2G38A

A pe/ppe protein complex from mycobacterium tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
77
Chain Sequence
PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward the structural genomics of complexes: Crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords PE FAMILY PROTEIN
total genus 33
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 2g38A00
4IYHA 4J7KA 4W4KA 4IYIA 2G38A 4J42A 4J41A 4J11A 4J7JA 4W4LA 4J10A 2GTSA 3FX7A 4KXRA
chains in the Genus database with same CATH superfamily
1AROP 3AG3B 3FYEB 1N33B 1M57C 4O2BA 4JI5B 3HKBA 5JH7B 1HNZO 1XL6A 1NH2D 5E1AC 1I94O 2IW5A 3BVOA 2DN9A 1FJGO 1JR9A 3RYHB 3HR0A 2JDIG 1VF7A 3RWRD 2CTRA 5L3GA 1CPYA 1AR5A 4KFMA 2FMLA 2KQXA 3E2EA 1SKVA 1ENVA 3L71H 4YXWG 5CB4A 4QJFB 4DV6O 1JVMA 1VEWA 3DGEA 4N23A 2QKSA 1H2GA 2LW7A 2IJKA 1GMGA 4LWSA 1HNWB 2Z0AA 3CJHA 1VQ8V 1PNKA 2UUBO 3FAVA 4JI1O 5C8YB 5EZYA 1AR1B 1Y76A 4JI8O 3OUFA 2L6LA 1OCCB 4FFBB 3QO7A 1HNXB 4LF9O 1SZTA 1W2BU 2V7QG 2QWNB 2WA3A 4JI6O 3NR7A 1Q3EA 4O4JA 2DQ0A 1PV0A 5GTHZ 5JVDB 1BQ0A 4X1YA 3T4DA 3ABKB 1F4MA 3W7WA 3OTOB 2QM4A 1YHQV 1WPXA 2ZE6A 4EKWA 2BOBC 2R9IA 4PHZA 5KLVH 3K5LA 2JS5A 1R6NA 1Q8IA 2HJDA 2AHZA 5BMVB 1GK9A 2ZE5A 1L1FA 3ABTA 3QVNA 1Q6HA 2XASA 2ARHA 4F6EA 1M57B 2HR3A 1BGYH 5FNVA 5IT9N 1B6QA 1OHHG 2QEXV 3THOA 4EFBA 3D36A 2UUCB 2WWWA 4HBNA 3G71V 3HKEA 3IJ4A 5ITZB 2RJZA 4FLXA 2L35A 4I9QA 5JJJB 4KL1A 4K3AA 4UB8Z 1PNLA 2N74A 5KHGA 2VQFB 2EJRA 1W0KG 4FZ1A 4JASA 4LF5B 5KHJA 3E8FA 1KBHA 3TGUH 2X6CA 2LGWA 5GONA 1IBKO 5EYPB 3ABLC 1HR0B 3G6BA 1FD9A 1SQFA 1V9PA 1XEQA 2ZIMA 1YCIA 5H9CA 3APOA 2HHHO 5EIBD 4L8JA 5BZBA 4NXMB 1GO3F 2ZR2A 5J2TB 1H8EG 1THZA 5FLXN 2NLJC 3FB6C 2EIJB 2JJ1G 1IZ3A 1R3JC 2UXDB 4TT3G 2WLLB 5JWPA 3N27A 2QTOA 1AI4A 1WA8A 1ZWIC 1IBMB 2OWOA 4JI7B 2HFEC 4PDRA 1MOFA 4XDLA 1K34A 3SYOA 4MVQA 1K5SA 4X66O 2IJJA 3ETGA 1H2KA 3T1YO 3K08A 2Q68A 4H37A 4JGSA 4J7ZA 3RYCA 4U7OA 4FLTA 3AK2A 3L70H 5KA5A 3HKDA 2LQTA 2LJ2A 4X64B 4DR1B 2VS0A 1VQ7V 2P4VA 1H2MA 2V1DA 3ABUA 2EZPA 1Z5VA 1H2NA 4LFCB 3H1JH 4CBCA 4PI0A 4QE9A 3MDSA 2DMXA 2Y0PA 3ZHTA 2GSMB 3CPWU 3U0ZA 4EEQA 2Q0OC 1OCZC 3CS5A 4LF5O 1GKFA 4J9ZB 1MNGA 3OGIB 1BZKA 1QLEB 1O9GA 4LF6B 3AG7A 4TOIA 5LP6A 3BHPA 2UXCO 2R9AA 4D7SA 1A32A 3UKMA 5EK0A 3B2EE 1U96A 4R50A 5KUMA 5DM6V 3ABMC 3ZIAG 4ZOLA 1R3LC 4DV0B 4FLYA 5LGUA 5CA3A 3CB2A 2C2AA 5A2QN 2ATKC 1NS1A 3I56V 4TV8B 4CH4A 3WB2A 4DR5B 4YJ2A 3E8HA 5B1AB 2E5LB 3B4SA 3HKDB 3DTUB 1JA8A 4RWUA 4R7CA 1ZAUA 3KCYA 4JV5O 4D7TA 2YXYA 4I4TB 2CH7B 3P3PA 4NTYA 3WB1A 5CMUA 1DF4A 4WBNB 1JCHA 5LYJB 2JVDA 5K1XA 3OMIB 2H3OA 4P2ZA 4KUMA 3I55V 3UT5A 3JASB 1FS0G 4J11A 4A5UB 3K3WA 1VQ6V 1HWYA 1US6A 4O2AA 5JJNB 1RPRA 2KSDA 4X62B 1D5AA 3ASNB 4PA3A 4B3RO 3RYFB 1BE3H 4BAYA 2KB1A 2LP7A 5B1BB 1N36O 3FB5C 4ZIBA 1XNRB 4CC5A 4FLUA 2QSAA 1S72V 2EBOA 3OEHG 3JATB 2GTAA 2KKWA 1PL4A 3LDEA 4IYHA 5J9PC 4LCUC 3M99B 4DK0A 4CS2A 4LF8B 4ZBMA 3CYOA 1XREA 3EHBB 1KECA 3IAYA 2A79B 2CE4A 3ZRSA 4BIUA 4NTWA 1AJNA 1MSWD 1YJWV 2BTQB 3K5NA 1M1KW 4FK5C 3E22B 2YXHA 5LP6B 5LYJA 4HAMA 4MVUA 1RP3B 4JYYA 1Q90D 4P30A 3SJQC 2VQEO 3H9VA 4YY3B 4I5SA 2XHBA 5L3BA 1V55C 3ZHUA 1DLBA 4B3SB 3SPCA 2R72A 4DV7B 1KKDA 4J7KA 3H1LH 1XILA 2IJHA 2WA4A 5FPRA 1XMQB 4O2BB 3ABLB 3E86A 4I55B 3OT7A 2W6IG 1TVKB 3L72H 1KQSU 1TUBA 3H1IH 4WFFA 1IURA 3P3NA 5LA6B 2EILC 3LDDA 5KMGB 1ZL8A 1NTKH 4PDMA 3W7SA 3ICXA 4U3JB 3ZBHA 3ZRVA 5IWAB 2EINC 4MTXA 4H33A 2ADPA 1OCZB 4FM1A 2GV9A 1R3IC 2WLNA 1FFTB 1KU9A 2P6JA 4JZGA 2R9RB 1QQCA 1KC8W 2X0LA 1SA0B 2WLKA 3JAKB 4H44B 3TCUA 5LXTA 5IYDO 3CCRV 2XAFA 2UUCO 4JPRA 2PYJA 2N04A 1QR8A 4K35A 3RYFA 5HFLA 3K0DA 5L3FA 3PN1A 4LWSB 2XTAA 2AGAA 4U3FH 3A0HZ 1JJOA 3WU2Z 1I5YA 1Q86W 1FAFA 2HLDG 5L3CA 4DV6B 4I4TA 1H2SB 4DR6B 4QGPA 4X1YB 2Q7EA 3B09A 4IT5A 1XBLA 1VQ9V 1H8HG 1U97A 3ZMSA 2MK3A 4BR6A 3RYHA 1K8AW 2A0LA 2GUZA 3J80N 1PPJH 1VQOV 2DYRB 4MSWC 3S3XA 1BHBA 5LL6Y 1QCEA 1TUBB 1CP9A 4CH3A 4QPKA 4UVBA 3CCEV 4P9PA 3CP1A 1TUEB 2EULA 1MZEA 3K0GA 2BTQA 4QIWF 1QR9A 5KUKA 2F95B 4X62O 4W4LA 4JAVA 4FJCC 5IJ0A 1Y4MA 1WJZA 5ITZA 1AP5A 4UCSA 2FTKA 3J81N 3CD6V 2QM7A 4C7UA 4JI2B 1K4CC 4FFBA 5H6QA 4Q6GA 2E74B 3O65A 3SYCA 2ZT9B 4OPAA 1QNMA 1WLEA 2LO1A 2W0XA 4FIPC 2UUAO 3SPHA 3W7TA 1BL8A 3OFNG 3K06A 1GN6A 1RM1C 1EN4A 4LFCO 5LP6C 3ZEDA 4W4KA 1NT2B 1RM1B 4RUFA 3A0BZ 1N0JA 2CUGA 4WFHA 2H8PC 2YI9A 4UCRA 1TVKA 1P7BA 4LNUA 2YIAA 2P90A 4OPHA 2NN4A 1V54B 1CEZA 4MTGA 1BMFG 1BT8A 4TV9B 3F5TA 3BEHA 4IYIA 1XOUA 2PF4E 3AEIA 1K92A 4B7EA 3HKEB 1NTZH 2FL4A 3MD0A 5LMUO 1LUVA 5EIBC 4GKJB 2UXBB 3ZRXA 1UJWB 4AHCA 2BOCC 1GM9A 4X20B 1Y6XA 1IBKB 3BRCA 3JD1A 4PI2A 5AG2A 1GAXA 4JI0B 4X1KA 5H6RA 3W7UA 4O4HA 4NXMO 4MW3A 1N32O 3QO5A 1L0LH 1FFXB 2EIKB 1EZJA 1WP8A 1PKXA 1K5QA 4DV2B 4DR7B 4JI5O 3BA8A 2M7WA 2FKXA 3GWOA 4BW9A 1VMGA 5IY5B 1P4RA 1KUQA 1SF9A 2R70A 5IWAO 1N8RW 2P06A 1SA0A 2QA4V 4JYBA 4B3MB 3SJCC 5LBQA 1DF5A 4F6RB 3CC7V 2Z3YA 2IU0A 1YTFB 3QO8A 4GZRB 1YEWA 3RYCB 4JAUA 4KXRA 4NKGB 5JCOA 1V55B 3CHXA 1X59A 1SC5B 1LUWA 2UXNA 5HFMA 4E4EA 5LMNB 2LGQA 4JI1B 4AILC 4Z1VA 1N33O 1E1RG 1QVFU 2GBOA 3X2QC 4O4IA 1S5JA 4X20A 3T1CA 3N2KB 2IU3A 2EIMB 1SERA 2NR5A 3CCLV 2DWEC 1P7GA 4LF4O 4J41A 5K1PA 1Y66A 3ABKC 3ZHRA 3ASOB 2WPDG 2Q6AA 3HKBB 3RN4A 4GYCB 1K33A 4N21A 4UCUA 5B3SB 2CGNA 2DW4A 5EBMC 4RUEA 3S3WA 2MW2B 2BCCH 5DEDA 1Q7YW 1SESA 3JD2A 1VF5B 1IX9A 1E79G 4TV9A 2E3CA 4I50A 4DR2B 3T1HB 5B1AC 4NVPA 5IDJA 4AQYO 1LR1A 2DYRC 2HKOA 1M90W 1R6TA 4PD4F 4B3TB 2YXLA 3CEIA 4LF4B 2XOKG 1I08A 4DRXA 1R73A 3P32A 1GRJA 1Z2GA 1BCCH 3GB7C 1S0VA 3OM3B 3PJSK 4H0LB 3K79A 4YY3O 1S5HC 4UCTA 4UVCA 3CC2V 5JCOC 1KP3A 1I94B 4ZI7A 4OX9O 5C8YA 4GX5A 5CA1B 3JSLA 1TAEA 4IIJA 3L73H 4DUYO 3QG5A 2CH7A 4XDKA 2Y0IA 2JGUA 4UXNA 4CS4A 4Z2WA 1IVSA 2UXXA 1IBMO 2QWRB 1I5XA 1SETA 2ZD9A 1OV9A 3WG7C 3ETQA 4QNHB 1NJIW 1WB7A 5KHKA 3HKCB 4G28B 3CXHF 3JASA 4JTAB 2IM9A 2HHHB 3ZCCA 3RFRA 1YITV 4DR2O 3JD3A 1AJQA 1MSDA 2PZSA 2UU9B 1HW7A 1I7FA 4E2LA 5J2UA 1YF2A 2LFSA 4LF6O 3SPJA 2F4VO 3ZRWB 3SJAC 3JATA 4TWKA 4OGQB 4DRXB 5EBLC 2VWJA 2ZE8A 4O4JB 2ITDC 4ZHQB 1OJHA 3ZMVA 1ZUQA 3N2KA 3CCJV 1RPOA 1SZXA 3UCSC 3B8MA 1AP6A 3GWKC 3APQA 4B3TO 1G4YB 2WLIB 1H2LA 4B3SO 4R6ZA 3RVZA 2IBZH 5KMGA 1CXZB 5LMNO 3WFVA 2F1MA 3SDLA 3K59A 3FKSG 1KB9F 4JAAA 5JJEB 3KCXA 5IYCO 1IXMA 3T1YB 2WLMA 1JJ2U 3JSNA 2OIEA 2Q9LA 3FB7C 2UXCB 2JEUA 1ZTEA 4B08A 2JJ2G 4JI6B 4JTCB 4UB6Z 2K9PA 4JZ2A 4XBFA 4U7NA 3SYAA 2Q0AA 1K97A 5JVDA 2EZOA 5GONB 2QWPB 2YIBA 5J2UB 3FYIB 3TJTA 4I7ZB 3RYIA 2FB5A 4K0KO 4X89A 4GKJO 2UXBO 1DTOA 1WPBA 3LNMB 2HJFC 4WFEA 3F7YC 3ETEA 5H2FZ 3T1HO 1GM8A 3MHHC 3M7MX 4AQYB 3CRRA 4DV7O 3J7AU 2XAHA 4NR1A 2F66C 4GCZA 1PNMA 1BQZA 3X2QB 4JI7O 1YTFD 1K7DA 1DK1A 3GVMA 3AK3A 3JD4A 3ABMB 3H01A 3OR6C 2Z5UA 2EX3A 1GM7A 1M93A 1G1XB 1PL0A 3OD4A 3QTCA 3CCQV 5KX5B 2P4KA 3EVKA 1RSOB 4GT1A 4KP4A 4BIOA 2GTSA 4DR4O 2VRZA 2ODMA 2Y69B 5D5QA 4DR1O 3AG3C 3F5WC 4HYOA 2P5OA 4RQEA 5EYPA 1NBMG 3BABA 4O4LA 4MW8A 2KG7B 1XI1A 2QDOA 3UO2A 5LHGA 2ZNIA 1BSMA 3OW2U 3ZN1A 1EBOA 4TV8A 4ZHQA 1FXKB 4DUYB 4YJ2B 3UQ8A 2QM8A 2OCCC 2Y4TA 3BFRA 3ZX6A 4RAIA 3LSQA 3ML0A 5B3SC 2DQ3A 1MA1A 5KHHA 2GHYA 4NTXA 4JV5B 3CMAV 4UVAA 2RCVA 2N05A 2Q4PA 1KKCA 1OCCC 4P9OA 4PDLA 5KX5A 1VQKV 4MVRA 1AR4A 1E1QG 5CB4B 1HNXO 1EZVH 3CC4V 4LFAB 3E35A 4PV1B 1FPOA 2D3OW 3CRMA 3D36C 3B77A 3K9AA 3P30A 3ZJZA 1N0NA 4FLZA 1VQPV 3FAVB 1R6KA 1NH2B 3OTOO 2OTJV 2EJ7A 1MZFA 2ZE7A 4BIZA 4NXNO 1VQ4V 4JI0O 1YXBA 1SQVH 2WLJA 3K9SA 2B9ZA 1OZ0A 1EM1A 1M9NA 3KZIZ 1URFA 1OCRB 2DJVA 2X6AA 3OMAB 1DGSA 3TK1A 4LF8O 1QLNA 3CXCU 2V4DA 4X65O 4CH5A 3HPLC 2YEVA 1VQLV 1D5NA 4FVMA 3H1KH 1XHXA 1NTMH 2F43G 4Q20A 2ADQB 2WAMA 5CN0A 1M56C 4UUJC 4J42A 4X1IA 4UV9A 4X1KB 5KA6A 3VOUA 3KKYA 4O4HB 3RBZA 5B1BC 3CCSV 3CE2A 3QNEA 3EXAA 2A06H 5DECA 5B1OA 2B1GA 3SR2C 4JI3B 4ICGA 1OCOC 1SQXH 4DV5B 3DXRB 2ZINA 1NI8A 3FFQA 5BMVA 2B1IA 1COWG 5L3EA 5EC1C 5J2TA 1F23A 4MS2A 1AI6A 4EFEA 2RMKB 4ZKIA 4O2AB 2ILMA 4J10A 5EBWC 2BSKB 1W0JG 1ZL8B 3AG1C 2YICA 3STZC 3AG1B 4FMTA 2PGGA 3K57A 4DK1A 2D2CB 2F23A 2ITCC 2IH1C 2O57A 2OYQA 5BR8B 4FLWA 1N4CA 1XMQO 4TSFG 4YJ3A 1EN5A 2Y69C 1JX9A 4O4IB 3K58A 1QBZA 3IGAC 1TGOA 1L8DA 2F4VB 4I55A 3OUSA 3G6EV 4X1IB 1P49A 2F93B 4DUZB 3AG4C 4D6TH 3L74H 3ZN0A 1J5EB 4JI4B 4JYAB 1YJ9V 1XL4A 4CZZA 3RVYA 2RN9A 4IIJB 3JALA 2RQ6A 5FNVB 1HR0O 5E79Z 1ZX3A 1G8MA 4FM0A 2QJ1A 4F4LA 4YHHB 3SPGA 1NVPB 4DYLA 2QGNA 4KHPB 4DR3B 3OR7C 2Q5ZA 4HZ3A 4DR7O 1GN3A 2ZNJA 3JAMN 4JTDB 3K5OA 1VQMV 1WA8B 4YIOA 3JAKA 3VQYA 4JI3O 5JQGB 3M8AA 4DV3O 4EB6B 2BSKA 1N34B 3VQVA 4MT8A 4HNAA 3SYQA 3WG7B 1JMKC 2Q67A 3N2GB 3UO3A 1R1BA 3G80A 1ROPA 1SRYA 4PDVA 3FD9A 3JAWB 1IXBA 1S76D 4FM2A 5TISZ 4Z1MG 5FL7G 3MHSC 1F4NA 3LSSA 1XMOO 3CSXA 5C93A 3K5MA 3VQXA 2E75B 4X65B 1VIBA 5IE9A 2BTOA 3U10A 1K9MW 1JOYA 2YIBD 2CTQA 3CCUV 4OX9B 2UUAB 4TUYB 3JD0A 2JEXA 4MVMA 3OE7G 3DSQA 4J7JA 1ORQC 3CRQA 1TA8A 2K1EA 2YEVB 5LXTB 2AXTZ 1K4DC 1FXVA 2QKCA 2Q8VA 5IJ0B 3E89A 1B06A 4FFKA 3STLC 4X8AA 1WN7A 4DXWA 4I9WA 1I0HA 4ZOLB 4RQFA 1OCOB 3R65A 5CBFA 3AG2C 1L0NH 3ZRWA 2E5LO 3LDCA 1AI5A 3BPZA 1XDCA 2Q73A 2E76B 4WCEV 1QLEC 4DR3O 2OCCB 4JF3A 2LFRA 3CX5F 3HB3B 1NZ6A 5IY5C 2ETNA 1KYOF 5LHIA 1B3QA 3WB0A 3BAAA 4PA6A 1AI7A 5BR8O 1XMOB 1SS3A 1WAZA 1M56B 3QF7A 1R3KC 1Q81W 4JYCA 3JCZA 2CGOA 3R66A 3JALB 3DC6A 2OCHA 4YHHO 2H94A 2VWKA 1VP7A 1QU7A 3MAQA 5D5PA 2YSUB 4XDJA 4WFAV 1NR7A 4TUYA 1OCRC 5CA0A 2QWOB 2XUMA 1RFYA 1YIJV 2DWDC 4NB5A 2QKAA 3UT5B 1HDJA 3ZS8C 2W6JG 5JQGA 2ZDIA 3C90A 2CTPA 2PI4A 3L75H 2Y4UA 1AILA 1Y67A 3ZMUA 1Q82W 3H1HH 4TQFA 3N2GA 4B3RB 3D3IA 2CAZC 4FZ0A 4RO2A 2XAQA 2UU9O 1Z5WA 4LNUB 2EILB 1QVGU 4PA9A 4WBNA 4DW1A 4LFBO 5IJ9B 2QE7G 2HVJC 4LBEC 3EFFK 1WB8A 2YC0A 2B5UA 2P67A 1FYJA 2OTLV 4X88A 4DW0A 2OIGA 2ZCEA 2FYUH 2PUSA 3JARA 5FPOA 5CBHA 5LGNA 4EB6A 1EN6A 3SJBC 2X6BA 1Q43A 1VQNV 1J5EO 4JYAO 2PY5A 4IL6Z 1NKDA 3D8CA 4HNAB 2NNUA 5KAIZ 3ZHQA 4MVZA 1F51A 1FXHA 1Q6IA 3IC9A 2P22C 5GTIZ 3IFXA 2HP8A 2LW1A 2KG7A 1X4TA 4IHJB 2AHYA 1FFXA 1XNRO 2WSSG 4NYKA 4ASUG 5CBGA 4DV4B 1NR1A 3U11A 2WLHA 3ZHSA 1AJPA 2CDYA 1XUQA 4I0XA 3T4ZA 2XT9A 1NVPD 3LSUA 1S77D 1VF6A 4K8XA 2YS8A 3BY6A 4K0KB 1EFRG 3CMEV 4DV4O 1GTOA 3E22A 1PM9A 3E8GA 1JPXA 3JCUZ 3NXSA 4FPPA 4DV5O 1K73W 3E8BA 4IGGA 4U3JA 1GN4A 4BW5A 2GUZB 2A3QA 1GN2A 1S5LZ 5CA0B 5F2VO 3B40A 4JI4O 4YIPA 2HVKC 4QPJA 3ZMTA 4GLXA 2DYSB 1MG1A 4B7KA 1YJNV 1LNQA 4LR3A 1YSCA 2AZ2A 2VQFO 4MTOA 3D3QA 1NU1H 1O9HA 1FJGB 1N36B 4KHPO 1BS3A 2GDSA 4DV2O 5CA1A 1ZSPA 4PA4A 3UM7A 3T2MA 1KMIZ 1ZLZA 1XQ8A 4LF7O 3RW0A 4LFBB 2XNDG 3AG4B 3VQWA 1D2DA 3F7VC 2BE3A 3OEEG 5B5EZ 2AW9A 2EIMC 2WLLA 2WLIA 2PTMA 3AK1A 4K8ZA 4LF9B 1P84F 1AB3A 2RNBA 4UCOA 3TETA 3TXQA 3K04A 3SYPA 1YZBA 5BY1A 2AZ0A 1YVWA 1VF6C 4DV0O 2JS3A 5LMUB 4CH6A 2DE0X 2DOSA 2YI8A 4H13B 3E83A 2RDCA 3OAAG 4GUNA 4MVOA 1G6UA 1S3JA 4LP8A 4WFBV 2YIDA 3BA9A 5DN6G 2JRIA 1J95A 1N32B 4LH6A 2IH3C 1IDSA 3K03A 3ASNC 1XHZA 1M4UA 4G27B 3C3TA 4PJ0Z 4ZI7B 5LHHA 1IBLB 2QTSA 1JFFA 3W7XA 3JYCA 5B1NA 5IJ9A 2Q7GA 4WFGA 1WNSA 1AVMA 3RT3C 4G2KA 3I5DA 4LH7A 2ZIOA 1NQTA 3Q4HA 4GX2A 3L9DA 4FLVA 4MTFA 5L3DA 2DYSC 1PP9H 1FXKC 4I0XB 1HP8A 1Y74A 3DXRA 3JARB 2HG5C 3G4SV 5EC2C 1F7YA 1Q5OA 2A7WA 1YI2V 2UXDO 3OGCC 4TQDA 4BWAA 2ZR3A 5IYZA 2VQEB 4X64O 2EINB 4GX0A 3SPIA 2XAGA 4CS3A 2CTWA 3CCMV 4DR4B 4DV3B 2XAJA 2JGDB 5LOVA 5BXZA 1FKAO 2G38A 4DR6O 2QR4A 1M5IA 4IHJA 2QWQB 4F6RA 5H5NA 4X9QA 2P7TC 4YJ3B 1UFIA 1V54C 1HNWO 3RYIB 4GKKB 4UFZA 4JI2O 3CRCA 2JIZG 3OMNB 5JH7A 2EIKC 3CWBH 1N34O 1W59A 1Y76B 3ETDA 1QHTA 1MABG 3G67A 1H38A 4ABMA 4LC1A 4DV1B 1JQ0A 2ZXWC 4B3MO 5KAFZ 4J9YB 4DUZO 1KP2A 4PA7A 1XNQO 4PELA 3C3SA 1Y74B 3A2FA 4NXNB 4L87A 4UCVA 2UUBB 2ZM6B 2PYLA 2YUAA 5B66Z 3ZMZA 1RSOA 2A9HA 2Q7HA 4AI8A 1MMMA 1YDXA 2Q69A 3O9OA 3A0RA 1BHAA 1WP7A 2JK5C 3AG2B 3FX7A 3ASOC 3CRAA 5IYZB 1K3EA 3FB8C 2IJIA 4MVSA 3IC7A 1T5EA 2W0FC 2OT5A 5A9GA 3CJHB 3VBBA 4I50B 4QE7A 4LFAO 2JGDA 5LOVB 5EZYB 4WF9V 4O4LB 3KG2A 2ZM6O 3B8NA 2YDEA 1IBLO 3CCVV 1Q6UA 3JAWA 2X7RB 4JI8B 2ZXWB 1XNQB 2Y48A 1PD3A 5GW7A 3A8TA 1B04A 4LF7B 1FXKA 4OXSA 3RGBA 1SQBH 2EIJC 3DC5A 5IYBO 4DO2A 1SQQH 3LNNA 3ZHVA 4CC6A 4R8CA 1GH6A 3SGIA 2ZKOA 5LA6A 4DR5O 5LGTA 2ZQMA 3TXSA 1VQ5V 2CK3G 1VARA 4J80A 4DV1O 2M6YA 4X66B 3HKCA 2PI5A 3OTFA 1JFFB 1SQPH 4UV8A 1HNZB 3LUTB 2ZDIC 4GKKO 2HEPA 1UPGA 5KHIA 3Q4HB 4GX1A 1KD1W 3BCCH 1SQGA
chains in the Genus database with same CATH topology
4IYHA 4J7KA 4W4KA 4IYIA 2G38A 4J42A 4J41A 4J11A 4J7JA 4W4LA 4J10A 2GTSA 3FX7A 4KXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYH A;  4J7K A;  4W4K A;  4IYI A;  2G38 A;  4J42 A;  4J41 A;  4J11 A;  4J7J A;  4W4L A;  4J10 A;  2GTS A;  3FX7 A;  4KXR A; 
#chains in the Genus database with same CATH topology
 1ARO P;  3AG3 B;  3FYE B;  1N33 B;  1M57 C;  4O2B A;  4JI5 B;  3HKB A;  5JH7 B;  1HNZ O;  1XL6 A;  1NH2 D;  5E1A C;  1I94 O;  2IW5 A;  3BVO A;  2DN9 A;  1FJG O;  1JR9 A;  3RYH B;  3HR0 A;  2JDI G;  1VF7 A;  3RWR D;  2CTR A;  5L3G A;  1CPY A;  1AR5 A;  4KFM A;  2FML A;  2KQX A;  3E2E A;  1SKV A;  1ENV A;  3L71 H;  4YXW G;  5CB4 A;  4QJF B;  4DV6 O;  1JVM A;  1VEW A;  3DGE A;  4N23 A;  2QKS A;  1H2G A;  2LW7 A;  2IJK A;  1GMG A;  4LWS A;  1HNW B;  2Z0A A;  3CJH A;  1VQ8 V;  1PNK A;  2UUB O;  3FAV A;  4JI1 O;  5C8Y B;  5EZY A;  1AR1 B;  1Y76 A;  4JI8 O;  3OUF A;  2L6L A;  1OCC B;  4FFB B;  3QO7 A;  1HNX B;  4LF9 O;  1SZT A;  1W2B U;  2V7Q G;  2QWN B;  2WA3 A;  4JI6 O;  3NR7 A;  1Q3E A;  4O4J A;  2DQ0 A;  1PV0 A;  5GTH Z;  5JVD B;  1BQ0 A;  4X1Y A;  3T4D A;  3ABK B;  1F4M A;  3W7W A;  3OTO B;  2QM4 A;  1YHQ V;  1WPX A;  2ZE6 A;  4EKW A;  2BOB C;  2R9I A;  4PHZ A;  5KLV H;  3K5L A;  2JS5 A;  1R6N A;  1Q8I A;  2HJD A;  2AHZ A;  5BMV B;  1GK9 A;  2ZE5 A;  1L1F A;  3ABT A;  3QVN A;  1Q6H A;  2XAS A;  2ARH A;  4F6E A;  1M57 B;  2HR3 A;  1BGY H;  5FNV A;  5IT9 N;  1B6Q A;  1OHH G;  2QEX V;  3THO A;  4EFB A;  3D36 A;  2UUC B;  2WWW A;  4HBN A;  3G71 V;  3HKE A;  3IJ4 A;  5ITZ B;  2RJZ A;  4FLX A;  2L35 A;  4I9Q A;  5JJJ B;  4KL1 A;  4K3A A;  4UB8 Z;  1PNL A;  2N74 A;  5KHG A;  2VQF B;  2EJR A;  1W0K G;  4FZ1 A;  4JAS A;  4LF5 B;  5KHJ A;  3E8F A;  1KBH A;  3TGU H;  2X6C A;  2LGW A;  5GON A;  1IBK O;  5EYP B;  3ABL C;  1HR0 B;  3G6B A;  1FD9 A;  1SQF A;  1V9P A;  1XEQ A;  2ZIM A;  1YCI A;  5H9C A;  3APO A;  2HHH O;  5EIB D;  4L8J A;  5BZB A;  4NXM B;  1GO3 F;  2ZR2 A;  5J2T B;  1H8E G;  1THZ A;  5FLX N;  2NLJ C;  3FB6 C;  2EIJ B;  2JJ1 G;  1IZ3 A;  1R3J C;  2UXD B;  4TT3 G;  2WLL B;  5JWP A;  3N27 A;  2QTO A;  1AI4 A;  1WA8 A;  1ZWI C;  1IBM B;  2OWO A;  4JI7 B;  2HFE C;  4PDR A;  1MOF A;  4XDL A;  1K34 A;  3SYO A;  4MVQ A;  1K5S A;  4X66 O;  2IJJ A;  3ETG A;  1H2K A;  3T1Y O;  3K08 A;  2Q68 A;  4H37 A;  4JGS A;  4J7Z A;  3RYC A;  4U7O A;  4FLT A;  3AK2 A;  3L70 H;  5KA5 A;  3HKD A;  2LQT A;  2LJ2 A;  4X64 B;  4DR1 B;  2VS0 A;  1VQ7 V;  2P4V A;  1H2M A;  2V1D A;  3ABU A;  2EZP A;  1Z5V A;  1H2N A;  4LFC B;  3H1J H;  4CBC A;  4PI0 A;  4QE9 A;  3MDS A;  2DMX A;  2Y0P A;  3ZHT A;  2GSM B;  3CPW U;  3U0Z A;  4EEQ A;  2Q0O C;  1OCZ C;  3CS5 A;  4LF5 O;  1GKF A;  4J9Z B;  1MNG A;  3OGI B;  1BZK A;  1QLE B;  1O9G A;  4LF6 B;  3AG7 A;  4TOI A;  5LP6 A;  3BHP A;  2UXC O;  2R9A A;  4D7S A;  1A32 A;  3UKM A;  5EK0 A;  3B2E E;  1U96 A;  4R50 A;  5KUM A;  5DM6 V;  3ABM C;  3ZIA G;  4ZOL A;  1R3L C;  4DV0 B;  4FLY A;  5LGU A;  5CA3 A;  3CB2 A;  2C2A A;  5A2Q N;  2ATK C;  1NS1 A;  3I56 V;  4TV8 B;  4CH4 A;  3WB2 A;  4DR5 B;  4YJ2 A;  3E8H A;  5B1A B;  2E5L B;  3B4S A;  3HKD B;  3DTU B;  1JA8 A;  4RWU A;  4R7C A;  1ZAU A;  3KCY A;  4JV5 O;  4D7T A;  2YXY A;  4I4T B;  2CH7 B;  3P3P A;  4NTY A;  3WB1 A;  5CMU A;  1DF4 A;  4WBN B;  1JCH A;  5LYJ B;  2JVD A;  5K1X A;  3OMI B;  2H3O A;  4P2Z A;  4KUM A;  3I55 V;  3UT5 A;  3JAS B;  1FS0 G;  4J11 A;  4A5U B;  3K3W A;  1VQ6 V;  1HWY A;  1US6 A;  4O2A A;  5JJN B;  1RPR A;  2KSD A;  4X62 B;  1D5A A;  3ASN B;  4PA3 A;  4B3R O;  3RYF B;  1BE3 H;  4BAY A;  2KB1 A;  2LP7 A;  5B1B B;  1N36 O;  3FB5 C;  4ZIB A;  1XNR B;  4CC5 A;  4FLU A;  2QSA A;  1S72 V;  2EBO A;  3OEH G;  3JAT B;  2GTA A;  2KKW A;  1PL4 A;  3LDE A;  4IYH A;  5J9P C;  4LCU C;  3M99 B;  4DK0 A;  4CS2 A;  4LF8 B;  4ZBM A;  3CYO A;  1XRE A;  3EHB B;  1KEC A;  3IAY A;  2A79 B;  2CE4 A;  3ZRS A;  4BIU A;  4NTW A;  1AJN A;  1MSW D;  1YJW V;  2BTQ B;  3K5N A;  1M1K W;  4FK5 C;  3E22 B;  2YXH A;  5LP6 B;  5LYJ A;  4HAM A;  4MVU A;  1RP3 B;  4JYY A;  1Q90 D;  4P30 A;  3SJQ C;  2VQE O;  3H9V A;  4YY3 B;  4I5S A;  2XHB A;  5L3B A;  1V55 C;  3ZHU A;  1DLB A;  4B3S B;  3SPC A;  2R72 A;  4DV7 B;  1KKD A;  4J7K A;  3H1L H;  1XIL A;  2IJH A;  2WA4 A;  5FPR A;  1XMQ B;  4O2B B;  3ABL B;  3E86 A;  4I55 B;  3OT7 A;  2W6I G;  1TVK B;  3L72 H;  1KQS U;  1TUB A;  3H1I H;  4WFF A;  1IUR A;  3P3N A;  5LA6 B;  2EIL C;  3LDD A;  5KMG B;  1ZL8 A;  1NTK H;  4PDM A;  3W7S A;  3ICX A;  4U3J B;  3ZBH A;  3ZRV A;  5IWA B;  2EIN C;  4MTX A;  4H33 A;  2ADP A;  1OCZ B;  4FM1 A;  2GV9 A;  1R3I C;  2WLN A;  1FFT B;  1KU9 A;  2P6J A;  4JZG A;  2R9R B;  1QQC A;  1KC8 W;  2X0L A;  1SA0 B;  2WLK A;  3JAK B;  4H44 B;  3TCU A;  5LXT A;  5IYD O;  3CCR V;  2XAF A;  2UUC O;  4JPR A;  2PYJ A;  2N04 A;  1QR8 A;  4K35 A;  3RYF A;  5HFL A;  3K0D A;  5L3F A;  3PN1 A;  4LWS B;  2XTA A;  2AGA A;  4U3F H;  3A0H Z;  1JJO A;  3WU2 Z;  1I5Y A;  1Q86 W;  1FAF A;  2HLD G;  5L3C A;  4DV6 B;  4I4T A;  1H2S B;  4DR6 B;  4QGP A;  4X1Y B;  2Q7E A;  3B09 A;  4IT5 A;  1XBL A;  1VQ9 V;  1H8H G;  1U97 A;  3ZMS A;  2MK3 A;  4BR6 A;  3RYH A;  1K8A W;  2A0L A;  2GUZ A;  3J80 N;  1PPJ H;  1VQO V;  2DYR B;  4MSW C;  3S3X A;  1BHB A;  5LL6 Y;  1QCE A;  1TUB B;  1CP9 A;  4CH3 A;  4QPK A;  4UVB A;  3CCE V;  4P9P A;  3CP1 A;  1TUE B;  2EUL A;  1MZE A;  3K0G A;  2BTQ A;  4QIW F;  1QR9 A;  5KUK A;  2F95 B;  4X62 O;  4W4L A;  4JAV A;  4FJC C;  5IJ0 A;  1Y4M A;  1WJZ A;  5ITZ A;  1AP5 A;  4UCS A;  2FTK A;  3J81 N;  3CD6 V;  2QM7 A;  4C7U A;  4JI2 B;  1K4C C;  4FFB A;  5H6Q A;  4Q6G A;  2E74 B;  3O65 A;  3SYC A;  2ZT9 B;  4OPA A;  1QNM A;  1WLE A;  2LO1 A;  2W0X A;  4FIP C;  2UUA O;  3SPH A;  3W7T A;  1BL8 A;  3OFN G;  3K06 A;  1GN6 A;  1RM1 C;  1EN4 A;  4LFC O;  5LP6 C;  3ZED A;  4W4K A;  1NT2 B;  1RM1 B;  4RUF A;  3A0B Z;  1N0J A;  2CUG A;  4WFH A;  2H8P C;  2YI9 A;  4UCR A;  1TVK A;  1P7B A;  4LNU A;  2YIA A;  2P90 A;  4OPH A;  2NN4 A;  1V54 B;  1CEZ A;  4MTG A;  1BMF G;  1BT8 A;  4TV9 B;  3F5T A;  3BEH A;  4IYI A;  1XOU A;  2PF4 E;  3AEI A;  1K92 A;  4B7E A;  3HKE B;  1NTZ H;  2FL4 A;  3MD0 A;  5LMU O;  1LUV A;  5EIB C;  4GKJ B;  2UXB B;  3ZRX A;  1UJW B;  4AHC A;  2BOC C;  1GM9 A;  4X20 B;  1Y6X A;  1IBK B;  3BRC A;  3JD1 A;  4PI2 A;  5AG2 A;  1GAX A;  4JI0 B;  4X1K A;  5H6R A;  3W7U A;  4O4H A;  4NXM O;  4MW3 A;  1N32 O;  3QO5 A;  1L0L H;  1FFX B;  2EIK B;  1EZJ A;  1WP8 A;  1PKX A;  1K5Q A;  4DV2 B;  4DR7 B;  4JI5 O;  3BA8 A;  2M7W A;  2FKX A;  3GWO A;  4BW9 A;  1VMG A;  5IY5 B;  1P4R A;  1KUQ A;  1SF9 A;  2R70 A;  5IWA O;  1N8R W;  2P06 A;  1SA0 A;  2QA4 V;  4JYB A;  4B3M B;  3SJC C;  5LBQ A;  1DF5 A;  4F6R B;  3CC7 V;  2Z3Y A;  2IU0 A;  1YTF B;  3QO8 A;  4GZR B;  1YEW A;  3RYC B;  4JAU A;  4KXR A;  4NKG B;  5JCO A;  1V55 B;  3CHX A;  1X59 A;  1SC5 B;  1LUW A;  2UXN A;  5HFM A;  4E4E A;  5LMN B;  2LGQ A;  4JI1 B;  4AIL C;  4Z1V A;  1N33 O;  1E1R G;  1QVF U;  2GBO A;  3X2Q C;  4O4I A;  1S5J A;  4X20 A;  3T1C A;  3N2K B;  2IU3 A;  2EIM B;  1SER A;  2NR5 A;  3CCL V;  2DWE C;  1P7G A;  4LF4 O;  4J41 A;  5K1P A;  1Y66 A;  3ABK C;  3ZHR A;  3ASO B;  2WPD G;  2Q6A A;  3HKB B;  3RN4 A;  4GYC B;  1K33 A;  4N21 A;  4UCU A;  5B3S B;  2CGN A;  2DW4 A;  5EBM C;  4RUE A;  3S3W A;  2MW2 B;  2BCC H;  5DED A;  1Q7Y W;  1SES A;  3JD2 A;  1VF5 B;  1IX9 A;  1E79 G;  4TV9 A;  2E3C A;  4I50 A;  4DR2 B;  3T1H B;  5B1A C;  4NVP A;  5IDJ A;  4AQY O;  1LR1 A;  2DYR C;  2HKO A;  1M90 W;  1R6T A;  4PD4 F;  4B3T B;  2YXL A;  3CEI A;  4LF4 B;  2XOK G;  1I08 A;  4DRX A;  1R73 A;  3P32 A;  1GRJ A;  1Z2G A;  1BCC H;  3GB7 C;  1S0V A;  3OM3 B;  3PJS K;  4H0L B;  3K79 A;  4YY3 O;  1S5H C;  4UCT A;  4UVC A;  3CC2 V;  5JCO C;  1KP3 A;  1I94 B;  4ZI7 A;  4OX9 O;  5C8Y A;  4GX5 A;  5CA1 B;  3JSL A;  1TAE A;  4IIJ A;  3L73 H;  4DUY O;  3QG5 A;  2CH7 A;  4XDK A;  2Y0I A;  2JGU A;  4UXN A;  4CS4 A;  4Z2W A;  1IVS A;  2UXX A;  1IBM O;  2QWR B;  1I5X A;  1SET A;  2ZD9 A;  1OV9 A;  3WG7 C;  3ETQ A;  4QNH B;  1NJI W;  1WB7 A;  5KHK A;  3HKC B;  4G28 B;  3CXH F;  3JAS A;  4JTA B;  2IM9 A;  2HHH B;  3ZCC A;  3RFR A;  1YIT V;  4DR2 O;  3JD3 A;  1AJQ A;  1MSD A;  2PZS A;  2UU9 B;  1HW7 A;  1I7F A;  4E2L A;  5J2U A;  1YF2 A;  2LFS A;  4LF6 O;  3SPJ A;  2F4V O;  3ZRW B;  3SJA C;  3JAT A;  4TWK A;  4OGQ B;  4DRX B;  5EBL C;  2VWJ A;  2ZE8 A;  4O4J B;  2ITD C;  4ZHQ B;  1OJH A;  3ZMV A;  1ZUQ A;  3N2K A;  3CCJ V;  1RPO A;  1SZX A;  3UCS C;  3B8M A;  1AP6 A;  3GWK C;  3APQ A;  4B3T O;  1G4Y B;  2WLI B;  1H2L A;  4B3S O;  4R6Z A;  3RVZ A;  2IBZ H;  5KMG A;  1CXZ B;  5LMN O;  3WFV A;  2F1M A;  3SDL A;  3K59 A;  3FKS G;  1KB9 F;  4JAA A;  5JJE B;  3KCX A;  5IYC O;  1IXM A;  3T1Y B;  2WLM A;  1JJ2 U;  3JSN A;  2OIE A;  2Q9L A;  3FB7 C;  2UXC B;  2JEU A;  1ZTE A;  4B08 A;  2JJ2 G;  4JI6 B;  4JTC B;  4UB6 Z;  2K9P A;  4JZ2 A;  4XBF A;  4U7N A;  3SYA A;  2Q0A A;  1K97 A;  5JVD A;  2EZO A;  5GON B;  2QWP B;  2YIB A;  5J2U B;  3FYI B;  3TJT A;  4I7Z B;  3RYI A;  2FB5 A;  4K0K O;  4X89 A;  4GKJ O;  2UXB O;  1DTO A;  1WPB A;  3LNM B;  2HJF C;  4WFE A;  3F7Y C;  3ETE A;  5H2F Z;  3T1H O;  1GM8 A;  3MHH C;  3M7M X;  4AQY B;  3CRR A;  4DV7 O;  3J7A U;  2XAH A;  4NR1 A;  2F66 C;  4GCZ A;  1PNM A;  1BQZ A;  3X2Q B;  4JI7 O;  1YTF D;  1K7D A;  1DK1 A;  3GVM A;  3AK3 A;  3JD4 A;  3ABM B;  3H01 A;  3OR6 C;  2Z5U A;  2EX3 A;  1GM7 A;  1M93 A;  1G1X B;  1PL0 A;  3OD4 A;  3QTC A;  3CCQ V;  5KX5 B;  2P4K A;  3EVK A;  1RSO B;  4GT1 A;  4KP4 A;  4BIO A;  2GTS A;  4DR4 O;  2VRZ A;  2ODM A;  2Y69 B;  5D5Q A;  4DR1 O;  3AG3 C;  3F5W C;  4HYO A;  2P5O A;  4RQE A;  5EYP A;  1NBM G;  3BAB A;  4O4L A;  4MW8 A;  2KG7 B;  1XI1 A;  2QDO A;  3UO2 A;  5LHG A;  2ZNI A;  1BSM A;  3OW2 U;  3ZN1 A;  1EBO A;  4TV8 A;  4ZHQ A;  1FXK B;  4DUY B;  4YJ2 B;  3UQ8 A;  2QM8 A;  2OCC C;  2Y4T A;  3BFR A;  3ZX6 A;  4RAI A;  3LSQ A;  3ML0 A;  5B3S C;  2DQ3 A;  1MA1 A;  5KHH A;  2GHY A;  4NTX A;  4JV5 B;  3CMA V;  4UVA A;  2RCV A;  2N05 A;  2Q4P A;  1KKC A;  1OCC C;  4P9O A;  4PDL A;  5KX5 A;  1VQK V;  4MVR A;  1AR4 A;  1E1Q G;  5CB4 B;  1HNX O;  1EZV H;  3CC4 V;  4LFA B;  3E35 A;  4PV1 B;  1FPO A;  2D3O W;  3CRM A;  3D36 C;  3B77 A;  3K9A A;  3P30 A;  3ZJZ A;  1N0N A;  4FLZ A;  1VQP V;  3FAV B;  1R6K A;  1NH2 B;  3OTO O;  2OTJ V;  2EJ7 A;  1MZF A;  2ZE7 A;  4BIZ A;  4NXN O;  1VQ4 V;  4JI0 O;  1YXB A;  1SQV H;  2WLJ A;  3K9S A;  2B9Z A;  1OZ0 A;  1EM1 A;  1M9N A;  3KZI Z;  1URF A;  1OCR B;  2DJV A;  2X6A A;  3OMA B;  1DGS A;  3TK1 A;  4LF8 O;  1QLN A;  3CXC U;  2V4D A;  4X65 O;  4CH5 A;  3HPL C;  2YEV A;  1VQL V;  1D5N A;  4FVM A;  3H1K H;  1XHX A;  1NTM H;  2F43 G;  4Q20 A;  2ADQ B;  2WAM A;  5CN0 A;  1M56 C;  4UUJ C;  4J42 A;  4X1I A;  4UV9 A;  4X1K B;  5KA6 A;  3VOU A;  3KKY A;  4O4H B;  3RBZ A;  5B1B C;  3CCS V;  3CE2 A;  3QNE A;  3EXA A;  2A06 H;  5DEC A;  5B1O A;  2B1G A;  3SR2 C;  4JI3 B;  4ICG A;  1OCO C;  1SQX H;  4DV5 B;  3DXR B;  2ZIN A;  1NI8 A;  3FFQ A;  5BMV A;  2B1I A;  1COW G;  5L3E A;  5EC1 C;  5J2T A;  1F23 A;  4MS2 A;  1AI6 A;  4EFE A;  2RMK B;  4ZKI A;  4O2A B;  2ILM A;  4J10 A;  5EBW C;  2BSK B;  1W0J G;  1ZL8 B;  3AG1 C;  2YIC A;  3STZ C;  3AG1 B;  4FMT A;  2PGG A;  3K57 A;  4DK1 A;  2D2C B;  2F23 A;  2ITC C;  2IH1 C;  2O57 A;  2OYQ A;  5BR8 B;  4FLW A;  1N4C A;  1XMQ O;  4TSF G;  4YJ3 A;  1EN5 A;  2Y69 C;  1JX9 A;  4O4I B;  3K58 A;  1QBZ A;  3IGA C;  1TGO A;  1L8D A;  2F4V B;  4I55 A;  3OUS A;  3G6E V;  4X1I B;  1P49 A;  2F93 B;  4DUZ B;  3AG4 C;  4D6T H;  3L74 H;  3ZN0 A;  1J5E B;  4JI4 B;  4JYA B;  1YJ9 V;  1XL4 A;  4CZZ A;  3RVY A;  2RN9 A;  4IIJ B;  3JAL A;  2RQ6 A;  5FNV B;  1HR0 O;  5E79 Z;  1ZX3 A;  1G8M A;  4FM0 A;  2QJ1 A;  4F4L A;  4YHH B;  3SPG A;  1NVP B;  4DYL A;  2QGN A;  4KHP B;  4DR3 B;  3OR7 C;  2Q5Z A;  4HZ3 A;  4DR7 O;  1GN3 A;  2ZNJ A;  3JAM N;  4JTD B;  3K5O A;  1VQM V;  1WA8 B;  4YIO A;  3JAK A;  3VQY A;  4JI3 O;  5JQG B;  3M8A A;  4DV3 O;  4EB6 B;  2BSK A;  1N34 B;  3VQV A;  4MT8 A;  4HNA A;  3SYQ A;  3WG7 B;  1JMK C;  2Q67 A;  3N2G B;  3UO3 A;  1R1B A;  3G80 A;  1ROP A;  1SRY A;  4PDV A;  3FD9 A;  3JAW B;  1IXB A;  1S76 D;  4FM2 A;  5TIS Z;  4Z1M G;  5FL7 G;  3MHS C;  1F4N A;  3LSS A;  1XMO O;  3CSX A;  5C93 A;  3K5M A;  3VQX A;  2E75 B;  4X65 B;  1VIB A;  5IE9 A;  2BTO A;  3U10 A;  1K9M W;  1JOY A;  2YIB D;  2CTQ A;  3CCU V;  4OX9 B;  2UUA B;  4TUY B;  3JD0 A;  2JEX A;  4MVM A;  3OE7 G;  3DSQ A;  4J7J A;  1ORQ C;  3CRQ A;  1TA8 A;  2K1E A;  2YEV B;  5LXT B;  2AXT Z;  1K4D C;  1FXV A;  2QKC A;  2Q8V A;  5IJ0 B;  3E89 A;  1B06 A;  4FFK A;  3STL C;  4X8A A;  1WN7 A;  4DXW A;  4I9W A;  1I0H A;  4ZOL B;  4RQF A;  1OCO B;  3R65 A;  5CBF A;  3AG2 C;  1L0N H;  3ZRW A;  2E5L O;  3LDC A;  1AI5 A;  3BPZ A;  1XDC A;  2Q73 A;  2E76 B;  4WCE V;  1QLE C;  4DR3 O;  2OCC B;  4JF3 A;  2LFR A;  3CX5 F;  3HB3 B;  1NZ6 A;  5IY5 C;  2ETN A;  1KYO F;  5LHI A;  1B3Q A;  3WB0 A;  3BAA A;  4PA6 A;  1AI7 A;  5BR8 O;  1XMO B;  1SS3 A;  1WAZ A;  1M56 B;  3QF7 A;  1R3K C;  1Q81 W;  4JYC A;  3JCZ A;  2CGO A;  3R66 A;  3JAL B;  3DC6 A;  2OCH A;  4YHH O;  2H94 A;  2VWK A;  1VP7 A;  1QU7 A;  3MAQ A;  5D5P A;  2YSU B;  4XDJ A;  4WFA V;  1NR7 A;  4TUY A;  1OCR C;  5CA0 A;  2QWO B;  2XUM A;  1RFY A;  1YIJ V;  2DWD C;  4NB5 A;  2QKA A;  3UT5 B;  1HDJ A;  3ZS8 C;  2W6J G;  5JQG A;  2ZDI A;  3C90 A;  2CTP A;  2PI4 A;  3L75 H;  2Y4U A;  1AIL A;  1Y67 A;  3ZMU A;  1Q82 W;  3H1H H;  4TQF A;  3N2G A;  4B3R B;  3D3I A;  2CAZ C;  4FZ0 A;  4RO2 A;  2XAQ A;  2UU9 O;  1Z5W A;  4LNU B;  2EIL B;  1QVG U;  4PA9 A;  4WBN A;  4DW1 A;  4LFB O;  5IJ9 B;  2QE7 G;  2HVJ C;  4LBE C;  3EFF K;  1WB8 A;  2YC0 A;  2B5U A;  2P67 A;  1FYJ A;  2OTL V;  4X88 A;  4DW0 A;  2OIG A;  2ZCE A;  2FYU H;  2PUS A;  3JAR A;  5FPO A;  5CBH A;  5LGN A;  4EB6 A;  1EN6 A;  3SJB C;  2X6B A;  1Q43 A;  1VQN V;  1J5E O;  4JYA O;  2PY5 A;  4IL6 Z;  1NKD A;  3D8C A;  4HNA B;  2NNU A;  5KAI Z;  3ZHQ A;  4MVZ A;  1F51 A;  1FXH A;  1Q6I A;  3IC9 A;  2P22 C;  5GTI Z;  3IFX A;  2HP8 A;  2LW1 A;  2KG7 A;  1X4T A;  4IHJ B;  2AHY A;  1FFX A;  1XNR O;  2WSS G;  4NYK A;  4ASU G;  5CBG A;  4DV4 B;  1NR1 A;  3U11 A;  2WLH A;  3ZHS A;  1AJP A;  2CDY A;  1XUQ A;  4I0X A;  3T4Z A;  2XT9 A;  1NVP D;  3LSU A;  1S77 D;  1VF6 A;  4K8X A;  2YS8 A;  3BY6 A;  4K0K B;  1EFR G;  3CME V;  4DV4 O;  1GTO A;  3E22 A;  1PM9 A;  3E8G A;  1JPX A;  3JCU Z;  3NXS A;  4FPP A;  4DV5 O;  1K73 W;  3E8B A;  4IGG A;  4U3J A;  1GN4 A;  4BW5 A;  2GUZ B;  2A3Q A;  1GN2 A;  1S5L Z;  5CA0 B;  5F2V O;  3B40 A;  4JI4 O;  4YIP A;  2HVK C;  4QPJ A;  3ZMT A;  4GLX A;  2DYS B;  1MG1 A;  4B7K A;  1YJN V;  1LNQ A;  4LR3 A;  1YSC A;  2AZ2 A;  2VQF O;  4MTO A;  3D3Q A;  1NU1 H;  1O9H A;  1FJG B;  1N36 B;  4KHP O;  1BS3 A;  2GDS A;  4DV2 O;  5CA1 A;  1ZSP A;  4PA4 A;  3UM7 A;  3T2M A;  1KMI Z;  1ZLZ A;  1XQ8 A;  4LF7 O;  3RW0 A;  4LFB B;  2XND G;  3AG4 B;  3VQW A;  1D2D A;  3F7V C;  2BE3 A;  3OEE G;  5B5E Z;  2AW9 A;  2EIM C;  2WLL A;  2WLI A;  2PTM A;  3AK1 A;  4K8Z A;  4LF9 B;  1P84 F;  1AB3 A;  2RNB A;  4UCO A;  3TET A;  3TXQ A;  3K04 A;  3SYP A;  1YZB A;  5BY1 A;  2AZ0 A;  1YVW A;  1VF6 C;  4DV0 O;  2JS3 A;  5LMU B;  4CH6 A;  2DE0 X;  2DOS A;  2YI8 A;  4H13 B;  3E83 A;  2RDC A;  3OAA G;  4GUN A;  4MVO A;  1G6U A;  1S3J A;  4LP8 A;  4WFB V;  2YID A;  3BA9 A;  5DN6 G;  2JRI A;  1J95 A;  1N32 B;  4LH6 A;  2IH3 C;  1IDS A;  3K03 A;  3ASN C;  1XHZ A;  1M4U A;  4G27 B;  3C3T A;  4PJ0 Z;  4ZI7 B;  5LHH A;  1IBL B;  2QTS A;  1JFF A;  3W7X A;  3JYC A;  5B1N A;  5IJ9 A;  2Q7G A;  4WFG A;  1WNS A;  1AVM A;  3RT3 C;  4G2K A;  3I5D A;  4LH7 A;  2ZIO A;  1NQT A;  3Q4H A;  4GX2 A;  3L9D A;  4FLV A;  4MTF A;  5L3D A;  2DYS C;  1PP9 H;  1FXK C;  4I0X B;  1HP8 A;  1Y74 A;  3DXR A;  3JAR B;  2HG5 C;  3G4S V;  5EC2 C;  1F7Y A;  1Q5O A;  2A7W A;  1YI2 V;  2UXD O;  3OGC C;  4TQD A;  4BWA A;  2ZR3 A;  5IYZ A;  2VQE B;  4X64 O;  2EIN B;  4GX0 A;  3SPI A;  2XAG A;  4CS3 A;  2CTW A;  3CCM V;  4DR4 B;  4DV3 B;  2XAJ A;  2JGD B;  5LOV A;  5BXZ A;  1FKA O;  2G38 A;  4DR6 O;  2QR4 A;  1M5I A;  4IHJ A;  2QWQ B;  4F6R A;  5H5N A;  4X9Q A;  2P7T C;  4YJ3 B;  1UFI A;  1V54 C;  1HNW O;  3RYI B;  4GKK B;  4UFZ A;  4JI2 O;  3CRC A;  2JIZ G;  3OMN B;  5JH7 A;  2EIK C;  3CWB H;  1N34 O;  1W59 A;  1Y76 B;  3ETD A;  1QHT A;  1MAB G;  3G67 A;  1H38 A;  4ABM A;  4LC1 A;  4DV1 B;  1JQ0 A;  2ZXW C;  4B3M O;  5KAF Z;  4J9Y B;  4DUZ O;  1KP2 A;  4PA7 A;  1XNQ O;  4PEL A;  3C3S A;  1Y74 B;  3A2F A;  4NXN B;  4L87 A;  4UCV A;  2UUB B;  2ZM6 B;  2PYL A;  2YUA A;  5B66 Z;  3ZMZ A;  1RSO A;  2A9H A;  2Q7H A;  4AI8 A;  1MMM A;  1YDX A;  2Q69 A;  3O9O A;  3A0R A;  1BHA A;  1WP7 A;  2JK5 C;  3AG2 B;  3FX7 A;  3ASO C;  3CRA A;  5IYZ B;  1K3E A;  3FB8 C;  2IJI A;  4MVS A;  3IC7 A;  1T5E A;  2W0F C;  2OT5 A;  5A9G A;  3CJH B;  3VBB A;  4I50 B;  4QE7 A;  4LFA O;  2JGD A;  5LOV B;  5EZY B;  4WF9 V;  4O4L B;  3KG2 A;  2ZM6 O;  3B8N A;  2YDE A;  1IBL O;  3CCV V;  1Q6U A;  3JAW A;  2X7R B;  4JI8 B;  2ZXW B;  1XNQ B;  2Y48 A;  1PD3 A;  5GW7 A;  3A8T A;  1B04 A;  4LF7 B;  1FXK A;  4OXS A;  3RGB A;  1SQB H;  2EIJ C;  3DC5 A;  5IYB O;  4DO2 A;  1SQQ H;  3LNN A;  3ZHV A;  4CC6 A;  4R8C A;  1GH6 A;  3SGI A;  2ZKO A;  5LA6 A;  4DR5 O;  5LGT A;  2ZQM A;  3TXS A;  1VQ5 V;  2CK3 G;  1VAR A;  4J80 A;  4DV1 O;  2M6Y A;  4X66 B;  3HKC A;  2PI5 A;  3OTF A;  1JFF B;  1SQP H;  4UV8 A;  1HNZ B;  3LUT B;  2ZDI C;  4GKK O;  2HEP A;  1UPG A;  5KHI A;  3Q4H B;  4GX1 A;  1KD1 W;  3BCC H;  1SQG A; 
#chains in the Genus database with same CATH homology
 4IYH A;  4J7K A;  4W4K A;  4IYI A;  2G38 A;  4J42 A;  4J41 A;  4J11 A;  4J7J A;  4W4L A;  4J10 A;  2GTS A;  3FX7 A;  4KXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...