1IURA

Dnaj domain of human kiaa0730 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
MHHHHHHLVPRGSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA0730 protein
publication title Solution structure of DnaJ domain of human KIAA0730 protein
rcsb
source organism Homo sapiens
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1iurA01
4J80A 1IURA 1FAFA 2GUZA 2QWNB 2CTWA 1FPOA 3UO3A 2KQXA 2CTQA 3UCSC 1BQZA 3AG7A 1BQ0A 2QWOB 2QWQB 2GUZB 2QSAA 2CTPA 2L6LA 3APOA 3BVOA 2LGWA 3UO2A 2YUAA 2DN9A 1NZ6A 1GH6A 2N05A 2Y4UA 2QWRB 3APQA 2Y4TA 1HDJA 2CUGA 2N04A 2YS8A 4J7ZA 2LO1A 4RWUA 2CTRA 2DMXA 2PF4E 2QWPB 1WJZA 1XBLA 2OCHA 2M6YA 1N4CA 4IT5A 2EJ7A
chains in the Genus database with same CATH superfamily
1GN2A 3FX7A 1YJ9V 1IDSA 4DW0A 1L8DA 4R8CA 3SPIA 4NR1A 2ZDIC 2H8PC 2ZE6A 1H8HG 4I55A 2ZIOA 1SESA 4I4TA 4UCTA 4JYBA 1JA8A 3CP1A 4Q20A 2B9ZA 2OIEA 4X88A 4NXMB 3ML0A 2B1IA 2MK3A 1ROPA 2ZE5A 2F93B 1HNWO 1VQNV 5EYPB 3M7MX 3CCMV 3L72H 1F7YA 1OCRB 4DR4B 4ZIBA 1KC8W 4MTFA 3Q4HB 2JGDA 2ZCEA 2WWWA 3ASNC 5KX5A 4K0KO 4B3SO 1R73A 4FK5C 3ZHUA 3RYFA 4JI1B 4TUYB 3B09A 4LF9B 1AJQA 3M99B 2DMXA 2UUCB 2ZKOA 1B3QA 4QNHB 4DUYO 2YXLA 3PN1A 1U97A 5IY5C 5B5EZ 4DV5O 3APQA 2EBOA 3QF7A 4J11A 5CA1B 3DC6A 2PF4E 1S77D 4JI6B 3I55V 3K5MA 1IXBA 1SQVH 4H13B 2OWOA 4R7CA 1OCCB 3ABKC 3CCSV 3D3IA 4TOIA 2AXTZ 4KHPO 3T1YB 2UXCB 4JI8B 2JDIG 3JD4A 2N04A 3ASNB 4QIWF 2W0XA 2UXDB 1HW7A 3FYIB 2D3OW 2CAZC 4JI5O 4R50A 1FXKB 2CH7A 2GBOA 3K03A 3KG2A 4FZ0A 2RCVA 1K92A 2F1MA 2W0FC 3CC7V 5IY5B 2QJ1A 2VQEO 1Y4MA 2L35A 5D5QA 1K5SA 1N36B 2YEVB 5IE9A 2BOCC 1DK1A 1OCOB 1R6TA 2P7TC 1IBMO 1BQ0A 3OT7A 4JTAB 1S5HC 4DR3O 2WLIB 1XDCA 2Z3YA 3UM7A 1Y76A 2CK3G 4D7TA 2EZPA 3SPCA 1N0JA 2R9RB 3BPZA 4HNAA 2CTRA 2PI5A 1Q86W 1IBLO 3ZIAG 3CXCU 3HKEB 1MABG 3JALA 5HFMA 2GTSA 3B8MA 4ZI7A 2AGAA 4QJFB 3H1LH 3JATB 2Q69A 3L9DA 2F66C 4DR6B 1UFIA 4GKKO 1YVWA 1GH6A 5LHGA 1MMMA 3WB0A 3WFVA 2QWRB 2A7WA 4CBCA 4Z1VA 3CS5A 1AP6A 5B1AB 1I08A 2O57A 4DR1B 3JD1A 1QU7A 1QVFU 5A2QN 4G2KA 3QNEA 2QTSA 5CBHA 4EFBA 3RYIA 1QVGU 1LUWA 4JZGA 4BW5A 5FPRA 1Y67A 3A8TA 1H2KA 4F6RA 1KUQA 4FLWA 1GM8A 1M57C 2ZE8A 4LC1A 3DGEA 5J2UA 5IJ9A 2LGQA 5GONB 5JCOC 5CBGA 1JFFA 4IT5A 3GWKC 3L71H 5L3FA 2JEUA 3F5TA 4X65B 4JI3O 1IURA 1BZKA 4JYAO 2KQXA 3TXSA 1Q90D 1BSMA 4EB6A 1THZA 3GVMA 3N2KA 2Q9LA 3TK1A 4UVBA 1N34O 1TUBA 1OCZC 3N27A 2PTMA 4DV7B 3E8FA 2QWPB 5KAFZ 1K4CC 2ZINA 5FPOA 4W4KA 3ZHQA 1R6KA 2DE0X 5H6QA 3JAKB 2IU0A 1NI8A 3WB1A 4TV8B 1G4YB 3BVOA 4GCZA 2ILMA 1LNQA 4TSFG 2HHHO 1EN5A 3OUSA 3OEHG 1JPXA 1UPGA 2PY5A 4JI2B 4JI0O 3KCXA 1VQOV 3E22B 1W2BU 5LOVB 4JGSA 1BQZA 1M57B 3O65A 2QM7A 3CCJV 2ZDIA 4YJ2A 2A3QA 4DV6B 2EIKC 1QBZA 2Q0OC 1YHQV 2Q0AA 1F51A 1BL8A 4ZKIA 3SJAC 3K06A 3RYCA 4J7JA 4OX9B 3RVYA 3S3XA 4J41A 3BABA 4WBNA 2XAJA 4XDJA 1JMKC 1AP5A 3BA8A 3KKYA 4X1YA 1OCZB 3E8BA 4FM1A 4D7SA 2PI4A 1OHHG 4IGGA 2Q73A 4NYKA 2QA4V 2GTAA 4LH6A 5JQGA 3ZMSA 4LF8O 2R70A 1JCHA 4LR3A 5C93A 5ITZB 3CYOA 3BCCH 1YZBA 2GHYA 2IH1C 3WB2A 3EXAA 4GZRB 2A0LA 3CHXA 5L3GA 1YTFB 1NT2B 3SYAA 5A9GA 1SS3A 5B66Z 5IYZA 4DR2O 3AG7A 1XQ8A 2Y0PA 1VQLV 5DECA 5GTHZ 1T5EA 3JARA 4X66B 3DXRA 4FFBB 3RYHB 4AI8A 1XNRO 1SQBH 1K97A 2EIKB 1NU1H 4O4LA 3G6EV 4P2ZA 4DV3B 4ZHQB 2OIGA 3IJ4A 2ZNJA 2DWEC 2IH3C 1WLEA 2CGOA 1N32O 4I55B 2YXHA 4WFBV 1FYJA 4I4TB 2FYUH 1Q43A 2FTKA 4J42A 2E74B 4FIPC 2YI8A 1Q5OA 4UB8Z 1BHAA 4FLTA 3TJTA 1I7FA 3AG4B 3FAVA 5JJJB 1BE3H 2ZNIA 4P9OA 5IYBO 4LFCB 1ZSPA 3HPLC 1YDXA 1OV9A 2FB5A 3SPHA 2JGDB 2QE7G 2DQ3A 5KX5B 3RT3C 4GX2A 4NXNO 1RPOA 1GN3A 1ZLZA 2HVJC 4UCSA 3RYFB 1Y74A 1CEZA 3T1HO 1EBOA 4ZBMA 2Y69C 3ZN0A 3ETGA 1K9MW 2UXBO 3UQ8A 3U10A 1P4RA 2HP8A 2N05A 3VQVA 3W7UA 3OAAG 4E4EA 4MVUA 1RFYA 4QGPA 1Q7YW 3PJSK 3JAWA 4LF7B 2FMLA 4LCUC 4O2AA 4P9PA 1HR0O 2LJ2A 5IJ0B 1QLEC 3K58A 1O9HA 1L0NH 4BIOA 1MG1A 1ZWIC 1NS1A 5IWAO 3P30A 3CRAA 1ZX3A 3STLC 1HDJA 4WFAV 4NB5A 2Q7HA 4KP4A 1XMOB 3T4ZA 1GAXA 2OCHA 1HNZO 2CDYA 1XL4A 4B3TB 1YITV 3UO3A 2FL4A 4DR7O 4BAYA 4H0LB 2Y0IA 1K7DA 3HKDA 2L6LA 1KD1W 5LMNO 4FLXA 2CH7B 2E75B 2Y69B 5CMUA 5LA6A 4FLVA 3CSXA 3OR7C 1GK9A 1KKCA 4RWUA 2ZM6B 4GX0A 1XNQB 3DC5A 2UXXA 1R6NA 4J80A 4N21A 1N0NA 3THOA 2EIMC 4WFHA 2EX3A 5FLXN 4PDVA 1ZL8A 5EIBD 4MVMA 2ZD9A 3QO5A 1Q8IA 1AVMA 1Y76B 2Q4PA 4LFAB 1VIBA 1FD9A 1AJNA 4HNAB 4MVRA 4LF4B 4DV2B 1FFXA 4PD4F 1FFTB 3JALB 4DW1A 3WG7C 3IAYA 3G80A 5KMGA 4ZI7B 1NTZH 3IC7A 1V55C 2X6CA 3H1KH 2YSUB 2DW4A 1V9PA 4FLZA 2RJZA 1MSDA 1R3JC 3ASOC 2RMKB 3CJHA 1JOYA 1GO3F 4YHHB 4FLUA 1WB8A 4N23A 3STZC 1JVMA 4FVMA 3U11A 3LSQA 3J81N 1Z5VA 2UUAB 2EIMB 1YIJV 1SETA 3RYIB 4MT8A 4NVPA 3ZHSA 5BZBA 2R9IA 4F6RB 2HEPA 2QM8A 5J2UB 4JV5O 5IJ9B 4XDLA 1V54C 1HNXO 1JFFB 4FZ1A 3OTOO 2HG5C 4ASUG 4FM2A 3CC4V 2EZOA 4LF6O 1AROP 3F7YC 4QE9A 3LNMB 1E1QG 1G6UA 3WG7B 4PV1B 4B3RO 4EB6B 2HLDG 4J9ZB 3N2KB 4FLYA 3B77A 1V55B 3SJCC 2QTOA 3CEIA 1TUBB 4TV9A 1XILA 5LGUA 2KB1A 2K9PA 3A0BZ 4I0XA 2BE3A 4DK1A 4LP8A 1PNMA 2WA4A 2ZQMA 1ZUQA 1P49A 2P5OA 3FFQA 3ZMUA 4DV0B 1DF4A 5EC2C 1N33B 2A9HA 3GB7C 2DYSC 3OE7G 2UUBO 4G27B 4RAIA 3A0RA 4UV9A 3L74H 3AK1A 4CC6A 2F4VO 4DUZO 4K8XA 2JS3A 1N8RW 2CTPA 1K8AW 4FMTA 1V54B 1JJOA 1F4MA 1I94B 4UCUA 4JI7O 4YJ2B 5KHIA 1IBKO 1PL4A 2YIBD 2XAGA 2YICA 1KECA 4UV8A 3RYCB 2ZE7A 4Z2WA 3H1IH 2JGUA 5IJ0A 4J9YB 4KXRA 3OMNB 1TVKA 2BTQA 4R6ZA 4WBNB 2NR5A 3E86A 4X1YB 2EILC 4PA4A 2IM9A 3W7SA 4H44B 2C2AA 4FJCC 2P67A 3K57A 5JQGB 1XI1A 2LO1A 2GUZA 4IIJA 1SQPH 2AHYA 4O2BA 5LP6A 5IYZB 4DV4O 2PYLA 1AR5A 1A32A 4GKJO 2WPDG 1EN4A 3K0DA 3W7WA 4UXNA 3JSNA 3BFRA 3FD9A 3JARB 3L75H 3DXRB 4K0KB 4MS2A 3TCUA 1QR8A 4DXWA 2VWKA 3NXSA 1XBLA 1NBMG 2P4KA 4O4LB 1WAZA 5JJEB 3TETA 4DUYB 1CPYA 1KP2A 5KUKA 1H2LA 3FB6C 5H6RA 5CA3A 3ABKB 2EILB 3B2EE 3SYQA 4TQFA 5B1BC 2XT9A 1KBHA 4X9QA 4DV5B 2HJFC 3IC9A 4ICGA 5BY1A 4B08A 4B3MO 3CXHF 4MSWC 1EFRG 3FAVB 3CCLV 5KHHA 2EINC 2Y48A 4YXWG 3LUTB 4KHPB 3R66A 4PJ0Z 2W6JG 1NJIW 1S72V 4DRXA 2F95B 2ITDC 5LMUO 3CC2V 3X2QC 5B3SC 2R72A 4JTCB 1OJHA 4UVCA 2QKSA 1Y74B 1SZXA 1MOFA 4JI5B 3UCSC 1FKAO 2V1DA 3WU2Z 4F4LA 3KZIZ 4X8AA 3CRMA 1AJPA 3LSUA 2DWDC 4GX1A 3H01A 2F43G 5IDJA 3BRCA 2VQEB 3HKCA 3ZX6A 4YY3O 1W0JG 4ZOLA 3JAWB 1Y66A 3IGAC 4O2AB 4DV6O 3RWRD 4GT1A 1IBMB 1FXHA 3ZEDA 1RSOA 4OPAA 4UB6Z 4DR3B 1BMFG 4BIZA 4JF3A 2EINB 1MA1A 1EZJA 2QKCA 4QPJA 3K04A 2V4DA 5CA0A 1JX9A 3OD4A 1IBLB 5KA5A 2GSMB 4KL1A 1YTFD 1Q6HA 2Z0AA 3OMIB 3X2QB 1BCCH 1NH2B 1WA8A 2WLJA 2PZSA 4LNUA 3HKDB 2OCCC 4BR6A 4AQYO 4GKKB 2YC0A 3OM3B 1Q6UA 1I5XA 5LA6B 2WLHA 2QKAA 3E83A 4XDKA 1SRYA 2K1EA 2PUSA 1J95A 2XHBA 1TA8A 1YJWV 3K79A 2UU9O 3A0HZ 3H9VA 1RPRA 3B40A 4QPKA 1VF5B 1KB9F 2KKWA 1ZL8B 1GM9A 4DV3O 4LF5O 4JPRA 1IVSA 5DEDA 4I50A 4BWAA 4CS2A 4BIUA 3ZRVA 2XAHA 3MHSC 4E2LA 4JI3B 4JYAB 3RBZA 4LWSA 1FFXB 3EFFK 2EIJC 3CRQA 4X64O 4DR5B 2E5LO 1R1BA 5KMGB 2ZR3A 1VQKV 1VQ5V 3R65A 5JWPA 1N34B 3OTFA 2A06H 4D6TH 4X62O 1FPOA 3B4SA 4J7KA 2WLNA 3CJHB 3JSLA 4JAAA 1P7GA 4L87A 2LGWA 4GYCB 3ETQA 3OW2U 2P06A 1VQMV 4EEQA 4DV1O 3ICXA 4K35A 5IT9N 1HWYA 1IZ3A 2Z5UA 2LQTA 3LNNA 3W7XA 2OTLV 5FL7G 3M8AA 1H2NA 1D5NA 1CXZB 3E89A 2BTOA 1M1KW 1VF6A 4FM0A 2H94A 3E35A 3VQYA 1NTKH 2W6IG 5B1NA 3ZMTA 2EIJB 3ZMVA 1J5EO 1M93A 1X4TA 1Y6XA 2WLLA 1K3EA 3JASA 4G28B 4TV9B 4LFBO 4I0XB 4UUJC 4UCOA 3SYCA 1PNLA 1K34A 1XMOO 4PA3A 4LF8B 2OT5A 1R3IC 1AR1B 4HBNA 4JASA 3LDCA 1NVPB 5FNVA 1IXMA 1NKDA 3K0GA 5BMVA 5LP6C 4K8ZA 4TWKA 2FKXA 1XMQO 4DR2B 3FYEB 3ZHVA 2CGNA 1XHZA 3SJBC 2ZXWC 1XNRB 4FPPA 3GWOA 1URFA 3CCUV 1WPBA 4JTDB 4RQEA 4WCEV 3I56V 3ZRXA 4F6EA 2EJRA 1TVKB 4MW8A 2BTQB 3D8CA 3N2GA 5EC1C 3RW0A 3P32A 3ZS8C 1VP7A 1N32B 1KQSU 1H38A 5LYJA 4YJ3A 1FJGO 3S3WA 2XNDG 3AG2C 4C7UA 2DYRC 3JYCA 5KUMA 4O4HA 2CTQA 1D2DA 4UCVA 2GUZB 1VQ9V 2YIDA 1S5JA 4IIJB 3HKBA 1YXBA 4O2BB 1QCEA 4JZ2A 3LSSA 3CCEV 5LP6B 2VQFO 5LL6Y 3ABTA 1SQGA 5EZYB 4OXSA 4MTXA 2ZR2A 4YHHO 1M4UA 2HKOA 5LBQA 2ZXWB 5GTIZ 4CH3A 1KKDA 3T1HB 1VQ7V 3HR0A 3JCZA 4JI4O 3VBBA 1PPJH 1I5YA 2X6AA 5BR8O 1Q6IA 4I5SA 1QLEB 2UXBB 4U3JA 3CMAV 3CX5F 1PM9A 1S76D 4CC5A 2X6BA 1YEWA 1YF2A 2P6JA 1PKXA 3MD0A 1GMGA 1M56C 1XEQA 2YUAA 4NXMO 4Z1MG 1VMGA 5IWAB 1B6QA 1DLBA 1HP8A 2LW7A 4OPHA 3BEHA 4DRXB 4DO2A 4DR4O 5JJNB 4W4LA 4WFEA 1ZTEA 1SZTA 1HNZB 1BS3A 5IYDO 4PDLA 3SYOA 4AILC 1NR1A 4EKWA 4DR7B 1WP8A 4DV0O 4JI1O 1Q3EA 2HFEC 4LF9O 2E76B 5LMNB 2UUCO 2DOSA 1U96A 2XOKG 3BHPA 2WLKA 1Z5WA 5CBFA 3HKCB 3VQWA 1H2SB 4O4IA 3CRRA 4ZOLB 4X1IA 2YDEA 1DGSA 3L73H 1BT8A 1NQTA 2RN9A 4WF9V 3UKMA 1XL6A 4X1KA 2GDSA 4JI6O 1F23A 1RSOB 3J80N 3G4SV 3SGIA 1QLNA 1FS0G 5J2TA 4DK0A 3RN4A 4UFZA 1EN6A 3LDEA 2NLJC 4IHJA 1S5LZ 1XOUA 3P3NA 3ASOB 1K73W 5CA0B 2RDCA 3T1YO 2UXCO 3QTCA 5E79Z 4JI8O 3ZRWA 1WA8B 2BSKA 3UT5B 1PNKA 1W59A 4LNUB 4ABMA 4CH4A 1SKVA 2UXDO 1MSWD 2N74A 1OCCC 1VARA 2P4VA 2M6YA 1PV0A 1GRJA 1EZVH 2WA3A 2YI9A 3VQXA 2HR3A 3F7VC 5BXZA 3CPWU 2OTJV 1TUEB 1SF9A 4IYIA 2QEXV 1VQPV 1GM7A 4U7NA 1YJNV 2KG7A 1PP9H 4WFGA 2DQ0A 2JEXA 1M9NA 4MVSA 1N36O 1FXKC 4U7OA 2X7RB 4P30A 2QM4A 3SR2C 2NNUA 4I50B 3E2EA 1YCIA 2JJ1G 4GX5A 3RFRA 3K9AA 4PA7A 5JH7A 4JV5B 1VF6C 3ZJZA 1HNXB 1XUQA 4X20A 3APOA 3OTOB 2QR4A 4RO2A 3SPGA 4LWSB 4LF6B 1AI5A 2XUMA 5IYCO 3LDDA 2OYQA 2LP7A 1SA0A 1BHBA 1OCOC 4MVOA 4B3RB 3CWBH 3ZBHA 3KCYA 5L3EA 1HNWB 4DR6O 3B8NA 2DYSB 2Q7EA 2Q6AA 3EHBB 3FKSG 3VOUA 4MW3A 5CB4A 4GUNA 4PA6A 5EZYA 5L3CA 4QE7A 4DR1O 1MZEA 3C90A 3L70H 4B3SB 1VQ8V 1JR9A 3JCUZ 1Z2GA 3CCVV 3OEEG 2IJKA 2UUBB 3T1CA 4BW9A 5L3BA 3RGBA 4EFEA 2QSAA 5B1AC 4X89A 3ZMZA 2F4VB 2P22C 4DUZB 2DN9A 1F4NA 1MNGA 3CRCA 3BAAA 5F2VO 5K1XA 4JI7B 1IBKB 1RM1C 5C8YA 2QDOA 4X65O 1GKFA 3A2FA 2JRIA 1VF7A 3AK3A 1YI2V 3QVNA 4IYHA 4LBEC 2NN4A 2Q67A 1L0LH 2AHZA 2WLLB 3H1JH 1X59A 5H5NA 3JASB 1NH2D 4XBFA 2IBZH 4H33A 4O4JA 3U0ZA 4AHCA 2V7QG 2ATKC 4DV7O 2ADPA 1KP3A 1SQFA 4HYOA 1PL0A 3CMEV 2BOBC 1E79G 3BA9A 5KAIZ 1H8EG 5J9PC 1JQ0A 3OMAB 4PELA 5FNVB 2Q68A 3UO2A 4PHZA 5LHHA 4JI2O 1B06A 5BMVB 4I7ZB 2AZ2A 3E8HA 1XREA 3G67A 1VEWA 4DV4B 4GKJB 3O9OA 1SQXH 3P3PA 1DF5A 1K33A 5LXTA 1QHTA 1P7BA 5B1BB 4PI0A 1RM1B 2VRZA 3F5WC 1H2GA 1EM1A 3D3QA 4GLXA 1AI7A 2YXYA 3AG3C 2ETNA 3SDLA 4OX9O 3N2GB 3DSQA 5CN0A 5H2FZ 4PDRA 2PGGA 2ZT9B 5HFLA 3SJQC 3C3TA 1WJZA 1LR1A 1N4CA 4NTYA 3D36A 5LYJB 4YJ3B 2WAMA 3MAQA 1Q82W 3DTUB 4B3MB 4UCRA 4DR5O 5EBMC 1WNSA 2ADQB 5B3SB 1KU9A 4O4HB 3OR6C 1JJ2U 1FXVA 1YSCA 3UT5A 2JJ2G 2WSSG 3HKBB 3AG1C 5EYPA 1D5AA 1SC5B 2BCCH 3ETEA 1TGOA 1SERA 1VQ6V 4MTGA 5LMUB 3Q4HA 1H2MA 5EBWC 4CS4A 4X66O 4I9QA 3ABLC 3K5OA 4TUYA 4H37A 3AG3B 1QNMA 4U3JB 3CCQV 5K1PA 2H3OA 2XAFA 4YY3B 1R3LC 2IJIA 3TXQA 4FFKA 1L1FA 1K4DC 5CA1A 2HVKC 2PYJA 2E3CA 5KLVH 4JAVA 1MZFA 1AI4A 2QGNA 5AG2A 3AG1B 2OCCB 1E1RG 4LFCO 5JVDB 1NVPD 3G71V 4RQFA 3ZHRA 3K9SA 2M7WA 1KYOF 4JAUA 3AG4C 2Y4UA 4KFMA 4WFFA 2HHHB 3ABLB 5EBLC 4AQYB 1VQ4V 1GTOA 3K59A 2AW9A 1FXKA 4HZ3A 2A79B 4JI0B 3J7AU 1W0KG 2MW2B 4NTWA 1AB3A 4B7KA 4IL6Z 4NKGB 4O4IB 4X1IB 1XHXA 2B5UA 2DJVA 2UU9B 2IJJA 4TQDA 4HAMA 1BGYH 4LF7O 2Y4TA 4OGQB 1M90W 2AZ0A 1M5IA 3T4DA 3ZN1A 2YEVA 3FB5C 4X1KB 3QO7A 4LF5B 2EJ7A 5B1OA 4CZZA 3AK2A 2JK5C 5J2TB 4RUFA 1QR9A 3H1HH 1ZAUA 2WLIA 4LH7A 4IHJB 2LFRA 2XTAA 4U3FH 5E1AC 5LGNA 1G8MA 2YIBA 4KUMA 3SPJA 3T2MA 4X64B 5LGTA 2EULA 2E5LB 2CUGA 3HKEA 3ZRWB 3K3WA 3I5DA 1B04A 2BSKB 4B3TO 2JS5A 5KHGA 3ZCCA 3JATA 3FB8C 2ZIMA 2QWQB 5KA6A 4X62B 1UJWB 3TGUH 1NZ6A 1OZ0A 1S0VA 4J10A 4CH6A 3E8GA 2ZM6O 3K5NA 1XNQO 2P90A 3JD0A 2KG7B 1S3JA 2JIZG 3MHHC 4DV1B 1RP3B 1NR7A 5DM6V 2Q5ZA 2IU3A 1AI6A 3QG5A 2QWOB 2UXNA 5JH7B 1GN6A 4JYCA 4YIOA 3K5LA 1I0HA 3OFNG 3EVKA 4MVQA 4X20B 5GONA 3RVZA 1P84F 4LFAO 2X0LA 3CE2A 4LF4O 4YIPA 4Q6GA 5TISZ 4DV2O 1SA0B 3ZHTA 1J5EB 1K5QA 1FAFA 2HJDA 3BY6A 1DTOA 4K3AA 1ORQC 4PI2A 1QQCA 3JD2A 4MVZA 3NR7A 1AR4A 4L8JA 4LFBB 3K08A 4B7EA 2JVDA 3QO8A 2R9AA 1SQQH 5CB4B 3CCRV 3AEIA 1NTMH 3JAKA 4RUEA 4NXNB 3ETDA 4TV8A 4UVAA 2WLMA 2RQ6A 5LHIA 2D2CB 3ABMC 1CP9A 2UUAO 4PDMA 5H9CA 3C3SA 3IFXA 2ODMA 3JD3A 3E22A 1XMQB 4A5UB 5LOVA 2GV9A 5D5PA 2VS0A 5GW7A 2IJHA 2B1GA 1IX9A 3W7TA 1WPXA 4PA9A 5JCOA 5C8YB 4MTOA 2XAQA 3CD6V 2Q7GA 5KHJA 2CTWA 1HR0B 1AILA 1Q81W 1PD3A 3AG2B 2G38A 4CS3A 3OGCC 4NTXA 2DYRB 3MDSA 3ABUA 1WN7A 4O4JB 3G6BA 1ENVA 3HB3B 1KMIZ 3D36C 2IW5A 5JVDA 2YIAA 1FJGB 5EIBC 2QWNB 2F23A 2RNBA 3JAMN 2ITCC 5ITZA 4TT3G 2LW1A 3ABMB 1R3KC 5L3DA 5KHKA 1WP7A 3SYPA 2XASA 1N33O 3CB2A 1LUVA 3ZRSA 3FB7C 4J7ZA 2ARHA 1O9GA 4I9WA 2VQFB 4CH5A 1OCRC 3OGIB 1COWG 1US6A 3OUFA 4JYYA 5LXTB 5EK0A 1GN4A 4FFBA 3RYHA 1I94O 1WB7A 5DN6G 4JI4B 2LFSA 1G1XB 5BR8B 1M56B 4DYLA 4ZHQA 2VWJA 1TAEA 2Q8VA 2CE4A 2YS8A 2KSDA
chains in the Genus database with same CATH topology
4J80A 1IURA 1FAFA 2GUZA 2QWNB 2CTWA 1FPOA 3UO3A 2KQXA 2CTQA 3UCSC 1BQZA 3AG7A 1BQ0A 2QWOB 2QWQB 2GUZB 2QSAA 2CTPA 2L6LA 3APOA 3BVOA 2LGWA 3UO2A 2YUAA 2DN9A 1NZ6A 1GH6A 2N05A 2Y4UA 2QWRB 3APQA 2Y4TA 1HDJA 2CUGA 2N04A 2YS8A 4J7ZA 2LO1A 4RWUA 2CTRA 2DMXA 2PF4E 2QWPB 1WJZA 1XBLA 2OCHA 2M6YA 1N4CA 4IT5A 2EJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J80 A;  1IUR A;  1FAF A;  2GUZ A;  2QWN B;  2CTW A;  1FPO A;  3UO3 A;  2KQX A;  2CTQ A;  3UCS C;  1BQZ A;  3AG7 A;  1BQ0 A;  2QWO B;  2QWQ B;  2GUZ B;  2QSA A;  2CTP A;  2L6L A;  3APO A;  3BVO A;  2LGW A;  3UO2 A;  2YUA A;  2DN9 A;  1NZ6 A;  1GH6 A;  2N05 A;  2Y4U A;  2QWR B;  3APQ A;  2Y4T A;  1HDJ A;  2CUG A;  2N04 A;  2YS8 A;  4J7Z A;  2LO1 A;  4RWU A;  2CTR A;  2DMX A;  2PF4 E;  2QWP B;  1WJZ A;  1XBL A;  2OCH A;  2M6Y A;  1N4C A;  4IT5 A;  2EJ7 A; 
#chains in the Genus database with same CATH topology
 1GN2 A;  3FX7 A;  1YJ9 V;  1IDS A;  4DW0 A;  1L8D A;  4R8C A;  3SPI A;  4NR1 A;  2ZDI C;  2H8P C;  2ZE6 A;  1H8H G;  4I55 A;  2ZIO A;  1SES A;  4I4T A;  4UCT A;  4JYB A;  1JA8 A;  3CP1 A;  4Q20 A;  2B9Z A;  2OIE A;  4X88 A;  4NXM B;  3ML0 A;  2B1I A;  2MK3 A;  1ROP A;  2ZE5 A;  2F93 B;  1HNW O;  1VQN V;  5EYP B;  3M7M X;  3CCM V;  3L72 H;  1F7Y A;  1OCR B;  4DR4 B;  4ZIB A;  1KC8 W;  4MTF A;  3Q4H B;  2JGD A;  2ZCE A;  2WWW A;  3ASN C;  5KX5 A;  4K0K O;  4B3S O;  1R73 A;  4FK5 C;  3ZHU A;  3RYF A;  4JI1 B;  4TUY B;  3B09 A;  4LF9 B;  1AJQ A;  3M99 B;  2DMX A;  2UUC B;  2ZKO A;  1B3Q A;  4QNH B;  4DUY O;  2YXL A;  3PN1 A;  1U97 A;  5IY5 C;  5B5E Z;  4DV5 O;  3APQ A;  2EBO A;  3QF7 A;  4J11 A;  5CA1 B;  3DC6 A;  2PF4 E;  1S77 D;  4JI6 B;  3I55 V;  3K5M A;  1IXB A;  1SQV H;  4H13 B;  2OWO A;  4R7C A;  1OCC B;  3ABK C;  3CCS V;  3D3I A;  4TOI A;  2AXT Z;  4KHP O;  3T1Y B;  2UXC B;  4JI8 B;  2JDI G;  3JD4 A;  2N04 A;  3ASN B;  4QIW F;  2W0X A;  2UXD B;  1HW7 A;  3FYI B;  2D3O W;  2CAZ C;  4JI5 O;  4R50 A;  1FXK B;  2CH7 A;  2GBO A;  3K03 A;  3KG2 A;  4FZ0 A;  2RCV A;  1K92 A;  2F1M A;  2W0F C;  3CC7 V;  5IY5 B;  2QJ1 A;  2VQE O;  1Y4M A;  2L35 A;  5D5Q A;  1K5S A;  1N36 B;  2YEV B;  5IE9 A;  2BOC C;  1DK1 A;  1OCO B;  1R6T A;  2P7T C;  1IBM O;  1BQ0 A;  3OT7 A;  4JTA B;  1S5H C;  4DR3 O;  2WLI B;  1XDC A;  2Z3Y A;  3UM7 A;  1Y76 A;  2CK3 G;  4D7T A;  2EZP A;  3SPC A;  1N0J A;  2R9R B;  3BPZ A;  4HNA A;  2CTR A;  2PI5 A;  1Q86 W;  1IBL O;  3ZIA G;  3CXC U;  3HKE B;  1MAB G;  3JAL A;  5HFM A;  2GTS A;  3B8M A;  4ZI7 A;  2AGA A;  4QJF B;  3H1L H;  3JAT B;  2Q69 A;  3L9D A;  2F66 C;  4DR6 B;  1UFI A;  4GKK O;  1YVW A;  1GH6 A;  5LHG A;  1MMM A;  3WB0 A;  3WFV A;  2QWR B;  2A7W A;  4CBC A;  4Z1V A;  3CS5 A;  1AP6 A;  5B1A B;  1I08 A;  2O57 A;  4DR1 B;  3JD1 A;  1QU7 A;  1QVF U;  5A2Q N;  4G2K A;  3QNE A;  2QTS A;  5CBH A;  4EFB A;  3RYI A;  1QVG U;  1LUW A;  4JZG A;  4BW5 A;  5FPR A;  1Y67 A;  3A8T A;  1H2K A;  4F6R A;  1KUQ A;  4FLW A;  1GM8 A;  1M57 C;  2ZE8 A;  4LC1 A;  3DGE A;  5J2U A;  5IJ9 A;  2LGQ A;  5GON B;  5JCO C;  5CBG A;  1JFF A;  4IT5 A;  3GWK C;  3L71 H;  5L3F A;  2JEU A;  3F5T A;  4X65 B;  4JI3 O;  1IUR A;  1BZK A;  4JYA O;  2KQX A;  3TXS A;  1Q90 D;  1BSM A;  4EB6 A;  1THZ A;  3GVM A;  3N2K A;  2Q9L A;  3TK1 A;  4UVB A;  1N34 O;  1TUB A;  1OCZ C;  3N27 A;  2PTM A;  4DV7 B;  3E8F A;  2QWP B;  5KAF Z;  1K4C C;  2ZIN A;  5FPO A;  4W4K A;  3ZHQ A;  1R6K A;  2DE0 X;  5H6Q A;  3JAK B;  2IU0 A;  1NI8 A;  3WB1 A;  4TV8 B;  1G4Y B;  3BVO A;  4GCZ A;  2ILM A;  1LNQ A;  4TSF G;  2HHH O;  1EN5 A;  3OUS A;  3OEH G;  1JPX A;  1UPG A;  2PY5 A;  4JI2 B;  4JI0 O;  3KCX A;  1VQO V;  3E22 B;  1W2B U;  5LOV B;  4JGS A;  1BQZ A;  1M57 B;  3O65 A;  2QM7 A;  3CCJ V;  2ZDI A;  4YJ2 A;  2A3Q A;  4DV6 B;  2EIK C;  1QBZ A;  2Q0O C;  1YHQ V;  2Q0A A;  1F51 A;  1BL8 A;  4ZKI A;  3SJA C;  3K06 A;  3RYC A;  4J7J A;  4OX9 B;  3RVY A;  3S3X A;  4J41 A;  3BAB A;  4WBN A;  2XAJ A;  4XDJ A;  1JMK C;  1AP5 A;  3BA8 A;  3KKY A;  4X1Y A;  1OCZ B;  3E8B A;  4FM1 A;  4D7S A;  2PI4 A;  1OHH G;  4IGG A;  2Q73 A;  4NYK A;  2QA4 V;  2GTA A;  4LH6 A;  5JQG A;  3ZMS A;  4LF8 O;  2R70 A;  1JCH A;  4LR3 A;  5C93 A;  5ITZ B;  3CYO A;  3BCC H;  1YZB A;  2GHY A;  2IH1 C;  3WB2 A;  3EXA A;  4GZR B;  2A0L A;  3CHX A;  5L3G A;  1YTF B;  1NT2 B;  3SYA A;  5A9G A;  1SS3 A;  5B66 Z;  5IYZ A;  4DR2 O;  3AG7 A;  1XQ8 A;  2Y0P A;  1VQL V;  5DEC A;  5GTH Z;  1T5E A;  3JAR A;  4X66 B;  3DXR A;  4FFB B;  3RYH B;  4AI8 A;  1XNR O;  1SQB H;  1K97 A;  2EIK B;  1NU1 H;  4O4L A;  3G6E V;  4P2Z A;  4DV3 B;  4ZHQ B;  2OIG A;  3IJ4 A;  2ZNJ A;  2DWE C;  2IH3 C;  1WLE A;  2CGO A;  1N32 O;  4I55 B;  2YXH A;  4WFB V;  1FYJ A;  4I4T B;  2FYU H;  1Q43 A;  2FTK A;  4J42 A;  2E74 B;  4FIP C;  2YI8 A;  1Q5O A;  4UB8 Z;  1BHA A;  4FLT A;  3TJT A;  1I7F A;  3AG4 B;  3FAV A;  5JJJ B;  1BE3 H;  2ZNI A;  4P9O A;  5IYB O;  4LFC B;  1ZSP A;  3HPL C;  1YDX A;  1OV9 A;  2FB5 A;  3SPH A;  2JGD B;  2QE7 G;  2DQ3 A;  5KX5 B;  3RT3 C;  4GX2 A;  4NXN O;  1RPO A;  1GN3 A;  1ZLZ A;  2HVJ C;  4UCS A;  3RYF B;  1Y74 A;  1CEZ A;  3T1H O;  1EBO A;  4ZBM A;  2Y69 C;  3ZN0 A;  3ETG A;  1K9M W;  2UXB O;  3UQ8 A;  3U10 A;  1P4R A;  2HP8 A;  2N05 A;  3VQV A;  3W7U A;  3OAA G;  4E4E A;  4MVU A;  1RFY A;  4QGP A;  1Q7Y W;  3PJS K;  3JAW A;  4LF7 B;  2FML A;  4LCU C;  4O2A A;  4P9P A;  1HR0 O;  2LJ2 A;  5IJ0 B;  1QLE C;  3K58 A;  1O9H A;  1L0N H;  4BIO A;  1MG1 A;  1ZWI C;  1NS1 A;  5IWA O;  3P30 A;  3CRA A;  1ZX3 A;  3STL C;  1HDJ A;  4WFA V;  4NB5 A;  2Q7H A;  4KP4 A;  1XMO B;  3T4Z A;  1GAX A;  2OCH A;  1HNZ O;  2CDY A;  1XL4 A;  4B3T B;  1YIT V;  3UO3 A;  2FL4 A;  4DR7 O;  4BAY A;  4H0L B;  2Y0I A;  1K7D A;  3HKD A;  2L6L A;  1KD1 W;  5LMN O;  4FLX A;  2CH7 B;  2E75 B;  2Y69 B;  5CMU A;  5LA6 A;  4FLV A;  3CSX A;  3OR7 C;  1GK9 A;  1KKC A;  4RWU A;  2ZM6 B;  4GX0 A;  1XNQ B;  3DC5 A;  2UXX A;  1R6N A;  4J80 A;  4N21 A;  1N0N A;  3THO A;  2EIM C;  4WFH A;  2EX3 A;  5FLX N;  4PDV A;  1ZL8 A;  5EIB D;  4MVM A;  2ZD9 A;  3QO5 A;  1Q8I A;  1AVM A;  1Y76 B;  2Q4P A;  4LFA B;  1VIB A;  1FD9 A;  1AJN A;  4HNA B;  4MVR A;  4LF4 B;  4DV2 B;  1FFX A;  4PD4 F;  1FFT B;  3JAL B;  4DW1 A;  3WG7 C;  3IAY A;  3G80 A;  5KMG A;  4ZI7 B;  1NTZ H;  3IC7 A;  1V55 C;  2X6C A;  3H1K H;  2YSU B;  2DW4 A;  1V9P A;  4FLZ A;  2RJZ A;  1MSD A;  1R3J C;  3ASO C;  2RMK B;  3CJH A;  1JOY A;  1GO3 F;  4YHH B;  4FLU A;  1WB8 A;  4N23 A;  3STZ C;  1JVM A;  4FVM A;  3U11 A;  3LSQ A;  3J81 N;  1Z5V A;  2UUA B;  2EIM B;  1YIJ V;  1SET A;  3RYI B;  4MT8 A;  4NVP A;  3ZHS A;  5BZB A;  2R9I A;  4F6R B;  2HEP A;  2QM8 A;  5J2U B;  4JV5 O;  5IJ9 B;  4XDL A;  1V54 C;  1HNX O;  1JFF B;  4FZ1 A;  3OTO O;  2HG5 C;  4ASU G;  4FM2 A;  3CC4 V;  2EZO A;  4LF6 O;  1ARO P;  3F7Y C;  4QE9 A;  3LNM B;  1E1Q G;  1G6U A;  3WG7 B;  4PV1 B;  4B3R O;  4EB6 B;  2HLD G;  4J9Z B;  3N2K B;  4FLY A;  3B77 A;  1V55 B;  3SJC C;  2QTO A;  3CEI A;  1TUB B;  4TV9 A;  1XIL A;  5LGU A;  2KB1 A;  2K9P A;  3A0B Z;  4I0X A;  2BE3 A;  4DK1 A;  4LP8 A;  1PNM A;  2WA4 A;  2ZQM A;  1ZUQ A;  1P49 A;  2P5O A;  3FFQ A;  3ZMU A;  4DV0 B;  1DF4 A;  5EC2 C;  1N33 B;  2A9H A;  3GB7 C;  2DYS C;  3OE7 G;  2UUB O;  4G27 B;  4RAI A;  3A0R A;  4UV9 A;  3L74 H;  3AK1 A;  4CC6 A;  2F4V O;  4DUZ O;  4K8X A;  2JS3 A;  1N8R W;  2CTP A;  1K8A W;  4FMT A;  1V54 B;  1JJO A;  1F4M A;  1I94 B;  4UCU A;  4JI7 O;  4YJ2 B;  5KHI A;  1IBK O;  1PL4 A;  2YIB D;  2XAG A;  2YIC A;  1KEC A;  4UV8 A;  3RYC B;  2ZE7 A;  4Z2W A;  3H1I H;  2JGU A;  5IJ0 A;  4J9Y B;  4KXR A;  3OMN B;  1TVK A;  2BTQ A;  4R6Z A;  4WBN B;  2NR5 A;  3E86 A;  4X1Y B;  2EIL C;  4PA4 A;  2IM9 A;  3W7S A;  4H44 B;  2C2A A;  4FJC C;  2P67 A;  3K57 A;  5JQG B;  1XI1 A;  2LO1 A;  2GUZ A;  4IIJ A;  1SQP H;  2AHY A;  4O2B A;  5LP6 A;  5IYZ B;  4DV4 O;  2PYL A;  1AR5 A;  1A32 A;  4GKJ O;  2WPD G;  1EN4 A;  3K0D A;  3W7W A;  4UXN A;  3JSN A;  3BFR A;  3FD9 A;  3JAR B;  3L75 H;  3DXR B;  4K0K B;  4MS2 A;  3TCU A;  1QR8 A;  4DXW A;  2VWK A;  3NXS A;  1XBL A;  1NBM G;  2P4K A;  4O4L B;  1WAZ A;  5JJE B;  3TET A;  4DUY B;  1CPY A;  1KP2 A;  5KUK A;  1H2L A;  3FB6 C;  5H6R A;  5CA3 A;  3ABK B;  2EIL B;  3B2E E;  3SYQ A;  4TQF A;  5B1B C;  2XT9 A;  1KBH A;  4X9Q A;  4DV5 B;  2HJF C;  3IC9 A;  4ICG A;  5BY1 A;  4B08 A;  4B3M O;  3CXH F;  4MSW C;  1EFR G;  3FAV B;  3CCL V;  5KHH A;  2EIN C;  2Y48 A;  4YXW G;  3LUT B;  4KHP B;  3R66 A;  4PJ0 Z;  2W6J G;  1NJI W;  1S72 V;  4DRX A;  2F95 B;  2ITD C;  5LMU O;  3CC2 V;  3X2Q C;  5B3S C;  2R72 A;  4JTC B;  1OJH A;  4UVC A;  2QKS A;  1Y74 B;  1SZX A;  1MOF A;  4JI5 B;  3UCS C;  1FKA O;  2V1D A;  3WU2 Z;  4F4L A;  3KZI Z;  4X8A A;  3CRM A;  1AJP A;  3LSU A;  2DWD C;  4GX1 A;  3H01 A;  2F43 G;  5IDJ A;  3BRC A;  2VQE B;  3HKC A;  3ZX6 A;  4YY3 O;  1W0J G;  4ZOL A;  3JAW B;  1Y66 A;  3IGA C;  4O2A B;  4DV6 O;  3RWR D;  4GT1 A;  1IBM B;  1FXH A;  3ZED A;  1RSO A;  4OPA A;  4UB6 Z;  4DR3 B;  1BMF G;  4BIZ A;  4JF3 A;  2EIN B;  1MA1 A;  1EZJ A;  2QKC A;  4QPJ A;  3K04 A;  2V4D A;  5CA0 A;  1JX9 A;  3OD4 A;  1IBL B;  5KA5 A;  2GSM B;  4KL1 A;  1YTF D;  1Q6H A;  2Z0A A;  3OMI B;  3X2Q B;  1BCC H;  1NH2 B;  1WA8 A;  2WLJ A;  2PZS A;  4LNU A;  3HKD B;  2OCC C;  4BR6 A;  4AQY O;  4GKK B;  2YC0 A;  3OM3 B;  1Q6U A;  1I5X A;  5LA6 B;  2WLH A;  2QKA A;  3E83 A;  4XDK A;  1SRY A;  2K1E A;  2PUS A;  1J95 A;  2XHB A;  1TA8 A;  1YJW V;  3K79 A;  2UU9 O;  3A0H Z;  3H9V A;  1RPR A;  3B40 A;  4QPK A;  1VF5 B;  1KB9 F;  2KKW A;  1ZL8 B;  1GM9 A;  4DV3 O;  4LF5 O;  4JPR A;  1IVS A;  5DED A;  4I50 A;  4BWA A;  4CS2 A;  4BIU A;  3ZRV A;  2XAH A;  3MHS C;  4E2L A;  4JI3 B;  4JYA B;  3RBZ A;  4LWS A;  1FFX B;  3EFF K;  2EIJ C;  3CRQ A;  4X64 O;  4DR5 B;  2E5L O;  1R1B A;  5KMG B;  2ZR3 A;  1VQK V;  1VQ5 V;  3R65 A;  5JWP A;  1N34 B;  3OTF A;  2A06 H;  4D6T H;  4X62 O;  1FPO A;  3B4S A;  4J7K A;  2WLN A;  3CJH B;  3JSL A;  4JAA A;  1P7G A;  4L87 A;  2LGW A;  4GYC B;  3ETQ A;  3OW2 U;  2P06 A;  1VQM V;  4EEQ A;  4DV1 O;  3ICX A;  4K35 A;  5IT9 N;  1HWY A;  1IZ3 A;  2Z5U A;  2LQT A;  3LNN A;  3W7X A;  2OTL V;  5FL7 G;  3M8A A;  1H2N A;  1D5N A;  1CXZ B;  3E89 A;  2BTO A;  1M1K W;  1VF6 A;  4FM0 A;  2H94 A;  3E35 A;  3VQY A;  1NTK H;  2W6I G;  5B1N A;  3ZMT A;  2EIJ B;  3ZMV A;  1J5E O;  1M93 A;  1X4T A;  1Y6X A;  2WLL A;  1K3E A;  3JAS A;  4G28 B;  4TV9 B;  4LFB O;  4I0X B;  4UUJ C;  4UCO A;  3SYC A;  1PNL A;  1K34 A;  1XMO O;  4PA3 A;  4LF8 B;  2OT5 A;  1R3I C;  1AR1 B;  4HBN A;  4JAS A;  3LDC A;  1NVP B;  5FNV A;  1IXM A;  1NKD A;  3K0G A;  5BMV A;  5LP6 C;  4K8Z A;  4TWK A;  2FKX A;  1XMQ O;  4DR2 B;  3FYE B;  3ZHV A;  2CGN A;  1XHZ A;  3SJB C;  2ZXW C;  1XNR B;  4FPP A;  3GWO A;  1URF A;  3CCU V;  1WPB A;  4JTD B;  4RQE A;  4WCE V;  3I56 V;  3ZRX A;  4F6E A;  2EJR A;  1TVK B;  4MW8 A;  2BTQ B;  3D8C A;  3N2G A;  5EC1 C;  3RW0 A;  3P32 A;  3ZS8 C;  1VP7 A;  1N32 B;  1KQS U;  1H38 A;  5LYJ A;  4YJ3 A;  1FJG O;  3S3W A;  2XND G;  3AG2 C;  4C7U A;  2DYR C;  3JYC A;  5KUM A;  4O4H A;  2CTQ A;  1D2D A;  4UCV A;  2GUZ B;  1VQ9 V;  2YID A;  1S5J A;  4IIJ B;  3HKB A;  1YXB A;  4O2B B;  1QCE A;  4JZ2 A;  3LSS A;  3CCE V;  5LP6 B;  2VQF O;  5LL6 Y;  3ABT A;  1SQG A;  5EZY B;  4OXS A;  4MTX A;  2ZR2 A;  4YHH O;  1M4U A;  2HKO A;  5LBQ A;  2ZXW B;  5GTI Z;  4CH3 A;  1KKD A;  3T1H B;  1VQ7 V;  3HR0 A;  3JCZ A;  4JI4 O;  3VBB A;  1PPJ H;  1I5Y A;  2X6A A;  5BR8 O;  1Q6I A;  4I5S A;  1QLE B;  2UXB B;  4U3J A;  3CMA V;  3CX5 F;  1PM9 A;  1S76 D;  4CC5 A;  2X6B A;  1YEW A;  1YF2 A;  2P6J A;  1PKX A;  3MD0 A;  1GMG A;  1M56 C;  1XEQ A;  2YUA A;  4NXM O;  4Z1M G;  1VMG A;  5IWA B;  1B6Q A;  1DLB A;  1HP8 A;  2LW7 A;  4OPH A;  3BEH A;  4DRX B;  4DO2 A;  4DR4 O;  5JJN B;  4W4L A;  4WFE A;  1ZTE A;  1SZT A;  1HNZ B;  1BS3 A;  5IYD O;  4PDL A;  3SYO A;  4AIL C;  1NR1 A;  4EKW A;  4DR7 B;  1WP8 A;  4DV0 O;  4JI1 O;  1Q3E A;  2HFE C;  4LF9 O;  2E76 B;  5LMN B;  2UUC O;  2DOS A;  1U96 A;  2XOK G;  3BHP A;  2WLK A;  1Z5W A;  5CBF A;  3HKC B;  3VQW A;  1H2S B;  4O4I A;  3CRR A;  4ZOL B;  4X1I A;  2YDE A;  1DGS A;  3L73 H;  1BT8 A;  1NQT A;  2RN9 A;  4WF9 V;  3UKM A;  1XL6 A;  4X1K A;  2GDS A;  4JI6 O;  1F23 A;  1RSO B;  3J80 N;  3G4S V;  3SGI A;  1QLN A;  1FS0 G;  5J2T A;  4DK0 A;  3RN4 A;  4UFZ A;  1EN6 A;  3LDE A;  2NLJ C;  4IHJ A;  1S5L Z;  1XOU A;  3P3N A;  3ASO B;  1K73 W;  5CA0 B;  2RDC A;  3T1Y O;  2UXC O;  3QTC A;  5E79 Z;  4JI8 O;  3ZRW A;  1WA8 B;  2BSK A;  3UT5 B;  1PNK A;  1W59 A;  4LNU B;  4ABM A;  4CH4 A;  1SKV A;  2UXD O;  1MSW D;  2N74 A;  1OCC C;  1VAR A;  2P4V A;  2M6Y A;  1PV0 A;  1GRJ A;  1EZV H;  2WA3 A;  2YI9 A;  3VQX A;  2HR3 A;  3F7V C;  5BXZ A;  3CPW U;  2OTJ V;  1TUE B;  1SF9 A;  4IYI A;  2QEX V;  1VQP V;  1GM7 A;  4U7N A;  1YJN V;  2KG7 A;  1PP9 H;  4WFG A;  2DQ0 A;  2JEX A;  1M9N A;  4MVS A;  1N36 O;  1FXK C;  4U7O A;  2X7R B;  4P30 A;  2QM4 A;  3SR2 C;  2NNU A;  4I50 B;  3E2E A;  1YCI A;  2JJ1 G;  4GX5 A;  3RFR A;  3K9A A;  4PA7 A;  5JH7 A;  4JV5 B;  1VF6 C;  3ZJZ A;  1HNX B;  1XUQ A;  4X20 A;  3APO A;  3OTO B;  2QR4 A;  4RO2 A;  3SPG A;  4LWS B;  4LF6 B;  1AI5 A;  2XUM A;  5IYC O;  3LDD A;  2OYQ A;  2LP7 A;  1SA0 A;  1BHB A;  1OCO C;  4MVO A;  4B3R B;  3CWB H;  3ZBH A;  3KCY A;  5L3E A;  1HNW B;  4DR6 O;  3B8N A;  2DYS B;  2Q7E A;  2Q6A A;  3EHB B;  3FKS G;  3VOU A;  4MW3 A;  5CB4 A;  4GUN A;  4PA6 A;  5EZY A;  5L3C A;  4QE7 A;  4DR1 O;  1MZE A;  3C90 A;  3L70 H;  4B3S B;  1VQ8 V;  1JR9 A;  3JCU Z;  1Z2G A;  3CCV V;  3OEE G;  2IJK A;  2UUB B;  3T1C A;  4BW9 A;  5L3B A;  3RGB A;  4EFE A;  2QSA A;  5B1A C;  4X89 A;  3ZMZ A;  2F4V B;  2P22 C;  4DUZ B;  2DN9 A;  1F4N A;  1MNG A;  3CRC A;  3BAA A;  5F2V O;  5K1X A;  4JI7 B;  1IBK B;  1RM1 C;  5C8Y A;  2QDO A;  4X65 O;  1GKF A;  3A2F A;  2JRI A;  1VF7 A;  3AK3 A;  1YI2 V;  3QVN A;  4IYH A;  4LBE C;  2NN4 A;  2Q67 A;  1L0L H;  2AHZ A;  2WLL B;  3H1J H;  1X59 A;  5H5N A;  3JAS B;  1NH2 D;  4XBF A;  2IBZ H;  4H33 A;  4O4J A;  3U0Z A;  4AHC A;  2V7Q G;  2ATK C;  4DV7 O;  2ADP A;  1KP3 A;  1SQF A;  4HYO A;  1PL0 A;  3CME V;  2BOB C;  1E79 G;  3BA9 A;  5KAI Z;  1H8E G;  5J9P C;  1JQ0 A;  3OMA B;  4PEL A;  5FNV B;  2Q68 A;  3UO2 A;  4PHZ A;  5LHH A;  4JI2 O;  1B06 A;  5BMV B;  4I7Z B;  2AZ2 A;  3E8H A;  1XRE A;  3G67 A;  1VEW A;  4DV4 B;  4GKJ B;  3O9O A;  1SQX H;  3P3P A;  1DF5 A;  1K33 A;  5LXT A;  1QHT A;  1P7B A;  5B1B B;  4PI0 A;  1RM1 B;  2VRZ A;  3F5W C;  1H2G A;  1EM1 A;  3D3Q A;  4GLX A;  1AI7 A;  2YXY A;  3AG3 C;  2ETN A;  3SDL A;  4OX9 O;  3N2G B;  3DSQ A;  5CN0 A;  5H2F Z;  4PDR A;  2PGG A;  2ZT9 B;  5HFL A;  3SJQ C;  3C3T A;  1WJZ A;  1LR1 A;  1N4C A;  4NTY A;  3D36 A;  5LYJ B;  4YJ3 B;  2WAM A;  3MAQ A;  1Q82 W;  3DTU B;  4B3M B;  4UCR A;  4DR5 O;  5EBM C;  1WNS A;  2ADQ B;  5B3S B;  1KU9 A;  4O4H B;  3OR6 C;  1JJ2 U;  1FXV A;  1YSC A;  3UT5 A;  2JJ2 G;  2WSS G;  3HKB B;  3AG1 C;  5EYP A;  1D5A A;  1SC5 B;  2BCC H;  3ETE A;  1TGO A;  1SER A;  1VQ6 V;  4MTG A;  5LMU B;  3Q4H A;  1H2M A;  5EBW C;  4CS4 A;  4X66 O;  4I9Q A;  3ABL C;  3K5O A;  4TUY A;  4H37 A;  3AG3 B;  1QNM A;  4U3J B;  3CCQ V;  5K1P A;  2H3O A;  2XAF A;  4YY3 B;  1R3L C;  2IJI A;  3TXQ A;  4FFK A;  1L1F A;  1K4D C;  5CA1 A;  2HVK C;  2PYJ A;  2E3C A;  5KLV H;  4JAV A;  1MZF A;  1AI4 A;  2QGN A;  5AG2 A;  3AG1 B;  2OCC B;  1E1R G;  4LFC O;  5JVD B;  1NVP D;  3G71 V;  4RQF A;  3ZHR A;  3K9S A;  2M7W A;  1KYO F;  4JAU A;  3AG4 C;  2Y4U A;  4KFM A;  4WFF A;  2HHH B;  3ABL B;  5EBL C;  4AQY B;  1VQ4 V;  1GTO A;  3K59 A;  2AW9 A;  1FXK A;  4HZ3 A;  2A79 B;  4JI0 B;  3J7A U;  1W0K G;  2MW2 B;  4NTW A;  1AB3 A;  4B7K A;  4IL6 Z;  4NKG B;  4O4I B;  4X1I B;  1XHX A;  2B5U A;  2DJV A;  2UU9 B;  2IJJ A;  4TQD A;  4HAM A;  1BGY H;  4LF7 O;  2Y4T A;  4OGQ B;  1M90 W;  2AZ0 A;  1M5I A;  3T4D A;  3ZN1 A;  2YEV A;  3FB5 C;  4X1K B;  3QO7 A;  4LF5 B;  2EJ7 A;  5B1O A;  4CZZ A;  3AK2 A;  2JK5 C;  5J2T B;  4RUF A;  1QR9 A;  3H1H H;  1ZAU A;  2WLI A;  4LH7 A;  4IHJ B;  2LFR A;  2XTA A;  4U3F H;  5E1A C;  5LGN A;  1G8M A;  2YIB A;  4KUM A;  3SPJ A;  3T2M A;  4X64 B;  5LGT A;  2EUL A;  2E5L B;  2CUG A;  3HKE A;  3ZRW B;  3K3W A;  3I5D A;  1B04 A;  2BSK B;  4B3T O;  2JS5 A;  5KHG A;  3ZCC A;  3JAT A;  3FB8 C;  2ZIM A;  2QWQ B;  5KA6 A;  4X62 B;  1UJW B;  3TGU H;  1NZ6 A;  1OZ0 A;  1S0V A;  4J10 A;  4CH6 A;  3E8G A;  2ZM6 O;  3K5N A;  1XNQ O;  2P90 A;  3JD0 A;  2KG7 B;  1S3J A;  2JIZ G;  3MHH C;  4DV1 B;  1RP3 B;  1NR7 A;  5DM6 V;  2Q5Z A;  2IU3 A;  1AI6 A;  3QG5 A;  2QWO B;  2UXN A;  5JH7 B;  1GN6 A;  4JYC A;  4YIO A;  3K5L A;  1I0H A;  3OFN G;  3EVK A;  4MVQ A;  4X20 B;  5GON A;  3RVZ A;  1P84 F;  4LFA O;  2X0L A;  3CE2 A;  4LF4 O;  4YIP A;  4Q6G A;  5TIS Z;  4DV2 O;  1SA0 B;  3ZHT A;  1J5E B;  1K5Q A;  1FAF A;  2HJD A;  3BY6 A;  1DTO A;  4K3A A;  1ORQ C;  4PI2 A;  1QQC A;  3JD2 A;  4MVZ A;  3NR7 A;  1AR4 A;  4L8J A;  4LFB B;  3K08 A;  4B7E A;  2JVD A;  3QO8 A;  2R9A A;  1SQQ H;  5CB4 B;  3CCR V;  3AEI A;  1NTM H;  3JAK A;  4RUE A;  4NXN B;  3ETD A;  4TV8 A;  4UVA A;  2WLM A;  2RQ6 A;  5LHI A;  2D2C B;  3ABM C;  1CP9 A;  2UUA O;  4PDM A;  5H9C A;  3C3S A;  3IFX A;  2ODM A;  3JD3 A;  3E22 A;  1XMQ B;  4A5U B;  5LOV A;  2GV9 A;  5D5P A;  2VS0 A;  5GW7 A;  2IJH A;  2B1G A;  1IX9 A;  3W7T A;  1WPX A;  4PA9 A;  5JCO A;  5C8Y B;  4MTO A;  2XAQ A;  3CD6 V;  2Q7G A;  5KHJ A;  2CTW A;  1HR0 B;  1AIL A;  1Q81 W;  1PD3 A;  3AG2 B;  2G38 A;  4CS3 A;  3OGC C;  4NTX A;  2DYR B;  3MDS A;  3ABU A;  1WN7 A;  4O4J B;  3G6B A;  1ENV A;  3HB3 B;  1KMI Z;  3D36 C;  2IW5 A;  5JVD A;  2YIA A;  1FJG B;  5EIB C;  2QWN B;  2F23 A;  2RNB A;  3JAM N;  2ITC C;  5ITZ A;  4TT3 G;  2LW1 A;  3ABM B;  1R3K C;  5L3D A;  5KHK A;  1WP7 A;  3SYP A;  2XAS A;  1N33 O;  3CB2 A;  1LUV A;  3ZRS A;  3FB7 C;  4J7Z A;  2ARH A;  1O9G A;  4I9W A;  2VQF B;  4CH5 A;  1OCR C;  3OGI B;  1COW G;  1US6 A;  3OUF A;  4JYY A;  5LXT B;  5EK0 A;  1GN4 A;  4FFB A;  3RYH A;  1I94 O;  1WB7 A;  5DN6 G;  4JI4 B;  2LFS A;  1G1X B;  5BR8 B;  1M56 B;  4DYL A;  4ZHQ A;  2VWJ A;  1TAE A;  2Q8V A;  2CE4 A;  2YS8 A;  2KSD A; 
#chains in the Genus database with same CATH homology
 4J80 A;  1IUR A;  1FAF A;  2GUZ A;  2QWN B;  2CTW A;  1FPO A;  3UO3 A;  2KQX A;  2CTQ A;  3UCS C;  1BQZ A;  3AG7 A;  1BQ0 A;  2QWO B;  2QWQ B;  2GUZ B;  2QSA A;  2CTP A;  2L6L A;  3APO A;  3BVO A;  2LGW A;  3UO2 A;  2YUA A;  2DN9 A;  1NZ6 A;  1GH6 A;  2N05 A;  2Y4U A;  2QWR B;  3APQ A;  2Y4T A;  1HDJ A;  2CUG A;  2N04 A;  2YS8 A;  4J7Z A;  2LO1 A;  4RWU A;  2CTR A;  2DMX A;  2PF4 E;  2QWP B;  1WJZ A;  1XBL A;  2OCH A;  2M6Y A;  1N4C A;  4IT5 A;  2EJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...