1IURA

Dnaj domain of human kiaa0730 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
b'MHHHHHHLVPRGSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0730 protein
publication title Solution structure of DnaJ domain of human KIAA0730 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1iurA01
1N4CA 2QWOB 1XBLA 2GUZB 1HDJA 2KQXA 3UO2A 2CTQA 2DMXA 1IURA 4J7ZA 1FPOA 2QWQB 2YUAA 2CTPA 2LGWA 1BQ0A 2QWNB 1WJZA 2Y4UA 2Y4TA 2DN9A 2L6LA 4RWUA 1BQZA 2CTRA 2EJ7A 2QWRB 2CTWA 2YS8A 2N04A 3BVOA 2M6YA 2PF4E 1GH6A 2N05A 2CUGA 3UCSC 2QSAA 3UO3A 1NZ6A 2OCHA 2QWPB 2LO1A 3APQA 3APOA 3AG7A 2GUZA 4J80A 1FAFA 4IT5A
chains in the Genus database with same CATH superfamily
4DR5B 2DWDC 2DMXA 1AI5A 4JI7O 3I56V 3IC9A 3JYCA 3T4DA 3VQYA 1NTZH 4DV7O 1VF7A 1DTOA 1N0JA 1UPGA 2YXYA 3N2KA 3T2MA 3H1IH 4E4EA 4MVQA 2JGUA 4MW3A 1S5HC 4JI8B 2Y0PA 1B3QA 5KUMA 2EBOA 2F66C 3CMAV 5LP6A 4U3JA 1AJPA 5H9CA 5LBQA 2DQ3A 2CAZC 1VQ7V 4JV5B 3FB5C 1OCZC 4FM0A 3T1YO 1RPRA 1A32A 5J9PC 4KL1A 1AB3A 2H8PC 5LMNB 2F4VO 4IYHA 2JIZG 2Q7EA 1NTKH 1OV9A 2MK3A 2FYUH 2WLHA 3FAVA 1IVSA 1VMGA 4FLUA 4FLWA 2P6JA 1FFXB 3OUSA 5KHJA 3G80A 4FVMA 2QKSA 4NXNB 4JASA 1Y76A 4L8JA 3UT5B 3ABMC 4DR7O 3SR2C 3KKYA 3T1HB 1K4DC 4JPRA 4XDJA 3LDDA 1HDJA 4LF7B 1N36O 4X20A 4MTOA 2JJ2G 1LNQA 4HNAA 3K06A 3MAQA 2QWRB 3JARB 5K1XA 1K5SA 2XOKG 4QJFB 2PGGA 5IY5B 1AR4A 4PDMA 1PPJH 4DV5O 4QE9A 2Q9LA 4EFBA 4O2BA 3JALB 1V54B 4X1KB 3HPLC 5D5QA 3CB2A 1OCRC 2Q8VA 4MVSA 1N33O 1WLEA 1TUEB 2ETNA 2QKAA 3BCCH 2VS0A 1ZX3A 4W4LA 1EN6A 4PDVA 4BIOA 1YI2V 2NNUA 1N8RW 2PYLA 3ABKB 1OHHG 5FL7G 5FPRA 3SJQC 1HR0B 2GTSA 2CTQA 1K97A 1JJ2U 1V55C 4DV3O 3RYHB 4U7NA 1QVFU 4DUYO 3HKEA 2ZE6A 1XMOB 1KKDA 1YJWV 4OXSA 1BCCH 1Q82W 4B3RB 2ZCEA 3JCUZ 3LSSA 4DV4O 3G6EV 1YF2A 3OUFA 2LJ2A 3W7WA 2KKWA 4BW9A 5DEDA 5LGTA 4LF5O 2IH1C 1BL8A 5J2TA 4PHZA 5H2FZ 2MW2B 2ITCC 3QTCA 1I5YA 3GB7C 2FTKA 4DR1O 1F4MA 1H38A 3UM7A 4DRXA 5B66Z 3ZHSA 3CRCA 1YTFB 4B3MB 5A2QN 4WF9V 4JI1B 3QO7A 4LWSA 2XT9A 1UJWB 2EINB 4Q20A 4PJ0Z 1WPBA 2ZXWC 4TWKA 4ZOLB 4PELA 3TXQA 2QTOA 1ROPA 2VQEB 2BCCH 3E83A 4I7ZB 1XBLA 2D3OW 5LOVB 5IDJA 3L73H 1ZSPA 2V4DA 4FK5C 3E22A 4YJ2A 1E79G 3DGEA 3RWRD 4W4KA 4AQYO 2EZPA 3ZRVA 2ZE8A 1XHXA 3RYIA 1YCIA 3K3WA 2PTMA 4D7TA 3M7MX 2FKXA 4P2ZA 1CP9A 3OAAG 2VRZA 3HKCB 2XAFA 4J7JA 4J10A 1F7YA 2ATKC 1OCCC 3OFNG 1PNMA 2EIKC 3W7TA 4LF8O 1NS1A 3U0ZA 4Q6GA 4B3TB 2M6YA 4WBNB 3JAKB 3AG4B 3ZHQA 2V1DA 3OGCC 2JS5A 1OJHA 5KX5A 2LW1A 4LFBB 2UXDO 1N32O 4MTFA 5TISZ 1XQ8A 2WAMA 5B3SB 1HP8A 1GM8A 4J9YB 2RNBA 3FD9A 2PZSA 3H01A 2UU9O 4J7ZA 2QWQB 4UCOA 5GW7A 4UCVA 1COWG 1I5XA 2Q0AA 4WFAV 4AI8A 1BS3A 2ZM6B 3WG7B 3RYFB 3B09A 1AJNA 4TSFG 5LXTB 1GH6A 2ZDIA 5LYJB 3GWKC 1ZLZA 3KG2A 2WSSG 4I0XB 4GT1A 3ZHUA 3JASB 1R3LC 2RN9A 3ZRXA 5H5NA 4LFCB 2E5LB 4LF6O 5H6QA 3AG2C 3WB0A 2RDCA 3FB8C 3SPHA 1F51A 4YJ3B 2F43G 4JZ2A 1Y66A 4P30A 2WLIB 4JI6B 2UXBB 2Y69C 1VQLV 1SS3A 1YITV 3CRRA 1SETA 3KZIZ 1RM1C 2AHYA 1OCZB 3CE2A 5IY5C 2Q68A 3RFRA 1BHBA 1FFXA 4H0LB 3BHPA 2YICA 3SPCA 3UT5A 4X89A 2CUGA 3CEIA 1M56C 2OT5A 3ZIAG 1VF6C 2DJVA 5LMUO 2X7RB 4K0KO 1IBKB 1Q43A 4DV1O 3D3QA 3ABKC 3ABMB 2LFSA 4AHCA 4DV0B 1WB8A 3K03A 4DXWA 3JARA 2KB1A 5CA0B 3EVKA 3SDLA 2GTAA 5EIBD 1JVMA 4KUMA 4DW1A 1Q90D 3DXRB 4RQFA 4IIJB 4GKKB 3JALA 4X1KA 1N34B 4JAUA 4X64O 4HYOA 1SA0B 2WLMA 4JAAA 3SJBC 2QEXV 3H1HH 2CTRA 4I9WA 1IX9A 3ETEA 1HNZB 3F7YC 3UO3A 3OTOO 1OCRB 1QLEC 5HFLA 5CBHA 3D36C 2LQTA 4NTWA 2HG5C 4YIOA 2VQFO 2LGWA 4CC6A 3CMEV 4RO2A 3RYHA 3TETA 3D3IA 3BABA 3UKMA 2QDOA 2IJHA 4UCTA 4GX0A 1SKVA 2PI4A 4DR6O 3K9AA 4Z1VA 4NR1A 3CCJV 5EC1C 1V55B 4K35A 4YY3O 5IYBO 1DF4A 1AP6A 3RGBA 2X6BA 4JI7B 1FPOA 4WFEA 1TGOA 3U10A 3T4ZA 4YHHO 3C90A 3JD0A 3CRAA 1EN4A 4DV7B 4GKJO 2YXLA 1H8HG 5ITZB 1WB7A 3CRQA 5JVDB 5B5EZ 3K5NA 3OM3B 3RBZA 2EIMC 2BOBC 2QWPB 3J81N 1K7DA 2IU0A 4GCZA 4NTYA 4I5SA 2CH7B 2RMKB 3CCEV 3ZJZA 2P5OA 1Q8IA 5CA1B 3LDCA 1K3EA 4G27B 3K9SA 1QLNA 2Q5ZA 5J2UB 4DR4O 3A0HZ 5JQGB 1PNKA 4FZ1A 1BQZA 2JGDB 3T1YB 4ZOLA 2PF4E 3B8NA 2A9HA 4X62O 2F4VB 3CRMA 3AEIA 4CS3A 2E3CA 4P9PA 3P30A 4JI5B 5LOVA 4I9QA 2R72A 4I55B 2ZXWB 3E8FA 2IH3C 5CB4B 2E74B 4K8ZA 2ILMA 4UXNA 1M1KW 5KHIA 3JATA 3VBBA 1PD3A 1YDXA 1K8AW 1P4RA 4KXRA 1B6QA 3B77A 2HP8A 3BPZA 3E8BA 3WFVA 4DR7B 2PUSA 3NXSA 4JGSA 5B1BC 2ZR3A 1P49A 4NB5A 1QBZA 1YTFD 3HKCA 1DGSA 5BMVB 2JEUA 3CCVV 4PA7A 3UO2A 3OR6C 1FJGO 5B3SC 2A0LA 2FL4A 2YIAA 1N0NA 4LF9O 4WFFA 1J5EO 4LC1A 1R3IC 2X0LA 4MVMA 3JD4A 2R9IA 2A7WA 1J95A 3FYEB 3LNNA 2QJ1A 4WBNA 3JAKA 1OCCB 4WFBV 1FKAO 1I0HA 3WG7C 4FLVA 2D2CB 3EXAA 4X1IB 3UQ8A 2YXHA 2PY5A 1Q6HA 2ITDC 2GSMB 4BWAA 1N33B 2LW7A 1H8EG 4UVAA 3L75H 4LF4B 1I7FA 3HKBB 4H33A 1SQGA 5GTHZ 2DE0X 5JCOC 5LGUA 4OX9O 3SYQA 4F4LA 1JOYA 5BR8B 3FB7C 4JTDB 4DUYB 2OIGA 3RYFA 2ZQMA 4X66O 2EILC 5LXTA 1K92A 4J42A 4UFZA 5LYJA 4PDLA 4I0XA 3W7UA 1JQ0A 3JASA 4FZ0A 1QCEA 3H1LH 2P4VA 2AXTZ 2V7QG 1ZAUA 4LF5B 1K5QA 4QPJA 3EFFK 1AI7A 4YJ3A 3K0GA 2EIJC 2EJ7A 3JSNA 5FNVB 1X4TA 2WLIA 3DC5A 5KUKA 2Z5UA 3X2QC 4MTXA 4DK1A 3AG2B 4DR1B 4FJCC 3ZRSA 2OCCC 1GAXA 3ZHTA 3WU2Z 3OMIB 1R6NA 4ZI7B 2Y69B 3LDEA 2BTOA 4QGPA 5C93A 1Z2GA 1RM1B 5C8YB 4DUZB 3BEHA 1DLBA 2UUCO 4UCSA 2G38A 5IYZB 2DYSC 4MVUA 4B08A 1H2MA 1P7GA 4DR3O 2HJFC 1M56B 5CN0A 2B1IA 1KKCA 5CA0A 1VQNV 4CC5A 1Z5WA 4U3FH 5HFMA 1HNWO 3DXRA 1YJ9V 4IIJA 2P06A 1ZUQA 4K8XA 1SA0A 4O4HB 1NH2B 4K3AA 3BAAA 3ZHRA 2CGNA 3H9VA 2OTJV 1NBMG 2YS8A 5JH7B 3LNMB 3AG3C 2YEVB 2YC0A 4GX5A 4X65O 4G2KA 3SYOA 4UB6Z 1FD9A 5KHGA 3SJCC 4XBFA 1NI8A 1N4CA 4UCUA 1S3JA 2R9RB 3BA9A 1P7BA 3TGUH 2HHHO 2UXDB 3ASNC 3DSQA 3ZMVA 4RQEA 5DECA 4RWUA 1L0LH 2F23A 4DO2A 1XNQO 1QLEB 3LSUA 4J11A 4U7OA 5L3CA 4DV6O 3IFXA 2UU9B 2ZNIA 2WA4A 2RCVA 3AK3A 1PP9H 4CH3A 1MNGA 1I94O 1YJNV 1SQXH 1VQ4V 3STZC 1VQ9V 2Y4UA 5ITZA 5JVDA 4R7CA 1NR7A 3M99B 2M7WA 5JJJB 4WFGA 4QPKA 4NKGB 3T1HO 2XUMA 2CH7A 5LA6B 1KMIZ 3EHBB 4LF7O 2WPDG 1H2NA 3ETDA 1YHQV 5CA1A 4LF6B 4GUNA 3VQVA 4PV1B 4AILC 1SQFA 3HKDB 5J2UA 4RAIA 2EIMB 5CBFA 5JQGA 4RUFA 1YIJV 2JGDA 1ZTEA 4IGGA 3BFRA 3U11A 4BW5A 4MW8A 1Q81W 1CPYA 3B8MA 5KA6A 2B5UA 4I55A 2QE7G 5CB4A 3ABTA 4DV2O 1QVGU 4PA9A 2W6IG 1OCOC 3OEEG 2JEXA 3IGAC 3QO5A 4TT3G 1IBMO 2CE4A 1AVMA 4MVRA 2YIBA 3DC6A 4EB6B 3JCZA 3ZMTA 4PI2A 5BMVA 3O9OA 5EBLC 3ZEDA 1YSCA 3FFQA 4I4TB 5B1BB 4CS2A 2UUBO 3THOA 2UXXA 2KG7B 1AROP 1D5NA 5IWAO 3UCSC 2WLLB 2UUAO 1XMQO 4H44B 1AI4A 1TVKB 1BMFG 2CGOA 1E1QG 1NQTA 1Q6IA 1AILA 1XEQA 4X1IA 4JI3O 1RP3B 1IZ3A 5KMGB 1LUWA 2BSKB 4UB8Z 2NR5A 3E89A 5B1OA 2HKOA 4NXMB 4KHPB 4PI0A 5EBWC 1YEWA 5EYPB 1M5IA 1WP7A 5IE9A 5IYDO 1EZVH 1SZTA 4UUJC 3HKBA 1NZ6A 3OTOB 4X9QA 4FLYA 4EEQA 1RSOB 2JK5C 2GUZB 2VQFB 1L0NH 3SYAA 2IBZH 3A0BZ 4GZRB 3CCUV 1AR5A 2OIEA 2WLKA 4DR6B 2GHYA 1P84F 3SYCA 1KB9F 4MSWC 4YY3B 2GBOA 2VQEO 5CA3A 5AG2A 4H37A 4MVOA 4BAYA 1QR9A 3QG5A 1FFTB 4LR3A 2PYJA 2YUAA 4YHHB 2EILB 5BY1A 1E1RG 5BZBA 1XNRO 2JJ1G 2A3QA 5FNVA 1GM9A 1CEZA 2N05A 1TA8A 4LNUB 1BZKA 4PA3A 2R9AA 3FB6C 3S3XA 3BRCA 4J7KA 2EIJB 3STLC 4FFBB 4Z1MG 4UVCA 1XILA 3CXHF 4NYKA 3J7AU 4ZI7A 4TQDA 3X2QB 3C3SA 1CXZB 3ZMUA 4OGQB 3VQXA 3BVOA 5F2VO 4B3TO 2E75B 5C8YA 2OCCB 4ZIBA 4X62B 4GX2A 4G28B 3L74H 5KAIZ 5L3FA 2Z0AA 5L3GA 5IYZA 4R8CA 2QWOB 3ZN1A 2Q0OC 4JYAO 2K1EA 2XAJA 4GX1A 1VF6A 3RN4A 4FMTA 4UVBA 4FFKA 1AJQA 2DYSB 1R6TA 1SQPH 2AZ2A 2ZE5A 3OT7A 3OMAB 3L71H 3SPIA 2WWWA 2XTAA 4O4HA 2UXNA 2A06H 3LUTB 2FMLA 1GO3F 2HJDA 2P22C 3Q4HB 5GONB 5JH7A 2F1MA 4F6RB 1M90W 2YEVA 3F7VC 1T5EA 1Q86W 4Z2WA 3SPJA 2YI8A 5L3EA 4B3SO 2VWJA 5CBGA 1QU7A 3ZHVA 1KC8W 3PN1A 1NJIW 3AG3B 5JJEB 2E5LO 1H2LA 3HR0A 5DM6V 2Y4TA 3OGIB 3AK2A 2Q7HA 1BSMA 1WNSA 4I50B 3D36A 5J2TB 4WFHA 2DW4A 3ABUA 3LSQA 1L1FA 1R73A 5EZYB 5LGNA 3CJHB 1S0VA 3ASNB 5CMUA 1Z5VA 3JAWB 1NH2D 3N2GB 3TCUA 3M8AA 4O4LB 1US6A 3BA8A 1WJZA 4J41A 1NR1A 1JCHA 1URFA 2IJIA 2F95B 4X66B 3G6BA 5EC2C 4JF3A 1MSDA 5L3DA 3QO8A 4JI0O 5LA6A 1DF5A 4O4IB 1FAFA 1V9PA 1K34A 1M57C 1D5AA 3OR7C 4CZZA 5LHGA 2AZ0A 4DR2O 1JPXA 3AG1C 1U96A 4ZKIA 1FXKC 3HKDA 2UXCO 3ABLB 2XAGA 4FLXA 1PM9A 2R70A 1H2KA 2Q69A 4CS4A 3OD4A 2AW9A 4LFAO 1GTOA 3FX7A 2ADPA 4N21A 2OTLV 3CD6V 4C7UA 1Q3EA 2JVDA 1GK9A 3RW0A 1XL6A 3KCYA 1N36B 1JFFB 4O2AB 2Z3YA 1W2BU 2ZIMA 2QTSA 3W7SA 3K58A 1SF9A 4FLTA 2EZOA 1SESA 1S72V 4LCUC 4E2LA 5K1PA 4PD4F 4UV8A 1SQQH 4FLZA 1HNXO 4EB6A 1H2SB 2UUCB 4DV5B 2EX3A 1K33A 4CBCA 1OCOB 2WLNA 5B1AB 5IJ9B 4DR3B 4I4TA 4JI2O 4TV9B 2KSDA 1YXBA 1VF5B 2KG7A 1S77D 3K5LA 5L3BA 3ICXA 1QNMA 2WLLA 1HNWB 1JR9A 3GVMA 1SZXA 5LP6C 3ZMZA 4B7EA 1TVKA 1F4NA 3MD0A 2LGQA 3QVNA 1G6UA 1VQKV 5KMGA 2BSKA 4DW0A 4A5UB 1BQ0A 1K9MW 1JX9A 4DV3B 5FPOA 5EYPA 3WB1A 3ZRWB 1VQ5V 1M9NA 4MVZA 1QQCA 4X65B 1B04A 1XUQA 1F23A 1VIBA 4JYCA 4CH4A 1RSOA 3AG7A 2GUZA 3RVZA 3PJSK 3P3NA 4IT5A 4IYIA 5E1AC 2XHBA 4DV4B 2Q6AA 2HHHB 1DK1A 1NVPB 1GMGA 4CH5A 2AGAA 4TUYB 4D6TH 3F5WC 1XNQB 1IBLO 5JCOA 4J9ZB 1Q6UA 4FPPA 4JI4O 1RPOA 2P7TC 3L72H 4FM2A 2WA3A 3MHSC 4DV6B 1KYOF 1Y6XA 1EZJA 2E76B 3HB3B 1XL4A 3GWOA 5D5PA 2ARHA 4JI5O 1R1BA 4KFMA 1Q5OA 2DOSA 1I94B 1R3JC 1GM7A 2EJRA 2YI9A 4IHJB 4O4JB 2CDYA 1THZA 3SJAC 1ZL8B 2Y48A 2W0FC 3CCQV 4LNUA 3L70H 4TV8B 1G4YB 1K4CC 3AK1A 3L9DA 1QR8A 1U97A 1QHTA 4FFBA 2BTQB 1VARA 4ZHQB 4L87A 5E79Z 3CSXA 4AQYB 2H94A 2C2AA 3CPWU 2ADQB 4GLXA 3SGIA 4XDKA 1XDCA 4DR5O 3CC4V 3CS5A 2CTPA 3G67A 4DV2B 5IJ0B 3ETGA 3F5TA 3CYOA 4LF8B 3E8GA 4HZ3A 3CP1A 1WA8B 5JJNB 1IBMB 3K5OA 1H2GA 1LR1A 2RQ6A 1YZBA 4LF4O 1O9GA 2LFRA 4JI8O 2P4KA 1IXBA 4J80A 5DN6G 3ZBHA 3RT3C 2ZKOA 1D2DA 5BR8O 2IM9A 1I08A 3Q4HA 2UUBB 1N32B 1ZWIC 5GONA 1SRYA 4F6RA 3CC7V 1EN5A 1Y67A 4NTXA 5IWAB 4JV5O 4MT8A 2UUAB 1XMQB 2K9PA 2FB5A 2ZD9A 1GN4A 1Y74B 2BE3A 5LMNO 2XAQA 4JI3B 2YDEA 3RYCB 1KP3A 3TXSA 1VQMV 3S3WA 1WAZA 1WP8A 2DN9A 4I50A 2JS3A 3CX5F 1W59A 1WPXA 3ZCCA 4NXNO 3P3PA 5EZYA 3CJHA 1S5LZ 1M93A 2LO1A 3JAWA 3ABLC 1VQ6V 1ENVA 3N2GA 3VOUA 2ZNJA 4O4LA 5EK0A 1MZEA 2KQXA 3ASOC 3B4SA 3G4SV 3K5MA 2JDIG 4ZBMA 2QA4V 4X8AA 2DYRB 2Q4PA 3ZMSA 5GTIZ 1KECA 4DUZO 4O4IA 3JD3A 4LH7A 1JJOA 5H6RA 3E86A 3CCSV 3E8HA 2YSUB 1HW7A 2XASA 1XNRB 5LL6Y 2H3OA 3JATB 3CCMV 4F6EA 4FIPC 2O57A 4FM1A 5KHHA 5B1AC 2AHZA 2EULA 4TQFA 2A79B 1BHAA 1M57B 3TJTA 3AG1B 3DTUB 1FXKB 3APQA 1KP2A 5LMUB 3CCRV 2B1GA 4MTGA 1JFFA 4O2AA 1HWYA 1HR0O 4K0KB 4JTCB 3K04A 4DV1B 1Y4MA 3JSLA 2XNDG 4PA4A 4CH6A 1XI1A 3C3TA 3A2FA 4X1YB 1NKDA 4YXWG 3G71V 1K73W 1XMOO 2NLJC 4JYBA 4OPAA 4DYLA 2OCHA 2QR4A 4B3RO 1KD1W 2ODMA 3ZS8C 2HFEC 3FKSG 1TUBB 5IJ9A 2IJJA 3K79A 4X64B 4JYAB 4KP4A 4TV9A 2ZDIC 1VEWA 2QWNB 1PNLA 4PA6A 3K57A 4HAMA 3ML0A 2HVJC 1YVWA 3ZX6A 1JA8A 1IDSA 1FS0G 2CTWA 2N04A 4D7SA 2BOCC 2YIBD 3N2KB 2QM4A 2QSAA 1GN6A 4JZGA 3CC2V 2JRIA 3VQWA 1EM1A 1NTMH 4B3MO 5LP6B 5EIBC 3K59A 3ZRWA 4U3JB 4JI1O 4HBNA 2GDSA 1BE3H 1SERA 1RFYA 4ICGA 3A8TA 1R6KA 2Y0IA 4B3SB 4YIPA 2W0XA 3APOA 4QIWF 3J80N 4LP8A 4DK0A 3MHHC 4X88A 5KLVH 4TUYA 1GN2A 2QKCA 3FAVB 3CXCU 4GKJB 3R65A 5LHHA 3O65A 1XHZA 3H1JH 4JAVA 1Y76B 2XAHA 1O9HA 2WLJA 5LHIA 1B06A 2X6CA 1LUVA 3KCXA 1WN7A 1UFIA 2IJKA 1EBOA 4IHJA 4O4JA 4X20B 2QM8A 4TOIA 2DQ0A 2Q7GA 4DR4B 1ZL8A 1V54C 1EFRG 3ETQA 3K08A 4HNAB 4JYYA 4TV8A 4JI0B 1SC5B 1AR1B 1OZ0A 4GYCB 1FXVA 4B7KA 4IL6Z 1NVPD 2HR3A 4QE7A 4DR2B 4O2BB 4WCEV 3IAYA 1XREA 2CK3G 2BTQA 4ZHQA 2UXCB 4XDLA 2B9ZA 1VQ8V 4LFBO 1AI6A 3OTFA 2L6LA 1FXHA 5IT9N 4LFAB 1VQPV 4BIZA 1VP7A 4LBEC 4EKWA 2ZINA 4P9OA 2DWEC 1KQSU 1L8DA 1FJGB 1G1XB 5IJ0A 4LF9B 2HLDG 3K0DA 1MZFA 1PV0A 1J5EB 4NXMO 3JD2A 4KHPO 1WA8A 1X59A 1PKXA 2W6JG 2ZM6O 1HNXB 3HKEB 3WB2A 3CWBH 3ZN0A 2IU3A 4BIUA 4H13B 1KBHA 3SYPA 5B1NA 3JD1A 1GN3A 4JI2B 1S5JA 1BGYH 2OYQA 4LFCO 1M4UA 2QM7A 5KA5A 2ZIOA 2YIDA 5IYCO 3QNEA 4EFEA 3I5DA 2HEPA 3SPGA 4LH6A 5KAFZ 5KHKA 1Y74A 4OPHA 2EINC 2L35A 4JI6O 2N74A 2UXBO 4BR6A 3RYCA 4OX9B 1AP5A 2DYRC 4DRXB 2P90A 1MMMA 1FYJA 3E35A 2LP7A 4LWSB 2QGNA 3OMNB 1VQOV 1W0KG 2OWOA 4N23A 1PL0A 2NN4A 2VWKA 2IW5A 3NR7A 3OEHG 4JTAB 2ZE7A 5A9GA 1GRJA 4R6ZA 1IURA 2Q67A 1TAEA 4QNHB 1IBKO 5EBMC 2P67A 5BXZA 3E22B 4YJ2B 1IBLB 3IJ4A 4DV0O 1MSWD 4JI4B 3B2EE 3A0RA 4NVPA 3ASOB 1NU1H 3OE7G 1Q7YW 3RYIB 2Q73A 2ZR2A 1BT8A 2GV9A 3TK1A 3H1KH 4GKKO 1XOUA 1KUQA 1N34O 3T1CA 1W0JG 3AG4C 4MS2A 1S76D 3OW2U 3W7XA 3QF7A 1GKFA 4UCRA 1KU9A 1HNZO 1FXKA 1MOFA 3N27A 1MABG 4R50A 3RVYA 1PL4A 3D8CA 3CHXA 1NT2B 2X6AA 3E2EA 5FLXN 3JAMN 1SQBH 1G8MA 3R66A 3IC7A 1R3KC 1ORQC 4ASUG 3P32A 3I55V 3FYIB 5KX5B 2RJZA 2ZT9B 1IXMA 4UV9A 4X1YA 1JMKC 4PDRA 3MDSA 1MG1A 3B40A 5JWPA 2F93B 4RUEA 3BY6A 1SQVH 2HVKC 4ABMA 3CCLV 2PI5A 1TUBA 2EIKB 1MA1A
chains in the Genus database with same CATH topology
1N4CA 2QWOB 1XBLA 2GUZB 1HDJA 2KQXA 3UO2A 2CTQA 2DMXA 1IURA 4J7ZA 1FPOA 2QWQB 2YUAA 2CTPA 2LGWA 1BQ0A 2QWNB 1WJZA 2Y4UA 2Y4TA 2DN9A 2L6LA 4RWUA 1BQZA 2CTRA 2EJ7A 2QWRB 2CTWA 2YS8A 2N04A 3BVOA 2M6YA 2PF4E 1GH6A 2N05A 2CUGA 3UCSC 2QSAA 3UO3A 1NZ6A 2OCHA 2QWPB 2LO1A 3APQA 3APOA 3AG7A 2GUZA 4J80A 1FAFA 4IT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4C A;  2QWO B;  1XBL A;  2GUZ B;  1HDJ A;  2KQX A;  3UO2 A;  2CTQ A;  2DMX A;  1IUR A;  4J7Z A;  1FPO A;  2QWQ B;  2YUA A;  2CTP A;  2LGW A;  1BQ0 A;  2QWN B;  1WJZ A;  2Y4U A;  2Y4T A;  2DN9 A;  2L6L A;  4RWU A;  1BQZ A;  2CTR A;  2EJ7 A;  2QWR B;  2CTW A;  2YS8 A;  2N04 A;  3BVO A;  2M6Y A;  2PF4 E;  1GH6 A;  2N05 A;  2CUG A;  3UCS C;  2QSA A;  3UO3 A;  1NZ6 A;  2OCH A;  2QWP B;  2LO1 A;  3APQ A;  3APO A;  3AG7 A;  2GUZ A;  4J80 A;  1FAF A;  4IT5 A; 
#chains in the Genus database with same CATH topology
 4DR5 B;  2DWD C;  2DMX A;  1AI5 A;  4JI7 O;  3I56 V;  3IC9 A;  3JYC A;  3T4D A;  3VQY A;  1NTZ H;  4DV7 O;  1VF7 A;  1DTO A;  1N0J A;  1UPG A;  2YXY A;  3N2K A;  3T2M A;  3H1I H;  4E4E A;  4MVQ A;  2JGU A;  4MW3 A;  1S5H C;  4JI8 B;  2Y0P A;  1B3Q A;  5KUM A;  2EBO A;  2F66 C;  3CMA V;  5LP6 A;  4U3J A;  1AJP A;  5H9C A;  5LBQ A;  2DQ3 A;  2CAZ C;  1VQ7 V;  4JV5 B;  3FB5 C;  1OCZ C;  4FM0 A;  3T1Y O;  1RPR A;  1A32 A;  5J9P C;  4KL1 A;  1AB3 A;  2H8P C;  5LMN B;  2F4V O;  4IYH A;  2JIZ G;  2Q7E A;  1NTK H;  1OV9 A;  2MK3 A;  2FYU H;  2WLH A;  3FAV A;  1IVS A;  1VMG A;  4FLU A;  4FLW A;  2P6J A;  1FFX B;  3OUS A;  5KHJ A;  3G80 A;  4FVM A;  2QKS A;  4NXN B;  4JAS A;  1Y76 A;  4L8J A;  3UT5 B;  3ABM C;  4DR7 O;  3SR2 C;  3KKY A;  3T1H B;  1K4D C;  4JPR A;  4XDJ A;  3LDD A;  1HDJ A;  4LF7 B;  1N36 O;  4X20 A;  4MTO A;  2JJ2 G;  1LNQ A;  4HNA A;  3K06 A;  3MAQ A;  2QWR B;  3JAR B;  5K1X A;  1K5S A;  2XOK G;  4QJF B;  2PGG A;  5IY5 B;  1AR4 A;  4PDM A;  1PPJ H;  4DV5 O;  4QE9 A;  2Q9L A;  4EFB A;  4O2B A;  3JAL B;  1V54 B;  4X1K B;  3HPL C;  5D5Q A;  3CB2 A;  1OCR C;  2Q8V A;  4MVS A;  1N33 O;  1WLE A;  1TUE B;  2ETN A;  2QKA A;  3BCC H;  2VS0 A;  1ZX3 A;  4W4L A;  1EN6 A;  4PDV A;  4BIO A;  1YI2 V;  2NNU A;  1N8R W;  2PYL A;  3ABK B;  1OHH G;  5FL7 G;  5FPR A;  3SJQ C;  1HR0 B;  2GTS A;  2CTQ A;  1K97 A;  1JJ2 U;  1V55 C;  4DV3 O;  3RYH B;  4U7N A;  1QVF U;  4DUY O;  3HKE A;  2ZE6 A;  1XMO B;  1KKD A;  1YJW V;  4OXS A;  1BCC H;  1Q82 W;  4B3R B;  2ZCE A;  3JCU Z;  3LSS A;  4DV4 O;  3G6E V;  1YF2 A;  3OUF A;  2LJ2 A;  3W7W A;  2KKW A;  4BW9 A;  5DED A;  5LGT A;  4LF5 O;  2IH1 C;  1BL8 A;  5J2T A;  4PHZ A;  5H2F Z;  2MW2 B;  2ITC C;  3QTC A;  1I5Y A;  3GB7 C;  2FTK A;  4DR1 O;  1F4M A;  1H38 A;  3UM7 A;  4DRX A;  5B66 Z;  3ZHS A;  3CRC A;  1YTF B;  4B3M B;  5A2Q N;  4WF9 V;  4JI1 B;  3QO7 A;  4LWS A;  2XT9 A;  1UJW B;  2EIN B;  4Q20 A;  4PJ0 Z;  1WPB A;  2ZXW C;  4TWK A;  4ZOL B;  4PEL A;  3TXQ A;  2QTO A;  1ROP A;  2VQE B;  2BCC H;  3E83 A;  4I7Z B;  1XBL A;  2D3O W;  5LOV B;  5IDJ A;  3L73 H;  1ZSP A;  2V4D A;  4FK5 C;  3E22 A;  4YJ2 A;  1E79 G;  3DGE A;  3RWR D;  4W4K A;  4AQY O;  2EZP A;  3ZRV A;  2ZE8 A;  1XHX A;  3RYI A;  1YCI A;  3K3W A;  2PTM A;  4D7T A;  3M7M X;  2FKX A;  4P2Z A;  1CP9 A;  3OAA G;  2VRZ A;  3HKC B;  2XAF A;  4J7J A;  4J10 A;  1F7Y A;  2ATK C;  1OCC C;  3OFN G;  1PNM A;  2EIK C;  3W7T A;  4LF8 O;  1NS1 A;  3U0Z A;  4Q6G A;  4B3T B;  2M6Y A;  4WBN B;  3JAK B;  3AG4 B;  3ZHQ A;  2V1D A;  3OGC C;  2JS5 A;  1OJH A;  5KX5 A;  2LW1 A;  4LFB B;  2UXD O;  1N32 O;  4MTF A;  5TIS Z;  1XQ8 A;  2WAM A;  5B3S B;  1HP8 A;  1GM8 A;  4J9Y B;  2RNB A;  3FD9 A;  2PZS A;  3H01 A;  2UU9 O;  4J7Z A;  2QWQ B;  4UCO A;  5GW7 A;  4UCV A;  1COW G;  1I5X A;  2Q0A A;  4WFA V;  4AI8 A;  1BS3 A;  2ZM6 B;  3WG7 B;  3RYF B;  3B09 A;  1AJN A;  4TSF G;  5LXT B;  1GH6 A;  2ZDI A;  5LYJ B;  3GWK C;  1ZLZ A;  3KG2 A;  2WSS G;  4I0X B;  4GT1 A;  3ZHU A;  3JAS B;  1R3L C;  2RN9 A;  3ZRX A;  5H5N A;  4LFC B;  2E5L B;  4LF6 O;  5H6Q A;  3AG2 C;  3WB0 A;  2RDC A;  3FB8 C;  3SPH A;  1F51 A;  4YJ3 B;  2F43 G;  4JZ2 A;  1Y66 A;  4P30 A;  2WLI B;  4JI6 B;  2UXB B;  2Y69 C;  1VQL V;  1SS3 A;  1YIT V;  3CRR A;  1SET A;  3KZI Z;  1RM1 C;  2AHY A;  1OCZ B;  3CE2 A;  5IY5 C;  2Q68 A;  3RFR A;  1BHB A;  1FFX A;  4H0L B;  3BHP A;  2YIC A;  3SPC A;  3UT5 A;  4X89 A;  2CUG A;  3CEI A;  1M56 C;  2OT5 A;  3ZIA G;  1VF6 C;  2DJV A;  5LMU O;  2X7R B;  4K0K O;  1IBK B;  1Q43 A;  4DV1 O;  3D3Q A;  3ABK C;  3ABM B;  2LFS A;  4AHC A;  4DV0 B;  1WB8 A;  3K03 A;  4DXW A;  3JAR A;  2KB1 A;  5CA0 B;  3EVK A;  3SDL A;  2GTA A;  5EIB D;  1JVM A;  4KUM A;  4DW1 A;  1Q90 D;  3DXR B;  4RQF A;  4IIJ B;  4GKK B;  3JAL A;  4X1K A;  1N34 B;  4JAU A;  4X64 O;  4HYO A;  1SA0 B;  2WLM A;  4JAA A;  3SJB C;  2QEX V;  3H1H H;  2CTR A;  4I9W A;  1IX9 A;  3ETE A;  1HNZ B;  3F7Y C;  3UO3 A;  3OTO O;  1OCR B;  1QLE C;  5HFL A;  5CBH A;  3D36 C;  2LQT A;  4NTW A;  2HG5 C;  4YIO A;  2VQF O;  2LGW A;  4CC6 A;  3CME V;  4RO2 A;  3RYH A;  3TET A;  3D3I A;  3BAB A;  3UKM A;  2QDO A;  2IJH A;  4UCT A;  4GX0 A;  1SKV A;  2PI4 A;  4DR6 O;  3K9A A;  4Z1V A;  4NR1 A;  3CCJ V;  5EC1 C;  1V55 B;  4K35 A;  4YY3 O;  5IYB O;  1DF4 A;  1AP6 A;  3RGB A;  2X6B A;  4JI7 B;  1FPO A;  4WFE A;  1TGO A;  3U10 A;  3T4Z A;  4YHH O;  3C90 A;  3JD0 A;  3CRA A;  1EN4 A;  4DV7 B;  4GKJ O;  2YXL A;  1H8H G;  5ITZ B;  1WB7 A;  3CRQ A;  5JVD B;  5B5E Z;  3K5N A;  3OM3 B;  3RBZ A;  2EIM C;  2BOB C;  2QWP B;  3J81 N;  1K7D A;  2IU0 A;  4GCZ A;  4NTY A;  4I5S A;  2CH7 B;  2RMK B;  3CCE V;  3ZJZ A;  2P5O A;  1Q8I A;  5CA1 B;  3LDC A;  1K3E A;  4G27 B;  3K9S A;  1QLN A;  2Q5Z A;  5J2U B;  4DR4 O;  3A0H Z;  5JQG B;  1PNK A;  4FZ1 A;  1BQZ A;  2JGD B;  3T1Y B;  4ZOL A;  2PF4 E;  3B8N A;  2A9H A;  4X62 O;  2F4V B;  3CRM A;  3AEI A;  4CS3 A;  2E3C A;  4P9P A;  3P30 A;  4JI5 B;  5LOV A;  4I9Q A;  2R72 A;  4I55 B;  2ZXW B;  3E8F A;  2IH3 C;  5CB4 B;  2E74 B;  4K8Z A;  2ILM A;  4UXN A;  1M1K W;  5KHI A;  3JAT A;  3VBB A;  1PD3 A;  1YDX A;  1K8A W;  1P4R A;  4KXR A;  1B6Q A;  3B77 A;  2HP8 A;  3BPZ A;  3E8B A;  3WFV A;  4DR7 B;  2PUS A;  3NXS A;  4JGS A;  5B1B C;  2ZR3 A;  1P49 A;  4NB5 A;  1QBZ A;  1YTF D;  3HKC A;  1DGS A;  5BMV B;  2JEU A;  3CCV V;  4PA7 A;  3UO2 A;  3OR6 C;  1FJG O;  5B3S C;  2A0L A;  2FL4 A;  2YIA A;  1N0N A;  4LF9 O;  4WFF A;  1J5E O;  4LC1 A;  1R3I C;  2X0L A;  4MVM A;  3JD4 A;  2R9I A;  2A7W A;  1J95 A;  3FYE B;  3LNN A;  2QJ1 A;  4WBN A;  3JAK A;  1OCC B;  4WFB V;  1FKA O;  1I0H A;  3WG7 C;  4FLV A;  2D2C B;  3EXA A;  4X1I B;  3UQ8 A;  2YXH A;  2PY5 A;  1Q6H A;  2ITD C;  2GSM B;  4BWA A;  1N33 B;  2LW7 A;  1H8E G;  4UVA A;  3L75 H;  4LF4 B;  1I7F A;  3HKB B;  4H33 A;  1SQG A;  5GTH Z;  2DE0 X;  5JCO C;  5LGU A;  4OX9 O;  3SYQ A;  4F4L A;  1JOY A;  5BR8 B;  3FB7 C;  4JTD B;  4DUY B;  2OIG A;  3RYF A;  2ZQM A;  4X66 O;  2EIL C;  5LXT A;  1K92 A;  4J42 A;  4UFZ A;  5LYJ A;  4PDL A;  4I0X A;  3W7U A;  1JQ0 A;  3JAS A;  4FZ0 A;  1QCE A;  3H1L H;  2P4V A;  2AXT Z;  2V7Q G;  1ZAU A;  4LF5 B;  1K5Q A;  4QPJ A;  3EFF K;  1AI7 A;  4YJ3 A;  3K0G A;  2EIJ C;  2EJ7 A;  3JSN A;  5FNV B;  1X4T A;  2WLI A;  3DC5 A;  5KUK A;  2Z5U A;  3X2Q C;  4MTX A;  4DK1 A;  3AG2 B;  4DR1 B;  4FJC C;  3ZRS A;  2OCC C;  1GAX A;  3ZHT A;  3WU2 Z;  3OMI B;  1R6N A;  4ZI7 B;  2Y69 B;  3LDE A;  2BTO A;  4QGP A;  5C93 A;  1Z2G A;  1RM1 B;  5C8Y B;  4DUZ B;  3BEH A;  1DLB A;  2UUC O;  4UCS A;  2G38 A;  5IYZ B;  2DYS C;  4MVU A;  4B08 A;  1H2M A;  1P7G A;  4DR3 O;  2HJF C;  1M56 B;  5CN0 A;  2B1I A;  1KKC A;  5CA0 A;  1VQN V;  4CC5 A;  1Z5W A;  4U3F H;  5HFM A;  1HNW O;  3DXR A;  1YJ9 V;  4IIJ A;  2P06 A;  1ZUQ A;  4K8X A;  1SA0 A;  4O4H B;  1NH2 B;  4K3A A;  3BAA A;  3ZHR A;  2CGN A;  3H9V A;  2OTJ V;  1NBM G;  2YS8 A;  5JH7 B;  3LNM B;  3AG3 C;  2YEV B;  2YC0 A;  4GX5 A;  4X65 O;  4G2K A;  3SYO A;  4UB6 Z;  1FD9 A;  5KHG A;  3SJC C;  4XBF A;  1NI8 A;  1N4C A;  4UCU A;  1S3J A;  2R9R B;  3BA9 A;  1P7B A;  3TGU H;  2HHH O;  2UXD B;  3ASN C;  3DSQ A;  3ZMV A;  4RQE A;  5DEC A;  4RWU A;  1L0L H;  2F23 A;  4DO2 A;  1XNQ O;  1QLE B;  3LSU A;  4J11 A;  4U7O A;  5L3C A;  4DV6 O;  3IFX A;  2UU9 B;  2ZNI A;  2WA4 A;  2RCV A;  3AK3 A;  1PP9 H;  4CH3 A;  1MNG A;  1I94 O;  1YJN V;  1SQX H;  1VQ4 V;  3STZ C;  1VQ9 V;  2Y4U A;  5ITZ A;  5JVD A;  4R7C A;  1NR7 A;  3M99 B;  2M7W A;  5JJJ B;  4WFG A;  4QPK A;  4NKG B;  3T1H O;  2XUM A;  2CH7 A;  5LA6 B;  1KMI Z;  3EHB B;  4LF7 O;  2WPD G;  1H2N A;  3ETD A;  1YHQ V;  5CA1 A;  4LF6 B;  4GUN A;  3VQV A;  4PV1 B;  4AIL C;  1SQF A;  3HKD B;  5J2U A;  4RAI A;  2EIM B;  5CBF A;  5JQG A;  4RUF A;  1YIJ V;  2JGD A;  1ZTE A;  4IGG A;  3BFR A;  3U11 A;  4BW5 A;  4MW8 A;  1Q81 W;  1CPY A;  3B8M A;  5KA6 A;  2B5U A;  4I55 A;  2QE7 G;  5CB4 A;  3ABT A;  4DV2 O;  1QVG U;  4PA9 A;  2W6I G;  1OCO C;  3OEE G;  2JEX A;  3IGA C;  3QO5 A;  4TT3 G;  1IBM O;  2CE4 A;  1AVM A;  4MVR A;  2YIB A;  3DC6 A;  4EB6 B;  3JCZ A;  3ZMT A;  4PI2 A;  5BMV A;  3O9O A;  5EBL C;  3ZED A;  1YSC A;  3FFQ A;  4I4T B;  5B1B B;  4CS2 A;  2UUB O;  3THO A;  2UXX A;  2KG7 B;  1ARO P;  1D5N A;  5IWA O;  3UCS C;  2WLL B;  2UUA O;  1XMQ O;  4H44 B;  1AI4 A;  1TVK B;  1BMF G;  2CGO A;  1E1Q G;  1NQT A;  1Q6I A;  1AIL A;  1XEQ A;  4X1I A;  4JI3 O;  1RP3 B;  1IZ3 A;  5KMG B;  1LUW A;  2BSK B;  4UB8 Z;  2NR5 A;  3E89 A;  5B1O A;  2HKO A;  4NXM B;  4KHP B;  4PI0 A;  5EBW C;  1YEW A;  5EYP B;  1M5I A;  1WP7 A;  5IE9 A;  5IYD O;  1EZV H;  1SZT A;  4UUJ C;  3HKB A;  1NZ6 A;  3OTO B;  4X9Q A;  4FLY A;  4EEQ A;  1RSO B;  2JK5 C;  2GUZ B;  2VQF B;  1L0N H;  3SYA A;  2IBZ H;  3A0B Z;  4GZR B;  3CCU V;  1AR5 A;  2OIE A;  2WLK A;  4DR6 B;  2GHY A;  1P84 F;  3SYC A;  1KB9 F;  4MSW C;  4YY3 B;  2GBO A;  2VQE O;  5CA3 A;  5AG2 A;  4H37 A;  4MVO A;  4BAY A;  1QR9 A;  3QG5 A;  1FFT B;  4LR3 A;  2PYJ A;  2YUA A;  4YHH B;  2EIL B;  5BY1 A;  1E1R G;  5BZB A;  1XNR O;  2JJ1 G;  2A3Q A;  5FNV A;  1GM9 A;  1CEZ A;  2N05 A;  1TA8 A;  4LNU B;  1BZK A;  4PA3 A;  2R9A A;  3FB6 C;  3S3X A;  3BRC A;  4J7K A;  2EIJ B;  3STL C;  4FFB B;  4Z1M G;  4UVC A;  1XIL A;  3CXH F;  4NYK A;  3J7A U;  4ZI7 A;  4TQD A;  3X2Q B;  3C3S A;  1CXZ B;  3ZMU A;  4OGQ B;  3VQX A;  3BVO A;  5F2V O;  4B3T O;  2E75 B;  5C8Y A;  2OCC B;  4ZIB A;  4X62 B;  4GX2 A;  4G28 B;  3L74 H;  5KAI Z;  5L3F A;  2Z0A A;  5L3G A;  5IYZ A;  4R8C A;  2QWO B;  3ZN1 A;  2Q0O C;  4JYA O;  2K1E A;  2XAJ A;  4GX1 A;  1VF6 A;  3RN4 A;  4FMT A;  4UVB A;  4FFK A;  1AJQ A;  2DYS B;  1R6T A;  1SQP H;  2AZ2 A;  2ZE5 A;  3OT7 A;  3OMA B;  3L71 H;  3SPI A;  2WWW A;  2XTA A;  4O4H A;  2UXN A;  2A06 H;  3LUT B;  2FML A;  1GO3 F;  2HJD A;  2P22 C;  3Q4H B;  5GON B;  5JH7 A;  2F1M A;  4F6R B;  1M90 W;  2YEV A;  3F7V C;  1T5E A;  1Q86 W;  4Z2W A;  3SPJ A;  2YI8 A;  5L3E A;  4B3S O;  2VWJ A;  5CBG A;  1QU7 A;  3ZHV A;  1KC8 W;  3PN1 A;  1NJI W;  3AG3 B;  5JJE B;  2E5L O;  1H2L A;  3HR0 A;  5DM6 V;  2Y4T A;  3OGI B;  3AK2 A;  2Q7H A;  1BSM A;  1WNS A;  4I50 B;  3D36 A;  5J2T B;  4WFH A;  2DW4 A;  3ABU A;  3LSQ A;  1L1F A;  1R73 A;  5EZY B;  5LGN A;  3CJH B;  1S0V A;  3ASN B;  5CMU A;  1Z5V A;  3JAW B;  1NH2 D;  3N2G B;  3TCU A;  3M8A A;  4O4L B;  1US6 A;  3BA8 A;  1WJZ A;  4J41 A;  1NR1 A;  1JCH A;  1URF A;  2IJI A;  2F95 B;  4X66 B;  3G6B A;  5EC2 C;  4JF3 A;  1MSD A;  5L3D A;  3QO8 A;  4JI0 O;  5LA6 A;  1DF5 A;  4O4I B;  1FAF A;  1V9P A;  1K34 A;  1M57 C;  1D5A A;  3OR7 C;  4CZZ A;  5LHG A;  2AZ0 A;  4DR2 O;  1JPX A;  3AG1 C;  1U96 A;  4ZKI A;  1FXK C;  3HKD A;  2UXC O;  3ABL B;  2XAG A;  4FLX A;  1PM9 A;  2R70 A;  1H2K A;  2Q69 A;  4CS4 A;  3OD4 A;  2AW9 A;  4LFA O;  1GTO A;  3FX7 A;  2ADP A;  4N21 A;  2OTL V;  3CD6 V;  4C7U A;  1Q3E A;  2JVD A;  1GK9 A;  3RW0 A;  1XL6 A;  3KCY A;  1N36 B;  1JFF B;  4O2A B;  2Z3Y A;  1W2B U;  2ZIM A;  2QTS A;  3W7S A;  3K58 A;  1SF9 A;  4FLT A;  2EZO A;  1SES A;  1S72 V;  4LCU C;  4E2L A;  5K1P A;  4PD4 F;  4UV8 A;  1SQQ H;  4FLZ A;  1HNX O;  4EB6 A;  1H2S B;  2UUC B;  4DV5 B;  2EX3 A;  1K33 A;  4CBC A;  1OCO B;  2WLN A;  5B1A B;  5IJ9 B;  4DR3 B;  4I4T A;  4JI2 O;  4TV9 B;  2KSD A;  1YXB A;  1VF5 B;  2KG7 A;  1S77 D;  3K5L A;  5L3B A;  3ICX A;  1QNM A;  2WLL A;  1HNW B;  1JR9 A;  3GVM A;  1SZX A;  5LP6 C;  3ZMZ A;  4B7E A;  1TVK A;  1F4N A;  3MD0 A;  2LGQ A;  3QVN A;  1G6U A;  1VQK V;  5KMG A;  2BSK A;  4DW0 A;  4A5U B;  1BQ0 A;  1K9M W;  1JX9 A;  4DV3 B;  5FPO A;  5EYP A;  3WB1 A;  3ZRW B;  1VQ5 V;  1M9N A;  4MVZ A;  1QQC A;  4X65 B;  1B04 A;  1XUQ A;  1F23 A;  1VIB A;  4JYC A;  4CH4 A;  1RSO A;  3AG7 A;  2GUZ A;  3RVZ A;  3PJS K;  3P3N A;  4IT5 A;  4IYI A;  5E1A C;  2XHB A;  4DV4 B;  2Q6A A;  2HHH B;  1DK1 A;  1NVP B;  1GMG A;  4CH5 A;  2AGA A;  4TUY B;  4D6T H;  3F5W C;  1XNQ B;  1IBL O;  5JCO A;  4J9Z B;  1Q6U A;  4FPP A;  4JI4 O;  1RPO A;  2P7T C;  3L72 H;  4FM2 A;  2WA3 A;  3MHS C;  4DV6 B;  1KYO F;  1Y6X A;  1EZJ A;  2E76 B;  3HB3 B;  1XL4 A;  3GWO A;  5D5P A;  2ARH A;  4JI5 O;  1R1B A;  4KFM A;  1Q5O A;  2DOS A;  1I94 B;  1R3J C;  1GM7 A;  2EJR A;  2YI9 A;  4IHJ B;  4O4J B;  2CDY A;  1THZ A;  3SJA C;  1ZL8 B;  2Y48 A;  2W0F C;  3CCQ V;  4LNU A;  3L70 H;  4TV8 B;  1G4Y B;  1K4C C;  3AK1 A;  3L9D A;  1QR8 A;  1U97 A;  1QHT A;  4FFB A;  2BTQ B;  1VAR A;  4ZHQ B;  4L87 A;  5E79 Z;  3CSX A;  4AQY B;  2H94 A;  2C2A A;  3CPW U;  2ADQ B;  4GLX A;  3SGI A;  4XDK A;  1XDC A;  4DR5 O;  3CC4 V;  3CS5 A;  2CTP A;  3G67 A;  4DV2 B;  5IJ0 B;  3ETG A;  3F5T A;  3CYO A;  4LF8 B;  3E8G A;  4HZ3 A;  3CP1 A;  1WA8 B;  5JJN B;  1IBM B;  3K5O A;  1H2G A;  1LR1 A;  2RQ6 A;  1YZB A;  4LF4 O;  1O9G A;  2LFR A;  4JI8 O;  2P4K A;  1IXB A;  4J80 A;  5DN6 G;  3ZBH A;  3RT3 C;  2ZKO A;  1D2D A;  5BR8 O;  2IM9 A;  1I08 A;  3Q4H A;  2UUB B;  1N32 B;  1ZWI C;  5GON A;  1SRY A;  4F6R A;  3CC7 V;  1EN5 A;  1Y67 A;  4NTX A;  5IWA B;  4JV5 O;  4MT8 A;  2UUA B;  1XMQ B;  2K9P A;  2FB5 A;  2ZD9 A;  1GN4 A;  1Y74 B;  2BE3 A;  5LMN O;  2XAQ A;  4JI3 B;  2YDE A;  3RYC B;  1KP3 A;  3TXS A;  1VQM V;  3S3W A;  1WAZ A;  1WP8 A;  2DN9 A;  4I50 A;  2JS3 A;  3CX5 F;  1W59 A;  1WPX A;  3ZCC A;  4NXN O;  3P3P A;  5EZY A;  3CJH A;  1S5L Z;  1M93 A;  2LO1 A;  3JAW A;  3ABL C;  1VQ6 V;  1ENV A;  3N2G A;  3VOU A;  2ZNJ A;  4O4L A;  5EK0 A;  1MZE A;  2KQX A;  3ASO C;  3B4S A;  3G4S V;  3K5M A;  2JDI G;  4ZBM A;  2QA4 V;  4X8A A;  2DYR B;  2Q4P A;  3ZMS A;  5GTI Z;  1KEC A;  4DUZ O;  4O4I A;  3JD3 A;  4LH7 A;  1JJO A;  5H6R A;  3E86 A;  3CCS V;  3E8H A;  2YSU B;  1HW7 A;  2XAS A;  1XNR B;  5LL6 Y;  2H3O A;  3JAT B;  3CCM V;  4F6E A;  4FIP C;  2O57 A;  4FM1 A;  5KHH A;  5B1A C;  2AHZ A;  2EUL A;  4TQF A;  2A79 B;  1BHA A;  1M57 B;  3TJT A;  3AG1 B;  3DTU B;  1FXK B;  3APQ A;  1KP2 A;  5LMU B;  3CCR V;  2B1G A;  4MTG A;  1JFF A;  4O2A A;  1HWY A;  1HR0 O;  4K0K B;  4JTC B;  3K04 A;  4DV1 B;  1Y4M A;  3JSL A;  2XND G;  4PA4 A;  4CH6 A;  1XI1 A;  3C3T A;  3A2F A;  4X1Y B;  1NKD A;  4YXW G;  3G71 V;  1K73 W;  1XMO O;  2NLJ C;  4JYB A;  4OPA A;  4DYL A;  2OCH A;  2QR4 A;  4B3R O;  1KD1 W;  2ODM A;  3ZS8 C;  2HFE C;  3FKS G;  1TUB B;  5IJ9 A;  2IJJ A;  3K79 A;  4X64 B;  4JYA B;  4KP4 A;  4TV9 A;  2ZDI C;  1VEW A;  2QWN B;  1PNL A;  4PA6 A;  3K57 A;  4HAM A;  3ML0 A;  2HVJ C;  1YVW A;  3ZX6 A;  1JA8 A;  1IDS A;  1FS0 G;  2CTW A;  2N04 A;  4D7S A;  2BOC C;  2YIB D;  3N2K B;  2QM4 A;  2QSA A;  1GN6 A;  4JZG A;  3CC2 V;  2JRI A;  3VQW A;  1EM1 A;  1NTM H;  4B3M O;  5LP6 B;  5EIB C;  3K59 A;  3ZRW A;  4U3J B;  4JI1 O;  4HBN A;  2GDS A;  1BE3 H;  1SER A;  1RFY A;  4ICG A;  3A8T A;  1R6K A;  2Y0I A;  4B3S B;  4YIP A;  2W0X A;  3APO A;  4QIW F;  3J80 N;  4LP8 A;  4DK0 A;  3MHH C;  4X88 A;  5KLV H;  4TUY A;  1GN2 A;  2QKC A;  3FAV B;  3CXC U;  4GKJ B;  3R65 A;  5LHH A;  3O65 A;  1XHZ A;  3H1J H;  4JAV A;  1Y76 B;  2XAH A;  1O9H A;  2WLJ A;  5LHI A;  1B06 A;  2X6C A;  1LUV A;  3KCX A;  1WN7 A;  1UFI A;  2IJK A;  1EBO A;  4IHJ A;  4O4J A;  4X20 B;  2QM8 A;  4TOI A;  2DQ0 A;  2Q7G A;  4DR4 B;  1ZL8 A;  1V54 C;  1EFR G;  3ETQ A;  3K08 A;  4HNA B;  4JYY A;  4TV8 A;  4JI0 B;  1SC5 B;  1AR1 B;  1OZ0 A;  4GYC B;  1FXV A;  4B7K A;  4IL6 Z;  1NVP D;  2HR3 A;  4QE7 A;  4DR2 B;  4O2B B;  4WCE V;  3IAY A;  1XRE A;  2CK3 G;  2BTQ A;  4ZHQ A;  2UXC B;  4XDL A;  2B9Z A;  1VQ8 V;  4LFB O;  1AI6 A;  3OTF A;  2L6L A;  1FXH A;  5IT9 N;  4LFA B;  1VQP V;  4BIZ A;  1VP7 A;  4LBE C;  4EKW A;  2ZIN A;  4P9O A;  2DWE C;  1KQS U;  1L8D A;  1FJG B;  1G1X B;  5IJ0 A;  4LF9 B;  2HLD G;  3K0D A;  1MZF A;  1PV0 A;  1J5E B;  4NXM O;  3JD2 A;  4KHP O;  1WA8 A;  1X59 A;  1PKX A;  2W6J G;  2ZM6 O;  1HNX B;  3HKE B;  3WB2 A;  3CWB H;  3ZN0 A;  2IU3 A;  4BIU A;  4H13 B;  1KBH A;  3SYP A;  5B1N A;  3JD1 A;  1GN3 A;  4JI2 B;  1S5J A;  1BGY H;  2OYQ A;  4LFC O;  1M4U A;  2QM7 A;  5KA5 A;  2ZIO A;  2YID A;  5IYC O;  3QNE A;  4EFE A;  3I5D A;  2HEP A;  3SPG A;  4LH6 A;  5KAF Z;  5KHK A;  1Y74 A;  4OPH A;  2EIN C;  2L35 A;  4JI6 O;  2N74 A;  2UXB O;  4BR6 A;  3RYC A;  4OX9 B;  1AP5 A;  2DYR C;  4DRX B;  2P90 A;  1MMM A;  1FYJ A;  3E35 A;  2LP7 A;  4LWS B;  2QGN A;  3OMN B;  1VQO V;  1W0K G;  2OWO A;  4N23 A;  1PL0 A;  2NN4 A;  2VWK A;  2IW5 A;  3NR7 A;  3OEH G;  4JTA B;  2ZE7 A;  5A9G A;  1GRJ A;  4R6Z A;  1IUR A;  2Q67 A;  1TAE A;  4QNH B;  1IBK O;  5EBM C;  2P67 A;  5BXZ A;  3E22 B;  4YJ2 B;  1IBL B;  3IJ4 A;  4DV0 O;  1MSW D;  4JI4 B;  3B2E E;  3A0R A;  4NVP A;  3ASO B;  1NU1 H;  3OE7 G;  1Q7Y W;  3RYI B;  2Q73 A;  2ZR2 A;  1BT8 A;  2GV9 A;  3TK1 A;  3H1K H;  4GKK O;  1XOU A;  1KUQ A;  1N34 O;  3T1C A;  1W0J G;  3AG4 C;  4MS2 A;  1S76 D;  3OW2 U;  3W7X A;  3QF7 A;  1GKF A;  4UCR A;  1KU9 A;  1HNZ O;  1FXK A;  1MOF A;  3N27 A;  1MAB G;  4R50 A;  3RVY A;  1PL4 A;  3D8C A;  3CHX A;  1NT2 B;  2X6A A;  3E2E A;  5FLX N;  3JAM N;  1SQB H;  1G8M A;  3R66 A;  3IC7 A;  1R3K C;  1ORQ C;  4ASU G;  3P32 A;  3I55 V;  3FYI B;  5KX5 B;  2RJZ A;  2ZT9 B;  1IXM A;  4UV9 A;  4X1Y A;  1JMK C;  4PDR A;  3MDS A;  1MG1 A;  3B40 A;  5JWP A;  2F93 B;  4RUE A;  3BY6 A;  1SQV H;  2HVK C;  4ABM A;  3CCL V;  2PI5 A;  1TUB A;  2EIK B;  1MA1 A; 
#chains in the Genus database with same CATH homology
 1N4C A;  2QWO B;  1XBL A;  2GUZ B;  1HDJ A;  2KQX A;  3UO2 A;  2CTQ A;  2DMX A;  1IUR A;  4J7Z A;  1FPO A;  2QWQ B;  2YUA A;  2CTP A;  2LGW A;  1BQ0 A;  2QWN B;  1WJZ A;  2Y4U A;  2Y4T A;  2DN9 A;  2L6L A;  4RWU A;  1BQZ A;  2CTR A;  2EJ7 A;  2QWR B;  2CTW A;  2YS8 A;  2N04 A;  3BVO A;  2M6Y A;  2PF4 E;  1GH6 A;  2N05 A;  2CUG A;  3UCS C;  2QSA A;  3UO3 A;  1NZ6 A;  2OCH A;  2QWP B;  2LO1 A;  3APQ A;  3APO A;  3AG7 A;  2GUZ A;  4J80 A;  1FAF A;  4IT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...