2B 4NTWA 4LFBO 1NT2B 4RQFA 4ZI7A 5KX5B 4X62O 3K57A 2KKWA 4UB8Z 2R72A 1CP9A 3HKDA 3APQA 2LO1A 4BW5A 4F6RA 1J5EB 1N34O 2WLLA 2HR3A 5KAIZ 5KUKA 2EIMC 4GZRB 3CCSV 3L74H 3O65A 2LJ2A 1MA1A 4CC5A 5IYDO 2XAJA 4EFBA 4MSWC 2E5LO 5B1AB 4BIOA 5JJEB 3RVZA 1SQXH 3CJHB 1QCEA 2P7TC 3T1HB 2ZD9A 1O9GA 3OR7C 4UB6Z 4HZ3A 1PNLA 1JJOA 1AI5A 4KHPO 1U96A 2AW9A 1K8AW 1N0NA 4B3RO 4HBNA 3G80A 5B1OA 2ZM6O 4I5SA 3IC9A 4O4IA 3OW2U 1GN6A 2LGWA 3B4SA 5IJ9B 2V4DA 4A5UB 1KMIZ 2EULA 2CK3G 5LA6B 1FJGO 4LF4O 3DXRA 4OX9O 1L8DA 2XTAA 1PPJH 1K97A 1B04A 1QQCA 3CRQA 4B3SB 1GTOA 2X7RB 5FPRA 3J80N 1OCOB 4PV1B 4ZOLB 5JVDB 5LL6Y 4I55A 2IH1C 2BTOA 2ITDC 2JS3A 4I0XA 4FLUA 2BSKA 1JJ2U 1NR7A 4LNUB 5B1BC 2YIBD 1XMQB 1NQTA 2GDSA 4AI8A 1AI4A 4FK5C 3OTOO 1MZFA 1KB9F 1SQVH 4DV2O 3K59A 4B3TB 4DR7O 1NR1A 4NKGB 2QA4V 3HKDB 2QEXV 2F93B 3QNEA 4DR3O 3CCRV 4F6RB 1Q5OA 4G2KA 5HFMA 2WLLB 4P9OA 4FLYA 1XNRB 3D36A 4CZZA 1K9MW 1NKDA 3CSXA 5IE9A 3H1LH 2HHHB 4O4LA 2HEPA 3S3WA 4X65O 5LMUO 3MHHC 3N27A 2EIMB 4CBCA 3HKEB 4PDRA 4U3FH 3SYPA 2QJ1A 1NS1A 2YUAA 4PDVA 3I55V 4FLXA 1EFRG 4WFEA 4IIJB 4K3AA 1BCCH 1Y67A 2XAQA 4O4IB 4GX2A 1M1KW 4DR4B 3L9DA 1R6KA 2HFEC 1VF5B 1PD3A 4HAMA 3NXSA 4H44B 5LHHA 5J2UA 5BR8B 2BTQB 1XNQB 1HDJA 1EZVH 3TK1A 2QWRB 4FM0A 2RQ6A 1FXVA 3CCQV 1XOUA 2CTQA 3OMNB 4I0XB 2BSKB 3STZC 4MVRA 3SYCA 1I94O 2VQFB 2F1MA 4ZKIA 2CTPA 2ZXWC 3FB6C 3TGUH 5CA0A 4ZIBA 2ZINA 3N2KB 1H2MA 2AXTZ 5KHKA 2FMLA 1ENVA 1QVGU 3OAAG 1KQSU 5B1BB 5IT9N 4DV5O 2K1EA 3A0BZ 1AI7A 4JI2O 1PNMA 2CGOA 1E79G 3FB7C 2EILC 2XASA 5L3EA 3L70H 2UUAB 5J2TA 1J5EO 3SJQC 3SYAA 4H33A 4BWAA 5GW7A 4JI4O 5FPOA 1H8HG 1LUVA 2KG7A 1GKFA 2Q7EA 5IYBO 4LF8O 3I56V 5EK0A 4PA9A 1R6NA 2Q69A 1JMKC 4AQYB 4DR6B 1K5QA 3T1HO 4ZBMA 2JEUA 2R70A 2WLKA 2B9ZA 4PA4A 2QKCA 3SJAC 4IHJA 3ABKC 1N36B 1B3QA 2ZR2A 5J2UB 2QM4A 3C3TA 2YI9A 3SR2C 1HNXB 1Q3EA 2Q67A 3MHSC 2XT9A 1IXMA 3CXHF 4J41A 2WLIB 1YIJV 1QHTA 1V54C 4LF7B 1G6UA 3QTCA 3ZN0A 4FZ0A 3LNMB 3BABA 2DJVA 1D5AA 1Q82W 4B3SO 3UQ8A 3EXAA 1N32O 3D3QA 1SKVA 4UFZA 3VQYA 4Q6GA 2AHZA 1BQZA 2LGQA 2ITCC 1M9NA 4KFMA 5CA3A 2FKXA 1WJZA 4NR1A 4RAIA 1NTMH 2ZT9B 4PI2A 5H6RA 2ZXWB 3A0RA 3ZHVA 1R3JC 3P32A 4GX5A 4B3TO 3T1YB 1S72V 2OTJV 2UXDB 2P4VA 4DV3O 5J2TB 3ASNC 1K3EA 4DR2O 3AG1C 3ZEDA 1SESA 2ZNJA 3C3SA 1G4YB 2FB5A 4JI3O 5ITZA 1XNRO 3ZMUA 1XMOB 2KG7B 2VWKA 4I9QA 1V55B 2ZDIA 2HHHO 1BSMA 2VRZA 4MVSA 4LFBB 4LFCB 4CS3A 2B5UA 4JI5O 2Q9LA 3WFVA 3E22A 4LR3A 2GV9A 2LFSA 1EN6A 3BAAA 3FAVB 2RCVA 4QPKA 2D2CB 4IHJB 3ZS8C 2CAZC 3ABUA 1XUQA 4JZ2A 2Q7GA 2C2AA 4I50A 4DR4O 4WCEV 1RPRA 3EVKA 3X2QC 2CDYA 1KUQA 4MVOA 4UV8A 1OCRC 3ABKB 4CH3A 3ZMVA 2UUBO 4FM1A 1RM1B 3G6BA 4DV1B 3K5MA 1K4DC 4KHPB 1K5SA 3Q4HB 5JWPA 1GN2A 5EC1C 3ZRVA 2OWOA 1RSOA 3TXSA 1FJGB 2DYSC 3ZRXA 4LF4B 5C8YB 2JVDA 1HR0B 3CC2V 2QWPB 2EIJC 3SPHA 1HWYA 1R73A 2O57A 4YXWG 1OCCC 5BZBA 4GX1A 1AJPA 1VEWA 2D3OW 1XHZA 2UXNA 2ETNA 2FYUH 3RYHB 4ZHQB 3FYIB 3IGAC 2Y4TA 2HVJC 3ASNB 1JQ0A 3B8MA 3AG1B 4PD4F 1URFA 2MK3A 1NBMG 1VQNV 2H8PC 4NYKA 3FB8C 3E22B 4DV2B 2KB1A 2XAHA 1WAZA 1VQ5V 3LSUA 3CB2A 1R3IC 3P30A 4QE9A 4DR3B 1VQ9V 3TCUA 3ZMSA 4K8ZA 1FXKA 3BPZA 2QM8A 1H2NA 1NZ6A 2RMKB 1MOFA 3DGEA 1WB7A 1KECA 1NTKH 4DRXB 5LMNO 3RWRD 1SQBH 1NTZH 1AR4A 2DQ0A 5H5NA 1GH6A 5EIBD 2DMXA 5LMUB 4MVMA 2X6CA 4MS2A 4R7CA 4ASUG 5IJ0A 1N36O 5KUMA 4JTDB 1GM9A 4UCUA 1HNXO 2CTRA 3AG4C 1FKAO 2QGNA 3LDDA 1O9HA 4FVMA 3VQWA 4PELA 1SETA 4AHCA 4J9ZB 4JZGA 5LP6C 4LF7O 1IX9A 2G38A 3JASA 4X88A 1P84F 3CJHA 4JI6B 1JFFA 2B1GA 1AROP 3WB0A 3KCXA 4MT8A 4J7ZA 4OXSA 2Y0PA 2Y69C 4JI0O 3DC5A 4H37A 4DW1A 2A79B 4BIZA 4QE7A 2LW7A 5LA6A 2A9HA 1IZ3A 4UXNA 3KZIZ 4F4LA 2R9IA 4TQDA 3JCUZ 1QLEB 1OCCB 4X20B 4I7ZB 4DUZB 5JVDA 4LH7A 1S0VA 2YIDA 3CC4V 1RFYA 1KP2A 1P7BA 4O2BA 1ZX3A 1FXKB 4LNUA 5FNVA 4DV5B 2Q73A 2BOBC 4LFCO 3A0HZ 3R65A 4LCUC 3KKYA 3L73H 4ICGA 3WG7B 5IWAO 5CBFA 3ZHRA 5IJ0B 1L1FA 3LDCA 2NNUA 1VF7A 4JTAB 2XHBA 3HR0A 3LDEA 4JI4B 5CA1B 2DQ3A 2E75B 1SF9A 4MVUA 1R3LC 3BY6A 2BOCC 4LF8B 2Q7HA 4H13B 1VF6C 2JIZG 3RBZA 1GM7A 3JASB 1S3JA 4BR6A 3AG2C 3CCJV 4BIUA 3E8FA 3OEEG 1JFFB 4U7NA 4DV1O 1YDXA 3HKEA 4JASA 1EBOA 2ZIOA 2OCCC 1YTFD 3AG4B 1Q43A 2HJFC 4GYCB 3H01A 4IIJA 4RUEA 1EM1A 3SPIA 1JPXA 1IXBA 3K9AA 3D8CA 4X1YB 4O4JB 2GUZA 3CC7V 1S5HC 4F6EA 3ABTA 3JAMN 1H38A 3HB3B 4R8CA 1Y74A 4FPPA 4HNAB 2JEXA 4N21A 5EBMC 2GTAA 1HR0O 4TUYB 4DV6B 3W7SA 4FFBB 4IT5A 5B3SC 2HKOA 2JJ2G 1HNZO 3CS5A 1AP6A 3M8AA 3RGBA 3MDSA 1ZAUA 2BTQA 4NTXA 1N32B 2RDCA 1H8EG 5LGNA 1KKCA 4DV0O 4O2BB 4X9QA 2IJHA 5FNVB 3CXCU 4TOIA 1AVMA 2F95B 5LGTA 3W7XA 1MNGA 2DE0X 5JQGB 1NVPD 4WFFA 4X1KA 3N2KA 4LWSA 1Q6UA 4YIOA 2P67A 1WLEA 4DV3B 1THZA 1SZTA 3LSSA 1MZEA 4UV9A 4DR2B 1K73W 3IC7A 2DW4A 1F51A 3ZBHA 4LF6O 4D7TA 2P5OA 4JI3B 4TV9A 3QVNA 2DYRC 3OGIB 2CE4A 4LF9O 4P9PA 2IJKA 3VQVA 4JI5B 5J9PC 4K0KO 1ZTEA 4K8XA 1WA8B 3D3IA 3FKSG 3RVYA 1DLBA 4CS4A 3E8GA 4YJ2B 5JH7A 4FZ1A 1Q8IA 2PF4E 2YXHA 3JARA 3CCVV 2GUZB 1F23A 4JI6O 3QG5A 2F4VO 4U3JB 4R6ZA 3F7VC 2DWEC 1Y74B 5H9CA 5JCOC 5LHGA 3ICXA 4JYAB 3RYCB 4H0LB 3OEHG 2UUBB 1FD9A 4B7KA 1WP7A 1NU1H 4JYCA 2PUSA 2NLJC 4W4KA 2ZE6A 4W4LA 3ZIAG 1VQKV 3T1CA 3ZMZA 4KXRA 2WLIA 2DN9A 1K4CC 4WFBV 4O4HA 3C90A 5TISZ 3ETGA 4X1KB 1E1RG 2CTWA 2X0LA 4LWSB 2YXLA 4UCVA 2ODMA 4DUZO 4MVQA 3CEIA 3K04A 1TUEB 2DOSA 3K3WA 2CGNA 3L72H 3BA9A 4J7KA 4TV9B 4D7SA 4D6TH 1GMGA 2WA3A 2PGGA 1UJWB 3SPCA 3ZN1A 1I5XA 2OTLV 1IBKB 1OCZC 3HKBB 3JCZA 4MTFA 1NH2D 2PYLA 5IDJA 1DF5A 2DYRB 1EN5A 2ZE5A 2A3QA 5E79Z 4PJ0Z 1E1QG 5JH7B 3K03A 1PL4A 3JARB 3AG3C 4NXMO 5LMNB 2W0XA 1QNMA 4WBNA 3U11A 5FL7G 1KYOF 3FX7A 3OMIB 4HYOA 3FAVA 4PA7A 1ORQC 3J81N 4UCRA 4OPHA 3CMAV 1QLNA 2HVKC 1Y4MA 1Y76A 3RW0A 4DV4O 1MSDA 2WSSG 2CUGA 2QDOA 5LHIA 1V9PA 1M93A 4WF9V 4DUYB 2LW1A 1YJWV 1K7DA 4O4HB 2QE7G 1K33A 4DV6O 3UT5A 2W6IG 1B6QA 1F4NA 2UUCB 4DO2A 1WNSA 1Z2GA 1AB3A 2N04A 5D5QA 5CB4B 1PM9A 2YIAA 3Q4HA 3ABMC 4JI0B 3VBBA 3TXQA 1YHQV 3GVMA 3QO8A 2PI4A 4UVCA 3OM3B 2XNDG 4TV8A 1P4RA 3R66A 2A06H 1SERA 5C8YA 2GSMB 4JV5O 1N8RW 1TAEA 4MTGA 2QWNB 2YXYA 1W59A 4MW8A 1P49A 4J10A 4FM2A 1BL8A 1B06A 4X8AA 4IYIA 2EILB 1YSCA 2ADQB 3HKCB 5KMGA 3RYHA 4ZHQA 1EZJA 3RYIA 2P90A 2P4KA 4XDLA 1QR9A 1N33B 1US6A 2IJIA 4I4TB 4FLTA 1Z5WA 4RWUA 4G27B 4CC6A 4WBNB 4DR5O 1JOYA 2WAMA 3E83A 1DTOA 1AILA 1SA0A 5IWAB 3S3XA 1WPXA 3JSLA 3AEIA 4IL6Z 4DR1B 2GTSA 3OR6C 2P22C 1Y76B 3SPGA 4DRXA 3CPWU 3CX5F 1F7YA 2WPDG 3SYOA 3K79A 4J80A 5EIBC 4JYAO 1GRJA 1XHXA 3UT5B 3ZHSA 5EC2C 2LQTA 4OPAA 5HFLA 1SRYA 2QWOB 4JPRA 3B2EE 1XILA 4X1IA 4I9WA 4KL1A 3UCSC 2W6JG 4PDLA 4FFKA 4WFGA 3EHBB 1V54B 3CRMA 2EJRA 4E4EA 4TV8B 2Q4PA 4J42A 5KHJA 3CRRA 1YF2A 4UCSA 3JD4A 1VARA 3BEHA 1HNZB 1M4UA 4UVAA 4TQFA 2OYQA 3M7MX 3T4ZA 2XAFA 1DGSA 1EN4A 4OGQB 5IY5C 1ZLZA 3EFFK 2Y48A 5E1AC 1Z5VA 2WLJA 4NB5A 5KMGB 3H1JH 2KSDA 3LUTB 4DV0B 3RYIB 1AP5A 1Q81W 5BXZA 4JAUA 3ZHTA 2JJ1G 3OE7G 5D5PA 3ZJZA 5LYJB 1IBKO 1XREA 5KA5A 4X20A 3FD9A 1BHBA 4XDKA 5GTHZ 3T4DA 1SA0B 4QIWF 3WB1A 1PKXA 2HJDA 4X64B 2VWJA 4LF6B 1TA8A 4B3MB 2ADPA 1QR8A 2MW2B 3H1KH 3F7YC 3IJ4A 3K08A 3J7AU 4O2AB 2YC0A 4LF9B 1DK1A 4LP8A 2QKSA 5KHIA 3K58A 4K0KB 1LNQA 1TUBA 5CBHA 1BHAA 5CA1A 2YS8A 5BMVA 3X2QB 4X1IB 3RFRA 2WWWA 2HLDG 2IU3A 3BA8A 1F4MA 2JGUA 4DUYO 1OCRB 5H6QA 5EBLC 2Q8VA 5JJJB 5B1AC 4LFAB 2F4VB 4JAVA 2UUCO 3CRCA 2CH7A 2HP8A 3JD2A 3ABLC 3QF7A 3H1IH 4FLWA 5LXTB 4QGPA 4JI1B 3ZHUA 2IM9A 1YJ9V 1OV9A 5L3BA 2PZSA 5LP6A 1ROPA 4PDMA 5EYPB 5KAFZ 3M99B 4B08A 4X1YA 4O4JA 1GN4A 1Y6XA 2PYJA 2Q6AA 2PI5A 4GCZA 1I5YA 2DYSB 3I5DA 4HNAA 4MTXA 3JD0A 1IDSA 2EIJB 3ZMTA 4TUYA 2JGDA 4FFBA 4DK0A 3E89A 5DEDA 5IY5B 3QO7A 4Q20A 1GO3F 3ML0A 3K0DA 4JYBA 2VQEB 1OCOC 1M57C 1QU7A 1YI2V 1XL6A 1N33O 4JF3A 3T2MA 1IBMB 5JQGA 5FLXN 2K9PA 4P30A 2YDEA 1BE3H 3ZHQA 3TETA 3ZRSA 3SGIA 1BT8A 2ZKOA 1VIBA 4DV7O 3E86A 2ZE8A 2JK5C 2EZOA 4EB6B 1H2SB 1DF4A 2YIBA 2QKAA 4UUJC 4DR1O 1TUBB 3E8BA 1GM8A 1CPYA 1UPGA 4L8JA 3JALA 2WLHA 4EFEA 5BMVB 1HP8A 3BCCH 2WLNA 3CWBH 2H3OA 5CBGA 2BE3A 1VQ8V 4JI8O 3JD1A 3JYCA 2WA4A 4DK1A 1IBLO 4NXMB 2H94A 3FB5C 4Z1MG 1WB8A 1WA8A 2KQXA 2A7WA 4WFAV 4UCOA 5DN6G 2CH7B 2ZE7A 5L3FA 2AHYA 1JX9A 1AR1B 1VF6A 1VP7A 1SQFA 3VOUA 3RYFA 4FMTA 5LP6B 1IVSA 3UM7A 4YJ2A 4DYLA 4GUNA 2OCHA 5L3DA 3LNNA 3UO3A 1Q7YW 1SS3A 4U3JA 4DV4B 1YTFB 2YEVB 3ABLB 1VQLV 2RNBA 2YSUB 3KG2A 1YXBA 1SZXA 4LF5B 3GWKC 2RJZA 2IJJA 2Y69B 3RYCA 2JGDB 3DTUB 3ETEA 3JAWB 3W7WA 1I7FA 1TVKA 1W2BU 3VQXA 5DM6V 2EBOA 1SQGA 1IURA 3OTFA 1AJQA 1KP3A 3SYQA 3APOA 2X6AA 3HPLC 1KU9A 4AILC 4YY3B 1MMMA 3CHXA 1WN7A 1M57B 1LUWA 2EINC 4J11A 4JV5B 2UXCO 5DECA 4GKKB 4YJ3B 5L3CA 4WFHA 4X64O 4NVPA 1BGYH 4DW0A 1NVPB 4ZI7B 4B3MO 3JALB 1R1BA 3D36C 2XOKG 4CH4A 2OT5A 3P3NA 4TSFG 1FAFA 4TWKA 3HKBA 3F5WC 4EKWA 4DR5B 4MTOA 5LOVA 1L0NH 1X59A 1JCHA 1L0LH 4RQEA 4N23A 2ZCEA 3OD4A 3G4SV 4XBFA 3UO2A 3RYFB 4MW3A 2UU9O 3AG2B 4LFAO 4BAYA 1M56C 5CMUA 3NR7A 2OCCB 2Y0IA 1G1XB 3JATA 2PTMA 4QPJA 1VMGA 2JDIG 4Z1VA 2QM7A 4JI1O 4PA6A 1YEWA 2HG5C 2ZIMA 4X89A 4NXNO 2IH3C 3AK1A 5KHGA 3GWOA 3E2EA 1GK9A 5BY1A 2JRIA 1TVKB 1A32A 3OUSA 1HNWO 5JCOA 3AK2A 1BZKA 4LBEC 1G8MA 2WLMA 3DXRB 1S76D 5B3SB 4DXWA 5F2VO 4RO2A 1D2DA 3E35A 1FS0G 1S5LZ 3OGCC 1H2KA 3FFQA 5KLVH 4I55B 2VQEO 1N0JA 5CB4A 2FL4A 1RP3B 3GB7C 1S77D 2FTKA 2UXBB 5A9GA 3CP1A 3QO5A 1XBLA 1IBMO 3A8TA 1JR9A 5H2FZ 3TJTA 1FXHA 4K35A 4EEQA 1SC5B 2EZPA 4LC1A 5K1PA 2EINB 2V7QG 3SJCC 3OT7A 2QWQB 2M6YA 3KCYA 5LOVB 4QJFB 4FIPC 3L71H 4X66B 4G28B 3IAYA 5A2QN 3THOA 3HKCA 1V55C 2N05A 3K5LA 3A2FA 3CE2A 4O4LB 4YHHB 4I4TA 2GBOA 4GKJB 3IFXA 4C7UA 1I08A 3JAKA 2BCCH 1PNKA 3N2GA 2EJ7A 1NH2B 1FFXA 3E8HA 1ZSPA 2F43G 2L35A 5GONA 3JATB 5B1NA 2AGAA 1YZBA 2QTOA 1YCIA 4NTYA 3DC6A 3CYOA 3F5TA 2ATKC 3WU2Z 3JSNA 4FLVA 3JD3A 1VQ6V 1BMFG 2DWDC 3PN1A 1WPBA 1YVWA 1SQPH 1M56B 3ZRWA 1OZ0A 1R6TA 1Q6HA 4MVZA 3G71V 1PV0A 4LF5O 3ETQA 2ILMA 1H2GA 1ZUQA 3OFNG 1RM1C 1QVFU 2R9RB 1K34A 3CMEV 3CCLV 2QR4A 2NR5A 3K5OA 1S5JA 3ZCCA 5B66Z 5CA0B 4YY3O 5IYZA 4JAAA 4UCTA 2R9AA 5K1XA 5EZYA 1XQ8A 4U7OA 4GKKO 2ARHA 4JI7B 1XMQO 4GX0A 4LH6A 5L3GA 4ABMA 1MSWD 3CCUV 2XAGA 2IU0A 4JTCB 5CN0A 1KD1W 4CH5A 2NN4A 4GLXA 2ZDIC 4J7JA 3W7UA 1GN3A 1D5NA 2ZNIA 1R3KC 1AJNA 3JAKB 5LYJA 3MD0A 1OCZB 3N2GB 3CCEV 2OIGA 1ZL8A 1PP9H 1FFXB 1XL4A 5GONB 1JVMA 2EIKC 4DV7B 5LBQA 3K5NA 1HW7A 4XDJA 1NJIW 1COWG 1U97A 1YJNV 1RPOA 3AG3B 1Q6IA 1MG1A 4TT3G 3ZRWB 4E2LA 4X62B 5EBWC 1T5EA 3H9VA 4CS2A 1MABG 2OIEA 4O2AA 4JI8B 3STLC 4R50A 1IBLB 1N34B 2P6JA 2LP7A 5JJNB 3ZX6A 2F66C 4CH6A 4IGGA 3SJBC 4YIPA 4L87A 3FYEB 2V1DA 1M5IA 2A0LA 3ASOC 1BQ0A 1N4CA 3P3PA 2E5LB 1SQQH 1W0JG 3AG7A 3SPJA 5BR8O 1XNQO 3ETDA 5IYZB 3UKMA 1JA8A 1QBZA 5EZYB 3CRAA 5LXTA 1FYJA 2IW5A 2AZ2A 1PL0A 3ABMB 2UXBO 2Q0AA 5GTIZ 3BFRA 4B3RB 3G6EV 1KBHA 5C93A 2VQFO 2ZM6B 5EYPA 3OUFA 4Z2WA 2ZR3A 2E76B 2YICA 2ZQMA 3BHPA 2EX3A 4GT1A 1I0HA 1M90W 2IBZH 4OX9B 3K9SA 2GHYA 3U0ZA 4RUFA 3B77A 4J9YB 1ZL8B
chains in the Genus database with same CATH topology
4J11A 4J7JA 4W4LA 3FX7A 2G38A 4J10A 4J41A 4J42A 2GTSA 4IYHA 4J7KA 4KXRA 4IYIA 4W4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J11 A;  4J7J A;  4W4L A;  3FX7 A;  2G38 A;  4J10 A;  4J41 A;  4J42 A;  2GTS A;  4IYH A;  4J7K A;  4KXR A;  4IYI A;  4W4K A; 
#chains in the Genus database with same CATH topology
 2M7W A;  3W7T A;  1QLE C;  5ITZ B;  4X66 O;  2Z0A A;  4FJC C;  4FLZ A;  4P2Z A;  4JYY A;  2UXC B;  1J95 A;  2UUA O;  3BVO A;  5LGU A;  1FXK C;  1OHH G;  4YHH O;  3BRC A;  2Y4U A;  4GKJ O;  1KKD A;  1Q86 W;  3K0G A;  1W0K G;  2X6B A;  3OTO B;  1YIT V;  2EIK B;  4DR7 B;  2XUM A;  3WG7 C;  3O9O A;  3H1H H;  3CD6 V;  4BW9 A;  1CEZ A;  4EB6 A;  1X4T A;  5B5E Z;  1NI8 A;  2YI8 A;  3WB2 A;  3B8N A;  5IYC O;  1UFI A;  4AQY O;  2F23 A;  4I50 B;  2Z5U A;  5KX5 A;  4DR6 O;  2P06 A;  1WP8 A;  3OMA B;  2L6L A;  3CCM V;  2UU9 B;  4KUM A;  1AR5 A;  4X65 B;  2N74 A;  3PJS K;  1KC8 W;  1AI6 A;  1LR1 A;  2AZ0 A;  4KP4 A;  4QNH B;  3MAQ A;  2PY5 A;  3ASO B;  1VQO V;  1K92 A;  1XEQ A;  2LFR A;  5KA6 A;  4NXN B;  2Q5Z A;  2VS0 A;  1FFT B;  3U10 A;  3L75 H;  4UVB A;  1P7G A;  3RT3 C;  5KHH A;  1RSO B;  5AG2 A;  1HNW B;  2YEV A;  2Q0O C;  1VQM V;  1VQ4 V;  3AK3 A;  1FPO A;  3K06 A;  2B1I A;  4PI0 A;  3DSQ A;  4JI7 O;  4PHZ A;  3JAW A;  1CXZ B;  2QSA A;  2QTS A;  1XI1 A;  1Y66 A;  2Q68 A;  1GAX A;  1BS3 A;  2Z3Y A;  3SDL A;  1OJH A;  5IJ9 A;  3T1Y O;  4B7E A;  3LSQ A;  4PA3 A;  2UXD O;  3B40 A;  2UXX A;  1I94 B;  1TGO A;  2W0F C;  1ZWI C;  4IYH A;  2E3C A;  3RN4 A;  2RN9 A;  3G67 A;  1Q90 D;  1XDC A;  4JGS A;  1VQP V;  1XMO O;  3B09 A;  4ZOL A;  2JS5 A;  2E74 B;  1VQ7 V;  1H2L A;  4YJ3 A;  4JI2 B;  4NTW A;  4LFB O;  1NT2 B;  4RQF A;  4ZI7 A;  5KX5 B;  4X62 O;  3K57 A;  2KKW A;  4UB8 Z;  2R72 A;  1CP9 A;  3HKD A;  3APQ A;  2LO1 A;  4BW5 A;  4F6R A;  1J5E B;  1N34 O;  2WLL A;  2HR3 A;  5KAI Z;  5KUK A;  2EIM C;  4GZR B;  3CCS V;  3L74 H;  3O65 A;  2LJ2 A;  1MA1 A;  4CC5 A;  5IYD O;  2XAJ A;  4EFB A;  4MSW C;  2E5L O;  5B1A B;  4BIO A;  5JJE B;  3RVZ A;  1SQX H;  3CJH B;  1QCE A;  2P7T C;  3T1H B;  2ZD9 A;  1O9G A;  3OR7 C;  4UB6 Z;  4HZ3 A;  1PNL A;  1JJO A;  1AI5 A;  4KHP O;  1U96 A;  2AW9 A;  1K8A W;  1N0N A;  4B3R O;  4HBN A;  3G80 A;  5B1O A;  2ZM6 O;  4I5S A;  3IC9 A;  4O4I A;  3OW2 U;  1GN6 A;  2LGW A;  3B4S A;  5IJ9 B;  2V4D A;  4A5U B;  1KMI Z;  2EUL A;  2CK3 G;  5LA6 B;  1FJG O;  4LF4 O;  3DXR A;  4OX9 O;  1L8D A;  2XTA A;  1PPJ H;  1K97 A;  1B04 A;  1QQC A;  3CRQ A;  4B3S B;  1GTO A;  2X7R B;  5FPR A;  3J80 N;  1OCO B;  4PV1 B;  4ZOL B;  5JVD B;  5LL6 Y;  4I55 A;  2IH1 C;  2BTO A;  2ITD C;  2JS3 A;  4I0X A;  4FLU A;  2BSK A;  1JJ2 U;  1NR7 A;  4LNU B;  5B1B C;  2YIB D;  1XMQ B;  1NQT A;  2GDS A;  4AI8 A;  1AI4 A;  4FK5 C;  3OTO O;  1MZF A;  1KB9 F;  1SQV H;  4DV2 O;  3K59 A;  4B3T B;  4DR7 O;  1NR1 A;  4NKG B;  2QA4 V;  3HKD B;  2QEX V;  2F93 B;  3QNE A;  4DR3 O;  3CCR V;  4F6R B;  1Q5O A;  4G2K A;  5HFM A;  2WLL B;  4P9O A;  4FLY A;  1XNR B;  3D36 A;  4CZZ A;  1K9M W;  1NKD A;  3CSX A;  5IE9 A;  3H1L H;  2HHH B;  4O4L A;  2HEP A;  3S3W A;  4X65 O;  5LMU O;  3MHH C;  3N27 A;  2EIM B;  4CBC A;  3HKE B;  4PDR A;  4U3F H;  3SYP A;  2QJ1 A;  1NS1 A;  2YUA A;  4PDV A;  3I55 V;  4FLX A;  1EFR G;  4WFE A;  4IIJ B;  4K3A A;  1BCC H;  1Y67 A;  2XAQ A;  4O4I B;  4GX2 A;  1M1K W;  4DR4 B;  3L9D A;  1R6K A;  2HFE C;  1VF5 B;  1PD3 A;  4HAM A;  3NXS A;  4H44 B;  5LHH A;  5J2U A;  5BR8 B;  2BTQ B;  1XNQ B;  1HDJ A;  1EZV H;  3TK1 A;  2QWR B;  4FM0 A;  2RQ6 A;  1FXV A;  3CCQ V;  1XOU A;  2CTQ A;  3OMN B;  4I0X B;  2BSK B;  3STZ C;  4MVR A;  3SYC A;  1I94 O;  2VQF B;  2F1M A;  4ZKI A;  2CTP A;  2ZXW C;  3FB6 C;  3TGU H;  5CA0 A;  4ZIB A;  2ZIN A;  3N2K B;  1H2M A;  2AXT Z;  5KHK A;  2FML A;  1ENV A;  1QVG U;  3OAA G;  1KQS U;  5B1B B;  5IT9 N;  4DV5 O;  2K1E A;  3A0B Z;  1AI7 A;  4JI2 O;  1PNM A;  2CGO A;  1E79 G;  3FB7 C;  2EIL C;  2XAS A;  5L3E A;  3L70 H;  2UUA B;  5J2T A;  1J5E O;  3SJQ C;  3SYA A;  4H33 A;  4BWA A;  5GW7 A;  4JI4 O;  5FPO A;  1H8H G;  1LUV A;  2KG7 A;  1GKF A;  2Q7E A;  5IYB O;  4LF8 O;  3I56 V;  5EK0 A;  4PA9 A;  1R6N A;  2Q69 A;  1JMK C;  4AQY B;  4DR6 B;  1K5Q A;  3T1H O;  4ZBM A;  2JEU A;  2R70 A;  2WLK A;  2B9Z A;  4PA4 A;  2QKC A;  3SJA C;  4IHJ A;  3ABK C;  1N36 B;  1B3Q A;  2ZR2 A;  5J2U B;  2QM4 A;  3C3T A;  2YI9 A;  3SR2 C;  1HNX B;  1Q3E A;  2Q67 A;  3MHS C;  2XT9 A;  1IXM A;  3CXH F;  4J41 A;  2WLI B;  1YIJ V;  1QHT A;  1V54 C;  4LF7 B;  1G6U A;  3QTC A;  3ZN0 A;  4FZ0 A;  3LNM B;  3BAB A;  2DJV A;  1D5A A;  1Q82 W;  4B3S O;  3UQ8 A;  3EXA A;  1N32 O;  3D3Q A;  1SKV A;  4UFZ A;  3VQY A;  4Q6G A;  2AHZ A;  1BQZ A;  2LGQ A;  2ITC C;  1M9N A;  4KFM A;  5CA3 A;  2FKX A;  1WJZ A;  4NR1 A;  4RAI A;  1NTM H;  2ZT9 B;  4PI2 A;  5H6R A;  2ZXW B;  3A0R A;  3ZHV A;  1R3J C;  3P32 A;  4GX5 A;  4B3T O;  3T1Y B;  1S72 V;  2OTJ V;  2UXD B;  2P4V A;  4DV3 O;  5J2T B;  3ASN C;  1K3E A;  4DR2 O;  3AG1 C;  3ZED A;  1SES A;  2ZNJ A;  3C3S A;  1G4Y B;  2FB5 A;  4JI3 O;  5ITZ A;  1XNR O;  3ZMU A;  1XMO B;  2KG7 B;  2VWK A;  4I9Q A;  1V55 B;  2ZDI A;  2HHH O;  1BSM A;  2VRZ A;  4MVS A;  4LFB B;  4LFC B;  4CS3 A;  2B5U A;  4JI5 O;  2Q9L A;  3WFV A;  3E22 A;  4LR3 A;  2GV9 A;  2LFS A;  1EN6 A;  3BAA A;  3FAV B;  2RCV A;  4QPK A;  2D2C B;  4IHJ B;  3ZS8 C;  2CAZ C;  3ABU A;  1XUQ A;  4JZ2 A;  2Q7G A;  2C2A A;  4I50 A;  4DR4 O;  4WCE V;  1RPR A;  3EVK A;  3X2Q C;  2CDY A;  1KUQ A;  4MVO A;  4UV8 A;  1OCR C;  3ABK B;  4CH3 A;  3ZMV A;  2UUB O;  4FM1 A;  1RM1 B;  3G6B A;  4DV1 B;  3K5M A;  1K4D C;  4KHP B;  1K5S A;  3Q4H B;  5JWP A;  1GN2 A;  5EC1 C;  3ZRV A;  2OWO A;  1RSO A;  3TXS A;  1FJG B;  2DYS C;  3ZRX A;  4LF4 B;  5C8Y B;  2JVD A;  1HR0 B;  3CC2 V;  2QWP B;  2EIJ C;  3SPH A;  1HWY A;  1R73 A;  2O57 A;  4YXW G;  1OCC C;  5BZB A;  4GX1 A;  1AJP A;  1VEW A;  2D3O W;  1XHZ A;  2UXN A;  2ETN A;  2FYU H;  3RYH B;  4ZHQ B;  3FYI B;  3IGA C;  2Y4T A;  2HVJ C;  3ASN B;  1JQ0 A;  3B8M A;  3AG1 B;  4PD4 F;  1URF A;  2MK3 A;  1NBM G;  1VQN V;  2H8P C;  4NYK A;  3FB8 C;  3E22 B;  4DV2 B;  2KB1 A;  2XAH A;  1WAZ A;  1VQ5 V;  3LSU A;  3CB2 A;  1R3I C;  3P30 A;  4QE9 A;  4DR3 B;  1VQ9 V;  3TCU A;  3ZMS A;  4K8Z A;  1FXK A;  3BPZ A;  2QM8 A;  1H2N A;  1NZ6 A;  2RMK B;  1MOF A;  3DGE A;  1WB7 A;  1KEC A;  1NTK H;  4DRX B;  5LMN O;  3RWR D;  1SQB H;  1NTZ H;  1AR4 A;  2DQ0 A;  5H5N A;  1GH6 A;  5EIB D;  2DMX A;  5LMU B;  4MVM A;  2X6C A;  4MS2 A;  4R7C A;  4ASU G;  5IJ0 A;  1N36 O;  5KUM A;  4JTD B;  1GM9 A;  4UCU A;  1HNX O;  2CTR A;  3AG4 C;  1FKA O;  2QGN A;  3LDD A;  1O9H A;  4FVM A;  3VQW A;  4PEL A;  1SET A;  4AHC A;  4J9Z B;  4JZG A;  5LP6 C;  4LF7 O;  1IX9 A;  2G38 A;  3JAS A;  4X88 A;  1P84 F;  3CJH A;  4JI6 B;  1JFF A;  2B1G A;  1ARO P;  3WB0 A;  3KCX A;  4MT8 A;  4J7Z A;  4OXS A;  2Y0P A;  2Y69 C;  4JI0 O;  3DC5 A;  4H37 A;  4DW1 A;  2A79 B;  4BIZ A;  4QE7 A;  2LW7 A;  5LA6 A;  2A9H A;  1IZ3 A;  4UXN A;  3KZI Z;  4F4L A;  2R9I A;  4TQD A;  3JCU Z;  1QLE B;  1OCC B;  4X20 B;  4I7Z B;  4DUZ B;  5JVD A;  4LH7 A;  1S0V A;  2YID A;  3CC4 V;  1RFY A;  1KP2 A;  1P7B A;  4O2B A;  1ZX3 A;  1FXK B;  4LNU A;  5FNV A;  4DV5 B;  2Q73 A;  2BOB C;  4LFC O;  3A0H Z;  3R65 A;  4LCU C;  3KKY A;  3L73 H;  4ICG A;  3WG7 B;  5IWA O;  5CBF A;  3ZHR A;  5IJ0 B;  1L1F A;  3LDC A;  2NNU A;  1VF7 A;  4JTA B;  2XHB A;  3HR0 A;  3LDE A;  4JI4 B;  5CA1 B;  2DQ3 A;  2E75 B;  1SF9 A;  4MVU A;  1R3L C;  3BY6 A;  2BOC C;  4LF8 B;  2Q7H A;  4H13 B;  1VF6 C;  2JIZ G;  3RBZ A;  1GM7 A;  3JAS B;  1S3J A;  4BR6 A;  3AG2 C;  3CCJ V;  4BIU A;  3E8F A;  3OEE G;  1JFF B;  4U7N A;  4DV1 O;  1YDX A;  3HKE A;  4JAS A;  1EBO A;  2ZIO A;  2OCC C;  1YTF D;  3AG4 B;  1Q43 A;  2HJF C;  4GYC B;  3H01 A;  4IIJ A;  4RUE A;  1EM1 A;  3SPI A;  1JPX A;  1IXB A;  3K9A A;  3D8C A;  4X1Y B;  4O4J B;  2GUZ A;  3CC7 V;  1S5H C;  4F6E A;  3ABT A;  3JAM N;  1H38 A;  3HB3 B;  4R8C A;  1Y74 A;  4FPP A;  4HNA B;  2JEX A;  4N21 A;  5EBM C;  2GTA A;  1HR0 O;  4TUY B;  4DV6 B;  3W7S A;  4FFB B;  4IT5 A;  5B3S C;  2HKO A;  2JJ2 G;  1HNZ O;  3CS5 A;  1AP6 A;  3M8A A;  3RGB A;  3MDS A;  1ZAU A;  2BTQ A;  4NTX A;  1N32 B;  2RDC A;  1H8E G;  5LGN A;  1KKC A;  4DV0 O;  4O2B B;  4X9Q A;  2IJH A;  5FNV B;  3CXC U;  4TOI A;  1AVM A;  2F95 B;  5LGT A;  3W7X A;  1MNG A;  2DE0 X;  5JQG B;  1NVP D;  4WFF A;  4X1K A;  3N2K A;  4LWS A;  1Q6U A;  4YIO A;  2P67 A;  1WLE A;  4DV3 B;  1THZ A;  1SZT A;  3LSS A;  1MZE A;  4UV9 A;  4DR2 B;  1K73 W;  3IC7 A;  2DW4 A;  1F51 A;  3ZBH A;  4LF6 O;  4D7T A;  2P5O A;  4JI3 B;  4TV9 A;  3QVN A;  2DYR C;  3OGI B;  2CE4 A;  4LF9 O;  4P9P A;  2IJK A;  3VQV A;  4JI5 B;  5J9P C;  4K0K O;  1ZTE A;  4K8X A;  1WA8 B;  3D3I A;  3FKS G;  3RVY A;  1DLB A;  4CS4 A;  3E8G A;  4YJ2 B;  5JH7 A;  4FZ1 A;  1Q8I A;  2PF4 E;  2YXH A;  3JAR A;  3CCV V;  2GUZ B;  1F23 A;  4JI6 O;  3QG5 A;  2F4V O;  4U3J B;  4R6Z A;  3F7V C;  2DWE C;  1Y74 B;  5H9C A;  5JCO C;  5LHG A;  3ICX A;  4JYA B;  3RYC B;  4H0L B;  3OEH G;  2UUB B;  1FD9 A;  4B7K A;  1WP7 A;  1NU1 H;  4JYC A;  2PUS A;  2NLJ C;  4W4K A;  2ZE6 A;  4W4L A;  3ZIA G;  1VQK V;  3T1C A;  3ZMZ A;  4KXR A;  2WLI A;  2DN9 A;  1K4C C;  4WFB V;  4O4H A;  3C90 A;  5TIS Z;  3ETG A;  4X1K B;  1E1R G;  2CTW A;  2X0L A;  4LWS B;  2YXL A;  4UCV A;  2ODM A;  4DUZ O;  4MVQ A;  3CEI A;  3K04 A;  1TUE B;  2DOS A;  3K3W A;  2CGN A;  3L72 H;  3BA9 A;  4J7K A;  4TV9 B;  4D7S A;  4D6T H;  1GMG A;  2WA3 A;  2PGG A;  1UJW B;  3SPC A;  3ZN1 A;  1I5X A;  2OTL V;  1IBK B;  1OCZ C;  3HKB B;  3JCZ A;  4MTF A;  1NH2 D;  2PYL A;  5IDJ A;  1DF5 A;  2DYR B;  1EN5 A;  2ZE5 A;  2A3Q A;  5E79 Z;  4PJ0 Z;  1E1Q G;  5JH7 B;  3K03 A;  1PL4 A;  3JAR B;  3AG3 C;  4NXM O;  5LMN B;  2W0X A;  1QNM A;  4WBN A;  3U11 A;  5FL7 G;  1KYO F;  3FX7 A;  3OMI B;  4HYO A;  3FAV A;  4PA7 A;  1ORQ C;  3J81 N;  4UCR A;  4OPH A;  3CMA V;  1QLN A;  2HVK C;  1Y4M A;  1Y76 A;  3RW0 A;  4DV4 O;  1MSD A;  2WSS G;  2CUG A;  2QDO A;  5LHI A;  1V9P A;  1M93 A;  4WF9 V;  4DUY B;  2LW1 A;  1YJW V;  1K7D A;  4O4H B;  2QE7 G;  1K33 A;  4DV6 O;  3UT5 A;  2W6I G;  1B6Q A;  1F4N A;  2UUC B;  4DO2 A;  1WNS A;  1Z2G A;  1AB3 A;  2N04 A;  5D5Q A;  5CB4 B;  1PM9 A;  2YIA A;  3Q4H A;  3ABM C;  4JI0 B;  3VBB A;  3TXQ A;  1YHQ V;  3GVM A;  3QO8 A;  2PI4 A;  4UVC A;  3OM3 B;  2XND G;  4TV8 A;  1P4R A;  3R66 A;  2A06 H;  1SER A;  5C8Y A;  2GSM B;  4JV5 O;  1N8R W;  1TAE A;  4MTG A;  2QWN B;  2YXY A;  1W59 A;  4MW8 A;  1P49 A;  4J10 A;  4FM2 A;  1BL8 A;  1B06 A;  4X8A A;  4IYI A;  2EIL B;  1YSC A;  2ADQ B;  3HKC B;  5KMG A;  3RYH A;  4ZHQ A;  1EZJ A;  3RYI A;  2P90 A;  2P4K A;  4XDL A;  1QR9 A;  1N33 B;  1US6 A;  2IJI A;  4I4T B;  4FLT A;  1Z5W A;  4RWU A;  4G27 B;  4CC6 A;  4WBN B;  4DR5 O;  1JOY A;  2WAM A;  3E83 A;  1DTO A;  1AIL A;  1SA0 A;  5IWA B;  3S3X A;  1WPX A;  3JSL A;  3AEI A;  4IL6 Z;  4DR1 B;  2GTS A;  3OR6 C;  2P22 C;  1Y76 B;  3SPG A;  4DRX A;  3CPW U;  3CX5 F;  1F7Y A;  2WPD G;  3SYO A;  3K79 A;  4J80 A;  5EIB C;  4JYA O;  1GRJ A;  1XHX A;  3UT5 B;  3ZHS A;  5EC2 C;  2LQT A;  4OPA A;  5HFL A;  1SRY A;  2QWO B;  4JPR A;  3B2E E;  1XIL A;  4X1I A;  4I9W A;  4KL1 A;  3UCS C;  2W6J G;  4PDL A;  4FFK A;  4WFG A;  3EHB B;  1V54 B;  3CRM A;  2EJR A;  4E4E A;  4TV8 B;  2Q4P A;  4J42 A;  5KHJ A;  3CRR A;  1YF2 A;  4UCS A;  3JD4 A;  1VAR A;  3BEH A;  1HNZ B;  1M4U A;  4UVA A;  4TQF A;  2OYQ A;  3M7M X;  3T4Z A;  2XAF A;  1DGS A;  1EN4 A;  4OGQ B;  5IY5 C;  1ZLZ A;  3EFF K;  2Y48 A;  5E1A C;  1Z5V A;  2WLJ A;  4NB5 A;  5KMG B;  3H1J H;  2KSD A;  3LUT B;  4DV0 B;  3RYI B;  1AP5 A;  1Q81 W;  5BXZ A;  4JAU A;  3ZHT A;  2JJ1 G;  3OE7 G;  5D5P A;  3ZJZ A;  5LYJ B;  1IBK O;  1XRE A;  5KA5 A;  4X20 A;  3FD9 A;  1BHB A;  4XDK A;  5GTH Z;  3T4D A;  1SA0 B;  4QIW F;  3WB1 A;  1PKX A;  2HJD A;  4X64 B;  2VWJ A;  4LF6 B;  1TA8 A;  4B3M B;  2ADP A;  1QR8 A;  2MW2 B;  3H1K H;  3F7Y C;  3IJ4 A;  3K08 A;  3J7A U;  4O2A B;  2YC0 A;  4LF9 B;  1DK1 A;  4LP8 A;  2QKS A;  5KHI A;  3K58 A;  4K0K B;  1LNQ A;  1TUB A;  5CBH A;  1BHA A;  5CA1 A;  2YS8 A;  5BMV A;  3X2Q B;  4X1I B;  3RFR A;  2WWW A;  2HLD G;  2IU3 A;  3BA8 A;  1F4M A;  2JGU A;  4DUY O;  1OCR B;  5H6Q A;  5EBL C;  2Q8V A;  5JJJ B;  5B1A C;  4LFA B;  2F4V B;  4JAV A;  2UUC O;  3CRC A;  2CH7 A;  2HP8 A;  3JD2 A;  3ABL C;  3QF7 A;  3H1I H;  4FLW A;  5LXT B;  4QGP A;  4JI1 B;  3ZHU A;  2IM9 A;  1YJ9 V;  1OV9 A;  5L3B A;  2PZS A;  5LP6 A;  1ROP A;  4PDM A;  5EYP B;  5KAF Z;  3M99 B;  4B08 A;  4X1Y A;  4O4J A;  1GN4 A;  1Y6X A;  2PYJ A;  2Q6A A;  2PI5 A;  4GCZ A;  1I5Y A;  2DYS B;  3I5D A;  4HNA A;  4MTX A;  3JD0 A;  1IDS A;  2EIJ B;  3ZMT A;  4TUY A;  2JGD A;  4FFB A;  4DK0 A;  3E89 A;  5DED A;  5IY5 B;  3QO7 A;  4Q20 A;  1GO3 F;  3ML0 A;  3K0D A;  4JYB A;  2VQE B;  1OCO C;  1M57 C;  1QU7 A;  1YI2 V;  1XL6 A;  1N33 O;  4JF3 A;  3T2M A;  1IBM B;  5JQG A;  5FLX N;  2K9P A;  4P30 A;  2YDE A;  1BE3 H;  3ZHQ A;  3TET A;  3ZRS A;  3SGI A;  1BT8 A;  2ZKO A;  1VIB A;  4DV7 O;  3E86 A;  2ZE8 A;  2JK5 C;  2EZO A;  4EB6 B;  1H2S B;  1DF4 A;  2YIB A;  2QKA A;  4UUJ C;  4DR1 O;  1TUB B;  3E8B A;  1GM8 A;  1CPY A;  1UPG A;  4L8J A;  3JAL A;  2WLH A;  4EFE A;  5BMV B;  1HP8 A;  3BCC H;  2WLN A;  3CWB H;  2H3O A;  5CBG A;  2BE3 A;  1VQ8 V;  4JI8 O;  3JD1 A;  3JYC A;  2WA4 A;  4DK1 A;  1IBL O;  4NXM B;  2H94 A;  3FB5 C;  4Z1M G;  1WB8 A;  1WA8 A;  2KQX A;  2A7W A;  4WFA V;  4UCO A;  5DN6 G;  2CH7 B;  2ZE7 A;  5L3F A;  2AHY A;  1JX9 A;  1AR1 B;  1VF6 A;  1VP7 A;  1SQF A;  3VOU A;  3RYF A;  4FMT A;  5LP6 B;  1IVS A;  3UM7 A;  4YJ2 A;  4DYL A;  4GUN A;  2OCH A;  5L3D A;  3LNN A;  3UO3 A;  1Q7Y W;  1SS3 A;  4U3J A;  4DV4 B;  1YTF B;  2YEV B;  3ABL B;  1VQL V;  2RNB A;  2YSU B;  3KG2 A;  1YXB A;  1SZX A;  4LF5 B;  3GWK C;  2RJZ A;  2IJJ A;  2Y69 B;  3RYC A;  2JGD B;  3DTU B;  3ETE A;  3JAW B;  3W7W A;  1I7F A;  1TVK A;  1W2B U;  3VQX A;  5DM6 V;  2EBO A;  1SQG A;  1IUR A;  3OTF A;  1AJQ A;  1KP3 A;  3SYQ A;  3APO A;  2X6A A;  3HPL C;  1KU9 A;  4AIL C;  4YY3 B;  1MMM A;  3CHX A;  1WN7 A;  1M57 B;  1LUW A;  2EIN C;  4J11 A;  4JV5 B;  2UXC O;  5DEC A;  4GKK B;  4YJ3 B;  5L3C A;  4WFH A;  4X64 O;  4NVP A;  1BGY H;  4DW0 A;  1NVP B;  4ZI7 B;  4B3M O;  3JAL B;  1R1B A;  3D36 C;  2XOK G;  4CH4 A;  2OT5 A;  3P3N A;  4TSF G;  1FAF A;  4TWK A;  3HKB A;  3F5W C;  4EKW A;  4DR5 B;  4MTO A;  5LOV A;  1L0N H;  1X59 A;  1JCH A;  1L0L H;  4RQE A;  4N23 A;  2ZCE A;  3OD4 A;  3G4S V;  4XBF A;  3UO2 A;  3RYF B;  4MW3 A;  2UU9 O;  3AG2 B;  4LFA O;  4BAY A;  1M56 C;  5CMU A;  3NR7 A;  2OCC B;  2Y0I A;  1G1X B;  3JAT A;  2PTM A;  4QPJ A;  1VMG A;  2JDI G;  4Z1V A;  2QM7 A;  4JI1 O;  4PA6 A;  1YEW A;  2HG5 C;  2ZIM A;  4X89 A;  4NXN O;  2IH3 C;  3AK1 A;  5KHG A;  3GWO A;  3E2E A;  1GK9 A;  5BY1 A;  2JRI A;  1TVK B;  1A32 A;  3OUS A;  1HNW O;  5JCO A;  3AK2 A;  1BZK A;  4LBE C;  1G8M A;  2WLM A;  3DXR B;  1S76 D;  5B3S B;  4DXW A;  5F2V O;  4RO2 A;  1D2D A;  3E35 A;  1FS0 G;  1S5L Z;  3OGC C;  1H2K A;  3FFQ A;  5KLV H;  4I55 B;  2VQE O;  1N0J A;  5CB4 A;  2FL4 A;  1RP3 B;  3GB7 C;  1S77 D;  2FTK A;  2UXB B;  5A9G A;  3CP1 A;  3QO5 A;  1XBL A;  1IBM O;  3A8T A;  1JR9 A;  5H2F Z;  3TJT A;  1FXH A;  4K35 A;  4EEQ A;  1SC5 B;  2EZP A;  4LC1 A;  5K1P A;  2EIN B;  2V7Q G;  3SJC C;  3OT7 A;  2QWQ B;  2M6Y A;  3KCY A;  5LOV B;  4QJF B;  4FIP C;  3L71 H;  4X66 B;  4G28 B;  3IAY A;  5A2Q N;  3THO A;  3HKC A;  1V55 C;  2N05 A;  3K5L A;  3A2F A;  3CE2 A;  4O4L B;  4YHH B;  4I4T A;  2GBO A;  4GKJ B;  3IFX A;  4C7U A;  1I08 A;  3JAK A;  2BCC H;  1PNK A;  3N2G A;  2EJ7 A;  1NH2 B;  1FFX A;  3E8H A;  1ZSP A;  2F43 G;  2L35 A;  5GON A;  3JAT B;  5B1N A;  2AGA A;  1YZB A;  2QTO A;  1YCI A;  4NTY A;  3DC6 A;  3CYO A;  3F5T A;  2ATK C;  3WU2 Z;  3JSN A;  4FLV A;  3JD3 A;  1VQ6 V;  1BMF G;  2DWD C;  3PN1 A;  1WPB A;  1YVW A;  1SQP H;  1M56 B;  3ZRW A;  1OZ0 A;  1R6T A;  1Q6H A;  4MVZ A;  3G71 V;  1PV0 A;  4LF5 O;  3ETQ A;  2ILM A;  1H2G A;  1ZUQ A;  3OFN G;  1RM1 C;  1QVF U;  2R9R B;  1K34 A;  3CME V;  3CCL V;  2QR4 A;  2NR5 A;  3K5O A;  1S5J A;  3ZCC A;  5B66 Z;  5CA0 B;  4YY3 O;  5IYZ A;  4JAA A;  4UCT A;  2R9A A;  5K1X A;  5EZY A;  1XQ8 A;  4U7O A;  4GKK O;  2ARH A;  4JI7 B;  1XMQ O;  4GX0 A;  4LH6 A;  5L3G A;  4ABM A;  1MSW D;  3CCU V;  2XAG A;  2IU0 A;  4JTC B;  5CN0 A;  1KD1 W;  4CH5 A;  2NN4 A;  4GLX A;  2ZDI C;  4J7J A;  3W7U A;  1GN3 A;  1D5N A;  2ZNI A;  1R3K C;  1AJN A;  3JAK B;  5LYJ A;  3MD0 A;  1OCZ B;  3N2G B;  3CCE V;  2OIG A;  1ZL8 A;  1PP9 H;  1FFX B;  1XL4 A;  5GON B;  1JVM A;  2EIK C;  4DV7 B;  5LBQ A;  3K5N A;  1HW7 A;  4XDJ A;  1NJI W;  1COW G;  1U97 A;  1YJN V;  1RPO A;  3AG3 B;  1Q6I A;  1MG1 A;  4TT3 G;  3ZRW B;  4E2L A;  4X62 B;  5EBW C;  1T5E A;  3H9V A;  4CS2 A;  1MAB G;  2OIE A;  4O2A A;  4JI8 B;  3STL C;  4R50 A;  1IBL B;  1N34 B;  2P6J A;  2LP7 A;  5JJN B;  3ZX6 A;  2F66 C;  4CH6 A;  4IGG A;  3SJB C;  4YIP A;  4L87 A;  3FYE B;  2V1D A;  1M5I A;  2A0L A;  3ASO C;  1BQ0 A;  1N4C A;  3P3P A;  2E5L B;  1SQQ H;  1W0J G;  3AG7 A;  3SPJ A;  5BR8 O;  1XNQ O;  3ETD A;  5IYZ B;  3UKM A;  1JA8 A;  1QBZ A;  5EZY B;  3CRA A;  5LXT A;  1FYJ A;  2IW5 A;  2AZ2 A;  1PL0 A;  3ABM B;  2UXB O;  2Q0A A;  5GTI Z;  3BFR A;  4B3R B;  3G6E V;  1KBH A;  5C93 A;  2VQF O;  2ZM6 B;  5EYP A;  3OUF A;  4Z2W A;  2ZR3 A;  2E76 B;  2YIC A;  2ZQM A;  3BHP A;  2EX3 A;  4GT1 A;  1I0H A;  1M90 W;  2IBZ H;  4OX9 B;  3K9S A;  2GHY A;  3U0Z A;  4RUF A;  3B77 A;  4J9Y B;  1ZL8 B; 
#chains in the Genus database with same CATH homology
 4J11 A;  4J7J A;  4W4L A;  3FX7 A;  2G38 A;  4J10 A;  4J41 A;  4J42 A;  2GTS A;  4IYH A;  4J7K A;  4KXR A;  4IYI A;  4W4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...