1IURA

Dnaj domain of human kiaa0730 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
MHHHHHHLVPRGSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of DnaJ domain of human KIAA0730 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA0730 protein
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1iurA01
2Y4UA 1FAFA 2PF4E 3BVOA 2LGWA 3AG7A 4J7ZA 1IURA 2QSAA 2EJ7A 2L6LA 2QWPB 2QWNB 1XBLA 2GUZA 2YS8A 4RWUA 3UO2A 2CTWA 1GH6A 1FPOA 3APQA 2N04A 2QWRB 2QWOB 1WJZA 2CUGA 1BQ0A 2Y4TA 2CTQA 2KQXA 4J80A 2YUAA 2CTPA 2N05A 2OCHA 2QWQB 2LO1A 3UO3A 2DN9A 1BQZA 2M6YA 1N4CA 2CTRA 2GUZB 3APOA 4IT5A 1NZ6A 3UCSC 1HDJA 2DMXA
chains in the Genus database with same CATH superfamily
4H0LB 4AQYB 2QTOA 3CRRA 4O4HA 2Q8VA 1NR1A 3K06A 2QKSA 4F6RA 4B3RO 3ABMC 2Y69B 1H2NA 1B6QA 5IJ0B 2IJJA 1B04A 4FFBB 4PA3A 2AW9A 1Y4MA 2OWOA 1N0NA 1H2GA 5B66Z 4XDKA 3ZX6A 1TA8A 1IURA 4ZI7A 3S3WA 2WAMA 3C3TA 4CS3A 4KUMA 2UXXA 1URFA 3K04A 4UFZA 3E8GA 3BAAA 1LR1A 3ETQA 2P22C 2IU0A 3IC9A 4EKWA 3HR0A 3K9AA 1M93A 2VWJA 4LF8B 2LP7A 2QR4A 4IHJA 5IT9N 4O4IA 1RPRA 1F23A 4PELA 4IIJB 4DYLA 3LSUA 4ZOLA 3VQVA 2PI5A 3P3PA 4FPPA 1IXMA 1M9NA 3AG3C 3AG3B 1SA0B 3TXSA 4BR6A 3OM3B 4AILC 2JGDA 3CC2V 1T5EA 5IE9A 5JJJB 3E35A 3CXHF 4R50A 3UQ8A 4DV2O 4Z1MG 4FFBA 1BT8A 3E8HA 1PL0A 1R3LC 1SRYA 1Q6HA 1SKVA 4UVAA 3D3QA 5L3CA 1W2BU 2PYLA 1VQ8V 4B08A 4JYYA 2LFSA 3OAAG 4J10A 1SC5B 5LL6Y 1YIJV 3S3XA 2OTJV 4JI3B 4DR7B 1K34A 5CA1B 1P7GA 2ZNJA 3OTOB 1GAXA 4GX1A 3ETDA 1VQ7V 5LGTA 1SERA 4B3TB 2KB1A 1X59A 4ZIBA 1MSDA 4YJ2B 2QWNB 2UXCB 1XMQB 3SYPA 1VF7A 1IBMB 3QTCA 4JI6B 3J7AU 4QIWF 1IDSA 3JASA 4QPJA 3ABKC 1QBZA 3U10A 4DV3O 3BY6A 4TV9B 1EFRG 2P4KA 2P7TC 4F6RB 4AI8A 2AHYA 2WPDG 4B3TO 3JD0A 2R9RB 1AR4A 1NJIW 1IVSA 2Y4TA 4WFBV 3N27A 4DO2A 2CK3G 2Y48A 2WA4A 3P3NA 3KCXA 2GDSA 4DR4B 1F7YA 3T2MA 3VOUA 4X8AA 4TT3G 4LF4B 5DEDA 1WP7A 4AHCA 1G6UA 2W0FC 3CCRV 4LF4O 1EBOA 4PA7A 1KC8W 2UXNA 1MG1A 3CRMA 5KMGB 2OCCB 4O4IB 3HB3B 3R65A 4X1YB 4GKJO 5JCOC 4GYCB 3K5NA 4QE9A 5KUKA 4GT1A 3B8NA 2WWWA 4GKKO 2GSMB 2JEUA 1K73W 1AI5A 1E79G 1VQ9V 3CSXA 5LBQA 1KBHA 2PYJA 1VF5B 3MDSA 5J9PC 4LH7A 2Q0OC 4YJ3A 2Z0AA 1OCOC 4W4KA 1N36O 4X1IB 2V1DA 1NS1A 5FPRA 4LF8O 1CPYA 1N33O 3G6BA 4KP4A 1G8MA 3SPCA 2GUZB 3CRAA 2X6AA 1Z5VA 5HFLA 5TISZ 3N2KB 1NVPD 4O4HB 2Q6AA 4DR2B 1VQKV 5GONB 1KB9F 1KP2A 2LFRA 3AEIA 3RYFB 1GTOA 5B1NA 1D5AA 4CC5A 2ITDC 1AI4A 4Q6GA 3JATB 1NR7A 1ZX3A 2F43G 2RDCA 3TETA 2FTKA 4DR1B 1FXKC 3H1JH 1ZL8A 1BS3A 2F1MA 4ABMA 4J11A 1JQ0A 1R3IC 4MVSA 5J2UA 4IGGA 3ABMB 2V7QG 1CXZB 2BOCC 5A9GA 4AQYO 1JPXA 2F4VO 4JYAO 2E74B 4LF9O 1KU9A 4U3FH 4X62B 1S3JA 5B1BC 4FLYA 4X66O 4MVQA 5DN6G 3E2EA 1XL6A 1BMFG 4JTCB 2ZM6B 4EB6A 4FLTA 1KUQA 4PDLA 1N33B 4NXMB 3IGAC 2CUGA 4R7CA 2JIZG 4JASA 2P5OA 3UO3A 3K03A 3HKBB 3OMIB 4B3SB 2E5LB 1RPOA 1MNGA 4R8CA 3T1CA 5CA0B 4GZRB 2KSDA 3J80N 2E5LO 4KFMA 1FJGB 1HWYA 4JI7B 4LFCO 5B1OA 3JARA 4NYKA 5JVDA 5GTIZ 4LWSA 1AP6A 2WSSG 3CCUV 1JA8A 1SQQH 3RBZA 1EN5A 1FXKA 4I0XB 3JAWB 4UCSA 2B1IA 1G1XB 4OPAA 2BOBC 5EBLC 1JCHA 5EC1C 3OUFA 2JVDA 2M7WA 2IJHA 3F5WC 3CWBH 3AK1A 4LF9B 2OCCC 5KHJA 4JYAB 4UXNA 3ABUA 4LR3A 1DF4A 4FLXA 3LSQA 3ZHRA 3ABTA 2OYQA 4OGQB 3L72H 4TV9A 3ZHSA 2JRIA 3SR2C 1NH2B 4WFHA 4LNUB 1FFXA 3D8CA 1Z2GA 3AG1B 3QO7A 4EB6B 4I7ZB 4TV8A 3EFFK 1WA8A 3JSLA 3K9SA 4ZHQA 1H2LA 5HFMA 2KG7B 2FL4A 4RWUA 2UU9B 5C8YA 4X89A 5GW7A 3CPWU 3ABKB 5DM6V 4H13B 1VQOV 3T4ZA 2FYUH 1OCZC 3RYHA 4DR5O 2PTMA 3HPLC 2UUAO 1SQFA 5CA3A 1Q6IA 2YC0A 5CA1A 3I55V 2EILB 4DV6O 2HEPA 4GX5A 5JCOA 2OT5A 4O2AA 3JALA 5IY5B 1IZ3A 2XT9A 3ASOB 3ASOC 4BWAA 1LUWA 1TVKB 1Q5OA 1N34B 1XMOB 4PA6A 3X2QC 3K57A 3JCZA 3CMAV 2Y0IA 5K1PA 2D3OW 2A06H 3SPGA 2ZQMA 5BMVA 2KKWA 1WAZA 4J9YB 5JWPA 4X1KA 4UV9A 1AB3A 2DYSC 5CA0A 4TUYA 1K8AW 1AJPA 2HHHO 3JAMN 1PD3A 4I50B 3K0GA 4A5UB 2ZXWC 3RVYA 2ZR3A 1YZBA 1GK9A 5L3FA 3H1HH 3UCSC 3TCUA 4LC1A 3NR7A 3ZJZA 4JGSA 4I4TA 2JEXA 3ZBHA 1TUBB 4DV0O 1L8DA 2OIEA 1PPJH 4FZ1A 4JAAA 3AG2C 2N74A 4PD4F 2YUAA 5JQGB 1XL4A 1SQPH 1XQ8A 4HAMA 4L87A 4DV3B 3OMNB 5KUMA 5H6RA 2R9IA 4B3SO 3CRCA 3CMEV 4X1KB 3E8BA 2ETNA 2QJ1A 5FLXN 1IBMO 3TGUH 1XMQO 3JATA 3OGIB 3QO8A 3CHXA 1VQMV 2UXCO 2WLLB 3K5LA 2QWQB 2E76B 4MVUA 3CXCU 1GMGA 4DV4O 1F4NA 2CTRA 1NZ6A 2HJDA 3VQWA 2Z3YA 1AI6A 2A0LA 2PF4E 2FMLA 4HNAA 4J7ZA 4I55B 1AJQA 3ZIAG 2Q0AA 4U7OA 2WLMA 4B7EA 2F4VB 2Q68A 2YDEA 3SPHA 2Z5UA 3OFNG 3W7XA 4B7KA 1P49A 4ICGA 4X1IA 3FAVB 1IBLB 4JI0B 4NXNO 3LSSA 4YJ3B 1RP3B 1Y66A 3G6EV 2B9ZA 4LF6O 3L74H 3RT3C 2IW5A 3RYCA 2HG5C 2YSUB 4P30A 2P90A 4PJ0Z 2F23A 3IFXA 1M5IA 4CBCA 3L73H 3TJTA 3K59A 5LXTA 4JI1O 2EILC 3ZMZA 4N23A 3ZRXA 1N32O 2IJKA 1AROP 5FNVA 2IJIA 2L6LA 2DYRB 1NU1H 1HNZB 3O9OA 2XASA 3HKDA 3WG7B 2QTSA 1QQCA 3X2QB 1R6NA 1NTKH 3SYAA 5LHGA 2Q73A 4PDRA 2H8PC 3IAYA 4MS2A 2YI8A 4B3RB 4TWKA 1H8HG 2AXTZ 2K9PA 1YVWA 4RUEA 2V4DA 5KA6A 2YIAA 2WLKA 3AG1C 5CB4B 3OEHG 2Q5ZA 1YI2V 2RNBA 1COWG 1NKDA 4QGPA 1P84F 1XNQO 1QU7A 4UCUA 1VEWA 4LFBB 2Y4UA 3HKBA 3M8AA 3OD4A 2JS3A 2ARHA 1WA8B 2UXDB 3T1YB 4FZ0A 3CX5F 4H44B 1N0JA 3L9DA 4DV5B 3Q4HA 4F6EA 3E22B 1FD9A 3RVZA 2BCCH 4DV1O 4MT8A 1QNMA 3K3WA 4K3AA 5J2UB 3G80A 1GO3F 1MZEA 5CB4A 2WLHA 4K35A 3O65A 4GX0A 3JAWA 2ZR2A 4KHPB 1H38A 3QG5A 4JZ2A 3EHBB 2PUSA 1WLEA 1UPGA 3D3IA 1VQ5V 4C7UA 3EXAA 4U7NA 1G4YB 3OMAB 5CN0A 2EINC 3ZN0A 4FIPC 4IYIA 4Z2WA 1K7DA 4FLVA 2QKCA 5A2QN 4BIZA 2GV9A 2DQ3A 3FB6C 1XDCA 5LP6C 3FD9A 5LYJB 1YJNV 4KXRA 1S5HC 1XHZA 3ZMTA 1NTZH 4PDMA 3B40A 3BCCH 2Q69A 1BQ0A 4JPRA 4X65B 4K8ZA 2ADQB 2DWDC 1E1RG 1MA1A 4IIJA 2DWEC 1JR9A 5CMUA 1N4CA 3FB5C 1OCOB 1U96A 2EZPA 4GUNA 2QE7G 1XUQA 4BIUA 4K8XA 3T1HO 1ZWIC 3GVMA 5B1AB 2Q67A 5GTHZ 1Z5WA 1M90W 4CH4A 3BA9A 4U3JA 1ZTEA 2P6JA 4LF5O 4LF7O 4O2BB 3ZHVA 5LMNO 2AZ2A 4YIPA 1J95A 2WLNA 1OHHG 1OCCC 5H6QA 2RMKB 3B8MA 3B09A 2HP8A 2UXBB 4UVCA 2IH3C 1QHTA 3F7VC 2NLJC 2KG7A 2NN4A 1NH2D 1OJHA 3Q4HB 5LGNA 1L0NH 3CCMV 1BE3H 2ILMA 2QM4A 5LXTB 2KQXA 2R9AA 1XILA 2XAHA 5EK0A 4I9QA 2PY5A 2DQ0A 2VQEO 5H9CA 5LYJA 4WFFA 1K4DC 3UM7A 2IM9A 5EC2C 5BY1A 1PNLA 4JF3A 5KX5A 2E3CA 3GB7C 3HKEB 4YXWG 4ASUG 5EYPA 3SDLA 1I5YA 2N04A 2XNDG 5K1XA 3I56V 4YJ2A 1W0KG 2MK3A 1K97A 2EIKC 4NTYA 5J2TB 3AK2A 4DW1A 3JYCA 4K0KO 2ZNIA 5BR8B 1QLEB 3LNMB 3WG7C 4MVRA 1AJNA 1FXHA 3PJSK 3ZMVA 2A9HA 1Q90D 1TUBA 5KHHA 5D5PA 5L3DA 3HKDB 5ITZB 1JVMA 2BSKA 2ZT9B 3E86A 3K58A 4DUZO 2DYSB 3E22A 5E1AC 3APOA 2XAQA 2YEVB 1QR9A 4O4JB 3CJHA 3UT5B 4BW5A 3IJ4A 2QSAA 3RYIA 3OUSA 5LA6A 3RN4A 4JI8O 2LGQA 4G28B 1BSMA 4PDVA 2RN9A 3FFQA 1FYJA 3E89A 4MVZA 1ZL8B 1KMIZ 4LCUC 4LF7B 1CP9A 4LP8A 3W7TA 3KZIZ 1HR0B 1OV9A 4I4TB 4D7SA 2XOKG 2AGAA 1I7FA 1FXVA 4X20B 2QWRB 1V9PA 2JGUA 2EIMB 4YHHB 2EIMC 4RAIA 4ZI7B 4FLZA 1DK1A 1Q6UA 3ZHQA 4UB6Z 1Y76A 4PI0A 1R1BA 3OGCC 1PNKA 3DC5A 5IYCO 2CTWA 4LFAO 2YIDA 1J5EO 4PV1B 2R72A 2UUCO 2JGDB 4LNUA 1OCCB 3ZRVA 3HKCB 3L75H 3QNEA 3N2GA 5KHKA 3FKSG 4X1YA 3B77A 1XBLA 3E8FA 5J2TA 3BRCA 1HNXO 2EZOA 2XAJA 5L3EA 5LP6A 4X64O 2A7WA 1Q81W 1BL8A 4UB8Z 3OW2U 5EYPB 3WB0A 3STLC 4DK1A 2DE0X 4Z1VA 3STZC 4GLXA 2VS0A 5E79Z 5IYDO 5AG2A 2VQFB 4KHPO 1O9HA 2ZXWB 3P32A 3T4DA 1FFTB 2QKAA 1VQPV 4O4LB 2YXLA 5KA5A 2LQTA 2LW1A 1WNSA 5IWAO 5LA6B 3JD3A 4NVPA 1H2MA 1KD1W 1RSOA 1MOFA 4DV7B 4DR6O 5CBHA 3W7WA 4FM1A 1B06A 2CTPA 4UV8A 5FL7G 3ZHTA 2ZIMA 1P7BA 1QLEC 1KYOF 2E75B 3K0DA 4IYHA 3CP1A 5KAIZ 1XI1A 3LUTB 2PGGA 3K08A 1NVPB 4ZKIA 1SQGA 1R6TA 4DUYO 1FPOA 3F7YC 4WFGA 3H1LH 2LJ2A 2P67A 2O57A 2Q9LA 2JDIG 3R66A 4PA9A 2GHYA 1K5QA 2HVKC 3CCQV 4F4LA 3MAQA 1W0JG 3D36A 1D2DA 4MTOA 1KECA 2F95B 2ZE8A 2EX3A 1EM1A 3ABLB 3CB2A 4BW9A 4BAYA 2M6YA 5H2FZ 1YJWV 3ZMUA 2EJRA 1HDJA 2MW2B 1PKXA 2IU3A 4JTAB 5KX5B 1QCEA 3FB7C 2EIKB 4WBNA 2XHBA 1DF5A 4MW3A 1N32B 4MW8A 4WCEV 3QF7A 3NXSA 4FLWA 2N05A 1AILA 1QVGU 1I94O 2FB5A 5IYZA 3I5DA 1IXBA 4FMTA 4RUFA 1JFFA 4X65O 3ZRSA 1GRJA 2ZKOA 5LHHA 3FYIB 2F93B 2RCVA 1MMMA 5LOVB 1SA0A 2DW4A 3FX7A 1R3KC 2Q7GA 3W7SA 4D6TH 4ZOLB 4N21A 4MTXA 1SQBH 4O4LA 2F66C 4JI0O 1IBLO 3C3SA 4JI5B 2DMXA 4DV7O 1VF6A 3OR7C 4R6ZA 1XEQA 3CRQA 3AG7A 4NTWA 2WA3A 5GONA 3SJAC 4OPHA 3KKYA 3B4SA 1THZA 4UCRA 4W4LA 3VQYA 2D2CB 1NI8A 4E2LA 2R70A 1K92A 2Q7HA 5LMUB 3ZN1A 5KAFZ 4DR3B 1I08A 1X4TA 3LNNA 2YICA 1RM1C 4P9PA 1PP9H 1BGYH 1GH6A 1BZKA 3WU2Z 2QWOB 3SYCA 2Q4PA 2W6JG 3LDCA 5LMNB 1P4RA 4J7JA 4P2ZA 3H9VA 1XNRO 2ZDIC 3GWKC 2ZD9A 4LFAB 1L0LH 3WB2A 2CH7B 1VQ6V 3T1HB 4UCTA 1BCCH 1XNRB 4YY3B 1NT2B 4PA4A 5EBWC 3OTFA 4RQEA 2JJ1G 1AR1B 4DR6B 4LFBO 4JI2B 4Q20A 1QR8A 2YI9A 3EVKA 5L3GA 5IWAB 1K3EA 1VMGA 2QEXV 3RGBA 3ZS8C 3BABA 2VQFO 4RO2A 1F51A 1GKFA 2XAFA 3CE2A 1HR0O 1YSCA 1IBKO 2ZDIA 1VQNV 5IJ9B 1ZAUA 2ZINA 4JAUA 3CCEV 2GBOA 4DXWA 4J41A 4X64B 3SGIA 3JASB 3A0BZ 3SJBC 2YXYA 1XREA 1L1FA 4IL6Z 3CYOA 4UVBA 5EIBC 2EINB 2X6CA 4JI5O 2LW7A 4NB5A 1GN4A 3ASNC 4X9QA 2UUCB 4QNHB 1ZLZA 1J5EB 1IBKB 1PM9A 4H37A 4YIOA 1Y74A 3ZEDA 5LP6B 1WPXA 1AVMA 1JFFB 4H33A 1KKCA 1UJWB 1GM8A 4HZ3A 4JV5O 1PNMA 5JH7B 2YIBD 3H1IH 1EZJA 1VP7A 1JOYA 3BEHA 4JI2O 3P30A 4P9OA 4UUJC 5FPOA 2Y0PA 4MTFA 3A0HZ 5BR8O 1KQSU 2HVJC 4JAVA 1PL4A 4YHHO 2ZCEA 2XAGA 2QDOA 3CS5A 2ATKC 4J7KA 2DN9A 1Y6XA 4CS4A 3RYFA 3K5MA 5BZBA 2WLJA 3QVNA 3SPIA 2QGNA 3G4SV 3BA8A 4LH6A 3CCVV 2UXDO 2P4VA 1RFYA 5DECA 2CE4A 3TK1A 4OXSA 1V54B 1I5XA 3SJCC 3QO5A 1JMKC 3DXRB 3E83A 1FXKB 1XHXA 2ITCC 1RM1B 2DOSA 4MVOA 2L35A 4QJFB 2EIJB 3CC4V 4WFAV 1WJZA 4GCZA 3IC7A 3BPZA 2AHZA 1H2SB 4PI2A 4XBFA 5B1BB 4QPKA 5C8YB 5IJ9A 4CH3A 1BHBA 1M1KW 4FJCC 4K0KB 4NXMO 1YJ9V 2QA4V 5IY5C 5IYBO 5FNVB 1AR5A 3AG2B 1VQ4V 4WFEA 5LHIA 2WLLA 1VARA 1K4CC 2VWKA 2OCHA 3JD2A 1Q3EA 3JALB 3UKMA 3CCJV 3FB8C 5F2VO 2X7RB 2A79B 4JV5B 1R73A 4FK5C 2ZIOA 2ADPA 4ZBMA 2CH7A 2VQEB 1JX9A 3WB1A 4MSWC 1S77D 4MVMA 3ZRWB 2JS5A 1NTMH 3MHSC 3AG4C 4KL1A 1N8RW 1ZSPA 3OT7A 1OCRC 1N34O 3HKEA 1SZTA 3ML0A 5LOVA 3AK3A 1EN6A 4CS2A 1K9MW 2CGNA 2BE3A 2HLDG 3ASNB 2BTQB 2P06A 1YITV 2G38A 4BIOA 4E4EA 1JJOA 4NR1A 4XDLA 1GN6A 4TQFA 3K5OA 1YF2A 3FYEB 1W59A 4G2KA 5ITZA 4TSFG 1GN3A 5EIBD 4JYCA 4O2AB 2QM8A 4O2BA 4DUYB 2YXHA 4HYOA 1OCZB 4YY3O 2VRZA 1M57B 2RQ6A 1TVKA 1PV0A 3U0ZA 4HBNA 1AP5A 4UCVA 3CEIA 4J42A 3BHPA 4IHJB 4I5SA 4TQDA 4GKKB 2JK5C 2JJ2G 1YEWA 4DV0B 4GKJB 1M56C 3SJQC 1Y67A 2W0XA 3MHHC 3RWRD 3ABLC 2DYRC 3ETGA 4FM2A 1XNQB 3RYIB 1H8EG 2NR5A 3OE7G 2X0LA 1VQLV 4J9ZB 3THOA 1DLBA 1YTFD 4DR4O 3ZCCA 1R3JC 4DR3O 5KLVH 2OIGA 1DGSA 2X6BA 5LMUO 1WB7A 3A2FA 4JZGA 1YDXA 3CCSV 5JJEB 5IYZB 4DUZB 1SQVH 2H94A 4TUYB 3JD4A 3F5TA 1B3QA 4RQFA 5JH7A 1KP3A 3SYOA 3RYCB 1WP8A 1V55B 4DV1B 1HNZO 4NKGB 2OTLV 1TGOA 2GTAA 1E1QG 1OZ0A 1K33A 5B1AC 2EULA 3GWOA 3WFVA 3FAVA 3DXRA 3CC7V 4JI1B 3KG2A 1CEZA 3T1YO 3A0RA 3OR6C 5H5NA 1HW7A 3H01A 2PZSA 3D36C 4HNAB 1I94B 2FKXA 5JJNB 1NQTA 1V54C 2C2AA 2A3QA 5EBMC 2EBOA 1LUVA 3JSNA 1YTFB 5L3BA 1YXBA 2QM7A 2BTQA 1TAEA 2AZ0A 1FS0G 2GTSA 3A8TA 2BSKB 1SETA 4I55A 1S5JA 4DR1O 4DV2B 2YEVA 4O4JA 2UXBO 1OCRB 4X88A 4DRXA 1SS3A 1H2KA 4UCOA 4FVMA 2B5UA 4JYBA 2HR3A 5IDJA 3DTUB 4DW0A 3ETEA 1Q7YW 2CDYA 4L8JA 4DR2O 4NTXA 5KHGA 4DV4B 4PHZA 1Y74B 1Q43A 1S5LZ 1IX9A 2Y69C 2ZE5A 1MZFA 4FFKA 5EZYB 1QVFU 3JAKB 4LFCB 4JI7O 2EJ7A 3PN1A 1R6KA 2WLIA 4DRXB 4EFEA 1ROPA 4MTGA 4ZHQB 4JTDB 3SYQA 2NNUA 4TV8B 2W6IG 2XTAA 1A32A 3L70H 3KCYA 3LDEA 4CH6A 4CH5A 4G27B 4CZZA 1FAFA 4LF6B 1GM7A 2ZE6A 3DC6A 4FLUA 2QWPB 1O9GA 2RJZA 3CJHB 3ZMSA 2GUZA 1WN7A 4I50A 1EN4A 5B5EZ 1JJ2U 2K1EA 4X66B 4U3JB 1VF6C 5BMVB 2ZE7A 1FKAO 1S0VA 3CD6V 5EZYA 3G67A 4LWSB 1ZUQA 3VBBA 3M99B 4FM0A 1HNXB 3JCUZ 4I9WA 1M4UA 2UUBO 1MABG 3M7MX 4JI4O 4X20A 1XMOO 3B2EE 1SESA 3U11A 1GM9A 2H3OA 1ENVA 1QLNA 1U97A 3BVOA 1WB8A 4LF5B 4XDJA 1FFXB 4DV6B 4DV5O 4J80A 1NBMG 1Y76B 3VQXA 2CAZC 2BTOA 4EEQA 4OX9B 4DR7O 2DJVA 1KKDA 2HKOA 4LBEC 2B1GA 1WPBA 1N36B 3LDDA 3UT5A 4EFBA 1D5NA 3ZRWA 1GN2A 2CGOA 3W7UA 2HJFC 3DSQA 1VIBA 2XUMA 1SF9A 3MD0A 4B3MB 3APQA 1YCIA 3K79A 4QE7A 3JAKA 5JQGA 1HNWB 5JVDB 2Q7EA 2LO1A 3CCLV 3JD1A 2HHHB 3RW0A 2WLIB 4I0XA 4WF9V 1HNWO 4CC6A 2EIJC 5D5QA 1S72V 5CBGA 2LGWA 1Q82W 1Q86W 2IH1C 3J81N 1SQXH 4B3MO 3H1KH 4D7TA 3JARB 1AI7A 3C90A 3DGEA 1HP8A 1K5SA 2YS8A 3UO2A 1US6A 3OEEG 2HFEC 5BXZA 1TUEB 3G71V 4JI8B 1V55C 1MSWD 2IBZH 3BFRA 4OX9O 3ICXA 3N2KA 2ODMA 1RSOB 5C93A 1Q8IA 4DK0A 4WBNB 2UUAB 1FJGO 3TXQA 3ZHUA 4DR5B 3SPJA 2UU9O 4JI6O 1BQZA 1ORQC 1XOUA 4JI4B 4IT5A 2YIBA 2UUBB 3RYHB 1BHAA 1M57C 3N2GB 2ZM6O 1DTOA 4NXNB 4TOIA 3AG4B 1F4MA 5KMGA 1I0HA 3L71H 5KHIA 5CBFA 3OTOO 2PI4A 2CTQA 3RFRA 1UFIA 1M56B 4JI3O 5LGUA 1LNQA 1SZXA 4X62O 1S76D 5IJ0A 5B3SC 1YHQV 3HKCA 5B3SB 4GX2A 1EZVH
chains in the Genus database with same CATH topology
2Y4UA 1FAFA 2PF4E 3BVOA 2LGWA 3AG7A 4J7ZA 1IURA 2QSAA 2EJ7A 2L6LA 2QWPB 2QWNB 1XBLA 2GUZA 2YS8A 4RWUA 3UO2A 2CTWA 1GH6A 1FPOA 3APQA 2N04A 2QWRB 2QWOB 1WJZA 2CUGA 1BQ0A 2Y4TA 2CTQA 2KQXA 4J80A 2YUAA 2CTPA 2N05A 2OCHA 2QWQB 2LO1A 3UO3A 2DN9A 1BQZA 2M6YA 1N4CA 2CTRA 2GUZB 3APOA 4IT5A 1NZ6A 3UCSC 1HDJA 2DMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  1FAF A;  2PF4 E;  3BVO A;  2LGW A;  3AG7 A;  4J7Z A;  1IUR A;  2QSA A;  2EJ7 A;  2L6L A;  2QWP B;  2QWN B;  1XBL A;  2GUZ A;  2YS8 A;  4RWU A;  3UO2 A;  2CTW A;  1GH6 A;  1FPO A;  3APQ A;  2N04 A;  2QWR B;  2QWO B;  1WJZ A;  2CUG A;  1BQ0 A;  2Y4T A;  2CTQ A;  2KQX A;  4J80 A;  2YUA A;  2CTP A;  2N05 A;  2OCH A;  2QWQ B;  2LO1 A;  3UO3 A;  2DN9 A;  1BQZ A;  2M6Y A;  1N4C A;  2CTR A;  2GUZ B;  3APO A;  4IT5 A;  1NZ6 A;  3UCS C;  1HDJ A;  2DMX A; 
#chains in the Genus database with same CATH topology
 4H0L B;  4AQY B;  2QTO A;  3CRR A;  4O4H A;  2Q8V A;  1NR1 A;  3K06 A;  2QKS A;  4F6R A;  4B3R O;  3ABM C;  2Y69 B;  1H2N A;  1B6Q A;  5IJ0 B;  2IJJ A;  1B04 A;  4FFB B;  4PA3 A;  2AW9 A;  1Y4M A;  2OWO A;  1N0N A;  1H2G A;  5B66 Z;  4XDK A;  3ZX6 A;  1TA8 A;  1IUR A;  4ZI7 A;  3S3W A;  2WAM A;  3C3T A;  4CS3 A;  4KUM A;  2UXX A;  1URF A;  3K04 A;  4UFZ A;  3E8G A;  3BAA A;  1LR1 A;  3ETQ A;  2P22 C;  2IU0 A;  3IC9 A;  4EKW A;  3HR0 A;  3K9A A;  1M93 A;  2VWJ A;  4LF8 B;  2LP7 A;  2QR4 A;  4IHJ A;  5IT9 N;  4O4I A;  1RPR A;  1F23 A;  4PEL A;  4IIJ B;  4DYL A;  3LSU A;  4ZOL A;  3VQV A;  2PI5 A;  3P3P A;  4FPP A;  1IXM A;  1M9N A;  3AG3 C;  3AG3 B;  1SA0 B;  3TXS A;  4BR6 A;  3OM3 B;  4AIL C;  2JGD A;  3CC2 V;  1T5E A;  5IE9 A;  5JJJ B;  3E35 A;  3CXH F;  4R50 A;  3UQ8 A;  4DV2 O;  4Z1M G;  4FFB A;  1BT8 A;  3E8H A;  1PL0 A;  1R3L C;  1SRY A;  1Q6H A;  1SKV A;  4UVA A;  3D3Q A;  5L3C A;  1W2B U;  2PYL A;  1VQ8 V;  4B08 A;  4JYY A;  2LFS A;  3OAA G;  4J10 A;  1SC5 B;  5LL6 Y;  1YIJ V;  3S3X A;  2OTJ V;  4JI3 B;  4DR7 B;  1K34 A;  5CA1 B;  1P7G A;  2ZNJ A;  3OTO B;  1GAX A;  4GX1 A;  3ETD A;  1VQ7 V;  5LGT A;  1SER A;  4B3T B;  2KB1 A;  1X59 A;  4ZIB A;  1MSD A;  4YJ2 B;  2QWN B;  2UXC B;  1XMQ B;  3SYP A;  1VF7 A;  1IBM B;  3QTC A;  4JI6 B;  3J7A U;  4QIW F;  1IDS A;  3JAS A;  4QPJ A;  3ABK C;  1QBZ A;  3U10 A;  4DV3 O;  3BY6 A;  4TV9 B;  1EFR G;  2P4K A;  2P7T C;  4F6R B;  4AI8 A;  2AHY A;  2WPD G;  4B3T O;  3JD0 A;  2R9R B;  1AR4 A;  1NJI W;  1IVS A;  2Y4T A;  4WFB V;  3N27 A;  4DO2 A;  2CK3 G;  2Y48 A;  2WA4 A;  3P3N A;  3KCX A;  2GDS A;  4DR4 B;  1F7Y A;  3T2M A;  3VOU A;  4X8A A;  4TT3 G;  4LF4 B;  5DED A;  1WP7 A;  4AHC A;  1G6U A;  2W0F C;  3CCR V;  4LF4 O;  1EBO A;  4PA7 A;  1KC8 W;  2UXN A;  1MG1 A;  3CRM A;  5KMG B;  2OCC B;  4O4I B;  3HB3 B;  3R65 A;  4X1Y B;  4GKJ O;  5JCO C;  4GYC B;  3K5N A;  4QE9 A;  5KUK A;  4GT1 A;  3B8N A;  2WWW A;  4GKK O;  2GSM B;  2JEU A;  1K73 W;  1AI5 A;  1E79 G;  1VQ9 V;  3CSX A;  5LBQ A;  1KBH A;  2PYJ A;  1VF5 B;  3MDS A;  5J9P C;  4LH7 A;  2Q0O C;  4YJ3 A;  2Z0A A;  1OCO C;  4W4K A;  1N36 O;  4X1I B;  2V1D A;  1NS1 A;  5FPR A;  4LF8 O;  1CPY A;  1N33 O;  3G6B A;  4KP4 A;  1G8M A;  3SPC A;  2GUZ B;  3CRA A;  2X6A A;  1Z5V A;  5HFL A;  5TIS Z;  3N2K B;  1NVP D;  4O4H B;  2Q6A A;  4DR2 B;  1VQK V;  5GON B;  1KB9 F;  1KP2 A;  2LFR A;  3AEI A;  3RYF B;  1GTO A;  5B1N A;  1D5A A;  4CC5 A;  2ITD C;  1AI4 A;  4Q6G A;  3JAT B;  1NR7 A;  1ZX3 A;  2F43 G;  2RDC A;  3TET A;  2FTK A;  4DR1 B;  1FXK C;  3H1J H;  1ZL8 A;  1BS3 A;  2F1M A;  4ABM A;  4J11 A;  1JQ0 A;  1R3I C;  4MVS A;  5J2U A;  4IGG A;  3ABM B;  2V7Q G;  1CXZ B;  2BOC C;  5A9G A;  4AQY O;  1JPX A;  2F4V O;  4JYA O;  2E74 B;  4LF9 O;  1KU9 A;  4U3F H;  4X62 B;  1S3J A;  5B1B C;  4FLY A;  4X66 O;  4MVQ A;  5DN6 G;  3E2E A;  1XL6 A;  1BMF G;  4JTC B;  2ZM6 B;  4EB6 A;  4FLT A;  1KUQ A;  4PDL A;  1N33 B;  4NXM B;  3IGA C;  2CUG A;  4R7C A;  2JIZ G;  4JAS A;  2P5O A;  3UO3 A;  3K03 A;  3HKB B;  3OMI B;  4B3S B;  2E5L B;  1RPO A;  1MNG A;  4R8C A;  3T1C A;  5CA0 B;  4GZR B;  2KSD A;  3J80 N;  2E5L O;  4KFM A;  1FJG B;  1HWY A;  4JI7 B;  4LFC O;  5B1O A;  3JAR A;  4NYK A;  5JVD A;  5GTI Z;  4LWS A;  1AP6 A;  2WSS G;  3CCU V;  1JA8 A;  1SQQ H;  3RBZ A;  1EN5 A;  1FXK A;  4I0X B;  3JAW B;  4UCS A;  2B1I A;  1G1X B;  4OPA A;  2BOB C;  5EBL C;  1JCH A;  5EC1 C;  3OUF A;  2JVD A;  2M7W A;  2IJH A;  3F5W C;  3CWB H;  3AK1 A;  4LF9 B;  2OCC C;  5KHJ A;  4JYA B;  4UXN A;  3ABU A;  4LR3 A;  1DF4 A;  4FLX A;  3LSQ A;  3ZHR A;  3ABT A;  2OYQ A;  4OGQ B;  3L72 H;  4TV9 A;  3ZHS A;  2JRI A;  3SR2 C;  1NH2 B;  4WFH A;  4LNU B;  1FFX A;  3D8C A;  1Z2G A;  3AG1 B;  3QO7 A;  4EB6 B;  4I7Z B;  4TV8 A;  3EFF K;  1WA8 A;  3JSL A;  3K9S A;  4ZHQ A;  1H2L A;  5HFM A;  2KG7 B;  2FL4 A;  4RWU A;  2UU9 B;  5C8Y A;  4X89 A;  5GW7 A;  3CPW U;  3ABK B;  5DM6 V;  4H13 B;  1VQO V;  3T4Z A;  2FYU H;  1OCZ C;  3RYH A;  4DR5 O;  2PTM A;  3HPL C;  2UUA O;  1SQF A;  5CA3 A;  1Q6I A;  2YC0 A;  5CA1 A;  3I55 V;  2EIL B;  4DV6 O;  2HEP A;  4GX5 A;  5JCO A;  2OT5 A;  4O2A A;  3JAL A;  5IY5 B;  1IZ3 A;  2XT9 A;  3ASO B;  3ASO C;  4BWA A;  1LUW A;  1TVK B;  1Q5O A;  1N34 B;  1XMO B;  4PA6 A;  3X2Q C;  3K57 A;  3JCZ A;  3CMA V;  2Y0I A;  5K1P A;  2D3O W;  2A06 H;  3SPG A;  2ZQM A;  5BMV A;  2KKW A;  1WAZ A;  4J9Y B;  5JWP A;  4X1K A;  4UV9 A;  1AB3 A;  2DYS C;  5CA0 A;  4TUY A;  1K8A W;  1AJP A;  2HHH O;  3JAM N;  1PD3 A;  4I50 B;  3K0G A;  4A5U B;  2ZXW C;  3RVY A;  2ZR3 A;  1YZB A;  1GK9 A;  5L3F A;  3H1H H;  3UCS C;  3TCU A;  4LC1 A;  3NR7 A;  3ZJZ A;  4JGS A;  4I4T A;  2JEX A;  3ZBH A;  1TUB B;  4DV0 O;  1L8D A;  2OIE A;  1PPJ H;  4FZ1 A;  4JAA A;  3AG2 C;  2N74 A;  4PD4 F;  2YUA A;  5JQG B;  1XL4 A;  1SQP H;  1XQ8 A;  4HAM A;  4L87 A;  4DV3 B;  3OMN B;  5KUM A;  5H6R A;  2R9I A;  4B3S O;  3CRC A;  3CME V;  4X1K B;  3E8B A;  2ETN A;  2QJ1 A;  5FLX N;  1IBM O;  3TGU H;  1XMQ O;  3JAT A;  3OGI B;  3QO8 A;  3CHX A;  1VQM V;  2UXC O;  2WLL B;  3K5L A;  2QWQ B;  2E76 B;  4MVU A;  3CXC U;  1GMG A;  4DV4 O;  1F4N A;  2CTR A;  1NZ6 A;  2HJD A;  3VQW A;  2Z3Y A;  1AI6 A;  2A0L A;  2PF4 E;  2FML A;  4HNA A;  4J7Z A;  4I55 B;  1AJQ A;  3ZIA G;  2Q0A A;  4U7O A;  2WLM A;  4B7E A;  2F4V B;  2Q68 A;  2YDE A;  3SPH A;  2Z5U A;  3OFN G;  3W7X A;  4B7K A;  1P49 A;  4ICG A;  4X1I A;  3FAV B;  1IBL B;  4JI0 B;  4NXN O;  3LSS A;  4YJ3 B;  1RP3 B;  1Y66 A;  3G6E V;  2B9Z A;  4LF6 O;  3L74 H;  3RT3 C;  2IW5 A;  3RYC A;  2HG5 C;  2YSU B;  4P30 A;  2P90 A;  4PJ0 Z;  2F23 A;  3IFX A;  1M5I A;  4CBC A;  3L73 H;  3TJT A;  3K59 A;  5LXT A;  4JI1 O;  2EIL C;  3ZMZ A;  4N23 A;  3ZRX A;  1N32 O;  2IJK A;  1ARO P;  5FNV A;  2IJI A;  2L6L A;  2DYR B;  1NU1 H;  1HNZ B;  3O9O A;  2XAS A;  3HKD A;  3WG7 B;  2QTS A;  1QQC A;  3X2Q B;  1R6N A;  1NTK H;  3SYA A;  5LHG A;  2Q73 A;  4PDR A;  2H8P C;  3IAY A;  4MS2 A;  2YI8 A;  4B3R B;  4TWK A;  1H8H G;  2AXT Z;  2K9P A;  1YVW A;  4RUE A;  2V4D A;  5KA6 A;  2YIA A;  2WLK A;  3AG1 C;  5CB4 B;  3OEH G;  2Q5Z A;  1YI2 V;  2RNB A;  1COW G;  1NKD A;  4QGP A;  1P84 F;  1XNQ O;  1QU7 A;  4UCU A;  1VEW A;  4LFB B;  2Y4U A;  3HKB A;  3M8A A;  3OD4 A;  2JS3 A;  2ARH A;  1WA8 B;  2UXD B;  3T1Y B;  4FZ0 A;  3CX5 F;  4H44 B;  1N0J A;  3L9D A;  4DV5 B;  3Q4H A;  4F6E A;  3E22 B;  1FD9 A;  3RVZ A;  2BCC H;  4DV1 O;  4MT8 A;  1QNM A;  3K3W A;  4K3A A;  5J2U B;  3G80 A;  1GO3 F;  1MZE A;  5CB4 A;  2WLH A;  4K35 A;  3O65 A;  4GX0 A;  3JAW A;  2ZR2 A;  4KHP B;  1H38 A;  3QG5 A;  4JZ2 A;  3EHB B;  2PUS A;  1WLE A;  1UPG A;  3D3I A;  1VQ5 V;  4C7U A;  3EXA A;  4U7N A;  1G4Y B;  3OMA B;  5CN0 A;  2EIN C;  3ZN0 A;  4FIP C;  4IYI A;  4Z2W A;  1K7D A;  4FLV A;  2QKC A;  5A2Q N;  4BIZ A;  2GV9 A;  2DQ3 A;  3FB6 C;  1XDC A;  5LP6 C;  3FD9 A;  5LYJ B;  1YJN V;  4KXR A;  1S5H C;  1XHZ A;  3ZMT A;  1NTZ H;  4PDM A;  3B40 A;  3BCC H;  2Q69 A;  1BQ0 A;  4JPR A;  4X65 B;  4K8Z A;  2ADQ B;  2DWD C;  1E1R G;  1MA1 A;  4IIJ A;  2DWE C;  1JR9 A;  5CMU A;  1N4C A;  3FB5 C;  1OCO B;  1U96 A;  2EZP A;  4GUN A;  2QE7 G;  1XUQ A;  4BIU A;  4K8X A;  3T1H O;  1ZWI C;  3GVM A;  5B1A B;  2Q67 A;  5GTH Z;  1Z5W A;  1M90 W;  4CH4 A;  3BA9 A;  4U3J A;  1ZTE A;  2P6J A;  4LF5 O;  4LF7 O;  4O2B B;  3ZHV A;  5LMN O;  2AZ2 A;  4YIP A;  1J95 A;  2WLN A;  1OHH G;  1OCC C;  5H6Q A;  2RMK B;  3B8M A;  3B09 A;  2HP8 A;  2UXB B;  4UVC A;  2IH3 C;  1QHT A;  3F7V C;  2NLJ C;  2KG7 A;  2NN4 A;  1NH2 D;  1OJH A;  3Q4H B;  5LGN A;  1L0N H;  3CCM V;  1BE3 H;  2ILM A;  2QM4 A;  5LXT B;  2KQX A;  2R9A A;  1XIL A;  2XAH A;  5EK0 A;  4I9Q A;  2PY5 A;  2DQ0 A;  2VQE O;  5H9C A;  5LYJ A;  4WFF A;  1K4D C;  3UM7 A;  2IM9 A;  5EC2 C;  5BY1 A;  1PNL A;  4JF3 A;  5KX5 A;  2E3C A;  3GB7 C;  3HKE B;  4YXW G;  4ASU G;  5EYP A;  3SDL A;  1I5Y A;  2N04 A;  2XND G;  5K1X A;  3I56 V;  4YJ2 A;  1W0K G;  2MK3 A;  1K97 A;  2EIK C;  4NTY A;  5J2T B;  3AK2 A;  4DW1 A;  3JYC A;  4K0K O;  2ZNI A;  5BR8 B;  1QLE B;  3LNM B;  3WG7 C;  4MVR A;  1AJN A;  1FXH A;  3PJS K;  3ZMV A;  2A9H A;  1Q90 D;  1TUB A;  5KHH A;  5D5P A;  5L3D A;  3HKD B;  5ITZ B;  1JVM A;  2BSK A;  2ZT9 B;  3E86 A;  3K58 A;  4DUZ O;  2DYS B;  3E22 A;  5E1A C;  3APO A;  2XAQ A;  2YEV B;  1QR9 A;  4O4J B;  3CJH A;  3UT5 B;  4BW5 A;  3IJ4 A;  2QSA A;  3RYI A;  3OUS A;  5LA6 A;  3RN4 A;  4JI8 O;  2LGQ A;  4G28 B;  1BSM A;  4PDV A;  2RN9 A;  3FFQ A;  1FYJ A;  3E89 A;  4MVZ A;  1ZL8 B;  1KMI Z;  4LCU C;  4LF7 B;  1CP9 A;  4LP8 A;  3W7T A;  3KZI Z;  1HR0 B;  1OV9 A;  4I4T B;  4D7S A;  2XOK G;  2AGA A;  1I7F A;  1FXV A;  4X20 B;  2QWR B;  1V9P A;  2JGU A;  2EIM B;  4YHH B;  2EIM C;  4RAI A;  4ZI7 B;  4FLZ A;  1DK1 A;  1Q6U A;  3ZHQ A;  4UB6 Z;  1Y76 A;  4PI0 A;  1R1B A;  3OGC C;  1PNK A;  3DC5 A;  5IYC O;  2CTW A;  4LFA O;  2YID A;  1J5E O;  4PV1 B;  2R72 A;  2UUC O;  2JGD B;  4LNU A;  1OCC B;  3ZRV A;  3HKC B;  3L75 H;  3QNE A;  3N2G A;  5KHK A;  3FKS G;  4X1Y A;  3B77 A;  1XBL A;  3E8F A;  5J2T A;  3BRC A;  1HNX O;  2EZO A;  2XAJ A;  5L3E A;  5LP6 A;  4X64 O;  2A7W A;  1Q81 W;  1BL8 A;  4UB8 Z;  3OW2 U;  5EYP B;  3WB0 A;  3STL C;  4DK1 A;  2DE0 X;  4Z1V A;  3STZ C;  4GLX A;  2VS0 A;  5E79 Z;  5IYD O;  5AG2 A;  2VQF B;  4KHP O;  1O9H A;  2ZXW B;  3P32 A;  3T4D A;  1FFT B;  2QKA A;  1VQP V;  4O4L B;  2YXL A;  5KA5 A;  2LQT A;  2LW1 A;  1WNS A;  5IWA O;  5LA6 B;  3JD3 A;  4NVP A;  1H2M A;  1KD1 W;  1RSO A;  1MOF A;  4DV7 B;  4DR6 O;  5CBH A;  3W7W A;  4FM1 A;  1B06 A;  2CTP A;  4UV8 A;  5FL7 G;  3ZHT A;  2ZIM A;  1P7B A;  1QLE C;  1KYO F;  2E75 B;  3K0D A;  4IYH A;  3CP1 A;  5KAI Z;  1XI1 A;  3LUT B;  2PGG A;  3K08 A;  1NVP B;  4ZKI A;  1SQG A;  1R6T A;  4DUY O;  1FPO A;  3F7Y C;  4WFG A;  3H1L H;  2LJ2 A;  2P67 A;  2O57 A;  2Q9L A;  2JDI G;  3R66 A;  4PA9 A;  2GHY A;  1K5Q A;  2HVK C;  3CCQ V;  4F4L A;  3MAQ A;  1W0J G;  3D36 A;  1D2D A;  4MTO A;  1KEC A;  2F95 B;  2ZE8 A;  2EX3 A;  1EM1 A;  3ABL B;  3CB2 A;  4BW9 A;  4BAY A;  2M6Y A;  5H2F Z;  1YJW V;  3ZMU A;  2EJR A;  1HDJ A;  2MW2 B;  1PKX A;  2IU3 A;  4JTA B;  5KX5 B;  1QCE A;  3FB7 C;  2EIK B;  4WBN A;  2XHB A;  1DF5 A;  4MW3 A;  1N32 B;  4MW8 A;  4WCE V;  3QF7 A;  3NXS A;  4FLW A;  2N05 A;  1AIL A;  1QVG U;  1I94 O;  2FB5 A;  5IYZ A;  3I5D A;  1IXB A;  4FMT A;  4RUF A;  1JFF A;  4X65 O;  3ZRS A;  1GRJ A;  2ZKO A;  5LHH A;  3FYI B;  2F93 B;  2RCV A;  1MMM A;  5LOV B;  1SA0 A;  2DW4 A;  3FX7 A;  1R3K C;  2Q7G A;  3W7S A;  4D6T H;  4ZOL B;  4N21 A;  4MTX A;  1SQB H;  4O4L A;  2F66 C;  4JI0 O;  1IBL O;  3C3S A;  4JI5 B;  2DMX A;  4DV7 O;  1VF6 A;  3OR7 C;  4R6Z A;  1XEQ A;  3CRQ A;  3AG7 A;  4NTW A;  2WA3 A;  5GON A;  3SJA C;  4OPH A;  3KKY A;  3B4S A;  1THZ A;  4UCR A;  4W4L A;  3VQY A;  2D2C B;  1NI8 A;  4E2L A;  2R70 A;  1K92 A;  2Q7H A;  5LMU B;  3ZN1 A;  5KAF Z;  4DR3 B;  1I08 A;  1X4T A;  3LNN A;  2YIC A;  1RM1 C;  4P9P A;  1PP9 H;  1BGY H;  1GH6 A;  1BZK A;  3WU2 Z;  2QWO B;  3SYC A;  2Q4P A;  2W6J G;  3LDC A;  5LMN B;  1P4R A;  4J7J A;  4P2Z A;  3H9V A;  1XNR O;  2ZDI C;  3GWK C;  2ZD9 A;  4LFA B;  1L0L H;  3WB2 A;  2CH7 B;  1VQ6 V;  3T1H B;  4UCT A;  1BCC H;  1XNR B;  4YY3 B;  1NT2 B;  4PA4 A;  5EBW C;  3OTF A;  4RQE A;  2JJ1 G;  1AR1 B;  4DR6 B;  4LFB O;  4JI2 B;  4Q20 A;  1QR8 A;  2YI9 A;  3EVK A;  5L3G A;  5IWA B;  1K3E A;  1VMG A;  2QEX V;  3RGB A;  3ZS8 C;  3BAB A;  2VQF O;  4RO2 A;  1F51 A;  1GKF A;  2XAF A;  3CE2 A;  1HR0 O;  1YSC A;  1IBK O;  2ZDI A;  1VQN V;  5IJ9 B;  1ZAU A;  2ZIN A;  4JAU A;  3CCE V;  2GBO A;  4DXW A;  4J41 A;  4X64 B;  3SGI A;  3JAS B;  3A0B Z;  3SJB C;  2YXY A;  1XRE A;  1L1F A;  4IL6 Z;  3CYO A;  4UVB A;  5EIB C;  2EIN B;  2X6C A;  4JI5 O;  2LW7 A;  4NB5 A;  1GN4 A;  3ASN C;  4X9Q A;  2UUC B;  4QNH B;  1ZLZ A;  1J5E B;  1IBK B;  1PM9 A;  4H37 A;  4YIO A;  1Y74 A;  3ZED A;  5LP6 B;  1WPX A;  1AVM A;  1JFF B;  4H33 A;  1KKC A;  1UJW B;  1GM8 A;  4HZ3 A;  4JV5 O;  1PNM A;  5JH7 B;  2YIB D;  3H1I H;  1EZJ A;  1VP7 A;  1JOY A;  3BEH A;  4JI2 O;  3P30 A;  4P9O A;  4UUJ C;  5FPO A;  2Y0P A;  4MTF A;  3A0H Z;  5BR8 O;  1KQS U;  2HVJ C;  4JAV A;  1PL4 A;  4YHH O;  2ZCE A;  2XAG A;  2QDO A;  3CS5 A;  2ATK C;  4J7K A;  2DN9 A;  1Y6X A;  4CS4 A;  3RYF A;  3K5M A;  5BZB A;  2WLJ A;  3QVN A;  3SPI A;  2QGN A;  3G4S V;  3BA8 A;  4LH6 A;  3CCV V;  2UXD O;  2P4V A;  1RFY A;  5DEC A;  2CE4 A;  3TK1 A;  4OXS A;  1V54 B;  1I5X A;  3SJC C;  3QO5 A;  1JMK C;  3DXR B;  3E83 A;  1FXK B;  1XHX A;  2ITC C;  1RM1 B;  2DOS A;  4MVO A;  2L35 A;  4QJF B;  2EIJ B;  3CC4 V;  4WFA V;  1WJZ A;  4GCZ A;  3IC7 A;  3BPZ A;  2AHZ A;  1H2S B;  4PI2 A;  4XBF A;  5B1B B;  4QPK A;  5C8Y B;  5IJ9 A;  4CH3 A;  1BHB A;  1M1K W;  4FJC C;  4K0K B;  4NXM O;  1YJ9 V;  2QA4 V;  5IY5 C;  5IYB O;  5FNV B;  1AR5 A;  3AG2 B;  1VQ4 V;  4WFE A;  5LHI A;  2WLL A;  1VAR A;  1K4C C;  2VWK A;  2OCH A;  3JD2 A;  1Q3E A;  3JAL B;  3UKM A;  3CCJ V;  3FB8 C;  5F2V O;  2X7R B;  2A79 B;  4JV5 B;  1R73 A;  4FK5 C;  2ZIO A;  2ADP A;  4ZBM A;  2CH7 A;  2VQE B;  1JX9 A;  3WB1 A;  4MSW C;  1S77 D;  4MVM A;  3ZRW B;  2JS5 A;  1NTM H;  3MHS C;  3AG4 C;  4KL1 A;  1N8R W;  1ZSP A;  3OT7 A;  1OCR C;  1N34 O;  3HKE A;  1SZT A;  3ML0 A;  5LOV A;  3AK3 A;  1EN6 A;  4CS2 A;  1K9M W;  2CGN A;  2BE3 A;  2HLD G;  3ASN B;  2BTQ B;  2P06 A;  1YIT V;  2G38 A;  4BIO A;  4E4E A;  1JJO A;  4NR1 A;  4XDL A;  1GN6 A;  4TQF A;  3K5O A;  1YF2 A;  3FYE B;  1W59 A;  4G2K A;  5ITZ A;  4TSF G;  1GN3 A;  5EIB D;  4JYC A;  4O2A B;  2QM8 A;  4O2B A;  4DUY B;  2YXH A;  4HYO A;  1OCZ B;  4YY3 O;  2VRZ A;  1M57 B;  2RQ6 A;  1TVK A;  1PV0 A;  3U0Z A;  4HBN A;  1AP5 A;  4UCV A;  3CEI A;  4J42 A;  3BHP A;  4IHJ B;  4I5S A;  4TQD A;  4GKK B;  2JK5 C;  2JJ2 G;  1YEW A;  4DV0 B;  4GKJ B;  1M56 C;  3SJQ C;  1Y67 A;  2W0X A;  3MHH C;  3RWR D;  3ABL C;  2DYR C;  3ETG A;  4FM2 A;  1XNQ B;  3RYI B;  1H8E G;  2NR5 A;  3OE7 G;  2X0L A;  1VQL V;  4J9Z B;  3THO A;  1DLB A;  1YTF D;  4DR4 O;  3ZCC A;  1R3J C;  4DR3 O;  5KLV H;  2OIG A;  1DGS A;  2X6B A;  5LMU O;  1WB7 A;  3A2F A;  4JZG A;  1YDX A;  3CCS V;  5JJE B;  5IYZ B;  4DUZ B;  1SQV H;  2H94 A;  4TUY B;  3JD4 A;  3F5T A;  1B3Q A;  4RQF A;  5JH7 A;  1KP3 A;  3SYO A;  3RYC B;  1WP8 A;  1V55 B;  4DV1 B;  1HNZ O;  4NKG B;  2OTL V;  1TGO A;  2GTA A;  1E1Q G;  1OZ0 A;  1K33 A;  5B1A C;  2EUL A;  3GWO A;  3WFV A;  3FAV A;  3DXR A;  3CC7 V;  4JI1 B;  3KG2 A;  1CEZ A;  3T1Y O;  3A0R A;  3OR6 C;  5H5N A;  1HW7 A;  3H01 A;  2PZS A;  3D36 C;  4HNA B;  1I94 B;  2FKX A;  5JJN B;  1NQT A;  1V54 C;  2C2A A;  2A3Q A;  5EBM C;  2EBO A;  1LUV A;  3JSN A;  1YTF B;  5L3B A;  1YXB A;  2QM7 A;  2BTQ A;  1TAE A;  2AZ0 A;  1FS0 G;  2GTS A;  3A8T A;  2BSK B;  1SET A;  4I55 A;  1S5J A;  4DR1 O;  4DV2 B;  2YEV A;  4O4J A;  2UXB O;  1OCR B;  4X88 A;  4DRX A;  1SS3 A;  1H2K A;  4UCO A;  4FVM A;  2B5U A;  4JYB A;  2HR3 A;  5IDJ A;  3DTU B;  4DW0 A;  3ETE A;  1Q7Y W;  2CDY A;  4L8J A;  4DR2 O;  4NTX A;  5KHG A;  4DV4 B;  4PHZ A;  1Y74 B;  1Q43 A;  1S5L Z;  1IX9 A;  2Y69 C;  2ZE5 A;  1MZF A;  4FFK A;  5EZY B;  1QVF U;  3JAK B;  4LFC B;  4JI7 O;  2EJ7 A;  3PN1 A;  1R6K A;  2WLI A;  4DRX B;  4EFE A;  1ROP A;  4MTG A;  4ZHQ B;  4JTD B;  3SYQ A;  2NNU A;  4TV8 B;  2W6I G;  2XTA A;  1A32 A;  3L70 H;  3KCY A;  3LDE A;  4CH6 A;  4CH5 A;  4G27 B;  4CZZ A;  1FAF A;  4LF6 B;  1GM7 A;  2ZE6 A;  3DC6 A;  4FLU A;  2QWP B;  1O9G A;  2RJZ A;  3CJH B;  3ZMS A;  2GUZ A;  1WN7 A;  4I50 A;  1EN4 A;  5B5E Z;  1JJ2 U;  2K1E A;  4X66 B;  4U3J B;  1VF6 C;  5BMV B;  2ZE7 A;  1FKA O;  1S0V A;  3CD6 V;  5EZY A;  3G67 A;  4LWS B;  1ZUQ A;  3VBB A;  3M99 B;  4FM0 A;  1HNX B;  3JCU Z;  4I9W A;  1M4U A;  2UUB O;  1MAB G;  3M7M X;  4JI4 O;  4X20 A;  1XMO O;  3B2E E;  1SES A;  3U11 A;  1GM9 A;  2H3O A;  1ENV A;  1QLN A;  1U97 A;  3BVO A;  1WB8 A;  4LF5 B;  4XDJ A;  1FFX B;  4DV6 B;  4DV5 O;  4J80 A;  1NBM G;  1Y76 B;  3VQX A;  2CAZ C;  2BTO A;  4EEQ A;  4OX9 B;  4DR7 O;  2DJV A;  1KKD A;  2HKO A;  4LBE C;  2B1G A;  1WPB A;  1N36 B;  3LDD A;  3UT5 A;  4EFB A;  1D5N A;  3ZRW A;  1GN2 A;  2CGO A;  3W7U A;  2HJF C;  3DSQ A;  1VIB A;  2XUM A;  1SF9 A;  3MD0 A;  4B3M B;  3APQ A;  1YCI A;  3K79 A;  4QE7 A;  3JAK A;  5JQG A;  1HNW B;  5JVD B;  2Q7E A;  2LO1 A;  3CCL V;  3JD1 A;  2HHH B;  3RW0 A;  2WLI B;  4I0X A;  4WF9 V;  1HNW O;  4CC6 A;  2EIJ C;  5D5Q A;  1S72 V;  5CBG A;  2LGW A;  1Q82 W;  1Q86 W;  2IH1 C;  3J81 N;  1SQX H;  4B3M O;  3H1K H;  4D7T A;  3JAR B;  1AI7 A;  3C90 A;  3DGE A;  1HP8 A;  1K5S A;  2YS8 A;  3UO2 A;  1US6 A;  3OEE G;  2HFE C;  5BXZ A;  1TUE B;  3G71 V;  4JI8 B;  1V55 C;  1MSW D;  2IBZ H;  3BFR A;  4OX9 O;  3ICX A;  3N2K A;  2ODM A;  1RSO B;  5C93 A;  1Q8I A;  4DK0 A;  4WBN B;  2UUA B;  1FJG O;  3TXQ A;  3ZHU A;  4DR5 B;  3SPJ A;  2UU9 O;  4JI6 O;  1BQZ A;  1ORQ C;  1XOU A;  4JI4 B;  4IT5 A;  2YIB A;  2UUB B;  3RYH B;  1BHA A;  1M57 C;  3N2G B;  2ZM6 O;  1DTO A;  4NXN B;  4TOI A;  3AG4 B;  1F4M A;  5KMG A;  1I0H A;  3L71 H;  5KHI A;  5CBF A;  3OTO O;  2PI4 A;  2CTQ A;  3RFR A;  1UFI A;  1M56 B;  4JI3 O;  5LGU A;  1LNQ A;  1SZX A;  4X62 O;  1S76 D;  5IJ0 A;  5B3S C;  1YHQ V;  3HKC A;  5B3S B;  4GX2 A;  1EZV H; 
#chains in the Genus database with same CATH homology
 2Y4U A;  1FAF A;  2PF4 E;  3BVO A;  2LGW A;  3AG7 A;  4J7Z A;  1IUR A;  2QSA A;  2EJ7 A;  2L6L A;  2QWP B;  2QWN B;  1XBL A;  2GUZ A;  2YS8 A;  4RWU A;  3UO2 A;  2CTW A;  1GH6 A;  1FPO A;  3APQ A;  2N04 A;  2QWR B;  2QWO B;  1WJZ A;  2CUG A;  1BQ0 A;  2Y4T A;  2CTQ A;  2KQX A;  4J80 A;  2YUA A;  2CTP A;  2N05 A;  2OCH A;  2QWQ B;  2LO1 A;  3UO3 A;  2DN9 A;  1BQZ A;  2M6Y A;  1N4C A;  2CTR A;  2GUZ B;  3APO A;  4IT5 A;  1NZ6 A;  3UCS C;  1HDJ A;  2DMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...