3CCEV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cceV00
1VQ6V 3G6EV 1K8AW 3CCRV 1Q7YW 4WF9V 1YHQV 3CXCU 3G71V 3CCVV 3CPWU 1QVGU 2OTLV 3CCEV 1KD1W 3CCMV 5DM6V 1VQ7V 2QA4V 3CC7V 1VQOV 1YI2V 1VQ8V 1KQSU 3CC4V 4WFAV 1R73A 1YIJV 4WCEV 3G4SV 3CMAV 1YJ9V 1Q82W 1K73W 1JJ2U 1QVFU 1YJNV 1M1KW 3CC2V 3CCQV 2OTJV 2D3OW 3CMEV 1Q86W 1KC8W 1W2BU 3I55V 1N8RW 1NJIW 1K9MW 3CD6V 1VQLV 3I56V 3OW2U 2QEXV 4WFBV 1Q81W 1VQ5V 1YJWV 1VQNV 1VQ9V 1VQKV 3CCUV 1VQPV 3CCSV 1VQ4V 1S72V 3CCJV 1VQMV 3CCLV 1YITV 1M90W
chains in the Genus database with same CATH superfamily
2VWKA 4FIPC 2JEXA 1E79G 4CH5A 3CCVV 3ZJZA 1Q43A 3UM7A 4ZI7A 3DXRB 1IX9A 4C7UA 5CA1B 1KP3A 4NXNO 2ARHA 4DR1B 4JASA 3SYOA 3W7WA 1YIJV 3H1HH 2DQ0A 2A06H 2A7WA 3T2MA 4LFCB 2QWOB 5BMVB 2CTWA 1M93A 3LDEA 4PA9A 3HB3B 3D3QA 1GMGA 4LFBB 3CPWU 2XTAA 4QE9A 2HKOA 5KHJA 4J42A 1THZA 1YJNV 3OTFA 3HKDA 2LW1A 2FL4A 5LHHA 1IZ3A 4ASUG 3D8CA 3E8BA 3LSUA 1BMFG 2RDCA 1Q5OA 1I94B 1WA8B 2EILB 3CCRV 4LP8A 2ZT9B 1IURA 5DM6V 1YTFB 4LWSA 1XILA 2KSDA 3ZX6A 3OFNG 1ORQC 1PNLA 4ICGA 4UV9A 4JI4O 4TV9A 3I56V 1OHHG 5L3GA 5LHGA 1K97A 2ZDIC 1F4NA 2ZINA 4WBNB 1FXHA 4BW5A 2KKWA 4U3JB 4N21A 2UUBO 1YDXA 4UXNA 1VP7A 3OMNB 4G2KA 1FFXA 2BOCC 3B77A 4X1IA 2D2CB 3CC2V 5JH7A 1GH6A 3ABLB 4LF7B 5E79Z 3K5MA 1KP2A 1US6A 1H38A 1D2DA 2QWQB 3B09A 1N32O 1F7YA 2WPDG 3VQWA 3BEHA 2NN4A 5B1BC 2WLHA 4JI3B 2H3OA 5GTHZ 1MMMA 4R7CA 4OPHA 3ZRSA 3FAVA 3QO7A 4MTFA 3G6BA 1K3EA 1ZAUA 5IYZA 5H2FZ 4LFAB 4HZ3A 3G71V 1AR4A 3UCSC 2CTQA 3JATB 1K5QA 1FJGB 4IIJB 3QF7A 1N33O 1BT8A 3JSNA 4I0XB 3SJQC 1L1FA 1JOYA 1DF4A 4MSWC 5C8YA 4EB6A 5B1AB 2LP7A 3CYOA 2B1IA 5EBLC 5FLXN 5LXTA 1VEWA 1GRJA 3SJBC 2DW4A 4DUYB 2VQFB 2CE4A 4OXSA 2EZPA 5JCOC 5IWAO 4DV2B 5IT9N 2V7QG 4ZHQA 4ZBMA 4YIOA 2ZE5A 4CH4A 3G67A 1OV9A 2PY5A 1XNRO 3ZRXA 4HNAB 3JCUZ 2A9HA 5FPOA 4JYAO 1B3QA 2E75B 4IHJB 4Q20A 2EJ7A 1A32A 3K59A 3OR6C 2OYQA 3E86A 3HKCB 2W0FC 1RSOB 1Y74A 3ZIAG 2BTOA 4O4JB 1M90W 2DYRB 3WB2A 4B7EA 2LO1A 3SPHA 1K8AW 1YHQV 2AZ2A 4ZKIA 4MVSA 3K5LA 3CJHB 4NR1A 3NR7A 1RP3B 4F6EA 3CB2A 1Z5VA 1H8HG 2L35A 4XDJA 1K34A 4PDRA 3OD4A 3VQXA 1BHBA 2WLIA 5B1BB 1SRYA 1QNMA 4HBNA 4J7KA 4LR3A 5LA6A 3P32A 4MW8A 2AHYA 4TOIA 1Q7YW 1FS0G 5KUMA 2YDEA 3KCYA 3R65A 2YXYA 1YI2V 4DR3O 4WFFA 4ZIBA 1P7BA 3U0ZA 2OCHA 1Q6IA 2AZ0A 3JAKA 5J9PC 3CX5F 5JJEB 1WLEA 3N27A 5DN6G 2PI4A 2F4VB 1EZJA 3GWKC 3AK1A 2IJJA 1TA8A 1QR9A 5KX5A 5F2VO 2ZE6A 2CGOA 1SKVA 4KFMA 5LMNO 2IBZH 3SYPA 3SJCC 2UXBB 2P67A 2XAJA 3HKBB 3OR7C 4UCVA 4QPKA 3SJAC 1NBMG 4B7KA 1S3JA 5JWPA 4WF9V 2LGQA 2Q0AA 3H9VA 4DR2O 2YSUB 1FXKA 3RYCA 4JI1O 1G4YB 3JASA 4G27B 1BS3A 5KA5A 2P7TC 1L8DA 4LWSB 4OX9B 4X1YA 1V55C 1IVSA 3O65A 5B3SC 4TV9B 2ZNJA 4NTXA 5LP6C 1HNXO 3TGUH 1K7DA 1Y4MA 3ZHRA 1N0JA 3BVOA 3ZHUA 4Z1MG 5CBHA 1S5HC 1RFYA 1E1QG 4K3AA 3AG3C 1K92A 2HG5C 1J95A 4K8XA 1EN6A 2AGAA 4KUMA 2ZCEA 1Y66A 3PN1A 1AB3A 4BWAA 4O4HB 4GKKB 4I7ZB 2N05A 3IAYA 1NH2B 4LCUC 5LBQA 4J9YB 1XMQO 3FAVB 5EZYA 3JAWA 4DW1A 1UFIA 3AG7A 4FFBB 4A5UB 3QVNA 1OCRB 5IJ9A 2GSMB 1PM9A 4TV8A 1VF7A 4J11A 4JV5B 4B3SB 1M5IA 4EKWA 2QWRB 5LMUB 1RPOA 2YEVA 5FPRA 5KLVH 3VOUA 1KYOF 1IXMA 2R9RB 4R50A 3BPZA 2DWEC 2IW5A 3ZBHA 3L71H 4DK0A 3MDSA 3OTOB 1MSDA 2LW7A 5HFLA 4FM1A 1HWYA 2VS0A 1FXVA 2YIBD 3QNEA 2UXXA 3LNNA 4DV4B 5LXTB 3CCMV 5LYJA 1VF6C 1K33A 1UJWB 1GN2A 5JJJB 3WB1A 4GLXA 1BHAA 4B3RB 1N0NA 1W2BU 2OCCC 3E22A 1H2SB 3R66A 3P3NA 3F5TA 2EIJC 4HAMA 1OZ0A 3OGIB 1Z5WA 2QTSA 2QKCA 4LFAO 1V55B 3A2FA 5B3SB 2Q8VA 3RYFB 3B40A 5L3BA 4CZZA 3T1YB 2Q7HA 4DRXA 3N2GA 5JJNB 2Q5ZA 2VQEO 2PYLA 4UB6Z 4AHCA 5EC2C 2IU3A 4DV6B 1COWG 3AG3B 3ZMUA 1GN3A 3BA8A 3CCQV 2VQFO 3UT5A 2D3OW 3M8AA 1WB7A 4B08A 1HP8A 2P4KA 3ZHSA 3TETA 4I55A 4EEQA 1KU9A 2WLMA 1WPBA 1SZTA 4LF9B 4JI5O 2UU9B 4JZ2A 3CC7V 4TQFA 1XOUA 5H5NA 5KHKA 4JF3A 4TWKA 2A3QA 4Z1VA 3KG2A 3ML0A 2F66C 3ZRWA 2YXLA 4NTWA 2V4DA 3MAQA 4AI8A 1F51A 5KX5B 2ZXWB 4GCZA 2BSKA 2WSSG 4B3TO 4JAVA 4XDKA 4DR4B 5JQGB 1BL8A 4GUNA 2YIBA 5EK0A 3RW0A 2RCVA 4JYBA 3FD9A 5IDJA 4YJ2A 3AG2B 4LF6B 3DC6A 3E8FA 3D3IA 1K4CC 4QPJA 4IT5A 3SR2C 4MVUA 4LNUB 2Q6AA 1SA0A 2KG7B 4FZ0A 1XDCA 5KHHA 2LFSA 5IJ0A 3ETDA 3K79A 1SQPH 3RYCB 3FKSG 1DF5A 3JASB 4IYIA 2XOKG 1H2NA 3IC9A 1G6UA 2XAGA 2B5UA 2BTQB 2H8PC 5H6QA 3RT3C 2EIJB 2Z5UA 2PYJA 4QNHB 2F4VO 3DSQA 5DEDA 4DV5B 5ITZA 1XUQA 1N36B 1J5EB 1ZTEA 2BOBC 4O2BB 1OCZC 4KXRA 3QTCA 3K04A 4PA7A 1FPOA 3CEIA 5KUKA 1M4UA 4FM2A 1ZX3A 4XDLA 4PI2A 1KKDA 4I5SA 2Q7EA 1N34B 3M7MX 2UUCB 5B1AC 1SF9A 1JX9A 3E8GA 1FAFA 3K58A 3ZHTA 2DOSA 3FB6C 1P4RA 4PDMA 4OX9O 3ZMZA 4RAIA 1W59A 4DUZB 3JAWB 5LGUA 3H1LH 5IJ9B 3OAAG 1VQPV 4PV1B 1AJNA 2OIEA 5KHIA 4TV8B 4GKJB 4JI6O 5H6RA 5CB4B 4AQYO 1E1RG 4I9WA 2DMXA 2GUZB 1I0HA 3CC4V 4K8ZA 3WG7C 4L8JA 4UCRA 5KMGA 2HJDA 4BAYA 5KAIZ 1IBMB 2ZQMA 1TVKB 3BABA 3LSSA 4O2AB 2JGDA 1OCOC 1S77D 1Q3EA 4DV1B 4UUJC 1QHTA 5FL7G 4YXWG 5EYPA 3A0BZ 2DYRC 3K57A 4CH6A 1HR0O 1NQTA 3ZN0A 4DK1A 3N2KA 3FB7C 3E22B 1NVPD 4D7SA 5GW7A 4CS3A 4DR5O 4YJ3A 4O4IA 3ZHQA 2FTKA 3E83A 3CCLV 4X66B 3SPJA 2L6LA 3D36C 2R9IA 5IE9A 1KUQA 2DN9A 1EZVH 4B3SO 5LMUO 1PL4A 1DLBA 2UXDB 1M56B 3IFXA 4WFAV 2R9AA 1NS1A 1NU1H 2H94A 3JD1A 3TJTA 2JJ1G 1KB9F 4WFBV 1Q81W 3W7TA 4DRXB 1JFFA 4U3FH 2UUAO 4WFHA 4GZRB 3HKEA 4RO2A 1Q8IA 2F93B 1S76D 5JVDA 5KHGA 4WFEA 3ASNC 4YHHO 4DV4O 1OCZB 2WLLA 5IY5C 1EM1A 2PF4E 3P3PA 1QVFU 1VIBA 4TSFG 4DR6B 4B3RO 4U7NA 1V54C 3T1CA 4PI0A 2ADQB 3O9OA 4I55B 5CBFA 4I4TA 4ZOLA 1VQ4V 4BW9A 4Z2WA 2ODMA 2ITCC 3CE2A 5B66Z 4DV7O 1O9GA 1Z2GA 1SERA 3EFFK 1Y67A 2CTPA 5GTIZ 1XL6A 4X1KA 1ZL8B 2GV9A 1AR5A 3ZRWB 3JALA 4NXMB 3T1YO 2R70A 3X2QC 4B3MB 4ABMA 1BQZA 1AP6A 1R6TA 2GHYA 4JI8O 3WG7B 3HR0A 4MT8A 3FB5C 5B1NA 3RYIB 4YJ2B 3J7AU 4EFEA 2QWPB 3SYQA 2HLDG 3ZHVA 2IH3C 1OCOB 1PD3A 4CC5A 1Q6HA 4KHPB 1AI5A 2CTRA 3S3WA 3FX7A 3OUSA 1SA0B 4LC1A 4LF4O 1SZXA 3SDLA 5IJ0B 3NXSA 4JI2O 1TUBB 1QVGU 1JA8A 3UQ8A 3L9DA 4P30A 4X20A 4LF9O 2UU9O 2DE0X 1EN5A 2K9PA 4R8CA 1FYJA 2UXCO 1VQ5V 3TXSA 5L3DA 4BIUA 2BE3A 1OCRC 1BQ0A 4O4LA 2EX3A 3CCEV 4FM0A 3THOA 3H1JH 4EFBA 2PZSA 4ZI7B 4LF8B 4FLZA 4FLVA 4BR6A 4DR4O 4QIWF 1CP9A 1NZ6A 3SPCA 1Q82W 3ETQA 4DV3B 1SQQH 3U10A 1F23A 1YCIA 1R6NA 4X62O 2ZM6O 1HNWO 4GX2A 3T1HB 3ASNB 2ZR2A 4PA3A 5IY5B 3E89A 3G80A 1GAXA 2OT5A 2Q9LA 2Y69C 2E5LB 2FB5A 3ETEA 3SYCA 4F6RA 1IBKB 1Y76A 2QM4A 1V54B 3OEEG 5CA0A 3LUTB 3HKDB 3IC7A 4CS2A 5CMUA 4LF5B 4PELA 1GM7A 3JD2A 5E1AC 4DW0A 2CH7A 4NXNB 1CPYA 1IDSA 3RVYA 3CHXA 1KQSU 1MG1A 4X9QA 1FFTB 4DV5O 3RWRD 1WNSA 1QQCA 5KMGB 1J5EO 2Z3YA 4R6ZA 3K0DA 4PA4A 1R1BA 4DR1O 1ZLZA 5B5EZ 3X2QB 3M99B 4LFCO 4LH6A 2OIGA 1TGOA 2JGDB 2EIKC 5L3FA 1H2KA 2HFEC 4J9ZB 3BHPA 4LFBO 1FFXB 2ILMA 4JYCA 1S0VA 2JDIG 2AHZA 4X1IB 1DK1A 3L74H 3EHBB 5JH7B 4H13B 2MK3A 5EIBD 5DECA 4UB8Z 3QO5A 3OT7A 4DUZO 1JCHA 4IL6Z 1O9HA 2PUSA 1WJZA 3W7SA 3CXCU 4GKJO 2P90A 2QWNB 1BE3H 4UFZA 3DXRA 1VMGA 4GT1A 4UCSA 1I94O 4X65B 4JI4B 1OCCC 2YC0A 3F7YC 5TISZ 1BSMA 3CSXA 1UPGA 3CRMA 2AW9A 1P49A 2F1MA 1B04A 4UVAA 3APQA 1NR1A 2B1GA 4J80A 5CN0A 2UUBB 5K1XA 2XHBA 3AG1B 5IYZB 1ZWIC 1AI7A 1QCEA 4FLXA 3UO2A 4DV0B 1QU7A 2ZKOA 2ZXWC 2EINC 3E35A 1VQ8V 5EBWC 3VBBA 1SQXH 2NNUA 3FFQA 4CBCA 1Q6UA 2E74B 4JI0B 1TAEA 4XBFA 4E2LA 1N32B 4OGQB 1URFA 5C8YB 4LF7O 1QBZA 3AG2C 4I4TB 4ZOLB 2WAMA 3AG4C 1VQKV 2Y69B 3OMAB 4EB6B 1AILA 1WA8A 4K35A 3L75H 4X66O 2HVJC 5K1PA 1LNQA 3IJ4A 5GONA 5IYBO 1FXKC 4JI3O 3W7XA 3KKYA 5J2UA 1T5EA 3ABMB 3OW2U 4ZHQB 4HYOA 3JALB 2V1DA 3ASOB 2Y0PA 3KZIZ 1EBOA 3OUFA 4U3JA 4D7TA 2WLJA 1GKFA 2HP8A 1N33B 4P9OA 4TQDA 1R73A 2B9ZA 1R3JC 2Q73A 4BIZA 1FJGO 2EULA 3E2EA 2X7RB 3QO8A 4E4EA 3ZCCA 2EIKB 4PD4F 1CEZA 4GX0A 1Y74B 2XNDG 1NVPB 2XASA 4NTYA 4JTAB 4RQEA 3ABKC 3DGEA 5IWAB 3K9AA 4MVOA 4F4LA 2KB1A 2XT9A 4GYCB 3KCXA 3GVMA 1M9NA 3FB8C 4DUYO 1SQVH 1K9MW 5KAFZ 4JAAA 5A2QN 4DV2O 1KKCA 2WLIB 4QGPA 2IJKA 3B4SA 4NXMO 5LA6B 3BCCH 2N74A 2FKXA 2GDSA 4JYAB 4AILC 1NI8A 3JATA 4O4LB 3ZMTA 5BR8B 3ICXA 2IU0A 1OCCB 2MW2B 1FD9A 2JIZG 2ZE7A 2YUAA 2F43G 3RGBA 4U7OA 1XNQB 2JEUA 4QE7A 1JR9A 4I0XA 2EBOA 3T4DA 1KC8W 3JAKB 4FPPA 2JGUA 1AJQA 2HHHB 1XMOB 4GX1A 3LSQA 1V9PA 2QGNA 4KHPO 2QDOA 2EINB 3ETGA 4GX5A 2QSAA 3K5NA 1DGSA 2P4VA 1G1XB 3T4ZA 2QE7G 2ATKC 4F6RB 1Y76B 1QLNA 3HPLC 3JD3A 4X64B 3WFVA 2M7WA 3AG4B 1KBHA 4FVMA 4J10A 4JTCB 2YICA 2FYUH 1YXBA 5HFMA 4DR3B 2CH7B 1I08A 1FXKB 1VQ7V 2BCCH 2VWJA 1I5XA 3JD4A 5FNVA 3SYAA 4IHJA 2ADPA 2W0XA 3SPGA 2ZDIA 4LF8O 4X1YB 3C3TA 1SETA 4H33A 2HJFC 3A0RA 1M56C 5LHIA 1VQLV 1QLEB 1JQ0A 1TUEB 4FLTA 1M57B 3HKCA 1RSOA 1IBLB 1OJHA 4O4JA 5CBGA 3JAMN 2LFRA 1AP5A 5BY1A 4X8AA 1RPRA 3OE7G 2Q7GA 1ROPA 2QJ1A 2Q0OC 3RFRA 3RN4A 2G38A 1AROP 2E5LO 1ZSPA 2YI9A 4FJCC 4MVMA 4QJFB 2NR5A 2UXBO 4TT3G 5LOVA 3APOA 4LF5O 3ABKB 1NH2D 1VQ6V 4JI1B 4I9QA 2XAQA 2QM8A 2OTLV 1U96A 2RNBA 3AK2A 1S5LZ 1L0NH 4UCUA 4WCEV 4K0KB 1YEWA 2OTJV 5L3EA 5EZYB 2RJZA 1VARA 4NB5A 3CRRA 1HNXB 1GK9A 3CRQA 4X89A 1P84F 2LGWA 2Q67A 1HW7A 1G8MA 1GN4A 1SQFA 1HNZB 1KD1W 1MOFA 2YEVB 2Y0IA 3STZC 1SQGA 4PHZA 4MTOA 2E3CA 2GTAA 1JJ2U 3HKBA 1WAZA 3ZS8C 4JPRA 4N23A 3B8MA 3E8HA 5J2TA 2JVDA 4RQFA 2YI8A 3BY6A 3K0GA 1NT2B 1SESA 4LBEC 2IH1C 4CS4A 3MHHC 4FZ1A 1SS3A 5JCOA 2E76B 3GB7C 1NKDA 3RYHA 1XMQB 5LYJB 4G28B 3ZMSA 3RBZA 5GONB 2YS8A 3CP1A 3LDCA 4GKKO 4X65O 5J2UB 2ZIOA 2HVKC 1LUVA 2RN9A 2OWOA 3IGAC 1MA1A 2JRIA 3QG5A 1YITV 4FMTA 4JV5O 2W6IG 1PL0A 4DV0O 1X4TA 5EBMC 1FKAO 4JGSA 1AI6A 2NLJC 2EZOA 4P2ZA 4Q6GA 4TUYA 1Q86W 1PNMA 4JI0O 4DR7B 2O57A 2JS3A 3L73H 3ZRVA 4DYLA 3N2GB 3OMIB 3OTOO 1H2MA 3A8TA 1D5AA 4O4HA 3CS5A 1JJOA 4YY3B 5BZBA 3FYEB 1K73W 1LUWA 3CMEV 3UT5B 3CXHF 3BA9A 4FFBA 4KL1A 3CCUV 1MZEA 2XUMA 4FFKA 3UKMA 4JYYA 3VQYA 4JI7B 5C93A 3W7UA 2QM7A 1R3LC 2A0LA 4I50A 2ETNA 2VQEB 3SGIA 2Y4UA 1KECA 1B6QA 1MABG 2BSKB 2ZR3A 1KMIZ 4DV6O 1YJ9V 3JARA 1GM8A 2RMKB 1H2LA 4KP4A 3AEIA 1YVWA 4UCOA 3J81N 1AVMA 1S72V 4JI5B 1MNGA 3JSLA 5IYDO 5EC1C 1P7GA 5BR8O 5FNVB 1LR1A 4PDLA 3RYFA 4UVBA 1XNQO 1DTOA 1N8RW 5LP6A 3C90A 3CRCA 3TCUA 2HHHO 1XMOO 3LNMB 4B3TB 3A0HZ 2YIDA 3AG1C 3L72H 5CA3A 2WA3A 4D6TH 5ITZB 4FLUA 2XAFA 4YIPA 2WLKA 4H44B 2Q69A 2W6JG 3I55V 4X64O 1I5YA 3TXQA 1YJWV 4LF6O 1WPXA 2YXHA 5LOVB 3CCSV 1K5SA 4UCTA 3I5DA 2PTMA 5D5QA 3JCZA 1K4DC 2RQ6A 2XAHA 4FK5C 1M1KW 4CH3A 3UO3A 4CC6A 3OEHG 2JJ2G 2EIMC 1GO3F 3F7VC 2IJHA 3OGCC 2F23A 3ABMC 3SPIA 1IBLO 1ENVA 1ZUQA 1YTFD 3ASOC 1MZFA 3Q4HA 1BZKA 1U97A 3CRAA 5JQGA 1PNKA 1VQOV 2WWWA 3K9SA 1MSWD 1R3IC 4MVQA 4MTGA 1XHZA 2QKSA 4P9PA 1Q90D 4RUFA 2CK3G 5KA6A 3H1IH 1N36O 3F5WC 1NJIW 5J2TB 1PV0A 2QEXV 4IGGA 4LNUA 4PA6A 3L70H 2KG7A 2CAZC 3K06A 1VF6A 3VQVA 3H01A 2PI5A 4PJ0Z 3RYHB 5EYPB 1N34O 1D5NA 2UUCO 1R3KC 3N2KB 1B06A 2KQXA 4K0KO 2BTQA 4JI6B 5A9GA 4H0LB 1GN6A 3CCJV 4O4IB 4YJ3B 4AQYB 3C3SA 4W4KA 1RM1C 3H1KH 2QTOA 1JPXA 3LDDA 4WFGA 5CA1A 1HNZO 2CGNA 1NTZH 4O2BA 2A79B 1NTKH 4TUYB 1Y6XA 5LGNA 1L0LH 5BMVA 2ITDC 1IBMO 1JFFB 1WB8A 1WN7A 1N4CA 1GTOA 3G6EV 2P22C 3HKEB 2JK5C 1W0KG 5JVDB 1HR0B 1EN4A 2DWDC 2IM9A 4H37A 2ZIMA 3FYIB 4DV1O 1BGYH 1PKXA 2K1EA 2WLLB 3CMAV 3GWOA 2QKAA 5B1OA 1X59A 4DR5B 2ZE8A 3K03A 4MVZA 4UVCA 1GM9A 5H9CA 2ZD9A 4W4LA 3EVKA 3ABTA 5CB4A 1IXBA 2X6BA 4UV8A 3P30A 4J7JA 2GUZA 2DYSC 2X0LA 3MD0A 2UXDO 2EIMB 5AG2A 5LGTA 2GTSA 3STLC 3ZN1A 5D5PA 4X1KB 3DTUB 1YF2A 4I50B 2UUAB 3TK1A 3BFRA 2VRZA 4DR7O 1H8EG 1TVKA 4WBNA 2Q68A 4O2AA 3RVZA 1QLEC 4YHHB 1M57C 1HDJA 1XL4A 3PJSK 1R6KA 1JMKC 3JARB 2IJIA 1XBLA 4YY3O 3K5OA 1XI1A 1NR7A 4DR6O 1EFRG 1XREA 1WP7A 2X6CA 1I7FA 4DV7B 4FLWA 3U11A 4X20B 2Q4PA 2WLNA 3AK3A 4MTXA 3MHSC 3J80N 1AR1B 5LP6B 3ZEDA 4JI7O 2HEPA 4DXWA 2R72A 1PP9H 2P06A 1RM1B 1XNRB 4MVRA 4JI8B 2N04A 1H2GA 4PDVA 2P6JA 2CUGA 2DQ3A 4B3MO 1JVMA 4MW3A 4IIJA 1S5JA 4LF4B 1VQ9V 3K3WA 4JI2B 1VQMV 3S3XA 2FMLA 4NYKA 1XHXA 1VF5B 1AJPA 4J7ZA 2QA4V 2EILC 1BCCH 3EXAA 4MS2A 2UXCB 1NTMH 1ZL8A 2QR4A 4OPAA 5CA0B 4RUEA 3WB0A 1VQNV 4NVPA 3CWBH 2Z0AA 3ABUA 3WU2Z 4L87A 2Y48A 2DYSB 3Q4HB 4HNAA 2P5OA 2C2AA 2HR3A 1XEQA 5IYCO 3RYIA 2JS5A 3B8NA 2WA4A 3BAAA 2X6AA 1HNWB 4X62B 2ZM6B 3DC5A 3ZMVA 1YZBA 1W0JG 3JYCA 2F95B 4JTDB 3B2EE 3BRCA 4J41A 3OM3B 2ZNIA 4DV3O 4BIOA 3ABLC 1QR8A 2CDYA 2UXNA 1AI4A 5BXZA 1PPJH 4FLYA 1YSCA 2GBOA 5LMNB 3K08A 3JD0A 1TUBA 2AXTZ 2EJRA 2LQTA 3T1HO 1XQ8A 2Y4TA 5LL6Y 5EIBC 3CJHA 4X88A 4JZGA 2OCCB 4IYHA 4RWUA 1CXZB 3G4SV 4JAUA 4DO2A 1IBKO 1WP8A 2DJVA 1F4MA 5L3CA 1SC5B 3CD6V 2LJ2A 2YIAA 4LH7A 4NKGB 1SQBH 3D36A 2M6YA 2PGGA 4DR2B
chains in the Genus database with same CATH topology
4FIPC 2JEXA 1E79G 3UKMA 3CCVV 3ZJZA 1CPYA 4HAMA 3RVYA 1V55B 3UM7A 1KQSU 1MG1A 1KP3A 1FFTB 5B3SB 4JASA 3SYOA 3W7WA 1YIJV 2DQ0A 2Z3YA 4R6ZA 3T2MA 3K0DA 4PA4A 5C93A 5L3BA 3W7UA 2QM7A 4CZZA 1R3LC 2A0LA 3X2QB 3M99B 3LDEA 4PA9A 3HB3B 2EIKC 5L3FA 1GMGA 1KECA 1B6QA 1MABG 3CPWU 2HFEC 5EC2C 2IU3A 4QE9A 4J9ZB 2HKOA 2ZR3A 1COWG 3AG3B 4JYCA 1S0VA 2JDIG 1YJ9V 2AHZA 3ZMUA 1GM8A 1THZA 1YJNV 3CCQV 4KP4A 2D3OW 1VQ8V 3EHBB 2MK3A 3AEIA 5LHHA 3TETA 3QO5A 4ASUG 3E8BA 1JCHA 1BMFG 1S72V 2WLMA 3CCRV 2EILB 3W7SA 3CXCU 5IYDO 2P90A 1SZTA 5EC1C 4LP8A 5DM6V 4GT1A 3CC7V 4JF3A 1YTFB 4TWKA 1OCCC 4PDLA 3KG2A 3OFNG 3F7YC 3ML0A 4UVBA 1ORQC 1PNLA 1DTOA 4UV9A 1N8RW 3I56V 1OHHG 5L3GA 5LHGA 3ZRWA 1K97A 3TCUA 4UVAA 2ZDIC 1F4NA 5CN0A 1NR1A 2B1GA 1FXHA 4BW5A 3AG1B 3LNMB 1ZWIC 1AI7A 1F51A 2ZXWB 4GCZA 4N21A 2WSSG 1QCEA 4UXNA 4JAVA 4XDKA 3AG1C 3OMNB 2ZXWC 1BL8A 2EINC 3E35A 4G2KA 5EK0A 5CA3A 5EBWC 3RW0A 2BOCC 3VBBA 2NNUA 2XAFA 3B77A 2WLKA 4CBCA 4JYBA 5IDJA 3CC2V 2Q69A 4XBFA 3ABLB 3AG2B 2W6JG 3I55V 1KP2A 4E2LA 3E8FA 1I5YA 3D3IA 1H38A 1K4CC 4QPJA 1YJWV 1QBZA 1WPXA 3AG2C 4MVUA 3CCSV 2Q6AA 2WAMA 2WPDG 3AG4C 1VQKV 2Y69B 3OMAB 3BEHA 2LFSA 5B1BC 2WLHA 2HVJC 1K5SA 3ETDA 3K79A 1LNQA 3FKSG 1DF5A 3JCZA 2XOKG 1K4DC 2XAHA 5IYBO 1FXKC 4FK5C 3W7XA 1M1KW 4R7CA 3ZRSA 2XAGA 3OEHG 2B5UA 3ABMB 5H6QA 2H8PC 2JJ2G 3QO7A 2EIJB 4MTFA 2EIMC 2Z5UA 3OW2U 1K3EA 1GO3F 3F7VC 4HYOA 2IJHA 3OGCC 2V1DA 3ASOB 3ABMC 1EBOA 3OUFA 3SPIA 4QNHB 2WLJA 1ENVA 1YTFD 4HZ3A 3ASOC 3G71V 1GKFA 1K5QA 1PNKA 1VQOV 2WWWA 1MSWD 4P9OA 1R3IC 4MVQA 2BOBC 4MTGA 1R73A 2QKSA 1R3JC 4P9PA 4BIZA 4RUFA 3E2EA 2CK3G 5KA6A 1OCZC 2X7RB 3F5WC 3QO8A 3SJQC 1L1FA 1JOYA 1DF4A 1NJIW 4MSWC 3K04A 2QEXV 3ZCCA 2EIKB 4PA7A 5KUKA 4PA6A 4XDLA 1CEZA 4GX0A 1KKDA 5B1AB 4I5SA 2LP7A 3K06A 2XNDG 3CYOA 3H01A 2B1IA 1NVPB 5EBLC 2PI5A 2XASA 4JTAB 4RQEA 3ABKC 5B1AC 3DGEA 2DW4A 1JX9A 3E8GA 3K9AA 4MVOA 4F4LA 2KB1A 4OXSA 3FB6C 1P4RA 1R3KC 2EZPA 4PDMA 1M9NA 3FB8C 3ZMZA 4RAIA 1K9MW 2V7QG 4ZBMA 5LGUA 2WLIB 3OAAG 1VQPV 2IJKA 1AJNA 3CCJV 3ZRXA 5H6RA 1RM1C 2QTOA 3ZMTA 1E1RG 1JPXA 4I9WA 2IU0A 1OCCB 2A9HA 3LDDA 2JIZG 4WFGA 3CC4V 2F43G 3WG7C 4U7OA 2JEUA 4QE7A 2A79B 2EBOA 4Q20A 3T4DA 5LGNA 1KC8W 4FPPA 4BAYA 1AJQA 2ITDC 3OR6C 2ZQMA 4GX1A 3LSQA 3E86A 2W0FC 3LSSA 3ZIAG 1M90W 2DYRB 1OCOC 1S77D 1GTOA 2EINB 3ETGA 3SPHA 3G6EV 2JK5C 4GX5A 4UUJC 1YHQV 1W0KG 1K8AW 5FL7G 4ZKIA 4YXWG 2DWDC 2QE7G 4H37A 4MVSA 2ATKC 3FYIB 3T4ZA 2DYRC 1PKXA 2K1EA 2WLLB 1NQTA 3ZN0A 1QLNA 3HPLC 3CMAV 3JD3A 3WFVA 3GWOA 5B1OA 1H8HG 3FB7C 4XDJA 1K34A 2M7WA 4PDRA 3AG4B 3K03A 4MVZA 1BHBA 1NVPD 4UVCA 2WLIA 5GW7A 5B1BB 1GM9A 1SRYA 5H9CA 2ZD9A 4JTCB 2FTKA 3E83A 3ABTA 3CCLV 3P32A 4MW8A 2AHYA 3SPJA 5HFMA 1Q7YW 2X6BA 2R9IA 1FS0G 4UV8A 5KUMA 3P30A 1FXKB 3R65A 1VQ7V 1DLBA 1YI2V 2DYSC 4WFFA 1I5XA 1M56B 3JD4A 3SYAA 2X0LA 3IFXA 3MD0A 4WFAV 1P7BA 3SPGA 2H94A 3JD1A 2EIMB 2ZDIA 5LGTA 4H33A 1SETA 2HJFC 5J9PC 3A0RA 3STLC 3ZN1A 2JJ1G 1M56C 5LHIA 1VQLV 3DTUB 4WFBV 3TK1A 1Q81W 1WLEA 1QLEB 3W7TA 5DN6G 2PI4A 1JQ0A 1TUEB 1EZJA 1H8EG 1M57B 2Q68A 2IJJA 4WFHA 1QR9A 3RVZA 5CBGA 4RO2A 1QLEC 1S76D 1M57C 2LFRA 4KFMA 4WFEA 1XL4A 3ASNC 4X8AA 3PJSK 1OCZB 3SYPA 1RPRA 2WLLA 3OE7G 1ROPA 5IY5C 1R6KA 1AROP 2P67A 2XAJA 1QVFU 2IJIA 4FJCC 4MVMA 4QJFB 4TSFG 4U7NA 3OR7C 1V54C 3T1CA 4TT3G 1NR7A 5CBFA 4QPKA 1EFRG 1NBMG 1VQ4V 3ABKB 1NH2D 2X6CA 1S3JA 2ITCC 1VQ6V 4WF9V 2XAQA 2QM8A 2YSUB 1FXKA 2OTLV 1G4YB 5KA5A 4G27B 2P7TC 2WLNA 1SERA 3EFFK 4WCEV 1V55C 4MTXA 3MHSC 2OTJV 1XL6A 5L3EA 1AR1B 5B3SC 4DXWA 3ZRWB 1RM1B 1GK9A 4MVRA 4X89A 1H2GA 3X2QC 1K7DA 1Y4MA 1G8MA 2Q67A 4PDVA 2P6JA 2GHYA 2DQ3A 3WG7B 1KD1W 1JVMA 4MW3A 1MOFA 2YEVB 4MT8A 3FB5C 3STZC 4Z1MG 4MTOA 5CBHA 5B1NA 1JJ2U 1S5HC 1E1QG 4JPRA 4N23A 3AG3C 3B8MA 3SYQA 3E8HA 1K92A 2HLDG 2HG5C 4RQFA 1J95A 2IH3C 1OCOB 1PD3A 3BY6A 3K0GA 1VQ9V 1AI5A 1SESA 4LBEC 2IH1C 3K3WA 3OUSA 1VQMV 3MHHC 4LC1A 4KUMA 3NXSA 1QVGU 1AJPA 1Y66A 3GB7C 4P30A 1NKDA 2QA4V 2EILC 4G28B 3ZMSA 1NH2B 3RBZA 4LCUC 3CP1A 5LBQA 3LDCA 4J9YB 4MS2A 2HVKC 4RUEA 4R8CA 1VQ5V 1VQNV 1OCRB 5L3DA 3IGAC 2GSMB 1YITV 3ABUA 4L87A 4BIUA 2Y48A 2DYSB 4EKWA 1OCRC 4FMTA 3CCEV 1RPOA 2YEVA 2C2AA 2W6IG 1PL0A 3VOUA 2HR3A 5IYCO 5EBMC 1IXMA 4JGSA 1AI6A 2NLJC 2EZOA 4QIWF 3B8NA 1CP9A 4P2ZA 3SPCA 1Q82W 2R9RB 2X6AA 4R50A 2DWEC 3ZMVA 1W0JG 2IW5A 3JYCA 4JTDB 1Q86W 1PNMA 1F23A 3OM3B 1R6NA 3ZRVA 3ABLC 1QR8A 2UXNA 1AI4A 4GX2A 5HFLA 1HWYA 3ASNB 1FXVA 1YSCA 2ZR2A 3OMIB 4PA3A 3K08A 3JD0A 2UXXA 3E89A 2EJRA 3QNEA 5IY5B 2OT5A 2Y69C 3CCMV 3SYCA 1K33A 3ETEA 4X88A 1UJWB 2OCCB 1BHAA 1V54B 5BZBA 3FYEB 3G4SV 4JAUA 4DO2A 1K73W 1F4MA 3OEEG 5L3CA 3CMEV 3LUTB 1W2BU 3CD6V 2OCCC 3IC7A 5CMUA 3D36A 3CCUV 4PELA 1GM7A 3JD2A 2EIJC 1OZ0A 5E1AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 V;  3G6E V;  1K8A W;  3CCR V;  1Q7Y W;  4WF9 V;  1YHQ V;  3CXC U;  3G71 V;  3CCV V;  3CPW U;  1QVG U;  2OTL V;  3CCE V;  1KD1 W;  3CCM V;  5DM6 V;  1VQ7 V;  2QA4 V;  3CC7 V;  1VQO V;  1YI2 V;  1VQ8 V;  1KQS U;  3CC4 V;  4WFA V;  1R73 A;  1YIJ V;  4WCE V;  3G4S V;  3CMA V;  1YJ9 V;  1Q82 W;  1K73 W;  1JJ2 U;  1QVF U;  1YJN V;  1M1K W;  3CC2 V;  3CCQ V;  2OTJ V;  2D3O W;  3CME V;  1Q86 W;  1KC8 W;  1W2B U;  3I55 V;  1N8R W;  1NJI W;  1K9M W;  3CD6 V;  1VQL V;  3I56 V;  3OW2 U;  2QEX V;  4WFB V;  1Q81 W;  1VQ5 V;  1YJW V;  1VQN V;  1VQ9 V;  1VQK V;  3CCU V;  1VQP V;  3CCS V;  1VQ4 V;  1S72 V;  3CCJ V;  1VQM V;  3CCL V;  1YIT V;  1M90 W; 
#chains in the Genus database with same CATH topology
 2VWK A;  4FIP C;  2JEX A;  1E79 G;  4CH5 A;  3CCV V;  3ZJZ A;  1Q43 A;  3UM7 A;  4ZI7 A;  3DXR B;  1IX9 A;  4C7U A;  5CA1 B;  1KP3 A;  4NXN O;  2ARH A;  4DR1 B;  4JAS A;  3SYO A;  3W7W A;  1YIJ V;  3H1H H;  2DQ0 A;  2A06 H;  2A7W A;  3T2M A;  4LFC B;  2QWO B;  5BMV B;  2CTW A;  1M93 A;  3LDE A;  4PA9 A;  3HB3 B;  3D3Q A;  1GMG A;  4LFB B;  3CPW U;  2XTA A;  4QE9 A;  2HKO A;  5KHJ A;  4J42 A;  1THZ A;  1YJN V;  3OTF A;  3HKD A;  2LW1 A;  2FL4 A;  5LHH A;  1IZ3 A;  4ASU G;  3D8C A;  3E8B A;  3LSU A;  1BMF G;  2RDC A;  1Q5O A;  1I94 B;  1WA8 B;  2EIL B;  3CCR V;  4LP8 A;  2ZT9 B;  1IUR A;  5DM6 V;  1YTF B;  4LWS A;  1XIL A;  2KSD A;  3ZX6 A;  3OFN G;  1ORQ C;  1PNL A;  4ICG A;  4UV9 A;  4JI4 O;  4TV9 A;  3I56 V;  1OHH G;  5L3G A;  5LHG A;  1K97 A;  2ZDI C;  1F4N A;  2ZIN A;  4WBN B;  1FXH A;  4BW5 A;  2KKW A;  4U3J B;  4N21 A;  2UUB O;  1YDX A;  4UXN A;  1VP7 A;  3OMN B;  4G2K A;  1FFX A;  2BOC C;  3B77 A;  4X1I A;  2D2C B;  3CC2 V;  5JH7 A;  1GH6 A;  3ABL B;  4LF7 B;  5E79 Z;  3K5M A;  1KP2 A;  1US6 A;  1H38 A;  1D2D A;  2QWQ B;  3B09 A;  1N32 O;  1F7Y A;  2WPD G;  3VQW A;  3BEH A;  2NN4 A;  5B1B C;  2WLH A;  4JI3 B;  2H3O A;  5GTH Z;  1MMM A;  4R7C A;  4OPH A;  3ZRS A;  3FAV A;  3QO7 A;  4MTF A;  3G6B A;  1K3E A;  1ZAU A;  5IYZ A;  5H2F Z;  4LFA B;  4HZ3 A;  3G71 V;  1AR4 A;  3UCS C;  2CTQ A;  3JAT B;  1K5Q A;  1FJG B;  4IIJ B;  3QF7 A;  1N33 O;  1BT8 A;  3JSN A;  4I0X B;  3SJQ C;  1L1F A;  1JOY A;  1DF4 A;  4MSW C;  5C8Y A;  4EB6 A;  5B1A B;  2LP7 A;  3CYO A;  2B1I A;  5EBL C;  5FLX N;  5LXT A;  1VEW A;  1GRJ A;  3SJB C;  2DW4 A;  4DUY B;  2VQF B;  2CE4 A;  4OXS A;  2EZP A;  5JCO C;  5IWA O;  4DV2 B;  5IT9 N;  2V7Q G;  4ZHQ A;  4ZBM A;  4YIO A;  2ZE5 A;  4CH4 A;  3G67 A;  1OV9 A;  2PY5 A;  1XNR O;  3ZRX A;  4HNA B;  3JCU Z;  2A9H A;  5FPO A;  4JYA O;  1B3Q A;  2E75 B;  4IHJ B;  4Q20 A;  2EJ7 A;  1A32 A;  3K59 A;  3OR6 C;  2OYQ A;  3E86 A;  3HKC B;  2W0F C;  1RSO B;  1Y74 A;  3ZIA G;  2BTO A;  4O4J B;  1M90 W;  2DYR B;  3WB2 A;  4B7E A;  2LO1 A;  3SPH A;  1K8A W;  1YHQ V;  2AZ2 A;  4ZKI A;  4MVS A;  3K5L A;  3CJH B;  4NR1 A;  3NR7 A;  1RP3 B;  4F6E A;  3CB2 A;  1Z5V A;  1H8H G;  2L35 A;  4XDJ A;  1K34 A;  4PDR A;  3OD4 A;  3VQX A;  1BHB A;  2WLI A;  5B1B B;  1SRY A;  1QNM A;  4HBN A;  4J7K A;  4LR3 A;  5LA6 A;  3P32 A;  4MW8 A;  2AHY A;  4TOI A;  1Q7Y W;  1FS0 G;  5KUM A;  2YDE A;  3KCY A;  3R65 A;  2YXY A;  1YI2 V;  4DR3 O;  4WFF A;  4ZIB A;  1P7B A;  3U0Z A;  2OCH A;  1Q6I A;  2AZ0 A;  3JAK A;  5J9P C;  3CX5 F;  5JJE B;  1WLE A;  3N27 A;  5DN6 G;  2PI4 A;  2F4V B;  1EZJ A;  3GWK C;  3AK1 A;  2IJJ A;  1TA8 A;  1QR9 A;  5KX5 A;  5F2V O;  2ZE6 A;  2CGO A;  1SKV A;  4KFM A;  5LMN O;  2IBZ H;  3SYP A;  3SJC C;  2UXB B;  2P67 A;  2XAJ A;  3HKB B;  3OR7 C;  4UCV A;  4QPK A;  3SJA C;  1NBM G;  4B7K A;  1S3J A;  5JWP A;  4WF9 V;  2LGQ A;  2Q0A A;  3H9V A;  4DR2 O;  2YSU B;  1FXK A;  3RYC A;  4JI1 O;  1G4Y B;  3JAS A;  4G27 B;  1BS3 A;  5KA5 A;  2P7T C;  1L8D A;  4LWS B;  4OX9 B;  4X1Y A;  1V55 C;  1IVS A;  3O65 A;  5B3S C;  4TV9 B;  2ZNJ A;  4NTX A;  5LP6 C;  1HNX O;  3TGU H;  1K7D A;  1Y4M A;  3ZHR A;  1N0J A;  3BVO A;  3ZHU A;  4Z1M G;  5CBH A;  1S5H C;  1RFY A;  1E1Q G;  4K3A A;  3AG3 C;  1K92 A;  2HG5 C;  1J95 A;  4K8X A;  1EN6 A;  2AGA A;  4KUM A;  2ZCE A;  1Y66 A;  3PN1 A;  1AB3 A;  4BWA A;  4O4H B;  4GKK B;  4I7Z B;  2N05 A;  3IAY A;  1NH2 B;  4LCU C;  5LBQ A;  4J9Y B;  1XMQ O;  3FAV B;  5EZY A;  3JAW A;  4DW1 A;  1UFI A;  3AG7 A;  4FFB B;  4A5U B;  3QVN A;  1OCR B;  5IJ9 A;  2GSM B;  1PM9 A;  4TV8 A;  1VF7 A;  4J11 A;  4JV5 B;  4B3S B;  1M5I A;  4EKW A;  2QWR B;  5LMU B;  1RPO A;  2YEV A;  5FPR A;  5KLV H;  3VOU A;  1KYO F;  1IXM A;  2R9R B;  4R50 A;  3BPZ A;  2DWE C;  2IW5 A;  3ZBH A;  3L71 H;  4DK0 A;  3MDS A;  3OTO B;  1MSD A;  2LW7 A;  5HFL A;  4FM1 A;  1HWY A;  2VS0 A;  1FXV A;  2YIB D;  3QNE A;  2UXX A;  3LNN A;  4DV4 B;  5LXT B;  3CCM V;  5LYJ A;  1VF6 C;  1K33 A;  1UJW B;  1GN2 A;  5JJJ B;  3WB1 A;  4GLX A;  1BHA A;  4B3R B;  1N0N A;  1W2B U;  2OCC C;  3E22 A;  1H2S B;  3R66 A;  3P3N A;  3F5T A;  2EIJ C;  4HAM A;  1OZ0 A;  3OGI B;  1Z5W A;  2QTS A;  2QKC A;  4LFA O;  1V55 B;  3A2F A;  5B3S B;  2Q8V A;  3RYF B;  3B40 A;  5L3B A;  4CZZ A;  3T1Y B;  2Q7H A;  4DRX A;  3N2G A;  5JJN B;  2Q5Z A;  2VQE O;  2PYL A;  4UB6 Z;  4AHC A;  5EC2 C;  2IU3 A;  4DV6 B;  1COW G;  3AG3 B;  3ZMU A;  1GN3 A;  3BA8 A;  3CCQ V;  2VQF O;  3UT5 A;  2D3O W;  3M8A A;  1WB7 A;  4B08 A;  1HP8 A;  2P4K A;  3ZHS A;  3TET A;  4I55 A;  4EEQ A;  1KU9 A;  2WLM A;  1WPB A;  1SZT A;  4LF9 B;  4JI5 O;  2UU9 B;  4JZ2 A;  3CC7 V;  4TQF A;  1XOU A;  5H5N A;  5KHK A;  4JF3 A;  4TWK A;  2A3Q A;  4Z1V A;  3KG2 A;  3ML0 A;  2F66 C;  3ZRW A;  2YXL A;  4NTW A;  2V4D A;  3MAQ A;  4AI8 A;  1F51 A;  5KX5 B;  2ZXW B;  4GCZ A;  2BSK A;  2WSS G;  4B3T O;  4JAV A;  4XDK A;  4DR4 B;  5JQG B;  1BL8 A;  4GUN A;  2YIB A;  5EK0 A;  3RW0 A;  2RCV A;  4JYB A;  3FD9 A;  5IDJ A;  4YJ2 A;  3AG2 B;  4LF6 B;  3DC6 A;  3E8F A;  3D3I A;  1K4C C;  4QPJ A;  4IT5 A;  3SR2 C;  4MVU A;  4LNU B;  2Q6A A;  1SA0 A;  2KG7 B;  4FZ0 A;  1XDC A;  5KHH A;  2LFS A;  5IJ0 A;  3ETD A;  3K79 A;  1SQP H;  3RYC B;  3FKS G;  1DF5 A;  3JAS B;  4IYI A;  2XOK G;  1H2N A;  3IC9 A;  1G6U A;  2XAG A;  2B5U A;  2BTQ B;  2H8P C;  5H6Q A;  3RT3 C;  2EIJ B;  2Z5U A;  2PYJ A;  4QNH B;  2F4V O;  3DSQ A;  5DED A;  4DV5 B;  5ITZ A;  1XUQ A;  1N36 B;  1J5E B;  1ZTE A;  2BOB C;  4O2B B;  1OCZ C;  4KXR A;  3QTC A;  3K04 A;  4PA7 A;  1FPO A;  3CEI A;  5KUK A;  1M4U A;  4FM2 A;  1ZX3 A;  4XDL A;  4PI2 A;  1KKD A;  4I5S A;  2Q7E A;  1N34 B;  3M7M X;  2UUC B;  5B1A C;  1SF9 A;  1JX9 A;  3E8G A;  1FAF A;  3K58 A;  3ZHT A;  2DOS A;  3FB6 C;  1P4R A;  4PDM A;  4OX9 O;  3ZMZ A;  4RAI A;  1W59 A;  4DUZ B;  3JAW B;  5LGU A;  3H1L H;  5IJ9 B;  3OAA G;  1VQP V;  4PV1 B;  1AJN A;  2OIE A;  5KHI A;  4TV8 B;  4GKJ B;  4JI6 O;  5H6R A;  5CB4 B;  4AQY O;  1E1R G;  4I9W A;  2DMX A;  2GUZ B;  1I0H A;  3CC4 V;  4K8Z A;  3WG7 C;  4L8J A;  4UCR A;  5KMG A;  2HJD A;  4BAY A;  5KAI Z;  1IBM B;  2ZQM A;  1TVK B;  3BAB A;  3LSS A;  4O2A B;  2JGD A;  1OCO C;  1S77 D;  1Q3E A;  4DV1 B;  4UUJ C;  1QHT A;  5FL7 G;  4YXW G;  5EYP A;  3A0B Z;  2DYR C;  3K57 A;  4CH6 A;  1HR0 O;  1NQT A;  3ZN0 A;  4DK1 A;  3N2K A;  3FB7 C;  3E22 B;  1NVP D;  4D7S A;  5GW7 A;  4CS3 A;  4DR5 O;  4YJ3 A;  4O4I A;  3ZHQ A;  2FTK A;  3E83 A;  3CCL V;  4X66 B;  3SPJ A;  2L6L A;  3D36 C;  2R9I A;  5IE9 A;  1KUQ A;  2DN9 A;  1EZV H;  4B3S O;  5LMU O;  1PL4 A;  1DLB A;  2UXD B;  1M56 B;  3IFX A;  4WFA V;  2R9A A;  1NS1 A;  1NU1 H;  2H94 A;  3JD1 A;  3TJT A;  2JJ1 G;  1KB9 F;  4WFB V;  1Q81 W;  3W7T A;  4DRX B;  1JFF A;  4U3F H;  2UUA O;  4WFH A;  4GZR B;  3HKE A;  4RO2 A;  1Q8I A;  2F93 B;  1S76 D;  5JVD A;  5KHG A;  4WFE A;  3ASN C;  4YHH O;  4DV4 O;  1OCZ B;  2WLL A;  5IY5 C;  1EM1 A;  2PF4 E;  3P3P A;  1QVF U;  1VIB A;  4TSF G;  4DR6 B;  4B3R O;  4U7N A;  1V54 C;  3T1C A;  4PI0 A;  2ADQ B;  3O9O A;  4I55 B;  5CBF A;  4I4T A;  4ZOL A;  1VQ4 V;  4BW9 A;  4Z2W A;  2ODM A;  2ITC C;  3CE2 A;  5B66 Z;  4DV7 O;  1O9G A;  1Z2G A;  1SER A;  3EFF K;  1Y67 A;  2CTP A;  5GTI Z;  1XL6 A;  4X1K A;  1ZL8 B;  2GV9 A;  1AR5 A;  3ZRW B;  3JAL A;  4NXM B;  3T1Y O;  2R70 A;  3X2Q C;  4B3M B;  4ABM A;  1BQZ A;  1AP6 A;  1R6T A;  2GHY A;  4JI8 O;  3WG7 B;  3HR0 A;  4MT8 A;  3FB5 C;  5B1N A;  3RYI B;  4YJ2 B;  3J7A U;  4EFE A;  2QWP B;  3SYQ A;  2HLD G;  3ZHV A;  2IH3 C;  1OCO B;  1PD3 A;  4CC5 A;  1Q6H A;  4KHP B;  1AI5 A;  2CTR A;  3S3W A;  3FX7 A;  3OUS A;  1SA0 B;  4LC1 A;  4LF4 O;  1SZX A;  3SDL A;  5IJ0 B;  3NXS A;  4JI2 O;  1TUB B;  1QVG U;  1JA8 A;  3UQ8 A;  3L9D A;  4P30 A;  4X20 A;  4LF9 O;  2UU9 O;  2DE0 X;  1EN5 A;  2K9P A;  4R8C A;  1FYJ A;  2UXC O;  1VQ5 V;  3TXS A;  5L3D A;  4BIU A;  2BE3 A;  1OCR C;  1BQ0 A;  4O4L A;  2EX3 A;  3CCE V;  4FM0 A;  3THO A;  3H1J H;  4EFB A;  2PZS A;  4ZI7 B;  4LF8 B;  4FLZ A;  4FLV A;  4BR6 A;  4DR4 O;  4QIW F;  1CP9 A;  1NZ6 A;  3SPC A;  1Q82 W;  3ETQ A;  4DV3 B;  1SQQ H;  3U10 A;  1F23 A;  1YCI A;  1R6N A;  4X62 O;  2ZM6 O;  1HNW O;  4GX2 A;  3T1H B;  3ASN B;  2ZR2 A;  4PA3 A;  5IY5 B;  3E89 A;  3G80 A;  1GAX A;  2OT5 A;  2Q9L A;  2Y69 C;  2E5L B;  2FB5 A;  3ETE A;  3SYC A;  4F6R A;  1IBK B;  1Y76 A;  2QM4 A;  1V54 B;  3OEE G;  5CA0 A;  3LUT B;  3HKD B;  3IC7 A;  4CS2 A;  5CMU A;  4LF5 B;  4PEL A;  1GM7 A;  3JD2 A;  5E1A C;  4DW0 A;  2CH7 A;  4NXN B;  1CPY A;  1IDS A;  3RVY A;  3CHX A;  1KQS U;  1MG1 A;  4X9Q A;  1FFT B;  4DV5 O;  3RWR D;  1WNS A;  1QQC A;  5KMG B;  1J5E O;  2Z3Y A;  4R6Z A;  3K0D A;  4PA4 A;  1R1B A;  4DR1 O;  1ZLZ A;  5B5E Z;  3X2Q B;  3M99 B;  4LFC O;  4LH6 A;  2OIG A;  1TGO A;  2JGD B;  2EIK C;  5L3F A;  1H2K A;  2HFE C;  4J9Z B;  3BHP A;  4LFB O;  1FFX B;  2ILM A;  4JYC A;  1S0V A;  2JDI G;  2AHZ A;  4X1I B;  1DK1 A;  3L74 H;  3EHB B;  5JH7 B;  4H13 B;  2MK3 A;  5EIB D;  5DEC A;  4UB8 Z;  3QO5 A;  3OT7 A;  4DUZ O;  1JCH A;  4IL6 Z;  1O9H A;  2PUS A;  1WJZ A;  3W7S A;  3CXC U;  4GKJ O;  2P90 A;  2QWN B;  1BE3 H;  4UFZ A;  3DXR A;  1VMG A;  4GT1 A;  4UCS A;  1I94 O;  4X65 B;  4JI4 B;  1OCC C;  2YC0 A;  3F7Y C;  5TIS Z;  1BSM A;  3CSX A;  1UPG A;  3CRM A;  2AW9 A;  1P49 A;  2F1M A;  1B04 A;  4UVA A;  3APQ A;  1NR1 A;  2B1G A;  4J80 A;  5CN0 A;  2UUB B;  5K1X A;  2XHB A;  3AG1 B;  5IYZ B;  1ZWI C;  1AI7 A;  1QCE A;  4FLX A;  3UO2 A;  4DV0 B;  1QU7 A;  2ZKO A;  2ZXW C;  2EIN C;  3E35 A;  1VQ8 V;  5EBW C;  3VBB A;  1SQX H;  2NNU A;  3FFQ A;  4CBC A;  1Q6U A;  2E74 B;  4JI0 B;  1TAE A;  4XBF A;  4E2L A;  1N32 B;  4OGQ B;  1URF A;  5C8Y B;  4LF7 O;  1QBZ A;  3AG2 C;  4I4T B;  4ZOL B;  2WAM A;  3AG4 C;  1VQK V;  2Y69 B;  3OMA B;  4EB6 B;  1AIL A;  1WA8 A;  4K35 A;  3L75 H;  4X66 O;  2HVJ C;  5K1P A;  1LNQ A;  3IJ4 A;  5GON A;  5IYB O;  1FXK C;  4JI3 O;  3W7X A;  3KKY A;  5J2U A;  1T5E A;  3ABM B;  3OW2 U;  4ZHQ B;  4HYO A;  3JAL B;  2V1D A;  3ASO B;  2Y0P A;  3KZI Z;  1EBO A;  3OUF A;  4U3J A;  4D7T A;  2WLJ A;  1GKF A;  2HP8 A;  1N33 B;  4P9O A;  4TQD A;  1R73 A;  2B9Z A;  1R3J C;  2Q73 A;  4BIZ A;  1FJG O;  2EUL A;  3E2E A;  2X7R B;  3QO8 A;  4E4E A;  3ZCC A;  2EIK B;  4PD4 F;  1CEZ A;  4GX0 A;  1Y74 B;  2XND G;  1NVP B;  2XAS A;  4NTY A;  4JTA B;  4RQE A;  3ABK C;  3DGE A;  5IWA B;  3K9A A;  4MVO A;  4F4L A;  2KB1 A;  2XT9 A;  4GYC B;  3KCX A;  3GVM A;  1M9N A;  3FB8 C;  4DUY O;  1SQV H;  1K9M W;  5KAF Z;  4JAA A;  5A2Q N;  4DV2 O;  1KKC A;  2WLI B;  4QGP A;  2IJK A;  3B4S A;  4NXM O;  5LA6 B;  3BCC H;  2N74 A;  2FKX A;  2GDS A;  4JYA B;  4AIL C;  1NI8 A;  3JAT A;  4O4L B;  3ZMT A;  5BR8 B;  3ICX A;  2IU0 A;  1OCC B;  2MW2 B;  1FD9 A;  2JIZ G;  2ZE7 A;  2YUA A;  2F43 G;  3RGB A;  4U7O A;  1XNQ B;  2JEU A;  4QE7 A;  1JR9 A;  4I0X A;  2EBO A;  3T4D A;  1KC8 W;  3JAK B;  4FPP A;  2JGU A;  1AJQ A;  2HHH B;  1XMO B;  4GX1 A;  3LSQ A;  1V9P A;  2QGN A;  4KHP O;  2QDO A;  2EIN B;  3ETG A;  4GX5 A;  2QSA A;  3K5N A;  1DGS A;  2P4V A;  1G1X B;  3T4Z A;  2QE7 G;  2ATK C;  4F6R B;  1Y76 B;  1QLN A;  3HPL C;  3JD3 A;  4X64 B;  3WFV A;  2M7W A;  3AG4 B;  1KBH A;  4FVM A;  4J10 A;  4JTC B;  2YIC A;  2FYU H;  1YXB A;  5HFM A;  4DR3 B;  2CH7 B;  1I08 A;  1FXK B;  1VQ7 V;  2BCC H;  2VWJ A;  1I5X A;  3JD4 A;  5FNV A;  3SYA A;  4IHJ A;  2ADP A;  2W0X A;  3SPG A;  2ZDI A;  4LF8 O;  4X1Y B;  3C3T A;  1SET A;  4H33 A;  2HJF C;  3A0R A;  1M56 C;  5LHI A;  1VQL V;  1QLE B;  1JQ0 A;  1TUE B;  4FLT A;  1M57 B;  3HKC A;  1RSO A;  1IBL B;  1OJH A;  4O4J A;  5CBG A;  3JAM N;  2LFR A;  1AP5 A;  5BY1 A;  4X8A A;  1RPR A;  3OE7 G;  2Q7G A;  1ROP A;  2QJ1 A;  2Q0O C;  3RFR A;  3RN4 A;  2G38 A;  1ARO P;  2E5L O;  1ZSP A;  2YI9 A;  4FJC C;  4MVM A;  4QJF B;  2NR5 A;  2UXB O;  4TT3 G;  5LOV A;  3APO A;  4LF5 O;  3ABK B;  1NH2 D;  1VQ6 V;  4JI1 B;  4I9Q A;  2XAQ A;  2QM8 A;  2OTL V;  1U96 A;  2RNB A;  3AK2 A;  1S5L Z;  1L0N H;  4UCU A;  4WCE V;  4K0K B;  1YEW A;  2OTJ V;  5L3E A;  5EZY B;  2RJZ A;  1VAR A;  4NB5 A;  3CRR A;  1HNX B;  1GK9 A;  3CRQ A;  4X89 A;  1P84 F;  2LGW A;  2Q67 A;  1HW7 A;  1G8M A;  1GN4 A;  1SQF A;  1HNZ B;  1KD1 W;  1MOF A;  2YEV B;  2Y0I A;  3STZ C;  1SQG A;  4PHZ A;  4MTO A;  2E3C A;  2GTA A;  1JJ2 U;  3HKB A;  1WAZ A;  3ZS8 C;  4JPR A;  4N23 A;  3B8M A;  3E8H A;  5J2T A;  2JVD A;  4RQF A;  2YI8 A;  3BY6 A;  3K0G A;  1NT2 B;  1SES A;  4LBE C;  2IH1 C;  4CS4 A;  3MHH C;  4FZ1 A;  1SS3 A;  5JCO A;  2E76 B;  3GB7 C;  1NKD A;  3RYH A;  1XMQ B;  5LYJ B;  4G28 B;  3ZMS A;  3RBZ A;  5GON B;  2YS8 A;  3CP1 A;  3LDC A;  4GKK O;  4X65 O;  5J2U B;  2ZIO A;  2HVK C;  1LUV A;  2RN9 A;  2OWO A;  3IGA C;  1MA1 A;  2JRI A;  3QG5 A;  1YIT V;  4FMT A;  4JV5 O;  2W6I G;  1PL0 A;  4DV0 O;  1X4T A;  5EBM C;  1FKA O;  4JGS A;  1AI6 A;  2NLJ C;  2EZO A;  4P2Z A;  4Q6G A;  4TUY A;  1Q86 W;  1PNM A;  4JI0 O;  4DR7 B;  2O57 A;  2JS3 A;  3L73 H;  3ZRV A;  4DYL A;  3N2G B;  3OMI B;  3OTO O;  1H2M A;  3A8T A;  1D5A A;  4O4H A;  3CS5 A;  1JJO A;  4YY3 B;  5BZB A;  3FYE B;  1K73 W;  1LUW A;  3CME V;  3UT5 B;  3CXH F;  3BA9 A;  4FFB A;  4KL1 A;  3CCU V;  1MZE A;  2XUM A;  4FFK A;  3UKM A;  4JYY A;  3VQY A;  4JI7 B;  5C93 A;  3W7U A;  2QM7 A;  1R3L C;  2A0L A;  4I50 A;  2ETN A;  2VQE B;  3SGI A;  2Y4U A;  1KEC A;  1B6Q A;  1MAB G;  2BSK B;  2ZR3 A;  1KMI Z;  4DV6 O;  1YJ9 V;  3JAR A;  1GM8 A;  2RMK B;  1H2L A;  4KP4 A;  3AEI A;  1YVW A;  4UCO A;  3J81 N;  1AVM A;  1S72 V;  4JI5 B;  1MNG A;  3JSL A;  5IYD O;  5EC1 C;  1P7G A;  5BR8 O;  5FNV B;  1LR1 A;  4PDL A;  3RYF A;  4UVB A;  1XNQ O;  1DTO A;  1N8R W;  5LP6 A;  3C90 A;  3CRC A;  3TCU A;  2HHH O;  1XMO O;  3LNM B;  4B3T B;  3A0H Z;  2YID A;  3AG1 C;  3L72 H;  5CA3 A;  2WA3 A;  4D6T H;  5ITZ B;  4FLU A;  2XAF A;  4YIP A;  2WLK A;  4H44 B;  2Q69 A;  2W6J G;  3I55 V;  4X64 O;  1I5Y A;  3TXQ A;  1YJW V;  4LF6 O;  1WPX A;  2YXH A;  5LOV B;  3CCS V;  1K5S A;  4UCT A;  3I5D A;  2PTM A;  5D5Q A;  3JCZ A;  1K4D C;  2RQ6 A;  2XAH A;  4FK5 C;  1M1K W;  4CH3 A;  3UO3 A;  4CC6 A;  3OEH G;  2JJ2 G;  2EIM C;  1GO3 F;  3F7V C;  2IJH A;  3OGC C;  2F23 A;  3ABM C;  3SPI A;  1IBL O;  1ENV A;  1ZUQ A;  1YTF D;  3ASO C;  1MZF A;  3Q4H A;  1BZK A;  1U97 A;  3CRA A;  5JQG A;  1PNK A;  1VQO V;  2WWW A;  3K9S A;  1MSW D;  1R3I C;  4MVQ A;  4MTG A;  1XHZ A;  2QKS A;  4P9P A;  1Q90 D;  4RUF A;  2CK3 G;  5KA6 A;  3H1I H;  1N36 O;  3F5W C;  1NJI W;  5J2T B;  1PV0 A;  2QEX V;  4IGG A;  4LNU A;  4PA6 A;  3L70 H;  2KG7 A;  2CAZ C;  3K06 A;  1VF6 A;  3VQV A;  3H01 A;  2PI5 A;  4PJ0 Z;  3RYH B;  5EYP B;  1N34 O;  1D5N A;  2UUC O;  1R3K C;  3N2K B;  1B06 A;  2KQX A;  4K0K O;  2BTQ A;  4JI6 B;  5A9G A;  4H0L B;  1GN6 A;  3CCJ V;  4O4I B;  4YJ3 B;  4AQY B;  3C3S A;  4W4K A;  1RM1 C;  3H1K H;  2QTO A;  1JPX A;  3LDD A;  4WFG A;  5CA1 A;  1HNZ O;  2CGN A;  1NTZ H;  4O2B A;  2A79 B;  1NTK H;  4TUY B;  1Y6X A;  5LGN A;  1L0L H;  5BMV A;  2ITD C;  1IBM O;  1JFF B;  1WB8 A;  1WN7 A;  1N4C A;  1GTO A;  3G6E V;  2P22 C;  3HKE B;  2JK5 C;  1W0K G;  5JVD B;  1HR0 B;  1EN4 A;  2DWD C;  2IM9 A;  4H37 A;  2ZIM A;  3FYI B;  4DV1 O;  1BGY H;  1PKX A;  2K1E A;  2WLL B;  3CMA V;  3GWO A;  2QKA A;  5B1O A;  1X59 A;  4DR5 B;  2ZE8 A;  3K03 A;  4MVZ A;  4UVC A;  1GM9 A;  5H9C A;  2ZD9 A;  4W4L A;  3EVK A;  3ABT A;  5CB4 A;  1IXB A;  2X6B A;  4UV8 A;  3P30 A;  4J7J A;  2GUZ A;  2DYS C;  2X0L A;  3MD0 A;  2UXD O;  2EIM B;  5AG2 A;  5LGT A;  2GTS A;  3STL C;  3ZN1 A;  5D5P A;  4X1K B;  3DTU B;  1YF2 A;  4I50 B;  2UUA B;  3TK1 A;  3BFR A;  2VRZ A;  4DR7 O;  1H8E G;  1TVK A;  4WBN A;  2Q68 A;  4O2A A;  3RVZ A;  1QLE C;  4YHH B;  1M57 C;  1HDJ A;  1XL4 A;  3PJS K;  1R6K A;  1JMK C;  3JAR B;  2IJI A;  1XBL A;  4YY3 O;  3K5O A;  1XI1 A;  1NR7 A;  4DR6 O;  1EFR G;  1XRE A;  1WP7 A;  2X6C A;  1I7F A;  4DV7 B;  4FLW A;  3U11 A;  4X20 B;  2Q4P A;  2WLN A;  3AK3 A;  4MTX A;  3MHS C;  3J80 N;  1AR1 B;  5LP6 B;  3ZED A;  4JI7 O;  2HEP A;  4DXW A;  2R72 A;  1PP9 H;  2P06 A;  1RM1 B;  1XNR B;  4MVR A;  4JI8 B;  2N04 A;  1H2G A;  4PDV A;  2P6J A;  2CUG A;  2DQ3 A;  4B3M O;  1JVM A;  4MW3 A;  4IIJ A;  1S5J A;  4LF4 B;  1VQ9 V;  3K3W A;  4JI2 B;  1VQM V;  3S3X A;  2FML A;  4NYK A;  1XHX A;  1VF5 B;  1AJP A;  4J7Z A;  2QA4 V;  2EIL C;  1BCC H;  3EXA A;  4MS2 A;  2UXC B;  1NTM H;  1ZL8 A;  2QR4 A;  4OPA A;  5CA0 B;  4RUE A;  3WB0 A;  1VQN V;  4NVP A;  3CWB H;  2Z0A A;  3ABU A;  3WU2 Z;  4L87 A;  2Y48 A;  2DYS B;  3Q4H B;  4HNA A;  2P5O A;  2C2A A;  2HR3 A;  1XEQ A;  5IYC O;  3RYI A;  2JS5 A;  3B8N A;  2WA4 A;  3BAA A;  2X6A A;  1HNW B;  4X62 B;  2ZM6 B;  3DC5 A;  3ZMV A;  1YZB A;  1W0J G;  3JYC A;  2F95 B;  4JTD B;  3B2E E;  3BRC A;  4J41 A;  3OM3 B;  2ZNI A;  4DV3 O;  4BIO A;  3ABL C;  1QR8 A;  2CDY A;  2UXN A;  1AI4 A;  5BXZ A;  1PPJ H;  4FLY A;  1YSC A;  2GBO A;  5LMN B;  3K08 A;  3JD0 A;  1TUB A;  2AXT Z;  2EJR A;  2LQT A;  3T1H O;  1XQ8 A;  2Y4T A;  5LL6 Y;  5EIB C;  3CJH A;  4X88 A;  4JZG A;  2OCC B;  4IYH A;  4RWU A;  1CXZ B;  3G4S V;  4JAU A;  4DO2 A;  1IBK O;  1WP8 A;  2DJV A;  1F4M A;  5L3C A;  1SC5 B;  3CD6 V;  2LJ2 A;  2YIA A;  4LH7 A;  4NKG B;  1SQB H;  3D36 A;  2M6Y A;  2PGG A;  4DR2 B; 
#chains in the Genus database with same CATH homology
 4FIP C;  2JEX A;  1E79 G;  3UKM A;  3CCV V;  3ZJZ A;  1CPY A;  4HAM A;  3RVY A;  1V55 B;  3UM7 A;  1KQS U;  1MG1 A;  1KP3 A;  1FFT B;  5B3S B;  4JAS A;  3SYO A;  3W7W A;  1YIJ V;  2DQ0 A;  2Z3Y A;  4R6Z A;  3T2M A;  3K0D A;  4PA4 A;  5C93 A;  5L3B A;  3W7U A;  2QM7 A;  4CZZ A;  1R3L C;  2A0L A;  3X2Q B;  3M99 B;  3LDE A;  4PA9 A;  3HB3 B;  2EIK C;  5L3F A;  1GMG A;  1KEC A;  1B6Q A;  1MAB G;  3CPW U;  2HFE C;  5EC2 C;  2IU3 A;  4QE9 A;  4J9Z B;  2HKO A;  2ZR3 A;  1COW G;  3AG3 B;  4JYC A;  1S0V A;  2JDI G;  1YJ9 V;  2AHZ A;  3ZMU A;  1GM8 A;  1THZ A;  1YJN V;  3CCQ V;  4KP4 A;  2D3O W;  1VQ8 V;  3EHB B;  2MK3 A;  3AEI A;  5LHH A;  3TET A;  3QO5 A;  4ASU G;  3E8B A;  1JCH A;  1BMF G;  1S72 V;  2WLM A;  3CCR V;  2EIL B;  3W7S A;  3CXC U;  5IYD O;  2P90 A;  1SZT A;  5EC1 C;  4LP8 A;  5DM6 V;  4GT1 A;  3CC7 V;  4JF3 A;  1YTF B;  4TWK A;  1OCC C;  4PDL A;  3KG2 A;  3OFN G;  3F7Y C;  3ML0 A;  4UVB A;  1ORQ C;  1PNL A;  1DTO A;  4UV9 A;  1N8R W;  3I56 V;  1OHH G;  5L3G A;  5LHG A;  3ZRW A;  1K97 A;  3TCU A;  4UVA A;  2ZDI C;  1F4N A;  5CN0 A;  1NR1 A;  2B1G A;  1FXH A;  4BW5 A;  3AG1 B;  3LNM B;  1ZWI C;  1AI7 A;  1F51 A;  2ZXW B;  4GCZ A;  4N21 A;  2WSS G;  1QCE A;  4UXN A;  4JAV A;  4XDK A;  3AG1 C;  3OMN B;  2ZXW C;  1BL8 A;  2EIN C;  3E35 A;  4G2K A;  5EK0 A;  5CA3 A;  5EBW C;  3RW0 A;  2BOC C;  3VBB A;  2NNU A;  2XAF A;  3B77 A;  2WLK A;  4CBC A;  4JYB A;  5IDJ A;  3CC2 V;  2Q69 A;  4XBF A;  3ABL B;  3AG2 B;  2W6J G;  3I55 V;  1KP2 A;  4E2L A;  3E8F A;  1I5Y A;  3D3I A;  1H38 A;  1K4C C;  4QPJ A;  1YJW V;  1QBZ A;  1WPX A;  3AG2 C;  4MVU A;  3CCS V;  2Q6A A;  2WAM A;  2WPD G;  3AG4 C;  1VQK V;  2Y69 B;  3OMA B;  3BEH A;  2LFS A;  5B1B C;  2WLH A;  2HVJ C;  1K5S A;  3ETD A;  3K79 A;  1LNQ A;  3FKS G;  1DF5 A;  3JCZ A;  2XOK G;  1K4D C;  2XAH A;  5IYB O;  1FXK C;  4FK5 C;  3W7X A;  1M1K W;  4R7C A;  3ZRS A;  2XAG A;  3OEH G;  2B5U A;  3ABM B;  5H6Q A;  2H8P C;  2JJ2 G;  3QO7 A;  2EIJ B;  4MTF A;  2EIM C;  2Z5U A;  3OW2 U;  1K3E A;  1GO3 F;  3F7V C;  4HYO A;  2IJH A;  3OGC C;  2V1D A;  3ASO B;  3ABM C;  1EBO A;  3OUF A;  3SPI A;  4QNH B;  2WLJ A;  1ENV A;  1YTF D;  4HZ3 A;  3ASO C;  3G71 V;  1GKF A;  1K5Q A;  1PNK A;  1VQO V;  2WWW A;  1MSW D;  4P9O A;  1R3I C;  4MVQ A;  2BOB C;  4MTG A;  1R73 A;  2QKS A;  1R3J C;  4P9P A;  4BIZ A;  4RUF A;  3E2E A;  2CK3 G;  5KA6 A;  1OCZ C;  2X7R B;  3F5W C;  3QO8 A;  3SJQ C;  1L1F A;  1JOY A;  1DF4 A;  1NJI W;  4MSW C;  3K04 A;  2QEX V;  3ZCC A;  2EIK B;  4PA7 A;  5KUK A;  4PA6 A;  4XDL A;  1CEZ A;  4GX0 A;  1KKD A;  5B1A B;  4I5S A;  2LP7 A;  3K06 A;  2XND G;  3CYO A;  3H01 A;  2B1I A;  1NVP B;  5EBL C;  2PI5 A;  2XAS A;  4JTA B;  4RQE A;  3ABK C;  5B1A C;  3DGE A;  2DW4 A;  1JX9 A;  3E8G A;  3K9A A;  4MVO A;  4F4L A;  2KB1 A;  4OXS A;  3FB6 C;  1P4R A;  1R3K C;  2EZP A;  4PDM A;  1M9N A;  3FB8 C;  3ZMZ A;  4RAI A;  1K9M W;  2V7Q G;  4ZBM A;  5LGU A;  2WLI B;  3OAA G;  1VQP V;  2IJK A;  1AJN A;  3CCJ V;  3ZRX A;  5H6R A;  1RM1 C;  2QTO A;  3ZMT A;  1E1R G;  1JPX A;  4I9W A;  2IU0 A;  1OCC B;  2A9H A;  3LDD A;  2JIZ G;  4WFG A;  3CC4 V;  2F43 G;  3WG7 C;  4U7O A;  2JEU A;  4QE7 A;  2A79 B;  2EBO A;  4Q20 A;  3T4D A;  5LGN A;  1KC8 W;  4FPP A;  4BAY A;  1AJQ A;  2ITD C;  3OR6 C;  2ZQM A;  4GX1 A;  3LSQ A;  3E86 A;  2W0F C;  3LSS A;  3ZIA G;  1M90 W;  2DYR B;  1OCO C;  1S77 D;  1GTO A;  2EIN B;  3ETG A;  3SPH A;  3G6E V;  2JK5 C;  4GX5 A;  4UUJ C;  1YHQ V;  1W0K G;  1K8A W;  5FL7 G;  4ZKI A;  4YXW G;  2DWD C;  2QE7 G;  4H37 A;  4MVS A;  2ATK C;  3FYI B;  3T4Z A;  2DYR C;  1PKX A;  2K1E A;  2WLL B;  1NQT A;  3ZN0 A;  1QLN A;  3HPL C;  3CMA V;  3JD3 A;  3WFV A;  3GWO A;  5B1O A;  1H8H G;  3FB7 C;  4XDJ A;  1K34 A;  2M7W A;  4PDR A;  3AG4 B;  3K03 A;  4MVZ A;  1BHB A;  1NVP D;  4UVC A;  2WLI A;  5GW7 A;  5B1B B;  1GM9 A;  1SRY A;  5H9C A;  2ZD9 A;  4JTC B;  2FTK A;  3E83 A;  3ABT A;  3CCL V;  3P32 A;  4MW8 A;  2AHY A;  3SPJ A;  5HFM A;  1Q7Y W;  2X6B A;  2R9I A;  1FS0 G;  4UV8 A;  5KUM A;  3P30 A;  1FXK B;  3R65 A;  1VQ7 V;  1DLB A;  1YI2 V;  2DYS C;  4WFF A;  1I5X A;  1M56 B;  3JD4 A;  3SYA A;  2X0L A;  3IFX A;  3MD0 A;  4WFA V;  1P7B A;  3SPG A;  2H94 A;  3JD1 A;  2EIM B;  2ZDI A;  5LGT A;  4H33 A;  1SET A;  2HJF C;  5J9P C;  3A0R A;  3STL C;  3ZN1 A;  2JJ1 G;  1M56 C;  5LHI A;  1VQL V;  3DTU B;  4WFB V;  3TK1 A;  1Q81 W;  1WLE A;  1QLE B;  3W7T A;  5DN6 G;  2PI4 A;  1JQ0 A;  1TUE B;  1EZJ A;  1H8E G;  1M57 B;  2Q68 A;  2IJJ A;  4WFH A;  1QR9 A;  3RVZ A;  5CBG A;  4RO2 A;  1QLE C;  1S76 D;  1M57 C;  2LFR A;  4KFM A;  4WFE A;  1XL4 A;  3ASN C;  4X8A A;  3PJS K;  1OCZ B;  3SYP A;  1RPR A;  2WLL A;  3OE7 G;  1ROP A;  5IY5 C;  1R6K A;  1ARO P;  2P67 A;  2XAJ A;  1QVF U;  2IJI A;  4FJC C;  4MVM A;  4QJF B;  4TSF G;  4U7N A;  3OR7 C;  1V54 C;  3T1C A;  4TT3 G;  1NR7 A;  5CBF A;  4QPK A;  1EFR G;  1NBM G;  1VQ4 V;  3ABK B;  1NH2 D;  2X6C A;  1S3J A;  2ITC C;  1VQ6 V;  4WF9 V;  2XAQ A;  2QM8 A;  2YSU B;  1FXK A;  2OTL V;  1G4Y B;  5KA5 A;  4G27 B;  2P7T C;  2WLN A;  1SER A;  3EFF K;  4WCE V;  1V55 C;  4MTX A;  3MHS C;  2OTJ V;  1XL6 A;  5L3E A;  1AR1 B;  5B3S C;  4DXW A;  3ZRW B;  1RM1 B;  1GK9 A;  4MVR A;  4X89 A;  1H2G A;  3X2Q C;  1K7D A;  1Y4M A;  1G8M A;  2Q67 A;  4PDV A;  2P6J A;  2GHY A;  2DQ3 A;  3WG7 B;  1KD1 W;  1JVM A;  4MW3 A;  1MOF A;  2YEV B;  4MT8 A;  3FB5 C;  3STZ C;  4Z1M G;  4MTO A;  5CBH A;  5B1N A;  1JJ2 U;  1S5H C;  1E1Q G;  4JPR A;  4N23 A;  3AG3 C;  3B8M A;  3SYQ A;  3E8H A;  1K92 A;  2HLD G;  2HG5 C;  4RQF A;  1J95 A;  2IH3 C;  1OCO B;  1PD3 A;  3BY6 A;  3K0G A;  1VQ9 V;  1AI5 A;  1SES A;  4LBE C;  2IH1 C;  3K3W A;  3OUS A;  1VQM V;  3MHH C;  4LC1 A;  4KUM A;  3NXS A;  1QVG U;  1AJP A;  1Y66 A;  3GB7 C;  4P30 A;  1NKD A;  2QA4 V;  2EIL C;  4G28 B;  3ZMS A;  1NH2 B;  3RBZ A;  4LCU C;  3CP1 A;  5LBQ A;  3LDC A;  4J9Y B;  4MS2 A;  2HVK C;  4RUE A;  4R8C A;  1VQ5 V;  1VQN V;  1OCR B;  5L3D A;  3IGA C;  2GSM B;  1YIT V;  3ABU A;  4L87 A;  4BIU A;  2Y48 A;  2DYS B;  4EKW A;  1OCR C;  4FMT A;  3CCE V;  1RPO A;  2YEV A;  2C2A A;  2W6I G;  1PL0 A;  3VOU A;  2HR3 A;  5IYC O;  5EBM C;  1IXM A;  4JGS A;  1AI6 A;  2NLJ C;  2EZO A;  4QIW F;  3B8N A;  1CP9 A;  4P2Z A;  3SPC A;  1Q82 W;  2R9R B;  2X6A A;  4R50 A;  2DWE C;  3ZMV A;  1W0J G;  2IW5 A;  3JYC A;  4JTD B;  1Q86 W;  1PNM A;  1F23 A;  3OM3 B;  1R6N A;  3ZRV A;  3ABL C;  1QR8 A;  2UXN A;  1AI4 A;  4GX2 A;  5HFL A;  1HWY A;  3ASN B;  1FXV A;  1YSC A;  2ZR2 A;  3OMI B;  4PA3 A;  3K08 A;  3JD0 A;  2UXX A;  3E89 A;  2EJR A;  3QNE A;  5IY5 B;  2OT5 A;  2Y69 C;  3CCM V;  3SYC A;  1K33 A;  3ETE A;  4X88 A;  1UJW B;  2OCC B;  1BHA A;  1V54 B;  5BZB A;  3FYE B;  3G4S V;  4JAU A;  4DO2 A;  1K73 W;  1F4M A;  3OEE G;  5L3C A;  3CME V;  3LUT B;  1W2B U;  3CD6 V;  2OCC C;  3IC7 A;  5CMU A;  3D36 A;  3CCU V;  4PEL A;  1GM7 A;  3JD2 A;  2EIJ C;  1OZ0 A;  5E1A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...