1YCIA

Factor inhibiting hif-1 alpha in complex with n-(carboxycarbonyl)-d-phenylalanine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
336
Chain Sequence
GEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of factor inhibiting hypoxia-inducible factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
total genus 99
structure length 336
sequence length 336
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1yciA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yciA01
2Y0IA 1MZEA 2YC0A 4NR1A 2WA3A 1H2KA 3OD4A 1YCIA 4B7EA 2CGOA 1H2MA 2WA4A 4Z1VA 2XUMA 2YDEA 2W0XA 3D8CA 1IZ3A 4QU2A 4Z2WA 1MZFA 3P3NA 3P3PA 1H2NA 3KCXA 4B7KA 4JAAA 2CGNA 1H2LA 5JWPA 3KCYA 4AI8A 2ILMA 4BIOA
chains in the Genus database with same CATH superfamily
2XAJA 1VQ8V 4LF8B 4B1MA 3JSNA 4JAUA 4DR3B 2D3OW 2DVFA 3HQUA 2EILC 4TSVA 4YW4A 2JB8A 1IPSA 3CC7V 4JV5B 3V64A 5CADA 1W8FA 5FXZA 5FPZA 3AVSA 4GWNA 3GGLA 4BA6A 1ZBE1 3OBZA 2PI4A 2WLQA 1LEDA 4X1KB 3A4UA 2UXCO 4NIHA 1FV2A 2R1DA 4CXXA 1COV2 4L87A 3VD4A 3AFKA 4F4LA 5FP7A 2HBUA 2Q8DA 3RWNA 2M6YA 1OURA 1NQTA 1QH6A 1WAZA 2DU0A 3S3XA 3AP5A 1OH4A 3ES4A 2EVXA 2W52A 5K1XA 1GICA 1N32B 3K46A 4XHXA 4JDNA 3T09A 4BOWA 5JJJB 5BY1A 2FCUA 5BUVA 2ITDC 3VZMA 1LHNA 1PNLA 1URXA 3EVKA 2YMZA 5A9GA 1W2NA 1FATA 1VQ5V 3BU0A 2OCCC 2WLLA 1OD3A 1RUD2 4XE9A 4GALA 2JJ2G 5DZGA 1D2QA 3GM8A 4D6SA 5A7WB 1F31A 1YFUA 4LF9B 1XJAA 2EZPA 1V6IA 3BYWA 1QR9A 3I3MA 1QH7A 5FYVA 4B7EA 2DUPA 4XZUG 4P9WA 2WA4A 4RYDA 1LOBA 1HRV3 1V55B 4NPRA 2QBXA 4JYBA 3ZO0B 1A32A 2HWE3 1YUDA 4WBBA 4YPJA 5JDBA 1IDSA 2WPDG 4QPIB 1XNRO 2ZMLA 3T4ZA 1QOTA 1UWWA 4WM8C 1FT9A 5LOVA 3TEYA 3T4DA 3RYHA 1ENRA 3B94A 4QPGB 5FPLA 2WKKA 3ME2A 4AFDA 1W04A 1VIWB 1FAFA 4TTGA 1D2SA 5C9AC 2ZEXA 2G9FA 2JG8A 3RI9A 5LATA 2EILB 4Y1XA 1D4M3 4IIJA 2HEYF 3JARA 3K3OA 5KR7A 4FLXA 3ATGA 1HR0B 4UAPA 2VMIA 3ASOC 4JV5O 1UD1A 4MUVA 3JD3A 2VOVA 3I2FA 2WRAA 4YG0A 4LOTA 5KXBA 4I50B 4EEQA 1Y9GA 2ZPXA 4BQ3A 1SG3A 1UW8A 1BLZA 3GYDA 1ZRIA 1VF6A 4X1KA 3CWBH 4B3RB 4B4RA 1YSCA 1R1A1 4O4LA 4GKXA 4FZ1A 1ULFA 5GLZA 1DHKB 1V6MA 1YLLA 5KMGB 3AG3C 5FNVA 3IM0A 2GP3A 2QTWB 2AH2A 2ZMNA 5B4XA 4LF8O 5E1RA 2JKBA 1BQZA 2LFRA 2WA3A 4CC5A 4TV8A 2NN8A 4PDWC 5B3SB 2I45A 1NTMH 2DDUA 5GONA 3RFRA 4FQ4A 4LJHA 1U5YA 1KRIA 1GAXA 4WBNB 4P02B 4NPMA 2GTSA 5E6HA 2A3XA 3CCUV 4BMBA 5HCHA 2YS8A 5C8CB 5IJ0B 3WSOA 5C33A 4GH4C 5EWSA 4MHUA 4CCMA 1N4CA 4XABA 3DYPA 5A3NA 2KG7A 4J11A 5LY2A 1XC6A 1WPBA 1RUG1 4FOYA 2IXKA 1TG7A 2ZQMA 1Q8OA 2D5FA 3DKWA 5C4WC 1NXD1 4HYOA 3AG1B 5CFCB 3IDAA 3HB3B 5J7MA 3HN1A 3WNMA 2DYRB 3IC7A 1W99A 5FO7B 4BK4A 5FY0A 2DUOA 2V4DA 3GHMA 1HXS3 1OV9A 4I02A 4XCAA 5LGUA 3W7UA 2FZ1A 1CX1A 2B9VA 1YI2V 5JJNB 1MZ6A 1FMD1 4AWDA 4XF4A 1RUE1 1IBLB 1JFFB 3ZN1A 1AJNA 5H6RA 3LSEA 2JD9A 2BW8A 5CFDA 3CD6V 4NHMA 5C7GA 4C7UA 4FLZA 1FXKA 5B1AB 3SH5A 1J83A 1PO13 1TE1B 1YJWV 1IBMB 2VTXA 4RQEA 1HNZO 5CAZA 2R071 3DXRA 2XGXA 4BE3A 4K8RB 2BCCH 2Q0OC 2H0BA 3ZRSA 3IZOA 1CAVA 1OF4A 1SZTA 3NV3A 3VBFC 4CDQC 3JD0A 1SQVH 4MTOA 1KD1W 1W8TA 3JATA 3ABTA 2D6KA 4X1YA 1AL0G 2GH2A 1Y74B 4I2OA 1SZXA 5KXEA 2X53S 2LALA 1Y4WA 3L74H 2VXRA 1YQ6A 3AG4B 5IK4A 3HKBB 1JUHA 5IYZB 3W7WA 4QGMA 5FYHA 2GSYA 1W8HA 1N34B 4DINB 5JPMB 4B3MO 1LHUA 3HN3A 4JI8O 4A7ZA 4FLVA 1YIJV 4PF1A 4CH3A 1BEV2 2A75A 2Z4FA 4Z92B 2YU2A 4Q0UA 4B7KA 4UW4A 3ASNB 3N7LA 2YSUB 3SNMA 5EP9A 4B1LA 4F7ZA 4YIPA 4EV0A 2JKXA 1YIFA 2V09A 3A21A 2RCVA 4RQPA 3ZS8C 2WT2A 5H9RA 2OZ6A 3RJ2X 1US3A 4LKDA 2VOXA 3VBRC 3K3WA 1SERA 3GF6A 3ZHVA 1AR71 2D6NA 2PHUA 1TME1 4WM8A 3QTCA 3H3ZA 5LA6B 4AI9A 1UYYA 2V7QG 2R70A 4R9BA 1DCSA 1Q86W 2G9GA 5GKAC 4CYDA 1ZRDA 4O4IA 2PN5A 2EIJC 4JTOA 3VQVA 4WM8B 1ZNPA 3K4AA 1LNSA 4JI6B 1VBC2 2XASA 1JR9A 3FBYA 1JHNA 5B5EZ 2WQ8A 5EYPA 4AVCA 3GZAA 1LENA 4LNUA 4YZ4A 3OTFA 1ZUQA 5BNOB 3MI8A 1NY72 2ZEWA 5FZGA 1UZZA 1W03A 2SBAA 1Q43A 4LA3A 3H9VA 3ETQA 3H8UA 4KH9A 1D4M1 4AHYA 5FXWA 1EUUA 1GM8A 3MF6A 1WA4A 1NAEA 1W9FA 5IVBA 2ZINA 3CHXA 1Z7S3 5LK5A 2DFCA 1QBZA 4RS5C 1VF6C 4A7KA 1E57A 1CZVA 1OLQA 3ZXJA 1O3SA 4L92A 1IS4A 1RUOA 4LO4B 5JJEB 4YM2A 5F6LB 2M7WA 3SYQA 1ZYBA 4NWWA 2C4XA 1FJGO 2IXLA 4P9LA 3JYCA 2GUZA 3KF5A 4Q4Y3 1MQTB 3J8F3 1H2SB 1W06A 3WVJA 4M3CA 4NHLA 1W2BU 4HVQA 3M3QA 5E1AC 1AR73 2ZKLA 4Z1MG 4FM2A 1OLMA 1CPYA 3UL2A 5FZFA 3O65A 4JRAA 4LT5A 2NQYA 5KHJA 3SYPA 3ELNA 2JGUA 1C5IA 4OVEA 5LRRA 2QDRA 5A1FA 2XONA 1UKRA 2RS52 1PPJH 3PTRB 4NOTA 1U5ZA 1UIJA 1YNAA 3K9AA 2P3JA 4WFFA 1B35C 2LJ2A 2BNMA 4X9QA 1NJIW 3JCZA 2WWUA 4L97A 2CTQA 2GBOA 1MS1A 4L0PA 5FXXA 3K5OA 1VMFA 3CLPA 3FLTA 2XHNA 3CZUA 3VHRA 1LGCA 1E1QG 4DUWA 2QDOA 2MPFA 1DQ5A 4AYUA 2PAKA 1ZSPA 1X9TA 4OXSA 3LIHA 4D6TH 2UUCO 4DRVA 2TEPA 1V00A 1KJRA 3E6DA 5IUQA 4NRMA 3OE7G 1RUD3 2QKDA 2IXJA 4MVMA 5C5TA 4P08A 1OA4A 3IN9A 2XJQA 4HMZA 4MXVA 4J41A 1GNHA 2VWJA 3N2KB 4CS3A 1OBNA 4WBNA 3M3CA 3APBA 2ZGPA 1QQP2 4YZ2A 4HLTA 1VMHA 2EICA 4FPOB 2QUOA 4OHZA 1HX6A 2QQJA 1MSWD 5DECA 1DF4A 2P90A 3CJXA 5IY5B 1WP8A 1C8M2 4UOJA 4Q0QA 1RXGA 4BZ4A 3U1XA 1FKAO 4EKWA 5FZOB 1KITA 1H38A 1L0LH 1UY3A 2K2SA 3B3QE 1HJGA 1S0EA 4O4HB 1M56C 1QY4A 1L8DA 2JGDB 3AMMA 4KGGA 1O5LA 2ZX3A 4DV0O 5H2FZ 4YM1A 3N9MA 3AKQA 2RDSA 1M90W 2WBKA 3JD4A 3LSQA 4UFIA 2VECA 5LBCA 1ND2B 2XJUA 2ZE5A 1VAMA 3C7FA 2UWAA 1LR1A 2VCAA 1OCZC 4CUBA 1JMUB 4PLNA 4JGZA 1I3HA 1KGYA 5IVVA 3G80A 1IX9A 3FFQA 4XJWA 2ZNIA 4LIVA 4CDWA 1CVNA 4J80A 2EA7A 1CX4A 3WG4A 5LMNB 4OUMA 1IXMA 1W2AX 4XMAA 4GX1A 3Q8CA 1RUC3 3ZX7A 5FZMA 1KDMA 3OT7A 5C3QA 1RHI2 5A7OA 5FPOA 4I4TA 4JYAO 5LYJA 2QE7G 4UFZA 4QPGC 5FL7G 4ARYA 2WLNA 2BNOA 4YW6A 3LA2A 2VULA 4OPAA 5K8SA 4AG4A 3POJA 4FO9A 4O7XA 4PLMA 3ETDA 1KKCA 3AK1A 3AG4C 2CDOA 4KFMA 1GZCA 3QO5A 1AX1A 4SLIA 1YI9A 4MVZA 4CSWA 4X1IB 1GSLA 3CCSV 4X66O 4MGSA 1VBA2 4JRLA 2A71A 5ITZA 4V1PA 3GJAA 3GCXA 1OA3A 1SDWA 4I55A 4HSJA 4X8PA 5DUVA 2ZZJA 2A5ZA 5AVPA 2PA7A 5JOWA 4PT6A 3P6BA 3ZVXA 4LKSA 2P3YA 1A8DA 2K9PA 5H9SA 4RA0A 3ITQA 3RMXA 3J7MA 3ON7A 4UCSA 4UWDA 2HWF2 2VOTA 1W6MA 5FIXA 5FREA 2VZTA 5GALA 2KR2A 2G1MA 3AKRA 3O1RA 4X20B 2PLV1 4CEYC 2Q5ZA 3NAPC 4LBMA 2XOKG 4K8XA 2P6CA 4MTFA 5IJ9A 3FE5A 3SPHA 4IDZA 3UM7A 1GZWB 1JOJA 3P3NA 1ZZ6A 1H4HA 2WNVC 1DGRA 1M06G 4UV8A 2XLAA 4FFIA 4JPRA 4Y5Z0 5LHIA 1H6YA 1W3XA 5ACA1 4META 3WP3A 3BA8A 1X9PA 3V0BA 1EV11 2Z2SB 2ARBA 4CCCA 2ZHKA 4MH0E 2RM22 4DUYO 4QT6A 4YLZA 3BRCA 2VTFA 1JH5A 4IGOA 4KUMA 1SFNA 2AYHA 3T30A 1QGLA 4FVVA 5CFDB 1VBC3 2XR4A 3DUIA 3WUDA 1GU3A 4N21A 4PA3A 4N9IA 2XJRA 1C4RA 3HNYM 2JIZG 2QQPA 4H14A 1YJLA 4DO0A 2L6LA 4HL0A 4IV1C 4TQFA 5BR8B 1U0AA 3ZIAG 2Q8EA 4GX2A 1PL0A 2ZZQA 1JW6A 1GWMA 1YC61 1ZA7A 2B46X 1PKXA 4ZY9A 2IWGB 1DBNA 5LBEA 4S2DA 2UU9B 2HEWF 3E22A 3G4SV 2XHKA 1DLBA 4UFLA 2YV8A 3EXUA 2Y6LA 1RUI1 1BVP1 3ZHTA 3KQRA 1WD3A 3CP1A 2ENRA 3X2QB 3I2HA 1SLCA 1DK1A 2WO1A 3W7XA 1CJDA 1OF3A 2AREA 4Z82A 3T4HB 4AL9A 5CG9A 1X36A 1H1AA 3FYEB 4HZ3A 3OD0A 4CDQA 3M3IA 1UPSA 2O8OA 1VMJA 3M8AA 4JI4B 1AX2A 2H0VA 1AI5A 3VD7A 3WDXA 2JS5A 1QQCA 2LROA 5EYPB 3UYJA 1MVEA 4P5HA 2AEYA 3A0RA 1WB8A 4M3CF 1AI6A 4CEYB 4FPLA 1CGPA 4A3ZA 4LK6A 2QE3A 1VEWA 5JMOA 2X05A 5ERLA 4I50A 1UY0A 3RYPA 1RUI3 2QQOA 3M2MA 3KVBA 5H9QA 3ES1A 1KP3A 2DVGA 2QSAA 4CDUA 2XQXA 2XXZA 4D69A 4R52A 3AYEA 3F95A 1VQ6V 1G9BA 1LEMA 5GJ6A 5LOVB 3MV11 4XF0A 3ZSEA 4P9YA 3LIGA 1VIBA 5LYJB 1KXGA 1T2XA 3BVCA 4M00A 1IOAA 1AJPA 3ZYRA 3NNFA 2G9ZA 2D44A 4UYBA 2ZT9B 1VBD1 3HOBA 5C3SA 5B1BC 4HFSA 1HJFA 2WYFA 4XF1A 4HONA 1NT2B 4CCDA 4LITA 2IU0A 1LODA 1BVVA 1G1XB 4OGQB 4GAZA 1CZSA 4COWA 4XDOA 3VDBA 5A7NA 1POV0 3VQWA 2PHRA 3LB9A 1ZTEA 1RP3B 1DZQA 1SBEA 1UMHA 4LP8A 4LBQD 4R50A 1G7YA 4UW5A 1NZIA 4U36A 3E8BA 1GR3A 1B06A 2ZIMA 2WSUA 1H2MA 5A1LA 1H1IA 3GZTB 1KB9F 3AVRA 2E75B 1RVF1 2FDGA 1FYUA 5E8AA 5F1RA 4XFCA 4QB6A 1C3HA 3RN4A 1ENVA 2SLIA 5L3EA 1G9CA 4X89A 3KV5A 3TRSB 1UY2A 1NA1C 5FLHA 5FAXA 1FPN2 4HT1T 4Q4V2 4HK9A 2HYKA 4BISA 3THOA 4ZKIA 1SA0B 2PI5A 4N7IA 4MT8A 3OY8A 4Q8LA 1JFFA 5JOZA 3OEEG 4K1ZA 2Q7EA 3RYHB 2GC2A 3ZHQA 3OF1A 3ZMZA 5FPAA 3UJOA 2ORZA 3TOJA 2OCHA 4UCTA 1BK0A 4XXPA 3CL1A 4XPVA 4J9ZB 1XQNA 3I56V 5IVCA 3CJHB 5CYYA 4AHXA 3CCLV 3CXHF 4Q0VA 1R1A2 5FJHA 2B7YA 4Q4W2 4HPKA 2DCZA 4ASLA 3WW4A 4AQ2A 4HN0A 3G6BA 3PVNA 1ULOA 1PGSA 1EZVH 3WG7C 5DAPA 4O61A 2LUWA 1WLCA 3K06A 5HXMA 1C8M3 2A6ZA 1H2GA 4Q4V3 1CP9A 3WCSA 1Q6UA 1RUC1 3VHNA 1S2EA 4EQVA 4ZI7B 3J80N 1YF2A 1FNZA 4JHTA 1SA0A 3J4UH 4MZUA 4YSFA 4PA9A 1G9AA 3FB7C 2R9RB 1YITV 2YICA 3ZFFC 3VQYA 3KZIZ 5A7SA 2ARAA 2X5IB 1HNWB 3J26N 2ZOEB 2ZJCA 3SITA 1SFPA 1YRZA 5FYUA 3B2EE 1XYPA 4FLUA 2LGWA 2R6QA 2JX9A 1F51A 1J3RA 1IBMO 3H01A 4CDXA 1W2OA 4HG6B 1IVSA 1GMGA 2EAKA 1HNWO 1QU0A 3MIHA 4JI2B 4AFMA 4E4ZA 4PQQA 2WINB 2IFWA 5EBLC 2IXHA 3STZC 5CVRA 3MW3A 1FXHA 4MGZE 3I2OA 1UY4A 1IHMA 3ZRWB 5F8PA 5GZDA 4UT5A 5DAWA 4DQAA 2P2KA 2ET7A 2R063 1F5FA 4CVUA 4QJFB 1IURA 3LCPA 1NA1A 2P4VA 4FOVA 2ZXWB 3OAAG 1SQ4A 1E5SA 2BTQA 5GW7A 3MHSC 4KQ7A 1LULA 1LJ7A 4K3AA 1VQ4V 4JI3B 3WW2A 4O65A 1I94O 5C6CA 3VHPA 3WG2A 2GNDA 3THTA 3H3UA 1QWRA 4FTEA 2Y33A 1OXCA 5FZ4A 4GKKO 3FZ3A 2K0GA 3PNAA 1WA8B 4C0BA 3FC0A 1DGRN 3IMMA 3WDWA 3R65A 2CH7A 3POSA 3LSUA 3PJYA 1BMV2 1ZL8B 3EQEA 2OA2A 3L9JT 5FZLA 4CP2A 1AVMA 1QVFU 4CUCA 2W08A 2AACA 4PBOA 2N74A 2AGSA 1W05A 1PNKA 2F43G 5DEDA 3WFVA 1C1FA 4XUQA 3ICXA 4LLFA 4PI0A 4P30A 2A7WA 2ETEA 1VRH2 3ABKC 1H9WA 3NSTA 1UX7A 1H6XA 1QJZA 1G86A 5DQ0A 4E2GA 5D8AA 5TSWA 1KKDA 4ABMA 3H9AA 5BMVA 3JQWA 5SV8A 5IYYA 3OOXA 3OEHG 2HKOA 1AXKA 1DGLA 3FAVA 1XNKA 1BQPA 1V9PA 3BODA 4GYCB 4A45A 3SKJE 3P5BA 1GZTA 5IDJA 3IKWA 1QHTA 4K9SA 4BHPA 2RS11 4O2BB 3O9OA 4PV1B 1MZ5A 5JR7B 4ASUG 1W9WA 5FKCA 2BERA 5FMBA 2DCKA 1VBC1 1H8TA 4XQDA 2YB7A 3ZOIA 4GIQA 1TMF3 1KFUL 1MVQA 4OI1A 3ABKB 4Z2AA 2GMMA 1UU4A 2VCMA 3I54A 5KAIZ 3KV6A 3ABUA 5C8YB 4DR5B 4UW6A 4GWIA 2BVVA 2EX3A 3OUJA 3N9PA 4LKEA 4JVAA 2D43A 1UY1A 1VBA1 3PHMA 2YIAA 2BGOA 3RZJA 1VAKA 5KHIA 2VH9A 4IE0A 1WLTA 4YIOA 1DQ1A 1AR82 3MEPA 4MX3A 3P32A 1OHFA 2RN9A 2H8PC 1LGNA 5LWBA 4Z8BA 3D0JA 1IG3A 3JUUA 5KX5A 3A8TA 1X33A 1AR4A 4X62B 4LFAB 2PTMA 2ZM6B 4AQSA 3NNLA 4FXGB 1GP4A 4H3WA 4OMDA 4B3SB 4BU2A 1S5LZ 3ZMTA 3VBHB 1B35A 3ASIA 3ZKYA 4IV1B 4IEUA 1RUD1 3TK1A 2EZOA 2KA3A 3HT2A 3CCMV 4P14A 1W8WA 5T5LA 2BEOA 3E89A 2LW8A 1PMHX 1Q5OA 2JE7A 1VBE2 3AP9A 3WB1A 4BIOA 4RN5A 1U5IA 1QR8A 4MVSA 5IW0A 4KHPB 1KUQA 4AEJA 3E35A 3C90A 4W50A 2PXJA 2A06H 4MW3A 4NIGA 3LDCA 2J22A 3CZJA 4OFGA 4DRXB 4G3YC 3FHIB 5JXHA 3H1WA 3OYWA 5JCOA 1ZRRA 4QX0A 5A3WA 2ES3A 2ZGRA 3ZXFA 1U12A 3W58A 1GNZA 1ONAA 4OZXA 2FD8A 1VQMV 2RJZA 5L3BA 3W20A 4J25A 3CJIB 1B09A 5L73A 4YYOA 4J10A 1K5JA 3H8RA 3STLC 4KWKA 2E7AA 4TZDA 4K35A 4HETA 4NYKA 5ITZB 1W6OA 1XU2A 4LH6A 3Q4HB 5DXDA 5F7UA 1PP9H 4G4FA 1EPZA 2P5OA 3GB7C 1CWPA 2X6CA 1S77D 4L11A 3QLQA 5C71A 1UU5A 4Q4Y1 1SLLA 2YU1A 4QX1A 3O1SA 5LCWL 3BI3A 3T2MA 1ULEA 4BH9A 5BNNB 2VNOA 1L1FA 1I9RA 3AL5A 1DU3D 4NRPA 2CTVA 2W47A 3H3LA 3U0ZA 2ZCWA 5FPUA 5FY1A 1R6TA 4JGZB 4YRDA 1XMOB 1FMD2 3D82A 2ZX1A 3QH6A 1Z5VA 5J2TA 4WFAV 1KMIZ 3RVYA 2F6BA 1F8VA 5H9CA 3LOIA 1QLEB 3LSDA 3VBSC 4WFBV 1HP8A 1LTEA 2EIMC 2E51A 4I55B 2HEVF 5I8TA 3ZYGA 3SPIA 1R1ZA 4BB3A 4XYXA 1FFXA 4LO7A 5FY7A 1JTZX 3H1IH 4JF3A 5C5UA 3OUIA 2NMNA 4D6QA 4QDQA 4CRQA 2VRZA 4AQTA 2X09A 4QPGA 3KCCA 3ASNC 4U3JA 1NE4A 3ZYJB 1SS3A 4GLXA 4KWLA 5A3OA 3MUY1 4IV3A 2YC2A 1REEA 1SRYA 2LS6A 4AEKA 2GU9A 1F7YA 1Z0HA 2AW9A 2X10A 4NIAA 1W8UA 3ZXAC 2R9AA 1RINA 2OIEA 1PO23 2BTVC 1JYNA 2JS3A 1NLRA 3DV8A 2WO2A 5FZ1A 5C3PA 3AMHA 4JYCA 4TQDA 3WF0A 2FDFA 5BNNA 2L9LA 2AEZA 1QLEC 2WLJA 1AF9A 2VVDA 4TSFG 1OUSA 1RUF2 3ALQA 2R9IA 1VP6A 4QKDA 2NZ9A 2F17A 3HR9A 3RPQA 1IZ3A 2CAZC 1SCSA 2QQVA 2ERFA 2F93B 3UT0A 1X8EA 3CBNA 4PA7A 4JI4O 1PO11 4XQ4A 2XAGA 4AR2A 3CJHA 4N53B 5CNAA 4GULA 2JDYA 2JG9B 1VQNV 2X6AA 4BMEA 3K59A 2VWKA 2WT1A 3I3DA 4M01A 5CBFA 5IJ9B 4CPBA 2A6XA 2QGNA 5DUWA 4O9GA 5FZ9A 4CDXB 4X64O 4JDOA 1WP7A 3SGIA 1XMOO 3LDKA 1HKDA 3LDEA 5IT6A 3LEKA 5GZEA 1LOEA 5FJKA 4IXLA 4XTMA 4NIDA 2VMDA 4Q1PA 1K7DA 2DYRC 3VOUA 3BHPA 5GTIZ 3VB9A 3HBZA 2QKCA 5GONB 2D93A 2Q1ZB 3WQ0A 2RG4A 4Z07A 1RUNA 1VB2A 3SJBC 1TME3 4P9PA 4INDA 5ISLA 2EIEA 1O4TA 4CU9A 1DGWX 1N33B 1S0JA 3C7OA 3EJKA 1KU9A 3IBMA 5JSPA 2VJXA 1SLAA 3VBUB 3MIGA 2ZXQA 1Y66A 1QJX2 2FDJA 3LDBA 5FPBA 1XDCA 3M4FA 4WVZA 1I5YA 4Q27A 4V2VA 1QLNA 3FB6C 3VBOC 4LBQA 4LTAA 2BDRA 3OFNG 1HB2A 1URFA 5L7OB 1MMMA 2Q8CA 2XJTA 1VF7A 1X8MA 1S0GA 5IWAB 2Z42A 3O5SA 2O0OA 5EZWA 1S5HC 4FQZA 2F95B 4DY5A 4DV5O 2PUSA 4XJ8A 1A8MA 1H4GA 3ACGA 2EF6A 1LUWA 4OHXA 2VQFO 1F23A 3F5TA 5A80A 4M0HA 2VZUA 1S0VA 4IL6Z 3WNNA 1QXRA 5K1PA 4H13B 2JE8A 4MSWC 2VMEA 2VQFB 3LPGA 4ZBMA 3ZYBA 4S2HA 3HNBM 4ZPIA 5IWFA 1Q8VA 3L70H 4PDVA 5ABJA 1EPWA 3T1HO 1LNQA 1Z7S1 3CCRV 2QQNA 2B1GA 3USUB 4NHKA 1I5ZA 2ZS6B 1XYOA 5IVEA 1G6NA 3B5LB 4WZFA 1ND2C 1SQQH 5CKMA 3DYOA 2W1SA 3POGA 4IYHA 4HK8A 4CDUB 5FZCA 1DYKA 1XL6A 4KU7A 1BT8A 1O5UA 5EHDA 4CXWA 5FOBB 3AB0A 1S76D 2VZ3A 5LEJA 2A0LA 1AL22 3DKQA 3SEEA 5IK8A 4R4ZA 2W3JA 1R3IC 1W9TA 3K4DA 2BV4A 2N7GA 1WW7A 2YUAA 4LBLA 1DGWA 2JDKA 1D4M2 3IPVB 3IFXA 4BYYA 1F15A 3ZMVA 1ZZCA 4UBGA 2D6PA 2YG0A 3UJQA 4YW1A 4BPZA 4A7YA 2B8MA 3JD1A 1Y43B 4Y20A 2RNBA 3HKCB 4RD7A 5KA5A 5A3PA 5KA6A 1H0BA 3POYA 1CONA 3V56A 2ADDA 2VQUA 3BIWE 1EY2A 4EB6B 5IYBO 3G6EV 2W91A 3W5MA 4K6BA 2GDFA 3HKBA 1WMXA 4GH4A 2AENA 2XLFA 1XMQO 4GB32 3EO6A 3MIBA 1PM7A 5A6YA 3IJ4A 5LXTB 1N34O 2ZCEA 3OMIB 1XRUA 1AR72 2DUQA 4BW9A 3N9LA 3MW2A 3EFFK 1VBE3 3E8FA 4HNAA 2GMEA 2ZKOA 3ILFA 1VQKV 1OFNA 3N35A 3QG5A 4B8EA 1GUIA 2NM1A 2HWC2 5CG8A 1OMIA 4OQ8A 4YW3A 4GMP0 1ASJ2 2ZGQA 4W4LA 2W0XA 2RS53 2I2SA 1RVF2 1AUYA 3QCWA 4JAAA 3T1HB 3OYWB 4NB5A 2BGCA 1S5JA 4MW8A 1RL3A 4LUKA 5CFDC 4LF5B 5HXVA 4X1YB 3OGRA 3S3WA 5FYBA 1AR81 4GA9A 2VNVA 4O2AA 4I3GA 3K08A 3VZLA 5B1AC 2ZIOA 2Q4PA 3LEIA 3B8MA 3SQOA 3T3YA 4PELA 4R9CA 4DEVA 2HWD2 4BM8A 2W92A 5LGNA 4X20A 1QJX1 1WKYA 4QGLA 2UWBA 3MFCA 3BTYA 3VDCA 1GKBA 2JVDA 1QJFA 2XWJB 2O57A 4FBFA 2ZDIC 5FOJB 1EN4A 1CZTA 4JKKA 2Q7GA 3I2JA 4AHZA 4QQ2A 2QFEA 4IGPA 1MNGA 3QOPA 2UUCB 3ZN6A 3N27A 1J1TA 5ANQA 4B3TO 5T5OA 3AZYA 1BKZA 2N05A 4Y4RA 1SZBA 4F6RB 1C57A 1RHI1 3FB5C 3OBRA 5FZ8A 2XVLA 2LW1A 2CSGA 2X29A 3K75B 5JAXA 1RC6A 4DFSA 5J9PC 4BLJA 3CEIA 3BPSA 4A6OA 3DC5A 3Q8AA 4O4IB 2AHZA 4EROA 3SYCA 1AB3A 2XVGA 5APAA 1WBLA 4J9YB 4R9AA 4ZIBA 1UQXA 2HWD3 4EN8B 1IQDC 2UYAA 3TEZA 4OX9O 4YJ2B 2P17A 4QAWA 2GHYA 4RHV2 1ULCA 1ND3A 2ZGSA 5B1NA 1Q7YW 5BV6A 5SV5A 3CO2A 4LFAO 2FQPA 2YXSA 4DV6B 2WQZC 3NJZA 3I7DA 3T1YB 2B9ZA 4JI3O 3BFRA 5FYYA 4Y4YA 4L99A 4JI5O 2P5BA 4CS2A 1YIPA 2LFSA 1ACCA 2BWAA 5T54A 2RM21 4Q6GA 2H6CA 4QE9A 1UL9A 4KP4A 1RYYA 1VQOV 2CL2A 2QJ1A 1V6KA 1PIV1 3QVNA 1YO8A 4FFKA 3CC2V 1XNRB 2PYJA 5FK7A 3PIJA 1KECA 2P4EA 2B5UA 4O4LB 3ML0A 5F39A 3O7OA 1VQLV 5FZOA 4KMQA 1XUQA 4IV3C 3OTOB 4FFGA 2C1FA 1E5RA 2B39A 3RWKX 3AZZA 1KQRA 4F6RA 1W90A 4OCTA 4YZ3A 1ZLZA 4JQTA 1OOPC 3H1HH 2ZGLA 4CDWC 3MLJA 3SHRA 5K9YA 4DZGA 4IV3B 1E1RG 1JMKC 2UXBO 3WG1A 5L3GA 4DUZB 3JD71 4YGDA 3HWJA 3D3IA 3C7HA 3AYAA 4CCEA 3RZKA 5D8AB 4F8AA 3DN7A 3H42B 1KBHA 4YJ3A 3AXDA 4AOCA 4SBVA 4I3PA 3WDVA 3FMGA 3MPBA 1BL8A 1KEXA 1ZZBA 1EV12 1A78A 4B3TB 3RZZA 2JIGA 4FIPC 1QEXA 2JICA 4DV7B 1HRV1 5J09A 1YWKA 1NR7A 4QKNA 1HRV2 3JATB 2K46A 4QPJA 2IJIA 4B3MB 1COV3 4AEDC 4G2KA 4QPIA 2FBEA 2YI9A 5BXXA 2A1XA 1QNMA 3C7GA 4Y26A 1WBFA 2P4KA 4OPHA 4Q4X1 2D40A 4KBBA 4TWTA 3KQ4B 1W39A 3F2ZA 3ETGA 1UYZA 3UNPA 2CH7B 2NNUA 2FHRA 2Q30A 4IEWA 5CKNA 3GBGA 3TXSA 1JZ4A 1PM9A 4JKMA 4LE3A 2XUMA 1G4YB 2RMU2 1O9GA 1RUG2 3OSDA 4AAPA 3TYJA 4A5UB 4G28B 1HLCA 3WINE 3BTXA 4PDMA 4AEMA 4AF9A 5G05L 1ZX3A 3LSSA 2VZSA 4XIOA 1RGSA 4LHNA 1R1BA 2Y6FA 4ZOLB 2E32A 4G27B 1QJX3 2EJRA 2CNAA 4FOWA 1P4RA 5FMOS 1OQEA 3OPZA 4YW5A 1KYOF 3JASB 2DFBA 4JI7O 1UKGA 4FFBB 1PX3A 2D3PA 2BOBC 1DQ4A 2HFEC 5L7OA 5LL6Y 2VG9A 4X64B 2P67A 4IEXA 3Q9OA 2Y69B 4QX3A 3VBHA 1W3VA 1SBFA 2XL7A 4Q0PA 1HQNA 4JYYA 3OY8B 3WF2A 3P30A 4YVWA 5IAXA 3O1OA 2MEV3 3E5QA 2DVDA 2VPVA 1B35B 1MA1A 1X4TA 2Y0PA 2YDEA 4QWNA 5FZAA 2Z5WA 4DR1B 4AQYO 1GBGA 1Y76A 2XL9A 1C8M1 3N7JA 4CPBD 5DUUA 2CWMA 3SJQC 2QQIA 1BBT3 1W8OA 1LR5A 3CYOA 1JJ2U 4ZHQA 1VBD3 2HWB3 1C8NA 2YGMA 3NL1A 4MSVA 2VMFA 2IXIA 4AFAA 5FPXA 4IEVA 5KWRA 1OJHA 2JWPA 5LB6A 1XILA 2HEPA 2ZBJA 3POEA 4O4JA 1DYOA 1JUIA 1UIKA 2DWRA 2IW5A 1FOD2 4QPKA 1XE7A 3TN92 1AL23 4FTBA 1W59A 5HV0A 3APOA 4OHWA 1UZWA 1HB3A 1WB7A 3PJSK 1FXVA 2PMWB 3BCWA 3MFAA 3K5NA 2DVAA 2FL4A 4DR4B 4QPIC 3VZKA 2WLHA 1PO21 1VAVA 3H50A 1W6NA 3SYAA 1DYPA 5CA6A 4XDKA 2CWSA 1PNFA 4RR3A 1PK6B 2MNGA 2FDIA 1AYM2 2DWDC 1RJ7A 3POIA 1YJ9V 1PK6A 4D3WA 3AZVA 4LWSB 2R49A 1H8VA 1YQ5A 2EXJA 3JAWA 3ZX6A 1QDCA 1NT0A 1OPMA 2DCJA 3T0BA 3NWKA 3N4MA 1K4CC 2E6VA 4TYSA 4JZGA 2LQTA 2JENA 1JZ8A 4MHRA 3N7KA 4BXFA 5A2QN 1QOSA 5K7PA 1ALYA 5J2UB 1MEC3 3A22A 2CU5A 2XPJA 2ZGUA 4E8CA 4C8DA 4TLGA 2GN7A 4CDUC 5KC6A 3M3EA 4P2ZA 3UKNA 5IHRA 2VR4A 4DUZO 4QQHA 4KNCA 3I55V 3UO3A 2RJLA 3PU8A 3ZSMA 2VC9A 3B69A 1PO12 1ZVFA 2WABA 2JECA 1SBDA 1QVGU 1HIXA 4OI0A 1Y3TA 5EC1C 1RMU3 1P49A 1J3QA 4XDQA 1W0KG 1RM1C 4QKFA 1FX5A 4DR7O 3OPWA 1CAVB 2R30A 3CEWA 2Q68A 2PQQA 2UXDO 1HN0A 1E79G 4WM7A 2P6JA 3UGFA 1K45A 4QHOA 3HVDA 1BHAA 1SHWB 4JV4A 1K3IA 3AFGA 4JTNA 2XKPA 3QO8A 3D8CA 2P34A 4O4HA 4TOIA 1WMDA 3H1MA 5L19A 1NH2B 4FLYA 3RVZA 3ZN4A 3FWEA 3POFA 5JSOA 3VBUC 5E79Z 5KXCA 2A3QA 4BWOA 1ULGA 1GOGA 1YEWA 3D3QA 1YHFA 3SDLA 4OHYA 4P9JA 2P3KA 4MTXA 1WMFA 4N90A 4UXAA 3KLSA 4NE9A 2PHLA 3WNKA 2QTOA 2A7AA 5IFTA 1N1YA 4FAGA 2ZMKA 3AL6A 1VQPV 2QWRB 1MS8A 1YTFB 2CV6A 5DAVA 2HR3A 3KM5A 4FFBA 2W6IG 3BGAA 2E26A 1Y9MA 1V6OA 3TNPB 4Y1ZA 5FUNA 1CAWB 3OPTA 1D2DA 5FP3A 3DL3A 3Q8EA 1WZXA 3O0XA 2IM9A 4BQ4A 1HNXO 2P06A 2GNBA 5JI9A 4GWJA 2UYBA 1UAIA 1LUVA 1AR61 2Y6HA 4QQPA 3WQBA 4N53C 3LPFA 3LD8A 2VQ0A 3BTAA 4QXCA 2F4VO 1F35A 1OVPA 4ZS2A 2ARHA 5EBMC 1B04A 3ZYHA 1XEQA 2JDHA 3IPVA 3ZN0A 2OTJV 5EJ3A 1QJU3 3T0AA 3JARB 2BBAA 1OI6A 5T5JA 3RBZA 4JI0B 5T3NA 3HKEB 3HR0A 1JHJA 4WFGA 5BZBA 2DU1A 2Y6KA 4RGKA 3BEHA 3TXQA 4YVWB 4PDWB 3N2GB 4FAHA 4CCOA 1NU1H 2D97A 5HFLA 3OR6C 5JXJA 1GM7A 4DXSA 4TT3G 3T4VA 1COV1 4Q2FA 3UV9A 4BWAA 4FPEA 3E6BA 5FV3A 2WFPA 1KQSU 1BCCH 4NTYA 2WIIB 1R093 4IERA 4HXCA 4LF7O 2H3OA 5D1IA 1W6QB 4U7NA 4Q20A 3ABMC 1XNBA 3J8F2 2QNKA 4PLOA 2IUWA 4K8ZA 3O1PA 4K3UA 2GDSA 3BOPA 4FPJA 2BZDA 3OGJA 5HV4A 3NJYA 3OBTA 5BYNA 4FPKA 1O6UA 4U3JB 2WAOA 1XNTA 3E5UA 1ZBA2 3WHUA 3WXPA 4IEOA 3ETPA 4YJ3B 2F1MA 1V9U3 1H2LA 2NR5A 2VBPA 2PAEA 1YZBA 4HKWA 2EBOA 1JBCA 4CP0A 1WN7A 4JGYA 4ZHQB 5DZEA 5IYZA 5K0UB 2Z0AA 1OCZB 4K8FA 2GSMB 1K12A 3PL0A 4LFBO 3B93A 3VDDA 1SLBA 5JZGB 4XBFA 1ZM1A 4XF9A 5B2GB 3W5NA 3RZHA 1S3JA 5DG2A 1TVKA 2MEV2 5EIBD 1ZA4A 1YJNV 3NQHA 1RUJ3 1LOAA 3IDEA 1QCEA 1OPOA 4ISRA 1Z5WA 1ZBA3 1QIQA 3BVOA 1AJOA 1UOBA 5FK8A 3PUQA 3I59A 4YNIA 5F2VO 4IHJB 4PCRA 5A33B 4RUEA 4AFBA 1Y67A 1VR3A 3ACHA 4XBQA 2C2AA 2XKOA 2NLJC 4HN1A 3VQXA 1N36B 2WLKA 3AYDA 4GJZA 1QQP3 1YI7A 3ACLA 4ZU5A 1BK1A 5HPOA 3I97A 4RFT0 1WPXA 1VJ2A 2WZPP 3B09A 3ZR6A 1VBE1 1FI2A 1BS3A 3AG1C 4B29A 2XDVA 2J42A 5J37A 2IH1C 4AVTA 1NZ6A 2Q67A 2X5IC 1GRJA 5IWAO 1FPN1 4FPFA 3H0OA 4BIUA 2HG5C 3M70A 2VU9A 4YFWA 1WUVA 4JDMA 4ONUA 1JX9A 5HCBA 3LEGA 4OX9B 1A3KA 1XNAA 2YYOA 3CMGA 3ZXGA 4QX5A 4P9XA 1STMA 2VE1A 2VOWA 5C8CC 2JG9A 2D5HA 5AVAA 4MGKE 3N2KA 1XNCA 4LBJA 1R1A3 2UXNA 3SCHA 4Q4W3 1OVSA 1ENSA 5FYMA 3PN1A 2QM8A 4GKYA 4F3JA 2JDIG 2VQEB 4P5YA 3DPRB 4X1IA 3M3OA 2Y4UA 5FR3A 1AYM3 5LBQA 4XDLA 4H0LB 1SESA 4R8CA 4LF6B 1JOPA 3ABMB 1NH2D 4KG8A 3B77A 1GOFA 2UU8A 1PNMA 1V70A 1W0JG 4DS0A 3ZMUA 1PGW1 2WJSA 2JK5C 2QM4A 3E1F1 4IEZA 2YBKA 3ETEA 2E9QA 4LH7A 1QJY3 2ZEZA 4ATEA 3R6SA 3AC0A 1UOGA 1O3RA 4XFFA 4YM3A 2VMCA 3WR0A 4AI1A 2P6HA 2HP8A 3UGGA 4Z2WA 4AXOA 4H33A 1Y6XA 4C1WA 5FZEA 4XTPA 2D98A 1H30A 2E31A 4MV2A 1VF5B 3FL7A 3JAMN 2DQ3A 3WF1A 2Q1MA 1BYHA 3CCQV 1VBB3 4CUAA 3KD4A 1MS5A 5T50A 4LC1A 5A1AA 3USSA 3WLUA 3L73H 1RSOA 1NTKH 3U78A 1K42A 4DEQA 5I8SA 4XFIA 4PJYA 2K1EA 4GWMA 1HXS2 5FBJA 3UT5A 2CHHA 3WDYA 1NY71 1BQ0A 3RQ0A 5AC93 5LA0A 4I4TB 2P37A 4OI2A 1BZWA 1XREA 3VUOA 1NCQC 1NYWA 4DY3A 2DCTA 2RM23 3KF3A 3JD73 4PD4F 1OOPA 3LEMA 4LXLA 3ZDSA 3JZVA 1MEC2 1N32O 1ND3B 3FLRA 1UYXA 2V4VA 2JG8B 2GC1A 3CX5F 4COUA 2Z5UA 1REDA 1W2TA 1NS1A 1YQ8A 1LB2A 3ZHRA 4MO3M 3E86A 4Y33A 4R8HA 1W8NA 4HAMA 1HW7A 4M4RA 4CCLA 4EZHA 5IVFA 2ZKNA 2W87A 5A3UA 5HCAA 2Q8VA 1O3QA 3DXUA 2ZX2A 2VUAA 3JXSA 1ZZ9A 4DR1O 4AQYB 2YEVB 3DXTA 3WNXA 1RSOB 1ENQA 5JXIA 3B9IA 1DIWA 3QO7A 1NTZH 4D94A 2R72A 5CU1A 4AK3A 3GHNA 3GDBA 4ZU7A 1FYJA 4XHBA 4QB2A 1O8PA 3SH3A 3AMPA 2WAMA 3VBRB 3VD3A 3B00A 1OOPB 1IGOA 4LBEC 1G8MA 2DMXA 5FZHA 2PHDA 1DZRA 5DM6V 4QDSA 2R1BA 1QDOA 2GV9A 2CDYA 3B02A 2RS33 2PYTA 1DFQA 1H8HG 3J7NA 3NV4A 1LU2A 1JZ3A 4BQWA 1REFA 2VW1A 1L3JA 3A0BZ 3KKYA 1N33O 2RVAA 2ZXWC 4IIJB 2AZ2A 2HH9A 1UZVA 2W46A 5FDBA 1O4ZA 4CUGA 3K4ZA 1E5IA 1Q8IA 1SPPB 4YHHB 1N3PA 1Q82W 4DV7O 3WW1A 4QXHA 4YFZA 4UI9L 3ZYIB 3UGHA 5JPNB 1J95A 2YBSA 4CBCA 2LRPA 3CS5A 1POV3 5D2AA 2FDHA 4QB1A 3FJSA 4X65O 4D0QA 4A42A 4QU2A 2D2CB 3KSCA 2RS32 3L2YA 1D0GA 3ZMSA 3T2QA 3CRCA 2QVSB 3AMQA 4WM7C 3E2EA 4AEDA 4RAIA 1HNXB 4XFGA 2OIIA 5F37A 4DR5O 1US2A 2OZJA 1BGYH 2G19A 2F4PA 3CDZB 1UMZA 3VKMA 2Q9LA 3U11A 4I0XA 3SPCA 1AHSA 3I49A 2ZE8A 4LHSA 2AHYA 1J58A 2OUJA 4Q5OA 1PX4A 3WHTA 4IE4A 3DPRA 3E22B 1GQGA 4UUJC 4N53A 5EBWC 5DPNA 2CYFA 4ARXA 1JZ5A 3ZN6B 2ODMA 2I74A 2DE0X 2VNGA 1BMFG 1MS3A 1V0AA 5CA0A 2W95A 4BK5A 3E83A 4I0BA 3A0NA 2W39A 4FPPA 2DYSC 5EYYA 3C3SA 4FP3A 4E4SA 2B42B 3IAQA 3RVHA 3ABLC 1AR5A 2YFUA 4UVAA 2W5FA 3JBG2 4CU6A 1YQ2A 3BIEA 1TZOA 3VV1A 2Y34A 5C4WB 3ZHSA 1KJLA 5FPRA 2AXTZ 4LORA 1NQJA 1R083 2GC0A 3FUQA 4DUXA 2N04A 5EJ1B 5KAFZ 2QWQB 3KB5A 5EQUA 4AVAA 3WQ1A 3MO4A 4J42A 2UUAO 1ODMA 5LP6B 2RS13 3HPNA 3INAA 2BRTA 4GH4B 5KHHA 2BP6A 1D5NA 1YCIA 3CMEV 1XHXA 1EP0A 2EXKA 1V9U2 3FHAA 2Z3YA 5JIUA 5LW9A 5LXTA 2V4AA 1AR92 1HXS1 4IEQA 4RUFA 1CAXA 2PGGA 3H7YA 1DQ6A 3C3TA 2XJSA 2VCBA 4LHKA 3I5DA 4XZPA 5L9BA 1IG0A 1UXXX 5K0UA 3MHHC 1QXJA 2A6WA 3K2OA 3HT1A 2WNOA 4JTDB 3KCXA 5IYDO 1XHZA 4LR3A 2VQAA 4H55A 5FRAA 5AC91 4WFEA 4K0KB 4QXKA 1MS0A 1S2KA 5KHKA 1XU1A 1RTVA 2WN2A 2BFUL 2EIKB 1SFYA 2IVJA 2WSVA 4DR6O 2J1AA 4AI2A 2JD4A 2WO7A 2QQWA 2EIDA 3KVAA 1O91A 4GT1A 3PUSA 3ASOB 2BTQB 1FMD3 3AMNA 3I59B 1OCRB 4PHZA 2NYYA 2YC4A 1P84F 4H37A 2Y26A 5JOXA 2EIBA 2JDUA 1R73A 2WSSG 4R7CA 1JZ6A 4PIXA 4UFKA 4XVHA 1K5QA 4XJUA 1PZ8A 3JSLA 4F83A 3URFA 1WA8A 2XG3A 5JR2A 4KGQA 3WT3A 1Q8PA 4KHPO 4LMFA 3WV6A 3BA9A 4J7JA 4LR4A 4AVSA 4Y1UA 1S72V 4AILC 1GV9A 3IIAA 1KDKA 1ND3C 2EINB 4AI8A 4JX0A 3NV2A 4JGZC 3CRRA 3WD5A 3M99B 5FBZA 3I2IA 4WVWA 1PK6C 4IHJA 3KV4A 1NLSA 5A33A 3UK9A 1XPWA 3RWRD 2D7FA 2MW2B 4AFCA 3BAAA 1YXBA 5FUIA 3ZXDA 3UQ8A 3H1LH 4P9IA 5FQ0A 4A6SA 4YVSB 3AG7A 5FP8A 3MW4A 4QM8A 5BR8O 1YVWA 1OFSA 3ZXEA 1UCXA 3V0AB 3DTUB 2WDBA 5I0RA 5CN0A 5DDJ3 3L2HA 1W9YA 2FMDA 5EXOA 1CAWA 4H7MA 4NXMO 4GKJO 3THPA 3WG3A 1ZAUA 1GN2A 1WA6X 2BNNA 3U4XA 1W28A 4OULA 1CEZA 4FZ0A 3G67A 1TUEB 1SQBH 4O2AB 4JHZA 1JPXA 5GLWA 5B1OA 3SYOA 3QNEA 2BTOA 5EFUA 3VBOA 4EN6B 3AKTA 2EXHA 4LPLA 3JAKA 5FLJA 2VAUA 4I0AA 4AE2A 5A6XA 3X2QC 3O0WA 2ITCC 3ILRA 2UUBO 4EN7B 1XNQB 4JYAB 5KBFA 2V1DA 1NKGA 4RGAA 4KU8A 4DV6O 4ZZ5A 1M93A 3I3QA 3UKVA 5LA2A 2HWF1 2VTXJ 4LULA 3VZNA 3OGCC 5DDJ2 4FT8A 2YXLA 1AR63 5JCTA 4LFBB 3PLQA 4M0NA 1SQXH 2E74B 4CA9A 3BALA 2J1SA 4B3SO 1SQGA 4KL1A 4Q8KA 5LMNO 5KC5A 3EHKA 2GH8A 1VBA3 2VZ1A 3NKGA 4XBLA 4IEPA 5FP4A 2ZGOA 1QJU1 3K51A 2LW7A 2QWNB 3CJIA 2RDCA 2JEMA 2WO3A 3ZSLA 1NA1B 4XBNA 4FOQA 3WEZA 1RITA 1MQTA 1XE0A 1GKFA 1JS9A 3OUHA 2VO5A 5FZKA 1CXZB 5F3IA 1PV0A 1QNYA 3S5AA 4AVBA 2NLRA 4H2AA 1NVPB 1J1LA 1HRI2 2IBZH 3BU7A 4LBOA 3WP5A 3GNEA 3T2PA 1AR62 1O4YA 4XXAA 1PVC3 4A3XA 3RJRA 3K0DA 3CKHA 4QQLA 1S0IA 1WW6A 1AXYA 1DZTA 4ZHNA 2GNMA 1I6XA 5T55A 3ZBHA 2XTAA 3MYXA 3ZPOA 1UXZA 1AP5A 5B1BB 4GJYA 2PAMA 1XB9A 3NRUA 2A73B 1K97A 3S7IA 2FMLA 4P00B 3J7AU 5CBGA 4NTWA 3J7LA 4NAOA 1J5EO 1JOBA 2WNUA 3NW4A 2ZEYA 2WLIB 2B5HA 3J81N 1HRI3 1I94B 1AJQA 1WNSA 2NMOA 2OS2A 1O9HA 3E97A 2YBPA 1JYTA 2YGLA 2GUZB 3CE2A 3O1TA 1M1KW 2XBO1 2G4IA 1A6CA 1PGL2 1W0PA 1N0NA 1MPXA 2VD7A 4RHV1 3N9NA 3MDSA 2UY9A 3HKCA 2WNEA 3KGZA 4X62O 4JGSA 1N3QA 5BNPB 4JTAB 2O1QA 4XIKA 2VBBA 5HI0A 4QE7A 2XOMA 1JODA 5GLUA 3LF7A 1RPOA 1AR1B 2WLPA 1SQFA 3UETA 1AYN1 1Z7S2 1H2KA 1JN2P 4Q4X2 2ZGTA 1BHGA 4RGGA 1RJ8A 2A6VA 1APNA 1LHWA 5C3RA 2DURA 1NI8A 3ZFGA 3K03A 4QMAA 5LASA 1PIV2 4D7YA 4Q4Y2 4L2NA 1ROPA 3V65A 1NLQA 3APQA 2YIBA 3TETA 2A79B 1N8RW 2UU9O 2FCVA 1MS4A 3FX3A 3MBWA 2FCTA 1ULDA 4COVA 5M0TA 2LO1A 4JZRA 2XMLA 5AG2A 2ORXA 4PDLA 3GXUA 3DF0A 2DTYA 2PQSA 3UCSC 3DGEA 2W1WA 3NJXA 2XHBA 1IBKB 4Q4W1 2BYVE 2BQPA 1AXZA 4IE7A 5DABA 4WF9V 1V55C 5F3GA 3CU7A 4DB5A 4MVRA 1OD5A 2YY1A 4PBPA 5FMDA 4DV2O 2YHJA 1LESA 1DP0A 2HWD1 1EUTA 4AQ6A 3AP4A 3RYRA 1WJZA 3UT5B 4EWAA 1YXWA 2ETNA 5J2TB 4D7TA 2Y6GA 4RQPB 3K5MA 2OYQA 1F9KA 1AR93 2VUJA 4XEZA 1OH3A 2J7MA 3LUTB 4PF5A 4UF0B 5CKQA 1HB4A 3PUHA 1RUH1 2QZ3A 4MVUA 4EN0A 4DV4O 3E6CC 1GP6A 4JI5B 4ES8A 4UCOA 1K8AW 5I0SA 3EHBB 4DXZA 2WNVB 4DO2A 3MHZA 2DV9A 2OX0A 1M4UA 1TUBA 1RVF3 2BU9A 4JAVA 1Q56A 2RS51 5IK7A 1W6NB 1R082 1NUKA 4PDRA 3U10A 3GZUC 2RMKB 3DSQA 1CN1A 3NMBA 5K4LA 4KG0A 1J5EB 1D7PM 4A41A 2KB1A 5L36A 4IE5A 5LP6A 1FV3A 1GWKA 3H7JA 1J59A 1AJKA 1TQ5A 3QF7A 1OKQA 5FLIA 1DQ0A 4E4DX 4DMIA 4ET7A 1WGPA 4DR2O 5EIYB 1LRHA 2OIGA 2ZNJA 2Q4SA 3GVMA 3AJZA 4KI5M 5FXVA 4YM0A 4RQPC 5JLVA 5LMUO 5C4WA 4NIIA 3HIFA 2HJIA 1I5XA 2ZA9A 1C28A 4OMCA 1BBT2 1LOFC 1EBOA 2Q73A 1N47A 2EALA 1SPPA 1ZBA1 4JZ2A 5KLVH 1K5SA 1X7NA 1GNYA 3ZSKA 3IAYA 4IETA 4YWAA 3FAVB 3HNMA 3O1VA 4LUMA 4TV9A 3T1MA 4NWVA 2WT0A 4BQYA 3U75A 4S2FA 4XETA 2UXCB 4NXMB 4K1YA 2JEUA 3KT4A 4OQ9A 3M7MX 1DG6A 2RJ2A 3WW3A 5DDJ1 2G38A 4GXLA 3I3BA 3KHCA 3TNQA 2QZ2A 2PFWA 3P3PA 3VDAA 1FFXB 3SH4A 3IIIA 4DR7B 1L7RA 3PURA 1I7FA 4XJZA 1NVPD 3LA3A 2TBVA 4ZOLA 2EAAA 4UCRA 3AKSA 1XBFA 5JZGA 3E8HA 4HZFA 2OW4A 2P1BA 3VKNA 1ZBE2 4Y22A 5C93A 1W0NA 1UX6A 3GBWA 3SCGA 2Y60A 1AYN2 5BNPA 5BNOA 3ZFEB 2NN4A 2ADPA 5A7WA 1T6BX 2JE9A 2ZDIA 4RR3C 1GFF2 2V5DA 5FLXN 3CNAA 1E5HA 4FM1A 2ZGKA 4QHBA 1JZ7A 3CIHA 1V9U1 4K20A 4DXWA 2EULA 3F5WC 1PZ7A 4I30A 4DR3O 3ZFGB 4LKFA 3THCA 4DV4B 1BMV1 4ES9A 5ABJB 3LAGA 1AYM1 1JYVA 3SJAC 4L8QA 2WR9A 2Q7HA 1HNZB 2R062 3MIEA 3RYIB 2EJ7A 1ND2A 4PIYA 3IT8A 1TVGA 5LMUB 5I91A 1OZ0A 5ANNA 1N1TA 5DAQA 1UZYA 4EN9B 4HOOA 1NCQB 2WLIA 3D36C 1EN6A 3VBRA 1TNRA 4FLWA 4QPWA 1DLCA 4CE8A 2Y38A 3MD0A 1GM9A 4B4QA 4AGVA 1RFYA 2DVBA 4Q1RA 3ZDVA 3TGUH 4PDWA 4CZSA 5FKBA 2QQUA 2WWJA 3PJQA 2LP7A 4ZKTB 3WNLA 4HBNA 1BSMA 2IC1A 3I2DA 4A44A 3THDA 1TMF1 3L72H 5I8YA 1NG0A 3ABZA 4BCUA 4GCZA 1QNWA 4UVCA 4CH5A 1F2NA 5A70A 2IJJA 2EIKC 2W68A 4OYUA 4DXTA 2YXHA 1MR5A 1T5EA 1RUE3 3OGIB 2XJPA 1G6UA 2VMHA 1GQHA 4ZZ8A 4DPNA 5B4NA 1SACA 3R66A 1YFWA 4NKGB 5FCCA 3RI8A 5T52A 1RUG3 4Y1YA 2RQ6A 3MPPG 1ENXA 3RGBA 2XAQA 2R16A 1QOOA 2X6BA 2VM9A 2ZX0A 3ROUA 5JXGA 4Y24A 1GMMA 2RR13 3WQ7A 2Q69A 4CCNA 1AP6A 1AROP 2ID4A 4CH4A 3JQXA 2YEVA 4P9GA 1QXPA 1JYIA 4HPKB 3PTYA 1CAUA 2GMPA 5IJ0A 3JB4C 3OMNB 2VVFA 4QX7A 5F9TA 5LK7B 1MZFA 1R6NA 3W9AA 3DPRC 5BNNC 4COYA 5FUPA 1Q3EA 1F4MA 2VZQA 3S0MA 3WP6A 3NXSA 4AHWA 2UY8A 5F6KA 5A7QA 4ZI7A 4OZOA 4IESA 3ZXKA 2BFUS 5CIRA 4QQOA 2WLLB 3WDUA 3I2GA 5KXDA 4BDVB 1Z2GA 2HLEA 4D8MA 1XOUA 5FMCA 4A4AA 4QGPA 1Q8QA 3VHOA 5FQ0B 4E2LA 2XNDG 1W6OB 4M3CB 1KD7A 3SC7X 3CJIC 1XYNA 2WN3A 5IE9A 5F2SA 5FZIA 3HD8B 4GKJB 2JG9C 3MIFA 5JOYA 5FY9A 1AR83 2ZTNA 5LHGA 1PM4A 4W6XA 3WF3A 2YPDA 4BQ1A 1FOD1 4NROA 3WNPA 3KT1A 1RUI2 5FWJA 4WVMB 3QH7A 5JVDA 4YGCA 2CAUA 4LOSA 2WAAA 3SPGA 3ZMOA 4JI2O 3BPZA 4UW3A 1K4DC 4BIZA 1EYBA 2Q8OA 2ZD9A 3K04A 1XBLA 3S6PA 4CEWA 4F6EA 3LZZA 4ATFA 1XNDA 3OEAA 1ST8A 2L35A 4HKLA 4YARA 4RL7A 4XAAA 1CESA 4YW2A 3NO8A 4MS2A 3DCQA 3RG0A 2V5YA 2VGDA 3M7AA 3AEIA 2HKXA 1FXKC 3RYFB 3TCUA 4EWDA 2CAVA 2YC0A 2CGPA 3GJBA 3FYIB 4URAA 3OR7C 2CTPA 4BW5A 4QX8A 1GN3A 1YYNA 4ORFA 1IS5A 5GLVA 4OHVA 1VB4A 4EWEA 3ZPYA 2HWC3 4AW7A 3CSXA 4XJAA 1FAYA 2RHPA 1MACA 5F5IA 4AI3A 2V72A 5I93A 4DIQA 4N23A 1LOGA 2R061 4FFFA 4NJ4A 1CJPA 4YW7A 2YI8A 2B1IA 3BTZA 1OQDA 5FZ3A 4QNHB 3ZHUA 2J1EA 2AZ0A 5C9AB 5D5PA 2VS0A 1FPN3 4Y5SA 3OG2A 4CP1A 1Q90D 5LA6A 5DAXA 5KUMA 1BEV1 3VBSB 2BOJA 2BOCC 4BLIA 4PJ0Z 2OQ6A 1XE8A 2DYCA 3R4DB 5FY4A 3JD2A 5CB4A 4CDQB 5F32A 4RHV3 1IKQA 2UURA 1JZ2A 5H6QA 2XQRA 3EBRA 4ITCA 3ZCCA 3AK3A 2RDQA 5JI7A 1SMVA 2FKXA 2OCCB 2BSKB 3J8F1 2W94A 3RNSA 1QJY1 3NR7A 4CEYA 3WCRA 3NAPA 2YIBD 2YUEA 4ZXKA 3U4SA 5D5QA 4FJCC 2AZ5A 2WZR3 5IYCO 3K79A 4C1XA 4IQPA 4FCAA 1PMJX 2XUEA 2JDAA 1P7GA 2GZWA 2PHWA 4LBQB 3UKMA 1R091 3M1HA 3RS6A 1GWLA 3LA7A 3JALB 1BE3H 3LQCA 4RR3B 3N2GA 5IT9N 2ZGNA 2A3YA 4IV1A 2Y0IA 4LO8A 1CPMA 4UCUA 1XQ8A 4UFHA 2D6OX 2RMU1 1S1AA 2QCSB 4U2AA 3PIGA 1VRBA 2FTKA 3TAYA 2WNUB 5CFCC 1UOFA 3WX5A 3GWKC 1OCCB 2CTWA 2IFRA 3ZN5A 1W6QA 5ACA2 1JI6A 1NQDA 3CF6E 4WV8A 2Y0OA 3D4KA 1S0CA 2P3IA 3I8TA 1LU1A 4NO4A 2YPJA 2WZR1 4JI6O 3A0HZ 3OMAB 3T08A 3C2UA 5FP9A 3Q8BA 2WQ4A 3LDRA 1GN6A 3ZIXA 5LEKA 4CH6A 4PIZA 3RRDA 5JUVA 1RUC2 4V2WA 4AAXA 2MHFA 1UU6A 1KS5A 4B08A 4Q29A 3RSJA 4GX5A 4N43C 1IBKO 4N43B 4YGEA 3TB0A 1GOHA 3VBOB 3JASA 2ZX4A 1Y9QA 1VLNA 4EJRA 5JH7A 4LLOA 2C9AA 1KFXL 2WUHA 3N9QA 2HVKC 3VD5A 4DUYB 4J6GA 2Q1FA 1O8SA 3AP7A 1JVMA 2E76B 3CMAV 2VL4A 3OUSA 2Q0AA 1PGW2 4IW3A 4WCEV 3CPWU 1F4HA 2OTLV 4K7JA 4LO6B 2OYZA 4LEJA 2V73A 2RMU3 1AYN3 1NE6A 3HBKA 4LE4A 1YJKA 2VZPA 5GZCA 3DEMA 4CP9A 1H1MA 1FS0G 1Y7BA 5L9VA 2MEV1 2VW0A 2GNTA 2VBDA 4UB8Z 2ADEA 3GZEA 1M57B 4FXKB 3RZGA 2UXXA 4E2QA 1V6JA 1P8JA 3B8NA 4TUYA 2CY6A 4XUOA 2DYSB 1GK9A 1JYXA 4DV5B 5CB7A 2K9ZA 1XMQB 3POWA 3P1IA 1BCXA 3DECA 5EIBC 4XFHA 1AILA 4CDXC 1K34A 4MVQA 5CA0B 4GQ7A 1B3QA 4Y3OA 5JWPA 1W2UA 4NHYA 3RYCA 4DYLA 5EJZB 3A0KA 4LBKA 4DRRA 1W6PB 1VQ7V 4JGYC 1JYWA 3T1LA 1BJQA 5F3CA 4I7ZB 4YY3B 4LIUA 4TLFA 1W9SA 4NMIA 3ZFFA 3ZXLA 2GN3A 3CXCU 4O9EA 4HANA 3IMNA 5A32B 1BEV3 2KD7A 3ACIA 1BHBA 2D3SA 3RYKA 3ZRXA 2Q5TA 1J3PA 5FYCA 5D8AC 2W1UA 1JYCA 1LKNA 4JKLA 2H94A 3PDQA 2QJVA 5FZ6A 3BUCA 3ZFEC 3ZEDA 4EYUA 3VZJA 1S4CA 3EB7A 4NTXA 3DC6A 3D36A 4JTCB 4I0WB 3IDCB 4QPYA 2HWE2 2JEXA 2E33A 1A34A 1G9FA 2BUKA 2P22C 4H44B 2OPKA 3IWZA 4LA2A 4DUVA 2JDPA 2IJHA 2A3WA 1WD4A 2GTAA 5F5CA 4B3NA 5EZYA 5CB4B 1PNGA 2YZ4A 1HN1A 5J48A 2QEXV 4YZ1A 1R3LC 5LA1A 4R4XA 3KS7A 4XF3A 3CCJV 3PMSA 4YHHO 4LNVA 2IH3C 1HQWA 2ZM6O 4R9DA 4YG6A 3T2OA 3PVEA 3UO2A 2WL1A 3W59A 3ZMNA 1HV1A 4KWJA 2E5LB 3OW2U 3HKDA 1CPNA 2XVKA 2JIJA 2FDKA 3FX7A 1CAXB 2DBNA 1VBD2 4DW0A 5J3UA 5CISA 4X66B 2E5LO 2J1TA 3ZRWA 2BVBA 3QD6A 4IL7A 3RMYA 1BXHA 4MYEA 1F4AA 5HCFA 4QU1A 2HHHO 1YFXA 3F7VC 2ET1A 3BB6A 3PVOA 3WU2Z 4X8AA 4AVVA 5F3EA 3WF4A 1JQ0A 1FD9A 1Y4MA 4HKOA 4AHCA 3VLBB 5CZKA 2IXCA 3ZJZA 1UNBA 2OT5A 1WCQA 3R0RA 1K33A 1FOD3 1K3EA 1Y74A 1HRI1 5H9PA 1GZWA 2QTSA 3BOWA 1UOJA 3WY6A 2RE9A 1CAUB 2XT9A 1JXNA 1JU4A 2R073 4ZU4A 2J1VA 5CA1B 4DV3O 3IAPA 3T0DA 3VL9A 3O12A 2JXAA 1HQLA 4IE6A 1I1EA 2HJFC 5JVVA 3F7YC 4RFRB 3WDTA 1JA8A 4EFBA 3J7HA 5C8WA 2ATFA 3LGRA 2XAHA 4WVMA 1OUXA 3N9OA 2YFZA 1RMU2 5JQGB 1KS4A 3K48A 4NHXA 3ZR5A 3K77A 1DF0A 1HW5A 4YVSC 3A2FA 4M3CE 2O8QA 4FPYA 4YY3O 1H8TB 4DR2B 3GBFA 5DN6G 2DJVA 4JI1O 3JALA 4UB6Z 3S57A 1R6KA 2ZHMA 1QHDA 1O7FA 2XBO2 4HVRA 2QQLA 1KC8W 2RR11 2VW2A 4EZ4A 2R072 3IC9A 1N36O 3D6EA 1SETA 3FD9A 1QU7A 4LF5O 2QWOB 3SR2C 2HVJC 5IATA 4PA6A 1TNFA 2JJ6A 5CA1A 2JDNA 3V0AA 2DW4A 4P9OA 4D6RA 1CIWA 1NCQA 3FFZA 3VD9A 1OKOA 1WLEA 2WNVA 1POV1 1IBLO 3J9SA 1RUJ1 4O2BA 5KX5B 2F23A 3VBFA 3RW0A 3B40A 2WZR2 4C0HA 1GH6A 5JIAA 4JI8B 1LOFA 1R3KC 2B4KA 5DG1A 1UO9A 4DR6B 3C8XA 3I2KA 4DNYA 4RWUA 5GLTA 4X6RB 1U97A 3B9CA 2UWCA 1NZCA 3VGIA 4ISQA 5DMYA 4OLLA 5BMVB 3BCCH 2PELA 3JD72 5DZFA 4FP2A 3NNGA 5IAVA 4LF7B 5DN2A 1UMIA 3VL8A 2XLGA 1OT5A 4JASA 3ZLIA 3N36A 1UZ0A 1V6NA 2FZ2A 3N7MA 1MG1A 1K5MB 3FBMA 2VQEO 3ZSJA 2F4LA 3SEPA 4W65A 1WCUA 4OUSA 3JCIA 5ACA3 2ARCA 3IGAC 2WS93 3K0GA 1V54C 1DDLA 4QGNA 1Q6HA 2YIDA 4IGGA 5J1XA 4JCKA 4QM9A 3NAPB 4CCKA 2HWE1 1FPOA 3QBQA 5A3MA 2OT7A 2HBTA 3IDBB 4S2GA 1K73W 5FNVB 2E3CA 1ZRFA 3LFMA 4MXWB 1RPRA 3AK2A 1W6PA 3WUCA 3KV9A 4NRQA 4LO5B 2C9KA 1D5AA 4KXRA 4FLTA 4AGGA 2H6BA 2EIMB 3NNMA 4H7LA 4JGYB 2W2IA 4DV3B 4TV9B 1U96A 3H8XA 4XUPA 2EINC 5LY1A 3RDIA 3OBAA 3RYIA 4DOUA 3JCUZ 4Q0SA 4L8JA 1PZ9A 4FPHA 5J98B 3AZXA 4FPGA 5B66Z 4BQ5A 5GZGA 2ZAHA 5L3DA 1OLME 3MUZ1 2A70A 2X8KA 4I5SA 4GMP1 2AUYA 3TBDA 3ZYPA 3RT3C 4IEYA 5GZFA 2BE3A 3VKFC 3VBUA 4KBZA 3BN6A 1EAH1 1S55A 4LBNA 5KUKA 3HKEA 4ZS3A 5JZGC 1NOVA 3LOBA 4MOAA 2KXLA 3KHBA 1PL4A 1SLIA 1S0BA 3VKLA 3WG7B 4UBHA 2PHXA 1ZZ8A 5K0UC 3RYCB 1I0HA 3VKOA 1EM1A 3KWVA 4J7ZA 4LF9O 3EYPA 4I01A 1TME2 3GWOA 4CXYA 5TISZ 4NUBA 1DF5A 1N1SA 1WLDA 3CRMA 1DQ2A 5L9RA 1QQP1 1M57C 1FXKB 3NNJA 1OCOC 4NN0A 2KM2A 1AZDA 1PVXA 4ASMB 2AR6A 2HLDG 2EIGA 3WNOA 2IZWA 1SEFA 1OA2A 3G6JB 4MG2A 3SCFA 2KG7B 2UXBB 1YDXA 1ODNA 2BJSA 5IJRA 2FYUH 1SQPH 3CCEV 2JDZA 1IPKA 3VBFB 3KMHA 3ZKUA 1LAJA 4U3FH 3AK0A 2OKXA 2W0FC 3HKDB 1XNQO 2MK3A 4GZRB 1HDJA 1VQ9V 2C24A 3FHQA 1SDDB 1THZA 5JMCA 4IYIA 5CA3A 2QA4V 4DK0A 4FSJA 4CEWB 5EPAA 1IKPA 1XL4A 1LGBA 2PLV2 4YG3A 1SC5B 5I0TA 1VRH3 4LF4O 5EC2C 3CCVV 5C70A 3RZLA 2QR4A 3JBG3 2BGPA 5CBLA 2ZR2A 4COZA 2ARXA 3ECQA 4MGYE 1DGSA 2OWOA 1I08A 4JI7B 2ADQB 4HNAB 4BXSV 2Y69C 1RUJ2 5BNQA 3A7QA 1GANA 4XUNA 1NKDA 3KZ4C 2QKSA 4M4PA 1XXNA 2VZOA 5GTHZ 1HV0A 1T6GC 2C0ZA 1XI1A 2WZ8A 3PUAA 4YZ5A 2X0LA 4XAEA 1AVBA 2Q6AA 2XWBB 4UFMA 3CQOA 2ZE6A 2KQXA 2BSKA 1KP2A 5FYTA 4PI2A 3AX4A 3K5LA 1K92A 1RXFA 1W0OA 3ACFA 3AYCA 1WCSA 2UUAB 1F5JA 3K57A 4NVPA 4D7SA 4E27A 4FM0A 5IFPA 4ZXEA 2ILMA 5BNOC 2QM7A 2PF4E 1YHQV 1DTOA 2AGAA 4UFJA 1AI4A 3JB8A 5AFBA 5FFOC 4URTA 2R7EB 1VP7A 3FLPA 3W7SA 4N9HA 5B3SC 2GC3A 2XB6C 4AEDB 3HQRA 2E53A 3AG3B 3TJTA 4JQRA 1PMIA 2VNRA 4JC1A 4E2SA 4Q4X3 3PVBB 3C3VA 2LTNA 1EFRG 3RZMA 4LF6O 3AG2C 1IS6A 2DF7A 4FVMA 1TMF2 4Y20B 4ASKA 2ZACA 2FMYA 1HDKA 1OSGA 4MTGA 1VBB2 3SLIA 3CRAA 1QF3A 4FMTA 3OD4A 3FN9A 2VY0A 1R3JC 2WWWA 1UPGA 3AM2A 4Y22B 2KKWA 1MQTC 3GCWA 3Q4HA 3FB8C 2VZVA 1N3OA 1SF9A 1RM1B 1RHI3 1SCRA 2W1QA 3ZFEA 4J1WA 3TN93 5C9AA 3PMEA 5BXZA 5AC92 2XAFA 1UJWB 3D5OA 4XDPA 2EXIA 1H8EG 4FFHA 2XBO3 5D21A 2IVIB 1HB1A 1HR0O 4E4HA 4PA4A 3I4IA 1CR7A 4QDRA 1ASJ3 3H1JH 3ZRVA 4QXBA 5HBAA 1EAH2 4TUYB 5T5PA 2DCYA 2CDPA 4CU7A 4MXWA 1Q6IA 3MIDA 3ST7A 4PQ9A 2RJKA 4LHLA 3ILNA 4MVTA 1GYKA 4X6QB 1YQCA 3USUA 5LHHA 4BIFA 4K0KO 2C5DA 5A6ZA 4BAYA 2RS31 2CE4A 2VOKA 2R042 5JH7B 3VBBA 2XH6A 4XFAA 4HVOA 3ZFFB 2QKAA 3K58A 4QIWF 4DK1A 3R4SA 5F5AA 1MZEA 1UYPA 3PUIA 4RS5A 4CTEA 1EN5A 3AJYA 5LBBA 2X7RB 4EE2A 4J1XA 1ASJ1 4XDJA 3EXAA 4DRXA 1QKQA 2OVUA 4JI1B 2LGQA 2HWF3 4TN7A 3O1MA 1FXZA 3JBG1 1M5IA 2J1RA 2ZR3A 1ULPA 2DWEC 1MABG 5FZBA 2HYXA 2WS92 1TAEA 5CBHA 4G9SB 4AZZA 3M8LA 3POBA 1VARA 1WW4A 3DXRB 1LCLA 3U37A 1CIYA 3G7DA 3T1CA 2HWB1 1PHMA 1WWYA 5JQGA 4OI4A 2XJVA 2NP0A 3AXEA 5C3OA 1UN1A 4UXNA 3WB2A 1G8WA 5LRSA 1H2NA 1YTFD 4GUNA 2QQKA 4N43A 1GQPA 4B4PA 1OC1A 5C8YA 4TV8B 4IGQA 3TEWA 1W8ZA 2D6LX 4I0XB 3S5QA 3WB0A 2Z69A 2E7QA 3B7MA 2DN9A 4UV9A 4UCVA 1N1VA 5J96B 3MF9A 5C8CA 1JCHA 1RUH2 2QWPB 4N7UA 3MLLA 5L3FA 3AKPA 4DV2B 4QX2A 5EYXA 2W6JG 5BY5A 1AR91 4FI9A 3B4SA 4YXWG 3SKVA 3MAQA 5LBFA 3OCPA 3K3NA 2YXYA 5KMGA 5CFCA 3U14A 1R081 3N3HA 3KT7A 3JU9A 2ZABA 1IXBA 1RIRA 1COWG 3BY6A 1UF2C 2O14A 1OCCC 3ORJA 1BZKA 2WNUC 4XW3A 2Z79A 1TVKB 1WLWA 2C26A 2CK3G 3C7EA 2D6MA 3ABLB 1M4WA 2DQ0A 1AX0A 5L3CA 2DTWA 2HHHB 4W6WA 5DUXA 1B6QA 1Z78A 4GMP3 4I09A 3ZIWA 3NV1A 2I07B 3JAKB 2ATKC 1JU3A 2KSDA 1DLLA 3KCYA 3NJVA 1L7LA 4TWKA 2CTRA 2Y4TA 3LDDA 5I0UA 1K9MW 3KG2A 5EV7A 1N0JA 1W6MB 4LFCO 1C5HA 4CZZA 5JCOC 5FPVA 3HQXA 5A32A 3AZWA 3HMYA 5ABJC 4I9QA 3H1KH 2OXBA 2RV9A 3AP6A 1M56B 1FJGB 3K9SA 4LWSA 3QACA 1EV13 4CU8A 1LECA 3FUOA 1I5PA 4UF0A 3SJCC 2C6SA 4KWUA 1X50A 4EB6A 3VN4A 1PIV3 4WM7B 1OQ1A 2JG8C 5F5QA 1GTOA 2JRIA 4LF4B 5A3TA 3UKTA 4DV1O 5IK5A 1FNYA 2WWSA 3IB3A 3H8OA 1ZRCA 2BWCA 2R0HA 5CMUA 4I9WA 4XC9A 3O0VA 4WVVA 1UPIA 4LNUB 5E89A 1S0FA 2VQTA 2R32A 2D3RA 4NXNB 4GB31 3SPJA 4Z1VA 3D0SA 2TNFA 2QDNA 4BJ0A 1FFTB 1ZZ7A 3S30A 5I0DA 3L9DA 4MVOA 1VMGA 1PD3A 2UXDB 3L71H 4DXRA 5JVDB 4CS4A 2RS12 2R041 4XQWA 5CEHA 2ZHLA 3EMRA 4RSUA 1PVC1 4Q4V1 4X65B 5LZ6A 2B45X 3TEXA 1K5MC 1LHOA 1L0NH 3W7TA 2E7TA 1TA8A 3BKZA 1CD3G 5EZYB 1AI7A 2PLV3 3LFIA 1Q81W 3L75H 4MGQA 2PZSA 2JJ1G 2R0FA 2W9XA 2A6YA 5J36A 5LA9A 2JB4A 4X88A 3OM3B 3AG2B 1QJEA 1WCKA 5H5NA 2UUBB 1F4NA 1TGOA 1R64A 2VVEA 3OEBA 5IVJA 2WZEA 3SXWA 2A9HA 4UVBA 4LFCB 3HAGA 4MGIE 3MLKA 5FYZA 3E8GA 1ZREA 2HWB2 1VE0A 4K40A 5FZ7A 2JGDA 5KHGA 2WLMA 3LE0A 4XACA 1GP5A 1MS9A 4E4EA 1OCOB 1D4VB 5G04L 3OUFA 4BR6A 1BBT1 1XOYA 2OPWA 5IY5C 1RUF1 2PHFA 3OTOO 1P7BA 1LOCA 3SMHA 2CUGA 1TEIA 4FK5C 1NCRC 5FWEA 5FO8B 3OGSA 4YGBA 4RS5B 4LQRA 3LKJA 5E16A 1VALA 2CGNA 4DV1B 3LNMB 1GZ9A 4A2UA 1RMU1 2X5IA 5JSRA 1O3TA 1VPHA 4W4KA 4HSLA 4W4ZA 3WOGA 1S0DA 4MADA 4IUGA 3ZM8A 2AC1A 3R05A 5HFMA 2PYLA 1IPJA 3T2TA 4GZ9A 2ZHNA 4U7OA 3TWIA 3B01A 2RDNA 2IU3A 5FY8A 5FMOL 3T1YO 3BABA 3CB2A 5A6QA 2RDRA 4W8JA 3VZOA 3MGUA 1D0HA 2JDMA 4DR4O 5FYSA 3O14A 3TN91 4XUTA 2F66C 3LWCA 4C90A 2YROA 4CEWC 1IQAA 4NAMA 1XSQA 2BPA2 1SKVA 5FY5A 1H9PA 2Y8KA 4NXNO 3I3EA 3H1YA 4FPCA 1GLHA 3S7EA 3VDDB 5LGTA 1G9DA 4R6ZA 1XSRA 4DV0B 3DGTA 3U07A 1ZBE3 2Y64A 2J1UA 1QJY2 3MDPA 1AL21 2DOSA 2HJDA 3X29B 2ZAAA 4RO2A 1JOYA 1VBB1 3O1UA 3R4UA 3CRQA 1V54B 4YVSA 2VMGA 4CDWB 4XMIA 1MEC1 1EAH3 5E88A 4E9KA 1ZX5A 3MV01 1U5XA 1JJOA 1X82A 2Y48A 4CC6A 4GB33 5FYIA 1Q8SA 1YFYA 3KGLA 3WZ1A 5A7PA 4LK7A 2OQ7A 1ZWIC 1GN4A 3A23A 1NCRA 4Y1VA 1CQ9A 3JAWB 1PGL1 2PHTA 2R043 5IVYA 2DBIA 4ZONA 1WW5A 3PU3A 2E63A 3VDDC 4YJ2A 1RB8G 2GP5A 3UESA 2QQMA 4XCBA 5F2WA 1X59A 5L7OC 5J2UA 3MZHA 3RYFA 4XILA 4GX0A 1GO3F 4OUEA 5AFEA 3ZFGC 2PY5A 3VBSA 3G71V 5EK0A 4YVWC 2CGOA 2VZRA 5BNPC 2VCCA 4N8MA 2BBVA 1UFIA 3D3AA 1PVC2 1LHVA 1M9NA 5GM0A 1ZL8A 3ZYFA 4XFBA 2EIJB 4BQ2A 4JI0O 3MICA 2HWC1 5FZDA 2VUCA 4NR1A 1OLRA 2LM3A 2WYSA 1MSDA 3CC4V 2NPIA 4Y5TA 2ZGMA 2FB5A 1PO22 4QD2A 1WCDJ 4W6YA 2WFF1 4IT5A 5FTTC 2WFF2 3LNNA 3GALA 1ORQC 1RUE2 1K5MA 4MLOA 1H8TC 4QKBA 4XOGA 1NBMG 2IJKA 1NR1A 4O4JB 2F4VB 3FKSG 3NVCA 4L9BA 1US6A 1S2BA 1Y76B 2GALA 1MOFA 2WS91 1OCRC 1V6LA 5FZ0A 4LCUC 4MGTA 1RUF3 4NPLA 2RR12 3OJBA 2WC2A 4ICGA 2Y6JA 4GKKB 4J7KA 1QMJA 4TXWA 1NCRB 2TUNA 4WZCA 4C91A 4FTSA 1QJU2 3W21A 1RUH3 2P7TC 1OHHG 1VRH1 1POQA 2BOIA 2OUHA 4RQFA 3SISA 2VUDA 4Q26A 2ZE7A 3WP4A 4XJ9A 3HJRA 2VXJA 1HWYA 1C1LA 2WFF3 3Q8FA 4CP9B 5BPXA 3HEIA 1TUBB 4GD4A 3V0BB 3OB8A 3E5XA 4XURA 1IS3A 4AGRA 3VBHC 1EZJA 3OGVA 3OGGA 3DYMA 1SLTA 1J84A 1NXMA 4QHZA 4K21A 1WMEA 3NKTA 5FO9B 2GAUA 4E8DA 1NX9A 1R092 2B9UA 4WFHA 4B3RO 5LP6C 5A3LA 4AI0A 4DW1A 4BQXA 3ENRA 4EFEA 1L7QA 3HPLC 4X8NA 4CCJA 1O59A
chains in the Genus database with same CATH topology
1U5IA 3R6SA 4AEJA 1O3RA 4XFFA 4YM3A 4AI1A 3WR0A 2Q0AA 1PGW2 4K7JA 4Z2WA 4AXOA 2DVFA 4OFGA 4TSVA 4G3YC 4YW4A 4LO6B 3FHIB 2OYZA 3V64A 5CADA 4C1WA 4LEJA 2V73A 4XTPA 5FPZA 2D98A 1AYN3 1NE6A 2RMU3 3H1WA 1H30A 3OYWA 4LE4A 1YJKA 4GWNA 4MV2A 1ZRRA 5GZCA 4BA6A 1OS7A 1H1MA 1ZBE1 2WLQA 1Y7BA 2ES3A 2MEV1 2ZGRA 3ZXFA 1LEDA 4YLMX 2VW0A 1U12A 3W58A 2GNTA 3A4UA 1GNZA 1ONAA 1FV2A 4OZXA 4FXKB 2Q1MA 1BYHA 2R1DA 1COV2 4E2QA 1V6JA 1VBB3 3KD4A 3AFKA 1MS5A 5T50A 3USSA 2CY6A 3WLUA 3RWNA 3CJIB 1QH6A 1B09A 5L73A 4YYOA 2DU0A 5I8SA 5CB7A 4KWKA 3AP5A 2E7AA 2K9ZA 4TZDA 4XFIA 4PJYA 4HETA 3POWA 1BCXA 3ES4A 1W6OA 1XU2A 2EVXA 4GWMA 4XFHA 3MS5A 1HXS2 2W52A 3WDYA 1NY71 1GICA 4CDXC 5DXDA 3RQ0A 5AC93 4XHXA 4GQ7A 4JDNA 2P37A 4BOWA 5BUVA 4G4FA 4OI2A 1EPZA 3SWTA 1BZWA 3V17A 5JWPA 3VZMA 1LHNA 1W2UA 3VUOA 1URXA 1NCQC 2YMZA 4L11A 1NYWA 3QLQA 3A0KA 4LBKA 4DRRA 1FATA 4DY3A 2DCTA 2RM23 1UU5A 3JD73 4Q4Y1 1W6PB 1OOPA 3ZDSA 1SLLA 4JGYC 1RUD2 3JZVA 4XE9A 1MEC2 3T1LA 4GALA 1BJQA 5DZGA 1ND3B 3FLRA 1D2QA 2JG8B 4TLFA 1ULEA 3ZFFA 3ZXLA 2GC1A 2GN3A 4BH9A 4COUA 4O9EA 1F31A 4HANA 1YFUA 5BNNB 2VNOA 1REDA 1I9RA 1DU3D 3IMNA 5A32B 1BEV3 1LB2A 2CTVA 1V6IA 2ZCWA 3U0ZA 1QH7A 4R8HA 4B7EA 2DUPA 4P9WA 2D3SA 4JGZB 2ZKNA 2WA4A 1LOBA 1HRV3 3RYKA 2Q5TA 4YRDA 1J3PA 1FMD2 3D82A 4NPRA 2ZX1A 3QH6A 5D8AC 1JYCA 1LKNA 5HCAA 2F6BA 1F8VA 1O3QA 2QJVA 3LOIA 2ZX2A 2VUAA 3ZO0B 3ZFEC 2HWE3 3LSDA 3VBSC 1YUDA 4WBBA 1ZZ9A 3VZJA 4M23A 1LTEA 4QPIB 3WNXA 5JDBA 2ZMLA 1ENQA 2E51A 2HEVF 3B9IA 5I8TA 1QOTA 1DIWA 4I0WB 3IDCB 3ZYGA 4QPYA 2HWE2 4WM8C 1FT9A 4D94A 1ENRA 5CU1A 1G9FA 2BUKA 3B94A 1R1ZA 4QPGB 4AK3A 4XYXA 4LO7A 2OPKA 3IWZA 3GHNA 4LA2A 4ZU7A 2WKKA 1JTZX 4XHBA 2A3WA 3ME2A 1WD4A 3SH3A 3AMPA 3VBRB 4AFDA 4B3NA 3B00A 1VIWB 2NMNA 1OOPB 4CRQA 1IGOA 1PNGA 2YZ4A 5J48A 4YZ1A 4AQTA 1D2SA 4QPGA 3KCCA 2PHDA 5C9AC 1DZRA 4R4XA 2G9FA 2JG8A 3RI9A 3KS7A 4XF3A 1NE4A 2R1BA 3PMSA 3ZYJB 4LNVA 4Y1XA 1D4M3 1HQWA 4KWLA 3EATX 1QDOA 2HEYF 3B02A 4IV3A 2RS33 3ATGA 1REEA 2PYTA 1DFQA 2VMIA 4R9DA 4YG6A 3PVEA 3NV4A 1LU2A 1UD1A 4AEKA 2WL1A 3W59A 3ZMNA 1REFA 2GU9A 4MUVA 2VW1A 4OJ8A 1HV1A 1L3JA 4KWJA 1Z0HA 1CPNA 2VOVA 2XVKA 3ZXAC 1RINA 1CAXB 1PO23 2BTVC 4YG0A 5FDBA 1NLRA 3DV8A 5KXBA 1O4ZA 3AMHA 2ZPXA 1VBD2 5J3UA 1UW8A 3GYDA 1N3PA 4B4RA 2BVBA 5BNNA 3QD6A 1R1A1 4IL7A 4GKXA 3RMYA 1BXHA 1GQWA 3WW1A 4YFZA 4MYEA 1ULFA 5HCFA 3ZYIB 5GLZA 1YFXA