1YCIA

Factor inhibiting hif-1 alpha in complex with n-(carboxycarbonyl)-d-phenylalanine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
336
Chain Sequence
GEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Selective inhibition of factor inhibiting hypoxia-inducible factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 99
structure length 336
sequence length 336
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1yciA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yciA01
3P3PA 2CGOA 2YDEA 3OD4A 3P3NA 1MZFA 3KCXA 4AI8A 1H2MA 2YC0A 4QU2A 5JWPA 1MZEA 4Z1VA 1IZ3A 2CGNA 2ILMA 2WA4A 2Y0IA 1YCIA 2XUMA 1H2LA 2WA3A 4JAAA 4Z2WA 2W0XA 3KCYA 4BIOA 3D8CA 4B7KA 4B7EA 1H2NA 4NR1A 1H2KA
chains in the Genus database with same CATH superfamily
4RN5A 1JZ4A 2R0HA 1BK0A 2XONA 2JVDA 1K3EA 1DDLA 2N7GA 3VQVA 2Q69A 4FTEA 4YY3O 1IPSA 3TETA 3D6EA 5DDJ2 2P4EA 4CUCA 1AL22 2QJVA 1KKCA 4DR2O 4R50A 4XXAA 4JGZC 1E5IA 1WBFA 2CWSA 3S5AA 1BBT3 4RGAA 2QWQB 2X6BA 3VZJA 1I9RA 1Y4MA 1ZL8A 3ZX6A 4JGZA 1K4DC 3JD0A 2Q8DA 4CDXC 1X8EA 1S0BA 4Y20B 2QE3A 1W8OA 4AK3A 1W90A 2PAKA 1CIWA 2FYUH 1GOFA 2FCVA 4A42A 3LAGA 4W6YA 3VUOA 5C4WC 1ZRCA 3FHQA 2ZNIA 4JI7B 5FJHA 2VMFA 4IIJB 3H1MA 2XH6A 4A3ZA 5C4WA 3CNAA 2QE7G 1RITA 1O4ZA 1ZZ6A 2QWNB 1JHNA 3UNPA 5K0UC 4XILA 1H6XA 4CUBA 4IYIA 3WF4A 2DFCA 4RR3C 1HWYA 1PMIA 4JI2B 2Y38A 4A6SA 1GN2A 1R6TA 1NT0A 4KXRA 4GLXA 3RZJA 4FPYA 1F2NA 1UO9A 1J1TA 2R1BA 3I2OA 4E4HA 4XBNA 5EP9A 3LIGA 1XB9A 2W6JG 1BLZA 2RS51 3LSEA 3DGTA 1UPIA 4Q4X3 3KG2A 4DR4O 3M8AA 3RPQA 3OSDA 4MX3A 4LE4A 5C3QA 4L8QA 2C5DA 2X0LA 2HHHO 2WKKA 1H2MA 3N9OA 3VD3A 3SYCA 5A33B 2RJ2A 3LFMA 4K8FA 4DR6B 1F51A 3BABA 4DV2B 3LEMA 3DSQA 1GKFA 2ODMA 2V73A 1YLLA 3AK1A 2RJKA 3H3ZA 5A7OA 1JYCA 4Y20A 3N27A 1XOUA 3QG5A 5B1AB 5M0TA 4QX2A 1AR83 3DYMA 3CIHA 2G9GA 4KU7A 4QWNA 1OD5A 1MOFA 3ST7A 4EEQA 1NCRC 1R1A2 3W7WA 4IIJA 2GN7A 3ZMUA 4BQ3A 2LRPA 2C0ZA 5T3NA 4E2LA 2ET1A 1PGL2 1ZREA 2A3XA 3OBAA 1XL4A 2E7QA 4LA3A 3H3UA 3SPJA 4QX8A 1VQNV 2YXYA 1W03A 2FDHA 2WLMA 2EIGA 3GBGA 1KBHA 1VBB3 3H1JH 4LR4A 2WSUA 1W8NA 3LEKA 3CP1A 5BNPB 5C93A 1YIJV 1I3HA 1SLCA 3C7HA 4GX1A 4AI0A 1NH2B 2XL9A 4WFAV 3ZKUA 1BGYH 5LMUB 1K4CC 1COV1 4KU8A 5T55A 2DVAA 1VBA3 1WGPA 2XKPA 1RIRA 4B1LA 1XI1A 2VUDA 2OT7A 2R071 4CE8A 1LGCA 4PIYA 2DCTA 4D6RA 3JAKB 3NW4A 4W4KA 5A33A 2YDEA 4FPPA 4MXVA 1Z7S1 4AQYB 1ND2B 3VKFC 1GN6A 1AI7A 5FYHA 1SBDA 4K8RB 3I2JA 5B1AC 3JYCA 1OHFA 4B3RO 4FO9A 4M01A 3ZKYA 3ZXJA 4XTMA 5C3PA 1VAMA 3ABUA 2HBTA 3ZMSA 1YYNA 4NAMA 1W2AX 2ZXWB 2JDHA 3PTYA 2CGOA 3DN7A 1MZFA 2WFPA 3N3HA 5L73A 5F8PA 2DU0A 2LS6A 1E1RG 2EALA 1SETA 3GB7C 4CH6A 1OUXA 4FI9A 4UFJA 4QE9A 4AG4A 4XDPA 5CBHA 4XC9A 2JX9A 4N21A 1SDDB 2A79B 4QX3A 4C90A 1QMJA 1WB8A 3R66A 4A7ZA 2XUEA 2D2CB 5KLVH 1GNHA 1LJ7A 5FPOA 4FLVA 1PIV3 4YW2A 1VQ5V 5BNPA 3POWA 3OUFA 5F1RA 3VBOB 3OM3B 2ZE7A 3H1HH 2WUHA 2CNAA 1RVF2 3PUIA 5GONB 4JDMA 3USSA 4LHKA 5E88A 3U07A 2ZEWA 5CMUA 1GWMA 1YITV 3DL3A 2BNMA 3K3NA 2CU5A 2H0BA 4RHV3 1L0LH 2HWC1 4AE2A 1ND2C 1SQ4A 5D21A 3JAKA 5AVAA 4HKWA 3J7HA 1QQP3 3T1YO 1ND2A 4QQHA 3OD4A 1H38A 5CBGA 2WR9A 2ZXWC 2WL1A 3FUOA 1IVSA 2D6MA 1QDOA 1PMJX 1FKAO 1ZRIA 3B02A 1Y4WA 4DZGA 5FZEA 1IG0A 1R3JC 2PLV1 5IK8A 3GM8A 4X9QA 5BMVB 1HN1A 4K20A 3LSDA 1QCEA 3VDBA 2B4KA 3RNSA 2EICA 3H8RA 2YG0A 4PQ9A 3VHNA 4PI0A 2BFUL 1ZZ9A 2W68A 5IVYA 4ZY9A 4Q0UA 1NA1B 1ROPA 4G2KA 2VOVA 3KQ4B 2Q68A 4O65A 1ASJ1 4EE2A 1BMV1 2GP5A 1TUBB 5EYPB 5ERLA 3OY8A 3G80A 3K77A 3C8XA 3VBOA 4NYKA 1JZ5A 1XRUA 2OCHA 4MGZE 1AR72 1UY2A 5F2SA 4YXWG 5J9PC 5GONA 3I7DA 4QE7A 2VOWA 2AHYA 2FDGA 4XJUA 1QJU1 2CY6A 5DDJ3 1AL23 4DUWA 4CP0A 4FPEA 4OFGA 1XOYA 4FP3A 4LBNA 3WB2A 1W2TA 3U4XA 2DCZA 1NVPB 1DLBA 1VP6A 5LP6C 4CEWB 2C24A 1RUD3 1IS6A 2Z4FA 2UYBA 3SJQC 3DEMA 4N90A 4Z82A 5LA2A 5LP6A 2M6YA 2VTXJ 3S7IA 2YFUA 4DEVA 3UO3A 3OF1A 4X1IB 2XDVA 3WDUA 3L72H 1OLMA 4FM0A 3S57A 1JX9A 1N3OA 4LBKA 4KG8A 1M4WA 1KC8W 1K5JA 4LF5B 5BMVA 1GMGA 5C8WA 2NN4A 2QQIA 4AGGA 2QVSB 2VZ3A 2ZEZA 3ETPA 4FPHA 1SZXA 1NA1C 4BWOA 1U5ZA 1ZWIC 1ULGA 3KSCA 2DCJA 4XJ9A 3KV6A 4COZA 2HWB1 3GYDA 4Q8KA 5CADA 4HXCA 3WP4A 1NA1A 2L35A 1SQXH 1CX4A 4GZ9A 4IHJB 3RYRA 1N8RW 1W8HA 1TUBA 5EYPA 3ZSMA 2RMKB 2GC1A 4NTWA 4HKLA 4GKKB 3CCLV 1N47A 2HG5C 5IFPA 3H9VA 5CAZA 3RYIA 3N7KA 1PV0A 4M3CB 3WUDA 2AACA 1AXKA 2ARBA 4C91A 1YHFA 1URFA 4JI0O 4LFAB 2V4DA 1K33A 4BLJA 4FLUA 5F37A 4LOTA 4ZHNA 3JXSA 5EIBC 4JI1B 2WLLB 1F4NA 4QM9A 1VBD1 3J8F3 4DR7O 5HXMA 3OMNB 2Z2SB 2DOSA 2KA3A 4Q4Y1 2OZ6A 4R6ZA 3D0SA 1UY3A 2ENRA 1U0AA 1IZ3A 2EAAA 1OCRB 1HRV2 3TK1A 3NNGA 2IW5A 2Y6GA 3C2UA 3P3PA 2OX0A 4X1IA 2ZIMA 4WV8A 1Y9MA 4AAXA 2WYFA 3ZR5A 3WF1A 2H8PC 2PYJA 1OC1A 4AQTA 5KHKA 4IGGA 3FE5A 4DK0A 4IEYA 1O7FA 1DQ5A 4FIPC 4RWUA 1IBLB 1TE1B 3T2TA 1WB7A 1XPWA 1LEMA 4W50A 4H2AA 5JLVA 4LE3A 2CK3G 2UUAB 4FXGB 2VOTA 5LATA 3VBSB 2EXIA 1YHQV 2VWJA 4AFAA 1GN4A 4WBBA 5BY5A 3BPZA 5FO8B 4GYCB 1AP6A 4M3CA 1LHOA 2ZACA 3ZSLA 5FK8A 4X88A 1EN4A 4JI6O 1BMFG 3D3QA 1UOGA 2YROA 3M3IA 5IJ0B 1R093 1RTVA 2E7AA 4HN1A 4BK5A 1EP0A 2WLLA 2RDQA 4KBBA 5FUPA 1E57A 1OI6A 1MS8A 2XLGA 5F6KA 1OCRC 3KVBA 2ZGRA 3E6DA 1DF4A 4BOWA 3O1MA 1QJX1 1RUE1 2JB8A 5E89A 2GDFA 2N74A 3WG2A 5JOWA 1YFUA 1HIXA 4X20B 1UKRA 2PXJA 5JJJB 1SPPB 3O0VA 4HT1T 3ROUA 4Y5Z0 1OZ0A 4DR1B 1XQ8A 3JD4A 3CRCA 3WNNA 3K79A 2ZE6A 3ZN0A 1WW7A 3B93A 1OCCC 3CRQA 3M3OA 4YHHO 4QM8A 2F43G 4DY3A 5EXOA 3HKEB 4ZU7A 2XBO3 2BNOA 3T0BA 3FX3A 5FUNA 1KJRA 1TGOA 5DG2A 1YO8A 3WNOA 4FFFA 3L9JT 1C28A 3AMHA 4LWSB 3UGFA 2WT0A 2HYKA 1JU4A 1Q6UA 3LD8A 1AR4A 1UZZA 1ZVFA 2AGSA 1JYXA 3J4UH 3WF0A 3ALQA 2P4KA 4CYDA 4PDVA 3GZEA 4E8CA 1CZSA 1COV2 2QQNA 3UGHA 4NKGB 4B29A 4EB6B 3I2KA 1UN1A 1YZBA 2JENA 2WNVB 3MYXA 3QCWA 2E6VA 4IEXA 2ZJCA 1BEV2 1UZYA 3RI8A 4DXRA 4N7UA 5FOBB 1XNQO 4QGMA 5FY7A 3A0BZ 2EIEA 1JW6A 3WXPA 3HMYA 2P3IA 2VW2A 1VBE3 1AR91 2PMWB 2RS32 4ZKTB 1ZLZA 1EUUA 4A3XA 1Y76B 1PO12 2RS12 3HD8B 2FDIA 1SPPA 4H3WA 2CTVA 5D1IA 4Q4W2 3JALA 2A1XA 2XR4A 3K4ZA 2QNKA 2FL4A 1N33O 1OFSA 2Q4SA 3AFKA 1VMFA 4CDUB 3CJIC 1V55B 4LJHA 2Y4UA 1PGW1 3WLUA 3I3BA 3RJ2X 1B09A 1K73W 1AJNA 1UOFA 3ABZA 2NMNA 2E32A 3CJIA 5FWJA 3HKEA 1JVMA 1N0NA 1N1TA 4JGYB 5FZ4A 1EV12 2AXTZ 3DXTA 2GTAA 3DPRB 1EBOA 1JOJA 4CC5A 2HEWF 4LWSA 1FPN1 2ETNA 4YM1A 1AR63 1W9WA 4Y1VA 1ZZBA 4GKXA 2P1BA 5JDBA 4LF9O 3I56V 4AHWA 3RYCB 2P2KA 4XFAA 3S30A 5FREA 3CO2A 1NUKA 4COYA 1H9WA 4JF3A 4IEVA 5IAXA 3LQCA 5LK7B 4FTSA 4BDVB 4YW4A 4EB6A 2G4IA 1OUSA 5EBLC 2RM21 1W9FA 2WNVA 4ET7A 1WA4A 2AENA 4HMZA 3NJYA 2Q7EA 4YWAA 3IDBB 3C7EA 5A1AA 4JYCA 1D4VB 5FZ1A 2RR12 1BKZA 2OVUA 5FMBA 5DAWA 2QQOA 1IQDC 1E5HA 2D40A 4K0KO 4E2GA 3LFIA 5A6YA 1H2GA 5K4LA 3PN1A 1Y76A 4I4TA 2A06H 3K08A 4CDUC 1V55C 5CB7A 4TYSA 3AP7A 2ZEYA 1C8M2 1YFXA 4JZRA 1RHI1 1SQFA 4TSFG 4BHPA 3WCSA 3FHIB 4CDUA 3ZSJA 2LW1A 4XXPA 3MZHA 1GSLA 2RN9A 4JGYC 2QKAA 3M3QA 2MPFA 1AILA 3DPRC 4QDRA 5F5IA 5FV3A 1JFFB 2QM4A 4UXAA 4JGYA 2TNFA 1QJEA 1OA4A 2X6AA 3K4AA 3DPRA 2UUCB 1LOBA 3POFA 2VZOA 5J09A 3BKZA 1KXGA 1JUHA 3RYCA 3B00A 3BU0A 5CG9A 1XJAA 4BQWA 1HRI2 2UWCA 4AGRA 2CSGA 2YBPA 3UT0A 3OEAA 4BMEA 3NV2A 1RUF1 2JIGA 2RMU2 1Z5VA 3PLQA 2W0XA 4BIOA 2QTSA 5LW9A 1V9PA 5A6ZA 4Z8BA 2C9AA 3UJQA 3IIIA 4LITA 3RVZA 3JATB 3H01A 5GTHZ 1KS5A 4Z92B 2ARHA 3KLSA 3ITQA 4DFSA 5AC93 4PF5A 1DP0A 2PF4E 4YM3A 2XQRA 4JV4A 4QDSA 4NHKA 4WBNB 4MGKE 4CCEA 3MI8A 1SS3A 4PV1B 2D98A 3K5MA 4GB31 2VUJA 5FP9A 3THPA 3LF7A 5FPZA 5JXHA 3K58A 4PLNA 4DRRA 1XREA 4MVUA 1SZBA 3VZKA 5JCTA 5AFEA 5JI9A 4LA2A 1VQOV 3LDKA 3U10A 4PBPA 1S55A 1NZ6A 2WLNA 2VGDA 4B4PA 4P9YA 4QX0A 5IYDO 3BAAA 4WZFA 4EWDA 1BQ0A 1S1AA 1JFFA 4I7ZB 1YIPA 3BB6A 1JHJA 2WO7A 1Y67A 1C1FA 1LTEA 2HWE1 3BYWA 1W9TA 5BY1A 4FBFA 2QA4V 2OA2A 4O2BB 4JI4O 4GKJB 4MSVA 2DVGA 1LRHA 5FCCA 2IXJA 5KC6A 3KT4A 3O1OA 3VKLA 2BV4A 4F4LA 3RI9A 4HSLA 5CFCB 2WN2A 1LCLA 3TYJA 1QHTA 4QXBA 4XBQA 3F5TA 4J1XA 5IK4A 3IJ4A 4OX9O 2EVXA 2ARCA 3RN4A 1AYM3 2CAZC 1Q5OA 1FJGO 1UCXA 2AUYA 2W39A 4Q4Y2 4KFMA 1Q3EA 5EFUA 4WVWA 1AP5A 1WLCA 3ES1A 2VU9A 4AI9A 3APQA 4XEZA 2A70A 4LORA 4IEUA 4QX5A 3RZKA 1JZ7A 4ARYA 4LH6A 1UY4A 1AHSA 4X8NA 4WBNA 4FQZA 3JBG2 4K35A 2TUNA 1GQHA 1TVKB 4JKLA 4OZOA 4YFZA 2WZR1 4IQPA 2W87A 3B8MA 4M0NA 4DR3O 4YJ3B 1N3PA 1XYOA 3W7SA 4EV0A 2ZX4A 4UFLA 2UXDO 3M7MX 2Q8VA 3TEXA 2QM7A 1G7YA 1CAWB 3N9PA 1ZZ8A 1VMHA 3JD71 1NTMH 3IDEA 3NNLA 3ABKB 1DGWX 4MT8A 1LHUA 5CFCC 5CA3A 1ENVA 3SC7X 5BPXA 2H94A 4BQ1A 5CFCA 4YJ2B 5LHGA 3C3TA 3TCUA 1IDSA 4PIZA 4GUNA 1SFYA 4WZCA 2KSDA 4KH9A 2K9PA 2Y48A 1BEV3 1BT8A 1XNRB 4I30A 4UFZA 3IAYA 4NUBA 4DRVA 3FYIB 5TISZ 2DWDC 2D3PA 1AYN2 2YGLA 4AZZA 1ZRDA 3NSTA 5IDJA 1OCOB 3SKJE 2WJSA 2RS33 4BQYA 3WG7B 4NIIA 1XNKA 2J42A 4Q4W3 4UW3A 1SERA 2R9IA 1W0OA 4L2NA 1UW8A 2QUOA 2JGDB 1UY1A 4CPBD 5C3RA 2MEV3 2C1FA 5GALA 2DQ0A 1M4UA 3ZYRA 1UYYA 4C1WA 3ZHRA 3RWKX 4FZ0A 3HQXA 3G4SV 4AI8A 4K6BA 2XASA 5HFMA 1FMD1 5FZ7A 1RB8G 4FAGA 5FPBA 3UV9A 3N36A 4ZZ8A 4GD4A 1EV13 1WPBA 3K06A 1JMUB 4B3SB 2GAUA 4I0BA 4CSWA 3FKSG 4F8AA 5FJKA 5LBEA 2C6SA 1IS4A 3ABKC 4BQ2A 3N9MA 5A3NA 3W5MA 2CHHA 1CAWA 5GM0A 4LPLA 1TA8A 3AKQA 2K9ZA 2R062 2GN3A 3MV11 5LY2A 3SXWA 1W39A 2OYQA 3H1IH 4LC1A 3P30A 3ACFA 2P6CA 3WNXA 3AG2B 2VQ0A 3ZPOA 1J3QA 3CPWU 4JI0B 3MPPG 2Q1FA 4XUQA 3AZYA 3H8UA 4IE4A 1NKGA 3ZN6B 1ZBE3 4DUZB 1KD1W 5ITZB 4DR7B 1TME1 4GX2A 3HQRA 4ZS3A 1DIWA 1GBGA 4AI1A 1KDKA 5J2TB 1V6NA 3K2OA 2BBVA 2ID4A 1N36B 3PVNA 1W8ZA 3BTYA 1X59A 1LECA 2VUCA 1AR92 4KGGA 5FLIA 4NTXA 5HBAA 4P5YA 1MS3A 1EPZA 4I0WB 4O7XA 2Y4TA 2DVDA 2CAUA 3ZVXA 3RG0A 3AG3B 4CEYC 3JB4C 4DUVA 4DXTA 1KB9F 4Q29A 2LP7A 1KQRA 4Z1VA 1UQXA 1N1YA 2ZR2A 4CEYA 5C8YA 4ARXA 2XUMA 4Q4V1 3KMHA 4LO8A 4IE5A 3R0RA 1NBMG 4Z1MG 1W8FA 3BIWE 1V54C 3CYOA 5FXWA 4E4SA 1UIJA 5ACA1 3DYPA 3H1YA 2FHRA 1HRI3 5T5JA 1RM1B 3GJAA 3NL1A 5H9SA 3A0NA 3AG2C 2G9ZA 2ZX1A 1S0VA 1WLEA 2RMU3 5JZGC 4CS4A 4LK6A 4LT5A 3KCXA 3E8GA 1VAKA 5FL7G 1UU5A 5J2UA 4META 1EAH2 5JZGA 3TN91 1G9DA 3VHPA 2RM22 2Z79A 5FY5A 3ZDVA 3ZN6A 2A0LA 1OHHG 4P30A 3ECQA 1MSDA 1FOD2 2X8KA 1QBZA 4CXYA 1UPSA 3HJRA 3POJA 5J2TA 4BMBA 1GK9A 4JQRA 4KHPB 2GBOA 5FLXN 4L92A 1K5QA 1DGRA 3OCPA 3AG3C 5CBFA 3BUCA 2BTOA 3M70A 4JI5O 3ZN1A 3KZ4C 3ZRXA 1BHAA 1VBC3 4ISQA 1AI6A 5LHHA 4XZUG 1R3LC 2X09A 5H9PA 2JDYA 2PHXA 1JZ2A 3IZOA 3E8HA 1FATA 3M2MA 3VB9A 2MNGA 3E97A 2K2SA 3T09A 3OW2U 4BW9A 4UBGA 1ZZCA 3RZZA 1RUC1 3VKMA 4BQ5A 1RM1C 1KD7A 2YUAA 1NKDA 3CKHA 4OHZA 3PMEA 4ATFA 4LLFA 3HN3A 2IM9A 2JEXA 2P37A 1G86A 4AVSA 1C4RA 5FO9B 1WCSA 1ZRFA 4CUAA 1CJPA 4YZ2A 3RVYA 3EBRA 2EXKA 1XXNA 4M4PA 4IV1B 4JQTA 4QPIB 1N34O 3AYDA 2WWSA 3SJAC 4FLTA 4FJCC 4JI3B 3E1F1 4UFKA 4QQOA 1L0NH 1S0EA 2QKSA 4LMFA 3DGEA 4R9BA 5EQUA 1J5EB 1EY2A 3JBG3 1J3RA 3IBMA 4QX7A 1JS9A 2ZZJA 3SITA 1QDCA 1W6MA 2VZVA 4M3CE 4YGBA 2EIMB 2F17A 2XJRA 2ZGOA 2XWBB 1HN0A 1DBNA 2JE9A 4GWNA 1DZRA 1JOYA 1K5SA 4BB3A 2D5FA 2A71A 1F4MA 3ZXDA 3UT5A 2Y60A 4RQEA 4LBQB 3B3QE 2EZOA 3AK3A 1Q56A 1AXYA 1VIWB 2Q7HA 3EXUA 3KV5A 4FAHA 3OPZA 1UMIA 1GFF2 4FOYA 2WO1A 4KL1A 4QHBA 5K1PA 5L9BA 3WNLA 4C0HA 4K7JA 4DV1O 4BIZA 1X7NA 1BCXA 1IQAA 4GMP3 5LK5A 1LOCA 3T2PA 4GWIA 3CF6E 4FLXA 3MHSC 2J22A 4K40A 2P34A 2HH9A 2AEYA 4FFKA 1RUG2 4LHSA 3FUQA 3GVMA 3U1XA 3PUSA 3E5UA 3ASOC 4LF9B 2ADPA 3K3WA 4IV1C 2VMHA 4E4ZA 4QPIC 2UURA 3F2ZA 1AYN3 3I8TA 3LSUA 2VWKA 4BIFA 1AR81 3C3SA 4IV1A 1TMF2 2VQTA 4QPIA 2B5UA 4BPZA 3B2EE 5H9RA 4E2QA 3WQ1A 1QJY2 3ZRWB 3SR2C 2EXHA 1G6NA 5KX5B 5ABJB 4H14A 3SQOA 1RUH2 4LBEC 1D2DA 3RZMA 1JYVA 2CTQA 3L71H 2EF6A 2EIMC 2D6KA 4J1WA 4BW5A 5L9RA 2R1DA 1S0CA 4LK7A 4RS5B 3PUAA 2R70A 2O1QA 2ZKLA 4PHZA 1MA1A 5IYCO 4INDA 1QWRA 2WC2A 3ZFFB 4UFMA 1SBEA 3ZO0B 2VNGA 4NHMA 4WF9V 1MVEA 3KF5A 5GZFA 1A78A 5DUXA 1W6OB 3MEPA 4XF3A 2OPWA 1VBA1 2R063 5A7SA 4HETA 3CXHF 1UMHA 2WLJA 3WZ1A 5APAA 3AZWA 4LHNA 2Q0OC 1GP6A 5FYCA 2YHJA 3WNMA 1IXMA 2J1AA 3ZMTA 2X5IB 1YJNV 1IKPA 2HKOA 3L2HA 2RG4A 3R6SA 5EHDA 3BCCH 2YGMA 5F32A 4AEMA 3HB3B 1WNSA 3M1HA 3SPIA 2JDZA 2XAQA 4CS3A 3RWNA 3CXCU 4B3MO 3RT3C 1AJQA 1ZBA1 1RXFA 1B06A 2VQFO 5ABJC 1NS1A 2PI4A 1EZVH 5EV7A 4BU2A 3ZRWA 5E1RA 1FAFA 4YZ3A 4XAEA 5KX5A 2B5HA 4P08A 5ABJA 3CCUV 4CCNA 1ND3B 1O3QA 1S77D 4BIUA 4UV9A 4RS5C 3GGLA 3BOPA 4DV3O 1WW6A 4DY5A 3ZX7A 1ODNA 1Z78A 4CCJA 5L7OC 4RS5A 3ZFFC 5FMOS 4CS2A 4NOTA 1ENQA 3VOUA 4UVCA 1RUI1 4XUTA 5L7OA 5FIXA 4QKBA 3FC0A 3ILFA 2YBKA 5JPNB 3ZFFA 5SV8A 2E5LB 2ZKNA 4F7ZA 3VZMA 5IYBO 2E63A 4U3JB 3TNQA 4ZONA 4YM2A 2NN8A 1W6OA 3OPTA 1V9U2 1WW5A 5T5PA 3VD9A 5EC2C 3DV8A 2UXCB 2X5IC 3JASB 5JI7A 4RHV1 1IBKB 4IV3B 3OJBA 2V09A 3USUB 1DZTA 1MS0A 1TNFA 3MUY1 2X5IA 1Q86W 1QQP1 2W92A 4ABMA 1YI9A 1K92A 2ZAHA 4ZXEA 3MLJA 1V70A 2XLFA 4K3AA 4DYLA 1YXWA 2QZ2A 4FPCA 2UUBO 2E9QA 2QQUA 3L75H 1CIYA 5I0SA 3P32A 3PVOA 3MUZ1 4HNAB 5JIUA 5F2VO 1FOD3 1DF5A 4TQFA 3BPSA 3URFA 4G9SB 4OX9B 1NT2B 1ND3C 3AG4B 2W2IA 4GH4B 2EBOA 2D6PA 1FJGB 1J83A 3H7JA 3ZXEA 1D4M2 5A3MA 1ND3A 4GWMA 3VD7A 4ITCA 4A5UB 2XVLA 1H8VA 1OFNA 2VZTA 3SPCA 1PVC2 3M7AA 1I94B 4MV2A 1H9PA 2G1MA 2EIJC 4ZPIA 3POYA 3GWKC 1BZWA 3UKMA 4UB8Z 4R7CA 2FKXA 5B2GB 1RXGA 2HEVF 1GM8A 5FWEA 4URAA 2LTNA 3PHMA 3AX4A 2DW4A 1DQ2A 3ZXKA 1M93A 1G8WA 4FPFA 4U3JA 5LMNO 4RL7A 4DR3B 4LEJA 3ZPYA 3ACLA 4IV3C 5DN2A 2LROA 4X62O 4DW1A 4F6RB 5DDJ1 5B4XA 3X29B 1AL21 4I09A 2A3WA 3JASA 5A3UA 3MIGA 4IV3A 1JZ8A 2VXJA 2HWD3 1VMJA 4Y24A 5FZOB 3USUA 3IB3A 5A80A 1SA0B 3LKJA 5LGTA 3ZIAG 4X65O 1QJZA 1HR0B 4Q0PA 2JG8B 1AL0G 4M0HA 4HVRA 4UW6A 4LNVA 1W6NB 3ATGA 1OKQA 4K21A 2ZX3A 1VLNA 2RQ6A 4FM2A 1POV0 1GN3A 3QO8A 3AG4C 3JUUA 4WFGA 4HPKB 2GC2A 4HNAA 4UCTA 2F66C 1W6PB 2W1UA 5CB4B 4XCBA 3FB6C 5CKQA 4GH4A 1BHBA 1DYKA 3UO2A 1HB2A 2I45A 1Q8OA 4CXXA 4PDRA 5LBCA 4DO2A 2BEOA 3CCQV 1CPYA 3ZSKA 1WP8A 3WG4A 1LKNA 1H2SB 4TXWA 3KB5A 3U0ZA 3WW4A 2AH2A 3GZUC 3C3VA 3KQRA 3POEA 4P9XA 5A7NA 4Q8LA 3D3AA 3POBA 4MGSA 5FK7A 4I5SA 3FYEB 5KAIZ 2UY8A 3RSJA 1FV2A 1YUDA 4WCEV 2ZHMA 1CGPA 1PPJH 3BFRA 3FB8C 1QXRA 1W05A 4BQXA 2DCKA 4V1PA 1XYPA 5BXZA 1RL3A 3BTZA 5EBMC 1KITA 3G7DA 1CONA 2JG8C 3CE2A 5FZOA 3RWRD 4DPNA 1SA0A 2JJ6A 2V4AA 5EBWC 4GCZA 1YDXA 1OOPB 2JG8A 4YM0A 1RYYA 4G4FA 1OVPA 3CS5A 3OGRA 1NCQC 4Q0SA 1W6NA 1VMGA 1BBT2 1PZ9A 2D93A 5ANQA 3JD3A 2AR6A 1F9KA 4DV6O 3BI3A 1LGBA 1R1A1 4A45A 1NCQA 3NKGA 2ZINA 4HPKA 1BHGA 2VO5A 1SQQH 2OUHA 1NYWA 2YC0A 1RUH3 1W6PA 1PGL1 4W6WA 5CB4A 1E5SA 3DYOA 4H37A 4X8AA 1QH7A 1UPGA 5DUUA 1W28A 4YVSC 1DYOA 4OMCA 2ZZQA 2HP8A 1S3JA 1NI8A 1W59A 1XDCA 4GX5A 3SKVA 4I02A 2HJFC 4MZUA 5HPOA 4LF4B 4YVSA 1WW4A 2CDOA 2D97A 2VMEA 4QGLA 3KGLA 4L97A 1H0BA 1T6GC 1DGLA 2WWJA 3AB0A 2ADDA 4CA9A 4QAWA 2EULA 1SKVA 5FYZA 3IPVB 1K45A 2BWCA 3ZXAC 4IE7A 1PX4A 4Q5OA 2PFWA 1XBFA 1JQ0A 4NROA 2DMXA 4HLTA 3D36C 5BR8B 1PZ7A 2B9VA 4XFIA 4Q4X2 4M3CF 5KA6A 4ZI7B 2AEZA 5DPNA 2A6XA 3D36A 5JQGB 1PNKA 1XMQO 1KFUL 1I5ZA 2IUWA 1O4YA 3ETEA 1BCCH 2VECA 2VQEB 5D8AB 3UJOA 1K42A 4GQ7A 3KT1A 4TZDA 1W06A 1Y74B 3VDAA 2QQVA 2C26A 3NMBA 4NXNO 1O8SA 4PDLA 4MVTA 3B4SA 3GWOA 2PHWA 5FZ0A 3OGIB 3ZOIA 1STMA 4NR1A 4CZSA 1O4TA 1EZJA 4ZOLB 5DZFA 1IOAA 4XFHA 2P5OA 4LO4B 4FPGA 3H0OA 2HLDG 4JPRA 2VVEA 4YW3A 3FLTA 1N32B 4OPAA 2GHYA 4AGVA 1P7GA 1NTKH 2WT2A 4C0BA 4Q0QA 2F4VB 1S0DA 3K75B 3CMAV 1QY4A 4AEJA 3GCXA 1XYNA 1G9CA 1WD4A 3WW3A 1PNLA 3PVEA 2L9LA 2LM3A 1A34A 3IT8A 1F7YA 1W0JG 1RVF1 1VBB2 4JDOA 4HVQA 2B46X 3S5QA 1GP5A 4BR6A 3T1HO 1FV3A 3QH7A 2BE3A 1G4YB 1V9U3 3ZIXA 1ZX3A 5FZIA 4CCOA 4UAPA 1S76D 3N9LA 1W3XA 4QIWF 3WDTA 1IPJA 5BXXA 1VBA2 5J1XA 4XBFA 2YB7A 4URTA 1H6YA 1VR3A 2GDSA 2LGWA 5JQGA 3HNYM 1FXKB 2VD7A 2PN5A 5DMYA 4JKKA 1NE6A 4JYAB 4TSVA 2HWC3 3T4HB 5FZAA 3MD0A 4PA7A 4Y26A 1UKGA 4BYYA 2Y8KA 1Y74A 5B1BB 2FQPA 1VBE1 4YZ1A 4I01A 1WA6X 3PDQA 1OLQA 1NTZH 1W2BU 2ZD9A 1OBNA 3CRRA 3T1CA 3VLBB 1R082 1TUEB 5IVFA 3RW0A 3ZLIA 5HCHA 2WLPA 1N34B 2ZTNA 1V0AA 5IE9A 2WNUB 5L9VA 1PVC3 3B9IA 2NLRA 2WAOA 4JV5O 3IKWA 1IHMA 5A2QN 2PLV3 1Q6IA 2AZ0A 2XJSA 5HI0A 4RQFA 3L74H 4JAVA 4N43B 1M06G 3BRCA 2LGQA 2FB5A 4RUEA 3N9NA 5I0TA 5B4NA 1AR71 2XJPA 2XHNA 1AR61 1PIV2 1KGYA 2R7EB 4XURA 1ASJ3 2QFEA 3ILRA 3O65A 1L7RA 5KHHA 5IHRA 2XXZA 2YV8A 4PDMA 5IT9N 4J10A 2LALA 3OMAB 4N53C 4DUYO 2JWPA 1K5MB 1XHZA 1FXKC 4BJ0A 1ULCA 3T0DA 4IE6A 2FZ2A 1MS5A 3T2MA 1JYIA 2VM9A 5FZ9A 1AB3A 1FXKA 4NXMO 3EHKA 2LW7A 3D4KA 4DB5A 5FZ3A 5B1BC 4Y1YA 4QKFA 1S0FA 2ET7A 5IWAO 4FOQA 3OAAG 3AZXA 4TT3G 4QD2A 1GLHA 4RO2A 4LQRA 1J58A 1K12A 3ASNB 4FXKB 3DCQA 3ZYBA 2WLQA 4XOGA 2PYTA 3G67A 4LNUB 3O9OA 4YZ4A 2WNUC 4G3YC 3V0BB 2J1VA 3THTA 4COVA 4OXSA 2VULA 3U75A 3VL8A 2OIGA 4AYUA 1JOPA 5F5AA 3LNNA 3KHBA 3APBA 4R4XA 2IFRA 4IGOA 2OIIA 2WNUA 4LO7A 3CJXA 2B7YA 4XF0A 4MW3A 3G6EV 1ZNPA 1R73A 4N43C 2W08A 3LEIA 2Z42A 4DV0B 1ZZ7A 4TV8B 3SJBC 1VQKV 1BVP1 5LBQA 1YJLA 1S72V 4N43A 4AFMA 4ZU5A 1KP2A 3NXSA 5KXCA 2HWB3 4CDQC 5IK5A 3TBDA 2GV9A 3MHZA 4OGQB 1BVVA 3OUJA 1EPWA 4KI5M 4CDQA 4LF8O 1WJZA 1RUNA 3NQHA 1K5MC 2W1WA 5BNNB 5F39A 2ATKC 4TLFA 4ISRA 3H7YA 4LFCB 3DUIA 5FPXA 5JOZA 1K5MA 4A4AA 1OXCA 3PUHA 2BSKB 2JDNA 4S2DA 3C90A 3B5LB 1WUVA 4QX1A 4XUOA 4LXLA 4LF7B 1HRV1 2YY1A 2Y0PA 1TNRA 3ASNC 2P67A 1Q7YW 1JZ3A 5T5OA 2VJXA 1VBD3 1RUD2 2JDMA 1FAYA 2WS93 2YMZA 2HVJC 1S5JA 4LBLA 4FFHA 4UVBA 3KF3A 3B09A 2GZWA 2QSAA 1MNGA 4B3MB 2XPJA 3V0BA 1R6KA 5JWPA 2DVFA 5G05L 5JCOC 4NRPA 3BA8A 1GM9A 4PCRA 3OMIB 5KHJA 1IG3A 2IU3A 1CPMA 2LW8A 4B7EA 5JCOA 3JB8A 3B7MA 4NTYA 2XT9A 4FLWA 2JS3A 3K5LA 5LGNA 1CP9A 2OZJA 1Y6XA 4HBNA 5LGUA 4TV8A 1Y7BA 2XLAA 1M1KW 4FVMA 4BM8A 4Z07A 1NH2D 4Q20A 4TUYA 5C3SA 1V6OA 2YUEA 4A7YA 1M90W 5FUIA 2GNBA 3SYAA 3J81N 5BNNC 1NLQA 2GNTA 3UQ8A 3GJBA 4XF1A 3OTOO 1NR7A 4QHZA 3R65A 2RE9A 2JJ2G 5EYXA 5BNNA 4AQ6A 1F5JA 1UX6A 3MBWA 2D7FA 1RUOA 5T54A 1I6XA 1YTFD 2Y0OA 3SISA 3LSSA 1AYM1 5JJEB 2VZQA 3POGA 1QGLA 4YG6A 2Y0IA 4EWEA 3OGGA 4XF9A 3J8F2 3IDCB 4AHXA 5L19A 1DGSA 5T50A 3VZNA 1SHWB 3E35A 4NMIA 4DOUA 4BZ4A 4XACA 3NRUA 4WM7B 1GANA 2PUSA 3ZSEA 5GTIZ 3VV1A 1I5XA 3T1LA 2QQKA 4AVAA 4ZZ5A 2I74A 5KR7A 1LESA 2VNRA 3AMMA 3EFFK 3B77A 1WCUA 2QZ3A 3S0MA 4KG0A 1K97A 3ZYHA 2V1DA 1OPOA 1NQJA 2P22C 4JTDB 2Y6KA 3K46A 3TXSA 4COWA 2CDPA 1KMIZ 4UUJC 1NG0A 3UYJA 2RV9A 4X6RB 2DV9A 2Q30A 3ZMOA 5EYYA 4CP2A 2DUOA 5FYTA 2PAMA 1HW5A 3HKBB 4ZS2A 5FYYA 1NE4A 1JPXA 2BW8A 3GHMA 3HKCB 5D2AA 2HJIA 5LY1A 4DINB 3M3CA 2Q8CA 1ODMA 3E6CC 4G28B 1DCSA 1VF5B 1BEV1 2W1QA 1UZWA 4BA6A 3CU7A 4LO6B 1HV0A 1R092 3P6BA 1YTFB 1W99A 2FMDA 4W65A 4MS2A 2JJ1G 2YU1A 3LEGA 2RS31 1N1SA 1PO11 2RS11 2SLIA 3QO5A 5CKMA 4Q4W1 4WM7A 2D5HA 1R083 1Z5WA 4EWAA 2YBSA 1BS3A 1DLCA 4CC6A 5IW0A 1ZM1A 4XQ4A 3NNFA 1JYNA 3LCPA 3J26N 3MDSA 2V4VA 3I3MA 4E27A 5IWFA 4JI2O 2CTWA 1CESA 2YEVB 2WLIB 2ITDC 3ZEDA 3ZXFA 1LENA 3MGUA 1O3SA 4LCUC 3I3QA 1KRIA 5EJZB 1EV11 5H9CA 5BNPC 3HAGA 5FXVA 3RQ0A 1Z0HA 1CX1A 1AUYA 4OI0A 5JSPA 4UW4A 3WR0A 1YXBA 4TQDA 2XBO2 2JD4A 1I5YA 3ZXGA 3LDRA 4KWKA 1ZAUA 4P14A 1JH5A 1OQDA 1D5NA 2B1GA 2GSYA 3WP5A 3HKBA 4DR6O 1FT9A 3IAPA 3HKCA 3ON7A 1XMOO 5EIBD 1NVPD 1YJKA 2PY5A 4XETA 1J1LA 3INAA 2QR4A 2RR11 2ZE8A 4R9CA 1CWPA 2EAKA 4DNYA 3H3LA 3MLLA 2XJTA 4IW3A 2E53A 1HNWO 4U2AA 3WG3A 5B5EZ 1IX9A 1UJWB 3GDBA 3OR6C 1KKDA 3J7LA 5B3SB 5FBZA 4CH3A 1GZCA 4YFWA 3WP6A 1VBE2 3CCJV 3WDWA 1C8M1 5FPLA 4LP8A 4YG0A 1J84A 4TWTA 4DRXB 4NRQA 2ZKOA 1LULA 2XVKA 2YEVA 5FP8A 2WLIA 5I0UA 4D6SA 2JEUA 3AP9A 3QACA 4QPGB 1VJ2A 2WLHA 4GIQA 3MHHC 2DJVA 4Y22B 1JR9A 2HKXA 2P3JA 3NNMA 1SLTA 4I55B 2WAAA 5A3WA 2K46A 3VBOC 3AYAA 5LMUO 3WOGA 4AOCA 2ZGSA 5FYSA 5EZYB 1BYHA 1P4RA 4G27B 3OUHA 5FAXA 4OZXA 5DM6V 1SQPH 1HRI1 5IVCA 2L6LA 1E1QG 4MW8A 4XHBA 1YJ9V 5E8AA 2F95B 1AR62 3W20A 5FPAA 4HL0A 4XDQA 5L3DA 4AQYO 2RMU1 4XJWA 2GNMA 1PVXA 5F3GA 1UWWA 1S0JA 1VP7A 2ZHLA 3HBZA 4O61A 4QJFB 4LIUA 4O9GA 3WT3A 3VBFB 4E2SA 1MVQA 2DTWA 1XSQA 1QKQA 1RUF3 1UAIA 4R4ZA 1XILA 4LIVA 1K3IA 3I3DA 5LEKA 3H1LH 5FXZA 2RDSA 3DKQA 1RPRA 3JQWA 4XIOA 3UM7A 1LOGA 5FZFA 4RGKA 1XSRA 4K1ZA 1VRBA 4Q2FA 2A6ZA 3OG2A 3CD6V 1US6A 2QQWA 1HDKA 4DRXA 4QPGC 4I0AA 1YVWA 1GRJA 4YVWB 4GB33 4QPGA 2PQQA 1UNBA 4Y22A 4XUPA 1Q8IA 4I55A 2G9FA 2R0FA 4A41A 1G9BA 4IEWA 1S5HC 4JI8B 3VHRA 3I2HA 1U96A 1X50A 4A7KA 1QR8A 1RMU2 5JVVA 1E79G 1ULEA 3ETGA 2P90A 5B1OA 3FMGA 2WBKA 3VHOA 4FFBB 1SLIA 1PZ8A 2EXJA 3B8NA 3WF3A 2ZDIA 4BH9A 2RCVA 3SYPA 1B35B 2BVBA 4K1YA 3ME2A 4JTNA 3V0AB 5LYJB 4ZU4A 3KVAA 3VBFC 3WHTA 4AXOA 4LBJA 2JKXA 4CEWC 5G04L 3I2DA 3VL9A 2YFZA 5HCAA 3J7AU 3HT1A 1F4HA 4JASA 4HFSA 3L70H 5F9TA 3VBFA 3QH6A 4CEWA 2W47A 1O3RA 2EJRA 1SLLA 4Y4YA 3CMGA 2JDIG 2JDKA 3JBG1 4LR3A 2JS5A 3UL2A 4YW1A 5AC92 3I2IA 2VAUA 2NP0A 1FNYA 2FZ1A 4AW7A 1XNCA 3SHRA 1XNTA 4J6GA 4MHRA 1I5PA 2PTMA 2XJQA 1CR7A 5KWRA 1AJOA 3AZVA 4YPJA 1LR5A 5GZCA 4ICGA 3E83A 2J1UA 5A6XA 1WMXA 4L11A 1P7BA 4TV9B 3KCYA 2CE4A 3AJZA 4FPOB 3AVSA 2WZR3 1MG1A 3ZHSA 4IHJA 5FZCA 2VTFA 3HKDB 1GYKA 3T1MA 3MIBA 3WV6A 4QPKA 1KDMA 4W4ZA 2X29A 1CJDA 4GMP1 1O5UA 5JXJA 1MSWD 1HNXB 2D6LX 3N35A 1HW7A 3ETQA 3WDYA 1VQMV 5FZKA 3WQBA 4FFBA 2NLJC 1OD3A 3JD73 1YQ8A 3GZTB 1CPNA 2UXXA 3V0AA 4MH0E 1XQNA 3VQXA 1AYN1 2HWF2 1MPXA 1WMEA 5FYUA 1NZIA 4NAOA 4P5HA 4F6EA 1AYM2 2DYCA 4IL7A 3D3IA 1ENXA 5BNOB 2ZHNA 3ZMZA 3TEYA 2WAMA 4XFCA 1RP3B 4ZHQB 4LF5O 4IERA 4Q0VA 2RHPA 2RDRA 1LODA 2XNDG 4BXFA 3M99B 1I7FA 1X36A 4HVOA 4OI4A 4WVZA 1ONAA 3KGZA 4JCKA 2GU9A 4RYDA 4X64O 4Y5SA 1W2OA 2LO1A 2GC3A 1WLTA 4L9BA 4KBZA 5FTTC 2R042 1M9NA 3MAQA 3ZRSA 1LAJA 5EPAA 5JOYA 1W8TA 2P3KA 4GKKO 3VBSC 1GO3F 2YZ4A 2JD9A 3CDZB 4JX0A 4TV9A 4RGGA 2Y6HA 1LU1A 1LGNA 1FMD3 3B94A 3VBSA 4QXKA 2PQSA 3HKDA 2R061 1MEC2 4E4EA 1J59A 1QR9A 2A6YA 3PU3A 2FTKA 3MPBA 4LFBB 4JI1O 3N7LA 3ENRA 2NR5A 3VBBA 4QXCA 1DFQA 1OSGA 4R8CA 2ORZA 2Y69B 2DQ3A 3ZYJB 2ZM6O 2ADQB 5LRSA 3T2OA 5IJ0A 3CRAA 1URXA 1HXS3 2JK5C 3JSLA 5BV6A 4LF8B 4RAIA 1YFYA 1MZ6A 3UETA 4CCCA 5BNOC 3ELNA 3OGSA 2XTAA 2WA3A 1UXZA 2WFF2 3EJKA 5L3CA 1OCZB 5FYVA 2BDRA 4ZBMA 4P9IA 4JZGA 4YY3B 3HOBA 5BNOA 3J7NA 1QNMA 4DR2B 2DUQA 5IYZB 1BQZA 4XAAA 2RJLA 4X20A 2Q7GA 2D3SA 5DEDA 1ZYBA 2VQAA 1QXPA 3T4ZA 2WQ4A 2WO3A 4AEDB 1IBLO 3AFGA 1NZCA 4Y3OA 4KP4A 2BTQB 2BNNA 2DWEC 2WDBA 5C5TA 4XMAA 3HR9A 2RDCA 3J9SA 2B1IA 2MEV2 2R72A 1O5LA 1UOJA 3JCZA 1PO22 2W91A 1P8JA 1GOGA 4JHZA 4KWUA 3O1PA 2OTLV 1C5IA 1L1FA 2VL4A 2A6VA 4J9YB 1M56B 1ULFA 1VE0A 1IKQA 1EN6A 2H6CA 3OEBA 1RGSA 3FFQA 4O4HB 2BOIA 2Y69C 4H33A 2ZMLA 1PMHX 1SESA 3SPGA 2EILB 4W6XA 3T2QA 3TOJA 3CC7V 3E8FA 1DU3D 1FFXB 2WNVC 3VBHB 1REEA 5KA5A 3OD0A 5ACA3 1EAH1 4UV8A 4J7KA 3FWEA 2ZIOA 3N2GB 4MTFA 1ACCA 1LHVA 3HWJA 1AI5A 2BRTA 4DR4B 2JICA 3ZDSA 2LUWA 1SZTA 5L3GA 1FOD1 2YIBA 3A21A 3NV4A 3Q4HB 4ASLA 3CRMA 2HHHB 3IFXA 1X82A 3E5XA 5KXDA 4B3TO 1ZBE2 1WBLA 5IYZA 2QWPB 4B08A 1AR1B 4AEDC 4CDXB 3FZ3A 1QVFU 1GNZA 4PBOA 1L7LA 4AEDA 2BTQA 5C4WB 1RSOB 2PGGA 3DF0A 2ATFA 3DXUA 1UYZA 3QOPA 4CCLA 5JVDB 5FYBA 2Q8EA 4P02B 5FZMA 5FZHA 5K0UB 3RYHB 3SH3A 3L2YA 2BBAA 4JAUA 1XU1A 4Y1ZA 1QOOA 1KJLA 5JXGA 3CSXA 1RMU3 1KQSU 4RR3B 4MSWC 1S0IA 4UCSA 4NHYA 1BL8A 4P9PA 1GOHA 4B1MA 4H13B 2QKDA 4O4HA 4QB2A 1NU1H 3KT7A 4XTPA 1WCKA 3WQ0A 4FP2A 3VD5A 3M3EA 4TN7A 4ASKA 4J41A 2JG9B 3Q8FA 5FZLA 3GF6A 2XAJA 1E5RA 4X6QB 1SRYA 1FFXA 3VBHA 1VIBA 2CGNA 3W7XA 3N2GA 2FDJA 3F5WC 5K1XA 2A7WA 3MIFA 2IFWA 4UT5A 2W9XA 4XYXA 3Q4HA 1NOVA 1JTZX 4D69A 3BALA 4JVAA 5JPMB 5GW7A 1GUIA 3ZN5A 3TWIA 1QU0A 3M8LA 3B40A 5GLVA 2VS0A 3W58A 2F93B 1LU2A 2XAFA 4CDXA 2BFUS 2C2AA 1JZ6A 4UBHA 1K9MW 1CZTA 2IH3C 4B3RB 1WN7A 4I3GA 4QU2A 1YJWV 1AJKA 3HPNA 1RSOA 2BGCA 1NCRB 5JUVA 4BCUA 2VW0A 4ASUG 1OA2A 4MTXA 2EX3A 1YWKA 1OVSA 4KMQA 4HN0A 2GNDA 3VDDB 5L3BA 5JVDA 3IGAC 4LH7A 1VBC2 3G71V 1QJFA 2GP3A 5K0UA 3RYHA 4RFRB 1HDJA 4MG2A 1K7DA 5KHIA 1DGRN 2EA7A 1IXBA 4XBLA 4YZ5A 4RR3A 4AILC 4AVVA 4YARA 2PYLA 3RZLA 5JSOA 1QQCA 3EYPA 4GX0A 3UKTA 1H4GA 2KXLA 2RDNA 3SJCC 1RUG1 1H1AA 2JG9C 4QT6A 1VAVA 4N7IA 4A2UA 1WD3A 4F83A 1THZA 4JDNA 5JAXA 2JG9A 2HWF3 3AXDA 1FYJA 3LIHA 1TMF1 5CA1B 3SDLA 4PJ0Z 3N7JA 3WCRA 3QNEA 1EUTA 2E3CA 2WPDG 1D0HA 1QJY1 4X89A 1XMOB 5IT6A 2Z5WA 1IGOA 5FPVA 2F4PA 1GV9A 1RUH1 1GKBA 5LL6Y 3JATA 1ZA4A 2OPKA 4LKEA 3O12A 1XNDA 3T1YB 3MF9A 2EINB 5KBFA 1MABG 4H7LA 2FMLA 3UK9A 1Y43B 5CEHA 1HNWB 1OH4A 3MFAA 2CGPA 2R043 4D6QA 2Y34A 3VDDC 1NCRA 1VRH3 4UWDA 3T3YA 5LA0A 5HFLA 3VDDA 1VARA 4GALA 3W5NA 3SCHA 2XMLA 3KZIZ 2UUCO 2ITCC 4AR2A 1MEC3 2OKXA 1M5IA 2ZR3A 1XHXA 3CC2V 4F3JA 1ULPA 2UY9A 2P4VA 2JDPA 4O2BA 4FLZA 5AFBA 3MW3A 4YGDA 5A6QA 2OS2A 1NY72 4OCTA 4B8EA 2E76B 4AF9A 2W94A 4LOSA 2Q8OA 4AAPA 1QOSA 4BK4A 5FR3A 2XOMA 4O9EA 1LOAA 2H6BA 1OJHA 3UKVA 1WWYA 5LASA 1WLWA 3KD4A 4LTAA 4DIQA 1N0JA 4NRMA 3RGBA 3AG1B 1GTOA 3O1TA 1COWG 1RJ8A 2WFF3 5KXBA 3HNMA 1PX3A 2AZ5A 4C8DA 1GZ9A 5BZBA 5CA1A 1SBFA 3POIA 5FY0A 2ETEA 4GZRB 5CN0A 2EINC 2VNVA 3ZRVA 5FXXA 2QQMA 4CP1A 4IEZA 1DTOA 2YC2A 1BZKA 1ZBA3 3P3NA 4QDQA 4GKYA 3THDA 3IM0A 3I59B 3ZS8C 3APOA 2VQUA 2A6WA 3SCFA 1UXXX 1QLNA 2VC9A 2UU9O 3NJXA 1MS9A 4JZ2A 4Y4RA 5HCBA 5LRRA 1PO23 3LB9A 4P9OA 1TVKA 3QD6A 4L8JA 4GA9A 4QB6A 4J11A 1U5XA 3PNAA 4YJ3A 1X4TA 1MZ5A 2DDUA 2F6BA 2YI9A 4UFIA 4C1XA 1LB2A 2OT5A 3ZYPA 4MVMA 4GKJO 5DAPA 1RUI3 1V9U1 3TNPB 3FBYA 5JXIA 3OY8B 1WCQA 3H1KH 1OF4A 1FNZA 1YRZA 2UWAA 4BAYA 1FD9A 3MW2A 1PKXA 3PTRB 1OLRA 4BE3A 1UZVA 1QF3A 3WNPA 3RRDA 1W0NA 2PHTA 4D3WA 1UOBA 3AG1C 2A73B 4YJ2A 3Q8BA 4MLOA 1QIQA 2BUKA 5CG8A 3GCWA 3IC9A 2BJSA 1NJIW 2VBDA 1OCOC 1LNQA 2Q4PA 5KXEA 4RA0A 3OT7A 3ZCCA 3WG7C 3TEZA 3STLC 5FLJA 2BOJA 3KHCA 1F15A 5LP6B 2VBPA 1RUJ2 1D4M1 2OXBA 3FLPA 3WQ7A 2O8QA 3ICXA 2G19A 4H55A 4DEQA 5EZWA 2VOKA 4KWJA 1I08A 3BGAA 1PVC1 1DQ0A 3I59A 5FQ0B 5SV5A 4RSUA 1TAEA 3Q8EA 2W6IG 3V64A 3AKRA 1W04A 1HJGA 1YF2A 2JGDA 4GXLA 3DC6A 4XHXA 1Q8QA 4AWDA 1BSMA 4JRAA 3BVCA 4H7MA 4DXWA 2QGNA 5FP3A 2SBAA 2WO2A 3LWCA 1EFRG 1LHWA 3GBFA 1CZVA 3TJTA 1VALA 2OW4A 4XDJA 2MW2B 3K0GA 1VF7A 1TG7A 1W2UA 1YNAA 1OV9A 2ZGUA 1BK1A 3RYIB 5T5LA 4BQ4A 4DV5O 3CZUA 3NJVA 3CJHB 1NXD1 2O57A 1XNRO 3ZJZA 3S6PA 1XEQA 3ZFGB 3W59A 1OLME 1ENRA 3LPFA 4IXLA 1JXNA 3LA2A 1HV1A 4AFCA 1Q81W 3BU7A 2QEXV 5BYNA 2WWUA 1GICA 3K9AA 2A5ZA 1HB3A 2PZSA 4JI6B 1KS4A 2UXBO 2HJDA 3B01A 4OI1A 3OR7C 3LPGA 1NQTA 1CAUB 4ZKIA 2ZGTA 3K57A 2B42B 3AL5A 3F95A 4TTGA 4NIGA 1GM7A 2QQLA 3LA3A 2F23A 1Q8SA 4IETA 5ITZA 5J48A 1DQ6A 1N4CA 4K9SA 2XG3A 2WRAA 1OT5A 4LLOA 2VTXA 3LOIA 5FQ0A 1DGWA 2ZQMA 4K8XA 5FYMA 1LEDA 3AVRA 4MYEA 2X10A 4Q1RA 4B3SO 4D94A 2QWOB 4DS0A 3OOXA 4LBQD 4YYOA 1CAVB 3DKWA 3JD1A 4X64B 2ZXQA 1FS0G 5I93A 1AXZA 2IJKA 4MTGA 4YHHB 4XQWA 1CAXB 5F3EA 3BTAA 1NX9A 4Q6GA 3ABTA 2OUJA 2GSMB 3ZFGC 5K7PA 3JAWB 4QQ2A 5LZ6A 4XDOA 3CJHA 2ZBJA 1G8MA 1GU3A 2WN3A 2R49A 3UESA 3ZFGA 3IDAA 2E75B 1BBT1 2HWD2 3O14A 5ISLA 1A32A 4DUZO 1AX1A 1MR5A 3GZAA 3IIAA 4JYBA 1JBCA 3RJRA 2WS91 1CQ9A 5A7QA 5LBBA 2ZM6B 5C5UA 1OMIA 4AHCA 1B6QA 1N36O 1QNYA 4KNCA 3I3EA 1CAUA 5GZDA 2VRZA 1SCSA 4C7UA 3FAVB 1NXMA 3PUQA 1Y9QA 1R1A3 3QBQA 3KKYA 1XNQB 1WKYA 4OHWA 1ULOA 2JKBA 3GBWA 3BVOA 4AHYA 2CYFA 3OEEG 1OQ1A 3H8XA 3RZGA 4EKWA 1IS3A 4PA4A 1PK6B 1VQPV 1DYPA 3TGUH 3RYFB 2Y6LA 2NZ9A 3FN9A 2VZPA 4AFDA 1BQPA 1W0PA 2EJ7A 1OCCB 4O2AB 2NM1A 1N33B 1CAVA 2DBIA 1RINA 5CFDB 1H2KA 5A3PA 4D7SA 1XE8A 4FM1A 1CAXA 3ZMVA 2AW9A 2Y33A 3FBMA 4Q4X1 3PJYA 2JIJA 4WM8B 3CBNA 2W3JA 3OTFA 4DR5O 4MVQA 3JAWA 4MVZA 2OWOA 1APNA 4FLYA 5JSRA 3RZHA 4HK8A 4LKFA 1Q90D 1TZOA 3ES4A 4XABA 2GTSA 3BY6A 3CLPA 3ZHVA 1AROP 2RS52 2F1MA 1ZTEA 2VPVA 2E74B 4YG3A 1MS1A 2ZOEB 3GHNA 4B7KA 4OHVA 2GH8A 5H6RA 4FFIA 4Y5TA 2OYZA 2W5FA 1D2QA 3ZIWA 2Y6FA 1OKOA 4PELA 5FP7A 4PI2A 4QPYA 4IEPA 3DTUB 4I9QA 4KHPO 1ZRRA 4M4RA 4MO3M 5FPRA 3J80N 2YPDA 2WSVA 3FAVA 2VUAA 4L0PA 1AVMA 2ZGNA 3JALB 5F5CA 5E16A 1PK6C 5B66Z 4JTOA 4R9AA 3ETDA 2AZ2A 3LSQA 4B3TB 1S4CA 5F7UA 4K0KB 3ACIA 1XU2A 4XJ8A 4BWAA 5E1AC 3H9AA 3ZN4A 1PK6A 1VBB1 3WSOA 4HYOA 3RYFA 2B9ZA 2VZUA 5CFDC 3CJIB 3W7TA 4O2AA 2PI5A 1XE0A 4LBQA 2FCTA 1I1EA 4PA9A 2XGXA 3D82A 3PVBB 4WM8C 5CFDA 1ULDA 5JIAA 1RVF3 1YIFA 4JHTA 1UYXA 4OUMA 2P6JA 2D3OW 3NWKA 3SH4A 1Q43A 3TAYA 5EJ1B 4WM8A 5LBFA 3QLQA 5H2FZ 5CNAA 1JU3A 4TLGA 4YNIA 2J1RA 2GMMA 3A4UA 1UU4A 2VCMA 5CYYA 4TOIA 4GJZA 1D7PM 1P49A 1JCHA 3JQXA 3VZLA 3PU8A 4ASMB 3O1UA 2O8OA 1PGSA 4JI3O 4HG6B 5C9AB 2R072 2BERA 1XC6A 1DZQA 3IMMA 3HEIA 1J5EO 1OPMA 1RUJ3 2BOBC 2ZGLA 1R081 3LGRA 1Z7S2 3A8TA 3SEEA 2DUPA 4LKDA 3WD5A 3WUCA 5IYYA 2Y26A 4I4TB 2D44A 4OQ8A 3WY6A 4NHXA 3FL7A 4YW7A 3A7QA 2W1SA 3AP4A 5F6LB 3C7FA 3THCA 1JMKC 4FMTA 1UMZA 4QKDA 1AF9A 5A3LA 2ZGKA 1SLBA 1I0HA 4CTEA 3RBZA 4S2GA 4NVPA 1LOFC 1YI7A 2EIBA 4QPWA 1PIV1 1QVGU 4Q1PA 4U3FH 2DN9A 4CU9A 5C71A 1LOFA 3BN6A 3KS7A 5FZ8A 5JMOA 2B39A 2DURA 4CH5A 1PM4A 3T08A 4L87A 1FI2A 4W4LA 3O0XA 2VG9A 1W0KG 2PHDA 1AR73 5JOXA 4UVAA 4K3UA 4IEQA 1UF2C 2NMOA 3ZYIB 2X7RB 1VQ8V 4K8ZA 1JJOA 1ZUQA 4EFBA 1SF9A 4KUMA 4KQ7A 1ZX5A 1H1IA 4DXSA 1SQGA 2VCBA 5C9AC 1VQLV 4JI4B 4WFHA 2ZHKA 3A0HZ 5FKBA 3BA9A 3FFZA 2QQJA 2QWRB 5C9AA 2VOXA 5CBLA 1O3TA 2HWC2 1POV3 2E7TA 1WZXA 3OE7G 5H9QA 4QHOA 5C70A 1LR1A 4MGQA 4LBOA 1H2LA 2GC0A 3SMHA 2C4XA 2IVIB 2YU2A 2VBBA 1YQ6A 1UL9A 1OURA 3VN4A 4XFGA 4PA3A 3LOBA 4HOOA 4HZFA 3FHAA 1Y66A 1A8MA 4IYHA 4J7JA 3PIGA 2QDOA 2Z69A 2DU1A 3B69A 5JR7B 2CH7B 2WIIB 3O1VA 2A75A 2PLV2 2ZGPA 1LNSA 1QU7A 4MTOA 2FDFA 2J1SA 4CDWB 4SBVA 5CISA 3WFVA 2YXHA 1PNFA 2WT1A 4JKMA 4A6OA 2GH2A 2B8MA 2XKOA 4MADA 2A9HA 3AKPA 3W7UA 4MVOA 2ZMKA 4I2OA 5DUWA 1ASJ2 1BMV2 5ANNA 1S2BA 4P00B 3RDIA 5JJNB 2UXDB 4GWJA 2H3OA 1ENSA 4CZZA 5IAVA 5IK7A 1VQ9V 2HFEC 4AFBA 4UCOA 1D2SA 2P06A 4QQLA 1ORQC 4AQSA 2RJZA 1F8VA 1O8PA 3AG7A 1A6CA 1V6KA 1RUD1 5A7WB 5I0DA 2BOCC 1QJU2 2BTVC 2F4LA 2VCCA 4GH4C 1HRV3 3RYKA 3IC7A 4OI2A 1AX2A 1WLDA 3ML0A 2JDAA 1O6UA 4X1KB 3CCSV 4D7TA 3QTCA 4MGYE 1PP9H 2GUZB 1V6MA 1UU6A 3NO8A 3MIDA 1WMFA 4D6TH 5I91A 3M4FA 2E5LO 4CDWC 1X9PA 2XJUA 2CH7A 2VH9A 4CU7A 1SEFA 4HK9A 4N9HA 3EHBB 3CQOA 4CDWA 2UU9B 5FNVB 2X05A 3BHPA 5FMDA 5EC1C 2UXCO 4Z2AA 3JZVA 3U11A 3HBKA 1IBKO 2HWB2 1X8MA 3U4SA 3AP6A 1C8NA 1W9SA 3WVJA 4U36A 4PD4F 4N9IA 4UOJA 2BYVE 3ZM8A 3ZYFA 3WDXA 1T5EA 1KFXL 4F6RA 4V2VA 2WZ8A 3T4VA 4NWWA 1Y9GA 1ZA7A 4IUGA 1V00A 2RS53 3LDCA 1PM9A 3J8F1 2LJ2A 5LHIA 2IC1A 5F5QA 1A8DA 5CA6A 1KP3A 3A23A 4AI2A 4QMAA 5A7WA 5BUVA 3WW2A 4CBCA 5LWBA 1D0GA 2V7QG 2YIDA 3KWVA 5A1LA 3TXQA 3OUSA 5FO7B 3FB5C 1VBD2 4P9JA 3PIJA 3KV4A 3ACGA 1H30A 2WS92 3AM2A 1IBMO 2BCCH 3OGJA 1JJ2U 3K4DA 3MFCA 3AMPA 4PA6A 2KG7B 2QKCA 5JH7B 1I94O 4QNHB 4S2FA 1M57B 4X1KA 5GLTA 3HQUA 4SLIA 2FDKA 2HR3A 4NE9A 1HNZO 2ZCEA 2VCAA 2GUZA 5DN6G 3O1RA 2AREA 5IVVA 3X2QB 3JARB 1HKDA 4OLLA 5KC5A 5J96B 2MHFA 2QTOA 3O1SA 2A3YA 5IVJA 4JTCB 2Q5TA 3WG1A 1JN2P 2WLKA 3PURA 5FNVA 2NPIA 1MQTB 3SGIA 2NQYA 3BCWA 5K9YA 1SFNA 4HKOA 5L3EA 4Y33A 5FMOL 5IVEA 4LF6O 2YICA 3VD4A 1U12A 5JR2A 1HR0O 1R091 4E9KA 3MW4A 4CCKA 1COV3 5J37A 3EB7A 1XE7A 3P1IA 1R6NA 5A7PA 4NWVA 1OOPC 3AJYA 4I9WA 4XDLA 2BP6A 2R073 4DV5B 1OOPA 5FZ6A 2WSSG 2OQ7A 2W52A 3D5OA 1Z7S3 1UFIA 3IN9A 3K5OA 1DHKB 1QEXA 1AZDA 1M57C 3DECA 1VB2A 2VVFA 3A22A 2UXBB 1CVNA 1PO13 1QJX2 1RUE2 3NV3A 2RS13 3LE0A 3EMRA 1UD1A 2KG7A 4FSJA 4X8PA 5JH7A 4XFBA 2IJIA 1UZ0A 3H8OA 1J95A 2YXLA 4XIKA 1LUVA 4NPRA 4RQPB 4YW6A 3AXEA 2PHFA 3AC0A 3WU2Z 4FFGA 2YC4A 3X2QC 1EN5A 3TB0A 3FX7A 4XF4A 2XBO1 3NNJA 4JGSA 3U78A 2J7MA 4H0LB 3H50A 3N2KB 4JRLA 3HNBM 2FCUA 3JARA 3N9QA 1Y3TA 4CP9B 1MQTC 2VE1A 4CEYB 5C8YB 4QKNA 1WA8B 1XL6A 3K51A 4JI5B 4EN6B 3IPVA 3AYEA 2P3YA 4YRDA 1MQTA 3LDEA 3CB2A 4AI3A 2XL7A 4PF1A 3Q9OA 5F3CA 2X6CA 4FPLA 1V54B 1HXS1 4PLOA 2JXAA 5GZEA 4AEKA 5D8AC 2YI8A 4QXHA 4ZI7A 1CEZA 4UCRA 4IL6Z 4CUGA 1SCRA 2AHZA 1TEIA 1SQBH 5JMCA 5D8AA 1MACA 4UF0B 4HZ3A 4ES8A 2ZPXA 3AYCA 1PD3A 5B1NA 5J2UB 5JZGB 4NIDA 2P5BA 3DC5A 1OA3A 2RR13 1U5IA 5L3FA 2N04A 4XUNA 4CRQA 1SFPA 5C8CB 5A70A 4ZOLA 3WX5A 4RQPC 2YYOA 2OQ6A 4LF4O 3K59A 4UCVA 3F7YC 4AL9A 2KM2A 1PNMA 4RQPA 1C8M3 2XJVA 5AG2A 2HVKC 1KEXA 3ORJA 4J42A 5FZBA 1V6IA 5K8SA 3LDDA 3T4DA 2V72A 5J36A 2ZX0A 5BNQA 3IAQA 3MLKA 3N2KA 3IWZA 3B9CA 4JYYA 4CP9A 1PGW2 5KUKA 1JODA 1S2EA 5BR8O 3SLIA 1WA8A 4P9WA 5FLHA 5C33A 3OUIA 2DFBA 2IJJA 3K04A 5I8SA 1VQ7V 5KHGA 2IXIA 2VQEO 1SDWA 3RVHA 4N8MA 4DV7O 4MGIE 1FPN2 2HBUA 4NB5A 3UCSC 1JUIA 5A32B 3AMQA 3HR0A 2ZS6B 3ZR6A 1HLCA 4DV1B 4TWKA 2QTWB 3OGCC 3JU9A 1QJU3 4EN7B 4DR5B 3H42B 3PMSA 4S2HA 4DUXA 5LCWL 4FTBA 3E8BA 1C1LA 4UF0A 2Q1MA 2ORXA 5DAQA 3E22B 3CEWA 3ASIA 2FMYA 4OUSA 2J1EA 5C8CC 3WINE 1N32O 2UXNA 3GNEA 4UFHA 5FZDA 1G9FA 4XZPA 3VDCA 4OYUA 4MOAA 5C8CA 1L7QA 2P7TC 2F4VO 3K48A 5F3IA 3CMEV 4Q27A 2PA7A 4WVVA 2DWRA 4ATEA 5L36A 3OBRA 3LA7A 2Z3YA 2VMCA 1W6MB 5IFTA 5FY4A 5J98B 4XFFA 1FXZA 4GULA 2IU0A 3ZHUA 5GLZA 1LHNA 4CH4A 1GP4A 4CPBA 1AI4A 1KYOF 2R9RB 1RMU1 2VZSA 2WNOA 3UT5B 1RHI2 1ALYA 4OVEA 3VBRB 2IXLA 1F5FA 3I2GA 1C5HA 1GWLA 4PJYA 1HB4A 1JOBA 2ZEXA 5FPUA 1V6JA 4JAAA 2GMEA 2R9AA 3D8CA 3K5NA 2XHKA 2I07B 4JYAO 4O4LB 3DXRB 1Q82W 1SLAA 1L8DA 4H44B 5A32A 3MDPA 1C3HA 4EQVA 4DO0A 1PL0A 5LXTB 1US2A 5AVPA 3NJZA 1W9YA 2JE8A 3I4IA 5E6HA 1V6LA 2JE7A 4NO4A 2E26A 4B4QA 1PL4A 2DVBA 3E22A 4OULA 3ASOB 1RUF2 3OBZA 1F23A 2Q67A 5AC91 1WP7A 4Q4Y3 3GALA 1NLSA 1YQCA 4PT6A 5IATA 3CCEV 4LBMA 4LNUA 2ZA9A 2OCCB 5HXVA 2CTPA 4LULA 1K34A 4N23A 2XWJB 4RUFA 5GJ6A 1CN1A 2IXKA 2VQFB 2WA4A 1AJPA 2Q1ZB 2ZGQA 1NR1A 4CVUA 2XB6C 4HANA 5IJRA 4D0QA 4YIPA 1LOEA 3VKNA 3VBRC 3QO7A 4GB32 2JIZG 2IH1C 4MVSA 4LUKA 2ZT9B 4DV3B 1C57A 3WDVA 1QOTA 1YCIA 3JD2A 2JECA 2Y6JA 3VBRA 3E89A 1HQWA 2YIAA 4ORFA 2CDYA 3T30A 1AVBA 1WPXA 1QHDA 3OBTA 2ILMA 3P5BA 3W9AA 5LA9A 3V65A 2UU8A 2KKWA 2P6HA 5C3OA 2HWF1 3FB7C 4O4LA 5DQ0A 3DXRA 2HWE2 2XVGA 3MIHA 2BSKA 5LXTA 1B3QA 3I2FA 5FBJA 2IVJA 1RPOA 5I8TA 3CEIA 3HT2A 1H2NA 3RYPA 4EN0A 5FMCA 5I0RA 4OHYA 2DBNA 2DF7A 2OCCC 3D0JA 4R9DA 2VMIA 1QJX3 1RUE3 4NJ4A 3RFRA 3VKOA 2UUBB 3E5QA 5CA0B 4X66O 1QNWA 2BPA2 5LEJA 2BGPA 2N05A 2R041 4OUEA 4YGEA 1GZTA 3AKTA 4DV0O 1VRH1 3LNMB 3ZHQA 3ZMNA 2YSUB 2KQXA 1OQEA 3WHUA 1RJ7A 2YPJA 4DV4O 1O9HA 1MEC1 5L7OB 1FXVA 1HQLA 1KU9A 3CCRV 1GWKA 4LKSA 2VMDA 3S3WA 1AX0A 5FY1A 2RVAA 1PM7A 2WZR2 1DQ1A 4L99A 1NLRA 2UYAA 2QM8A 3E2EA 4LFCO 1Q8PA 1W8UA 2BVVA 3A0RA 5IUQA 4DQAA 2CUGA 5EJ3A 5D5QA 1MZEA 4LF7O 4GMP0 4ZXKA 4EN8B 4EZHA 4QU1A 2A3QA 4EFEA 5FP4A 5LA1A 5LMNB 2V5DA 5DXDA 2JDUA 3H1WA 1WAZA 3JD72 2WFF1 5FYIA 4NPLA 1RFYA 2PHUA 2R32A 2DYSB 3JSNA 4X62B 4I3PA 2IBZH 2R30A 3W21A 4M00A 2ADEA 4BXSV 4B3NA 4O4JB 2EIDA 4WM7C 4R52A 3ABLB 2KB1A 4JI7O 2XOKG 5A3OA 1GMMA 5DUVA 3MV01 2X53S 4CU8A 3NVCA 4X65B 1N1VA 1YEWA 2R6QA 1FX5A 1UY0A 1GNYA 2E33A 1KUQA 2EIKB 3KM5A 5CA0A 4A44A 1DG6A 4U7NA 4XCAA 5LOVB 5DAVA 1HQNA 3QVNA 1AR93 2MEV1 3L9DA 5EWSA 1PO21 3HVDA 4FQ4A 2LFSA 3MICA 1F35A 1P84F 2YXSA 2B45X 2I2SA 4CCMA 4FZ1A 4IDZA 5GLWA 1EM1A 3JAMN 2CV6A 5KAFZ 3K3OA 1GAXA 3Q8CA 4EZ4A 2ZMNA 4DMIA 4NPMA 2VR4A 3V56A 2EIJB 4YW5A 1SMVA 3S3XA 3CZJA 3J7MA 1FXHA 3EVKA 1G9AA 5EK0A 1FMD2 4XPVA 2QQPA 1DK1A 4RD7A 2A7AA 1L3JA 1VEWA 4XVHA 3AZZA 1HJFA 3LZZA 1UX7A 5CIRA 1FPN3 5HV4A 1R3IC 1R1BA 4OMDA 4QB1A 2E31A 4HAMA 3CL1A 3SYQA 4DV2O 5CVRA 3SPHA 2DYSC 1JYWA 3CX5F 2ARAA 4FT8A 4OPHA 3ILNA 1DF0A 1HXS2 5KMGB 3ABLC 1QH6A 1EAH3 3PJQA 1SACA 1PHMA 1ZBE1 4O4JA 4AVTA 2RM23 4CXWA 4CCDA 4J9ZB 4COUA 2R16A 4PLMA 4EYUA 1TVGA 2EIKC 3A2FA 4BISA 1FPOA 2QCSB 2K1EA 1POQA 4NN0A 1T6BX 3SCGA 4DV6B 5KUMA 2EZPA 5LOVA 5FZGA 1QXJA 2PHRA 1O59A 2KD7A 3OB8A 1TME2 1MMMA 4HONA 3I55V 1IBMB 4ZIBA 2HLEA 4MGTA 3LDBA 3VGIA 3HIFA 2W0FC 2K0GA 1RHI3 3R4DB 3WW1A 4OHXA 3PJSK 2O14A 5TSWA 3ABMB 1VPHA 1HNZB 2WYSA 2LQTA 2VW1A 1ZSPA 1US3A 4EJRA 5GZGA 3Q8AA 5FDBA 1U5YA 3O5SA 2DCYA 3E6BA 2ERFA 3RS6A 4KWLA 2IXHA 3STZC 4Q4V2 2M7WA 5IJ9B 2D3RA 4OQ9A 2DYRB 4Y1XA 3WNKA 1FFTB 2P17A 3SH5A 2IJHA 4P9GA 3SEPA 3T0AA 2VY0A 5ACA2 4LF6B 5KMGA 1W8WA 3MIEA 4W8JA 4NIHA 5B3SC 1XMQB 1JI6A 3BEHA 2PELA 1NCQB 3I97A 3BTXA 1KECA 3CHXA 3TN92 4NIAA 1D5AA 3AK0A 5DZGA 5DG1A 1XNAA 2TBVA 4LUMA 4PIXA 1JA8A 3WB0A 1REDA 1S2KA 1DLLA 4NXNB 5J3UA 1S5LZ 2O0OA 1VBC1 5IY5B 4XE9A 2D6OX 2QDRA 3THOA 2RNBA 3ABMC 1DQ4A 2W95A 4YVSB 1R3KC 3N4MA 2ARXA 2Q5ZA 2ZX2A 1XNBA 3WEZA 3R4SA 4MHUA 4QQPA 3OPWA 1UYPA 1QLEB 2NYYA 2W46A 2QDNA 5EZYA 1X9TA 3AEIA 1S0GA 2ZDIC 5HCFA 2C9KA 2DYRC 3TEWA 5T52A 4B4RA 2UWBA 2IWGB 2HWE3 3T1HB 5A9GA 4Q26A 4DK1A 5IJ9A 1NAEA 3NV1A 4J80A 1RUC2 3PL0A 1RUG3 1MS4A 4WFFA 2D43A 1G6UA 2WQ8A 4FCAA 1BE3H 3K0DA 3S7EA 2GALA 5DECA 2PHLA 1G1XB 2VNOA 2AC1A 1W3VA 1TMF3 3CC4V 1Z2GA 3KV9A 3BIEA 2XHBA 2ZNJA 1QJY3 5DABA 1GQPA 4CU6A 3QF7A 1F31A 4DXZA 1GR3A 2CTRA 4E8DA 5CU1A 1BXHA 4MUVA 5IY5C 3AKSA 4J7ZA 3FD9A 4YVWC 4WVMB 5CZKA 1W2NA 3R05A 1YC61 1H1MA 2Q0AA 4UB6Z 4XQDA 4XJZA 5LB6A 3UGGA 4YVWA 4I50B 1QLEC 2FD8A 5FFOC 1T2XA 4YIOA 4JV5B 2MK3A 2Q9LA 4ES9A 4D8MA 4FPKA 3MF6A 3I54A 2HEYF 1NY71 2JRIA 2XQXA 3AK2A 3MO4A 1CXZB 4XJAA 1F4AA 2VZ1A 3VZOA 3VQWA 4EROA 3CCVV 5FY9A 2OTJV 1B35C 4QGPA 3ZHTA 3ZYGA 5CKNA 2QBXA 2VVDA 1OF3A 2QJ1A 3WP3A 2WNEA 4AVCA 5FKCA 2V5YA 1WMDA 1B35A 3AL6A 4AQ2A 4LO5B 4GJYA 2WQZC 3NAPB 3OGVA 4X1YB 5LYJA 4FOWA 2YIBD 2Q73A 2WINB 3GXUA 4HSJA 2BGOA 3VQYA 4DUYB 4DV7B 3OYWB 1VF6C 4MXWB 3UKNA 3SNMA 1REFA 2ES3A 3C7OA 3WF2A 1VF6A 4NXMB 5H6QA 1IURA 4UXNA 4UCUA 4QGNA 4XW3A 5IWAB 1AR82 2GMPA 3A0KA 3JCIA 3C7GA 2BWAA 3IMNA 3HPLC 1B04A 1YSCA 1UIKA 3BOWA 5FRAA 4WVMA 1H4HA 4Y1UA 1IPKA 4JI8O 2LFRA 4GAZA 1VRH2 3ZFEB 3AP5A 1H8EG 1O91A 2IZWA 2Y64A 4IE0A 5IVBA 4I50A 2AGAA 1SG3A 3CCMV 3G6BA 2Z5UA 2WWWA 2TEPA 4LFAO 4AHZA 1SC5B 4IT5A 2JGUA 5I8YA 4WFEA 1FYUA 2BQPA 1HP8A 2B9UA 3EXAA 1HB1A 3ZXLA 1U97A 4XDKA 5FOJB 3AMNA 1XUQA 2HYXA 5C6CA 3FJSA 3N7MA 3NAPC 2ZABA 4EN9B 4JTAB 5EIYB 4PDWB 1K8AW 1N3QA 3NAPA 4X1YA 4N53B 1VB4A 2KR2A 1RUJ1 2Z0AA 1H8HG 1W6QB 3E86A 3OYWA 3L73H 3EQEA 4AVBA 1AR5A 2H0VA 1R64A 4MXWA 2VZRA 1YQ5A 4ZHQA 3U14A 3G6JB 5C7GA 2CL2A 4V2WA 4JC1A 5D5PA 4KGQA 5LA6B 3RMXA 1ZBA2 4P2ZA 4RFT0 1D4M3 3K9SA 4I0XB 1BJQA 1TME3 4O4IB 5F2WA 4UW5A 2J1TA 4FK5C 4DW0A 5DZEA 2D6NA 3ZFEC 1JYTA 3BODA 2UUAO 1RC6A 2VMGA 1GQGA 4E4DX 4UI9L 1GH6A 3ZFEA 1GZWB 3WB1A 4FPJA 3KCCA 3F7VC 1SQVH 4XMIA 1HNXO 5GKAC 3ACHA 1PNGA 3CWBH 2JB4A 3OEHG 4YGCA 3I5DA 4QPJA 1H8TB 3HN1A 1WCDJ 2ZE5A 1RUI2 4PQQA 4Z2WA 4NHLA 3OFNG 5A1FA 4Q4V3 5HV0A 2OIEA 1R1ZA 1YFWA 4CDQB 4J25A 3I49A 4ONUA 3VBUB 3U37A 1TQ5A 4MVRA 4LHLA 5DAXA 2AYHA 1LUWA 4PDWC 4D7YA 2WABA 3NKTA 1OH3A 2JEMA 1ST8A 1VQ6V 1NQDA 3EO6A 4UYBA 4FVVA 1YQ2A 4PDWA 1OCZC 3OTOB 4R8HA 2DTYA 4IGQA 3O0WA 2XAHA 4RHV2 4N53A 1POV1 1VQ4V 4YSFA 1ZL8B 4JGZB 1Q6HA 3SYOA 1QQP2 1W6QA 2HEPA 2CAVA 2WZEA 4GT1A 2PAEA 3R4UA 3TN93 4YLZA 4DR1O 5A3TA 2ZAAA 1Q8VA 4IEOA 1X33A 2ZCWA 1EYBA 2IXCA 2BU9A 2YS8A 3POSA 5LA6A 2E51A 1CD3G 5FY8A 3ZBHA 2XAGA 4IGPA 2Q6AA 4I0XA 4O4IA 5GLUA 4BLIA 5J7MA 4IESA 1O9GA 3RMYA 4X66B 5E79Z 3LUTB 2DE0X 1M56C 1GZWA 2FBEA 4LFBO 1IS5A 4WFBV 1XBLA 3NR7A 1H8TC 3K03A 4P9LA 2BZDA 3FLRA 4FOVA 3JCUZ 1J3PA 2WZPP 1A3KA 2CWMA 2ZGMA 3O7OA 4TUYB 2EILC 1H8TA 1HX6A 3TRSB 4DV4B 3VBUC 5H5NA 4U7OA 1YI2V 2G38A 3VBHC 2VXRA 2HWD1 3VBUA 2NNUA 1RUC3
chains in the Genus database with same CATH topology
2R0HA 3MS5A 1FATA 3M2MA 4QPGC 4GH4C 1HRV3 3RYKA 1OIJB 1DDLA 2MNGA 2N7GA 3E97A 4I0AA 4OI2A 1AX2A 1WLDA 4FTEA 2K2SA 3D6EA 5DDJ2 4UBGA 4YVWB 1ZZCA 1AL22 2QJVA 4XXAA 4GB33 1RUC1 4JGZC 3RZZA 4QPGA 3VKMA 1KD7A 1WBFA 2CWSA 2PQQA 4Y22A 1BBT3 4RGAA 3VZJA 4D7TA 1I9RA 2G9FA 2R0FA 4MGYE 3PVJA 1G9BA 4JGZA 4IEWA 4CDXC 1X8EA 4OHZA 3PMEA 4ATFA 1S0BA 3VHRA 1V6MA 1X50A 4LLFA 4Y20B 4FFAA 4A7KA 1UU6A 3NO8A 2QE3A 3MIDA 1WMFA 4AK3A 1RMU2 5I91A 5JVVA 2P37A 2PAKA 1G86A 3M4FA 4CDWC 1CIWA 1ULEA 2XJUA 4AVSA 1C4RA 2VH9A 3LAGA 5FO9B 1WCSA 4W6YA 3VUOA 1SEFA 3FMGA 5C4WC 1ZRCA 1ZRFA 4CVYA 4HK9A 4N9HA 1CJPA 4YZ2A 3VHOA 3EBRA 4CDWA 2EXKA 1XXNA 1SLIA 1PZ8A 3H1MA 2EXJA 2XH6A 4IV1B 4BH9A 5C4WA 4QPIB 3AYDA 3CNAA 1B35B 2WWSA 2BVBA 4K1YA 1RITA 3ME2A 1O4ZA 1ZZ6A 3JZVA 4JTNA 3V0AB 1JHNA 3U11A 2HWB2 5K0UC 1X8MA 4ZU4A 3VBFC 4XILA 3WHTA 4AXOA 4LBJA 3AP6A 4CEWC 3I2DA 4QQOA 1C8NA 3VL9A 5HCAA 1S0EA 2DFCA 4U36A 3WVJA 3HT1A 4N9IA 4RR3C 4R9BA 4HFSA 1EY2A 1PMIA 2BYVE 5F9TA 3VBFA 2Y38A 3WDXA 1KFXL 3JBG3 3QH6A 4CEWA 1DS1A 1J3RA 1O3RA 3IBMA 4NWWA 1V00A 2RS53 4C5WA 4FPYA 2ZZJA 1F2NA 1QDCA 3J8F1 3SITA 5F5QA 2IC1A 1SLLA 1J1TA 1W6MA 4Y4YA 1A8DA 5CA6A 4M3CE 4YGBA 2XJRA 2R1BA 2ZGOA 4AI2A 3JBG1 2XWBB 1DBNA 2JE9A 4GWNA 1DZRA 4XBNA 3UL2A 4QMAA 4YW1A 5AC92 5BUVA 3WW2A 2D5FA 2A71A 1D0GA 2NP0A 2RS51 1FNYA 2FZ1A 3LSEA 3ZXDA 4AW7A 1OIJC 1XNCA 3DGTA 1UPIA 3SHRA 4Q4X3 4LBQB 4J6GA 5FO7B 3B3QE 1Q56A 1AXYA 1VIWB 3RPQA 2PTMA 2XJQA 4MX3A 1VBD2 4P9JA 3EXUA 1CR7A 4FAHA 4LE4A 3OPZA 1OIJA 5KWRA 1GFF2 1AJOA 4FOYA 2C5DA 4KL1A 3AZVA 4L8QA 1H30A 2WS92 3AM2A 2WKKA 3OGJA 4QHBA 1H2MA 1LR5A 3MFCA 5A33B 5GZCA 3AMPA 4K8FA 4C0HA 4K7JA 4L11A 1X7NA 4S2FA 1BCXA 1IQAA 4GMP3 3KCYA 5LK5A 3AJZA 5GLTA 1LOCA 2V73A 4FPOB 1YLLA 4SLIA 2WZR3 3CF6E 2RJKA 4K40A 3H3ZA 2P34A 1JYCA 1GYKA 4Y20A 3T1MA 3MIBA 1RUG2 2AREA 3WV6A 1KDMA 3FUQA 2X29A 1AR83 1CJDA 4GMP1 1O5UA 2G9GA 3E5UA 4KU7A 1OD5A 3ST7A 2D6LX 4E4ZA 4IV1C 1HKDA 2VMHA 4QPIC 1NCRC 2UURA 4OLLA 5KC5A 3N35A 5J96B 2MHFA 1R1A2 3ETQA 1AYN3 2A3YA 3I8TA 3WDYA 2GN7A 4BIFA 2Q5TA 1AR81 3WG1A 1JN2P 2C0ZA 3JD73 5T3NA 2ET1A 4IV1A 1PGL2 1TMF2 4QPIA 1ZREA 3O2GA 3GZTB 4BPZA 2A3XA 1CPNA 2NPIA 4YLMX 1MQTB 2E7QA 5H9RA 4E2QA 4LA3A 3H3UA 3V0AA 3WQ1A 4MH0E 1XQNA 2NQYA 3BCWA 5K9YA 1SFNA 1QJY2 4HKOA 1AYN1 2EXHA 1G6NA 2HWF2 5FMOL 1WMEA 5ABJB 2EIGA 4H14A 1RUH2 1U12A 3GBGA 1VBB3 4P5HA