1YCIA

Factor inhibiting hif-1 alpha in complex with n-(carboxycarbonyl)-d-phenylalanine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
336
Chain Sequence
GEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Selective inhibition of factor inhibiting hypoxia-inducible factor
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 336
sequence length 336
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1yciA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yciA01
1H2KA 1YCIA 2WA4A 2WA3A 4JAAA 2CGNA 1H2NA 2W0XA 3KCYA 1MZFA 3D8CA 4Z2WA 2XUMA 4B7KA 3P3NA 4QU2A 2ILMA 3P3PA 3KCXA 4BIOA 4NR1A 2Y0IA 4AI8A 1H2LA 2YC0A 1MZEA 2YDEA 4B7EA 1H2MA 4Z1VA 5JWPA 3OD4A 2CGOA 1IZ3A
chains in the Genus database with same CATH superfamily
1T6BX 4E4SA 2BZDA 5CA0A 3J9SA 2WZEA 3GGLA 3DKQA 3FFQA 1YRZA 1OFSA 1ZBE2 1FV3A 5I8SA 3RYPA 1IX9A 5B1AC 1HN1A 3I97A 5LRRA 1LOBA 1SA0A 2VZ3A 1JXNA 1XSQA 3ST7A 3OTOB 5KBFA 4TT3G 3ETPA 1A8DA 1JBCA 4J9YB 3POSA 2YXLA 3NNGA 1YF2A 3MV01 4QKDA 4ORFA 1B09A 5JI7A 2YIBD 4HETA 2W46A 2DVBA 4F6EA 3SKVA 5E8AA 2J42A 2Y26A 4DO0A 2OTLV 1C8NA 4LBMA 4PA7A 2DVDA 3RJ2X 1FV2A 5B1NA 1Q56A 1ONAA 4D6QA 3CHXA 3KS7A 4ZU4A 1UN1A 5GLTA 4QD2A 4W4ZA 2GV9A 4O4IA 3ACFA 2IXIA 1W99A 3IWZA 4DXSA 3TNPB 3DYOA 4UBHA 1VQ8V 1X4TA 1J5EB 1W0PA 2SBAA 5GM0A 2QQWA 4CSWA 1HQNA 3H1KH 4QX0A 4TYSA 1ASJ3 5D5PA 2VWJA 2ZKOA 2EILB 4B7EA 2Z69A 4NPRA 4BIUA 1F35A 1G9FA 4QPJA 1Z7S3 3AZYA 3EJKA 4QU1A 2BVBA 4KFMA 3I2JA 3ZXJA 1DQ6A 1DBNA 4BMEA 4GWMA 1IBLB 1NR1A 2YICA 1NS1A 4PJYA 5AC92 4Y5TA 4BIZA 5GLVA 2EIKC 3E8BA 1OQ1A 3A8TA 4PQ9A 2AC1A 2BNMA 2RDRA 4MGKE 2GMMA 2CAZC 2FDGA 5EZYB 3I2IA 1CAVB 3K5LA 3ZRWB 2H6CA 2IJIA 2WNUC 3AG4B 3M3OA 1HIXA 1S0JA 5K9YA 4CXYA 3BUCA 1WJZA 1HW5A 4RA0A 1MS9A 1PGW2 2NM1A 2GC1A 2VRZA 5DDJ1 4AI9A 4UT5A 2LFSA 2XT9A 1ZRIA 3NL1A 3WSOA 1MACA 2XJQA 2ZEYA 3Q4HA 1FJGO 1MR5A 1UU5A 3CE2A 5G04L 4GKJO 2WQZC 1DHKB 3QF7A 1QXJA 4PBOA 4RQFA 4BW9A 1KGYA 5EZYA 1CAVA 3ZRWA 1YLLA 4I0XA 2VMEA 1VQOV 5IJRA 2QA4V 2RS32 2HYXA 2AW9A 3CRCA 2FZ2A 3HR0A 4FM1A 5JMOA 3MAQA 3POIA 2HH9A 1YYNA 4CVUA 3S6PA 2ZMKA 2VVEA 4JYYA 2VTXJ 4AF9A 3HAGA 2RNBA 1I0HA 5JIAA 2RS51 3BODA 2WZR3 5IWAO 3TB0A 3GB7C 4LUKA 3PTRB 2Q69A 2AEZA 2W39A 3GWOA 4IYIA 1OCOC 3RGBA 1AI7A 2UY8A 2VCMA 3JD3A 2CV6A 5FLHA 2BWAA 4B4RA 2IVIB 1H8EG 4WM8A 1AXYA 3WHTA 2E75B 2QWQB 4H37A 2KA3A 4N21A 1PO12 1LGNA 1GANA 3E5XA 1LHWA 2R32A 1ULDA 2VNVA 4EN9B 4DEVA 1OF4A 5FYSA 4CS3A 2ID4A 1WMEA 1G9AA 3S3XA 2A6VA 3O14A 5EJ1B 4LF7O 3T4VA 4XBLA 5IVVA 4H3WA 3OD4A 2NQYA 3UESA 1W6OB 2L6LA 1AJOA 2FL4A 3H8UA 1X8EA 4AEDB 4AXOA 2ZR2A 4V2VA 1JN2P 4Y5Z0 1VQ4V 4LHSA 4N43B 1O4TA 3VHRA 2BTVC 5IYCO 4W4KA 5ACA1 4UFKA 2P67A 2R041 2Q8EA 2JJ6A 3ZXDA 2VWKA 4FSJA 2YB7A 1HRI2 2QTOA 1RUH1 1W2AX 3QD6A 1SS3A 4UCOA 4Q4W3 4KHPO 3OCPA 2QWRB 5JVVA 1Q82W 1DGRA 4ZXEA 3AG1C 3CF6E 1XNRO 3INAA 5IATA 2W95A 2AHZA 2P6JA 1R6NA 4LF6B 1WMXA 3CEWA 1JJ2U 1JOYA 3UT5B 1W6OA 5DPNA 3VQXA 5I0UA 4GLXA 1E5IA 4N43A 4O9GA 2C5DA 5IY5C 1C8M3 4JV5B 3DUIA 1PGL1 4O4JB 4BQWA 1XNCA 5BNQA 3PU8A 3WNXA 4AYUA 1K5MB 3THPA 4DK1A 3AZVA 3ROUA 1DK1A 4GMP1 5IUQA 2LO1A 4LMFA 1LUWA 1M5IA 3AMQA 4K9SA 3J7MA 3UT5A 3THOA 5KHGA 4I0WB 4PA6A 2UWBA 1VBB2 3KD4A 3G6BA 2OYQA 5GTHZ 4OHVA 4J9ZB 1MS4A 4H33A 3QVNA 4JYBA 4O4JA 1BYHA 2HFEC 1VBC1 3P30A 3MLKA 4ASLA 5LY1A 1HP8A 4FPFA 5J2UB 2YBKA 1OKOA 2WT0A 4UBGA 4NROA 4E4DX 4ZI7B 4JYAB 3WW4A 1PL0A 1T6GC 3R05A 3WG3A 4HAMA 4PQQA 2WJSA 1YJ9V 2JG9A 4JKLA 4KBZA 3APQA 2J1RA 2OPWA 4XQWA 5LOVA 5FMOL 2PYJA 1HNZO 2UUCB 3WDUA 4ZZ5A 3VBFA 5BMVA 2WLMA 3JUUA 4J7KA 3WF2A 5J98B 1YITV 3VUOA 5FZDA 3WW1A 3KMHA 4P9GA 1VRH2 2OIEA 5J2UA 3CP1A 4ZI7A 2Q7GA 4Y1XA 3VBUB 2WN2A 4W6WA 3H8OA 1ODMA 2YIBA 1AJKA 2W92A 4ZS2A 3HMYA 1NCRB 1MPXA 4DV2O 4MW8A 4TOIA 2OUJA 3SCFA 1H2LA 3M3QA 1UZ0A 3IBMA 1E5RA 3JD4A 1AR81 2ZABA 2Q30A 3NXSA 4HSJA 3GF6A 4YXWG 1ULEA 4RHV2 1Q86W 1D2SA 3D3IA 1LGBA 1X33A 3BTZA 5IVEA 4NAOA 1AYN3 1PIV1 2KB1A 1LEMA 3K08A 4UCTA 4P14A 4OYUA 4FM2A 3FHIB 3VBUA 1V6KA 1JJOA 4DV4B 4Z2AA 4ISRA 3HD8B 4FPGA 1K42A 4OPHA 5T5LA 4W8JA 4B3MO 3ZRVA 3CMAV 2W9XA 3BCCH 1UO9A 2YXSA 2OQ7A 5HV0A 5C8YA 1N47A 2ZX4A 3L71H 2CDPA 2CH7B 2ETNA 4AVCA 3KV5A 2ARAA 2RS13 2VCBA 1JOJA 1NJIW 2P5OA 2HJDA 2YFUA 1H0BA 4DY3A 3T1YB 3CCQV 4YZ2A 3FUQA 3BIEA 2FDFA 2O14A 2VQ0A 4IEZA 3RI8A 2QGNA 1ZA7A 2EA7A 1YUDA 5FUNA 1YEWA 1W8ZA 4UW5A 3FUOA 5FREA 2IH1C 2R6QA 3JCIA 3B4SA 4E2LA 1F8VA 4CP1A 3WG4A 3ELNA 2XBO2 4N7IA 2C6SA 1S5HC 1LU1A 4QKNA 1DF0A 5C9AC 2JICA 1Q3EA 1I9RA 4CRQA 3QG5A 2VBDA 1W28A 4DR2B 5A33B 1Q5OA 5EBMC 5FJHA 4JF3A 3ASOC 2HWD1 4CXWA 3JU9A 1GM9A 2ZHNA 4HLTA 4YVWC 3MDPA 1OLMA 1W2UA 5JZGB 3CJIA 1SERA 3OB8A 3IDCB 3QBQA 5GJ6A 5KX5B 4K8RB 1X82A 2ARCA 4JI8B 4X66B 3FC0A 2ZPXA 3SHRA 1O6UA 1ULCA 4DW1A 1RUG1 1SLAA 1FAFA 2VPVA 1G6UA 1TUBA 4NIGA 4Y24A 5CNAA 5JOYA 1PO21 4MLOA 4BJ0A 4YJ2B 1LOFA 4J25A 2LALA 4HVOA 1ND3B 2PHRA 3ZHTA 3ZYIB 4GZRB 5JZGA 2R7EB 3DL3A 3WP6A 4QU2A 2ZEZA 1OPMA 1G9DA 4AEMA 1JYXA 4K3UA 4KXRA 1JZ4A 3FD9A 3VHNA 5J3UA 4P9PA 4FP2A 5JMCA 1UOFA 1VQNV 1NI8A 2PQSA 2BQPA 1JU3A 5H9CA 3B77A 5FDBA 1M90W 2TUNA 2YG0A 3OE7G 2Y48A 3CX5F 2VTFA 1EV12 4QKBA 3IT8A 1ND2B 1JQ0A 3AP5A 5DG2A 1ND3A 4YGCA 3VHPA 1EAH2 3JSNA 1VQ9V 1GWKA 4ZKIA 5CBGA 1UJWB 4YW1A 2V72A 4BQ5A 3N4MA 1WCQA 3R4DB 4XFBA 1KEXA 1AR91 4CCOA 4CP0A 1AL21 1VMHA 5FZ9A 3E6BA 3ETQA 1UPIA 1N32B 3ZFFA 4F7ZA 5LMUB 5I0SA 3TCUA 4AG4A 3NNFA 2XHNA 1UX7A 4ZY9A 5IE9A 4UFHA 5GZFA 1SQGA 2Q8VA 4Z07A 1EN4A 4R50A 4LA2A 3POYA 1KKCA 1ND2A 1TMF2 1UOGA 4RD7A 2ZNIA 1HJFA 2JDKA 4CCNA 1SKVA 2EAAA 2NN4A 1J3RA 4CDWA 4IEXA 3A0RA 1Y66A 4CCLA 1MG1A 2WFF2 4YZ5A 2FB5A 4BYYA 5CADA 2ERFA 1XU2A 4MVRA 4TSVA 1XILA 2X29A 4I2OA 3AK0A 2WO1A 4YWAA 4GCZA 2ARXA 1MZFA 1Y67A 3OW2U 4X62B 5HXVA 1QJY1 2XUMA 1U97A 4AHZA 4XBNA 4GB33 3H1LH 2N74A 4E4ZA 2EIJB 2PELA 4X20A 4LITA 3SEEA 3AMPA 4KWJA 4IESA 4EJRA 2UUAO 4XIKA 1RMU3 2YEVB 3AG4C 2WDBA 5FMDA 2Y33A 4QXBA 5GW7A 4GJYA 5FXZA 2A71A 3OR6C 2D44A 4DR3O 1IHMA 4D6TH 1UKRA 1L7RA 4BWOA 1RUJ2 1KFXL 4BPZA 4OHWA 2PA7A 4I9WA 4EWAA 4XFCA 4XDQA 1WUVA 1PM7A 4NB5A 4RQPA 4FZ1A 1YO8A 1LR5A 4ZONA 1AX0A 4YY3O 4LNUB 4FFFA 2QM8A 1Z0HA 3ZFGB 2YEVA 4IDZA 5E6HA 1ZREA 1Z5VA 2PMWB 3BFRA 4I50B 5K4LA 2D6NA 1TG7A 4CA9A 1LNSA 4WM7A 2P6CA 3WF1A 4JAUA 4XVHA 2WWUA 1QJFA 2PAEA 2RJLA 2ZGKA 1YZBA 4AHCA 2WC2A 2PLV3 2WAAA 2XDVA 3RZJA 2A3YA 2R062 3SJQC 3MIBA 2HWE2 4OQ9A 4AQSA 4DR4O 4HK9A 2UUBB 1VJ2A 4A6OA 2O0OA 1BEV1 1FT9A 3TXQA 2MEV1 4OMCA 5A32B 3ZHVA 1UYXA 1RUI2 2FDKA 4LNUA 2Q8OA 1NZ6A 5BY5A 3HKBB 4LF4O 4I50A 2GP5A 1STMA 2YPJA 1BS3A 4NIIA 2B4KA 1HB1A 4GZ9A 1V55B 3AYAA 2UXDB 2WNEA 4JX0A 2EVXA 1NU1H 2YXHA 1Y9MA 4R9BA 4QE7A 3UL2A 2Q68A 4AEDC 2J7MA 4YARA 1UPGA 5DUWA 4W4LA 4QXKA 1WMDA 1PP9H 2OCHA 4NXMB 4DR6O 2F1MA 4PA4A 3OD0A 3NRUA 3W7XA 1MZ5A 4ZU5A 5GLZA 3HKBA 3BALA 4GWNA 4JI0B 4RS5B 1W8OA 4O4HA 3SQOA 5C8CB 3RYCB 4E8DA 2VOTA 4DUWA 2VZSA 4P5YA 1FNZA 1WLDA 3M1HA 1RITA 1M56B 5JXGA 4HANA 4OLLA 3DXRA 1SCSA 2QBXA 5KAFZ 2HWF2 2ZOEB 2BCCH 2HEVF 5FWJA 1DG6A 1X7NA 3G6JB 2QQOA 2DWEC 4L8JA 4F4LA 1V9U2 3K77A 3TN92 4SBVA 2PI4A 5CB4B 2QQUA 1KD1W 2UXBB 3IAQA 1K5MC 3SH5A 1UOJA 4RS5A 2R9RB 4MVZA 3ZO0B 2FMLA 2VOVA 3MHZA 1XRUA 3RYCA 1VBA2 3ZMTA 4EE2A 1NA1B 4E2QA 3CQOA 2JGDB 1TE1B 2RJZA 4R9DA 3U4SA 2XPJA 1UNBA 4AVAA 3QTCA 1AR5A 4LOTA 2Y64A 1Q8QA 2XJRA 2IH3C 4YW7A 3KLSA 2LROA 4CC5A 3GZTB 2NN8A 4HG6B 2D93A 1HNXO 5JDBA 3LZZA 5IFTA 5CB4A 1SPPB 4EWDA 2QQKA 1HNWO 5LL6Y 3MHSC 1CP9A 3IZOA 5JUVA 4QHBA 1H1AA 4COZA 1VF6A 2DDUA 1S5JA 1NA1A 1CEZA 3O7OA 3N27A 4ATFA 4N8MA 5DAQA 2YHJA 5JH7B 3SYQA 4Q4V1 4LK6A 4LE4A 4QX2A 1BMV1 2A73B 3U37A 3HT2A 2WO3A 3C3TA 4K8ZA 1JTZX 1SPPA 1UKGA 3NV2A 2RMU3 2R073 1KXGA 4DK0A 5C3OA 2ZGPA 2EINC 3JBG1 3JSLA 5FV3A 3VBUC 1Q8SA 2TBVA 1TVGA 3F5WC 5LP6B 1WA4A 5BYNA 1NZIA 5L3BA 4QT6A 3KKYA 1PGSA 1AYM1 1NCRC 3QNEA 4DUVA 3EBRA 3HNMA 4BWAA 1SHWB 5JH7A 5DECA 5FZLA 2VMFA 5L9BA 2AEYA 4J10A 1YQ2A 3KT1A 5DN2A 3T1LA 1FD9A 3TWIA 2JJ1G 4UF0B 2K46A 4JTOA 4AI0A 5J7MA 1W2NA 1W6QB 3VZLA 4M3CF 1BJQA 1RM1B 1PX4A 3QH6A 1I7FA 2AZ0A 1OURA 5E1AC 4H44B 3VLBB 4NIHA 1C5HA 3VHOA 2Q1ZB 5FP7A 4O4LB 2CTRA 3OMNB 4DUZB 2PAMA 1THZA 3TXSA 3KZIZ 2DFCA 5BY1A 3U4XA 2WBKA 2J1UA 2WR9A 3KQRA 2KD7A 1W6QA 2A9HA 1GUIA 2X10A 2XQXA 2XKPA 5K0UB 2IJHA 5ANQA 4JGSA 1IQAA 5JIUA 5FPUA 3K46A 4EYUA 4Y1UA 3PUIA 4O4LA 4YYOA 1N1YA 3LD8A 2EJ7A 3ZYPA 3IMNA 2ZDIA 1HN0A 4DXWA 2Q8DA 1EN5A 3E35A 1D4VB 3AYEA 1XC6A 3B8NA 3BYWA 5FY5A 4M0NA 3WOGA 1GN4A 5FMCA 3BTAA 5JI9A 2JRIA 5LWBA 1FS0G 2ZZJA 4KWLA 3TEWA 1TME1 3WQBA 1RUNA 3J8F3 2Q0OC 3J80N 5KUKA 5K0UA 1UYYA 3NKTA 4XJ8A 1Q81W 2YC2A 1R3JC 3SPHA 4XETA 2KR2A 4OQ8A 2Y6KA 5F5AA 3FBMA 1SBDA 5IVCA 4I01A 2ILMA 3GBGA 3CCEV 4MGTA 4CH3A 1AVMA 1CPNA 4RN5A 1J3PA 3OGVA 1VRBA 2IXJA 4GKYA 3LSEA 4B1LA 4Q4X3 3OTOO 3CLPA 4WFHA 5K1XA 5C3QA 2B1GA 2BWCA 2PXJA 3U75A 3GYDA 4PT6A 4BMBA 4AFBA 3CRQA 3L70H 1POV3 3OGCC 3T2OA 1WLEA 5LBQA 3MV11 5LZ6A 1H8HG 1HB2A 3LA3A 1WN7A 5FLJA 1MZ6A 1S0FA 4NHYA 4E4EA 3HBKA 2RS53 1RTVA 1QIQA 4WZCA 4XDOA 1WB7A 3OF1A 2ZM6B 2JIGA 2RJKA 3I3QA 1MSWD 2OTJV 3DC5A 5DAVA 2JS5A 4IV1B 2VQFB 4R9CA 1RHI3 4YM3A 2C1FA 3OTFA 5FK7A 1BT8A 3ZHRA 1PNGA 5L7OB 2QQPA 1D4M2 4O65A 4AVBA 1J5EO 1ND2C 2BTQA 1QJU1 2HEPA 4CZSA 5D8AB 1YC61 2QZ2A 4YPJA 5IVJA 4B29A 1UY4A 4JI2B 4WBBA 3ZS8C 4LPLA 4BXSV 4UCVA 3T30A 1F5JA 1YQ5A 3HJRA 4LF5B 3AKSA 1H4GA 3N7MA 2LRPA 5EIBD 4IV1A 1IBLO 4NRMA 4LXLA 2C2AA 2R043 4LR4A 4L8QA 3R66A 1OOPA 1S0VA 1RUE3 2HP8A 1VF5B 4WFEA 2DOSA 2QKAA 5F3CA 3SJCC 1YI9A 2OKXA 2RM23 4JZ2A 1OT5A 2D2CB 5C3SA 2BRTA 3A2FA 4KNCA 4X1IB 3ZMUA 1Q8OA 5AVPA 2GC2A 5JVDB 1GP5A 1SETA 2UWAA 1VBD3 2E6VA 5FPBA 5TSWA 2H8PC 5FWEA 2NZ9A 1YQCA 2EIJC 3THTA 3E5UA 3QO7A 1WP7A 2HBTA 1NTMH 3ZMVA 3DPRB 3K58A 4P5HA 4E8CA 1FMD3 2XJVA 1NG0A 4B8EA 4CPBD 4DR5B 2IXKA 2C9AA 3AXEA 1R1A2 1W8WA 2ZHLA 4Q1RA 1OCZB 1IPSA 2Q4PA 4LBQB 4AZZA 3MICA 2FDHA 1VF7A 4OVEA 2B7YA 4QQPA 5JVDA 3CRRA 1RUC3 5JXHA 1WD4A 2EAKA 1POQA 2WFPA 2RN9A 3S30A 1VBC3 2IC1A 5L3FA 4JYCA 4N90A 2VQEB 3JD0A 2Y6HA 4FP3A 1KP2A 3DPRA 4JKMA 1S2KA 1OHFA 1AYN2 5FZOA 4UW6A 1XPWA 2I45A 3LEKA 1PM4A 3ZFGC 1Y74B 3WD5A 2RJ2A 2VMHA 1UMIA 5EIYB 4K0KB 4JRLA 2EZPA 2XJUA 1AI6A 5KA6A 1ZBE3 4ITCA 2CK3G 4HKLA 1K3IA 4P9JA 1S2BA 3IDEA 1HQLA 4FM0A 3ZIWA 3OEHG 2VZRA 2EZOA 3NNMA 1J83A 2O8QA 2WSUA 5CU1A 3ICXA 1ZM1A 3FFZA 1AX1A 2VULA 4LKFA 4EZ4A 3CYOA 4ABMA 4AAXA 1Y74A 2GBOA 3PMSA 4Q4Y1 5A1AA 4XURA 3M8LA 2OCCB 2W0XA 2B1IA 3KCYA 1V55C 3BOPA 5T50A 1XMQB 3X2QB 4LF6O 5A80A 3WG2A 1EPZA 4AGGA 1MS8A 3PU3A 5GONB 2ZHMA 5JR2A 1OA3A 1UFIA 2CSGA 4UVAA 3JAWA 4JV5O 4AFDA 2H94A 4B3NA 5LBCA 1WBLA 1ZLZA 4Y4YA 1V70A 1BHGA 2YS8A 4MZUA 3KHBA 3H50A 2VD7A 1OV9A 4NYKA 1CJDA 3UNPA 5GKAC 1SQFA 4QQHA 1ZRFA 4RS5C 5T55A 4WF9V 4FLWA 3CCJV 1XNBA 5C8CC 4FPOB 2QDOA 3FLPA 3IJ4A 3ZN4A 2NMNA 2RR13 4EN7B 4K8XA 5DABA 4OUEA 1DQ2A 4Y1VA 5AC93 3IM0A 2IW5A 2LTNA 3PLQA 5IJ9B 5FYCA 4L97A 1CIYA 3VB9A 5E1RA 3WF3A 2BBVA 5A3PA 2VECA 3NWKA 1CN1A 2ZAHA 5LEKA 1A8MA 4JYAO 3W7TA 3MBWA 4FPEA 3K48A 2Y0OA 3POJA 2DCYA 3WDYA 1VF6C 1BSMA 2X0LA 4K40A 3LWCA 1NA1C 4R8HA 1CAWB 2D3OW 2CGPA 4G27B 3N9OA 3BU7A 4QQ2A 1E1QG 5GLUA 5HCFA 2JDMA 1HRV3 4NXNB 1Y43B 3ABUA 3O9OA 4CEYA 2UWCA 2UUCO 1D7PM 2OUHA 1QNWA 3LEIA 3ZN5A 4AQYB 3BB6A 4L92A 2VZUA 4MTGA 3VD3A 4GD4A 4UYBA 1LHOA 2VMIA 1YHQV 4U3JB 3NNJA 5EK0A 4DPNA 1WW5A 5FBJA 3CZJA 5JR7B 1Z5WA 2P3KA 2L35A 4U36A 2D6KA 4FO9A 3LSDA 2HWC1 4FFIA 1CAWA 3MZHA 3CC7V 2YU2A 1NT0A 1W9FA 1LAJA 3RZGA 4TV9B 5FPAA 1BBT1 4U2AA 1PV0A 1ZZ8A 3E8GA 1KITA 2VCCA 1KS4A 2LW1A 4YGDA 2VO5A 1XYPA 1UAIA 2IFWA 2X53S 2JECA 4FFBB 5FY0A 1PO13 1NQDA 3H01A 5FYUA 3B9IA 1O3QA 4JHZA 4U3JA 3SDLA 4FLXA 3E83A 1OUSA 4NR1A 1OI6A 2Y0IA 4DV4O 2VQTA 2GHYA 5HCBA 1GZ9A 1QDOA 5LP6C 1TNRA 3ECQA 2LFRA 4XC9A 3VL8A 4IEPA 4RFRB 1R092 3D0JA 4JAVA 2XG3A 1BXHA 4LO4B 4TV9A 4HZFA 1K92A 4MUVA 2AZ5A 4QHZA 2HKOA 5E16A 1GAXA 4EQVA 3WZ1A 2XJPA 2OX0A 4XTPA 5ANNA 2F4LA 3RW0A 3T1HB 3B2EE 5EBLC 4XEZA 4MGSA 1RMU2 2G1MA 3JD72 4LNVA 1COV2 1RM1C 3U78A 3BA8A 4XACA 2LW8A 3ACLA 4A7YA 2ZKNA 1Q7YW 1AR73 5CFDC 4PD4F 1XEQA 5EJZB 3ZM8A 3ZHUA 3I55V 2JE8A 4U7OA 3I2KA 1E79G 2ZDIC 3IDAA 1PD3A 1VBE3 1VRH1 3NJXA 1D5AA 3H3ZA 1H1MA 3CCRV 1TVKB 4Y26A 2E3CA 3QO8A 3WQ1A 1REEA 4LHNA 5DAWA 5FLXN 4QGPA 4Q8LA 4MXVA 2YZ4A 4DR2O 1OSGA 5CBLA 3OUIA 4YSFA 1L7QA 4LF9B 2WLJA 5FY1A 5C4WB 1TAEA 5K0UC 2IBZH 2ZGQA 1EBOA 4AGVA 1JPXA 4CPBA 5B1AB 5T5JA 1QJY3 1SFYA 2ZMNA 2ATFA 3OEEG 4JI8O 4X66O 1J1LA 3K5OA 1QLEB 4QM8A 2BE3A 4QX5A 4RYDA 2VMDA 5CVRA 1N1VA 3UO3A 4HOOA 1GLHA 5FP8A 2R0FA 4QX7A 4K6BA 3AZXA 3ZRSA 2VBPA 5FPVA 4UVCA 2WZ8A 2E5LB 1UYPA 5DN6G 5C4WA 3IAYA 1UZWA 3VN4A 2DW4A 2AREA 4XBQA 2VW0A 3ZR5A 3W9AA 3SYCA 1REFA 5DM6V 2EIGA 4IEVA 2VNGA 2VAUA 2ORXA 5C8WA 2JVDA 3NJZA 4UUJC 4X64B 1SZBA 3OYWB 2ZXQA 5BNOB 1QOSA 1RUD2 2Q7HA 1UCXA 1QMJA 3N3HA 3ZKYA 2QQVA 1UMHA 3OOXA 4E2SA 1PNFA 1DDLA 3QH7A 3MF6A 1N36B 2WL1A 1RPOA 1G6NA 3JQWA 1M4WA 2GMEA 2BFUS 2BGCA 4Q5OA 1K9MW 1DZRA 5BXZA 3B01A 2QQNA 1N33B 4HVRA 5FOJB 2IZWA 3PUSA 2IWGB 3AP4A 3FB5C 1KMIZ 1N32O 5KXBA 2QZ3A 5FQ0B 1R081 1RUOA 5LMUO 1SESA 3KF5A 3ZKUA 3NNLA 3OYWA 1VQ5V 2Q5TA 4IV1C 2K2SA 3VKLA 1ZZ7A 5BNOA 4F83A 2VS0A 3JQXA 1OQEA 2JGUA 4FPKA 2ZX2A 1YVWA 2UU9B 5L7OC 3MIDA 4RFT0 3OPTA 2Y38A 1RFYA 5D8AC 2YI8A 2ZD9A 2R9IA 4WCEV 5IK5A 3LUTB 1W90A 3H1WA 3USSA 4XJUA 4Z8BA 4O61A 4M0HA 4PIXA 5FZ6A 1ZTEA 3G71V 1BK0A 5KC6A 1G9BA 4PF5A 4X8AA 4LHKA 5I0TA 4IYHA 3VQVA 3ZX7A 3EHKA 3FN9A 2UY9A 3HKDB 2XWBB 4OX9B 2QM4A 4XUNA 5FQ0A 4X62O 4MVMA 3JALB 4EFEA 2WNUA 2DURA 4UW3A 3W7SA 1NKGA 3TAYA 1V6NA 1GKFA 5JLVA 4AQ2A 2HWB2 4DZGA 3VDAA 3VKFC 5IHRA 3S0MA 2D5HA 2C9KA 3LEGA 4FVMA 1PNKA 1KD7A 3ORJA 1VP7A 5A7QA 3ZMNA 3AL6A 1K7DA 4QIWF 1SBFA 2EICA 1R1ZA 2PHLA 2XUEA 3HKDA 4CH6A 2AYHA 3HPNA 1DLBA 1W2BU 4S2GA 1PX3A 3JALA 3OUFA 4CCDA 2FYUH 4GH4B 4YW3A 2ZS6B 4HN0A 1P4RA 4YY3B 2A6YA 2MPFA 2WSSG 1US3A 3J7LA 2R072 5FY8A 4BR6A 2VBBA 5KXDA 4XJZA 3RNSA 4HN1A 3VBRB 4ZZ8A 4V1PA 4YM1A 4YJ3B 1TGOA 3L9JT 1Q6UA 3K75B 1ZRCA 1OCZC 1JZ5A 2EXJA 4BQ3A 2XONA 3AVRA 4J1WA 3HT1A 4MX3A 2VR4A 1TMF1 4AVVA 3I54A 2UUBO 5GALA 3PIGA 2VMCA 3C8XA 5C5TA 3QLQA 4GH4A 1VQLV 3CS5A 1ROPA 5LBFA 1A32A 3OGGA 1HWYA 1WCUA 2JD4A 1R73A 1SQBH 2BP6A 3HQUA 3KHCA 3VGIA 4K8FA 4X9QA 4FOVA 3RYIB 1SLLA 4GAZA 4Q8KA 4FLYA 3JCZA 3VBRA 2M6YA 3ZXGA 3CBNA 5CG9A 4LKEA 1BE3H 3N2KB 4YJ3A 4L87A 2VU9A 2PQQA 4JI6B 2BSKA 2UXDO 5KMGB 3WUDA 4XZUG 4QKFA 4A5UB 3IN9A 2HVJC 1QDCA 2DWRA 2VW1A 1HDKA 3STZC 4DIQA 5EYXA 4EN8B 1UF2C 1S0DA 4GMP0 1EV13 4FK5C 1AXZA 1L7LA 1LHVA 3UQ8A 5FZEA 3ABKB 4NXMO 3MFCA 1EAH3 1V6IA 1QXPA 3BVOA 5LGUA 2PI5A 3N9LA 3SJBC 2BBAA 2ZNJA 3N2KA 2GNMA 1Q6IA 1J3QA 2JDZA 4P9XA 3I59A 4BZ4A 2OCCC 2DE0X 4JI0O 5KMGA 3SH3A 2BNOA 2WS91 4DV0B 3M3IA 3PVEA 3X2QC 4B08A 3LNMB 4LFCB 1W04A 4I30A 1HB3A 1N1TA 2C4XA 2H6BA 1CIWA 4GIQA 3DF0A 1AJNA 2AENA 4YFZA 3O1UA 1QJX1 4FXKB 1LULA 1CPYA 1BZKA 3CWBH 3J8F2 1K33A 4XF9A 3AMMA 1DCSA 1ZZ6A 4I9QA 2J22A 1QY4A 2XAGA 2WFF3 1NR7A 4RQEA 2UXBO 1AR61 1BL8A 3FLRA 4BQ1A 1UOBA 3WG7B 5EBWC 4G3YC 5FPRA 3RI9A 5D2AA 3UKNA 5FFOC 1GP4A 5A7PA 4AVSA 1SFNA 5A3NA 5A9GA 2UYBA 5FPXA 3ZRXA 2GTSA 1G7YA 2O8OA 3ATGA 1RUI1 1FOD1 1QWRA 1FPN1 4Q4X2 4MVSA 1GM7A 1O7FA 4UWDA 2PAKA 5CA1A 5IFPA 1O3SA 1SBEA 3HR9A 5FY9A 4ONUA 5A7WB 5I91A 3F7VC 3MW4A 2FQPA 3LKJA 5FY4A 5FXXA 4QE9A 3DGEA 2Y69B 5JSRA 1SF9A 4FFHA 1PNLA 3PDQA 2RS52 3ZDVA 2WWSA 3FLTA 3WDTA 2BNNA 2D6MA 3FAVB 4LH6A 2ZAAA 4AGRA 4F8AA 1Y76B 1NTKH 1AB3A 3SYOA 4JCKA 3HKEB 1P8JA 2EXIA 4NWVA 4XFGA 3KGZA 2OYZA 1S3JA 1RHI2 2XLFA 1QQP1 3JXSA 4XQ4A 5LXTB 1GN2A 1DGWX 2WNOA 3K5NA 1WCKA 1OLRA 1LESA 3R4UA 5C3PA 4KP4A 2GMPA 3WNKA 3CC2V 1TUEB 1AI5A 3RZZA 2P1BA 2MNGA 3PIJA 3L74H 3UJQA 2RV9A 1GH6A 4HNAA 3LQCA 4CH5A 5EP9A 4CEWC 1M1KW 3FAVA 3R4SA 2XAJA 4C8DA 2R063 5KXEA 4JTNA 4LO6B 2HWE3 1Y76A 3TNQA 3ZN0A 3WF4A 2TEPA 4IIJB 5LCWL 3IGAC 5ABJB 2ETEA 3HKEA 4QGNA 5ACA2 3VBOB 3U11A 4QWNA 4W65A 5LXTA 4G9SB 5HI0A 2R042 3P3PA 1FATA 5BNPC 4OMDA 1RUH2 3TYJA 5KLVH 3TEYA 1O91A 2G9GA 5F37A 5HFMA 1XUQA 4ATEA 1FI2A 1AHSA 2E74B 5FKCA 2W08A 2VC9A 3ZSEA 4IGOA 1WMFA 3GNEA 5ABJA 1M06G 4K21A 4DUZO 5FYVA 4Y20B 3BCWA 1VBD2 1PGL2 4PLOA 2Q4SA 2XWJB 4WV8A 3OGIB 2JDHA 3KVBA 3S7IA 2X6BA 3R6SA 5LBEA 2BGOA 3WUCA 1W8UA 3EXUA 4C1WA 1N1SA 3MPPG 4Y1YA 2WAMA 3LEMA 1ZVFA 2BJSA 4L2NA 1Q43A 3ZXEA 5HXMA 3OUJA 2ZGSA 4XFFA 2WINB 1BQPA 3BA9A 4UI9L 5C9AA 1KRIA 3E8FA 4Y20A 2HWF3 2OXBA 1JZ8A 1RUC2 1XQNA 4QB2A 1ASJ1 1VBC2 2ZEWA 3BVCA 2ADEA 3B00A 4FPJA 2W3JA 1CWPA 4DV3B 4OUMA 1V9U3 3TN93 1Z7S1 4YVWA 3G80A 5JJNB 3M99B 2RHPA 5C33A 2KKWA 4FPPA 1QXRA 3LPFA 1S2EA 4DRVA 1RUF3 4Z1MG 3CJXA 1PK6B 3LE0A 1GZWB 4WFGA 4GX1A 5C4WC 4TWKA 4AQTA 4OHZA 1VBA3 3AZWA 2UU8A 3GHNA 1IKPA 4DUXA 3IKWA 3Q8AA 2GZWA 5APAA 3BKZA 5CG8A 4DS0A 1MZEA 1QLEC 4JDMA 3V64A 3BABA 2H0VA 4IXLA 2W47A 3W7WA 3T1MA 4C7UA 2E76B 4OHYA 4PLMA 1N8RW 4WVZA 3RVZA 3OGRA 5SV8A 5DUXA 1PK6A 2GC3A 1GZWA 4CE8A 1XB9A 2FDJA 1XNAA 3WDWA 2MW2B 2O1QA 3P5BA 5A6ZA 1F4AA 3MFAA 2VOKA 1VAKA 4PI2A 2R30A 5J1XA 4QHOA 5LHGA 2AUYA 2ZM6O 4FTBA 3NR7A 2VQFO 4X65B 2A3WA 4NPLA 5BNNC 1F15A 3KGLA 5BNOC 2D40A 2KXLA 1PIV2 1AX2A 2JG8B 2CTVA 4OULA 5L19A 1NOVA 4FXGB 5AG2A 2ZMLA 2D5FA 2WZR1 5D1IA 3E6DA 3RT3C 1H2KA 1CZSA 4NHKA 3VDCA 4LO8A 1S0IA 3V56A 4JI2O 5LEJA 2QWPB 3NAPC 1QU7A 4J41A 4NRQA 1P7GA 2RR12 2O57A 4LF5O 2JIJA 1UU6A 4FAGA 5IW0A 3I4IA 2QFEA 4I0AA 3ZN6B 1WA6X 3OR7C 5JOXA 2BEOA 1MS1A 3I8TA 2XQRA 3LF7A 4MHRA 2ZX1A 1O9HA 1GM8A 5DZEA 2LP7A 2JG8A 2WZPP 4RO2A 1HR0B 3RWNA 1SLBA 2XGXA 1GN3A 1YXBA 1OC1A 4DV7B 3ABMB 1YJNV 2CGOA 4MHUA 3O1OA 4C91A 3SEPA 2Y34A 2OPKA 2C26A 3CL1A 4L0PA 4NRPA 2DF7A 4AFCA 2E7TA 2PYTA 2W87A 2CL2A 1IBKB 1HRV2 4PLNA 5F32A 3POBA 1WKYA 3ZN6A 3ETDA 1JZ2A 4N23A 5C5UA 1V6OA 2PYLA 2FHRA 4Q4W1 3J7HA 3ZIXA 1OLQA 1S55A 4XJ9A 2ZGTA 5A6QA 4MXWB 3W58A 2PHFA 3E97A 4DR5O 4FPLA 4CU8A 1DTOA 5LB6A 3B3QE 3VL9A 3MIHA 1QQCA 4LFBB 1C28A 5A6YA 1C8M1 3SLIA 5FMOS 1RUG2 4YG6A 4UV8A 4JTDB 2YV8A 3AKTA 3FX7A 3AFGA 1MMMA 5B5EZ 1IS4A 3JB4C 3CCUV 1PO22 1O4ZA 4GH4C 5HBAA 5EV7A 4FCAA 1NCQB 3ABLB 3OM3B 4A45A 2CWSA 1BQ0A 4BU2A 2CTWA 1ZRRA 2VQEO 2ZX3A 4X6RB 2J1EA 3WQ0A 4MXWA 2GUZB 4OGQB 4QPYA 2WNVB 1WW7A 1I5PA 3AMHA 5DAPA 1SQ4A 3VBRC 2BOJA 3KT7A 1R1BA 4K0KO 4P2ZA 4XCBA 2IJKA 1I5ZA 1VR3A 1XOUA 2P3YA 3SITA 4FI9A 4K1YA 3BN6A 5GZGA 4B3RB 1ST8A 5D21A 1QU0A 1NXMA 4HXCA 4QPGB 3EHBB 1OLME 1NCQA 2D7FA 5EYYA 3ZFEB 4AAPA 1YJKA 4D94A 2EULA 4JTAB 2GUZA 3A7QA 2WNVA 1QNYA 4MGYE 4HKOA 3I56V 1OHHG 4GALA 4OZOA 5A3WA 1AL22 5IYZB 1JU4A 3MEPA 3WT3A 4AFAA 1XMQO 1QVGU 4A3ZA 1AR72 1WPBA 4X89A 3AYDA 4AEDA 4JQTA 1GZCA 4CCKA 3D8CA 3C7GA 3OMIB 1LR1A 4FOYA 4IEQA 1VBE2 2HLEA 4HPKB 4QPGA 1JMUB 3AP6A 2ZACA 5EC2C 4V2WA 1NQTA 3POFA 1D4M3 3H9VA 4IGQA 1IG0A 3ABKC 3LDKA 3ZMSA 1U12A 3ZXFA 3RZLA 2XMLA 5LA9A 2DMXA 4J7JA 3APBA 4BQ4A 1N0JA 1DU3D 4OFGA 4Y22B 4CS4A 1JODA 1FPOA 3VZKA 3D3QA 2AR6A 1NXD1 1AR1B 1QJY2 3A0BZ 3SPGA 1GTOA 3CIHA 5KXCA 1ZYBA 3ZSLA 3GCXA 3N9QA 5JCOC 4HPKA 1D0GA 2CE4A 4K20A 1HB4A 3L2YA 1GRJA 3WF0A 1UY0A 2ENRA 1RJ7A 3RPQA 1K5MA 3S5AA 3C7OA 3MYXA 4Y4RA 3HB3B 4QXCA 2P90A 4FFKA 2DUOA 2ZE8A 2YUEA 3IIIA 3KG2A 3EVKA 1B04A 1H38A 1YQ8A 1EFRG 3WG7C 4KWUA 5DAXA 1AI4A 4WBNB 5LMNB 2NNUA 4MTFA 1XBFA 1Y6XA 2RS11 2OVUA 3CCVV 1TA8A 4EZHA 2RVAA 2GDSA 4KGGA 4OI1A 1N3PA 3UV9A 4NXNO 3FX3A 4COVA 3N7JA 2RDCA 2XLAA 4YHHB 2DU0A 3BIWE 1XNKA 3A0NA 1UYZA 4AQYO 4HSLA 2GSYA 1W9YA 1S4CA 3FWEA 2EINB 2AZ2A 4ASKA 4O7XA 1QEXA 1RB8G 3WG1A 2Z3YA 1VB4A 2X5IB 2Y69C 2WABA 4UB8Z 1R1A3 2ES3A 4CBCA 4XILA 4WBNA 1Y9GA 3T08A 1UD1A 3TRSB 4ZOLB 1GKBA 1U5IA 4OUSA 4IGPA 2MEV2 4NVPA 1RVF3 4O2AB 4JGZB 2ATKC 2VJXA 4D3WA 1IBMB 1HJGA 3MIGA 5IAVA 5KHHA 1LHNA 3H1IH 3SC7X 5FYIA 3DN7A 1W06A 1CGPA 4GT1A 5IYYA 3ON7A 3JD1A 3MD0A 2JDIG 1NKDA 5HV4A 4UW4A 4PA9A 2X5IA 1G8MA 4P9YA 2LGQA 1SQPH 1JYVA 5H2FZ 1POV0 1SQXH 1QJZA 1GZTA 1NCRA 5FYYA 4Z2WA 3UYJA 4AEKA 5KR7A 1IOAA 4ZOLA 3O1VA 2DU1A 1UY2A 3LCPA 2VXJA 1D2QA 3ZMZA 3DYPA 5ABJC 4JGZA 3WNPA 5IT6A 1QLNA 3T3YA 4YZ4A 4OI4A 3TOJA 3VBOC 3HWJA 4META 1RL3A 3GZUC 1UW8A 3N9PA 4NE9A 1MEC3 2GNDA 2IFRA 2Q7EA 4OI0A 2OIIA 2F17A 2V4VA 2CAUA 3NMBA 3WHUA 3WFVA 3T1HO 4EB6B 1N34B 4WVWA 4FLTA 5EJ3A 4S2HA 4J6GA 5H9PA 3H1JH 3NQHA 4IW3A 1QJEA 3H1HH 2VUDA 2ZZQA 3UGFA 5FNVB 2CH7A 4DRRA 3LFMA 5F2VO 1I5YA 1KBHA 5K8SA 3CDZB 4GKKB 1UXZA 1JYNA 1Q8PA 1ZSPA 2WKKA 3QCWA 2F4VB 4DMIA 3OBTA 2QQMA 2DQ0A 3VD7A 1DGLA 2OZ6A 3GZAA 4PF1A 2GNTA 3ZYGA 1SACA 3M8AA 4LF9O 1ZUQA 1TZOA 4CDXB 2Z79A 3MGUA 3RSJA 5FO9B 5BZBA 2Y4UA 1AILA 3POWA 4L9BA 4OI2A 3WNMA 3W5NA 5FNVA 2ZE5A 1OJHA 1S0EA 3OEBA 1BK1A 4SLIA 4PIYA 5C3RA 4TLFA 3CCMV 1WLWA 5A33A 1LEDA 3HQRA 5JQGB 2PHTA 3PUHA 1GP6A 1UU4A 3LDEA 5I8YA 1RPRA 1MA1A 2YY1A 1T5EA 4XYXA 1RC6A 1OCRB 2E5LO 2ZQMA 2UXCB 2C0ZA 5KX5A 1PK6C 4GB31 5EWSA 4XAEA 1AVBA 1IPJA 2RDQA 2WLPA 1OKQA 5T5PA 3K79A 3ASNC 1JZ3A 3TETA 1V6MA 2EX3A 4JI5B 2XB6C 4JHTA 1BMV2 4D7YA 1DF4A 1KDKA 3B09A 1RMU1 4CYDA 4X64O 4YJ2A 2OT5A 3MO4A 3CMEV 4CXXA 1RYYA 2YC4A 5FXWA 1OA2A 3BOWA 4NKGB 3T2PA 3H3UA 3JBG2 5GTIZ 3APOA 4QNHB 4MO3M 4P9LA 2BVVA 2LUWA 4DINB 2MK3A 1N36O 5FZKA 2VZOA 2YBPA 2QEXV 4TV8B 3UCSC 3WR0A 2DVGA 1MQTC 4H7LA 1AYM2 1S0BA 1N33O 4BW5A 4NHLA 5FZ8A 1GK9A 5IWFA 5DUVA 3LDCA 1KS5A 1YDXA 4X6QB 5H9QA 4TUYB 3VD9A 4ZIBA 1S0CA 3K0DA 1B06A 1G1XB 4YVSB 5C71A 3KT4A 4NTXA 5CMUA 2UU9O 3LB9A 4FMTA 2JG8C 1SLTA 4GULA 3I2OA 1VQ7V 2PLV1 1OCCB 3H0OA 4TV8A 4ZHQB 2BGPA 4UCUA 1BZWA 1L1FA 4NJ4A 1JVMA 4A7KA 5FZIA 4PI0A 4FVVA 1R093 5A1LA 5B66Z 4OX9O 3DXUA 4TUYA 4LF8B 4YGEA 4OXSA 3AVSA 2IUWA 3BAAA 3LSUA 2WPDG 1H4HA 1H1IA 2WIIB 4YVSA 1SLIA 3LSSA 1ULOA 1I94B 1MABG 5JOWA 3WEZA 1W39A 3JD73 3ABMC 1COV3 4IUGA 2P4EA 4ZHQA 2Y6LA 4AFMA 3D0SA 3VKOA 4A42A 4RGKA 2DQ3A 1CAUB 1IVSA 4FQ4A 2ZTNA 3PVBB 4LBNA 4COWA 3CNAA 1XE8A 4AWDA 1AZDA 4ZHNA 1ULFA 4J7ZA 2VOWA 4XXPA 3OSDA 4JDNA 1A34A 3SMHA 1TME2 2ZINA 4NIAA 3LOBA 1YJLA 5FCCA 1ULPA 1GFF2 2ZHKA 2JDAA 4BE3A 4AI8A 1NLSA 4LA3A 4XMAA 3RRDA 4X1YB 4LULA 1CJPA 3AEIA 1ACCA 1JS9A 3HOBA 2K0GA 3WP5A 4MH0E 2K9PA 2QWNB 3RWKX 2I74A 3HQXA 3HNYM 1CAUA 1IPKA 1AL0G 3DSQA 3VBHB 1VMJA 4O2BB 2YMZA 4JC1A 4DR1B 1NVPB 1K8AW 1SG3A 3RG0A 3B94A 3RYFB 2VW2A 2PHUA 1NCQC 4UCRA 3ABLC 1BMFG 1W2TA 3ZFGA 1PMHX 3KV6A 1LOEA 2DCJA 1EM1A 4X1YA 4UCSA 3K51A 1A78A 1V54B 1JUIA 3KQ4B 4CUBA 1ZBA1 2WNVC 4OPAA 4LUMA 5FRAA 4N9IA 3L73H 1KJRA 3LA2A 1SRYA 1G4YB 2W68A 4IV3B 3EFFK 4AI1A 4JI6O 2A70A 3VBHA 4O2BA 5CA0B 2JIZG 4YRDA 3WXPA 4LIUA 4YIOA 4YFWA 2Y8KA 3RYFA 1OD3A 5IK4A 5A32A 5IYDO 1FFXB 1FX5A 1RUD3 4QPGC 1GYKA 1QJU2 3C90A 3ZFEC 3RYKA 3CU7A 1KP3A 1WP8A 5JWPA 1A6CA 4FFGA 3OY8B 4JAAA 4IE5A 1JHJA 1E1RG 1WB8A 2QWOB 4PIZA 2P2KA 1OF3A 3A0KA 3CCSV 2ZX0A 1W0NA 2ZCEA 3MHHC 2DBIA 2BERA 4DV0O 4Y1ZA 3VZOA 4MSWC 3O1TA 4LR3A 1ENQA 4DB5A 3VD4A 4LFCO 4ZXKA 2H0BA 1B3QA 1FFXA 4URTA 3PUQA 2RMU1 2R071 3RDIA 4UV9A 4MT8A 1AJQA 1XI1A 1ENRA 4JGYC 3OY8A 1NAEA 3IPVB 3E2EA 2P6HA 1RUF2 4LJHA 4NWWA 5IT9N 3FE5A 1LTEA 1C4RA 5C8CA 4CDQB 4O4IB 3MLJA 4BHPA 2YSUB 2OT7A 5B3SC 3UKMA 5EQUA 1NY71 5T5OA 4ICGA 3SJAC 3B9CA 4QGLA 4HVQA 4DV6B 3Q8CA 3H3LA 5FZ7A 3WNLA 4KG8A 3QO5A 4HZ3A 2NMOA 1VALA 2HWB3 4XDKA 4MGQA 3PL0A 4RR3C 3IPVA 1XMOB 1MNGA 5CKQA 1WCSA 2V4AA 3PUAA 1CX4A 2OW4A 2VM9A 3CPWU 1GNZA 4CDQA 5FZHA 4C90A 3K5MA 2WWWA 3SPJA 2XL9A 2JGDA 4XF1A 1Y4MA 1VARA 3M2MA 5H6QA 4TTGA 1WA8B 3ES4A 2ZR3A 3GALA 4XE9A 1DIWA 1W59A 4TZDA 3OPWA 3T1CA 4EFBA 4FJCC 2WQ8A 1CQ9A 2ZEXA 3EYPA 5LGTA 2XAHA 3ZSMA 4IEOA 4XPVA 2VY0A 4AR2A 3Q4HB 4LBQD 1VEWA 4KBBA 1IQDC 3B93A 1EUUA 3K0GA 2X5IC 5F2WA 1HV0A 1KQRA 2P3IA 3SYPA 2WLHA 1GU3A 2OQ6A 3SKJE 1BHAA 4JVAA 5H5NA 4CUAA 4I0XB 1WA8A 4DQAA 1FYJA 5F3IA 1VAMA 2R70A 2Y6FA 5DMYA 2XJSA 3AKQA 4A44A 3OPZA 1NZCA 2QQIA 4RWUA 3J8F1 4R52A 4Z1VA 4HMZA 4JGZC 2QDNA 4S2FA 2YROA 2WWJA 5IVYA 1UIKA 5A3UA 4Q4Y2 3MDSA 4RAIA 1GBGA 4QPIC 1PVC1 4IETA 4QX3A 4TQDA 1IG3A 5LP6A 5GLWA 1N3OA 3LDRA 5CFDB 3ASIA 4Q4X1 2XXZA 4BK5A 5ERLA 4WM8B 1VQMV 1BCXA 3RMYA 2YPDA 4NHXA 1VQPV 5FP9A 5B1BB 1J58A 3L9DA 1POV1 1RINA 4LLFA 1AP5A 4R9AA 4UF0A 4FBFA 5F5IA 1XSRA 1RXFA 4BM8A 3STLC 2V1DA 1QCEA 1GMGA 2ARHA 2IM9A 1LNQA 1XNQB 2XHKA 4Q0PA 3WCRA 4GX0A 3D36A 1TQ5A 3EMRA 4AW7A 4HONA 3HVDA 4X1KB 5CFDA 1CONA 1OD5A 5HPOA 3U07A 1XE7A 1RHI1 4YM2A 1N3QA 1XREA 1KECA 4IE6A 5CYYA 1BHBA 3GZEA 1S76D 3PNAA 4E4HA 3ZSJA 3O0WA 3K9SA 2X6CA 1NX9A 4PBPA 4QB6A 5F9TA 4PDWB 4LORA 5A3MA 3F7YC 4IE7A 5C6CA 1AP6A 4DV3O 1W9SA 3IAPA 2AGAA 4JZRA 5A6XA 3WDVA 3E8HA 3C2UA 1ENXA 4ES8A 5DDJ3 2JKBA 4X1KA 3M3CA 3GHMA 1FNYA 3I49A 5G05L 4ARXA 4COYA 3BGAA 4CDXC 1UQXA 2VUJA 2P4KA 3WX5A 2GU9A 3G4SV 1JYWA 4I3GA 1K12A 2J1TA 1RUE1 1DLCA 3VBSB 2GN7A 1JI6A 2ZXWB 4CCCA 5A3TA 4PDWA 1DGSA 2W1UA 3D5OA 3N9NA 3BEHA 1JFFB 3RYHB 1F2NA 3VZNA 5GZEA 3C3VA 4XDPA 4CP9B 2RM21 2R16A 4CCEA 2JS3A 4B1MA 1OVPA 5I0RA 4IL6Z 4QQLA 2GDFA 3T0DA 1OCRC 1A3KA 4PDRA 2E53A 4B4PA 1HXS1 4P9IA 1L0LH 3U10A 1JYTA 2QNKA 2HWC2 3PN1A 2QTWB 4YW4A 2YGMA 5FR3A 1VBD1 2VH9A 1VIBA 2V7QG 1O5LA 5LYJB 3HN1A 4UFLA 2XKOA 2GAUA 4DR7B 1BBT2 5A7NA 3U14A 3VBSA 2DWDC 2CU5A 1OH3A 4CU6A 1FMD1 2EIEA 3RS6A 1JFFA 3RYHA 2P37A 3NJVA 5FYBA 1SQVH 4X65O 4CP9A 3G6EV 4I55B 3C7HA 4FLVA 1CX1A 1DP0A 3D3AA 1ZZCA 1LCLA 1US2A 2JG9B 4GXLA 1CXZB 4JI7B 2ZE6A 1CESA 4CUCA 5AFEA 5LOVB 4DEQA 3BU0A 4QDRA 2KM2A 3PJQA 1KU9A 3VBFB 5BMVB 4CU9A 4I02A 1RUC1 2XAFA 1W6MB 5H9SA 5LYJA 1Y7BA 1GSLA 3RZKA 1WBFA 5FLIA 2UURA 4EV0A 5ACA3 4MVOA 3VDBA 5L7OA 3T09A 4I55A 4NAMA 2Q9LA 1RUH3 3BTYA 5D8AA 2FCVA 3CRMA 3KF3A 4YVSC 1CZTA 2ZT9B 1ZBE1 2BOCC 3GCWA 1HR0O 1C1LA 3K3OA 5T52A 4DV7O 1X9TA 1OCCC 2GH8A 1MVEA 4FT8A 2WSVA 4WVVA 2Y6GA 3R65A 4C1XA 1DGWA 1W6MA 1Y9QA 3RBZA 2J1SA 2ZKLA 2DCKA 3BI3A 3LPGA 4LHLA 1KFUL 3I3BA 2VVDA 1NT2B 1JYIA 1IBKO 1IS3A 5LGNA 3F2ZA 4C0BA 3OMAB 4EEQA 2V5DA 5FPOA 3WQ7A 4YZ3A 4XHBA 3AL5A 1XDCA 4XUTA 2JB8A 2QUOA 5F5CA 4GMP3 1VMFA 3E5QA 5C8YB 1JA8A 4H0LB 2LGWA 1O4YA 1SLCA 2W5FA 3GJAA 1GOGA 3UM7A 2WLIB 1QR8A 4X1IA 4FIPC 4YGBA 2PTMA 4LFBO 3K06A 3AC0A 4BOWA 3AG7A 3NVCA 3AXDA 4DXTA 1RVF2 3Q8FA 3DC6A 3ZXAC 4CS2A 2Q0AA 1LU2A 2DYSB 4DNYA 2VZPA 1X59A 2BW8A 2VZ1A 1PKXA 2F4PA 3H1YA 4FOQA 5FBZA 1GNYA 1GR3A 4KH9A 2RR11 4LBQA 2WLIA 5LBBA 4NPMA 5J48A 5AC91 3TBDA 2ZGRA 2RMKB 1YI2V 2ZA9A 3M4FA 4NTWA 3WB1A 1HDJA 3FKSG 1K4DC 5F3EA 3VBHC 4HT1T 3I3MA 4B3RO 5AFBA 3ACGA 3SR2C 2A06H 3ZN1A 4RGAA 3CJIB 1PGW1 3PTYA 2FD8A 1MEC2 1B6QA 2CDYA 2SLIA 3FL7A 1IXMA 3GDBA 1R3LC 1PPJH 1XU1A 1V54C 3N35A 5JJJB 1SEFA 3M3EA 5KC5A 2ZBJA 1LOGA 4X8NA 1GMMA 1HRV1 5DQ0A 4IV3C 2JXAA 4XFIA 3HNBM 1TUBB 4I0BA 2E7QA 1K4CC 1R082 4N53B 3MIEA 5KA5A 2X09A 1NYWA 3KV4A 1AR83 3J7NA 2RS31 3IMMA 1US6A 1F4MA 1K97A 2I07B 4ARYA 4PJ0Z 1KDMA 4BAYA 1O3RA 1PIV3 1AJPA 1HKDA 1SDDB 3OAAG 1SC5B 3RVHA 2M7WA 3TJTA 4W6XA 5F2SA 2BTOA 1V6JA 2HHHB 4Y5SA 4CCMA 4TSFG 4B7KA 2BV4A 4N53A 3I2HA 2QE7G 5GONA 4DXRA 1JUHA 1W8HA 3ILFA 3I2GA 3TEZA 3T2TA 3CC4V 2RDNA 2WQ4A 3MUZ1 1PO11 1Q90D 2D97A 2E31A 4D8MA 4XF3A 1FFTB 3ZHSA 4DUYB 2P06A 2DCZA 3D6EA 3OJBA 3ZFFB 5BR8B 5L36A 3NV4A 1QOOA 1GQGA 3F5TA 3BRCA 1I08A 3ACHA 4NO4A 2FDIA 4B3TB 4CDQC 2YC0A 4XHXA 4XAAA 5LMNO 2FKXA 3ZOIA 4Z82A 5DEDA 3K59A 4LKDA 4OHXA 2XL7A 4LO7A 5JSPA 4KG0A 4CDWB 5CKMA 2BU9A 2WLQA 1S77D 1HRI1 2ZGUA 2GSMB 3JAMN 5IJ9A 3W5MA 1JMKC 2YI9A 2HWD3 3S7EA 4A4AA 4YHHO 4Q6GA 2BUKA 1URFA 3SCHA 4IGGA 1C1FA 2XOMA 3DTUB 1R64A 3MW3A 4JI1B 1AR71 4FPHA 4CEWB 5B4NA 4UFIA 1I6XA 1ORQC 1KKDA 3DKWA 1AUYA 4BXFA 4JI3B 1NH2D 1VBE1 4X20B 3DEMA 2EIBA 1RUG3 2Z5UA 1O5UA 5CBHA 1XYNA 4LFAB 1QOTA 4ISQA 2AH2A 4AILC 3AFKA 4QJFB 1PO23 3KCCA 3K4DA 5BNPB 2EILC 3E1F1 4W6YA 1DQ4A 1T2XA 1IBMO 2VG9A 3VD5A 4DV1B 1JHNA 1FXZA 1ZAUA 4IE4A 4MGIE 4TQFA 2E63A 4CEWA 1VBB1 5FO7B 1PNMA 4H14A 5A7OA 4KUMA 2Z2SB 1H8TB 1NTZH 5JPNB 2W0FC 3FHQA 3M70A 3VKNA 4RQPB 2W2IA 1GN6A 3OBZA 4G2KA 3A4UA 3A0HZ 3IC7A 4NOTA 5BNPA 3N9MA 2VQUA 4WM7B 4FFBA 4U3FH 2MHFA 1NLQA 1SFPA 2XTAA 4JZGA 1SDWA 2Q67A 4D7TA 5J2TB 2GC0A 4AHWA 1AR93 1AL23 3D36C 3T2QA 1N34O 2NPIA 2B45X 2WS92 2R1DA 4PV1B 1YIJV 1H2GA 1H8TA 1XQ8A 3UKVA 4YM0A 3ZHQA 4WM8C 2K9ZA 3ML0A 1W8FA 1EPWA 2V09A 5A70A 5B1BC 1JYCA 5E88A 4QGMA 1QJX2 5A7SA 1QGLA 5KHJA 4B3SB 1GNHA 3SXWA 1NBMG 2VE1A 5FO8B 3N2GB 2AGSA 2R72A 4GKKO 3ZYHA 1FXHA 3HN3A 3THDA 1X36A 3ZLIA 1XL6A 1AR62 5J2TA 1VP6A 2D3RA 4DY5A 2XVLA 5LA1A 3SPCA 2F4VO 4TWTA 3ZCCA 4MSVA 1ZA4A 4XOGA 1CD3G 4NTYA 4BLIA 3VOUA 4DV5B 2D6LX 4MTOA 3U0ZA 1F23A 1CVNA 3LA7A 2QSAA 3ZR6A 3ETGA 3WLUA 1FOD2 4RHV1 3UGHA 4OCTA 3LFIA 5I0DA 1FPN2 4JDOA 4LEJA 1WAZA 3Q9OA 3T0BA 1TVKA 4FZ0A 3WW3A 2B46X 4IE0A 2RG4A 4EROA 1VQKV 3ME2A 4QAWA 3N2GA 4PA3A 4PDWC 1OVSA 4WVMB 1YFXA 1LOCA 4YZ1A 2XH6A 4O4HB 3K57A 2CHHA 3JCUZ 4WFAV 5CEHA 2GALA 5IVBA 3VQYA 1XE0A 5C70A 2E32A 3DXRB 4K7JA 5FZ4A 2UXCO 1OPOA 4N43C 3P3NA 2H3OA 2EXKA 4TLGA 5TISZ 2G4IA 4XUQA 4R4XA 5J36A 1DF5A 2NP0A 1UZYA 5CA6A 1QQP2 2CTQA 3N36A 5BNNB 2IXLA 3NW4A 4JI5O 3VBSC 2ZXWC 3E6CC 1CPMA 1SMVA 3K9AA 3OFNG 4WVMA 1OZ0A 4JI4B 4IT5A 3EXAA 1YTFD 4BK4A 4M4RA 2IU0A 4N7UA 3RN4A 3A22A 4AOCA 5C7GA 4IEYA 3G7DA 2W6IG 5IDJA 3ZYRA 4BQ2A 2QCSB 3NAPB 2XBO1 1BLZA 5FYZA 4AI3A 1XBLA 2X05A 1BEV3 3GXUA 4GWIA 2P5BA 1AROP 1RGSA 2MEV3 4DOUA 2HYKA 5BNNA 4R8CA 3KSCA 5CIRA 3V0BB 5LK7B 4MGZE 5A2QN 2Y0PA 3B7MA 2AHYA 4NHMA 3P1IA 4GYCB 2A0LA 4AQ6A 4FOWA 1HLCA 5FK8A 1ZBA3 3L2HA 1Y3TA 3H42B 2JG9C 3H7JA 3AK3A 3K4AA 2ODMA 3U1XA 5FZBA 4LE3A 1ENSA 3NAPA 4ZS3A 5CISA 1SQQH 5EPAA 1PMIA 2JE9A 3VBFC 1W9WA 4BQYA 2XJTA 3ZX6A 4GQ7A 1E5HA 3O0VA 4X8PA 1Z2GA 3V0BA 5JAXA 1UL9A 4LF8O 5C93A 2ZGOA 3CMGA 1K3EA 2PF4E 3JARB 2YU1A 1M57B 5LW9A 1L8DA 2VTXA 5LATA 3RYRA 1Q6HA 1I94O 2KQXA 4ZKTB 3FYEB 5T54A 3CO2A 4CP2A 5BPXA 4DO2A 2PY5A 4Q0UA 3K4ZA 2LQTA 3V0AB 3T4ZA 1EV11 2A3QA 5LY2A 1HV1A 3H8XA 1ASJ2 3VDDB 1NH2B 4M3CE 1EAH1 1WCDJ 3Q8EA 2Q8CA 2IXHA 1Z7S2 3JARA 1LOAA 2ADDA 2F23A 4BDVB 3AM2A 3K04A 1ZRDA 5FP4A 3VZMA 2L9LA 3D82A 3UO2A 4FTSA 2XLGA 1MVQA 1QKQA 5FZGA 3A23A 2W91A 3UETA 3SCGA 3HEIA 3V0AA 3MF9A 4J42A 2W1WA 1P49A 4CUGA 4D6RA 4FAHA 2D6OX 5A3LA 3GBWA 3C7EA 2V5YA 1W0OA 1FKAO 5FIXA 3VDDA 4WZFA 2ZIMA 4DR1O 4L99A 2QTSA 3EQEA 5FYTA 1J59A 2DVFA 3O12A 4P9OA 2WFF1 1U0AA 2WA4A 1PL4A 1X50A 4M4PA 4MVUA 2DYSC 5ISLA 5FZMA 1GOFA 1CAXB 4AK3A 4MTXA 4P08A 1WNSA 2ZGNA 2JENA 1DYKA 5FYHA 1OUXA 4LC1A 1ZWIC 3ZPOA 4Q4V3 1EUTA 1WWYA 4CH4A 3OBAA 2QJVA 5FXVA 1OA4A 3FMGA 3SGIA 3IB3A 1K5SA 2JB4A 4NN0A 3CD6V 1DLLA 3J26N 4QDQA 1LHUA 3SNMA 2D43A 3CJIC 2EIDA 2J1VA 3RYIA 1CAXA 1UZVA 2WZR2 3JBG3 4LOSA 1W6NB 1J84A 1H6XA 3FHAA 3P32A 1OXCA 5DUUA 4BH9A 1RUJ1 1R3IC 5CBFA 1AYM3 3KWVA 3LSQA 2WLLB 5H9RA 3AP9A 3DV8A 4N53C 4UXNA 4Q0VA 4GUNA 4P30A 1LOFC 4IEUA 2A6WA 3ABZA 3WP3A 2W1QA 4EWEA 3KV9A 4I09A 2XNDG 4WFBV 1QR9A 2IJJA 4TN7A 5JZGC 4NMIA 5L9RA 2V73A 3V65A 4XABA 3BPZA 1PVC3 2A5ZA 1TNFA 1W6NA 5EYPB 1REDA 5FYMA 4R4ZA 5DDJ2 2R061 4XF4A 2HWE1 2CWMA 1F31A 2BPA2 3URFA 3K03A 1NE4A 2PZSA 1APNA 2AXTZ 1PZ7A 3LOIA 3UJOA 5IK8A 1PM9A 2DUQA 4LBKA 5JCOA 4MYEA 3VBBA 2WLLA 3NJYA 4G4FA 2QKSA 4BQXA 4AEJA 1JX9A 2BTQB 2EJRA 4R7CA 2ZGLA 2CDOA 3X29B 1YFUA 5FJKA 4DV6O 1ND3C 4Q4W2 3IC9A 2ADPA 2JD9A 4YW5A 4N9HA 1XHXA 2E9QA 2EIMB 5B2GB 2C24A 3N7KA 4A3XA 4AI2A 2WO7A 5EYPA 5A3OA 4Q20A 1XMOO 1UWWA 3LDDA 3ZFFC 1YTFB 1OBNA 3W20A 4CDUB 3IIAA 2Y6JA 4COUA 1C8M2 3KB5A 5B4XA 3RWRD 1ZZBA 5F6LB 1MOFA 3WY6A 5JXIA 4J11A 2Z5WA 2XOKG 1L3JA 3O1MA 1OOPB 1UX6A 4XBFA 4DRXB 2GN3A 5E89A 3RZHA 1ZX5A 4CDWC 4MADA 2VZTA 3O1SA 1TME3 2WT2A 3ZBHA 4PDVA 5A7WA 1JH5A 1FXVA 5L3EA 5L9VA 1IXBA 3T4DA 2PHWA 2VNOA 4ET7A 4M00A 2ORZA 5HCAA 1CZVA 3PJYA 4MOAA 2A1XA 4UFMA 4CDUA 3FJSA 2HWF1 3ZYBA 2G38A 1KJLA 5JCTA 4MW3A 1YNAA 1AF9A 5EC1C 4ZPIA 4LBLA 1R3KC 2R1BA 3I2DA 5EHDA 2FZ1A 3RQ0A 4DRXA 3ZXLA 2DCTA 3AKPA 1V9U1 3TN91 4LH7A 4LCUC 2DV9A 1G8WA 5GZCA 3FB7C 1RUF1 3S57A 1G86A 4CC6A 1FJGB 2JE7A 1TEIA 4EN6B 4H55A 2AACA 1VBA1 3LIHA 4GKJB 1K34A 4P00B 2IU3A 1JOBA 1HXS3 1IDSA 4ASUG 1F9KA 1L0NH 1CR7A 5J9PC 4IEWA 3AG2B 2D3PA 3ENRA 1OQDA 4LBJA 3G67A 2VNRA 2WLNA 2OS2A 1H8TC 4M01A 4IIJA 2BOIA 3POGA 4RQPC 1EZJA 3VBOA 5FZOB 1QH7A 3NSTA 1D0HA 2HEWF 5LK5A 3Q8BA 1MSDA 3IFXA 1QJU3 5FMBA 4FTEA 5FPLA 1XYOA 3ZPYA 2OWOA 5LA0A 4FLZA 5IWAB 1ULGA 4MV2A 4WM7C 3WVJA 3RFRA 2G19A 3GVMA 4JRAA 5FOBB 2FBEA 1YQ6A 3C7FA 1PZ8A 1XNQO 3ILRA 1VAVA 1S72V 4BIOA 3THCA 3ES1A 3EB7A 2XVKA 4Y33A 4AE2A 4F6RB 3LGRA 3JYCA 2YIDA 3PJSK 3LAGA 2ET1A 1IS5A 1ZX3A 4LBOA 5DZFA 1RIRA 4LKSA 2GNBA 1FXKB 4EKWA 3KZ4C 2X7RB 2W94A 2ITCC 4JV4A 4XXAA 3O65A 1UPSA 4AHYA 1SZTA 3DYMA 3WW2A 1EN6A 1K5JA 1WZXA 3M7MX 3AG3B 2YYOA 4J80A 4LF7B 2TNFA 2KG7B 1PVXA 4P02B 3FBYA 2VXRA 2WYSA 4UAPA 2UYAA 5IK7A 4B4QA 2P7TC 4I4TB 3TGUH 4F6RA 3CCLV 1IZ3A 3FYIB 3QACA 5FZCA 2RS12 3ASNB 4XJAA 1IURA 2B8MA 3AK2A 3MPBA 5IJ0B 2BOBC 4QPWA 2WAOA 4GX2A 5CA3A 1RSOB 3JAWB 4AL9A 1FXKA 1W6PB 4A2UA 1UZZA 4BISA 4KHPB 1Q8VA 2WYFA 2JWPA 1H30A 1XNRB 1XHZA 2Q6AA 5FZ0A 1YFYA 1MS5A 2HG5C 4BCUA 1LJ7A 3VZJA 2WLKA 2KG7A 1DFQA 1U5ZA 2CUGA 4XFAA 5FUIA 2RQ6A 4P9WA 2B5UA 4QM9A 5FP3A 1MQTB 4I4TA 3R0RA 1K73W 3I7DA 2OA2A 4GA9A 1D2DA 4Q0QA 5JOZA 4CZZA 5IJ0A 5F5QA 2XVGA 3ZYJB 1RSOA 2QQJA 1E5SA 1W6PA 4JKKA 1VE0A 1AR82 1ALYA 1DYOA 2FMDA 3CXCU 4DR7O 4PCRA 2EF6A 1R6KA 4KGQA 2CY6A 3WP4A 1IS6A 3H7YA 4GX5A 3EO6A 3SISA 2HR3A 5L3CA 1ZNPA 3HIFA 3LIGA 3J81N 1GV9A 1C3HA 4ASMB 4ZU7A 4UXAA 3A21A 3WCSA 4WFFA 2ET7A 1ENVA 2WT1A 3MI8A 1N4CA 5I8TA 1GQHA 3K2OA 2VL4A 4NUBA 3CEIA 2QKCA 1MQTA 1GWMA 4JI7O 1K45A 1QH6A 1W8NA 3L72H 2FMYA 2UXNA 2LW7A 2PN5A 1M56C 4LQRA 5HCHA 3D4KA 3K3WA 4CEYB 2JX9A 1YI7A 2DTYA 3OT7A 1I3HA 4W50A 1WLCA 4XCAA 3CKHA 4MVTA 1DZTA 3WU2Z 5JXJA 3AX4A 5M0TA 5J09A 5SV5A 1O8SA 4QB1A 4XDJA 4HK8A 1WLTA 2ZJCA 5FY7A 2CAVA 5KUMA 1GWLA 5CKNA 4Q4Y3 1BGYH 1E57A 1W2OA 2NLJC 1HNZB 4YNIA 1BKZA 4KI5M 4G28B 1HW7A 4RSUA 1DQ1A 4QMAA 1GICA 5L73A 5KWRA 2GH2A 1KC8W 1C57A 2XASA 3B5LB 4E9KA 5LA6B 2RS33 3DGTA 4Q26A 3TK1A 2E7AA 4XIOA 2ARBA 2GTAA 1KQSU 4ES9A 1VLNA 1YIFA 2NYYA 2R9AA 4HL0A 2VOXA 2HWD2 4FPCA 3RMXA 1JW6A 5H6RA 4DV2B 4PELA 1QNMA 1M57C 3NKGA 1F7YA 3KM5A 5CB7A 3LNNA 1WW4A 1LGCA 2A3XA 4FPYA 5I93A 4LP8A 3OUSA 5LHIA 3CRAA 2EBOA 1DZQA 4LWSB 4Z92B 1KUQA 5E79Z 3ZVXA 2QR4A 3UKTA 5LA6A 1GO3F 4XZPA 1VMGA 1GOHA 1XNTA 1VQ6V 1D4M1 2Z4FA 2CNAA 1XNDA 3B40A 3VDDC 4B3MB 1W3XA 4XDLA 4MG2A 2QVSB 4QX1A 1U5YA 2Q73A 1I5XA 1EZVH 1B35B 2W52A 2JDPA 1F4NA 4XFHA 5F6KA 4CU7A 4YG3A 1W8TA 2Y60A 3PMEA 1ODNA 4R6ZA 5CFCB 3S5QA 4GB32 3JAKB 5DZGA 4LWSA 2B42B 3MW2A 3JZVA 2F95B 3AYCA 2I2SA 1QBZA 2DYRB 4QQOA 4Q1PA 5IYBO 1O8PA 3ILNA 3WV6A 2D6PA 1HRI3 3T1YO 4FLUA 4XMIA 5FKBA 3E22B 1DQ0A 1OH4A 3B02A 1V9PA 4U7NA 2VUAA 2OIGA 1B35A 3ABTA 1WW6A 3BHPA 2NLRA 2XHBA 4PHZA 2BDRA 2E26A 5HFLA 4D6SA 3O5SA 4HYOA 5CFCA 5IAXA 1AR92 3JAKA 3AK1A 3WDXA 1UMZA 5FZ3A 2HWC3 5BV6A 2ITDC 3J7AU 4LLOA 5F8PA 1H2NA 2EXHA 1SZXA 3FB8C 1AR4A 4GWJA 2JEXA 1BBT3 1YXWA 2RCVA 3O1PA 3E22A 1M9NA 3ZFEA 1P7BA 3NV1A 3I3DA 4JGYB 3B69A 1JZ6A 2QJ1A 1R1A1 3T4HB 3DXTA 2P3JA 2HLDG 3JASB 2PLV2 2G9FA 2VCAA 1YJWV 1VBB3 5IYZA 2R0HA 1NQJA 1U96A 2HHHO 5B3SB 1RVF1 5KAIZ 1J1TA 3M7AA 5J37A 5K7PA 3CB2A 4YIPA 1AYN1 2A6XA 5KHKA 3NO8A 3JB8A 2QDRA 4FQZA 2JK5C 4JGYA 4KL1A 4XJWA 5KHIA 4RR3B 2Q1MA 3JASA 4PDLA 4DUYO 5DXDA 2F6BA 3USUB 2PGGA 3JD2A 2BYVE 4Q2FA 4Y22A 5T3NA 5JSOA 1COWG 1O3TA 2B5HA 5BR8O 2LS6A 2Q1FA 3AKRA 4XUPA 4AVTA 4IQPA 4Q27A 3GWKC 3ZJZA 2A7WA 4B3TO 1H9WA 4NIDA 1W03A 2DJVA 5FZFA 1VRH3 2A75A 1MEC1 1OFNA 1PMJX 5EXOA 4A7ZA 1LENA 4Y3OA 4HBNA 3B8MA 4MVQA 2B9VA 4H13B 2B9ZA 3LDBA 2QM7A 4RR3A 2JKXA 4ZBMA 2FCUA 2EIMC 4D0QA 4K35A 3USUA 1N0NA 3ETEA 3H9AA 5LASA 3AJZA 3ITQA 1M93A 5BXXA 2EIKB 3WNOA 4OZXA 4JI1O 4QXHA 1BVP1 2JEUA 5A1FA 1DYPA 4CDUC 2ZGMA 3HKCB 2WNUB 4RHV3 3BTXA 1UXXX 4JI3O 1Y4WA 1BEV2 2JDYA 4D7SA 5FUPA 2W1SA 1OOPC 4LFAO 3O0XA 1P84F 2RDSA 3GJBA 4URAA 4F3JA 3ZEDA 1QHDA 1F51A 1O59A 1S5LZ 1GQPA 2PHDA 2P4VA 2PHXA 4QPIB 2QE3A 4DV1O 5FAXA 1XOYA 1ZBA2 5LRSA 1EYBA 3RJRA 3N7LA 2CGNA 3UGGA 1NVPD 3L75H 3HKCA 1YSCA 4K3AA 2D98A 2VUCA 2P34A 3WINE 1V0AA 2UUAB 1J95A 4KMQA 1EY2A 4XQDA 4IERA 1W05A 4O2AA 3RZMA 5FL7G 1MS3A 4YLZA 2JEMA 5D5QA 4CCJA 3OGSA 1W3VA 4DR3B 1C5IA 4QPIA 1Q8IA 2VVFA 4JTCB 1OCOB 5F7UA 4GKXA 3W7UA 4BB3A 3I5DA 2UXXA 2XBO3 2R49A 4D69A 3AG2C 1UIJA 3KCXA 1V00A 4IHJB 2YDEA 1R083 4DYLA 2GP3A 4LK7A 1G9CA 5K1PA 4RUEA 5EFUA 5L3DA 2RMU2 3DPRC 1PHMA 2VGDA 1R6TA 4O9EA 2DN9A 1RXGA 5F3GA 1QF3A 2DBNA 4K1ZA 5AVAA 3QOPA 4Q29A 2WRAA 2N05A 2HJIA 4Q0SA 1O9GA 4X88A 4RUFA 4B3SO 2F66C 1V6LA 4JPRA 1WD3A 3DCQA 1W9TA 3PVNA 4DR4B 4EB6A 3AB0A 4GJZA 2BSKB 3WB0A 5CAZA 2OZJA 1BCCH 1ZZ9A 4HKWA 2DYCA 3TEXA 4YG0A 1DQ5A 5FPZA 3UK9A 4IHJA 4DV5O 4AHXA 1NY72 4UFZA 2Q5ZA 3AMNA 1KB9F 3OGJA 2NR5A 4RGGA 4LF4B 1FXKC 3SH4A 2IXCA 1Z78A 1ZL8B 1W0KG 4E27A 3AG1B 2K1EA 2XAQA 3SPIA 2A7AA 1XJAA 2Y4TA 3OG2A 3CXHF 2V4DA 3H8RA 4A41A 3AG3C 3WB2A 2BFUL 5J96B 2YUAA 3POEA 3I59B 3H1MA 4XF0A 2X6AA 3KVAA 3FZ3A 2HBUA 2YGLA 4IL7A 5F39A 2YXYA 2F43G 3P6BA 4BIFA 1UY3A 3K3NA 5IY5B 4UOJA 1R091 4CDXA 2W6JG 1MS0A 5CZKA 3CSXA 4DXZA 4J1XA 4EN0A 4MS2A 4DR6B 3RVYA 1PZ9A 2P17A 3E86A 3OEAA 1YCIA 4Q4V2 2DTWA 2VZVA 4BA6A 2XR4A 1LODA 3I2FA 1ZL8A 1JCHA 2ZIOA 3AZZA 5F1RA 3F95A 1HX6A 2JJ2G 3JD71 5JQGA 1BVVA 3UT0A 1COV1 4QX8A 2WA3A 1H2SB 3W59A 3PURA 1NLRA 4I5SA 4JI4O 1LRHA 1X8MA 2B9UA 4XW3A 4XUOA 3JATB 4KU7A 4XTMA 1H6YA 3FB6C 1QHTA 1RJ8A 4DFSA 2LM3A 1OMIA 4S2DA 2DVAA 2X8KA 1YHFA 1JZ7A 1WPXA 3OBRA 3MUY1 3S3WA 2A79B 2RE9A 5CA1B 4BLJA 1TMF3 3HPLC 4CTEA 1S0GA 1RP3B 2YBSA 3AJYA 3T0AA 4INDA 5BUVA 4LT5A 3T2MA 1LKNA 2QKDA 2A6ZA 3E89A 4H2AA 5GZDA 3ACIA 2VQAA 1PVC2 4LIVA 3JATA 1FYUA 3CZUA 4E2GA 2VZQA 4HFSA 2WUHA 1HNXB 2DUPA 4CEYC 3BY6A 3AP7A 4L11A 3ZXKA 4JASA 1EP0A 1HNWB 1NE6A 1H8VA 2N04A 3SYAA 1VPHA 1H9PA 4DW0A 3PHMA 2LJ2A 2WN3A 4LBEC 1M4UA 3HBZA 3ZIAG 3ALQA 1I1EA 4HNAB 1JR9A 1W0JG 2CTPA 2QQLA 1LUVA 2KSDA 3WNNA 5EZWA 5FTTC 2FCTA 1H2MA 1QVFU 5ITZB 1RUJ3 2ADQB 4KU8A 2WS93 5FZ1A 1K5QA 3ZDSA 4C0HA 1UY1A 1XL4A 3VQWA 1RUD1 4KQ7A 5LA2A 1VIWB 4M3CB 1QJX3 3NV3A 2IVJA 2CYFA 4YW6A 1F4HA 3GBFA 1URXA 3BPSA 5IVFA 2J1AA 1XXNA 2E51A 4LO5B 4TXWA 2N7GA 4UVBA 3O1RA 1AR63 2HJFC 3MIFA 2G9ZA 2E33A 5ITZA 2HEYF 1KYOF 5JPMB 2YIAA 1BQZA 4JQRA 2VMGA 3ZMOA 1RUI3 1FOD3 2EALA 1RUE2 3ZYFA 4PDMA 1FPN3 2WO2A 5EIBC 1VB2A 4A6SA 2PUSA 4I3PA 4LTAA 4M3CA 1D5NA 4RL7A 2YFZA 2RM22 1X9PA 2JDNA 2DFBA 1B35C 1IGOA 4UFJA 3VV1A 5LHHA 4H7MA 3W21A 1HXS2 3IDBB 1U5XA 3DECA 2F93B 5CFCC 3PVOA 3GM8A 5DG1A 5C9AB 1DGRN 1LECA 3CJHB 5FZAA 4UB6Z 2JDUA 3MLLA 1AXKA 2ZE7A 3ASOB 2DYRC 2ZCWA 1SCRA 1IKQA 2HWB1 4YVWB 1NUKA 1QQP3 1FMD2 5JJEB 2Z0AA 3C3SA 1JOPA 3OUHA 1FAYA 1YWKA 2HVKC 4I7ZB 4QPKA 2P22C 5L3GA 1YFWA 1YIPA 2B39A 2Z42A 1WGPA 5CN0A 3I3EA 1LB2A 4QDSA 2FTKA 1SA0B 2D3SA 4YW2A 4IV3A 1F5FA 1HQWA 2HKXA 2PFWA 3J4UH 3CJHA 3ZSKA 4KWKA 5B1OA 1S1AA 3VKMA
chains in the Genus database with same CATH topology
1RGSA 1VBC3 2MEV3 4E4SA 1DS1A 2IC1A 4DOUA 4JGZB 2HYKA 5BNNA 3J9SA 4N90A 3KSCA 5CIRA 4D3WA 4FP3A 3V0BB 3DPRA 1S2KA 1OHFA 3MIGA 1AYN2 5KHHA 1LHNA 4UW6A 4MGZE 5LK7B 2I45A 3DN7A 1CGPA 3FFQA 3ZFGC 3WD5A 1YRZA 3B7MA 1OFSA 2VMHA 4NHMA 4JRLA 4UW4A 1ZBE2 4FOWA 4AQ6A 1FV3A 2XJUA 2X5IA 1HLCA 2WBQA 5I8SA 1ZBA3 3RYPA 1ZBE3 4ITCA 4P9YA 3L2HA 1Y3TA 2JG9C 1POV0 3H7JA 1QJZA 1NCRA 5LRRA 1VZ4A 4HKLA 1LOBA 4Z2WA 1JXNA 4LE3A 1ENSA 3NAPA 3ST7A 4AEKA 4P9JA 1S2BA 3IDEA 1HQLA 1IOAA 3ZIWA 5KBFA 1PMIA 2JE9A 2DU1A 1A8DA 3VBFC 1JBCA 4FFAA 3LCPA 1D2QA 3POSA 2XJTA 5ABJC 4JGZA 2O8QA 4GQ7A 5IT6A 2WSUA 1OIKA 4YZ4A 3O0VA 5CU1A 4OI4A 4X8PA 4ORFA 1B09A 5JI7A 3TOJA 3V0BA 3VBOC 5JAXA 3HWJA 1ZM1A 1RL3A 1UL9A 1AX1A 2VULA 3FFZA 4META 3GZUC 1UW8A 4HETA 1MEC3 2GNDA 2ZGOA 2IFRA 2DVBA 3PMSA 4OI0A 2OIIA 5E8AA 2Y26A 2CAUA 4Q4Y1 3WHUA 1C8NA 4LBMA 2DVDA 3RJ2X 3M8LA 1FV2A 3RYRA 2W0XA 1Q56A 3KCYA 1ONAA 4WVWA 3BOPA 4ZKTB 5T50A 3KS7A 5T54A 3CO2A 4ZU4A 5EJ3A 4CP2A 1UN1A 5GLTA 3WG2A 4S2HA 4QD2A 4J6GA 5H9PA 1EPZA 4AGGA 5BPXA 1MS8A 2IXIA 4Q0UA 2ZHMA 3IWZA 3V0AB 3TNPB 2ZZQA 4UBHA 1OA3A 4DRRA 1EV11 1W0PA 2SBAA 1HV1A 5GM0A 4AFDA 4B3NA 1HQNA 1ASJ2 5K8SA 3VDDB 4M3CE 1EAH1 1WBLA 4TYSA 1ASJ3 1WCDJ 4Y4YA 2IXHA 1Z7S2 4B7EA 2Z69A 4NPRA 1LOAA 1Q8PA 1V70A 1G9FA 3EJKA 1Z7S3 3AZYA 3AM2A 4MZUA 2WKKA 3H50A 3QCWA 4DMIA 3OBTA 4M26A 1CJDA 1ZRDA 2BVBA 1DGLA 5GKAC 2OZ6A 3GZAA 2GNTA 1DQ6A 1DBNA 3VZMA 3ZXJA 3ZYGA 1SACA 4QQHA 1ZRFA 4RS5C 5T55A 3D82A 4BMEA 4GWMA 2XLGA 1MVQA 4CDXB 4FTSA 1QKQA 1XNBA 5C8CC 4FPOB 2Z79A 3MGUA 3RSJA 5FO9B 3FLPA 4M2FA 1OIIA 3SCGA 3ZN4A 2NMNA 4PJYA 2RR13 4EN7B 5AC92 3V0AA 3POWA 4L9BA 4OI2A 3MF9A 5GLVA 1OQ1A 1DQ2A 4Y1VA 5AC93 4PQ9A 1S0EA 2BNMA 4FAHA 1BK1A 2GMMA 4MGKE 2D6OX 3IM0A 5A3LA 1CAVB 3GBWA 2LTNA 2H6CA 2V5YA 3PLQA 1W0OA 2WNUC 4SLIA 4PIYA 3VDDA 4WZFA 4L99A 4L97A 3M3OA 4TLFA 3EQEA 5E1RA 1J59A 1HIXA 1WLWA 5A33A 1LEDA 1S0JA 2DVFA 5K9YA 3O12A 1HW5A 4RA0A 2BBVA 2PHTA 2WFF1 1U0AA 1MS9A 1PGW2 2NM1A 1OIHA 2WA4A 2VECA 2GC1A 1OTJA 1UU4A 5I8YA 1X50A 5DDJ1 3NWKA 1CN1A 2ZAHA 5LEKA 1CAXB 3NL1A 1A8MA 2YY1A 4XYXA 1RC6A 1MACA 2XJQA 4FPEA 3K48A 4AK3A 2Y0OA 1MR5A 2DCYA 1UU5A 2C0ZA 1PK6C 3WDYA 4GB31 5EWSA 1AVBA 1IPJA 2WLPA 3LWCA 4K40A 1NA1C 4R8HA 2ZGNA 1CAWB 2CGPA 1OKQA 5T5PA 2WQZC 1DHKB 2JENA 1QXJA 3BU7A 1DYKA 4PBOA 4QQ2A 5GLUA 5HCFA 1HRV3 1V6MA 1Y43B 4Q4V3 4CEYA 1CAVA 2UWCA