3CCEV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cceV00
3CCSV 1W2BU 2QA4V 2OTJV 1VQ4V 1VQOV 3CPWU 2D3OW 1VQNV 3G71V 4WF9V 1NJIW 1K8AW 1R73A 1M1KW 1VQ5V 1VQ6V 1M90W 1VQ8V 3G4SV 4WCEV 1YHQV 3CCQV 1YJNV 3CMEV 2QEXV 3OW2U 3CC4V 1YJWV 1VQKV 1JJ2U 3G6EV 1KD1W 3CC2V 3CCEV 1VQ7V 1VQMV 3CCJV 3CCLV 1YITV 4WFBV 4WFAV 3CC7V 1YIJV 1K9MW 1QVGU 1VQLV 1KQSU 2OTLV 3CCVV 1Q81W 5DM6V 3CD6V 1VQ9V 3CMAV 1VQPV 1QVFU 1Q82W 1K73W 3I55V 1S72V 3I56V 3CCRV 3CCUV 1N8RW 1YI2V 3CXCU 3CCMV 1KC8W 1Q86W 1YJ9V 1Q7YW
chains in the Genus database with same CATH superfamily
1Y74B 2PYJA 4DRXA 1HR0B 4CH4A 4O4HB 3ZMZA 3MD0A 1FXHA 4LF4B 1AI6A 4WFAV 1IBKB 3B40A 2LW1A 2B9ZA 2YICA 3H1KH 1NTMH 3CRAA 1PNKA 1MNGA 4JI5O 1AJNA 1M5IA 1N0NA 4TQDA 3STLC 1RSOB 4DV0O 1SQGA 3ZIAG 1P84F 2R9IA 1YF2A 2K1EA 4NTYA 4DV5B 4HNAB 2IJHA 4B7KA 4G28B 3FKSG 1EN4A 2Q9LA 5LL6Y 1NTKH 4DV3O 1TUBB 3QF7A 3EVKA 4XBFA 1XMQO 4NXMB 1SERA 4LWSB 1FXKB 3WB2A 3FB6C 3CCSV 4DR5B 4DUZO 4X64O 1RPOA 3ML0A 2BSKB 2Y48A 2QTOA 5LMUB 3HKCA 4KP4A 1ROPA 2EIMB 1R6KA 3D36C 3CCJV 4P9PA 1HW7A 4R50A 2XAQA 4JZ2A 5EIBD 3AG1C 4O4IB 3ZMSA 4DR5O 1V55C 4DV1O 4YHHO 3D36A 2ZCEA 5H6QA 1Q3EA 3TETA 2ZR3A 2Q73A 3K5OA 2WSSG 3O65A 5E79Z 2M6YA 4MSWC 1EZJA 3CHXA 1K4CC 4MW3A 2E5LO 1N0JA 1P7GA 3QNEA 1HP8A 3AK2A 3OEEG 3T1YO 1FAFA 2F4VO 3K58A 4DW0A 2H8PC 1NR7A 4DO2A 3K59A 5KMGA 1Q43A 5CBFA 2OTLV 1ZLZA 4LF5B 3LDCA 4I9QA 1Q82W 2DWEC 3FX7A 4FLZA 3S3WA 2A9HA 4JI2B 1EN5A 5EBMC 5FNVA 4CS4A 2XAHA 2PF4E 2WLKA 2LFSA 2P06A 2CGOA 4N23A 4UCUA 3ZMVA 1SA0A 4FZ1A 4PJ0Z 2DE0X 4NXNB 3W7WA 5F2VO 2YIBD 4JTAB 3JASB 3I5DA 1N34B 2R72A 3L9DA 2ILMA 2OCCC 1AR1B 1HWYA 1XNRB 3NXSA 2W0XA 3EFFK 3FAVB 4DRXB 2Y4UA 3D3IA 1AROP 2JRIA 1H8HG 1BZKA 2CTQA 4KHPO 1H2MA 1NQTA 2IH3C 3KG2A 1MA1A 4J11A 5LA6A 1CXZB 1SQXH 4JI8O 3FD9A 2EIKB 3BY6A 2GSMB 1XL4A 4GLXA 2B1GA 1N8RW 2DQ3A 4JTCB 4ZBMA 4H33A 1K4DC 2YIAA 4GUNA 4PI2A 1Q6IA 2NN4A 3ASOB 5A2QN 5BZBA 1W0KG 2A3QA 2JEUA 3ZN0A 1JR9A 2XT9A 4F6RB 1BQ0A 4FLWA 2CK3G 4IHJB 5LP6C 1QLNA 1HNZB 1VARA 1NR1A 4ZOLB 4KFMA 3H1IH 5B1BC 5LYJA 1L0LH 5BR8O 5CMUA 3TGUH 2GUZB 4JTDB 4MTOA 2GTSA 5L3EA 1BE3H 1TA8A 3JASA 1NU1H 5IYCO 1Q81W 5ITZB 2EILB 3CRRA 4DK0A 2ZE7A 2GUZA 1PPJH 4MVZA 3L70H 2AHYA 1D5AA 4IT5A 5LOVB 1S5HC 1ZSPA 2CDYA 1Y67A 5KAIZ 5LA6B 4R8CA 1SKVA 1AI5A 1WNSA 5FLXN 1BT8A 3ZMTA 4GX2A 2OWOA 3JD2A 1GKFA 3JD1A 4J7JA 2XHBA 1YVWA 3IFXA 3CCUV 1OHHG 2AZ0A 4JI3B 1QNMA 1VQ5V 4O2BA 2WA3A 1Q5OA 3L75H 3SJAC 5DEDA 3DSQA 5KA6A 3CXHF 4GX5A 2Y0IA 5IJ0A 1XL6A 1DK1A 3WB1A 4U3FH 1YTFB 3U10A 1ZWIC 1S72V 1QR9A 3DXRA 4LFAO 4JI7B 1S5LZ 1SQQH 4J9YB 4I0XA 2P4VA 1K8AW 3STZC 3GWKC 5IJ0B 2YEVA 3ABMB 4RUFA 2QKCA 2DN9A 2ZT9B 3L74H 2V4DA 3IAYA 2IU3A 4DV2B 4ZKIA 1OCCC 2RCVA 4DV1B 2WLMA 1YI2V 5D5PA 1FPOA 1OZ0A 4MTXA 4R6ZA 2DOSA 1I08A 2IJIA 3F7YC 4O4LA 1LUVA 4X1YB 4JF3A 3ABKC 2HVKC 4FVMA 1EZVH 5JH7B 4FLVA 2BOCC 4MVUA 3RW0A 2FB5A 3SDLA 4B3MO 2JGDA 4JI4O 3JARA 3CE2A 3SJCC 1EBOA 3M8AA 5JH7A 5KHGA 1YZBA 3G71V 4CC5A 2JK5C 1IURA 4FK5C 3OT7A 4B3TB 1BMFG 2RNBA 4MVSA 5B1AC 2LGWA 3OAAG 3JALA 5B66Z 1HDJA 1WLEA 2GBOA 2G38A 3X2QB 5CB4B 3T4ZA 3WU2Z 2EIMC 3QO8A 1OCRC 4Z1MG 1QBZA 3FB5C 1WP8A 2HHHO 2JGUA 2D3OW 2F1MA 4PA4A 1M93A 4WFFA 5KLVH 4X64B 2FTKA 2Q69A 3AG2B 5GTIZ 2XUMA 3ETEA 1XI1A 1MMMA 3CD6V 2YXYA 4FFBB 4WBNA 1DGSA 5E1AC 1P7BA 3R66A 4FLYA 2EJ7A 4DUYB 3B2EE 5L3CA 2UUCO 2Q7GA 4LC1A 2KB1A 3BRCA 4YJ2B 2QWNB 3LSSA 1O9HA 3N27A 1JPXA 4JI5B 2ZE6A 1KP2A 4DR4B 4X65B 2LQTA 1S0VA 4LCUC 4PHZA 1S77D 1M1KW 4YJ3B 3ZRWA 5LGUA 2QA4V 5EK0A 4QNHB 4LF8O 5LHIA 2IJJA 3JD0A 4LF7O 1VMGA 4C7UA 5IY5C 1KD1W 5IDJA 3PJSK 5IE9A 2A06H 3A2FA 1RM1B 2ADQB 4FIPC 1GH6A 3F5TA 3TJTA 5IYDO 3CSXA 1NT2B 1OCCB 3HR0A 2CTWA 3P3NA 3JAWA 2P4KA 2RN9A 2OIEA 4B3SB 1PNLA 1G1XB 2DWDC 1K5QA 2JGDB 2O57A 4O4IA 1B6QA 5IWAO 5C93A 4K8ZA 5CBGA 2HR3A 4HYOA 4ASUG 3GVMA 4GZRB 3E89A 4L87A 2GTAA 3B09A 1JOYA 2A79B 4X20B 4I50A 2Q7EA 4XDJA 4NKGB 3T4DA 4J9ZB 3K3WA 2GV9A 1MOFA 4RQFA 2X6BA 5K1PA 4MVOA 3P3PA 4X8AA 3VQYA 4FPPA 1TVKA 1VEWA 4FLUA 2Y4TA 2E3CA 2LJ2A 1F23A 1IXBA 5LMUO 2ZDIC 3TCUA 3P30A 3E8HA 2V1DA 1PM9A 2WLNA 4FFKA 1AB3A 4UUJC 2Z3YA 4HZ3A 2WAMA 4YXWG 1UFIA 1NKDA 2DQ0A 2FL4A 4MTGA 4P2ZA 5A9GA 1Q8IA 2QR4A 2DYRB 4DV0B 3ASNC 1GK9A 1PL4A 2UUBO 4O4HA 3BHPA 4NTWA 1N32O 4F4LA 4J7ZA 3A0HZ 3H1JH 2OCCB 4ABMA 3OM3B 1Q6UA 3G6EV 4GX1A 4MT8A 3SR2C 2B1IA 1WAZA 2EZPA 3AG3B 3ZCCA 2GHYA 1H2KA 2JDIG 3VBBA 1X59A 4IYHA 3OE7G 2HP8A 4K0KB 3F7VC 3ZHRA 2ZM6B 1NJIW 3D8CA 5ITZA 4W4KA 2Q67A 4J80A 2EILC 2MW2B 4LNUA 3L71H 5IWAB 4J41A 3RT3C 1J5EB 4I55B 3ZRSA 5BMVA 3J80N 3CMAV 3Q4HA 4OPAA 1N33B 1MZFA 3I55V 1OJHA 4EFBA 3U11A 2P90A 4PA7A 1XNQO 1DTOA 1BCCH 4H0LB 1WB8A 4LH7A 1GRJA 5KA5A 1AJPA 4TT3G 2OT5A 3ABUA 5KAFZ 1AJQA 1U96A 1WA8B 3PN1A 2QSAA 4BWAA 3BFRA 3JAWB 5LHHA 3ASOC 4QIWF 3E8GA 1MABG 4I7ZB 4TV8B 3QTCA 4BIOA 3ICXA 1Q7YW 5J2UB 2AXTZ 1XMOO 1VQ6V 3OD4A 1RP3B 2F43G 4R7CA 4AQYO 3JAMN 5C8YB 4OXSA 4JI0B 4ZOLA 2PZSA 3K57A 3J7AU 4JYAB 1KUQA 4GT1A 1KQSU 5JQGB 4YJ3A 5KUMA 3WB0A 1J95A 5IYZA 1Z5VA 3RVZA 2P67A 4CH5A 1NH2B 3AG4C 5KHKA 4TV9A 5GTHZ 4NVPA 4MVRA 5BY1A 3E22B 4P9OA 3ZHSA 4I4TB 1KP3A 1YIJV 1K92A 4YJ2A 3GWOA 4IGGA 5JVDA 4Z1VA 5DM6V 3ZRXA 5LHGA 2BTQA 3QO5A 4XDKA 3MDSA 1AP5A 1L8DA 4WF9V 3HKDB 5CA0A 2L35A 1AVMA 3ETQA 5KUKA 3CCLV 2ADPA 1BSMA 1BQZA 2ZINA 4ZI7A 1Y66A 3CJHA 1IVSA 4NYKA 5H2FZ 3OTFA 4Z2WA 4JI4B 1CEZA 2VQFO 4DR1B 3BA8A 2PUSA 2UXXA 3LSUA 2ARHA 3H9VA 1GM7A 3RBZA 4PD4F 4GKJO 2UUAB 3AK1A 1VQKV 1M4UA 2EULA 3E35A 3CCEV 3CYOA 4PELA 1HNWO 2Q8VA 2W6IG 5CA0B 2E74B 2JS5A 1SF9A 1BL8A 2ZD9A 2X6CA 3VQWA 1WA8A 1M56C 2IM9A 5K1XA 3SPHA 2X7RB 1JCHA 1YCIA 4I4TA 3HKEB 2N04A 5GW7A 3W7UA 2D2CB 4GYCB 1YITV 3LNMB 4DW1A 1CPYA 4IHJA 2X6AA 1N36B 5LYJB 3G80A 5EBWC 3SJQC 4JV5O 2ATKC 1V9PA 4DV4B 1I94O 3CCMV 3E83A 4DV6O 3ZRWB 4FLTA 3S3XA 2N05A 2JEXA 5DN6G 1F7YA 3K06A 3K5LA 1Y6XA 1XBLA 3ABKB 3ZN1A 3TK1A 2UU9O 5BR8B 3K08A 3CXCU 1LNQA 4RWUA 2ZR2A 4IL6Z 2JS3A 4X62O 1R3JC 1I0HA 2P5OA 5B3SB 3G67A 4O2BB 2QJ1A 4UCSA 2P22C 1XMOB 3ABTA 1XEQA 3FYEB 5B1NA 2PI4A 3MHSC 2CH7A 1RSOA 3G6BA 1GN4A 4J42A 4DUZB 1R3IC 3SPIA 5B5EZ 1M57C 2WLJA 2ZXWC 1DF5A 1G6UA 1SZTA 2ITDC 2JJ1G 2BTQB 4CS2A 4PDRA 3DTUB 1AR4A 2YIBA 1VQNV 3SYPA 1Y4MA 1FKAO 4DR4O 5FL7G 3K0GA 2BE3A 1VF6A 2CTRA 2FMLA 3HKCB 1VQLV 4G2KA 3RVYA 4WFGA 3MHHC 2IH1C 1E1RG 1F4MA 1ZX3A 4O4JA 4UCOA 5H6RA 4DYLA 4OX9B 1KC8W 1COWG 1PKXA 1VQ4V 2LW7A 5JWPA 1H2GA 1XUQA 3N2KB 4HNAA 2Y0PA 4QPKA 3KKYA 3CMEV 3TXSA 3RWRD 3UCSC 4NB5A 5GONB 4N21A 2F95B 1JFFB 2Y69B 4HAMA 3RYHB 1FJGO 4CC6A 3K04A 1YTFD 4BIUA 3T1YB 5LGTA 1VF7A 3X2QC 2E5LB 1XHXA 1VQOV 2RDCA 2RJZA 1Q6HA 3O9OA 4O2AB 1THZA 1JVMA 3CB2A 1V54B 1WN7A 1VQMV 4PDLA 4U7OA 3E8BA 2WLHA 3OGIB 4X1YA 4U3JA 4E2LA 1O9GA 4F6RA 1N4CA 2M7WA 3VOUA 1KMIZ 1JMKC 1I7FA 2EBOA 1SRYA 3JD3A 3H01A 1SS3A 1IBMO 2HVJC 5HFLA 4CZZA 2PYLA 2EINB 3FYIB 3FB7C 2YC0A 5L3GA 3IJ4A 5LXTB 1BHBA 3HKBA 3BCCH 4JAVA 1SC5B 4MW8A 4DV6B 2CE4A 3JAKB 2R9RB 2VRZA 3CPWU 4TSFG 2H94A 1XMQB 1EN6A 3BA9A 2RQ6A 4BAYA 4B3RO 4NR1A 1GMGA 3KCXA 4FM1A 4LFBB 2AGAA 3ZMUA 1KYOF 5AG2A 2HFEC 2CGNA 1Z2GA 3A0RA 2K9PA 5LMNB 4X9QA 4DK1A 3SYQA 5KHHA 3CWBH 2XAJA 1SQBH 2ZQMA 3IC9A 3ASNB 1WP7A 3CC4V 1E79G 3GB7C 4HBNA 1S76D 4WFBV 3UKMA 1JQ0A 1FFXA 5B3SC 4DV4O 5CB4A 3SYCA 1SQPH 1DF4A 3RYCA 2QWRB 4LF7B 3BPZA 2DJVA 3JARB 3KZIZ 2YI9A 3C90A 2QDOA 3ZS8C 3TXQA 4OX9O 1B04A 2Q6AA 4JI6O 4JPRA 1NBMG 1P4RA 3K9SA 3SPJA 4DR3B 4J10A 2WA4A 2EIKC 4KXRA 3SPCA 4X20A 4RAIA 1IBLO 3I56V 2ZKOA 2E75B 2WWWA 1H2NA 2UUCB 2CAZC 1TUBA 1IX9A 4TUYB 1NTZH 4TWKA 1OCOB 3B8NA 1OV9A 1K5SA 3DXRB 1R6NA 2BOBC 3B77A 2Q7HA 4EFEA 2XTAA 2PTMA 3OR7C 4H37A 1YXBA 3VQXA 4UCVA 2KSDA 4FFBA 2ZE8A 1VIBA 2ZNJA 3K5MA 3UM7A 2EZOA 2QWQB 3VQVA 1JJ2U 2Q0OC 1QLEB 1GTOA 3ETDA 2W0FC 4ZHQB 3WFVA 3ZJZA 5D5QA 4O4JB 2HJFC 4DUYO 1Y74A 1K7DA 1M56B 1ENVA 4UVAA 2XASA 3JSNA 1Y76A 4I9WA 3THOA 1GN2A 2UXDO 1NZ6A 5KX5A 1PV0A 3OMNB 1RM1C 3HKDA 2XOKG 2HEPA 1M9NA 1SESA 2YDEA 4BW9A 3APOA 4WFHA 5CBHA 4PI0A 4UB8Z 3HKBB 3QO7A 4TQFA 3ZBHA 1XOUA 1B06A 4QE7A 3DC6A 4UVCA 1WPBA 2Z5UA 4LP8A 4WBNB 2JIZG 5H5NA 2Q4PA 2Q0AA 4AILC 3ZHTA 4I5SA 3W7SA 3EXAA 4DV7O 2QKSA 3CX5F 5LBQA 4JV5B 3CS5A 1G4YB 2FKXA 3W7XA 3T2MA 4KUMA 2DW4A 1BS3A 2ZM6O 1GN6A 1FFTB 2YI8A 3M7MX 2VQEO 3BEHA 5FPRA 3WG7C 3JATB 3LUTB 2UXBO 3HKEA 4LF5O 3SYAA 5CA1A 2NR5A 4I50B 1NVPD 4CS3A 1MSWD 3OUFA 4TV8A 3QG5A 2P6JA 3ZRVA 2F4VB 2WPDG 3CRMA 2ZE5A 4LNUB 1PNMA 4OPHA 2HJDA 3AEIA 4LF6B 1S5JA 4QE9A 1TVKB 2YXHA 3UT5A 2YS8A 4JI3O 4AI8A 5GONA 4X88A 4EEQA 2BSKA 4LFBO 1F4NA 1F51A 1PP9H 1JA8A 2DYSC 5EBLC 5JJNB 4GCZA 5IJ9B 1LUWA 1H8EG 1UPGA 1QHTA 5J2TA 3IC7A 4ZIBA 3OTOB 1W2BU 1LR1A 1QQCA 3ABMC 4DXWA 3P32A 1N32B 2UUAO 1TUEB 2XAGA 2KKWA 2ZDIA 1NH2D 4X1IA 1QVGU 2EX3A 4DR1O 3NR7A 4LR3A 2KQXA 2WLIB 3C3SA 5DECA 5LP6B 4IYIA 4JI1O 1AILA 2ODMA 2LP7A 4IIJB 1SQFA 1ORQC 3RYFA 4XDLA 2ZIMA 5L3FA 1YJWV 1G8MA 5LXTA 3APQA 3E22A 2YIDA 4QJFB 3FAVA 4UXNA 1S3JA 4B3SO 2Y69C 4GX0A 4G27B 4U3JB 2YUAA 1IBMB 2Z0AA 2WLLA 1NVPB 4E4EA 1GM9A 1I5YA 4NXMO 1ZTEA 1DLBA 1VP7A 2OIGA 3ABLC 4X89A 1D2DA 1XREA 2UXDB 3CP1A 1OCZC 2EIJC 1K3EA 1HR0O 2ZNIA 1HNZO 3HB3B 4DR7O 4KHPB 4RQEA 2H3OA 2VWJA 1US6A 2AZ2A 2HKOA 4JI0O 1XNRO 5KMGB 4DR2O 3B4SA 2F23A 1B3QA 3ZHVA 3RGBA 3RYCB 1T5EA 3ABLB 1TGOA 1GM8A 4RUEA 2EINC 1V55B 2HG5C 3N2KA 1VQPV 5CA3A 3AK3A 2UXNA 3Q4HB 5EYPA 2XNDG 1IBKO 1EFRG 2A0LA 4FZ0A 4JI8B 4DR7B 2L6LA 4LH6A 3B8MA 3LNNA 1BGYH 3JYCA 2VS0A 1VQ7V 4PA3A 2LFRA 1XNQB 1HNXB 2YSUB 2JVDA 2AW9A 1QVFU 4H44B 1IBLB 4W4LA 5JVDB 3RYFB 1AI4A 2B5UA 1J5EO 4A5UB 4FMTA 4DR2B 3E86A 4JASA 4D7SA 5L3DA 1XDCA 5KX5B 1YHQV 4Q6GA 4YY3O 2FYUH 2XAFA 5LMNO 4UCRA 3UQ8A 5BXZA 5LGNA 2V7QG 4OGQB 4B3TO 1FD9A 3A0BZ 4UV9A 4LF9O 2F93B 4JAAA 4CH6A 1NS1A 3ETGA 4UFZA 1R3KC 4UV8A 5EC2C 4JZGA 1Y76B 4X66O 4CH3A 4GKKO 4BW5A 3W7TA 3DC5A 2UUBB 4X66B 4FM0A 5J2UA 3FFQA 4UCTA 2DYRC 3K0DA 1V54C 4TUYA 4PDMA 5HFMA 2AHZA 1X4TA 3RYIB 4O2AA 4K3AA 2E76B 2CTPA 3AG1B 4F6EA 3F5WC 2PY5A 5IYBO 2PI5A 1FFXB 3EHBB 2ITCC 5CA1B 5J2TB 5JJEB 3AG2C 4CBCA 5IJ9A 1SZXA 1ZUQA 4WFEA 2P7TC 2YXLA 4LFCO 4FM2A 5JQGA 4GKKB 4QPJA 2IW5A 1FJGB 4UVBA 1W59A 5C8YA 3CC7V 4JYCA 3L73H 4IIJA 2ZIOA 3CCRV 3SGIA 1H38A 3CEIA 3LDDA 3ZX6A 4DV5O 4B7EA 2IBZH 1L0NH 4KL1A 2QWPB 3G4SV 2X0LA 4X65O 3E2EA 3OR6C 1IZ3A 4X1KA 4NTXA 2QM7A 5FPOA 2C2AA 4LFAB 1WPXA 4DV7B 3C3TA 4LWSA 5J9PC 4MTFA 1QLEC 5KHIA 1YJ9V 4ZI7B 5EZYA 2A7WA 4GKJB 3JSLA 1R73A 1ZAUA 4UB6Z 3JD4A 2UXBB 2W6JG 1YSCA 3ZHUA 2CUGA 1WB7A 4ZHQA 1SA0B 4LF8B 5B1BB 3JALB 1MG1A 4LBEC 2VWKA 4X1KB 3H1HH 3SPGA 3CRCA 4RO2A 1H2LA 4MVQA 1Q90D 4MVMA 1OCZB 2EIJB 3A8TA 2EJRA 4K8XA 4YIPA 1RPRA 5EZYB 5B1AB 2PGGA 1Z5WA 3UO3A 1YDXA 4TV9B 1FXVA 3DGEA 1VQ9V 5JCOC 2MK3A 1K97A 4MS2A 1JX9A 4D6TH 5LOVA 2QM4A 3OEHG 4EKWA 3ZEDA 2UU9B 4PDVA 4H13B 3OW2U 3T1HO 3WG7B 2HHHB 3OGCC 5JCOA 3AG3C 3CCVV 2N74A 1QU7A 5FNVB 3M99B 3FB8C 3J81N 2OCHA 4DR6B 1AI7A 1K34A 3RYHA 4J7KA 1JFFA 1IDSA 3UT5B 1N33O 4JYYA 3BAAA 1VQ8V 4X62B 2LGQA 2ETNA 4WCEV 3K5NA 1MZEA 4DV2O 2BCCH 1R1BA 4JAUA 2QTSA 4NXNO 3OMIB 1FXKC 1K9MW 1N36O 4U7NA 2Q68A 3LDEA 4JI1B 1H2SB 1OCOC 4FJCC 3AG7A 4ICGA 4B3MB 1L1FA 4I55A 4JI2O 2OTJV 4TOIA 2DMXA 1QR8A 3BABA 1AR5A 4JI7O 5CN0A 4LF6O 1GAXA 1FXKA 2UXCB 1U97A 2QM8A 3ZHQA 3RN4A 1XHZA 4BR6A 1HNWB 1VF5B 3OTOO 1SQVH 1I94B 1K33A 1N34O 1KKCA 2YEVB 2WLIA 3RYIA 4DR3O 3OMAB 4B08A 5EIBC 5LP6A 1UJWB 3MAQA 4LFCB 2VQEB 4JI6B 1PL0A 3JAKA 3K79A 1R6TA 2VQFB 3K9AA 3KCYA 3HPLC 1KU9A 4QGPA 5IYZB 3U0ZA 2QWOB 3QVNA 5KHJA 3JCZA 4JGSA 1KBHA 1YEWA 2R9AA 4FLXA 2F66C 1Q86W 1FYJA 1KKDA 3AG4B 1ZL8B 3JCUZ 3D3QA 4L8JA 2UXCO 3CCQV 2KG7B 2NLJC 5EYPB 1WJZA 2NNUA 2QGNA 2QKAA 3OFNG 2R70A 3T1HB 3H1LH 4D7TA 1E1QG 4BIZA 3N2GB 5IY5B 2DYSB 2OYQA 4B3RB 4LF9B 1FS0G 1MSDA 1M90W 4YHHB 2JJ2G 4PV1B 3UO2A 2QEXV 4EB6B 1A32A 4Q20A 2HLDG 4P30A 1P49A 3SYOA 4JYAO 5BMVB 1JJOA 1CP9A 3JATA 2ZXWB 3K03A 3BVOA 4DR6O 5B1OA 1K73W 4EB6A 5L3BA 2WLLB 3CRQA 4PA9A 1URFA 2BTOA 5IT9N 2Q5ZA 3T1CA 1XQ8A 4AHCA 1PD3A 1NI8A 1YJNV 3N2GA 2IJKA 1GN3A 1XILA 1QCEA 3R65A 4LF4O 4I0XB 1IXMA 3OUSA 2LO1A 3SJBC 4DV3B 1RFYA 2QE7G 1GO3F 1R3LC 1D5NA 3IGAC 1AP6A 1W0JG 2IU0A 4K35A 4JYBA 1VF6C 1TAEA 5JJJB 1I5XA 4PA6A 4YY3B 1SETA 3RFRA 5H9CA 1EM1A 4AQYB 3CC2V 1OCRB 1M57B 3CJHB 2CH7B 2RMKB 3L72H 4O4LB 2GDSA 1ZL8A 5EC1C 5TISZ 1KECA 2KG7A 1BHAA 4YIOA 4X1IB 1HNXO 1KB9F 3LSQA 4K0KO 3E8FA
chains in the Genus database with same CATH topology
3ZRWA 5LGUA 2QA4V 5EK0A 4QNHB 1VQ4V 1H2GA 5LHIA 2IJJA 3B8MA 3JD0A 4QPKA 3ZMZA 3CMEV 3MD0A 1FXHA 5IY5C 3JYCA 1KD1W 1VQ7V 4PA3A 5IDJA 1AI6A 2LFRA 3PJSK 4WFAV 1RM1B 2YSUB 4FIPC 4N21A 2Y69B 5IYDO 4HAMA 1QVFU 1OCCB 1PNKA 3K04A 1AI4A 1YTFD 1AJNA 2B5UA 4BIUA 5LGTA 1PNLA 3X2QC 2DWDC 1K5QA 1VQOV 3STLC 1B6QA 5C93A 4FMTA 5CBGA 3E86A 4JASA 5L3DA 1THZA 3ZIAG 1YHQV 1JVMA 2HR3A 2XAFA 4HYOA 4ASUG 2R9IA 1V54B 5LGNA 2K1EA 3E89A 4L87A 4PDLA 1VQMV 2V7QG 4U7OA 3E8BA 2WLHA 2IJHA 4G28B 4E2LA 3FKSG 2M7WA 1JOYA 4UV9A 3VOUA 2A79B 1SERA 4XBFA 2EBOA 1FXKB 1SRYA 4XDJA 3JD3A 3H01A 3FB6C 3ETGA 3T4DA 3CCSV 4J9ZB 3K3WA 1RPOA 1MOFA 1R3KC 2HVJC 3ML0A 4RQFA 5HFLA 2Y48A 2X6BA 4UV8A 4CZZA 2QTOA 2EINB 4KP4A 4MVOA 1ROPA 5EC2C 2EIMB 1R6KA 3CCJV 3FYIB 3FB7C 5L3GA 4X8AA 4P9PA 4BW5A 3W7TA 1BHBA 4FPPA 4R50A 2XAQA 4JAVA 1F23A 4MW8A 3AG1C 2ZDIC 5HFMA 2DYRC 3K0DA 1V54C 4PDMA 3TCUA 3P30A 2AHZA 3E8HA 3ZMSA 2R9RB 2V1DA 1V55C 2WLNA 3CPWU 4TSFG 4UUJC 2H94A 3AG1B 3D36A 3F5WC 5H6QA 4BAYA 2Z3YA 5IYBO 4HZ3A 2PI5A 1GMGA 3EHBB 2WAMA 2ZR3A 3TETA 2ITCC 4YXWG 2WSSG 3AG2C 1NKDA 3ZMUA 4CBCA 2DQ0A 2HFEC 4MTGA 4WFEA 3A0RA 4MSWC 4P2ZA 1EZJA 2P7TC 2DYRB 3ASNC 1K4CC 1GK9A 3SYQA 4MW3A 2XAJA 3QNEA 3OEEG 4F4LA 4QPJA 2IW5A 2ZQMA 2OCCB 3OM3B 3ASNB 3CC4V 1E79G 3GB7C 3G6EV 4UVBA 1S76D 4WFBV 3UKMA 3CC7V 2H8PC 1JQ0A 4GX1A 5B3SC 1NR7A 4DO2A 4JYCA 4MT8A 2B1IA 3SYCA 2EZPA 5CBFA 2OTLV 3AG3B 3LDCA 1DF4A 3ZCCA 1Q82W 2DWEC 2GHYA 2A9HA 3VBBA 2JDIG 3CCRV 5EBMC 1H38A 3LDDA 3OE7G 2XAHA 3F7VC 1NJIW 2WLKA 2LFSA 3G4SV 4N23A 2Q67A 2Q6AA 4JPRA 3ZMVA 2EILC 2X0LA 3E2EA 3OR6C 1NBMG 1P4RA 2QM7A 2C2AA 3SPJA 3W7WA 1WPXA 4JTAB 2EIKC 3ZRSA 3SPCA 3CMAV 3LSQA 4RAIA 2OCCC 1AR1B 5J9PC 1HWYA 3I55V 4MTFA 1QLEC 3I56V 2P90A 3NXSA 2WWWA 3EFFK 1YJ9V 4PA7A 3D3IA 1AROP 1DTOA 1H8HG 1R73A 3JD4A 2W6JG 1NQTA 1YSCA 2IH3C 4TWKA 3KG2A 5KA5A 1OCOB 3B8NA 1K5SA 1AJPA 1R6NA 4TT3G 2BOBC 2OT5A 3B77A 3ABUA 2EIKB 3BY6A 1AJQA 2GSMB 1XL4A 5B1BB 3OR7C 5LHHA 1MG1A 4LBEC 3ASOC 4QIWF 2B1GA 4H37A 3E8GA 1N8RW 2DQ3A 4JTCB 1MABG 4ZBMA 4H33A 3SPGA 1Q7YW 1K4DC 4RO2A 4MVQA 1VQ6V 3ASOB 3UM7A 4MVMA 2F43G 4R7CA 1OCZB 2EIJB 2EJRA 2EZOA 5BZBA 1JJ2U 1W0KG 4OXSA 3ZN0A 2JEUA 1QLEB 1GTOA 3ETDA 1RPRA 5B1AB 2W0FC 3WFVA 3ZJZA 4GT1A 2HJFC 1KQSU 2CK3G 1FXVA 3DGEA 1K7DA 1M56B 1ENVA 5KUMA 1VQ9V 1QLNA 1J95A 4UVAA 2XASA 2MK3A 4I9WA 1K97A 1NR1A 3RVZA 2P67A 4MS2A 4KFMA 1JX9A 3OMNB 1RM1C 1NH2B 2XOKG 3AG4C 5B1BC 1M9NA 3OEHG 4EKWA 1SESA 4PDVA 5CMUA 4WFHA 3OW2U 4MVRA 5CBHA 4JTDB 4P9OA 4MTOA 5L3EA 1KP3A 1YIJV 1K92A 3QO7A 3GWOA 3WG7B 3OGCC 3AG3C 5IYCO 3CCVV 1Q81W 5DM6V 2EILB 3ZRXA 4QE7A 3M99B 3FB8C 4UVCA 2Z5UA 4LP8A 5LHGA 1AI7A 2JIZG 3QO5A 1K34A 4XDKA 4MVZA 2AHYA 4WF9V 1S5HC 4I5SA 3W7SA 1VQ8V 2QKSA 4WCEV 5KUKA 5LBQA 4R8CA 3CCLV 1G4YB 4JAUA 1AI5A 3OMIB 1FXKC 1K9MW 3ZMTA 4GX2A 4U7NA 3W7XA 1Y66A 2Q68A 3LDEA 3JD2A 2DW4A 4KUMA 3T2MA 1GKFA 3JD1A 1OCOC 3IFXA 3CCUV 1CEZA 1FFTB 4FJCC 1OHHG 2UXXA 1L1FA 2OTJV 3BEHA 1QR8A 3WG7C 1VQ5V 3LUTB 5CN0A 1GM7A 3RBZA 3SYAA 1NVPD 1FXKA 1VQKV 1MSWD 3OUFA 3E35A 3CCEV 3CYOA 2QM8A 2P6JA 4PELA 3ZRVA 5KA6A 2W6IG 2WPDG 4GX5A 1PNMA 1BL8A 1XL6A 1K33A 3AEIA 1YTFB 2YEVB 2WLIA 1ZWIC 2ZD9A 1S72V 1QR9A 2X6CA 3OMAB 4QE9A 1UJWB 1M56C 4J9YB 1PL0A 3K79A 1K8AW 3K9AA 3STZC 4X88A 3SPHA 2X7RB 2YEVA 1JCHA 3ABMB 3HPLC 4RUFA 5GW7A 3W7UA 1YITV 3LNMB 1F4NA 1F51A 1CPYA 2X6AA 2DYSC 3JCZA 5EBLC 4JGSA 2IU3A 5EBWC 3SJQC 4ZKIA 1OCCC 4GCZA 2ATKC 1H8EG 2WLMA 1YI2V 3IC7A 3CCMV 1Q86W 1KKDA 1W2BU 1OZ0A 4MTXA 3E83A 4R6ZA 3AG4B 2IJIA 3F7YC 1M1KW 3ABMC 4DXWA 3P32A 3ZRWB 4JF3A 3CCQV 3ABKC 2HVKC 1TUEB 2XAGA 2ZDIA 2NLJC 1NH2D 2JEXA 5DN6G 2BOCC 4MVUA 3RW0A 1QVGU 2NNUA 3OFNG 3K06A 3ABKB 3ZN1A 3TK1A 2WLIB 1E1QG 4BIZA 3K08A 1EBOA 3CXCU 1LNQA 5IY5B 2DYSB 2LP7A 1FS0G 3G71V 2ZR2A 2JK5C 1ORQC 1M90W 2JJ2G 4XDLA 5L3FA 4FK5C 2QEXV 1YJWV 1G8MA 4Q20A 2HLDG 1BMFG 1R3JC 4P30A 3SYOA 4MVSA 5B1AC 5B3SB 3OAAG 1CP9A 1WLEA 2ZXWB 3K03A 3X2QB 3T4ZA 4QJFB 5B1OA 1K73W 4UXNA 2EIMC 3QO8A 1S3JA 1OCRC 2WLLB 4Z1MG 3ABTA 1QBZA 5L3BA 3FB5C 4PA9A 3FYEB 5B1NA 2Y69C 2D3OW 4GX0A 3T1CA 4G27B 2PI4A 3MHSC 4PA4A 1PD3A 4WFFA 1YJNV 2IJKA 2WLLA 1NVPB 2FTKA 1GM9A 1QCEA 1R3IC 1I5YA 2Q69A 3AG2B 3R65A 3SPIA 1DLBA 3ETEA 3ABLC 1M57C 2WLJA 4X89A 1IXMA 2ZXWC 3OUSA 1DF5A 1SZTA 2QE7G 3CD6V 3CP1A 1GO3F 2ITDC 2JJ1G 1R3LC 1OCZC 2EIJC 1K3EA 5E1AC 3IGAC 1W0JG 3HB3B 2IU0A 1P7BA 4PDRA 3DTUB 4RQEA 4JYBA 5L3CA 2HKOA 1I5XA 1VQNV 3SYPA 4PA6A 1SETA 1Y4MA 5FL7G 3K0GA 5H9CA 4LC1A 2KB1A 3CC2V 1OCRB 3LSSA 3ABLB 1M57B 1JPXA 1VQLV 4G2KA 1GM8A 3RVYA 4WFGA 3MHHC 4RUEA 1KP2A 2IH1C 1E1RG 1F4MA 5EC1C 2EINC 1V55B 2HG5C 1VQPV 5CA3A 2UXNA 1KECA 1BHAA 1S0VA 4LCUC 5H6RA 2XNDG 1KC8W 1COWG 1S77D 1PKXA 1EFRG 2A0LA 3E8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS V;  1W2B U;  2QA4 V;  2OTJ V;  1VQ4 V;  1VQO V;  3CPW U;  2D3O W;  1VQN V;  3G71 V;  4WF9 V;  1NJI W;  1K8A W;  1R73 A;  1M1K W;  1VQ5 V;  1VQ6 V;  1M90 W;  1VQ8 V;  3G4S V;  4WCE V;  1YHQ V;  3CCQ V;  1YJN V;  3CME V;  2QEX V;  3OW2 U;  3CC4 V;  1YJW V;  1VQK V;  1JJ2 U;  3G6E V;  1KD1 W;  3CC2 V;  3CCE V;  1VQ7 V;  1VQM V;  3CCJ V;  3CCL V;  1YIT V;  4WFB V;  4WFA V;  3CC7 V;  1YIJ V;  1K9M W;  1QVG U;  1VQL V;  1KQS U;  2OTL V;  3CCV V;  1Q81 W;  5DM6 V;  3CD6 V;  1VQ9 V;  3CMA V;  1VQP V;  1QVF U;  1Q82 W;  1K73 W;  3I55 V;  1S72 V;  3I56 V;  3CCR V;  3CCU V;  1N8R W;  1YI2 V;  3CXC U;  3CCM V;  1KC8 W;  1Q86 W;  1YJ9 V;  1Q7Y W; 
#chains in the Genus database with same CATH topology
 1Y74 B;  2PYJ A;  4DRX A;  1HR0 B;  4CH4 A;  4O4H B;  3ZMZ A;  3MD0 A;  1FXH A;  4LF4 B;  1AI6 A;  4WFA V;  1IBK B;  3B40 A;  2LW1 A;  2B9Z A;  2YIC A;  3H1K H;  1NTM H;  3CRA A;  1PNK A;  1MNG A;  4JI5 O;  1AJN A;  1M5I A;  1N0N A;  4TQD A;  3STL C;  1RSO B;  4DV0 O;  1SQG A;  3ZIA G;  1P84 F;  2R9I A;  1YF2 A;  2K1E A;  4NTY A;  4DV5 B;  4HNA B;  2IJH A;  4B7K A;  4G28 B;  3FKS G;  1EN4 A;  2Q9L A;  5LL6 Y;  1NTK H;  4DV3 O;  1TUB B;  3QF7 A;  3EVK A;  4XBF A;  1XMQ O;  4NXM B;  1SER A;  4LWS B;  1FXK B;  3WB2 A;  3FB6 C;  3CCS V;  4DR5 B;  4DUZ O;  4X64 O;  1RPO A;  3ML0 A;  2BSK B;  2Y48 A;  2QTO A;  5LMU B;  3HKC A;  4KP4 A;  1ROP A;  2EIM B;  1R6K A;  3D36 C;  3CCJ V;  4P9P A;  1HW7 A;  4R50 A;  2XAQ A;  4JZ2 A;  5EIB D;  3AG1 C;  4O4I B;  3ZMS A;  4DR5 O;  1V55 C;  4DV1 O;  4YHH O;  3D36 A;  2ZCE A;  5H6Q A;  1Q3E A;  3TET A;  2ZR3 A;  2Q73 A;  3K5O A;  2WSS G;  3O65 A;  5E79 Z;  2M6Y A;  4MSW C;  1EZJ A;  3CHX A;  1K4C C;  4MW3 A;  2E5L O;  1N0J A;  1P7G A;  3QNE A;  1HP8 A;  3AK2 A;  3OEE G;  3T1Y O;  1FAF A;  2F4V O;  3K58 A;  4DW0 A;  2H8P C;  1NR7 A;  4DO2 A;  3K59 A;  5KMG A;  1Q43 A;  5CBF A;  2OTL V;  1ZLZ A;  4LF5 B;  3LDC A;  4I9Q A;  1Q82 W;  2DWE C;  3FX7 A;  4FLZ A;  3S3W A;  2A9H A;  4JI2 B;  1EN5 A;  5EBM C;  5FNV A;  4CS4 A;  2XAH A;  2PF4 E;  2WLK A;  2LFS A;  2P06 A;  2CGO A;  4N23 A;  4UCU A;  3ZMV A;  1SA0 A;  4FZ1 A;  4PJ0 Z;  2DE0 X;  4NXN B;  3W7W A;  5F2V O;  2YIB D;  4JTA B;  3JAS B;  3I5D A;  1N34 B;  2R72 A;  3L9D A;  2ILM A;  2OCC C;  1AR1 B;  1HWY A;  1XNR B;  3NXS A;  2W0X A;  3EFF K;  3FAV B;  4DRX B;  2Y4U A;  3D3I A;  1ARO P;  2JRI A;  1H8H G;  1BZK A;  2CTQ A;  4KHP O;  1H2M A;  1NQT A;  2IH3 C;  3KG2 A;  1MA1 A;  4J11 A;  5LA6 A;  1CXZ B;  1SQX H;  4JI8 O;  3FD9 A;  2EIK B;  3BY6 A;  2GSM B;  1XL4 A;  4GLX A;  2B1G A;  1N8R W;  2DQ3 A;  4JTC B;  4ZBM A;  4H33 A;  1K4D C;  2YIA A;  4GUN A;  4PI2 A;  1Q6I A;  2NN4 A;  3ASO B;  5A2Q N;  5BZB A;  1W0K G;  2A3Q A;  2JEU A;  3ZN0 A;  1JR9 A;  2XT9 A;  4F6R B;  1BQ0 A;  4FLW A;  2CK3 G;  4IHJ B;  5LP6 C;  1QLN A;  1HNZ B;  1VAR A;  1NR1 A;  4ZOL B;  4KFM A;  3H1I H;  5B1B C;  5LYJ A;  1L0L H;  5BR8 O;  5CMU A;  3TGU H;  2GUZ B;  4JTD B;  4MTO A;  2GTS A;  5L3E A;  1BE3 H;  1TA8 A;  3JAS A;  1NU1 H;  5IYC O;  1Q81 W;  5ITZ B;  2EIL B;  3CRR A;  4DK0 A;  2ZE7 A;  2GUZ A;  1PPJ H;  4MVZ A;  3L70 H;  2AHY A;  1D5A A;  4IT5 A;  5LOV B;  1S5H C;  1ZSP A;  2CDY A;  1Y67 A;  5KAI Z;  5LA6 B;  4R8C A;  1SKV A;  1AI5 A;  1WNS A;  5FLX N;  1BT8 A;  3ZMT A;  4GX2 A;  2OWO A;  3JD2 A;  1GKF A;  3JD1 A;  4J7J A;  2XHB A;  1YVW A;  3IFX A;  3CCU V;  1OHH G;  2AZ0 A;  4JI3 B;  1QNM A;  1VQ5 V;  4O2B A;  2WA3 A;  1Q5O A;  3L75 H;  3SJA C;  5DED A;  3DSQ A;  5KA6 A;  3CXH F;  4GX5 A;  2Y0I A;  5IJ0 A;  1XL6 A;  1DK1 A;  3WB1 A;  4U3F H;  1YTF B;  3U10 A;  1ZWI C;  1S72 V;  1QR9 A;  3DXR A;  4LFA O;  4JI7 B;  1S5L Z;  1SQQ H;  4J9Y B;  4I0X A;  2P4V A;  1K8A W;  3STZ C;  3GWK C;  5IJ0 B;  2YEV A;  3ABM B;  4RUF A;  2QKC A;  2DN9 A;  2ZT9 B;  3L74 H;  2V4D A;  3IAY A;  2IU3 A;  4DV2 B;  4ZKI A;  1OCC C;  2RCV A;  4DV1 B;  2WLM A;  1YI2 V;  5D5P A;  1FPO A;  1OZ0 A;  4MTX A;  4R6Z A;  2DOS A;  1I08 A;  2IJI A;  3F7Y C;  4O4L A;  1LUV A;  4X1Y B;  4JF3 A;  3ABK C;  2HVK C;  4FVM A;  1EZV H;  5JH7 B;  4FLV A;  2BOC C;  4MVU A;  3RW0 A;  2FB5 A;  3SDL A;  4B3M O;  2JGD A;  4JI4 O;  3JAR A;  3CE2 A;  3SJC C;  1EBO A;  3M8A A;  5JH7 A;  5KHG A;  1YZB A;  3G71 V;  4CC5 A;  2JK5 C;  1IUR A;  4FK5 C;  3OT7 A;  4B3T B;  1BMF G;  2RNB A;  4MVS A;  5B1A C;  2LGW A;  3OAA G;  3JAL A;  5B66 Z;  1HDJ A;  1WLE A;  2GBO A;  2G38 A;  3X2Q B;  5CB4 B;  3T4Z A;  3WU2 Z;  2EIM C;  3QO8 A;  1OCR C;  4Z1M G;  1QBZ A;  3FB5 C;  1WP8 A;  2HHH O;  2JGU A;  2D3O W;  2F1M A;  4PA4 A;  1M93 A;  4WFF A;  5KLV H;  4X64 B;  2FTK A;  2Q69 A;  3AG2 B;  5GTI Z;  2XUM A;  3ETE A;  1XI1 A;  1MMM A;  3CD6 V;  2YXY A;  4FFB B;  4WBN A;  1DGS A;  5E1A C;  1P7B A;  3R66 A;  4FLY A;  2EJ7 A;  4DUY B;  3B2E E;  5L3C A;  2UUC O;  2Q7G A;  4LC1 A;  2KB1 A;  3BRC A;  4YJ2 B;  2QWN B;  3LSS A;  1O9H A;  3N27 A;  1JPX A;  4JI5 B;  2ZE6 A;  1KP2 A;  4DR4 B;  4X65 B;  2LQT A;  1S0V A;  4LCU C;  4PHZ A;  1S77 D;  1M1K W;  4YJ3 B;  3ZRW A;  5LGU A;  2QA4 V;  5EK0 A;  4QNH B;  4LF8 O;  5LHI A;  2IJJ A;  3JD0 A;  4LF7 O;  1VMG A;  4C7U A;  5IY5 C;  1KD1 W;  5IDJ A;  3PJS K;  5IE9 A;  2A06 H;  3A2F A;  1RM1 B;  2ADQ B;  4FIP C;  1GH6 A;  3F5T A;  3TJT A;  5IYD O;  3CSX A;  1NT2 B;  1OCC B;  3HR0 A;  2CTW A;  3P3N A;  3JAW A;  2P4K A;  2RN9 A;  2OIE A;  4B3S B;  1PNL A;  1G1X B;  2DWD C;  1K5Q A;  2JGD B;  2O57 A;  4O4I A;  1B6Q A;  5IWA O;  5C93 A;  4K8Z A;  5CBG A;  2HR3 A;  4HYO A;  4ASU G;  3GVM A;  4GZR B;  3E89 A;  4L87 A;  2GTA A;  3B09 A;  1JOY A;  2A79 B;  4X20 B;  4I50 A;  2Q7E A;  4XDJ A;  4NKG B;  3T4D A;  4J9Z B;  3K3W A;  2GV9 A;  1MOF A;  4RQF A;  2X6B A;  5K1P A;  4MVO A;  3P3P A;  4X8A A;  3VQY A;  4FPP A;  1TVK A;  1VEW A;  4FLU A;  2Y4T A;  2E3C A;  2LJ2 A;  1F23 A;  1IXB A;  5LMU O;  2ZDI C;  3TCU A;  3P30 A;  3E8H A;  2V1D A;  1PM9 A;  2WLN A;  4FFK A;  1AB3 A;  4UUJ C;  2Z3Y A;  4HZ3 A;  2WAM A;  4YXW G;  1UFI A;  1NKD A;  2DQ0 A;  2FL4 A;  4MTG A;  4P2Z A;  5A9G A;  1Q8I A;  2QR4 A;  2DYR B;  4DV0 B;  3ASN C;  1GK9 A;  1PL4 A;  2UUB O;  4O4H A;  3BHP A;  4NTW A;  1N32 O;  4F4L A;  4J7Z A;  3A0H Z;  3H1J H;  2OCC B;  4ABM A;  3OM3 B;  1Q6U A;  3G6E V;  4GX1 A;  4MT8 A;  3SR2 C;  2B1I A;  1WAZ A;  2EZP A;  3AG3 B;  3ZCC A;  2GHY A;  1H2K A;  2JDI G;  3VBB A;  1X59 A;  4IYH A;  3OE7 G;  2HP8 A;  4K0K B;  3F7V C;  3ZHR A;  2ZM6 B;  1NJI W;  3D8C A;  5ITZ A;  4W4K A;  2Q67 A;  4J80 A;  2EIL C;  2MW2 B;  4LNU A;  3L71 H;  5IWA B;  4J41 A;  3RT3 C;  1J5E B;  4I55 B;  3ZRS A;  5BMV A;  3J80 N;  3CMA V;  3Q4H A;  4OPA A;  1N33 B;  1MZF A;  3I55 V;  1OJH A;  4EFB A;  3U11 A;  2P90 A;  4PA7 A;  1XNQ O;  1DTO A;  1BCC H;  4H0L B;  1WB8 A;  4LH7 A;  1GRJ A;  5KA5 A;  1AJP A;  4TT3 G;  2OT5 A;  3ABU A;  5KAF Z;  1AJQ A;  1U96 A;  1WA8 B;  3PN1 A;  2QSA A;  4BWA A;  3BFR A;  3JAW B;  5LHH A;  3ASO C;  4QIW F;  3E8G A;  1MAB G;  4I7Z B;  4TV8 B;  3QTC A;  4BIO A;  3ICX A;  1Q7Y W;  5J2U B;  2AXT Z;  1XMO O;  1VQ6 V;  3OD4 A;  1RP3 B;  2F43 G;  4R7C A;  4AQY O;  3JAM N;  5C8Y B;  4OXS A;  4JI0 B;  4ZOL A;  2PZS A;  3K57 A;  3J7A U;  4JYA B;  1KUQ A;  4GT1 A;  1KQS U;  5JQG B;  4YJ3 A;  5KUM A;  3WB0 A;  1J95 A;  5IYZ A;  1Z5V A;  3RVZ A;  2P67 A;  4CH5 A;  1NH2 B;  3AG4 C;  5KHK A;  4TV9 A;  5GTH Z;  4NVP A;  4MVR A;  5BY1 A;  3E22 B;  4P9O A;  3ZHS A;  4I4T B;  1KP3 A;  1YIJ V;  1K92 A;  4YJ2 A;  3GWO A;  4IGG A;  5JVD A;  4Z1V A;  5DM6 V;  3ZRX A;  5LHG A;  2BTQ A;  3QO5 A;  4XDK A;  3MDS A;  1AP5 A;  1L8D A;  4WF9 V;  3HKD B;  5CA0 A;  2L35 A;  1AVM A;  3ETQ A;  5KUK A;  3CCL V;  2ADP A;  1BSM A;  1BQZ A;  2ZIN A;  4ZI7 A;  1Y66 A;  3CJH A;  1IVS A;  4NYK A;  5H2F Z;  3OTF A;  4Z2W A;  4JI4 B;  1CEZ A;  2VQF O;  4DR1 B;  3BA8 A;  2PUS A;  2UXX A;  3LSU A;  2ARH A;  3H9V A;  1GM7 A;  3RBZ A;  4PD4 F;  4GKJ O;  2UUA B;  3AK1 A;  1VQK V;  1M4U A;  2EUL A;  3E35 A;  3CCE V;  3CYO A;  4PEL A;  1HNW O;  2Q8V A;  2W6I G;  5CA0 B;  2E74 B;  2JS5 A;  1SF9 A;  1BL8 A;  2ZD9 A;  2X6C A;  3VQW A;  1WA8 A;  1M56 C;  2IM9 A;  5K1X A;  3SPH A;  2X7R B;  1JCH A;  1YCI A;  4I4T A;  3HKE B;  2N04 A;  5GW7 A;  3W7U A;  2D2C B;  4GYC B;  1YIT V;  3LNM B;  4DW1 A;  1CPY A;  4IHJ A;  2X6A A;  1N36 B;  5LYJ B;  3G80 A;  5EBW C;  3SJQ C;  4JV5 O;  2ATK C;  1V9P A;  4DV4 B;  1I94 O;  3CCM V;  3E83 A;  4DV6 O;  3ZRW B;  4FLT A;  3S3X A;  2N05 A;  2JEX A;  5DN6 G;  1F7Y A;  3K06 A;  3K5L A;  1Y6X A;  1XBL A;  3ABK B;  3ZN1 A;  3TK1 A;  2UU9 O;  5BR8 B;  3K08 A;  3CXC U;  1LNQ A;  4RWU A;  2ZR2 A;  4IL6 Z;  2JS3 A;  4X62 O;  1R3J C;  1I0H A;  2P5O A;  5B3S B;  3G67 A;  4O2B B;  2QJ1 A;  4UCS A;  2P22 C;  1XMO B;  3ABT A;  1XEQ A;  3FYE B;  5B1N A;  2PI4 A;  3MHS C;  2CH7 A;  1RSO A;  3G6B A;  1GN4 A;  4J42 A;  4DUZ B;  1R3I C;  3SPI A;  5B5E Z;  1M57 C;  2WLJ A;  2ZXW C;  1DF5 A;  1G6U A;  1SZT A;  2ITD C;  2JJ1 G;  2BTQ B;  4CS2 A;  4PDR A;  3DTU B;  1AR4 A;  2YIB A;  1VQN V;  3SYP A;  1Y4M A;  1FKA O;  4DR4 O;  5FL7 G;  3K0G A;  2BE3 A;  1VF6 A;  2CTR A;  2FML A;  3HKC B;  1VQL V;  4G2K A;  3RVY A;  4WFG A;  3MHH C;  2IH1 C;  1E1R G;  1F4M A;  1ZX3 A;  4O4J A;  4UCO A;  5H6R A;  4DYL A;  4OX9 B;  1KC8 W;  1COW G;  1PKX A;  1VQ4 V;  2LW7 A;  5JWP A;  1H2G A;  1XUQ A;  3N2K B;  4HNA A;  2Y0P A;  4QPK A;  3KKY A;  3CME V;  3TXS A;  3RWR D;  3UCS C;  4NB5 A;  5GON B;  4N21 A;  2F95 B;  1JFF B;  2Y69 B;  4HAM A;  3RYH B;  1FJG O;  4CC6 A;  3K04 A;  1YTF D;  4BIU A;  3T1Y B;  5LGT A;  1VF7 A;  3X2Q C;  2E5L B;  1XHX A;  1VQO V;  2RDC A;  2RJZ A;  1Q6H A;  3O9O A;  4O2A B;  1THZ A;  1JVM A;  3CB2 A;  1V54 B;  1WN7 A;  1VQM V;  4PDL A;  4U7O A;  3E8B A;  2WLH A;  3OGI B;  4X1Y A;  4U3J A;  4E2L A;  1O9G A;  4F6R A;  1N4C A;  2M7W A;  3VOU A;  1KMI Z;  1JMK C;  1I7F A;  2EBO A;  1SRY A;  3JD3 A;  3H01 A;  1SS3 A;  1IBM O;  2HVJ C;  5HFL A;  4CZZ A;  2PYL A;  2EIN B;  3FYI B;  3FB7 C;  2YC0 A;  5L3G A;  3IJ4 A;  5LXT B;  1BHB A;  3HKB A;  3BCC H;  4JAV A;  1SC5 B;  4MW8 A;  4DV6 B;  2CE4 A;  3JAK B;  2R9R B;  2VRZ A;  3CPW U;  4TSF G;  2H94 A;  1XMQ B;  1EN6 A;  3BA9 A;  2RQ6 A;  4BAY A;  4B3R O;  4NR1 A;  1GMG A;  3KCX A;  4FM1 A;  4LFB B;  2AGA A;  3ZMU A;  1KYO F;  5AG2 A;  2HFE C;  2CGN A;  1Z2G A;  3A0R A;  2K9P A;  5LMN B;  4X9Q A;  4DK1 A;  3SYQ A;  5KHH A;  3CWB H;  2XAJ A;  1SQB H;  2ZQM A;  3IC9 A;  3ASN B;  1WP7 A;  3CC4 V;  1E79 G;  3GB7 C;  4HBN A;  1S76 D;  4WFB V;  3UKM A;  1JQ0 A;  1FFX A;  5B3S C;  4DV4 O;  5CB4 A;  3SYC A;  1SQP H;  1DF4 A;  3RYC A;  2QWR B;  4LF7 B;  3BPZ A;  2DJV A;  3JAR B;  3KZI Z;  2YI9 A;  3C90 A;  2QDO A;  3ZS8 C;  3TXQ A;  4OX9 O;  1B04 A;  2Q6A A;  4JI6 O;  4JPR A;  1NBM G;  1P4R A;  3K9S A;  3SPJ A;  4DR3 B;  4J10 A;  2WA4 A;  2EIK C;  4KXR A;  3SPC A;  4X20 A;  4RAI A;  1IBL O;  3I56 V;  2ZKO A;  2E75 B;  2WWW A;  1H2N A;  2UUC B;  2CAZ C;  1TUB A;  1IX9 A;  4TUY B;  1NTZ H;  4TWK A;  1OCO B;  3B8N A;  1OV9 A;  1K5S A;  3DXR B;  1R6N A;  2BOB C;  3B77 A;  2Q7H A;  4EFE A;  2XTA A;  2PTM A;  3OR7 C;  4H37 A;  1YXB A;  3VQX A;  4UCV A;  2KSD A;  4FFB A;  2ZE8 A;  1VIB A;  2ZNJ A;  3K5M A;  3UM7 A;  2EZO A;  2QWQ B;  3VQV A;  1JJ2 U;  2Q0O C;  1QLE B;  1GTO A;  3ETD A;  2W0F C;  4ZHQ B;  3WFV A;  3ZJZ A;  5D5Q A;  4O4J B;  2HJF C;  4DUY O;  1Y74 A;  1K7D A;  1M56 B;  1ENV A;  4UVA A;  2XAS A;  3JSN A;  1Y76 A;  4I9W A;  3THO A;  1GN2 A;  2UXD O;  1NZ6 A;  5KX5 A;  1PV0 A;  3OMN B;  1RM1 C;  3HKD A;  2XOK G;  2HEP A;  1M9N A;  1SES A;  2YDE A;  4BW9 A;  3APO A;  4WFH A;  5CBH A;  4PI0 A;  4UB8 Z;  3HKB B;  3QO7 A;  4TQF A;  3ZBH A;  1XOU A;  1B06 A;  4QE7 A;  3DC6 A;  4UVC A;  1WPB A;  2Z5U A;  4LP8 A;  4WBN B;  2JIZ G;  5H5N A;  2Q4P A;  2Q0A A;  4AIL C;  3ZHT A;  4I5S A;  3W7S A;  3EXA A;  4DV7 O;  2QKS A;  3CX5 F;  5LBQ A;  4JV5 B;  3CS5 A;  1G4Y B;  2FKX A;  3W7X A;  3T2M A;  4KUM A;  2DW4 A;  1BS3 A;  2ZM6 O;  1GN6 A;  1FFT B;  2YI8 A;  3M7M X;  2VQE O;  3BEH A;  5FPR A;  3WG7 C;  3JAT B;  3LUT B;  2UXB O;  3HKE A;  4LF5 O;  3SYA A;  5CA1 A;  2NR5 A;  4I50 B;  1NVP D;  4CS3 A;  1MSW D;  3OUF A;  4TV8 A;  3QG5 A;  2P6J A;  3ZRV A;  2F4V B;  2WPD G;  3CRM A;  2ZE5 A;  4LNU B;  1PNM A;  4OPH A;  2HJD A;  3AEI A;  4LF6 B;  1S5J A;  4QE9 A;  1TVK B;  2YXH A;  3UT5 A;  2YS8 A;  4JI3 O;  4AI8 A;  5GON A;  4X88 A;  4EEQ A;  2BSK A;  4LFB O;  1F4N A;  1F51 A;  1PP9 H;  1JA8 A;  2DYS C;  5EBL C;  5JJN B;  4GCZ A;  5IJ9 B;  1LUW A;  1H8E G;  1UPG A;  1QHT A;  5J2T A;  3IC7 A;  4ZIB A;  3OTO B;  1W2B U;  1LR1 A;  1QQC A;  3ABM C;  4DXW A;  3P32 A;  1N32 B;  2UUA O;  1TUE B;  2XAG A;  2KKW A;  2ZDI A;  1NH2 D;  4X1I A;  1QVG U;  2EX3 A;  4DR1 O;  3NR7 A;  4LR3 A;  2KQX A;  2WLI B;  3C3S A;  5DEC A;  5LP6 B;  4IYI A;  4JI1 O;  1AIL A;  2ODM A;  2LP7 A;  4IIJ B;  1SQF A;  1ORQ C;  3RYF A;  4XDL A;  2ZIM A;  5L3F A;  1YJW V;  1G8M A;  5LXT A;  3APQ A;  3E22 A;  2YID A;  4QJF B;  3FAV A;  4UXN A;  1S3J A;  4B3S O;  2Y69 C;  4GX0 A;  4G27 B;  4U3J B;  2YUA A;  1IBM B;  2Z0A A;  2WLL A;  1NVP B;  4E4E A;  1GM9 A;  1I5Y A;  4NXM O;  1ZTE A;  1DLB A;  1VP7 A;  2OIG A;  3ABL C;  4X89 A;  1D2D A;  1XRE A;  2UXD B;  3CP1 A;  1OCZ C;  2EIJ C;  1K3E A;  1HR0 O;  2ZNI A;  1HNZ O;  3HB3 B;  4DR7 O;  4KHP B;  4RQE A;  2H3O A;  2VWJ A;  1US6 A;  2AZ2 A;  2HKO A;  4JI0 O;  1XNR O;  5KMG B;  4DR2 O;  3B4S A;  2F23 A;  1B3Q A;  3ZHV A;  3RGB A;  3RYC B;  1T5E A;  3ABL B;  1TGO A;  1GM8 A;  4RUE A;  2EIN C;  1V55 B;  2HG5 C;  3N2K A;  1VQP V;  5CA3 A;  3AK3 A;  2UXN A;  3Q4H B;  5EYP A;  2XND G;  1IBK O;  1EFR G;  2A0L A;  4FZ0 A;  4JI8 B;  4DR7 B;  2L6L A;  4LH6 A;  3B8M A;  3LNN A;  1BGY H;  3JYC A;  2VS0 A;  1VQ7 V;  4PA3 A;  2LFR A;  1XNQ B;  1HNX B;  2YSU B;  2JVD A;  2AW9 A;  1QVF U;  4H44 B;  1IBL B;  4W4L A;  5JVD B;  3RYF B;  1AI4 A;  2B5U A;  1J5E O;  4A5U B;  4FMT A;  4DR2 B;  3E86 A;  4JAS A;  4D7S A;  5L3D A;  1XDC A;  5KX5 B;  1YHQ V;  4Q6G A;  4YY3 O;  2FYU H;  2XAF A;  5LMN O;  4UCR A;  3UQ8 A;  5BXZ A;  5LGN A;  2V7Q G;  4OGQ B;  4B3T O;  1FD9 A;  3A0B Z;  4UV9 A;  4LF9 O;  2F93 B;  4JAA A;  4CH6 A;  1NS1 A;  3ETG A;  4UFZ A;  1R3K C;  4UV8 A;  5EC2 C;  4JZG A;  1Y76 B;  4X66 O;  4CH3 A;  4GKK O;  4BW5 A;  3W7T A;  3DC5 A;  2UUB B;  4X66 B;  4FM0 A;  5J2U A;  3FFQ A;  4UCT A;  2DYR C;  3K0D A;  1V54 C;  4TUY A;  4PDM A;  5HFM A;  2AHZ A;  1X4T A;  3RYI B;  4O2A A;  4K3A A;  2E76 B;  2CTP A;  3AG1 B;  4F6E A;  3F5W C;  2PY5 A;  5IYB O;  2PI5 A;  1FFX B;  3EHB B;  2ITC C;  5CA1 B;  5J2T B;  5JJE B;  3AG2 C;  4CBC A;  5IJ9 A;  1SZX A;  1ZUQ A;  4WFE A;  2P7T C;  2YXL A;  4LFC O;  4FM2 A;  5JQG A;  4GKK B;  4QPJ A;  2IW5 A;  1FJG B;  4UVB A;  1W59 A;  5C8Y A;  3CC7 V;  4JYC A;  3L73 H;  4IIJ A;  2ZIO A;  3CCR V;  3SGI A;  1H38 A;  3CEI A;  3LDD A;  3ZX6 A;  4DV5 O;  4B7E A;  2IBZ H;  1L0N H;  4KL1 A;  2QWP B;  3G4S V;  2X0L A;  4X65 O;  3E2E A;  3OR6 C;  1IZ3 A;  4X1K A;  4NTX A;  2QM7 A;  5FPO A;  2C2A A;  4LFA B;  1WPX A;  4DV7 B;  3C3T A;  4LWS A;  5J9P C;  4MTF A;  1QLE C;  5KHI A;  1YJ9 V;  4ZI7 B;  5EZY A;  2A7W A;  4GKJ B;  3JSL A;  1R73 A;  1ZAU A;  4UB6 Z;  3JD4 A;  2UXB B;  2W6J G;  1YSC A;  3ZHU A;  2CUG A;  1WB7 A;  4ZHQ A;  1SA0 B;  4LF8 B;  5B1B B;  3JAL B;  1MG1 A;  4LBE C;  2VWK A;  4X1K B;  3H1H H;  3SPG A;  3CRC A;  4RO2 A;  1H2L A;  4MVQ A;  1Q90 D;  4MVM A;  1OCZ B;  2EIJ B;  3A8T A;  2EJR A;  4K8X A;  4YIP A;  1RPR A;  5EZY B;  5B1A B;  2PGG A;  1Z5W A;  3UO3 A;  1YDX A;  4TV9 B;  1FXV A;  3DGE A;  1VQ9 V;  5JCO C;  2MK3 A;  1K97 A;  4MS2 A;  1JX9 A;  4D6T H;  5LOV A;  2QM4 A;  3OEH G;  4EKW A;  3ZED A;  2UU9 B;  4PDV A;  4H13 B;  3OW2 U;  3T1H O;  3WG7 B;  2HHH B;  3OGC C;  5JCO A;  3AG3 C;  3CCV V;  2N74 A;  1QU7 A;  5FNV B;  3M99 B;  3FB8 C;  3J81 N;  2OCH A;  4DR6 B;  1AI7 A;  1K34 A;  3RYH A;  4J7K A;  1JFF A;  1IDS A;  3UT5 B;  1N33 O;  4JYY A;  3BAA A;  1VQ8 V;  4X62 B;  2LGQ A;  2ETN A;  4WCE V;  3K5N A;  1MZE A;  4DV2 O;  2BCC H;  1R1B A;  4JAU A;  2QTS A;  4NXN O;  3OMI B;  1FXK C;  1K9M W;  1N36 O;  4U7N A;  2Q68 A;  3LDE A;  4JI1 B;  1H2S B;  1OCO C;  4FJC C;  3AG7 A;  4ICG A;  4B3M B;  1L1F A;  4I55 A;  4JI2 O;  2OTJ V;  4TOI A;  2DMX A;  1QR8 A;  3BAB A;  1AR5 A;  4JI7 O;  5CN0 A;  4LF6 O;  1GAX A;  1FXK A;  2UXC B;  1U97 A;  2QM8 A;  3ZHQ A;  3RN4 A;  1XHZ A;  4BR6 A;  1HNW B;  1VF5 B;  3OTO O;  1SQV H;  1I94 B;  1K33 A;  1N34 O;  1KKC A;  2YEV B;  2WLI A;  3RYI A;  4DR3 O;  3OMA B;  4B08 A;  5EIB C;  5LP6 A;  1UJW B;  3MAQ A;  4LFC B;  2VQE B;  4JI6 B;  1PL0 A;  3JAK A;  3K79 A;  1R6T A;  2VQF B;  3K9A A;  3KCY A;  3HPL C;  1KU9 A;  4QGP A;  5IYZ B;  3U0Z A;  2QWO B;  3QVN A;  5KHJ A;  3JCZ A;  4JGS A;  1KBH A;  1YEW A;  2R9A A;  4FLX A;  2F66 C;  1Q86 W;  1FYJ A;  1KKD A;  3AG4 B;  1ZL8 B;  3JCU Z;  3D3Q A;  4L8J A;  2UXC O;  3CCQ V;  2KG7 B;  2NLJ C;  5EYP B;  1WJZ A;  2NNU A;  2QGN A;  2QKA A;  3OFN G;  2R70 A;  3T1H B;  3H1L H;  4D7T A;  1E1Q G;  4BIZ A;  3N2G B;  5IY5 B;  2DYS B;  2OYQ A;  4B3R B;  4LF9 B;  1FS0 G;  1MSD A;  1M90 W;  4YHH B;  2JJ2 G;  4PV1 B;  3UO2 A;  2QEX V;  4EB6 B;  1A32 A;  4Q20 A;  2HLD G;  4P30 A;  1P49 A;  3SYO A;  4JYA O;  5BMV B;  1JJO A;  1CP9 A;  3JAT A;  2ZXW B;  3K03 A;  3BVO A;  4DR6 O;  5B1O A;  1K73 W;  4EB6 A;  5L3B A;  2WLL B;  3CRQ A;  4PA9 A;  1URF A;  2BTO A;  5IT9 N;  2Q5Z A;  3T1C A;  1XQ8 A;  4AHC A;  1PD3 A;  1NI8 A;  1YJN V;  3N2G A;  2IJK A;  1GN3 A;  1XIL A;  1QCE A;  3R65 A;  4LF4 O;  4I0X B;  1IXM A;  3OUS A;  2LO1 A;  3SJB C;  4DV3 B;  1RFY A;  2QE7 G;  1GO3 F;  1R3L C;  1D5N A;  3IGA C;  1AP6 A;  1W0J G;  2IU0 A;  4K35 A;  4JYB A;  1VF6 C;  1TAE A;  5JJJ B;  1I5X A;  4PA6 A;  4YY3 B;  1SET A;  3RFR A;  5H9C A;  1EM1 A;  4AQY B;  3CC2 V;  1OCR B;  1M57 B;  3CJH B;  2CH7 B;  2RMK B;  3L72 H;  4O4L B;  2GDS A;  1ZL8 A;  5EC1 C;  5TIS Z;  1KEC A;  2KG7 A;  1BHA A;  4YIO A;  4X1I B;  1HNX O;  1KB9 F;  3LSQ A;  4K0K O;  3E8F A; 
#chains in the Genus database with same CATH homology
 3ZRW A;  5LGU A;  2QA4 V;  5EK0 A;  4QNH B;  1VQ4 V;  1H2G A;  5LHI A;  2IJJ A;  3B8M A;  3JD0 A;  4QPK A;  3ZMZ A;  3CME V;  3MD0 A;  1FXH A;  5IY5 C;  3JYC A;  1KD1 W;  1VQ7 V;  4PA3 A;  5IDJ A;  1AI6 A;  2LFR A;  3PJS K;  4WFA V;  1RM1 B;  2YSU B;  4FIP C;  4N21 A;  2Y69 B;  5IYD O;  4HAM A;  1QVF U;  1OCC B;  1PNK A;  3K04 A;  1AI4 A;  1YTF D;  1AJN A;  2B5U A;  4BIU A;  5LGT A;  1PNL A;  3X2Q C;  2DWD C;  1K5Q A;  1VQO V;  3STL C;  1B6Q A;  5C93 A;  4FMT A;  5CBG A;  3E86 A;  4JAS A;  5L3D A;  1THZ A;  3ZIA G;  1YHQ V;  1JVM A;  2HR3 A;  2XAF A;  4HYO A;  4ASU G;  2R9I A;  1V54 B;  5LGN A;  2K1E A;  3E89 A;  4L87 A;  4PDL A;  1VQM V;  2V7Q G;  4U7O A;  3E8B A;  2WLH A;  2IJH A;  4G28 B;  4E2L A;  3FKS G;  2M7W A;  1JOY A;  4UV9 A;  3VOU A;  2A79 B;  1SER A;  4XBF A;  2EBO A;  1FXK B;  1SRY A;  4XDJ A;  3JD3 A;  3H01 A;  3FB6 C;  3ETG A;  3T4D A;  3CCS V;  4J9Z B;  3K3W A;  1RPO A;  1MOF A;  1R3K C;  2HVJ C;  3ML0 A;  4RQF A;  5HFL A;  2Y48 A;  2X6B A;  4UV8 A;  4CZZ A;  2QTO A;  2EIN B;  4KP4 A;  4MVO A;  1ROP A;  5EC2 C;  2EIM B;  1R6K A;  3CCJ V;  3FYI B;  3FB7 C;  5L3G A;  4X8A A;  4P9P A;  4BW5 A;  3W7T A;  1BHB A;  4FPP A;  4R50 A;  2XAQ A;  4JAV A;  1F23 A;  4MW8 A;  3AG1 C;  2ZDI C;  5HFM A;  2DYR C;  3K0D A;  1V54 C;  4PDM A;  3TCU A;  3P30 A;  2AHZ A;  3E8H A;  3ZMS A;  2R9R B;  2V1D A;  1V55 C;  2WLN A;  3CPW U;  4TSF G;  4UUJ C;  2H94 A;  3AG1 B;  3D36 A;  3F5W C;  5H6Q A;  4BAY A;  2Z3Y A;  5IYB O;  4HZ3 A;  2PI5 A;  1GMG A;  3EHB B;  2WAM A;  2ZR3 A;  3TET A;  2ITC C;  4YXW G;  2WSS G;  3AG2 C;  1NKD A;  3ZMU A;  4CBC A;  2DQ0 A;  2HFE C;  4MTG A;  4WFE A;  3A0R A;  4MSW C;  4P2Z A;  1EZJ A;  2P7T C;  2DYR B;  3ASN C;  1K4C C;  1GK9 A;  3SYQ A;  4MW3 A;  2XAJ A;  3QNE A;  3OEE G;  4F4L A;  4QPJ A;  2IW5 A;  2ZQM A;  2OCC B;  3OM3 B;  3ASN B;  3CC4 V;  1E79 G;  3GB7 C;  3G6E V;  4UVB A;  1S76 D;  4WFB V;  3UKM A;  3CC7 V;  2H8P C;  1JQ0 A;  4GX1 A;  5B3S C;  1NR7 A;  4DO2 A;  4JYC A;  4MT8 A;  2B1I A;  3SYC A;  2EZP A;  5CBF A;  2OTL V;  3AG3 B;  3LDC A;  1DF4 A;  3ZCC A;  1Q82 W;  2DWE C;  2GHY A;  2A9H A;  3VBB A;  2JDI G;  3CCR V;  5EBM C;  1H38 A;  3LDD A;  3OE7 G;  2XAH A;  3F7V C;  1NJI W;  2WLK A;  2LFS A;  3G4S V;  4N23 A;  2Q67 A;  2Q6A A;  4JPR A;  3ZMV A;  2EIL C;  2X0L A;  3E2E A;  3OR6 C;  1NBM G;  1P4R A;  2QM7 A;  2C2A A;  3SPJ A;  3W7W A;  1WPX A;  4JTA B;  2EIK C;  3ZRS A;  3SPC A;  3CMA V;  3LSQ A;  4RAI A;  2OCC C;  1AR1 B;  5J9P C;  1HWY A;  3I55 V;  4MTF A;  1QLE C;  3I56 V;  2P90 A;  3NXS A;  2WWW A;  3EFF K;  1YJ9 V;  4PA7 A;  3D3I A;  1ARO P;  1DTO A;  1H8H G;  1R73 A;  3JD4 A;  2W6J G;  1NQT A;  1YSC A;  2IH3 C;  4TWK A;  3KG2 A;  5KA5 A;  1OCO B;  3B8N A;  1K5S A;  1AJP A;  1R6N A;  4TT3 G;  2BOB C;  2OT5 A;  3B77 A;  3ABU A;  2EIK B;  3BY6 A;  1AJQ A;  2GSM B;  1XL4 A;  5B1B B;  3OR7 C;  5LHH A;  1MG1 A;  4LBE C;  3ASO C;  4QIW F;  2B1G A;  4H37 A;  3E8G A;  1N8R W;  2DQ3 A;  4JTC B;  1MAB G;  4ZBM A;  4H33 A;  3SPG A;  1Q7Y W;  1K4D C;  4RO2 A;  4MVQ A;  1VQ6 V;  3ASO B;  3UM7 A;  4MVM A;  2F43 G;  4R7C A;  1OCZ B;  2EIJ B;  2EJR A;  2EZO A;  5BZB A;  1JJ2 U;  1W0K G;  4OXS A;  3ZN0 A;  2JEU A;  1QLE B;  1GTO A;  3ETD A;  1RPR A;  5B1A B;  2W0F C;  3WFV A;  3ZJZ A;  4GT1 A;  2HJF C;  1KQS U;  2CK3 G;  1FXV A;  3DGE A;  1K7D A;  1M56 B;  1ENV A;  5KUM A;  1VQ9 V;  1QLN A;  1J95 A;  4UVA A;  2XAS A;  2MK3 A;  4I9W A;  1K97 A;  1NR1 A;  3RVZ A;  2P67 A;  4MS2 A;  4KFM A;  1JX9 A;  3OMN B;  1RM1 C;  1NH2 B;  2XOK G;  3AG4 C;  5B1B C;  1M9N A;  3OEH G;  4EKW A;  1SES A;  4PDV A;  5CMU A;  4WFH A;  3OW2 U;  4MVR A;  5CBH A;  4JTD B;  4P9O A;  4MTO A;  5L3E A;  1KP3 A;  1YIJ V;  1K92 A;  3QO7 A;  3GWO A;  3WG7 B;  3OGC C;  3AG3 C;  5IYC O;  3CCV V;  1Q81 W;  5DM6 V;  2EIL B;  3ZRX A;  4QE7 A;  3M99 B;  3FB8 C;  4UVC A;  2Z5U A;  4LP8 A;  5LHG A;  1AI7 A;  2JIZ G;  3QO5 A;  1K34 A;  4XDK A;  4MVZ A;  2AHY A;  4WF9 V;  1S5H C;  4I5S A;  3W7S A;  1VQ8 V;  2QKS A;  4WCE V;  5KUK A;  5LBQ A;  4R8C A;  3CCL V;  1G4Y B;  4JAU A;  1AI5 A;  3OMI B;  1FXK C;  1K9M W;  3ZMT A;  4GX2 A;  4U7N A;  3W7X A;  1Y66 A;  2Q68 A;  3LDE A;  3JD2 A;  2DW4 A;  4KUM A;  3T2M A;  1GKF A;  3JD1 A;  1OCO C;  3IFX A;  3CCU V;  1CEZ A;  1FFT B;  4FJC C;  1OHH G;  2UXX A;  1L1F A;  2OTJ V;  3BEH A;  1QR8 A;  3WG7 C;  1VQ5 V;  3LUT B;  5CN0 A;  1GM7 A;  3RBZ A;  3SYA A;  1NVP D;  1FXK A;  1VQK V;  1MSW D;  3OUF A;  3E35 A;  3CCE V;  3CYO A;  2QM8 A;  2P6J A;  4PEL A;  3ZRV A;  5KA6 A;  2W6I G;  2WPD G;  4GX5 A;  1PNM A;  1BL8 A;  1XL6 A;  1K33 A;  3AEI A;  1YTF B;  2YEV B;  2WLI A;  1ZWI C;  2ZD9 A;  1S72 V;  1QR9 A;  2X6C A;  3OMA B;  4QE9 A;  1UJW B;  1M56 C;  4J9Y B;  1PL0 A;  3K79 A;  1K8A W;  3K9A A;  3STZ C;  4X88 A;  3SPH A;  2X7R B;  2YEV A;  1JCH A;  3ABM B;  3HPL C;  4RUF A;  5GW7 A;  3W7U A;  1YIT V;  3LNM B;  1F4N A;  1F51 A;  1CPY A;  2X6A A;  2DYS C;  3JCZ A;  5EBL C;  4JGS A;  2IU3 A;  5EBW C;  3SJQ C;  4ZKI A;  1OCC C;  4GCZ A;  2ATK C;  1H8E G;  2WLM A;  1YI2 V;  3IC7 A;  3CCM V;  1Q86 W;  1KKD A;  1W2B U;  1OZ0 A;  4MTX A;  3E83 A;  4R6Z A;  3AG4 B;  2IJI A;  3F7Y C;  1M1K W;  3ABM C;  4DXW A;  3P32 A;  3ZRW B;  4JF3 A;  3CCQ V;  3ABK C;  2HVK C;  1TUE B;  2XAG A;  2ZDI A;  2NLJ C;  1NH2 D;  2JEX A;  5DN6 G;  2BOC C;  4MVU A;  3RW0 A;  1QVG U;  2NNU A;  3OFN G;  3K06 A;  3ABK B;  3ZN1 A;  3TK1 A;  2WLI B;  1E1Q G;  4BIZ A;  3K08 A;  1EBO A;  3CXC U;  1LNQ A;  5IY5 B;  2DYS B;  2LP7 A;  1FS0 G;  3G71 V;  2ZR2 A;  2JK5 C;  1ORQ C;  1M90 W;  2JJ2 G;  4XDL A;  5L3F A;  4FK5 C;  2QEX V;  1YJW V;  1G8M A;  4Q20 A;  2HLD G;  1BMF G;  1R3J C;  4P30 A;  3SYO A;  4MVS A;  5B1A C;  5B3S B;  3OAA G;  1CP9 A;  1WLE A;  2ZXW B;  3K03 A;  3X2Q B;  3T4Z A;  4QJF B;  5B1O A;  1K73 W;  4UXN A;  2EIM C;  3QO8 A;  1S3J A;  1OCR C;  2WLL B;  4Z1M G;  3ABT A;  1QBZ A;  5L3B A;  3FB5 C;  4PA9 A;  3FYE B;  5B1N A;  2Y69 C;  2D3O W;  4GX0 A;  3T1C A;  4G27 B;  2PI4 A;  3MHS C;  4PA4 A;  1PD3 A;  4WFF A;  1YJN V;  2IJK A;  2WLL A;  1NVP B;  2FTK A;  1GM9 A;  1QCE A;  1R3I C;  1I5Y A;  2Q69 A;  3AG2 B;  3R65 A;  3SPI A;  1DLB A;  3ETE A;  3ABL C;  1M57 C;  2WLJ A;  4X89 A;  1IXM A;  2ZXW C;  3OUS A;  1DF5 A;  1SZT A;  2QE7 G;  3CD6 V;  3CP1 A;  1GO3 F;  2ITD C;  2JJ1 G;  1R3L C;  1OCZ C;  2EIJ C;  1K3E A;  5E1A C;  3IGA C;  1W0J G;  3HB3 B;  2IU0 A;  1P7B A;  4PDR A;  3DTU B;  4RQE A;  4JYB A;  5L3C A;  2HKO A;  1I5X A;  1VQN V;  3SYP A;  4PA6 A;  1SET A;  1Y4M A;  5FL7 G;  3K0G A;  5H9C A;  4LC1 A;  2KB1 A;  3CC2 V;  1OCR B;  3LSS A;  3ABL B;  1M57 B;  1JPX A;  1VQL V;  4G2K A;  1GM8 A;  3RVY A;  4WFG A;  3MHH C;  4RUE A;  1KP2 A;  2IH1 C;  1E1R G;  1F4M A;  5EC1 C;  2EIN C;  1V55 B;  2HG5 C;  1VQP V;  5CA3 A;  2UXN A;  1KEC A;  1BHA A;  1S0V A;  4LCU C;  5H6R A;  2XND G;  1KC8 W;  1COW G;  1S77 D;  1PKX A;  1EFR G;  2A0L A;  3E8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...