1YCIA

Factor inhibiting hif-1 alpha in complex with n-(carboxycarbonyl)-d-phenylalanine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
336
Chain Sequence
GEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of factor inhibiting hypoxia-inducible factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
total genus 99
structure length 336
sequence length 336
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1yciA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yciA01
4B7EA 2CGOA 1IZ3A 2XUMA 3P3PA 1YCIA 3P3NA 4JAAA 3KCXA 4Z2WA 5JWPA 2W0XA 2ILMA 4Z1VA 3OD4A 4BIOA 2WA3A 1MZFA 1H2KA 2YDEA 4AI8A 4QU2A 2CGNA 4B7KA 2YC0A 1H2LA 1H2MA 3D8CA 2WA4A 1H2NA 2Y0IA 4NR1A 3KCYA 1MZEA
chains in the Genus database with same CATH superfamily
4EWEA 4I30A 5KX5B 4TUYA 2E5LB 4JTNA 4CP9B 4GKXA 1XQNA 5J9PC 4C1XA 2P5OA 1X33A 1LENA 1N33O 3ZXGA 4EN9B 5JMOA 3O1OA 3THTA 1MZEA 1KBHA 3NW4A 1QDOA 4OHZA 4LKSA 2ATKC 3LDBA 4LF8O 1DGWA 4MSWC 2XAFA 3ZIWA 1BEV2 4B3SB 1SFPA 2UUAB 5LY2A 1A3KA 3M3IA 4MUVA 4D6RA 4XFAA 2HLEA 1IKPA 2DTWA 5JI9A 1A8MA 1HV1A 4QPIC 2NMNA 1O4ZA 4EN0A 1YFUA 1FS0G 3DC5A 2E7QA 1AR73 2ZXWC 4Z2AA 1BBT2 1YFXA 4TZDA 4DB5A 2CE4A 1W03A 3A21A 4F8AA 3I2DA 4GKYA 1K5MC 5IYYA 2XNDG 4XUNA 2DYRB 5EIBC 4LIUA 3WF2A 5HCAA 4JKLA 4AQSA 2JG9C 2YXHA 5CKNA 1YF2A 2R7EB 4FM0A 1SLTA 5EPAA 2X0LA 1VAVA 2BWAA 4GMP1 4P9LA 3OUIA 2W08A 4YIPA 2PAKA 2FQPA 2Y38A 3M1HA 5FFOC 1YQ2A 3UM7A 4P5HA 1W6PA 4FPEA 3IC7A 1SLCA 1HNXB 1K73W 1SESA 1PZ9A 4HT1T 3OG2A 4QGPA 1M1KW 4DR6B 1LAJA 2WKKA 3E22A 2FDKA 2CK3G 5FZ1A 3SCGA 1YDXA 1ZL8B 5IFPA 4IGOA 2Y69B 1HV0A 5JZGC 2AR6A 3CC7V 4CVUA 3ZXAC 2DFBA 1S3JA 2QGNA 3CXHF 4MHRA 2NZ9A 3KHBA 1HB4A 2FMLA 2PLV3 1R093 4O65A 4XFCA 5B1AC 3MHSC 3N7LA 5EP9A 1DHKB 3JD73 1Q6HA 2GC0A 3GBFA 2FMDA 5FYVA 3P3PA 2ZPXA 4ZHNA 4OQ9A 4GLXA 3CX5F 1BXHA 4MH0E 5DZEA 1H2SB 4AEDB 1ZNPA 1ENVA 2ZJCA 1U5XA 1HW7A 2HWD2 5DZGA 5I0UA 4CH6A 4NPLA 5JOXA 4I2OA 4D69A 4I50A 3WW1A 2EINC 5FY1A 3RVZA 3GNEA 1DGRA 2WAMA 3R6SA 2IXIA 4IV1B 4Z92B 3U11A 2DU0A 3T1YB 2QJ1A 3RMXA 4M4RA 1KGYA 1DYOA 3UGFA 1IPKA 1COV3 1JZ6A 1IBLO 1QU0A 3K3WA 5T5JA 5GLWA 4QX0A 3W9AA 1N3PA 2PYTA 1UCXA 4X1KA 4GMP3 1HRI1 3WG2A 3ZMSA 1HRI3 2RJKA 1UJWB 5JIAA 5BMVB 4P9OA 2JEUA 3N3HA 3VKNA 2QQOA 5FYBA 1WBFA 1WWYA 3DUIA 5JJNB 3K0DA 5JH7A 2BOJA 2Y26A 4JGSA 4BZ4A 3MW3A 2ARXA 4XQDA 1FD9A 5IUQA 5K8SA 2P5BA 3IBMA 1JW6A 1OFSA 4H33A 3O0XA 2C1FA 1NI8A 1JOBA 4QKNA 3VBOB 3E6DA 3R4DB 4INDA 4JQTA 4LUMA 2GN7A 3SH4A 4XXAA 1QJFA 3APOA 4X8NA 1TMF3 1JJOA 1YJLA 1Q3EA 3WNPA 4E4EA 4BIZA 2VUCA 2HEYF 2YFUA 4PDRA 5AC91 5JSRA 1OBNA 2EICA 4MGKE 4FMTA 2PQQA 2DURA 5DM6V 5GJ6A 4O4JA 4FP2A 3ZN4A 5FP7A 2GC2A 4AFMA 5DAVA 2QKDA 4LA3A 2XT9A 3NSTA 3ETEA 4Q4X2 3AMQA 3SH3A 4FLZA 3ZMUA 2QQMA 3KVBA 4M01A 1XSRA 2K0GA 5DG1A 1S55A 4AFAA 4XFBA 3BU7A 3NJZA 2VNRA 1NVPD 2XONA 4QWNA 5FZDA 1IG0A 3POGA 5DDJ2 2Q67A 4ISQA 2LFRA 5DAWA 3ACIA 3AM2A 4PA4A 4CEWB 4ZONA 1RHI3 1UZVA 2VBDA 2A3WA 2O8QA 2KSDA 2P1BA 4AQYO 1W39A 4PCRA 2YC2A 5DAPA 2Y6KA 4OQ8A 3O9OA 3WEZA 2W1QA 4K3AA 4XDOA 1QJU1 1QU7A 1PO23 3NNLA 4YJ2A 4P2ZA 1ND2B 4GH4B 4TQDA 1V9PA 1TNRA 2LW1A 1XILA 1XUQA 2N74A 3VKOA 4DFSA 1M06G 1AX1A 2P3KA 1OCCB 1H8TA 2BFUL 4BXSV 1ND2A 4GH4A 1VF6C 4QPWA 4FFHA 5KLVH 5FO8B 3KCXA 1PO22 3OPZA 3WVJA 1BLZA 3BUCA 1LNSA 1Z7S1 3UJQA 2JS3A 4HXCA 1VBC2 1JQ0A 1SQ4A 3J8F2 3JBG1 2RNBA 1J5EO 2OPWA 1KJLA 1GOGA 2H8PC 3TN91 1D0GA 4NTYA 3ZFFC 4TQFA 4BW5A 1AR81 2R063 5KWRA 4D7YA 4XEZA 4O4IA 3C7FA 1F5JA 4PIYA 5LBQA 4LFAB 3CRMA 1UKRA 3UJOA 5A3LA 1F4AA 2A6YA 1Q8SA 1YFYA 4JGZC 1JOJA 1IBMB 3O14A 3VOUA 2CTQA 4NRPA 1C8M1 4E4SA 1ONAA 3BCCH 2PHUA 3R4SA 4ZHQB 3RYCB 3POBA 3GBWA 5C3RA 4OPAA 3RW0A 1SETA 2ZXQA 3HKBB 1N0NA 2DQ3A 4CEYA 5FIXA 2L9LA 4JI5B 3C3TA 1AJPA 2EA7A 1SFYA 5FYIA 4IEUA 2JE9A 1NLRA 2HJDA 4JZ2A 3CWBH 1BEV1 2A71A 5LP6C 2VMEA 3HQXA 4CCCA 3DECA 3ZRVA 3DYPA 2VXJA 2QKCA 4CXYA 4V2VA 3VQWA 1ZX5A 1JFFA 3I5DA 1OPOA 4MXVA 3T0BA 5T52A 1T6GC 2A7AA 3CMGA 5JR2A 4IQPA 4AI9A 2RS53 2H0BA 1I3HA 1WMFA 4CUBA 4P9XA 1WLEA 4X1IB 3ZO0B 1UMHA 3L2HA 4QB6A 5K1PA 4MW3A 2Y0PA 4GIQA 1WLWA 1MMMA 2HWF3 3BTZA 4KI5M 3JD3A 2P3JA 2W1UA 3QO5A 5FYCA 3H1YA 4GZ9A 4DYLA 1QH7A 4CC6A 1GZWB 3RBZA 1N1YA 3K08A 4JAAA 4O4IB 1X36A 1CESA 5EZYB 2VW1A 1RUE3 4UFZA 2WZR1 4XE9A 1PGL1 2W52A 1JS9A 1W2OA 5KHJA 2FYUH 4DEVA 4W65A 2LGWA 1QQCA 2ZM6O 1QOOA 2VL4A 2XR4A 1YI9A 4C8DA 1FXHA 5AG2A 1TEIA 4YM3A 5FZFA 1OH4A 5L73A 1VP6A 3A2FA 4YW6A 2F95B 3KV6A 5IVFA 2D3OW 1QR8A 3HOBA 1YI2V 3UGGA 2E32A 3HAGA 3CMEV 3THDA 4U2AA 2PUSA 1HP8A 3H1WA 2WYFA 4HPKB 1XSQA 2RS33 2DYCA 2W92A 3B93A 4IGQA 1W05A 3K4ZA 4ZHQA 4CH3A 3RYCA 2OS2A 1R091 4NB5A 1YITV 1WLTA 1GN3A 2CTRA 3RWNA 1V6KA 5BNNC 1CPNA 4C90A 3G6BA 2AEZA 2WDBA 1W2UA 4WM7C 3NNFA 4GKKB 3AC0A 2DU1A 3RZHA 3RZJA 5DDJ3 2Z4FA 4YG0A 2XUMA 2ZGNA 5HI0A 4LBOA 3RSJA 2QM4A 1KKDA 4H13B 5IAVA 4J11A 2XVLA 3QACA 4ISRA 2ITDC 2VZ1A 2VC9A 3KG2A 3CO2A 4MGIE 3R05A 2HG5C 2ZR2A 2ATFA 4NPMA 2Q7HA 4AVBA 5LXTA 2VG9A 4UFLA 3ABKB 1LHVA 5F3CA 1POV3 1SPPB 4O4LA 1WD3A 2ZHMA 1QNMA 1O59A 4K8RB 1K8AW 4LMFA 4PDLA 2YROA 1YIJV 2W3JA 3LIGA 3Q4HB 2OQ6A 3NV1A 4DO0A 1TGOA 2RMU2 2JXAA 5CG9A 2Q1ZB 4XDLA 3E89A 2MNGA 3MF9A 4WVZA 4X20A 2QJVA 4NIGA 2YEVA 2BTQA 3G80A 4XAAA 1UZYA 1GKBA 3J7LA 4XDPA 1RL3A 1YUDA 3GHMA 2A6VA 4X8PA 4P9IA 1F51A 1EV13 1SDWA 3ZFEB 3QOPA 1W8FA 4A42A 1I7FA 2BNNA 4K21A 5LHIA 4LHSA 5LCWL 4J7ZA 4CH5A 3D3AA 1UKGA 3NWKA 4DV4B 2W0XA 1WJZA 3CNAA 2F93B 1S0VA 5JVDA 2XTAA 5F2SA 5LGTA 5L3FA 3FWEA 1LOBA 2W6IG 2YPDA 4OHYA 4DR4B 4OHXA 1RM1B 2P6CA 5FK8A 3LEKA 4RR3A 3BGAA 3K2OA 2UUCB 2OYQA 1NCRA 5FMOS 5L7OC 4N53B 1QDCA 1QBZA 1DGLA 2VBPA 2VU9A 2EIKC 4ASUG 2DCYA 1GU3A 4CU9A 3NNMA 1FT9A 2V1DA 1AF9A 3JQXA 3B09A 1D0HA 4IGGA 4U7NA 2R073 2RQ6A 5TISZ 5A3PA 2JG8B 3ALQA 2OUJA 4MVZA 5JZGA 1JH5A 1R083 2WR9A 4Q2FA 3BI3A 4S2HA 4GJYA 1NQJA 2RS12 4RYDA 3PU8A 1JUHA 2WN2A 3UO2A 4K7JA 5BXZA 1RUG2 1UW8A 1PO12 3UK9A 1H9PA 4I0AA 1QJU3 2GH8A 1I94B 1ND2C 4GH4C 1CX1A 2HLDG 4TV9A 1JODA 4CDUB 2E63A 1JZ4A 4QGLA 3I3BA 5CFDB 3HKEB 4H44B 2X09A 2WFF1 4JI4B 1VBE3 2D97A 1E79G 3OEEG 2BEOA 5GZDA 4UFMA 2NLJC 3RNSA 1URFA 3VD5A 1UY3A 5BNQA 3JALA 1VIBA 4Z82A 5FMOL 1MS5A 5BZBA 2LS6A 5KHIA 3IDBB 3CCMV 5IVBA 5BXXA 1RVF3 2L35A 5BNPB 3OGIB 3HQUA 3M70A 1UZZA 1VQMV 3JAWA 1C5HA 1OF4A 4OUSA 3AG2B 5I91A 1FPN1 3ZYIB 4IV1A 1V70A 3FMGA 3F7VC 4E2LA 4PIXA 4L92A 1IKQA 1GZTA 4J9ZB 1WA6X 4N43B 3AKSA 5A7WA 2AREA 4UW6A 3ZN0A 1BMV1 1AR82 3QH7A 3HQRA 1D4M2 3CCRV 4DV1O 4PDMA 3AL5A 2LQTA 3C8XA 4LFCB 1H8VA 4DEQA 3N9MA 4JKKA 1QIQA 4K9SA 4CEYC 3Q8FA 2J1RA 1VF6A 3IWZA 4UCSA 1HR0O 2W39A 3WDTA 4QT6A 4XMAA 4AI8A 2N04A 2G9ZA 1C8M2 1URXA 5J2UB 4PBPA 2A6WA 4QPGB 3AG1C 1H4HA 3M3OA 4O9GA 2XHNA 4UXAA 1L7RA 1D4M1 3LSSA 3ZDVA 2UXXA 1XU1A 4DW0A 5FP3A 1HQWA 4B3MB 1AR93 4OHVA 1VRH3 1N4CA 1I5YA 4DV0B 4XUTA 5LB6A 1K12A 5IJ0A 1X4TA 4B8EA 3HNYM 2XBO2 1ZZ6A 3BALA 2CWMA 5HCHA 1MR5A 2YZ4A 2C6SA 4CXXA 3DXUA 2CUGA 4FQ4A 1QLNA 1DDLA 4YARA 4BIUA 1WKYA 1S0FA 4HNAB 2JJ1G 3VHNA 4KFMA 5FZ8A 2SLIA 1RUJ2 3GYDA 4PHZA 4OMCA 1GLHA 1GV9A 2D6MA 4UVCA 2EXJA 4MTXA 1D7PM 2ZGKA 3BABA 3OUFA 3LF7A 1QJX3 1NU1H 2HWF1 3H8RA 1D2DA 5LATA 5CFCA 1YHQV 5FNVB 1E5SA 4JDOA 5FJHA 3VZJA 2AZ2A 3HKDB 1DG6A 3E86A 3H3LA 3K9SA 1Y76A 2VQFB 1AX2A 5EV7A 1WW5A 1HXS1 4NR1A 3FE5A 3LZZA 5EYPB 1VQLV 1NE6A 3B02A 5IVJA 3BA9A 2Q0AA 4Q20A 3TEYA 4KXRA 1PGL2 2X7RB 1PIV2 3HN1A 4OI1A 2D5HA 2LW8A 3CU7A 4C91A 2VRZA 1JZ3A 4BU2A 3R4UA 1BHAA 1QNWA 3ORJA 3NV4A 2ZKNA 4M00A 4EE2A 4Q4Y2 3POWA 1MQTA 5J48A 1NVPB 1PIV3 2OIIA 3ZX6A 4Q4X3 3BEHA 2DVAA 4CDQA 4LPLA 1SACA 2UXDB 2W2IA 4XF1A 1AR72 2W6JG 5ITZA 5JH7B 3AYDA 1RPOA 1Q8PA 2XAHA 4DV3B 3U75A 1VBB3 3CJIB 5F3GA 2YXSA 4EN6B 4FPOB 4X1KB 1O6UA 1FV2A 3UT0A 5T5PA 4QGNA 4QKFA 1S5JA 3J4UH 4MGYE 4XTMA 2FKXA 2YPJA 3PDQA 4KHPO 3I56V 1D2SA 2HR3A 4E2SA 1YRZA 1BK0A 2JB4A 1M57B 3FC0A 3ZFGC 2OT5A 3LSQA 1AR71 2QDNA 2ZX4A 1HIXA 2YFZA 4K40A 4MV2A 1RUD2 2WLHA 3JAKA 4X62B 1ULCA 2B42B 2NP0A 1OJHA 2AHYA 1WB8A 2ZA9A 4GJZA 1JFFB 1TMF1 4X62O 3H0OA 2RMU1 4UOJA 2DOSA 3VQXA 2LROA 4LFBO 3OD4A 4HNAA 3NKGA 2VCMA 2KR2A 1IBLB 1AJQA 1XRUA 1OT5A 2O1QA 3RZGA 4CU6A 3POFA 2WS92 4AK3A 4IHJA 3SKVA 4XDKA 3IMMA 4G4FA 1M56B 2ZX0A 2KB1A 1JN2P 4BM8A 1O5LA 1AJOA 2J1SA 3QVNA 2Y69C 2YICA 4DV5B 1K9MW 1XHXA 5ERLA 4CP1A 4JTOA 3ZYRA 1QLEC 3WFVA 2R16A 1XQ8A 2A9HA 3J7MA 2P3YA 3AFGA 1OF3A 3H1KH 5ABJC 4LCUC 1WGPA 1OZ0A 5D1IA 5JOZA 2IH3C 4OCTA 1OHHG 4LBJA 3J9SA 4U7OA 1WA4A 3WQ1A 4LA2A 2P90A 3WNOA 4FZ0A 1HRV3 3BY6A 2ZNJA 2QVSB 1RUE2 3ZXJA 3IC9A 5FREA 5FK7A 3PN1A 3BCWA 4QX7A 3GB7C 2OWOA 5L3CA 5A7WB 5CNAA 4PD4F 1C57A 2HWE1 4LQRA 5LA6B 4B08A 5A6XA 1I5ZA 4CEWA 3S7EA 3STLC 3ZHSA 4WM8C 2P2KA 1K3IA 4YM1A 5FZCA 3I59B 1ZRFA 4DXWA 1RXGA 5C3PA 4AGRA 2Q73A 3WDWA 1YCIA 1KXGA 3ABUA 1RUG1 1Y4WA 4HG6B 1CAXB 4I01A 1QJU2 2YDEA 2HEPA 2UWAA 1RUI1 1E1RG 1KFUL 3OGGA 5C9AB 4QB2A 3GZUC 5EBLC 2HWE2 2GU9A 1QJZA 3CS5A 1N36B 3S57A 1WA8B 5AVAA 2H6CA 1C8NA 3AVSA 3WF3A 1R081 4JV5O 3MICA 4MVQA 1G4YB 5KXCA 1EUUA 4XDQA 3GVMA 3E8FA 4ASLA 3ZR6A 5B1BC 3USSA 1PVC3 5KX5A 2WJSA 4S2FA 4DV2O 2KXLA 3JALB 5FMDA 3U4SA 3OBRA 4PJ0Z 3ZN1A 1GNZA 5FZGA 3LD8A 4L2NA 4IEOA 1ZUQA 4IEPA 4NXMB 3ZSEA 5EHDA 3TK1A 3L72H 4PJYA 4CDWA 4R8HA 1W04A 4Y33A 1GN4A 4RWUA 3SPIA 4L8QA 5LBBA 4TWTA 4E9KA 2PTMA 2F4VO 5A1AA 1LKNA 3SLIA 3GCWA 1UY0A 3K5LA 4PF5A 1G6UA 2WWSA 2CGNA 2EX3A 1I6XA 5LRSA 1W99A 4XC9A 3OY8B 2I2SA 3UESA 3G4SV 1WN7A 4JGYC 4IDZA 2PF4E 2C4XA 4TLFA 3H1MA 4HZFA 5KHGA 2Q8OA 4UWDA 1RUI3 3T3YA 4Q4V3 2E3CA 1XMQB 5B4NA 4AHWA 1W9WA 1GZCA 1WMEA 2GC3A 3RYFB 4EN8B 3ZS8C 1JYIA 5FYUA 2VZ3A 1RSOB 2Z69A 2ETNA 4XFIA 4QQPA 1MZ6A 3AP5A 4CDQB 3B40A 2OVUA 5B3SC 4D6TH 1YJWV 3OPWA 3H8UA 3TOJA 2XVGA 5F2VO 4JVAA 4R9AA 1LTEA 4LFBB 3VDDB 4PQQA 2GHYA 1EPZA 1MVEA 3J7NA 2AGSA 1C28A 3AP9A 1JYCA 2HWC1 4MLOA 1XMQO 2QQWA 1AILA 3D8CA 2RJLA 2P3IA 3O5SA 2FTKA 4IEXA 1UY1A 5FAXA 5H2FZ 4YLZA 5K0UC 5KAIZ 3RYHB 3IAQA 3PMSA 5IVEA 1K5MA 5F3IA 3KHCA 1K7DA 3TYJA 3URFA 4W50A 4HVRA 1AR83 4QD2A 3TWIA 3WB2A 3MUZ1 1CN1A 1JTZX 1XNBA 5IYCO 3OEAA 3Q8AA 1KD1W 1HDKA 3O1MA 4I0XA 4YW4A 4IUGA 3MPBA 5IDJA 2WSUA 1EY2A 1NZIA 1BCCH 4XBNA 4META 4O4HA 3RZKA 4F6RB 1PM4A 4X6RB 1HXS2 2MHFA 2VZSA 5EXOA 3TNPB 4P9JA 2PI4A 3OGJA 1B35A 1XOUA 3UL2A 3WDXA 3KSCA 2EXIA 3H8OA 2EIGA 1L0LH 4Z2WA 1W6PB 5C3OA 2A06H 3MIBA 5EWSA 4YG6A 3RZZA 4BDVB 1BE3H 1Q56A 3QBQA 5LWBA 5JQGA 4BK5A 1SQXH 5F9TA 1IS5A 1AI6A 5GLTA 4Q4Y1 5CU1A 2HWD3 1XDCA 5CADA 1NKGA 1LOFA 5GTHZ 4YW7A 2XOKG 4QJFB 1H6XA 4LITA 4FK5C 2YC0A 3M3QA 4GX0A 2Q9LA 2ZABA 5F6LB 1RUD1 2BV4A 2C9KA 4DV6O 2H94A 3JCUZ 4WFFA 2RCVA 2JKXA 2UXDO 1YQ6A 3OCPA 1E5RA 5JMCA 3OB8A 4DW1A 4IE7A 2E33A 4E8CA 5A3TA 4HVOA 5FPRA 1PD3A 1XU2A 4KG8A 1LNQA 2CU5A 4X88A 3ZN5A 1DQ2A 4KU8A 4Y22B 5K9YA 4X1YA 2WPDG 4K8FA 2JGUA 5CA3A 4XUQA 3U4XA 4BISA 2D2CB 3ZHQA 3N4MA 3AG2C 4DV0O 2YUAA 5ABJA 5JXHA 1ZSPA 3P6BA 1PMHX 2VH9A 4FFKA 4DV1B 4EB6A 2F23A 4CP9A 1UF2C 2D93A 5CFDA 4C0HA 3JASB 2P4KA 4Q1PA 4JGZB 1ZZBA 3ON7A 1WLDA 2AENA 1V55B 5ACA2 5LMNO 3BA8A 2VOXA 2BNOA 2WAOA 4N21A 3L70H 2W1SA 2BP6A 4NIHA 2YBPA 3LNMB 4LJHA 3BU0A 1H1IA 2JEMA 1E5IA 3DGEA 2XJUA 1PO13 4WFAV 5C8WA 3G67A 2XJVA 3AMHA 4P00B 4XXPA 4KQ7A 1JHJA 4ARYA 5H9CA 1PGSA 2B1IA 5B5EZ 1GN2A 1JVMA 4COZA 2EAKA 4RS5C 4NIIA 2XAQA 1FNYA 4Y1UA 2HP8A 1OLRA 4MT8A 4E4ZA 3PURA 2XOMA 3WP4A 2XJSA 3ABTA 3GCXA 2RS52 4IV3A 2ITCC 3K06A 4IE5A 1SQVH 1YZBA 1VRH1 1RUC2 1W9TA 1JMKC 3E2EA 5AFBA 1U12A 4H3WA 2IJKA 3ST7A 3VD3A 5LOVB 2TUNA 4KWLA 4YSFA 4FPLA 4IYHA 3T1YO 3SJAC 3BPSA 1REFA 5KAFZ 3IIIA 1Y9GA 1PPJH 4MOAA 3T4HB 2J42A 5KR7A 5KC5A 4QGMA 3MLKA 1SBFA 2GDFA 4KBBA 1CJDA 4D0QA 4CZSA 2IH1C 4UW4A 4X64O 4KWKA 1OLME 1ZBE2 5HV0A 1FPN2 3BTAA 5CA1B 4QPGA 1R1A2 4H14A 4CC5A 4GKJB 4RS5A 4XBLA 5A6ZA 5HXMA 4LC1A 3OFNG 1XL6A 4BW9A 3LDDA 4YNIA 1KDMA 1PK6C 2D5FA 3WF0A 4CXWA 4C7UA 3M99B 1XNTA 4YJ2B 5TSWA 4I3GA 2YC4A 5ACA3 5DAQA 1S0BA 5DG2A 4RD7A 1RUNA 3VZKA 1G86A 4IEQA 5C4WC 4JI8B 4IL6Z 5FXZA 3FFZA 2ZXWB 1VPHA 1KP2A 5GW7A 3R0RA 4LO7A 4O4JB 2W0FC 5FLHA 1XL4A 1C1FA 5DECA 2VQEB 5FY4A 4A7ZA 2VZUA 4DV2B 1Y66A 1ZRDA 3HPLC 2SBAA 3B9CA 2YIAA 5GZFA 1IG3A 4FSJA 2PZSA 5E1AC 4LF6B 4ES9A 3WB0A 5FQ0B 2C0ZA 2WAAA 2B1GA 3KT1A 4CDUC 3SYCA 4YPJA 1YYNA 2JD4A 5FWEA 1U96A 2Y33A 4DR5O 2BE3A 1Q6IA 1OD3A 4WFGA 2R1DA 1RMU3 1R3LC 3KZ4C 2E26A 1W2TA 1UN1A 2OXBA 1U97A 1NQTA 4UYBA 2D44A 4XW3A 1WLCA 5J1XA 1OD5A 4E8DA 5JIUA 1NH2D 4Q0VA 2ZKOA 1UIKA 5B1BB 4XHXA 2VQ0A 1XNDA 2QQKA 2ZE5A 1UYPA 1Y4MA 2VMGA 4ABMA 5AC93 2HVKC 4PDWB 1KJRA 4WM8A 4FPGA 1UIJA 5D8AC 4BB3A 4X1YB 4EQVA 3DXRA 2QBXA 2GC1A 2EXKA 3AKTA 4I55B 1LGNA 2JGDB 3X2QB 2GMEA 5EYXA 3PVBB 1IS6A 3H50A 2DCTA 4UT5A 3LFMA 2WNUB 4AEMA 1BVVA 1FYJA 2PXJA 1QJY3 2HWC2 1VR3A 2WNUA 5FKBA 2JDHA 5FZKA 2HEVF 2X5IC 2ZCEA 3KQRA 3AFKA 2VWKA 4DY5A 3AMPA 5JR7B 1HNWO 2B4KA 4TWKA 4YW3A 5FYMA 4BQXA 4UUJC 3QTCA 3NAPA 2DVGA 2ZNIA 5D2AA 5DUVA 3SC7X 1SRYA 2GSYA 4MVMA 3EBRA 2MEV2 4AAXA 1SC5B 3LB9A 2K46A 3DCQA 4A45A 1H1AA 3HNBM 4Q0SA 5L9RA 4Y22A 3C2UA 3O1SA 3FLTA 4N90A 1EAH3 4XIOA 4PELA 4DK1A 3A7QA 3AYEA 5EJ1B 1DF5A 5H9SA 4ZS3A 3IIAA 4QXBA 2RDQA 2JE8A 2Y60A 3NL1A 4JDMA 3ZRWB 1CAUB 3IDEA 2UXCB 1Y76B 1SZBA 4I0WB 4X20B 2JEXA 3HKDA 3MUY1 1GQPA 3V0AB 1P49A 1LOAA 2GV9A 4QQOA 2E75B 1PKXA 5A32A 4PDVA 3V56A 3ZVXA 3CCUV 3B01A 1ZL8A 1RFYA 3DPRA 5B4XA 1XYOA 4UXNA 1VMGA 1J3PA 4P9PA 4LO6B 3N35A 4PA9A 5CKQA 3W7UA 1B35C 4XZUG 2P37A 3C7GA 2ET1A 2FDJA 2RE9A 2Z79A 1DGRN 1TMF2 3H9VA 2XLAA 1S2KA 5FPZA 1AR63 2KG7A 3CSXA 2XL9A 4A7KA 4LF5B 1LOGA 3M3CA 4CP2A 4XURA 1BQPA 4GX2A 4LBQD 2RJZA 4PV1B 4YVSB 1B35B 3T4DA 3VQVA 5LGNA 2Q8DA 2YB7A 4BIFA 1I9RA 1BGYH 4URTA 1FXZA 2VY0A 1PK6A 3PUSA 2ZGSA 2YBSA 1WCQA 2PLV1 5I8SA 1YI7A 4A6OA 4SBVA 3JQWA 4XF9A 1VAMA 4DV3O 4OULA 3DPRC 3G6JB 2ZEWA 1UOFA 4GWMA 1JYWA 3WG1A 2UUBO 2R9RB 3K5OA 4AAPA 4QM9A 4QHBA 3LUTB 5A7OA 1ENQA 4WBBA 4W4KA 4ZU5A 1J59A 3N27A 1SLLA 2JDUA 3ACFA 4A7YA 3WG7B 2YU2A 2Y4TA 3NR7A 5A7NA 1US2A 2UXNA 3MO4A 4J7KA 1IBKO 5L19A 5DZFA 3BRCA 3JARB 1XNAA 1EN6A 2V09A 2JDIG 1B6QA 5LMNB 3AG3B 4X65O 2XKOA 5JJEB 2WQ4A 5EJ3A 4DR5B 5HXVA 3MBWA 1J1TA 5EQUA 3LAGA 4UBHA 3OJBA 4Q5OA 4BQWA 1V54C 4RQPC 3WV6A 1PVXA 4QU2A 1MS9A 3SXWA 5JSOA 3TRSB 1AYN2 2OW4A 4EWAA 5FYZA 2IBZH 2VECA 1ORQC 3O1UA 3WHTA 4LO8A 4UBGA 2XPJA 1B04A 3RJRA 1MS0A 3VBOA 2QSAA 2YHJA 4FTBA 2HEWF 4LH6A 3POEA 4LF8B 1S1AA 4QDRA 1LGCA 1IBKB 4CUAA 2LFSA 2WIIB 4ZBMA 3LNNA 5H5NA 4AHCA 4NWWA 2Q1MA 4WF9V 2DTYA 1YTFD 4JX0A 2VQFO 1OFNA 4NMIA 4JYAB 1C1LA 2Q68A 4I55A 3FUOA 3NV2A 5F1RA 1PHMA 3L71H 1L7LA 2GP3A 5FCCA 1N32B 4I9QA 4MTOA 1W6NB 1EAH2 3ECQA 1SEFA 2IFRA 2QZ2A 1W9SA 3MD0A 1V00A 4Q4W3 4IYIA 3I8TA 2RR13 4Z1MG 3ES4A 3VBUC 4NYKA 4CU7A 2BERA 1AXKA 4I0BA 1I0HA 2E9QA 3KF5A 4HN1A 1P7BA 1UZWA 5FY9A 1US6A 2WN3A 3B5LB 2IM9A 2PYLA 1CAXA 2AW9A 5LA2A 5L7OB 3ZYGA 5CB7A 1A8DA 1S2EA 1TQ5A 3VBFA 3LSUA 1F15A 3RWKX 1GWMA 1HJFA 1V9U1 5FPBA 1CPMA 1MS1A 4Q4W1 2NLRA 5LMUB 4HK9A 2WABA 1F35A 5L7OA 2DMXA 3K46A 4F6RA 1AVMA 4LOSA 1UNBA 4WCEV 4JDNA 4MW8A 4ZPIA 3VDAA 4B4RA 4JI0B 1W8NA 3ZJZA 2F4PA 2WNUC 1AL23 4Q26A 1D4M3 1UO9A 2IU3A 4EZ4A 4CDWC 4FFBB 3AYAA 4XJ9A 1N34B 1VIWB 1JYTA 3JD1A 4FI9A 4QPJA 4K3UA 1MABG 4XABA 3QO8A 4A5UB 1JCHA 1WNSA 2C9AA 1C8M3 3CCSV 3IFXA 4PLOA 3JAKB 3FHQA 4Q6GA 2A5ZA 5LK7B 3ML0A 4JYAO 3UO3A 4LKFA 2JIGA 1SMVA 4X89A 2EZOA 3NQHA 2VGDA 3OBTA 2DJVA 4AGGA 4B4PA 4HETA 4DV4O 3M3EA 3ZKUA 4HYOA 3ZMVA 1QJX1 1VQPV 4XUPA 1PNFA 1QHDA 4XJAA 4QNHB 4NXMO 3HKCA 1TNFA 3ZHUA 2GSMB 1YQ5A 4BQYA 3TCUA 2VWJA 1Q7YW 3OW2U 1GH6A 2AUYA 1MOFA 1WPXA 1NTZH 4G3YC 4QDQA 1H2GA 2ZHNA 4AFBA 4QE9A 1FFXB 3OAAG 2WLKA 2ZAHA 2NNUA 3SMHA 1ALYA 1ASJ1 2ZDIA 5KXBA 2R30A 1D2QA 3WQ0A 1CAWB 2UYBA 2UWBA 4J25A 1CZSA 2ZS6B 3IM0A 3WU2Z 1QJX2 3S3WA 4FOYA 1KS5A 3UYJA 4N23A 3FFQA 1V6LA 3FL7A 4AW7A 2VOTA 2GH2A 2WNVA 4YZ3A 3RGBA 2R1BA 1BSMA 4YHHO 4RGGA 2QQLA 2QE3A 3ZFGA 1TME1 4CE8A 4LBQB 1ZBE3 2ADEA 3JYCA 4RUFA 1V6OA 4LLOA 2XDVA 1ASJ2 2EIDA 5FPLA 4L9BA 1S0JA 1O3RA 5FLXN 2QWPB 2HH9A 3IT8A 5A3NA 1CP9A 4GX1A 4KBZA 1BMFG 3I54A 4CCDA 4BOWA 5E8AA 1Y3TA 3MHHC 2R072 1NUKA 3VBOC 2ILMA 4AR2A 3DYMA 4OGQB 1K5SA 4Q4Y3 4MXWB 2QWOB 3I7DA 3BTXA 1KMIZ 1KS4A 2JDNA 1DCSA 1H9WA 2DDUA 2DWRA 3OM3B 1LHNA 4AI0A 2ZIMA 1WP8A 3ZMZA 4X64B 4DUWA 4HK8A 1FAYA 4Z1VA 4FLUA 5LP6B 3ASOC 1JJ2U 3JB4C 2UYAA 2EZPA 3HBZA 3W7SA 4YY3O 2WZ8A 1SLIA 1WA8A 1KC8W 2R071 2E6VA 2XJPA 5HCBA 1UL9A 1X50A 4DV7B 1EBOA 2N7GA 1OSGA 2IU0A 1HRI2 1RUG3 5CA0B 1ENSA 3UCSC 2UXCO 2JRIA 2OUHA 3RI8A 4M3CA 4ET7A 2KD7A 3FBMA 3M7AA 4OI2A 4YWAA 1IURA 3VZMA 1DU3D 2CHHA 3GWOA 3CHXA 4HBNA 1S4CA 3PTYA 3TEWA 3BB6A 4HLTA 1WCUA 4YXWG 4GKKO 4RGAA 3CCLV 4GWIA 4XAEA 4QPIA 4LBMA 4TSVA 4RHV3 3RZMA 1VQNV 3AG4B 2EVXA 1ZZ9A 2E51A 3JATA 1AL22 4P08A 1ULEA 2CDOA 1BZWA 3S30A 4B7EA 2JK5C 2ZZJA 5IJRA 4IGPA 2RMKB 1O8SA 2YXYA 2VMDA 4HFSA 4TV8A 4UI9L 3BOPA 2VE1A 3FX7A 2DBIA 2AGAA 1R3IC 2QQNA 3WF4A 1VBD3 2ZX1A 1RYYA 1BCXA 4F3JA 3K3OA 3G71V 1POV0 3OF1A 3ABMB 4J80A 2BVBA 3SHRA 3SCFA 5JSPA 1NE4A 2XXZA 5F3EA 3J7HA 5FZOB 1OCOC 4BLIA 4LTAA 1UMZA 2PHRA 1PNMA 1KP3A 2RM21 4QX8A 1Y9MA 1VALA 4IEYA 3WOGA 1JZ2A 1SDDB 1SS3A 4QQHA 2XB6C 5CG8A 4R52A 1ZBE1 2D43A 4CUCA 2DUQA 4M3CB 4Q0UA 2BJSA 1S5HC 3Q8BA 3IKWA 1DF4A 1P84F 4TUYB 5BPXA 2X6BA 1RUF1 1DQ6A 5HFMA 4TSFG 1LOCA 3SEPA 4JV5B 5FZAA 4MGSA 2HJFC 4DR2B 1FPN3 4GWJA 2WNEA 4Y1XA 2VXRA 1UPSA 5A1FA 3MLJA 2BGPA 4IETA 3VL9A 1H2KA 4K0KB 5CMUA 1COV2 5AVPA 5LBCA 2IWGB 4IEWA 1HB3A 1K45A 4JPRA 4O61A 4C0BA 1F2NA 3B77A 1BJQA 5FRAA 2JICA 1BK1A 1UYXA 4IV3C 2DQ0A 4FXGB 2UU9O 4LE4A 3MGUA 4HSLA 1YNAA 4JYCA 3UKTA 1H6YA 4P30A 3MV11 5FYTA 2WL1A 4LOTA 1RSOA 4V1PA 3ZXDA 1RMU1 3O0WA 4O9EA 1TZOA 4TV9B 3RPQA 3WSOA 3W58A 2DYRC 4CDXC 2J1TA 5K4LA 3ZHVA 4N9HA 4Z07A 3C90A 4LLFA 5L3DA 2QTOA 1QVGU 2QA4V 3MYXA 5C8YB 2LP7A 4JI7B 4G9SB 1BMV2 4IIJB 1L0NH 5GALA 1V9U2 4I5SA 5C70A 4F6EA 2Q8VA 1H8EG 1WW7A 1AXZA 4YYOA 3KT4A 1ULFA 1GMGA 3CXCU 2UXBB 5E6HA 1EV12 5FP9A 1EP0A 3HWJA 3AJZA 3WQ7A 1OCRC 3JARA 4E27A 3QH6A 3P1IA 3MAQA 2VCBA 2R043 1TA8A 2F4LA 4NTWA 1EPWA 3RWRD 3ZXKA 3L74H 1JZ5A 1ENXA 4QKBA 4CSWA 1MSDA 3SYQA 1L8DA 5FLJA 3ZX7A 5FZ0A 5A6QA 5GLVA 3WUCA 4WM8B 1JZ8A 2PHXA 3EHBB 1RC6A 1DZQA 1W6OB 4XF4A 3H7JA 1W0JG 2UUAO 1E5HA 2WA3A 1QQP1 2VW0A 2B45X 5JXGA 4LK6A 5KXDA 3QO7A 4GUNA 5EFUA 1SA0A 2J7MA 4DUYB 2JDMA 4NIAA 1X9PA 5JJJB 4WM7B 4LBNA 3KKYA 4JC1A 1FXKA 2VMFA 4UVBA 4U3JB 4CCJA 2HWF2 4QDSA 3LA2A 4OZOA 1WD4A 4O2AB 3CJIC 5C93A 3VBSB 4CRQA 1MPXA 1ZZCA 4LFCO 2Y64A 3F5TA 4RSUA 4FM1A 3WNKA 1DQ5A 5FYHA 3QF7A 1W0PA 3OGVA 2H6BA 3BOWA 4S2GA 4GZRB 4B1MA 1XREA 2ZAAA 3T1CA 3GWKC 1PIV1 1ZTEA 1HQNA 4IXLA 1LUWA 2GTAA 2AACA 2YUEA 1BHBA 1NXD1 1DYKA 4IW3A 1NJIW 3PHMA 3ETDA 1YIFA 1IQDC 5GZGA 2OIEA 1CD3G 1QQP3 1O3SA 4DINB 5H9PA 2ZTNA 3PUQA 4KP4A 1S0EA 1G8WA 1RUF3 4S2DA 3WT3A 1XNQO 1BBT1 4QPIB 4QPYA 1QY4A 4JI4O 1RUH3 4NHXA 3ZFFA 1OQEA 3SQOA 3T2MA 5C8CB 2M6YA 2Q30A 4ZZ5A 2A75A 3CRQA 4BQ5A 2QQVA 5KMGA 2LO1A 4X1IA 2BFUS 1WP7A 3MZHA 2ZMKA 1GTOA 3I49A 2WO1A 4AVSA 1D5AA 4I3PA 4BMEA 2IW5A 5IFTA 2YIBD 2EINB 2QDOA 2HBTA 2OT7A 2R6QA 2YU1A 2WNVC 1LODA 3MLLA 2ADDA 4L97A 4J6GA 4DR1O 4W4LA 1VB2A 4FIPC 3M4FA 1PNLA 4IHJB 5C8CC 1REEA 1RIRA 3KV4A 3D4KA 5FMBA 2C5DA 4XMIA 1GP6A 4LF4O 3ZOIA 3OMNB 1U5ZA 5CFDC 4BQ4A 2WO3A 2PAEA 1RXFA 1Z0HA 2P6HA 2Y6HA 3VDDC 2ZE6A 5ITZB 3ASOB 4PA6A 4NTXA 1MZFA 1X82A 4MO3M 2GALA 1P4RA 2V5YA 5CA6A 2MPFA 3ZCCA 1VAKA 3AZZA 2YG0A 2QQIA 4AG4A 4U36A 1O9HA 2F4VB 2R0HA 1RUJ3 3ZYPA 4K1YA 2RVAA 2WS91 2YGMA 1RUH1 4ZU4A 4DXRA 3I2HA 2BGOA 4LNUA 1ZBA1 2CTWA 3ZFEC 1NY72 1NXMA 2JDYA 3ELNA 3AX4A 3UKNA 5EBWC 4GQ7A 3WDVA 4R9BA 5T54A 4NXNB 1HWYA 2UUBB 1X9TA 1AL0G 3CJHB 4ZOLB 5IYZB 2CTVA 1UWWA 1SLBA 4N53A 4KGQA 4YGEA 2XG3A 5FOJB 3H3ZA 4Y4RA 1K97A 5FZ9A 2R32A 1I5PA 3OBAA 2WNOA 5FNVA 3DKWA 1BZKA 2G9FA 4ZXEA 5JI7A 3JD4A 2KA3A 3APBA 5BV6A 1NT2B 4FBFA 1K92A 3G7DA 3VBBA 5KMGB 3VQYA 4IL7A 5LYJA 1FFXA 4JZRA 2Y0OA 4AFCA 4UB8Z 1AUYA 4LR4A 1R3JC 5FZOA 2Q7GA 1ZRCA 1IGOA 4JTDB 3FAVA 4AVCA 4GAZA 4PBOA 2OTLV 1TG7A 1KU9A 3T4VA 3UT5B 2OZJA 3OTFA 3WNMA 4DMIA 2WLNA 1IVSA 2JS5A 2LTNA 3SPGA 5CEHA 4CDQC 1AP5A 5A6YA 1BQZA 3K03A 3K3NA 5GZEA 1J1LA 1DF0A 2VCCA 5KA6A 4NIDA 4CU8A 4MYEA 4M0HA 5KXEA 2HBUA 2IVJA 2E5LO 3GXUA 2JE7A 4LO4B 4JHZA 1Y43B 5A7SA 5KUMA 2HWB1 4G2KA 5A33A 5C7GA 5CBGA 2Z5WA 1F9KA 3PUIA 5F5CA 2DVFA 4YVSA 3AG4C 5C4WA 2BBAA 1A78A 3EXAA 3JSNA 4HVQA 4O4LB 1GWLA 2Z3YA 4HKLA 5JLVA 3ZM8A 2BTOA 3VKMA 2NN4A 1XNCA 4Q0QA 3T1HB 4H7LA 5DN6G 4GB31 2VQEO 3HT1A 1PGW2 2J22A 4K8XA 1C3HA 3RQ0A 4CDXB 3LDEA 4DV7O 3MF6A 3JD72 1AI4A 1COV1 1PVC2 1EUTA 3VZNA 1HX6A 4RQPA 2R041 4LK7A 2FDHA 1N0JA 1DYPA 3CYOA 2B9ZA 3HR0A 4MG2A 3DPRB 3FAVB 3ZN6B 4UFKA 5KHHA 1VP7A 5B3SB 1PM7A 2B5UA 4DV5O 5FMCA 2ZGRA 1CX4A 3AJYA 4N43C 4JASA 3JAMN 5SV8A 5F32A 4G27B 1K34A 3C3SA 3AP7A 5C71A 5GONB 2ZOEB 1EZJA 5IVCA 2EIBA 3JD71 3POYA 5JCTA 4YVSC 1OLQA 3N2KA 1EV11 4JAVA 1OUSA 5A70A 5K1XA 3ZMNA 4XBFA 2B9VA 2PHDA 3WNNA 4NXNO 3VD7A 2RDCA 4COUA 5LEKA 4JV4A 2W68A 1PO21 4XFHA 4BQ1A 1FJGO 1PMJX 4Y20A 3HD8B 3ZFGB 2R70A 4LNUB 1J3RA 1Q8QA 3JBG2 5BNPA 1PL0A 2EBOA 2O0OA 4MADA 4A6SA 1F4MA 4M3CF 3LDKA 4AZZA 3U07A 3THCA 4CCNA 1ST8A 3W5MA 4I50B 2ZKLA 4JI2B 3CZUA 2ZGLA 3MPPG 4DIQA 4SLIA 1KRIA 2BCCH 3ZXFA 3NVCA 2RMU3 4OFGA 3JU9A 1W0NA 5JOWA 2Q0OC 5GONA 1PZ8A 1A32A 5J36A 3AG7A 3POJA 1W3VA 4JGYA 1FYUA 2X05A 1T6BX 1XJAA 2WQ8A 3FBYA 4AHZA 5F5IA 5B1OA 3TAYA 1U0AA 1FOD3 4P9GA 4YG3A 1HKDA 4UCUA 3IDCB 5F8PA 1RGSA 1N1TA 4Y20B 1UD1A 1SZTA 2CSGA 4RQPB 3K58A 1L1FA 2HFEC 2CDPA 1ZBA3 1GNYA 2A1XA 5IYBO 3U10A 3OUSA 3THPA 1V55C 3J80N 2ZZQA 1ZRIA 3ILFA 2FDIA 4CDWB 1MEC3 2PHWA 2EILB 1JHNA 1DLCA 1UX6A 4CCKA 3N9QA 3OBZA 2B7YA 2FMYA 2WZR2 3D36A 2YY1A 1UPIA 4QPKA 2DUPA 3JCIA 2BU9A 1X8EA 4R9DA 4FLVA 1YO8A 3I55V 1MS4A 1YJ9V 1NA1B 5BYNA 4UCOA 1NR7A 3WG4A 2FCTA 4RL7A 2W94A 2JD9A 4QX5A 4L99A 4LNVA 1NQDA 4COWA 1QLEB 3SH5A 5D21A 3FN9A 4YZ4A 2VZPA 4XIKA 2Y48A 2A7WA 4YVWB 5FP8A 4NN0A 5C9AA 4DUVA 4RHV2 1GZ9A 5I8YA 4RAIA 3VBSC 2PN5A 5LHGA 3OGCC 2PY5A 4FLYA 3ZDSA 1O3TA 4P9YA 4XTPA 5JCOA 2BSKA 3E5UA 3K5NA 5FXWA 1CZTA 4HAMA 2WO2A 2OIGA 1JYXA 3VBHB 2XH6A 2Q5TA 4EZHA 4AXOA 1S77D 3NNJA 5L3GA 2LRPA 2VQAA 3CKHA 2A6XA 4FO9A 4BA6A 3GDBA 1Y74B 1S72V 3O65A 4TV8B 1FV3A 5DUXA 4DXZA 3OYWA 2IC1A 4KHPB 3I3DA 4N53C 2JWPA 1MVQA 4D7TA 1FAFA 3HJRA 3KMHA 1VQ9V 5IHRA 2BVVA 5LA1A 2CY6A 2HKXA 1SQFA 1E57A 5CBHA 5C9AC 2AZ5A 3N36A 3D0SA 1G9FA 2C26A 3K9AA 3QNEA 1RUH2 1NH2B 2UU8A 3RZLA 2ZQMA 3V0AA 1ZBA2 2WLIB 1NY71 5FO9B 1VRBA 1GQHA 5FY0A 3VV1A 2QQUA 3GJAA 1AB3A 2VZQA 3ZRWA 3SITA 3O1VA 5FPVA 3VDCA 3VUOA 1UZ0A 3MEPA 4DRRA 5CBFA 2K9PA 2G4IA 2AXTZ 1DFQA 3BKZA 5T50A 2BGCA 1A6CA 2YI8A 2Q7EA 4GB33 1XOYA 4YVWC 1TUBB 1IPJA 3RYIA 4ZKIA 4QQLA 2DE0X 3WCSA 3ACGA 5BNOC 3A0RA 2GP5A 2ARAA 5IY5B 2WT1A 4LHKA 2HVJC 4AEDC 4UW5A 3OD0A 1XNRB 4AGVA 3NAPB 4FQZA 1GSLA 1F4NA 3TETA 1MQTB 3INAA 4I9WA 4Q27A 5DDJ1 2WLIA 1O9GA 1R73A 3NNGA 5F37A 1SFNA 2GN3A 2Y6JA 2RR12 2HWB2 1V6MA 1HNZB 2B9UA 4H37A 4EV0A 4JTCB 4WFBV 4NAOA 2R72A 1NCRB 3EVKA 3H1IH 3RVHA 1RM1C 4XFFA 1AYM3 2L6LA 5D5QA 1R64A 5IW0A 2DVDA 3H8XA 1YTFB 3CEIA 3OGRA 5E1RA 1QKQA 3FLRA 4FLXA 5FY8A 4BLJA 2R042 3ACLA 1NX9A 1HNXO 1P8JA 2ORZA 2C2AA 3DF0A 4NHMA 5E79Z 5FZLA 2RR11 4HANA 3ZPOA 1C4RA 4BIOA 2JDKA 1J95A 1KKCA 1JX9A 3ZSMA 3TEZA 5APAA 5J7MA 3HKBA 3AZVA 2FL4A 4Y1ZA 1B06A 1BYHA 3O0VA 1Z7S2 1PGW1 3FB5C 3SR2C 3AP6A 3D82A 1VBC1 3Q8EA 2V73A 3KCCA 2D3PA 4XDJA 1ULPA 4X9QA 4DO2A 3AK3A 3BTYA 2HKOA 3LDRA 4MX3A 4ES8A 4BH9A 3MDSA 3ZN6A 1S0CA 4OX9O 5K0UB 4AE2A 1J83A 2WLQA 3AB0A 5EYPA 4J42A 3UGHA 4WVMA 5FO7B 2J1EA 3UETA 3N7KA 3LEMA 3ILNA 3T08A 3STZC 1OOPA 3VLBB 1AR5A 1VQ5V 3EMRA 1FMD2 1ZWIC 2P22C 1ZREA 2Z2SB 3PIGA 3J8F1 1VMFA 4JTAB 5FZMA 4QHZA 4O4HB 3E8BA 3CJXA 5C6CA 4LF5O 3HR9A 1NA1A 3W21A 1WUVA 3H42B 2QWNB 3K04A 1AP6A 2VZRA 2QKAA 4Q8KA 5A33B 1DZTA 1XYPA 4CTEA 4D6QA 1G9DA 1DQ1A 1IQAA 2GNBA 1UX7A 4RGKA 1Q90D 5HFLA 1KUQA 3AG3C 2IXLA 3VBSA 1H8TB 3HT2A 3D0JA 4JCKA 3VD4A 4TT3G 3RYHA 1I5XA 3HIFA 1R6TA 3UT5A 3WNXA 2OA2A 4HPKA 1XB9A 1XE8A 2XBO1 3WX5A 1POQA 1QXRA 1OVPA 1VQ8V 4D8MA 1NR1A 1WCKA 1O3QA 2IVIB 1RUJ1 3C7OA 2VUAA 3F7YC 3AG1B 3JD0A 3ZXEA 1ND3B 4YHHB 3GJBA 5LOVA 1ODNA 4A2UA 4GKJO 3OSDA 4OYUA 2A70A 2RV9A 1NT0A 2XQXA 2GTSA 1SG3A 3AMNA 3I3MA 1GK9A 2EIMC 1IBMO 5J98B 4YGBA 3CJHA 3RFRA 1YHFA 1M4UA 4EEQA 1S76D 2IJHA 1CAVB 4KG0A 3C3VA 3LDCA 2LW7A 4TOIA 3PIJA 3RS6A 3OY8A 1NCQA 3T1LA 1XE0A 4D94A 1QWRA 3IAYA 4JRAA 2R0FA 1XHZA 3CC2V 1SBDA 3I4IA 2BYVE 3OPTA 1NLSA 5FL7G 3RG0A 4CCOA 3A4UA 1MS3A 2IXHA 3EYPA 4H0LB 4AEDA 2CH7B 5FXVA 1V6IA 3JXSA 4KWUA 5JAXA 1OHFA 3ASIA 5SV5A 4NROA 1VARA 3PVOA 4Q29A 2DF7A 1JR9A 3WW4A 4AILC 4ARXA 3ROUA 1CIYA 3N7MA 3PL0A 4TN7A 4B1LA 2YIDA 4Y5Z0 3OMAB 4JI1O 5JVDB 1YIPA 3W59A 4Y3OA 1M57C 4UB6Z 3K51A 4NUBA 1SBEA 4CZZA 2LALA 2VPVA 4FAGA 3KS7A 1HNZO 3X29B 4R50A 4K20A 4C1WA 3ZYJB 2FZ1A 3T0AA 3ZXLA 2V4DA 1S0IA 2XLFA 1NG0A 3H1JH 1OURA 2LGQA 1OCZB 4OZXA 1VMJA 2PMWB 2GDSA 4EKWA 4QQ2A 4AVTA 1CXZB 2BTQB 2P6JA 1BEV3 4FOWA 3WUDA 4PLNA 2XAJA 1ZLZA 4J9YB 1UQXA 5B1AB 2JG8C 3VBRC 4FFBA 1G9BA 2F1MA 2Q4SA 3WG3A 1W8WA 2V5DA 4DY3A 5C4WB 2D6NA 3TB0A 5ACA1 3F95A 1ND3A 1ULOA 2XJRA 1KB9F 1PK6B 2CV6A 4JKMA 2DWEC 4WZFA 3JZVA 4CCMA 2QR4A 1ZAUA 1AR4A 2V72A 1L3JA 1GR3A 2RS31 2D6LX 2G38A 3BFRA 1Z5WA 2QM8A 1HQLA 5J37A 4KMQA 4OPHA 2W95A 1K4DC 3VBUB 3B8MA 3LFIA 1T5EA 1R6KA 3IDAA 5CFCC 2X5IA 3KWVA 3N7JA 5BR8O 3N9NA 4B3TO 2WINB 1UU6A 1OPMA 1XNQB 5HV4A 1WBLA 3CMAV 4W6YA 5LA9A 3NAPC 1GYKA 1N34O 2E7TA 2DCJA 5IYDO 3AZWA 4N7UA 2CGOA 1RUC3 1RUC1 2B39A 2VOKA 2F66C 1WZXA 3MW4A 4YFZA 5DQ0A 2CGPA 3MDPA 4NOTA 3WXPA 2XAGA 5E16A 1SF9A 3F2ZA 2ZACA 5FUIA 4N8MA 5KBFA 5DPNA 2ZGTA 1WCSA 2OKXA 1OXCA 2JG9A 1QOTA 4B3NA 4LKEA 1MQTC 2XWJB 4WVMB 4K1ZA 4M3CE 2W91A 2E7AA 3PU3A 4YW2A 1F5FA 1R1A1 1GO3F 2D3SA 5LASA 2XHKA 5K7PA 3NMBA 2IJJA 5FWJA 2VM9A 1HB2A 1Q43A 1J58A 2ZT9B 4ONUA 4WFEA 2EULA 1GBGA 4FJCC 1QMJA 3JASA 4FAHA 4GX5A 1SQBH 3V64A 4GALA 3A23A 1Z78A 1PO11 4Q4X1 5C33A 5L9VA 2AYHA 1HDJA 5DUUA 1X7NA 4ATEA 3AP4A 5FZ4A 2VZTA 2GAUA 3VB9A 2ENRA 3KM5A 1RUD3 1Y7BA 3B8NA 1W2AX 3IPVB 1MG1A 3ABKC 4JI3O 5FPOA 4GMP0 2ES3A 2EIJB 4EFBA 4A44A 3ME2A 2KKWA 1Y67A 3APQA 2EXHA 2JGDA 2EIEA 2X6CA 1W0OA 2MEV3 2JDZA 1ODMA 1YSCA 1JA8A 2FDFA 4LT5A 2RN9A 2WNVB 4IEVA 3OE7G 5IATA 5I93A 2P4EA 2UXBO 4DR3B 4FPJA 4Y1VA 3WY6A 1OCCC 2ZBJA 5M0TA 3ZIAG 5F5QA 5FV3A 1NTKH 4AI3A 3U14A 1F8VA 3O1PA 1AYN3 1YXWA 3E35A 3B4SA 5A7QA 2PA7A 3B9IA 2RHPA 2ERFA 3ZSLA 3P3NA 4QXCA 1V54B 3ZYHA 4JI6B 4YGDA 4Q4W2 1AYM2 5FZIA 3CCJV 1CONA 3H1HH 2VTXA 5JPMB 3LCPA 3WP3A 3MI8A 4CS4A 1S0GA 5J96B 1JOYA 1W2NA 3AKQA 1JUIA 1HRV2 3Q8CA 1UPGA 4XJZA 3TEXA 2CTPA 5FUPA 3WNLA 3IN9A 2FB5A 1FOD1 1V6JA 3R66A 1RVF2 3CLPA 3VBUA 2CYFA 1VQ4V 5FBZA 2VVDA 4YGCA 3LKJA 2ZX3A 4NHLA 5FZ3A 3PJQA 4WBNB 4I7ZB 3VD9A 1K5QA 3PJYA 2VVEA 2ZE8A 3NV3A 3E5QA 4LORA 1W8OA 2P67A 5JPNB 5FQ0A 2ZEZA 5F39A 1GFF2 5IT9N 2VBBA 4FXKB 2DV9A 3M8LA 1VEWA 4DRVA 4QPGC 3Q4HA 2QQPA 2D6PA 1G7YA 5JVVA 3A0NA 2RDRA 3SPCA 1HR0B 1LRHA 4CA9A 4ZU7A 3KGZA 5LA6A 4BWAA 1ZA4A 4AVVA 4COYA 2WSSG 1OH3A 3VBHA 3V0BA 3MV01 5GLUA 4O2BB 4K8ZA 2ZGUA 1LHWA 5J09A 1FPOA 4YW5A 2V4VA 5FZ7A 3LWCA 1QOSA 2GUZB 2EALA 3RMYA 4FTEA 4AQ2A 2D3RA 1XBFA 2JENA 4I4TA 5FPUA 3PUAA 3MIHA 1H2NA 1WAZA 4IESA 1OCZC 1R6NA 2P06A 3ZLIA 2Y6LA 2E74B 4WBNA 2YBKA 3K77A 4MSVA 3TN93 4PA3A 4BJ0A 3KT7A 2PGGA 5A3OA 1QR9A 1O7FA 2JECA 4ZKTB 4B7KA 4EWDA 4E2QA 2WS93 2WBKA 1NZ6A 5H6QA 3VBRB 2QNKA 2VZOA 4RFRB 1PL4A 4LHNA 3JD2A 3QLQA 3HB3B 5C8YA 4PI2A 4R7CA 4M0NA 3AYCA 1X59A 4FFIA 3T2QA 4XZPA 2CAZC 5BY5A 5FTTC 3LPGA 3E8GA 3V65A 4OUEA 3VKFC 1CGPA 3ZYBA 3HKEA 4DRXA 5LW9A 4FVMA 2A73B 4PLMA 3HEIA 1OCRB 3ABLB 3ZHRA 1MACA 3ES1A 1MS8A 4ASKA 1WPBA 2DUOA 2QM7A 1OLMA 4B3RO 3M2MA 2PLV2 3ENRA 3S5AA 2RM23 2HWC3 2H3OA 1VF7A 2Q4PA 2AC1A 2DN9A 3PNAA 2A3XA 2F43G 4BR6A 2PAMA 2FCUA 3OEBA 5FKCA 5A1LA 2Y34A 3GF6A 1I08A 1NBMG 2A0LA 5IWAO 1E1QG 3AVRA 1OCOB 2PHFA 5ABJB 1QXPA 2A79B 4NAMA 2OZ6A 5JUVA 1EN4A 3ZSJA 1W59A 2Q8CA 4UF0A 4FPHA 4OX9B 4TXWA 5EBMC 1PX4A 3CJIA 3PLQA 1HW5A 2JDPA 5FY5A 3BN6A 1OQ1A 4X66O 4J7JA 2ZMNA 3ZIXA 5IVYA 4UCTA 4RR3B 3E83A 2AH2A 5HBAA 2R9IA 4FVVA 1AL21 5BUVA 4I4TB 1UU4A 3IZOA 2VNVA 3O1TA 3BYWA 4JZGA 3WR0A 2FHRA 4XF0A 2CWSA 3J81N 1N36O 2PHTA 3FYEB 1GQGA 4JI7O 3A8TA 1HB1A 4H55A 4LF7B 2VTFA 1H8HG 5G05L 1M9NA 4NHKA 3I59A 1SCRA 3LA7A 1V9U3 1R1ZA 3ZFEA 3BIWE 2P17A 1STMA 4RO2A 3KCYA 2ZHLA 1AR1B 4XVHA 3S5QA 3ATGA 3GZAA 1JXNA 3PUHA 3WZ1A 2WZR3 1RUE1 3K79A 3HMYA 3RYPA 3OEHG 1TVGA 4DZGA 3AXEA 5CBLA 3OR6C 4WFHA 1VBA2 2UU9B 1QJY2 3CDZB 5DABA 1VBC3 3SDLA 4RQEA 4YFWA 2WYSA 1SQQH 3K0GA 2XGXA 2ZM6B 3CC4V 4LF4B 3U78A 1W8HA 5ISLA 1EM1A 5A7PA 4QB1A 4LWSB 5IAXA 3B69A 4Q1RA 2EIKB 3ZMOA 3POIA 1V6NA 1RTVA 1IOAA 1G8MA 3K59A 3DC6A 2F6BA 5EC2C 2EF6A 3U1XA 1P7GA 3GM8A 3POSA 4XHBA 2WZPP 3USUB 1VQ6V 4B3SO 4UW3A 4LKDA 1RUI2 4HKOA 2YS8A 1VBA1 1MNGA 2WLLB 1N1SA 2ORXA 1KITA 4WM7A 1W2BU 4YVWA 2RDNA 4M4PA 4CH4A 4DNYA 3KVAA 4AHXA 2VOWA 5FY7A 4NRMA 3IJ4A 4QX1A 5LMUO 4L8JA 1DQ4A 3DXTA 2WUHA 3ZKYA 4K35A 4FOVA 1R082 4DS0A 4OI0A 1K5MB 2DW4A 1ZX3A 3SPHA 5EZWA 5LA0A 4UFHA 3TNQA 1RINA 1VQOV 3B7MA 1IXBA 3JATB 4ORFA 4BE3A 2PELA 4JI3B 1FMD3 5CAZA 4XUOA 4KL1A 2OCCC 2ZINA 2VTXJ 4LBLA 4JF3A 2VOVA 4XACA 2ET7A 4Y4YA 2WFF2 3AL6A 4UCVA 1BKZA 3J26N 3H7YA 4R4XA 5BNPC 1GAXA 5DEDA 4D6SA 2QTWB 3P32A 4DOUA 1ZVFA 1QEXA 5DUWA 3OOXA 2XJQA 1Q8VA 2ETEA 1UOBA 1AYM1 4FOQA 3EB7A 1VF5B 4I02A 1ZM1A 1PNGA 2X6AA 3IGAC 5LP6A 4DXSA 3N9PA 2B5HA 3KD4A 4GA9A 1VLNA 1Z7S3 1QXJA 1FOD2 1Q8OA 1OA3A 3VHRA 2WO7A 1JI6A 3CRCA 4N9IA 4PDWC 2UY9A 3CB2A 1KDKA 4IE0A 4DXTA 4LO5B 1C5IA 3T1HO 3TGUH 4ZY9A 4IE4A 4CPBD 3T30A 3WDYA 4RQFA 2EIMB 4QHOA 2AHZA 2HYKA 1QCEA 4JAUA 2VNGA 4GT1A 1HRV1 2J1UA 4NJ4A 3T2PA 2V7QG 5BMVA 2BWCA 1TAEA 1R3KC 2QZ3A 1LR1A 3CCEV 2Z5UA 1NKDA 2YMZA 1SCSA 2K9ZA 3CRRA 1QQP2 2VJXA 1W9FA 3BPZA 3BVCA 2ADQB 4QXHA 1UXZA 4KWJA 2QEXV 5A2QN 1B09A 3K75B 5JOYA 2AZ0A 4DR6O 3FX3A 4XCAA 2X29A 4XBQA 3J8F3 1O91A 3P30A 4NWVA 4GWNA 2O8OA 1Z2GA 5GLZA 1IHMA 4TTGA 2A6ZA 2DYSB 1CAWA 1GUIA 2GMMA 4QM8A 4LF7O 5LK5A 4YJ3A 1UYYA 2MEV1 3I2GA 5J2TB 1OI6A 2D6OX 3P5BA 4YRDA 5KHKA 5LBFA 5CYYA 1AXYA 4LUKA 4QE7A 3HBKA 5GM0A 5KA5A 1UOGA 1VJ2A 1GICA 1WW6A 1Y74A 4P9WA 2ZE7A 2IZWA 1TME2 1XNRO 2X8KA 4JRLA 1DLBA 2K2SA 2CDYA 2WFPA 2WLJA 4O2BA 2ADPA 3ZBHA 2FD8A 2Q69A 2IJIA 1ACCA 4FTSA 4JI6O 1AI5A 2Y0IA 1PV0A 2ID4A 3N9OA 4BMBA 3EFFK 2OQ7A 1UXXX 4CDXA 4LBKA 5T5LA 2I74A 3ZFFB 4LWSA 3IAPA 3AXDA 3LEGA 5D5PA 5D8AB 1H2LA 4I0XB 3CRAA 3T2OA 4CPBA 3THOA 4GXLA 1FFTB 1VBB1 4CEWC 2JDAA 2EJRA 4JI8O 3RYKA 2WZEA 3L9JT 4BXFA 4D7SA 4P14A 4B3RB 5IWAB 1XYNA 1YEWA 3GGLA 1K3EA 4RS5B 2X10A 4I09A 2RS13 3HVDA 1CR7A 1G1XB 3LOBA 4FCAA 3M8AA 1VQKV 4L11A 1LEDA 4HL0A 5DXDA 2UY8A 3CQOA 5IK4A 3DV8A 3WP6A 3TJTA 1Y6XA 2EAAA 2HJIA 3JCZA 4MVTA 4FM2A 3D6EA 3T4ZA 4ZXKA 1EN5A 2GNDA 2VQUA 4XOGA 1SZXA 2RJ2A 4NVPA 4COVA 1N3QA 1FXKB 1O5UA 3ASNC 3C7HA 2R061 3CF6E 5LYJB 3TXQA 5A3UA 4Q8LA 2WFF3 3IB3A 1YVWA 2J1VA 3PVNA 5IWFA 3UKVA 4MXWA 3LE0A 3PJSK 1CQ9A 1XNKA 1H8TC 1LCLA 1W6MB 2XVKA 2JB8A 1FXKC 3D3QA 2BTVC 1W8UA 1W6NA 2QUOA 2QDRA 4ZI7B 4Q0PA 4JI0O 4UVAA 1NAEA 4LP8A 1NA1C 2VD7A 1DGSA 2R062 2TEPA 5A3WA 3WW3A 3FHAA 4LBQA 5AFEA 5CB4A 2XASA 3LGRA 5LGUA 2CNAA 5L3BA 3GALA 1H30A 4GYCB 3HN3A 2NN8A 3LSEA 2OX0A 1QJY1 1KQSU 5IJ9B 4HZ3A 2E53A 2BOIA 3ILRA 1ND3C 3ETQA 3ZR5A 3J7AU 4XCBA 1OKOA 1N1VA 3A22A 3S3XA 1DZRA 1XMOO 3H3UA 1OMIA 1DP0A 2E76B 2D6KA 2Q8EA 4ZI7A 2WWUA 3FB8C 1KFXL 2G9GA 2NPIA 3L2YA 5T5OA 1VRH2 2TBVA 5FPAA 1XBLA 2XHBA 2I07B 5CKMA 4MHUA 1K33A 5I0RA 1GM9A 4EROA 3CCQV 3EO6A 5LEJA 4WVVA 3N2KB 1WB7A 1UYZA 5FBJA 2P4VA 3BIEA 2RS11 2VR4A 3BAAA 3ASNB 1H1MA 1QGLA 2JG9B 1WMDA 1AR62 4LF6O 4DQAA 1JYNA 5F7UA 1VQ7V 1JU3A 4OMDA 4AQ6A 2QCSB 3ZHTA 1Z5VA 1AI7A 1CWPA 5C8CA 1B3QA 1H38A 3DEMA 3MFAA 3JBG3 3M7MX 1G9CA 1TE1B 4QIWF 1PM9A 2VCAA 1THZA 3E22B 1U5IA 4WV8A 3CE2A 1RUOA 3L73H 4MTGA 3SEEA 2FCVA 4LXLA 4PT6A 4JI5O 3I97A 3FB7C 2LUWA 1WMXA 2KG7B 3H01A 2FBEA 3NXSA 4MGZE 2ZGQA 5L9BA 1T2XA 3FD9A 1CPYA 1VBA3 2X5IB 2BOBC 3RYRA 1BVP1 4BHPA 3OTOB 5J3UA 3VN4A 1PP9H 1EAH1 2AEYA 1JBCA 2JVDA 4BK4A 2BRTA 3F5WC 1RVF1 4LEJA 2W1WA 2BSKB 2JIZG 3HPNA 2MW2B 5CA1A 4BPZA 5I0TA 1FATA 1HN0A 1JOPA 3MW2A 4FLTA 4BWOA 4CBCA 2VS0A 2DCZA 2Q6AA 3I2FA 3BHPA 2GNMA 1KYOF 5LY1A 1CAUA 4DR7O 4KUMA 2NYYA 3W20A 1F4HA 1J5EB 3SJBC 4QX3A 2NQYA 1W28A 5CZKA 4FP3A 4LH7A 1LGBA 2WRAA 4RN5A 4N43A 1AHSA 4UF0B 3KQ4B 5EZYA 2HWE3 5C5TA 3SJCC 1W6OA 1ULDA 1BBT3 3EQEA 3O12A 5EK0A 3E6BA 3LPFA 4DR3O 3I2IA 3S6PA 3DN7A 1OV9A 5A32B 4YM2A 2WT0A 4P5YA 3CL1A 2GBOA 4L87A 3PTRB 2LM3A 4B3MO 2Y8KA 2KM2A 4AOCA 5GKAC 3A0HZ 3I2JA 1JZ7A 4ICGA 5CA0A 2HHHO 2BQPA 3GHNA 1Q6UA 4XJ8A 1VBD2 3AK1A 3RN4A 1IZ3A 1GANA 4DRXB 1GM7A 3K5MA 3DYOA 4QMAA 2BDRA 3I2OA 1KECA 2QTSA 1UFIA 4HKWA 5FZHA 1N47A 1OVSA 3N2GB 2BPA2 1N32O 1LHOA 2UWCA 1MEC2 3TBDA 4MGTA 1Q81W 4QKDA 5EC1C 4YM0A 3GZEA 3RJ2X 2ZGMA 3VDBA 4W8JA 3E97A 1AX0A 4DUYO 3VHOA 2D98A 1WW4A 1OQDA 3QCWA 1YWKA 3NO8A 1DK1A 3QD6A 5E89A 3I3EA 4MVRA 1SERA 2H0VA 5BR8B 4FPKA 4XJWA 3K4DA 3AZYA 2MK3A 1DIWA 1ZZ7A 1DBNA 5JXJA 4OUMA 2OTJV 3NJVA 2FZ2A 2PYJA 4HSJA 4NO4A 5DMYA 3FHIB 3W5NA 2GUZA 3X2QC 3VHPA 1GP5A 1O8PA 4FPCA 2ARCA 3R65A 3QG5A 5EYYA 5T3NA 1NCQC 1KD7A 2VO5A 1XEQA 1BHGA 5JWPA 3SCHA 1AR91 3PVEA 1Q5OA 4NHYA 5LRRA 1G9AA 1YQCA 4H2AA 3WG7C 1X8MA 2VULA 4AF9A 3KGLA 4TLGA 5H9QA 4E2GA 4YZ2A 4B4QA 3E8HA 3FLPA 4UFJA 3RDIA 4HOOA 4NPRA 3Q9OA 4PDWA 1CAVA 1W6MA 1ULGA 5LHHA 3VBRA 1PX3A 3CEWA 4DR4O 4EJRA 5IK5A 3VL8A 1WCDJ 5FJKA 5B1NA 4LBEC 2BUKA 3ETGA 1RJ7A 3VBFC 1YJKA 4FFGA 4K0KO 3NJYA 3W7TA 3JB8A 2IXJA 2YXLA 1QF3A 1YFWA 2PHLA 3MIGA 3D36C 2ZEYA 1OKQA 1CVNA 5CN0A 1IPSA 2VNOA 1LU1A 2PI5A 4FPYA 1QHTA 3AMMA 3NKTA 4PQ9A 5DAXA 1HNWB 1W9YA 5L3EA 5A3MA 3AKPA 4J1XA 5C5UA 2ZD9A 1L7QA 3ZMTA 2WT2A 1MA1A 2QKSA 2WLLA 3L9DA 5G04L 4F7ZA 3CD6V 4AFDA 1AVBA 3MIEA 3SNMA 1M56C 1F23A 4D3WA 3OTOO 1SPPA 2UUCO 2R9AA 3ETPA 2QFEA 2BW8A 1TUEB 4A41A 2DWDC 4CS2A 3GZTB 3UKMA 1BS3A 3I3QA 3SISA 2YEVB 4LF9O 5F6KA 4Z8BA 2ZEXA 3OT7A 4JI2O 4U3JA 3ABLC 5FZBA 1MSWD 2NM1A 3WDUA 4OI4A 5CISA 2W87A 1S5LZ 4X6QB 2HWD1 3E1F1 1OA2A 4YJ3B 1DGWX 1AZDA 4QXKA 5JXIA 3LIHA 1IX9A 2Z0AA 5FLIA 4ASMB 4Q4V2 2Y4UA 4KGGA 4QU1A 3NJXA 5LXTB 2CAUA 2OCHA 2XQRA 4DR2O 4JI1B 3ITQA 4R4ZA 4Y1YA 2ZDIC 4XF3A 1US3A 2RM22 3VBFB 4IIJA 1REDA 4AI2A 2YGLA 1J3QA 4DR1B 2XLGA 4UCRA 2GMPA 4PIZA 4JGYB 1ZZ8A 2F17A 4X66B 3DSQA 1HLCA 3E6CC 2B46X 2XMLA 5EIBD 1LR5A 4GULA 1W8TA 4XQWA 2IXCA 2W5FA 1PNKA 3KB5A 2VAUA 3FUQA 4LIVA 1AYN1 1G6NA 5FPXA 2I45A 4LR3A 5ANNA 1ZYBA 3O7OA 4AEKA 1OUXA 2W9XA 3NRUA 4GB32 4BCUA 1LOFC 4OLLA 4FPPA 2OCCB 3W7WA 2WA4A 4R8CA 5FP4A 1ENRA 1LECA 4Y26A 4BQ2A 5A9GA 4NRQA 1PVC1 5BNNA 4Y5SA 1NCRC 1FKAO 4AL9A 5FR3A 4XETA 3WQBA 5AC92 1I1EA 4BQ3A 4BAYA 2DCKA 1BL8A 4ZOLA 2KQXA 5IYZA 2D7FA 2A3QA 2DBNA 4IEZA 5JZGB 5LL6Y 3AEIA 5CB4B 2JG8A 4V2WA 1AR61 1EFRG 3BVOA 3ZYFA 3SJQC 4CUGA 3OGSA 5GTIZ 1HXS3 3RYIB 3A0BZ 1YQ8A 4Y24A 2D40A 4F4LA 4A3XA 3IMNA 1H2MA 3TXSA 1ZA7A 4RA0A 1IDSA 3KV9A 1RB8G 4YZ1A 1RMU2 1VB4A 5B2GB 5BNNB 3VZOA 4JGZA 1CZVA 4JYBA 3K57A 1N8RW 4YW1A 3K4AA 5JDBA 3WB1A 3WF1A 3O1RA 3MIDA 2QE7G 5H6RA 1LESA 1GN6A 1VBE1 2WSVA 1UMIA 4K6BA 4AYUA 4J41A 3ICXA 5C3SA 4J10A 4EYUA 3OUJA 1FX5A 4MVOA 1JMUB 2WQZC 2QQJA 3WW2A 3CBNA 3MIFA 4LF9B 1LUVA 5BNOB 3VGIA 4OHWA 1GNHA 1LOEA 1UY2A 4KU7A 4Y5TA 2NMOA 4MGQA 2RG4A 2EILC 3OYWB 3B00A 1VBE2 1Y9QA 3USUA 1W0KG 4MS2A 4F83A 1LJ7A 5F2WA 1BT8A 2N05A 3LEIA 3ABZA 1K42A 3T2TA 5J2UA 3WP5A 5BY1A 4RFT0 1CIWA 4GD4A 1N3OA 1GM8A 3KF3A 3KLSA 2WWWA 3V0BB 1GRJA 2JJ2G 4RR3C 1Q82W 1TME3 1FXVA 3RRDA 5CIRA 4JYYA 1NTMH 5HPOA 2E31A 4A3ZA 4OXSA 2WLMA 3TN92 1LEMA 2OPKA 2YYOA 4O7XA 4QX2A 2HYXA 1N33B 3N9LA 3FKSG 2JKBA 5IJ0B 3VBHC 4W6WA 2IFWA 3S0MA 5IK8A 1VBD1 4KH9A 5I0SA 4NE9A 1XC6A 2B8MA 4FT8A 2YIBA 2BOCC 4U3FH 4AHYA 5FZ6A 4AVAA 3UQ8A 4YIOA 2VMHA 4LHLA 4CYDA 2XUEA 1SHWB 2IXKA 4X65B 2IUWA 3AK0A 3CP1A 2PFWA 3L75H 3B3QE 1FNZA 1GP4A 5LBEA 1GWKA 4B29A 3RI9A 1YLLA 5H9RA 4AQYB 1FI2A 3LA3A 1QNYA 1GOFA 1HJGA 1AROP 5FDBA 2ZGOA 1MEC1 5ANQA 1A34A 4W6XA 3CCVV 3A0KA 1VBB2 5BNOA 2BZDA 1H0BA 4UFIA 1W3XA 1O4YA 4XJUA 5T55A 5IY5C 4HN0A 5I0DA 2C24A 4MZUA 1FJGB 4WVWA 4IE6A 4IT5A 1AR92 2CL2A 1HN1A 2Y6GA 1IS4A 2OYZA 1R1BA 1GZWA 4IV1C 4RHV1 2BBVA 3FZ3A 3JAWB 4MTFA 3AK2A 1KEXA 5F5AA 1NCQB 4L0PA 5I8TA 5KUKA 2O14A 3FJSA 1V0AA 5FOBB 3I2KA 2M7WA 1NZCA 5B66Z 2YV8A 1RPRA 4AEJA 2ZR3A 1VE0A 1COWG 2LJ2A 4PA7A 5A80A 1QH6A 2HHHB 3AKRA 4AQTA 2G19A 3LOIA 2YI9A 2VVFA 2ARBA 2ARHA 4FFFA 2FDGA 2VUDA 3B94A 1ROPA 2K1EA 4CDUA 2GNTA 4YZ5A 3RYFA 1SQGA 2CH7A 1TVKA 1KQRA 2VQTA 2RDSA 3WINE 3MFCA 3DXRB 1W8ZA 5DN2A 5C3QA 1DQ0A 2BNMA 1K4CC 1XI1A 1GMMA 4LFAO 4DPNA 4W4ZA 4DUXA 3SKJE 4MVUA 1YJNV 1D4VB 1PZ7A 1EYBA 3K48A 1UY4A 2ZGPA 1SKVA 1UOJA 5EJZB 3N2GA 3ZRSA 3T1MA 1R092 1UAIA 3ACHA 4CEYB 5IE9A 1LULA 4CCEA 4XQ4A 3WHUA 1MZ5A 1JYVA 3ZPYA 4J1WA 1EZVH 4IERA 3RT3C 3OR7C 1JU4A 2QWQB 1F7YA 3W7XA 1I94O 2VUJA 5HCFA 2XJTA 5E88A 4UV9A 2RS32 3SYAA 3HKCB 2ODMA 3ABMC 1VMHA 2DVBA 1OOPC 1BQ0A 3H9AA 4R6ZA 5L36A 1M90W 3PMEA 2Q1FA 5LZ6A 2JJ6A 4AWDA 4UV8A 1NLQA 2A3YA 3T0DA 1LB2A 2X53S 3DL3A 5EIYB 4X8AA 4BYYA 5FYYA 4FZ1A 1CJPA 1ZRRA 4KNCA 1AJNA 1O4TA 5CFCB 4YY3B 1D5NA 4DR7B 3ZRXA 2Y6FA 1JPXA 2ZCWA 4HMZA 1OOPB 3LSDA 2Q5ZA 5JQGB 2WLPA 3BODA 3B2EE 5GZCA 3UNPA 3FYIB 3E5XA 3DGTA 4E4HA 4ZS2A 4XILA 4Q4V1 2XL7A 3CIHA 4HONA 1GKFA 1AJKA 1LHUA 3T09A 1SQPH 1Q86W 1J84A 4EN7B 4DUZB 1XPWA 3GBGA 3C7EA 4O2AA 5D8AA 4MVSA 3ZEDA 3H1LH 4RUEA 3OUHA 1NS1A 2VMCA 3U0ZA 2EJ7A 4DUZO 1NYWA 3D3IA 3WD5A 2DFCA 2JX9A 3SPJA 2RS51 2W47A 3JUUA 3U37A 3G6EV 1NOVA 2DYSC 3SYOA 3EJKA 1RJ8A 4JHTA 2HWB3 2YSUB 3DTUB 4FLWA 1SA0B 5IK7A 4QAWA 1F31A 4CS3A 2XBO3 5FUNA 1RITA 4ATFA 2TNFA 3EHKA 4XYXA 2NR5A 4DV6B 1DLLA 2XWBB 3LQCA 5JCOC 1OC1A 2CAVA 1RHI1 1RUF2 3KZIZ 5IT6A 2Z42A 4FPFA 2QWRB 1IXMA 1W90A 3UV9A 4G28B 3D5OA 3WCRA 1M93A 2J1AA 5J2TA 4CCLA 1SLAA 1ASJ3 1R1A3 5K0UA 1IS3A 5KC6A 3CPWU 1Q8IA 4DK0A 1QJEA 3KV5A 3HNMA 2VW2A 4PI0A 4PF1A 2WC2A 1K5JA 4XFGA 1RHI2 2UURA 1M4WA 3VDDA 2P7TC 4A4AA 4ITCA 4GCZA 3S7IA 3SGIA 3DKQA 1S0DA 1FMD1 1GOHA 2VMIA 2EIJC 2R49A 3OMIB 4ZIBA 4NKGB 5CVRA 4CP0A 2ZHKA 1UU5A 5IVVA 3RVYA 1QVFU 2VZVA 1TUBA 4AI1A 4ZZ8A 4N7IA 1CEZA 1TVKB 2WWJA 2O57A 3ZSKA 1S2BA 4LE3A 1DTOA 3VZLA 2PQSA 4P02B 1XE7A 4IV3B 3WLUA 4JQRA 4TYSA 1POV1 1H4GA 1XMOB 1M5IA 4XPVA 1U5YA 4EB6B 3MHZA 1W6QA 2ZMLA 1RP3B 4H7MA 4WZCA 2V4AA 1OA4A 4URAA 4LULA 2P34A 1APNA 3EXUA 5IJ9A 2JIJA 3CZJA 5FYSA 1W6QB 5FXXA 1YC61 1PMIA 5FZEA 2W46A 1LU2A 4UAPA 2ZX2A 4E4DX 2XKPA 3JSLA 4OVEA 4EFEA 1W06A 3AZXA 2GZWA 2G1MA 4B3TB 2ZIOA 3IPVA 4R9CA 3VKLA 1YXBA 3FB6C 3SYPA 1XXNA
chains in the Genus database with same CATH topology
4EWEA 5FOJB 5EZWA 5CADA 4I30A 1LOFA 3H3ZA 2R32A 3TNQA 3DKWA 1RINA 2G9FA 4JTNA 3B7MA 5JI7A 4GKXA 4ORFA 4BE3A 1XQNA 3V15A 2PELA 2KA3A 2YC0A 3M3QA 4C1XA 3APBA 5BV6A 1FMD3 1X33A 1LENA 5CAZA 3ZXGA 4FBFA 4EN9B 4KL1A 2ZABA 3G7DA 3THTA 4IL7A 1MZEA 4LBLA 5F6LB 1RUD1 2Y0OA 4AFCA 3NW4A 2VOVA 1QDOA 4OHZA 2ET7A 4Y4YA 2WFF2 1AUYA 1DGWA 4LR4A 3OCPA 1BKZA 3J26N 3ZIWA 5JMCA 3H7YA 1ZRCA 1BEV2 4R4XA 1IGOA 4AVCA 5BNPC 4PBOA 4HVOA 1XU2A 4KG8A 4DOUA 2OZJA 1A3KA 3OTFA 1ZVFA 3M3IA 4MUVA 4DMIA 4XFAA 5DUWA 3ZN5A 4NE0A 1DQ2A 2XJQA 1IKPA 1Q8VA 4KU8A 2DTWA 2ETEA 1AYM1 5JI9A 1A8MA 4FOQA 2LTNA 1HV1A 4QPIC 2NMNA 1O4ZA 4I02A 4Y22B 4EN0A 1ZM1A 1YFUA 1PNGA 4CDQC 5K9YA 5GZEA 1J1LA 2E7QA 4K8FA 1AR73 1DF0A 2B5HA 3U4XA 3KD4A 4GA9A 3N4MA 1VLNA 1BBT2 1YFXA 4M0HA 4MYEA 1Z7S3 5KXEA 5ABJA 4TZDA 4DB5A 1QXJA 2JE7A 4LO4B 1Y43B 1FOD2 4F8AA 1Q8OA 1OA3A 3VHRA 2VH9A 3I2DA 4GKYA 4N9IA 1K5MC 2HWB1 4PDWC 2UY9A 5A33A 1KDKA 2Z5WA 1F9KA 1UF2C 2D93A 2DVFA 4LO5B 4YVSA 1C5IA 5C4WA 5CFDA 4C0HA 1A78A 5HCAA 4AQSA 4HVQA 4Q1PA 2JG9C 4JGZB 3WDYA 4HKLA 1ZZBA 5JLVA 1WLDA 3VKMA 1SLTA 1XNCA 4Q0QA 2AENA 4H7LA 1VAVA 2HYKA 2BWAA 4GMP1 4GB31 4P9LA 5ACA2 2VNGA 1HRV1 2W08A 2VOXA 2BNOA 3HT1A 1PGW2 2BWCA 2PAKA 2FQPA 2QZ3A 2Y38A 1C3HA 3M1HA 3RQ0A 4CDXB 5FFOC 3MF6A 4P5HA 1W6PA 3JD72 4FPEA 1COV1 1PVC2 1H1IA 2YMZA 3VZNA 1SCSA 1SLCA 1HX6A 2JEMA 2K9ZA 2R041 2XJUA 4RQPA 1QQP2 4M2EA 3BPZA 1PO13 1PZ9A 4HT1T 5C8WA 1DYPA 2WKKA 3DPRB 3ZN6B 2XJVA 3AMHA 4XXPA 1OS7A 4KQ7A 4KWJA 3SCGA 1PGSA 5KHHA 1PM7A 1B09A 5JOYA 1HV0A 4COZA 5JZGC 3FX3A 2ZGRA 1CX4A 2AR6A 2EAKA 3AJYA 4N43C 4RS5C 2X29A 1FNYA 4XBQA 4Y1UA 1OLRA 3J8F3 1O91A 3ZXAC 2DFBA 4NWVA 5SV8A 4E4ZA 2NZ9A 4GWNA 2O8OA 5GLZA 1IHMA 3AP7A 3WP4A 2A6ZA 2ZOEB 2XJSA 1CAWA 2PLV3 1R093 4XFCA 2RS52 2GMMA 4QM8A 4IV3A 3N7LA 5LK5A 3JD71 1DHKB 3JD73 2MEV1 1DRYA 3POYA 2GC0A 3GBFA 1VRH1 1RUC2 5JCTA 2FMDA 4YVSC 1OI6A 1OLQA 2D6OX 3P3PA 5AFBA 4YRDA 5KHKA 2ZPXA 4M2GA 1U12A 4H3WA 1EV11 3ZMNA 1AXYA 1BXHA 4LUKA 4MH0E 5DZEA 3ST7A 4AEDB 1ZNPA 2PHDA 5GM0A 2TUNA 4KWLA 2ZJCA 1U5XA 1VJ2A 4YSFA 1GICA 2HWD2 1WW6A 5DZGA 4FPLA 5I0UA 2OG7A 5JOXA 4COUA 4I2OA 4P9WA 4D69A 5LEKA 4JV4A 2W68A 3O2GA 1PO21 4XFHA 3WW1A 4BQ1A 2IZWA 1TME2 1REFA 2X8KA 4JRLA 3GNEA 2K2SA 2WFPA 1DGRA 4Y20A 3R6SA 2IXIA 4IV1B 1OIJB 3HD8B 4Z92B 2DU0A 3U11A 3ZFGB 1J3RA 1Q8QA 3RMXA 5KC5A 4M2FA 4QGMA 3MLKA 1SBFA 2GDFA 4KBBA