3CCEV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cceV00
2QEXV 1VQOV 1M90W 3CC2V 3CMEV 1Q82W 3I55V 1KQSU 3CCVV 1M1KW 1VQ4V 4WCEV 1VQ5V 1N8RW 1VQ7V 3CMAV 1Q7YW 3CPWU 3CCJV 3CCRV 4WFBV 1YJ9V 1VQ8V 1Q86W 1KD1W 1VQ9V 1VQLV 1S72V 4WFAV 3G71V 5DM6V 3CC4V 1K8AW 1K73W 1Q81W 1NJIW 3G6EV 2OTLV 3OW2U 2OTJV 3I56V 3CCSV 1YJWV 4WF9V 3CCLV 1QVFU 1YITV 3CCQV 1QVGU 1YJNV 3CCEV 1W2BU 3CCUV 1KC8W 1VQ6V 1VQNV 1VQKV 1YHQV 1YI2V 1YIJV 3CD6V 1VQPV 3CCMV 1JJ2U 1R73A 2D3OW 1VQMV 3CXCU 3CC7V 3G4SV 1K9MW 2QA4V
chains in the Genus database with same CATH superfamily
3E22A 5JQGB 2X6AA 2ZNIA 4F6RA 2ZE7A 5JCOA 2QKCA 2P4KA 3Q4HA 3ZHQA 4UXNA 1WN7A 3N27A 1V54B 3ZMVA 4N23A 4BR6A 5FPRA 1MA1A 4JI8O 3MHSC 1NZ6A 2OIEA 4LF9O 4MS2A 3H1JH 2CH7A 2X6CA 3D3QA 2XTAA 2A9HA 4KP4A 4WFFA 3JARB 5LBQA 2ADQB 4UVAA 1GM7A 1NKDA 1Q3EA 2IJKA 1N36O 3CMAV 3AG1C 4YJ2A 1Q86W 2XAJA 5CN0A 1BE3H 1URFA 4K0KO 1AI4A 2HR3A 1EN5A 2XOKG 1HR0O 1ZTEA 4LR3A 1KQSU 2R70A 4J7ZA 4LFBO 2AGAA 2WLMA 3ZIAG 5LL6Y 4DR1B 2V1DA 4WFHA 1AR5A 3AK3A 5IWAB 4JV5B 1GK9A 4MVUA 4CS2A 2B9ZA 1M57B 2GDSA 4Q20A 5CA0A 4JI7B 3N2KA 5EIBD 4LH6A 3L75H 1Q6HA 5IY5C 1Q5OA 1T5EA 1DTOA 3JYCA 4NKGB 3UO3A 1I94O 5JJEB 2DMXA 4WBNA 3LDDA 2JGDB 4JI0O 1OCCC 1F7YA 5IYDO 5J2TB 1QVFU 2IM9A 3QNEA 2QWOB 5J2UA 3AG7A 4DR5O 5KUKA 3W7TA 5H6RA 1IBMB 2EIJC 1WP8A 2P5OA 4FM0A 2P7TC 1PD3A 2JEUA 3OTOO 4JF3A 1GN4A 2IW5A 3ZHVA 1XNQB 3J7AU 2R9AA 4BIUA 3HKBA 3T1YO 4OGQB 2BTQB 3SJQC 5D5QA 3JASB 1U97A 5BXZA 5LYJB 3DTUB 1GH6A 1XILA 3RYCA 1K97A 4GKJO 1P84F 3G71V 3E8HA 4X62O 3E86A 2JS5A 1D2DA 1M4UA 1Q6IA 5EIBC 4O4HA 1XBLA 1GM9A 2ILMA 3BHPA 3APOA 4DV7B 3VQVA 1LUVA 2P06A 3OAAG 1KKDA 4NXNB 4AI8A 1MABG 3JD2A 2C2AA 2EZOA 3O9OA 4LF4O 5L3CA 2V4DA 3CCUV 3VBBA 1QQCA 3OD4A 3JAWA 4PA3A 4HZ3A 1KBHA 2QKSA 2UXDO 2LQTA 1GN3A 2EILB 1VP7A 1PP9H 4W4LA 2Y0PA 2JDIG 2YC0A 2QM4A 2EIKC 3IFXA 3FYEB 2CH7B 3TXSA 4UV8A 4GUNA 3KCXA 1Y74B 4F6EA 3QO8A 4DR7B 3OUSA 2W0FC 4PI2A 3CC7V 1VQOV 4P9PA 1L1FA 4R7CA 4QGPA 4DR1O 1Y67A 1N34B 3ABKC 5LXTA 2N05A 4HBNA 1M56C 4FLVA 1YTFD 2IJJA 2B1GA 3ZHSA 1R3IC 3RYFA 3SYAA 5LMNO 3T2MA 4MVZA 1OCOB 3EFFK 4HNAB 4JYCA 1RP3B 3CPWU 2AZ2A 1VF6C 4PDRA 2IU3A 1B04A 3AK1A 1DLBA 3MAQA 3X2QC 2Z0AA 4EB6A 2P6JA 4D6TH 2QM7A 5LGTA 1F51A 5CA0B 3CCEV 3N2KB 1IBMO 3TK1A 1GKFA 1E1RG 2XNDG 1JCHA 1KECA 3ABMC 5L3FA 2R72A 4PJ0Z 4FLWA 1DK1A 1OHHG 4DRXA 5B3SB 1XNQO 3LSUA 1FXKA 2VS0A 3ABUA 5KAIZ 1R3KC 4WBNB 5HFLA 4HYOA 5EK0A 1BSMA 1V9PA 4O4IA 1M93A 2E3CA 1UPGA 4JI1B 5J2UB 1IBLB 5AG2A 4I9WA 4XDLA 2Q4PA 1I08A 4JYYA 3OMIB 2ATKC 1Z5VA 4LFAB 5H6QA 4X1IA 4DXWA 1H2SB 1KP2A 3FKSG 3BFRA 1FFTB 3OGIB 1Q81W 3HKBB 1PNLA 2NR5A 3N2GA 2KB1A 2RCVA 2VWJA 4BIZA 3EXAA 4X1YA 3UKMA 3SPCA 4WFEA 1QLNA 4NXNO 3ETEA 3RYCB 1HDJA 1FS0G 4FVMA 2PTMA 1SA0A 3L71H 1NTKH 5JVDB 1BS3A 2E74B 3E89A 4IHJA 2H3OA 3FB8C 1O9HA 3SYQA 2EIMB 4LF8B 1YZBA 3JD1A 4QPJA 5BY1A 1I5XA 3AG4C 1S76D 4DYLA 2BSKB 1PM9A 3F7YC 5KUMA 2PI4A 1NS1A 2YSUB 2DOSA 4I4TA 1B3QA 4RUEA 4O4LB 1XNRO 2CTQA 4LWSA 2UUAB 3B09A 4NTYA 2FB5A 3CCQV 3F7VC 2E5LB 3A0HZ 4G28B 5KHGA 1Q82W 1QLEB 5IDJA 3CCJV 3W7XA 3WG7B 1HP8A 3K06A 2ZKOA 1OCZB 3G67A 3DGEA 1TVKB 3ZRXA 4LF6O 1VQNV 5CMUA 1SQQH 3ZN0A 2P67A 2ZDIC 1GM8A 3QG5A 1LUWA 4KHPB 4DV4O 1G8MA 3AG3B 1XREA 2EINB 2BOBC 4J42A 1AR4A 3BY6A 5L3GA 3RYFB 3GWKC 4FZ0A 1MSWD 2BCCH 2ZD9A 4X66B 3D36A 5KHKA 2GUZA 2Q68A 1H2LA 3GVMA 2V7QG 4JI8B 3K5MA 2XAFA 1YJ9V 1IBLO 4J7JA 3KZIZ 1QR9A 2R9RB 4WFAV 1TAEA 5CBGA 4EB6B 1F4MA 3RT3C 1TGOA 1Y6XA 4J11A 1IBKB 3FB6C 1ZL8A 3PJSK 1AVMA 1YJNV 2WLIA 3OMAB 4PA9A 4FLZA 4K0KB 2KG7A 2F66C 4PA6A 5CA3A 4DRXB 2CTPA 3SYPA 1FXKB 1S3JA 2YI8A 4PI0A 1JX9A 4JGSA 1NJIW 4H13B 1RSOA 2HLDG 1E79G 1MZFA 3IJ4A 2A7WA 3B8NA 2JGDA 2PY5A 1GRJA 1YITV 1SQGA 4MTOA 1VQ6V 4FMTA 3CEIA 4O2AA 1AJNA 2ITCC 2YXYA 3UM7A 1W59A 5BMVB 1SKVA 1NH2B 3E8BA 4FPPA 1NVPD 3K9AA 4JI6B 2DYSC 3H01A 1RPRA 2BE3A 2Z5UA 4FFBB 2JJ2G 4TUYA 1QVGU 4B3TB 3ICXA 4X1YB 1XMQB 3CHXA 4DR2B 4JI2O 5H9CA 4E4EA 4EFBA 5EC1C 1SA0B 5DEDA 2BTQA 1Y76A 1SQBH 1KP3A 4DR5B 3JASA 4IHJB 4DR6B 2UXBO 5LYJA 1ZSPA 3U10A 3AG1B 4ICGA 3A0RA 4EFEA 1H2NA 1KMIZ 4JASA 3FD9A 4KL1A 3NR7A 1MZEA 3H1IH 2WLKA 5JJNB 1AROP 3DXRA 4QE7A 2Q67A 4UFZA 5B1AB 1NT2B 3T1YB 1AJQA 4QJFB 5CA1A 2E76B 2Q5ZA 2JEXA 4LWSB 4WF9V 3F5WC 4GKJB 1OV9A 2WA4A 2XUMA 4RQFA 4FLXA 2ZR3A 3P3NA 4JYAB 2G38A 1K3EA 3HKDB 3BRCA 3JD3A 2NNUA 1JR9A 5LHGA 2ODMA 3K03A 3SPIA 3CRAA 2Y48A 1VF5B 4R8CA 5LP6C 4X66O 3BCCH 5EBMC 2EJ7A 3LDCA 5HFMA 3UT5A 1ZLZA 3MDSA 4Z1VA 3DC5A 5IE9A 3RW0A 2FYUH 4CC6A 1SQVH 5CBFA 3IGAC 1Y74A 4LF4B 3QTCA 2UU9B 1QU7A 4PA7A 1M1KW 1P7GA 5LGNA 1IBKO 1Q7YW 4N21A 3OM3B 2UXNA 3E8FA 1GMGA 4JTCB 2UXDB 2EIJB 1O9GA 3MD0A 1F23A 3ASOC 2WAMA 2GUZB 3K79A 4GZRB 1S77D 1R6KA 1ZX3A 4MW3A 3K08A 1YVWA 1NR7A 5H2FZ 1HNXO 2IJIA 3ZMUA 1S72V 4HNAA 3L73H 2H8PC 1YXBA 1ZL8B 4UCSA 2O57A 4J7KA 3OEHG 3ZCCA 1EN4A 5BR8B 2WLIB 2KG7B 5KA5A 4LP8A 3K5OA 3ASNC 1BQ0A 3APQA 3CE2A 4JI6O 5LMNB 4LCUC 1S5LZ 2NLJC 2ZCEA 1RSOB 4B3TO 3ZBHA 1XMQO 1K8AW 2OCHA 4DR2O 3L74H 2F93B 3WU2Z 1KC8W 4O2AB 5E79Z 1L0NH 4DR6O 2QEXV 4X1KA 3CYOA 4LNUA 3CCVV 1V54C 1MOFA 2DN9A 4X64O 3HKCB 2EZPA 5L3BA 2ETNA 2RDCA 2GSMB 4TQDA 4NTWA 4AILC 4RWUA 4TUYB 4UV9A 3K0GA 4X88A 1W0KG 2FKXA 1R73A 3OUFA 3OR6C 2PZSA 4PDMA 1IZ3A 1Y76B 2ZE5A 1K7DA 5EBWC 2RN9A 5KAFZ 3RYIB 1SF9A 3TGUH 3IAYA 2ZM6O 5KMGA 2X0LA 3ABKB 1NI8A 2UXXA 3L70H 5JVDA 4LF5O 1MMMA 4B3MB 4JYAO 1M56B 2JK5C 4X20B 1EN6A 4NB5A 2WLNA 4ZHQA 3DXRB 5TISZ 1G4YB 2PI5A 4J80A 4ZOLA 5IT9N 4CS3A 5CA1B 2UUCB 2BSKA 4FFKA 5B1BB 3JATB 1FJGO 1NTZH 1M57C 2DW4A 4K3AA 1XOUA 2VQEO 1NR1A 1SRYA 4O4LA 2CDYA 2UU9O 3X2QB 3VQXA 5JH7B 2IH3C 3ZHTA 2ZT9B 3J80N 1FXVA 4DV2O 3ABMB 5LA6A 4JI5O 1XQ8A 1CEZA 3JCUZ 3JD4A 1VQLV 3IC7A 1WLEA 3RGBA 3G6EV 4DV5B 1V55B 3UT5B 4JAUA 3SPJA 4DW0A 4DV0B 4GCZA 3ZS8C 3ZN1A 2D2CB 3RVYA 2X7RB 4DO2A 3CP1A 1TVKA 1XNRB 3E2EA 4IGGA 4W4KA 2AZ0A 2YXHA 2RNBA 1TA8A 2LO1A 2H94A 5BR8O 2BTOA 5LHIA 1PNMA 4K35A 2AHZA 1HNWB 3ML0A 1KB9F 4CS4A 1YTFB 4X8AA 4P9OA 3QO7A 1H38A 5D5PA 1VQPV 1BHAA 1M9NA 2YEVB 4JPRA 4QPKA 1KKCA 4LF6B 1N33O 5DN6G 2YDEA 1N32O 2QWPB 2OIGA 2M7WA 1OJHA 4J10A 4I55B 3CXHF 3P30A 2YIBA 2CGOA 1OCRB 4DV4B 1WPBA 2ITDC 2LW7A 4I0XA 1E1QG 3K5NA 3C3TA 2A0LA 1XMOB 2D3OW 4P30A 3ZMTA 2VQFB 1WPXA 1D5AA 2LJ2A 4QIWF 2Y69C 3C90A 2F23A 4R50A 3FAVA 2A3QA 4TWKA 2CTRA 1U96A 2YXLA 1QCEA 2EILC 5JCOC 3CCMV 2HJFC 4X1KB 1XUQA 4LNUB 3EVKA 1H2KA 1Q43A 2QTSA 3O65A 2F1MA 5BMVA 4B3MO 1NBMG 4MVQA 3WB0A 3LSSA 1EFRG 4DUZB 3JD0A 4BW9A 1RFYA 3OMNB 4KFMA 4FK5C 4FJCC 1FPOA 1MG1A 4FFBA 3WB2A 2F43G 2Q0AA 2UUCO 3B40A 5IJ0A 4B08A 1N8RW 2DE0X 3ZJZA 3SJCC 2ZE6A 5KMGB 1FKAO 2DYRB 3SJBC 4DUYB 4PA4A 1JPXA 5K1XA 4B3RO 4ZHQB 5ITZB 1OCOC 1YHQV 1ENVA 3U11A 2FL4A 4MW8A 4TSFG 4ZOLB 4BIOA 2EULA 4DV5O 3SYOA 2EX3A 1K4CC 4DV0O 4JI2B 2K9PA 4DV3B 4OPHA 4MTGA 3VQYA 3GWOA 3W7WA 1N0NA 1YEWA 2HFEC 1Q6UA 2KSDA 2UXBB 5B3SC 1SQXH 4PD4F 2RMKB 2UUBO 3W7UA 3JAKB 5LA6B 2HP8A 1VQ4V 2QR4A 2P22C 1HNWO 3HKDA 1F4NA 4A5UB 3ETDA 1P4RA 5EYPA 4UVBA 4GKKO 4QNHB 2ZIMA 2Q73A 4IL6Z 1RM1B 1P7BA 2QWQB 1BMFG 1M5IA 3UCSC 1QHTA 4TOIA 3CS5A 2Y4UA 4OXSA 3K59A 3SYCA 2YIDA 5A9GA 3R66A 3BAAA 1KUQA 1XMOO 3I56V 1ROPA 2LGQA 2VQFO 2GHYA 1AI7A 2XAHA 3I5DA 4XDKA 3LSQA 2DWEC 2DYSB 5K1PA 3BA8A 3M8AA 2ZINA 1KYOF 1DF5A 4IIJA 3H1HH 3I55V 1S5JA 1VQ7V 2AW9A 1JJOA 3FX7A 5KHHA 1S0VA 3STZC 2WSSG 2QWRB 5B66Z 2JRIA 4I50B 2W6JG 1QBZA 1Z5WA 4B3SO 3CX5F 1H2MA 1HWYA 1Z2GA 4I0XB 4UCTA 2XASA 5H5NA 1GO3F 4LF7B 4YY3O 2VRZA 4CZZA 1G1XB 2YIAA 4TV8A 2QWNB 3G6BA 1P49A 4B7EA 3CC2V 4YIPA 4G2KA 2OCCC 4DUZO 5FLXN 1WB7A 3P3PA 4J9ZB 1VQ9V 3FAVB 4UCRA 3LNMB 3OR7C 1K73W 1GTOA 1GAXA 2FTKA 2Z3YA 1JA8A 4UB8Z 4JAAA 1HNXB 2ZXWB 2W6IG 1SETA 2HG5C 1OZ0A 1W0JG 2CGNA 4JAVA 2WA3A 1HW7A 1THZA 3A2FA 5KX5B 1FXHA 4DUYO 4OX9O 3H1LH 1OCZC 3P32A 3HKCA 4YXWG 1NVPB 4LH7A 1AJPA 2LP7A 1JMKC 2YUAA 4PDVA 5LP6B 3OE7G 2A79B 4MT8A 3ABLC 3L9DA 2EJRA 3OFNG 1NH2D 5IJ0B 3CXCU 3G4SV 5JWPA 1UFIA 3ETGA 4DV3O 5GW7A 1R6TA 1VIBA 3T4ZA 1JVMA 4GYCB 5LMUO 3QO5A 4NYKA 1SERA 1BCCH 3RYIA 2LGWA 3D8CA 3CC4V 3CRRA 4L8JA 4X64B 3HKEB 2WLJA 1I7FA 3ASOB 4OPAA 4X20A 2W0XA 2X6BA 4K8ZA 3UQ8A 2QA4V 3J81N 3OGCC 4JZGA 2CTWA 3CCRV 4WFBV 3FFQA 4UCUA 1X4TA 2JJ1G 2PYLA 3AG2C 3JATA 4QE9A 2OYQA 4JYBA 2YS8A 2XAQA 1FXKC 4Z1MG 2ZM6B 1VF6A 4X9QA 3OT7A 1VQMV 4LF5B 1YDXA 4F4LA 1CXZB 1I5YA 1TUBB 1SZXA 2DJVA 3CMEV 5JH7A 3PN1A 5EYPB 1AP6A 2Y0IA 4NXMO 5FL7G 4ZIBA 4PHZA 4ZBMA 4CBCA 5IY5B 3E83A 1PPJH 1R6NA 1FYJA 3ZHUA 2JIZG 1FJGB 1XI1A 1YI2V 1IXMA 1OCCB 2BOCC 3R65A 1K9MW 1G6UA 1Q8IA 2VQEB 2MK3A 4O4JA 3M7MX 1VQ5V 2ADPA 2IJHA 3DC6A 4BWAA 3RN4A 5L3EA 4JI4O 2R9IA 1TUEB 2A06H 4CH6A 4LF7O 2OTLV 4DV2B 5IJ9A 4JI5B 1LR1A 5GONA 1EM1A 3QVNA 3K0DA 4IYIA 1COWG 4IIJB 4WFGA 1D5NA 4G27B 2ZQMA 2YEVA 4X65B 2CK3G 2WLLB 1N4CA 4DW1A 1XL6A 2ZE8A 3UO2A 5C8YB 1XDCA 2Q9LA 4P2ZA 3SR2C 3CCLV 4MTFA 4I55A 1XEQA 5B1AC 4ZI7B 4TV8B 1FAFA 2N04A 2UXCB 4LFCO 1RPOA 2Q69A 1AI5A 2QSAA 1MSDA 1M90W 1ZUQA 5IYCO 4U3JB 1AP5A 2DQ0A 3K5LA 4JZ2A 2WLHA 2Q8VA 1BGYH 1N33B 4BW5A 1PL0A 2HKOA 1N32B 2Q7EA 1B6QA 1LNQA 2F4VO 5CB4B 4GX5A 3MHHC 1CP9A 5KLVH 3ZRWA 1J95A 1IX9A 4YIOA 3JCZA 4FLUA 1BQZA 4BAYA 5B1NA 2HJDA 4H33A 3SDLA 3RYHB 2CUGA 4FLYA 4UCVA 1X59A 4GX2A 3QF7A 2CE4A 4DR4B 1NU1H 1DGSA 1EBOA 1XL4A 2EIKB 4LBEC 3KCYA 3C3SA 2CAZC 1VF7A 3TXQA 2Q7HA 3D36C 1L0LH 3AK2A 2FMLA 3FB7C 2AXTZ 1NTMH 5CBHA 2GTSA 2XT9A 2ZDIA 2HVJC 4AHCA 2OWOA 2N74A 5KHIA 3JSLA 3W7SA 1W2BU 3ZX6A 1VQKV 1MNGA 1JJ2U 1PNKA 3E35A 4EEQA 3FYIB 5FNVA 5ITZA 2QDOA 5FPOA 4YHHB 2AHYA 4C7UA 4MVOA 3T1HB 5GTHZ 2IH1C 2GV9A 1AILA 3HPLC 2E5LO 3B8MA 1WNSA 4X89A 1XHZA 5LOVB 3WB1A 1JQ0A 4B3RB 3SPHA 1BT8A 1VARA 4CH3A 2QJ1A 3JAKA 4DV1B 1R3LC 3OEEG 1SQPH 4I5SA 4UVCA 4L87A 2JGUA 2Y69B 4ASUG 1ORQC 2P90A 5IYZA 3LDEA 2LW1A 2Q7GA 4RAIA 4YJ3A 4FM2A 2Q0OC 4O2BA 4X65O 3BEHA 3E22B 4O4JB 3B4SA 3A8TA 1EZVH 4F6RB 1IURA 3T4DA 3A0BZ 2YICA 2L6LA 3Q4HB 4DK1A 2UUBB 3K58A 4H37A 5L3DA 5IJ9B 5DM6V 2GBOA 3K57A 3OW2U 5GONB 1IXBA 2UXCO 5C93A 1HNZB 4GKKB 3CJHA 4U3FH 2K1EA 1QNMA 4UB6Z 2Q6AA 4U7OA 1JFFA 4YJ2B 5IWAO 4JV5O 4U7NA 1NQTA 2RQ6A 4CH4A 4TT3G 3LUTB 4JI7O 4MTXA 4I50A 4CC5A 3IC9A 1IVSA 1BZKA 5B1BC 1BHBA 4J41A 3SPGA 4FM1A 4XDJA 1KD1W 1PL4A 4DR4O 3AG4B 2QE7G 5DECA 1YF2A 5GTIZ 1K92A 3EHBB 2ARHA 4B7KA 1A32A 1J5EB 3ZRWB 1H8EG 4AQYB 1L8DA 1JOYA 1DF4A 1Y4MA 1WAZA 2PYJA 4I7ZB 4B3SB 2JS3A 3SJAC 5B1OA 1FFXA 4EKWA 1V55C 3ZEDA 4YY3B 2P4VA 5KX5A 4MVSA 3JALA 1XHXA 2IBZH 2MW2B 4R6ZA 5LHHA 2XAGA 2HEPA 4YHHO 3CRQA 1BL8A 3FB5C 4DV6B 1Q90D 5LP6A 4DR3B 4I9QA 4MVMA 3THOA 5EC2C 3BA9A 1UJWB 3T1HO 1ZAUA 2HHHB 3ZHRA 1PKXA 4TV9A 3M99B 5E1AC 4E2LA 4OX9B 2OTJV 2HVKC 4ZKIA 1R1BA 1SZTA 4PV1B 3CD6V 1K33A 4DV7O 1YSCA 3HKEA 5FNVB 4UCOA 4DV1O 3HB3B 2JVDA 2L35A 1QR8A 3VOUA 2Y4TA 1OCRC 2PF4E 5F2VO 4GT1A 4K8XA 3K3WA 5LMUB 3ZMSA 3ZRSA 3RVZA 1B06A 4O4HB 5EZYA 2KKWA 1YCIA 3H9VA 4FZ1A 4HAMA 3B2EE 1TUBA 2QTOA 4D7SA 1GN6A 2DQ3A 3TETA 1HNZO 3WFVA 3E8GA 3VQWA 4J9YB 1WA8A 3CRMA 5IYZB 2OCCB 4DR7O 2B1IA 4MSWC 3NXSA 4YJ3B 3OTFA 2QM8A 1SESA 4O2BB 1GN2A 3JAWB 3BPZA 4JTDB 1N34O 3LNNA 2WWWA 1YJWV 4JI3B 1K4DC 4TQFA 5JQGA 1VQ8V 3RFRA 3TJTA 4RO2A 3SGIA 4RQEA 3KG2A 5KHJA 1SQFA 2M6YA 4LC1A 3CJHB 4NXMB 4H44B 3AEIA 3KKYA 4NVPA 1YIJV 3STLC 1JFFB 3CWBH 2DYRC 5LXTB 4DK0A 4NR1A 1US6A 3ABLB 3JARA 3L72H 2EIMC 3K9SA 4RUFA 1J5EO 4IYHA 3ABTA 2WLLA 4AQYO 5C8YA 1EZJA 4D7TA 1H2GA 4JI4B 3ETQA 1AB3A 2E75B 1S5HC 2YI9A 4GLXA 4XBFA 4ZI7A 4CH5A 2B5UA 1ZWIC 4PELA 1N0JA 2XHBA 4LF9B 1VEWA 2YIBD 1SC5B 4JI1O 4H0LB 4U3JA 3CB2A 5B5EZ 2KQXA 1SS3A 3G80A 1N36B 1K5QA 4DV6O 2EBOA 4DR3O 4LFAO 2F95B 1QLEC 3AG2B 2HHHO 1FFXB 1Y66A 5IYBO 5BZBA 5CB4A 1HR0B 4MVRA 3WG7C 3U0ZA 5EBLC 2RJZA 3JALB 3K04A 4LFCB 5KA6A 3H1KH 3D3IA 4O4IB 4KXRA 3DSQA 1IDSA 4KUMA 3RYHA 1RM1C 4LFBB 5A2QN 2GTAA 2QGNA 1FD9A 5J2TA 4Q6GA 4X1IB 4PDLA 2F4VB 3AG3C 2EINC 2ZR2A 4TV9B 2QKAA 3T1CA 4LF8O 3ZRVA 2VWKA 2LFSA 1H8HG 3CRCA 3N2GB 4GX0A 3RBZA 1AR1B 1I94B 1CPYA 5JJJB 3S3XA 4IT5A 3CSXA 4JI0B 2ZNJA 4ABMA 2WPDG 2IU0A 2DWDC 1AI6A 1VMGA 3GB7C 3RWRD 4WCEV 3JSNA 1PV0A 2UUAO 4FLTA 3BVOA 1WJZA 2LFRA 5J9PC 1KU9A 1K34A 3OTOB 1R3JC 3HR0A 3B77A 5EZYB 4UUJC 4JTAB 3JAMN 4JI3O 3S3WA 1I0HA 2PGGA 3TCUA 5LOVA 4NTXA 3ZMZA 2NN4A 2ZXWC 4I4TB 3BABA 4FIPC 1WA8B 3ASNB 1K5SA 5LGUA 1WP7A 3CCSV 3F5TA 2OT5A 4X62B 4GX1A 2PUSA 4KHPO 4Z2WA 1WB8A 2ZIOA
chains in the Genus database with same CATH topology
2X6AA 2XAFA 2AHYA 4MVOA 1YJ9V 1NBMG 4MVQA 1QR9A 2R9RB 4WFAV 4UXNA 3LSSA 2IH1C 1EFRG 5CBGA 3JD0A 1F4MA 1V54B 3HPLC 3OMNB 4N23A 3ZMVA 3FB6C 3B8MA 4KFMA 3MHSC 4FK5C 4X89A 3PJSK 1YJNV 4FJCC 2WLIA 1MG1A 3OMAB 4MS2A 4PA9A 2X6CA 2F43G 1JQ0A 4PA6A 3SPHA 5CA3A 2A9HA 4KP4A 4WFFA 3SYPA 5LBQA 1FXKB 1S3JA 4UVAA 1GM7A 1NKDA 2IJKA 1N8RW 3CMAV 3AG1C 3ZJZA 1R3LC 3OEEG 1Q86W 2XAJA 5CN0A 1JX9A 4I5SA 4UVCA 4L87A 2DYRB 4JGSA 1NJIW 2Y69B 2HLDG 1E79G 1JPXA 4PA4A 4ASUG 1AI4A 2HR3A 1ORQC 2P90A 3B8NA 3LDEA 1YITV 2XOKG 4MTOA 4RAIA 1VQ6V 1OCOC 1YHQV 4FMTA 1ENVA 3BEHA 4MW8A 1AJNA 2ITCC 4TSFG 3T4DA 3UM7A 1KQSU 2WLMA 3E8BA 4FPPA 1NVPD 1NH2B 3SYOA 1K4CC 3ZIAG 4H37A 3K9AA 5L3DA 5DM6V 4MTGA 3OW2U 2DYSC 2V1DA 3GWOA 4WFHA 3W7WA 3H01A 1RPRA 2Z5UA 5C93A 2JJ2G 2HFEC 1GK9A 4MVUA 1QVGU 1M57B 5B3SC 4Q20A 2K1EA 3W7UA 2Q6AA 4U7OA 5IY5C 5H9CA 3JYCA 1DTOA 5EC1C 1VQ4V 1F4NA 1KP3A 3ETDA 1P4RA 4U7NA 4UVBA 1NQTA 3LDDA 4TT3G 3LUTB 1OCCC 3AG1B 4MTXA 5IYDO 4QNHB 3A0RA 1QVFU 3QNEA 4JASA 1RM1B 1P7BA 2WLKA 5KUKA 5B1BC 1BMFG 1AROP 3W7TA 1BHBA 5H6RA 4QE7A 2Q67A 2EIJC 3SPGA 5B1AB 2P7TC 1AJQA 1PD3A 4XDJA 2JEUA 4OXSA 4QJFB 1KD1W 3AG4B 2QE7G 3SYCA 4JF3A 2JEXA 1K92A 2IW5A 3I56V 3EHBB 4BIUA 1ROPA 4WF9V 3F5WC 2GHYA 3ZRWB 1AI7A 1H8EG 2XAHA 4XDKA 3LSQA 2DWEC 4RQFA 2DYSB 1JOYA 1DF4A 1Y4MA 2ZR3A 1K3EA 5B1OA 3SJQC 1DF5A 4EKWA 3I55V 3JD3A 1V55C 2NNUA 1VQ7V 3DTUB 5LHGA 3K03A 3SPIA 1S0VA 1K97A 3STZC 2WSSG 2Y48A 4MVSA 4R8CA 3G71V 3E8HA 2W6JG 5EBMC 3LDCA 1QBZA 5HFMA 3E86A 1HWYA 4R6ZA 5LHHA 2XAGA 2XASA 1GO3F 3RW0A 1BL8A 3FB5C 4CZZA 5CBFA 4MVMA 5EC2C 3IGAC 1UJWB 3CC2V 4PA7A 1M1KW 1GM9A 4G2KA 2OCCC 5LGNA 1PKXA 1Q7YW 4N21A 4J9ZB 1VQ9V 3OM3B 2UXNA 2OTJV 3LNMB 3OAAG 3E8FA 1GMGA 3M99B 3OR7C 2EIJB 3MD0A 4JTCB 1K73W 1F23A 1KKDA 1MABG 3JD2A 3ASOC 1GTOA 2FTKA 2WAMA 2Z3YA 2HVKC 5E1AC 1SZTA 2C2AA 4E2LA 2EZOA 4ZKIA 2ZXWB 2W6IG 5L3CA 3K79A 1SETA 2HG5C 1OZ0A 3CCUV 1K33A 1S77D 3CD6V 1W0JG 1R6KA 1YSCA 4JAVA 3VBBA 4PA3A 3HB3B 1THZA 4HZ3A 4MW3A 3K08A 2QKSA 1QR8A 1FXHA 2EILB 1NR7A 1OCZC 3VOUA 2IJIA 3P32A 3ZMUA 1OCRC 1S72V 2JDIG 2H8PC 4GT1A 4YXWG 3OEHG 1NVPB 2EIKC 3ZCCA 1AJPA 2LP7A 3IFXA 2WLIB 3K3WA 3FYEB 4PDVA 3ZMSA 3OE7G 4UV8A 3ZRSA 5KA5A 2A79B 4MT8A 3RVZA 4LP8A 3ABLC 3QO8A 2EJRA 3OUSA 3OFNG 2W0FC 1NH2D 3CXCU 3CC7V 1VQOV 3G4SV 4P9PA 3ASNC 1L1FA 4R7CA 3ETGA 4HAMA 5GW7A 2QTOA 3ABKC 3T4ZA 2DQ3A 1JVMA 4LCUC 3TETA 2NLJC 1M56C 1YTFD 2IJJA 3QO5A 3WFVA 1SERA 2B1GA 3E8GA 3CC4V 4J9YB 1K8AW 1R3IC 2OCCB 2B1IA 4MSWC 3NXSA 2WLJA 2QM8A 1SESA 4JTDB 3SYAA 1KC8W 3ASOB 3T2MA 2WWWA 2X6BA 1YJWV 2QA4V 2QEXV 4MVZA 3OGCC 3CYOA 3CCVV 1OCOB 1MOFA 1V54C 3EFFK 1K4DC 4JYCA 3CPWU 2EZPA 5L3BA 4WFBV 3CCRV 1VQ8V 2GSMB 4PDRA 4RO2A 2IU3A 2JJ1G 4RQEA 1DLBA 3KG2A 3AG2C 3X2QC 4QE9A 4LC1A 4UV9A 2P6JA 4JYBA 3AEIA 3K0GA 2XAQA 2QM7A 5LGTA 1F51A 3CCEV 1FXKC 4X88A 3TK1A 1GKFA 1YIJV 3STLC 1E1RG 2XNDG 1JCHA 1KECA 3ABMC 4Z1MG 1W0KG 5L3FA 1R73A 3OUFA 3OR6C 1VQMV 4F4LA 1I5YA 4PDMA 2DYRC 3CMEV 1OHHG 1K7DA 5EBWC 3ABLB 5B3SB 1FXKA 2EIMC 3ABUA 1R3KC 4RUFA 5FL7G 5HFLA 4ZBMA 4CBCA 3ABTA 5IY5B 2WLLA 4HYOA 5EK0A 3E83A 2X0LA 3ABKB 2UXXA 1EZJA 1R6NA 1M56B 2JK5C 1H2GA 2JIZG 4I9WA 1YI2V 1S5HC 1IXMA 2WLNA 1OCCB 2BOCC 4XDLA 4XBFA 3R65A 1K9MW 2B5UA 2MK3A 1ZWIC 3OMIB 1G4YB 2PI5A 4PELA 2ATKC 1VQ5V 2IJHA 5H6QA 4DXWA 1KP2A 3FKSG 5B1BB 5L3EA 1FFTB 2R9IA 1TUEB 1M57C 1Q81W 2OTLV 2DW4A 1K5QA 2EBOA 1PNLA 2KB1A 1NR1A 1SRYA 1QLEC 3AG2B 3K0DA 4BIZA 3X2QB 1COWG 5BZBA 1Y66A 3UKMA 5IYBO 4WFGA 2IH3C 3SPCA 4G27B 4WFEA 2ZQMA 1QLNA 4MVRA 3WG7C 1FXVA 2YEVA 3ETEA 3ABMB 2CK3G 1FS0G 5EBLC 2WLLB 1CEZA 3K04A 5KA6A 3D3IA 1XL6A 3JD4A 1VQLV 3E89A 4KUMA 3IC7A 1RM1C 1WLEA 3G6EV 3FB8C 1V55B 3SYQA 4JAUA 3SPJA 2EIMB 4P2ZA 3CCLV 4MTFA 4GCZA 3ZN1A 3JD1A 3RVYA 2X7RB 5B1AC 4DO2A 4QPJA 3CP1A 1RPOA 1I5XA 2Q69A 3AG4C 1S76D 1AI5A 4PDLA 1M90W 3AG3C 3E2EA 2EINC 2ZR2A 3T1CA 5IYCO 3F7YC 2DQ0A 5KUMA 2H94A 3ZRVA 2PI4A 5LHIA 2YSUB 1PNMA 2WLHA 2AHZA 2LFSA 1H8HG 4GX0A 3RBZA 1AR1B 3ML0A 4RUEA 4BW5A 1PL0A 1CPYA 2HKOA 1YTFB 1B6QA 1LNQA 4X8AA 4P9OA 3CCQV 3QO7A 4GX5A 1H38A 3F7VC 3MHHC 1CP9A 1VQPV 3ZRWA 1BHAA 1J95A 2WPDG 2IU0A 2DWDC 1M9NA 2YEVB 1AI6A 4G28B 3JCZA 4JPRA 3GB7C 4QPKA 1Q82W 1QLEB 4WCEV 4BAYA 5IDJA 5B1NA 4H33A 5DN6G 2M7WA 3CCJV 3W7XA 3WG7B 4GX2A 2LFRA 3K06A 5J9PC 3P30A 1K34A 1OCZB 1OCRB 1R3JC 3DGEA 3ZRXA 3B77A 2ITDC 4UUJC 1VQNV 4JTAB 1E1QG 5CMUA 2A0LA 1EBOA 1XL4A 3ZN0A 2D3OW 2EIKB 4LBEC 2P67A 4P30A 3ZMTA 2ZDIC 1GM8A 1WPXA 3TCUA 4QIWF 2Y69C 3ZMZA 2ZXWC 3FB7C 4FIPC 1G8MA 3AG3B 5CBHA 3ASNB 2EINB 2BOBC 3BY6A 4R50A 5L3GA 1K5SA 2ZDIA 2HVJC 5LGUA 3CCSV 1MSWD 4TWKA 2OT5A 3W7SA 2ZD9A 1W2BU 3D36A 1QCEA 2EILC 4GX1A 1VQKV 3CCMV 2Q68A 1JJ2U 1PNKA 2HJFC 3E35A 3FYIB 2V7QG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX V;  1VQO V;  1M90 W;  3CC2 V;  3CME V;  1Q82 W;  3I55 V;  1KQS U;  3CCV V;  1M1K W;  1VQ4 V;  4WCE V;  1VQ5 V;  1N8R W;  1VQ7 V;  3CMA V;  1Q7Y W;  3CPW U;  3CCJ V;  3CCR V;  4WFB V;  1YJ9 V;  1VQ8 V;  1Q86 W;  1KD1 W;  1VQ9 V;  1VQL V;  1S72 V;  4WFA V;  3G71 V;  5DM6 V;  3CC4 V;  1K8A W;  1K73 W;  1Q81 W;  1NJI W;  3G6E V;  2OTL V;  3OW2 U;  2OTJ V;  3I56 V;  3CCS V;  1YJW V;  4WF9 V;  3CCL V;  1QVF U;  1YIT V;  3CCQ V;  1QVG U;  1YJN V;  3CCE V;  1W2B U;  3CCU V;  1KC8 W;  1VQ6 V;  1VQN V;  1VQK V;  1YHQ V;  1YI2 V;  1YIJ V;  3CD6 V;  1VQP V;  3CCM V;  1JJ2 U;  1R73 A;  2D3O W;  1VQM V;  3CXC U;  3CC7 V;  3G4S V;  1K9M W;  2QA4 V; 
#chains in the Genus database with same CATH topology
 3E22 A;  5JQG B;  2X6A A;  2ZNI A;  4F6R A;  2ZE7 A;  5JCO A;  2QKC A;  2P4K A;  3Q4H A;  3ZHQ A;  4UXN A;  1WN7 A;  3N27 A;  1V54 B;  3ZMV A;  4N23 A;  4BR6 A;  5FPR A;  1MA1 A;  4JI8 O;  3MHS C;  1NZ6 A;  2OIE A;  4LF9 O;  4MS2 A;  3H1J H;  2CH7 A;  2X6C A;  3D3Q A;  2XTA A;  2A9H A;  4KP4 A;  4WFF A;  3JAR B;  5LBQ A;  2ADQ B;  4UVA A;  1GM7 A;  1NKD A;  1Q3E A;  2IJK A;  1N36 O;  3CMA V;  3AG1 C;  4YJ2 A;  1Q86 W;  2XAJ A;  5CN0 A;  1BE3 H;  1URF A;  4K0K O;  1AI4 A;  2HR3 A;  1EN5 A;  2XOK G;  1HR0 O;  1ZTE A;  4LR3 A;  1KQS U;  2R70 A;  4J7Z A;  4LFB O;  2AGA A;  2WLM A;  3ZIA G;  5LL6 Y;  4DR1 B;  2V1D A;  4WFH A;  1AR5 A;  3AK3 A;  5IWA B;  4JV5 B;  1GK9 A;  4MVU A;  4CS2 A;  2B9Z A;  1M57 B;  2GDS A;  4Q20 A;  5CA0 A;  4JI7 B;  3N2K A;  5EIB D;  4LH6 A;  3L75 H;  1Q6H A;  5IY5 C;  1Q5O A;  1T5E A;  1DTO A;  3JYC A;  4NKG B;  3UO3 A;  1I94 O;  5JJE B;  2DMX A;  4WBN A;  3LDD A;  2JGD B;  4JI0 O;  1OCC C;  1F7Y A;  5IYD O;  5J2T B;  1QVF U;  2IM9 A;  3QNE A;  2QWO B;  5J2U A;  3AG7 A;  4DR5 O;  5KUK A;  3W7T A;  5H6R A;  1IBM B;  2EIJ C;  1WP8 A;  2P5O A;  4FM0 A;  2P7T C;  1PD3 A;  2JEU A;  3OTO O;  4JF3 A;  1GN4 A;  2IW5 A;  3ZHV A;  1XNQ B;  3J7A U;  2R9A A;  4BIU A;  3HKB A;  3T1Y O;  4OGQ B;  2BTQ B;  3SJQ C;  5D5Q A;  3JAS B;  1U97 A;  5BXZ A;  5LYJ B;  3DTU B;  1GH6 A;  1XIL A;  3RYC A;  1K97 A;  4GKJ O;  1P84 F;  3G71 V;  3E8H A;  4X62 O;  3E86 A;  2JS5 A;  1D2D A;  1M4U A;  1Q6I A;  5EIB C;  4O4H A;  1XBL A;  1GM9 A;  2ILM A;  3BHP A;  3APO A;  4DV7 B;  3VQV A;  1LUV A;  2P06 A;  3OAA G;  1KKD A;  4NXN B;  4AI8 A;  1MAB G;  3JD2 A;  2C2A A;  2EZO A;  3O9O A;  4LF4 O;  5L3C A;  2V4D A;  3CCU V;  3VBB A;  1QQC A;  3OD4 A;  3JAW A;  4PA3 A;  4HZ3 A;  1KBH A;  2QKS A;  2UXD O;  2LQT A;  1GN3 A;  2EIL B;  1VP7 A;  1PP9 H;  4W4L A;  2Y0P A;  2JDI G;  2YC0 A;  2QM4 A;  2EIK C;  3IFX A;  3FYE B;  2CH7 B;  3TXS A;  4UV8 A;  4GUN A;  3KCX A;  1Y74 B;  4F6E A;  3QO8 A;  4DR7 B;  3OUS A;  2W0F C;  4PI2 A;  3CC7 V;  1VQO V;  4P9P A;  1L1F A;  4R7C A;  4QGP A;  4DR1 O;  1Y67 A;  1N34 B;  3ABK C;  5LXT A;  2N05 A;  4HBN A;  1M56 C;  4FLV A;  1YTF D;  2IJJ A;  2B1G A;  3ZHS A;  1R3I C;  3RYF A;  3SYA A;  5LMN O;  3T2M A;  4MVZ A;  1OCO B;  3EFF K;  4HNA B;  4JYC A;  1RP3 B;  3CPW U;  2AZ2 A;  1VF6 C;  4PDR A;  2IU3 A;  1B04 A;  3AK1 A;  1DLB A;  3MAQ A;  3X2Q C;  2Z0A A;  4EB6 A;  2P6J A;  4D6T H;  2QM7 A;  5LGT A;  1F51 A;  5CA0 B;  3CCE V;  3N2K B;  1IBM O;  3TK1 A;  1GKF A;  1E1R G;  2XND G;  1JCH A;  1KEC A;  3ABM C;  5L3F A;  2R72 A;  4PJ0 Z;  4FLW A;  1DK1 A;  1OHH G;  4DRX A;  5B3S B;  1XNQ O;  3LSU A;  1FXK A;  2VS0 A;  3ABU A;  5KAI Z;  1R3K C;  4WBN B;  5HFL A;  4HYO A;  5EK0 A;  1BSM A;  1V9P A;  4O4I A;  1M93 A;  2E3C A;  1UPG A;  4JI1 B;  5J2U B;  1IBL B;  5AG2 A;  4I9W A;  4XDL A;  2Q4P A;  1I08 A;  4JYY A;  3OMI B;  2ATK C;  1Z5V A;  4LFA B;  5H6Q A;  4X1I A;  4DXW A;  1H2S B;  1KP2 A;  3FKS G;  3BFR A;  1FFT B;  3OGI B;  1Q81 W;  3HKB B;  1PNL A;  2NR5 A;  3N2G A;  2KB1 A;  2RCV A;  2VWJ A;  4BIZ A;  3EXA A;  4X1Y A;  3UKM A;  3SPC A;  4WFE A;  1QLN A;  4NXN O;  3ETE A;  3RYC B;  1HDJ A;  1FS0 G;  4FVM A;  2PTM A;  1SA0 A;  3L71 H;  1NTK H;  5JVD B;  1BS3 A;  2E74 B;  3E89 A;  4IHJ A;  2H3O A;  3FB8 C;  1O9H A;  3SYQ A;  2EIM B;  4LF8 B;  1YZB A;  3JD1 A;  4QPJ A;  5BY1 A;  1I5X A;  3AG4 C;  1S76 D;  4DYL A;  2BSK B;  1PM9 A;  3F7Y C;  5KUM A;  2PI4 A;  1NS1 A;  2YSU B;  2DOS A;  4I4T A;  1B3Q A;  4RUE A;  4O4L B;  1XNR O;  2CTQ A;  4LWS A;  2UUA B;  3B09 A;  4NTY A;  2FB5 A;  3CCQ V;  3F7V C;  2E5L B;  3A0H Z;  4G28 B;  5KHG A;  1Q82 W;  1QLE B;  5IDJ A;  3CCJ V;  3W7X A;  3WG7 B;  1HP8 A;  3K06 A;  2ZKO A;  1OCZ B;  3G67 A;  3DGE A;  1TVK B;  3ZRX A;  4LF6 O;  1VQN V;  5CMU A;  1SQQ H;  3ZN0 A;  2P67 A;  2ZDI C;  1GM8 A;  3QG5 A;  1LUW A;  4KHP B;  4DV4 O;  1G8M A;  3AG3 B;  1XRE A;  2EIN B;  2BOB C;  4J42 A;  1AR4 A;  3BY6 A;  5L3G A;  3RYF B;  3GWK C;  4FZ0 A;  1MSW D;  2BCC H;  2ZD9 A;  4X66 B;  3D36 A;  5KHK A;  2GUZ A;  2Q68 A;  1H2L A;  3GVM A;  2V7Q G;  4JI8 B;  3K5M A;  2XAF A;  1YJ9 V;  1IBL O;  4J7J A;  3KZI Z;  1QR9 A;  2R9R B;  4WFA V;  1TAE A;  5CBG A;  4EB6 B;  1F4M A;  3RT3 C;  1TGO A;  1Y6X A;  4J11 A;  1IBK B;  3FB6 C;  1ZL8 A;  3PJS K;  1AVM A;  1YJN V;  2WLI A;  3OMA B;  4PA9 A;  4FLZ A;  4K0K B;  2KG7 A;  2F66 C;  4PA6 A;  5CA3 A;  4DRX B;  2CTP A;  3SYP A;  1FXK B;  1S3J A;  2YI8 A;  4PI0 A;  1JX9 A;  4JGS A;  1NJI W;  4H13 B;  1RSO A;  2HLD G;  1E79 G;  1MZF A;  3IJ4 A;  2A7W A;  3B8N A;  2JGD A;  2PY5 A;  1GRJ A;  1YIT V;  1SQG A;  4MTO A;  1VQ6 V;  4FMT A;  3CEI A;  4O2A A;  1AJN A;  2ITC C;  2YXY A;  3UM7 A;  1W59 A;  5BMV B;  1SKV A;  1NH2 B;  3E8B A;  4FPP A;  1NVP D;  3K9A A;  4JI6 B;  2DYS C;  3H01 A;  1RPR A;  2BE3 A;  2Z5U A;  4FFB B;  2JJ2 G;  4TUY A;  1QVG U;  4B3T B;  3ICX A;  4X1Y B;  1XMQ B;  3CHX A;  4DR2 B;  4JI2 O;  5H9C A;  4E4E A;  4EFB A;  5EC1 C;  1SA0 B;  5DED A;  2BTQ A;  1Y76 A;  1SQB H;  1KP3 A;  4DR5 B;  3JAS A;  4IHJ B;  4DR6 B;  2UXB O;  5LYJ A;  1ZSP A;  3U10 A;  3AG1 B;  4ICG A;  3A0R A;  4EFE A;  1H2N A;  1KMI Z;  4JAS A;  3FD9 A;  4KL1 A;  3NR7 A;  1MZE A;  3H1I H;  2WLK A;  5JJN B;  1ARO P;  3DXR A;  4QE7 A;  2Q67 A;  4UFZ A;  5B1A B;  1NT2 B;  3T1Y B;  1AJQ A;  4QJF B;  5CA1 A;  2E76 B;  2Q5Z A;  2JEX A;  4LWS B;  4WF9 V;  3F5W C;  4GKJ B;  1OV9 A;  2WA4 A;  2XUM A;  4RQF A;  4FLX A;  2ZR3 A;  3P3N A;  4JYA B;  2G38 A;  1K3E A;  3HKD B;  3BRC A;  3JD3 A;  2NNU A;  1JR9 A;  5LHG A;  2ODM A;  3K03 A;  3SPI A;  3CRA A;  2Y48 A;  1VF5 B;  4R8C A;  5LP6 C;  4X66 O;  3BCC H;  5EBM C;  2EJ7 A;  3LDC A;  5HFM A;  3UT5 A;  1ZLZ A;  3MDS A;  4Z1V A;  3DC5 A;  5IE9 A;  3RW0 A;  2FYU H;  4CC6 A;  1SQV H;  5CBF A;  3IGA C;  1Y74 A;  4LF4 B;  3QTC A;  2UU9 B;  1QU7 A;  4PA7 A;  1M1K W;  1P7G A;  5LGN A;  1IBK O;  1Q7Y W;  4N21 A;  3OM3 B;  2UXN A;  3E8F A;  1GMG A;  4JTC B;  2UXD B;  2EIJ B;  1O9G A;  3MD0 A;  1F23 A;  3ASO C;  2WAM A;  2GUZ B;  3K79 A;  4GZR B;  1S77 D;  1R6K A;  1ZX3 A;  4MW3 A;  3K08 A;  1YVW A;  1NR7 A;  5H2F Z;  1HNX O;  2IJI A;  3ZMU A;  1S72 V;  4HNA A;  3L73 H;  2H8P C;  1YXB A;  1ZL8 B;  4UCS A;  2O57 A;  4J7K A;  3OEH G;  3ZCC A;  1EN4 A;  5BR8 B;  2WLI B;  2KG7 B;  5KA5 A;  4LP8 A;  3K5O A;  3ASN C;  1BQ0 A;  3APQ A;  3CE2 A;  4JI6 O;  5LMN B;  4LCU C;  1S5L Z;  2NLJ C;  2ZCE A;  1RSO B;  4B3T O;  3ZBH A;  1XMQ O;  1K8A W;  2OCH A;  4DR2 O;  3L74 H;  2F93 B;  3WU2 Z;  1KC8 W;  4O2A B;  5E79 Z;  1L0N H;  4DR6 O;  2QEX V;  4X1K A;  3CYO A;  4LNU A;  3CCV V;  1V54 C;  1MOF A;  2DN9 A;  4X64 O;  3HKC B;  2EZP A;  5L3B A;  2ETN A;  2RDC A;  2GSM B;  4TQD A;  4NTW A;  4AIL C;  4RWU A;  4TUY B;  4UV9 A;  3K0G A;  4X88 A;  1W0K G;  2FKX A;  1R73 A;  3OUF A;  3OR6 C;  2PZS A;  4PDM A;  1IZ3 A;  1Y76 B;  2ZE5 A;  1K7D A;  5EBW C;  2RN9 A;  5KAF Z;  3RYI B;  1SF9 A;  3TGU H;  3IAY A;  2ZM6 O;  5KMG A;  2X0L A;  3ABK B;  1NI8 A;  2UXX A;  3L70 H;  5JVD A;  4LF5 O;  1MMM A;  4B3M B;  4JYA O;  1M56 B;  2JK5 C;  4X20 B;  1EN6 A;  4NB5 A;  2WLN A;  4ZHQ A;  3DXR B;  5TIS Z;  1G4Y B;  2PI5 A;  4J80 A;  4ZOL A;  5IT9 N;  4CS3 A;  5CA1 B;  2UUC B;  2BSK A;  4FFK A;  5B1B B;  3JAT B;  1FJG O;  1NTZ H;  1M57 C;  2DW4 A;  4K3A A;  1XOU A;  2VQE O;  1NR1 A;  1SRY A;  4O4L A;  2CDY A;  2UU9 O;  3X2Q B;  3VQX A;  5JH7 B;  2IH3 C;  3ZHT A;  2ZT9 B;  3J80 N;  1FXV A;  4DV2 O;  3ABM B;  5LA6 A;  4JI5 O;  1XQ8 A;  1CEZ A;  3JCU Z;  3JD4 A;  1VQL V;  3IC7 A;  1WLE A;  3RGB A;  3G6E V;  4DV5 B;  1V55 B;  3UT5 B;  4JAU A;  3SPJ A;  4DW0 A;  4DV0 B;  4GCZ A;  3ZS8 C;  3ZN1 A;  2D2C B;  3RVY A;  2X7R B;  4DO2 A;  3CP1 A;  1TVK A;  1XNR B;  3E2E A;  4IGG A;  4W4K A;  2AZ0 A;  2YXH A;  2RNB A;  1TA8 A;  2LO1 A;  2H94 A;  5BR8 O;  2BTO A;  5LHI A;  1PNM A;  4K35 A;  2AHZ A;  1HNW B;  3ML0 A;  1KB9 F;  4CS4 A;  1YTF B;  4X8A A;  4P9O A;  3QO7 A;  1H38 A;  5D5P A;  1VQP V;  1BHA A;  1M9N A;  2YEV B;  4JPR A;  4QPK A;  1KKC A;  4LF6 B;  1N33 O;  5DN6 G;  2YDE A;  1N32 O;  2QWP B;  2OIG A;  2M7W A;  1OJH A;  4J10 A;  4I55 B;  3CXH F;  3P30 A;  2YIB A;  2CGO A;  1OCR B;  4DV4 B;  1WPB A;  2ITD C;  2LW7 A;  4I0X A;  1E1Q G;  3K5N A;  3C3T A;  2A0L A;  1XMO B;  2D3O W;  4P30 A;  3ZMT A;  2VQF B;  1WPX A;  1D5A A;  2LJ2 A;  4QIW F;  2Y69 C;  3C90 A;  2F23 A;  4R50 A;  3FAV A;  2A3Q A;  4TWK A;  2CTR A;  1U96 A;  2YXL A;  1QCE A;  2EIL C;  5JCO C;  3CCM V;  2HJF C;  4X1K B;  1XUQ A;  4LNU B;  3EVK A;  1H2K A;  1Q43 A;  2QTS A;  3O65 A;  2F1M A;  5BMV A;  4B3M O;  1NBM G;  4MVQ A;  3WB0 A;  3LSS A;  1EFR G;  4DUZ B;  3JD0 A;  4BW9 A;  1RFY A;  3OMN B;  4KFM A;  4FK5 C;  4FJC C;  1FPO A;  1MG1 A;  4FFB A;  3WB2 A;  2F43 G;  2Q0A A;  2UUC O;  3B40 A;  5IJ0 A;  4B08 A;  1N8R W;  2DE0 X;  3ZJZ A;  3SJC C;  2ZE6 A;  5KMG B;  1FKA O;  2DYR B;  3SJB C;  4DUY B;  4PA4 A;  1JPX A;  5K1X A;  4B3R O;  4ZHQ B;  5ITZ B;  1OCO C;  1YHQ V;  1ENV A;  3U11 A;  2FL4 A;  4MW8 A;  4TSF G;  4ZOL B;  4BIO A;  2EUL A;  4DV5 O;  3SYO A;  2EX3 A;  1K4C C;  4DV0 O;  4JI2 B;  2K9P A;  4DV3 B;  4OPH A;  4MTG A;  3VQY A;  3GWO A;  3W7W A;  1N0N A;  1YEW A;  2HFE C;  1Q6U A;  2KSD A;  2UXB B;  5B3S C;  1SQX H;  4PD4 F;  2RMK B;  2UUB O;  3W7U A;  3JAK B;  5LA6 B;  2HP8 A;  1VQ4 V;  2QR4 A;  2P22 C;  1HNW O;  3HKD A;  1F4N A;  4A5U B;  3ETD A;  1P4R A;  5EYP A;  4UVB A;  4GKK O;  4QNH B;  2ZIM A;  2Q73 A;  4IL6 Z;  1RM1 B;  1P7B A;  2QWQ B;  1BMF G;  1M5I A;  3UCS C;  1QHT A;  4TOI A;  3CS5 A;  2Y4U A;  4OXS A;  3K59 A;  3SYC A;  2YID A;  5A9G A;  3R66 A;  3BAA A;  1KUQ A;  1XMO O;  3I56 V;  1ROP A;  2LGQ A;  2VQF O;  2GHY A;  1AI7 A;  2XAH A;  3I5D A;  4XDK A;  3LSQ A;  2DWE C;  2DYS B;  5K1P A;  3BA8 A;  3M8A A;  2ZIN A;  1KYO F;  1DF5 A;  4IIJ A;  3H1H H;  3I55 V;  1S5J A;  1VQ7 V;  2AW9 A;  1JJO A;  3FX7 A;  5KHH A;  1S0V A;  3STZ C;  2WSS G;  2QWR B;  5B66 Z;  2JRI A;  4I50 B;  2W6J G;  1QBZ A;  1Z5W A;  4B3S O;  3CX5 F;  1H2M A;  1HWY A;  1Z2G A;  4I0X B;  4UCT A;  2XAS A;  5H5N A;  1GO3 F;  4LF7 B;  4YY3 O;  2VRZ A;  4CZZ A;  1G1X B;  2YIA A;  4TV8 A;  2QWN B;  3G6B A;  1P49 A;  4B7E A;  3CC2 V;  4YIP A;  4G2K A;  2OCC C;  4DUZ O;  5FLX N;  1WB7 A;  3P3P A;  4J9Z B;  1VQ9 V;  3FAV B;  4UCR A;  3LNM B;  3OR7 C;  1K73 W;  1GTO A;  1GAX A;  2FTK A;  2Z3Y A;  1JA8 A;  4UB8 Z;  4JAA A;  1HNX B;  2ZXW B;  2W6I G;  1SET A;  2HG5 C;  1OZ0 A;  1W0J G;  2CGN A;  4JAV A;  2WA3 A;  1HW7 A;  1THZ A;  3A2F A;  5KX5 B;  1FXH A;  4DUY O;  4OX9 O;  3H1L H;  1OCZ C;  3P32 A;  3HKC A;  4YXW G;  1NVP B;  4LH7 A;  1AJP A;  2LP7 A;  1JMK C;  2YUA A;  4PDV A;  5LP6 B;  3OE7 G;  2A79 B;  4MT8 A;  3ABL C;  3L9D A;  2EJR A;  3OFN G;  1NH2 D;  5IJ0 B;  3CXC U;  3G4S V;  5JWP A;  1UFI A;  3ETG A;  4DV3 O;  5GW7 A;  1R6T A;  1VIB A;  3T4Z A;  1JVM A;  4GYC B;  5LMU O;  3QO5 A;  4NYK A;  1SER A;  1BCC H;  3RYI A;  2LGW A;  3D8C A;  3CC4 V;  3CRR A;  4L8J A;  4X64 B;  3HKE B;  2WLJ A;  1I7F A;  3ASO B;  4OPA A;  4X20 A;  2W0X A;  2X6B A;  4K8Z A;  3UQ8 A;  2QA4 V;  3J81 N;  3OGC C;  4JZG A;  2CTW A;  3CCR V;  4WFB V;  3FFQ A;  4UCU A;  1X4T A;  2JJ1 G;  2PYL A;  3AG2 C;  3JAT A;  4QE9 A;  2OYQ A;  4JYB A;  2YS8 A;  2XAQ A;  1FXK C;  4Z1M G;  2ZM6 B;  1VF6 A;  4X9Q A;  3OT7 A;  1VQM V;  4LF5 B;  1YDX A;  4F4L A;  1CXZ B;  1I5Y A;  1TUB B;  1SZX A;  2DJV A;  3CME V;  5JH7 A;  3PN1 A;  5EYP B;  1AP6 A;  2Y0I A;  4NXM O;  5FL7 G;  4ZIB A;  4PHZ A;  4ZBM A;  4CBC A;  5IY5 B;  3E83 A;  1PPJ H;  1R6N A;  1FYJ A;  3ZHU A;  2JIZ G;  1FJG B;  1XI1 A;  1YI2 V;  1IXM A;  1OCC B;  2BOC C;  3R65 A;  1K9M W;  1G6U A;  1Q8I A;  2VQE B;  2MK3 A;  4O4J A;  3M7M X;  1VQ5 V;  2ADP A;  2IJH A;  3DC6 A;  4BWA A;  3RN4 A;  5L3E A;  4JI4 O;  2R9I A;  1TUE B;  2A06 H;  4CH6 A;  4LF7 O;  2OTL V;  4DV2 B;  5IJ9 A;  4JI5 B;  1LR1 A;  5GON A;  1EM1 A;  3QVN A;  3K0D A;  4IYI A;  1COW G;  4IIJ B;  4WFG A;  1D5N A;  4G27 B;  2ZQM A;  2YEV A;  4X65 B;  2CK3 G;  2WLL B;  1N4C A;  4DW1 A;  1XL6 A;  2ZE8 A;  3UO2 A;  5C8Y B;  1XDC A;  2Q9L A;  4P2Z A;  3SR2 C;  3CCL V;  4MTF A;  4I55 A;  1XEQ A;  5B1A C;  4ZI7 B;  4TV8 B;  1FAF A;  2N04 A;  2UXC B;  4LFC O;  1RPO A;  2Q69 A;  1AI5 A;  2QSA A;  1MSD A;  1M90 W;  1ZUQ A;  5IYC O;  4U3J B;  1AP5 A;  2DQ0 A;  3K5L A;  4JZ2 A;  2WLH A;  2Q8V A;  1BGY H;  1N33 B;  4BW5 A;  1PL0 A;  2HKO A;  1N32 B;  2Q7E A;  1B6Q A;  1LNQ A;  2F4V O;  5CB4 B;  4GX5 A;  3MHH C;  1CP9 A;  5KLV H;  3ZRW A;  1J95 A;  1IX9 A;  4YIO A;  3JCZ A;  4FLU A;  1BQZ A;  4BAY A;  5B1N A;  2HJD A;  4H33 A;  3SDL A;  3RYH B;  2CUG A;  4FLY A;  4UCV A;  1X59 A;  4GX2 A;  3QF7 A;  2CE4 A;  4DR4 B;  1NU1 H;  1DGS A;  1EBO A;  1XL4 A;  2EIK B;  4LBE C;  3KCY A;  3C3S A;  2CAZ C;  1VF7 A;  3TXQ A;  2Q7H A;  3D36 C;  1L0L H;  3AK2 A;  2FML A;  3FB7 C;  2AXT Z;  1NTM H;  5CBH A;  2GTS A;  2XT9 A;  2ZDI A;  2HVJ C;  4AHC A;  2OWO A;  2N74 A;  5KHI A;  3JSL A;  3W7S A;  1W2B U;  3ZX6 A;  1VQK V;  1MNG A;  1JJ2 U;  1PNK A;  3E35 A;  4EEQ A;  3FYI B;  5FNV A;  5ITZ A;  2QDO A;  5FPO A;  4YHH B;  2AHY A;  4C7U A;  4MVO A;  3T1H B;  5GTH Z;  2IH1 C;  2GV9 A;  1AIL A;  3HPL C;  2E5L O;  3B8M A;  1WNS A;  4X89 A;  1XHZ A;  5LOV B;  3WB1 A;  1JQ0 A;  4B3R B;  3SPH A;  1BT8 A;  1VAR A;  4CH3 A;  2QJ1 A;  3JAK A;  4DV1 B;  1R3L C;  3OEE G;  1SQP H;  4I5S A;  4UVC A;  4L87 A;  2JGU A;  2Y69 B;  4ASU G;  1ORQ C;  2P90 A;  5IYZ A;  3LDE A;  2LW1 A;  2Q7G A;  4RAI A;  4YJ3 A;  4FM2 A;  2Q0O C;  4O2B A;  4X65 O;  3BEH A;  3E22 B;  4O4J B;  3B4S A;  3A8T A;  1EZV H;  4F6R B;  1IUR A;  3T4D A;  3A0B Z;  2YIC A;  2L6L A;  3Q4H B;  4DK1 A;  2UUB B;  3K58 A;  4H37 A;  5L3D A;  5IJ9 B;  5DM6 V;  2GBO A;  3K57 A;  3OW2 U;  5GON B;  1IXB A;  2UXC O;  5C93 A;  1HNZ B;  4GKK B;  3CJH A;  4U3F H;  2K1E A;  1QNM A;  4UB6 Z;  2Q6A A;  4U7O A;  1JFF A;  4YJ2 B;  5IWA O;  4JV5 O;  4U7N A;  1NQT A;  2RQ6 A;  4CH4 A;  4TT3 G;  3LUT B;  4JI7 O;  4MTX A;  4I50 A;  4CC5 A;  3IC9 A;  1IVS A;  1BZK A;  5B1B C;  1BHB A;  4J41 A;  3SPG A;  4FM1 A;  4XDJ A;  1KD1 W;  1PL4 A;  4DR4 O;  3AG4 B;  2QE7 G;  5DEC A;  1YF2 A;  5GTI Z;  1K92 A;  3EHB B;  2ARH A;  4B7K A;  1A32 A;  1J5E B;  3ZRW B;  1H8E G;  4AQY B;  1L8D A;  1JOY A;  1DF4 A;  1Y4M A;  1WAZ A;  2PYJ A;  4I7Z B;  4B3S B;  2JS3 A;  3SJA C;  5B1O A;  1FFX A;  4EKW A;  1V55 C;  3ZED A;  4YY3 B;  2P4V A;  5KX5 A;  4MVS A;  3JAL A;  1XHX A;  2IBZ H;  2MW2 B;  4R6Z A;  5LHH A;  2XAG A;  2HEP A;  4YHH O;  3CRQ A;  1BL8 A;  3FB5 C;  4DV6 B;  1Q90 D;  5LP6 A;  4DR3 B;  4I9Q A;  4MVM A;  3THO A;  5EC2 C;  3BA9 A;  1UJW B;  3T1H O;  1ZAU A;  2HHH B;  3ZHR A;  1PKX A;  4TV9 A;  3M99 B;  5E1A C;  4E2L A;  4OX9 B;  2OTJ V;  2HVK C;  4ZKI A;  1R1B A;  1SZT A;  4PV1 B;  3CD6 V;  1K33 A;  4DV7 O;  1YSC A;  3HKE A;  5FNV B;  4UCO A;  4DV1 O;  3HB3 B;  2JVD A;  2L35 A;  1QR8 A;  3VOU A;  2Y4T A;  1OCR C;  2PF4 E;  5F2V O;  4GT1 A;  4K8X A;  3K3W A;  5LMU B;  3ZMS A;  3ZRS A;  3RVZ A;  1B06 A;  4O4H B;  5EZY A;  2KKW A;  1YCI A;  3H9V A;  4FZ1 A;  4HAM A;  3B2E E;  1TUB A;  2QTO A;  4D7S A;  1GN6 A;  2DQ3 A;  3TET A;  1HNZ O;  3WFV A;  3E8G A;  3VQW A;  4J9Y B;  1WA8 A;  3CRM A;  5IYZ B;  2OCC B;  4DR7 O;  2B1I A;  4MSW C;  3NXS A;  4YJ3 B;  3OTF A;  2QM8 A;  1SES A;  4O2B B;  1GN2 A;  3JAW B;  3BPZ A;  4JTD B;  1N34 O;  3LNN A;  2WWW A;  1YJW V;  4JI3 B;  1K4D C;  4TQF A;  5JQG A;  1VQ8 V;  3RFR A;  3TJT A;  4RO2 A;  3SGI A;  4RQE A;  3KG2 A;  5KHJ A;  1SQF A;  2M6Y A;  4LC1 A;  3CJH B;  4NXM B;  4H44 B;  3AEI A;  3KKY A;  4NVP A;  1YIJ V;  3STL C;  1JFF B;  3CWB H;  2DYR C;  5LXT B;  4DK0 A;  4NR1 A;  1US6 A;  3ABL B;  3JAR A;  3L72 H;  2EIM C;  3K9S A;  4RUF A;  1J5E O;  4IYH A;  3ABT A;  2WLL A;  4AQY O;  5C8Y A;  1EZJ A;  4D7T A;  1H2G A;  4JI4 B;  3ETQ A;  1AB3 A;  2E75 B;  1S5H C;  2YI9 A;  4GLX A;  4XBF A;  4ZI7 A;  4CH5 A;  2B5U A;  1ZWI C;  4PEL A;  1N0J A;  2XHB A;  4LF9 B;  1VEW A;  2YIB D;  1SC5 B;  4JI1 O;  4H0L B;  4U3J A;  3CB2 A;  5B5E Z;  2KQX A;  1SS3 A;  3G80 A;  1N36 B;  1K5Q A;  4DV6 O;  2EBO A;  4DR3 O;  4LFA O;  2F95 B;  1QLE C;  3AG2 B;  2HHH O;  1FFX B;  1Y66 A;  5IYB O;  5BZB A;  5CB4 A;  1HR0 B;  4MVR A;  3WG7 C;  3U0Z A;  5EBL C;  2RJZ A;  3JAL B;  3K04 A;  4LFC B;  5KA6 A;  3H1K H;  3D3I A;  4O4I B;  4KXR A;  3DSQ A;  1IDS A;  4KUM A;  3RYH A;  1RM1 C;  4LFB B;  5A2Q N;  2GTA A;  2QGN A;  1FD9 A;  5J2T A;  4Q6G A;  4X1I B;  4PDL A;  2F4V B;  3AG3 C;  2EIN C;  2ZR2 A;  4TV9 B;  2QKA A;  3T1C A;  4LF8 O;  3ZRV A;  2VWK A;  2LFS A;  1H8H G;  3CRC A;  3N2G B;  4GX0 A;  3RBZ A;  1AR1 B;  1I94 B;  1CPY A;  5JJJ B;  3S3X A;  4IT5 A;  3CSX A;  4JI0 B;  2ZNJ A;  4ABM A;  2WPD G;  2IU0 A;  2DWD C;  1AI6 A;  1VMG A;  3GB7 C;  3RWR D;  4WCE V;  3JSN A;  1PV0 A;  2UUA O;  4FLT A;  3BVO A;  1WJZ A;  2LFR A;  5J9P C;  1KU9 A;  1K34 A;  3OTO B;  1R3J C;  3HR0 A;  3B77 A;  5EZY B;  4UUJ C;  4JTA B;  3JAM N;  4JI3 O;  3S3W A;  1I0H A;  2PGG A;  3TCU A;  5LOV A;  4NTX A;  3ZMZ A;  2NN4 A;  2ZXW C;  4I4T B;  3BAB A;  4FIP C;  1WA8 B;  3ASN B;  1K5S A;  5LGU A;  1WP7 A;  3CCS V;  3F5T A;  2OT5 A;  4X62 B;  4GX1 A;  2PUS A;  4KHP O;  4Z2W A;  1WB8 A;  2ZIO A; 
#chains in the Genus database with same CATH homology
 2X6A A;  2XAF A;  2AHY A;  4MVO A;  1YJ9 V;  1NBM G;  4MVQ A;  1QR9 A;  2R9R B;  4WFA V;  4UXN A;  3LSS A;  2IH1 C;  1EFR G;  5CBG A;  3JD0 A;  1F4M A;  1V54 B;  3HPL C;  3OMN B;  4N23 A;  3ZMV A;  3FB6 C;  3B8M A;  4KFM A;  3MHS C;  4FK5 C;  4X89 A;  3PJS K;  1YJN V;  4FJC C;  2WLI A;  1MG1 A;  3OMA B;  4MS2 A;  4PA9 A;  2X6C A;  2F43 G;  1JQ0 A;  4PA6 A;  3SPH A;  5CA3 A;  2A9H A;  4KP4 A;  4WFF A;  3SYP A;  5LBQ A;  1FXK B;  1S3J A;  4UVA A;  1GM7 A;  1NKD A;  2IJK A;  1N8R W;  3CMA V;  3AG1 C;  3ZJZ A;  1R3L C;  3OEE G;  1Q86 W;  2XAJ A;  5CN0 A;  1JX9 A;  4I5S A;  4UVC A;  4L87 A;  2DYR B;  4JGS A;  1NJI W;  2Y69 B;  2HLD G;  1E79 G;  1JPX A;  4PA4 A;  4ASU G;  1AI4 A;  2HR3 A;  1ORQ C;  2P90 A;  3B8N A;  3LDE A;  1YIT V;  2XOK G;  4MTO A;  4RAI A;  1VQ6 V;  1OCO C;  1YHQ V;  4FMT A;  1ENV A;  3BEH A;  4MW8 A;  1AJN A;  2ITC C;  4TSF G;  3T4D A;  3UM7 A;  1KQS U;  2WLM A;  3E8B A;  4FPP A;  1NVP D;  1NH2 B;  3SYO A;  1K4C C;  3ZIA G;  4H37 A;  3K9A A;  5L3D A;  5DM6 V;  4MTG A;  3OW2 U;  2DYS C;  2V1D A;  3GWO A;  4WFH A;  3W7W A;  3H01 A;  1RPR A;  2Z5U A;  5C93 A;  2JJ2 G;  2HFE C;  1GK9 A;  4MVU A;  1QVG U;  1M57 B;  5B3S C;  4Q20 A;  2K1E A;  3W7U A;  2Q6A A;  4U7O A;  5IY5 C;  5H9C A;  3JYC A;  1DTO A;  5EC1 C;  1VQ4 V;  1F4N A;  1KP3 A;  3ETD A;  1P4R A;  4U7N A;  4UVB A;  1NQT A;  3LDD A;  4TT3 G;  3LUT B;  1OCC C;  3AG1 B;  4MTX A;  5IYD O;  4QNH B;  3A0R A;  1QVF U;  3QNE A;  4JAS A;  1RM1 B;  1P7B A;  2WLK A;  5KUK A;  5B1B C;  1BMF G;  1ARO P;  3W7T A;  1BHB A;  5H6R A;  4QE7 A;  2Q67 A;  2EIJ C;  3SPG A;  5B1A B;  2P7T C;  1AJQ A;  1PD3 A;  4XDJ A;  2JEU A;  4OXS A;  4QJF B;  1KD1 W;  3AG4 B;  2QE7 G;  3SYC A;  4JF3 A;  2JEX A;  1K92 A;  2IW5 A;  3I56 V;  3EHB B;  4BIU A;  1ROP A;  4WF9 V;  3F5W C;  2GHY A;  3ZRW B;  1AI7 A;  1H8E G;  2XAH A;  4XDK A;  3LSQ A;  2DWE C;  4RQF A;  2DYS B;  1JOY A;  1DF4 A;  1Y4M A;  2ZR3 A;  1K3E A;  5B1O A;  3SJQ C;  1DF5 A;  4EKW A;  3I55 V;  3JD3 A;  1V55 C;  2NNU A;  1VQ7 V;  3DTU B;  5LHG A;  3K03 A;  3SPI A;  1S0V A;  1K97 A;  3STZ C;  2WSS G;  2Y48 A;  4MVS A;  4R8C A;  3G71 V;  3E8H A;  2W6J G;  5EBM C;  3LDC A;  1QBZ A;  5HFM A;  3E86 A;  1HWY A;  4R6Z A;  5LHH A;  2XAG A;  2XAS A;  1GO3 F;  3RW0 A;  1BL8 A;  3FB5 C;  4CZZ A;  5CBF A;  4MVM A;  5EC2 C;  3IGA C;  1UJW B;  3CC2 V;  4PA7 A;  1M1K W;  1GM9 A;  4G2K A;  2OCC C;  5LGN A;  1PKX A;  1Q7Y W;  4N21 A;  4J9Z B;  1VQ9 V;  3OM3 B;  2UXN A;  2OTJ V;  3LNM B;  3OAA G;  3E8F A;  1GMG A;  3M99 B;  3OR7 C;  2EIJ B;  3MD0 A;  4JTC B;  1K73 W;  1F23 A;  1KKD A;  1MAB G;  3JD2 A;  3ASO C;  1GTO A;  2FTK A;  2WAM A;  2Z3Y A;  2HVK C;  5E1A C;  1SZT A;  2C2A A;  4E2L A;  2EZO A;  4ZKI A;  2ZXW B;  2W6I G;  5L3C A;  3K79 A;  1SET A;  2HG5 C;  1OZ0 A;  3CCU V;  1K33 A;  1S77 D;  3CD6 V;  1W0J G;  1R6K A;  1YSC A;  4JAV A;  3VBB A;  4PA3 A;  3HB3 B;  1THZ A;  4HZ3 A;  4MW3 A;  3K08 A;  2QKS A;  1QR8 A;  1FXH A;  2EIL B;  1NR7 A;  1OCZ C;  3VOU A;  2IJI A;  3P32 A;  3ZMU A;  1OCR C;  1S72 V;  2JDI G;  2H8P C;  4GT1 A;  4YXW G;  3OEH G;  1NVP B;  2EIK C;  3ZCC A;  1AJP A;  2LP7 A;  3IFX A;  2WLI B;  3K3W A;  3FYE B;  4PDV A;  3ZMS A;  3OE7 G;  4UV8 A;  3ZRS A;  5KA5 A;  2A79 B;  4MT8 A;  3RVZ A;  4LP8 A;  3ABL C;  3QO8 A;  2EJR A;  3OUS A;  3OFN G;  2W0F C;  1NH2 D;  3CXC U;  3CC7 V;  1VQO V;  3G4S V;  4P9P A;  3ASN C;  1L1F A;  4R7C A;  3ETG A;  4HAM A;  5GW7 A;  2QTO A;  3ABK C;  3T4Z A;  2DQ3 A;  1JVM A;  4LCU C;  3TET A;  2NLJ C;  1M56 C;  1YTF D;  2IJJ A;  3QO5 A;  3WFV A;  1SER A;  2B1G A;  3E8G A;  3CC4 V;  4J9Y B;  1K8A W;  1R3I C;  2OCC B;  2B1I A;  4MSW C;  3NXS A;  2WLJ A;  2QM8 A;  1SES A;  4JTD B;  3SYA A;  1KC8 W;  3ASO B;  3T2M A;  2WWW A;  2X6B A;  1YJW V;  2QA4 V;  2QEX V;  4MVZ A;  3OGC C;  3CYO A;  3CCV V;  1OCO B;  1MOF A;  1V54 C;  3EFF K;  1K4D C;  4JYC A;  3CPW U;  2EZP A;  5L3B A;  4WFB V;  3CCR V;  1VQ8 V;  2GSM B;  4PDR A;  4RO2 A;  2IU3 A;  2JJ1 G;  4RQE A;  1DLB A;  3KG2 A;  3AG2 C;  3X2Q C;  4QE9 A;  4LC1 A;  4UV9 A;  2P6J A;  4JYB A;  3AEI A;  3K0G A;  2XAQ A;  2QM7 A;  5LGT A;  1F51 A;  3CCE V;  1FXK C;  4X88 A;  3TK1 A;  1GKF A;  1YIJ V;  3STL C;  1E1R G;  2XND G;  1JCH A;  1KEC A;  3ABM C;  4Z1M G;  1W0K G;  5L3F A;  1R73 A;  3OUF A;  3OR6 C;  1VQM V;  4F4L A;  1I5Y A;  4PDM A;  2DYR C;  3CME V;  1OHH G;  1K7D A;  5EBW C;  3ABL B;  5B3S B;  1FXK A;  2EIM C;  3ABU A;  1R3K C;  4RUF A;  5FL7 G;  5HFL A;  4ZBM A;  4CBC A;  3ABT A;  5IY5 B;  2WLL A;  4HYO A;  5EK0 A;  3E83 A;  2X0L A;  3ABK B;  2UXX A;  1EZJ A;  1R6N A;  1M56 B;  2JK5 C;  1H2G A;  2JIZ G;  4I9W A;  1YI2 V;  1S5H C;  1IXM A;  2WLN A;  1OCC B;  2BOC C;  4XDL A;  4XBF A;  3R65 A;  1K9M W;  2B5U A;  2MK3 A;  1ZWI C;  3OMI B;  1G4Y B;  2PI5 A;  4PEL A;  2ATK C;  1VQ5 V;  2IJH A;  5H6Q A;  4DXW A;  1KP2 A;  3FKS G;  5B1B B;  5L3E A;  1FFT B;  2R9I A;  1TUE B;  1M57 C;  1Q81 W;  2OTL V;  2DW4 A;  1K5Q A;  2EBO A;  1PNL A;  2KB1 A;  1NR1 A;  1SRY A;  1QLE C;  3AG2 B;  3K0D A;  4BIZ A;  3X2Q B;  1COW G;  5BZB A;  1Y66 A;  3UKM A;  5IYB O;  4WFG A;  2IH3 C;  3SPC A;  4G27 B;  4WFE A;  2ZQM A;  1QLN A;  4MVR A;  3WG7 C;  1FXV A;  2YEV A;  3ETE A;  3ABM B;  2CK3 G;  1FS0 G;  5EBL C;  2WLL B;  1CEZ A;  3K04 A;  5KA6 A;  3D3I A;  1XL6 A;  3JD4 A;  1VQL V;  3E89 A;  4KUM A;  3IC7 A;  1RM1 C;  1WLE A;  3G6E V;  3FB8 C;  1V55 B;  3SYQ A;  4JAU A;  3SPJ A;  2EIM B;  4P2Z A;  3CCL V;  4MTF A;  4GCZ A;  3ZN1 A;  3JD1 A;  3RVY A;  2X7R B;  5B1A C;  4DO2 A;  4QPJ A;  3CP1 A;  1RPO A;  1I5X A;  2Q69 A;  3AG4 C;  1S76 D;  1AI5 A;  4PDL A;  1M90 W;  3AG3 C;  3E2E A;  2EIN C;  2ZR2 A;  3T1C A;  5IYC O;  3F7Y C;  2DQ0 A;  5KUM A;  2H94 A;  3ZRV A;  2PI4 A;  5LHI A;  2YSU B;  1PNM A;  2WLH A;  2AHZ A;  2LFS A;  1H8H G;  4GX0 A;  3RBZ A;  1AR1 B;  3ML0 A;  4RUE A;  4BW5 A;  1PL0 A;  1CPY A;  2HKO A;  1YTF B;  1B6Q A;  1LNQ A;  4X8A A;  4P9O A;  3CCQ V;  3QO7 A;  4GX5 A;  1H38 A;  3F7V C;  3MHH C;  1CP9 A;  1VQP V;  3ZRW A;  1BHA A;  1J95 A;  2WPD G;  2IU0 A;  2DWD C;  1M9N A;  2YEV B;  1AI6 A;  4G28 B;  3JCZ A;  4JPR A;  3GB7 C;  4QPK A;  1Q82 W;  1QLE B;  4WCE V;  4BAY A;  5IDJ A;  5B1N A;  4H33 A;  5DN6 G;  2M7W A;  3CCJ V;  3W7X A;  3WG7 B;  4GX2 A;  2LFR A;  3K06 A;  5J9P C;  3P30 A;  1K34 A;  1OCZ B;  1OCR B;  1R3J C;  3DGE A;  3ZRX A;  3B77 A;  2ITD C;  4UUJ C;  1VQN V;  4JTA B;  1E1Q G;  5CMU A;  2A0L A;  1EBO A;  1XL4 A;  3ZN0 A;  2D3O W;  2EIK B;  4LBE C;  2P67 A;  4P30 A;  3ZMT A;  2ZDI C;  1GM8 A;  1WPX A;  3TCU A;  4QIW F;  2Y69 C;  3ZMZ A;  2ZXW C;  3FB7 C;  4FIP C;  1G8M A;  3AG3 B;  5CBH A;  3ASN B;  2EIN B;  2BOB C;  3BY6 A;  4R50 A;  5L3G A;  1K5S A;  2ZDI A;  2HVJ C;  5LGU A;  3CCS V;  1MSW D;  4TWK A;  2OT5 A;  3W7S A;  2ZD9 A;  1W2B U;  3D36 A;  1QCE A;  2EIL C;  4GX1 A;  1VQK V;  3CCM V;  2Q68 A;  1JJ2 U;  1PNK A;  2HJF C;  3E35 A;  3FYI B;  2V7Q G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...