1IURA

Dnaj domain of human kiaa0730 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
MHHHHHHLVPRGSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of DnaJ domain of human KIAA0730 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA0730 protein
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1iurA01
3APQA 2QSAA 2LO1A 2OCHA 4J80A 1IURA 2DN9A 2CTQA 3APOA 2CTPA 2QWRB 2YUAA 1BQ0A 2M6YA 3UO2A 1FPOA 2DMXA 2LGWA 2PF4E 2QWOB 3BVOA 1BQZA 2N05A 4RWUA 2GUZB 1HDJA 1NZ6A 2QWQB 1WJZA 2CTRA 2L6LA 4J7ZA 2N04A 2KQXA 3UO3A 1N4CA 2QWNB 2Y4TA 2YS8A 1GH6A 2QWPB 4IT5A 3UCSC 2CUGA 2CTWA 2Y4UA 2EJ7A 3AG7A 1FAFA 2GUZA 1XBLA
chains in the Genus database with same CATH superfamily
3JCUZ 1B6QA 5EK0A 3CCMV 2C2AA 3CCSV 1FD9A 4JZ2A 2IH1C 1BQZA 3IGAC 4I55B 5KHIA 4X1KB 2DJVA 3OE7G 1SQXH 2F66C 4U7OA 3GWOA 3LDEA 1VF6A 1SETA 2P67A 1OCZB 3T2MA 3FB7C 4LNUB 4ZOLB 3VOUA 3BFRA 1TUEB 4MW3A 3CC7V 5H5NA 3MHSC 4B7KA 1XDCA 1TGOA 1IVSA 3KCYA 3QTCA 2GSMB 3IC9A 4JI1B 4BW5A 4OGQB 2XAHA 2YXLA 3EFFK 1VQKV 2BCCH 3B77A 4BWAA 5GONA 2PYLA 3K0GA 2WPDG 3D36C 1E1RG 3IC7A 5BMVB 3APQA 5C8YA 1K7DA 4FZ0A 5KX5B 1NR1A 3E83A 1OJHA 4FIPC 4MTFA 1ZL8A 5C8YB 5L3BA 3RFRA 1Q86W 4K8XA 1Y74B 5LBQA 3VQXA 2P90A 1E1QG 5CB4A 2WA4A 1SQBH 2HVJC 1YDXA 1V55C 3C3SA 4LF6O 3B40A 2KSDA 3CRCA 3SJBC 4L87A 4GX0A 3DGEA 5LGUA 4J9YB 3ZJZA 5L3GA 3BEHA 3FX7A 5CMUA 4MVOA 2PI5A 3NR7A 2A79B 3RVYA 4AQYO 4FLVA 4G27B 4X65O 2ZNIA 3OM3B 4E2LA 4PA3A 2UUBB 1KBHA 1R3JC 1MABG 2ZE5A 4GUNA 1DGSA 3CJHA 1X59A 1Z5WA 3E22A 3BCCH 4B3TO 3OUFA 4LF5B 5EYPB 2QDOA 4R7CA 3BRCA 1JOYA 4UV9A 2GHYA 1HNWB 1F51A 5J2UB 4UCSA 2HEPA 5BXZA 4IHJA 4PDMA 3H1JH 2ZIMA 5IDJA 1XILA 2VQEB 1KKCA 4WBNB 1GN6A 4X62B 3D3QA 4IHJB 3UCSC 3A0BZ 4K3AA 3CCEV 3JSLA 1BE3H 4BIUA 2DE0X 4GKJB 3K5LA 3CCUV 4JYAO 4O4LA 1R3KC 3T1YO 3BVOA 5IJ9A 1OCRB 2EILC 4RAIA 2JGDA 2RMKB 4MVMA 4NB5A 4DRXA 2YXYA 5DECA 1Q82W 2OIEA 3J81N 2Y69C 1BL8A 4TQFA 4DW0A 5LHGA 1N34B 3DSQA 4OPHA 1H8HG 3L9DA 2WLKA 2Z0AA 1S76D 1VF7A 3OD4A 2XAFA 4Z1VA 2BTQA 2DN9A 2YDEA 4YY3O 1SC5B 2WLLB 2ZM6B 2F1MA 1BQ0A 4L8JA 1NQTA 4JI5O 2GUZB 3QNEA 4O4HB 2F23A 4I4TB 2NNUA 1GO3F 3D8CA 5JH7B 4DUZB 1I5YA 3FB5C 4DR5B 1G8MA 4LWSB 2KG7A 1CP9A 3GWKC 3BHPA 3TK1A 4ZKIA 3H9VA 1YJ9V 3ASOC 3ZCCA 3ZRWB 4FVMA 1GM8A 3JYCA 1KB9F 4DRXB 3W7WA 1MSDA 3T1HO 3FYIB 4I5SA 2V7QG 1L1FA 1YF2A 4JI3O 1R1BA 1K97A 2K9PA 1M57B 5JJNB 1WB7A 3ZMZA 1YHQV 1ZLZA 4PELA 1URFA 1IBLB 5B66Z 2YUAA 1SERA 3ZHVA 1Y4MA 1LR1A 3ABKB 2V1DA 2QM7A 4MS2A 4PDRA 4JAVA 3VQYA 1VARA 4TUYA 2OTLV 3U11A 4PI2A 3I56V 2QA4V 4RQEA 1K9MW 2X0LA 4JZGA 2YEVB 5BMVA 3P3PA 5L3FA 4O2BB 4WCEV 4PV1B 4FLTA 1BZKA 1D5AA 3ZRWA 1KKDA 2Q0OC 4UVCA 5CN0A 1HR0O 1KYOF 4JI7O 1JQ0A 1SQFA 3K0DA 5CBHA 4P2ZA 2X6CA 3S3XA 2NLJC 1NBMG 3A2FA 3QVNA 4AHCA 4NKGB 2IM9A 3FAVA 3SYQA 4GT1A 3SPJA 1US6A 3P3NA 4YJ3A 3CRRA 3E22B 5CA1A 3OMNB 3RN4A 5JWPA 3ABTA 4WFEA 2D3OW 1J95A 3OT7A 4FM1A 1VQPV 2WLMA 5B1AC 3L71H 1MZFA 2ZIOA 5H9CA 1YVWA 4QIWF 3JAMN 1IBKB 1O9HA 2EIKC 2B9ZA 1IBKO 2W6JG 4WFHA 2CTQA 3K04A 2AGAA 5JQGB 3ETDA 3E35A 5CA0B 3RBZA 5KUMA 2XHBA 3CJHB 2WLIB 5LMUO 1RPRA 1KD1W 2R9IA 4F6RA 2R9RB 2WLHA 1V55B 4UVBA 2MW2B 1QCEA 5J2UA 3HKCB 1VQ8V 1K33A 4EFBA 4XBFA 1JX9A 4GZRB 3CCLV 4TWKA 3ZMTA 2EIJB 5B1BC 5B3SB 1S77D 4I50B 3SR2C 4JI7B 5AG2A 2WLLA 1Q6UA 1SESA 4DW1A 1U97A 4O4HA 2GUZA 5IYZB 2EIMB 3JALB 4UCRA 4UUJC 1XL4A 1AR1B 2ADPA 2EULA 1KP3A 4H0LB 2HLDG 4F6RB 5KHGA 1VQ4V 3SJQC 3N2GA 4HAMA 1GH6A 2EINC 2ITDC 3F7VC 3AEIA 4Q6GA 4LFBB 1S5JA 3ZRXA 2M7WA 4X20A 1YCIA 3QF7A 1FXVA 5CBGA 4TUYB 4IYIA 4OXSA 1QLEC 1HNXB 1PM9A 3R65A 2M6YA 1DF5A 5KA6A 2ZKOA 2QM8A 1SQPH 3RYHA 2YIBD 2LJ2A 3SYAA 1Q81W 3AG2C 1YITV 1N4CA 2QWPB 1OCOB 4LF9O 1Q43A 2OIGA 1K34A 2QKSA 1XMOO 4TV9B 2QTOA 2ZM6O 1DLBA 2XNDG 4NR1A 3WG7C 2IH3C 2OCCB 3LDDA 4TOIA 4I9QA 2PY5A 2KKWA 1Q5OA 5KX5A 3ASNC 1H2NA 2HP8A 4X66O 1Y74A 3I55V 1U96A 1K5SA 1K3EA 2XAQA 3DC6A 3CMEV 5LXTA 2WLIA 2CUGA 4DK0A 1HNZB 4JGSA 4FM2A 2DYSC 5EIBC 1FFXB 4JI6B 5JH7A 4DV4O 4KL1A 1VQOV 4B3MO 2QGNA 3L72H 2PF4E 2RJZA 3WU2Z 4PDLA 4PA4A 4B3RO 1RM1B 3DXRA 3RT3C 4O4LB 4G2KA 3JAWB 4AQYB 4JI5B 3CC4V 1NTMH 1FYJA 2ATKC 4PJ0Z 4X89A 2HHHB 1KP2A 4QJFB 3JALA 1QR9A 3SJAC 2P7TC 2AXTZ 4X66B 2H8PC 2Y0PA 1I94B 3GB7C 2G38A 4KFMA 3T1YB 4X64B 4R8CA 1MSWD 3T4DA 3TETA 2B1IA 2ZR2A 1NS1A 2GTSA 1NTKH 2FMLA 2LGWA 3BPZA 2LW1A 2A7WA 4ICGA 3AG3C 1WP7A 3TXSA 4FLYA 2WSSG 5GTHZ 2OWOA 1Q6HA 4PDVA 4FPPA 3UM7A 1HNXO 4JI8O 3K9SA 5JVDA 1MZEA 4O4IB 4QE9A 5IJ0A 4A5UB 4DUZO 4ZI7A 3WB2A 2AZ2A 5B1NA 1AJPA 1AROP 2UXXA 4K35A 1R6KA 1IXMA 5C93A 5DM6V 1SQQH 3JAKA 2DOSA 1A32A 2CH7B 5IY5B 3K79A 2ODMA 5LXTB 5EC2C 4XDJA 1ZWIC 2ZE8A 2F4VB 2YI9A 3KKYA 1VQ5V 2PZSA 4P9PA 3EVKA 3MDSA 3CPWU 3RVZA 1GKFA 4X20B 1IZ3A 1QLNA 1M5IA 2VS0A 2BOBC 1LNQA 2EZOA 2JEUA 4MW8A 2E75B 4U7NA 1AP5A 1S5HC 4DR2B 4ZI7B 2CK3G 1WAZA 4DR3O 3FAVB 3JD3A 2NN4A 4X9QA 3ZRVA 1IBMB 1WP8A 5LHIA 1W0JG 4DR6B 4D6TH 1PKXA 3FB6C 3E8BA 5JCOA 4ZIBA 1IURA 3APOA 3E2EA 1S3JA 1PL4A 4I0XB 4B3TB 1ZX3A 4B7EA 4CZZA 2E76B 2GV9A 2PTMA 3OEEG 2A06H 4I50A 1X4TA 1ZAUA 1GTOA 2HJDA 2V4DA 2F93B 1BHAA 1MA1A 2ZNJA 5KAFZ 3K06A 5D5PA 1KECA 2FTKA 4X62O 2E5LB 1FXKB 2Z5UA 3JAWA 3AK3A 3OMIB 1Y67A 4UVAA 4TV8A 5ITZA 2VQFB 4G28B 2EIMC 2IJHA 4CS4A 3K03A 4QNHB 3BY6A 4UB8Z 4RUEA 4DR4B 4X65B 1BHBA 5CA1B 3SJCC 5KHHA 4B3SB 4J7ZA 1WA8A 4LFCO 1PL0A 4WF9V 5EBLC 1THZA 3CE2A 4UCUA 1LUVA 3UT5A 1L0LH 3ETGA 4FLZA 3QO8A 3ABMC 1G4YB 2RDCA 1FS0G 1F4NA 1JCHA 2WLNA 4NTWA 5LOVA 2DWDC 1EM1A 2P4KA 4U3JA 3WG7B 1UFIA 3T1HB 3IFXA 1M4UA 2F4VO 2PGGA 3W7TA 1OCZC 5FNVB 4DR2O 5GTIZ 2BTQB 5EIBD 1UJWB 4JI2O 1RSOB 1LUWA 2QWRB 4TQDA 4OX9B 4JI3B 3H1LH 2UXCO 3M8AA 4DV7B 5KHJA 3STZC 1AB3A 3O9OA 1DF4A 5A9GA 1GN4A 4BW9A 4W4KA 3CCJV 1HW7A 1AI6A 2ITCC 3OR7C 4FZ1A 1XHZA 1KU9A 2A9HA 3U10A 2Q7HA 1Q7YW 4O2AA 4AI8A 3VQWA 1Q3EA 1QR8A 2K1EA 1SQVH 4MVQA 1FFXA 2Q68A 4X88A 2PYJA 3S3WA 2ZR3A 3ABLC 2RCVA 4WFAV 1L0NH 2IU0A 1FAFA 3D3IA 3K58A 5HFLA 1XL6A 4I4TA 2BSKA 2DQ0A 4CH6A 5BR8B 4F4LA 1NH2D 4P9OA 1YTFD 2KG7B 1QVFU 3AG3B 2CTRA 2X7RB 3OTOO 4WBNA 1I7FA 4UV8A 3BA9A 4MVUA 1YXBA 4DK1A 3G80A 1WNSA 2YIDA 4GKJO 3F5WC 1XHXA 2P22C 1M9NA 5F2VO 1OZ0A 1M1KW 5KLVH 3AG1C 2AW9A 4X64O 3THOA 4KP4A 3CXHF 1GM9A 3LUTB 3JASA 2OTJV 4DV3B 3W7UA 3CP1A 3UO3A 1K4DC 2QWNB 3CX5F 3JASB 4N23A 3L75H 4Q20A 4GCZA 3AG2B 4DR4O 2E5LO 3LNMB 4LFAB 3E8FA 4YJ3B 2P06A 4JYYA 2P5OA 3PJSK 1VF5B 1JFFA 5EC1C 1ORQC 2DYRC 3JARB 3OTOB 5IY5C 2A0LA 2QKCA 5LYJA 4LWSA 4HBNA 3OGCC 4B3RB 1AI4A 5D5QA 4NTYA 3ABLB 4X8AA 4CH4A 4JI0O 3IAYA 2LQTA 1TVKB 5JQGA 1S0VA 2DYRB 3DC5A 2DMXA 4LFAO 3JAKB 3OGIB 1NZ6A 3SDLA 5EBWC 2HJFC 3K57A 2FB5A 4LP8A 1NJIW 1BGYH 5BR8O 1PNMA 3CRAA 3SYCA 3L74H 1K4CC 3T1CA 2Z3YA 1NTZH 1OCOC 4CC6A 3OAAG 3OUSA 3JD0A 1DTOA 2QWOB 4EEQA 3ZRSA 4JF3A 3U0ZA 1J5EO 1CPYA 1WA8B 3TCUA 3CXCU 4J7JA 3G71V 4MTOA 3HKBA 1SF9A 4DV5O 4GKKO 4R6ZA 2Q9LA 2UXDO 2Q6AA 1I5XA 2EJRA 3SPGA 3F7YC 1YJWV 1P7GA 2EBOA 3CHXA 1B3QA 4D7SA 4JI1O 2OCHA 1Y6XA 3M7MX 3OW2U 4DR1O 3X2QC 3LNNA 2PUSA 4J11A 4QE7A 3E8HA 2Q73A 4F6EA 2NR5A 4FFBA 2Q5ZA 3CCQV 1EFRG 4DV7O 2IW5A 3OTFA 2D2CB 4DV2B 4PHZA 1VP7A 2YSUB 2ZDIC 3KG2A 1RSOA 2RNBA 2IJIA 3JSNA 1R3LC 3X2QB 1XNRB 1N36B 1V54B 5FPRA 2Q67A 4LF4B 3FKSG 4DV0O 3M99B 1JFFB 4LH6A 5JCOC 4TV9A 1XBLA 3ASNB 2XUMA 4R50A 4KHPB 4XDKA 4ZHQA 1PNLA 4JTAB 5IJ0B 1ROPA 2CDYA 2YXHA 3OR6C 5BZBA 3CCRV 3PN1A 4LF8O 3K5MA 4GX1A 3K5OA 4DV4B 5IWAB 3RGBA 4LF7O 4JYAB 1M56C 5IWAO 5KA5A 5IYDO 4JI8B 2QTSA 4ZBMA 1NVPD 5LA6B 2L35A 2WWWA 1I08A 2QWQB 4HYOA 4YIPA 3SYPA 2AHYA 2X6BA 1P4RA 4FLXA 4JYCA 5GONB 1YJNV 4QPKA 1FKAO 5IYZA 4Z1MG 4PD4F 1OHHG 3ABUA 3HKBB 2UUCB 2JIZG 3P32A 1G1XB 1XI1A 5DEDA 3N2KB 1QBZA 5LGTA 1QQCA 3AG4C 2QM4A 3CB2A 1OCRC 2EILB 4BIZA 4UXNA 5LP6B 4YIOA 4LNUA 1SKVA 5CB4B 4TV8B 2JK5C 1QVGU 4LBEC 5H6RA 2FKXA 4FM0A 2AHZA 1HNZO 2E74B 1N32O 2P4VA 4DV2O 4JTDB 5E1AC 2EZPA 2FL4A 2IJKA 3WB0A 3FFQA 5KMGA 1GN3A 4CH5A 2ZE6A 5LYJB 2YIBA 1AR4A 4RQFA 4DXWA 1AVMA 5B1AB 4DV6O 4FFBB 2ADQB 1H8EG 2EINB 2JJ1G 4O2AB 1ZL8B 2ZXWC 4JASA 4MVSA 4K0KB 2W0FC 4LFBO 2H3OA 4CBCA 4NTXA 1XNQO 3J7AU 1TAEA 3ZN1A 4DR3B 2LFSA 2W6IG 2GBOA 5IT9N 1CXZB 4J80A 2JEXA 4GYCB 5JJEB 4JV5B 3ZN0A 1M90W 1YEWA 3B4SA 2DYSB 2WLJA 2ZCEA 2JDIG 1AR5A 3A0HZ 1JVMA 1SA0A 2BE3A 1AI7A 3A8TA 4OX9O 3B8MA 1KMIZ 1B04A 5K1PA 1GMGA 4PA6A 1FJGO 1D5NA 1XQ8A 4NXNB 3ZHTA 3MHHC 3ZIAG 4JAUA 4MVRA 1QLEB 1HDJA 1TUBB 1N34O 1R6NA 3SPCA 4LC1A 1QU7A 4NVPA 1SZTA 1JR9A 5IYBO 1R73A 5LMUB 4B3MB 2VWKA 2ZE7A 3ICXA 1VF6C 2B1GA 4MSWC 3ABKC 4JI0B 1VQ7V 3JARA 4I0XA 5K1XA 3UO2A 3JATB 2N05A 1W2BU 1VQ6V 1EN4A 3ABMB 4X1YA 2LW7A 3JATA 1MMMA 2Y4TA 1FFTB 3RYIA 2UUAB 4WFFA 3JD4A 4KHPO 5LMNB 4DV1O 4EB6B 5JVDB 2BTOA 4O4IA 4AILC 2P6JA 1H2KA 4ABMA 1D2DA 2H94A 4XDLA 4IGGA 4J7KA 1VQ9V 4LF8B 1XEQA 2KQXA 1MNGA 5CBFA 4J41A 4DV3O 3N2KA 5J2TA 1T5EA 1N0JA 3ZHQA 1BMFG 2HHHO 3O65A 1FXKC 2ZXWB 4CC5A 1S72V 5LMNO 4KXRA 2E3CA 3RYCB 3QO5A 4BAYA 4KUMA 4IL6Z 2ZINA 4LF4O 1GN2A 1P7BA 3C90A 5HFMA 2HFEC 4YHHB 3ZEDA 1KUQA 1VQMV 2Y4UA 2F95B 5IE9A 1BSMA 3H1HH 4O2BA 1EN6A 1GM7A 1WLEA 1CEZA 3BA8A 1SA0B 2LFRA 1PNKA 3SPHA 1AI5A 4MTXA 3EXAA 3L70H 3LSSA 1IBMO 1BCCH 2XT9A 3LSQA 2UXCB 1IXBA 3AK2A 4RO2A 1DK1A 2VRZA 4J9ZB 4YXWG 2N74A 3C3TA 3N27A 4DUYB 3QG5A 3AG4B 2CTPA 4DV6B 2Q69A 3CCVV 4RWUA 5EZYB 2JS5A 2OCCC 3FYEB 4K8ZA 3CMAV 1M93A 2Y48A 3JCZA 2OYQA 4I7ZB 1HP8A 1RPOA 3K08A 1Y76A 4HNAB 4JV5O 2QKAA 3B8NA 3G67A 2DQ3A 2OT5A 5FLXN 1NH2B 1N32B 1ZTEA 1AP6A 4UCVA 3HKDB 4U3JB 3KCXA 2PI4A 1QHTA 2Q4PA 4IYHA 1YIJV 1FXKA 2O57A 1IDSA 1I94O 1TVKA 3H1KH 3HKEA 4GX2A 2ZDIA 3RYFB 4O4JB 3ZHUA 1O9GA 1SS3A 5EYPA 2EX3A 2QEXV 2GDSA 2ZQMA 2HVKC 3K9AA 5GW7A 5LGNA 3E86A 4WFGA 2XAGA 2VQFO 1S5LZ 1FPOA 4PI0A 5KAIZ 1PD3A 1NKDA 3AG1B 4DR5O 1M57C 2Q7EA 3RW0A 5B5EZ 4PA9A 4LFCB 4QGPA 4UB6Z 4FJCC 1GAXA 3UT5B 2IBZH 2IU3A 3L73H 1L8DA 4LCUC 4DV1B 2UU9O 3E89A 1YI2V 5TISZ 1V54C 2GTAA 3H1IH 4JI6O 4LH7A 4X1IA 4X1KA 2UUAO 2UXNA 1R6TA 3CWBH 4W4LA 3QO7A 3OMAB 3RYFA 4NXMB 3STLC 1F23A 2ARHA 1VQLV 1JJ2U 2LO1A 1MOFA 3G6EV 1I0HA 2YC0A 4TT3G 2XAJA 4J42A 3RWRD 3K5NA 1K5QA 3A0RA 1W59A 1M56B 1Y66A 1XMOB 3ZMSA 2L6LA 3HB3B 3D36A 3Q4HB 1PP9H 1FXHA 3T4ZA 1VEWA 4DR7B 1AILA 2CAZC 1Q8IA 2EJ7A 1OV9A 1TUBA 3E8GA 5KUKA 4EB6A 2QR4A 3K3WA 2ETNA 3ZMUA 4HZ3A 5BY1A 4BIOA 3TXQA 2JVDA 4LF7B 5B1OA 4FFKA 4YJ2A 1N33O 3ZX6A 1PV0A 2YEVA 2IJJA 4LF5O 4EFEA 2XASA 3N2GB 1RFYA 3SGIA 2JGUA 5LOVB 2QE7G 4PA7A 3ETEA 4OPAA 1ZUQA 1BT8A 5EBMC 1WPXA 2QJ1A 4JI4O 5ITZB 2YI8A 4K0KO 2Q7GA 4JI2B 3CD6V 2BSKB 4LF6B 4O4JA 5IYCO 5KHKA 1H38A 1VQNV 5FPOA 4JTCB 1COWG 2BOCC 3DTUB 4BR6A 4GKKB 4LF9B 3JD1A 1WPBA 1AJQA 1N36O 3HR0A 3K59A 2CGOA 5L3EA 5A2QN 2Q0AA 4TSFG 1PPJH 1K92A 1H2LA 4YY3B 2JGDB 3VQVA 4YJ2B 5J9PC 4ASUG 3AK1A 4DV5B 2WA3A 2HR3A 2JS3A 4IIJA 1J5EB 1XNQB 1H2MA 4GX5A 4I9WA 4DYLA 3BAAA 3ZS8C 4WFBV 2JJ2G 3CYOA 1HNWO 2X6AA 1N33B 2JRIA 5E79Z 5FNVA 1Q90D 3ML0A 1ZSPA 3B09A 2DW4A 3DXRB 4NYKA 1AJNA 2F43G 2VQEO 1XOUA 3H01A 4B3SO 1Q6IA 1JJOA 5KMGB 1NVPB 1K73W 5B3SC 2WAMA 1MG1A 4ZHQB 4DV0B 1P84F 1XREA 4N21A 1KC8W 2RN9A 4C7UA 3F5TA 3SYOA 1JPXA 4UCTA 1GRJA 5J2TB 4NXMO 2CH7A 3KZIZ 4JYBA 1N0NA 3MAQA 3ZHSA 1B06A 1NR7A 2VWJA 2UUBO 1F4MA 1WN7A 4FLUA 4E4EA 4DR6O 3EHBB 2DWEC 2UU9B 3CRQA 2B5UA 3LSUA 4LR3A 3VBBA 2EIKB 3WFVA 4CH3A 4UFZA 3CSXA 2YS8A 3IJ4A 3P30A 4I55A 1G6UA 3RYIB 3ZBHA 4D7TA 1XNRO 5LL6Y 1R3IC 5H2FZ 5FL7G 3Q4HA 1QNMA 4H33A 3CS5A 4X1IB 1RM1C 3NXSA 4ZOLA 5LP6C 3HKDA 5H6QA 1UPGA 2N04A 3GVMA 1NI8A 1Z2GA 3WB1A 1EZJA 5LHHA 3LDCA 1YZBA 3CC2V 3AG7A 3CEIA 3HPLC 1VIBA 1N8RW 2Q8VA 5EZYA 4RUFA 4DO2A 1W0KG 2YIAA 1RP3B 2Y0IA 2HG5C 1FJGB 3OEHG 2W0XA 3FD9A 1KQSU 2AZ0A 1SRYA 4H37A 1EBOA 3RYHB 2UXDB 2XOKG 2R9AA 3RYCA 3ZHRA 1NT2B 3UQ8A 2RQ6A 4IT5A 1VMGA 4DR1B 4X1YB 5CA0A 4IIJB 5LP6A 1IBLO 1SQGA 4MT8A 2UXBO 2ZT9B 4QPJA 4CS3A 3W7SA 4DUYO 4DR7O 4H13B 3UKMA 2KB1A 1XMQB 4YHHO 4JAAA 4J10A 1WB8A 4JI4B 4MTGA 3TJTA 1JA8A 3ETQA 1E79G 1XUQA 1NU1H 2XTAA 1OCCC 5IJ9B 3HKCA 5DN6G 2HKOA 2CGNA 5CA3A 4U3FH 4P30A 3G4SV 1JMKC 4CS2A 5LA6A 1SZXA 1K8AW 1H2SB 3ASOB 3BABA 1WJZA 4JPRA 1OCCB 2FYUH 3SPIA 3CRMA 3OFNG 1YTFB 1EN5A 4FK5C 3J80N 4Z2WA 1Y76B 4HNAA 5L3DA 2EIJC 5B1BB 1F7YA 3MD0A 2LP7A 2R72A 4MVZA 5L3CA 2A3QA 3ZMVA 4GLXA 2ZD9A 1ENVA 3W7XA 2MK3A 1V9PA 2ILMA 1IX9A 3TGUH 2CTWA 2YICA 1HWYA 2Y69B 3HKEB 3JD2A 1GK9A 3FB8C 4B08A 2QSAA 4FMTA 1EZVH 4EKWA 1YSCA 2UUCO 1H2GA 3I5DA 1Z5VA 3B2EE 3G6BA 2CE4A 5JJJB 1BS3A 1TA8A 2LGQA 4FLWA 4H44B 1HR0B 1XMQO 2R70A 1P49A 2UXBB 4NXNO 3R66A 4UCOA
chains in the Genus database with same CATH topology
3APQA 2QSAA 2LO1A 2OCHA 4J80A 1IURA 2DN9A 2CTQA 3APOA 2CTPA 2QWRB 2YUAA 1BQ0A 2M6YA 3UO2A 1FPOA 2DMXA 2LGWA 2PF4E 2QWOB 3BVOA 1BQZA 2N05A 4RWUA 2GUZB 1HDJA 1NZ6A 2QWQB 1WJZA 2CTRA 2L6LA 4J7ZA 2N04A 2KQXA 3UO3A 1N4CA 2QWNB 2Y4TA 2YS8A 1GH6A 2QWPB 4IT5A 3UCSC 2CUGA 2CTWA 2Y4UA 2EJ7A 3AG7A 1FAFA 2GUZA 1XBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APQ A;  2QSA A;  2LO1 A;  2OCH A;  4J80 A;  1IUR A;  2DN9 A;  2CTQ A;  3APO A;  2CTP A;  2QWR B;  2YUA A;  1BQ0 A;  2M6Y A;  3UO2 A;  1FPO A;  2DMX A;  2LGW A;  2PF4 E;  2QWO B;  3BVO A;  1BQZ A;  2N05 A;  4RWU A;  2GUZ B;  1HDJ A;  1NZ6 A;  2QWQ B;  1WJZ A;  2CTR A;  2L6L A;  4J7Z A;  2N04 A;  2KQX A;  3UO3 A;  1N4C A;  2QWN B;  2Y4T A;  2YS8 A;  1GH6 A;  2QWP B;  4IT5 A;  3UCS C;  2CUG A;  2CTW A;  2Y4U A;  2EJ7 A;  3AG7 A;  1FAF A;  2GUZ A;  1XBL A; 
#chains in the Genus database with same CATH topology
 3JCU Z;  1B6Q A;  5EK0 A;  3CCM V;  2C2A A;  3CCS V;  1FD9 A;  4JZ2 A;  2IH1 C;  1BQZ A;  3IGA C;  4I55 B;  5KHI A;  4X1K B;  2DJV A;  3OE7 G;  1SQX H;  2F66 C;  4U7O A;  3GWO A;  3LDE A;  1VF6 A;  1SET A;  2P67 A;  1OCZ B;  3T2M A;  3FB7 C;  4LNU B;  4ZOL B;  3VOU A;  3BFR A;  1TUE B;  4MW3 A;  3CC7 V;  5H5N A;  3MHS C;  4B7K A;  1XDC A;  1TGO A;  1IVS A;  3KCY A;  3QTC A;  2GSM B;  3IC9 A;  4JI1 B;  4BW5 A;  4OGQ B;  2XAH A;  2YXL A;  3EFF K;  1VQK V;  2BCC H;  3B77 A;  4BWA A;  5GON A;  2PYL A;  3K0G A;  2WPD G;  3D36 C;  1E1R G;  3IC7 A;  5BMV B;  3APQ A;  5C8Y A;  1K7D A;  4FZ0 A;  5KX5 B;  1NR1 A;  3E83 A;  1OJH A;  4FIP C;  4MTF A;  1ZL8 A;  5C8Y B;  5L3B A;  3RFR A;  1Q86 W;  4K8X A;  1Y74 B;  5LBQ A;  3VQX A;  2P90 A;  1E1Q G;  5CB4 A;  2WA4 A;  1SQB H;  2HVJ C;  1YDX A;  1V55 C;  3C3S A;  4LF6 O;  3B40 A;  2KSD A;  3CRC A;  3SJB C;  4L87 A;  4GX0 A;  3DGE A;  5LGU A;  4J9Y B;  3ZJZ A;  5L3G A;  3BEH A;  3FX7 A;  5CMU A;  4MVO A;  2PI5 A;  3NR7 A;  2A79 B;  3RVY A;  4AQY O;  4FLV A;  4G27 B;  4X65 O;  2ZNI A;  3OM3 B;  4E2L A;  4PA3 A;  2UUB B;  1KBH A;  1R3J C;  1MAB G;  2ZE5 A;  4GUN A;  1DGS A;  3CJH A;  1X59 A;  1Z5W A;  3E22 A;  3BCC H;  4B3T O;  3OUF A;  4LF5 B;  5EYP B;  2QDO A;  4R7C A;  3BRC A;  1JOY A;  4UV9 A;  2GHY A;  1HNW B;  1F51 A;  5J2U B;  4UCS A;  2HEP A;  5BXZ A;  4IHJ A;  4PDM A;  3H1J H;  2ZIM A;  5IDJ A;  1XIL A;  2VQE B;  1KKC A;  4WBN B;  1GN6 A;  4X62 B;  3D3Q A;  4IHJ B;  3UCS C;  3A0B Z;  4K3A A;  3CCE V;  3JSL A;  1BE3 H;  4BIU A;  2DE0 X;  4GKJ B;  3K5L A;  3CCU V;  4JYA O;  4O4L A;  1R3K C;  3T1Y O;  3BVO A;  5IJ9 A;  1OCR B;  2EIL C;  4RAI A;  2JGD A;  2RMK B;  4MVM A;  4NB5 A;  4DRX A;  2YXY A;  5DEC A;  1Q82 W;  2OIE A;  3J81 N;  2Y69 C;  1BL8 A;  4TQF A;  4DW0 A;  5LHG A;  1N34 B;  3DSQ A;  4OPH A;  1H8H G;  3L9D A;  2WLK A;  2Z0A A;  1S76 D;  1VF7 A;  3OD4 A;  2XAF A;  4Z1V A;  2BTQ A;  2DN9 A;  2YDE A;  4YY3 O;  1SC5 B;  2WLL B;  2ZM6 B;  2F1M A;  1BQ0 A;  4L8J A;  1NQT A;  4JI5 O;  2GUZ B;  3QNE A;  4O4H B;  2F23 A;  4I4T B;  2NNU A;  1GO3 F;  3D8C A;  5JH7 B;  4DUZ B;  1I5Y A;  3FB5 C;  4DR5 B;  1G8M A;  4LWS B;  2KG7 A;  1CP9 A;  3GWK C;  3BHP A;  3TK1 A;  4ZKI A;  3H9V A;  1YJ9 V;  3ASO C;  3ZCC A;  3ZRW B;  4FVM A;  1GM8 A;  3JYC A;  1KB9 F;  4DRX B;  3W7W A;  1MSD A;  3T1H O;  3FYI B;  4I5S A;  2V7Q G;  1L1F A;  1YF2 A;  4JI3 O;  1R1B A;  1K97 A;  2K9P A;  1M57 B;  5JJN B;  1WB7 A;  3ZMZ A;  1YHQ V;  1ZLZ A;  4PEL A;  1URF A;  1IBL B;  5B66 Z;  2YUA A;  1SER A;  3ZHV A;  1Y4M A;  1LR1 A;  3ABK B;  2V1D A;  2QM7 A;  4MS2 A;  4PDR A;  4JAV A;  3VQY A;  1VAR A;  4TUY A;  2OTL V;  3U11 A;  4PI2 A;  3I56 V;  2QA4 V;  4RQE A;  1K9M W;  2X0L A;  4JZG A;  2YEV B;  5BMV A;  3P3P A;  5L3F A;  4O2B B;  4WCE V;  4PV1 B;  4FLT A;  1BZK A;  1D5A A;  3ZRW A;  1KKD A;  2Q0O C;  4UVC A;  5CN0 A;  1HR0 O;  1KYO F;  4JI7 O;  1JQ0 A;  1SQF A;  3K0D A;  5CBH A;  4P2Z A;  2X6C A;  3S3X A;  2NLJ C;  1NBM G;  3A2F A;  3QVN A;  4AHC A;  4NKG B;  2IM9 A;  3FAV A;  3SYQ A;  4GT1 A;  3SPJ A;  1US6 A;  3P3N A;  4YJ3 A;  3CRR A;  3E22 B;  5CA1 A;  3OMN B;  3RN4 A;  5JWP A;  3ABT A;  4WFE A;  2D3O W;  1J95 A;  3OT7 A;  4FM1 A;  1VQP V;  2WLM A;  5B1A C;  3L71 H;  1MZF A;  2ZIO A;  5H9C A;  1YVW A;  4QIW F;  3JAM N;  1IBK B;  1O9H A;  2EIK C;  2B9Z A;  1IBK O;  2W6J G;  4WFH A;  2CTQ A;  3K04 A;  2AGA A;  5JQG B;  3ETD A;  3E35 A;  5CA0 B;  3RBZ A;  5KUM A;  2XHB A;  3CJH B;  2WLI B;  5LMU O;  1RPR A;  1KD1 W;  2R9I A;  4F6R A;  2R9R B;  2WLH A;  1V55 B;  4UVB A;  2MW2 B;  1QCE A;  5J2U A;  3HKC B;  1VQ8 V;  1K33 A;  4EFB A;  4XBF A;  1JX9 A;  4GZR B;  3CCL V;  4TWK A;  3ZMT A;  2EIJ B;  5B1B C;  5B3S B;  1S77 D;  4I50 B;  3SR2 C;  4JI7 B;  5AG2 A;  2WLL A;  1Q6U A;  1SES A;  4DW1 A;  1U97 A;  4O4H A;  2GUZ A;  5IYZ B;  2EIM B;  3JAL B;  4UCR A;  4UUJ C;  1XL4 A;  1AR1 B;  2ADP A;  2EUL A;  1KP3 A;  4H0L B;  2HLD G;  4F6R B;  5KHG A;  1VQ4 V;  3SJQ C;  3N2G A;  4HAM A;  1GH6 A;  2EIN C;  2ITD C;  3F7V C;  3AEI A;  4Q6G A;  4LFB B;  1S5J A;  3ZRX A;  2M7W A;  4X20 A;  1YCI A;  3QF7 A;  1FXV A;  5CBG A;  4TUY B;  4IYI A;  4OXS A;  1QLE C;  1HNX B;  1PM9 A;  3R65 A;  2M6Y A;  1DF5 A;  5KA6 A;  2ZKO A;  2QM8 A;  1SQP H;  3RYH A;  2YIB D;  2LJ2 A;  3SYA A;  1Q81 W;  3AG2 C;  1YIT V;  1N4C A;  2QWP B;  1OCO B;  4LF9 O;  1Q43 A;  2OIG A;  1K34 A;  2QKS A;  1XMO O;  4TV9 B;  2QTO A;  2ZM6 O;  1DLB A;  2XND G;  4NR1 A;  3WG7 C;  2IH3 C;  2OCC B;  3LDD A;  4TOI A;  4I9Q A;  2PY5 A;  2KKW A;  1Q5O A;  5KX5 A;  3ASN C;  1H2N A;  2HP8 A;  4X66 O;  1Y74 A;  3I55 V;  1U96 A;  1K5S A;  1K3E A;  2XAQ A;  3DC6 A;  3CME V;  5LXT A;  2WLI A;  2CUG A;  4DK0 A;  1HNZ B;  4JGS A;  4FM2 A;  2DYS C;  5EIB C;  1FFX B;  4JI6 B;  5JH7 A;  4DV4 O;  4KL1 A;  1VQO V;  4B3M O;  2QGN A;  3L72 H;  2PF4 E;  2RJZ A;  3WU2 Z;  4PDL A;  4PA4 A;  4B3R O;  1RM1 B;  3DXR A;  3RT3 C;  4O4L B;  4G2K A;  3JAW B;  4AQY B;  4JI5 B;  3CC4 V;  1NTM H;  1FYJ A;  2ATK C;  4PJ0 Z;  4X89 A;  2HHH B;  1KP2 A;  4QJF B;  3JAL A;  1QR9 A;  3SJA C;  2P7T C;  2AXT Z;  4X66 B;  2H8P C;  2Y0P A;  1I94 B;  3GB7 C;  2G38 A;  4KFM A;  3T1Y B;  4X64 B;  4R8C A;  1MSW D;  3T4D A;  3TET A;  2B1I A;  2ZR2 A;  1NS1 A;  2GTS A;  1NTK H;  2FML A;  2LGW A;  3BPZ A;  2LW1 A;  2A7W A;  4ICG A;  3AG3 C;  1WP7 A;  3TXS A;  4FLY A;  2WSS G;  5GTH Z;  2OWO A;  1Q6H A;  4PDV A;  4FPP A;  3UM7 A;  1HNX O;  4JI8 O;  3K9S A;  5JVD A;  1MZE A;  4O4I B;  4QE9 A;  5IJ0 A;  4A5U B;  4DUZ O;  4ZI7 A;  3WB2 A;  2AZ2 A;  5B1N A;  1AJP A;  1ARO P;  2UXX A;  4K35 A;  1R6K A;  1IXM A;  5C93 A;  5DM6 V;  1SQQ H;  3JAK A;  2DOS A;  1A32 A;  2CH7 B;  5IY5 B;  3K79 A;  2ODM A;  5LXT B;  5EC2 C;  4XDJ A;  1ZWI C;  2ZE8 A;  2F4V B;  2YI9 A;  3KKY A;  1VQ5 V;  2PZS A;  4P9P A;  3EVK A;  3MDS A;  3CPW U;  3RVZ A;  1GKF A;  4X20 B;  1IZ3 A;  1QLN A;  1M5I A;  2VS0 A;  2BOB C;  1LNQ A;  2EZO A;  2JEU A;  4MW8 A;  2E75 B;  4U7N A;  1AP5 A;  1S5H C;  4DR2 B;  4ZI7 B;  2CK3 G;  1WAZ A;  4DR3 O;  3FAV B;  3JD3 A;  2NN4 A;  4X9Q A;  3ZRV A;  1IBM B;  1WP8 A;  5LHI A;  1W0J G;  4DR6 B;  4D6T H;  1PKX A;  3FB6 C;  3E8B A;  5JCO A;  4ZIB A;  1IUR A;  3APO A;  3E2E A;  1S3J A;  1PL4 A;  4I0X B;  4B3T B;  1ZX3 A;  4B7E A;  4CZZ A;  2E76 B;  2GV9 A;  2PTM A;  3OEE G;  2A06 H;  4I50 A;  1X4T A;  1ZAU A;  1GTO A;  2HJD A;  2V4D A;  2F93 B;  1BHA A;  1MA1 A;  2ZNJ A;  5KAF Z;  3K06 A;  5D5P A;  1KEC A;  2FTK A;  4X62 O;  2E5L B;  1FXK B;  2Z5U A;  3JAW A;  3AK3 A;  3OMI B;  1Y67 A;  4UVA A;  4TV8 A;  5ITZ A;  2VQF B;  4G28 B;  2EIM C;  2IJH A;  4CS4 A;  3K03 A;  4QNH B;  3BY6 A;  4UB8 Z;  4RUE A;  4DR4 B;  4X65 B;  1BHB A;  5CA1 B;  3SJC C;  5KHH A;  4B3S B;  4J7Z A;  1WA8 A;  4LFC O;  1PL0 A;  4WF9 V;  5EBL C;  1THZ A;  3CE2 A;  4UCU A;  1LUV A;  3UT5 A;  1L0L H;  3ETG A;  4FLZ A;  3QO8 A;  3ABM C;  1G4Y B;  2RDC A;  1FS0 G;  1F4N A;  1JCH A;  2WLN A;  4NTW A;  5LOV A;  2DWD C;  1EM1 A;  2P4K A;  4U3J A;  3WG7 B;  1UFI A;  3T1H B;  3IFX A;  1M4U A;  2F4V O;  2PGG A;  3W7T A;  1OCZ C;  5FNV B;  4DR2 O;  5GTI Z;  2BTQ B;  5EIB D;  1UJW B;  4JI2 O;  1RSO B;  1LUW A;  2QWR B;  4TQD A;  4OX9 B;  4JI3 B;  3H1L H;  2UXC O;  3M8A A;  4DV7 B;  5KHJ A;  3STZ C;  1AB3 A;  3O9O A;  1DF4 A;  5A9G A;  1GN4 A;  4BW9 A;  4W4K A;  3CCJ V;  1HW7 A;  1AI6 A;  2ITC C;  3OR7 C;  4FZ1 A;  1XHZ A;  1KU9 A;  2A9H A;  3U10 A;  2Q7H A;  1Q7Y W;  4O2A A;  4AI8 A;  3VQW A;  1Q3E A;  1QR8 A;  2K1E A;  1SQV H;  4MVQ A;  1FFX A;  2Q68 A;  4X88 A;  2PYJ A;  3S3W A;  2ZR3 A;  3ABL C;  2RCV A;  4WFA V;  1L0N H;  2IU0 A;  1FAF A;  3D3I A;  3K58 A;  5HFL A;  1XL6 A;  4I4T A;  2BSK A;  2DQ0 A;  4CH6 A;  5BR8 B;  4F4L A;  1NH2 D;  4P9O A;  1YTF D;  2KG7 B;  1QVF U;  3AG3 B;  2CTR A;  2X7R B;  3OTO O;  4WBN A;  1I7F A;  4UV8 A;  3BA9 A;  4MVU A;  1YXB A;  4DK1 A;  3G80 A;  1WNS A;  2YID A;  4GKJ O;  3F5W C;  1XHX A;  2P22 C;  1M9N A;  5F2V O;  1OZ0 A;  1M1K W;  5KLV H;  3AG1 C;  2AW9 A;  4X64 O;  3THO A;  4KP4 A;  3CXH F;  1GM9 A;  3LUT B;  3JAS A;  2OTJ V;  4DV3 B;  3W7U A;  3CP1 A;  3UO3 A;  1K4D C;  2QWN B;  3CX5 F;  3JAS B;  4N23 A;  3L75 H;  4Q20 A;  4GCZ A;  3AG2 B;  4DR4 O;  2E5L O;  3LNM B;  4LFA B;  3E8F A;  4YJ3 B;  2P06 A;  4JYY A;  2P5O A;  3PJS K;  1VF5 B;  1JFF A;  5EC1 C;  1ORQ C;  2DYR C;  3JAR B;  3OTO B;  5IY5 C;  2A0L A;  2QKC A;  5LYJ A;  4LWS A;  4HBN A;  3OGC C;  4B3R B;  1AI4 A;  5D5Q A;  4NTY A;  3ABL B;  4X8A A;  4CH4 A;  4JI0 O;  3IAY A;  2LQT A;  1TVK B;  5JQG A;  1S0V A;  2DYR B;  3DC5 A;  2DMX A;  4LFA O;  3JAK B;  3OGI B;  1NZ6 A;  3SDL A;  5EBW C;  2HJF C;  3K57 A;  2FB5 A;  4LP8 A;  1NJI W;  1BGY H;  5BR8 O;  1PNM A;  3CRA A;  3SYC A;  3L74 H;  1K4C C;  3T1C A;  2Z3Y A;  1NTZ H;  1OCO C;  4CC6 A;  3OAA G;  3OUS A;  3JD0 A;  1DTO A;  2QWO B;  4EEQ A;  3ZRS A;  4JF3 A;  3U0Z A;  1J5E O;  1CPY A;  1WA8 B;  3TCU A;  3CXC U;  4J7J A;  3G71 V;  4MTO A;  3HKB A;  1SF9 A;  4DV5 O;  4GKK O;  4R6Z A;  2Q9L A;  2UXD O;  2Q6A A;  1I5X A;  2EJR A;  3SPG A;  3F7Y C;  1YJW V;  1P7G A;  2EBO A;  3CHX A;  1B3Q A;  4D7S A;  4JI1 O;  2OCH A;  1Y6X A;  3M7M X;  3OW2 U;  4DR1 O;  3X2Q C;  3LNN A;  2PUS A;  4J11 A;  4QE7 A;  3E8H A;  2Q73 A;  4F6E A;  2NR5 A;  4FFB A;  2Q5Z A;  3CCQ V;  1EFR G;  4DV7 O;  2IW5 A;  3OTF A;  2D2C B;  4DV2 B;  4PHZ A;  1VP7 A;  2YSU B;  2ZDI C;  3KG2 A;  1RSO A;  2RNB A;  2IJI A;  3JSN A;  1R3L C;  3X2Q B;  1XNR B;  1N36 B;  1V54 B;  5FPR A;  2Q67 A;  4LF4 B;  3FKS G;  4DV0 O;  3M99 B;  1JFF B;  4LH6 A;  5JCO C;  4TV9 A;  1XBL A;  3ASN B;  2XUM A;  4R50 A;  4KHP B;  4XDK A;  4ZHQ A;  1PNL A;  4JTA B;  5IJ0 B;  1ROP A;  2CDY A;  2YXH A;  3OR6 C;  5BZB A;  3CCR V;  3PN1 A;  4LF8 O;  3K5M A;  4GX1 A;  3K5O A;  4DV4 B;  5IWA B;  3RGB A;  4LF7 O;  4JYA B;  1M56 C;  5IWA O;  5KA5 A;  5IYD O;  4JI8 B;  2QTS A;  4ZBM A;  1NVP D;  5LA6 B;  2L35 A;  2WWW A;  1I08 A;  2QWQ B;  4HYO A;  4YIP A;  3SYP A;  2AHY A;  2X6B A;  1P4R A;  4FLX A;  4JYC A;  5GON B;  1YJN V;  4QPK A;  1FKA O;  5IYZ A;  4Z1M G;  4PD4 F;  1OHH G;  3ABU A;  3HKB B;  2UUC B;  2JIZ G;  3P32 A;  1G1X B;  1XI1 A;  5DED A;  3N2K B;  1QBZ A;  5LGT A;  1QQC A;  3AG4 C;  2QM4 A;  3CB2 A;  1OCR C;  2EIL B;  4BIZ A;  4UXN A;  5LP6 B;  4YIO A;  4LNU A;  1SKV A;  5CB4 B;  4TV8 B;  2JK5 C;  1QVG U;  4LBE C;  5H6R A;  2FKX A;  4FM0 A;  2AHZ A;  1HNZ O;  2E74 B;  1N32 O;  2P4V A;  4DV2 O;  4JTD B;  5E1A C;  2EZP A;  2FL4 A;  2IJK A;  3WB0 A;  3FFQ A;  5KMG A;  1GN3 A;  4CH5 A;  2ZE6 A;  5LYJ B;  2YIB A;  1AR4 A;  4RQF A;  4DXW A;  1AVM A;  5B1A B;  4DV6 O;  4FFB B;  2ADQ B;  1H8E G;  2EIN B;  2JJ1 G;  4O2A B;  1ZL8 B;  2ZXW C;  4JAS A;  4MVS A;  4K0K B;  2W0F C;  4LFB O;  2H3O A;  4CBC A;  4NTX A;  1XNQ O;  3J7A U;  1TAE A;  3ZN1 A;  4DR3 B;  2LFS A;  2W6I G;  2GBO A;  5IT9 N;  1CXZ B;  4J80 A;  2JEX A;  4GYC B;  5JJE B;  4JV5 B;  3ZN0 A;  1M90 W;  1YEW A;  3B4S A;  2DYS B;  2WLJ A;  2ZCE A;  2JDI G;  1AR5 A;  3A0H Z;  1JVM A;  1SA0 A;  2BE3 A;  1AI7 A;  3A8T A;  4OX9 O;  3B8M A;  1KMI Z;  1B04 A;  5K1P A;  1GMG A;  4PA6 A;  1FJG O;  1D5N A;  1XQ8 A;  4NXN B;  3ZHT A;  3MHH C;  3ZIA G;  4JAU A;  4MVR A;  1QLE B;  1HDJ A;  1TUB B;  1N34 O;  1R6N A;  3SPC A;  4LC1 A;  1QU7 A;  4NVP A;  1SZT A;  1JR9 A;  5IYB O;  1R73 A;  5LMU B;  4B3M B;  2VWK A;  2ZE7 A;  3ICX A;  1VF6 C;  2B1G A;  4MSW C;  3ABK C;  4JI0 B;  1VQ7 V;  3JAR A;  4I0X A;  5K1X A;  3UO2 A;  3JAT B;  2N05 A;  1W2B U;  1VQ6 V;  1EN4 A;  3ABM B;  4X1Y A;  2LW7 A;  3JAT A;  1MMM A;  2Y4T A;  1FFT B;  3RYI A;  2UUA B;  4WFF A;  3JD4 A;  4KHP O;  5LMN B;  4DV1 O;  4EB6 B;  5JVD B;  2BTO A;  4O4I A;  4AIL C;  2P6J A;  1H2K A;  4ABM A;  1D2D A;  2H94 A;  4XDL A;  4IGG A;  4J7K A;  1VQ9 V;  4LF8 B;  1XEQ A;  2KQX A;  1MNG A;  5CBF A;  4J41 A;  4DV3 O;  3N2K A;  5J2T A;  1T5E A;  1N0J A;  3ZHQ A;  1BMF G;  2HHH O;  3O65 A;  1FXK C;  2ZXW B;  4CC5 A;  1S72 V;  5LMN O;  4KXR A;  2E3C A;  3RYC B;  3QO5 A;  4BAY A;  4KUM A;  4IL6 Z;  2ZIN A;  4LF4 O;  1GN2 A;  1P7B A;  3C90 A;  5HFM A;  2HFE C;  4YHH B;  3ZED A;  1KUQ A;  1VQM V;  2Y4U A;  2F95 B;  5IE9 A;  1BSM A;  3H1H H;  4O2B A;  1EN6 A;  1GM7 A;  1WLE A;  1CEZ A;  3BA8 A;  1SA0 B;  2LFR A;  1PNK A;  3SPH A;  1AI5 A;  4MTX A;  3EXA A;  3L70 H;  3LSS A;  1IBM O;  1BCC H;  2XT9 A;  3LSQ A;  2UXC B;  1IXB A;  3AK2 A;  4RO2 A;  1DK1 A;  2VRZ A;  4J9Z B;  4YXW G;  2N74 A;  3C3T A;  3N27 A;  4DUY B;  3QG5 A;  3AG4 B;  2CTP A;  4DV6 B;  2Q69 A;  3CCV V;  4RWU A;  5EZY B;  2JS5 A;  2OCC C;  3FYE B;  4K8Z A;  3CMA V;  1M93 A;  2Y48 A;  3JCZ A;  2OYQ A;  4I7Z B;  1HP8 A;  1RPO A;  3K08 A;  1Y76 A;  4HNA B;  4JV5 O;  2QKA A;  3B8N A;  3G67 A;  2DQ3 A;  2OT5 A;  5FLX N;  1NH2 B;  1N32 B;  1ZTE A;  1AP6 A;  4UCV A;  3HKD B;  4U3J B;  3KCX A;  2PI4 A;  1QHT A;  2Q4P A;  4IYH A;  1YIJ V;  1FXK A;  2O57 A;  1IDS A;  1I94 O;  1TVK A;  3H1K H;  3HKE A;  4GX2 A;  2ZDI A;  3RYF B;  4O4J B;  3ZHU A;  1O9G A;  1SS3 A;  5EYP A;  2EX3 A;  2QEX V;  2GDS A;  2ZQM A;  2HVK C;  3K9A A;  5GW7 A;  5LGN A;  3E86 A;  4WFG A;  2XAG A;  2VQF O;  1S5L Z;  1FPO A;  4PI0 A;  5KAI Z;  1PD3 A;  1NKD A;  3AG1 B;  4DR5 O;  1M57 C;  2Q7E A;  3RW0 A;  5B5E Z;  4PA9 A;  4LFC B;  4QGP A;  4UB6 Z;  4FJC C;  1GAX A;  3UT5 B;  2IBZ H;  2IU3 A;  3L73 H;  1L8D A;  4LCU C;  4DV1 B;  2UU9 O;  3E89 A;  1YI2 V;  5TIS Z;  1V54 C;  2GTA A;  3H1I H;  4JI6 O;  4LH7 A;  4X1I A;  4X1K A;  2UUA O;  2UXN A;  1R6T A;  3CWB H;  4W4L A;  3QO7 A;  3OMA B;  3RYF A;  4NXM B;  3STL C;  1F23 A;  2ARH A;  1VQL V;  1JJ2 U;  2LO1 A;  1MOF A;  3G6E V;  1I0H A;  2YC0 A;  4TT3 G;  2XAJ A;  4J42 A;  3RWR D;  3K5N A;  1K5Q A;  3A0R A;  1W59 A;  1M56 B;  1Y66 A;  1XMO B;  3ZMS A;  2L6L A;  3HB3 B;  3D36 A;  3Q4H B;  1PP9 H;  1FXH A;  3T4Z A;  1VEW A;  4DR7 B;  1AIL A;  2CAZ C;  1Q8I A;  2EJ7 A;  1OV9 A;  1TUB A;  3E8G A;  5KUK A;  4EB6 A;  2QR4 A;  3K3W A;  2ETN A;  3ZMU A;  4HZ3 A;  5BY1 A;  4BIO A;  3TXQ A;  2JVD A;  4LF7 B;  5B1O A;  4FFK A;  4YJ2 A;  1N33 O;  3ZX6 A;  1PV0 A;  2YEV A;  2IJJ A;  4LF5 O;  4EFE A;  2XAS A;  3N2G B;  1RFY A;  3SGI A;  2JGU A;  5LOV B;  2QE7 G;  4PA7 A;  3ETE A;  4OPA A;  1ZUQ A;  1BT8 A;  5EBM C;  1WPX A;  2QJ1 A;  4JI4 O;  5ITZ B;  2YI8 A;  4K0K O;  2Q7G A;  4JI2 B;  3CD6 V;  2BSK B;  4LF6 B;  4O4J A;  5IYC O;  5KHK A;  1H38 A;  1VQN V;  5FPO A;  4JTC B;  1COW G;  2BOC C;  3DTU B;  4BR6 A;  4GKK B;  4LF9 B;  3JD1 A;  1WPB A;  1AJQ A;  1N36 O;  3HR0 A;  3K59 A;  2CGO A;  5L3E A;  5A2Q N;  2Q0A A;  4TSF G;  1PPJ H;  1K92 A;  1H2L A;  4YY3 B;  2JGD B;  3VQV A;  4YJ2 B;  5J9P C;  4ASU G;  3AK1 A;  4DV5 B;  2WA3 A;  2HR3 A;  2JS3 A;  4IIJ A;  1J5E B;  1XNQ B;  1H2M A;  4GX5 A;  4I9W A;  4DYL A;  3BAA A;  3ZS8 C;  4WFB V;  2JJ2 G;  3CYO A;  1HNW O;  2X6A A;  1N33 B;  2JRI A;  5E79 Z;  5FNV A;  1Q90 D;  3ML0 A;  1ZSP A;  3B09 A;  2DW4 A;  3DXR B;  4NYK A;  1AJN A;  2F43 G;  2VQE O;  1XOU A;  3H01 A;  4B3S O;  1Q6I A;  1JJO A;  5KMG B;  1NVP B;  1K73 W;  5B3S C;  2WAM A;  1MG1 A;  4ZHQ B;  4DV0 B;  1P84 F;  1XRE A;  4N21 A;  1KC8 W;  2RN9 A;  4C7U A;  3F5T A;  3SYO A;  1JPX A;  4UCT A;  1GRJ A;  5J2T B;  4NXM O;  2CH7 A;  3KZI Z;  4JYB A;  1N0N A;  3MAQ A;  3ZHS A;  1B06 A;  1NR7 A;  2VWJ A;  2UUB O;  1F4M A;  1WN7 A;  4FLU A;  4E4E A;  4DR6 O;  3EHB B;  2DWE C;  2UU9 B;  3CRQ A;  2B5U A;  3LSU A;  4LR3 A;  3VBB A;  2EIK B;  3WFV A;  4CH3 A;  4UFZ A;  3CSX A;  2YS8 A;  3IJ4 A;  3P30 A;  4I55 A;  1G6U A;  3RYI B;  3ZBH A;  4D7T A;  1XNR O;  5LL6 Y;  1R3I C;  5H2F Z;  5FL7 G;  3Q4H A;  1QNM A;  4H33 A;  3CS5 A;  4X1I B;  1RM1 C;  3NXS A;  4ZOL A;  5LP6 C;  3HKD A;  5H6Q A;  1UPG A;  2N04 A;  3GVM A;  1NI8 A;  1Z2G A;  3WB1 A;  1EZJ A;  5LHH A;  3LDC A;  1YZB A;  3CC2 V;  3AG7 A;  3CEI A;  3HPL C;  1VIB A;  1N8R W;  2Q8V A;  5EZY A;  4RUF A;  4DO2 A;  1W0K G;  2YIA A;  1RP3 B;  2Y0I A;  2HG5 C;  1FJG B;  3OEH G;  2W0X A;  3FD9 A;  1KQS U;  2AZ0 A;  1SRY A;  4H37 A;  1EBO A;  3RYH B;  2UXD B;  2XOK G;  2R9A A;  3RYC A;  3ZHR A;  1NT2 B;  3UQ8 A;  2RQ6 A;  4IT5 A;  1VMG A;  4DR1 B;  4X1Y B;  5CA0 A;  4IIJ B;  5LP6 A;  1IBL O;  1SQG A;  4MT8 A;  2UXB O;  2ZT9 B;  4QPJ A;  4CS3 A;  3W7S A;  4DUY O;  4DR7 O;  4H13 B;  3UKM A;  2KB1 A;  1XMQ B;  4YHH O;  4JAA A;  4J10 A;  1WB8 A;  4JI4 B;  4MTG A;  3TJT A;  1JA8 A;  3ETQ A;  1E79 G;  1XUQ A;  1NU1 H;  2XTA A;  1OCC C;  5IJ9 B;  3HKC A;  5DN6 G;  2HKO A;  2CGN A;  5CA3 A;  4U3F H;  4P30 A;  3G4S V;  1JMK C;  4CS2 A;  5LA6 A;  1SZX A;  1K8A W;  1H2S B;  3ASO B;  3BAB A;  1WJZ A;  4JPR A;  1OCC B;  2FYU H;  3SPI A;  3CRM A;  3OFN G;  1YTF B;  1EN5 A;  4FK5 C;  3J80 N;  4Z2W A;  1Y76 B;  4HNA A;  5L3D A;  2EIJ C;  5B1B B;  1F7Y A;  3MD0 A;  2LP7 A;  2R72 A;  4MVZ A;  5L3C A;  2A3Q A;  3ZMV A;  4GLX A;  2ZD9 A;  1ENV A;  3W7X A;  2MK3 A;  1V9P A;  2ILM A;  1IX9 A;  3TGU H;  2CTW A;  2YIC A;  1HWY A;  2Y69 B;  3HKE B;  3JD2 A;  1GK9 A;  3FB8 C;  4B08 A;  2QSA A;  4FMT A;  1EZV H;  4EKW A;  1YSC A;  2UUC O;  1H2G A;  3I5D A;  1Z5V A;  3B2E E;  3G6B A;  2CE4 A;  5JJJ B;  1BS3 A;  1TA8 A;  2LGQ A;  4FLW A;  4H44 B;  1HR0 B;  1XMQ O;  2R70 A;  1P49 A;  2UXB B;  4NXN O;  3R66 A;  4UCO A; 
#chains in the Genus database with same CATH homology
 3APQ A;  2QSA A;  2LO1 A;  2OCH A;  4J80 A;  1IUR A;  2DN9 A;  2CTQ A;  3APO A;  2CTP A;  2QWR B;  2YUA A;  1BQ0 A;  2M6Y A;  3UO2 A;  1FPO A;  2DMX A;  2LGW A;  2PF4 E;  2QWO B;  3BVO A;  1BQZ A;  2N05 A;  4RWU A;  2GUZ B;  1HDJ A;  1NZ6 A;  2QWQ B;  1WJZ A;  2CTR A;  2L6L A;  4J7Z A;  2N04 A;  2KQX A;  3UO3 A;  1N4C A;  2QWN B;  2Y4T A;  2YS8 A;  1GH6 A;  2QWP B;  4IT5 A;  3UCS C;  2CUG A;  2CTW A;  2Y4U A;  2EJ7 A;  3AG7 A;  1FAF A;  2GUZ A;  1XBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...