2G38A

A pe/ppe protein complex from mycobacterium tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
77
Chain Sequence
PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords PE FAMILY PROTEIN
publication title Toward the structural genomics of complexes: Crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 33
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 2g38A00
4J10A 3FX7A 4J42A 4J11A 4IYIA 4J7JA 4KXRA 4W4KA 4J7KA 4W4LA 4J41A 2GTSA 2G38A 4IYHA
chains in the Genus database with same CATH superfamily
5JVDA 1NR1A 1VQ9V 1B06A 4B3TO 4YJ3A 1OCRC 3CCLV 2EX3A 1AJNA 3JARA 3K9SA 2D2CB 3N2GA 1Y67A 4UVCA 4DR1B 2CH7A 3W7WA 4DV2B 3ZIAG 4R8CA 1L1FA 3OTOO 4NXMO 1Y4MA 2P4KA 4P9PA 3SYOA 3N2KA 5LYJA 4O2BA 1QVFU 1P7GA 1BMFG 2Q6AA 4JAVA 5C8YB 1FAFA 4I50B 2AW9A 1DF4A 4X9QA 4DR2O 3H1HH 5L3EA 1R6NA 1E1RG 4YXWG 5CN0A 4MVQA 4H33A 2IW5A 2IU0A 1PPJH 1JPXA 1G8MA 2OYQA 2V7QG 3QVNA 4R7CA 4JI1O 1OCOB 2OIEA 3F7VC 4MVMA 1JQ0A 5EK0A 3EVKA 2XAHA 2WLMA 1GM7A 4LF6O 2L6LA 1K97A 3ZCCA 1T5EA 1S5JA 1NTKH 1SQVH 4PA7A 1SA0B 5EBWC 4EKWA 4I7ZB 1QU7A 4K3AA 1XEQA 3IAYA 1GN6A 1IURA 1DK1A 1JJ2U 2FYUH 1GK9A 1VQ4V 3RYFA 4AI8A 2B1IA 2NR5A 4FMTA 4O4JB 3ZS8C 4QNHB 2W6JG 5BMVA 4B3TB 4NTWA 2YICA 1K92A 2DWDC 3JASB 5B1BC 4PI2A 5FNVB 3LDEA 2P4VA 4W4KA 1RP3B 3OTOB 4NXMB 3A0BZ 3CCRV 4UB8Z 3ZBHA 1VIBA 4JGSA 3CCEV 2MK3A 4WFEA 1WP7A 2ETNA 2YC0A 5AG2A 5A2QN 3ABUA 3ZHUA 2Z3YA 4O4LA 4X20B 2DYRB 4U3JA 4PDMA 4DR2B 1M56C 1ORQC 1HW7A 1EFRG 1BQ0A 4PDLA 2OCHA 3SPGA 3KKYA 1ENVA 2R9AA 5EC1C 3FFQA 4JI1B 5FL7G 5JCOC 3HKEB 1S77D 4JV5O 4O2AB 3CC2V 2LFRA 5GONB 5KUMA 3JSNA 2EIKC 4LF6B 1AB3A 1PNLA 4UCVA 2DYSC 1Q43A 3AG4B 1KUQA 3KCYA 1Z5VA 4RAIA 3ASNC 4UCUA 2E74B 1I5YA 4DR4O 1AI6A 1Q8IA 4C7UA 5JCOA 2Y69C 2B5UA 1Y74A 1SRYA 1XHZA 2UXXA 4X64B 4L87A 2YDEA 1WPBA 3GWOA 3ZHVA 2BOCC 3J81N 2DJVA 2B1GA 2WLIA 2E5LO 2Z0AA 2AHYA 1JVMA 4KHPO 3ZHRA 4Q6GA 4BR6A 4FZ1A 4X62O 1Q5OA 4RQFA 3DTUB 3A2FA 5J2UA 2CAZC 4I55B 3WFVA 1SKVA 2PZSA 3JAMN 5IJ0B 5GTIZ 1YHQV 1IVSA 1KECA 3MHSC 3WG7B 1LR1A 4MW3A 4LP8A 4UCTA 2ZE5A 1VQPV 5EIBC 2UU9O 2F4VO 3R65A 2WWWA 1R3LC 3C90A 3L70H 1OCZB 4GT1A 1JFFA 2GDSA 3SPCA 5K1PA 3LUTB 3K0DA 1UFIA 5IYZB 2Z5UA 1Y76A 2YEVB 5EBLC 2CTQA 3L73H 1YSCA 2ZXWB 4MVUA 3K57A 1VQKV 1ZLZA 2Q73A 2WA3A 3T1CA 3W7SA 1NVPD 4JV5B 2R9IA 1IZ3A 1Q82W 2LP7A 1QCEA 1L0NH 1AI7A 3HB3B 3T2MA 4GX5A 1XILA 1Q90D 4LH6A 3DSQA 4WFGA 1B04A 1HNWO 2ZKOA 5IY5B 3OEEG 1UJWB 1SZXA 4LCUC 4DR4B 4X1YB 4JI3O 4NYKA 1SF9A 4ZBMA 4CH3A 2VS0A 1TVKA 1LUVA 4O4IA 5DM6V 1TAEA 4JTAB 1R3KC 3QO8A 3STZC 4BIUA 4OXSA 4EB6A 2AZ0A 2E5LB 1WP8A 4KHPB 3JAKA 1YEWA 1HNZO 4X62B 4B3SO 5KA5A 1RSOB 3QG5A 4DO2A 4X1IB 1KKCA 1V54C 4DRXB 4Z2WA 1VF5B 5LHGA 3ZHTA 2AGAA 5L3CA 2YXYA 3ZRWB 2A0LA 4DV1O 2ZIOA 2ZM6O 4LNUB 4YIPA 2UU9B 2F4VB 4JI7O 2WA4A 1PL0A 4F4LA 4IT5A 1NQTA 2RCVA 1AI4A 2ODMA 3O9OA 3G71V 2F93B 1FXKC 1WNSA 2XNDG 1WLEA 2LGQA 1FXVA 2QM7A 2A79B 2PI4A 5JH7B 5KX5A 5EZYA 1BGYH 4ZI7B 3K58A 3CMEV 5LMNO 1Q6HA 2UXDO 4FLUA 1HNWB 1V55C 1IX9A 3AG3B 1FFTB 1FXKA 4JI3B 1OJHA 1KBHA 2WLJA 1R3JC 2IJHA 2E76B 4G27B 2NNUA 1HWYA 2JJ2G 3BAAA 4PELA 3WB1A 3RT3C 5CBGA 1GTOA 2BTQB 1K7DA 2HG5C 5CB4A 1M57B 1Q3EA 3HKBB 2WLLA 3NXSA 4MTOA 1VQ8V 2JVDA 5KHJA 1HNZB 4UVBA 2P67A 3ABLB 1PKXA 4FPPA 1I7FA 4B3SB 4NTYA 1OCOC 4DR6O 5BY1A 4ZHQB 4X66O 4UV8A 3K0GA 4I50A 1SC5B 1M5IA 2C2AA 4J41A 4DV1B 5LP6B 2ZM6B 1D5AA 4LFAO 2P5OA 1W2BU 1GN3A 2RNBA 1RFYA 4GX0A 4HZ3A 4JI7B 2ZDIC 1QR9A 1SQXH 4MW8A 3CS5A 3RGBA 4U3FH 5JWPA 5KMGB 3Q4HB 5IWAO 4TV8A 3DC6A 1AI5A 1MNGA 3UM7A 4I5SA 1M4UA 3RYHB 3IC9A 5CBFA 3OMAB 4HYOA 1YI2V 1DTOA 2ZINA 1ZL8A 3E8FA 1H2KA 1DF5A 1EM1A 4HBNA 1QNMA 3AK1A 3OFNG 4J80A 4UXNA 2EILC 2QDOA 2A9HA 5EBMC 2OWOA 3TCUA 1SQGA 4MVOA 5B1NA 4DV5O 2ZDIA 1E1QG 4DUZO 2PI5A 1SA0A 3OW2U 4Q20A 5E1AC 4EFEA 3D36C 4MSWC 5LMNB 4HNAB 3D3IA 1JMKC 2UXDB 2YS8A 3K9AA 1SQPH 3E8BA 2XAJA 2QTOA 4DUYB 1MG1A 2OCCB 4QE9A 3DC5A 4CZZA 1SERA 4YJ2A 3RVYA 1WJZA 2DYRC 1K4DC 1CEZA 1WN7A 1HP8A 3L72H 3D36A 1Y6XA 5KA6A 3K06A 4J10A 2HHHO 1U97A 4MVRA 4JI8O 3BVOA 2QTSA 2JRIA 4RUFA 1I0HA 4DR6B 3F5WC 2V1DA 3FB5C 4X66B 1Z5WA 3AG1C 4Z1MG 4TWKA 4X20A 5L3GA 4I4TA 4LFAB 1M1KW 2P22C 1US6A 3K03A 3ZX6A 3SPHA 3CX5F 4QIWF 4X8AA 5IWAB 4G28B 4WCEV 1YTFD 3E89A 4IIJB 5EYPB 4FLXA 4E4EA 3J7AU 5LXTB 2RQ6A 3CMAV 2XT9A 2LFSA 4O2AA 1X59A 1AP5A 1V9PA 1GM9A 4JYCA 4DV5B 2GTSA 3JD3A 4DUZB 2GTAA 5CA1B 3APOA 3M8AA 3SJAC 4D7TA 3RN4A 5KUKA 3FX7A 4NR1A 2LJ2A 1KMIZ 2EZOA 5KAFZ 2B9ZA 3JAWA 3S3WA 1P49A 1XL4A 2UUBO 5JQGA 1XQ8A 2EULA 1AR5A 3SYQA 4J9ZB 3K3WA 2E75B 4P30A 4XDLA 1OCZC 2DW4A 2ZR3A 1EN4A 2HHHB 2IH3C 2VWKA 1R6KA 1YJWV 2A3QA 4TT3G 4JI8B 2ZE7A 3JATA 4I55A 3BA9A 2MW2B 2KG7A 2GUZA 4H13B 3RYIA 2AHZA 1O9GA 2YI9A 3CRRA 2ZXWC 1N4CA 2K9PA 4PJ0Z 4UCSA 5EIBD 4BW9A 2QA4V 5IYBO 2QM8A 1EBOA 2ITCC 5LGUA 4FFKA 1R1BA 3B4SA 4GX1A 5B3SB 1XUQA 1OV9A 3FD9A 2RJZA 4WBNB 4FLYA 4NVPA 5LA6A 4DV7O 1JR9A 5IYZA 3U11A 4K0KO 2UXCO 1QLNA 3LDDA 4MT8A 1OHHG 1VQ6V 3LSUA 1SETA 2A06H 1PL4A 2ADQB 1MOFA 2R9RB 4DV6O 4R50A 2QE7G 5L3BA 3SJCC 1AROP 1K8AW 5LBQA 2JGDA 1FS0G 4X64O 2DWEC 1GAXA 4DV4O 2AXTZ 1M93A 1IDSA 1B6QA 3SYCA 3H1IH 4UFZA 2WAMA 1NH2D 2QSAA 3K79A 3ZMUA 2UUBB 3RBZA 2CUGA 1RM1B 1NVPB 1UPGA 4KUMA 5K1XA 5ITZB 1H2MA 2EINB 4LFCB 1OCCB 5KHIA 3RW0A 1GH6A 1RSOA 1FJGO 1W59A 1HDJA 3QO5A 4X1IA 4JPRA 4YHHO 4BIZA 1XNRO 1YIJV 2VRZA 5IYDO 2F66C 1PNKA 1CXZB 5EC2C 2FMLA 3X2QC 2UXBO 3LSSA 2Y48A 3TJTA 4GZRB 1IXMA 3CHXA 4DK0A 2RN9A 1MABG 5DECA 4DV7B 2IU3A 4K0KB 3VBBA 2UXCB 4H37A 3UO3A 4KXRA 4TUYA 2VQFO 3JD4A 2ZD9A 1AP6A 5IJ9A 4X1KB 3E22B 1K34A 1VQOV 2XOKG 1SQFA 2HVJC 2BCCH 1R6TA 4DV6B 1K4CC 5JH7A 4AHCA 3CCJV 3RWRD 4ZI7A 3BRCA 1HNXO 3FB8C 3HKCA 2EJ7A 5FPRA 2BSKB 3LDCA 3LSQA 3P3NA 4TV9B 3GWKC 4JYAO 4DV4B 2XAGA 1VF6C 5CA3A 5JVDB 4YY3O 2QR4A 3JALB 3OUFA 4YJ3B 2CTRA 1XMQO 2E3CA 3CB2A 2W0FC 3CJHB 2BTQA 2KKWA 1AR4A 3N2GB 4OX9O 4JASA 5GW7A 2CH7B 1VQMV 3I55V 1QLEC 1QBZA 1IBKO 1ZX3A 4JI4O 3OTFA 4MTGA 4TQDA 4BWAA 2EIMC 2PUSA 2N74A 1VF6A 1FJGB 2QGNA 1O9HA 3N2KB 4LWSA 4O2BB 3QNEA 1OZ0A 1KP2A 4QPJA 4YHHB 4ZHQA 1OCRB 1XNRB 1FFXB 1KQSU 3ZN0A 5FPOA 4PA3A 3IJ4A 1FXHA 5J2TB 1SESA 3SYAA 1NTMH 3ASOB 5H9CA 2HR3A 2DN9A 2QWRB 3CXCU 3JCZA 5CA0B 4DW1A 5B1OA 2UXBB 5KMGA 1VF7A 3Q4HA 4PV1B 3AG2C 2DOSA 2QWQB 3J80N 4PA4A 1S72V 2D3OW 3H1LH 1N32O 4FFBA 2ITDC 2VQFB 4RO2A 3OR7C 3B40A 1QR8A 2ZNIA 4LF9O 5LOVB 4F6RA 2DQ3A 4ZIBA 1XI1A 4IL6Z 3LNMB 1HNXB 2UUAO 3CCUV 4PD4F 4CBCA 5F2VO 1JOYA 2Y4TA 3QTCA 1MSWD 4OGQB 4J42A 3FB7C 4UCOA 1S76D 2Q0AA 4JYAB 4IHJB 3ZMSA 4YY3B 3PJSK 4MTXA 3A0HZ 3SPJA 3G4SV 3OD4A 5KAIZ 5E79Z 1AR1B 1XMQB 4FJCC 1H2LA 4CS2A 2F1MA 1PP9H 4DXWA 5LGTA 1JJOA 3SGIA 4FLWA 4OX9B 2Y0IA 3MAQA 4K35A 3CC7V 2Q7HA 1IBKB 3T4ZA 4XDJA 1A32A 3FAVA 1X4TA 4JI4B 4ZKIA 5KHGA 1SQBH 5L3FA 2CGOA 2RMKB 4LH7A 3CRMA 5LGNA 1WA8B 3L75H 1TGOA 2P06A 2JGUA 2JJ1G 4RWUA 2WLKA 2CDYA 2LW7A 3JD2A 1QHTA 5D5PA 1BZKA 3NR7A 3JYCA 1PD3A 4GLXA 4IIJA 3AEIA 5EYPA 3WU2Z 1IXBA 1N32B 5BR8O 2ZNJA 4GKJO 2PYLA 3EFFK 3T1HO 3UT5A 3RVZA 4LF9B 3VOUA 3OUSA 1WAZA 3ABKB 2UUAB 1N0JA 2ZIMA 5H6RA 4JI2O 3KCXA 4DUYO 4UUJC 3ETDA 2JS3A 4PI0A 1YZBA 2X7RB 1YTFB 1KB9F 2OTJV 1KP3A 4WFAV 1BS3A 2JK5C 4D7SA 1GO3F 2ZR2A 1KKDA 4WFBV 3AK2A 2FKXA 5KHHA 2X6BA 5CMUA 3JD0A 2Y0PA 2BTOA 4JZGA 3CCMV 1P84F 3K5OA 2IH1C 2HJFC 5C8YA 4J7JA 3S3XA 2PYJA 4JAUA 1YITV 1Z2GA 3MDSA 2Q0OC 2Q4PA 2QJ1A 5J2UB 4A5UB 4JI5O 3E35A 3DXRB 4JI6O 3B77A 3I5DA 1EZJA 3M7MX 4ASUG 1BSMA 1H8EG 3ICXA 2W0XA 4U7NA 1HR0O 3BFRA 4EEQA 4WBNA 1N34O 1Q81W 5JJEB 1JFFB 2JS5A 4MVSA 1NKDA 3MD0A 4ICGA 4LR3A 4IYHA 5D5QA 1K5QA 2K1EA 1Y76B 5BXZA 5BR8B 2Q8VA 1NJIW 2CK3G 1K9MW 4GKJB 4GCZA 3T1HB 4LF5O 3ML0A 1RM1C 1Y66A 3G6EV 4J7KA 1F7YA 3H1JH 2EINC 1ZTEA 2BOBC 4JI2B 4O4JA 1OCCC 1CPYA 2M7WA 4QPKA 2ILMA 1FPOA 1G4YB 3OT7A 3JASA 3CRAA 1YVWA 2CTPA 1PM9A 1EZVH 1N8RW 3OM3B 5FNVA 1KD1W 3T1YO 4O4IB 3KZIZ 1ZUQA 1M90W 4J11A 1NZ6A 1BHBA 1J95A 4EB6B 2XAQA 3ZRVA 2LGWA 3JAKB 1EN6A 5LL6Y 2O57A 1YF2A 4HAMA 4MVZA 1K5SA 4X88A 3DGEA 4PA9A 4DV0O 1BT8A 3P3PA 4X89A 4IGGA 4YIOA 4JI5B 1L0LH 5LHIA 4JI6B 4UV9A 4I9WA 1VQLV 3UKMA 3AG4C 5CBHA 1MZEA 1XOUA 3SJBC 1WB7A 2YIBA 3CRCA 3L71H 4UVAA 2KQXA 1H2SB 1WB8A 4DK1A 1XDCA 2CE4A 2P7TC 1S3JA 2PTMA 1ZAUA 1K3EA 1HR0B 1Q6IA 2HJDA 4LF7O 4H44B 3HKEA 1GM8A 1THZA 3MHHC 1N34B 1SZTA 2QWNB 2CTWA 2FB5A 1IBLO 5GONA 1B3QA 1V54B 1R3IC 3VQVA 4CH4A 1QQCA 2ADPA 4LF5B 3K5NA 5HFLA 5JJNB 2Q7GA 3THOA 3H01A 5EZYB 3BEHA 1VQ7V 2DQ0A 3WB0A 5B5EZ 3H1KH 3F7YC 5A9GA 4LFBO 3WG7C 1P4RA 1FXKB 1P7BA 1FYJA 4FM0A 2H8PC 3HKDB 3VQYA 1TUBB 3IFXA 3JALA 3T1YB 2LW1A 4N23A 3U0ZA 3CJHA 4ABMA 4LFCO 1DLBA 4KP4A 2F23A 4FIPC 3ASOC 2QM4A 4QE7A 5CB4B 4GKKO 2WLLB 5IJ0A 1V55B 3UQ8A 5H6QA 3N27A 4DV0B 2IM9A 3L74H 2W6IG 3D8CA 4B7EA 2OTLV 3R66A 3ZRSA 1FFXA 3K04A 1MA1A 3CRQA 3E83A 2NN4A 3JSLA 4I0XB 5J2TA 5B66Z 3BY6A 4ZOLB 5IY5C 5LHHA 1H2GA 5TISZ 4U7OA 1J5EO 5CA0A 3UO2A 5FLXN 4WFHA 4LF7B 2YEVA 1D5NA 3CCVV 2Q67A 4TV8B 3SDLA 3L9DA 1E79G 1IBLB 5KLVH 2CGNA 2H3OA 1H2NA 1BCCH 5C93A 2GSMB 5LMUO 1ZWIC 1M9NA 1ZL8B 1VP7A 2EJRA 3UCSC 5LOVA 1GN2A 2N05A 2JEUA 2QWPB 1Q6UA 2UXNA 4X1YA 1GMGA 2JDIG 1BQZA 5H5NA 3ETEA 1GKFA 2HEPA 4XDKA 4QGPA 1R73A 3O65A 1S0VA 4EFBA 2YXHA 4JF3A 4LFBB 2EBOA 4IHJA 1Q86W 4MS2A 4X65O 5HFMA 2ZCEA 2EILB 4BAYA 5B1AB 4F6EA 4YJ2B 4GX2A 4LF8O 2QKCA 4BW5A 3VQXA 3IC7A 2XASA 4GKKB 4DRXA 3F5TA 1LUWA 2EIJB 3HR0A 1I08A 2P90A 3ZRWA 4FLVA 2R72A 1H8HG 4O4HB 1WA8A 1XMOO 4LNUA 4IYIA 1ZSPA 2Y4UA 3D3QA 1K33A 1LNQA 3HPLC 4Z1VA 4DR3O 4I4TB 1F4NA 2YIDA 2QKSA 1I5XA 3AG3C 1URFA 3ABKC 3OEHG 1J5EB 2IJJA 1NS1A 3I56V 3GVMA 5J9PC 2PY5A 3CCSV 4CS4A 3SPIA 4GYCB 3E8GA 4MTFA 1GRJA 3LNNA 3A8TA 2IBZH 5LMUB 3AG1B 4LC1A 1M57C 3OAAG 4WFFA 1N33O 4RUEA 1BL8A 3CPWU 1SS3A 1NI8A 1AJQA 4B3RO 1BE3H 4JI0O 3RYCB 3OR6C 3ABLC 4B7KA 4NB5A 4JZ2A 2YI8A 3AK3A 4FLTA 2QKAA 4OPAA 3FB6C 3CYOA 3JARB 3ABMB 4RQEA 5LP6C 3JAWB 1NU1H 4X65B 2HLDG 3HKBA 4B3MO 2ZT9B 5JJJB 1XNQO 4GUNA 2NLJC 2R70A 2WPDG 5JQGB 4LF4O 4JYYA 3TXSA 2DE0X 2LO1A 2ZE6A 4LF8B 3KG2A 5LYJB 2G38A 2YUAA 1I94O 1ROPA 4PHZA 2WLNA 3M99B 1N0NA 4J9YB 3CSXA 1G6UA 4K8XA 3JATB 3FKSG 5LP6A 3BABA 3DXRA 2ZQMA 1XMOB 4B08A 2KG7B 2GUZB 2LQTA 3RYIB 2HKOA 2IJKA 4UCRA 3IGAC 4AILC 4JYBA 4DR3B 1G1XB 1MZFA 5GTHZ 3RYHA 4TSFG 3ZN1A 3H9VA 4WF9V 3CE2A 5LA6B 2OCCC 3A0RA 4JAAA 2UUCO 2XTAA 4FM1A 3CCQV 1WPXA 1MMMA 4TQFA 1SQQH 1Q7YW 1N33B 3ZRXA 4HNAA 4FVMA 4PA6A 4I9QA 1N36O 1W0KG 4B3RB 4JI0B 1QVGU 3FYIB 1RPRA 3OMIB 1K73W 5KHKA 3FYEB 3RYFB 2Q5ZA 5BMVB 4PDRA 1U96A 1VARA 2JGDB 3BA8A 1IBMO 1GN4A 3ETQA 4J7ZA 2YSUB 1FD9A 3G6BA 3K08A 4R6ZA 2JIZG 3BCCH 4B3MB 4NTXA 2YIBD 1XNQB 2XUMA 4PDVA 2XAFA 2V4DA 1PV0A 4LF4B 1YCIA 4CS3A 2GV9A 3CXHF 3AG7A 3BPZA 2BE3A 2PF4E 4CC5A 4NXNO 4FK5C 3GB7C 4UB6Z 5BZBA 2GBOA 1NR7A 1I94B 2ARHA 1BHAA 3VQWA 2F95B 4O4LB 4KL1A 5DEDA 5B1BB 4U3JB 1F4MA 3P30A 4FZ0A 2PGGA 4NKGB 4P9OA 1JA8A 1S5HC 4OPHA 1NT2B 4DR5O 1MSDA 3RFRA 4H0LB 1CP9A 3W7TA 5LXTA 1XHXA 1VQ5V 3CD6V 3ZHSA 3JD1A 3EXAA 1KC8W 2UUCB 4JTDB 4CH6A 3ETGA 1YDXA 1VEWA 1M56B 4TUYB 4BIOA 5IJ9B 5CA1A 3OE7G 4DV3O 3W7XA 1N36B 4FM2A 2WLHA 3X2QB 2F43G 1VMGA 4AQYO 1FKAO 3HKCB 5IYCO 1Y74B 1JX9A 1YXBA 2IJIA 4FLZA 1IBMB 1DGSA 2EIKB 2H94A 3HKDA 2Q9LA 4TOIA 3ZMVA 1YJ9V 2DYSB 1TUBA 1PNMA 2WLIB 3ASNB 3E86A 5B3SC 3TETA 2L35A 1NTZH 3OGIB 2YXLA 1L8DA 4JTCB 2Y69B 2DMXA 2OT5A 1S5LZ 4NXNB 2X6AA 2Q68A 4CC6A 3JCUZ 3QO7A 3K59A 5IE9A 1COWG 2XHBA 1F51A 4LWSB 3U10A 2VWJA 2KSDA 3TXQA 1AJPA 4CH5A 2ATKC 4I0XA 3OMNB 4W4LA 4E2LA 1D2DA 1RPOA 4ZOLA 5IDJA 1JCHA 2M6YA 4DR5B 4L8JA 1QLEB 2FTKA 1AVMA 2JEXA 2EIMB 4N21A 2X0LA 4DR7O 5H2FZ 2Q7EA 1KU9A 3BHPA 3EHBB 2A7WA 4FFBB 2QEXV 1NBMG 1AILA 5IT9N 2VQEO 2EZPA 3CC4V 4K8ZA 3B09A 4DYLA 5B1AC 5DN6G 1XBLA 4F6RB 4DV3B 4XBFA 1TUEB 2KB1A 2FL4A 3T4DA 2HVKC 2AZ2A 3AG2B 4AQYB 4KFMA 4P2ZA 1TVKB 2EIJC 2RDCA 1F23A 2P6JA 1H38A 3TK1A 4DR1O 5ITZA 1XL6A 3E8HA 4DV2O 3K5LA 2ZE8A 3CP1A 3G80A 2WSSG 1W0JG 3APQA 3ABTA 3ZHQA 3WB2A 3B2EE 3ZMZA 3SJQC 3FAVB 3C3TA 1YJNV 3SYPA 4O4HA 4DW0A 1NH2B 3ZEDA 3ZJZA 3CWBH 4G2KA 4LBEC 5L3DA 1VQNV 3CEIA 3C3SA 2QWOB 3B8MA 3SR2C 2HP8A 4QJFB 3TGUH 3B8NA 3ZMTA 1TA8A 2GHYA 3G67A 1KYOF 4X1KA 3E22A 3OGCC 2Q69A 3E2EA 3W7UA 3PN1A 3ABMC 4DR7B 2N04A 3K5MA 3P32A 2YIAA 4D6TH 2OIGA 5KX5B 3UT5B 2VQEB 1EN5A 2BSKA 4TV9A 2HFEC 3RYCA 2X6CA 3QF7A 3STLC 1XREA
chains in the Genus database with same CATH topology
4J10A 3FX7A 4J42A 4J11A 4IYIA 4J7JA 4KXRA 4W4KA 4J7KA 4W4LA 4J41A 2GTSA 2G38A 4IYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J10 A;  3FX7 A;  4J42 A;  4J11 A;  4IYI A;  4J7J A;  4KXR A;  4W4K A;  4J7K A;  4W4L A;  4J41 A;  2GTS A;  2G38 A;  4IYH A; 
#chains in the Genus database with same CATH topology
 5JVD A;  1NR1 A;  1VQ9 V;  1B06 A;  4B3T O;  4YJ3 A;  1OCR C;  3CCL V;  2EX3 A;  1AJN A;  3JAR A;  3K9S A;  2D2C B;  3N2G A;  1Y67 A;  4UVC A;  4DR1 B;  2CH7 A;  3W7W A;  4DV2 B;  3ZIA G;  4R8C A;  1L1F A;  3OTO O;  4NXM O;  1Y4M A;  2P4K A;  4P9P A;  3SYO A;  3N2K A;  5LYJ A;  4O2B A;  1QVF U;  1P7G A;  1BMF G;  2Q6A A;  4JAV A;  5C8Y B;  1FAF A;  4I50 B;  2AW9 A;  1DF4 A;  4X9Q A;  4DR2 O;  3H1H H;  5L3E A;  1R6N A;  1E1R G;  4YXW G;  5CN0 A;  4MVQ A;  4H33 A;  2IW5 A;  2IU0 A;  1PPJ H;  1JPX A;  1G8M A;  2OYQ A;  2V7Q G;  3QVN A;  4R7C A;  4JI1 O;  1OCO B;  2OIE A;  3F7V C;  4MVM A;  1JQ0 A;  5EK0 A;  3EVK A;  2XAH A;  2WLM A;  1GM7 A;  4LF6 O;  2L6L A;  1K97 A;  3ZCC A;  1T5E A;  1S5J A;  1NTK H;  1SQV H;  4PA7 A;  1SA0 B;  5EBW C;  4EKW A;  4I7Z B;  1QU7 A;  4K3A A;  1XEQ A;  3IAY A;  1GN6 A;  1IUR A;  1DK1 A;  1JJ2 U;  2FYU H;  1GK9 A;  1VQ4 V;  3RYF A;  4AI8 A;  2B1I A;  2NR5 A;  4FMT A;  4O4J B;  3ZS8 C;  4QNH B;  2W6J G;  5BMV A;  4B3T B;  4NTW A;  2YIC A;  1K92 A;  2DWD C;  3JAS B;  5B1B C;  4PI2 A;  5FNV B;  3LDE A;  2P4V A;  4W4K A;  1RP3 B;  3OTO B;  4NXM B;  3A0B Z;  3CCR V;  4UB8 Z;  3ZBH A;  1VIB A;  4JGS A;  3CCE V;  2MK3 A;  4WFE A;  1WP7 A;  2ETN A;  2YC0 A;  5AG2 A;  5A2Q N;  3ABU A;  3ZHU A;  2Z3Y A;  4O4L A;  4X20 B;  2DYR B;  4U3J A;  4PDM A;  4DR2 B;  1M56 C;  1ORQ C;  1HW7 A;  1EFR G;  1BQ0 A;  4PDL A;  2OCH A;  3SPG A;  3KKY A;  1ENV A;  2R9A A;  5EC1 C;  3FFQ A;  4JI1 B;  5FL7 G;  5JCO C;  3HKE B;  1S77 D;  4JV5 O;  4O2A B;  3CC2 V;  2LFR A;  5GON B;  5KUM A;  3JSN A;  2EIK C;  4LF6 B;  1AB3 A;  1PNL A;  4UCV A;  2DYS C;  1Q43 A;  3AG4 B;  1KUQ A;  3KCY A;  1Z5V A;  4RAI A;  3ASN C;  4UCU A;  2E74 B;  1I5Y A;  4DR4 O;  1AI6 A;  1Q8I A;  4C7U A;  5JCO A;  2Y69 C;  2B5U A;  1Y74 A;  1SRY A;  1XHZ A;  2UXX A;  4X64 B;  4L87 A;  2YDE A;  1WPB A;  3GWO A;  3ZHV A;  2BOC C;  3J81 N;  2DJV A;  2B1G A;  2WLI A;  2E5L O;  2Z0A A;  2AHY A;  1JVM A;  4KHP O;  3ZHR A;  4Q6G A;  4BR6 A;  4FZ1 A;  4X62 O;  1Q5O A;  4RQF A;  3DTU B;  3A2F A;  5J2U A;  2CAZ C;  4I55 B;  3WFV A;  1SKV A;  2PZS A;  3JAM N;  5IJ0 B;  5GTI Z;  1YHQ V;  1IVS A;  1KEC A;  3MHS C;  3WG7 B;  1LR1 A;  4MW3 A;  4LP8 A;  4UCT A;  2ZE5 A;  1VQP V;  5EIB C;  2UU9 O;  2F4V O;  3R65 A;  2WWW A;  1R3L C;  3C90 A;  3L70 H;  1OCZ B;  4GT1 A;  1JFF A;  2GDS A;  3SPC A;  5K1P A;  3LUT B;  3K0D A;  1UFI A;  5IYZ B;  2Z5U A;  1Y76 A;  2YEV B;  5EBL C;  2CTQ A;  3L73 H;  1YSC A;  2ZXW B;  4MVU A;  3K57 A;  1VQK V;  1ZLZ A;  2Q73 A;  2WA3 A;  3T1C A;  3W7S A;  1NVP D;  4JV5 B;  2R9I A;  1IZ3 A;  1Q82 W;  2LP7 A;  1QCE A;  1L0N H;  1AI7 A;  3HB3 B;  3T2M A;  4GX5 A;  1XIL A;  1Q90 D;  4LH6 A;  3DSQ A;  4WFG A;  1B04 A;  1HNW O;  2ZKO A;  5IY5 B;  3OEE G;  1UJW B;  1SZX A;  4LCU C;  4DR4 B;  4X1Y B;  4JI3 O;  4NYK A;  1SF9 A;  4ZBM A;  4CH3 A;  2VS0 A;  1TVK A;  1LUV A;  4O4I A;  5DM6 V;  1TAE A;  4JTA B;  1R3K C;  3QO8 A;  3STZ C;  4BIU A;  4OXS A;  4EB6 A;  2AZ0 A;  2E5L B;  1WP8 A;  4KHP B;  3JAK A;  1YEW A;  1HNZ O;  4X62 B;  4B3S O;  5KA5 A;  1RSO B;  3QG5 A;  4DO2 A;  4X1I B;  1KKC A;  1V54 C;  4DRX B;  4Z2W A;  1VF5 B;  5LHG A;  3ZHT A;  2AGA A;  5L3C A;  2YXY A;  3ZRW B;  2A0L A;  4DV1 O;  2ZIO A;  2ZM6 O;  4LNU B;  4YIP A;  2UU9 B;  2F4V B;  4JI7 O;  2WA4 A;  1PL0 A;  4F4L A;  4IT5 A;  1NQT A;  2RCV A;  1AI4 A;  2ODM A;  3O9O A;  3G71 V;  2F93 B;  1FXK C;  1WNS A;  2XND G;  1WLE A;  2LGQ A;  1FXV A;  2QM7 A;  2A79 B;  2PI4 A;  5JH7 B;  5KX5 A;  5EZY A;  1BGY H;  4ZI7 B;  3K58 A;  3CME V;  5LMN O;  1Q6H A;  2UXD O;  4FLU A;  1HNW B;  1V55 C;  1IX9 A;  3AG3 B;  1FFT B;  1FXK A;  4JI3 B;  1OJH A;  1KBH A;  2WLJ A;  1R3J C;  2IJH A;  2E76 B;  4G27 B;  2NNU A;  1HWY A;  2JJ2 G;  3BAA A;  4PEL A;  3WB1 A;  3RT3 C;  5CBG A;  1GTO A;  2BTQ B;  1K7D A;  2HG5 C;  5CB4 A;  1M57 B;  1Q3E A;  3HKB B;  2WLL A;  3NXS A;  4MTO A;  1VQ8 V;  2JVD A;  5KHJ A;  1HNZ B;  4UVB A;  2P67 A;  3ABL B;  1PKX A;  4FPP A;  1I7F A;  4B3S B;  4NTY A;  1OCO C;  4DR6 O;  5BY1 A;  4ZHQ B;  4X66 O;  4UV8 A;  3K0G A;  4I50 A;  1SC5 B;  1M5I A;  2C2A A;  4J41 A;  4DV1 B;  5LP6 B;  2ZM6 B;  1D5A A;  4LFA O;  2P5O A;  1W2B U;  1GN3 A;  2RNB A;  1RFY A;  4GX0 A;  4HZ3 A;  4JI7 B;  2ZDI C;  1QR9 A;  1SQX H;  4MW8 A;  3CS5 A;  3RGB A;  4U3F H;  5JWP A;  5KMG B;  3Q4H B;  5IWA O;  4TV8 A;  3DC6 A;  1AI5 A;  1MNG A;  3UM7 A;  4I5S A;  1M4U A;  3RYH B;  3IC9 A;  5CBF A;  3OMA B;  4HYO A;  1YI2 V;  1DTO A;  2ZIN A;  1ZL8 A;  3E8F A;  1H2K A;  1DF5 A;  1EM1 A;  4HBN A;  1QNM A;  3AK1 A;  3OFN G;  4J80 A;  4UXN A;  2EIL C;  2QDO A;  2A9H A;  5EBM C;  2OWO A;  3TCU A;  1SQG A;  4MVO A;  5B1N A;  4DV5 O;  2ZDI A;  1E1Q G;  4DUZ O;  2PI5 A;  1SA0 A;  3OW2 U;  4Q20 A;  5E1A C;  4EFE A;  3D36 C;  4MSW C;  5LMN B;  4HNA B;  3D3I A;  1JMK C;  2UXD B;  2YS8 A;  3K9A A;  1SQP H;  3E8B A;  2XAJ A;  2QTO A;  4DUY B;  1MG1 A;  2OCC B;  4QE9 A;  3DC5 A;  4CZZ A;  1SER A;  4YJ2 A;  3RVY A;  1WJZ A;  2DYR C;  1K4D C;  1CEZ A;  1WN7 A;  1HP8 A;  3L72 H;  3D36 A;  1Y6X A;  5KA6 A;  3K06 A;  4J10 A;  2HHH O;  1U97 A;  4MVR A;  4JI8 O;  3BVO A;  2QTS A;  2JRI A;  4RUF A;  1I0H A;  4DR6 B;  3F5W C;  2V1D A;  3FB5 C;  4X66 B;  1Z5W A;  3AG1 C;  4Z1M G;  4TWK A;  4X20 A;  5L3G A;  4I4T A;  4LFA B;  1M1K W;  2P22 C;  1US6 A;  3K03 A;  3ZX6 A;  3SPH A;  3CX5 F;  4QIW F;  4X8A A;  5IWA B;  4G28 B;  4WCE V;  1YTF D;  3E89 A;  4IIJ B;  5EYP B;  4FLX A;  4E4E A;  3J7A U;  5LXT B;  2RQ6 A;  3CMA V;  2XT9 A;  2LFS A;  4O2A A;  1X59 A;  1AP5 A;  1V9P A;  1GM9 A;  4JYC A;  4DV5 B;  2GTS A;  3JD3 A;  4DUZ B;  2GTA A;  5CA1 B;  3APO A;  3M8A A;  3SJA C;  4D7T A;  3RN4 A;  5KUK A;  3FX7 A;  4NR1 A;  2LJ2 A;  1KMI Z;  2EZO A;  5KAF Z;  2B9Z A;  3JAW A;  3S3W A;  1P49 A;  1XL4 A;  2UUB O;  5JQG A;  1XQ8 A;  2EUL A;  1AR5 A;  3SYQ A;  4J9Z B;  3K3W A;  2E75 B;  4P30 A;  4XDL A;  1OCZ C;  2DW4 A;  2ZR3 A;  1EN4 A;  2HHH B;  2IH3 C;  2VWK A;  1R6K A;  1YJW V;  2A3Q A;  4TT3 G;  4JI8 B;  2ZE7 A;  3JAT A;  4I55 A;  3BA9 A;  2MW2 B;  2KG7 A;  2GUZ A;  4H13 B;  3RYI A;  2AHZ A;  1O9G A;  2YI9 A;  3CRR A;  2ZXW C;  1N4C A;  2K9P A;  4PJ0 Z;  4UCS A;  5EIB D;  4BW9 A;  2QA4 V;  5IYB O;  2QM8 A;  1EBO A;  2ITC C;  5LGU A;  4FFK A;  1R1B A;  3B4S A;  4GX1 A;  5B3S B;  1XUQ A;  1OV9 A;  3FD9 A;  2RJZ A;  4WBN B;  4FLY A;  4NVP A;  5LA6 A;  4DV7 O;  1JR9 A;  5IYZ A;  3U11 A;  4K0K O;  2UXC O;  1QLN A;  3LDD A;  4MT8 A;  1OHH G;  1VQ6 V;  3LSU A;  1SET A;  2A06 H;  1PL4 A;  2ADQ B;  1MOF A;  2R9R B;  4DV6 O;  4R50 A;  2QE7 G;  5L3B A;  3SJC C;  1ARO P;  1K8A W;  5LBQ A;  2JGD A;  1FS0 G;  4X64 O;  2DWE C;  1GAX A;  4DV4 O;  2AXT Z;  1M93 A;  1IDS A;  1B6Q A;  3SYC A;  3H1I H;  4UFZ A;  2WAM A;  1NH2 D;  2QSA A;  3K79 A;  3ZMU A;  2UUB B;  3RBZ A;  2CUG A;  1RM1 B;  1NVP B;  1UPG A;  4KUM A;  5K1X A;  5ITZ B;  1H2M A;  2EIN B;  4LFC B;  1OCC B;  5KHI A;  3RW0 A;  1GH6 A;  1RSO A;  1FJG O;  1W59 A;  1HDJ A;  3QO5 A;  4X1I A;  4JPR A;  4YHH O;  4BIZ A;  1XNR O;  1YIJ V;  2VRZ A;  5IYD O;  2F66 C;  1PNK A;  1CXZ B;  5EC2 C;  2FML A;  3X2Q C;  2UXB O;  3LSS A;  2Y48 A;  3TJT A;  4GZR B;  1IXM A;  3CHX A;  4DK0 A;  2RN9 A;  1MAB G;  5DEC A;  4DV7 B;  2IU3 A;  4K0K B;  3VBB A;  2UXC B;  4H37 A;  3UO3 A;  4KXR A;  4TUY A;  2VQF O;  3JD4 A;  2ZD9 A;  1AP6 A;  5IJ9 A;  4X1K B;  3E22 B;  1K34 A;  1VQO V;  2XOK G;  1SQF A;  2HVJ C;  2BCC H;  1R6T A;  4DV6 B;  1K4C C;  5JH7 A;  4AHC A;  3CCJ V;  3RWR D;  4ZI7 A;  3BRC A;  1HNX O;  3FB8 C;  3HKC A;  2EJ7 A;  5FPR A;  2BSK B;  3LDC A;  3LSQ A;  3P3N A;  4TV9 B;  3GWK C;  4JYA O;  4DV4 B;  2XAG A;  1VF6 C;  5CA3 A;  5JVD B;  4YY3 O;  2QR4 A;  3JAL B;  3OUF A;  4YJ3 B;  2CTR A;  1XMQ O;  2E3C A;  3CB2 A;  2W0F C;  3CJH B;  2BTQ A;  2KKW A;  1AR4 A;  3N2G B;  4OX9 O;  4JAS A;  5GW7 A;  2CH7 B;  1VQM V;  3I55 V;  1QLE C;  1QBZ A;  1IBK O;  1ZX3 A;  4JI4 O;  3OTF A;  4MTG A;  4TQD A;  4BWA A;  2EIM C;  2PUS A;  2N74 A;  1VF6 A;  1FJG B;  2QGN A;  1O9H A;  3N2K B;  4LWS A;  4O2B B;  3QNE A;  1OZ0 A;  1KP2 A;  4QPJ A;  4YHH B;  4ZHQ A;  1OCR B;  1XNR B;  1FFX B;  1KQS U;  3ZN0 A;  5FPO A;  4PA3 A;  3IJ4 A;  1FXH A;  5J2T B;  1SES A;  3SYA A;  1NTM H;  3ASO B;  5H9C A;  2HR3 A;  2DN9 A;  2QWR B;  3CXC U;  3JCZ A;  5CA0 B;  4DW1 A;  5B1O A;  2UXB B;  5KMG A;  1VF7 A;  3Q4H A;  4PV1 B;  3AG2 C;  2DOS A;  2QWQ B;  3J80 N;  4PA4 A;  1S72 V;  2D3O W;  3H1L H;  1N32 O;  4FFB A;  2ITD C;  2VQF B;  4RO2 A;  3OR7 C;  3B40 A;  1QR8 A;  2ZNI A;  4LF9 O;  5LOV B;  4F6R A;  2DQ3 A;  4ZIB A;  1XI1 A;  4IL6 Z;  3LNM B;  1HNX B;  2UUA O;  3CCU V;  4PD4 F;  4CBC A;  5F2V O;  1JOY A;  2Y4T A;  3QTC A;  1MSW D;  4OGQ B;  4J42 A;  3FB7 C;  4UCO A;  1S76 D;  2Q0A A;  4JYA B;  4IHJ B;  3ZMS A;  4YY3 B;  3PJS K;  4MTX A;  3A0H Z;  3SPJ A;  3G4S V;  3OD4 A;  5KAI Z;  5E79 Z;  1AR1 B;  1XMQ B;  4FJC C;  1H2L A;  4CS2 A;  2F1M A;  1PP9 H;  4DXW A;  5LGT A;  1JJO A;  3SGI A;  4FLW A;  4OX9 B;  2Y0I A;  3MAQ A;  4K35 A;  3CC7 V;  2Q7H A;  1IBK B;  3T4Z A;  4XDJ A;  1A32 A;  3FAV A;  1X4T A;  4JI4 B;  4ZKI A;  5KHG A;  1SQB H;  5L3F A;  2CGO A;  2RMK B;  4LH7 A;  3CRM A;  5LGN A;  1WA8 B;  3L75 H;  1TGO A;  2P06 A;  2JGU A;  2JJ1 G;  4RWU A;  2WLK A;  2CDY A;  2LW7 A;  3JD2 A;  1QHT A;  5D5P A;  1BZK A;  3NR7 A;  3JYC A;  1PD3 A;  4GLX A;  4IIJ A;  3AEI A;  5EYP A;  3WU2 Z;  1IXB A;  1N32 B;  5BR8 O;  2ZNJ A;  4GKJ O;  2PYL A;  3EFF K;  3T1H O;  3UT5 A;  3RVZ A;  4LF9 B;  3VOU A;  3OUS A;  1WAZ A;  3ABK B;  2UUA B;  1N0J A;  2ZIM A;  5H6R A;  4JI2 O;  3KCX A;  4DUY O;  4UUJ C;  3ETD A;  2JS3 A;  4PI0 A;  1YZB A;  2X7R B;  1YTF B;  1KB9 F;  2OTJ V;  1KP3 A;  4WFA V;  1BS3 A;  2JK5 C;  4D7S A;  1GO3 F;  2ZR2 A;  1KKD A;  4WFB V;  3AK2 A;  2FKX A;  5KHH A;  2X6B A;  5CMU A;  3JD0 A;  2Y0P A;  2BTO A;  4JZG A;  3CCM V;  1P84 F;  3K5O A;  2IH1 C;  2HJF C;  5C8Y A;  4J7J A;  3S3X A;  2PYJ A;  4JAU A;  1YIT V;  1Z2G A;  3MDS A;  2Q0O C;  2Q4P A;  2QJ1 A;  5J2U B;  4A5U B;  4JI5 O;  3E35 A;  3DXR B;  4JI6 O;  3B77 A;  3I5D A;  1EZJ A;  3M7M X;  4ASU G;  1BSM A;  1H8E G;  3ICX A;  2W0X A;  4U7N A;  1HR0 O;  3BFR A;  4EEQ A;  4WBN A;  1N34 O;  1Q81 W;  5JJE B;  1JFF B;  2JS5 A;  4MVS A;  1NKD A;  3MD0 A;  4ICG A;  4LR3 A;  4IYH A;  5D5Q A;  1K5Q A;  2K1E A;  1Y76 B;  5BXZ A;  5BR8 B;  2Q8V A;  1NJI W;  2CK3 G;  1K9M W;  4GKJ B;  4GCZ A;  3T1H B;  4LF5 O;  3ML0 A;  1RM1 C;  1Y66 A;  3G6E V;  4J7K A;  1F7Y A;  3H1J H;  2EIN C;  1ZTE A;  2BOB C;  4JI2 B;  4O4J A;  1OCC C;  1CPY A;  2M7W A;  4QPK A;  2ILM A;  1FPO A;  1G4Y B;  3OT7 A;  3JAS A;  3CRA A;  1YVW A;  2CTP A;  1PM9 A;  1EZV H;  1N8R W;  3OM3 B;  5FNV A;  1KD1 W;  3T1Y O;  4O4I B;  3KZI Z;  1ZUQ A;  1M90 W;  4J11 A;  1NZ6 A;  1BHB A;  1J95 A;  4EB6 B;  2XAQ A;  3ZRV A;  2LGW A;  3JAK B;  1EN6 A;  5LL6 Y;  2O57 A;  1YF2 A;  4HAM A;  4MVZ A;  1K5S A;  4X88 A;  3DGE A;  4PA9 A;  4DV0 O;  1BT8 A;  3P3P A;  4X89 A;  4IGG A;  4YIO A;  4JI5 B;  1L0L H;  5LHI A;  4JI6 B;  4UV9 A;  4I9W A;  1VQL V;  3UKM A;  3AG4 C;  5CBH A;  1MZE A;  1XOU A;  3SJB C;  1WB7 A;  2YIB A;  3CRC A;  3L71 H;  4UVA A;  2KQX A;  1H2S B;  1WB8 A;  4DK1 A;  1XDC A;  2CE4 A;  2P7T C;  1S3J A;  2PTM A;  1ZAU A;  1K3E A;  1HR0 B;  1Q6I A;  2HJD A;  4LF7 O;  4H44 B;  3HKE A;  1GM8 A;  1THZ A;  3MHH C;  1N34 B;  1SZT A;  2QWN B;  2CTW A;  2FB5 A;  1IBL O;  5GON A;  1B3Q A;  1V54 B;  1R3I C;  3VQV A;  4CH4 A;  1QQC A;  2ADP A;  4LF5 B;  3K5N A;  5HFL A;  5JJN B;  2Q7G A;  3THO A;  3H01 A;  5EZY B;  3BEH A;  1VQ7 V;  2DQ0 A;  3WB0 A;  5B5E Z;  3H1K H;  3F7Y C;  5A9G A;  4LFB O;  3WG7 C;  1P4R A;  1FXK B;  1P7B A;  1FYJ A;  4FM0 A;  2H8P C;  3HKD B;  3VQY A;  1TUB B;  3IFX A;  3JAL A;  3T1Y B;  2LW1 A;  4N23 A;  3U0Z A;  3CJH A;  4ABM A;  4LFC O;  1DLB A;  4KP4 A;  2F23 A;  4FIP C;  3ASO C;  2QM4 A;  4QE7 A;  5CB4 B;  4GKK O;  2WLL B;  5IJ0 A;  1V55 B;  3UQ8 A;  5H6Q A;  3N27 A;  4DV0 B;  2IM9 A;  3L74 H;  2W6I G;  3D8C A;  4B7E A;  2OTL V;  3R66 A;  3ZRS A;  1FFX A;  3K04 A;  1MA1 A;  3CRQ A;  3E83 A;  2NN4 A;  3JSL A;  4I0X B;  5J2T A;  5B66 Z;  3BY6 A;  4ZOL B;  5IY5 C;  5LHH A;  1H2G A;  5TIS Z;  4U7O A;  1J5E O;  5CA0 A;  3UO2 A;  5FLX N;  4WFH A;  4LF7 B;  2YEV A;  1D5N A;  3CCV V;  2Q67 A;  4TV8 B;  3SDL A;  3L9D A;  1E79 G;  1IBL B;  5KLV H;  2CGN A;  2H3O A;  1H2N A;  1BCC H;  5C93 A;  2GSM B;  5LMU O;  1ZWI C;  1M9N A;  1ZL8 B;  1VP7 A;  2EJR A;  3UCS C;  5LOV A;  1GN2 A;  2N05 A;  2JEU A;  2QWP B;  1Q6U A;  2UXN A;  4X1Y A;  1GMG A;  2JDI G;  1BQZ A;  5H5N A;  3ETE A;  1GKF A;  2HEP A;  4XDK A;  4QGP A;  1R73 A;  3O65 A;  1S0V A;  4EFB A;  2YXH A;  4JF3 A;  4LFB B;  2EBO A;  4IHJ A;  1Q86 W;  4MS2 A;  4X65 O;  5HFM A;  2ZCE A;  2EIL B;  4BAY A;  5B1A B;  4F6E A;  4YJ2 B;  4GX2 A;  4LF8 O;  2QKC A;  4BW5 A;  3VQX A;  3IC7 A;  2XAS A;  4GKK B;  4DRX A;  3F5T A;  1LUW A;  2EIJ B;  3HR0 A;  1I08 A;  2P90 A;  3ZRW A;  4FLV A;  2R72 A;  1H8H G;  4O4H B;  1WA8 A;  1XMO O;  4LNU A;  4IYI A;  1ZSP A;  2Y4U A;  3D3Q A;  1K33 A;  1LNQ A;  3HPL C;  4Z1V A;  4DR3 O;  4I4T B;  1F4N A;  2YID A;  2QKS A;  1I5X A;  3AG3 C;  1URF A;  3ABK C;  3OEH G;  1J5E B;  2IJJ A;  1NS1 A;  3I56 V;  3GVM A;  5J9P C;  2PY5 A;  3CCS V;  4CS4 A;  3SPI A;  4GYC B;  3E8G A;  4MTF A;  1GRJ A;  3LNN A;  3A8T A;  2IBZ H;  5LMU B;  3AG1 B;  4LC1 A;  1M57 C;  3OAA G;  4WFF A;  1N33 O;  4RUE A;  1BL8 A;  3CPW U;  1SS3 A;  1NI8 A;  1AJQ A;  4B3R O;  1BE3 H;  4JI0 O;  3RYC B;  3OR6 C;  3ABL C;  4B7K A;  4NB5 A;  4JZ2 A;  2YI8 A;  3AK3 A;  4FLT A;  2QKA A;  4OPA A;  3FB6 C;  3CYO A;  3JAR B;  3ABM B;  4RQE A;  5LP6 C;  3JAW B;  1NU1 H;  4X65 B;  2HLD G;  3HKB A;  4B3M O;  2ZT9 B;  5JJJ B;  1XNQ O;  4GUN A;  2NLJ C;  2R70 A;  2WPD G;  5JQG B;  4LF4 O;  4JYY A;  3TXS A;  2DE0 X;  2LO1 A;  2ZE6 A;  4LF8 B;  3KG2 A;  5LYJ B;  2G38 A;  2YUA A;  1I94 O;  1ROP A;  4PHZ A;  2WLN A;  3M99 B;  1N0N A;  4J9Y B;  3CSX A;  1G6U A;  4K8X A;  3JAT B;  3FKS G;  5LP6 A;  3BAB A;  3DXR A;  2ZQM A;  1XMO B;  4B08 A;  2KG7 B;  2GUZ B;  2LQT A;  3RYI B;  2HKO A;  2IJK A;  4UCR A;  3IGA C;  4AIL C;  4JYB A;  4DR3 B;  1G1X B;  1MZF A;  5GTH Z;  3RYH A;  4TSF G;  3ZN1 A;  3H9V A;  4WF9 V;  3CE2 A;  5LA6 B;  2OCC C;  3A0R A;  4JAA A;  2UUC O;  2XTA A;  4FM1 A;  3CCQ V;  1WPX A;  1MMM A;  4TQF A;  1SQQ H;  1Q7Y W;  1N33 B;  3ZRX A;  4HNA A;  4FVM A;  4PA6 A;  4I9Q A;  1N36 O;  1W0K G;  4B3R B;  4JI0 B;  1QVG U;  3FYI B;  1RPR A;  3OMI B;  1K73 W;  5KHK A;  3FYE B;  3RYF B;  2Q5Z A;  5BMV B;  4PDR A;  1U96 A;  1VAR A;  2JGD B;  3BA8 A;  1IBM O;  1GN4 A;  3ETQ A;  4J7Z A;  2YSU B;  1FD9 A;  3G6B A;  3K08 A;  4R6Z A;  2JIZ G;  3BCC H;  4B3M B;  4NTX A;  2YIB D;  1XNQ B;  2XUM A;  4PDV A;  2XAF A;  2V4D A;  1PV0 A;  4LF4 B;  1YCI A;  4CS3 A;  2GV9 A;  3CXH F;  3AG7 A;  3BPZ A;  2BE3 A;  2PF4 E;  4CC5 A;  4NXN O;  4FK5 C;  3GB7 C;  4UB6 Z;  5BZB A;  2GBO A;  1NR7 A;  1I94 B;  2ARH A;  1BHA A;  3VQW A;  2F95 B;  4O4L B;  4KL1 A;  5DED A;  5B1B B;  4U3J B;  1F4M A;  3P30 A;  4FZ0 A;  2PGG A;  4NKG B;  4P9O A;  1JA8 A;  1S5H C;  4OPH A;  1NT2 B;  4DR5 O;  1MSD A;  3RFR A;  4H0L B;  1CP9 A;  3W7T A;  5LXT A;  1XHX A;  1VQ5 V;  3CD6 V;  3ZHS A;  3JD1 A;  3EXA A;  1KC8 W;  2UUC B;  4JTD B;  4CH6 A;  3ETG A;  1YDX A;  1VEW A;  1M56 B;  4TUY B;  4BIO A;  5IJ9 B;  5CA1 A;  3OE7 G;  4DV3 O;  3W7X A;  1N36 B;  4FM2 A;  2WLH A;  3X2Q B;  2F43 G;  1VMG A;  4AQY O;  1FKA O;  3HKC B;  5IYC O;  1Y74 B;  1JX9 A;  1YXB A;  2IJI A;  4FLZ A;  1IBM B;  1DGS A;  2EIK B;  2H94 A;  3HKD A;  2Q9L A;  4TOI A;  3ZMV A;  1YJ9 V;  2DYS B;  1TUB A;  1PNM A;  2WLI B;  3ASN B;  3E86 A;  5B3S C;  3TET A;  2L35 A;  1NTZ H;  3OGI B;  2YXL A;  1L8D A;  4JTC B;  2Y69 B;  2DMX A;  2OT5 A;  1S5L Z;  4NXN B;  2X6A A;  2Q68 A;  4CC6 A;  3JCU Z;  3QO7 A;  3K59 A;  5IE9 A;  1COW G;  2XHB A;  1F51 A;  4LWS B;  3U10 A;  2VWJ A;  2KSD A;  3TXQ A;  1AJP A;  4CH5 A;  2ATK C;  4I0X A;  3OMN B;  4W4L A;  4E2L A;  1D2D A;  1RPO A;  4ZOL A;  5IDJ A;  1JCH A;  2M6Y A;  4DR5 B;  4L8J A;  1QLE B;  2FTK A;  1AVM A;  2JEX A;  2EIM B;  4N21 A;  2X0L A;  4DR7 O;  5H2F Z;  2Q7E A;  1KU9 A;  3BHP A;  3EHB B;  2A7W A;  4FFB B;  2QEX V;  1NBM G;  1AIL A;  5IT9 N;  2VQE O;  2EZP A;  3CC4 V;  4K8Z A;  3B09 A;  4DYL A;  5B1A C;  5DN6 G;  1XBL A;  4F6R B;  4DV3 B;  4XBF A;  1TUE B;  2KB1 A;  2FL4 A;  3T4D A;  2HVK C;  2AZ2 A;  3AG2 B;  4AQY B;  4KFM A;  4P2Z A;  1TVK B;  2EIJ C;  2RDC A;  1F23 A;  2P6J A;  1H38 A;  3TK1 A;  4DR1 O;  5ITZ A;  1XL6 A;  3E8H A;  4DV2 O;  3K5L A;  2ZE8 A;  3CP1 A;  3G80 A;  2WSS G;  1W0J G;  3APQ A;  3ABT A;  3ZHQ A;  3WB2 A;  3B2E E;  3ZMZ A;  3SJQ C;  3FAV B;  3C3T A;  1YJN V;  3SYP A;  4O4H A;  4DW0 A;  1NH2 B;  3ZED A;  3ZJZ A;  3CWB H;  4G2K A;  4LBE C;  5L3D A;  1VQN V;  3CEI A;  3C3S A;  2QWO B;  3B8M A;  3SR2 C;  2HP8 A;  4QJF B;  3TGU H;  3B8N A;  3ZMT A;  1TA8 A;  2GHY A;  3G67 A;  1KYO F;  4X1K A;  3E22 A;  3OGC C;  2Q69 A;  3E2E A;  3W7U A;  3PN1 A;  3ABM C;  4DR7 B;  2N04 A;  3K5M A;  3P32 A;  2YIA A;  4D6T H;  2OIG A;  5KX5 B;  3UT5 B;  2VQE B;  1EN5 A;  2BSK A;  4TV9 A;  2HFE C;  3RYC A;  2X6C A;  3QF7 A;  3STL C;  1XRE A; 
#chains in the Genus database with same CATH homology
 4J10 A;  3FX7 A;  4J42 A;  4J11 A;  4IYI A;  4J7J A;  4KXR A;  4W4K A;  4J7K A;  4W4L A;  4J41 A;  2GTS A;  2G38 A;  4IYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...