3CCEV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cceV00
5DM6V 1JJ2U 3G6EV 3CCSV 1YITV 3CC2V 3CCLV 1YHQV 2D3OW 3CC4V 3CC7V 1VQ9V 1VQNV 3CCQV 2OTLV 1VQ6V 3CPWU 2OTJV 1Q7YW 2QEXV 3CD6V 2QA4V 1YJ9V 1M90W 1Q86W 1QVGU 3I56V 3CCUV 3OW2U 3CCVV 1VQLV 1N8RW 1VQMV 1K73W 3CXCU 1NJIW 1KD1W 1VQ7V 1VQKV 1VQ4V 1S72V 1KC8W 3CCJV 1Q81W 1VQOV 1K9MW 1KQSU 3CCRV 3I55V 1YIJV 1YJNV 1R73A 1VQPV 1QVFU 1YI2V 1K8AW 3CCEV 3CMAV 4WF9V 4WCEV 3G71V 1YJWV 3CMEV 1W2BU 4WFAV 1M1KW 1Q82W 1VQ8V 3G4SV 3CCMV 1VQ5V 4WFBV
chains in the Genus database with same CATH superfamily
5CBFA 3DGEA 4JI7B 2EINB 5KHHA 3D3QA 4O2BB 4DV6B 2E75B 3OW2U 3CCVV 1EZVH 1SQGA 4GZRB 2AZ0A 2ZXWC 4MTOA 1XMQO 2V4DA 4NB5A 1XMOB 4FM1A 3FX7A 1O9GA 3K03A 5GONA 3OTFA 3W7UA 3K9AA 3CCEV 1CP9A 2DN9A 1HNZO 4WCEV 1E1QG 5KA6A 2IH1C 4DR5B 1WB7A 1I0HA 1ORQC 4DO2A 1N36O 1JCHA 2K1EA 5B1OA 4X8AA 4D7TA 3JD0A 2WLMA 1XL6A 1FFXA 3AG4C 2Y0PA 4C7UA 1WNSA 3RYHA 5LGUA 4XBFA 5JJEB 3CRMA 4KUMA 5ITZB 1H2GA 1RSOB 4JI6B 1Q43A 3E22B 3QTCA 4ZBMA 3A0BZ 2ZXWB 2W0FC 2YUAA 3ZRWA 5CB4B 1VQMV 3UO2A 4LF6O 5IJ0B 4JYYA 1I5YA 4PD4F 2E3CA 2V7QG 2X0LA 1HNWB 2Q0OC 4OPHA 3WU2Z 3OAAG 3BY6A 1AR1B 4DV3O 1J5EB 1TUBB 5CA1A 2DYRB 3AK3A 2YEVA 3AG4B 1AILA 2OYQA 4WFHA 3LNNA 4UCVA 1KMIZ 2F23A 1I7FA 2A0LA 4UCUA 4J9YB 3G80A 3P3NA 5EK0A 1MMMA 1WPXA 3L75H 4QE7A 5JVDB 3ABKC 1HW7A 1WLEA 1FS0G 2FKXA 4I50A 3CCLV 1R6KA 3SPIA 5B5EZ 1FJGB 4DR2B 3E8GA 4D7SA 3K0GA 3QO8A 1DLBA 1RM1B 2YC0A 3FYEB 2DOSA 3GVMA 3JARB 1HDJA 5EIBD 2ZINA 3WB1A 2Y69C 4DR3O 4ZKIA 3DC5A 2KG7A 2RQ6A 3DTUB 4FFBB 1OV9A 3T1CA 3N2KA 3RVZA 1OZ0A 3BHPA 1G4YB 2QM7A 2X6AA 3HKDB 3I56V 2ZDIA 2JDIG 3BCCH 3EXAA 2EZOA 1YF2A 3JCZA 3P30A 4NXNB 2ZIOA 4UV8A 4DRXB 1ZL8A 3ABKB 2HP8A 4QIWF 4BAYA 4JYAB 1P7BA 3OMIB 4WFBV 2H3OA 1VF5B 2DWDC 1IBLO 5JCOA 1VQLV 1F7YA 1R3JC 1IBKB 3LUTB 2Y69B 2DYSB 1NBMG 4HBNA 4UV9A 4O4IA 4J41A 3B09A 1ZSPA 2Q69A 5BY1A 2JGUA 2QWRB 1WB8A 1OJHA 5E79Z 1MNGA 4UVCA 1SA0A 5L3DA 5DM6V 4E2LA 3X2QC 2YXHA 5J2TA 5H6RA 2DJVA 4QPJA 1Q6HA 1OCCC 1Z2GA 2RDCA 1SQQH 3SYAA 3O9OA 4TWKA 2ZE6A 2HFEC 1SQPH 2M6YA 3ZIAG 4I4TB 3AG1C 3OGCC 4JV5B 4BWAA 2IJIA 5LHIA 4WFFA 2A9HA 4QE9A 1YCIA 3OTOO 4MVZA 4LNUB 2ZCEA 4J11A 3K59A 2BSKA 4Z1VA 3CXCU 2IJJA 3ML0A 3A0HZ 1SETA 2YIDA 2PF4E 4EB6A 3CP1A 4MVSA 3K04A 5A2QN 2UXBO 4PA4A 4PI0A 4JI8O 2EIJC 1K92A 2XHBA 2ZDIC 4RUEA 3RVYA 1VQ4V 3OGIB 1H2NA 2UXXA 4CS4A 1WN7A 4XDKA 2EZPA 4MVRA 1LUVA 1BQZA 1SZXA 3D3IA 3CMAV 4NTXA 1JMKC 4PDVA 3MHHC 4XDJA 4JI7O 4DV6O 4I5SA 3S3WA 2P22C 2X7RB 3QF7A 1H38A 4R8CA 1AR4A 1SC5B 3BRCA 3A0RA 5KAIZ 3HKBB 5EBMC 3ZHVA 1SESA 3TXSA 1XUQA 4TQDA 2F4VO 1Y66A 3K5OA 2QTOA 1M57C 5KX5A 4LF7O 5KUKA 1L0LH 3JSNA 3CCSV 5IYCO 2LP7A 4DR1O 4GX0A 3CC7V 4RQFA 4JZGA 1L1FA 2ZQMA 3LDDA 5EYPB 1YDXA 2AHYA 1ENVA 2XAHA 1RFYA 3UT5B 3JD1A 5KMGA 1MA1A 2ZR3A 4X66B 3NR7A 1AJPA 3FYIB 5K1PA 2PUSA 2HHHO 3STZC 1NR7A 4WFEA 4UCOA 4X65O 4DR4O 3K79A 2LGQA 4Q20A 3CCQV 1B3QA 3OEEG 2RNBA 3L71H 4JTCB 3LDEA 1W0KG 4P9OA 1M57B 4GYCB 1Y76B 3VQYA 4IHJA 4YJ2A 1S3JA 1K97A 5JJNB 4CS3A 1PPJH 5DEDA 1N4CA 3CC2V 3MD0A 4I9WA 3WB2A 4ZHQB 4X1YB 5B66Z 4CBCA 3CRRA 5KHJA 1MOFA 1RPRA 1Q6UA 2ATKC 3JALB 2YS8A 4X20A 1CEZA 2WLIB 2X6BA 2QM4A 4DK1A 2IU3A 2ZE8A 4UVBA 3G4SV 1VQ5V 1EN4A 4DR2O 1YITV 4JAVA 2BSKB 4IGGA 5IYBO 2XTAA 2QWPB 4PA6A 4LC1A 4DV4B 3ABTA 1KB9F 4O4LB 1K4DC 2AHZA 1BS3A 4B3MO 4DR6B 1N32B 2CTPA 3JD3A 2O57A 3H1HH 3ETDA 4YHHO 5LBQA 1NS1A 5BMVB 4YY3B 4NXNO 2CTWA 2WLLA 3KCXA 4WBNB 4CH5A 4I55A 4LFAB 5IDJA 2OWOA 1QCEA 4K8ZA 3CCRV 1N34B 2N05A 5CMUA 4JI3O 2VQEO 1Y74A 4X64O 3HB3B 4NVPA 1WP8A 4GKKB 4UCRA 5EBWC 3A8TA 1YEWA 3ABLC 3CJHB 4DW0A 2HLDG 4KHPB 2ZE5A 4PA7A 3LDCA 1TVKB 1YZBA 3L72H 4B7KA 3BAAA 2WLJA 3AK2A 4OPAA 4CH6A 3FB5C 1H8EG 4I0XA 3DXRB 1N0JA 4J80A 1GK9A 2PGGA 4MTGA 4JI4O 4LF9B 5LOVA 3CRAA 4BW9A 4L8JA 1Q7YW 4LF5O 4IT5A 5LYJB 2ETNA 1PNKA 3S3XA 1Q3EA 3TCUA 1JX9A 1NZ6A 3B8MA 3L74H 1W59A 4DUYB 3IC7A 1YXBA 2PYJA 4A5UB 4RAIA 1LR1A 3ABLB 2YSUB 3E8FA 1HWYA 1L8DA 4FLVA 4RO2A 1TA8A 2D3OW 3OE7G 1QQCA 1VQ9V 1EBOA 1X59A 3JCUZ 5LHGA 2QEXV 3LSUA 1CXZB 4PV1B 2XT9A 4PELA 1IZ3A 2UXDB 3RYCA 1BHBA 1PNMA 3OEHG 4ZOLB 1FAFA 5IYZA 3K58A 3B8NA 2YDEA 1FFTB 1ZUQA 2CGNA 2P67A 4TOIA 3AEIA 4O4HB 3E2EA 2ZNJA 1IXMA 4NTYA 3ZBHA 4DV2O 5LXTA 4TUYA 2CTRA 4JI1O 4PI2A 3SPCA 4DV1O 3WB0A 3AG3B 3AK1A 4MW3A 1H2MA 1HP8A 2HKOA 2Q73A 1R73A 3ZHTA 3O65A 4FLUA 4LFBO 4JYBA 3JASB 2E5LB 5LA6B 3M7MX 3OUFA 2HJDA 4J10A 1PL4A 5F2VO 3T4DA 2P5OA 5KHKA 3RYFA 3N27A 3TXQA 2ZM6B 3CB2A 3OT7A 4PA9A 4NR1A 1H2KA 3JATA 1M1KW 4DV5B 4WFAV 1GN4A 1COWG 1UFIA 1F4MA 1OCRB 2Z0AA 3H1LH 4UVAA 3CCMV 4NKGB 4DR7B 4X1KA 4DV7B 4OGQB 3D36A 3OD4A 1D5AA 1FYJA 4AQYB 2UUCB 4N23A 4J7JA 1YSCA 3K08A 4JTAB 4JF3A 2GHYA 1AP5A 4YIPA 1AP6A 3CYOA 4JYCA 4Q6GA 2XAFA 4MVMA 5IY5C 4JI0B 1Y6XA 3RBZA 4LF4B 1D5NA 2A7WA 2VS0A 4XDLA 4F6RB 2LFRA 5A9GA 3MDSA 5C8YA 3JD4A 2H8PC 2GDSA 2CH7A 3OMAB 1N0NA 2F66C 4CH4A 1M90W 1BHAA 2BOBC 3CHXA 1WJZA 4G28B 3T1YO 3R66A 4W4LA 2UUAO 2VQFO 2DQ3A 2H94A 1R3IC 1WP7A 1FKAO 1G1XB 1VEWA 4X89A 3ZHUA 2A3QA 5JWPA 5CA0B 2QR4A 2OTLV 2LO1A 1T5EA 1RPOA 3FAVB 1O9HA 5CBGA 4FJCC 5BR8B 3ASNC 5CBHA 5IY5B 1Q81W 4ICGA 2CGOA 4EKWA 4TV8B 2CAZC 1BGYH 4FFKA 2W6JG 4W4KA 1HR0B 1KBHA 2AZ2A 4HNAB 3B4SA 1X4TA 4X1IB 5FLXN 3APQA 3OUSA 1GTOA 4QGPA 4KP4A 2JS3A 3FFQA 3MHSC 3VBBA 4H44B 2R9AA 1SKVA 1VF7A 4LWSA 4O2AA 3T4ZA 2ZT9B 1UJWB 5FPOA 1XEQA 1NH2D 5L3CA 4UB8Z 3D36C 3K0DA 3KKYA 1PP9H 1XQ8A 4LFCB 5IJ9A 5JH7B 4GKKO 3CMEV 2OIEA 3UKMA 4GKJB 2XAJA 4X62B 4FM0A 3SYQA 1GN6A 2GUZB 5B1BC 2BTQA 1QVGU 3RWRD 5EZYB 3RYFB 1IX9A 1XNQB 1IDSA 1AROP 3L9DA 5KHIA 4NXMO 4DK0A 2YI9A 3T1HB 4O4JA 4LF9O 1XNRO 3M8AA 3W7SA 5LMUB 2IBZH 4B3TO 3J81N 4FLYA 4JAUA 4DXWA 5CN0A 2B1IA 4YJ3A 2OIGA 1AJQA 1B04A 3CSXA 5GONB 1JR9A 2KQXA 5LL6Y 4ZI7A 3I55V 3T2MA 1NR1A 2FTKA 4HAMA 2CH7B 3SPJA 2QKAA 4UUJC 1FXVA 4PJ0Z 4LF8B 3RFRA 5LMNB 2Q0AA 2UXDO 1FFXB 1NJIW 3RYHB 1WA8A 2LW7A 5JQGA 1WAZA 3H01A 3EVKA 4PA3A 1GH6A 1B6QA 5IWAO 1XDCA 1HNXO 3HPLC 3IC9A 3ZRWB 2F95B 1FPOA 3ZMUA 4FLXA 2R9IA 1VF6A 3WG7C 1P49A 1SF9A 1V54C 2JJ2G 3C3SA 3RN4A 4HZ3A 5CA1B 2UU9O 3X2QB 4E4EA 1SERA 4MW8A 5FL7G 3RYIA 1JPXA 2LGWA 2YEVB 1K8AW 3QVNA 3JAWA 2YI8A 4J42A 3K5NA 1OCCB 1R6TA 3JAMN 1FXHA 3VOUA 4RQEA 3CD6V 4IIJA 1BSMA 4MTFA 1VQ7V 1VQOV 3AG1B 4I9QA 4JI5B 4DR7O 3JYCA 1JFFA 3QO7A 3N2GA 3BFRA 4U3JA 4I50B 2CTQA 3E83A 2N04A 1TUEB 4WFGA 4CC6A 3K5MA 2UUCO 1D2DA 1V54B 1DTOA 2JJ1G 2Y0IA 2HJFC 4DUZB 2D2CB 3PJSK 1LUWA 1XMOO 2BOCC 5JCOC 4N21A 2GTAA 1V55C 1G6UA 1U96A 3PN1A 4CH3A 1GN3A 2GSMB 2EJ7A 2KG7B 4DR5O 2X6CA 5J2UA 1B06A 2EIJB 3SPGA 5D5PA 5B3SC 4JI2B 3N2KB 5LP6A 3H1JH 2JGDA 1YJWV 4MSWC 2Y48A 3K3WA 2IH3C 2KB1A 3H9VA 1K4CC 2LFSA 1ZL8B 1S72V 2Q67A 1VP7A 1G8MA 1M56C 2Z5UA 4JZ2A 4JI6O 3OFNG 1K33A 3SYPA 2BE3A 4WF9V 3H1IH 2FMLA 1MSDA 2ZE7A 2AW9A 2V1DA 5H5NA 1N33B 1R3KC 4RUFA 3WFVA 1V55B 4GCZA 4U7NA 1I94B 1HNWO 1CPYA 2WSSG 1E79G 1H2LA 4O4IB 2WLHA 1J5EO 2W6IG 5FNVA 1NVPD 1M9NA 1XMQB 1SA0B 2HG5C 2MW2B 3OMNB 3TK1A 2K9PA 1HNZB 5J2TB 1EM1A 3L70H 3ETQA 3JSLA 1ZX3A 1AI4A 2F93B 2PYLA 3MAQA 3HKCA 3ZX6A 1P4RA 3ZS8C 2EIKC 3THOA 2R9RB 1UPGA 1JOYA 2YICA 2NR5A 4BIUA 3W7WA 1F23A 3SJQC 1FJGO 3FKSG 4JASA 2FB5A 4MVUA 4B3RB 3OM3B 4LP8A 3CRCA 2WWWA 3Q4HA 1OCZC 4UXNA 4EB6B 2WPDG 3VQWA 1YJNV 1XHXA 2ODMA 2RCVA 4PHZA 3ZHQA 4X62O 3HKEA 1W2BU 4PDMA 2DQ0A 5L3FA 5E1AC 2ZR2A 4DV3B 4AI8A 2P6JA 5LP6C 3ICXA 4FM2A 2QGNA 2XNDG 5B1AC 3K5LA 1K73W 3CWBH 1N8RW 4D6TH 1S5HC 2F1MA 5D5QA 4DW1A 1BT8A 4RWUA 4JYAO 1SS3A 1AJNA 4G27B 5CA3A 2HVKC 1GRJA 4TV9A 1BL8A 1MSWD 1IBKO 1OCZB 1S0VA 4P30A 4O2BA 4GX1A 2L6LA 2QWQB 3ZMSA 2Q6AA 2PI4A 1BZKA 3ZJZA 3ETEA 1H2SB 5KX5B 4MVOA 4LF8O 3FD9A 4DR3B 5BXZA 1JJ2U 3ETGA 5LGNA 2LQTA 5KMGB 3A2FA 1OCOC 2LJ2A 3IGAC 1GO3F 2CDYA 4TSFG 4JV5O 1YIJV 1JJOA 3P3PA 4PDRA 2L35A 5GW7A 3SYCA 3BEHA 5ITZA 4K3AA 4F4LA 1RSOA 3ZCCA 3E22A 5HFLA 4ABMA 2R70A 2EIMC 1A32A 3GWKC 4NTWA 2GV9A 1Y4MA 4K8XA 1GKFA 5CB4A 4IHJB 5TISZ 4YJ2B 1IBLB 1Q90D 2R72A 2EBOA 5IJ0A 3UCSC 2NLJC 5J9PC 2B5UA 2RMKB 5H9CA 1TUBA 1Z5VA 4FIPC 2EILC 2Q68A 3ABMC 1YTFD 2HR3A 4IL6Z 3CE2A 4GUNA 3AG2C 4X20B 1P7GA 1IVSA 4FMTA 2PTMA 1S76D 1EZJA 2WLKA 4LCUC 4GX2A 2QJ1A 1NU1H 2E76B 2Q4PA 3RGBA 5JVDA 4H0LB 3TETA 2OTJV 1QVFU 5DN6G 2Q5ZA 5JJJB 1U97A 2VWKA 2EINC 3JD2A 3VQXA 4JI2O 3JARA 2LW1A 1WPBA 4FZ1A 3ABMB 1AI5A 3APOA 2QE7G 2WLLB 4FFBA 2UXBB 3AG2B 3G67A 3F5WC 1F51A 4EEQA 4I55B 4X66O 1FD9A 4KFMA 4R7CA 3HKDA 2A06H 1Y74B 2MK3A 3BA8A 1F4NA 1MZFA 4DRXA 1N33O 4X9QA 2UUBB 2JRIA 2QKCA 1H8HG 4QJFB 3ZHRA 2DW4A 2ADQB 4F6EA 4LR3A 2IU0A 3H1KH 2IM9A 1PV0A 1KKDA 3AG7A 2JEUA 3ZRVA 4EFBA 4I0XB 3KG2A 1QU7A 2F4VB 1GM9A 5LOVB 2YXYA 3GWOA 1NI8A 1K7DA 3UM7A 1THZA 4LF7B 2DYRC 4BIZA 1Q86W 5EC1C 1NQTA 4DR1B 2AXTZ 2DWEC 2ZNIA 1IURA 4IYHA 2AGAA 4JGSA 4U3FH 2GTSA 4B08A 4R50A 1YI2V 4OXSA 4I4TA 2HHHB 1YVWA 4B3RO 5B1NA 3ZMTA 4DV4O 4X65B 1GM8A 4DR4B 4B3SB 4LNUA 4UCSA 4HYOA 3RYCB 4MVQA 2N74A 1QBZA 4KL1A 5IYZB 4BIOA 3DC6A 1JVMA 1VIBA 4DR6O 1N32O 1RM1C 2YIAA 1PNLA 2VWJA 4YY3O 1KECA 2Q8VA 5LXTB 3ASNB 4TUYB 3D8CA 2PI5A 4LFAO 2YIBA 1NKDA 1I5XA 4YIOA 1N34O 3CEIA 2EJRA 3E89A 4MT8A 1JQ0A 5KLVH 1M5IA 1Q6IA 4GX5A 1L0NH 4Z2WA 2FYUH 1KP2A 2HVJC 2DMXA 1ZLZA 5L3EA 1PM9A 5GTHZ 1KKCA 2ZIMA 3FB6C 4UB6Z 4OX9B 4KHPO 4CS2A 4DV0B 5L3BA 5IE9A 2B1GA 2IJKA 5GTIZ 3JATB 2VRZA 2C2AA 3B40A 3HKBA 2DYSC 4YXWG 1QLEC 4X1KB 4UFZA 3VQVA 4B3MB 2P06A 3ZN0A 4TQFA 1SRYA 1XBLA 3EHBB 4UCTA 2KKWA 4Z1MG 4LH6A 4YHHB 1E1RG 4P2ZA 5EYPA 4DUYO 3UT5A 2Y4TA 3LNMB 1KUQA 3TJTA 5C93A 4FK5C 5KA5A 5EC2C 5C8YB 3SJBC 4J9ZB 1XHZA 5B1BB 4I7ZB 4JI3B 2DE0X 2VQEB 2ADPA 4X64B 2XAQA 1NVPB 1GN2A 5BZBA 3P32A 4MS2A 1QLEB 3K9SA 1KYOF 2GBOA 1AI6A 1Y76A 3EFFK 2EX3A 1YHQV 5IT9N 3B2EE 3F5TA 4JI4B 2ZD9A 2W0XA 2QSAA 4LF5B 4ZHQA 5LHHA 4X1YA 2G38A 3B77A 4IYIA 2YXLA 2P4VA 2WA4A 3SR2C 1SQFA 2KSDA 3JALA 3SJCC 2E5LO 2WLIA 1PD3A 1QLNA 3L73H 1VQ8V 5HFMA 4KXRA 1DK1A 3QO5A 3GB7C 3E86A 1VQ6V 2B9ZA 1S77D 1IBMB 2UXCB 1M4UA 3ASOC 1I08A 2ZM6O 1K5SA 4DV5O 1DF4A 4LWSB 4O2AB 4DV7O 4O4LA 4FLTA 3WG7B 5K1XA 3CXHF 3LSQA 2QWOB 4AQYO 4H33A 1R6NA 1SZTA 5BMVA 4DV2B 4R6ZA 2QTSA 4WBNA 1GM7A 3U11A 5IJ9B 4JI1B 3FB7C 4DV1B 4JI0O 2UUBO 1W0JG 4LF4O 1SQXH 4LBEC 3IFXA 2E74B 1KP3A 1Q8IA 3JAKA 2BTQB 3CC4V 3BPZA 4LFBB 3ASOB 2F43G 1BE3H 2ILMA 2JVDA 1US6A 4TT3G 2A79B 2IJHA 5EBLC 1ROPA 3CJHA 1KC8W 1VMGA 4AILC 4EFEA 4O4JB 4CZZA 1TVKA 2QDOA 4G2KA 3OR7C 1MABG 4JTDB 4K0KB 4BR6A 3DXRA 1PL0A 2P4KA 4YJ3B 5BR8O 3QG5A 3SPHA 4FLZA 1VF6C 3KCYA 3F7VC 4ZI7B 1HR0O 1RP3B 2Q7EA 5LYJA 1M93A 5B3SB 2ZKOA 2OT5A 1Q5OA 2JIZG 2Q9LA 2IW5A 5KAFZ 4GLXA 2RJZA 1R3LC 4B3SO 3IJ4A 3K57A 1BCCH 1VQNV 2PY5A 3E8HA 2QA4V 1AR5A 3CCUV 1M56B 2CUGA 1WA8B 1N36B 5JQGB 1DGSA 4J7ZA 3W7TA 3CRQA 3T1YB 4CC5A 4JAAA 1OHHG 5KUMA 2ITDC 2VQFB 1YTFB 2UUAB 4ZOLA 4QNHB 3E35A 1R1BA 1S5JA 2BCCH 3ZHSA 1KU9A 1TGOA 4O4HA 2OCCC 2ARHA 3M99B 5L3GA 2PZSA 2XUMA 1NTKH 4LFCO 1FXKA 1PKXA 5IYDO 4J7KA 4LF6B 3J80N 4NYKA 3RYIB 3C3TA 4GKJO 2HEPA 1JA8A 1IXBA 1Z5WA 3DSQA 3K06A 3JAWB 1Q82W 5DECA 1KQSU 4OX9O 3ABUA 4IIJB 2QM8A 2WAMA 1DF5A 4DV0O 1GMGA 3JASA 2Z3YA 3I5DA 3SGIA 1QR9A 1XNQO 2EIKB 3U10A 5LA6A 1MG1A 3U0ZA 1XOUA 3T1HO 3SDLA 1URFA 1JFFB 3N2GB 1K5QA 2YIBD 1XREA 4U3JB 5LMUO 1V9PA 2XOKG 4PDLA 3OR6C 2OCCB 2BTOA 4AHCA 1YJ9V 3UQ8A 2NN4A 1KD1W 1QNMA 1S5LZ 1SQVH 2Q7HA 1LNQA 3RW0A 1EFRG 4MTXA 5J2UB 2FL4A 3ZMZA 1GAXA 5LP6B 3JAKB 3C90A 2JGDB 1ZWIC 3IAYA 5LMNO 3ZRSA 2P7TC 2XAGA 5B1AB 4F6RA 1ZTEA 2WA3A 2NNUA 3SYOA 3TGUH 4ZIBA 5LGTA 4B7EA 3SJAC 4QPKA 3ZN1A 4L87A 4NXMB 3ZRXA 1AB3A 2UXNA 4FVMA 2P90A 1EN6A 1VQPV 1BMFG 3CX5F 1XNRB 3G6EV 4B3TB 5CA0A 1XL4A 3FAVA 5FNVB 1XI1A 3QNEA 1FXKC 2CK3G 3FB8C 3AG3C 3ZMVA 4TV8A 3R65A 1QHTA 1SQBH 1EN5A 4HNAA 4X1IA 1OCOB 1IBMO 2UXCO 1K3EA 3RT3C 3W7XA 3BVOA 3KZIZ 4BW5A 3HKCB 3STLC 3F7YC 2EULA 5EIBC 3CS5A 4JI5O 1NT2B 1K9MW 5H6QA 1MZEA 2QWNB 1BQ0A 1NH2B 1AI7A 3UO3A 2Y4UA 4FZ0A 1AVMA 2EIMB 3NXSA 2M7WA 1NTMH 3J7AU 5H2FZ 2JEXA 4U7OA 5IWAB 4DUZO 1HNXB 4K35A 4GT1A 3CPWU 1OCRC 1FXKB 3G6BA 4H13B 3E8BA 3Q4HB 3OTOB 2QKSA 5AG2A 1P84F 2OCHA 3HKEB 2CE4A 1ZAUA 3BA9A 3BABA 2UU9B 2EILB 4ASUG 5JH7A 4P9PA 1J95A 4H37A 4FLWA 1NTZH 4JPRA 2Q7GA 1Y67A 4X88A 2WLNA 2JK5C 1QR8A 2GUZA 4JI8B 4LH7A 4FPPA 1VQKV 5KHGA 2RN9A 3CCJV 5EZYA 2XASA 4DYLA 1XILA 1VARA 1K34A 4K0KO 3HR0A 2JS5A 5FPRA 4TV9B 2ITCC 3G71V 3LSSA 3ZEDA 1TAEA 1I94O
chains in the Genus database with same CATH topology
2Y48A 3K3WA 2IH3C 5EBWC 5CBFA 3ZN0A 3DGEA 1SRYA 2KB1A 2EINB 3ABLC 3EHBB 1K4CC 3OW2U 3CCVV 4Z1MG 1E1RG 2HLDG 4P2ZA 2LFSA 2ZXWC 4MTOA 1S72V 2Q67A 1G8MA 1M56C 2Z5UA 4PA7A 3LDCA 3K03A 3LNMB 3OFNG 1K33A 2WLJA 3W7UA 3SYPA 3K9AA 5C93A 4FK5C 3CCEV 1CP9A 3FB5C 1H8EG 4WF9V 4WCEV 1E1QG 5KA5A 5EC2C 5KA6A 2IH1C 4J9ZB 5B1BB 2V1DA 1GK9A 1ORQC 4DO2A 4MTGA 2XAQA 1JCHA 1R3KC 4RUFA 3WFVA 1NVPB 1V55B 4GCZA 4U7NA 2K1EA 5B1OA 1Q7YW 4X8AA 3JD0A 1CPYA 2WLMA 1XL6A 2WSSG 5BZBA 3P32A 1E79G 1PNKA 4MS2A 3AG4C 2WLHA 1QLEB 3TCUA 1JX9A 3B8MA 2W6IG 5LGUA 1NVPD 3IC7A 1M9NA 1AI6A 4XBFA 4KUMA 1H2GA 3EFFK 2HG5C 3OMNB 4RAIA 3TK1A 3ABLB 2YSUB 3E8FA 1HWYA 4ZBMA 4RO2A 2ZXWB 1YHQV 2D3OW 3OE7G 1VQ9V 2W0FC 1EBOA 3ZRWA 5LHGA 2QEXV 1AI4A 2ZD9A 1VQMV 4PELA 1I5YA 2X0LA 2V7QG 1P4RA 1BHBA 2EIKC 1PNMA 5LHHA 2R9RB 3OEHG 3B77A 3OAAG 1JOYA 3BY6A 1AR1B 3B8NA 2DYRB 4BIUA 3W7WA 1FFTB 2WLIA 1F23A 1PD3A 1VQ8V 1QLNA 5HFMA 2P67A 3SJQC 3FKSG 2YEVA 3AEIA 3QO5A 3AG4B 3GB7C 4JASA 3E86A 1VQ6V 3E2EA 1IXMA 4MVUA 3OM3B 4WFHA 1S77D 4LP8A 2WWWA 3SPCA 3AG3B 3ASOC 1OCZC 2A0LA 4MW3A 1K5SA 4UXNA 2HKOA 2WPDG 4J9YB 1YJNV 1R73A 1DF4A 5EK0A 1W2BU 1WPXA 4PDMA 2DQ0A 4QE7A 5L3FA 5E1AC 3ABKC 3WG7B 2ZR2A 1WLEA 4JYBA 2P6JA 1FS0G 3CCLV 1R6KA 3LSQA 3SPIA 2XNDG 4H33A 1R6NA 3OUFA 5B1AC 1SZTA 1K73W 3E8GA 1N8RW 1S5HC 3K0GA 3QO8A 1DLBA 3T4DA 4R6ZA 1RM1B 1GM7A 3FYEB 3FB7C 1W0JG 1AJNA 4G27B 5CA3A 2HVKC 4LBEC 2Y69C 4PA9A 3IFXA 4ZKIA 1M1KW 1KP3A 3DTUB 4WFAV 1COWG 1F4MA 1OCRB 4UVAA 3CCMV 3T1CA 1BL8A 3CC4V 3D36A 3RVZA 1OZ0A 1MSWD 3ASOB 1G4YB 2QM7A 1OCZB 2F43G 2X6AA 3I56V 1S0VA 2ZDIA 2JDIG 4TT3G 2A79B 2IJHA 5EBLC 2EZOA 3JCZA 3P30A 4P30A 4GX1A 1ROPA 4N23A 1YSCA 1KC8W 3K08A 4JTAB 4JF3A 3ZMSA 4UV8A 2GHYA 2Q6AA 2PI4A 3ABKB 3ZJZA 3ETEA 4CZZA 3CYOA 4JYCA 4MVOA 4QIWF 4BAYA 2XAFA 4MVMA 5IY5C 3RBZA 4G2KA 3OR7C 1MABG 4XDLA 1P7BA 2LFRA 3OMIB 4JTDB 4WFBV 1JJ2U 3JD4A 1PL0A 2H8PC 3OMAB 3ETGA 5LGNA 2DWDC 1M90W 1BHAA 2BOBC 1VQLV 3SPHA 1OCOC 1R3JC 4G28B 3IGAC 3F7VC 3LUTB 2Y69B 2DYSB 1GO3F 1NBMG 2DQ3A 4TSFG 4UV9A 5B3SB 2OT5A 1YIJV 2JIZG 4PDRA 2H94A 1R3IC 2Q69A 4X89A 5GW7A 2IW5A 3SYCA 3BEHA 4UVCA 5L3DA 4F4LA 5DM6V 1R3LC 4E2LA 3X2QC 3ZCCA 5HFLA 1VQNV 2OTLV 2EIMC 3E8HA 5H6RA 1RPOA 2QA4V 4QPJA 3CCUV 1M56B 1Y4MA 5CBGA 4FJCC 1GKFA 3ASNC 5CBHA 1OCCC 5IY5B 2EBOA 1Q81W 3SYAA 4TWKA 2HFEC 3W7TA 4EKWA 2NLJC 5J9PC 1OHHG 2W6JG 2B5UA 5KUMA 3ZIAG 2ITDC 1YTFB 3AG1C 3OGCC 4QNHB 3E35A 2IJIA 5LHIA 4WFFA 5H9CA 2A9HA 3OUSA 1GTOA 4QE9A 4FIPC 2EILC 4MVZA 4KP4A 2Q68A 3ABMC 1YTFD 2OCCC 3CXCU 2IJJA 2HR3A 3M99B 3ML0A 5L3GA 3MHSC 1FXKA 1PKXA 3AG2C 3VBBA 5IYDO 1SETA 4FMTA 1S76D 1EZJA 2WLKA 4LCUC 3CP1A 4MVSA 4GX2A 3K04A 3K06A 1Q82W 4PA4A 3T4ZA 1KQSU 3ABUA 1UJWB 2QM8A 2WAMA 1DF5A 1NH2D 2EIJC 1GMGA 3TETA 5L3CA 2Z3YA 2OTJV 1QR9A 1K92A 3K0DA 1QVFU 2EIKB 5DN6G 1MG1A 2ZDIC 4RUEA 3RVYA 1VQ4V 2EINC 3JD2A 2UXXA 4XDKA 2EZPA 4MVRA 1K5QA 3D3IA 2XOKG 3CMAV 4PDLA 4PDVA 3CMEV 3MHHC 4XDJA 3ABMB 3OR6C 3UKMA 2OCCB 2XAJA 1AI5A 4I5SA 2QE7G 2WLLB 3SYQA 3AG2B 2X7RB 5B1BC 3F5WC 1F51A 1YJ9V 1QVGU 1H38A 4R8CA 4KFMA 4R7CA 1KD1W 1LNQA 3A0RA 1AROP 3RW0A 1EFRG 5EBMC 4MTXA 2MK3A 1SESA 1F4NA 3ZMZA 1Y66A 1ZWIC 2QTOA 1M57C 3W7SA 1H8HG 4QJFB 3ZRSA 5KUKA 2DW4A 2P7TC 2XAGA 5B1AB 3CCSV 5IYCO 2LP7A 4GX0A 3CC7V 4JAUA 4DXWA 4RQFA 5CN0A 2IU0A 1L1FA 2ZQMA 3LDDA 2B1IA 2AHYA 1AJQA 1ENVA 2NNUA 2XAHA 3SYOA 3JD1A 1KKDA 5LGTA 2ZR3A 2JEUA 3ZRVA 1AJPA 3I55V 3FYIB 4QPKA 3ZN1A 4L87A 3T2MA 1NR1A 2FTKA 3KG2A 3STZC 3ZRXA 1NR7A 2UXNA 4HAMA 1GM9A 2P90A 3SPJA 4UUJC 4WFEA 1VQPV 1FXVA 1BMFG 3GWOA 3G6EV 1K7DA 3UM7A 1THZA 3K79A 4Q20A 2DYRC 3CCQV 4BIZA 1Q86W 5EC1C 1NQTA 3OEEG 1XL4A 2DWEC 1NJIW 4JTCB 3LDEA 4JGSA 1W0KG 4P9OA 1M57B 3QNEA 1FXKC 1S3JA 4R50A 1K97A 2CK3G 3H01A 3FB8C 3AG3C 4PA3A 1YI2V 3ZMVA 4OXSA 1B6QA 3R65A 3HPLC 3ZRWB 3CC2V 1OCOB 3ZMUA 1K3EA 2R9IA 3W7XA 5B1NA 3ZMTA 4BW5A 1GM8A 3WG7C 3STLC 3MD0A 4I9WA 3F7YC 4HYOA 4MVQA 1K9MW 1V54C 2JJ2G 5H6QA 1QBZA 4CBCA 1MOFA 1JVMA 1NH2B 4HZ3A 1AI7A 1RPRA 2ATKC 1CEZA 2WLIB 2X6BA 1RM1C 3X2QB 1SERA 4MW8A 5FL7G 2IU3A 1PNLA 2EIMB 1JPXA 2YEVB 3NXSA 2M7WA 3G4SV 4UVBA 1K8AW 1VQ5V 2JEXA 4U7OA 1YITV 4JAVA 1KECA 4GT1A 3ASNB 1OCCB 1FXHA 3VOUA 4RQEA 3CPWU 2PI5A 5IYBO 1OCRC 3CD6V 1FXKB 4MTFA 4PA6A 1NKDA 3E8BA 1I5XA 4LC1A 1VQ7V 2QKSA 1VQOV 3AG1B 2EJRA 3ABTA 3E89A 4MT8A 1JQ0A 3JYCA 4GX5A 1K4DC 2AHZA 3QO7A 1KP2A 2EILB 4ASUG 3E83A 2HVJC 1J95A 4P9PA 4H37A 5L3EA 3JD3A 1TUEB 4WFGA 3ETDA 4JPRA 3FB6C 5LBQA 1V54B 4X88A 2WLNA 2JK5C 1DTOA 2JJ1G 2WLLA 1QR8A 2HJFC 3PJSK 1VQKV 4FPPA 2BOCC 5L3BA 4N21A 5IDJA 1V55C 3CCJV 2XASA 2B1GA 1QCEA 2IJKA 2GSMB 3CCRV 1K34A 2C2AA 5CMUA 2DYSC 2ITCC 2X6CA 4YXWG 1QLEC 3G71V 2EIJB 3HB3B 3SPGA 3LSSA 5B3SC 1YJWV 4MSWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 V;  1JJ2 U;  3G6E V;  3CCS V;  1YIT V;  3CC2 V;  3CCL V;  1YHQ V;  2D3O W;  3CC4 V;  3CC7 V;  1VQ9 V;  1VQN V;  3CCQ V;  2OTL V;  1VQ6 V;  3CPW U;  2OTJ V;  1Q7Y W;  2QEX V;  3CD6 V;  2QA4 V;  1YJ9 V;  1M90 W;  1Q86 W;  1QVG U;  3I56 V;  3CCU V;  3OW2 U;  3CCV V;  1VQL V;  1N8R W;  1VQM V;  1K73 W;  3CXC U;  1NJI W;  1KD1 W;  1VQ7 V;  1VQK V;  1VQ4 V;  1S72 V;  1KC8 W;  3CCJ V;  1Q81 W;  1VQO V;  1K9M W;  1KQS U;  3CCR V;  3I55 V;  1YIJ V;  1YJN V;  1R73 A;  1VQP V;  1QVF U;  1YI2 V;  1K8A W;  3CCE V;  3CMA V;  4WF9 V;  4WCE V;  3G71 V;  1YJW V;  3CME V;  1W2B U;  4WFA V;  1M1K W;  1Q82 W;  1VQ8 V;  3G4S V;  3CCM V;  1VQ5 V;  4WFB V; 
#chains in the Genus database with same CATH topology
 5CBF A;  3DGE A;  4JI7 B;  2EIN B;  5KHH A;  3D3Q A;  4O2B B;  4DV6 B;  2E75 B;  3OW2 U;  3CCV V;  1EZV H;  1SQG A;  4GZR B;  2AZ0 A;  2ZXW C;  4MTO A;  1XMQ O;  2V4D A;  4NB5 A;  1XMO B;  4FM1 A;  3FX7 A;  1O9G A;  3K03 A;  5GON A;  3OTF A;  3W7U A;  3K9A A;  3CCE V;  1CP9 A;  2DN9 A;  1HNZ O;  4WCE V;  1E1Q G;  5KA6 A;  2IH1 C;  4DR5 B;  1WB7 A;  1I0H A;  1ORQ C;  4DO2 A;  1N36 O;  1JCH A;  2K1E A;  5B1O A;  4X8A A;  4D7T A;  3JD0 A;  2WLM A;  1XL6 A;  1FFX A;  3AG4 C;  2Y0P A;  4C7U A;  1WNS A;  3RYH A;  5LGU A;  4XBF A;  5JJE B;  3CRM A;  4KUM A;  5ITZ B;  1H2G A;  1RSO B;  4JI6 B;  1Q43 A;  3E22 B;  3QTC A;  4ZBM A;  3A0B Z;  2ZXW B;  2W0F C;  2YUA A;  3ZRW A;  5CB4 B;  1VQM V;  3UO2 A;  4LF6 O;  5IJ0 B;  4JYY A;  1I5Y A;  4PD4 F;  2E3C A;  2V7Q G;  2X0L A;  1HNW B;  2Q0O C;  4OPH A;  3WU2 Z;  3OAA G;  3BY6 A;  1AR1 B;  4DV3 O;  1J5E B;  1TUB B;  5CA1 A;  2DYR B;  3AK3 A;  2YEV A;  3AG4 B;  1AIL A;  2OYQ A;  4WFH A;  3LNN A;  4UCV A;  1KMI Z;  2F23 A;  1I7F A;  2A0L A;  4UCU A;  4J9Y B;  3G80 A;  3P3N A;  5EK0 A;  1MMM A;  1WPX A;  3L75 H;  4QE7 A;  5JVD B;  3ABK C;  1HW7 A;  1WLE A;  1FS0 G;  2FKX A;  4I50 A;  3CCL V;  1R6K A;  3SPI A;  5B5E Z;  1FJG B;  4DR2 B;  3E8G A;  4D7S A;  3K0G A;  3QO8 A;  1DLB A;  1RM1 B;  2YC0 A;  3FYE B;  2DOS A;  3GVM A;  3JAR B;  1HDJ A;  5EIB D;  2ZIN A;  3WB1 A;  2Y69 C;  4DR3 O;  4ZKI A;  3DC5 A;  2KG7 A;  2RQ6 A;  3DTU B;  4FFB B;  1OV9 A;  3T1C A;  3N2K A;  3RVZ A;  1OZ0 A;  3BHP A;  1G4Y B;  2QM7 A;  2X6A A;  3HKD B;  3I56 V;  2ZDI A;  2JDI G;  3BCC H;  3EXA A;  2EZO A;  1YF2 A;  3JCZ A;  3P30 A;  4NXN B;  2ZIO A;  4UV8 A;  4DRX B;  1ZL8 A;  3ABK B;  2HP8 A;  4QIW F;  4BAY A;  4JYA B;  1P7B A;  3OMI B;  4WFB V;  2H3O A;  1VF5 B;  2DWD C;  1IBL O;  5JCO A;  1VQL V;  1F7Y A;  1R3J C;  1IBK B;  3LUT B;  2Y69 B;  2DYS B;  1NBM G;  4HBN A;  4UV9 A;  4O4I A;  4J41 A;  3B09 A;  1ZSP A;  2Q69 A;  5BY1 A;  2JGU A;  2QWR B;  1WB8 A;  1OJH A;  5E79 Z;  1MNG A;  4UVC A;  1SA0 A;  5L3D A;  5DM6 V;  4E2L A;  3X2Q C;  2YXH A;  5J2T A;  5H6R A;  2DJV A;  4QPJ A;  1Q6H A;  1OCC C;  1Z2G A;  2RDC A;  1SQQ H;  3SYA A;  3O9O A;  4TWK A;  2ZE6 A;  2HFE C;  1SQP H;  2M6Y A;  3ZIA G;  4I4T B;  3AG1 C;  3OGC C;  4JV5 B;  4BWA A;  2IJI A;  5LHI A;  4WFF A;  2A9H A;  4QE9 A;  1YCI A;  3OTO O;  4MVZ A;  4LNU B;  2ZCE A;  4J11 A;  3K59 A;  2BSK A;  4Z1V A;  3CXC U;  2IJJ A;  3ML0 A;  3A0H Z;  1SET A;  2YID A;  2PF4 E;  4EB6 A;  3CP1 A;  4MVS A;  3K04 A;  5A2Q N;  2UXB O;  4PA4 A;  4PI0 A;  4JI8 O;  2EIJ C;  1K92 A;  2XHB A;  2ZDI C;  4RUE A;  3RVY A;  1VQ4 V;  3OGI B;  1H2N A;  2UXX A;  4CS4 A;  1WN7 A;  4XDK A;  2EZP A;  4MVR A;  1LUV A;  1BQZ A;  1SZX A;  3D3I A;  3CMA V;  4NTX A;  1JMK C;  4PDV A;  3MHH C;  4XDJ A;  4JI7 O;  4DV6 O;  4I5S A;  3S3W A;  2P22 C;  2X7R B;  3QF7 A;  1H38 A;  4R8C A;  1AR4 A;  1SC5 B;  3BRC A;  3A0R A;  5KAI Z;  3HKB B;  5EBM C;  3ZHV A;  1SES A;  3TXS A;  1XUQ A;  4TQD A;  2F4V O;  1Y66 A;  3K5O A;  2QTO A;  1M57 C;  5KX5 A;  4LF7 O;  5KUK A;  1L0L H;  3JSN A;  3CCS V;  5IYC O;  2LP7 A;  4DR1 O;  4GX0 A;  3CC7 V;  4RQF A;  4JZG A;  1L1F A;  2ZQM A;  3LDD A;  5EYP B;  1YDX A;  2AHY A;  1ENV A;  2XAH A;  1RFY A;  3UT5 B;  3JD1 A;  5KMG A;  1MA1 A;  2ZR3 A;  4X66 B;  3NR7 A;  1AJP A;  3FYI B;  5K1P A;  2PUS A;  2HHH O;  3STZ C;  1NR7 A;  4WFE A;  4UCO A;  4X65 O;  4DR4 O;  3K79 A;  2LGQ A;  4Q20 A;  3CCQ V;  1B3Q A;  3OEE G;  2RNB A;  3L71 H;  4JTC B;  3LDE A;  1W0K G;  4P9O A;  1M57 B;  4GYC B;  1Y76 B;  3VQY A;  4IHJ A;  4YJ2 A;  1S3J A;  1K97 A;  5JJN B;  4CS3 A;  1PPJ H;  5DED A;  1N4C A;  3CC2 V;  3MD0 A;  4I9W A;  3WB2 A;  4ZHQ B;  4X1Y B;  5B66 Z;  4CBC A;  3CRR A;  5KHJ A;  1MOF A;  1RPR A;  1Q6U A;  2ATK C;  3JAL B;  2YS8 A;  4X20 A;  1CEZ A;  2WLI B;  2X6B A;  2QM4 A;  4DK1 A;  2IU3 A;  2ZE8 A;  4UVB A;  3G4S V;  1VQ5 V;  1EN4 A;  4DR2 O;  1YIT V;  4JAV A;  2BSK B;  4IGG A;  5IYB O;  2XTA A;  2QWP B;  4PA6 A;  4LC1 A;  4DV4 B;  3ABT A;  1KB9 F;  4O4L B;  1K4D C;  2AHZ A;  1BS3 A;  4B3M O;  4DR6 B;  1N32 B;  2CTP A;  3JD3 A;  2O57 A;  3H1H H;  3ETD A;  4YHH O;  5LBQ A;  1NS1 A;  5BMV B;  4YY3 B;  4NXN O;  2CTW A;  2WLL A;  3KCX A;  4WBN B;  4CH5 A;  4I55 A;  4LFA B;  5IDJ A;  2OWO A;  1QCE A;  4K8Z A;  3CCR V;  1N34 B;  2N05 A;  5CMU A;  4JI3 O;  2VQE O;  1Y74 A;  4X64 O;  3HB3 B;  4NVP A;  1WP8 A;  4GKK B;  4UCR A;  5EBW C;  3A8T A;  1YEW A;  3ABL C;  3CJH B;  4DW0 A;  2HLD G;  4KHP B;  2ZE5 A;  4PA7 A;  3LDC A;  1TVK B;  1YZB A;  3L72 H;  4B7K A;  3BAA A;  2WLJ A;  3AK2 A;  4OPA A;  4CH6 A;  3FB5 C;  1H8E G;  4I0X A;  3DXR B;  1N0J A;  4J80 A;  1GK9 A;  2PGG A;  4MTG A;  4JI4 O;  4LF9 B;  5LOV A;  3CRA A;  4BW9 A;  4L8J A;  1Q7Y W;  4LF5 O;  4IT5 A;  5LYJ B;  2ETN A;  1PNK A;  3S3X A;  1Q3E A;  3TCU A;  1JX9 A;  1NZ6 A;  3B8M A;  3L74 H;  1W59 A;  4DUY B;  3IC7 A;  1YXB A;  2PYJ A;  4A5U B;  4RAI A;  1LR1 A;  3ABL B;  2YSU B;  3E8F A;  1HWY A;  1L8D A;  4FLV A;  4RO2 A;  1TA8 A;  2D3O W;  3OE7 G;  1QQC A;  1VQ9 V;  1EBO A;  1X59 A;  3JCU Z;  5LHG A;  2QEX V;  3LSU A;  1CXZ B;  4PV1 B;  2XT9 A;  4PEL A;  1IZ3 A;  2UXD B;  3RYC A;  1BHB A;  1PNM A;  3OEH G;  4ZOL B;  1FAF A;  5IYZ A;  3K58 A;  3B8N A;  2YDE A;  1FFT B;  1ZUQ A;  2CGN A;  2P67 A;  4TOI A;  3AEI A;  4O4H B;  3E2E A;  2ZNJ A;  1IXM A;  4NTY A;  3ZBH A;  4DV2 O;  5LXT A;  4TUY A;  2CTR A;  4JI1 O;  4PI2 A;  3SPC A;  4DV1 O;  3WB0 A;  3AG3 B;  3AK1 A;  4MW3 A;  1H2M A;  1HP8 A;  2HKO A;  2Q73 A;  1R73 A;  3ZHT A;  3O65 A;  4FLU A;  4LFB O;  4JYB A;  3JAS B;  2E5L B;  5LA6 B;  3M7M X;  3OUF A;  2HJD A;  4J10 A;  1PL4 A;  5F2V O;  3T4D A;  2P5O A;  5KHK A;  3RYF A;  3N27 A;  3TXQ A;  2ZM6 B;  3CB2 A;  3OT7 A;  4PA9 A;  4NR1 A;  1H2K A;  3JAT A;  1M1K W;  4DV5 B;  4WFA V;  1GN4 A;  1COW G;  1UFI A;  1F4M A;  1OCR B;  2Z0A A;  3H1L H;  4UVA A;  3CCM V;  4NKG B;  4DR7 B;  4X1K A;  4DV7 B;  4OGQ B;  3D36 A;  3OD4 A;  1D5A A;  1FYJ A;  4AQY B;  2UUC B;  4N23 A;  4J7J A;  1YSC A;  3K08 A;  4JTA B;  4JF3 A;  2GHY A;  1AP5 A;  4YIP A;  1AP6 A;  3CYO A;  4JYC A;  4Q6G A;  2XAF A;  4MVM A;  5IY5 C;  4JI0 B;  1Y6X A;  3RBZ A;  4LF4 B;  1D5N A;  2A7W A;  2VS0 A;  4XDL A;  4F6R B;  2LFR A;  5A9G A;  3MDS A;  5C8Y A;  3JD4 A;  2H8P C;  2GDS A;  2CH7 A;  3OMA B;  1N0N A;  2F66 C;  4CH4 A;  1M90 W;  1BHA A;  2BOB C;  3CHX A;  1WJZ A;  4G28 B;  3T1Y O;  3R66 A;  4W4L A;  2UUA O;  2VQF O;  2DQ3 A;  2H94 A;  1R3I C;  1WP7 A;  1FKA O;  1G1X B;  1VEW A;  4X89 A;  3ZHU A;  2A3Q A;  5JWP A;  5CA0 B;  2QR4 A;  2OTL V;  2LO1 A;  1T5E A;  1RPO A;  3FAV B;  1O9H A;  5CBG A;  4FJC C;  5BR8 B;  3ASN C;  5CBH A;  5IY5 B;  1Q81 W;  4ICG A;  2CGO A;  4EKW A;  4TV8 B;  2CAZ C;  1BGY H;  4FFK A;  2W6J G;  4W4K A;  1HR0 B;  1KBH A;  2AZ2 A;  4HNA B;  3B4S A;  1X4T A;  4X1I B;  5FLX N;  3APQ A;  3OUS A;  1GTO A;  4QGP A;  4KP4 A;  2JS3 A;  3FFQ A;  3MHS C;  3VBB A;  4H44 B;  2R9A A;  1SKV A;  1VF7 A;  4LWS A;  4O2A A;  3T4Z A;  2ZT9 B;  1UJW B;  5FPO A;  1XEQ A;  1NH2 D;  5L3C A;  4UB8 Z;  3D36 C;  3K0D A;  3KKY A;  1PP9 H;  1XQ8 A;  4LFC B;  5IJ9 A;  5JH7 B;  4GKK O;  3CME V;  2OIE A;  3UKM A;  4GKJ B;  2XAJ A;  4X62 B;  4FM0 A;  3SYQ A;  1GN6 A;  2GUZ B;  5B1B C;  2BTQ A;  1QVG U;  3RWR D;  5EZY B;  3RYF B;  1IX9 A;  1XNQ B;  1IDS A;  1ARO P;  3L9D A;  5KHI A;  4NXM O;  4DK0 A;  2YI9 A;  3T1H B;  4O4J A;  4LF9 O;  1XNR O;  3M8A A;  3W7S A;  5LMU B;  2IBZ H;  4B3T O;  3J81 N;  4FLY A;  4JAU A;  4DXW A;  5CN0 A;  2B1I A;  4YJ3 A;  2OIG A;  1AJQ A;  1B04 A;  3CSX A;  5GON B;  1JR9 A;  2KQX A;  5LL6 Y;  4ZI7 A;  3I55 V;  3T2M A;  1NR1 A;  2FTK A;  4HAM A;  2CH7 B;  3SPJ A;  2QKA A;  4UUJ C;  1FXV A;  4PJ0 Z;  4LF8 B;  3RFR A;  5LMN B;  2Q0A A;  2UXD O;  1FFX B;  1NJI W;  3RYH B;  1WA8 A;  2LW7 A;  5JQG A;  1WAZ A;  3H01 A;  3EVK A;  4PA3 A;  1GH6 A;  1B6Q A;  5IWA O;  1XDC A;  1HNX O;  3HPL C;  3IC9 A;  3ZRW B;  2F95 B;  1FPO A;  3ZMU A;  4FLX A;  2R9I A;  1VF6 A;  3WG7 C;  1P49 A;  1SF9 A;  1V54 C;  2JJ2 G;  3C3S A;  3RN4 A;  4HZ3 A;  5CA1 B;  2UU9 O;  3X2Q B;  4E4E A;  1SER A;  4MW8 A;  5FL7 G;  3RYI A;  1JPX A;  2LGW A;  2YEV B;  1K8A W;  3QVN A;  3JAW A;  2YI8 A;  4J42 A;  3K5N A;  1OCC B;  1R6T A;  3JAM N;  1FXH A;  3VOU A;  4RQE A;  3CD6 V;  4IIJ A;  1BSM A;  4MTF A;  1VQ7 V;  1VQO V;  3AG1 B;  4I9Q A;  4JI5 B;  4DR7 O;  3JYC A;  1JFF A;  3QO7 A;  3N2G A;  3BFR A;  4U3J A;  4I50 B;  2CTQ A;  3E83 A;  2N04 A;  1TUE B;  4WFG A;  4CC6 A;  3K5M A;  2UUC O;  1D2D A;  1V54 B;  1DTO A;  2JJ1 G;  2Y0I A;  2HJF C;  4DUZ B;  2D2C B;  3PJS K;  1LUW A;  1XMO O;  2BOC C;  5JCO C;  4N21 A;  2GTA A;  1V55 C;  1G6U A;  1U96 A;  3PN1 A;  4CH3 A;  1GN3 A;  2GSM B;  2EJ7 A;  2KG7 B;  4DR5 O;  2X6C A;  5J2U A;  1B06 A;  2EIJ B;  3SPG A;  5D5P A;  5B3S C;  4JI2 B;  3N2K B;  5LP6 A;  3H1J H;  2JGD A;  1YJW V;  4MSW C;  2Y48 A;  3K3W A;  2IH3 C;  2KB1 A;  3H9V A;  1K4C C;  2LFS A;  1ZL8 B;  1S72 V;  2Q67 A;  1VP7 A;  1G8M A;  1M56 C;  2Z5U A;  4JZ2 A;  4JI6 O;  3OFN G;  1K33 A;  3SYP A;  2BE3 A;  4WF9 V;  3H1I H;  2FML A;  1MSD A;  2ZE7 A;  2AW9 A;  2V1D A;  5H5N A;  1N33 B;  1R3K C;  4RUF A;  3WFV A;  1V55 B;  4GCZ A;  4U7N A;  1I94 B;  1HNW O;  1CPY A;  2WSS G;  1E79 G;  1H2L A;  4O4I B;  2WLH A;  1J5E O;  2W6I G;  5FNV A;  1NVP D;  1M9N A;  1XMQ B;  1SA0 B;  2HG5 C;  2MW2 B;  3OMN B;  3TK1 A;  2K9P A;  1HNZ B;  5J2T B;  1EM1 A;  3L70 H;  3ETQ A;  3JSL A;  1ZX3 A;  1AI4 A;  2F93 B;  2PYL A;  3MAQ A;  3HKC A;  3ZX6 A;  1P4R A;  3ZS8 C;  2EIK C;  3THO A;  2R9R B;  1UPG A;  1JOY A;  2YIC A;  2NR5 A;  4BIU A;  3W7W A;  1F23 A;  3SJQ C;  1FJG O;  3FKS G;  4JAS A;  2FB5 A;  4MVU A;  4B3R B;  3OM3 B;  4LP8 A;  3CRC A;  2WWW A;  3Q4H A;  1OCZ C;  4UXN A;  4EB6 B;  2WPD G;  3VQW A;  1YJN V;  1XHX A;  2ODM A;  2RCV A;  4PHZ A;  3ZHQ A;  4X62 O;  3HKE A;  1W2B U;  4PDM A;  2DQ0 A;  5L3F A;  5E1A C;  2ZR2 A;  4DV3 B;  4AI8 A;  2P6J A;  5LP6 C;  3ICX A;  4FM2 A;  2QGN A;  2XND G;  5B1A C;  3K5L A;  1K73 W;  3CWB H;  1N8R W;  4D6T H;  1S5H C;  2F1M A;  5D5Q A;  4DW1 A;  1BT8 A;  4RWU A;  4JYA O;  1SS3 A;  1AJN A;  4G27 B;  5CA3 A;  2HVK C;  1GRJ A;  4TV9 A;  1BL8 A;  1MSW D;  1IBK O;  1OCZ B;  1S0V A;  4P30 A;  4O2B A;  4GX1 A;  2L6L A;  2QWQ B;  3ZMS A;  2Q6A A;  2PI4 A;  1BZK A;  3ZJZ A;  3ETE A;  1H2S B;  5KX5 B;  4MVO A;  4LF8 O;  3FD9 A;  4DR3 B;  5BXZ A;  1JJ2 U;  3ETG A;  5LGN A;  2LQT A;  5KMG B;  3A2F A;  1OCO C;  2LJ2 A;  3IGA C;  1GO3 F;  2CDY A;  4TSF G;  4JV5 O;  1YIJ V;  1JJO A;  3P3P A;  4PDR A;  2L35 A;  5GW7 A;  3SYC A;  3BEH A;  5ITZ A;  4K3A A;  4F4L A;  1RSO A;  3ZCC A;  3E22 A;  5HFL A;  4ABM A;  2R70 A;  2EIM C;  1A32 A;  3GWK C;  4NTW A;  2GV9 A;  1Y4M A;  4K8X A;  1GKF A;  5CB4 A;  4IHJ B;  5TIS Z;  4YJ2 B;  1IBL B;  1Q90 D;  2R72 A;  2EBO A;  5IJ0 A;  3UCS C;  2NLJ C;  5J9P C;  2B5U A;  2RMK B;  5H9C A;  1TUB A;  1Z5V A;  4FIP C;  2EIL C;  2Q68 A;  3ABM C;  1YTF D;  2HR3 A;  4IL6 Z;  3CE2 A;  4GUN A;  3AG2 C;  4X20 B;  1P7G A;  1IVS A;  4FMT A;  2PTM A;  1S76 D;  1EZJ A;  2WLK A;  4LCU C;  4GX2 A;  2QJ1 A;  1NU1 H;  2E76 B;  2Q4P A;  3RGB A;  5JVD A;  4H0L B;  3TET A;  2OTJ V;  1QVF U;  5DN6 G;  2Q5Z A;  5JJJ B;  1U97 A;  2VWK A;  2EIN C;  3JD2 A;  3VQX A;  4JI2 O;  3JAR A;  2LW1 A;  1WPB A;  4FZ1 A;  3ABM B;  1AI5 A;  3APO A;  2QE7 G;  2WLL B;  4FFB A;  2UXB B;  3AG2 B;  3G67 A;  3F5W C;  1F51 A;  4EEQ A;  4I55 B;  4X66 O;  1FD9 A;  4KFM A;  4R7C A;  3HKD A;  2A06 H;  1Y74 B;  2MK3 A;  3BA8 A;  1F4N A;  1MZF A;  4DRX A;  1N33 O;  4X9Q A;  2UUB B;  2JRI A;  2QKC A;  1H8H G;  4QJF B;  3ZHR A;  2DW4 A;  2ADQ B;  4F6E A;  4LR3 A;  2IU0 A;  3H1K H;  2IM9 A;  1PV0 A;  1KKD A;  3AG7 A;  2JEU A;  3ZRV A;  4EFB A;  4I0X B;  3KG2 A;  1QU7 A;  2F4V B;  1GM9 A;  5LOV B;  2YXY A;  3GWO A;  1NI8 A;  1K7D A;  3UM7 A;  1THZ A;  4LF7 B;  2DYR C;  4BIZ A;  1Q86 W;  5EC1 C;  1NQT A;  4DR1 B;  2AXT Z;  2DWE C;  2ZNI A;  1IUR A;  4IYH A;  2AGA A;  4JGS A;  4U3F H;  2GTS A;  4B08 A;  4R50 A;  1YI2 V;  4OXS A;  4I4T A;  2HHH B;  1YVW A;  4B3R O;  5B1N A;  3ZMT A;  4DV4 O;  4X65 B;  1GM8 A;  4DR4 B;  4B3S B;  4LNU A;  4UCS A;  4HYO A;  3RYC B;  4MVQ A;  2N74 A;  1QBZ A;  4KL1 A;  5IYZ B;  4BIO A;  3DC6 A;  1JVM A;  1VIB A;  4DR6 O;  1N32 O;  1RM1 C;  2YIA A;  1PNL A;  2VWJ A;  4YY3 O;  1KEC A;  2Q8V A;  5LXT B;  3ASN B;  4TUY B;  3D8C A;  2PI5 A;  4LFA O;  2YIB A;  1NKD A;  1I5X A;  4YIO A;  1N34 O;  3CEI A;  2EJR A;  3E89 A;  4MT8 A;  1JQ0 A;  5KLV H;  1M5I A;  1Q6I A;  4GX5 A;  1L0N H;  4Z2W A;  2FYU H;  1KP2 A;  2HVJ C;  2DMX A;  1ZLZ A;  5L3E A;  1PM9 A;  5GTH Z;  1KKC A;  2ZIM A;  3FB6 C;  4UB6 Z;  4OX9 B;  4KHP O;  4CS2 A;  4DV0 B;  5L3B A;  5IE9 A;  2B1G A;  2IJK A;  5GTI Z;  3JAT B;  2VRZ A;  2C2A A;  3B40 A;  3HKB A;  2DYS C;  4YXW G;  1QLE C;  4X1K B;  4UFZ A;  3VQV A;  4B3M B;  2P06 A;  3ZN0 A;  4TQF A;  1SRY A;  1XBL A;  3EHB B;  4UCT A;  2KKW A;  4Z1M G;  4LH6 A;  4YHH B;  1E1R G;  4P2Z A;  5EYP A;  4DUY O;  3UT5 A;  2Y4T A;  3LNM B;  1KUQ A;  3TJT A;  5C93 A;  4FK5 C;  5KA5 A;  5EC2 C;  5C8Y B;  3SJB C;  4J9Z B;  1XHZ A;  5B1B B;  4I7Z B;  4JI3 B;  2DE0 X;  2VQE B;  2ADP A;  4X64 B;  2XAQ A;  1NVP B;  1GN2 A;  5BZB A;  3P32 A;  4MS2 A;  1QLE B;  3K9S A;  1KYO F;  2GBO A;  1AI6 A;  1Y76 A;  3EFF K;  2EX3 A;  1YHQ V;  5IT9 N;  3B2E E;  3F5T A;  4JI4 B;  2ZD9 A;  2W0X A;  2QSA A;  4LF5 B;  4ZHQ A;  5LHH A;  4X1Y A;  2G38 A;  3B77 A;  4IYI A;  2YXL A;  2P4V A;  2WA4 A;  3SR2 C;  1SQF A;  2KSD A;  3JAL A;  3SJC C;  2E5L O;  2WLI A;  1PD3 A;  1QLN A;  3L73 H;  1VQ8 V;  5HFM A;  4KXR A;  1DK1 A;  3QO5 A;  3GB7 C;  3E86 A;  1VQ6 V;  2B9Z A;  1S77 D;  1IBM B;  2UXC B;  1M4U A;  3ASO C;  1I08 A;  2ZM6 O;  1K5S A;  4DV5 O;  1DF4 A;  4LWS B;  4O2A B;  4DV7 O;  4O4L A;  4FLT A;  3WG7 B;  5K1X A;  3CXH F;  3LSQ A;  2QWO B;  4AQY O;  4H33 A;  1R6N A;  1SZT A;  5BMV A;  4DV2 B;  4R6Z A;  2QTS A;  4WBN A;  1GM7 A;  3U11 A;  5IJ9 B;  4JI1 B;  3FB7 C;  4DV1 B;  4JI0 O;  2UUB O;  1W0J G;  4LF4 O;  1SQX H;  4LBE C;  3IFX A;  2E74 B;  1KP3 A;  1Q8I A;  3JAK A;  2BTQ B;  3CC4 V;  3BPZ A;  4LFB B;  3ASO B;  2F43 G;  1BE3 H;  2ILM A;  2JVD A;  1US6 A;  4TT3 G;  2A79 B;  2IJH A;  5EBL C;  1ROP A;  3CJH A;  1KC8 W;  1VMG A;  4AIL C;  4EFE A;  4O4J B;  4CZZ A;  1TVK A;  2QDO A;  4G2K A;  3OR7 C;  1MAB G;  4JTD B;  4K0K B;  4BR6 A;  3DXR A;  1PL0 A;  2P4K A;  4YJ3 B;  5BR8 O;  3QG5 A;  3SPH A;  4FLZ A;  1VF6 C;  3KCY A;  3F7V C;  4ZI7 B;  1HR0 O;  1RP3 B;  2Q7E A;  5LYJ A;  1M93 A;  5B3S B;  2ZKO A;  2OT5 A;  1Q5O A;  2JIZ G;  2Q9L A;  2IW5 A;  5KAF Z;  4GLX A;  2RJZ A;  1R3L C;  4B3S O;  3IJ4 A;  3K57 A;  1BCC H;  1VQN V;  2PY5 A;  3E8H A;  2QA4 V;  1AR5 A;  3CCU V;  1M56 B;  2CUG A;  1WA8 B;  1N36 B;  5JQG B;  1DGS A;  4J7Z A;  3W7T A;  3CRQ A;  3T1Y B;  4CC5 A;  4JAA A;  1OHH G;  5KUM A;  2ITD C;  2VQF B;  1YTF B;  2UUA B;  4ZOL A;  4QNH B;  3E35 A;  1R1B A;  1S5J A;  2BCC H;  3ZHS A;  1KU9 A;  1TGO A;  4O4H A;  2OCC C;  2ARH A;  3M99 B;  5L3G A;  2PZS A;  2XUM A;  1NTK H;  4LFC O;  1FXK A;  1PKX A;  5IYD O;  4J7K A;  4LF6 B;  3J80 N;  4NYK A;  3RYI B;  3C3T A;  4GKJ O;  2HEP A;  1JA8 A;  1IXB A;  1Z5W A;  3DSQ A;  3K06 A;  3JAW B;  1Q82 W;  5DEC A;  1KQS U;  4OX9 O;  3ABU A;  4IIJ B;  2QM8 A;  2WAM A;  1DF5 A;  4DV0 O;  1GMG A;  3JAS A;  2Z3Y A;  3I5D A;  3SGI A;  1QR9 A;  1XNQ O;  2EIK B;  3U10 A;  5LA6 A;  1MG1 A;  3U0Z A;  1XOU A;  3T1H O;  3SDL A;  1URF A;  1JFF B;  3N2G B;  1K5Q A;  2YIB D;  1XRE A;  4U3J B;  5LMU O;  1V9P A;  2XOK G;  4PDL A;  3OR6 C;  2OCC B;  2BTO A;  4AHC A;  1YJ9 V;  3UQ8 A;  2NN4 A;  1KD1 W;  1QNM A;  1S5L Z;  1SQV H;  2Q7H A;  1LNQ A;  3RW0 A;  1EFR G;  4MTX A;  5J2U B;  2FL4 A;  3ZMZ A;  1GAX A;  5LP6 B;  3JAK B;  3C90 A;  2JGD B;  1ZWI C;  3IAY A;  5LMN O;  3ZRS A;  2P7T C;  2XAG A;  5B1A B;  4F6R A;  1ZTE A;  2WA3 A;  2NNU A;  3SYO A;  3TGU H;  4ZIB A;  5LGT A;  4B7E A;  3SJA C;  4QPK A;  3ZN1 A;  4L87 A;  4NXM B;  3ZRX A;  1AB3 A;  2UXN A;  4FVM A;  2P90 A;  1EN6 A;  1VQP V;  1BMF G;  3CX5 F;  1XNR B;  3G6E V;  4B3T B;  5CA0 A;  1XL4 A;  3FAV A;  5FNV B;  1XI1 A;  3QNE A;  1FXK C;  2CK3 G;  3FB8 C;  3AG3 C;  3ZMV A;  4TV8 A;  3R65 A;  1QHT A;  1SQB H;  1EN5 A;  4HNA A;  4X1I A;  1OCO B;  1IBM O;  2UXC O;  1K3E A;  3RT3 C;  3W7X A;  3BVO A;  3KZI Z;  4BW5 A;  3HKC B;  3STL C;  3F7Y C;  2EUL A;  5EIB C;  3CS5 A;  4JI5 O;  1NT2 B;  1K9M W;  5H6Q A;  1MZE A;  2QWN B;  1BQ0 A;  1NH2 B;  1AI7 A;  3UO3 A;  2Y4U A;  4FZ0 A;  1AVM A;  2EIM B;  3NXS A;  2M7W A;  1NTM H;  3J7A U;  5H2F Z;  2JEX A;  4U7O A;  5IWA B;  4DUZ O;  1HNX B;  4K35 A;  4GT1 A;  3CPW U;  1OCR C;  1FXK B;  3G6B A;  4H13 B;  3E8B A;  3Q4H B;  3OTO B;  2QKS A;  5AG2 A;  1P84 F;  2OCH A;  3HKE B;  2CE4 A;  1ZAU A;  3BA9 A;  3BAB A;  2UU9 B;  2EIL B;  4ASU G;  5JH7 A;  4P9P A;  1J95 A;  4H37 A;  4FLW A;  1NTZ H;  4JPR A;  2Q7G A;  1Y67 A;  4X88 A;  2WLN A;  2JK5 C;  1QR8 A;  2GUZ A;  4JI8 B;  4LH7 A;  4FPP A;  1VQK V;  5KHG A;  2RN9 A;  3CCJ V;  5EZY A;  2XAS A;  4DYL A;  1XIL A;  1VAR A;  1K34 A;  4K0K O;  3HR0 A;  2JS5 A;  5FPR A;  4TV9 B;  2ITC C;  3G71 V;  3LSS A;  3ZED A;  1TAE A;  1I94 O; 
#chains in the Genus database with same CATH homology
 2Y48 A;  3K3W A;  2IH3 C;  5EBW C;  5CBF A;  3ZN0 A;  3DGE A;  1SRY A;  2KB1 A;  2EIN B;  3ABL C;  3EHB B;  1K4C C;  3OW2 U;  3CCV V;  4Z1M G;  1E1R G;  2HLD G;  4P2Z A;  2LFS A;  2ZXW C;  4MTO A;  1S72 V;  2Q67 A;  1G8M A;  1M56 C;  2Z5U A;  4PA7 A;  3LDC A;  3K03 A;  3LNM B;  3OFN G;  1K33 A;  2WLJ A;  3W7U A;  3SYP A;  3K9A A;  5C93 A;  4FK5 C;  3CCE V;  1CP9 A;  3FB5 C;  1H8E G;  4WF9 V;  4WCE V;  1E1Q G;  5KA5 A;  5EC2 C;  5KA6 A;  2IH1 C;  4J9Z B;  5B1B B;  2V1D A;  1GK9 A;  1ORQ C;  4DO2 A;  4MTG A;  2XAQ A;  1JCH A;  1R3K C;  4RUF A;  3WFV A;  1NVP B;  1V55 B;  4GCZ A;  4U7N A;  2K1E A;  5B1O A;  1Q7Y W;  4X8A A;  3JD0 A;  1CPY A;  2WLM A;  1XL6 A;  2WSS G;  5BZB A;  3P32 A;  1E79 G;  1PNK A;  4MS2 A;  3AG4 C;  2WLH A;  1QLE B;  3TCU A;  1JX9 A;  3B8M A;  2W6I G;  5LGU A;  1NVP D;  3IC7 A;  1M9N A;  1AI6 A;  4XBF A;  4KUM A;  1H2G A;  3EFF K;  2HG5 C;  3OMN B;  4RAI A;  3TK1 A;  3ABL B;  2YSU B;  3E8F A;  1HWY A;  4ZBM A;  4RO2 A;  2ZXW B;  1YHQ V;  2D3O W;  3OE7 G;  1VQ9 V;  2W0F C;  1EBO A;  3ZRW A;  5LHG A;  2QEX V;  1AI4 A;  2ZD9 A;  1VQM V;  4PEL A;  1I5Y A;  2X0L A;  2V7Q G;  1P4R A;  1BHB A;  2EIK C;  1PNM A;  5LHH A;  2R9R B;  3OEH G;  3B77 A;  3OAA G;  1JOY A;  3BY6 A;  1AR1 B;  3B8N A;  2DYR B;  4BIU A;  3W7W A;  1FFT B;  2WLI A;  1F23 A;  1PD3 A;  1VQ8 V;  1QLN A;  5HFM A;  2P67 A;  3SJQ C;  3FKS G;  2YEV A;  3AEI A;  3QO5 A;  3AG4 B;  3GB7 C;  4JAS A;  3E86 A;  1VQ6 V;  3E2E A;  1IXM A;  4MVU A;  3OM3 B;  4WFH A;  1S77 D;  4LP8 A;  2WWW A;  3SPC A;  3AG3 B;  3ASO C;  1OCZ C;  2A0L A;  4MW3 A;  1K5S A;  4UXN A;  2HKO A;  2WPD G;  4J9Y B;  1YJN V;  1R73 A;  1DF4 A;  5EK0 A;  1W2B U;  1WPX A;  4PDM A;  2DQ0 A;  4QE7 A;  5L3F A;  5E1A C;  3ABK C;  3WG7 B;  2ZR2 A;  1WLE A;  4JYB A;  2P6J A;  1FS0 G;  3CCL V;  1R6K A;  3LSQ A;  3SPI A;  2XND G;  4H33 A;  1R6N A;  3OUF A;  5B1A C;  1SZT A;  1K73 W;  3E8G A;  1N8R W;  1S5H C;  3K0G A;  3QO8 A;  1DLB A;  3T4D A;  4R6Z A;  1RM1 B;  1GM7 A;  3FYE B;  3FB7 C;  1W0J G;  1AJN A;  4G27 B;  5CA3 A;  2HVK C;  4LBE C;  2Y69 C;  4PA9 A;  3IFX A;  4ZKI A;  1M1K W;  1KP3 A;  3DTU B;  4WFA V;  1COW G;  1F4M A;  1OCR B;  4UVA A;  3CCM V;  3T1C A;  1BL8 A;  3CC4 V;  3D36 A;  3RVZ A;  1OZ0 A;  1MSW D;  3ASO B;  1G4Y B;  2QM7 A;  1OCZ B;  2F43 G;  2X6A A;  3I56 V;  1S0V A;  2ZDI A;  2JDI G;  4TT3 G;  2A79 B;  2IJH A;  5EBL C;  2EZO A;  3JCZ A;  3P30 A;  4P30 A;  4GX1 A;  1ROP A;  4N23 A;  1YSC A;  1KC8 W;  3K08 A;  4JTA B;  4JF3 A;  3ZMS A;  4UV8 A;  2GHY A;  2Q6A A;  2PI4 A;  3ABK B;  3ZJZ A;  3ETE A;  4CZZ A;  3CYO A;  4JYC A;  4MVO A;  4QIW F;  4BAY A;  2XAF A;  4MVM A;  5IY5 C;  3RBZ A;  4G2K A;  3OR7 C;  1MAB G;  4XDL A;  1P7B A;  2LFR A;  3OMI B;  4JTD B;  4WFB V;  1JJ2 U;  3JD4 A;  1PL0 A;  2H8P C;  3OMA B;  3ETG A;  5LGN A;  2DWD C;  1M90 W;  1BHA A;  2BOB C;  1VQL V;  3SPH A;  1OCO C;  1R3J C;  4G28 B;  3IGA C;  3F7V C;  3LUT B;  2Y69 B;  2DYS B;  1GO3 F;  1NBM G;  2DQ3 A;  4TSF G;  4UV9 A;  5B3S B;  2OT5 A;  1YIJ V;  2JIZ G;  4PDR A;  2H94 A;  1R3I C;  2Q69 A;  4X89 A;  5GW7 A;  2IW5 A;  3SYC A;  3BEH A;  4UVC A;  5L3D A;  4F4L A;  5DM6 V;  1R3L C;  4E2L A;  3X2Q C;  3ZCC A;  5HFL A;  1VQN V;  2OTL V;  2EIM C;  3E8H A;  5H6R A;  1RPO A;  2QA4 V;  4QPJ A;  3CCU V;  1M56 B;  1Y4M A;  5CBG A;  4FJC C;  1GKF A;  3ASN C;  5CBH A;  1OCC C;  5IY5 B;  2EBO A;  1Q81 W;  3SYA A;  4TWK A;  2HFE C;  3W7T A;  4EKW A;  2NLJ C;  5J9P C;  1OHH G;  2W6J G;  2B5U A;  5KUM A;  3ZIA G;  2ITD C;  1YTF B;  3AG1 C;  3OGC C;  4QNH B;  3E35 A;  2IJI A;  5LHI A;  4WFF A;  5H9C A;  2A9H A;  3OUS A;  1GTO A;  4QE9 A;  4FIP C;  2EIL C;  4MVZ A;  4KP4 A;  2Q68 A;  3ABM C;  1YTF D;  2OCC C;  3CXC U;  2IJJ A;  2HR3 A;  3M99 B;  3ML0 A;  5L3G A;  3MHS C;  1FXK A;  1PKX A;  3AG2 C;  3VBB A;  5IYD O;  1SET A;  4FMT A;  1S76 D;  1EZJ A;  2WLK A;  4LCU C;  3CP1 A;  4MVS A;  4GX2 A;  3K04 A;  3K06 A;  1Q82 W;  4PA4 A;  3T4Z A;  1KQS U;  3ABU A;  1UJW B;  2QM8 A;  2WAM A;  1DF5 A;  1NH2 D;  2EIJ C;  1GMG A;  3TET A;  5L3C A;  2Z3Y A;  2OTJ V;  1QR9 A;  1K92 A;  3K0D A;  1QVF U;  2EIK B;  5DN6 G;  1MG1 A;  2ZDI C;  4RUE A;  3RVY A;  1VQ4 V;  2EIN C;  3JD2 A;  2UXX A;  4XDK A;  2EZP A;  4MVR A;  1K5Q A;  3D3I A;  2XOK G;  3CMA V;  4PDL A;  4PDV A;  3CME V;  3MHH C;  4XDJ A;  3ABM B;  3OR6 C;  3UKM A;  2OCC B;  2XAJ A;  1AI5 A;  4I5S A;  2QE7 G;  2WLL B;  3SYQ A;  3AG2 B;  2X7R B;  5B1B C;  3F5W C;  1F51 A;  1YJ9 V;  1QVG U;  1H38 A;  4R8C A;  4KFM A;  4R7C A;  1KD1 W;  1LNQ A;  3A0R A;  1ARO P;  3RW0 A;  1EFR G;  5EBM C;  4MTX A;  2MK3 A;  1SES A;  1F4N A;  3ZMZ A;  1Y66 A;  1ZWI C;  2QTO A;  1M57 C;  3W7S A;  1H8H G;  4QJF B;  3ZRS A;  5KUK A;  2DW4 A;  2P7T C;  2XAG A;  5B1A B;  3CCS V;  5IYC O;  2LP7 A;  4GX0 A;  3CC7 V;  4JAU A;  4DXW A;  4RQF A;  5CN0 A;  2IU0 A;  1L1F A;  2ZQM A;  3LDD A;  2B1I A;  2AHY A;  1AJQ A;  1ENV A;  2NNU A;  2XAH A;  3SYO A;  3JD1 A;  1KKD A;  5LGT A;  2ZR3 A;  2JEU A;  3ZRV A;  1AJP A;  3I55 V;  3FYI B;  4QPK A;  3ZN1 A;  4L87 A;  3T2M A;  1NR1 A;  2FTK A;  3KG2 A;  3STZ C;  3ZRX A;  1NR7 A;  2UXN A;  4HAM A;  1GM9 A;  2P90 A;  3SPJ A;  4UUJ C;  4WFE A;  1VQP V;  1FXV A;  1BMF G;  3GWO A;  3G6E V;  1K7D A;  3UM7 A;  1THZ A;  3K79 A;  4Q20 A;  2DYR C;  3CCQ V;  4BIZ A;  1Q86 W;  5EC1 C;  1NQT A;  3OEE G;  1XL4 A;  2DWE C;  1NJI W;  4JTC B;  3LDE A;  4JGS A;  1W0K G;  4P9O A;  1M57 B;  3QNE A;  1FXK C;  1S3J A;  4R50 A;  1K97 A;  2CK3 G;  3H01 A;  3FB8 C;  3AG3 C;  4PA3 A;  1YI2 V;  3ZMV A;  4OXS A;  1B6Q A;  3R65 A;  3HPL C;  3ZRW B;  3CC2 V;  1OCO B;  3ZMU A;  1K3E A;  2R9I A;  3W7X A;  5B1N A;  3ZMT A;  4BW5 A;  1GM8 A;  3WG7 C;  3STL C;  3MD0 A;  4I9W A;  3F7Y C;  4HYO A;  4MVQ A;  1K9M W;  1V54 C;  2JJ2 G;  5H6Q A;  1QBZ A;  4CBC A;  1MOF A;  1JVM A;  1NH2 B;  4HZ3 A;  1AI7 A;  1RPR A;  2ATK C;  1CEZ A;  2WLI B;  2X6B A;  1RM1 C;  3X2Q B;  1SER A;  4MW8 A;  5FL7 G;  2IU3 A;  1PNL A;  2EIM B;  1JPX A;  2YEV B;  3NXS A;  2M7W A;  3G4S V;  4UVB A;  1K8A W;  1VQ5 V;  2JEX A;  4U7O A;  1YIT V;  4JAV A;  1KEC A;  4GT1 A;  3ASN B;  1OCC B;  1FXH A;  3VOU A;  4RQE A;  3CPW U;  2PI5 A;  5IYB O;  1OCR C;  3CD6 V;  1FXK B;  4MTF A;  4PA6 A;  1NKD A;  3E8B A;  1I5X A;  4LC1 A;  1VQ7 V;  2QKS A;  1VQO V;  3AG1 B;  2EJR A;  3ABT A;  3E89 A;  4MT8 A;  1JQ0 A;  3JYC A;  4GX5 A;  1K4D C;  2AHZ A;  3QO7 A;  1KP2 A;  2EIL B;  4ASU G;  3E83 A;  2HVJ C;  1J95 A;  4P9P A;  4H37 A;  5L3E A;  3JD3 A;  1TUE B;  4WFG A;  3ETD A;  4JPR A;  3FB6 C;  5LBQ A;  1V54 B;  4X88 A;  2WLN A;  2JK5 C;  1DTO A;  2JJ1 G;  2WLL A;  1QR8 A;  2HJF C;  3PJS K;  1VQK V;  4FPP A;  2BOC C;  5L3B A;  4N21 A;  5IDJ A;  1V55 C;  3CCJ V;  2XAS A;  2B1G A;  1QCE A;  2IJK A;  2GSM B;  3CCR V;  1K34 A;  2C2A A;  5CMU A;  2DYS C;  2ITC C;  2X6C A;  4YXW G;  1QLE C;  3G71 V;  2EIJ B;  3HB3 B;  3SPG A;  3LSS A;  5B3S C;  1YJW V;  4MSW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...