1YCIA

Factor inhibiting hif-1 alpha in complex with n-(carboxycarbonyl)-d-phenylalanine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
336
Chain Sequence
GEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Selective inhibition of factor inhibiting hypoxia-inducible factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 99
structure length 336
sequence length 336
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1yciA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yciA01
2CGNA 3OD4A 2WA4A 5JWPA 1MZEA 1H2LA 4B7KA 3KCYA 4QU2A 2ILMA 2Y0IA 2W0XA 4B7EA 2WA3A 3D8CA 4NR1A 2XUMA 1H2MA 1IZ3A 4AI8A 2YDEA 4Z1VA 4JAAA 2CGOA 1YCIA 3P3PA 4BIOA 2YC0A 1H2KA 3P3NA 3KCXA 1H2NA 4Z2WA 1MZFA
chains in the Genus database with same CATH superfamily
1MQTC 1GP4A 1O8PA 3BOPA 1NXD1 1VBE3 3JYCA 5BNOC 5B4XA 1DGRN 2VW0A 1NLRA 2JJ1G 4FSJA 5JJEB 5C93A 4CU6A 3JD3A 5DAPA 3E83A 1VBE2 4META 4YW4A 3ROUA 5FYTA 2W6IG 4ASKA 1LGNA 4LOTA 3VKFC 3I49A 3ZIAG 1MS1A 4D6QA 1W0NA 4NWWA 2VWKA 1SFPA 2HHHB 1JBCA 1JOBA 4IE6A 3GZTB 1GFF2 1XREA 4DR4B 1UKRA 1RSOB 1QEXA 3HNMA 3EBRA 1H1IA 4HKWA 1SS3A 2PI4A 3WU2Z 4N53C 2VOKA 2LTNA 5F3IA 5FZFA 2RM21 2WL1A 3QACA 2W68A 2ZGQA 2JRIA 2BZDA 2EF6A 2DYRB 4Q4W1 1NA1A 3MIGA 1D4M1 2WS91 1S1AA 4NHKA 3FYIB 3ZSJA 4JGYC 1NLSA 3IC7A 3WDUA 4K8XA 4HKLA 1XSRA 3IC9A 3CJIB 2VTXA 1MEC1 4LO8A 2ZGSA 3O5SA 4M3CB 3FB7C 1IBKO 4IESA 4BW5A 3AL5A 3EB7A 1QJX1 1FKAO 1JOJA 4JI2B 5G04L 5E8AA 2HP8A 4IL6Z 3LZZA 3G6BA 5A3PA 4CDUC 4YYOA 5GLZA 4GQ7A 4CEYC 1ZX5A 1W6NB 2BOBC 2EILB 3ZYPA 3D36C 1XNQO 5FDBA 1YIFA 1N33B 3OMNB 1A8MA 5EV7A 4R52A 2LS6A 1UZWA 1N1VA 1VMHA 4DUYB 1H6XA 4JGZC 2EIMC 3WZ1A 4DR3B 4JC1A 4FCAA 2EZOA 2BGCA 1VALA 5E16A 4XFFA 4M01A 4WFFA 3B9CA 5C3PA 3AG1B 4NB5A 2XAQA 2XT9A 1RMU3 3IIAA 4XABA 1RM1C 1SDWA 2ZE6A 2P3JA 4QQHA 1UN1A 1RMU2 5CA1A 2W1UA 1HN0A 1TZOA 2CGNA 1RUH3 1N3OA 1C8NA 1PIV3 4A6OA 2A7AA 3C3SA 1NH2B 1OFNA 2R063 1G7YA 1JVMA 1LEDA 4E27A 4X89A 1RUH2 3DEMA 1RUOA 1DQ0A 1PIV2 3EYPA 2XASA 4MXWA 2R062 1OLRA 4O2AA 3E8BA 4XFIA 1XHXA 2FTKA 3K4ZA 2D7FA 1GMMA 3S7EA 4RFT0 5FYYA 2VQFO 1EN4A 3AKRA 4ZI7A 3VDAA 3HEIA 3ETQA 4UCSA 1RINA 1E57A 3ICXA 3NV1A 4LK6A 5L19A 1CAUB 2PF4E 5IK5A 1S2BA 1Q90D 1MS8A 1B35C 2ATKC 2VC9A 4FOQA 2V1DA 3WOGA 4XBQA 1THZA 2JENA 4DV5O 2RV9A 2X6CA 5FZLA 4IETA 3BA9A 5BY1A 5CVRA 1NQTA 5FMOL 4O4JA 4B3RB 4AVVA 1X9TA 3K58A 4AHWA 5IW0A 2OCHA 3ZMTA 3AFGA 3W20A 1HNWO 2R042 4ONUA 2WR9A 1KXGA 1MZ5A 1PO23 5GTHZ 1YLLA 1A8DA 2Y34A 4UF0B 1JYCA 3A0KA 1OHHG 2RJLA 1XDCA 1LOGA 3ACIA 3MLLA 3B4SA 2DVAA 1XNBA 2AEZA 2B5UA 3AMQA 3S7IA 2O0OA 3H3LA 5FXVA 5A3WA 2YHJA 2ZOEB 2VOVA 4XZUG 4EZ4A 3K03A 3AP6A 3USUB 5L9VA 3CCRV 4LO6B 1O4ZA 1CJPA 3MBWA 1VPHA 2RS52 1MS4A 4KUMA 1R6NA 2IJJA 4LULA 4QM8A 1POV0 5F3EA 4CPBD 5L7OA 2RMU3 5BNNC 4G9SB 3T1YB 5CBHA 1R093 5FPAA 4CH4A 1XBLA 2RMU2 1YFXA 2HYKA 1YI9A 1O4TA 4ZU5A 1R092 1LHNA 1NKDA 5FFOC 4R9DA 2KQXA 1WA8A 2HEVF 2HBTA 2W87A 2ZD9A 3WB1A 3B93A 5A1AA 2WSVA 2HJIA 3BHPA 2GTSA 3POEA 1FOD1 5FY1A 3TOJA 4LLFA 4B1MA 1VBD3 2Y6GA 4COYA 1J5EB 3O0WA 3BALA 4Y1ZA 3HKBB 2WYFA 1AVMA 1VBD2 3OEEG 4FM1A 1E5RA 1NTZH 1JCHA 2BNNA 2FBEA 4J41A 1O91A 3R4SA 4PHZA 2X5IC 1JR9A 4PDWC 3ZMOA 4JPRA 3I59B 1F23A 3AK0A 1OC1A 4H7MA 1FFXA 2YIDA 1QY4A 4FAHA 4MZUA 2DDUA 4PLMA 4CH5A 1V6OA 1V6KA 3ALQA 4U3FH 1EZJA 3ECQA 3P5BA 4AHCA 2D6LX 5C9AB 4O2BA 3MF9A 3L75H 4YGCA 2Q5TA 3UK9A 2VUDA 4QE7A 3MF6A 1Q82W 4FFBA 3OPZA 4IE7A 1J59A 1HB1A 1F5FA 3AB0A 2Y60A 2CTPA 5FYZA 2CAUA 3KMHA 5LRSA 4AVTA 1CZVA 2RG4A 2K46A 1TG7A 2TUNA 1A3KA 1G9CA 2SBAA 5L3DA 4CVUA 3I2GA 2AGSA 3RZHA 1GNYA 2CAVA 5J2UA 3NNLA 4H2AA 4JI7B 3WG7B 1PKXA 2RDRA 2WAAA 1F35A 4L92A 4M00A 4XXPA 5CFDA 2HG5C 2ZDIA 1F31A 2YICA 1DU3D 1UY3A 3T1HB 3ZIWA 3CJHA 4I0WB 1GQPA 1DQ1A 1GQGA 5LHIA 1FXKA 3MUZ1 2Q0OC 3AYEA 1LESA 3I2DA 4UCRA 3DXRA 1ASJ1 4AGGA 3HKCA 4PBOA 4CEWC 1VJ2A 3THDA 1UIJA 4E9KA 5LP6B 4I0AA 3ZKYA 4QU2A 2A75A 3G7DA 1PVC2 3TEYA 1EUUA 3SCFA 4DV3B 4YHHO 3TETA 4BE3A 1N36B 1WNSA 1OCCC 3WD5A 4A4AA 4K8ZA 5T55A 3CRCA 1ZSPA 2YXHA 4YNIA 3AG4C 1Q86W 3CSXA 2HH9A 4AI0A 3K5OA 1COV3 3O9OA 4AI2A 4TV9A 4XFHA 4AEDB 1ZREA 1IBMB 5LA9A 4L99A 2HJDA 1DQ5A 1COV2 1EYBA 4M0HA 4LKFA 4LPLA 3VKLA 2GC2A 5F2SA 1OPMA 5CIRA 3K57A 2ZCWA 2P1BA 3MW3A 2BV4A 3IPVA 5ABJA 1QH6A 1VQ5V 5EQUA 2D5FA 3F95A 5LCWL 5JIUA 1XQNA 1SLAA 4XILA 1YFUA 1VBC1 2E76B 3S30A 5DZGA 5A7OA 4I0XB 5EIYB 4FZ1A 1JH5A 2UUCO 4K21A 2WA4A 4QIWF 3KD4A 5C3QA 1NU1H 3B8MA 4CUBA 2JGDB 5BV6A 1AJKA 4RD7A 2QQIA 3EHKA 2Q8OA 2HWC3 1JYVA 5CZKA 4GALA 1UFIA 1QF3A 2FDFA 4WFGA 1PGW2 5CYYA 1TMF3 3SEEA 4J7KA 2AZ5A 5JVVA 3GJAA 1QHDA 5JH7A 2ADEA 2HWC2 1VQKV 3KG2A 1R3IC 4AILC 2Q1MA 2CK3G 1BL8A 2H6CA 1TMF2 1YO8A 4XTMA 4JAAA 3LNNA 2VOTA 5A1FA 4OI4A 1S0EA 5KUMA 3WF3A 4Y1UA 4R8CA 4K1ZA 4PIXA 3ZXJA 4CP2A 5A3MA 5F6LB 3I4IA 4RUEA 2FDKA 1JZ4A 4LFCB 4XMAA 4QKFA 4I55B 2ZKOA 1FNYA 3OOXA 1SLIA 2C26A 3T4ZA 1WLWA 4UCTA 2PAEA 1H2SB 1PK6C 1YQ2A 2XJPA 5GZEA 2RQ6A 2NLRA 2RM22 1K3IA 1YTFB 3GZAA 4HKOA 4EB6A 1SCRA 4HPKA 1IGOA 3OGJA 2WT2A 2YUEA 4MGYE 3WY6A 4Q4W2 2V09A 5DAWA 2FCVA 2WS92 2WLHA 3H8OA 4O65A 2VXRA 3VBHA 4DUWA 2JICA 2BWAA 2Q5ZA 2D6MA 2TBVA 2XVKA 3X2QB 3FLRA 4I09A 1C57A 2BSKB 3AM2A 4LKDA 2P34A 3POBA 2YB7A 4L11A 5JWPA 4XIKA 4ET7A 5FY8A 4OUSA 4LBEC 3I3EA 1SPPB 1QJX2 2VO5A 3U11A 2PHDA 5FWJA 4FTSA 4CSWA 1WCSA 3ZFGB 1LNSA 5J2TA 4HN1A 3AX4A 4QE9A 1PL0A 1HB3A 1FATA 3LNMB 3JCUZ 1N32B 1UXZA 1EPZA 4DV7O 4RYDA 3C3VA 2ZEXA 4U7NA 2FQPA 5F8PA 1W6PA 4GH4C 2ZXWB 2WO7A 4C0BA 3U4SA 5I0RA 3OY8A 2WAOA 2EX3A 5LYJB 4XFAA 4XJ9A 1NS1A 3LDDA 1N34O 2WFF3 3JXSA 1OLME 5L3GA 4YW7A 1CAVA 5J96B 1UZVA 1PL4A 1BHGA 4K20A 4OHYA 2G19A 2WFF2 3H1YA 1HR0O 2VPVA 1TVKB 4Y1XA 3CZUA 1K9MW 5T5OA 4UAPA 4FPEA 3I2HA 2WLJA 2JG9B 4MLOA 1SFYA 2ZZJA 2QKSA 5DDJ1 1SQVH 4LJHA 3WP4A 4W4KA 3R05A 5LBCA 4NXNB 5A2QN 2IVJA 2N04A 3PTRB 2Y0IA 4IIJA 1NTKH 4UBHA 2FHRA 1OCRB 3Q8CA 2DBIA 5A70A 3I2IA 1BQ0A 4MSWC 4X8PA 3UCSC 2ZMLA 1DGRA 3K08A 3B00A 3TNPB 4RR3B 1ULDA 2LGQA 4WVVA 2VMGA 2EICA 4FFFA 3OBAA 1I08A 5B1NA 5GONB 4AOCA 1OOPC 4TQFA 1W9WA 5IE9A 4WVMA 2VE1A 5H9RA 2Y6FA 4YG6A 4X20B 3M3QA 3ILFA 4FPLA 3VBUC 3V56A 4D8MA 2GTAA 1ZAUA 2ZZQA 4CXXA 1QKQA 5LOVA 4EV0A 4N43A 4O61A 3BTYA 1I5PA 3RYFB 3NW4A 4LF4O 2D43A 4ZXEA 2ZJCA 4NHLA 5C5TA 1YHFA 5F3CA 1OA3A 3CRRA 5F6KA 2DCJA 3UL2A 5F32A 5CA0A 2V5DA 2KB1A 4MGQA 1NH2D 4F6RB 1X8EA 2B7YA 2K0GA 5EC1C 3POWA 3TB0A 4AEKA 2V4AA 2DYSB 5IVFA 5C4WC 2FDIA 3VGIA 1SFNA 4F8AA 3BB6A 3RVHA 3HQRA 4B4PA 2AXTZ 1V00A 1IPKA 4AL9A 3OR7C 5IFTA 3UJOA 3RYKA 4CUAA 4YZ2A 4QM9A 5HFLA 3J81N 4XBNA 4YPJA 4IT5A 2DN9A 1W6MB 1JS9A 5HXMA 1AI6A 1AXZA 2Y0OA 3VBSA 3L2HA 1PO13 3AK1A 4KQ7A 4S2GA 5KA6A 5KAIZ 1AZDA 3SJCC 2VNVA 5FREA 3OBZA 4NROA 1AR4A 1KB9F 4JI4O 4DO0A 4P08A 1PO12 5J48A 1C8M1 4DR1O 1JMKC 3WB0A 3FB8C 1JU3A 3LDRA 2EIKB 2J7MA 3URFA 3BIEA 4CDQA 4X9QA 3NL1A 1QXJA 4CA9A 4XFCA 1QR9A 2WLIA 4NO4A 3K5MA 4EE2A 2KG7B 4YSFA 4COWA 4X1IB 4KGQA 2IFRA 4DOUA 4JTOA 5LB6A 4L8QA 2Q7HA 3HVDA 2WZPP 5K7PA 4D69A 1NLQA 1S2EA 3WINE 2E51A 2A3QA 2QQVA 3K9SA 1IZ3A 5D5PA 1CZSA 1KD1W 4DV0B 1RUC3 1T2XA 3UKNA 1H2KA 2Z79A 3ABMC 3M2MA 4HK8A 4XHBA 1YQCA 1HDJA 3FHIB 3RNSA 1HX6A 1AJQA 2XL9A 1C1LA 3C8XA 2VW2A 3NO8A 5ACA1 1F4HA 4A41A 4GX2A 5C71A 1REEA 1H8EG 5HV4A 1RHI3 5ISLA 1RUD3 4W65A 1MQTB 3GNEA 5BNOB 1EM1A 3PJYA 3VL9A 4JKLA 4BHPA 2HWB1 4ZHQB 4UCVA 4FXGB 4K9SA 2JDUA 2EIDA 3WG3A 4YGBA 1LHUA 3TGUH 1K5JA 3CB2A 1W8TA 3SNMA 1LOFA 1Y67A 2GV9A 2WNVA 1CXZB 4LHSA 1BT8A 1D0GA 4ISRA 2W9XA 3NAPC 4EN8B 1Y7BA 4N53B 4E2LA 4DV6B 1VMJA 4LC1A 1HLCA 1ASJ2 4GJYA 4JI1B 4PD4F 2XKOA 4I9WA 4TV8A 5ITZA 1YC61 2NZ9A 4DRRA 4LE4A 4FFIA 5FZKA 1H2LA 2JJ6A 3ZX7A 3W7XA 5F7UA 4ZU7A 2IH1C 5FZOB 1NT0A 4UFZA 1K33A 3LAGA 1RC6A 2EBOA 3TK1A 1P4RA 4JV5B 4B3TB 5JCTA 1Z7S3 1IURA 5T50A 1H38A 4DXZA 4HL0A 4FIPC 3AL6A 1VQ8V 2PGGA 1Z7S2 2ARXA 3AK2A 4CDUB 5AC93 4LBJA 3D82A 3JAWA 4CEYB 1EP0A 2DOSA 2DWEC 3FUQA 5AC92 5FJHA 4QKNA 2F23A 1WPXA 4CU9A 1GBGA 3U14A 3N36A 1J1TA 3B9IA 1OV9A 4IGGA 2PFWA 3QD6A 1WLDA 2QM8A 1TME3 4JGZB 1C4RA 2EIMB 2KA3A 5EYYA 2UY9A 1OUSA 3ZRWA 3JSNA 3BCCH 1VBC2 1MZEA 4MVUA 4QDQA 4GMP1 1ZZ7A 3VBOA 3N2GA 1COWG 5FZ4A 1P7GA 1RM1B 3LIGA 3S6PA 5HCAA 4LH7A 4LR4A 4PELA 3W7TA 4XJUA 3THOA 4DZGA 5JVDA 4K0KO 5A7PA 5I91A 2UXXA 1JYTA 2JG8A 5A6YA 3CCVV 4MSVA 4TWKA 2ADQB 4OX9B 3POGA 4A7KA 1PP9H 4WVWA 4LCUC 1XOUA 2QQPA 5I0SA 5IVCA 3OT7A 2CNAA 3D0JA 1QBZA 3LOIA 3WHUA 5I0DA 3P30A 5H9PA 2JB4A 1AP6A 5ANQA 2FCUA 2W3JA 4JASA 4H7LA 3QH6A 1J3PA 3LKJA 1VQ7V 4BWAA 3CCEV 1D2QA 3ASIA 4Q0QA 3CJXA 1BBT3 3D3QA 3UO3A 2VUAA 2DVDA 1B35B 4CP9A 1IG3A 1BBT2 5EJZB 3PMSA 4NIAA 4MXWB 3DSQA 4Q4X1 4YM1A 4XUTA 4NRPA 4O2AB 2NNUA 1S0FA 3ST7A 5I8SA 1JJ2U 4LKSA 4XACA 4LIUA 1AVBA 2GMEA 1QJU3 4H37A 2R0FA 1DF5A 3I7DA 5GJ6A 2YDEA 3WXPA 3H1HH 2ZHNA 5IVJA 4ZI7B 1N4CA 1XNQB 3GHNA 1ZZCA 3H1JH 4NJ4A 4ZPIA 3T4HB 3OMIB 4PBPA 3E22A 2WQ8A 1WLTA 1W2AX 3RQ0A 3MZHA 4HSJA 4FLXA 1W0OA 4JKKA 2QWRB 5J3UA 2EIJB 4LUKA 1FPN1 4JYAB 3MHHC 1WCDJ 1OXCA 2TEPA 4XZPA 1VIBA 3BN6A 3K0DA 4QKBA 5K0UA 3N7KA 1YNAA 1KS4A 2IJKA 3SHRA 3VZOA 4IW3A 3U0ZA 1W0JG 1XNCA 3VB9A 4LORA 1F4NA 1Z78A 4D7YA 4LHNA 2UU9O 3UKMA 1XNRO 3F5TA 2W46A 3ZSEA 1SKVA 2ZX4A 2PQSA 5C5UA 5C8CA 2UUAB 2EULA 1K4DC 1BMFG 2WNOA 1IXMA 2D2CB 1SQGA 3LA3A 4I4TA 5D8AA 1GZWA 2Q1FA 5JXGA 4HG6B 1JZ8A 2J1TA 5BXZA 4N9IA 2J42A 3R4UA 2DMXA 4JTAB 1NTMH 3T1CA 2RDCA 1YTFD 4OI0A 4HLTA 1KDKA 4O4IA 4NTYA 3D4KA 4LF6B 1ZL8A 4AQ6A 1K42A 4TUYA 1SLLA 2UWAA 4IV3A 1LHOA 3AEIA 4UFIA 4DXWA 1WW7A 3SPIA 2WLPA 5L7OB 4WM8C 5GTIZ 5FZHA 5IWAB 1KS5A 4PDRA 1Y6XA 3OUJA 1BE3H 5J37A 2CDYA 3IFXA 2D3OW 2X5IB 3RBZA 3RVYA 3HR0A 3NNFA 4PDWB 2CTQA 1WA8B 1LOCA 1R1A1 4ZOLA 1I6XA 1KC8W 3BCWA 3FB5C 3ZMVA 3E35A 1KU9A 2WLLA 4BK5A 2P6HA 1CAXA 3B02A 1BYHA 2W47A 4BOWA 5FBZA 1S0JA 4BZ4A 4QMAA 3TWIA 4DUZO 3TJTA 3HAGA 1FS0G 1URFA 3GZEA 1XNKA 1FV3A 2CL2A 2Y4UA 2RS31 3K3OA 2LFRA 5CBFA 5AFBA 3NNMA 1LR1A 1V6JA 1YVWA 4P9IA 2XBO1 3CMGA 5EIBC 2ZEWA 3B77A 4AQYB 3CZJA 3C7GA 3JD1A 1FFXB 5FK8A 2Y26A 3WDXA 2LW8A 1H4GA 3GCXA 3K9AA 1BCXA 4YZ1A 4LMFA 1AR81 2OYZA 2Q8VA 4N9HA 4ASMB 3LSEA 2JX9A 3JALA 2ZGMA 5A80A 1GZTA 2VL4A 3WP5A 1VF6C 2E7QA 5CMUA 5JQGB 3LGRA 2P67A 4FFBB 2WUHA 4IGOA 1YSCA 3DV8A 4K8FA 1RPRA 1R083 4GKYA 3G6EV 4LF5B 1QQP1 4J25A 1H1AA 3J26N 5FP7A 1R082 5JZGC 1FJGB 3RDIA 3ZYBA 4CEWB 2LROA 2HVJC 3A0BZ 4FOWA 3SC7X 1DZTA 3SYCA 3QO7A 3CQOA 1O5UA 2RE9A 1MR5A 1REDA 5J2UB 4XDJA 3S0MA 1V6NA 3H3UA 2ZGNA 2WLNA 1W59A 2VNOA 4SBVA 1E5IA 4UV9A 2J1SA 1FI2A 1MSDA 5CFDB 2YI9A 2ZE7A 5F9TA 2Q6AA 5F5IA 3N2KA 1NKGA 1XHZA 2WQZC 2J1VA 1FXKB 3AG4B 1OCZC 4RS5C 4JI8O 1ACCA 1PNGA 4JRAA 3N9LA 4AHZA 2GALA 3JQXA 4LBQA 4NAOA 5FPLA 2JEUA 1NI8A 4CZSA 2R9AA 3ZKUA 2ZGKA 4H33A 1XMQB 4AI3A 1M1KW 3LEKA 4OZOA 2HKOA 3I2KA 2XGXA 2VG9A 4J9YB 1W2TA 1BMV2 4XDLA 1VP6A 5DM6V 1NBMG 1X50A 4LNUA 1XL6A 5LW9A 4BR6A 4CDWA 2Z2SB 1NZ6A 3AMHA 2WJSA 2AUYA 4I7ZB 4ES8A 2PLV1 1HRV1 3VDDA 5JXHA 4TV9B 2D97A 1QVFU 3N4MA 1SESA 2W6JG 2LUWA 5ACA3 5BY5A 3CYOA 4XHXA 2IM9A 4A7ZA 5KUKA 4MHUA 3SPGA 4DR7O 5A6XA 1QXRA 5ACA2 3CU7A 1QR8A 3PN1A 1CPMA 3BTZA 3SDLA 5GLTA 5ABJB 5JJJB 4HVRA 1QCEA 4PDVA 1K73W 1UY0A 4UOJA 1DF4A 1MPXA 4RFRB 1MNGA 5L3BA 3A7QA 2YU2A 4NHXA 5GW7A 1OVSA 1C5HA 2XAHA 2QKDA 3TN91 2BRTA 3HOBA 3T09A 2GMMA 3U10A 1YUDA 1JMUB 4H13B 2HWB2 3NQHA 1M90W 1GNHA 3LIHA 4YFWA 5C8WA 1UMHA 2I45A 4MTGA 3B7MA 5LBEA 2EIBA 4ZBMA 2GH2A 5DAQA 2DBNA 4CDXA 5I8YA 4QPIA 1RTVA 5LGTA 5JOYA 2BW8A 2WYSA 5JH7B 2GH8A 5KHHA 1PK6B 3CO2A 2OZ6A 4FLWA 2AC1A 2V72A 1MZFA 1XE8A 3CC4V 4K40A 2FKXA 2E33A 4PJ0Z 5JLVA 1OA2A 3ZPOA 2XLAA 4ZKIA 4OXSA 3X29B 4FM0A 3H42B 1AXKA 2PHWA 2VVEA 1W03A 5GLUA 4GKKO 5AVAA 2P5OA 4D7SA 1QJEA 1V0AA 4X1YA 1ROPA 3ZFFA 3ZYGA 4CDXC 4LH6A 2MPFA 2CWSA 1G9FA 1UU5A 5GLVA 4QD2A 4Q1RA 2Q7EA 5DEDA 1IG0A 2VBDA 4NWVA 4G27B 2JD9A 1UO9A 4EB6B 2ZHMA 4HPKB 3WNNA 1ORQC 2LRPA 3WF1A 2VZOA 1ENSA 4K35A 4D94A 4P30A 3OGGA 5KBFA 2VULA 5LBQA 5DUXA 2JIZG 1K7DA 1NCQA 2I07B 3OR6C 1B06A 4V1PA 5FP9A 1JJOA 2YEVB 1C1FA 4Q26A 1YJLA 1ZRDA 1HXS3 3DN7A 1UMZA 2VBPA 4FTBA 3PUAA 4L0PA 2WIIB 5A7QA 1HXS2 1QDOA 4GCZA 4DV2O 4WFAV 3V64A 3ZLIA 1GZ9A 3L2YA 4MV2A 4W4ZA 5AVPA 1C5IA 2GUZA 4Y4RA 2VZSA 2R1DA 3WNPA 2ZQMA 3ZHTA 1EBOA 3PU8A 1QXPA 4OHXA 5FYHA 3HNBM 1JZ5A 5B2GB 1OMIA 2F4PA 2YY1A 4QHOA 4NMIA 5FP8A 4N8MA 1VE0A 3O65A 5JXIA 2UURA 2BYVE 2B42B 5FOBB 3K0GA 5F3GA 1UU6A 3D3IA 3ZIXA 1Q8PA 1OFSA 1UPGA 4P9XA 1CN1A 4Z92B 2HR3A 2WFPA 2D5HA 1PNKA 1WAZA 1ZBE3 3KVAA 4QGLA 3QOPA 2PQQA 2D6PA 4YY3B 3A0NA 1VMGA 2CH7B 2PHLA 2VRZA 1ZWIC 4HZFA 3K3NA 1ZBE2 4CE8A 4KBZA 3VD9A 1VRBA 1J83A 1OOPB 2WWWA 4Q4X2 1GLHA 3LDKA 2VCCA 2XJTA 1DLBA 4IIJB 5LXTA 1Y74A 3RYHA 4MGKE 1V6LA 1L7RA 1W8WA 4LFBO 3RZMA 4CCEA 2ZGUA 4Q4V1 2F4VO 2DUQA 3C7FA 1H1MA 2O8QA 3M99B 5TISZ 2XOKG 4J11A 3J7LA 3PMEA 1H2NA 2ZINA 5ANNA 1EAH3 2CDPA 3KGLA 4UVBA 1FPN3 4IERA 5FXWA 3KZ4C 4NAMA 4AW7A 3I2OA 2X0LA 2QWQB 1EUTA 3UT5A 3JD73 4WVMB 2JE8A 2WDBA 2BOJA 4AI8A 1FPN2 2ZS6B 4OUMA 4BDVB 4GWIA 2QE3A 2GP5A 1SETA 1HQWA 4GT1A 5C4WB 4YG0A 2QQWA 4HYOA 4X8NA 5T5LA 1AJPA 1XYOA 2YC2A 2RMKB 4EFEA 4RQEA 1GK9A 5KMGA 3MIBA 1B3QA 5GM0A 2D6OX 2OVUA 3A4UA 2JDPA 1UMIA 4MADA 1AX2A 2A3XA 2WABA 2P3KA 3EXAA 5LA6A 5CA0B 2UXCB 3RG0A 4NPMA 3IAQA 1WCUA 4UB6Z 1GH6A 5LEJA 3VBFA 2PUSA 4G2KA 3LUTB 2HYXA 4FOYA 3ZCCA 3PTYA 2V5YA 3MD0A 3ZXEA 2DUPA 1FX5A 2I2SA 1AR61 1X8MA 4MT8A 5JMOA 2H0BA 2BFUS 2GDSA 4DRVA 4EEQA 3VBRA 3N35A 3VZJA 1FYJA 3P3PA 3JB8A 4FM2A 3OUHA 1FMD1 4MH0E 3W58A 2UUBO 4DQAA 2QKCA 3VBFC 2ADDA 2E32A 3M1HA 1UYXA 3TRSB 4R6ZA 3OTFA 4QHZA 4D6TH 1PX4A 5J1XA 4MOAA 3I2FA 5BYNA 3SH4A 4QX3A 3SISA 4JDNA 1QDCA 1VRH1 4YG3A 5LK7B 5JCOC 2IBZH 4BIZA 1VEWA 1WA4A 3FLPA 1LGCA 2ZE8A 3ABMB 3OYWA 5LHGA 4JYBA 1XB9A 5FPVA 4OQ8A 3U4XA 1IQAA 4DV1O 1N0NA 5DZFA 3MIDA 4AEDC 1D2SA 4YJ3B 3WNLA 3QLQA 4QQ2A 1KJRA 4FPOB 2OUHA 1UOFA 3SYOA 2RS32 5FAXA 4EROA 1QJY1 5CN0A 1BZKA 1CX4A 3PL0A 2XBO2 3A8TA 1N1YA 4KU8A 5H5NA 2ZM6B 4CPBA 4OHVA 5KC6A 1K34A 2VQEO 4Z2WA 3QBQA 4TT3G 2ARHA 1POV3 4FFKA 3SR2C 3AZVA 3FAVA 4JTDB 4OPAA 3FB6C 2OXBA 3GF6A 2JE9A 2Q67A 2EAKA 4OFGA 2F17A 3RYIB 3RYCB 1Q56A 2RS13 4WV8A 2JK5C 2W95A 2ORZA 2QWOB 1A34A 2CGPA 4XXAA 3V0BA 1UYPA 4CC6A 1VQMV 3ZR5A 3I55V 4MVRA 3POJA 4I50A 3FMGA 4V2WA 3DYOA 4JVAA 3IKWA 4GX0A 1H8TC 4PIYA 2E5LO 2P3YA 3OUFA 1W39A 2KD7A 1MSWD 2QSAA 1BKZA 2ES3A 3GYDA 1D0HA 1KUQA 3AZWA 2XJUA 4YZ5A 2J1RA 1W8FA 3ASNB 1D7PM 1G6NA 1V9PA 1AYN3 1JHJA 5D5QA 4OQ9A 4MVMA 5JSOA 3DCQA 3BTAA 3FZ3A 1K45A 3A0HZ 2QUOA 1TQ5A 1AYN2 2ZNJA 4Y5SA 1CIYA 4A44A 2WWJA 4FFHA 1Z0HA 4HZ3A 2L35A 3A0RA 4UT5A 4JQRA 4KWJA 4BMEA 1X36A 2P90A 5IJ0A 4B08A 3G71V 1W6OA 3DYPA 2RR13 5EHDA 2P37A 5HFMA 3STLC 3CEWA 4RQPA 5FLJA 5IYYA 2WN3A 4OPHA 2G38A 5A33B 3JBG1 2ATFA 3WNOA 5CKNA 3JB4C 2EINC 3AYCA 2E31A 4ZIBA 2BOIA 5FZ7A 4OVEA 4FPCA 4COVA 5B3SC 1OBNA 1GAXA 1HRV3 3FL7A 5G05L 3X2QC 4KFMA 1GR3A 2O57A 1JFFA 1AYM1 4H0LB 2BNMA 3HJRA 3SGIA 5FMCA 1ND3A 2WSUA 3O1UA 4IEXA 2PLV2 4NRMA 1HRV2 5LZ6A 2HWD1 1AILA 4QPKA 5GZGA 3ASOC 2XTAA 1VMFA 4ZZ8A 2Y0PA 1OVPA 2DFCA 5FL7G 5DG1A 1F8VA 4DR5O 3U78A 2JIGA 1Y9QA 4FVMA 2P06A 3EMRA 4B1LA 5H6RA 4JZ2A 3M3OA 3MUY1 3JD0A 2MEV3 1SQQH 4EN0A 5JMCA 5HV0A 3FC0A 1WD4A 3WQBA 2JE7A 2ZXWC 1E1RG 4Q8KA 1N0JA 1QJFA 2OIEA 1OT5A 2E63A 2QVSB 3OGIB 4YVSC 3OEBA 5JJNB 3THCA 2VCAA 3CLPA 4IEVA 1JHNA 3O1SA 5LWBA 1AI7A 4LF8B 4Y26A 1S76D 3T2OA 4PI0A 3WNKA 5JVDB 1VBA1 4FQ4A 3VLBB 3OM3B 3SJQC 1OD3A 3W5MA 4BAYA 3SCHA 4COUA 4PT6A 4LBLA 1O3RA 4LA3A 3VQVA 4CP1A 5AFEA 4FLVA 5LK5A 1P7BA 1JU4A 1V9U1 3VKOA 3N9NA 4DR6B 4J6GA 2YUAA 2HBUA 1J58A 3L71H 4KH9A 1B09A 2W5FA 5E1AC 5KXEA 2X10A 3LA2A 3U75A 1SQBH 2DQ0A 4NIIA 4FPYA 3LSUA 2YXSA 4RGGA 2BPA2 2AR6A 2HWF3 3K79A 1AB3A 4QGPA 2OYQA 1VQLV 2F1MA 1R3KC 2HWF2 4XDPA 4BW9A 2QM4A 3JD4A 4J10A 4RR3C 4CP9B 4EQVA 1JYWA 2FDHA 3OPTA 1SC5B 3KCCA 5EXOA 1RUE1 3KF3A 2ZX2A 1GICA 2GAUA 4OGQB 3LSQA 4A42A 1DZQA 3WP6A 2N05A 1C3HA 1W6QB 3ZRVA 3J7NA 4LBQD 1ZBA1 5LA0A 2F43G 3J4UH 1ND2A 1HRI3 3JARB 4CUGA 3A23A 5A9GA 5JIAA 4PA4A 3QTCA 3SJBC 3K04A 4FLZA 1HRI2 1S0CA 1VBB1 2OTLV 2OQ7A 4AFDA 1AXYA 1WP8A 4IHJA 3GXUA 4FLUA 4X62O 1YHQV 4JYCA 2ZGOA 2CU5A 4A3ZA 5CG8A 5CFCA 2K2SA 4E8DA 4AVCA 3CCMV 1SZBA 5K0UB 2HWE1 2YG0A 3Q4HB 1DQ2A 2WQ4A 5LGUA 5LBFA 1M06G 2PY5A 3THPA 2P2KA 4JI6B 2AENA 2VZQA 3E5QA 5FZIA 4Q5OA 4AGRA 5CG9A 3L73H 2G9ZA 5EZWA 1LKNA 4YW6A 3GWKC 3T0DA 4DR4O 2A6WA 4KGGA 3J80N 5FKBA 1W3XA 4KXRA 4RHV3 3E8HA 3NVCA 1LUVA 5D8AB 2ZGTA 3I3MA 1B6QA 2OIIA 1EN6A 2JDMA 4AQTA 1YDXA 1NVPD 5BNPC 1UY2A 4Q29A 2VMCA 2ZXQA 2ARBA 4XQ4A 4COZA 2R30A 1KECA 3WQ0A 1JI6A 3ZXKA 3ZXGA 4IV3B 3JASA 3WUCA 3B5LB 4R7CA 2WNUA 2VOWA 3LQCA 5FLHA 1I0HA 4JI2O 4YJ2B 3SQOA 5APAA 1RUF1 5EJ3A 1LOAA 1W2OA 5JPNB 4HVQA 4EFBA 3ZEDA 4XUOA 1TA8A 2W0FC 3PIGA 1F51A 1QMJA 2QR4A 3TYJA 1PV0A 2UU9B 5JSRA 4GAZA 1UF2C 2DU1A 2FDJA 2W08A 3OW2U 1R6KA 4JTNA 3VHOA 2R9IA 3SKVA 4CCDA 1RSOA 5F5CA 5FZEA 1G4YB 3ZXLA 2Y6HA 2IZWA 4DXSA 4DUYO 5IY5B 3OSDA 1KBHA 3LA7A 3ATGA 2WO2A 4DR3O 3FX3A 2BWCA 2BU9A 1DGWX 1GSLA 3MDSA 3H01A 3NXSA 1XEQA 5A3TA 4RGKA 1LECA 5JZGB 2E7TA 4AFBA 1JTZX 5BUVA 3J7AU 2V4VA 1XXNA 2P22C 4WM7C 4AAPA 1NAEA 3BU7A 4PDMA 3CJIA 3DXUA 5B1AB 4QWNA 1XILA 4YW3A 4GMP0 3PJSK 1K5QA 4C1XA 1L0NH 1IS6A 2OWOA 5LMUO 4GUNA 3E6CC 4Z82A 2YS8A 1W6NA 1WCKA 2WZR1 4D3WA 1OCZB 3VBBA 2O1QA 4RS5B 4LITA 1AR62 4Z2AA 2B9VA 1H8VA 1X82A 2OZJA 3W7SA 5FOJB 4WBNA 3AP9A 4DUZB 3OTOO 3OF1A 1LRHA 5IATA 1DG6A 5FZBA 1J1LA 3OGVA 5A3LA 4CS3A 1FMD2 4NXMB 5EPAA 4CP0A 1IBLB 4UCUA 1X9PA 3CRAA 4Q0UA 3CRMA 2GDFA 3ZFEA 5FP3A 1X4TA 1L7QA 1H0BA 1DIWA 1IKQA 3MLKA 4B3RO 5CKQA 4O9EA 4B3SB 5DPNA 4XUNA 4R4ZA 1OI6A 4H55A 5DAVA 2CWMA 5FRAA 3LE0A 1HKDA 4RGAA 3LDCA 1O3SA 4BQ1A 2QDNA 4B7KA 3UT0A 5FYCA 4CC5A 4V2VA 2YYOA 4QX0A 5B4NA 1QJY3 1NA1C 4ZS2A 1MS9A 2HEPA 4C7UA 2XDVA 1MVQA 1QJY2 2YFZA 5IAXA 1CIWA 3SYAA 1OLMA 3MFAA 4DIQA 3G80A 1TAEA 3HQXA 4M4PA 1TNRA 4BQ4A 1MA1A 4HMZA 5FMOS 3H1WA 3ZSLA 1W3VA 1QNYA 3FUOA 5FYMA 5FUIA 4CS2A 2YC0A 1QJZA 3WB2A 2D3RA 5DMYA 1PM9A 3C2UA 3LFMA 3WDTA 2Z5UA 5FYIA 3T1YO 1CONA 2RJ2A 3UO2A 2GN3A 3VD4A 1URXA 5BZBA 1GN3A 4BISA 5IYCO 4LTAA 2ADPA 2EAAA 1A78A 1U5ZA 4QXHA 4YVWA 3POIA 4A2UA 4JI8B 3HBZA 1OURA 5IK4A 4NYKA 3LB9A 4RUFA 1GP6A 2VNGA 4NRQA 2BERA 3ACLA 4XC9A 2NPIA 3GDBA 4C0HA 5LGNA 1K3EA 4ZONA 3AXEA 3IMNA 2A5ZA 2ZX1A 2VZUA 1CVNA 2CTVA 3BEHA 1PVXA 4CDXB 1XOYA 5CISA 3ZX6A 3B69A 2RHPA 2FCTA 2R6QA 2ENRA 1S0BA 1S3JA 1SLCA 1U97A 3USUA 3O12A 1ALYA 3USSA 4LWSB 5L3FA 4H3WA 3ZM8A 2AEYA 4LF7B 4D6RA 4JQTA 4DR7B 2XJVA 3E6BA 4PA9A 2R071 1OUXA 1IPJA 1PMJX 2R043 4MGIE 2QCSB 4X1YB 4N23A 1GOHA 2M7WA 1FXVA 3JBG2 4HN0A 1BVP1 2QZ3A 2R16A 4X66B 4M4RA 1AYM3 1S4CA 5IYZA 4Q1PA 1Y76A 3OEAA 1CWPA 1LGBA 3LFIA 2ZMNA 4YZ4A 4DINB 1AYM2 2BBAA 2PHRA 4ARXA 1RXFA 4CS4A 1KGYA 2HWD3 3LOBA 4NIGA 2EIJC 4TSFG 1NQDA 2CY6A 5KX5B 3ZPYA 1Y43B 2HWD2 4P9LA 3HKBA 1M56C 4Y5TA 2RS53 2YROA 2A7WA 4NTXA 3O14A 1W2BU 3SYQA 1VQOV 4RL7A 4URTA 2F66C 3JAKB 3I59A 3T1HO 3I97A 2UXNA 5FLIA 5DUVA 4X6RB 4QQLA 1DQ4A 4G28B 4R4XA 4GKKB 1RFYA 5C9AA 1N1SA 1UL9A 2WLMA 1WW6A 5FYVA 4DV3O 3P32A 1VBA2 2LM3A 5KXCA 5GKAC 3FLTA 1N36O 2DVBA 1V9U3 2DVFA 2K9PA 2XHBA 5A32B 3BFRA 2F93B 4LK7A 2ARCA 1RUG1 5FZ8A 1V9U2 4TTGA 5L7OC 3J8F1 4UWDA 3ML0A 3D5OA 4NIDA 2CDOA 4UFMA 3FBYA 4INDA 4HETA 1FPOA 1GN2A 3K06A 4P5HA 1AL23 1ZZBA 4PV1B 4E4EA 2WRAA 2QWNB 1ULOA 2ZPXA 3OUSA 3J7HA 1AL22 3KT7A 2XONA 4K8RB 1KKCA 1WD3A 3SEPA 5GZCA 1K97A 1YQ5A 2LFSA 1JUHA 1YQ6A 3O0XA 4AVBA 4DV2B 4B3NA 3DGEA 5K4LA 2JDKA 1RUE2 1MG1A 1QLNA 3A22A 1VBE1 5LXTB 5LP6A 1Y74B 4B3MB 2UY8A 3RYHB 1GRJA 5IK7A 2R49A 4I3PA 1FAYA 2VQAA 5LL6Y 4IEZA 2HJFC 1MOFA 1UW8A 1US6A 4M0NA 3CNAA 2HVKC 1FXZA 4DR2B 3AJYA 3OAAG 4JI3B 5F5AA 4XEZA 4TQDA 4LO4B 2XKPA 4BXFA 2ZBJA 1CPNA 2W94A 4GKJB 5EYPA 4AVSA 4DY3A 2HWE3 2UU8A 1DQ6A 1SQXH 2WZEA 2IU3A 4XW3A 1G8MA 2B8MA 1TGOA 5M0TA 2HWE2 5BMVA 1OH3A 5KWRA 3ORJA 4XYXA 4WBBA 2XVGA 3MEPA 4MGTA 1ODNA 5L3EA 3M3EA 5L9RA 4QQOA 4BU2A 1PVC3 4NPLA 4LFCO 1S0DA 2F95B 3O7OA 4HNAA 2PHXA 4NN0A 5LA6B 1HW5A 4Y20A 1DGWA 1LODA 3ZRSA 3VBFB 1HN1A 1I3HA 2VOXA 4QPYA 2E9QA 3GZUC 1VP7A 3KCXA 3NV3A 1RP3B 2P6CA 5T5JA 1RITA 4S2FA 5CFDC 2ZDIC 1IS5A 2JGDA 3O0VA 4N90A 5GLWA 5L9BA 5IHRA 2VH9A 3ABZA 1FXKC 4XF0A 3VBRB 2XJSA 2LGWA 4LNVA 1KFUL 2GU9A 4Y3OA 3RW0A 2AACA 1Q8IA 4DB5A 1HDKA 1YI7A 1MACA 3UNPA 2VTXJ 4Z07A 1RUF2 2VZTA 2BUKA 1A6CA 3VDCA 3T1LA 3WG2A 3VQXA 2R70A 1RMU1 2YXYA 4GX1A 3AYDA 1IOAA 4CXYA 1LENA 3CKHA 1GN6A 4FFGA 2HEYF 4ATFA 3N3HA 1N8RW 2XR4A 1N32O 1K5SA 4I55A 3OYWB 1GKBA 4XJAA 3MI8A 3DYMA 1F4MA 4JI5B 1RUH1 5IVEA 1PIV1 3F7YC 5A7SA 3ILRA 5FXZA 2R061 2B45X 5K9YA 2AHZA 3UQ8A 1NJIW 1XMOO 4D0QA 3MV11 2X09A 4AQ2A 1SA0A 1Z2GA 2L9LA 1HNXB 2JKBA 3H1LH 1JYNA 3KV5A 4DNYA 5BNQA 2RCVA 4DK0A 1ST8A 2MHFA 1H8TB 5ABJC 5IAVA 3WNXA 2ZR2A 2VMHA 4IEQA 3UKVA 1DFQA 2AHYA 4HVOA 1SPPA 3TEXA 1UPIA 4AI1A 3TBDA 4NXNO 3KVBA 2IXJA 1ZRIA 1W8UA 3L70H 1R3LC 1I94O 3EHBB 3KHBA 1UQXA 1WW5A 4EYUA 2WZR2 4M3CE 2DUOA 3N9QA 4QDSA 2RM23 5EIBD 4IXLA 4XVHA 5FWEA 1SLBA 4KHPB 1DLCA 4Q4W3 1ZA4A 1PO21 3K5LA 4IDZA 1D4M3 2WS93 4GULA 5HCHA 5LRRA 4GA9A 2LJ2A 1W8NA 2C2AA 3SCGA 3AZYA 3ZN6B 5JDBA 1D4M2 2XMLA 2EINB 1NCRA 2ZNIA 1MEC3 3CF6E 2L6LA 4HANA 1GM7A 5B3SB 4XPVA 1KP2A 4DW0A 2NMOA 2VMFA 4UXAA 5JOXA 1MEC2 3MIEA 2Z0AA 1QJX3 3K77A 2JEMA 3B2EE 2EA7A 4PF1A 1KFXL 3CCLV 2DTYA 2QGNA 2XOMA 3CCSV 2YBPA 4U36A 2GNTA 4U3JB 2JG9A 5IVBA 4JHZA 1R73A 1CD3G 3ASOB 5JI7A 4J42A 2RMU1 3CP1A 5BPXA 3ZRXA 1R091 1XU2A 4RAIA 3ZMUA 2YZ4A 4K1YA 3BTXA 1OA4A 1LULA 4XJWA 3AG7A 3VD5A 1KITA 1S0GA 4LOSA 5BXXA 2NM1A 3VBHC 5LASA 1VQ4V 4O4HA 3H3ZA 4JI0B 2NQYA 1Z5WA 1CAWB 5A7WA 1BGYH 1JFFB 5LMNB 4YARA 2ZMKA 2EXKA 4Q4Y1 4TYSA 5K1XA 1UAIA 3VDBA 4YVSB 4JAUA 5H9SA 4B7EA 3ZN5A 1KEXA 4QX1A 3WV6A 1DYKA 2CTWA 1ZYBA 3T08A 1VBD1 1BS3A 1LNQA 4QXKA 5GONA 2F4LA 2NMNA 3ON7A 4TOIA 5IT6A 4FZ0A 5EBLC 4GD4A 1SMVA 4IGQA 4OMDA 1OF4A 1IKPA 2JWPA 2PZSA 3RRDA 1U5IA 2TNFA 1IX9A 4UW6A 3K48A 3RI8A 4AFCA 3H9AA 3M70A 3RYFA 2Y48A 3MAQA 2G4IA 3DKWA 1BXHA 4UFKA 4QX2A 4PA7A 2A73B 5IT9N 1S0VA 4FT8A 3BAAA 4F6RA 1RJ8A 4EJRA 4LHKA 1NT2B 5FTTC 3PU3A 5BR8B 4KWKA 4IE4A 3GALA 4I3GA 3WSOA 1M57C 4YLZA 4XJ8A 4N7IA 1PMIA 2PN5A 3ABKC 5FPRA 3RPQA 1Q8SA 3IWZA 2X53S 1W6MA 4ZKTB 2UWBA 4LBKA 4U2AA 4P9YA 2GC1A 1WZXA 4ABMA 1HJGA 2V73A 4X1KA 3Q8BA 1J84A 1H4HA 1Y9MA 1Z5VA 5IVVA 4XOGA 4TZDA 3E8FA 4UB8Z 4FVVA 2EIGA 3ES1A 3NJVA 3JQWA 4LP8A 5FZ1A 3O1VA 3CD6V 2JIJA 3UETA 3ABLC 4FI9A 1MZ6A 1P49A 2P4VA 3ZSMA 2PXJA 1RUNA 1WN7A 1GWMA 4HFSA 2ZA9A 3H8UA 3AXDA 3BY6A 4KMQA 5C3OA 1A32A 4R9AA 4P9OA 2RDNA 2QQUA 4N43C 3M3IA 2WO1A 5JAXA 1VQ6V 5C8YA 1GZCA 2DCYA 3QF7A 3MIHA 4PQ9A 2OW4A 1H30A 1NG0A 4JV4A 1WA6X 4P9GA 4J7JA 2NR5A 5BNPB 4CZZA 4E4ZA 4DO2A 3IDAA 5KAFZ 1COV1 2K9ZA 5LHHA 2ZE5A 1OCOB 3TXQA 1FOD3 2KR2A 5JXJA 5FNVA 4EN7B 2A3WA 4XBFA 4GXLA 4QGNA 4Y5Z0 2Z4FA 4K3UA 1FOD2 1H2GA 4LIVA 3U07A 4DUVA 1PD3A 4JZGA 3IAYA 5BNOA 5CNAA 1N47A 4JV5O 4B3TO 4MGSA 5J7MA 3JCZA 5DN2A 3M3CA 4R8HA 2OPWA 2X29A 3STZC 3J8F2 1JYXA 4AWDA 3M7AA 4BIFA 3CC7V 1O3TA 3HIFA 5FIXA 1R6TA 4KNCA 4FPKA 4WFBV 3VBSC 2A0LA 4UVAA 2LW1A 3ABUA 2Q0AA 1IHMA 3E5XA 4ISQA 4GZRB 2HWC1 3SH5A 5F39A 3WF0A 4H14A 3AFKA 3H9VA 3AJZA 4XFGA 5KA5A 4N53A 2QFEA 1TMF1 4CDQC 3FFQA 3NNJA 1W9TA 2UYAA 5B66Z 1XE0A 2QM7A 1HQLA 3S5QA 2FZ2A 4OLLA 2BTOA 4JGYA 4E2GA 2Z42A 1LB2A 4WM7B 4CCMA 2ZX3A 2IJIA 5FZOA 3HKDA 1R1BA 1QOTA 1NOVA 3K2OA 3MO4A 3E5UA 5FKCA 5LBBA 4OX9O 1AR71 1G9BA 3WF2A 1W28A 3TEZA 4UW4A 3WVJA 3SMHA 4GYCB 1VB4A 3DUIA 4CDUA 3I8TA 2Y8KA 4RN5A 4CEYA 1R3JC 3D36A 4YWAA 2GHYA 4Y1YA 4DRXA 1YJNV 1ASJ3 1PPJH 3OMAB 5E6HA 1O7FA 3ETEA 1ENQA 1W0PA 1SQ4A 1RJ7A 4JGZA 3WX5A 4XFBA 5J98B 3G4SV 1MS0A 3HKEA 1UYZA 1CGPA 5L73A 2YSUB 3UKTA 3HWJA 4WCEV 2NN8A 1YEWA 5FPUA 1Q3EA 5KC5A 3CPWU 2B39A 2J1UA 1LOFC 4FQZA 2W0XA 3ASNC 1GV9A 1WPBA 2EALA 5A1LA 2WA3A 2WNVC 4QX7A 1UU4A 4H44B 3S57A 4Z1VA 2Q9LA 1NE6A 2WBKA 5FZMA 2W1WA 3ZXFA 4RSUA 2BOCC 4JX0A 1AL0G 1SZTA 1UZYA 4WBNB 2HLEA 4Q20A 1JYIA 2DWDC 5CAZA 1REFA 3H50A 1JZ3A 1NA1B 3RN4A 1AF9A 2XJQA 2WN2A 2OCCC 2YIBD 1F4AA 4X65B 1D5NA 3JUUA 1F15A 2GSYA 1ULCA 3ZFEB 4JYAO 4Q27A 4FLYA 4OZXA 2OA2A 4QB2A 1DP0A 3VQYA 2WFF1 1YYNA 2VXJA 3HT2A 1VBC3 1JZ2A 5FCCA 3VHPA 2ZGRA 1JW6A 4KBBA 4JKMA 4XAEA 3MW2A 2P7TC 4W6YA 2DWRA 4DW1A 3ZOIA 1AR91 1B35A 3BUCA 1KRIA 4JDOA 2GNDA 2UUAO 5FZCA 2D6NA 3AP7A 3HN1A 5LMUB 3T0AA 3L9JT 3WNMA 3DGTA 3PUSA 3M8AA 3AKQA 3IIIA 1W8OA 5IJ9A 2B9ZA 2QJ1A 2D6KA 1AJOA 4OYUA 2CGOA 1LU1A 1Q6IA 2OT7A 4JGSA 2Z3YA 5T54A 3OTOB 4LF6O 4K3AA 2CYFA 4TLGA 4IEYA 3VBOC 3WCRA 3WG1A 3RMXA 1DYPA 4PQQA 1R1ZA 5IWAO 2ZKLA 3NMBA 2ET7A 3D3AA 4FAGA 5K1PA 4WFEA 3BPSA 3CXCU 5CA1B 4FTEA 3LPFA 2XQXA 2JB8A 4YVWB 2JG8C 5FQ0A 3WDVA 3HQUA 1IBKB 5JOWA 1APNA 2FD8A 1W8HA 2ZABA 4MUVA 2UXDO 1LHVA 3Q8AA 5BNNA 5FUPA 3F5WC 1PO22 2IVIB 4BK4A 2WKKA 3QG5A 1RYYA 4KG8A 4B4QA 2B5HA 3D6EA 1YIJV 2VUCA 2ETNA 2IW5A 4QXCA 1BEV1 4KWUA 1XPWA 1WB8A 4AQSA 4FPJA 1BVVA 3ZMSA 4ASUG 1KMIZ 5A6ZA 1OKOA 1ULFA 4AQYO 3MW4A 4BQXA 5FY0A 4OHWA 4YIPA 2DE0X 3O1OA 2V7QG 5IJRA 3CDZB 5B5EZ 1JQ0A 2GN7A 1M56B 4O4JB 3APBA 1OJHA 1VQPV 1LOEA 3ZXAC 4F83A 2X5IA 5FZ3A 4XQWA 2CUGA 4NHMA 4PDWA 1EN5A 1S5HC 1UIKA 1UOJA 4XF3A 3GB7C 4LF5O 1ZZ6A 2QJVA 5IYZB 3CXHF 1SG3A 4EN9B 4Q4Y3 4IQPA 2IH3C 1Y76B 4XUPA 2QZ2A 1PO11 5F1RA 4Q0VA 1FJGO 4Q4Y2 1E79G 2XB6C 2PYTA 4XDKA 2VQFB 4F6EA 3ELNA 1BHAA 5K0UC 4IV1A 3K3WA 5I0UA 3RZLA 4GLXA 3QO5A 2YGLA 2M6YA 2D44A 4O7XA 5DDJ3 1ULEA 1RVF1 1HWYA 4L9BA 5C8CC 3LDEA 5DDJ2 4DV5B 2BCCH 4D6SA 1RUC1 2ET1A 3ZDSA 1UKGA 5D8AC 4JRLA 4BIOA 4A7YA 2MW2B 2A06H 5FMBA 5JQGA 2DCTA 2BNOA 3U37A 4F7ZA 1EV11 1HNWB 1M93A 4IV1C 1EPWA 3KZIZ 3I56V 1XMQO 4QPGA 4QT6A 2IUWA 4L87A 1D4VB 1LUWA 3PVBB 1OZ0A 1SCSA 4BXSV 2D3PA 3CS5A 1GOGA 3C90A 1RHI1 2AW9A 4AI9A 1GU3A 1RUD1 4IV3C 2XH6A 4CEWA 3AK3A 1XNAA 2XAJA 4AXOA 3OB8A 4UCOA 3DL3A 2Y4TA 3MV01 4GKXA 3P3NA 4FK5C 3CMAV 3RMYA 3T3YA 3I3BA 2C9KA 2A6ZA 3S3XA 3DPRA 2DJVA 2ODMA 4ICGA 5C33A 4O9GA 3JD2A 4QPGC 2FDGA 3KF5A 2OQ6A 3R6SA 3ITQA 4O2BB 3UESA 2P17A 2EJRA 2LO1A 5LATA 5IY5C 4BH9A 2VMDA 3AKSA 2MK3A 3QO8A 3P1IA 1QOOA 4IYHA 2H0VA 5DUWA 1NR1A 2UXBO 3AC0A 4WFHA 1BLZA 1QGLA 3DPRC 3RJRA 4NR1A 4P9WA 4F3JA 4IEUA 1MS5A 4UFLA 5B1AC 5EK0A 5L3CA 1CP9A 3BVOA 5EYPB 1P84F 1Z7S1 5JI9A 2XAFA 4PA6A 3T4VA 2GBOA 1BQPA 5EBMC 2VU9A 1O6UA 2DCZA 5AC91 5BMVB 4MX3A 3CJHB 2ZT9B 2P5BA 1C8M3 1DF0A 3NSTA 5DN6G 4MVTA 2R9RB 3DXRB 4LUMA 3HKCB 1J95A 1C8M2 4FLTA 1W2UA 2QQOA 4HNAB 3VD3A 1WLCA 4HK9A 3AG3C 3VN4A 1NX9A 1YJ9V 4QDRA 4E4HA 3OGRA 5FYBA 4Y20B 1LHWA 1TME1 3RI9A 1SACA 2FYUH 2JKXA 3BABA 1UY1A 3OPWA 2X6BA 4FO9A 4BQ3A 1G6UA 2DF7A 2J1EA 5HCFA 1POQA 3CWBH 4J7ZA 1I5XA 1R64A 2YXLA 1RXGA 3EQEA 3V0AA 4P9PA 2FMDA 2QE7G 3EJKA 1M9NA 1Y3TA 1AX0A 3T1MA 1MABG 2QKAA 1W9FA 1W0KG 5LY2A 1I1EA 1PK6A 4LKEA 1U5YA 4Q6GA 3MPPG 1N3PA 2BP6A 3RWNA 2N7GA 2VUJA 2W91A 5F37A 5EJ1B 5FK7A 3E8GA 5E88A 4AR2A 2MNGA 3IPVB 1STMA 3HNYM 3H8RA 2HFEC 4R9BA 4EWAA 2HWB3 1OQEA 4JAVA 1AR73 1N1TA 1ENRA 4CDWC 3ZHUA 1IPSA 3ZHQA 2UWCA 1BBT1 1GWLA 2VQ0A 2H8PC 3VDDC 1AR72 4CYDA 1QIQA 5GZFA 5E89A 4YHHB 4Q0SA 1F7YA 3PUHA 1HQNA 1QH7A 3PVOA 4LFAO 1UCXA 1SA0B 2X6AA 3C7EA 1C28A 1YWKA 5DZEA 3JZVA 4JCKA 2VECA 1MVEA 1QJU1 4BQ5A 5FO7B 1SF9A 4NHYA 3TCUA 4IUGA 4PLOA 3OGSA 3ZO0B 4IL7A 1EZVH 4AFAA 1NR7A 4YY3O 2YEVA 4GH4A 1LEMA 3NKGA 3OCPA 3H1KH 3KHCA 3HT1A 1AR1B 2JGUA 5E1RA 1F2NA 4NKGB 1X33A 1ZTEA 3SJAC 1U96A 2A3YA 4XQDA 1DDLA 5CKMA 5DXDA 1FFTB 1LJ7A 3SITA 3VHRA 2QQJA 1PGSA 2Q1ZB 3WW4A 4QPIC 3RYRA 4AK3A 3ACFA 4ATEA 4J9ZB 3AMPA 5HBAA 3WQ7A 4HBNA 1G8WA 1G1XB 3LF7A 1G86A 4OHZA 3MFCA 2UUCB 1DGLA 1WLEA 1V6MA 5CA6A 2XHNA 3WF4A 4FBFA 2XWJB 3A2FA 2DU0A 1SERA 5T3NA 2JJ2G 2W92A 3OJBA 4WZFA 1SDDB 1XMOB 1YF2A 3POFA 3GWOA 2OTJV 4YW5A 1AX1A 4GB31 5JOZA 1XQ8A 1NCRB 3E1F1 3BODA 3PURA 2ZACA 3ZHVA 3VBHB 1GN4A 3ZFFC 1V54B 3L9DA 2IJHA 2ZX0A 3AKPA 3VL8A 3JSLA 1GNZA 4GMP3 3WLUA 1AR93 2CH7A 5H9QA 1GKFA 2IXHA 3JCIA 1AR92 1UX6A 1BCCH 3R66A 1BHBA 1DYOA 1S72V 1OOPA 3APQA 3U1XA 2WLKA 5J2TB 3EFFK 5IYBO 3WT3A 4X6QB 3TEWA 2UXCO 3VBUA 2AZ0A 1I94B 2Q8EA 4BQWA 1UY4A 2VY0A 4BQYA 4O4HB 3VOUA 1NCQC 2VW1A 4Q2FA 3FN9A 5A7WB 3ES4A 1W6PB 1O9HA 5I0TA 2RDSA 5H6QA 1Q6UA 2Y33A 5LEKA 3OY8B 2IXKA 4DMIA 4MGZE 3MIFA 1DBNA 1TUBA 2Y69B 1DLLA 2XHKA 3O1RA 1CAVB 1AHSA 3UGHA 2BEOA 5A6QA 3E6DA 1PZ8A 5C4WA 1AJNA 3CCUV 4FMTA 4LEJA 1S5JA 1M57B 4J1XA 4XMIA 4QHBA 1PNLA 3MHSC 4Q4X3 1Y9GA 4MTFA 4YIOA 3ABKB 4FPGA 4LQRA 1NYWA 4XIOA 1ZX3A 2JECA 2QQLA 4A5UB 3V65A 5DAXA 2GNBA 4R50A 4N7UA 3ILNA 3POYA 3AKTA 1BEV3 4L97A 1K4CC 1IS3A 4P14A 2VM9A 4K6BA 4DV7B 3CCJV 1DTOA 1BEV2 2CE4A 3CMEV 2ERFA 1WMDA 1R081 1U12A 1HV1A 2QQKA 1VAMA 4DV4O 2ZM6O 3KSCA 1WWYA 3ABLB 4DEQA 2VZPA 4BJ0A 3R4DB 1F9KA 1N34B 2JXAA 2YU1A 3CX5F 4JHTA 2B46X 3H0OA 3GGLA 2DV9A 4LF9O 4QGMA 4OCTA 3T2QA 1HR0B 5LOVB 2YBSA 5FYSA 5FR3A 4EZHA 1SHWB 1T5EA 4N43B 3ZN4A 1L7LA 2HLDG 3W7WA 1OLQA 2A1XA 1UZ0A 3IN9A 2EXJA 3K4DA 4X1KB 1RB8G 3BKZA 2VZ3A 2EIEA 4MG2A 4YXWG 3JATA 4DPNA 1FNZA 2LP7A 2JDNA 3WHTA 2PAKA 4TLFA 4QPWA 1KKDA 1XJAA 3DXTA 3VZKA 1E5HA 1ENXA 1I5ZA 1VARA 4YJ3A 1CEZA 2IWGB 5SV8A 2A6XA 1TE1B 1RVF3 5FYUA 1BMV1 2Y38A 1OPOA 3FWEA 1K92A 2C5DA 2B1IA 2ZTNA 5I93A 1RVF2 5C8YB 3ACGA 3HMYA 2OPKA 3RWRD 3LEIA 2LALA 4NOTA 1GANA 4QQPA 1RUC2 3W9AA 1R1A3 3AP4A 1IVSA 4LXLA 4C91A 1EV13 3RYIA 3AVSA 3I5DA 4LR3A 3VBSB 4BCUA 1NE4A 2BBVA 3RYCA 2X05A 3POSA 1R1A2 3RYPA 1EV12 5FNVB 1HP8A 4B8EA 3N9PA 3W59A 3J7MA 4LF4B 1SBDA 2FMLA 1O5LA 3NAPA 4A6SA 3VBRC 4CDQB 3F7VC 1RHI2 1VQNV 1RUD2 2RS33 1UWWA 1AR5A 2WLIB 3WP3A 2JDZA 2QEXV 2XBO3 2Z69A 4I0BA 4MW8A 5CB4A 1WJZA 4XURA 1NUKA 1GOFA 3IBMA 4AGVA 4UFJA 3GCWA 2C24A 1OHFA 3ZSKA 2E75B 3UYJA 1CESA 1AR83 3MYXA 1G9AA 5FO9B 1CX1A 3LPGA 3S3WA 1V6IA 3ZYIB 4YGDA 3MPBA 1AR82 2KM2A 5A3OA 3ACHA 5JPMB 1QQP3 3I54A 3GHMA 5FV3A 2VAUA 4BWOA 1QQP2 2QDRA 4JGYB 2VQTA 1UOGA 4JI4B 1JX9A 2QTSA 4UI9L 3KLSA 4LF8O 5A33A 4BYYA 3HKDB 4DR1B 3Q8EA 1UZZA 3KWVA 2XJRA 1OQ1A 2AREA 3WG4A 2PYLA 1SQFA 2ETEA 4MXVA 2P4EA 3RWKX 5HI0A 5GALA 3NR7A 3PVEA 1BK1A 3GM8A 4DR6O 2XUMA 3GBFA 1K8AW 2EXIA 3WW1A 3AZXA 5KXBA 5EZYA 5K8SA 3E86A 1WB7A 2WNVB 1PM7A 2WC2A 1W9SA 4SLIA 2ZAAA 3N7JA 2VMEA 4IEOA 3DF0A 4DRXB 3BYWA 4I02A 1US3A 4YM3A 1AUYA 2Q68A 4HXCA 1S5LZ 2G9FA 1W8ZA 4W4LA 4CCCA 1HB2A 5EC2C 2GSMB 2DQ3A 1YFYA 5B1BC 4L8JA 1OSGA 4GWMA 2PAMA 3HKEB 4ZU4A 3OD4A 1J3QA 4TV8B 5ITZB 3H7YA 2B1GA 1B04A 2OCCB 1HXS1 1TME2 1HB4A 4U7OA 2PHUA 2DURA 3RS6A 2FZ1A 4XE9A 1ZLZA 3WW2A 2OKXA 4X64O 2WWUA 1DZRA 3FYEB 3ETGA 2PLV3 4QX8A 4KWLA 4EKWA 5D1IA 3VD7A 1W2NA 4AYUA 1TNFA 1UXXX 1QLEC 1W9YA 3AMMA 5KHGA 3IZOA 4DEVA 2BTQA 3JAWB 3TAYA 2BDRA 2JDYA 1HNZO 2DTWA 2P3IA 1RUJ1 3OG2A 5HXVA 2F6BA 5E79Z 4RQPC 2EJ7A 3CBNA 3ZXDA 1SBEA 2CAZC 2X8KA 1J3RA 2XG3A 1W04A 3TN93 2D40A 4JI6O 4XF9A 1GM9A 1XI1A 3ZRWB 1QVGU 3IAPA 1ZBE1 3TN92 3SLIA 5H2FZ 3VBOB 3N2GB 2A70A 1ND3C 3DKQA 3N9OA 3PHMA 4ITCA 2Q30A 2VMIA 4KU7A 1PX3A 3ZYHA 3CHXA 3RZZA 4NIHA 5CEHA 3VKNA 3P6BA 2CSGA 2EVXA 1XYPA 3FKSG 3M7MX 3LEGA 3EVKA 1W6QA 3ENRA 3N7MA 1NY71 2JG8B 5IJ9B 4G3YC 1Q8VA 4GX5A 3RJ2X 1QJU2 3B40A 3JARA 1QNWA 1XL4A 4F4LA 3FBMA 1SBFA 2H6BA 1RUI1 1K5MA 3K5NA 1V55C 1Q8QA 5FLXN 4P9JA 4P5YA 3RT3C 4RO2A 2JD4A 4C90A 2XNDG 2VCBA 5DQ0A 2P6JA 4UXNA 2SLIA 1EAH1 2ZGLA 3GBGA 4GJZA 4B29A 3KQRA 3UJQA 3JD71 3Q4HA 4BIUA 5FQ0B 3VQWA 3KV6A 4O4LA 4UUJC 2JDHA 2VZRA 1KQSU 1OKQA 1VR3A 4CCOA 1F5JA 4P2ZA 5IYDO 5C70A 2JEXA 5KHIA 3A21A 2H94A 5BNNB 3NV2A 4I5SA 3VZLA 4WM8A 3FJSA 1K5MC 5IFPA 1QU0A 5CU1A 2G9GA 1QHTA 4DXRA 2N74A 1LU2A 3FHAA 2HKXA 4GB33 5FZAA 2DFBA 5CB7A 3BU0A 2RJZA 4K0KB 5GZDA 2ZEYA 2FMYA 4GB32 3G67A 1LR5A 2OT5A 1WW4A 4Y1VA 2E26A 3E22B 1GTOA 3K51A 4IE5A 4FP2A 1GP5A 2XLGA 4Y24A 4AFMA 4QAWA 1O59A 1AI5A 2WAMA 4NUBA 4UW3A 3BVCA 2ID4A 4LLOA 3KT1A 1FT9A 2BTVC 2RNBA 1GYKA 3D8CA 3NV4A 5F2VO 4FJCC 1KP3A 4J80A 2NP0A 1GO3F 2IFWA 4Z1MG 1KJLA 1WBLA 1JXNA 4YJ2A 3OBRA 1YJWV 1ND2C 3CL1A 5KR7A 4EWDA 3WUDA 2RJKA 2VNRA 2HHHO 3GJBA 2VJXA 3BRCA 4YZ3A 4Y22A 3H7JA 1PZ9A 5C8CB 2GMPA 1NZCA 2UXDB 2YPJA 3ETDA 4I4TB 3NJZA 1GZWB 5LY1A 4W8JA 5EP9A 5KXDA 2XXZA 4UFHA 3BA8A 2IXLA 5CFCC 1VF6A 5A3NA 3R0RA 1M4WA 4IV1B 3O1PA 2R1BA 3AMNA 1OCOC 2A9HA 4NXMO 2WWSA 3NJXA 4O4IB 1IBLO 4LT5A 2X7RB 4P02B 5FMDA 1ZL8B 5JZGA 3ZYFA 3T30A 4TUYB 5FPZA 4NTWA 1XSQA 2PA7A 4B3SO 4WF9V 1I5YA 3R65A 4ES9A 3KV9A 1FYUA 4TSVA 3AG2C 4QX5A 3B94A 1BZWA 1JZ7A 1RPOA 2C4XA 1POV1 1ZUQA 3ZDVA 3K75B 2JDIG 4HT1T 4Q4V3 3IM0A 1DGSA 3ZN0A 3Q8FA 1VAKA 3T2PA 4ZOLB 3T2MA 4MO3M 4Q4V2 2ZAHA 2WLLB 3BPZA 2RS11 4QPGB 1CAXB 4KL1A 1I7FA 1XNRB 3HPNA 3IDBB 2YFUA 1VIWB 3I3QA 3H8XA 5C3RA 2ZEZA 4RS5A 3LD8A 4Y33A 1N33O 2VGDA 2XWBB 1JZ6A 2Y64A 4BA6A 2WNUC 1QU7A 4I01A 2Q73A 1VF5B 4YGEA 4MVOA 5FY7A 5CADA 5JR7B 2W1QA 5DECA 1CZTA 3F2ZA 1OCCB 3C7HA 1DK1A 3DPRB 1YCIA 5EBWC 1AYN1 4WZCA 1CJDA 3WFVA 1JN2P 3AZZA 4M3CA 3JALB 4CUCA 2A6YA 1W90A 2LW7A 1YXWA 3MHZA 2AZ2A 4N21A 1FAFA 1PMHX 2VS0A 1AR63 4PF5A 3T0BA 4OUEA 2DYRC 4MTOA 5T52A 2EXHA 2KKWA 2RR11 5C6CA 5LA2A 4CTEA 3NWKA 4A3XA 3AG3B 3GVMA 2VZ1A 1KD7A 4AEMA 4OMCA 1TUEB 3CJIC 1FMD3 3PDQA 1HV0A 3LSSA 4BM8A 3RGBA 1YITV 2WSSG 1O4YA 2AH2A 2E7AA 3QCWA 4L2NA 4LF7O 3N2KB 1ZZ9A 1VRH3 1ZVFA 1H9PA 3H1MA 2BQPA 2EILC 1VRH2 4AF9A 1XRUA 2LQTA 3PIJA 3HR9A 1QWRA 4X66O 5FJKA 4LBQB 4Z8BA 2MEV1 3ZMZA 2VD7A 1M5IA 4DS0A 1H6YA 3INAA 4ZZ5A 1LTEA 1PGL1 5FPXA 1IXBA 3OFNG 3AG1C 5FY9A 2P4KA 2VBBA 2G1MA 1LCLA 2BVBA 3ZFEC 1D2DA 2UXBB 4E4SA 1K12A 2W2IA 3I3DA 4CXWA 3V0AB 4ORFA 4LNUB 1WMEA 2XVLA 4CDWB 3ABTA 2ZCEA 1GUIA 3ZBHA 2GNMA 3UV9A 1E1QG 1CAUA 3HBKA 4TN7A 3VDDB 2A6VA 3ZMNA 4JDMA 2ITDC 3SPJA 5SV5A 1JPXA 5FZGA 3QVNA 5EYXA 3ME2A 4LWSA 1H9WA 3NRUA 2PHFA 4QB6A 2B4KA 1W05A 3GBWA 4C8DA 1MS3A 2ILMA 4ARYA 1H2MA 5HPOA 2PHTA 4URAA 2W52A 5FZ6A 1YJKA 2ZHLA 1WMFA 3PNAA 2JS3A 4XTPA 2HWF1 3IB3A 4LBMA 5IVYA 4ZXKA 2OS2A 4UF0A 1NVPB 3IMMA 1NQJA 4AEJA 4TWTA 2YI8A 2YC4A 1J5EO 2VTFA 3WCSA 3N9MA 1GMGA 3T4DA 1CPYA 2IXCA 2A79B 2WLQA 4QPIB 5KX5A 1S77D 1V70A 2D98A 2VQUA 1UOBA 5FZDA 4YVWC 3CE2A 1CR7A 1GM8A 1HRI1 1HW7A 2QTOA 3CIHA 2WT1A 2JS5A 4GH4B 5FZ9A 3JAKA 3FE5A 2YBKA 3WR0A 5FXXA 4LHLA 3SXWA 3JBG3 4BB3A 2QNKA 1XNDA 4HAMA 5FPBA 5FY5A 1Q8OA 3ZFFB 1OF3A 4M3CF 4B3MO 2BGPA 3IDEA 4AE2A 2WPDG 4QPJA 2QDOA 1P8JA 2FB5A 5C3SA 2GC3A 2VVFA 4QB1A 3UGFA 4PA3A 5FZ0A 5A32A 4DR2O 1O9GA 4JI3O 2E6VA 1ZRRA 5KHKA 1RUJ3 5L36A 4GIQA 4GWJA 3BI3A 5AG2A 1M4UA 4GKJO 1BSMA 4LFAB 4RHV1 1GWKA 3KS7A 2DYCA 3E89A 4AHYA 2B9UA 1RUJ2 1XUQA 4JI7O 4G4FA 4ASLA 4YW2A 5B1OA 5DG2A 2DCKA 4YM2A 3NJYA 2DW4A 1NCQB 4BLJA 1VLNA 3T2TA 4DXTA 3CEIA 1S0IA 1ZRFA 3OUIA 2ZHKA 4FPHA 4PJYA 4KG0A 2Q8CA 5DUUA 2C1FA 2Z5WA 4RA0A 1RL3A 5JUVA 5IWFA 1YRZA 4B4RA 3VKMA 4LO7A 2GC0A 5HCBA 3MDPA 1VBA3 4XAAA 2GUZB 5IUQA 3NKTA 3VBUB 5JSPA 4Q0PA 4UVCA 4W6XA 1YQ8A 1NY72 1RIRA 1WBFA 1AI4A 2E74B 3DC6A 1RUI3 1N3QA 4J1WA 2WT0A 3FHQA 1RUI2 2YIBA 3OD0A 1Y4WA 4FP3A 1S55A 1TUBB 3K4AA 1IBMO 1KDMA 2YGMA 2QQNA 5C9AC 1YFWA 1EAH2 3WQ1A 4QJFB 4I9QA 3DC5A 2WNEA 2PYJA 1YXBA 1XU1A 3JD72 1U5XA 4UV8A 1AROP 3SYPA 2C9AA 2VWJA 1RUE3 3ZYRA 4CCLA 4D7TA 3PUQA 3K46A 5J09A 2WZ8A 2K1EA 3OE7G 3WEZA 3RZJA 1VQ9V 4YW1A 4Y4YA 3M8LA 1ZBA3 4JI5O 2FL4A 1ULPA 1FD9A 3CCQV 4P00B 4QU1A 1ZM1A 4QXBA 1ZBA2 3WG7C 5FO8B 2HEWF 1IDSA 1VBB3 5FPOA 4DYLA 1EY2A 1FV2A 3IT8A 1HNXO 3FD9A 3B01A 5JCOA 1VBB2 5FP4A 3VZNA 4EN6B 4XDQA 4FPFA 2OX0A 3D0SA 2QTWB 1ONAA 1ZRCA 4IEWA 2CTRA 3UT5B 3QH7A 2H3OA 3I2JA 5A7NA 2Q4SA 4AEDA 3RZGA 5LP6C 2NN4A 4AHXA 1VB2A 3E97A 1ZNPA 1Q6HA 4MTXA 4KP4A 3AVRA 3RSJA 5KMGB 1UJWB 5T5PA 1PM4A 1SZXA 4MYEA 4PIZA 3DTUB 5D21A 3JATB 1SEFA 4JTCB 3UM7A 4BLIA 4IE0A 1XYNA 1PNMA 2ZR3A 2Q7GA 1NXMA 1BQZA 5TSWA 4XJZA 4PDLA 4I0XA 4OI2A 2BJSA 4KHPO 2EZPA 4E4DX 4XCAA 4LFBB 4CH3A 1UD1A 5F5QA 2IXIA 4WVZA 2F4VB 2ORXA 4A45A 4JYYA 1OQDA 5H9CA 1YZBA 2YPDA 1S2KA 2Y6KA 4CH6A 3N27A 1UX7A 3M4FA 3C7OA 1HIXA 4DV4B 2PMWB 2UYBA 1H8TA 1SQPH 1TEIA 3B3QE 1Y4MA 2D3SA 1VAVA 1L8DA 4KI5M 4LBOA 1HJFA 1LAJA 3L72H 2DVGA 3CRQA 1RUF3 5EWSA 1U0AA 3ETPA 4LF9B 2BFUL 2GZWA 4LO5B 3THTA 2ZIOA 1SLTA 1H8HG 1WMXA 2KXLA 3K59A 3TNQA 3SPCA 3EO6A 2GP3A 5J9PC 4XF1A 4DUXA 2XQRA 3NAPB 2RS12 5FUNA 5J36A 3JU9A 3W7UA 4HSLA 4RWUA 1L1FA 1ODMA 3JAMN 4JI0O 4PLNA 5EFUA 1IS4A 4HONA 4MVSA 5LMNO 4LBNA 3PVNA 3DECA 2O14A 2ARAA 4JZRA 5CB4B 5FBJA 3PUIA 5IDJA 5KLVH 4CCNA 3AYAA 3H1IH 2J1AA 2YMZA 3ZN6A 3VHNA 2NYYA 4HOOA 1Y66A 1BJQA 3L74H 3KCYA 1YI2V 4OI1A 3FAVB 2OUJA 4JF3A 2BSKA 1WCQA 3NNGA 1T6BX 3ZS8C 3N7LA 2V4DA 2UUBB 2QBXA 4U3JA 3PLQA 3J9SA 1ZZ8A 1XC6A 3HN3A 3LDBA 3ZN1A 4AVAA 4FOVA 2WZR3 1QQCA 3V0BB 3ZFGA 1W06A 1YIPA 4Q8LA 4I50B 2RN9A 2RR12 1Q7YW 3LEMA 2R041 1GQHA 3LCPA 3WW3A 2E53A 3SKJE 2E3CA 5B1BB 2Q4PA 4DV1B 5BR8O 1CAWA 4ZHNA 3KB5A 4K7JA 3ZJZA 2ZGPA 1US2A 2I74A 4QKDA 2PI5A 4YFZA 3B8NA 3C3TA 2ITCC 5EZYB 1WP7A 3MLJA 4YVSA 4DY5A 5LYJA 4LE3A 5C7GA 4AG4A 2AGAA 3ZFGC 1NZIA 3MICA 2VQEB 4XUQA 3VZMA 3KQ4B 4GWNA 4CU7A 1IQDC 2XLFA 1TVKA 2RS51 3QNEA 1QLEB 4CBCA 4UW5A 4UBGA 1PZ7A 5IJ0B 3S5AA 3IJ4A 1W6OB 1DCSA 4I30A 4CCKA 3MGUA 2MEV2 4EWEA 4RQPB 2R72A 2QWPB 4FPPA 3LWCA 4TXWA 1CQ9A 1PGL2 2RDQA 3IGAC 1NCRC 1JOPA 3FX7A 1V54C 2E5LB 2ZIMA 2Y6LA 4RQFA 2QQMA 1XE7A 1W99A 1X59A 4RR3A 2W1SA 5I8TA 2XAGA 1ND3B 1OD5A 3PJQA 2J22A 4CRQA 2R7EB 2BTQB 1WKYA 3KKYA 2C6SA 2JG9C 2A71A 5DABA 4YM0A 3ZVXA 4MVQA 5FY4A 4X20A 4OULA 5JR2A 2IU0A 2BGOA 3G6JB 2WO3A 1ULGA 3KT4A 1RGSA 1OCRC 4X8AA 2OIGA 4MS2A 4XBLA 4LA2A 5F2WA 1AL21 1V55B 1E5SA 4I2OA 1VF7A 4YRDA 4NPRA 2PELA 4XETA 1G9DA 3SH3A 3ZHSA 4IEPA 3WDWA 1EFRG 2R0HA 3AP5A 4NVPA 3WDYA 1SRYA 1UPSA 2ZKNA 2Y69C 1D5AA 4ZS3A 4GZ9A 3ZR6A 4X64B 4AAXA 3UGGA 5CA3A 4CCJA 4PCRA 4BQ2A 1KYOF 2WINB 2XL7A 1PHMA 3O1MA 3EXUA 5LA1A 4FXKB 1X7NA 4C1WA 1K5MB 4E2QA 4S2HA 3W21A 1FXHA 4DV0O 1Q81W 5IK8A 1UYYA 1Q5OA 4XCBA 2R073 4DK1A 1HNZB 3OBTA 2Q69A 4CU8A 3KM5A 4ZY9A 1O8SA 3RZKA 3B09A 3KGZA 3FFZA 2IC1A 4W50A 2R072 5BNPA 4DR5B 1QOSA 1UNBA 3BIWE 4R9CA 4BMBA 5CBGA 4PI2A 2BE3A 1WGPA 3RFRA 2DYSC 3OEHG 3TXSA 4O4LB 1L3JA 3SPHA 4MW3A 3RVZA 1JODA 4WM8B 4DFSA 3VV1A 1O3QA 1ENVA 1AP5A 2XPJA 3BGAA 4XDOA 1PVC1 3LSDA 4AZZA 4MVZA 1LOBA 4RHV2 4E8CA 2PTMA 2AYHA 4W6WA 1ND2B 1PNFA 2KG7A 4X1IA 3BOWA 3IDCB 3HB3B 2KSDA 5KHJA 3HD8B 1OH4A 3Q9OA 4IHJB 4UYBA 1XBFA 2VCMA 2JDAA 2VVDA 1KQRA 2O8OA 4X88A 3W5NA 1DHKB 4DV6O 3APOA 2JVDA 5CFCB 5CBLA 2CV6A 4JI1O 2R32A 2EIKC 3ZYJB 4QNHB 1JA8A 5ERLA 3E2EA 3O1TA 3HPLC 2CHHA 3VUOA 5D2AA 4MHRA 3KV4A 4S2DA 1BK0A 2YIAA 2W39A 5A3UA 1JUIA 1XNTA 4Y22B 1RUG3 4NE9A 4IYIA 1WUVA 4WM7A 3OGCC 2YV8A 1MQTA 1JOYA 1T6GC 2RVAA 1Q43A 4IGPA 4XF4A 2Q8DA 3J8F3 3AG2B 1RUG2 2BVVA 4BPZA 2VR4A 3ZHRA 2QA4V 4ZHQA 2NLJC 3CC2V 1MMMA 1ZA7A 2D93A 2VZVA 1I9RA 1TVGA 4E2SA 4X65O 1PGW1 1L0LH 3JASB 1QNMA 2XUEA 2Y6JA 4X62B 2C0ZA 2WNUB
chains in the Genus database with same CATH topology
3W59A 1MQTC 3BOPA 5T5JA 1SBDA 1RITA 1NXD1 1VBE3 1O5LA 5BNOC 3NAPA 3S0MA 3SWTA 4S2FA 1DGRN 2VW0A 1NLRA 1V6NA 5CFDC 4FSJA 3H3UA 1IS5A 2ZGNA 3O0VA 4N90A 2VNOA 5GLWA 4SBVA 3VBRC 4CDQB 1VBE2 4META 1FI2A 4YW4A 5CFDB 3ROUA 1RHI2 1LGNA 5F9TA 2VH9A 1RUD2 2RS33 3VKFC 2WQZC 4XF0A 3VBRB 2XJSA 1MS1A 3WP3A 2JDZA 4LNVA 4NWWA 2XBO3 2Z69A 1JBCA 4YLMX 4I0BA 3GZTB 1KFUL 4RS5C 2GU9A 1GFF2 3IBMA 4AGVA 1PNGA 4DB5A 1HDKA 1UKRA 1YI7A 1MACA 3EBRA 4JRAA 1H1IA 4HKWA 4AHZA 1OHFA 3ZSKA 2GALA 3JQXA 4LBQA 4Z07A 1CESA 1AR83 1RUF2 2VOKA 2BUKA 4M26A 2LTNA 4N53C 1A6CA 4CZSA 3T1LA 2RM21 3MYXA 3WG2A 2WL1A 3QACA 1RMU1 5FO9B 1G9AA 3AYDA 2W68A 1IOAA 2ZGQA 1LENA 1V6IA 2ZGKA 3ZYIB 4YGDA 4AI3A 3MPBA 1AR82 2EF6A 2HEYF 2KM2A 4Q4W1 4ATFA 3N3HA 2XGXA 2VG9A 1NA1A 1BMV2 3OYWB 1GKBA 5JPMB 3MIGA 1VP6A 1D4M1 2WS91 4XJAA 1S1AA 3MI8A 1QQP3 3I54A 4NHKA 1X50A 1RUH1 3ZSJA 4JGYC 1PIV1 3GHMA 4CDWA 1NLSA 2Z2SB 3WDUA 3ILRA 2R061 4HKLA 3AMHA 4BWOA 2B45X 2WJSA 2AUYA 1QQP2 3CJIB 4ES8A 2QDRA 4JGYB 2PLV1 1OIJC 1HRV1 3VDDA 1MEC1 5K9YA 4LO8A 2ZGSA 2D97A 3KLSA 3N4MA 3O5SA 4AQ2A 4M3CB 2LUWA 5ACA3 5A33A 5BY5A 4BYYA 1UZZA 4IESA 4XHXA 2JKBA 4DNYA 4A7ZA 1QJX1 5BNQA 1JOJA 2XJRA 1OQ1A 1QXRA 2AREA 5E8AA 2MHFA 1H8TB 3CU7A 5ACA2 5ABJC 3WG4A 2ETEA 3LZZA 4MXVA 1CPMA 3WNXA 5HI0A 5GALA 4CDUC 3PVEA 4YYOA 1BK1A 5GLZA 4GQ7A 5GLTA 5ABJB 4HVRA 4CEYC 2XUMA 1ZX5A 3GBFA 1W6NB 2EXIA 2VMHA 3WW1A 3AZXA 3ZYPA 1JR7A 5KXBA 5K8SA 2WNVB 4IEQA 3UKVA 1PM7A 2WC2A 1DFQA 2Q4AA 4SLIA 2ZAAA 3N7JA 1C5HA 2QKDA 3TN91 5FDBA 4HVOA 2GMMA 1YIFA 4IEOA 3U10A 3DF0A 1UPIA 1A8MA 5EV7A 1YUDA 4AI1A 4R52A 2HWB2 3TBDA 4I02A 4YM3A 2IXJA 1GNHA 1N1VA 4YFWA 1AUYA 5C8WA 4JGZC 2G9FA 3WZ1A 4JC1A 5HSXA 2I45A 4FCAA 1WW5A 2BGCA 3B7MA 1VALA 5E16A 4XFFA 1YFYA 4M01A 2WZR2 1OSGA 4GWMA 2GH2A 3B9CA 4CDXA 4M3CE 2DUOA 2PAMA 5I8YA 4ZU4A 2RM23 3OD4A 1J3QA 1RMU3 4M27A 4QPIA 3IIAA 3H7YA 1RTVA 4IXLA 1SDWA 1HXS1 1TME2 1SLBA 5JOYA 2BW8A 2P3JA 4Q4W3 1OIIA 1ZA4A 1PO21 4QQHA 1UN1A 2GH8A 1RMU2 2DURA 2PHUA 3RS6A 2FZ1A 5KHHA 4XE9A 1PK6B 1D4M3 2WS93 2OZ6A 3CO2A 3WW2A 4GULA 5LRRA 1MZFA 2CGNA 1XE8A 1RUH3 4GA9A 4K40A 1N3OA 1C8NA 1PIV3 5JLVA 3SCGA 3AZYA 2A7AA 1OA2A 1OFNA 3ZN6B 5JDBA 1D4M2 1DZRA 2R063 1G7YA 2XLAA 1NCRA 1LEDA 4E27A 3X29B 2PLV3 1RUH2 1MEC3 3CF6E 4KWLA 1AXKA 1RUOA 2PHWA 2VVEA 4HANA 1DQ0A 5GLUA 1PIV2 4XPVA 5AVAA 4MXWA 4D7SA 5D1IA 2NMOA 2R062 4AYUA