1YCIA

Factor inhibiting hif-1 alpha in complex with n-(carboxycarbonyl)-d-phenylalanine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
336
Chain Sequence
b'GEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Selective inhibition of factor inhibiting hypoxia-inducible factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 99
structure length 336
sequence length 336
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1yciA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yciA01
1H2NA 1H2KA 2YDEA 4AI8A 1MZEA 4NR1A 1YCIA 2CGOA 1MZFA 3P3NA 4BIOA 3KCXA 3P3PA 4Z1VA 4QU2A 1IZ3A 2Y0IA 2WA4A 3KCYA 3D8CA 1H2LA 5JWPA 2CGNA 4Z2WA 4B7KA 4JAAA 2XUMA 3OD4A 2YC0A 4B7EA 2W0XA 2WA3A 1H2MA 2ILMA
chains in the Genus database with same CATH superfamily
3UKNA 1JZ2A 2P34A 1WMFA 2RM22 1VMGA 3PVBB 4FBFA 5CFDB 4ATFA 3CC4V 2RR11 1JOPA 5F37A 4XDQA 4XQDA 1LHWA 2ZGLA 2VMHA 2R70A 5EYXA 1KECA 1NZIA 4JTOA 3UKMA 4ES8A 5DZEA 3CKHA 3C3SA 4ZHQB 3R66A 1EP0A 1XU2A 4O65A 1OOPB 1UAIA 5JZGB 1Q6UA 4AEDB 4U3JA 3E5UA 3N2GB 3O5SA 3CCVV 4GA9A 1HP8A 1MS5A 4RN5A 5KX5B 3MV11 4W4LA 4O2BB 1GICA 1CJPA 2DVDA 1QOTA 1WAZA 3BIWE 3U4SA 1BJQA 1GFF2 2NZ9A 1VMJA 4QWNA 1L0LH 3I49A 1Q5OA 2GC3A 5FZ7A 5I8TA 5A7QA 1A3KA 4TOIA 4YM0A 4BLJA 4I50A 1XOYA 4CVUA 4WM8C 4Q4Y2 1FPN1 5CNAA 4Y24A 4A44A 4GMP1 3U78A 5IDJA 1O4YA 2Q0OC 4R8CA 3RYKA 2OQ6A 2CDPA 4B3SO 1QU7A 1WP8A 1KB9F 3CDZB 5ERLA 4FPJA 4HN1A 1LEDA 2XDVA 1BQ0A 2M6YA 2WO7A 2XHNA 4P9GA 3GZTB 4JKMA 1ZA7A 4MZUA 4LF4B 4KHPO 1G9FA 1EY2A 2QEXV 3POBA 4TQDA 2F4PA 1F4HA 4PELA 3OBAA 2A75A 3LIHA 3N7KA 3M7AA 3RI8A 3JQXA 2JEUA 3JSNA 3RYIA 4Q0SA 1RINA 1W3XA 3OUHA 1MR5A 4QXHA 3HQRA 1UOFA 3ITQA 4I0WB 2W39A 4FPYA 3GWKC 1WW5A 1IBMB 5FPOA 3WG7C 1PVC1 1HRV2 3RGBA 1JFFB 4BHPA 2ZJCA 2H6BA 3BU7A 1MS0A 3JCIA 1I7FA 1CZTA 5JJNB 3EQEA 3ES4A 1UPGA 1FATA 4E2LA 4PIZA 2N05A 1XHZA 1CPYA 1HRI3 4MXWB 3WCRA 1RVF3 2JE9A 5FY5A 1XHXA 4P02B 4UT5A 1F15A 4LF6O 5CA3A 4N53B 2VQFB 4YGEA 1SQVH 2ES3A 2ZX3A 1PK6C 4QE9A 1PK6A 1GNYA 3IAPA 3K3NA 4QGPA 3FAVA 1H4HA 3CZUA 3ZR6A 1XNAA 4ABMA 3UM7A 2A0LA 1VRH3 3IN9A 2XJUA 3WW2A 1HDJA 2F1MA 4IE0A 5IJRA 5GTHZ 3E8GA 2DYRC 4JI8B 1FNZA 1HNZB 2HWB2 3BB6A 3FWEA 2QQLA 5E8AA 1HX6A 2HWE3 2OXBA 3E6DA 1BZKA 5A3PA 3K3OA 1ZVFA 2CHHA 5F5AA 3FMGA 4LF8O 1MG1A 4NUBA 3CB2A 2HYKA 3DXRA 3UGHA 2R071 2E31A 2GMEA 4DRRA 1GOFA 1OCZB 3VBOB 2FDJA 4LF9O 4CU9A 5L3CA 2D6KA 1LU1A 1OCRC 2RG4A 4MXVA 1AYM1 4YGBA 3KCXA 1PGL2 1RUJ2 5E6HA 1IZ3A 2K46A 1W9YA 1OCCB 5C3QA 1N32B 2EICA 1G9CA 3FLRA 1J59A 4A3XA 1BHAA 3ZIAG 2P22C 4UCTA 3OTFA 4D7SA 2WDBA 3LD8A 4A42A 1W2OA 2JJ6A 3FYEB 4COVA 5TSWA 4FFFA 5KXCA 1QMJA 4PCRA 2JKBA 2UWCA 4P9YA 4I0XB 3WB1A 4MTGA 1JJOA 3ZPOA 1UX6A 1SDDB 3B8NA 4RFRB 1XE8A 4F4LA 1GWLA 4GKKO 4XAEA 1I3HA 5KHJA 3CJIB 1HR0O 5LA1A 1VBE3 2VOTA 2ARHA 1CZSA 1K4DC 4YJ2B 2JGUA 1QHTA 1VBB2 1DQ2A 4BQ3A 1WWYA 3QO8A 3BCWA 4IE6A 1D4VB 4YLZA 2XASA 1NT0A 1AR1B 3ZXKA 2RS31 2CTVA 2E51A 2LP7A 4DV3B 4R50A 5CMUA 2A3YA 2XTAA 1JYNA 4QQ2A 1QKQA 3B8MA 2OCCC 1Z7S2 2V4VA 4GB32 2XBO2 2RJLA 1ZX5A 5FMBA 2Y6FA 1VALA 1C5IA 2O8QA 1V00A 4AK3A 4CPBA 2PZSA 1BHGA 2EIMB 3CE2A 4TSFG 3I2KA 1ZWIC 2HWF1 1ULCA 3KT1A 1N8RW 3VL8A 4IERA 5LBEA 4FO9A 1QU0A 1O5LA 3H0OA 3G6JB 1Q6IA 3VQXA 5EJZB 2ZNJA 4I4TB 3OF1A 4FLTA 5A7SA 1V6LA 1W90A 1A34A 3JASB 1ZZBA 5GJ6A 1IQDC 4XDOA 5ITZB 5J48A 3IMNA 2RJKA 4DEVA 3ZSKA 4RGGA 5KAFZ 4H14A 1NCQC 4I9QA 1NCQA 5C4WC 5C4WA 4K35A 4IYHA 1PZ7A 4IYIA 3RRDA 4JGYB 4X62B 3ABMC 3CMAV 4XJ9A 2VMDA 2ZX0A 3WNKA 1HQWA 3KZ4C 4Y22B 2XAJA 4CA9A 2JG8A 1D2SA 5A6QA 5CA0A 2XHKA 3NNJA 1FOD1 1CAXB 2ZCEA 4B29A 3JSLA 3AXDA 2R9IA 1R64A 1ULGA 4JAAA 2AH2A 3KV5A 1JU3A 3MBWA 3C7OA 1AI4A 2BZDA 1WLTA 3NRUA 1RL3A 3B4SA 2FMLA 4Q0VA 4XXAA 1RMU2 1BMFG 4CCEA 1QNMA 4MVOA 1OI6A 5CADA 4KGGA 1RTVA 4UAPA 1IPKA 3DYOA 3CO2A 1VP7A 2W47A 3JYCA 5EYPB 1HB4A 1GP5A 3GBGA 1ZBA3 1OFSA 4DV5B 1KYOF 4R9AA 4I01A 3BA9A 1MA1A 3I59B 3ZHQA 2BOIA 1TMF2 1QWRA 2Q0AA 1XQ8A 4IIJB 5ABJC 5ABJA 1PO12 4ISRA 2QBXA 3U4XA 4PLMA 3ACLA 3T2TA 4OGQB 4M0NA 2E7AA 1B3QA 4MVQA 4H13B 1KFXL 1LOGA 2ETEA 5L9RA 1JI6A 4KWUA 3WDUA 2YDEA 3DCQA 4Q4W2 1RPRA 1N0JA 3ZXLA 1NZCA 1ASJ2 1QY4A 1QJY3 1YFWA 5BNNB 3VBSB 5DXDA 1TNFA 3FJSA 4RHV3 2IVJA 1YFYA 5FYYA 3M70A 1AR73 4MLOA 3UYJA 4JAUA 4NO4A 1IS6A 3H3UA 2E53A 3ECQA 3H8OA 4MUVA 4J1XA 5FYSA 2IXHA 3H9AA 3ZFEB 2HWC1 2X10A 2VRZA 3LSEA 1U5ZA 4PJYA 4C1WA 4LHLA 4JZGA 2HP8A 1OBNA 4N90A 2EIJC 3IDEA 3I56V 3T1YO 5HCFA 1TVKA 2ZDIC 5JAXA 1UCXA 1FI2A 4EFBA 1ULPA 4IV1B 1K5SA 4D6QA 1ZNPA 1C57A 1KC8W 3L74H 2LQTA 4E2GA 3OTOB 4KMQA 3Q8AA 1JZ4A 3HKBB 2WQ4A 2PFWA 3LPFA 1AR62 3N35A 3M3CA 5AFBA 3MIEA 3K51A 2E76B 1S1AA 1EAH1 4Y1VA 5HFLA 3ATGA 3TK1A 2CAUA 5IJ0B 1UY3A 4FVVA 2LUWA 1WN7A 1OQEA 3ETEA 1IGOA 3LOBA 1RUH2 3GZUC 5FYHA 2X6CA 3EMRA 1XE0A 2WS93 4GWJA 4IEWA 2WSVA 4DV0O 3DGTA 3T1MA 5IY5B 2Q8CA 3WB2A 1RUOA 5LHHA 2CU5A 3H01A 3BALA 3I4IA 1V9U1 5LEJA 1CAWB 4QJFB 3K5LA 3UJOA 1PIV2 5BZBA 5A7PA 5AC93 2A70A 1KJRA 1Y4WA 1URXA 1NH2B 1PV0A 4AVVA 2HJDA 4WFGA 5H5NA 1P49A 2IBZH 3SPCA 3I3DA 4IE7A 3E97A 5CFDC 2YIAA 4X1YB 5FY4A 5CFDA 1S5JA 1JX9A 1K34A 4HOOA 3CEIA 1L1FA 1SQXH 2WNVB 4JYYA 2B42B 4ZHQA 1OOPC 1F31A 3O1RA 2H0BA 4JI7B 5JZGC 1YYNA 5JZGA 2EXHA 4AEDC 4AEDA 2ADEA 1ZREA 4Y33A 3ZXGA 2DQ0A 3ZRWB 3IJ4A 3H7JA 3R0RA 1YO8A 3R4DB 4M4PA 4M3CA 2UU8A 4XBLA 4CU8A 4JI0B 1JR9A 3GBFA 3PUIA 3L75H 3VKOA 4NHXA 4JC1A 2PLV1 4UB8Z 1HJFA 3V0AB 3LSDA 5KHIA 5CFCB 3IKWA 1EYBA 4E4SA 5LZ6A 4NMIA 2WLLA 5F6KA 4OI0A 4ZS2A 1B09A 4UUJC 5IATA 3W7UA 1Q81W 1NBMG 3ZXDA 3M3IA 1ENRA 1UX7A 2ZGUA 3HR9A 2VCCA 4S2HA 1BGYH 2QM4A 4LQRA 3ILFA 1AVBA 1AF9A 1XBFA 2XGXA 3TB0A 2B8MA 5AVPA 3B2EE 5FV3A 2Y0OA 4DR3O 4HMZA 3KVBA 4NPRA 1XL4A 2D3RA 3WNXA 1BCCH 5T5JA 4PIYA 1TE1B 1WCUA 1OF4A 4WBBA 3P1IA 2CTRA 3RYFB 1UYXA 3WP3A 4Z82A 2Y6KA 4OI1A 1TME3 4LBQD 1PNMA 5F3GA 1W6QB 2R9AA 1RUD2 4YWAA 5FZBA 4CUCA 4ZKIA 1ENXA 1R1A2 3L73H 1F2NA 5JWPA 1WZXA 5FKCA 4AE2A 3LSQA 1HN1A 1MS9A 3AXEA 5FJKA 4D6TH 2IH1C 3C2UA 4HKOA 1UPIA 1JFFA 1PGSA 4CDXB 3ABZA 2Z3YA 2QWOB 1WLCA 2ZHKA 2YIBD 1W8ZA 3PJQA 2R043 2V73A 2X05A 2YG0A 2ZHLA 3POJA 5GONA 4UVBA 2OT5A 4CDUA 4N53C 2VULA 2RM21 1MVQA 1R1ZA 2WIIB 3IPVB 3K0GA 1Z5WA 3LA3A 2QTOA 3K57A 1PX4A 1B04A 1LCLA 3IT8A 1VBD2 4DXTA 4JAVA 1SESA 1BQPA 2J1SA 3KT4A 5DM6V 4DEQA 3M8LA 4LO7A 1D5NA 1DZTA 5J37A 2GZWA 2VVFA 5F8PA 2ADPA 1KEXA 1JZ5A 1HRI1 1IDSA 1RVF1 4NOTA 5BPXA 4FM0A 3HPNA 5B1AB 3E83A 4Q2FA 2UUAO 1UOGA 5LK5A 2BTQA 3VN4A 4BQWA 2P90A 1SC5B 4GLXA 1OCZC 4BLIA 3VBOC 3VBOA 4IESA 2QQPA 1X9PA 1VRH1 5DUWA 4NHLA 2YBKA 5FO7B 4JI3O 4E27A 5LHIA 3WUCA 1EZJA 5C3OA 1Y74B 1OCCC 1BBT3 1UZ0A 1KP2A 1N1TA 2I45A 5A33B 3KQ4B 3K9SA 2YIDA 1LEMA 1YSCA 2ZGMA 4V2WA 3VL9A 3O1TA 2WZR2 1CQ9A 2X7RB 4LF5B 3ZMVA 3VZNA 5FWEA 1WB8A 3NNFA 4RL7A 1QQP2 4X20B 3QBQA 2WFF2 1GU3A 4LH6A 4PDWB 2O8OA 3LFMA 3ZHSA 4I0XA 3V56A 4UFZA 3CX5F 1SFNA 3LSSA 4JASA 4IXLA 3BIEA 5IVJA 4X64B 4DW1A 1AXKA 1GZCA 5A3UA 3CJIC 2UYAA 4XF3A 2DTYA 3ZKYA 4BJ0A 4W6XA 2YGMA 1SLCA 4ARYA 2ZMLA 1LGCA 3JD73 4BCUA 1EUTA 2V5DA 4UV9A 4X6RB 3QLQA 3B9IA 1MZFA 4C0BA 4UVCA 3OPWA 5J1XA 5FYCA 4N43B 3ZCCA 2PHFA 5CYYA 4KFMA 3CCJV 1UQXA 4XAAA 4LF6B 4NKGB 1NXMA 1ONAA 2F66C 5I8SA 2EIMC 1Z5VA 4DYLA 2IFWA 2VTXA 4XDKA 2WLIB 3TCUA 1R083 2VMEA 1VBE1 3N7LA 2WC2A 5LOVB 2VVDA 4GCZA 1EZVH 3IAYA 3C7HA 2XJRA 2QJ1A 1HW7A 1UOBA 2ORZA 3FB8C 1YQ2A 2CWMA 1RUG2 3RWKX 1RUC2 3HD8B 1XPWA 1ZLZA 4QQHA 1JHNA 3TNPB 4R9BA 1DFQA 2BTVC 4N7UA 4RD7A 3IM0A 2ZGPA 5CB4B 5JOZA 5F5CA 2NMNA 1LUVA 2QQMA 4PQQA 2GNMA 4NRMA 4YW6A 3VD7A 3RZKA 4M3CF 4YW4A 4LFCB 5JJJB 3U37A 3USSA 5HXVA 2RS13 2W5FA 4UCSA 3D8CA 2HWB1 2OKXA 1XL6A 3INAA 4B7EA 4JGYC 4I09A 1AJNA 4RQFA 3SPHA 1OF3A 1VBA3 4QIWF 3P3PA 4QKNA 2DWEC 2VBPA 5FPLA 1SDWA 5BY5A 2OIEA 1CZVA 3KT7A 5D21A 3T4DA 5A32A 5IWAO 5JI9A 3FX3A 2ZPXA 1OH4A 3KF3A 3BTYA 4Y4YA 5CG8A 3QH7A 2YPJA 2WN3A 3JCZA 1NKDA 4XIKA 4BB3A 1R6KA 1PHMA 1H9WA 1WA6X 4KG8A 4GJYA 4HXCA 3F5WC 1B35A 1XQNA 2ZMKA 2XJVA 5EYPA 5FLIA 3RYHB 2MNGA 1DF0A 1VF6C 4AFBA 1VF6A 3VBUA 3VD5A 3QOPA 3SNMA 4IIJA 1JUIA 2C2AA 3ABKB 4XUPA 3K4DA 3P32A 2B4KA 2ZE7A 4AI8A 1FMD3 4ZOLB 3MO4A 2VH9A 4AW7A 4FPLA 3ZYRA 3WR0A 2DTWA 3DKWA 3UL2A 1QR8A 4J7ZA 3PU3A 4WVZA 1GMMA 1OCOC 3SYAA 4MH0E 5EXOA 2WFPA 5BNNC 4X66O 3VBSC 4GH4A 3GYDA 2QQIA 1VBB1 4NHKA 1N36O 4Y1UA 3TWIA 3AMHA 4DXSA 2ZOEB 2EJ7A 3THDA 4AQYO 1K4CC 5DUXA 3TN92 3RW0A 5L73A 1PNKA 3I3BA 1QIQA 1WCQA 3QD6A 5LHGA 1Z7S1 3VUOA 3MIGA 3AKSA 1P7BA 4W50A 3GALA 2IH3C 4LBMA 1CJDA 2CV6A 4DV2O 2ZKLA 1LHUA 5FAXA 3W21A 4B4PA 3PUQA 3VBFB 4IV1C 4AQTA 4IV1A 4RHV1 1O3QA 3Q8FA 3BVCA 5JMOA 1AR71 1W99A 1RPOA 1ZAUA 2R6QA 2NM1A 4XJ8A 4NIAA 2I07B 2OUHA 4XURA 4BAYA 1LECA 1WUVA 3HKBA 3GVMA 2Q30A 4F6RB 5C3SA 5A70A 1QVGU 2ET1A 1K3IA 5LBBA 2P7TC 5LEKA 5BV6A 4HK9A 3ZHRA 4BXFA 5A9GA 5LYJB 3TJTA 2ZGKA 4D94A 3CRAA 5IJ0A 3I54A 4CBCA 2VPVA 5JMCA 2RDNA 2RMKB 5IT6A 1BZWA 1RB8G 4QGLA 2CGPA 4HKWA 1I5PA 4MOAA 1M4WA 3PU8A 2VOKA 3AZWA 1RM1C 3WW1A 2QQJA 4IGOA 2LALA 5FY8A 5JR2A 3AEIA 2ARXA 4RGKA 3ZMZA 3BN6A 3RMYA 1CAWA 3SJQC 1AXYA 3BTAA 4EWEA 3UT5B 2JXAA 1VQPV 4ONUA 2CH7B 4O4JA 4FFHA 3FLPA 1AZDA 4AHCA 1CAVA 1HXS3 3ZIXA 3O1OA 1X8MA 1K97A 2ZEYA 2ZINA 4PA7A 2BJSA 1GZ9A 2HVKC 3SHRA 2OYQA 1V6NA 3A7QA 1VR3A 1W2BU 1W05A 1YQ6A 5T50A 4CUAA 2WNVC 4K9SA 2WNVA 2ZCWA 3W5MA 1VB2A 1WA8B 4LE4A 3PTYA 3LUTB 2GALA 2BOJA 5IK8A 1O4TA 2QE3A 3DGEA 4K8XA 2Z5UA 3OW2U 2HHHO 2X29A 4H55A 4RQPB 1SFPA 4TT3G 5FCCA 4DIQA 1WBLA 5A3MA 1G8MA 3N7JA 2VC9A 1ZRCA 4EN8B 1SQQH 2C0ZA 4EV0A 1S72V 4Q4W1 4DR4O 4YIPA 3N9NA 2Y4UA 5KHKA 2JGDA 3M99B 3IFXA 2VQUA 1PO23 3ZXEA 4YVWB 3WQ0A 5FR3A 4UCUA 2JDPA 4BQ2A 3G67A 3E6CC 4EN6B 2ZZJA 5HPOA 2WO1A 1YVWA 3KHBA 5CFCC 2DVBA 1ND3B 2YPDA 4IL7A 1SBEA 5KA5A 1OA2A 4E8CA 1COV3 3T1YB 1FAFA 2CUGA 3JATA 1EUUA 3ZSEA 1YTFB 1A78A 2ZGSA 4TLGA 1YUDA 3FLTA 4B3RO 5JXIA 2QZ2A 1FXKB 1NXD1 2J1TA 4IV3A 2DU1A 1W03A 4DPNA 1IBLB 3AK0A 3L72H 4LBJA 4CH4A 2VM9A 3ZSMA 5K1PA 2D5FA 2E26A 5CBLA 3B5LB 3ZYIB 3J8F2 3TNQA 3CS5A 5H9CA 5FUPA 2J1AA 4I30A 1NCRC 3S5AA 1SA0B 1NCRA 1YI2V 1QLNA 1DDLA 4CPBD 4XILA 2Y0PA 2ITCC 1HNXO 3BODA 4Z8BA 1ZBE2 5B1BC 2F95B 4C0HA 4IEZA 4XQWA 5HCAA 2O1QA 2WO2A 2I2SA 5CBGA 4O7XA 2FD8A 4GALA 1GN4A 2E7TA 2VW2A 2VOVA 1LOAA 4P14A 1OD3A 1K45A 5F39A 1L0NH 4ISQA 4COZA 5FZGA 4XMIA 1IBKO 4EN9B 3R05A 4CDXC 4CDXA 2A9HA 2RHPA 2QSAA 3B01A 1BEV3 2YMZA 1OFNA 3PIGA 5A7NA 4QPWA 5IVYA 4DUZO 5GKAC 3A21A 3ZHUA 1PIV1 1YQ5A 2QTWB 3M3OA 1XMOO 3POSA 2WPDG 4DV1B 2F4VO 1CIYA 5B5EZ 2Y69C 3EHKA 3THTA 4FPOB 4CUBA 3IPVA 1W06A 2DN9A 4HNAA 2ADQB 4NAMA 1JPXA 2CYFA 2AW9A 2D40A 1W2TA 1RXGA 4DV4O 1SBFA 3LKJA 1NVPD 4OFGA 3KZIZ 3ZMOA 1K12A 4CTEA 3WF0A 4EN0A 2I74A 2DCYA 1RHI2 1AL0G 5K4LA 3OGCC 3MLKA 3RDIA 1URFA 2RR12 2ETNA 5B1AC 4Y20B 3HKCB 2NLRA 1US6A 3I2DA 2PQQA 1Q86W 4J10A 3K2OA 1UNBA 2UXCB 4YVSB 4YG0A 4META 2FCUA 3OGIB 3LEIA 2UWBA 2KD7A 3O7OA 1VJ2A 4FZ1A 4DS0A 1JN2P 4OVEA 4K8FA 2AHZA 4Y1XA 4XETA 1N47A 4WVMB 4P5YA 2XOMA 4XCAA 2QKSA 2VZUA 4UFHA 5D5PA 2EAAA 3ZFGB 1X59A 2LTNA 3S3WA 5HCHA 4N8MA 3H1IH 1J1LA 3PTRB 4QHBA 2HWD3 1KMIZ 3EFFK 4H0LB 1WLEA 3BEHA 1NS1A 3GZAA 4DR3B 3WP6A 3JBG3 5C7GA 2KG7B 5HFMA 4M0HA 2CTWA 3O1UA 4FLUA 2WQZC 4KNCA 2IJKA 4XDPA 2NN8A 4H7MA 3H50A 4DV7O 4XZUG 4Y1YA 4JYBA 2JS5A 4J6GA 4L8QA 4D3WA 3SC7X 5B4NA 4LE3A 4IEUA 3HKDB 4XUOA 4XDLA 1FPN2 5CISA 5DG2A 2AR6A 2CGNA 3OBZA 3VBHB 4JKLA 1KUQA 1XSRA 5CN0A 1O8SA 1UFIA 1RUD1 3QH6A 3RS6A 4LA2A 2TNFA 4YY3O 2ZIOA 3OE7G 1R1A1 2QQUA 4K6BA 1I5YA 3STZC 4BE3A 4JYAO 1US2A 4A4AA 2DUQA 4W4ZA 2GSMB 3F7VC 4Q8LA 4N43C 3RI9A 4N43A 1SRYA 4ZHNA 2AC1A 4LP8A 5F2SA 5JR7B 5F3CA 4LFBO 4YFWA 3VDDB 4MADA 5JUVA 4HONA 4DR1O 4LK7A 3AM2A 1KQSU 3L9DA 5LRRA 2W1QA 3K58A 4UF0A 2WLIA 2EINC 4RAIA 1AI6A 2VG9A 5LOVA 4WM7B 2X53S 2HKXA 4X6QB 2BRTA 4LO4B 1PVC2 5FO9B 2E74B 3ACGA 1F8VA 3FUQA 5F3EA 1BYHA 1W6NA 3V0BB 4JF3A 1A8DA 1UZZA 2BNMA 2YI8A 1M5IA 1KQRA 3PUSA 5C8CC 5C8CA 3BU0A 3RMXA 4QHZA 4OX9O 1ULDA 1ZX3A 3E22A 5EP9A 1GQGA 4Q0QA 3O9OA 1ND2B 5CB4A 2LS6A 1VBD1 1OVPA 4M4RA 1UZWA 3QO5A 1XU1A 1XJAA 5DEDA 1CIWA 4CZZA 1OLQA 3NAPB 3WV6A 4WFBV 3CLPA 3AKQA 1UU6A 3GJBA 3OUIA 1VQ6V 2FBEA 2YROA 3NJXA 4N9HA 4FZ0A 1UYPA 5KAIZ 1WP7A 1QJU3 1PZ8A 3PUAA 1XNDA 1K5JA 2QQNA 2XQRA 3APQA 2Y4TA 3BTXA 4JI3B 1DQ0A 1Y3TA 2LM3A 4L11A 1OLMA 4QKBA 2QWPB 2WABA 3MZHA 4MVZA 1VF5B 1IG3A 4UW4A 1WMDA 3FX7A 5C8YB 4YGCA 3CSXA 2ZM6B 2XWJB 3BABA 3WNNA 3UO2A 3M1HA 4YGDA 5L36A 3BGAA 4G28B 5A2QN 4LUMA 4LT5A 1L7LA 1JBCA 4AQ6A 4EEQA 1S2KA 2W95A 2R072 4DR7O 3W7SA 3MIFA 3N9PA 2W2IA 4DW0A 1O9HA 3RYHA 1AI7A 2ZTNA 4LF7O 2UUBB 3P5BA 5J2UB 1N1YA 5FREA 5C9AC 5C9AA 3WP4A 4ATEA 4P00B 1AYM2 4JV5O 4MX3A 3ABKC 1GKFA 4AL9A 3JD2A 4M01A 3HJRA 1F23A 4CDQB 2XOKG 1S2BA 4KWLA 3G7DA 3C90A 1RUE3 3K0DA 3UESA 3AP6A 2K9PA 2L9LA 5FP8A 3W7WA 1ZZ7A 2WLHA 4NIIA 1AJPA 4KBBA 4IE5A 1POQA 1R3IC 1YJNV 1YC61 2DJVA 2E6VA 1FFTB 4QQLA 3PLQA 3O14A 1J1TA 1K92A 4BK4A 3VBBA 4DY5A 1JCHA 5GLTA 3ZLIA 2JDIG 2ZE6A 1JODA 1RUF3 2QCSB 1JZ6A 2DFBA 1SCRA 1AL23 5ACA3 1JA8A 2YU2A 5E16A 3ZN6B 1HQNA 4BMBA 1AX1A 4FLVA 3O12A 4HANA 2DCZA 1DGLA 3U14A 4R7CA 2FDHA 5F5QA 1NLQA 2RS32 1W6PB 4JTDB 3C7EA 3WHUA 2BGCA 4FQZA 3W9AA 1VQ5V 1ZL8B 2NLJC 2OTJV 1EN6A 3POFA 4MT8A 1UN1A 1OV9A 1YHQV 1NAEA 2VBBA 4CXWA 3LGRA 1RUC1 4F6RA 4Q4X2 1RUI2 3SYQA 4O4HB 4QXKA 2P3KA 1A32A 2M7WA 4O4IA 4OHXA 3JB8A 4AVTA 5LYJA 4HSJA 4K8RB 4BYYA 3RYCB 4B1LA 2Y64A 1E5IA 1XNTA 1HQLA 3FD9A 1MSWD 4JI5O 1W0PA 3UO3A 1BT8A 3CRMA 2WLMA 3WT3A 4RR3B 4GYCB 1XREA 4RYDA 1UKGA 5JQGA 2NMOA 2R1BA 1IKPA 2Y26A 2ZNIA 1O5UA 2VZTA 1C8M1 2DCJA 4NIGA 2ET7A 4TYSA 4YW1A 1BXHA 2A71A 4KL1A 3OEHG 4L8JA 3KV9A 1KITA 1P8JA 4BIUA 1TVGA 5LP6A 2YY1A 4IT5A 3URFA 2D5HA 3ALQA 1IURA 4KP4A 4TLFA 2UXNA 3ZKUA 3JU9A 1Y76B 2RMU3 4COWA 5CIRA 1QLEB 3DYMA 3N7MA 2UU9O 2ZEXA 3PVOA 3NXSA 3ZYGA 4IETA 4RQPC 4JVAA 5BNOC 4RQPA 5BNOA 4K7JA 3ABUA 4QHOA 4AHXA 3HPLC 3ZXFA 3D5OA 2B7YA 5CVRA 2Y38A 3MUY1 1HXS1 3VOUA 2NN4A 1NI8A 2GDFA 2BBVA 2B39A 2HVJC 3BTZA 4AQYB 1G9DA 3OY8B 4TV9B 2MEV3 4YVWC 2W46A 4YVWA 4XC9A 3RZMA 2D3SA 5CAZA 4ZI7A 4B08A 5FZCA 2A7WA 1P7GA 3M7MX 3S5QA 2BTOA 5LBCA 1YWKA 4HVQA 1ND3C 2P37A 2BGPA 3IC7A 1U5XA 1AR4A 3N2KB 4W65A 2QQWA 1LNSA 3TN91 3CWBH 2VOXA 3OJBA 3H1YA 3CEWA 4B3TO 4DV2B 4QPJA 4CYDA 1QDCA 2FHRA 4UBHA 3LCPA 1H2LA 2XMLA 4E8DA 1UMZA 1K33A 4QXBA 3WZ1A 3CCRV 4TSVA 1W39A 1Q8OA 3L9JT 1JMKC 1FXKC 3R65A 1E79G 2E3CA 1VLNA 3HR0A 3B9CA 2RDQA 4COUA 1CGPA 2P6CA 1PO21 3RZLA 4OCTA 1KD7A 4U3FH 4R9CA 2DMXA 3OYWA 3HB3B 1W8WA 2VQ0A 2UUCB 2G4IA 2JD4A 5FBJA 1SQPH 1RIRA 4I0BA 3JD4A 3SITA 2A3QA 2JX9A 5KXBA 4OHZA 5D1IA 1IS3A 4PBOA 2ODMA 1LOBA 1BE3H 5E1RA 3JD3A 1JQ0A 4QB6A 5EIBD 1L8DA 4WBNB 1FFXA 1ZA4A 4G3YC 4MGZE 2JDZA 1AYN3 3CCLV 4PLOA 1AILA 1V55B 1U96A 1I5ZA 4UXAA 1RJ7A 2VMCA 3AG3B 2QKAA 4XW3A 1EAH2 4JZ2A 4KH9A 5BXZA 5FNVB 1DK1A 1KXGA 2JEXA 2GC0A 2UXXA 2QGNA 2ZGRA 1W8NA 1T6GC 5EFUA 1C28A 1LOFC 1LOFA 5JXJA 4F7ZA 3KGLA 2VY0A 4MS2A 2X0LA 1L3JA 2TUNA 1V9U2 4JI6B 5FMOS 3AMPA 4DOUA 1XB9A 3FZ3A 4FPHA 5FYZA 4MG2A 1YNAA 4EN7B 1OZ0A 4DR4B 3K04A 3DC6A 2HEYF 1BEV1 2NP0A 2EILC 1EPZA 4XFAA 4AVAA 1DP0A 3A2FA 3MV01 5LW9A 4K1YA 3FFZA 1MEC3 2AZ2A 4DR6O 3RJ2X 4GIQA 2Q1ZB 1BSMA 4YVSC 2XJTA 2W1WA 4YVSA 1IS4A 1WW6A 2ZEWA 3A8TA 4ASUG 4FTEA 5FZ1A 3ZIWA 4I55B 3JARB 4WVWA 1AX2A 4HN0A 5CBFA 5KUMA 2EIBA 1WPXA 3ZDVA 2F43G 1I94O 2IZWA 4LR4A 4ZZ8A 5L7OB 4CRQA 4MYEA 3ZFGC 4LOSA 4Q26A 4CU7A 4DUXA 3R6SA 3ZFFB 5M0TA 3VKLA 1BS3A 1JYTA 3T1CA 2PQSA 3ZRSA 5L3FA 1H2SB 2WWUA 4PJ0Z 4MSVA 5EBWC 4LWSB 4EQVA 2KG7A 1AP6A 5HBAA 5FP7A 4YZ1A 2XWBB 4CDWB 1JZ3A 4FOVA 4QNHB 1VF7A 2KSDA 1PVXA 2A7AA 1MS1A 1OKOA 4GMP0 3N36A 1EV13 3O1VA 2GH8A 1Z78A 3OG2A 2MPFA 1S4CA 4JDMA 4J7JA 2JDNA 2YU1A 3HKDA 4Q0PA 4FXGB 4FJCC 3FL7A 2D6OX 4LLFA 5DN2A 4CP9A 4YXWG 4NYKA 3VBHC 2VXJA 3VBHA 3WF3A 1IPJA 4K8ZA 4KG0A 4JTAB 1DF5A 1DBNA 1ZBE1 5D8AC 1VBC1 3NV3A 5D8AA 5FPBA 4GULA 2IW5A 3HBKA 2V5YA 4R4XA 1SPPB 2MK3A 2C26A 3W7XA 1XMOB 3POYA 2B9ZA 3VBRB 4JX0A 1Y66A 4LFAO 2F4VB 3LF7A 1M56B 2BVVA 1AR83 3VDDC 1M06G 2LROA 3WQ1A 3TRSB 2KA3A 1VQ9V 4AOCA 4YRDA 4QGMA 2W08A 1ZZ9A 4WM7C 1YQ8A 4WM7A 5JVDA 5FY1A 3ZVXA 3NV2A 2Z79A 2PY5A 2VWJA 1YI9A 2YUEA 1VQOV 5EBLC 4QB1A 3ACFA 2VNGA 4FOYA 1S77D 1JYIA 2QQVA 2QFEA 3HWJA 5JH7A 1VB4A 5A6XA 4CP2A 2OVUA 1ND2C 1YXBA 4WZFA 2L6LA 4HAMA 1W8HA 2XUMA 3OGGA 4J7KA 3QG5A 1HV1A 3I3QA 3NAPC 4Q27A 5BYNA 1RHI1 1YZBA 3VD4A 4LHSA 3JD0A 1MQTB 4LBQB 1GM7A 3I2FA 2E63A 4BPZA 3K75B 3PMSA 5GLUA 2QE7G 4DXWA 4IEXA 4I7ZB 4YZ3A 3Q8CA 3CJHB 4YZ5A 2FDIA 4O61A 4CEWB 1W9SA 2E5LB 1GZWB 2Q7EA 1YXWA 2D2CB 2VTFA 5LA6B 1LGNA 1PM7A 2CSGA 5C8YA 3X2QB 1VQMV 4R9DA 1QJEA 5T52A 4A45A 1HRI2 4C7UA 1RVF2 3N27A 1FV2A 4EYUA 1VQNV 1N1SA 3LDKA 3ZBHA 3W58A 1U5IA 1QXJA 1APNA 4LNUB 4J42A 2BPA2 3PDQA 3AL6A 1BL8A 3FN9A 5FUNA 1IHMA 3SLIA 4AG4A 3NKTA 1KD1W 1QJU1 1VRH2 1TZOA 2IFRA 1AR93 2XHBA 3O1MA 4QPIB 1HDKA 3VD9A 3J7HA 2RS53 3KV4A 2QWRB 2IUWA 4CDQC 3ZN0A 4CDQA 1ENQA 3ACHA 4DV6B 5LGUA 1GN2A 3J7MA 3ASOC 1NJIW 1MZ6A 1WBFA 5A7WB 3Q4HA 3GZEA 2D43A 1C3HA 2HWE2 4CS4A 1MS8A 4QE7A 4AILC 3IZOA 4WM8A 4JQRA 1TAEA 2UY8A 2WRAA 2Y60A 3V64A 4QAWA 1U12A 2P4KA 1AI5A 4LR3A 4JI2B 2GNBA 2ITDC 4IGQA 4AI9A 2ZX1A 1NYWA 2J22A 5IJ9A 5A3NA 1HWYA 4LK6A 4LITA 1JYWA 2DWDC 1LOCA 2OZJA 2V09A 2VZVA 2C24A 3DL3A 1G7YA 1WCDJ 1JJ2U 1GP4A 4H33A 4LFBB 1AHSA 1R093 1K5MB 2AEYA 2WWSA 1Q8SA 2PXJA 5JLVA 4NTWA 4EB6B 2D6LX 3OGJA 1YCIA 4DR2B 3T30A 3D3AA 4ASKA 1RUE1 4XUNA 2IXLA 4FSJA 3EXAA 2F93B 1LR5A 1HN0A 2W0XA 1F5JA 5JCTA 4JZRA 1ULEA 4OX9B 3I55V 5GLWA 5T5LA 1COWG 3OMAB 1NQDA 4B3NA 3H7YA 5EYYA 3WNLA 4BQ1A 3FUOA 5F2WA 3I5DA 4P9IA 2ID4A 4FTSA 1RUF1 3H1WA 4AI1A 1W59A 3WF1A 1I9RA 1MVEA 1D4M3 4BDVB 2CDOA 4PDRA 1FXZA 1VBE2 3RFRA 4DY3A 1WPBA 3SJBC 4MGIE 2WO3A 2R30A 3RYCA 2V72A 2VCMA 2O0OA 3WINE 1Q8IA 4MGTA 5B1NA 5L3DA 4MGQA 4UFLA 2YFUA 4X1IB 3ZYBA 3ZN5A 4N23A 4TXWA 4BIFA 4NVPA 3N3HA 4RR3C 5FDBA 4RR3A 5JDBA 3A23A 4ZONA 2KR2A 5GZDA 3KS7A 1PMJX 2FMYA 5EPAA 1VARA 2H94A 3AL5A 3WX5A 1PNFA 4NRPA 1UF2C 5F7UA 2OPWA 2Z42A 5JOYA 1MABG 5FYMA 3PN1A 1JU4A 3ORJA 2OPKA 1WJZA 4X8AA 4CS2A 4JV5B 2XQXA 5FPRA 5LBFA 3G4SV 3E2EA 3HKEB 3CXCU 2V4DA 3NVCA 5FZ3A 3OB8A 1MS4A 2YB7A 3ILNA 5FYBA 1A8MA 1IBMO 2ERFA 3SXWA 2BUKA 5JSOA 1M57B 4H44B 3WG4A 3WUDA 4KWJA 1X7NA 2PHLA 2P06A 3AJZA 2ZKNA 1O3RA 1PMHX 2JE8A 4DO2A 1MPXA 3MHHC 1XI1A 2XVLA 1AJOA 4HBNA 5LA9A 1E5HA 2DWRA 1VP6A 2F4LA 3OY8A 3SYPA 2F17A 4X8NA 2EF6A 1J84A 2RMU1 1SZTA 3SJCC 1ENSA 2VQFO 2HEWF 4E9KA 4YJ3A 3KM5A 1REDA 1OUSA 2GMPA 3CJXA 1VQ4V 4NAOA 1NE6A 4NROA 3MPBA 3CRCA 4QQOA 3AZXA 5L3BA 3KWVA 4GKXA 3S7IA 4NXNB 1FPN3 2DYCA 1H38A 4GMP3 5G04L 3T4VA 3H1MA 4P5HA 2Z4FA 2DE0X 5FRAA 1SFYA 4JDOA 1W2NA 1RYYA 3ZXJA 5T54A 3I2JA 3KSCA 3WVJA 3ETPA 3S6PA 4CH3A 5FQ0B 3AVRA 1KDMA 2ENRA 2VU9A 4Q4X1 1RUI1 1QJX3 1QJY2 3L2YA 3KQRA 4YNIA 4I50B 2G9GA 3VZMA 3B00A 3F7YC 4RUFA 4RHV2 4TQFA 1S0FA 4D7YA 1POV3 1AR72 2GN7A 2FTKA 1N33B 3PJYA 3SKVA 4MVMA 4XF0A 4YW5A 1EN4A 5CB7A 3M8AA 1V55C 4ZU7A 1ROPA 1UJWB 3B02A 2RDSA 2HH9A 4S2GA 3AG3C 4EZ4A 1G4YB 5AVAA 4J41A 4ZKTB 2AREA 5EJ3A 1VE0A 5FNVA 2WAAA 4TV8A 2ZIMA 3APBA 4UXNA 1UIJA 3RYIB 4H37A 1AP5A 2WUHA 2VQTA 4MVRA 1T6BX 2CL2A 2P4EA 5IE9A 3DEMA 1DLBA 3VDBA 2PYJA 3ABLB 3LSUA 3OUJA 3H1HH 2BFUL 3M2MA 1K7DA 3WG7B 3JALB 3PIJA 4EFEA 5LK7B 4D69A 1KS4A 1W6OB 3VHOA 5FJHA 4V2VA 2VO5A 3CCEV 1OHFA 1WLDA 4NWWA 4XYXA 4DV3O 2VZRA 3QTCA 1G6NA 1J95A 3K46A 5FZ8A 2ZE5A 1N3QA 2QA4V 2QM8A 4J25A 1VQ8V 4JQTA 2UXBO 1O9GA 3BPSA 3AMMA 2VZ3A 2W68A 2JDAA 1KS5A 2A1XA 4G2KA 2WS92 5BNPB 5LMUB 3T4ZA 4MGYE 4CCCA 1N3PA 3ZN1A 3JARA 2QJVA 4HZ3A 5KMGB 4B3TB 5I0DA 3U11A 1AJQA 4LKDA 5G05L 1ENVA 2JE7A 5AC92 3CU7A 1AYM3 4Y5TA 2WJSA 3AX4A 4DR5B 3I97A 4ZY9A 4CEYC 4CEYA 3POEA 1XE7A 5IFPA 1WLWA 4BZ4A 3ZFFC 3ZFFA 4X1KB 2W92A 2FDFA 5A3OA 1Q8QA 3AP9A 1H8VA 4G27B 1UPSA 2C1FA 3BOWA 3ICXA 4OQ8A 4LWSA 1TUEB 2JDKA 2V7QG 4XFGA 1OPOA 4LBOA 4X62O 5FK7A 4CDWC 3FC0A 2R0FA 4YM2A 2XJQA 1D5AA 2DCKA 2FDGA 3EXUA 1FXHA 1ZRFA 3CXHF 4QPYA 4FFKA 2RN9A 3J7AU 2TEPA 1NLSA 2OX0A 5FKBA 4YW2A 2Y0IA 4X8PA 3VQWA 4HETA 3O65A 1SS3A 4AI3A 1CPMA 2ZDIA 3LWCA 5T5PA 3PMEA 1EN5A 1VAVA 1KKCA 4OZOA 5BXXA 3K5MA 1ZSPA 2WLPA 4FM2A 1Q3EA 2VOWA 3U0ZA 5JJEB 4GKJO 1SACA 5IWFA 1ZRDA 5IK4A 5L3EA 1VMFA 2JENA 3CMGA 3IB3A 2B9VA 2YEVB 4DV5O 1SPPA 2WNOA 3B40A 5A3TA 1GNZA 5IYBO 3VBRC 3VBRA 5FPAA 4PDVA 1VIBA 2W6JG 2X8KA 1R3JC 3HEIA 2ARCA 4K3AA 4FAHA 3KB5A 4G4FA 1BK0A 2VVEA 4XEZA 4P9LA 2PTMA 1M1KW 1VQKV 2HWF3 1KDKA 1L7QA 4CU6A 4BMEA 2XH6A 5A6ZA 1AUYA 2GUZA 2DBIA 1VAKA 1PP9H 3LA7A 2YV8A 1FD9A 1QDOA 2G1MA 4UI9L 4Q20A 4AAXA 2XAFA 3AKTA 3LDRA 1BMV2 1PM9A 2Q1MA 2XKOA 3TEXA 2KB1A 4QM8A 3GHNA 4M3CE 4PLNA 3GB7C 2VS0A 1TME2 2VJXA 4XF4A 4DR6B 1AR81 3MIDA 5C93A 1MQTC 3HMYA 4E4ZA 4LBQA 4FFBB 5IK5A 4BIZA 4FMTA 4LMFA 2IJIA 4L9BA 4CXYA 3WXPA 3QO7A 3HNMA 1NY71 2GDSA 1SLBA 1NTZH 1V9PA 4NPMA 2RCVA 4AYUA 4UVAA 3CJHA 3E1F1 2XJPA 4R4ZA 1XNRO 2XL9A 1OOPA 5FZ9A 3K5OA 1FOD3 1NE4A 1GZWA 4W6WA 5F3IA 4O2AB 5APAA 2ZT9B 1SQFA 5LA6A 2R042 3X2QC 3HT2A 3CC7V 5K1XA 4ZU4A 3OTOO 2JECA 2Q8VA 4E4EA 4X88A 3N2GA 3G71V 5BR8B 4BW5A 4PBPA 2GSYA 4ARXA 3A0RA 2VW1A 5KX5A 4HG6B 4MO3M 4QKFA 4A7KA 5LY1A 5K9YA 4ZZ5A 5FLXN 4O2BA 4K3UA 3F5TA 4H3WA 2WAMA 5BNQA 1GO3F 3NL1A 4AQSA 4Y5SA 3ZX6A 1W8TA 2CAVA 2QKDA 4QPIC 3H8XA 2JG8B 4QPIA 3I8TA 1U97A 1M4UA 5FPVA 2OZ6A 1NVPB 2H6CA 3PVEA 3WDXA 4B3MO 5A7WA 1OKQA 3GWOA 1MZ5A 4QDRA 5DZGA 4KQ7A 3EHBB 2D93A 3NR7A 4L2NA 3L71H 3TEWA 4FTBA 4NTXA 2Y6GA 4C8DA 2AENA 2OQ7A 2P17A 3LDDA 1QNWA 2EIGA 1SERA 1QHDA 3K08A 3HVDA 1YDXA 4WV8A 4LFAB 3J7NA 1XXNA 5CA6A 2JIJA 5GW7A 1LUWA 2HWC3 3SCGA 3WW4A 1SF9A 2A06H 4EB6A 1BBT2 1FS0G 2IXCA 4QKDA 1QJFA 3A0HZ 4OYUA 2E9QA 2VR4A 2QR4A 1HNWB 3WQBA 3HQXA 5KBFA 2BP6A 4YW3A 4XCBA 4QX8A 1UKRA 1G9BA 1DU3D 2ZMNA 2PHUA 2VZSA 3ZMTA 1QCEA 5TISZ 3KGZA 1Z0HA 1G86A 3DTUB 1R091 2PYLA 1ZZCA 4GUNA 4N21A 2WQ8A 1W9TA 1SG3A 1HB3A 3AB0A 3LEKA 5EK0A 1ZM1A 3WW3A 5AFEA 3OD4A 5B1OA 4LIUA 4ZXEA 4MXWA 3OAAG 5CBHA 1SEFA 2YHJA 3ML0A 3JD72 3MIBA 2JB4A 3OGSA 3WNMA 5I0UA 3VHPA 1GOGA 3ETDA 2DOSA 2EIJB 3T2QA 4N53A 5EC2C 5DZFA 2SBAA 5F1RA 2YUAA 1VQLV 1Y9MA 1EPWA 4AI2A 1NU1H 1RSOB 1YIFA 4X1IA 3SR2C 4XBQA 1GK9A 3VHRA 3THPA 4FXKB 1MMMA 2WZ8A 1YLLA 2XXZA 4MW3A 5LL6Y 2D97A 2D3PA 4AHWA 1EBOA 1QBZA 5JVVA 4PDLA 2ZGOA 3JAWB 1R082 4IEPA 2ILMA 4UBGA 2BOCC 4RA0A 4MVSA 1DZQA 1RUNA 2NNUA 1H0BA 3EYPA 2YI9A 2KXLA 1WMXA 5CU1A 5A1FA 2YXYA 1J3PA 1DTOA 2A6ZA 1WW7A 1GQPA 3CPWU 3BYWA 1UU4A 2ORXA 3OOXA 5K8SA 2ADDA 4AR2A 1V6JA 2H3OA 3LNNA 3TYJA 3NNLA 5IYYA 2IJJA 3UGFA 5FZLA 1QQCA 3KVAA 1CPNA 3ZSLA 1W28A 5ANNA 2C5DA 3AKPA 2R063 4P9PA 2RS12 2G19A 1DQ4A 4B3SB 1GTOA 4J80A 4BK5A 3ZR5A 3RNSA 3H3ZA 2HWE1 5JXHA 4YG6A 1XNKA 3DSQA 4KHPB 1VBA2 1FPOA 2EULA 4Q29A 4QM9A 3CCMV 2C9AA 3OEBA 1QXRA 4MVUA 2K1EA 2PLV3 3NW4A 1IKQA 4Q4V3 2DW4A 4A2UA 1UMIA 4RSUA 1OD5A 5H2FZ 5CEHA 2CNAA 4MTXA 4PHZA 2Y8KA 4P9JA 1E1QG 4XHBA 1BVVA 3CJIA 5DAXA 4YJ2A 5ISLA 2Q4SA 3W20A 4GZ9A 5JPMB 4M3CB 4QX2A 5J7MA 2EIKB 5LXTB 2B1IA 1J83A 5L3GA 1SQ4A 3U07A 3AVSA 5IYZB 2DVAA 3FB7C 1ORQC 2BERA 1YITV 3R4UA 5LATA 3K4AA 3QACA 4JI1O 1I5XA 1S3JA 1OA4A 2Q9LA 1FMD2 1S0CA 3RZHA 5FZHA 5FQ0A 1NR7A 5HI0A 2PAKA 4ZBMA 1C5HA 2WLLB 3IDBB 2BE3A 5FZIA 2BOBC 5DMYA 4ORFA 3KHCA 2ZE8A 5DDJ3 2BNNA 1I0HA 4LH7A 1DYKA 2YICA 2XAGA 2XPJA 4D0QA 4F3JA 4UWDA 3FHAA 4I4TA 3VV1A 3ZO0B 3JASA 4UCVA 4LF5O 3VGIA 1UXXX 4HT1T 5ITZA 3ASNB 2XT9A 2ZGTA 1HJGA 2BGOA 2X09A 4LF8B 1PGW1 2LW8A 1QJX1 4V1PA 1N34O 1ZRRA 5FZMA 1GKBA 1U5YA 4FIPC 4JGYA 3B7MA 4LF9B 2RM23 4X64O 4ASMB 1EFRG 1POV1 1V6OA 3ABLC 5KLVH 1S0JA 2GAUA 4FPGA 1Y4MA 3ABTA 5H6RA 2HJFC 2N7GA 1B6QA 4Y22A 1C8M2 4FPPA 5DUUA 4OI4A 2YXLA 2RDRA 4INDA 3JALA 3SPGA 4Q8KA 2Q8EA 5FZDA 1W6OA 1CAXA 4IHJB 4LA3A 3OBTA 3WY6A 1DYOA 5FZ4A 3SH5A 4YPJA 4GX2A 1JHJA 4BQ5A 2X6AA 2B5HA 2Q8OA 5IAVA 4GWMA 4BR6A 4QX7A 1FJGO 3B77A 5K0UB 3AMNA 4EROA 5GONB 2W9XA 3OM3B 5LGNA 5I8YA 2QNKA 4X65O 2GN3A 4OUSA 3B94A 5H9RA 1UZVA 4CDUB 1XYNA 4Y26A 2Q7HA 1IVSA 5BNPC 2WR9A 4DRXB 5BNPA 4Z2AA 4CS3A 3I59A 2RJZA 2DCTA 2WBKA 2FDKA 2A6WA 3J26N 5KMGA 3AMQA 4GKKB 3T4HB 1HR0B 4ZIBA 2ZBJA 3SPJA 2AACA 2LRPA 1BK1A 3AK2A 1LOEA 2VQAA 5LB6A 1HXS2 1JZ7A 1WKYA 4COYA 4YIOA 5J2TB 4X1KA 5BNNA 1UY4A 2JDUA 3VBSA 2OIIA 4AXOA 4Q4Y3 2BTQB 4LFCO 1ZBA1 1YJLA 4PA4A 4XFHA 2PA7A 4A41A 1F7YA 1Q6HA 2ZGQA 1CEZA 3ZFEC 3TEZA 4R52A 2HEVF 3ZFEA 3E89A 3G80A 2WWJA 4WCEV 3UQ8A 5E1AC 3DXTA 5JPNB 1YIJV 4RQEA 3NQHA 1H8EG 3J81N 3WG1A 3BHPA 1DGWX 1QJY1 4CC6A 4B4QA 1PO22 3FHQA 1O7FA 4Y4RA 1V70A 4XJWA 5EBMC 4GT1A 2LW1A 1Y7BA 2AHYA 1LENA 2LJ2A 1I1EA 2GP3A 3S3XA 4LKFA 5IYCO 3RVYA 4GZRB 4Q6GA 3LEGA 4EWAA 2YEVA 1HRV3 5FXZA 1COV2 3NWKA 3WNOA 3RZJA 5DAPA 1LHNA 2AXTZ 3LEMA 3I2HA 2CWSA 2W0FC 3DECA 2E7QA 4WFAV 3MF9A 1N1VA 2VECA 4QDQA 1X8EA 2W87A 1SQGA 3E6BA 2LFSA 3MD0A 2HEPA 1YFUA 3K77A 4XDJA 3D36C 1F35A 2BCCH 1US3A 3D36A 5IY5C 1XRUA 2WLNA 4K0KO 1UXZA 1BVP1 4DRVA 3H1KH 3J7LA 4AGVA 3MPPG 2ZX2A 4NE9A 2EXKA 1D2DA 3FE5A 2UXBB 1VEWA 3ZSJA 3NSTA 4AFAA 3WG3A 3RZGA 5JSPA 1CX1A 5B3SB 5FFOC 2HWB3 1GYKA 1DIWA 4FFBA 4X1YA 2LGQA 1ZZ6A 2D7FA 3ZRXA 3D3QA 1BLZA 2OW4A 1IXMA 3OEEG 5EHDA 2YGLA 2MHFA 5GM0A 1KBHA 3UT0A 2JICA 2FB5A 3RJRA 2WS91 2VUCA 4D6SA 4LO6B 4FT8A 2ZQMA 1IQAA 2YYOA 2PHXA 3POIA 5FZAA 4O2AA 1BEV2 4KI5M 2JWPA 5A7OA 4DZGA 5AC91 3FKSG 3ZRWA 1RUJ3 5D2AA 1REFA 4R8HA 3DPRB 3ROUA 5ANQA 3NO8A 2WL1A 4Q1RA 5BMVB 1ULOA 4UW5A 3T2PA 2Z69A 1YF2A 1XNQO 3VKFC 4FLZA 2ZHNA 4IEQA 1MSDA 2G38A 2JKXA 1UIKA 2JG8C 3V0AA 5CFCA 4UFIA 3A0KA 4OHVA 4P9WA 3D3IA 1Q43A 4E2SA 3KKYA 1WMEA 5FL7G 2VBDA 5J3UA 5A32B 4L97A 4FPFA 4LC1A 3RWNA 2VGDA 4URAA 1I08A 3IAQA 4KWKA 1D0GA 3K48A 4GKJB 1TUBB 1G8WA 1B35B 4URTA 1NA1B 1VBB3 5E79Z 4J9YB 2JK5C 1BKZA 1DQ1A 3ETGA 2AUYA 3BI3A 2V4AA 5SV5A 3VBUB 4RO2A 3ACIA 1SETA 4QX3A 2O14A 1KP3A 4QX5A 1JTZX 1MS3A 1YIPA 1Z7S3 4GB33 4YFZA 2Z0AA 3CCQV 2BNOA 3RYFA 2PI4A 1QEXA 2XBO3 2HWD2 5KHGA 3O1PA 5HV4A 5IT9N 1PNGA 5DQ0A 1VBC2 1W6QA 4IE4A 1OCOB 2FZ2A 1X33A 4XUQA 4LBNA 3JBG2 4DV0B 3B69A 4GH4B 3GBWA 4OMCA 4HKLA 1DGRA 2R7EB 1GNHA 5SV8A 1P4RA 2BQPA 3NNMA 4HVRA 3OT7A 2EAKA 4HL0A 5LY2A 4LTAA 3SYCA 4XABA 1UO9A 2WT1A 4FOQA 4JHTA 1DZRA 5KC6A 1M93A 1BMV1 2UXDO 3VZJA 4DUYO 5IW0A 1GSLA 3EJKA 1TME1 2WAOA 1AR5A 2EBOA 5IUQA 5FOBB 3DV8A 4I9WA 1H4GA 3K5NA 1OQ1A 2Y33A 1SZXA 1JH5A 1XNRB 4MSWC 4P9OA 2YBSA 1RSOA 2JG9B 4AZZA 3KMHA 5FIXA 1HV0A 5DAWA 2DURA 4QU1A 1XSQA 3GHMA 4EJRA 1JYCA 1XYOA 1RITA 1IBLO 2CTQA 1HB2A 2Y6LA 2HR3A 3I2OA 3TAYA 5GZGA 3DF0A 5JOWA 4FVMA 3JAWA 1Y6XA 1DLLA 2R041 3RT3C 4UV8A 3MIHA 1UY1A 4ZU5A 2WNEA 1RMU3 4FPCA 3RG0A 2NQYA 3A0NA 2YZ4A 3AP4A 2FMDA 1S2EA 5FYVA 1OQDA 1SLLA 1WD4A 5EIYB 2H8PC 4CC5A 4B3MB 4HVOA 3THCA 1KU9A 3SDLA 1RM1B 1TMF3 1CXZB 1QNYA 2ZGNA 1RXFA 2P6JA 2EVXA 1NTKH 4QD2A 5CKNA 1PO13 1Q8PA 4CUGA 5FOJB 3OEAA 1Y74A 1MNGA 2XL7A 1QXPA 3TXSA 5A33A 4O4JB 1STMA 3TEYA 1PZ9A 5IHRA 3PHMA 5EZYB 1CAVB 5IVBA 1QVFU 3HNBM 4Q4W3 5LASA 1LKNA 3Q8BA 3VDCA 1ASJ3 1QJU2 1X9TA 1N3OA 3RVHA 4YARA 3VZKA 4BIOA 3ZN4A 4FLWA 4PT6A 4DV1O 1SBDA 3D0SA 3CRRA 4X20A 4PDWC 4PDWA 4D7TA 4GX0A 1F4MA 2X5IB 1TGOA 4NHMA 1AROP 3NV4A 1WA4A 2R061 4NIHA 2Q67A 1OUXA 4DXRA 1BBT1 1W3VA 5FPXA 1IG0A 2HBUA 1WCSA 3WF4A 2W94A 5J9PC 5A1AA 2EIKC 1XILA 1ZRIA 5LXTA 4K40A 2IVIB 5LA2A 2JGDB 2CGOA 5IYZA 4IGPA 1FKAO 3FYIB 1QH7A 3D4KA 5FXVA 5J36A 4IL6Z 3CF6E 2DUOA 1JMUB 4WF9V 4Q4V1 2PHTA 2WA3A 3PVNA 2UXCO 4DUVA 3GCXA 4PA9A 1H8TB 1G9AA 4PD4F 2V1DA 4MHRA 3JB4C 3C3TA 1RUE2 2WINB 2ARAA 1AR63 3CZJA 1F4AA 3JATB 5LCWL 4QPGB 3E86A 2VWKA 4CZSA 1WW4A 1RFYA 5E88A 3JD71 4IEVA 1GM8A 3IC9A 2EZOA 2Q69A 3LNMB 1JZ8A 1OLME 1RUH3 2HG5C 3E5XA 4IV3B 1RUF2 3UKVA 5T55A 3TGUH 1S0DA 2UURA 4HPKB 2VD7A 4YZ4A 2W1UA 4JV4A 3ASNC 4IEOA 1AL22 3ZMSA 2IXIA 2J1EA 5ACA2 5J98B 4UYBA 2D6PA 2XAQA 2UUAB 1LULA 1NCRB 3JXSA 4FK5C 1PIV3 2P5OA 1BQZA 4AWDA 1R081 4JGZB 1KRIA 3OCPA 5B1BB 4I3GA 5EJ1B 4XPVA 4I2OA 5DDJ1 5JXGA 3WDVA 4QT6A 2WWWA 3UV9A 4JPRA 4BA6A 3RZZA 2OT7A 3CC2V 4GX1A 4FOWA 2ZA9A 4N7IA 4A7ZA 4QMAA 4IHJA 1XNCA 3RYRA 2N74A 1FAYA 2P67A 3LFIA 4XF9A 2ZX4A 2NYYA 5JIUA 2XB6C 5K0UC 5K0UA 3JAMN 4AFDA 2RS11 1LESA 4WVVA 2VE1A 2JJ1G 4CDUC 1OT5A 4UB6Z 4AEMA 1UYZA 4AEJA 2Y69B 5LWBA 1ODMA 2UYBA 1GBGA 2GC1A 2WZEA 4XQ4A 4DRXA 2A6VA 4PQ9A 1GMGA 3LZZA 1VBA1 3MICA 4HNAB 5FZFA 3RBZA 5L19A 4MGKE 3E8BA 3AG7A 2D44A 3NMBA 1W2UA 4DFSA 3HAGA 5F5IA 3PJSK 1W9FA 4ZOLA 1YFXA 3ZOIA 3MI8A 3RQ0A 2EXJA 3P6BA 2DBNA 4OQ9A 2P1BA 4NWVA 3B93A 1UYYA 5J2TA 4NIDA 5IFTA 3E8HA 1PX3A 1X50A 4IQPA 2GP5A 4JI1B 4BXSV 1S76D 3OMIB 5C8WA 1T5EA 2RMU2 1N0NA 1K9MW 1K8AW 4XXPA 2Q6AA 4E4DX 3WNPA 2GTAA 2IC1A 1CX4A 4TUYB 1Q7YW 4XACA 4JDNA 4EWDA 1FMD1 3GXUA 3OD0A 4GWNA 2Y6JA 3SMHA 1DG6A 3SCFA 3HQUA 3JD1A 1NUKA 4QPKA 4U36A 4H7LA 3QNEA 3T08A 3BVOA 4IW3A 4AVBA 4DK0A 4CP1A 3LDEA 2C6SA 2ZM6O 2MEV2 1OXCA 4OPHA 3NJYA 3VBFC 1V0AA 4S2FA 4Q4Y1 3VBFA 2R9RB 2GV9A 1RUD3 4RFT0 3TXQA 2D6MA 1H30A 1ULFA 3PURA 3T1LA 1GOHA 1CR7A 1R1A3 1H2KA 4MTFA 1YHFA 3LE0A 3H8UA 3ILRA 2UUBO 5FZOB 2ZEZA 5CKMA 1N34B 1AX0A 2FCVA 4D8MA 4XJUA 1SLAA 2PI5A 2VCAA 3IDCB 4Y5Z0 1LHVA 1RJ8A 1LAJA 3WQ7A 3H9VA 3AG2B 1OLRA 4LBEC 2BV4A 4GWIA 5A80A 3T0DA 1Y9QA 2ARBA 2ZXWB 4LHNA 1NT2B 4M00A 2GHYA 5IWAB 3FBYA 4XJAA 2ZAHA 3VHNA 5E89A 1FJGB 1H1MA 4OHWA 1HRV1 4CSWA 1HB1A 1K5QA 2OA2A 2XG3A 1VBD3 2Y6HA 3J4UH 5A1LA 3UT5A 4X65B 2CH7A 4QQPA 2A5ZA 5GTIZ 4AI0A 5EC1C 5B3SC 2Z2SB 1RGSA 2MW2B 2VMGA 4UF0B 4DO0A 1YJWV 4A6SA 4EZHA 2EINB 2P6HA 5B4XA 1S0VA 2P2KA 4TZDA 5A6YA 1NZ6A 2PUSA 1AYN2 2EXIA 5EIBC 4W6YA 1W6NB 3I2IA 1WA8A 1W9WA 4WZCA 2RV9A 3AYEA 5C8CB 5F9TA 4QB2A 5FUIA 5FMDA 3E22B 2ZXQA 3CD6V 4K21A 3HIFA 3UK9A 4PI2A 1H2GA 1W8UA 4O9GA 3Q9OA 3M3QA 5LGTA 4X66B 1MZEA 5JCOC 4QXCA 5JCOA 2QWNB 3AJYA 2A79B 3DPRC 1N36B 4GX5A 3DPRA 2AYHA 1Q8VA 2Q4PA 2VUJA 5BMVA 3MEPA 2QZ3A 3SJAC 3H1LH 3OBRA 3C3VA 2WZR3 1GH6A 2QDNA 4JRAA 2PELA 3U1XA 2E75B 2W91A 4SBVA 1HW5A 4DK1A 2DF7A 3I3MA 4RS5B 3O0XA 1OMIA 1QQP3 2WFF3 1SHWB 3SH3A 1ND3A 5IK7A 2ZR2A 2VZPA 1QR9A 3VKNA 3ZHVA 2OIGA 4AGGA 4ET7A 4ASLA 1PGL1 1RUJ1 3N9QA 1C1FA 1MEC2 2JDMA 4YM1A 1KKDA 3UKTA 1T2XA 4BWAA 4OZXA 5GZFA 3J80N 2VTXJ 1TUBA 2VQEO 1B35C 1NA1C 5FP3A 1NA1A 1C4RA 3WHTA 1FXKA 1H6YA 5CG9A 3RVZA 4YG3A 4DUWA 3X29B 3EBRA 2ZS6B 3ASIA 2AZ5A 3I7DA 5C9AB 3VBUC 3N9MA 4JHZA 2OYZA 4OPAA 1TEIA 5FP9A 3ES1A 5LMNO 4I0AA 2JJ2G 3ZXAC 1PNLA 1CAUB 4XBNA 2LGWA 3GGLA 1G6UA 1SA0A 1COV1 2VZ1A 3T0AA 3BY6A 3AZZA 3HBZA 1OA3A 2DDUA 3T1HO 4PI0A 4XTMA 3RYPA 5EZWA 1W8OA 2YSUB 4BU2A 5I0TA 1PL4A 2J1VA 3N9OA 4GH4C 2L35A 3ZJZA 4K0KB 1K3EA 2GBOA 5FZKA 1AJKA 1W0OA 2XONA 4KUMA 2RQ6A 4AF9A 3FB5C 3VQYA 5DPNA 3USUB 1JYVA 1KGYA 1EV12 1J5EO 3WDWA 1LRHA 1ODNA 2WLQA 1RUG3 1RUC3 3DN7A 3RSJA 5JOXA 4P08A 4GD4A 2FKXA 3WCSA 4GB31 3GCWA 3I2GA 1O3TA 1REEA 2XBO1 1FXVA 1PL0A 2JDYA 4ICGA 2FZ1A 2ZR3A 3AG1B 4WFEA 2NR5A 1PM4A 3U10A 4K20A 5JIAA 4KU7A 1UWWA 4GKYA 4A6OA 4B4RA 2VNRA 4NXMO 1S5LZ 3C8XA 5LBQA 4LO5B 4X9QA 1R6NA 2JG9C 4L87A 2JG9A 2DVFA 2HHHB 1R6TA 5KWRA 4OULA 2F23A 1W0NA 3G6EV 1H2MA 5FYTA 3H3LA 3DYPA 5FYUA 1C8M3 3MHZA 1AR82 5FK8A 1DGSA 4B8EA 2RE9A 3IDAA 2JRIA 2DU0A 1GP6A 1GUIA 2QDRA 3AP5A 4LEJA 2LFRA 2YC0A 4O4IB 2UUCO 1DLCA 4YSFA 2KM2A 3K03A 4Y20A 3HKCA 1NY72 3TETA 4HK8A 2KKWA 1XNQB 2W52A 1R1BA 2JIZG 2BEOA 4B1MA 1XBLA 3CNAA 3SQOA 4JTCB 5GLZA 1IS5A 1JOBA 4EKWA 3K59A 1S0BA 5JQGB 5BUVA 1TG7A 3S7EA 4WVMA 2SLIA 1BHBA 3C7GA 1QH6A 4J1WA 1XOUA 4UFKA 4UW3A 2VMIA 2GNDA 3ZFGA 4B3RB 1JW6A 4MGSA 3WSOA 5EZYA 2UY9A 2BVBA 3BCCH 5B2GB 1DF4A 3W59A 1RMU1 1OC1A 1H9PA 4IGGA 4TTGA 5LP6B 3HNYM 4JYCA 1N4CA 4C1XA 3OMNB 2VAUA 3UGGA 4MHUA 3C7FA 3O1SA 2WKKA 1SLIA 4EE2A 1TMF1 2X5IC 1W6MB 2X5IA 2EZPA 5KA6A 2N04A 1HNXB 1S0EA 4FFGA 3TN93 3BRCA 1PO11 5BNOB 1W0KG 4JI6O 4TWTA 3ZEDA 1OJHA 2J42A 3DUIA 2X6BA 1NR1A 4LO8A 1JUHA 1LNQA 2BBAA 3OGRA 2HWD1 1TQ5A 3T2MA 2J1UA 1ASJ1 1IBKB 3MUZ1 3IBMA 4PIXA 1AR92 1LU2A 4RUEA 3AKRA 3JBG1 3AG4B 4OLLA 4QGNA 2P4VA 5J09A 4ZI7B 1DYPA 3T3YA 2RS52 3E8FA 2UXDB 4DUZB 4DUYB 1O59A 3AK1A 3M3EA 2QQKA 3N4MA 2XUEA 1X36A 1YJ9V 1H8TC 4AGRA 1H8TA 4XVHA 2OCHA 3ON7A 1YQCA 4UOJA 1YI7A 4Z92B 3HT1A 4I3PA 5FXWA 2VCBA 4LKSA 1FX5A 2ZABA 3VDDA 2B1GA 1UU5A 4F83A 3APOA 1H1AA 4J11A 3NNGA 2B5UA 5IVVA 1IOAA 4QPGC 4QPGA 2OTLV 3DKQA 4WFHA 3IIAA 4CP0A 4DV4B 1QGLA 2YFZA 2PGGA 3W7TA 4PV1B 4XBFA 4BWOA 4XFBA 3V0BA 4XFFA 4IV3C 3LAGA 1R092 3SYOA 2A6XA 3GDBA 5FLHA 4W4KA 4HPKA 1OSGA 4H2AA 4LIVA 4MW8A 3OYWB 3K79A 2IU0A 1O91A 5GLVA 3K9AA 4XMAA 2WZPP 1V6KA 1ND2A 1OH3A 4L92A 2A6YA 3AFGA 4JCKA 4F6EA 1V54B 4LJHA 2P3IA 3BAAA 3D6EA 1AR61 1W2AX 2BW8A 1NH2D 1S5HC 3WB0A 3NAPA 3POGA 4FP2A 3HN1A 1SCSA 1OPMA 1X4TA 1ALYA 4JGZC 4XIOA 4JGZA 3UETA 3LQCA 2R72A 3IIIA 4UFMA 1GAXA 4LKEA 4S2DA 1RUH1 1FFXB 3SEEA 1J58A 5AG2A 4LNVA 5C3RA 2IXKA 4U2AA 2JD9A 4UCOA 2WA4A 1D4M2 1TNRA 2JB8A 1UD1A 1WGPA 4Z2WA 3MFAA 4YHHO 4XFCA 1UOJA 4J9ZB 4MVTA 3TBDA 1O6UA 5H6QA 5FY9A 3MDPA 1L7RA 1XMQO 4NJ4A 1VIWB 3F95A 3RWRD 1I6XA 3VDAA 2PAEA 2XLAA 4JI4O 4DV7B 2WNUB 1DHKB 1K73W 4XOGA 3NV1A 1YEWA 5HV0A 1P84F 5J2UA 2RNBA 3OPTA 1Y43B 3JAKB 5L9VA 3MFCA 3AYCA 2A73B 4AAPA 3HN3A 3AYAA 3ZMNA 3CQOA 3OSDA 2KQXA 2BSKB 4TWKA 5C5TA 3EO6A 3POWA 4RWUA 2D6NA 2GNTA 1HLCA 1F5FA 2PHDA 4KGQA 4JRLA 1Y9GA 2QQOA 4CCOA 3MW2A 4DNYA 3SEPA 2PHWA 4OI2A 2EILB 5EV7A 4P2ZA 3MDSA 2H0VA 4LHKA 5KR7A 4YY3B 1THZA 3AP7A 1SQBH 3ZYFA 4IUGA 3G6BA 2O57A 3STLC 3VB9A 4JYAB 3T0BA 4NR1A 5DG1A 3P30A 3F2ZA 1C1LA 3THOA 4I5SA 2D3OW 1LHOA 3VD3A 2RJ2A 3V65A 3LOIA 2VL4A 1CN1A 5CA1B 4DR1B 4RGAA 4FI9A 4TUYA 4CCKA 3ZMUA 3WEZA 5H9PA 1GLHA 3J8F3 1DGRN 5I91A 1G1XB 3ZN6A 5FYIA 5DAVA 2HJIA 2E5LO 2IM9A 2BYVE 3WLUA 4BM8A 4Q0UA 3MAQA 3ZYJB 2VXRA 1CWPA 1W6PA 2E32A 2YXSA 1ZBE3 1VBC3 4XUTA 3LPGA 4K1ZA 5CZKA 1ZL8A 3WFVA 1KFUL 1PD3A 2W3JA 4MV2A 1JOYA 3T2OA 3AZVA 4CCJA 1J3QA 2WSUA 2PMWB 1OHHG 3MLJA 1FNYA 4AHZA 3BPZA 5DABA 5FZOA 5FZEA 4LXLA 4AHYA 4O4HA 3O0WA 5KXEA 1VQ7V 3ZYHA 1JOJA 4AFCA 3UJQA 3BKZA 4CCLA 3U75A 1ACCA 1AL21 5ACA1 4FPKA 4CP9B 3AG2C 2C4XA 3CMEV 4DV6O 2Y48A 3UNPA 2QDOA 4FAGA 4Z07A 5H9QA 4R6ZA 4ITCA 4DB5A 5CKQA 2ZXWC 2FCTA 3QCWA 5D8AB 1V6IA 2CE4A 1UMHA 5FMCA 3SGIA 4O4LB 3WF2A 2PN5A 1DGWA 2QVSB 2W1SA 2QM7A 4JI2O 4NTYA 3OUSA 2JIGA 4JGSA 2Q1FA 1GWMA 4AVSA 4XHXA 4FLYA 1YJKA 3UCSC 3DC5A 1PGW2 1QJX2 4LF4O 4DR7B 2XLFA 1GN3A 1KJLA 1GZTA 1AXZA 3MW3A 2VNVA 1Z2GA 2Q8DA 2A3WA 1RHI3 4LF7B 3ZRVA 3IWZA 3OUFA 2WT2A 4FCAA 4NRQA 3VZLA 3GJAA 2DYSB 1NKGA 2RR13 2UWAA 1H2NA 5JVDB 4LULA 4DR2O 2VW0A 1ZZ8A 4GAZA 1UL9A 1IX9A 1LB2A 4BQXA 4E4HA 1VAMA 2OS2A 1CONA 1Y76A 4Q1PA 2XAHA 1QF3A 1QLEC 5JH7B 2Q68A 4ZXKA 4FPEA 1W0JG 3FBMA 4N9IA 3H1JH 3OPZA 2XNDG 2QTSA 2R16A 1MACA 2YC2A 3CP1A 5FBZA 1SKVA 2W6IG 4E2QA 4QDSA 1UZYA 4OHYA 4FM1A 3SPIA 1VPHA 1SLTA 3MF6A 3FFQA 2AEZA 3OFNG 4CCNA 4HFSA 2DFCA 5BY1A 5LA0A 2QUOA 2K9ZA 2J7MA 4TV9A 3EB7A 3MYXA 1DQ5A 3J9SA 1ZYBA 3IMMA 4RS5C 4RS5A 4LLOA 3WDTA 2ATFA 3N2KA 3PNAA 5H9SA 2ZHMA 4U3JB 3ZPYA 5JI7A 2HLDG 4L0PA 4CCMA 3CCUV 1S0IA 2PYTA 2ATKC 4JI8O 4KU8A 2IJHA 1LJ7A 1ZBA2 1HNZO 4F8AA 4YZ2A 3ST7A 2XJSA 1GN6A 1Y67A 1Q56A 4SLIA 5IVCA 2MEV1 5FY0A 2WZR1 4OUMA 1O4ZA 1DQ6A 1ZUQA 2A3XA 4LCUC 1QQP1 2WFF1 1NTMH 1CAUA 3SH4A 1JVMA 3NJVA 3VZOA 2B45X 3W5NA 4XE9A 2XLGA 3ASOB 3MGUA 4PF5A 3HOBA 3Q4HB 3VQVA 1LGBA 4LBLA 4XZPA 3LB9A 2AZ0A 5IYDO 4JI5B 5DECA 4WM8B 4NHYA 2FL4A 3SKJE 4DQAA 2DVGA 3R4SA 5C71A 5DAQA 1NLRA 1N32O 3FHIB 1XEQA 5IJ9B 4B7KA 3JQWA 4WBNA 1CP9A 2GU9A 1PVC3 3USUA 1Q90D 1E1RG 1WD3A 3B3QE 3OR6C 3SCHA 3ZDSA 5KC5A 2HFEC 2D98A 5A3WA 3KCYA 4UCRA 3GM8A 4HLTA 1SZBA 2R1DA 3VLBB 3AG1C 2Y34A 4FP3A 2XKPA 3S0MA 5DN6G 1CESA 4OUEA 4UW6A 4A5UB 2WT0A 1IXBA 2WLJA 1IPSA 1UY2A 2YC4A 2XVGA 2UU9B 3H8RA 4NXNO 3QF7A 2CAZC 3MLLA 1AYN1 2PAMA 4XF1A 3K4ZA 3A4UA 3JZVA 5F32A 3BOPA 5F6LB 1RUG1 2GTSA 4A7YA 5FZ0A 4Z1MG 2Q7GA 1SMVA 3NKGA 3ZX7A 1GQHA 2HWF2 2VZOA 3SISA 1CD3G 3KF5A 4LUKA 4Q5OA 3LDBA 1D0HA 3KLSA 4QU2A 3S57A 2GH2A 4BH9A 1RP3B 1RC6A 2R073 1PK6B 2VUAA 5F2VO 3FAVB 3AK3A 4I55A 1XDCA 1PPJH 4KBZA 3ZYPA 4XJZA 4YM3A 2P3YA 1N33O 3CIHA 1JS9A 2DYRB 5L7OC 5L7OA 3MHSC 4PDMA 1MOFA 5GZEA 4X89A 2CDYA 2P3JA 1JXNA 3AFKA 2VQEB 1GR3A 4YYOA 1H8HG 4XTPA 2Z5WA 4FQ4A 3JUUA 3VKMA 1FYJA 3CRQA 3LA2A 1MEC1 3A22A 4I02A 2R49A 3ETQA 5LP6C 5L9BA 5J96B 3DXRB 5GZCA 2DV9A 5LMNB 4BOWA 3GNEA 2ZD9A 2ZKOA 1FOD2 4CDWA 1W8FA 2WN2A 1R3KC 2JS3A 1GANA 3L70H 5IAXA 2P5BA 1W6MA 1OCRB 3T1HB 2CY6A 3KD4A 2PHRA 4CH6A 5FO8B 2K2SA 2HLEA 3M4FA 1WCKA 1EM1A 4AFMA 1VRBA 2AGAA 3QVNA 1AB3A 2R32A 2ZACA 4NB5A 1CVNA 5FZ6A 1J5EB 1OURA 2RS33 1E5RA 2WYSA 3AG4C 5FY7A 2ZZQA 2EA7A 5FMOL 4GJZA 2BFUS 2LO1A 4XFIA 2E33A 4YJ3B 5LMUO 2BDRA 1WNSA 2YXHA 1EV11 3IGAC 1M56C 4AEKA 3ZHTA 3MW4A 2BU9A 4Q4X3 1RUI3 3P3NA 4Z1VA 4NXMB 1M90W 3KG2A 1VMHA 3ENRA 3L2HA 4DR5O 4JKKA 4A3ZA 4G9SB 1NQJA 5KHHA 4WFFA 2IWGB 1F9KA 2F6BA 4IEYA 3A0BZ 2XVKA 3D82A 4HYOA 2JEMA 2HWC2 2RDCA 1QOSA 4HZFA 2BWAA 4KXRA 3OGVA 4C91A 2OCCB 2YBPA 5C33A 1NG0A 1K42A 1UY0A 1V54C 4ZS3A 1MQTA 4AVCA 2K0GA 5I0SA 4W8JA 2WYFA 2EALA 1XYPA 3RN4A 5EWSA 2RVAA 1GV9A 1Q82W 1I94B 1A6CA 1PMIA 4CEWC 4LBKA 1GRJA 4CEWA 1BCXA 4LOTA 5HCBA 1C8NA 1JYXA 4PA6A 1DCSA 2VUDA 4U7NA 2YIBA 3CHXA 1O3SA 4DMIA 4L99A 1NCQB 4TV8B 4ZPIA 2Q73A 2TBVA 5C4WB 1PKXA 2JVDA 3LIGA 4PA3A 4LNUA 3WG2A 3WP5A 4D6RA 2WNUC 4U7OA 2WNUA 3N9LA 3WD5A 1AVMA 4JTNA 5LRSA 2G9ZA 2HYXA 3FB6C 4IDZA 3ABMB 2Q5TA 4P9XA 1V6MA 3DXUA 3JAKA 1ST8A 4MTOA 3WDYA 5CA0B 4P30A 3CCSV 1S0GA 1LTEA 2BSKA 2FQPA 3E5QA 2FYUH 5FP4A 5B66Z 1XC6A 2EX3A 1FYUA 4DINB 3CYOA 5A3LA 2DQ3A 2JDHA 3KCCA 2GC2A 5FWJA 3ME2A 4PF1A 1YTFD 3Q8EA 2YS8A 4LORA 5I93A 1F51A 4OXSA 3T09A 3WU2Z 2EIDA 5FLJA 5C70A 4GQ7A 2CTPA 1NOVA 5T5OA 1AR91 5I0RA 4DXZA 3CBNA 3AYDA 1K5MC 5CA1A 1K5MA 4HSLA 5ABJB 3PUHA 5FPZA 3PL0A 2R062 4Y1ZA 5KXDA 3BA8A 2RS51 4GXLA 3OR7C 2R0HA 4CEYB 1HIXA 4JI7O 5FPUA 1S55A 3WOGA 5C6CA 5GALA 5DUVA 3RPQA 3ELNA 5IVFA 4LPLA 1QJZA 1NQTA 2VNOA 1YRZA 2PLV2 1R3LC 5FTTC 1D7PM 5BR8O 5FXXA 1O8PA 4Q4V2 3AC0A 1GM9A 4CH5A 2PF4E 4JI0O 1NX9A 3EVKA 2B9UA 3CL1A 1D2QA 5JSRA 1H6XA 2IXJA 1OVSA 2AGSA 1FV3A 5KUKA 3NJZA 1B06A 4YW7A 5T3NA 2DUPA 4NPLA 1M9NA 2HBTA 4NN0A 3J8F1 1EAH3 3BFRA 1E5SA 4CE8A 3K06A 2OWOA 1LR1A 4Y3OA 1LODA 4BQ4A 1TVKB 4UFJA 1X82A 1QOOA 3ZS8C 2HKOA 4OMDA 4C90A 2CK3G 3GF6A 4O4LA 4AQ2A 4TN7A 4YHHB 3ZM8A 3D0JA 4ES9A 2G9FA 2ZAAA 3JCUZ 3S30A 4QX1A 3O0VA 2EIEA 4FLXA 2GMMA 1V9U3 2BWCA 2OUJA 1POV0 1D4M1 3K3WA 1XMQB 1J3RA 1W04A 3H42B 3KV6A 2QKCA 4JI4B 5C5UA 4QX0A 1TA8A 2EJRA 2J1RA 2LW7A 3TOJA 2VMFA 5DDJ2 1FT9A 1XNBA 1U0AA 2DYSC 4CCDA 4BW9A 4O9EA 2WLKA 5C3PA 2WSSG 5IVEA 1WB7A 2XR4A 3AZYA 1R73A 4BISA 3BUCA 2GUZB 1UW8A 4CXXA 1HNWO 3HKEA 2VZQA 2IU3A 1GWKA 4BQYA 5EQUA 3B09A 3E35A 2Q5ZA 2C9KA 1F4NA 5HXMA 1E57A 1XUQA 1H1IA 3LDCA 1ZTEA 4FFIA 3I3EA 5K7PA 1M57C 2QWQB 1HKDA 2NPIA 5D5QA 2B46X
chains in the Genus database with same CATH topology
1R1A3 1H2KA 3UKNA 1YHFA 3AK0A 2P34A 1G6NA 1WMFA 2RM22 4LBJA 3PVBB 4FBFA 1N3QA 3ZSMA 3H8UA 5CFDB 3ILRA 2D5FA 4ATFA 5CBLA 2RR11 3AMMA 1AX0A 3B5LB 3J8F2 3ZYIB 3TNQA 2W68A 4XJUA 4XDQA 4XQDA 1SLAA 1LHWA 1KS5A 2WS92 2ZGLA 4I30A 2VMHA 5BNPB 1NCRC 4MGYE 1NCRA 5EYXA 1DDLA 3IDCB 4Y5Z0 1LHVA 1RJ8A 4M2GA 4JTOA 1N3PA 3WQ7A 4XILA 4ES8A 2QJVA 5DZEA 1EP0A 1OLRA 3BODA 4Z8BA 1ZBE2 1XU2A 3U11A 1OOPB 1UAIA 2JE7A 5AC92 3CU7A 1AYM3 5JZGB 4C0HA 1Y9QA 2ARBA 4IEZA 2WJSA 4XQWA 5HCAA 4LHNA 2O1QA 3AX4A 2I2SA 4AEDB 4GALA 4M00A 4CEYC 4CEYA 3E5UA 2E7TA 2VW2A 2VOVA 1LOAA 4P14A 3O5SA 1XE7A 4ISQA 1WLWA 4GA9A 4COZA 4XMIA 4BZ4A 1MS5A 3FBYA 3ZFFC 4XJAA 2ZAHA 3ZFFA 3VHNA 3R05A 4EN9B 5E89A 1H1MA 4OHWA 4CDXC 4CDXA 1HRV1 1Q8QA 3AP9A 2OA2A 2XG3A 2RHPA 1VBD3 1H8VA 3J4UH 1GICA 1UPSA 3B01A 1CJPA 1BEV3 2C1FA 2YMZA 1OFNA 2DVDA 3BOWA 1QOTA 4QQPA 4XFGA 2A5ZA 5GKAC 4AI0A 1OPOA 1PIV1 3BIWE 3M3OA 4LBOA 3POSA 2Z2SB 4CDWC 1RGSA 1BJQA 1GFF2 2VMGA 3FC0A 2WBPA 2NZ9A 2R0FA 4YM2A 2XJQA 2DCKA 2P2KA 3EHKA 4TZDA 3EXUA 1ZRFA 3THTA 4FPOB 4QPYA 1Q5OA 1AYN2 3IPVA 2EXIA 2GC3A 2TEPA 1NLSA 4W6YA 1W6NB 5I8TA 2CYFA 1A3KA 4YM0A 2D40A 4YW2A 4WZCA 4BLJA 2Y0IA 4X8PA 4WM8C 3AYEA 5C8CB 4Q4Y2 4HETA 5F9TA 1FPN1 5CNAA 1SBFA 4AI3A 3LKJA 4Y24A 4GMP1 1CPMA 1O4YA 4K21A 4OFGA 3HIFA 3UK9A 3LWCA 3RYKA 3ZMOA 4CTEA 5T5PA 4EN0A 3PMEA 2I74A 2DCYA 4O9GA 1VAVA 5BXXA 1RHI2 3Q9OA 3M3QA 1GY9A 4FPJA 4HN1A 1LEDA 1MZEA 2WLPA 1AL0G 1Q3EA 2VOWA 3U0ZA 3MLKA 1SACA 3RDIA 4P9GA 3AJYA 1ZRDA 2RR12 3GZTB 5IK4A 3DPRC 2JENA 4MZUA 3DPRA 1G9FA 1EY2A 4Y20B 2AYHA 2NLRA 1Q8VA 2F4PA 1GNZA 2VUJA 3I2DA 3MEPA 2PQQA 2A75A 3VBRC 3N7KA 2QZ3A 3VBRA 3OBRA 3M7AA 3C3VA 3SWTA 3RI8A 2WZR3 4YVSB 2QDNA 4YG0A 3JQXA 4JRAA 2PELA 4META 2X8KA 2UWBA 4FAHA 3KB5A 4G4FA 3O7OA 1VJ2A 4SBVA 1HW5A 2VVEA 4XEZA 4DS0A 4Q0SA 4P9LA 1JN2P 2PTMA 4OVEA 1RINA 2HWF3 1KDKA 4K8FA 2DF7A 4RS5B 3O0XA 1OMIA 1QQP3 4Y1XA 2WFF3 1MR5A 3SH3A 1ND3A 5IK7A 4XETA 1N47A 4WVMB 4BMEA 2XH6A 1AUYA 4I0WB 2W39A 4FPYA 3VKNA 1VAKA 3LA7A 1WW5A 2YV8A 4AGGA 2EAAA 3ZFGB 4ASLA 1PGL1 2OG5A 1PVC1 1RUJ1 2LTNA 1HRV2 1C1FA 1MEC2 1QDOA 4YM1A 1J1LA 4QHBA 2HWD3 3UKTA 4BHPA 2ZJCA 4OZXA 2H6BA 3AKTA 3BU7A 1MS0A 5GZFA 1BMV2 3JCIA 1B35C 2Q1MA 2XKOA 1NA1C 1NA1A 3EQEA 3ES4A 4QM8A 1C4RA 3WHTA 3GHNA 4M3CE 4PLNA 5CG9A 3GZAA 1FATA 3WP6A 3JBG3 1TME2 4YG3A 4XF4A 4M0HA 1AR81 4PIZA 3MIDA 3X29B 3EBRA 1HRI3