3CCEV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cceV00
3CC2V 1R73A 1VQ7V 1JJ2U 4WFAV 3CCEV 2QA4V 1VQ6V 1N8RW 4WF9V 1YI2V 1VQ8V 3CC4V 1Q81W 4WCEV 3CC7V 1Q82W 1K8AW 3CCUV 3I56V 1YITV 3G6EV 1KC8W 2OTLV 1VQMV 3CCRV 1VQ5V 1YJNV 1QVFU 1VQOV 1Q7YW 2QEXV 1M90W 3CPWU 3CMAV 1YJWV 1VQPV 2OTJV 3CCSV 3I55V 3OW2U 3G4SV 3CXCU 3CMEV 1NJIW 1W2BU 1VQLV 1S72V 1YIJV 1QVGU 3CCMV 1Q86W 3CCLV 4WFBV 1YJ9V 1K9MW 1KQSU 1VQ4V 2D3OW 1M1KW 1VQ9V 3CD6V 5DM6V 3CCJV 1VQKV 3G71V 3CCVV 3CCQV 1VQNV 1K73W 1YHQV 1KD1W
chains in the Genus database with same CATH superfamily
2O57A 1O9HA 1R3JC 3Q4HB 4GKJB 2WWWA 1KP3A 1F4NA 4MT8A 4DUYO 3DXRB 3OW2U 1CEZA 1QVFU 3SPGA 1K4DC 4X65B 5CA1B 3E22A 2JGDB 1EN6A 4LF9B 3HR0A 4MVMA 1EZVH 2CAZC 5KHGA 3CC2V 2E76B 3SJQC 2WLJA 4W4KA 2VWJA 4P2ZA 4TQFA 3BA9A 3F5TA 4J10A 2B5UA 2Q7EA 1FFXA 1B04A 1FFXB 3S3WA 3LDDA 1QLEC 1W0KG 2ITDC 3AG4C 1DK1A 4UCSA 4J7KA 2M7WA 4PA6A 4FFBA 1DTOA 4X62B 5ITZA 2ADQB 1NTKH 1G1XB 4F6EA 3JALB 5BR8O 2Y4UA 2HKOA 4X64B 2RQ6A 4MVOA 4P9OA 4NXNO 3G6BA 4DR1B 1R73A 4EFBA 4JTCB 3FB7C 1PL4A 4DXWA 3BABA 3ASOC 4MTFA 2D2CB 4BIUA 4UCOA 1R1BA 1BHAA 1KUQA 1YJNV 3RBZA 1QBZA 1J5EB 5LYJA 3OTFA 1OV9A 1HNZB 3CCJV 1KYOF 1N0JA 4XBFA 5EC1C 2Y69C 4K8XA 5D5PA 3B2EE 3CRMA 5IYZA 1OCOB 5H6RA 1I5YA 4GLXA 2DQ0A 5JWPA 4O4LB 3W7XA 2XAHA 1D2DA 4JI7B 5LOVB 2OTJV 3TXQA 2OT5A 3LNMB 1NVPB 4J7JA 4DV2O 1K33A 1UFIA 4FK5C 4JI2B 3K79A 4IHJA 3E35A 4GX2A 1SRYA 3F5WC 3RVZA 3ZRVA 2PYLA 1ZX3A 1YSCA 1GRJA 5IY5C 2MK3A 4E2LA 4BR6A 4LFCB 3K57A 2DWEC 1ZL8B 2BOBC 4K0KB 1IXMA 3K08A 4LNUA 1EM1A 4H0LB 4JTDB 5BMVA 3IGAC 2EZPA 4EKWA 3E8HA 4DR6B 3FB6C 1WAZA 2Q0OC 4LFAB 4DV7B 2HJFC 3JD0A 3L72H 4FLWA 4J42A 3OFNG 3CMAV 1PNKA 4GUNA 1VQ4V 4CC6A 5J2TB 4B3MB 1ZSPA 2FL4A 4EFEA 3L75H 4UV9A 1IURA 5EBMC 2UXCB 4X66B 4DR3O 1NT2B 2UUCB 1P7BA 5L3CA 1BQ0A 3H9VA 4L87A 4JAAA 2JIZG 3C90A 4JI5O 1GO3F 2QM7A 3AG1C 1I94B 1RSOB 2QJ1A 4J7ZA 5DM6V 4PI0A 4I5SA 2Z5UA 2Q68A 3UQ8A 2GUZB 1JMKC 5KMGA 2AZ0A 3MHSC 2UXDO 3T2MA 3VQWA 1AP6A 3ZHVA 1A32A 4FFKA 5LGUA 4G2KA 3H01A 3OT7A 1QR8A 3P30A 3D36A 2A3QA 1KP2A 3ABTA 3BVOA 4UXNA 3RWRD 3RN4A 2H94A 2LW1A 5GTIZ 3SPIA 1K7DA 1XHZA 1BSMA 3ZMUA 1KB9F 4X88A 3NXSA 1R6TA 4B3RO 5DECA 1R3LC 3CC7V 4CS3A 3K04A 1Q3EA 1IX9A 2YI9A 4L8JA 5H5NA 3JATA 5KHJA 2ZNIA 1Y74A 1JA8A 1QQCA 3K58A 3RYIB 2F4VB 5AG2A 3FB8C 2EX3A 3CCVV 1IDSA 3K5MA 3AG7A 4FFBB 3AG2B 4WBNA 5LA6B 5LXTA 3BEHA 5KA6A 3ASNB 3TGUH 3J80N 4KXRA 2VQFO 3CJHA 5K1XA 4LWSB 2EIKB 4O4HB 4RQFA 2Q8VA 4PDMA 2Q7HA 2EJ7A 1GKFA 4GCZA 2Q9LA 4CZZA 5JJJB 4J11A 3JD1A 1I5XA 5C93A 4E4EA 1D5AA 3X2QB 2E5LO 2EINC 1QLNA 4PHZA 1Y76B 2A9HA 1M56B 4UCVA 3O9OA 4PELA 2ATKC 2JS3A 1KECA 2VWKA 4D6TH 5B1NA 4JI8B 4IHJB 1QVGU 1VQ9V 2IJHA 4DR5B 5CA0A 2YS8A 3AEIA 2XT9A 3P3PA 1VQ7V 3K0GA 1IXBA 2ZT9B 4ZBMA 5BXZA 1WPBA 3H1HH 1ROPA 3UO3A 2R72A 3WB0A 5BMVB 3CSXA 2WLMA 2W6JG 1XNQB 3APOA 1ZL8A 2HR3A 5L3EA 3D3IA 4ZOLB 4LF6B 4MTOA 1P49A 4NXMB 4U3JB 1P84F 4WFGA 2QSAA 3ICXA 3JAWA 4BW5A 4OXSA 1NKDA 4YY3O 4QGPA 1AVMA 1H2MA 5CBGA 4X1YA 1HDJA 1EBOA 3ABLB 3OUFA 3UKMA 4PDRA 4JYCA 4QPKA 4NR1A 2JS5A 2QE7G 3CCSV 3TK1A 2UUBB 1JCHA 4PA7A 4IT5A 2A79B 2YEVB 1R3KC 4J41A 3G71V 1RFYA 2Q6AA 4I4TA 3CCEV 3T1HB 1IBMO 1G6UA 1BMFG 4O2AA 4OX9O 2WLHA 3G6EV 3ZIAG 2ADPA 4LFBB 3MDSA 1XBLA 1ZTEA 3AG3B 1SA0B 2VQFB 3CX5F 1LR1A 2ZE8A 4EB6B 4AQYB 1MZFA 5KX5A 4DK0A 2YC0A 1UJWB 1H8EG 1YTFD 1BQZA 4XDLA 5JQGA 2JEXA 3CEIA 4R6ZA 4X9QA 1I7FA 2F1MA 1YJWV 4DUZO 4R8CA 4RWUA 1Q43A 2YUAA 4B3TB 3QNEA 2ZINA 5IJ0B 3JAKA 2RN9A 1XMOB 2LFSA 4UVAA 3JSLA 4DV5O 3OR7C 1XNRB 4MVRA 4PD4F 2LP7A 4DRXB 1IBLB 1M5IA 3D8CA 1WB7A 4B7EA 4K8ZA 1S5LZ 2IH1C 5FL7G 1PPJH 4OPHA 2XASA 2PGGA 1Q90D 1URFA 1PD3A 2CK3G 2ETNA 3VQXA 5JVDB 2RMKB 4KFMA 3X2QC 4UB8Z 3HKDB 2NLJC 4FLXA 5CMUA 1Q82W 3JATB 2WLIB 4B3TO 3KCXA 1XNQO 2EIKC 3FYIB 4GKKB 4OPAA 5L3GA 4RAIA 3ASNC 4LF4B 1DF4A 3W7WA 1R6KA 1XOUA 1MABG 2P90A 3AG2C 3ZRSA 1KBHA 3E8BA 4HYOA 2UXCO 1D5NA 4QNHB 4P9PA 1NTZH 2OYQA 3OGIB 4AQYO 4I9WA 2M6YA 4JI8O 2EIJB 2XAGA 3HB3B 5EBWC 2GHYA 4CH5A 4PDLA 2IJIA 2XOKG 2F66C 1FXKC 4D7TA 4NYKA 4X1IA 5C8YA 2CTQA 2XAFA 1LUVA 4X8AA 2XUMA 4CH3A 1RSOA 3ETQA 4IIJA 3IAYA 2QWPB 4JI1O 3SPCA 3ZEDA 4QE7A 2UU9B 5LMNB 1P7GA 2ZE5A 1VQMV 3ZHSA 1Q6IA 2NN4A 5CB4B 1GM9A 4O4IB 3RVYA 2GBOA 4DV0B 3RFRA 1H38A 2AW9A 4DR7B 3BHPA 4TV8B 4LP8A 1OZ0A 4IYIA 1TAEA 4MVZA 4H44B 3BPZA 3E83A 3HKBB 2YXLA 4GKKO 4JASA 4F4LA 2QKCA 1I94O 1XL6A 3A8TA 3CS5A 1Q86W 1XMQB 3HKEA 3EHBB 2VS0A 1M57B 1X59A 5EK0A 5IWAO 1SZXA 1TGOA 4O4IA 3DGEA 5J2UA 3J81N 4R7CA 1XL4A 3E86A 2OCHA 2YICA 3A0HZ 4WBNB 5E79Z 4B3SB 4IIJB 4DR4O 4GT1A 4YIOA 1SF9A 4B08A 1SKVA 4DR2B 4H37A 2AXTZ 2IU3A 3IJ4A 3APQA 2NR5A 4FM2A 4KHPO 4CS4A 4JI0O 1WN7A 1H8HG 4HZ3A 1VQ5V 2K9PA 3GWOA 3RYHB 3RYFB 4ZIBA 4X66O 2UUAB 3SGIA 2LGQA 2ZR3A 1PL0A 2Q4PA 4FVMA 1XHXA 4YXWG 2WA4A 4JI2O 1AI7A 3THOA 4TV9A 1SQBH 4LCUC 1LNQA 2B1GA 3OD4A 1AJNA 1JOYA 4DV7O 1R3IC 3ZHTA 2V1DA 5LBQA 3M8AA 1ZLZA 3ABMC 1WJZA 3FX7A 1OCOC 4JI6O 1NI8A 1M4UA 4FLYA 2CH7A 2Y69B 3MD0A 3WG7B 2WLLA 2KQXA 1N0NA 1KC8W 1S5JA 2ZE6A 4I0XA 4X65O 3STZC 1G8MA 2IJJA 2P6JA 3N27A 1PV0A 3LSSA 4JAUA 4KUMA 5EZYA 2BE3A 2Y48A 3T4ZA 5JCOC 1GK9A 2VQEB 4UVBA 4DV6O 1SQFA 1S0VA 4WFAV 3RYHA 1YTFB 2N74A 4J9YB 1Z5VA 4LWSA 1NQTA 5TISZ 4LF6O 1QHTA 4O4LA 1NZ6A 4YJ3B 2PI4A 4JI5B 4B3SO 3ZRXA 3LNNA 3N2GB 4U3FH 2HVKC 4EB6A 5CB4A 2JK5C 2CGNA 3KCYA 2CTRA 4TSFG 3H1IH 4DV3B 4B3MO 3ABKB 3K5LA 2P4KA 5FPOA 4JV5O 1V55C 3K5OA 1SQGA 2UXXA 4O4JB 4X1IB 4U7NA 3CRAA 2WLNA 2LQTA 3BCCH 4RQEA 4PA4A 5D5QA 1ORQC 3EFFK 2X0LA 1Q6UA 1HR0B 3BFRA 1RPRA 1SS3A 4I4TB 2ITCC 1H2SB 4HBNA 5FLXN 2ZNJA 2Q73A 1TUBB 4MVSA 4DUYB 4MS2A 1TUBA 2WA3A 3CP1A 1XILA 1B3QA 1DLBA 4U7OA 1Q81W 3GVMA 2YDEA 3P32A 3GWKC 3PJSK 5A2QN 3K59A 3K03A 1TA8A 2HP8A 5EYPB 5GONA 1XUQA 3HKDA 3SJCC 4QE9A 1WLEA 2DYRB 3OEHG 2Q7GA 2P4VA 2KSDA 4I55A 2A0LA 5CA0B 4UUJC 3SYQA 1F7YA 4LF8B 4FM0A 2QTOA 3UCSC 1YDXA 1YF2A 1SA0A 4A5UB 2AHYA 1JR9A 4P30A 1HNZO 3UM7A 3CRRA 4LH7A 1R6NA 1FJGB 4ASUG 2EZOA 1YCIA 1K3EA 5J9PC 3OAAG 1EN5A 2IH3C 2F93B 2UXNA 2PUSA 4X20B 2YIBA 3R65A 1HNXB 1YHQV 1FD9A 1US6A 3JALA 3QVNA 3FFQA 2WAMA 4NXNB 3CJHB 3FYEB 3CHXA 3CRQA 2H8PC 2PTMA 2OTLV 4XDKA 3VOUA 3FAVB 1BS3A 1BHBA 1WA8B 1FXVA 1AJPA 1EZJA 4PV1B 1SC5B 3WB1A 5LMUO 1GH6A 1V55B 4FJCC 1XI1A 3ABKC 5EZYB 4F6RB 2ZXWB 3K9SA 1JJ2U 4CH4A 1XREA 2ZM6B 4R50A 1RP3B 1H2NA 1GN3A 4YHHO 1Y4MA 3AK1A 4DV4O 2JEUA 2EULA 2JJ1G 2OCCC 3JAWB 1IBKB 2UXBB 3BRCA 3JD2A 1S77D 4DUZB 3CD6V 4NKGB 1Y74B 3QG5A 1HNWO 2LO1A 2Q5ZA 1PNMA 3KZIZ 4C7UA 3HPLC 3I5DA 1SQXH 4DR7O 5LXTB 3QTCA 3CCRV 4JYAB 4O2BA 5J2UB 4DV0O 4JF3A 3TCUA 2GSMB 3LSUA 4MW8A 1LUWA 4XDJA 2XHBA 1FJGO 2HEPA 3SJAC 3M7MX 3W7SA 3OMNB 3D36C 4GX0A 3OTOO 2AZ2A 5J2TA 2UU9O 3WG7C 3H1LH 4LF8O 4KHPB 1L1FA 1VF5B 1JVMA 2EIMC 3ABMB 2N04A 4JI3B 1VQOV 5C8YB 1X4TA 1SQQH 4GYCB 5EC2C 3ZHQA 1YJ9V 1VEWA 1QU7A 4JI4O 4YHHB 5CA1A 5F2VO 5K1PA 2Y4TA 1NVPD 1N33B 3A0BZ 1G4YB 3OMAB 4X1YB 2N05A 4X1KA 4LF4O 4PJ0Z 4X1KB 1P4RA 4PI2A 5JJNB 1AP5A 5LMUB 3QO7A 1FS0G 4LF7O 5HFMA 3ZJZA 3JAKB 1FXKA 1RPOA 3UT5B 2LJ2A 3OE7G 4Q6GA 1K92A 4J80A 2IM9A 2DQ3A 4JYYA 3G67A 4DV6B 4O2AB 1YITV 2VQEO 2QM8A 2QDOA 3LSQA 1YVWA 3SPJA 2XAJA 3AK3A 1N32O 2E75B 3OM3B 3JASB 3JARA 1N33O 4YJ2A 1OHHG 4ZOLA 2FKXA 3CB2A 3S3XA 1KKCA 3K9AA 2QKAA 5JH7A 2E5LB 3GB7C 4UVCA 4Z1MG 1XMOO 1M57C 2ZD9A 3WU2Z 1MMMA 2DOSA 2ODMA 2XAQA 1S76D 3ETEA 2XNDG 4UCRA 1MOFA 1YXBA 2QR4A 4K35A 1MNGA 2JGDA 2HHHB 2Y0PA 4FZ1A 1AI6A 3ETDA 4JZ2A 1OCCB 1BL8A 4I9QA 2QM4A 4FPPA 2GUZA 4J9ZB 1KMIZ 4DYLA 2HLDG 3HKEB 4GKJO 2IJKA 3UO2A 4JI0B 1N34B 4OX9B 2JRIA 1HNWB 1VQ8V 1OCRB 2GTAA 1K97A 3NR7A 2R9RB 3HKCA 5DEDA 1FXKB 3UT5A 1QR9A 1GMGA 4N23A 2DJVA 4TOIA 3SYCA 1N36B 5KLVH 3JCUZ 1SERA 4DR4B 2UUBO 3I55V 1QCEA 3CCMV 2EIJC 1I0HA 3L71H 4UCUA 1VF6C 1M93A 2AHZA 1YI2V 4DV5B 2ZDIA 3SYOA 1ZAUA 4CH6A 3FD9A 2F43G 4ZI7B 1YZBA 3HKCB 3T1CA 3EVKA 2WSSG 2Z0AA 2CTPA 1GM7A 2CE4A 4FLTA 2R9IA 4BAYA 4LF5B 3MAQA 2DYSB 1GAXA 1HP8A 2C2AA 1VF7A 2PZSA 2E3CA 4BW9A 3ABUA 1Y6XA 2EILC 4CBCA 5LHIA 3N2KA 3U0ZA 3BY6A 4LFBO 1N36O 5H9CA 3OUSA 2AGAA 2YXHA 5BZBA 1W0JG 4JI6B 4I7ZB 1O9GA 4LH6A 5B1AC 1K34A 2YIAA 1ZWIC 3CCUV 3ETGA 5KHHA 2B9ZA 3E89A 2HVJC 4JYBA 1SQPH 2Q69A 2HFEC 1Q5OA 4TUYA 5KUMA 2EBOA 4QPJA 4FZ0A 1K5SA 4FLZA 3QO8A 1BT8A 3JASA 2CUGA 3ZN0A 3ZMTA 4DRXA 4IYHA 4KP4A 4H13B 3D3QA 5BY1A 5IJ9B 3OEEG 2FB5A 3AG3C 1T5EA 3F7YC 3RYCB 1COWG 2JDIG 2P06A 1DF5A 4JI1B 2V4DA 3RYCA 4DW0A 2NNUA 1GM8A 1NS1A 2QWRB 3T1HO 4DR2O 2VRZA 1L8DA 5DN6G 3TJTA 3ZCCA 3CYOA 4FLUA 2Y0IA 2IU0A 4MVQA 4H33A 3ZHRA 1Q8IA 3ABLC 2FYUH 3CRCA 1WA8A 2DW4A 4YY3B 5CBHA 1AR1B 2BCCH 3ZBHA 1SZTA 5IWAB 1XMQO 1PM9A 2BTQA 1F23A 5BR8B 1FPOA 1MSDA 3U11A 2PI5A 1Q6HA 1TVKA 1Y67A 4I50A 5KHIA 3CCQV 5LHHA 2A7WA 1PKXA 2Q67A 2G38A 1S3JA 2IW5A 4JPRA 3A2FA 3TETA 4RO2A 2F4VO 3T1YO 4MVUA 4QJFB 5EBLC 4JI4B 3WFVA 4QIWF 2LFRA 2X6CA 1F51A 3OGCC 1YIJV 5KAIZ 2EJRA 1M1KW 3J7AU 5LMNO 3OMIB 4TQDA 1M56C 1TUEB 5CBFA 5IYDO 2QWQB 4U3JA 2P7TC 2EINB 3JD3A 2W0FC 4X89A 5IYBO 3SR2C 4UCTA 1S5HC 4K0KO 3QO5A 3ZS8C 3SPHA 4WFFA 3QF7A 1PNLA 1AI5A 4LF9O 4B7KA 4LFCO 1BCCH 4TWKA 1VARA 1UPGA 2W6IG 2E74B 2DWDC 2RCVA 1FKAO 4F6RA 2RNBA 4I55B 4O2BB 4HNAA 2UXDB 5H6QA 2OIEA 4PA3A 1BGYH 1VP7A 2X6BA 2CH7B 1WP8A 3E8FA 3H1JH 2LW7A 1SETA 1FYJA 4FLVA 3ZRWB 1H2GA 2HG5C 3RW0A 4ICGA 4X20A 1V9PA 5CN0A 5ITZB 4Z2WA 3ZN1A 5EYPA 2ZM6O 4WCEV 4D7SA 1E1RG 5IYZB 3C3TA 1GN2A 2RDCA 3T1YB 3F7VC 5IE9A 1W2BU 4BWAA 3B77A 3W7TA 2ZQMA 4AILC 3T4DA 3B09A 1IBLO 3SDLA 4YIPA 1Y66A 2LGWA 2ZKOA 1E79G 4W4LA 1NR1A 2ZCEA 2YI8A 1VMGA 4AI8A 2QWNB 3AG1B 5JH7B 1DGSA 1YEWA 3CXHF 5LL6Y 1L0LH 3CC4V 4X62O 1SESA 1E1QG 2YIBD 4LF7B 2ARHA 3AK2A 3B8MA 4NTYA 2BTOA 3K0DA 2R9AA 4O4JA 1WP7A 2ZE7A 5IDJA 4FM1A 4MTXA 3LDEA 1XQ8A 1CP9A 4DR5O 1EN4A 3L9DA 2HHHO 4GZRB 3ZMSA 3FB5C 1IZ3A 3N2GA 2GTSA 2DMXA 4N21A 5KUKA 2X7RB 2BSKB 1HW7A 4ABMA 5B1AB 4JI3O 1FXHA 4G28B 3L73H 4UB6Z 4B3RB 1JQ0A 3FKSG 1AB3A 3ZX6A 2A06H 3MHHC 3CWBH 3SYAA 3I56V 4BIZA 3HKBA 1AI4A 1VF6A 5IY5B 3R66A 4PDVA 2WLLB 5B1OA 2R70A 1CPYA 1CXZB 2EILB 3B40A 1J5EO 1VQKV 1WPXA 2HJDA 4LC1A 2F95B 1JFFB 3LDCA 1N8RW 3U10A 3TXSA 4JAVA 2BTQB 4I0XB 3ZMZA 3JYCA 1K8AW 2DYSC 4NTWA 5FNVB 4DV2B 2QTSA 1VIBA 3SYPA 2V7QG 4DW1A 3RT3C 2P5OA 2YSUB 3G4SV 4AHCA 1PP9H 2D3OW 4DV4B 2F23A 5KX5B 1BE3H 5HFLA 5KAFZ 3P3NA 3SJBC 2UUCO 3STLC 4ZHQA 5GONB 3DXRA 1NH2B 2CGOA 1MA1A 2CDYA 1MZEA 3DTUB 5JQGB 4UFZA 2QEXV 5L3FA 1M90W 2PF4E 4RUEA 4WFHA 4NB5A 3ASOB 4LFAO 1K73W 5LOVA 1KD1W 5IT9N 3L70H 1AR5A 3KKYA 1NTMH 1U97A 3G80A 1OCRC 3EXAA 4DR1O 3IC7A 2KG7A 4TV9B 2KG7B 5IJ9A 3ZHUA 1WNSA 4PA9A 1JFFA 4WFEA 3E22B 3A0RA 4JGSA 2YXYA 4GX5A 1OCCC 2OIGA 4FMTA 4FIPC 1NJIW 5A9GA 1JJOA 1AROP 1VQ6V 1F4MA 3AG4B 3FAVA 1QLEB 3PN1A 2L6LA 1NU1H 4YJ3A 3IC9A 5B66Z 3RGBA 3VQYA 1VQNV 3C3SA 1FAFA 3JD4A 2H3OA 1ENVA 2GV9A 4TT3G 1IBKO 1N4CA 1Z5WA 3IFXA 3LUTB 3DC6A 2ZIMA 5FPRA 2DN9A 2BSKA 1IBMB 2OWOA 2FTKA 1NBMG 5KHKA 1N34O 4O4HA 4NTXA 3W7UA 2B1IA 2DE0X 4ZI7A 1EFRG 2P22C 1S72V 4JYAO 5H2FZ 4ZHQB 2ILMA 1OJHA 3K06A 3RYIA 5IYCO 3WB2A 3ZMVA 2QA4V 1KKDA 4NXMO 5LGNA 2W0XA 5B3SC 5LP6A 2JJ2G 5LP6B 5FNVA 1M9NA 1K5QA 3B4SA 1Q7YW 2UXBO 1H2LA 4BIOA 1AR4A 3CXCU 5IJ0A 3KG2A 5JVDA 4TV8A 2BOCC 4UV8A 4JTAB 2MW2B 2K1EA 4DV3O 4JV5B 4RUFA 3JAMN 3JARB 1GN6A 4MTGA 3H1KH 1AJQA 1JPXA 4DK1A 2WPDG 4K3AA 5JJEB 1N32B 4HNAB 5JCOA 4OGQB 2L35A 5EIBD 4GX1A 1K4CC 3OR6C 1OCZB 3DC5A 1KQSU 1QNMA 2PYJA 1W59A 2JVDA 2EIMB 4G27B 1Z2GA 4CC5A 4WF9V 2IBZH 4X64O 2WLIA 1IVSA 5L3BA 3OTOB 2X6AA 4MW3A 1GTOA 1AILA 2ZIOA 1VQPV 1FFTB 5LA6A 3CMEV 5B1BB 5LHGA 4LR3A 4WFBV 1RM1B 3B8NA 3O65A 2ZDIC 2YIDA 1ZUQA 2QWOB 2RJZA 5EIBC 1V54B 1NR7A 3JCZA 3K3WA 1HR0O 4HAMA 3ML0A 4DO2A 3K5NA 3M99B 3E2EA 2PY5A 2GDSA 1THZA 4DV1O 4IGGA 3CE2A 4JI7O 4DV1B 2OCCB 1VQLV 4LNUB 4CS2A 2YEVA 1U96A 2ZR2A 2KKWA 5LGTA 1B6QA 2FMLA 4JZGA 1J95A 5E1AC 1SQVH 5LYJB 2ZXWC 1V54C 1MG1A 1H2KA 2JGUA 1XDCA 2QGNA 1RM1C 2UUAO 2Z3YA 5B1BC 3VQVA 1HWYA 3Q4HA 1K9MW 2XTAA 4LBEC 5KA5A 3DSQA 5KMGB 1XEQA 3L74H 5CA3A 3RYFA 4MSWC 3BA8A 2CTWA 1BZKA 4IL6Z 4LF5O 1HNXO 2KB1A 1L0NH 1WB8A 5L3DA 1JX9A 1OCZC 3CPWU 1MSWD 4DR3B 5GW7A 3BAAA 2Q0AA 4KL1A 4ZKIA 2WLKA 3N2KB 4EEQA 1TVKB 4I50B 3JSNA 4NVPA 1NH2D 3VBBA 1B06A 1XNRO 2QKSA 2P67A 3E8GA 1GN4A 1Y76A 5GTHZ 4Z1VA 4Q20A 5B5EZ 2DYRC 3CCLV 3ZRWA 4DR6O 1KU9A 5LP6C 4YJ2B 4TUYB 5B3SB 1I08A
chains in the Genus database with same CATH topology
5CN0A 1R3JC 2LFSA 4UVAA 3ZN1A 1PNMA 3OR7C 3HPLC 4WCEV 2WWWA 4MVRA 2LP7A 1E1RG 1KP3A 3CCRV 1F4NA 4MT8A 2IH1C 5FL7G 4JF3A 3TCUA 2GSMB 4XDJA 4MW8A 3OW2U 3F7VC 1W2BU 1CEZA 1QVFU 3B77A 3W7SA 2XASA 3SPGA 1K4DC 2ZQMA 3T4DA 3OMNB 3W7TA 4GX0A 1Y66A 1PD3A 2CK3G 4MVMA 3WG7C 3CC2V 1E79G 3SJQC 2WLJA 4KFMA 3X2QC 1L1FA 1NR1A 2NLJC 1JVMA 5CMUA 2EIMC 1Q82W 3ABMB 4P2ZA 2WLIB 1VQOV 3AG1B 2EIKC 3FYIB 2B5UA 5L3GA 3CC4V 5EC2C 1YJ9V 1SESA 1E1QG 4RAIA 3B8MA 3ASNC 1DF4A 3W7WA 1R6KA 3K0DA 3LDDA 1QLEC 3AG2C 1MABG 1W0KG 2P90A 3AG4C 2ITDC 3E8BA 3ZRSA 4HYOA 5IDJA 1NVPD 4QNHB 4P9PA 4MTXA 3LDEA 1CP9A 1G4YB 2M7WA 3OMAB 4I9WA 1P4RA 4PA6A 2EIJB 3QO7A 1FS0G 3ZMSA 2XAGA 1DTOA 3HB3B 5HFMA 3ZJZA 1FXKA 1RPOA 5EBWC 3FB5C 2GHYA 4N21A 4PDLA 2X7RB 3OE7G 5KUKA 2IJIA 2XOKG 2HKOA 1K92A 4MVOA 4P9OA 1FXKC 5B1AB 1R73A 1FXHA 2DQ3A 2XAFA 4G28B 4X8AA 1JQ0A 4JTCB 3FB7C 3FKSG 4DXWA 3SPCA 4QE7A 3MHHC 3ASOC 4MTFA 3SYAA 4BIUA 4BIZA 3I56V 1YITV 2QM8A 1AI4A 3LSQA 1VQMV 1BHAA 1YJNV 3RBZA 3SPJA 1QBZA 5IY5B 2XAJA 4PDVA 2WLLB 5B1OA 1GM9A 3RVYA 1CPYA 2EILB 3OM3B 3CCJV 1VQKV 1H38A 1WPXA 4LP8A 4XBFA 4LC1A 5EC1C 1OHHG 1OZ0A 2Y69C 3K9AA 3LDCA 1N8RW 1OCOB 3GB7C 5H6RA 4UVCA 1I5YA 4Z1MG 4JAVA 4MVZA 2DQ0A 3ZMZA 3JYCA 1K8AW 3E83A 2DYSC 1M57C 2ZD9A 3W7XA 2XAHA 3SYPA 4JASA 2V7QG 2XAQA 4F4LA 1S76D 3ETEA 1XL6A 2OTJV 2OT5A 2YSUB 2XNDG 3G4SV 1Q86W 3LNMB 4QJFB 2D3OW 1NVPB 3EHBB 1MOFA 1M57B 5EK0A 5HFLA 1K33A 4FK5C 3STLC 3K79A 3DGEA 3E35A 1NH2B 4GX2A 1AI6A 3ETDA 4R7CA 1XL4A 3E86A 1SRYA 3F5WC 3RVZA 1OCCB 3ZRVA 1BL8A 3DTUB 4FPPA 5L3FA 2QEXV 1M90W 1YSCA 5IY5C 4RUEA 4WFHA 2MK3A 4E2LA 4J9ZB 2HLDG 2IJKA 4GT1A 3ASOB 2DWEC 1K73W 1KD1W 1VQ8V 1OCRB 1K97A 4H37A 2IU3A 2BOBC 1IXMA 2R9RB 3K08A 4JTDB 1OCRC 3IGAC 3IC7A 2EZPA 4EKWA 1FXKB 1QR9A 3E8HA 1GMGA 3FB6C 4N23A 3SYCA 4HZ3A 1H8HG 2HJFC 3JD0A 1VQ5V 1SERA 3GWOA 3OFNG 3CMAV 4PA9A 3I55V 1PNKA 4WFEA 3A0RA 1QCEA 3CCMV 1VQ4V 2EIJC 2ZR3A 4JGSA 4GX5A 1PL0A 1OCCC 4FMTA 4FIPC 4UV9A 1NJIW 5EBMC 2AHZA 4YXWG 1AROP 1VQ6V 1F4MA 3AG4B 1YI2V 1QLEB 2ZDIA 3SYOA 1AI7A 2F43G 1P7BA 5L3CA 4L87A 4LCUC 1LNQA 3T1CA 2B1GA 2JIZG 1AJNA 2WSSG 1JOYA 1GO3F 2QM7A 1VQNV 1GM7A 3AG1C 3JD4A 1R3IC 1ENVA 2R9IA 4TT3G 4BAYA 5DM6V 3IFXA 2V1DA 3LUTB 2DYSB 4I5SA 2Z5UA 5LBQA 2Q68A 3ABMC 2FTKA 2C2AA 1NBMG 1OCOC 3MHSC 2Y69B 3T2MA 3ABUA 3MD0A 3WG7B 2WLLA 3W7UA 2B1IA 5LGUA 1KC8W 4G2KA 3H01A 1QR8A 3P30A 3D36A 2EILC 1KP2A 2IJJA 1G8MA 2P6JA 3ABTA 4UXNA 3STZC 3LSSA 4JAUA 4KUMA 4CBCA 1EFRG 2H94A 5LHIA 1S72V 2Y48A 3K06A 3T4ZA 3SPIA 1K7DA 3BY6A 1GK9A 5IYCO 4UVBA 3ZMUA 5H9CA 3OUSA 3ZMVA 4X88A 1S0VA 3NXSA 1W0JG 4WFAV 5BZBA 2QA4V 1YTFB 1KKDA 4J9YB 5LGNA 5B3SC 1R3LC 5B1AC 3CC7V 1NQTA 1K34A 3K04A 1ZWIC 2JJ2G 3CCUV 3ETGA 1M9NA 3E89A 1K5QA 2HVJC 4JYBA 1Q7YW 2Q69A 2PI4A 2HFEC 3CXCU 5KUMA 2EBOA 3KG2A 4QPJA 1K5SA 3ZRXA 2BOCC 3QO8A 4UV8A 4JTAB 2K1EA 3FB8C 3CCVV 4RUFA 4MTGA 2HVKC 1AJQA 2JK5C 3AG2B 3ZN0A 3ZMTA 1JPXA 4KP4A 3BEHA 5KA6A 3ASNB 4TSFG 3ABKB 2WPDG 1V55C 3OEEG 3AG3C 4GX1A 2EIKB 1K4CC 2UXXA 3F7YC 3OR6C 1OCZB 1KQSU 4RQFA 4PDMA 4U7NA 1GKFA 2WLNA 1COWG 4GCZA 2JDIG 1DF5A 4CZZA 2EIMB 4G27B 3JD1A 2NNUA 1GM8A 1I5XA 5C93A 4RQEA 3X2QB 4PA4A 4WF9V 1ORQC 2WLIA 2EINC 3EFFK 1QLNA 2X0LA 5DN6G 3ZCCA 2A9HA 5L3BA 1M56B 2X6AA 1RPRA 3CYOA 4MW3A 4PELA 1GTOA 2ATKC 1KECA 2ITCC 5B1NA 1VQPV 1FFTB 3CMEV 5B1BB 5LHGA 2IU0A 1QVGU 4MVQA 1VQ9V 4H33A 4MVSA 3B8NA 4WFBV 1RM1B 2IJHA 4MS2A 2ZDIC 3ABLC 3CP1A 1V54B 1DLBA 4U7OA 1NR7A 3JCZA 3AEIA 2DW4A 3K3WA 1VQ7V 4HAMA 5CBHA 1AR1B 3K0GA 3ML0A 4DO2A 1Q81W 4ZBMA 1SZTA 3P32A 3PJSK 1ROPA 3K03A 3M99B 3E2EA 2WLMA 2W6JG 1THZA 4QE9A 1WLEA 2DYRB 1F23A 3OEHG 2HR3A 2OCCB 5L3EA 3D3IA 1VQLV 2PI5A 4MTOA 2YEVA 2ZR2A 2A0LA 5LGTA 1B6QA 4UUJC 3CCQV 3SYQA 4WFGA 1J95A 4BW5A 5E1AC 5LHHA 2QTOA 1PKXA 1NKDA 4OXSA 2ZXWC 5CBGA 2Q67A 1V54C 1RM1C 2AHYA 1MG1A 1S3JA 4P30A 2IW5A 4JPRA 3UM7A 1EBOA 3ABLB 3TETA 4RO2A 1R6NA 3OUFA 3UKMA 4MVUA 2EZOA 5EBLC 4ASUG 1K3EA 2Z3YA 3WFVA 4PDRA 4QIWF 4JYCA 5B1BC 5J9PC 4QPKA 2LFRA 2QE7G 3OAAG 2IH3C 2X6CA 1F51A 1HWYA 3TK1A 2UXNA 1JCHA 3OGCC 3CCSV 1K9MW 4PA7A 1YIJV 2EJRA 4LBEC 1M1KW 2A79B 5KA5A 3OMIB 2YEVB 1M56C 1R3KC 1TUEB 5CBFA 3G71V 3R65A 5IYDO 5CA3A 2P7TC 1YHQV 2EINB 3JD3A 2W0FC 4MSWC 4X89A 5IYBO 2Q6AA 3CCEV 1S5HC 3QO5A 1BMFG 2WAMA 3SPHA 3FYEB 4WFFA 2WLHA 3G6EV 2H8PC 1PNLA 2OTLV 3ZIAG 1AI5A 4XDKA 2KB1A 3VOUA 5L3DA 1JX9A 1OCZC 4TWKA 3CPWU 2W6IG 1MSWD 1BHBA 3AG3B 1FXVA 1AJPA 1EZJA 1V55B 2DWDC 5GW7A 4FJCC 3ABKC 4ZKIA 2WLKA 2ZXWB 1JJ2U 1NH2D 3VBBA 4R50A 1UJWB 2QKSA 1H8EG 2P67A 5H6QA 4XDLA 3E8GA 1YTFD 4PA3A 2JEXA 1Y4MA 2X6BA 4R6ZA 4Q20A 2JEUA 2JJ1G 2OCCC 3E8FA 1YJWV 4R8CA 1SETA 2DYRC 3CCLV 3JD2A 3ZRWA 1S77D 3QNEA 3CD6V 3ZRWB 1H2GA 2HG5C 3RW0A 5B3SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 V;  1R73 A;  1VQ7 V;  1JJ2 U;  4WFA V;  3CCE V;  2QA4 V;  1VQ6 V;  1N8R W;  4WF9 V;  1YI2 V;  1VQ8 V;  3CC4 V;  1Q81 W;  4WCE V;  3CC7 V;  1Q82 W;  1K8A W;  3CCU V;  3I56 V;  1YIT V;  3G6E V;  1KC8 W;  2OTL V;  1VQM V;  3CCR V;  1VQ5 V;  1YJN V;  1QVF U;  1VQO V;  1Q7Y W;  2QEX V;  1M90 W;  3CPW U;  3CMA V;  1YJW V;  1VQP V;  2OTJ V;  3CCS V;  3I55 V;  3OW2 U;  3G4S V;  3CXC U;  3CME V;  1NJI W;  1W2B U;  1VQL V;  1S72 V;  1YIJ V;  1QVG U;  3CCM V;  1Q86 W;  3CCL V;  4WFB V;  1YJ9 V;  1K9M W;  1KQS U;  1VQ4 V;  2D3O W;  1M1K W;  1VQ9 V;  3CD6 V;  5DM6 V;  3CCJ V;  1VQK V;  3G71 V;  3CCV V;  3CCQ V;  1VQN V;  1K73 W;  1YHQ V;  1KD1 W; 
#chains in the Genus database with same CATH topology
 2O57 A;  1O9H A;  1R3J C;  3Q4H B;  4GKJ B;  2WWW A;  1KP3 A;  1F4N A;  4MT8 A;  4DUY O;  3DXR B;  3OW2 U;  1CEZ A;  1QVF U;  3SPG A;  1K4D C;  4X65 B;  5CA1 B;  3E22 A;  2JGD B;  1EN6 A;  4LF9 B;  3HR0 A;  4MVM A;  1EZV H;  2CAZ C;  5KHG A;  3CC2 V;  2E76 B;  3SJQ C;  2WLJ A;  4W4K A;  2VWJ A;  4P2Z A;  4TQF A;  3BA9 A;  3F5T A;  4J10 A;  2B5U A;  2Q7E A;  1FFX A;  1B04 A;  1FFX B;  3S3W A;  3LDD A;  1QLE C;  1W0K G;  2ITD C;  3AG4 C;  1DK1 A;  4UCS A;  4J7K A;  2M7W A;  4PA6 A;  4FFB A;  1DTO A;  4X62 B;  5ITZ A;  2ADQ B;  1NTK H;  1G1X B;  4F6E A;  3JAL B;  5BR8 O;  2Y4U A;  2HKO A;  4X64 B;  2RQ6 A;  4MVO A;  4P9O A;  4NXN O;  3G6B A;  4DR1 B;  1R73 A;  4EFB A;  4JTC B;  3FB7 C;  1PL4 A;  4DXW A;  3BAB A;  3ASO C;  4MTF A;  2D2C B;  4BIU A;  4UCO A;  1R1B A;  1BHA A;  1KUQ A;  1YJN V;  3RBZ A;  1QBZ A;  1J5E B;  5LYJ A;  3OTF A;  1OV9 A;  1HNZ B;  3CCJ V;  1KYO F;  1N0J A;  4XBF A;  5EC1 C;  2Y69 C;  4K8X A;  5D5P A;  3B2E E;  3CRM A;  5IYZ A;  1OCO B;  5H6R A;  1I5Y A;  4GLX A;  2DQ0 A;  5JWP A;  4O4L B;  3W7X A;  2XAH A;  1D2D A;  4JI7 B;  5LOV B;  2OTJ V;  3TXQ A;  2OT5 A;  3LNM B;  1NVP B;  4J7J A;  4DV2 O;  1K33 A;  1UFI A;  4FK5 C;  4JI2 B;  3K79 A;  4IHJ A;  3E35 A;  4GX2 A;  1SRY A;  3F5W C;  3RVZ A;  3ZRV A;  2PYL A;  1ZX3 A;  1YSC A;  1GRJ A;  5IY5 C;  2MK3 A;  4E2L A;  4BR6 A;  4LFC B;  3K57 A;  2DWE C;  1ZL8 B;  2BOB C;  4K0K B;  1IXM A;  3K08 A;  4LNU A;  1EM1 A;  4H0L B;  4JTD B;  5BMV A;  3IGA C;  2EZP A;  4EKW A;  3E8H A;  4DR6 B;  3FB6 C;  1WAZ A;  2Q0O C;  4LFA B;  4DV7 B;  2HJF C;  3JD0 A;  3L72 H;  4FLW A;  4J42 A;  3OFN G;  3CMA V;  1PNK A;  4GUN A;  1VQ4 V;  4CC6 A;  5J2T B;  4B3M B;  1ZSP A;  2FL4 A;  4EFE A;  3L75 H;  4UV9 A;  1IUR A;  5EBM C;  2UXC B;  4X66 B;  4DR3 O;  1NT2 B;  2UUC B;  1P7B A;  5L3C A;  1BQ0 A;  3H9V A;  4L87 A;  4JAA A;  2JIZ G;  3C90 A;  4JI5 O;  1GO3 F;  2QM7 A;  3AG1 C;  1I94 B;  1RSO B;  2QJ1 A;  4J7Z A;  5DM6 V;  4PI0 A;  4I5S A;  2Z5U A;  2Q68 A;  3UQ8 A;  2GUZ B;  1JMK C;  5KMG A;  2AZ0 A;  3MHS C;  2UXD O;  3T2M A;  3VQW A;  1AP6 A;  3ZHV A;  1A32 A;  4FFK A;  5LGU A;  4G2K A;  3H01 A;  3OT7 A;  1QR8 A;  3P30 A;  3D36 A;  2A3Q A;  1KP2 A;  3ABT A;  3BVO A;  4UXN A;  3RWR D;  3RN4 A;  2H94 A;  2LW1 A;  5GTI Z;  3SPI A;  1K7D A;  1XHZ A;  1BSM A;  3ZMU A;  1KB9 F;  4X88 A;  3NXS A;  1R6T A;  4B3R O;  5DEC A;  1R3L C;  3CC7 V;  4CS3 A;  3K04 A;  1Q3E A;  1IX9 A;  2YI9 A;  4L8J A;  5H5N A;  3JAT A;  5KHJ A;  2ZNI A;  1Y74 A;  1JA8 A;  1QQC A;  3K58 A;  3RYI B;  2F4V B;  5AG2 A;  3FB8 C;  2EX3 A;  3CCV V;  1IDS A;  3K5M A;  3AG7 A;  4FFB B;  3AG2 B;  4WBN A;  5LA6 B;  5LXT A;  3BEH A;  5KA6 A;  3ASN B;  3TGU H;  3J80 N;  4KXR A;  2VQF O;  3CJH A;  5K1X A;  4LWS B;  2EIK B;  4O4H B;  4RQF A;  2Q8V A;  4PDM A;  2Q7H A;  2EJ7 A;  1GKF A;  4GCZ A;  2Q9L A;  4CZZ A;  5JJJ B;  4J11 A;  3JD1 A;  1I5X A;  5C93 A;  4E4E A;  1D5A A;  3X2Q B;  2E5L O;  2EIN C;  1QLN A;  4PHZ A;  1Y76 B;  2A9H A;  1M56 B;  4UCV A;  3O9O A;  4PEL A;  2ATK C;  2JS3 A;  1KEC A;  2VWK A;  4D6T H;  5B1N A;  4JI8 B;  4IHJ B;  1QVG U;  1VQ9 V;  2IJH A;  4DR5 B;  5CA0 A;  2YS8 A;  3AEI A;  2XT9 A;  3P3P A;  1VQ7 V;  3K0G A;  1IXB A;  2ZT9 B;  4ZBM A;  5BXZ A;  1WPB A;  3H1H H;  1ROP A;  3UO3 A;  2R72 A;  3WB0 A;  5BMV B;  3CSX A;  2WLM A;  2W6J G;  1XNQ B;  3APO A;  1ZL8 A;  2HR3 A;  5L3E A;  3D3I A;  4ZOL B;  4LF6 B;  4MTO A;  1P49 A;  4NXM B;  4U3J B;  1P84 F;  4WFG A;  2QSA A;  3ICX A;  3JAW A;  4BW5 A;  4OXS A;  1NKD A;  4YY3 O;  4QGP A;  1AVM A;  1H2M A;  5CBG A;  4X1Y A;  1HDJ A;  1EBO A;  3ABL B;  3OUF A;  3UKM A;  4PDR A;  4JYC A;  4QPK A;  4NR1 A;  2JS5 A;  2QE7 G;  3CCS V;  3TK1 A;  2UUB B;  1JCH A;  4PA7 A;  4IT5 A;  2A79 B;  2YEV B;  1R3K C;  4J41 A;  3G71 V;  1RFY A;  2Q6A A;  4I4T A;  3CCE V;  3T1H B;  1IBM O;  1G6U A;  1BMF G;  4O2A A;  4OX9 O;  2WLH A;  3G6E V;  3ZIA G;  2ADP A;  4LFB B;  3MDS A;  1XBL A;  1ZTE A;  3AG3 B;  1SA0 B;  2VQF B;  3CX5 F;  1LR1 A;  2ZE8 A;  4EB6 B;  4AQY B;  1MZF A;  5KX5 A;  4DK0 A;  2YC0 A;  1UJW B;  1H8E G;  1YTF D;  1BQZ A;  4XDL A;  5JQG A;  2JEX A;  3CEI A;  4R6Z A;  4X9Q A;  1I7F A;  2F1M A;  1YJW V;  4DUZ O;  4R8C A;  4RWU A;  1Q43 A;  2YUA A;  4B3T B;  3QNE A;  2ZIN A;  5IJ0 B;  3JAK A;  2RN9 A;  1XMO B;  2LFS A;  4UVA A;  3JSL A;  4DV5 O;  3OR7 C;  1XNR B;  4MVR A;  4PD4 F;  2LP7 A;  4DRX B;  1IBL B;  1M5I A;  3D8C A;  1WB7 A;  4B7E A;  4K8Z A;  1S5L Z;  2IH1 C;  5FL7 G;  1PPJ H;  4OPH A;  2XAS A;  2PGG A;  1Q90 D;  1URF A;  1PD3 A;  2CK3 G;  2ETN A;  3VQX A;  5JVD B;  2RMK B;  4KFM A;  3X2Q C;  4UB8 Z;  3HKD B;  2NLJ C;  4FLX A;  5CMU A;  1Q82 W;  3JAT B;  2WLI B;  4B3T O;  3KCX A;  1XNQ O;  2EIK C;  3FYI B;  4GKK B;  4OPA A;  5L3G A;  4RAI A;  3ASN C;  4LF4 B;  1DF4 A;  3W7W A;  1R6K A;  1XOU A;  1MAB G;  2P90 A;  3AG2 C;  3ZRS A;  1KBH A;  3E8B A;  4HYO A;  2UXC O;  1D5N A;  4QNH B;  4P9P A;  1NTZ H;  2OYQ A;  3OGI B;  4AQY O;  4I9W A;  2M6Y A;  4JI8 O;  2EIJ B;  2XAG A;  3HB3 B;  5EBW C;  2GHY A;  4CH5 A;  4PDL A;  2IJI A;  2XOK G;  2F66 C;  1FXK C;  4D7T A;  4NYK A;  4X1I A;  5C8Y A;  2CTQ A;  2XAF A;  1LUV A;  4X8A A;  2XUM A;  4CH3 A;  1RSO A;  3ETQ A;  4IIJ A;  3IAY A;  2QWP B;  4JI1 O;  3SPC A;  3ZED A;  4QE7 A;  2UU9 B;  5LMN B;  1P7G A;  2ZE5 A;  1VQM V;  3ZHS A;  1Q6I A;  2NN4 A;  5CB4 B;  1GM9 A;  4O4I B;  3RVY A;  2GBO A;  4DV0 B;  3RFR A;  1H38 A;  2AW9 A;  4DR7 B;  3BHP A;  4TV8 B;  4LP8 A;  1OZ0 A;  4IYI A;  1TAE A;  4MVZ A;  4H44 B;  3BPZ A;  3E83 A;  3HKB B;  2YXL A;  4GKK O;  4JAS A;  4F4L A;  2QKC A;  1I94 O;  1XL6 A;  3A8T A;  3CS5 A;  1Q86 W;  1XMQ B;  3HKE A;  3EHB B;  2VS0 A;  1M57 B;  1X59 A;  5EK0 A;  5IWA O;  1SZX A;  1TGO A;  4O4I A;  3DGE A;  5J2U A;  3J81 N;  4R7C A;  1XL4 A;  3E86 A;  2OCH A;  2YIC A;  3A0H Z;  4WBN B;  5E79 Z;  4B3S B;  4IIJ B;  4DR4 O;  4GT1 A;  4YIO A;  1SF9 A;  4B08 A;  1SKV A;  4DR2 B;  4H37 A;  2AXT Z;  2IU3 A;  3IJ4 A;  3APQ A;  2NR5 A;  4FM2 A;  4KHP O;  4CS4 A;  4JI0 O;  1WN7 A;  1H8H G;  4HZ3 A;  1VQ5 V;  2K9P A;  3GWO A;  3RYH B;  3RYF B;  4ZIB A;  4X66 O;  2UUA B;  3SGI A;  2LGQ A;  2ZR3 A;  1PL0 A;  2Q4P A;  4FVM A;  1XHX A;  4YXW G;  2WA4 A;  4JI2 O;  1AI7 A;  3THO A;  4TV9 A;  1SQB H;  4LCU C;  1LNQ A;  2B1G A;  3OD4 A;  1AJN A;  1JOY A;  4DV7 O;  1R3I C;  3ZHT A;  2V1D A;  5LBQ A;  3M8A A;  1ZLZ A;  3ABM C;  1WJZ A;  3FX7 A;  1OCO C;  4JI6 O;  1NI8 A;  1M4U A;  4FLY A;  2CH7 A;  2Y69 B;  3MD0 A;  3WG7 B;  2WLL A;  2KQX A;  1N0N A;  1KC8 W;  1S5J A;  2ZE6 A;  4I0X A;  4X65 O;  3STZ C;  1G8M A;  2IJJ A;  2P6J A;  3N27 A;  1PV0 A;  3LSS A;  4JAU A;  4KUM A;  5EZY A;  2BE3 A;  2Y48 A;  3T4Z A;  5JCO C;  1GK9 A;  2VQE B;  4UVB A;  4DV6 O;  1SQF A;  1S0V A;  4WFA V;  3RYH A;  1YTF B;  2N74 A;  4J9Y B;  1Z5V A;  4LWS A;  1NQT A;  5TIS Z;  4LF6 O;  1QHT A;  4O4L A;  1NZ6 A;  4YJ3 B;  2PI4 A;  4JI5 B;  4B3S O;  3ZRX A;  3LNN A;  3N2G B;  4U3F H;  2HVK C;  4EB6 A;  5CB4 A;  2JK5 C;  2CGN A;  3KCY A;  2CTR A;  4TSF G;  3H1I H;  4DV3 B;  4B3M O;  3ABK B;  3K5L A;  2P4K A;  5FPO A;  4JV5 O;  1V55 C;  3K5O A;  1SQG A;  2UXX A;  4O4J B;  4X1I B;  4U7N A;  3CRA A;  2WLN A;  2LQT A;  3BCC H;  4RQE A;  4PA4 A;  5D5Q A;  1ORQ C;  3EFF K;  2X0L A;  1Q6U A;  1HR0 B;  3BFR A;  1RPR A;  1SS3 A;  4I4T B;  2ITC C;  1H2S B;  4HBN A;  5FLX N;  2ZNJ A;  2Q73 A;  1TUB B;  4MVS A;  4DUY B;  4MS2 A;  1TUB A;  2WA3 A;  3CP1 A;  1XIL A;  1B3Q A;  1DLB A;  4U7O A;  1Q81 W;  3GVM A;  2YDE A;  3P32 A;  3GWK C;  3PJS K;  5A2Q N;  3K59 A;  3K03 A;  1TA8 A;  2HP8 A;  5EYP B;  5GON A;  1XUQ A;  3HKD A;  3SJC C;  4QE9 A;  1WLE A;  2DYR B;  3OEH G;  2Q7G A;  2P4V A;  2KSD A;  4I55 A;  2A0L A;  5CA0 B;  4UUJ C;  3SYQ A;  1F7Y A;  4LF8 B;  4FM0 A;  2QTO A;  3UCS C;  1YDX A;  1YF2 A;  1SA0 A;  4A5U B;  2AHY A;  1JR9 A;  4P30 A;  1HNZ O;  3UM7 A;  3CRR A;  4LH7 A;  1R6N A;  1FJG B;  4ASU G;  2EZO A;  1YCI A;  1K3E A;  5J9P C;  3OAA G;  1EN5 A;  2IH3 C;  2F93 B;  2UXN A;  2PUS A;  4X20 B;  2YIB A;  3R65 A;  1HNX B;  1YHQ V;  1FD9 A;  1US6 A;  3JAL A;  3QVN A;  3FFQ A;  2WAM A;  4NXN B;  3CJH B;  3FYE B;  3CHX A;  3CRQ A;  2H8P C;  2PTM A;  2OTL V;  4XDK A;  3VOU A;  3FAV B;  1BS3 A;  1BHB A;  1WA8 B;  1FXV A;  1AJP A;  1EZJ A;  4PV1 B;  1SC5 B;  3WB1 A;  5LMU O;  1GH6 A;  1V55 B;  4FJC C;  1XI1 A;  3ABK C;  5EZY B;  4F6R B;  2ZXW B;  3K9S A;  1JJ2 U;  4CH4 A;  1XRE A;  2ZM6 B;  4R50 A;  1RP3 B;  1H2N A;  1GN3 A;  4YHH O;  1Y4M A;  3AK1 A;  4DV4 O;  2JEU A;  2EUL A;  2JJ1 G;  2OCC C;  3JAW B;  1IBK B;  2UXB B;  3BRC A;  3JD2 A;  1S77 D;  4DUZ B;  3CD6 V;  4NKG B;  1Y74 B;  3QG5 A;  1HNW O;  2LO1 A;  2Q5Z A;  1PNM A;  3KZI Z;  4C7U A;  3HPL C;  3I5D A;  1SQX H;  4DR7 O;  5LXT B;  3QTC A;  3CCR V;  4JYA B;  4O2B A;  5J2U B;  4DV0 O;  4JF3 A;  3TCU A;  2GSM B;  3LSU A;  4MW8 A;  1LUW A;  4XDJ A;  2XHB A;  1FJG O;  2HEP A;  3SJA C;  3M7M X;  3W7S A;  3OMN B;  3D36 C;  4GX0 A;  3OTO O;  2AZ2 A;  5J2T A;  2UU9 O;  3WG7 C;  3H1L H;  4LF8 O;  4KHP B;  1L1F A;  1VF5 B;  1JVM A;  2EIM C;  3ABM B;  2N04 A;  4JI3 B;  1VQO V;  5C8Y B;  1X4T A;  1SQQ H;  4GYC B;  5EC2 C;  3ZHQ A;  1YJ9 V;  1VEW A;  1QU7 A;  4JI4 O;  4YHH B;  5CA1 A;  5F2V O;  5K1P A;  2Y4T A;  1NVP D;  1N33 B;  3A0B Z;  1G4Y B;  3OMA B;  4X1Y B;  2N05 A;  4X1K A;  4LF4 O;  4PJ0 Z;  4X1K B;  1P4R A;  4PI2 A;  5JJN B;  1AP5 A;  5LMU B;  3QO7 A;  1FS0 G;  4LF7 O;  5HFM A;  3ZJZ A;  3JAK B;  1FXK A;  1RPO A;  3UT5 B;  2LJ2 A;  3OE7 G;  4Q6G A;  1K92 A;  4J80 A;  2IM9 A;  2DQ3 A;  4JYY A;  3G67 A;  4DV6 B;  4O2A B;  1YIT V;  2VQE O;  2QM8 A;  2QDO A;  3LSQ A;  1YVW A;  3SPJ A;  2XAJ A;  3AK3 A;  1N32 O;  2E75 B;  3OM3 B;  3JAS B;  3JAR A;  1N33 O;  4YJ2 A;  1OHH G;  4ZOL A;  2FKX A;  3CB2 A;  3S3X A;  1KKC A;  3K9A A;  2QKA A;  5JH7 A;  2E5L B;  3GB7 C;  4UVC A;  4Z1M G;  1XMO O;  1M57 C;  2ZD9 A;  3WU2 Z;  1MMM A;  2DOS A;  2ODM A;  2XAQ A;  1S76 D;  3ETE A;  2XND G;  4UCR A;  1MOF A;  1YXB A;  2QR4 A;  4K35 A;  1MNG A;  2JGD A;  2HHH B;  2Y0P A;  4FZ1 A;  1AI6 A;  3ETD A;  4JZ2 A;  1OCC B;  1BL8 A;  4I9Q A;  2QM4 A;  4FPP A;  2GUZ A;  4J9Z B;  1KMI Z;  4DYL A;  2HLD G;  3HKE B;  4GKJ O;  2IJK A;  3UO2 A;  4JI0 B;  1N34 B;  4OX9 B;  2JRI A;  1HNW B;  1VQ8 V;  1OCR B;  2GTA A;  1K97 A;  3NR7 A;  2R9R B;  3HKC A;  5DED A;  1FXK B;  3UT5 A;  1QR9 A;  1GMG A;  4N23 A;  2DJV A;  4TOI A;  3SYC A;  1N36 B;  5KLV H;  3JCU Z;  1SER A;  4DR4 B;  2UUB O;  3I55 V;  1QCE A;  3CCM V;  2EIJ C;  1I0H A;  3L71 H;  4UCU A;  1VF6 C;  1M93 A;  2AHZ A;  1YI2 V;  4DV5 B;  2ZDI A;  3SYO A;  1ZAU A;  4CH6 A;  3FD9 A;  2F43 G;  4ZI7 B;  1YZB A;  3HKC B;  3T1C A;  3EVK A;  2WSS G;  2Z0A A;  2CTP A;  1GM7 A;  2CE4 A;  4FLT A;  2R9I A;  4BAY A;  4LF5 B;  3MAQ A;  2DYS B;  1GAX A;  1HP8 A;  2C2A A;  1VF7 A;  2PZS A;  2E3C A;  4BW9 A;  3ABU A;  1Y6X A;  2EIL C;  4CBC A;  5LHI A;  3N2K A;  3U0Z A;  3BY6 A;  4LFB O;  1N36 O;  5H9C A;  3OUS A;  2AGA A;  2YXH A;  5BZB A;  1W0J G;  4JI6 B;  4I7Z B;  1O9G A;  4LH6 A;  5B1A C;  1K34 A;  2YIA A;  1ZWI C;  3CCU V;  3ETG A;  5KHH A;  2B9Z A;  3E89 A;  2HVJ C;  4JYB A;  1SQP H;  2Q69 A;  2HFE C;  1Q5O A;  4TUY A;  5KUM A;  2EBO A;  4QPJ A;  4FZ0 A;  1K5S A;  4FLZ A;  3QO8 A;  1BT8 A;  3JAS A;  2CUG A;  3ZN0 A;  3ZMT A;  4DRX A;  4IYH A;  4KP4 A;  4H13 B;  3D3Q A;  5BY1 A;  5IJ9 B;  3OEE G;  2FB5 A;  3AG3 C;  1T5E A;  3F7Y C;  3RYC B;  1COW G;  2JDI G;  2P06 A;  1DF5 A;  4JI1 B;  2V4D A;  3RYC A;  4DW0 A;  2NNU A;  1GM8 A;  1NS1 A;  2QWR B;  3T1H O;  4DR2 O;  2VRZ A;  1L8D A;  5DN6 G;  3TJT A;  3ZCC A;  3CYO A;  4FLU A;  2Y0I A;  2IU0 A;  4MVQ A;  4H33 A;  3ZHR A;  1Q8I A;  3ABL C;  2FYU H;  3CRC A;  1WA8 A;  2DW4 A;  4YY3 B;  5CBH A;  1AR1 B;  2BCC H;  3ZBH A;  1SZT A;  5IWA B;  1XMQ O;  1PM9 A;  2BTQ A;  1F23 A;  5BR8 B;  1FPO A;  1MSD A;  3U11 A;  2PI5 A;  1Q6H A;  1TVK A;  1Y67 A;  4I50 A;  5KHI A;  3CCQ V;  5LHH A;  2A7W A;  1PKX A;  2Q67 A;  2G38 A;  1S3J A;  2IW5 A;  4JPR A;  3A2F A;  3TET A;  4RO2 A;  2F4V O;  3T1Y O;  4MVU A;  4QJF B;  5EBL C;  4JI4 B;  3WFV A;  4QIW F;  2LFR A;  2X6C A;  1F51 A;  3OGC C;  1YIJ V;  5KAI Z;  2EJR A;  1M1K W;  3J7A U;  5LMN O;  3OMI B;  4TQD A;  1M56 C;  1TUE B;  5CBF A;  5IYD O;  2QWQ B;  4U3J A;  2P7T C;  2EIN B;  3JD3 A;  2W0F C;  4X89 A;  5IYB O;  3SR2 C;  4UCT A;  1S5H C;  4K0K O;  3QO5 A;  3ZS8 C;  3SPH A;  4WFF A;  3QF7 A;  1PNL A;  1AI5 A;  4LF9 O;  4B7K A;  4LFC O;  1BCC H;  4TWK A;  1VAR A;  1UPG A;  2W6I G;  2E74 B;  2DWD C;  2RCV A;  1FKA O;  4F6R A;  2RNB A;  4I55 B;  4O2B B;  4HNA A;  2UXD B;  5H6Q A;  2OIE A;  4PA3 A;  1BGY H;  1VP7 A;  2X6B A;  2CH7 B;  1WP8 A;  3E8F A;  3H1J H;  2LW7 A;  1SET A;  1FYJ A;  4FLV A;  3ZRW B;  1H2G A;  2HG5 C;  3RW0 A;  4ICG A;  4X20 A;  1V9P A;  5CN0 A;  5ITZ B;  4Z2W A;  3ZN1 A;  5EYP A;  2ZM6 O;  4WCE V;  4D7S A;  1E1R G;  5IYZ B;  3C3T A;  1GN2 A;  2RDC A;  3T1Y B;  3F7V C;  5IE9 A;  1W2B U;  4BWA A;  3B77 A;  3W7T A;  2ZQM A;  4AIL C;  3T4D A;  3B09 A;  1IBL O;  3SDL A;  4YIP A;  1Y66 A;  2LGW A;  2ZKO A;  1E79 G;  4W4L A;  1NR1 A;  2ZCE A;  2YI8 A;  1VMG A;  4AI8 A;  2QWN B;  3AG1 B;  5JH7 B;  1DGS A;  1YEW A;  3CXH F;  5LL6 Y;  1L0L H;  3CC4 V;  4X62 O;  1SES A;  1E1Q G;  2YIB D;  4LF7 B;  2ARH A;  3AK2 A;  3B8M A;  4NTY A;  2BTO A;  3K0D A;  2R9A A;  4O4J A;  1WP7 A;  2ZE7 A;  5IDJ A;  4FM1 A;  4MTX A;  3LDE A;  1XQ8 A;  1CP9 A;  4DR5 O;  1EN4 A;  3L9D A;  2HHH O;  4GZR B;  3ZMS A;  3FB5 C;  1IZ3 A;  3N2G A;  2GTS A;  2DMX A;  4N21 A;  5KUK A;  2X7R B;  2BSK B;  1HW7 A;  4ABM A;  5B1A B;  4JI3 O;  1FXH A;  4G28 B;  3L73 H;  4UB6 Z;  4B3R B;  1JQ0 A;  3FKS G;  1AB3 A;  3ZX6 A;  2A06 H;  3MHH C;  3CWB H;  3SYA A;  3I56 V;  4BIZ A;  3HKB A;  1AI4 A;  1VF6 A;  5IY5 B;  3R66 A;  4PDV A;  2WLL B;  5B1O A;  2R70 A;  1CPY A;  1CXZ B;  2EIL B;  3B40 A;  1J5E O;  1VQK V;  1WPX A;  2HJD A;  4LC1 A;  2F95 B;  1JFF B;  3LDC A;  1N8R W;  3U10 A;  3TXS A;  4JAV A;  2BTQ B;  4I0X B;  3ZMZ A;  3JYC A;  1K8A W;  2DYS C;  4NTW A;  5FNV B;  4DV2 B;  2QTS A;  1VIB A;  3SYP A;  2V7Q G;  4DW1 A;  3RT3 C;  2P5O A;  2YSU B;  3G4S V;  4AHC A;  1PP9 H;  2D3O W;  4DV4 B;  2F23 A;  5KX5 B;  1BE3 H;  5HFL A;  5KAF Z;  3P3N A;  3SJB C;  2UUC O;  3STL C;  4ZHQ A;  5GON B;  3DXR A;  1NH2 B;  2CGO A;  1MA1 A;  2CDY A;  1MZE A;  3DTU B;  5JQG B;  4UFZ A;  2QEX V;  5L3F A;  1M90 W;  2PF4 E;  4RUE A;  4WFH A;  4NB5 A;  3ASO B;  4LFA O;  1K73 W;  5LOV A;  1KD1 W;  5IT9 N;  3L70 H;  1AR5 A;  3KKY A;  1NTM H;  1U97 A;  3G80 A;  1OCR C;  3EXA A;  4DR1 O;  3IC7 A;  2KG7 A;  4TV9 B;  2KG7 B;  5IJ9 A;  3ZHU A;  1WNS A;  4PA9 A;  1JFF A;  4WFE A;  3E22 B;  3A0R A;  4JGS A;  2YXY A;  4GX5 A;  1OCC C;  2OIG A;  4FMT A;  4FIP C;  1NJI W;  5A9G A;  1JJO A;  1ARO P;  1VQ6 V;  1F4M A;  3AG4 B;  3FAV A;  1QLE B;  3PN1 A;  2L6L A;  1NU1 H;  4YJ3 A;  3IC9 A;  5B66 Z;  3RGB A;  3VQY A;  1VQN V;  3C3S A;  1FAF A;  3JD4 A;  2H3O A;  1ENV A;  2GV9 A;  4TT3 G;  1IBK O;  1N4C A;  1Z5W A;  3IFX A;  3LUT B;  3DC6 A;  2ZIM A;  5FPR A;  2DN9 A;  2BSK A;  1IBM B;  2OWO A;  2FTK A;  1NBM G;  5KHK A;  1N34 O;  4O4H A;  4NTX A;  3W7U A;  2B1I A;  2DE0 X;  4ZI7 A;  1EFR G;  2P22 C;  1S72 V;  4JYA O;  5H2F Z;  4ZHQ B;  2ILM A;  1OJH A;  3K06 A;  3RYI A;  5IYC O;  3WB2 A;  3ZMV A;  2QA4 V;  1KKD A;  4NXM O;  5LGN A;  2W0X A;  5B3S C;  5LP6 A;  2JJ2 G;  5LP6 B;  5FNV A;  1M9N A;  1K5Q A;  3B4S A;  1Q7Y W;  2UXB O;  1H2L A;  4BIO A;  1AR4 A;  3CXC U;  5IJ0 A;  3KG2 A;  5JVD A;  4TV8 A;  2BOC C;  4UV8 A;  4JTA B;  2MW2 B;  2K1E A;  4DV3 O;  4JV5 B;  4RUF A;  3JAM N;  3JAR B;  1GN6 A;  4MTG A;  3H1K H;  1AJQ A;  1JPX A;  4DK1 A;  2WPD G;  4K3A A;  5JJE B;  1N32 B;  4HNA B;  5JCO A;  4OGQ B;  2L35 A;  5EIB D;  4GX1 A;  1K4C C;  3OR6 C;  1OCZ B;  3DC5 A;  1KQS U;  1QNM A;  2PYJ A;  1W59 A;  2JVD A;  2EIM B;  4G27 B;  1Z2G A;  4CC5 A;  4WF9 V;  2IBZ H;  4X64 O;  2WLI A;  1IVS A;  5L3B A;  3OTO B;  2X6A A;  4MW3 A;  1GTO A;  1AIL A;  2ZIO A;  1VQP V;  1FFT B;  5LA6 A;  3CME V;  5B1B B;  5LHG A;  4LR3 A;  4WFB V;  1RM1 B;  3B8N A;  3O65 A;  2ZDI C;  2YID A;  1ZUQ A;  2QWO B;  2RJZ A;  5EIB C;  1V54 B;  1NR7 A;  3JCZ A;  3K3W A;  1HR0 O;  4HAM A;  3ML0 A;  4DO2 A;  3K5N A;  3M99 B;  3E2E A;  2PY5 A;  2GDS A;  1THZ A;  4DV1 O;  4IGG A;  3CE2 A;  4JI7 O;  4DV1 B;  2OCC B;  1VQL V;  4LNU B;  4CS2 A;  2YEV A;  1U96 A;  2ZR2 A;  2KKW A;  5LGT A;  1B6Q A;  2FML A;  4JZG A;  1J95 A;  5E1A C;  1SQV H;  5LYJ B;  2ZXW C;  1V54 C;  1MG1 A;  1H2K A;  2JGU A;  1XDC A;  2QGN A;  1RM1 C;  2UUA O;  2Z3Y A;  5B1B C;  3VQV A;  1HWY A;  3Q4H A;  1K9M W;  2XTA A;  4LBE C;  5KA5 A;  3DSQ A;  5KMG B;  1XEQ A;  3L74 H;  5CA3 A;  3RYF A;  4MSW C;  3BA8 A;  2CTW A;  1BZK A;  4IL6 Z;  4LF5 O;  1HNX O;  2KB1 A;  1L0N H;  1WB8 A;  5L3D A;  1JX9 A;  1OCZ C;  3CPW U;  1MSW D;  4DR3 B;  5GW7 A;  3BAA A;  2Q0A A;  4KL1 A;  4ZKI A;  2WLK A;  3N2K B;  4EEQ A;  1TVK B;  4I50 B;  3JSN A;  4NVP A;  1NH2 D;  3VBB A;  1B06 A;  1XNR O;  2QKS A;  2P67 A;  3E8G A;  1GN4 A;  1Y76 A;  5GTH Z;  4Z1V A;  4Q20 A;  5B5E Z;  2DYR C;  3CCL V;  3ZRW A;  4DR6 O;  1KU9 A;  5LP6 C;  4YJ2 B;  4TUY B;  5B3S B;  1I08 A; 
#chains in the Genus database with same CATH homology
 5CN0 A;  1R3J C;  2LFS A;  4UVA A;  3ZN1 A;  1PNM A;  3OR7 C;  3HPL C;  4WCE V;  2WWW A;  4MVR A;  2LP7 A;  1E1R G;  1KP3 A;  3CCR V;  1F4N A;  4MT8 A;  2IH1 C;  5FL7 G;  4JF3 A;  3TCU A;  2GSM B;  4XDJ A;  4MW8 A;  3OW2 U;  3F7V C;  1W2B U;  1CEZ A;  1QVF U;  3B77 A;  3W7S A;  2XAS A;  3SPG A;  1K4D C;  2ZQM A;  3T4D A;  3OMN B;  3W7T A;  4GX0 A;  1Y66 A;  1PD3 A;  2CK3 G;  4MVM A;  3WG7 C;  3CC2 V;  1E79 G;  3SJQ C;  2WLJ A;  4KFM A;  3X2Q C;  1L1F A;  1NR1 A;  2NLJ C;  1JVM A;  5CMU A;  2EIM C;  1Q82 W;  3ABM B;  4P2Z A;  2WLI B;  1VQO V;  3AG1 B;  2EIK C;  3FYI B;  2B5U A;  5L3G A;  3CC4 V;  5EC2 C;  1YJ9 V;  1SES A;  1E1Q G;  4RAI A;  3B8M A;  3ASN C;  1DF4 A;  3W7W A;  1R6K A;  3K0D A;  3LDD A;  1QLE C;  3AG2 C;  1MAB G;  1W0K G;  2P90 A;  3AG4 C;  2ITD C;  3E8B A;  3ZRS A;  4HYO A;  5IDJ A;  1NVP D;  4QNH B;  4P9P A;  4MTX A;  3LDE A;  1CP9 A;  1G4Y B;  2M7W A;  3OMA B;  4I9W A;  1P4R A;  4PA6 A;  2EIJ B;  3QO7 A;  1FS0 G;  3ZMS A;  2XAG A;  1DTO A;  3HB3 B;  5HFM A;  3ZJZ A;  1FXK A;  1RPO A;  5EBW C;  3FB5 C;  2GHY A;  4N21 A;  4PDL A;  2X7R B;  3OE7 G;  5KUK A;  2IJI A;  2XOK G;  2HKO A;  1K92 A;  4MVO A;  4P9O A;  1FXK C;  5B1A B;  1R73 A;  1FXH A;  2DQ3 A;  2XAF A;  4G28 B;  4X8A A;  1JQ0 A;  4JTC B;  3FB7 C;  3FKS G;  4DXW A;  3SPC A;  4QE7 A;  3MHH C;  3ASO C;  4MTF A;  3SYA A;  4BIU A;  4BIZ A;  3I56 V;  1YIT V;  2QM8 A;  1AI4 A;  3LSQ A;  1VQM V;  1BHA A;  1YJN V;  3RBZ A;  3SPJ A;  1QBZ A;  5IY5 B;  2XAJ A;  4PDV A;  2WLL B;  5B1O A;  1GM9 A;  3RVY A;  1CPY A;  2EIL B;  3OM3 B;  3CCJ V;  1VQK V;  1H38 A;  1WPX A;  4LP8 A;  4XBF A;  4LC1 A;  5EC1 C;  1OHH G;  1OZ0 A;  2Y69 C;  3K9A A;  3LDC A;  1N8R W;  1OCO B;  3GB7 C;  5H6R A;  4UVC A;  1I5Y A;  4Z1M G;  4JAV A;  4MVZ A;  2DQ0 A;  3ZMZ A;  3JYC A;  1K8A W;  3E83 A;  2DYS C;  1M57 C;  2ZD9 A;  3W7X A;  2XAH A;  3SYP A;  4JAS A;  2V7Q G;  2XAQ A;  4F4L A;  1S76 D;  3ETE A;  1XL6 A;  2OTJ V;  2OT5 A;  2YSU B;  2XND G;  3G4S V;  1Q86 W;  3LNM B;  4QJF B;  2D3O W;  1NVP B;  3EHB B;  1MOF A;  1M57 B;  5EK0 A;  5HFL A;  1K33 A;  4FK5 C;  3STL C;  3K79 A;  3DGE A;  3E35 A;  1NH2 B;  4GX2 A;  1AI6 A;  3ETD A;  4R7C A;  1XL4 A;  3E86 A;  1SRY A;  3F5W C;  3RVZ A;  1OCC B;  3ZRV A;  1BL8 A;  3DTU B;  4FPP A;  5L3F A;  2QEX V;  1M90 W;  1YSC A;  5IY5 C;  4RUE A;  4WFH A;  2MK3 A;  4E2L A;  4J9Z B;  2HLD G;  2IJK A;  4GT1 A;  3ASO B;  2DWE C;  1K73 W;  1KD1 W;  1VQ8 V;  1OCR B;  1K97 A;  4H37 A;  2IU3 A;  2BOB C;  1IXM A;  2R9R B;  3K08 A;  4JTD B;  1OCR C;  3IGA C;  3IC7 A;  2EZP A;  4EKW A;  1FXK B;  1QR9 A;  3E8H A;  1GMG A;  3FB6 C;  4N23 A;  3SYC A;  4HZ3 A;  1H8H G;  2HJF C;  3JD0 A;  1VQ5 V;  1SER A;  3GWO A;  3OFN G;  3CMA V;  4PA9 A;  3I55 V;  1PNK A;  4WFE A;  3A0R A;  1QCE A;  3CCM V;  1VQ4 V;  2EIJ C;  2ZR3 A;  4JGS A;  4GX5 A;  1PL0 A;  1OCC C;  4FMT A;  4FIP C;  4UV9 A;  1NJI W;  5EBM C;  2AHZ A;  4YXW G;  1ARO P;  1VQ6 V;  1F4M A;  3AG4 B;  1YI2 V;  1QLE B;  2ZDI A;  3SYO A;  1AI7 A;  2F43 G;  1P7B A;  5L3C A;  4L87 A;  4LCU C;  1LNQ A;  3T1C A;  2B1G A;  2JIZ G;  1AJN A;  2WSS G;  1JOY A;  1GO3 F;  2QM7 A;  1VQN V;  1GM7 A;  3AG1 C;  3JD4 A;  1R3I C;  1ENV A;  2R9I A;  4TT3 G;  4BAY A;  5DM6 V;  3IFX A;  2V1D A;  3LUT B;  2DYS B;  4I5S A;  2Z5U A;  5LBQ A;  2Q68 A;  3ABM C;  2FTK A;  2C2A A;  1NBM G;  1OCO C;  3MHS C;  2Y69 B;  3T2M A;  3ABU A;  3MD0 A;  3WG7 B;  2WLL A;  3W7U A;  2B1I A;  5LGU A;  1KC8 W;  4G2K A;  3H01 A;  1QR8 A;  3P30 A;  3D36 A;  2EIL C;  1KP2 A;  2IJJ A;  1G8M A;  2P6J A;  3ABT A;  4UXN A;  3STZ C;  3LSS A;  4JAU A;  4KUM A;  4CBC A;  1EFR G;  2H94 A;  5LHI A;  1S72 V;  2Y48 A;  3K06 A;  3T4Z A;  3SPI A;  1K7D A;  3BY6 A;  1GK9 A;  5IYC O;  4UVB A;  3ZMU A;  5H9C A;  3OUS A;  3ZMV A;  4X88 A;  1S0V A;  3NXS A;  1W0J G;  4WFA V;  5BZB A;  2QA4 V;  1YTF B;  1KKD A;  4J9Y B;  5LGN A;  5B3S C;  1R3L C;  5B1A C;  3CC7 V;  1NQT A;  1K34 A;  3K04 A;  1ZWI C;  2JJ2 G;  3CCU V;  3ETG A;  1M9N A;  3E89 A;  1K5Q A;  2HVJ C;  4JYB A;  1Q7Y W;  2Q69 A;  2PI4 A;  2HFE C;  3CXC U;  5KUM A;  2EBO A;  3KG2 A;  4QPJ A;  1K5S A;  3ZRX A;  2BOC C;  3QO8 A;  4UV8 A;  4JTA B;  2K1E A;  3FB8 C;  3CCV V;  4RUF A;  4MTG A;  2HVK C;  1AJQ A;  2JK5 C;  3AG2 B;  3ZN0 A;  3ZMT A;  1JPX A;  4KP4 A;  3BEH A;  5KA6 A;  3ASN B;  4TSF G;  3ABK B;  2WPD G;  1V55 C;  3OEE G;  3AG3 C;  4GX1 A;  2EIK B;  1K4C C;  2UXX A;  3F7Y C;  3OR6 C;  1OCZ B;  1KQS U;  4RQF A;  4PDM A;  4U7N A;  1GKF A;  2WLN A;  1COW G;  4GCZ A;  2JDI G;  1DF5 A;  4CZZ A;  2EIM B;  4G27 B;  3JD1 A;  2NNU A;  1GM8 A;  1I5X A;  5C93 A;  4RQE A;  3X2Q B;  4PA4 A;  4WF9 V;  1ORQ C;  2WLI A;  2EIN C;  3EFF K;  1QLN A;  2X0L A;  5DN6 G;  3ZCC A;  2A9H A;  5L3B A;  1M56 B;  2X6A A;  1RPR A;  3CYO A;  4MW3 A;  4PEL A;  1GTO A;  2ATK C;  1KEC A;  2ITC C;  5B1N A;  1VQP V;  1FFT B;  3CME V;  5B1B B;  5LHG A;  2IU0 A;  1QVG U;  4MVQ A;  1VQ9 V;  4H33 A;  4MVS A;  3B8N A;  4WFB V;  1RM1 B;  2IJH A;  4MS2 A;  2ZDI C;  3ABL C;  3CP1 A;  1V54 B;  1DLB A;  4U7O A;  1NR7 A;  3JCZ A;  3AEI A;  2DW4 A;  3K3W A;  1VQ7 V;  4HAM A;  5CBH A;  1AR1 B;  3K0G A;  3ML0 A;  4DO2 A;  1Q81 W;  4ZBM A;  1SZT A;  3P32 A;  3PJS K;  1ROP A;  3K03 A;  3M99 B;  3E2E A;  2WLM A;  2W6J G;  1THZ A;  4QE9 A;  1WLE A;  2DYR B;  1F23 A;  3OEH G;  2HR3 A;  2OCC B;  5L3E A;  3D3I A;  1VQL V;  2PI5 A;  4MTO A;  2YEV A;  2ZR2 A;  2A0L A;  5LGT A;  1B6Q A;  4UUJ C;  3CCQ V;  3SYQ A;  4WFG A;  1J95 A;  4BW5 A;  5E1A C;  5LHH A;  2QTO A;  1PKX A;  1NKD A;  4OXS A;  2ZXW C;  5CBG A;  2Q67 A;  1V54 C;  1RM1 C;  2AHY A;  1MG1 A;  1S3J A;  4P30 A;  2IW5 A;  4JPR A;  3UM7 A;  1EBO A;  3ABL B;  3TET A;  4RO2 A;  1R6N A;  3OUF A;  3UKM A;  4MVU A;  2EZO A;  5EBL C;  4ASU G;  1K3E A;  2Z3Y A;  3WFV A;  4PDR A;  4QIW F;  4JYC A;  5B1B C;  5J9P C;  4QPK A;  2LFR A;  2QE7 G;  3OAA G;  2IH3 C;  2X6C A;  1F51 A;  1HWY A;  3TK1 A;  2UXN A;  1JCH A;  3OGC C;  3CCS V;  1K9M W;  4PA7 A;  1YIJ V;  2EJR A;  4LBE C;  1M1K W;  2A79 B;  5KA5 A;  3OMI B;  2YEV B;  1M56 C;  1R3K C;  1TUE B;  5CBF A;  3G71 V;  3R65 A;  5IYD O;  5CA3 A;  2P7T C;  1YHQ V;  2EIN B;  3JD3 A;  2W0F C;  4MSW C;  4X89 A;  5IYB O;  2Q6A A;  3CCE V;  1S5H C;  3QO5 A;  1BMF G;  2WAM A;  3SPH A;  3FYE B;  4WFF A;  2WLH A;  3G6E V;  2H8P C;  1PNL A;  2OTL V;  3ZIA G;  1AI5 A;  4XDK A;  2KB1 A;  3VOU A;  5L3D A;  1JX9 A;  1OCZ C;  4TWK A;  3CPW U;  2W6I G;  1MSW D;  1BHB A;  3AG3 B;  1FXV A;  1AJP A;  1EZJ A;  1V55 B;  2DWD C;  5GW7 A;  4FJC C;  3ABK C;  4ZKI A;  2WLK A;  2ZXW B;  1JJ2 U;  1NH2 D;  3VBB A;  4R50 A;  1UJW B;  2QKS A;  1H8E G;  2P67 A;  5H6Q A;  4XDL A;  3E8G A;  1YTF D;  4PA3 A;  2JEX A;  1Y4M A;  2X6B A;  4R6Z A;  4Q20 A;  2JEU A;  2JJ1 G;  2OCC C;  3E8F A;  1YJW V;  4R8C A;  1SET A;  2DYR C;  3CCL V;  3JD2 A;  3ZRW A;  1S77 D;  3QNE A;  3CD6 V;  3ZRW B;  1H2G A;  2HG5 C;  3RW0 A;  5B3S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...