1YCIA

Factor inhibiting hif-1 alpha in complex with n-(carboxycarbonyl)-d-phenylalanine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
336
Chain Sequence
GEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of factor inhibiting hypoxia-inducible factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
total genus 99
structure length 336
sequence length 336
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1yciA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yciA01
1MZEA 1H2NA 1MZFA 2WA3A 4B7KA 3P3NA 2ILMA 4NR1A 2XUMA 1H2LA 3OD4A 2W0XA 4Z1VA 1H2MA 2CGOA 4Z2WA 1H2KA 5JWPA 3KCXA 3P3PA 4JAAA 4QU2A 1YCIA 4AI8A 2YDEA 2Y0IA 1IZ3A 2WA4A 2YC0A 4BIOA 4B7EA 3KCYA 2CGNA 3D8CA
chains in the Genus database with same CATH superfamily
5A33A 4L87A 4BR6A 4CDQC 1CIYA 2DVFA 2F4PA 2ZT9B 4P9YA 1QNYA 1PL4A 2LRPA 4W6YA 2FDIA 3RYIB 4HLTA 4Q4V1 1I5ZA 1K7DA 4D0QA 3OY8B 3KLSA 4DY5A 2EZOA 4XFBA 4MVUA 2ZMNA 1C57A 1CD3G 5LBCA 4A5UB 4O9GA 1VMHA 5CA1B 2JD9A 3PJYA 5JMCA 5F3EA 3BN6A 3CRRA 5FO7B 4DV0O 1GM8A 2HR3A 1EUTA 5A32A 2L35A 5FZKA 1NTZH 3DF0A 1CAVA 3WUCA 1FMD3 1WLTA 1MMMA 3M3QA 4CEWC 1PO22 2GAUA 4LF8B 5DUVA 4X88A 2XONA 2ZS6B 3AK1A 1V70A 5BXXA 4LORA 1S3JA 3AMHA 1VARA 5FYSA 4RQPB 3BTXA 1K33A 3OMNB 4K8ZA 1H8TA 2VMCA 4JHTA 2CDYA 4DRXA 3PVEA 1QMJA 4XXPA 1PGL1 3ALQA 5KC5A 1XSRA 1RUD3 5F3CA 1X36A 5FWEA 5A3OA 3OUHA 3AYDA 1WB8A 1C3HA 4ZKTB 2C26A 3QBQA 2V73A 1OPMA 4PT6A 4MGTA 3E5QA 4AI8A 4MVOA 3RS6A 3Q8CA 2NZ9A 1KRIA 3BPZA 3VKOA 4JV5O 1BJQA 5FZAA 1GO3F 5HXMA 2UY8A 1X9PA 1WCUA 5ACA3 3JUUA 4LF7B 3AG3C 4X65O 2NYYA 1GN6A 2ADPA 2GH2A 3SCHA 2W1UA 1XE0A 2RS12 3MIEA 5EFUA 4DB5A 2D5HA 1GYKA 5FYUA 3KKYA 1HRV3 3JB4C 3ACHA 1EV12 1CN1A 1JU3A 3JATB 1PK6A 4GKXA 5BNOB 1VE0A 4TT3G 4QXBA 4YVWB 2QDOA 3P32A 3GALA 3ZSEA 3SYPA 2PLV3 2G4IA 4CDWB 1F9KA 1PO11 4XJWA 2EILB 4GUNA 4GX2A 4Z1VA 1NS1A 3VBUB 1YVWA 1DQ4A 4BQ5A 4RA0A 1DLLA 2XJVA 2J1EA 4ITCA 4HNAA 2IH1C 4XF1A 2ZHNA 3P5BA 5A6XA 4EN9B 5FKBA 1N1VA 5FZ1A 3CX5F 4W4LA 4S2GA 4L97A 1OVSA 3POJA 3LD8A 5G04L 1H8EG 4LBMA 2DFCA 4Q4X3 1W6MA 4TTGA 3VQWA 5FYYA 5FZIA 4CZSA 3ZRVA 3JBG3 2Q7EA 3VBRB 2IXLA 1UAIA 4XABA 1HKDA 4RWUA 3RYPA 2PI4A 3N27A 2Q8VA 1ULOA 2OUJA 5A3WA 2WNVB 5C8YB 4AFBA 4UCOA 5JCTA 3QO7A 3BOWA 2C5DA 4I50B 1S0JA 4X62O 1LOBA 1O6UA 3BGAA 1BBT1 5K0UA 5IT6A 1JYIA 3FAVA 1Y9MA 1TA8A 2PHUA 4FZ1A 2ZGLA 2R1BA 2QE7G 5J2TA 2WO1A 3MFAA 1RUE1 2LGWA 1XNRO 3AYEA 5LP6A 4MS2A 1WMXA 1REEA 4JI8O 2R49A 2D6KA 2W9XA 2EBOA 2PXJA 2PMWB 3AP7A 3QH6A 1QJZA 5CKQA 3F7YC 5CA0A 4JGSA 4OZXA 1WJZA 1OHHG 2Q8CA 3G80A 2VH9A 3FHQA 2IFWA 4NTWA 4NRQA 4IV1B 3ZN1A 2BDRA 5T5OA 2JB4A 4I0WB 1QQCA 5K1PA 4MGSA 3RYFA 4LFAB 2Y48A 4I4TB 2P4EA 4NHLA 3IN9A 2YEVB 2CAVA 3SJBC 1GR3A 3A2FA 1PMIA 3K48A 3CJHB 4M3CB 1ACCA 4IL7A 4XEZA 1N0JA 3ZXFA 2YIBD 5EJ3A 1VIWB 2R072 4KWKA 2VMIA 1YSCA 2IH3C 1BEV1 1KJLA 3VDCA 1V9U2 3LA7A 4QHBA 4WFEA 4B3TO 2VUDA 1G7YA 3SHRA 4Y22A 4B1LA 4LNUA 2JE8A 5DG1A 1GOHA 5JUVA 1AP5A 3VHPA 1YI2V 1BQPA 1N8RW 3K08A 5EZWA 2CGNA 4QPJA 3PNAA 1CZVA 3HKDA 4DR6O 4FQZA 2CY6A 1QJFA 1E5IA 1VRBA 4QB2A 1IPKA 5IVBA 3T0AA 5FP3A 2R72A 1XNDA 1TME2 5CVRA 3MDPA 3HN1A 1DP0A 1AROP 4R4ZA 2VZ1A 2RR13 3F2ZA 1C1FA 3LAGA 3KV9A 2QVSB 3AKPA 1H2NA 5LRRA 1QVFU 1UY4A 2EIJC 3WB2A 5JH7B 2WO2A 3LEMA 4GB33 4CDWA 2JRIA 2LO1A 1HDKA 2CHHA 2FMYA 5JSRA 4RAIA 2FDJA 3SDLA 2I74A 2DN9A 5ERLA 3T0BA 3MHSC 2VWKA 4W65A 5T5PA 3VBFB 3SR2C 4XYXA 3L2HA 5LBFA 4EB6B 1RYYA 5IK4A 1IXMA 2E33A 4K8RB 4QKBA 4A42A 4JDMA 3WF3A 5H6QA 4P9LA 2EXKA 4R9BA 1SACA 4W8JA 3VZLA 2R043 5ABJA 1U96A 4LA3A 4B7KA 3CD6V 5F7UA 2XHNA 1PGSA 3LDDA 4LF8O 5J36A 1DG6A 2ZX3A 1WPXA 1ODNA 1TMF2 2R061 3VD9A 1YCIA 4QDSA 2OT7A 4AI3A 2VQ0A 3ZYJB 3OEHG 5T55A 4AVVA 5C5UA 4X1KA 4IXLA 1JI6A 1YTFD 2HP8A 4P02B 3L75H 3ABLB 1AYN1 1VMFA 3I7DA 1OQDA 2NPIA 4OPHA 3WQ0A 2WSVA 2VGDA 3D3AA 1IKQA 3G7DA 2WA4A 3N2KB 1REFA 4NIGA 1O9GA 4Q27A 5FRAA 5I0RA 4UB8Z 2B8MA 5B4NA 2X09A 1RMU1 3VBRA 4QKDA 2XLFA 2HWB1 2P3YA 5FZLA 2GTAA 2DCKA 4FPLA 4RHV3 4YGBA 1QQP2 3A22A 4RGGA 4I2OA 5IVJA 4ZXKA 2QWPB 5C7GA 4NHYA 1F4NA 3GZUC 4G2KA 1FYJA 3BIWE 1V6JA 1TVGA 5FYIA 1GKBA 1WGPA 1SQQH 4LFCO 3ZN5A 3BRCA 3DTUB 1SQ4A 2FTKA 2CTVA 3HVDA 1M93A 5BNOC 1UY0A 4RQPC 3HOBA 3RYHB 3K0GA 2VNRA 1QJEA 2WNVA 1C1LA 4LK6A 2VXJA 1C8M2 1MEC1 3AKSA 3ACGA 5FV3A 3KV5A 2E74B 3NR7A 3HIFA 1M57C 4LIVA 2VNOA 1KBHA 4I01A 4BQ2A 1Q6HA 4HSJA 5EP9A 3C3SA 3J8F1 4OQ9A 2GZWA 4HK9A 4TQDA 4Q1PA 2OT5A 4H33A 3AJZA 1RPOA 1X59A 1JS9A 4OUEA 1N32O 5FZBA 1ZREA 4GAZA 5DXDA 5CKMA 3RJRA 4DO2A 3VZJA 3AVSA 4QX5A 3ZXAC 3OTOO 3KM5A 1GP6A 4B4RA 1B06A 4AEDC 3FE5A 1JU4A 2RJ2A 5EHDA 3NVCA 4KU7A 4QMAA 5CBHA 5ACA2 4JZRA 1MSDA 2VOTA 2IZWA 4H0LB 4UW6A 2Z0AA 2FHRA 1ENSA 3FLTA 4Y1UA 3K9AA 4XFHA 4YWAA 3MGUA 4BK4A 1YLLA 3MV01 3AZVA 4LO7A 3ZXGA 2QWNB 2D44A 1YIJV 2B1IA 4LUKA 2HJFC 3IWZA 3ZJZA 5JR7B 5HCFA 2WWJA 1JZ3A 4XOGA 3OJBA 1N47A 4EFBA 2WZ8A 3VHNA 4CXYA 4JI1O 4WV8A 3GWKC 4FXKB 4AOCA 4INDA 2TNFA 4AFDA 2ZEXA 1YITV 4P9JA 1GZTA 4JGZB 1QKQA 1K8AW 2NN8A 1OOPC 2QKAA 3HBKA 1AHSA 2F1MA 2GP5A 2A06H 1SBDA 2OW4A 1RFYA 1VBC3 1A34A 3WF4A 3KZIZ 2W68A 1AR71 1S0GA 4NPMA 1KD7A 4ISQA 1NQDA 2RDCA 4XQWA 4FFHA 2KQXA 3B3QE 4AW7A 3ECQA 3EO6A 2WYSA 4XFAA 1PIV1 2R062 3BFRA 1ZZBA 1VQ9V 4CEWB 2GMPA 3G6EV 4KWLA 1E1QG 3E6BA 3DXRA 4UT5A 3AZWA 1ZBA2 5HXVA 4HKWA 2HWF2 2WS93 1XYOA 2YIAA 4NOTA 5C6CA 4KH9A 1OT5A 2BP6A 4AFAA 2Y6JA 1ST8A 4H7LA 1GZWB 4FOQA 4IDZA 4ATEA 1ZRDA 3E6DA 2XXZA 4QXHA 1NQTA 3ZMNA 3GHNA 4I50A 1TAEA 3JCZA 4Q4V3 3WNXA 1T6GC 5IAVA 5C8CB 2NN4A 4CU9A 1W0KG 3C7HA 1A78A 2D97A 3D4KA 2FCVA 1H1IA 4XF3A 1NZCA 3AMMA 2K0GA 3NAPC 4META 4YGDA 3ZMUA 1HQLA 4MVQA 3H1YA 1C4RA 3ABKC 4CEYA 3OMAB 4C0BA 4YG0A 2X8KA 3DSQA 2ZM6B 3G6JB 1V6MA 2QNKA 3V65A 1GM7A 4HMZA 1UOJA 3GF6A 3ELNA 3PJSK 1W6NA 5FYBA 2A3WA 1WKYA 5LGNA 2IC1A 5KHGA 3N9LA 5FZMA 2QEXV 1PGL2 3KB5A 2EXIA 4NTXA 2XTAA 1EM1A 3FL7A 2Q1MA 5FPBA 2W1QA 3TOJA 1L8DA 2JIJA 1M57B 4OPAA 2R9RB 4Q0SA 1JFFB 2KR2A 4WVWA 1N4CA 3M3IA 2XLAA 2Q69A 4YLZA 1OC1A 5CISA 1IS5A 4Y33A 3VD4A 3ZN4A 1YC61 4UXAA 1W03A 3OT7A 5LBQA 2BV4A 4UBGA 4WFFA 5JLVA 3VHOA 4DR5B 1DZTA 1FXKA 4JCKA 4XVHA 4YY3B 2VM9A 1WP8A 3JAWA 4ES9A 2Y8KA 1Z0HA 3QG5A 3KVBA 4LBEC 1KKDA 1QOTA 2YGMA 4QQ2A 2ZE8A 4K1ZA 3UL2A 4IGGA 2A3XA 1LJ7A 2CDPA 2OZ6A 2G9FA 2BQPA 2ZE7A 4PA7A 2XGXA 3J9SA 5IJ9B 3LIGA 1WLEA 1K3EA 2CH7A 4DW0A 3N3HA 4Q4Y3 3WG2A 4QPGC 4PI0A 3GM8A 3RYFB 1ONAA 2DCJA 1TMF3 1ASJ1 2YXYA 5B5EZ 3U75A 2Z69A 3ASIA 1ULPA 2XOKG 4HPKB 4JI6B 4YZ5A 5CFCC 3QACA 5LXTB 3NJXA 1JUIA 5FY4A 2Y60A 3O65A 3CZJA 2XL7A 2ZR2A 4RO2A 2HEWF 2LTNA 4J9YB 2NR5A 3L73H 2BTQB 3AL5A 3MIFA 4KUMA 4DMIA 1FV3A 4NN0A 3WNOA 5IYZB 3K4ZA 2AR6A 4QXKA 2DWRA 5FJHA 4LOSA 3MV11 1GK9A 3PVNA 1TVKA 1L0LH 2ADDA 4TYSA 2FB5A 1VQLV 5KXCA 1OA3A 1AYN2 3W7XA 2WAOA 1AJQA 2IW5A 4HYOA 5J1XA 4QQPA 4RHV1 2VCBA 3AZZA 3K04A 3GNEA 4LK7A 4XIKA 2QDRA 5L3CA 2WFF2 5C5TA 4X9QA 1W6MB 5DAXA 3CPWU 3MIBA 2UYAA 3RNSA 3TETA 5HCAA 2JICA 2ZZQA 4ZU4A 2VO5A 1ZBE2 1FMD2 1ZTEA 2P4KA 2JJ2G 5FY0A 2YU2A 5BNPA 3FBYA 1C5HA 4FPGA 4QKFA 2PAMA 4DNYA 4JI5B 5A80A 3MYXA 4JTDB 3K46A 3S5AA 4IV3A 2DQ3A 1XSQA 5FLXN 5IVYA 2QTSA 5F1RA 1AR4A 4QX2A 1IGOA 4LF6O 2EICA 3K4DA 3JB8A 1HW5A 1H1MA 2GBOA 3RYKA 2FQPA 5CU1A 4YGEA 2EIGA 4ZZ5A 2D6MA 1JJ2U 2YXLA 4IEQA 5HCHA 1ND2C 3IFXA 3ZVXA 1U0AA 5IJRA 5FO9B 1Y9GA 5LY1A 3EHKA 4DYLA 1FT9A 2A70A 4OYUA 1OH3A 3N7MA 1PZ7A 4QM8A 4AI2A 1ROPA 4WFGA 4YIOA 1RUOA 2VZRA 2VZQA 5GLZA 2GALA 4L8JA 3W7SA 4CH4A 3VBFC 3B9CA 3IT8A 1KQSU 3H50A 1Y76A 1I5YA 4FFGA 2VRZA 1I94B 2UXXA 2QKCA 1KGYA 1BE3H 1SQBH 4IE4A 4CUGA 3B9IA 3O1SA 4D7SA 1EBOA 2VU9A 4NE9A 2CAZC 1RM1C 1Q3EA 2CTWA 3G6BA 4PDWA 3WF2A 3ZXLA 1UJWB 4Q0VA 3K79A 3OBZA 1JOPA 1GN3A 5FK8A 4WFAV 4FTBA 1VEWA 1IOAA 4LKSA 1V6NA 4HK8A 1NJIW 2ZXQA 4UV9A 4DR1B 3KT1A 3ZSLA 3PIGA 4EJRA 3R4DB 4YZ2A 2V5DA 4NUBA 3W5NA 2YPDA 3HR9A 1WP7A 3CBNA 3WX5A 4UCSA 3TXQA 1H9PA 3JBG1 4COWA 4H14A 1VP7A 1QHTA 4U3JB 5T3NA 4TZDA 4FLYA 2GDFA 4OHYA 1H4GA 4AQYO 3C2UA 2JDUA 1PNKA 1V6OA 4LBQB 5FPUA 4LCUC 3LFIA 2VVEA 1Z78A 2CDOA 4XUNA 1SQVH 2GC3A 1JOYA 1A3KA 2F43G 5CG8A 3EXAA 2RS32 1VQMV 5BR8B 2DYCA 4GJYA 4YVWA 1QDCA 3FC0A 5LHHA 2DURA 3KV6A 4GMP3 2QQLA 2JS5A 3PMSA 3OMIB 3GZEA 2EILC 1J3RA 1PMJX 4C1WA 1QJU2 2BSKA 1W8UA 3WQBA 1V9U3 2ZGRA 1NCRA 3ZMZA 3I3EA 4Y20B 1K5JA 4DIQA 4EZ4A 5FP4A 4FMTA 3UKNA 1BBT2 3A0BZ 3O1RA 3FBMA 4K20A 1P49A 1GZWA 5JJEB 1PM9A 2WLLB 4YW7A 4A7YA 1V9PA 2DCYA 1OCCC 3AG3B 1J3PA 1UX7A 1P4RA 4XMAA 5FZ9A 1PMHX 1FKAO 2ZCWA 1K73W 4KBBA 2ZCEA 1YJ9V 1OFSA 1UOFA 3K77A 4RGKA 1KP2A 1RUI3 4J9ZB 2OTLV 3HD8B 5CA3A 3JALA 1NTKH 1XOUA 5FY5A 4MZUA 1OJHA 2H8PC 5BV6A 2PUSA 3AP5A 4PBPA 3ZFFC 5KA5A 2D6OX 4GB31 1TZOA 2ZMKA 4YARA 2K9ZA 3CCSV 1OFNA 1CZTA 3WQ7A 1NY71 4FPHA 3IM0A 1K97A 3EFFK 1KEXA 4J7KA 2XDVA 1UD1A 3H1KH 4B3RO 5GONA 4LP8A 5AC91 3NV4A 1ND2A 3SH4A 3LNNA 3DEMA 5LA2A 1GICA 4M3CA 2LGQA 5DMYA 4LLFA 2LALA 3ZSKA 5C3QA 3KF5A 1XC6A 4RHV2 1EZVH 1GMMA 3IGAC 2FBEA 2A71A 4A45A 5FZ6A 4MHUA 1RUD1 5DUXA 2RHPA 1VMGA 5IY5C 3CB2A 1UOBA 1XPWA 4RFT0 5A3NA 2DWEC 1R1A2 2ZABA 5LEKA 2WQZC 4PI2A 3PJQA 3WDWA 2FZ2A 3WT3A 5IVFA 2Y0OA 4HXCA 5A1FA 4DV5B 2YB7A 1YJKA 4Z2AA 4AE2A 5GTIZ 3W58A 4FVMA 3R65A 1JODA 4DFSA 2Q0AA 4Y22B 5F2WA 2OXBA 4F6RA 1AYM2 5D8AB 4JYYA 3S0MA 3NRUA 3I2DA 1W9WA 5JXGA 2DUPA 3O12A 5DQ0A 1BCCH 3I49A 3IPVB 2JXAA 2HEVF 5FKCA 1CPMA 3UK9A 3HQUA 4ZXEA 5C3PA 2AH2A 1UWWA 2ZQMA 3OEEG 2A7AA 5FPVA 2VZTA 4UFIA 4UVAA 4YW3A 1UU6A 5EC1C 1VQ4V 2GUZA 2UU8A 1QXJA 1LOGA 2YYOA 4V1PA 1QU7A 1AXZA 3ZFGB 3ZR5A 5SV5A 1XMQB 1NKGA 2ZKLA 2OUHA 1W6NB 4KG0A 1JW6A 3MPBA 2L9LA 4CDUC 3N36A 1Q8IA 1R1BA 1G1XB 4UB6Z 1JCHA 1YI9A 1J5EB 3DECA 4NVPA 4JI7O 4CDXC 4JASA 3GZTB 3CMEV 3VHRA 4DR7O 3OD0A 1WWYA 3GJAA 2XNDG 2E32A 1S77D 3KQRA 3AK2A 3FB5C 2UUBO 1W6PB 2B5HA 2YI8A 3I2FA 3ACFA 4LFCB 4IIJB 4I4TA 3QF7A 4DXRA 3I56V 5JXJA 4UFLA 3Q4HA 2UUAB 4HETA 3OG2A 4ZIBA 1NA1A 4AGVA 4TLFA 2IU3A 3T4VA 1TE1B 5KLVH 4PCRA 4AYUA 1LECA 3B40A 1QNWA 1HNZB 3T2QA 2ZKOA 3CEIA 2UWCA 2BW8A 1ALYA 2HJIA 1CAWA 3TB0A 3URFA 2OCCB 1VRH1 1W2NA 4K3AA 1HRI1 2BU9A 5JOWA 1XUQA 4CUBA 1D7PM 4XXAA 2ARAA 4M0HA 4XFIA 1SFYA 3NWKA 1RM1B 1K5QA 2Q6AA 2VS0A 3GB7C 1FOD3 1X50A 2Y0PA 2W39A 2OQ6A 2P37A 2EA7A 4OGQB 1E5SA 3WP6A 3OEBA 5EYPB 1LUWA 1W9SA 2XB6C 4CDXA 4IGPA 3SPHA 2PTMA 3P3NA 4KHPO 3VQVA 3RYIA 4CP2A 3E5UA 2HEPA 4EN6B 4I0AA 3OSDA 1MACA 3INAA 3F7VC 1MOFA 2YY1A 4G4FA 1DIWA 4IT5A 4M4RA 1DGWA 2DBNA 2JIZG 1W2TA 4KG8A 4YJ3B 3FX3A 5JJNB 3VBUC 4X65B 5K0UB 4WZFA 3CWBH 1GBGA 1HW7A 4Y3OA 4KI5M 5GLVA 2XAGA 4EN7B 1AI6A 4QKNA 3S57A 1K42A 5GLUA 5LGTA 2X6CA 3S30A 2QM7A 1ZM1A 4IE0A 4S2HA 2YPJA 2TUNA 1PP9H 2OYZA 2QQOA 4TSFG 5AG2A 3P3PA 1RUD2 2HH9A 5IVCA 3DYOA 5L73A 3CCMV 3ZRXA 4CZZA 3SPGA 3GHMA 3THOA 5FY9A 1IX9A 4AFCA 4E8DA 2ES3A 1YHFA 4ZKIA 2CTPA 2DCZA 4B3SB 2E63A 5C8WA 4Q8KA 4QIWF 4NIDA 3NQHA 4EV0A 3S3WA 1F4HA 5A3PA 5J7MA 4FP2A 2LFSA 3U14A 4D6TH 1PO13 5LL6Y 2A3YA 2QZ2A 5CA0B 2AACA 2C1FA 4PLMA 1XQ8A 5LHIA 2C9KA 4XJZA 2BFUL 4XILA 2PZSA 1E1RG 2WNUC 3SPIA 2OVUA 2XAQA 4MGQA 5GJ6A 3UESA 4LO8A 2CL2A 5APAA 5D2AA 4DZGA 2XR4A 2ZA9A 2JG8B 5LYJB 1LESA 2W5FA 1W6OB 5LMNO 4N53B 1XREA 2O1QA 3NW4A 1MS4A 5AC92 4MH0E 5GLTA 3VL9A 2PGGA 4GZ9A 4J42A 1X8MA 2WN3A 2YV8A 4TXWA 1JTZX 2QTOA 4DV6O 3T4HB 3C7FA 2NQYA 3NNLA 1RUC1 1URXA 4NR1A 3QLQA 5IJ0B 2C24A 3JD73 2R0HA 4B3SO 1WA6X 3VN4A 1SDDB 2VBBA 3I2OA 3WUDA 2JENA 1F51A 1OQ1A 4LH7A 2BERA 2R071 2XHBA 1VRH2 3ZFFA 3I97A 2JGDB 3HQXA 1R082 2G9GA 4CU6A 5A1LA 4FOVA 1MS5A 4AQ6A 1DF4A 4PIZA 5FNVB 3VV1A 2A0LA 4O4LA 4QQOA 4MXVA 3E97A 3WDVA 3DCQA 3LGRA 2JJ1G 5C8YA 3STZC 3ZFGC 4G27B 2Q1ZB 2XJTA 2MEV3 1J95A 5EC2C 1RP3B 1R1ZA 2R0FA 3QCWA 5CG9A 4CVUA 1AR73 1OHFA 4U7NA 4FLUA 2D98A 3L9DA 2VE1A 1LGCA 5I93A 1CJDA 3JD2A 1JBCA 4N8MA 4TSVA 3OFNG 2ZKNA 2LUWA 3ILNA 3ABTA 4PF5A 2GC2A 3LFMA 5GALA 3ZSMA 4P5HA 3T1CA 1EN5A 1XU1A 4NMIA 4E2GA 4DXTA 4MUVA 3OUJA 3ZFGA 2Q7GA 3UYJA 2OWOA 4AFMA 2ADQB 4X20A 4BIUA 4YZ1A 2VC9A 2P67A 4YG3A 2E51A 5FZOB 1K5MC 1UPSA 1SCRA 3SKJE 4QD2A 3VLBB 3LPFA 5FYHA 1JHNA 4ZY9A 4UW3A 2JX9A 2QSAA 3JU9A 3OEAA 4AEDB 2NNUA 4RSUA 3KHBA 3RWKX 4Q4Y1 2RM23 3MW4A 4J80A 4O4HA 4WF9V 4PD4F 1S5JA 3USSA 3K3OA 1D0HA 4LF7O 4DRRA 3QTCA 4AWDA 1VQOV 1NI8A 4JF3A 1RHI1 2VUJA 3VZOA 5FYMA 3ON7A 3GXUA 2UUAO 4CCCA 5F6KA 4AI0A 1BHGA 5H2FZ 2W91A 1MZ6A 2XPJA 1E57A 2Z2SB 4K21A 3PTRB 2PYTA 5G05L 4HG6B 3RVHA 1OZ0A 3OGGA 2UUBB 1M1KW 1UZZA 1AI7A 1W8HA 3DYPA 4MGZE 2CAUA 5L3FA 1JXNA 4OQ8A 1HWYA 1H2GA 2RMKB 4FBFA 3MDSA 3ILRA 1AJOA 1NT0A 3SXWA 3VQYA 2ZX1A 1WPBA 5A3MA 3AMQA 4AILC 3M1HA 4CXWA 4AHXA 5B1AC 2WFF3 3K4AA 1GLHA 1UYXA 2YC4A 1Q82W 4JAVA 2ARHA 4KWJA 4QNHB 3FLRA 4CYDA 1ULCA 2UXNA 1W6PA 3I4IA 1NOVA 1YRZA 2X7RB 1SLBA 3I2IA 4AR2A 4IV3C 1H2SB 3VBSC 3OGSA 3TEXA 4OI1A 3ZRWB 1JA8A 4BQ1A 3RYRA 1V6KA 1W04A 2VULA 2Y6HA 4Y1YA 1VAVA 4NIIA 4LIUA 5LYJA 2D40A 3HKCA 1BCXA 5FFOC 2OCCC 4IUGA 1WCDJ 4IEZA 3POGA 1XILA 1N36B 2UXDB 1FXZA 1FOD1 1S5HC 3LSUA 5IK8A 4UYBA 5BMVB 2JDHA 1HRI3 1VB4A 2QQNA 3ZHSA 1V55C 2JB8A 4QPGA 2E75B 3K58A 4LFBB 1L7LA 2W0FC 1VBB3 2QQKA 3M8LA 3UO3A 1IDSA 3MIGA 2BVBA 3O9OA 4LF6B 1CZSA 1FATA 1OF4A 5GONB 4JGZC 4IERA 4AEJA 4DR3O 5LOVB 4FIPC 2WQ8A 4ASUG 5HCBA 1FFXB 1GUIA 3AMPA 1UZYA 1BSMA 1SHWB 2X5IB 4E4HA 1EN4A 1C8M3 2LFRA 4JQTA 4GWJA 5H9SA 5C70A 1K34A 1WW6A 4Q20A 4XJ8A 1EV13 3K3NA 2A1XA 3J7LA 3PHMA 1U5YA 4LWSB 1QHDA 3T09A 1W8TA 5FZOA 2YUEA 4Z92B 2YBKA 4BWOA 3JBG2 4FI9A 4IV3B 5FZ7A 2KG7A 2PYJA 4EQVA 1RJ7A 1UF2C 2J1SA 4AZZA 3SQOA 5FYVA 1BMV2 1UYYA 4J1XA 3ROUA 1M56C 4RR3B 1XNRB 4LA2A 4YHHO 2IBZH 1B6QA 1TUBA 2VW2A 2HWF3 2WO3A 4D6QA 4W4ZA 1QU0A 2ZHMA 4DR4B 4XDPA 1URFA 1CGPA 2BOBC 5LMNB 1DQ5A 4BMEA 3AP9A 2WLPA 1DFQA 2VZSA 4Y4YA 2VZUA 1JZ2A 1I7FA 3JQXA 4I30A 2R6QA 3OPZA 4NYKA 4YIPA 2QJVA 2R063 4XZPA 1B09A 1Q8VA 2PHDA 4JRLA 4Y5SA 4PJYA 1W0PA 1ZNPA 3C3VA 5FMBA 1AR92 4X64O 2V1DA 2ZE6A 4KWUA 3VKNA 3GBFA 3K06A 2A79B 5KMGA 1HV0A 4AAXA 4LF5B 5K0UC 5J2UA 1N34B 4YHHB 2N7GA 1YQ6A 2HWD3 3E22A 2HHHB 3V56A 2Y6KA 4XETA 5FPRA 3RYCB 4FOWA 4IYIA 4DV5O 1H6YA 1AVBA 5HPOA 1ND2B 4AVBA 4MADA 4XCAA 2WNOA 3F5WC 4OFGA 3PU3A 2ORXA 1UOGA 1O4YA 1LGNA 4CCJA 1W0OA 2HKOA 3APQA 4LNVA 2GMMA 3JATA 2WLKA 3POWA 3BVCA 4Y20A 2OYQA 4IV1C 1RUJ2 3OPWA 2IVIB 1KD1W 1IG0A 4QDQA 4JYAO 5E6HA 2DUQA 3W9AA 2RE9A 4Q2FA 3CHXA 2P5BA 1GN4A 1PGW2 1GP4A 1LOAA 4N21A 4IEWA 5EPAA 3ZFEB 2L6LA 3RVYA 1ZA7A 1AL23 1NG0A 1Q8OA 1QBZA 1R081 2V4AA 4DR2O 1VBD2 4GQ7A 3T1MA 4Q5OA 3CXCU 2EINC 3Q8FA 1Q7YW 3ZMTA 2WLQA 1PK6C 4A41A 3FB7C 1DLCA 4DV3B 2ARBA 4FTEA 3OAAG 2HWE2 4RGAA 5IWAB 1Y9QA 4BXSV 5EJZB 3VBSA 4PA4A 4P5YA 3ZKUA 2LW1A 4HFSA 1MZEA 1UY1A 4K8XA 3ABUA 2XWJB 3POFA 3C7EA 4Y24A 1XL4A 1ZBA1 4B29A 5CBFA 2W08A 4UUJC 2D43A 1L0NH 1K12A 3ZHRA 1SQFA 4AG4A 2GUZB 3ZLIA 3C7OA 1I0HA 2E6VA 4M4PA 3JCUZ 3TCUA 2YIBA 5C9AB 4PIYA 2ZIOA 5LOVA 3LSQA 4IL6Z 3WHTA 3PTYA 2VMGA 1BZWA 1UXZA 2I2SA 5KBFA 2KSDA 1EPWA 1A8DA 1PX3A 1SS3A 1VAKA 3N9QA 5EYPA 2QTWB 4AL9A 3UT0A 2AW9A 3UO2A 1FXVA 1S0BA 2DV9A 3N9PA 3OGJA 2HWC2 4CU8A 3AYCA 4N23A 1VBE1 4XQDA 4JHZA 1IZ3A 4JYAB 2G38A 3T2TA 3DXRB 2Y6GA 4WVZA 2H0VA 3M2MA 3A0KA 2DJVA 3H1LH 4YJ3A 3ASOB 1BVP1 3ETGA 5L19A 1UU5A 1G9FA 2Q4SA 5KXEA 3FX7A 1U5IA 1H6XA 3HT1A 1GMGA 2EIEA 4J41A 3NXSA 4Y5TA 3BA8A 5JJJB 4PA3A 1DYPA 3NKTA 1FI2A 2XAFA 1B35A 4XF9A 3BOPA 2VWJA 1ZVFA 5LP6C 4O2BB 1GWLA 2BRTA 1YQ2A 1SBFA 4LHLA 3JYCA 5FNVA 4DY3A 4CH5A 3ZYIB 1DCSA 3AEIA 5IK5A 2W1SA 2BZDA 2GNTA 4MTXA 4KL1A 3WNMA 1F2NA 2GN7A 1C5IA 3NNGA 3JASB 5BNPB 1H2MA 3EQEA 3GDBA 1Y3TA 1AI5A 1UY3A 1Z7S2 1R6NA 3ZYPA 5JVDA 2HWC1 2UUCB 1IG3A 4JTOA 2PHXA 1AJNA 1B35B 2ZEZA 4GKKO 3J8F3 1LRHA 3JQWA 3H3LA 4IHJB 1DQ2A 3PL0A 2R32A 1VQ5V 5HI0A 2EULA 4HKOA 4DEVA 2JEUA 3RI9A 1J3QA 5L7OA 4YW6A 1ZBE3 1NAEA 4BK5A 1AF9A 4TV8B 5FBJA 3H42B 2XOMA 1PVXA 1SG3A 3TEWA 3TJTA 2FL4A 3D0JA 4CA9A 3N2GA 2WWSA 1M56B 1XXNA 1JFFA 3BI3A 3M7MX 3K75B 2Q8OA 5LBEA 4RUFA 2VTFA 4RR3A 4OUMA 2FMLA 2IVJA 4J10A 2YUAA 1VMJA 1WBLA 3BTZA 3WDUA 4NXNO 3I3DA 3WY6A 5DZEA 5JVDB 2W46A 4PDRA 2ZGQA 3L74H 1PKXA 2W87A 5ANNA 1LHVA 1QLNA 1IS4A 3A23A 3OY8A 2XWBB 2E3CA 2BWCA 5I8TA 3HMYA 3FKSG 4NXNB 1X7NA 4AI1A 3JXSA 3ZYHA 4CEYB 3X2QB 4M0NA 3VBOA 1S2EA 3KMHA 2DU1A 5FLHA 3IMMA 4GIQA 4ZHQA 1LKNA 1QY4A 3MF9A 4QM9A 3MPPG 2MK3A 1AZDA 1IBLB 2PELA 3LUTB 4LULA 1O91A 4I55A 5FUPA 1D4M3 1TG7A 3J4UH 2BNOA 4GH4A 4CCNA 5C3SA 4LEJA 2HYKA 1S1AA 4LFBO 4CDWC 4J7JA 1QEXA 1KB9F 1UXXX 5DPNA 4CCOA 3CL1A 2Y33A 4D94A 2DBIA 3JD72 1SBEA 2GHYA 5A7PA 1CVNA 3I3MA 4JI2O 1UIJA 1D4VB 2EINB 1D5NA 1S2KA 2ZGSA 3L2YA 5A7NA 1SA0A 5LP6B 5CADA 5JOYA 3W7TA 1QNMA 1RMU3 3SMHA 2I07B 3RZHA 3MUZ1 4JI8B 3AVRA 3AKQA 3L9JT 4K35A 3JD0A 4PDVA 2WZR2 4KGQA 1Y4WA 4XUPA 4J1WA 3LCPA 2VUCA 5CZKA 1IXBA 1N34O 3TN93 1JJOA 1V55B 1MQTC 3B93A 2F4LA 3O7OA 1NCQA 1KUQA 1JZ8A 3VBOC 5B3SB 2YZ4A 2JEXA 1ZBA3 2W52A 1KU9A 4A44A 4LO6B 4I09A 4DV1O 2UU9O 2WDBA 1MS9A 1NVPB 3CJIB 1TNRA 2VQAA 3HNYM 2KD7A 2P5OA 2PLV2 4V2VA 5EYYA 3V0AA 3LIHA 5FXZA 2R073 1FFTB 3I2GA 3IC7A 1POV0 4K7JA 4N43C 3VDDC 4DUWA 4E8CA 4YYOA 1COV2 2B39A 2W3JA 2RDNA 2Q7HA 3WB0A 4QX1A 2RS53 3TGUH 4FFBB 1Z2GA 4D6SA 4K40A 3FZ3A 1Q56A 1SLCA 2ZX2A 3H1WA 1C28A 3ETEA 4A7KA 3R4UA 4GULA 4K3UA 4ZHNA 4ZU7A 2DVGA 4O4JB 4FVVA 2DW4A 4CPBA 3ETDA 1RHI2 2WFF1 5E1AC 1QJU3 5LATA 3B8NA 1RUH1 5EV7A 4UFHA 3BUCA 2JDKA 1WW5A 4JZGA 4DQAA 4FLVA 3VBUA 4MGYE 5EYXA 1KYOF 5IYDO 1THZA 1W2OA 1MABG 3WDTA 4IW3A 1R083 5GZGA 3TN92 4I9WA 4NJ4A 4D8MA 3KGLA 1E5RA 4BIFA 3K5MA 5CEHA 2NM1A 4UCRA 4JPRA 2PAEA 2MNGA 5D8AA 2JGUA 4WFBV 2Q73A 1PPJH 4E4EA 1ENQA 2JVDA 1J1LA 4MTGA 3V0BA 3JAMN 4MG2A 3GYDA 3GVMA 1RVF1 5HFLA 1UY2A 4RR3C 1VIBA 2F4VO 2XHKA 3I2KA 2FCUA 2KM2A 4GX1A 4QHZA 5FREA 3WFVA 3DN7A 2DVAA 1HR0B 2YBPA 2RM21 3RT3C 2JS3A 1ZRCA 1POV3 1COV3 5KUMA 1AI4A 2A5ZA 4SLIA 4IEYA 2WT0A 2OZJA 2ZDIA 2ZGMA 2LROA 3X29B 3WG7B 4J7ZA 1SC5B 5KMGB 3EMRA 5LA6A 1F31A 5AVAA 4IE7A 4YVSC 4AK3A 2VQEO 1YFYA 4FT8A 1WMDA 4AEKA 1X4TA 1WCQA 2AZ5A 3RYCA 3H8XA 1CJPA 2CWSA 1RL3A 1ZX3A 2A73B 4LE3A 1VBE2 2BGOA 5KUKA 5IYYA 1V00A 1K5SA 1YJNV 2J42A 1OOPB 1VR3A 4MXWA 1GNZA 3HKEA 4W6WA 1HNWB 3WF0A 4CCMA 5DM6V 1U5ZA 2DUOA 5IHRA 2ZPXA 2OCHA 4H3WA 2V09A 1W9FA 2JECA 1FJGO 5BNQA 1OA2A 5FR3A 3H1IH 1EAH3 4BLJA 2WS91 4BE3A 1XMOO 1FPN1 4K0KO 4NPLA 1D4M1 3RBZA 3CDZB 1PNMA 2Q4PA 3W20A 1MR5A 1IQAA 2AENA 3SCGA 1GQHA 4Q4W3 1ZLZA 2DOSA 3ZCCA 2IM9A 4JI3B 1SEFA 5KXDA 4OXSA 4CS2A 4PDWB 1UN1A 1W3XA 1UPGA 3FD9A 4LLOA 4RS5C 2DMXA 1W59A 2MW2B 4DV1B 5F5IA 3V0AB 4PQ9A 4ZONA 1XJAA 3D5OA 1HNXO 2PHFA 2B9VA 1SF9A 2HVJC 1HRV1 3VBSB 1R64A 3THCA 5IAXA 1RINA 5JI9A 4ZHQB 4N9IA 4LWSA 3SPJA 2FDHA 3O5SA 1ORQC 1Q5OA 1QR9A 3HWJA 4Q1RA 5D5QA 2ARCA 4F83A 3LDEA 4QWNA 5TSWA 3USUA 4DV2B 4AHZA 3HNBM 5H9QA 2W95A 2GDSA 3CCQV 2HWD1 1Q86W 2ZNIA 1HB4A 5JZGC 4J25A 3X2QC 1MNGA 2Y0IA 1PO21 1JYCA 1TGOA 1VBD1 5A6QA 2JE7A 1ZYBA 5LA1A 1LNQA 4B4QA 1EAH1 1Z5VA 2D6LX 2ZNJA 2ET7A 3FUQA 4X20B 5FCCA 2WLLA 5L3GA 1W8OA 4UI9L 3TEZA 5C8CA 1REDA 3SYAA 2RMU3 1XBFA 1ASJ2 4ASKA 5K9YA 5FOBB 3POEA 5ABJB 3T0DA 2VCMA 5K1XA 3SITA 3SJAC 3LQCA 4FCAA 4UXNA 1RVF2 4HPKA 4EN8B 1UZWA 4LPLA 3BU7A 2V72A 4X8AA 4FPFA 1R6KA 4I3PA 5FP7A 5KHIA 5B1NA 2WA3A 4LQRA 3ZN6B 2XL9A 4LKDA 4AQTA 1LOCA 3ABKB 1N32B 1AJPA 2ERFA 2J1RA 5C3OA 3IAQA 2BCCH 1ZSPA 3FFZA 1W0NA 3LNMB 1UKRA 1O3SA 3ZPOA 4TUYB 3NV2A 2VQTA 5BPXA 3WW2A 1YZBA 1SLIA 3VZNA 4Z8BA 1JX9A 3DYMA 4IEVA 4CH3A 2VCCA 1F5JA 4X1IA 1OSGA 1E79G 3MIDA 4BB3A 2OA2A 4XTPA 5A7SA 1GTOA 3OR7C 4BPZA 1FD9A 1VF7A 3BPSA 1UW8A 5FXVA 3OGVA 5T5LA 3U78A 5F5AA 1E5HA 3N2KA 1XNBA 2K46A 5KHKA 3H1HH 1GQPA 4LKFA 2YBSA 5HV0A 1FS0G 1AL0G 2Q9LA 5LY2A 3APOA 5H9PA 2YICA 1ZX5A 2IJKA 2F17A 1Y4MA 4BW9A 1CPNA 4YFZA 1SZBA 4GLXA 3SJQC 4WBNB 3O1VA 3B8MA 3ZHQA 4QX3A 1DYOA 3IMNA 1SMVA 5A6YA 1KMIZ 1RGSA 1WBFA 4OHWA 1ODMA 4N43A 3VDDA 4XDJA 4RD7A 5I91A 2K1EA 3K57A 2UY9A 4GWMA 1KKCA 3P1IA 1FAFA 4B3MO 2QJ1A 4ET7A 1I5PA 5FLIA 1SPPB 2DU0A 2W0XA 3NAPA 1CWPA 4AHCA 1OH4A 3VBRC 2ZR3A 4CU7A 5BR8O 3MEPA 1MQTA 4XJ9A 2QWRB 4QB6A 1NUKA 2HJDA 4Q0QA 5CFDB 3B2EE 3KVAA 2A3QA 3AXDA 3AG4B 5D5PA 4JC1A 3QOPA 1WAZA 5KXBA 3VBBA 2UU9B 2VMDA 3WB1A 3UNPA 1OBNA 2B5UA 4PA9A 3D3QA 1CP9A 1S76D 1UU4A 3VDBA 5IFTA 4YJ2A 1W6QB 4FAGA 3GJBA 4LBOA 2ZHKA 3AFGA 2ZZJA 2F23A 5FPLA 3O1TA 1W90A 3JD71 2C9AA 2WO7A 3ZOIA 2K9PA 5JWPA 5IE9A 3WQ1A 2BOCC 3RGBA 4WM7C 1NT2B 5IWAO 1I1EA 3Q4HB 3CLPA 4GH4C 4FLTA 2IWGB 2GMEA 1XNKA 2XVGA 2C4XA 1WB7A 1VBA3 5FJKA 1MS1A 4P14A 1IBMB 3MICA 3HKBA 5J9PC 4Z2WA 1M90W 3LKJA 1G9AA 4DV3O 1CAXB 1T2XA 1ZBE1 3J7HA 4I5SA 1V0AA 4BIOA 2QQIA 4L2NA 3CF6E 2JDPA 1GOFA 1R092 1V6LA 5LHGA 4EROA 2YXSA 5FXWA 4R9AA 1IS3A 1BZKA 4IV1A 3NO8A 2ATFA 1JYNA 2BVVA 4HZ3A 2QQPA 4OMCA 4E4DX 2JG9B 3LSSA 4ES8A 4EE2A 2HWF1 3JARB 5DECA 4EWDA 2XQXA 1Q81W 5C4WC 2AYHA 3CE2A 5JOZA 3LEKA 1VPHA 3WG7C 3M7AA 2HBTA 4A4AA 3CJXA 3WG4A 3T4DA 4NRPA 4BDVB 4F3JA 1X9TA 2QUOA 4CDQB 5EWSA 4I55B 3DKQA 4CEWA 3LDCA 3FAVB 3RZLA 1SA0B 3I5DA 3ZXKA 1GZCA 1AR62 4GB32 1RUF2 3U1XA 2NLJC 2ET1A 5FYZA 4MW8A 3MAQA 2HHHO 5CN0A 2P3IA 1XNAA 2PQQA 4E2SA 1OMIA 3K5NA 3MO4A 2WLNA 2MEV1 1J84A 4DV6B 2IJHA 1PL0A 4O61A 3BCCH 1JZ6A 5H5NA 1DQ1A 4COZA 3I54A 4TUYA 1KDMA 5IY5B 1UMIA 2IXHA 3AG1C 2ZXWB 2RS31 1WD4A 1H1AA 3OR6C 2EAKA 2UYBA 3WR0A 4XDKA 3IIAA 3WZ1A 2GN3A 2WLHA 3B94A 2ZHLA 2ZDIC 2JJ6A 1RITA 2ZAAA 4WVMA 5F8PA 4CBCA 2P7TC 5FOJB 2WUHA 1O8PA 2ILMA 5A70A 3RMXA 4MW3A 2ARXA 1N1SA 4DV0B 2O8OA 3AZYA 1UIKA 1VBC1 2WIIB 1K45A 5A2QN 1UO9A 1GNYA 1NX9A 3FLPA 4QHOA 3VD5A 4Z1MG 3FN9A 1WW7A 3O1OA 2HLDG 2UXBB 1YJLA 4WVVA 2VOWA 5CFDA 1QJX3 2SLIA 2W1WA 4WZCA 1HNWO 5DUUA 4J11A 2DTWA 1K5MA 1KFUL 2QWQB 2ZMLA 2P34A 1FXHA 2XT9A 4CCDA 3WEZA 3OD4A 1F23A 1AYN3 3LF7A 3ZYRA 4FTSA 5CMUA 3LE0A 2WLIA 5BNNC 3SPCA 1XE7A 1QXPA 3ICXA 5B66Z 4MVSA 2RN9A 5JCOA 1QVGU 3HJRA 2ID4A 3BKZA 4XQ4A 4URTA 1POV1 4K0KB 2XBO1 4X1YB 1YQCA 2B7YA 2QM8A 3W21A 3FJSA 1JQ0A 2BBVA 4JKMA 4MHRA 4NIAA 2RR11 3RVZA 2QQWA 3UJOA 3ZIWA 3WP4A 3POYA 2WFPA 1U12A 4ARYA 4E2QA 3THTA 2XAHA 1CAUB 3MFCA 2VOXA 4XC9A 2E76B 5CB4B 5KWRA 4LUMA 1F4AA 1RUJ1 3N9OA 2DYRC 1S2BA 1RUF1 3HNMA 1YI7A 4RQFA 3OGRA 2A9HA 1F15A 3O1PA 5IATA 2JG9A 3KCCA 4B08A 4ZOLA 4GA9A 5FYCA 1TUBB 4MTFA 5FQ0A 1AILA 1RXGA 1ZZ6A 2AEYA 4YVSB 5FZCA 5JPNB 1PGW1 3WW1A 4CEYC 3HPLC 1PO12 1QOSA 4YNIA 4H2AA 4AI9A 4WFHA 3THPA 4HONA 2JIGA 1JMKC 4GXLA 1QGLA 3ZN0A 4MXWB 4I9QA 2XBO3 3BCWA 1K9MW 2YI9A 1OCOB 4NTYA 4LBLA 1UQXA 3K03A 3DGTA 1JZ5A 1HV1A 1QXRA 5FZ3A 3DPRA 4XDOA 3BB6A 1PNLA 2HWB3 4YRDA 4N53A 1PM7A 1G6NA 2WN2A 4H13B 4E4ZA 3VBHC 1WN7A 4NAMA 1U5XA 3A7QA 4I0XB 2CE4A 3KG2A 2BTOA 5LW9A 5FIXA 5I0SA 3WP5A 3CU7A 1K3IA 2HFEC 4QQLA 2Y26A 4BHPA 5K4LA 4ASMB 1UCXA 2YFZA 3L70H 2K2SA 2D3SA 2D6NA 5EQUA 2ZIMA 3VGIA 4PA6A 4D6RA 1H8TB 3FWEA 2WWWA 4JI4B 3OUSA 1AR93 4QPGB 3RZKA 2W6JG 1LU1A 2IXJA 3CP1A 4MT8A 3BA9A 1ZL8A 3O0WA 1GKFA 3F5TA 4JI0O 3W5MA 5E79Z 3CCUV 3OBRA 1S4CA 5CB4A 2LQTA 4A2UA 3UKMA 1WW4A 3UJQA 1Z7S1 2VMEA 4YW1A 3SYOA 2XUEA 3IIIA 3WU2Z 1P7BA 1XRUA 2Z3YA 1L3JA 3C3TA 2WNEA 4HANA 2YROA 4JYBA 1AR72 4WBNA 3POBA 1QIQA 1N1YA 2YXHA 5JOXA 2ZGKA 5GM0A 1G86A 1OD5A 2B4KA 4GALA 3CCRV 1VQ8V 2FYUH 4NO4A 1ZAUA 1YIFA 4UF0B 4L99A 2ZBJA 4LC1A 1GV9A 3N2GB 3ZRSA 5A3UA 2WT2A 3CRAA 5IK7A 2EIMC 4OHZA 2VUAA 5FP8A 3FHIB 4HN0A 5FO8B 1WA8B 5FPAA 2W47A 2WBKA 4X1YA 3MLJA 2VQFO 4DK0A 4BAYA 4CP9A 3I55V 1RUC3 4UCUA 2E7QA 5KX5A 1CIWA 1CX4A 2PN5A 1GM9A 4U3JA 1W6OA 2LJ2A 3O1UA 4LH6A 5C9AC 4JAUA 1RUG3 2AZ0A 2R1DA 4X6QB 1UZ0A 2D3OW 5F2SA 1LEDA 4D3WA 1VAMA 1XNQO 3IB3A 2ETEA 4OVEA 1NQJA 2JDIG 3RG0A 3WLUA 1F4MA 2XKOA 4LF4O 4TQFA 2CH7B 1OLME 2VVDA 1WD3A 3A0HZ 2IU0A 1MQTB 1MVQA 3MBWA 3NAPB 4UFZA 2HWC3 5E16A 1LODA 2BUKA 3ZN6A 4YG6A 4Y1ZA 3TK1A 4NXMO 2P6JA 2SBAA 3SNMA 2AZ2A 3SEEA 5C8CC 4FPOB 3NKGA 2PY5A 2KKWA 5FQ0B 5FY1A 4DS0A 3CC2V 3PIJA 4QDRA 3J81N 4XAAA 2XKPA 2DVBA 3WG1A 4Z07A 4ZI7B 4P08A 4YZ4A 1RUF3 2TBVA 4ZBMA 4HL0A 2X0LA 4L11A 1QF3A 2Q30A 2D6PA 3WXPA 3ES1A 5FAXA 2XLGA 5F6LB 1DQ0A 1ND3B 2Y4TA 4P9OA 1WNSA 3AB0A 1O5LA 1RUC2 2DTYA 5A7OA 1R3JC 3Q8BA 5K7PA 2Z5UA 1NLRA 5FYTA 5IYZA 5CBLA 1STMA 2J22A 4SBVA 3C7GA 3ZHUA 1CESA 1N3OA 4ORFA 2J7MA 5IT9N 1OUXA 2J1VA 3FB6C 1LHOA 1VQKV 2ZTNA 3B69A 1A32A 3QO8A 2RQ6A 4QT6A 1H8HG 1H8VA 1Q90D 4GKJB 2BE3A 1W2BU 1I5XA 2I45A 5IYBO 3UQ8A 1GZ9A 4CS4A 5BNNB 3ML0A 2CGOA 1OLMA 2DWDC 4BZ4A 2RS11 3LDKA 3ITQA 1I3HA 4JGYA 4XFFA 2AGAA 1OV9A 2KA3A 3ILFA 4ARXA 4HVQA 2RVAA 3ZX7A 5L36A 2RJZA 4XDQA 1SRYA 1L1FA 4ISRA 5FDBA 4O4LB 2R70A 1W9YA 3WSOA 1ZZ7A 1UPIA 4J6GA 5J37A 2VBPA 4MSVA 5LASA 1OCRC 3RFRA 1HXS1 3B7MA 3E8GA 2B42B 4O4IA 3JD4A 2YC2A 2KB1A 3IDBB 4FFFA 1VF6C 1FNYA 1LNSA 1VBA1 4E27A 3IC9A 3MLLA 4EKWA 1VQ7V 4U3FH 3T2PA 2WAAA 2WRAA 5J2UB 1W8ZA 1ULGA 4GKJO 3I3QA 1V9U1 1XDCA 1VBB2 4X8NA 5EJ1B 2RS13 2AHYA 2H0BA 5IVVA 1SETA 3DC6A 1OKQA 4PLNA 2RJKA 3WOGA 1DQ6A 3M4FA 4YFWA 1ZZ9A 3C90A 2R041 3BY6A 2CYFA 2BGCA 2QKDA 3ZYGA 3E83A 4KHPB 4CCEA 1POQA 2EX3A 4C1XA 1PIV3 1DLBA 1D4M2 3U11A 2EIDA 3ZFEA 2VOVA 3PLQA 1S72V 1QLEB 4P00B 4DV7O 2B9UA 5K8SA 2XJSA 4AEMA 1OUSA 4IE5A 4AAPA 2FDFA 2A6YA 1UZVA 1VQ6V 4YVWC 1QH7A 4LBQA 1BK0A 2PHTA 4QPKA 3ME2A 3H8RA 3OE7G 1IVSA 5IWFA 1PNFA 1SKVA 5KHJA 2EXHA 1NA1C 4L0PA 1O3QA 1DK1A 4EFEA 5A33B 2EIJB 3AX4A 5C4WB 3JAKA 3CCVV 4TN7A 4L8QA 1IKPA 4DUZO 3MI8A 1BK1A 3OBTA 3PVBB 5LMUB 3T1YB 3J7MA 3MIHA 4B7EA 2W94A 4JV4A 1R3KC 1H2LA 2A6VA 3IKWA 5KC6A 2VZPA 5F39A 4H44B 2C6SA 3AFKA 1AX2A 1X82A 4XURA 1YQ8A 4XUOA 5EZYB 3RDIA 1I9RA 4HVRA 2P22C 1Q6UA 2VY0A 1LOFA 1S0IA 1WMEA 4EWAA 3G71V 2E5LB 3CKHA 1FOD2 2WABA 4EYUA 3WCSA 4CPBD 3ASNC 1WMFA 4HVOA 4JI7B 3SJCC 2PI5A 1GOGA 3CC7V 5E88A 2RS52 4X66O 1DGLA 5BZBA 4DUYO 4QPIB 4DR4O 3LA3A 2ZGOA 4E4SA 4FLWA 2JK5C 4ATFA 2V5YA 4RQPA 5LBBA 3ZYBA 3OB8A 1AX0A 5KR7A 3RN4A 5BXZA 4BQ4A 4FLZA 1OPOA 3TNPB 4ZS3A 1YIPA 1HDJA 4ONUA 4PDWC 4K9SA 4S2DA 1BMFG 3WG3A 4MO3M 1QLEC 4JI2B 2P2KA 4JKKA 1R3LC 4XCBA 4N7UA 1BL8A 4QPYA 5FZGA 2FDKA 3GGLA 1MS0A 3ZIXA 4BYYA 5GW7A 3E86A 4X62B 4KQ7A 1SDWA 3CJHA 4JRAA 1XNCA 5FXXA 3G4SV 3NL1A 3WV6A 3HKBB 1O7FA 2WLJA 1GNHA 2EIKB 1FV2A 1BHBA 1N3QA 1I08A 3VD7A 4TWTA 1HLCA 1D2QA 1YDXA 3AZXA 4XUQA 3EHBB 1OXCA 2YS8A 2LM3A 5FP9A 2M6YA 2IXCA 1DBNA 4AGRA 1YNAA 2ZEYA 5FK7A 3HPNA 1SQXH 3E8HA 2OS2A 2ZD9A 4A7ZA 1CAVB 4NPRA 2D3RA 2HG5C 2BBAA 4RFRB 1H9WA 3APBA 3OM3B 4OUSA 5HV4A 4I02A 4EB6A 4X66B 4X89A 1K4DC 4UVCA 3OOXA 1H0BA 5FTTC 3KZ4C 3RJ2X 5H9CA 1WZXA 2R7EB 4ICGA 5ITZB 1NE4A 4HNAB 2WZR1 3QNEA 2PFWA 2YFUA 4E2LA 2KG7B 4XJUA 2EJRA 1AXYA 4TLGA 1SPPA 1EFRG 2P06A 2ZINA 1XNQB 3ST7A 1AL22 4HAMA 3J7AU 1K5MB 3KT7A 3LSDA 5FZ4A 1RUJ3 3TRSB 2ZEWA 3FYEB 4BCUA 1AUYA 5EIYB 3BEHA 4KNCA 1OD3A 1W8NA 4DR2B 5TISZ 1AR1B 1WLDA 1BXHA 4GKYA 1ZRIA 1W0JG 5I0UA 2ETNA 2H6BA 2F4VB 4BLIA 2F6BA 4UCVA 3WW4A 2VQFB 2X6AA 3T4ZA 2UUCO 2EALA 2DYSC 4IIJA 1KS4A 4XW3A 4YJ2B 5H9RA 1PNGA 2ZE5A 1NXMA 5A7WA 4A6SA 2HLEA 2JDZA 4MYEA 1RHI3 4JKLA 4LE4A 1NKDA 3CO2A 4IEXA 5IW0A 3RWNA 4WVMB 1XU2A 4H37A 3ZXDA 4XBNA 2IXKA 3T30A 1YTFB 3DXTA 4PV1B 4M3CE 4DOUA 5IUQA 1OURA 1PM4A 4F6RB 4PELA 2VW1A 3TAYA 4UF0A 2YIDA 2HWE3 2VXRA 2KXLA 4P9WA 1LHWA 1CR7A 5FUIA 1NVPD 2VD7A 3LWCA 4TOIA 2A75A 1NLQA 2ZGPA 4BJ0A 1DGRA 4CCLA 3AL6A 3JAWB 3BU0A 1HX6A 2PF4E 5JQGA 2X5IC 4DRVA 5I8YA 3SYCA 4JDOA 1MZ5A 4YGCA 3H01A 2G9ZA 3V0BB 1US6A 5A3TA 2Q67A 3QH7A 1LR5A 4COVA 5A9GA 4ZS2A 2AEZA 3LDRA 5HFMA 1Z7S3 4N90A 1FPN3 2D7FA 1UX6A 1F35A 4CP9B 5FLJA 3CSXA 3Q8EA 3DXUA 3DUIA 1GN2A 3K3WA 4LOTA 3J8F2 2RMU1 1N3PA 1V6IA 4KMQA 1HIXA 1NCRC 2UURA 5AFBA 2E53A 2AGSA 2EAAA 5F37A 2ZM6O 4GH4B 5DAQA 1YHQV 1T5EA 1CAXA 4NB5A 4DR7B 4O2AA 4OI0A 3NSTA 1RUI1 2IFRA 5LEJA 2EF6A 1Q8SA 1YO8A 2CGPA 4XIOA 2EZPA 1QJY1 3ZRWA 4LF9O 4NHKA 2QQUA 3G67A 2C2AA 5DDJ2 1AJKA 4DRXB 1XMQO 3M3OA 4CTEA 1JPXA 5EBWC 4QX0A 3TN91 1VP6A 4LMFA 3VKMA 2FDGA 2XVLA 3CMGA 3NJYA 5CB7A 4MVMA 4XAEA 5EK0A 4WM7B 4MX3A 3CIHA 5GTHZ 5IFPA 3LA2A 4IESA 1ZA4A 1EV11 5J98B 1DF0A 4UAPA 2WZPP 3B4SA 4C91A 1RUH2 1NCQC 1C8NA 3N35A 1XBLA 4W50A 1WA4A 1MS8A 3FYIB 1DHKB 1V54C 5F32A 4JI1B 3IAYA 3OCPA 1L7QA 3MF6A 1GQGA 3ACIA 1UL9A 2B9ZA 2QE3A 2HWB2 3O14A 4NKGB 2ZAHA 3BYWA 1M5IA 1PHMA 5DABA 3QVNA 2GSMB 3SH5A 3BABA 3SISA 1EN6A 3W7UA 1BEV3 4PDLA 3PURA 2OQ7A 1KXGA 1PD3A 3ENRA 3NNFA 3GCWA 4YW2A 3U0ZA 1BHAA 3ABMB 4JGYC 4YM1A 3H3UA 1ASJ3 3K59A 4XFGA 4OX9B 4R6ZA 3PU8A 3ZYFA 2XASA 4ASLA 1SQPH 3NNJA 4Q0UA 5DDJ3 1SFPA 5B1OA 5FMCA 5LK5A 4NHMA 4QU2A 1HQWA 1SLAA 5A6ZA 2WNUA 5LA9A 3TBDA 2EIKC 4GX5A 1VF6A 1VJ2A 4O4HB 2UXDO 3ETQA 4F6EA 4BXFA 2QQVA 3LB9A 2BFUS 4AQSA 2ZJCA 3RQ0A 4B3RB 5D21A 4FOYA 4DO0A 1W8FA 2DFBA 3R0RA 4N9HA 1SZTA 1GSLA 3WNNA 2YC0A 3WP3A 4OCTA 2R30A 1IBKO 4MSWC 5L3EA 4LHKA 3E8BA 1PK6B 1SFNA 1U97A 4FPPA 1YQ5A 2A6XA 3FFQA 5F5QA 3VBHB 1XEQA 4M01A 1OCZB 4JVAA 4JV5B 5D1IA 1KECA 3KD4A 3H8OA 3GWOA 5JR2A 2GNBA 1J5EO 5HBAA 4PDMA 4EEQA 2J1TA 4JZ2A 5GZDA 3AG4C 5A32B 3TNQA 1S0EA 1HJFA 2Z79A 4P9IA 2DF7A 1QJY2 5CNAA 3E22B 4FAHA 1HRI2 2BPA2 3O0XA 4P9XA 4KBZA 3OGIB 5L9RA 1KITA 4LF9B 5CKNA 5BY5A 1HJGA 4URAA 1LHNA 4ABMA 4AVTA 1RSOB 2B1GA 1WCKA 4O2AB 1DZQA 1CONA 1Q8QA 2XH6A 4CUCA 1O4TA 1RUG1 4P2ZA 1ULFA 1GP5A 4L9BA 2MPFA 3KHCA 2FCTA 2DCTA 5L3BA 2R16A 2Y4UA 2BTQA 5FY8A 3EYPA 3AXEA 4C7UA 5FZDA 5LGUA 4QPWA 4HBNA 1WLCA 1MVEA 2NLRA 5LRSA 4XBQA 5LB6A 3OYWA 4R4XA 2YG0A 2ENRA 3U37A 3SEPA 5C3RA 3CNAA 3BHPA 4HT1T 1TME3 3TXSA 4FM2A 3L71H 2DYRB 4B3NA 1DGRN 3E1F1 3E89A 4Q4Y2 3NMBA 1R093 3AG2C 1O3TA 1W99A 4MVRA 3OPTA 2P6HA 1QWRA 4BQYA 3ASNB 1P84F 4FPCA 1AL21 3CRCA 1KFXL 5SV8A 3H1MA 4F8AA 1PVC3 1WUVA 3VOUA 4MVZA 3ZSJA 2FKXA 3ORJA 1UMHA 4JX0A 1HP8A 1VBA2 2WJSA 1X33A 3BVOA 3VZKA 4DR5O 2NP0A 1D0GA 5FY7A 3ZX6A 1BMV1 3FHAA 1M06G 1Y67A 3IAPA 3RW0A 4FPEA 3HEIA 1VRH3 5D8AC 3VDAA 3KT4A 3KWVA 1COV1 4XMIA 4FFBA 4ZI7A 1AR63 4CDUA 2R9IA 3B5LB 4GX0A 4P30A 3LZZA 5FZ0A 4DW1A 2IUWA 4H55A 2WQ4A 1SESA 2Y64A 1HR0O 3A4UA 3VL8A 3WNKA 1FXKB 3J26N 4QGMA 3AMNA 2GC1A 4U36A 4Q29A 4GMP0 3PVOA 1EPZA 1QCEA 5I8SA 1G6UA 4BWAA 4IE6A 3RSJA 4COYA 2GNMA 3P6BA 3AG2B 3LOBA 3K0DA 4G28B 4PQQA 3E2EA 1DTOA 4BA6A 3AG1B 3LEIA 2WNVC 2GNDA 3LDBA 3N7JA 5FPZA 1MS3A 3ATGA 5FZHA 3T1LA 4JTNA 1LCLA 4FJCC 5EXOA 1S55A 2UXCO 3ZKYA 3WHUA 3N4MA 1RC6A 1QQP1 4WM8A 1JHJA 2ZX4A 1YYNA 2Y69C 2OIEA 4RYDA 4OHXA 5JMOA 3JCIA 3ZM8A 5KX5B 2E7AA 4GYCB 1CX1A 4LBKA 3OUFA 1HNZO 1S0CA 2JDNA 4BM8A 3E6CC 4O7XA 4OLLA 4P9PA 3IPVA 4B4PA 4BOWA 5B1BB 2FD8A 4YZ3A 1HB3A 3AK0A 1NU1H 4DXWA 2RNBA 1HN1A 3VZMA 2VNGA 1JYWA 3VBHA 4JYCA 1XOYA 2EJ7A 3T3YA 4FFKA 4QGPA 2GV9A 4XACA 4OULA 3GBGA 1NXD1 1HRV2 3MLKA 1AX1A 4FPJA 2QKSA 2VZVA 1OLRA 3P30A 3KS7A 3CZUA 4WM8C 3ACLA 1JOBA 5LWBA 2IJIA 2WLIB 2X29A 4AQYB 1XB9A 1IBKB 1H8TC 2D93A 3M3EA 2BEOA 2CK3G 3EBRA 4R7CA 5BNPC 3DGEA 2EVXA 1G8MA 2CTRA 4FM0A 4JI4O 2BSKB 3R4SA 1R3IC 5ACA1 1BLZA 4AQ2A 1PIV2 3UCSC 4FO9A 1XE8A 4AVSA 4Q6GA 3K2OA 4DR1O 1QQP3 3AG7A 5J48A 4AVCA 1XL6A 5ITZA 2XAJA 3JZVA 1AP6A 5FZEA 3UM7A 3EJKA 2RDQA 3CEWA 3S7EA 1KJRA 5JCOC 5C93A 3AKRA 2F66C 4B8EA 4LT5A 5JIAA 1TME1 1IBLO 3HKCB 3SCFA 1TVKB 3RYHA 3MHZA 3JALB 1EZJA 1G8WA 4UOJA 1EY2A 4IQPA 1PZ9A 3DPRB 2LW7A 1AR91 2JDYA 2VL4A 3PDQA 3UKVA 3S6PA 4NIHA 5DAWA 5LMUO 3T1YO 3WW3A 5C71A 3OBAA 1OCZC 2XBO2 4DUZB 3PUAA 3EVKA 1N1TA 4NROA 2AC1A 2CWMA 5IYCO 2RMU2 3SLIA 4IHJA 5C9AA 4OX9O 4DINB 3OTOB 1VF5B 4UV8A 3N7LA 3M8AA 5BUVA 1JVMA 1WCSA 4JGZA 1CQ9A 1MA1A 2OIIA 4BQXA 1VB2A 1JOJA 2ZGTA 3BODA 2OX0A 4ZOLB 3RPQA 2XJPA 2O0OA 1JYTA 3DC5A 3ZXJA 3AK3A 2GSYA 3M99B 3KV4A 4Q4X2 2H3OA 2X10A 5F5CA 1FPOA 5FZFA 4G9SB 1S5LZ 5IDJA 2VQUA 2XJRA 4LO5B 4JI0B 1OKOA 1YFXA 3BTYA 3ZFEC 2P17A 1P7GA 1AR61 5CBGA 2OKXA 2LS6A 4R8CA 1B35C 4CC5A 1HXS3 4I0XA 5AC93 3USUB 1SLLA 2Y69B 1W9TA 3A21A 5T52A 1YFWA 3R6SA 5LZ6A 2BJSA 2FZ1A 1US3A 3H9VA 1O9HA 2IJJA 1IQDC 3FMGA 4MVTA 4DUYB 2VAUA 1FX5A 2HBUA 3T2OA 1O3RA 1UNBA 3ABMC 4JGYB 4CSWA 2ODMA 1GH6A 2E5LO 1EYBA 2E31A 1HB2A 3W59A 1R091 5AFEA 2W92A 3BTAA 1MEC2 4K8FA 1G9CA 1NLSA 2EIMB 2HEYF 2VPVA 4KFMA 5DN2A 5B3SC 2NMOA 5JI7A 5JVVA 4QE7A 5L3DA 2QDNA 1H38A 2WPDG 4NHXA 1D5AA 4P9GA 5L7OB 2QBXA 3ZS8C 1UYZA 1QJX1 1LEMA 2F93B 4AVAA 1V54B 3NV3A 3BAAA 3RZJA 4FSJA 2PYLA 2YMZA 2QFEA 3B01A 4N53C 4I0BA 4DV4B 3FUOA 2Q68A 1TQ5A 4FZ0A 1O8SA 3DPRC 2WWUA 1YFUA 1ENXA 3MD0A 3O0VA 2QZ3A 4CE8A 2JWPA 3STLC 3SC7X 4QAWA 4Q8LA 4QJFB 4O4JA 1HXS2 4NWVA 5T50A 3C8XA 1FAYA 1GRJA 2HWD2 1NA1B 4BQ3A 4N43B 3VDDB 3LEGA 1G9DA 1OOPA 2WZR3 4DEQA 5ABJC 4YW5A 3PN1A 4DXZA 3ZR6A 4IETA 2VECA 4RL7A 1R1A1 2D5FA 2Y6LA 5JPMB 4X1IB 3U07A 3D36A 1PVC1 2Q1FA 2QGNA 5T54A 2P6CA 2XVKA 4X6RB 2XG3A 2G19A 4IEPA 1LOFC 1VBE3 4EZHA 2DYSB 4BMBA 3JSNA 4OHVA 3U4XA 2BNNA 3PUHA 4TV9A 2X53S 1RUI2 1AVMA 4LTAA 2YHJA 1H30A 1GU3A 1ULEA 1JYVA 1APNA 2XUMA 4CS3A 3R05A 3WDYA 2WYFA 4NXMB 2XQRA 2N04A 3HBZA 4D7TA 3WCRA 2O8QA 2XJUA 1SERA 4PIXA 2GH8A 5DZFA 2RM22 5J3UA 1KQRA 1RUE3 4YPJA 4LHNA 3MW2A 2RDSA 3UETA 2E26A 1JZ7A 1AR5A 1IPSA 3A0RA 2YGLA 4B3TB 2RS51 2DQ0A 4COUA 1NH2B 5DDJ1 1XI1A 1OI6A 3VKLA 1DGWX 3ZBHA 1OCOC 2EIBA 3WD5A 3CRQA 1TNFA 2EXJA 5CFDC 4CDQA 1W05A 1Q8PA 5CYYA 3UKTA 4I7ZB 3ZEDA 4Z82A 2X6BA 4UCTA 4LBQD 3U10A 4YSFA 1N33O 2QQJA 1D2SA 2CUGA 2QA4V 1QJU1 1VQPV 2AREA 1CAWB 4HSLA 3EB7A 5IJ0A 4I3GA 2AHZA 3I59A 2P4VA 2PHRA 1R1A3 4DXSA 2HVKC 4QU1A 2JKBA 2WZEA 2UXBO 2E9QA 3I8TA 4XF0A 1KC8W 1DF5A 2A6WA 2BYVE 1OF3A 2R042 4YW4A 4S2FA 4U2AA 1YXWA 3HB3B 4NRMA 1XHXA 3J7NA 1EUUA 5FBZA 2F95B 1FXKC 1VQNV 1PV0A 1DGSA 2PQSA 1K4CC 1RUE2 5DG2A 1UYPA 4PLOA 4GCZA 3AM2A 5J2TB 2UWAA 2OTJV 4JI6O 4JI3O 1Y74B 3VD3A 3KCYA 5LXTA 3D3IA 1LENA 3S5QA 3UGHA 1T6BX 4G3YC 4WBBA 4XDLA 2B45X 3ZMVA 1A8MA 4FFIA 2QWOB 1O4ZA 5BNOA 2QCSB 3S7IA 5F2VO 1LAJA 4QPIA 1XMOB 1CXZB 4R9DA 3OW2U 3QO5A 4RUEA 2ZX0A 4XPVA 4FXGB 4OI4A 2GP3A 3H7YA 2O14A 1RSOA 1NTMH 3LSEA 5J09A 4MOAA 3M3CA 4F7ZA 2ORZA 1JN2P 2W2IA 4M3CF 1VBC2 1W3VA 1GAXA 4Y1XA 4JAAA 1SQGA 5FL7G 3W7WA 2R9AA 1EAH2 4QQHA 1Y6XA 2Y6FA 4PF1A 1S0VA 2CSGA 5GZCA 3HN3A 1KS5A 3IDEA 3ZHTA 5AVPA 3CS5A 3CJIA 1ZRRA 2QM4A 3VBFA 3WINE 4QGLA 3I2JA 5T5JA 4LJHA 1HN0A 4XJAA 3MW3A 2VBDA 3F95A 2BWAA 5BYNA 4AF9A 2OPKA 2M7WA 4LBNA 2IXIA 5CAZA 3HR0A 1J59A 4Q4W1 3GCXA 5L9BA 4MGKE 3KCXA 3PUIA 1BQZA 1RTVA 1CAUA 1QDOA 2VW0A 4Y4RA 3CRMA 2LP7A 1BEV2 5I0TA 4C90A 3ZHVA 2WT1A 1TEIA 3IDCB 3R66A 2PAKA 1IBMO 3U4SA 1I94O 2BNMA 1IURA 1SLTA 2WR9A 2FMDA 5LCWL 2ADEA 3JSLA 4RS5A 1HQNA 4R8HA 2VOKA 3IZOA 5JZGA 4LBJA 3VUOA 4QX8A 1GANA 4YM0A 4CDUB 5E1RA 1YF2A 4IEUA 3VQXA 5GZEA 4CC6A 2DDUA 5KAFZ 1Y76B 3EXUA 3UV9A 3CJIC 2Q8EA 1F5FA 4R50A 4XF4A 5LA6B 4CXXA 4LXLA 4W6XA 4D7YA 2Y34A 1BKZA 2H6CA 4XBFA 4Q26A 1EP0A 1N0NA 2WINB 4WM8B 4NAOA 2RJLA 1GWKA 1IPJA 5GZFA 1XHZA 4DV4O 5JQGB 3I59B 4LKEA 3MHHC 1OQEA 1NR1A 3E35A 3D82A 3POIA 4D69A 5B2GB 5JSPA 1BBT3 5M0TA 1LB2A 1W6QA 2YU1A 2H94A 3RWRD 2GC0A 2WS92 3ZDVA 1W2AX 5F3IA 3KGZA 1LULA 1XYPA 1BT8A 5DAPA 1H2KA 1COWG 5L7OC 1ND3A 1ZRFA 5CFCA 4OI2A 1FYUA 4L92A 3CYOA 4LFAO 5KA6A 3RRDA 2WNUB 2P3KA 3MZHA 2ATKC 4FP3A 1RB8G 4WCEV 2LW8A 3KSCA 5CA6A 4C0HA 3MUY1 4Q4V2 1ZUQA 3ZO0B 3GZAA 1JMUB 2PHWA 1DYKA 4XUTA 4F4LA 4IYHA 3AP4A 4AEDA 2WKKA 3B02A 1MG1A 3OGCC 1DZRA 3RZGA 4GWNA 4XHBA 2N05A 4KXRA 4BW5A 2CV6A 1AR83 5I0DA 1LGBA 4X64B 5JDBA 5FMOS 4R52A 3L72H 4JTAB 3HKEB 2CNAA 3O1MA 1UKGA 3UGGA 3RI8A 4YVSA 3B00A 4GD4A 3CCJV 1Q43A 5EZYA 3LOIA 2VTXA 1IS6A 3CCEV 4IGQA 3M70A 2MEV2 3H3ZA 3VKFC 4UW4A 1CPYA 2UWBA 3IDAA 4RQEA 2J1AA 5LA0A 4QGNA 2ITDC 5FZ8A 1RUNA 4JTCB 3K5LA 4HOOA 4XE9A 1JZ4A 3AP6A 1OCRB 2P3JA 1PX4A 1BYHA 1PVC2 1TUEB 3OYWB 4X1KB 3ABLC 4PHZA 1AR81 4MTOA 1WA8A 2VJXA 1FJGB 4MGIE 2VCAA 1NZIA 4CP0A 2JEMA 2J1UA 3WDXA 4IEOA 1D2DA 4TWKA 1AXKA 1ZZ8A 4UVBA 3K9SA 4FM1A 1J58A 3N9MA 4DR6B 2PLV1 1OCCB 2WSSG 3SYQA 5JSOA 1YEWA 4LF4B 1B3QA 2QQMA 1XQNA 3N9NA 4BU2A 1ULDA 3AC0A 2W6IG 5JZGB 1RPRA 4CP1A 5JXIA 4BIZA 2A7WA 3T1HB 5FWJA 2Z42A 4HKLA 2OIGA 2HYXA 3ZFFB 1ZZCA 1M4WA 5C4WA 3D36C 1NE6A 1NCQB 3TEYA 1UMZA 2JDAA 1NCRB 2RCVA 4UWDA 1JH5A 3A0NA 1Q6IA 3CXHF 3ES4A 3HQRA 1MPXA 4H7MA 1BS3A 1RUG2 2JG9C 4FPYA 2CU5A 2WSUA 4K6BA 4MV2A 3UGFA 1Y66A 3ZIAG 1AYM1 3ZMOA 4DV2O 3KF3A 4TV9B 4RN5A 3OUIA 5IVEA 1MZFA 2JG8A 4GT1A 2P90A 3FB8C 3TWIA 1W28A 2CTQA 2YSUB 1QH6A 1QJX2 1JR9A 2Q0OC 4LHSA 3NNMA 1HNXB 1NBMG 5DEDA 1FMD1 2XMLA 2Q8DA 1OVPA 1SCSA 1GWMA 5GLWA 2O57A 1O5UA 2ZOEB 2JDMA 1M9NA 4BISA 4TV8A 5F9TA 3WNPA 3CCLV 4LITA 3I3BA 1AYM3 3B77A 5EIBD 3JAKB 3ABZA 3T2MA 3D8CA 3JD1A 3CC4V 3CQOA 3UT5B 5H6RA 4CCKA 4FPKA 1O59A 3K51A 2ZXWC 1UFIA 4DPNA 1I6XA 4Q4W2 4XTMA 1PO23 4FLXA 3SH3A 2AUYA 4AXOA 1LU2A 4KGGA 1FFXA 4QPIC 3IBMA 2OPWA 2GU9A 1ENRA 5JH7A 1XYNA 2ITCC 3PUSA 4N7IA 3NJZA 3B09A 4A6OA 3H7JA 2D2CB 3SGIA 2VTXJ 4EWEA 3BIEA 1N33B 2X05A 1LR1A 3JARA 1RIRA 3ZXEA 5BNNA 1Y7BA 5FMOL 5DUWA 2N74A 5JIUA 2UXCB 1DDLA 4O65A 1RUH3 2Y38A 4DV7B 1R73A 4XHXA 1NR7A 4AGGA 4KP4A 4CRQA 2RDRA 5CA1A 2X5IA 4R9CA 4B1MA 2ZGUA 3RZMA 4DR3B 5BY1A 4O4IB 1W06A 3OF1A 4V2WA 2RS33 5IJ9A 4UW5A 1W8WA 3Q8AA 5F3GA 1P8JA 2JE9A 2AXTZ 4YM2A 3WNLA 2V4DA 1NYWA 4CH6A 5FUNA 1H4HA 5LK7B 2ZGNA 2YDEA 2VR4A 1LOEA 5A7WB 3JD3A 4OZOA 4UFMA 4GZRB 1W39A 4KU8A 3WF1A 1ZWIC 4W4KA 2V4VA 5B4XA 2WC2A 5DN6G 3ASOC 1CEZA 1BQ0A 3AKTA 1AB3A 1RVF3 2VG9A 4A3XA 2Z4FA 5FMDA 3ETPA 1RMU2 2JKXA 2WAMA 4Y1VA 4HN1A 1YJWV 3ZMSA 2BOIA 3UT5A 5CIRA 1BVVA 4CDXB 4X8PA 2P1BA 4ZZ8A 1XNTA 3LPGA 1Y74A 2PHLA 3I2HA 1B04A 4A3ZA 3AYAA 3NV1A 5C33A 4PJ0Z 1C8M1 4B3MB 3D0SA 3HKDB 3PUQA 2VVFA 3H0OA 3HT2A 1ND3C 5BMVA 4JI5O 3E5XA 5DAVA 2QR4A 1VLNA 1J1TA 2JGDA 4Y5Z0 4E9KA 1JYXA 5GKAC 4HZFA 1RXFA 1GFF2 3J80N 2Q5TA 5J96B 4EN0A 3DL3A 3BALA 1VBB1 2A6ZA 1L7RA 2TEPA 3A8TA 4ZPIA 2JG8C 2HWE1 2C0ZA 3SKVA 4UFKA 1X8EA 1PZ8A 1VALA 1G4YB 4AHWA 4LO4B 1TMF1 4O9EA 2NMNA 3E8FA 4GJZA 4MLOA 1BGYH 4OMDA 3DV8A 2YEVA 3T08A 2GTSA 2DE0X 1SZXA 4UBHA 3WVJA 2HKXA 3N7KA 4QB1A 1W2UA 1NZ6A 1QR8A 4Q0PA 3NJVA 1LUVA 1QJY3 5CFCB 1MEC3 3HAGA 4LR4A 1DU3D 1LTEA 4LF5O 4BQWA 4ZU5A 5EBLC 5ISLA 3S3XA 1A6CA 3ZPYA 1NY72 5ANQA 4GWIA 1F7YA 4JQRA 1AR82 1ZL8B 1IHMA 1US2A 4LR3A 3VBOB 2VMFA 2RV9A 1RJ8A 2WL1A 4C8DA 2D3PA 4WM7A 3H1JH 1K92A 1JUHA 5JXHA 3JASA 4DK1A 3T1HO 4YXWG 1S0DA 1F8VA 2Z5WA 3POSA 4DUXA 5E89A 4XBLA 2E7TA 4UFJA 3Q9OA 2B46X 1VBD3 1R6TA 2VZ3A 3RZZA 2PA7A 1Y43B 2RG4A 4PBOA 2JD4A 4M00A 2RR12 2Q5ZA 3THDA 5FPOA 2V7QG 4FK5C 3KQ4B 1LHUA 5L9VA 1J83A 1WLWA 1KP3A 2MHFA 5A1AA 1ENVA 4RS5B 2VQEB 4YY3O 1MSWD 4Q4X1 1OLQA 4XFCA 4NWWA 5KHHA 3H8UA 4U7OA 5B1BC 1FNZA 3K5OA 1S0FA 2BGPA 5B1AB 2BTVC 4K1YA 1YXBA 3QD6A 3DKWA 3H9AA 4QE9A 1OA4A 4GMP1 2BOJA 3IJ4A 2WLMA 1KDKA 3VB9A 2VNVA 5EIBC 4GKKB 3ZDSA 5A3LA 4FQ4A 1FPN2 2VMHA 2VZOA 5FPXA 5A7QA 1YWKA 2DVDA 4JDNA 4Y26A 4DUVA 1Z5WA 1NH2D 1YUDA 2XJQA 1G9BA 1QOOA 2ZACA 3OTFA 3RMYA 4O2BA 5EBMC 5DZGA 5E8AA 4QXCA 3TYJA 3GBWA 2G1MA 5JAXA 3PMEA 4YM3A 1HB1A 3CMAV 3D6EA 4CUAA 4IGOA 1N36O 4LNUB 3AJYA 4XZUG 3V64A 4BH9A 4QX7A 1M4UA 4AHYA 5KAIZ
chains in the Genus database with same CATH topology
3ZSJA 5A33A 4CDQC 1CPNA 4YFZA 1FOD3 2F4PA 2DVFA 1VBA2 2WJSA 1X50A 2W39A 1X33A 2P37A 4P9YA 1QNYA 3VZKA 2NP0A 1D0GA 2EA7A 3WP6A 4W6YA 3IMNA 1BMV1 1M06G 1SMVA 4HLTA 4FPEA 2XB6C 1I5ZA 1RGSA 1WBFA 4OHWA 4Q4V1 4CDXA 4N43A 3VDDA 1VRH3 3P3NA 2PTMA 5D8AC 3KT4A 3OY8B 3KLSA 4CP2A 1COV1 4XMIA 3E5UA 4DY5A 4XFBA 4EN6B 2ZMNA 4I0AA 1AR63 4CDUA 3B5LB 1C57A 1CD3G 4RD7A 1MACA 3INAA 3LZZA 5I91A 4O9GA 2YY1A 4H55A 4G4FA 3PJYA 2WQ4A 1DIWA 5JMCA 2UY9A 3A4UA 4GWMA 1DGWA 3VL8A 5FO7B 3J26N 4QGMA 4KG8A 3AMNA 2GC1A 4U36A 5A32A 3FX3A 5FLIA 4Q29A 3VBUC 4GMP0 1EPZA 2DU0A 3PVOA 2W0XA 3DF0A 1CAVA 5I8SA 3WUCA 3NAPA 1FMD3 5K0UB 1WLTA 3VBRC 3M3QA 4WZFA 3MEPA 4CEWC 3RSJA 4COYA 1MQTA 4XJ9A 1PO22 2GAUA 2GNMA 1GBGA 4Q0QA 5DUVA 5CFDB 2ZS6B 3AXDA 3LOBA 1V70A 5GLVA 5BXXA 4EN7B 5GLUA 4JC1A 3S30A 3AMHA 4BA6A 1ZM1A 3R1JA 4S2HA 4RQPB 1DS0A 2WNVC 1H8TA 3QOPA 2YPJA 2GNDA 2TUNA 3N7JA 5KXBA 5FPZA 2OYZA 1MS3A 3PVEA 1QMJA 3ATGA 4XXPA 3T1LA 3P3PA 1PGL1 4JTNA 1RUD2 3ALQA 1LCLA 5KC5A 5EXOA 1RUD3 1S55A 1X36A 5L73A 1UU4A 3WHUA 3N4MA 1RC6A 1QQP1 4WM8A 1W6QB 3GHMA 4FAGA 2ZX4A 3AYDA 1YYNA 2ZHKA 3AFGA 4LBOA 1C3HA 2ZZJA 4AFCA 3QBQA 4ZKTB 2V73A 4OHXA 1OPMA 3JCIA 2C9AA 3JD71 2ES3A 1YHFA 5JWPA 2E7AA 3WQ1A 3E5QA 4AI8A 3RS6A 4WM7C 2NZ9A 1KRIA 2DCZA 1I1EA 3CLPA 3BPZA 4GH4C 2IWGB 4LBKA 1S0CA 2E63A 2GMEA 5C8WA 1XNKA 2XVGA 4Q8KA 4BM8A 3VKOA 3E6CC 1VBA3 4OLLA 4M2IA 3IPVA 1MS1A 4J5IA 4B4PA 1BJQA 4P14A 4BOWA 4EV0A 4YZ3A 3MICA 2UY8A 4Z2WA 5J7MA 3LKJA 3AK0A 4FP2A 5ACA3 1G9AA 3JUUA 1CAXB 1PO13 2A3YA 2QZ2A 3VZMA 1ZBE1 2NYYA 3MS5A 2GH2A 2VNGA 3SCHA 2C1FA 4PLMA 1OIJC 3VBHA 4BIOA 4XJZA 2RS12 3MIEA 4L2NA 5EFUA 2BFUL 3CF6E 4XILA 4DB5A 2D5HA 1GYKA 1R092 2WNUC 1V6LA 2OVUA 4EROA 1HRV3 3JB4C 2YXSA 3GBGA 4OULA 1NXD1 5GJ6A 4R9AA 1HRV2 3MLKA 4LO8A 1EV12 1IS3A 1CN1A 1AX1A 4FPJA 4IV1A 1PK6A 3NO8A 2CL2A 1OLRA 4GKXA 5BNOB 3KS7A 2ATFA 4YVWB 2BVVA 3GALA 3ACLA 4WM8C 3ZSEA 4DZGA 2QQPA 2PLV3 2G4IA 4E4DX 2JG9B 2ZA9A 1F9KA 4CDWB 2X29A 2JG8B 1LESA 1PO11 4XJWA 4ES8A 2Q4AA 1W6OB 4N53B 2HWF1 2O1QA 4Z1VA 3NW4A 4EWDA 1MS4A 3VBUB 5AC92 1H8TC 1DQ4A 2D93A 3M3EA 4MH0E 2BEOA 4RA0A 3EBRA 5GLTA 3VL9A 5BNPC 5C4WC 1DLLA 2AYHA 2EVXA 2XJVA 5JOZA 4ITCA 1X8MA 3M7AA 2YV8A 3CJXA 3WG4A 4XF1A 1JTZX 2ZHNA 3R4SA 5ACA1 4AQ2A 4F3JA 4OJ8A 4EN9B 2NQYA 2QUOA 1PIV2 1RUC1 1N1VA 4NR1A 1URXA 3QLQA 5EWSA 4CEWA 4CDQB 3JD73 4S2GA 4FO9A 1XE8A 2R0HA