3RWRD

Crystal structure of the human xrcc4-xlf complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
227
structure length
227
Chain Sequence
b'MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein XRCC4
publication title Structure of human XLF-XRCC4: assembly of a functional DNA repair complex
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
total genus 49
structure length 227
sequence length 227
chains with identical sequence E, H, I, L, M, O, Q, S, T, W, X
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rwrD02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 3rwrD01
3II6A 3RWRA 3RWRD 2QM4A 1M5IA 3SR2C 4XA4A 5CJ4A 3SR2A 5CHXA 5CJ0A 2R9AA 1FU1A 1KU9A 3MUDA 1IK9A
chains in the Genus database with same CATH superfamily
4WCEV 2P06A 4MW3A 5J2UA 4EB6A 4GKJB 4PA4A 2YSUB 4O4IB 1MA1A 2QWQB 3DC6A 3ZRXA 2LFRA 3HKCA 2AW9A 4FLXA 4HNAB 3IC9A 1AI7A 2X6CA 2IJIA 4X1KB 3CRAA 4LF5O 2OCCC 3FB6C 2MK3A 4G28B 2P22C 2IW5A 4DR3B 4DUZO 4B3RB 3RFRA 3CXHF 4JTAB 4JASA 2DWEC 2HHHB 1DGSA 5CBHA 4TV8A 1BT8A 3QVNA 5IY5B 1H2MA 1N33O 1WA8A 2XASA 3APOA 3CCRV 2KG7A 2OTLV 3CMAV 4NXNB 3G6EV 3B2EE 4DV7B 2ATKC 2P67A 4R8CA 3NXSA 3WB1A 4HBNA 2FB5A 2D3OW 4ZIBA 1PV0A 1VQMV 3M99B 1PNLA 2GTSA 4L8JA 2X6BA 1GK9A 4PV1B 4IGGA 1XOUA 1JFFB 1KU9A 2RQ6A 4I4TB 4NXNO 1FJGO 1VF6C 2AZ0A 4DV7O 1KB9F 1IBMO 1M1KW 4JYYA 2EIJB 2Q5ZA 5CJ4A 3CWBH 1V54C 1VQ5V 4X1IB 2HLDG 1R6KA 4LF9O 2Q9LA 5DM6V 2NN4A 3APQA 2CUGA 2BCCH 3JCUZ 3JD2A 4JI8O 1D5AA 4LFBB 1HP8A 3KCXA 3L74H 4QE7A 3ZRWA 1RSOA 1Y76B 5IJ0B 1TA8A 3OM3B 2EILC 2IH1C 1NVPB 2NLJC 2BOBC 3JD1A 4UB6Z 5C8YB 1XREA 3X2QB 3CS5A 3H01A 4YY3B 4LFBO 1WPBA 4JI1B 4CKMA 2R9RB 2Q73A 1NS1A 3ZMTA 4I50B 4JYBA 2JIZG 1K34A 2EIMB 5LHHA 5CA1B 1VQOV 2QDOA 5BMVA 4YIPA 4LF6O 1KC8W 3OUSA 4JF3A 1XL4A 3ZN0A 1YCIA 4K0KO 1EBOA 5JVDA 4X8AA 2PI4A 1PD3A 1HR0O 3U11A 3SJBC 2CH7B 2Q0OC 3A8TA 3OEEG 5B1NA 2KKWA 1Y6XA 2HVKC 2N74A 5E1AC 1I94B 2VWJA 2GDSA 2FMLA 4TV9B 1I5YA 2JS5A 3K06A 3P32A 3QNEA 3BHPA 1KKDA 3B8MA 1WPXA 4YJ3A 1CXZB 1GAXA 4JTCB 4X65B 4O4HB 1IBLB 1CP9A 1GM7A 1AJPA 1N36O 2QEXV 3RWRD 3N2GB 3LSQA 5LMUB 1QVGU 2YIAA 1YI2V 1AR5A 1XNQO 4DUYB 1B6QA 2BSKA 3QO8A 3ZRSA 1IK9A 4WFEA 3QO7A 1SERA 1NKDA 3ETDA 4DRXA 1OCRB 1SA0B 1K7DA 5LMUO 5B3SB 1BS3A 1V55C 2GHYA 4I0XA 3DC5A 3JASA 5CJ0A 4PA9A 2ZD9A 4UV9A 4YJ2B 5LA6A 2X6AA 4QGPA 4MVOA 2O57A 4ZBMA 5K1XA 3VBBA 3W7XA 2DYSB 1ZUQA 3HKEB 1SESA 3HKBA 4QPJA 2W6JG 5CB4A 1QHTA 1OCOB 3CPWU 2XAJA 3ZHUA 4O4LB 5JCOC 5KAIZ 4FM0A 4LWSA 5JCOA 3CCQV 2DMXA 1SQFA 1S5HC 5EBMC 1VF7A 3ASOC 2LQTA 2P90A 5KX5A 1Q3EA 1U97A 1FU1A 2UXDB 2ZXWB 4G79A 3MHHC 3CSXA 4UXNA 4IIJA 4DV5O 2ADQB 5KHKA 3K03A 2PYJA 5LGNA 1AI5A 4R50A 5LXTA 4NTWA 1KBHA 3JD3A 5H6RA 2JEXA 1KECA 1HWYA 5HFMA 2Y3WA 4HNAA 4IYHA 3A0BZ 2LGQA 1MZEA 4X1KA 5J2UB 4LCUC 4EB6B 1XBLA 4B7KA 1KP2A 3HB3B 3HKDA 1VIBA 1QNMA 1JR9A 1EFRG 2PUSA 4QIWF 2Q4PA 5J9PC 3HKCB 5A2QN 3BA8A 4K8XA 2AGAA 2RJZA 4UUJC 2F4VB 4K8ZA 4TWKA 1SS3A 2OCCB 1XNRO 3D36A 1SF9A 2YI8A 4F4LA 4P2ZA 3VQWA 2GV9A 1R3IC 1UFIA 2HR3A 2IJKA 4PD4F 2YIBD 1EM1A 4JI6O 5J2TA 1VF5B 1WA8B 1XMOB 1TVKA 3NR7A 4BWAA 2KG7B 2OTJV 4GX5A 1JFFA 1OJHA 2P7TC 4I4TA 4A5UB 4DR4B 3JSNA 3JYCA 1RP3B 3ZX6A 3E8GA 2IBZH 2GTAA 5H2FZ 2ZE8A 4MW8A 2QWPB 1VQLV 4PDMA 5LP6C 2ZIOA 4GFCA 1IBKO 1XMQB 1WNSA 2FTKA 1DLBA 2Z0AA 5KHHA 5LP6A 3AG4C 3ML0A 4JTDB 4UCUA 1NTZH 1JVMA 2MW2B 2ZCEA 1BE3H 3H1JH 1W59A 2R9IA 4DV2B 2YXHA 3VQVA 4DR7O 4AQYO 3OTOO 2UXBO 3TCUA 5KA6A 3W7UA 1N32O 2VRZA 4GZRB 1V54B 3CCJV 3K04A 3RT3C 1Y76A 4NYKA 3C90A 3RVYA 1S72V 4J42A 2UUAB 1AILA 1FXKC 1H8HG 2ZE6A 3ZIAG 4NXMO 1BSMA 2QKCA 1FXKA 4DV4O 4BIUA 3OFNG 3ZRWB 1S77D 1RSOB 4R6ZA 3GWOA 3P30A 1PPJH 3FYIB 4UFZA 4J11A 4I50A 1L8DA 4GCZA 3UKMA 4CKNA 2P4VA 1M57C 3L70H 5CA1A 2ZIMA 2JJ2G 2EILB 5GTHZ 4ASUG 3E35A 2K9PA 2YICA 3ABLC 5ITZA 4WF9V 3T1CA 2PTMA 1AP6A 4CBCA 2CH7A 1S5LZ 2WLIA 3K5MA 1PM9A 3R66A 2LFSA 4X66O 1G6UA 1TUBA 2Y0PA 1M9NA 1ENVA 3KG2A 2L35A 1M56C 2DYRC 4MTOA 5F2VO 5IYCO 3L73H 1FAFA 4BR6A 1R6TA 5EIBC 2HJFC 3ETQA 1FXHA 1GN6A 1YDXA 4B7EA 1HNXO 4J80A 1YTFD 1M93A 3TJTA 2FKXA 1HNZO 1DK1A 1H2SB 2RMKB 3ZMVA 4JI2O 4DV6B 4L87A 4KXRA 1K92A 4D7TA 5C93A 4NR1A 1WB8A 1KD1W 5H6QA 3T1YB 3PN1A 1P4RA 2DE0X 2NNUA 2V1DA 3CRCA 5IWAO 4DV6O 1SRYA 2EJRA 4FFBA 1FD9A 4IT5A 1Y67A 4LF8B 4I0XB 1YXBA 4XDJA 2YI9A 1F23A 5LA6B 1SQPH 2G38A 2UUCB 2AZ2A 2UU9B 4O4LA 3Q4HB 4ABMA 2ZT9B 1N0NA 1UPGA 2QTSA 3RYCB 4FLUA 3ICXA 4JI7B 5IYBO 2N05A 2YIDA 3CE2A 1M4UA 1QR8A 4DR5B 3S3WA 3IAYA 2QWNB 3HKBB 4N23A 3K0DA 2XT9A 2VS0A 3F7VC 2YEVA 5CB4B 1VQ8V 3GWKC 2P4KA 3BAAA 1K5QA 3A2FA 4JI7O 1Q7YW 4UCSA 4H0LB 5DECA 3IJ4A 2QGNA 3UQ8A 4HAMA 3K9AA 2EINC 1BHBA 3F7YC 5KX5B 3E8FA 1MMMA 1K9MW 4JAUA 3ASOB 4AHCA 2DW4A 3I55V 4AI8A 4IIJB 3UO3A 1NTMH 4CH6A 4MS2A 1K3EA 4LF5B 2Q6AA 3T4ZA 5JH7A 5LXTB 4PDRA 5JJNB 4WBNA 3QG5A 4DUZB 3STZC 4CH5A 4JI5O 4QE9A 4ZKIA 2M7WA 5L3BA 2X0LA 2IU3A 3MHSC 4LH6A 3HKDB 5LYJA 3SYCA 4XA4A 5KHJA 1N33B 3SPCA 1KP3A 4D6TH 1AI6A 2PGGA 3WB0A 1ZLZA 5DN6G 2XAHA 1S5JA 1L0NH 3O9OA 1JA8A 2ZDIC 4BW5A 2XTAA 1YJWV 2FYUH 4CC6A 2ZDIA 4CH3A 1QLEC 1RPOA 4G27B 4K3AA 3J80N 1FJGB 2VQEO 2ARHA 1IBMB 2OWOA 3MD0A 1IZ3A 2QJ1A 1AP5A 3BABA 4PHZA 4ZI7A 1Q6UA 5J2TB 1TVKB 5IYDO 2DWDC 1G4YB 2CTPA 4LF9B 2GBOA 4TSFG 2UXCO 1QR9A 1MSWD 2XHBA 1JPXA 3IGAC 1GM8A 4OPAA 4DK0A 3EXAA 3JAWA 2DQ3A 1VF6A 1THZA 3K5NA 1COWG 4JI8B 4W4KA 4UVCA 2VWKA 1PKXA 3CCVV 3BEHA 1VQ4V 4GEUA 1XL6A 3SR2C 1Q86W 1NU1H 3CB2A 5LP6B 3W7TA 1K4CC 5CBFA 1IURA 4JI0O 3WU2Z 3RYHB 4RUFA 1XQ8A 3SR2A 3LNNA 2WA4A 3CCSV 3AG4B 1R3KC 2F93B 5AG2A 2C2AA 1IX9A 2CK3G 2A9HA 4J41A 1OV9A 1Q90D 3ZEDA 5CN0A 4NB5A 4KHPO 2ETNA 3D3QA 1P7GA 1OCCC 3FAVB 5B1BC 4O2BA 1EZJA 1FXKB 4LF6B 2PF4E 3JARB 4K0KB 1HR0B 1BHAA 1LR1A 1JJOA 2ZINA 4FZ0A 2H3OA 1M57B 5D5QA 4DXWA 3AK2A 3JATA 4ZOLA 3OR7C 1JCHA 3K08A 2KSDA 5ITZB 1HNWO 2WWWA 4CC5A 4GUNA 4NKGB 2WLIB 3ABLB 4Q20A 3ZHSA 1AVMA 4X1YA 4DO2A 3ZMUA 4J7ZA 3W7WA 1K73W 1N36B 1TUBB 1IVSA 5IDJA 1F51A 5L3FA 3E89A 3UT5A 1QLNA 1XNQB 4GT1A 3L75H 3MAQA 1M56B 2DYRB 1FYJA 1URFA 5KUKA 1WLEA 4P30A 1FXVA 3ABMC 3D8CA 5EBLC 4PJ0Z 5LGUA 4DV0O 3O65A 5IE9A 5FPOA 4FZ1A 3K58A 2UXXA 4RQFA 3ZMSA 3H1KH 2E5LO 2Q68A 3EHBB 2LW7A 2QM7A 4LF7O 3SPHA 5LOVB 3I56V 3AG1C 1B04A 2ZR3A 3QO5A 4YXWG 1ZWIC 4GKKO 2OIEA 4U7NA 5EC2C 4B3TO 2OCHA 5FNVA 3G67A 1V9PA 1QCEA 3Q4HA 4FFBB 2F95B 1LUWA 3OMNB 3RYCA 4K35A 3SPGA 3EVKA 4EFBA 3ZRVA 4CS2A 3OGCC 5B1AC 4RAIA 5IYZB 4PI0A 1VQPV 3WG7B 2EZPA 2CDYA 2W0FC 3M7MX 2VQFO 3EFFK 4PA3A 1JX9A 4QNHB 1ZL8A 2Q67A 4DV5B 3FD9A 5IJ9B 3TXQA 2RN9A 2YEVB 2UUBO 1G1XB 1NZ6A 3SJAC 2WA3A 1HDJA 4GYCB 4C7UA 4PDLA 5IT9N 2LO1A 1J5EO 1JJ2U 3C3SA 1VP7A 5KHIA 4MVUA 2JJ1G 1KKCA 2P6JA 2L6LA 4FK5C 2Y3VA 2Q69A 1EN6A 1NR1A 5KA5A 2EINB 3T2MA 3VQYA 4ZHQA 4XDLA 1EZVH 5L3EA 4X88A 3B8NA 3OE7G 5JH7B 5FPRA 2IH3C 4TQDA 1WP8A 4WBNB 1W0JG 3Q0YA 5BR8O 4X64O 3TXSA 1XNRB 4DV3O 3BPZA 2QWOB 2V4DA 1E1QG 4LR3A 1Q5OA 3CX5F 2CGOA 4JZ2A 5B5EZ 1E1RG 5LYJB 4JI6B 4MTGA 3FX7A 4P9PA 1XDCA 4TUYA 2QKAA 1BGYH 1VQKV 2Q7HA 2ZKOA 1VQ7V 4MT8A 4EEQA 2GUZA 3BFRA 2B1IA 5EBWC 2HG5C 1H2NA 1Q6IA 1VQNV 2ITCC 1IBKB 3B77A 1FFTB 2EIKC 1GH6A 3ABKC 1QLEB 2Z3YA 5GW7A 4B3SO 1Q82W 4LFAO 3J7AU 1ZX3A 2BTOA 2WPDG 5B1OA 4ZI7B 4DR7B 4AQYB 3OTOB 3H9VA 2UXBB 4UB8Z 1N32B 1NTKH 3CRRA 1Z2GA 1RFYA 1R3LC 3JAWB 3RYHA 3T4DA 3VQXA 3PYIA 4NXMB 4DW0A 3F5WC 2XAFA 3PJSK 2WLMA 5D5PA 3GB7C 2ADPA 4DV4B 1BCCH 2R9AA 3W7SA 4F6RB 4JYCA 2RDCA 3CP1A 2OIGA 2E3CA 2X7RB 2HVJC 3CCUV 1AROP 3FAVA 1MZFA 1I08A 3ZHVA 2RNBA 3DTUB 1AR1B 5FLXN 1WN7A 3L9DA 4MVRA 3JARA 3BA9A 2JK5C 1DF5A 4WFGA 3K57A 1NH2B 2AXTZ 4DK1A 1RM1C 1YZBA 4OX9O 1PL4A 1Z5WA 5BZBA 3K5LA 2CTQA 4AILC 4O2BB 1OCCB 1XUQA 4X66B 1VMGA 4X20B 3F5TA 5B1BB 3K59A 4HZ3A 2NR5A 2QKSA 1K97A 4QJFB 4JI4O 4GFAA 3OR6C 1GMGA 3FKSG 4BAYA 3CMEV 3SYQA 1QVFU 5EZYA 3FB8C 1HNXB 5EK0A 3JATB 4ZOLB 4JI3B 3BRCA 1IDSA 1HNZB 1FS0G 4JI2B 5LMNO 1Q8IA 3BCCH 3E86A 1OCZC 4OPHA 4ICGA 4X1YB 3CC7V 1MSDA 2XAGA 2IJJA 4DW1A 1BQ0A 3ZHRA 1XHXA 2CTWA 4P9OA 2E75B 3GVMA 4JI3O 5EC1C 3AK1A 3UT5B 5LHGA 3L71H 2R72A 5IWAB 2QM8A 3AG2C 4G2KA 4LFCB 1X4TA 5JQGA 3CEIA 3OT7A 1AI4A 1M90W 1YF2A 3J81N 1VQ9V 5LOVA 3II6A 1YHQV 3ABMB 5CA0A 1CPYA 1S0VA 4JAVA 2EX3A 4JV5B 4UCOA 1L0LH 4DR6O 3E83A 4KFMA 4LFCO 3SYAA 3AG7A 2A79B 1QBZA 3SYOA 3RVZA 5FL7G 3ETGA 1H2GA 1OZ0A 5CMUA 1DTOA 5CA3A 1U96A 4FLYA 2YC0A 1ZSPA 3ZJZA 3FB7C 4JV5O 3AG1B 1FKAO 3FFQA 2Z5UA 3KZIZ 1PP9H 2DOSA 2EJ7A 3WG7C 1AJNA 2BOCC 2BTQB 2WLJA 2P5OA 2PY5A 3G80A 5IYZA 5FNVB 4WFAV 2ZNIA 2QA4V 1WJZA 3AG3C 4LF4B 3H1HH 1R3JC 1B3QA 1O9HA 1SETA 1N34O 5JJEB 2WLKA 3CCMV 1QQCA 5KLVH 4GX1A 5IJ9A 3CC2V 3SDLA 4EKWA 3QTCA 4DR2O 3CRQA 1Q43A 2YUAA 2B1GA 4PI2A 4LF4O 1LNQA 4JYAO 5B1AB 2B9ZA 4GX0A 3JALA 1ZL8B 4FLTA 4LC1A 3RYIA 1QU7A 1NVPD 3OAAG 2HKOA 2WLNA 3B09A 2JGDA 1BL8A 4JI5B 4GLXA 3LUTB 2QWRB 5LHIA 3OMAB 2YXYA 1R73A 3CD6V 1SZTA 2ZE5A 4X62O 1G8MA 3UCSC 5L3CA 3ZMZA 2ZM6B 5TISZ 4O4JA 3STLC 4DYLA 1I5XA 4GX2A 3TK1A 3AK3A 1GN3A 1K4DC 5BY1A 4ZHQB 3M8AA 5GONA 4J10A 1M5IA 2ZM6O 3CHXA 3LNMB 1K33A 3ZHTA 2VQEB 1GM9A 1JQ0A 4H37A 4YHHO 4RQEA 4FLZA 2Y4UA 3N2KA 2HJDA 3CJHA 1KYOF 3H1IH 4HYOA 4W4LA 3MUDA 3IFXA 5EYPB 4GKJO 4KP4A 5B66Z 4OXSA 3D3IA 3RWRA 2UXCB 1YTFB 1XI1A 2OYQA 1R1BA 5L3DA 4Z1VA 4JPRA 4TUYB 5EIBD 2Y4TA 4OGQB 1YJNV 1NI8A 1JOYA 2QE7G 4UV8A 2GUZB 1YITV 2JGUA 4I9QA 4IHJA 3E22A 1NJIW 4DR3O 2W0XA 4IYIA 2Q8VA 1K8AW 4B3RO 4JI0B 4E4EA 3MDSA 3ABUA 2HHHO 2EIKB 2WLHA 3ABKB 1CEZA 4NTYA 1GO3F 1RPRA 3AEIA 4MTXA 2PZSA 2Q0AA 5H9CA 4H13B 4F6RA 1FFXA 4YIOA 5HFLA 4KHPB 2IU0A 1Y74A 2CE4A 2LJ2A 1GN4A 3JAKA 3ABTA 2DQ0A 1IXBA 3QF7A 2AHYA 4Z1MG 3JD0A 3LSSA 4F6EA 3JSLA 1DF4A 2A3QA 1IXMA 1PNKA 1ZTEA 3KKYA 4U3JA 4LP8A 3G6BA 4X20A 3OTFA 2HEPA 1N8RW 3TGUH 1J95A 2WLLA 3RBZA 4DR1B 1Q81W 1HNWB 2QR4A 3BVOA 3ZHQA 1N4CA 1RM1B 5A9GA 2UXNA 1O9GA 3U10A 4DV1B 3DXRA 2D2CB 4J9ZB 2F23A 4DR1O 1EN5A 2Q7GA 2PI5A 1AB3A 1WP7A 2JRIA 5EZYB 1MG1A 1XHZA 4DV0B 4YY3O 2WAMA 4O2AB 4JAAA 1H2LA 1ORQC 4DV1O 4JI1O 4LNUA 1YSCA 4H44B 1SZXA 2E5LB 4PDVA 1SC5B 3LDDA 3ASNC 2E76B 1SQVH 2F1MA 3B4SA 4LF7B 3E8BA 1OCZB 1JMKC 1MNGA 4GKKB 3OGIB 1P49A 1Y4MA 3HPLC 2YIBA 4B3TB 4FPPA 1NQTA 5JQGB 4TQFA 2A06H 1BZKA 5KMGA 2XAQA 1I94O 3AG2B 3E2EA 1H2KA 3UM7A 5CA0B 1NT2B 1PL0A 1US6A 4J9YB 3CXCU 1SQXH 3CC4V 2BTQA 2CGNA 4X65O 4LH7A 1IBLO 1P7BA 1LUVA 2VQFB 2A0LA 3L72H 1XEQA 1PNMA 2ITDC 5KHGA 4DUYO 2XUMA 4D7SA 2UUBB 2ZR2A 4KL1A 4CKPA 1T5EA 2KQXA 2Q7EA 1J5EB 1Y66A 3AG3B 1F7YA 4PELA 4FM1A 1ZAUA 4CS3A 4B08A 1SQGA 1XILA 1KQSU 3HR0A 4RO2A 3DSQA 3SGIA 3JALB 3SPJA 2JVDA 1NH2D 3RYFA 3RYIB 4FFKA 3RGBA 1VEWA 4R7CA 1A32A 2JGDB 4X64B 4I55A 5BR8B 4Q6GA 3UO2A 4DV3B 3ZN1A 5BXZA 1NR7A 2ILMA 4X89A 1FPOA 4O4IA 4O4JB 2EZOA 1S76D 3CCEV 3THOA 2UXDO 3FB5C 2CAZC 5GONB 1EN4A 2Y69B 4PA6A 3OEHG 2ZQMA 5EYPA 1I7FA 1SKVA 1ROPA 1GRJA 1H8EG 1YVWA 3N2KB 4B3SB 4LFAB 5KAFZ 3CJHB 4Z2WA 2WSSG 4IL6Z 4CZZA 5IY5C 3TETA 4MTFA 2V7QG 2F66C 1H38A 1GKFA 3G4SV 4B3MB 4U7OA 4MVMA 3D36C 3SPIA 3R65A 4I9WA 4X9QA 3K0GA 1L1FA 1YEWA 4MVSA 4BW9A 5KUMA 2IJHA 1SQQH 1P84F 4TV8B 4BIOA 1D5NA 3CRMA 4IHJB 3E22B 3P3PA 4B3MO 2F4VO 2YS8A 4J7JA 4J7KA 1MOFA 3K79A 3DGEA 2EIJC 4H33A 3N27A 1YJ9V 4RUEA 4LBEC 3K9SA 4UVAA 4CH4A 1E79G 3G71V 4X1IA 2W6IG 1XMOO 1FFXB 3E8HA 1YIJV 5K1PA 4DR4O 4OX9B 1Y74B 1KUQA 3JAKB 3RN4A 3OMIB 4EFEA 2CTRA 3CCLV 2H94A 3I5DA 1XMQO 4JI4B 1S3JA 3X2QC 1WAZA 5JJJB 5IJ0A 3JD4A 3K3WA 2IM9A 4U3JB 4XDKA 3ETEA 5C8YA 1SQBH 2QTOA 2A7WA 4DV2O 5DEDA 1F4NA 2ODMA 3VOUA 5E79Z 2EIMC 2WLLB 4FLVA 3P3NA 5LMNB 2UUAO 2DJVA 2LP7A 4FIPC 2HP8A 1GTOA 4UCTA 2JDIG 4WFHA 5L3GA 4O2AA 1VARA 4UVBA 4NTXA 3IC7A 1KMIZ 3DXRB 1X59A 4WFFA 2QSAA 4XBFA 4JGSA 1TAEA 1I0HA 3H1LH 5BMVB 4TV9A 4N21A 3A0RA 3RW0A 1W0KG 3CYOA 4E2LA 1VQ6V 1K5SA 4LNUB 1N0JA 5JVDB 4DR6B 2XOKG 3LSUA 2LW1A 4FMTA 3ZS8C 4O4HA 1Z5VA 2XNDG 1R6NA 3BY6A 4GEXA 2GSMB 5CHXA 3N2GA 3ASNB 4U3FH 3LDCA 4YJ3B 5H5NA 1D2DA 4TT3G 1W2BU 4PA7A 1OCRC 5GTIZ 1F4MA 4I5SA 5KMGB 5B3SC 2N04A 1WB7A 1SA0A 1N34B 4KUMA 3T1HB 3LDEA 2M6YA 2K1EA 4WFBV 2BSKB 4MVZA 3SJQC 3ZBHA 5LGTA 4DR2B 3OD4A 1BQZA 2HFEC 4YJ2A 3K5OA 3FYEB 2KB1A 4RWUA 4DRXB 1AR4A 4BIZA 5JWPA 4JYAB 3Q0XA 2H8PC 3WB2A 2DYSC 1TGOA 3T1HO 3JCZA 4I7ZB 3T1YO 3JASB 3HKEA 2AHZA 4FJCC 1OCOC 2ZE7A 3A0HZ 1V55B 2E74B 1MABG 3ZCCA 1NBMG 2RCVA 3SJCC 2LGWA 4UCRA 1B06A 3U0ZA 4TOIA 4CS4A 2QM4A 3KCYA 1BMFG 4JZGA 2JS3A 2JEUA 2YDEA 2Y0IA 4LF8O 2BE3A 3WFVA 5LBQA 4X62B 4FM2A 3SYPA 3B40A 1OHHG 4FVMA 2ZXWC 2F43G 2DN9A 1Q6HA 3OW2U 2Y48A 5LL6Y 2UUCO 2UU9O 4UCVA 3S3XA 2B5UA 3C3TA 2FL4A 4QPKA 1AJQA 3RYFB 2EBOA 4MSWC 2OT5A 3OUFA 4LWSB 4NVPA 4DR5O 2EULA 4FLWA 4MVQA 2ZNJA 1GN2A 5CBGA 2PYLA 2Y69C 4I55B 2YXLA 1HW7A 4YHHB 2R70A 1UJWB 1TUEB 3JAMN
chains in the Genus database with same CATH topology
2PTMA 2Q7GA 5J2UA 4EB6A 4GKJB 3K5MA 5JH7B 4O4IB 5FPRA 4TQDA 5EZYB 4WBNB 1XHZA 1G6UA 1TUBA 4DV0B 4O2AB 1XNRB 3HKCA 3BPZA 4FLXA 2V4DA 4HNAB 4LNUA 4LR3A 1Q5OA 2E5LB 4X1KB 5EIBC 3ETQA 5LYJB 4JI6B 2F1MA 2P22C 4LF7B 4DR3B 4B3RB 4TUYA 3RFRA 1JMKC 1M93A 4GKKB 1P49A 2HHHB 1DGSA 1H2SB 2Q7HA 2YIBA 4B3TB 4TV8A 4EEQA 5JQGB 4DV6B 4TQFA 5KMGA 4D7TA 1IBKB 4NXNB 5CA0B 1NT2B 3PN1A 3T1YB 3B2EE 4DV7B 2BTOA 2BTQA 3WB1A 4HBNA 4ZI7B 4DR7B 4LH7A 4AQYB 4ZIBA 3OTOB 2UXBB 4L8JA 1N32B 2VQFB 4FFBA 1KU9A 1JFFB 2RQ6A 4I4TB 4LF8B 3JAWB 3RYHA 5KHGA 3VQXA 2YI9A 4NXMB 5CJ4A 4D7SA 2UUBB 5LA6B 4KL1A 1T5EA 5D5PA 4DV4B 2UUCB 4X1IB 2UU9B 4O4LA 2Q7EA 1J5EB 2R9AA 4F6RB 3RYCB 4FLUA 3ICXA 4JI7B 2E3CA 1M4UA 4FM1A 4DR5B 3IAYA 1ZAUA 4CS3A 3HKBB 4B08A 1WN7A 5CB4B 1D5AA 4LFBB 1SQGA 3JARA 3BA9A 3BAAA 3K57A 3DSQA 3SGIA 3JALB 3A2FA 4DK1A 1RSOA 2JVDA 3RYFA 4UCSA 5IJ0B 3RYIB 1TA8A 1Z5WA 3K5LA 4AILC 5C8YB 3RGBA 4O2BB 4X66B 3UQ8A 4X20B 4YY3B 5BR8B 4X64B 4I55A 5KX5B 4Q6GA 3K59A 4DV3B 1WPBA 4JI1B 4AHCA 4IIJB 4I50B 4CH6A 4LF5B 5JH7A 5LXTB 5CA1B 4O4IA 4O4JB 5JJNB 5BMVA 5EZYA 4WBNA 3QG5A 1HNXB 4DUZB 3JATB 4ZOLB 4JI3B 3BRCA 4CH5A 3THOA 2CAZC 1HNZB 5GONB 5JVDA 3U11A 4JI2B 5EYPA 1Q8IA 3SJBC 1I7FA 4LH6A 3HKDB 5LYJA 1SKVA 2KKWA 4X1YB 4XA4A 5KHJA 1N33B 1I94B 2VWJA 4TV9B 2JS5A 1XHXA 3WB0A 2PGGA 3BHPA 3UT5B 3N2KB 1S5JA 4B3SB 4LFAB 4YJ3A 2R72A 5IWAB 4X65B 4O4HB 4LFCB 1IBLB 1X4TA 2F66C 5JQGA 4CC6A 4B3MB 4CH3A 5LOVA 3II6A 3RWRD 1FJGB 3N2GB 5LMUB 5CA0A 2YIAA 1IBMB 2OWOA 1YEWA 2EX3A 4JV5B 4DUYB 2QJ1A 4BW9A 4UCOA 4TV8B 3BABA 4PHZA 4ZI7A 1IK9A 5J2TB 4IHJB 3E22B 4DRXA 1TVKB 4LF9B 1SA0B 2XHBA 4FLYA 4DK0A 3JASA 5CJ0A 3JAWA 3FFQA 2BTQB 2P5OA 3K5NA 2PY5A 5IYZA 4JI8B 4YJ2B 5FNVB 5LA6A 2ZNIA 2VWKA 4CH4A 4X1IA 4LF4B 1O9HA 1FFXB 5K1XA 3SR2C 3CB2A 5LP6B 5K1PA 4OX9B 5JJEB 3RYHB 1XQ8A 3HKEB 1QQCA 3SR2A 3LNNA 3HKBA 5IJ9A 3JAKB 2F93B 3QTCA 1Q43A 5CB4A 1QHTA 4EFEA 4PI2A 4O4LB 5JCOC 3ZEDA 3JALA 4JI4B 4FLTA 5JJJB 4FM0A 5IJ0A 5JCOA 3RYIA 1SQFA 2IM9A 4U3JB 5C8YA 4O2BA 1VF7A 4LF6B 5KX5A 3JARB 1Q3EA 4JI5B 1FU1A 2UXDB 4K0KB 4GLXA 1HR0B 3CSXA 4FLVA 1JJOA 4IIJA 5LMNB 5KHKA 2PYJA 2ZINA 2ZM6B 5LXTA 4O4JA 4UCTA 5D5QA 4O2AA 3JATA 4ZOLA 4ZHQA 1KMIZ 4HNAA 4ZHQB 5ITZB 5GONA 4CC5A 1TAEA 4X1KA 5J2UB 1M5IA 4EB6B 3HKDA 4X1YA 3CHXA 1N36B 5BMVB 1TUBB 2PUSA 4TV9A 2VQEB 3HKCB 3UT5A 4FLZA 3N2KA 1XNQB 3BA8A 4LNUB 5JVDB 4K8XA 4DR6B 3MAQA 2RJZA 3MUDA 3ZS8C 5EYPB 4O4HA 1Z5VA 2F4VB 3RWRA 2UXCB 1XI1A 2OYQA 4K8ZA 5CHXA 4TUYB 5EIBD 3N2GA 5FPOA 2YI8A 4YJ3B 3VQWA 3K58A 2GV9A 2YIBD 2JGUA 4I9QA 5J2TA 4IHJA 3E22A 5KMGB 1XMOB 1TVKA 4BWAA 1SA0A 5LOVB 1N34B 1JFFA 1B04A 4I4TA 3T1HB 4DR4B 3JSNA 4JI0B 4DR2B 5FNVA 4YJ2A 3K5OA 1V9PA 5LP6C 2PZSA 2ZIOA 4DRXB 4JYAB 3WB2A 2Q0AA 4FFBB 2F95B 1TGOA 1FFXA 4F6RA 1XMQB 1WNSA 3RYCA 4KHPB 5KHHA 5LP6A 3JASB 4UCUA 4EFBA 3HKEA 4CS2A 2ZCEA 3JAKA 4DV2B 5IYZB 3VQVA 3QF7A 3SJCC 4PI0A 4UCRA 3U0ZA 4TOIA 4CS4A 2QM4A 3M7MX 3JSLA 4DV5B 2UUAB 4X62B 4FM2A 4U3JA 5IJ9B 4FVMA 4X20A 3SJAC 3OTFA 4GYCB 2HEPA 4UCVA 1HNWB 3RYFB 4DR1B 4UFZA 4I50A 1L8DA 4NVPA 5KHIA 4FLWA 5CA1A 2ZIMA 2ZNJA 1O9GA 2PYLA 3U10A 4I55B 2YXLA 1HW7A 4YHHB 2R70A 4DV1B 3VQYA 5ITZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3II6 A;  3RWR A;  3RWR D;  2QM4 A;  1M5I A;  3SR2 C;  4XA4 A;  5CJ4 A;  3SR2 A;  5CHX A;  5CJ0 A;  2R9A A;  1FU1 A;  1KU9 A;  3MUD A;  1IK9 A; 
#chains in the Genus database with same CATH topology
 4WCE V;  2P06 A;  4MW3 A;  5J2U A;  4EB6 A;  4GKJ B;  4PA4 A;  2YSU B;  4O4I B;  1MA1 A;  2QWQ B;  3DC6 A;  3ZRX A;  2LFR A;  3HKC A;  2AW9 A;  4FLX A;  4HNA B;  3IC9 A;  1AI7 A;  2X6C A;  2IJI A;  4X1K B;  3CRA A;  4LF5 O;  2OCC C;  3FB6 C;  2MK3 A;  4G28 B;  2P22 C;  2IW5 A;  4DR3 B;  4DUZ O;  4B3R B;  3RFR A;  3CXH F;  4JTA B;  4JAS A;  2DWE C;  2HHH B;  1DGS A;  5CBH A;  4TV8 A;  1BT8 A;  3QVN A;  5IY5 B;  1H2M A;  1N33 O;  1WA8 A;  2XAS A;  3APO A;  3CCR V;  2KG7 A;  2OTL V;  3CMA V;  4NXN B;  3G6E V;  3B2E E;  4DV7 B;  2ATK C;  2P67 A;  4R8C A;  3NXS A;  3WB1 A;  4HBN A;  2FB5 A;  2D3O W;  4ZIB A;  1PV0 A;  1VQM V;  3M99 B;  1PNL A;  2GTS A;  4L8J A;  2X6B A;  1GK9 A;  4PV1 B;  4IGG A;  1XOU A;  1JFF B;  1KU9 A;  2RQ6 A;  4I4T B;  4NXN O;  1FJG O;  1VF6 C;  2AZ0 A;  4DV7 O;  1KB9 F;  1IBM O;  1M1K W;  4JYY A;  2EIJ B;  2Q5Z A;  5CJ4 A;  3CWB H;  1V54 C;  1VQ5 V;  4X1I B;  2HLD G;  1R6K A;  4LF9 O;  2Q9L A;  5DM6 V;  2NN4 A;  3APQ A;  2CUG A;  2BCC H;  3JCU Z;  3JD2 A;  4JI8 O;  1D5A A;  4LFB B;  1HP8 A;  3KCX A;  3L74 H;  4QE7 A;  3ZRW A;  1RSO A;  1Y76 B;  5IJ0 B;  1TA8 A;  3OM3 B;  2EIL C;  2IH1 C;  1NVP B;  2NLJ C;  2BOB C;  3JD1 A;  4UB6 Z;  5C8Y B;  1XRE A;  3X2Q B;  3CS5 A;  3H01 A;  4YY3 B;  4LFB O;  1WPB A;  4JI1 B;  4CKM A;  2R9R B;  2Q73 A;  1NS1 A;  3ZMT A;  4I50 B;  4JYB A;  2JIZ G;  1K34 A;  2EIM B;  5LHH A;  5CA1 B;  1VQO V;  2QDO A;  5BMV A;  4YIP A;  4LF6 O;  1KC8 W;  3OUS A;  4JF3 A;  1XL4 A;  3ZN0 A;  1YCI A;  4K0K O;  1EBO A;  5JVD A;  4X8A A;  2PI4 A;  1PD3 A;  1HR0 O;  3U11 A;  3SJB C;  2CH7 B;  2Q0O C;  3A8T A;  3OEE G;  5B1N A;  2KKW A;  1Y6X A;  2HVK C;  2N74 A;  5E1A C;  1I94 B;  2VWJ A;  2GDS A;  2FML A;  4TV9 B;  1I5Y A;  2JS5 A;  3K06 A;  3P32 A;  3QNE A;  3BHP A;  1KKD A;  3B8M A;  1WPX A;  4YJ3 A;  1CXZ B;  1GAX A;  4JTC B;  4X65 B;  4O4H B;  1IBL B;  1CP9 A;  1GM7 A;  1AJP A;  1N36 O;  2QEX V;  3RWR D;  3N2G B;  3LSQ A;  5LMU B;  1QVG U;  2YIA A;  1YI2 V;  1AR5 A;  1XNQ O;  4DUY B;  1B6Q A;  2BSK A;  3QO8 A;  3ZRS A;  1IK9 A;  4WFE A;  3QO7 A;  1SER A;  1NKD A;  3ETD A;  4DRX A;  1OCR B;  1SA0 B;  1K7D A;  5LMU O;  5B3S B;  1BS3 A;  1V55 C;  2GHY A;  4I0X A;  3DC5 A;  3JAS A;  5CJ0 A;  4PA9 A;  2ZD9 A;  4UV9 A;  4YJ2 B;  5LA6 A;  2X6A A;  4QGP A;  4MVO A;  2O57 A;  4ZBM A;  5K1X A;  3VBB A;  3W7X A;  2DYS B;  1ZUQ A;  3HKE B;  1SES A;  3HKB A;  4QPJ A;  2W6J G;  5CB4 A;  1QHT A;  1OCO B;  3CPW U;  2XAJ A;  3ZHU A;  4O4L B;  5JCO C;  5KAI Z;  4FM0 A;  4LWS A;  5JCO A;  3CCQ V;  2DMX A;  1SQF A;  1S5H C;  5EBM C;  1VF7 A;  3ASO C;  2LQT A;  2P90 A;  5KX5 A;  1Q3E A;  1U97 A;  1FU1 A;  2UXD B;  2ZXW B;  4G79 A;  3MHH C;  3CSX A;  4UXN A;  4IIJ A;  4DV5 O;  2ADQ B;  5KHK A;  3K03 A;  2PYJ A;  5LGN A;  1AI5 A;  4R50 A;  5LXT A;  4NTW A;  1KBH A;  3JD3 A;  5H6R A;  2JEX A;  1KEC A;  1HWY A;  5HFM A;  2Y3W A;  4HNA A;  4IYH A;  3A0B Z;  2LGQ A;  1MZE A;  4X1K A;  5J2U B;  4LCU C;  4EB6 B;  1XBL A;  4B7K A;  1KP2 A;  3HB3 B;  3HKD A;  1VIB A;  1QNM A;  1JR9 A;  1EFR G;  2PUS A;  4QIW F;  2Q4P A;  5J9P C;  3HKC B;  5A2Q N;  3BA8 A;  4K8X A;  2AGA A;  2RJZ A;  4UUJ C;  2F4V B;  4K8Z A;  4TWK A;  1SS3 A;  2OCC B;  1XNR O;  3D36 A;  1SF9 A;  2YI8 A;  4F4L A;  4P2Z A;  3VQW A;  2GV9 A;  1R3I C;  1UFI A;  2HR3 A;  2IJK A;  4PD4 F;  2YIB D;  1EM1 A;  4JI6 O;  5J2T A;  1VF5 B;  1WA8 B;  1XMO B;  1TVK A;  3NR7 A;  4BWA A;  2KG7 B;  2OTJ V;  4GX5 A;  1JFF A;  1OJH A;  2P7T C;  4I4T A;  4A5U B;  4DR4 B;  3JSN A;  3JYC A;  1RP3 B;  3ZX6 A;  3E8G A;  2IBZ H;  2GTA A;  5H2F Z;  2ZE8 A;  4MW8 A;  2QWP B;  1VQL V;  4PDM A;  5LP6 C;  2ZIO A;  4GFC A;  1IBK O;  1XMQ B;  1WNS A;  2FTK A;  1DLB A;  2Z0A A;  5KHH A;  5LP6 A;  3AG4 C;  3ML0 A;  4JTD B;  4UCU A;  1NTZ H;  1JVM A;  2MW2 B;  2ZCE A;  1BE3 H;  3H1J H;  1W59 A;  2R9I A;  4DV2 B;  2YXH A;  3VQV A;  4DR7 O;  4AQY O;  3OTO O;  2UXB O;  3TCU A;  5KA6 A;  3W7U A;  1N32 O;  2VRZ A;  4GZR B;  1V54 B;  3CCJ V;  3K04 A;  3RT3 C;  1Y76 A;  4NYK A;  3C90 A;  3RVY A;  1S72 V;  4J42 A;  2UUA B;  1AIL A;  1FXK C;  1H8H G;  2ZE6 A;  3ZIA G;  4NXM O;  1BSM A;  2QKC A;  1FXK A;  4DV4 O;  4BIU A;  3OFN G;  3ZRW B;  1S77 D;  1RSO B;  4R6Z A;  3GWO A;  3P30 A;  1PPJ H;  3FYI B;  4UFZ A;  4J11 A;  4I50 A;  1L8D A;  4GCZ A;  3UKM A;  4CKN A;  2P4V A;  1M57 C;  3L70 H;  5CA1 A;  2ZIM A;  2JJ2 G;  2EIL B;  5GTH Z;  4ASU G;  3E35 A;  2K9P A;  2YIC A;  3ABL C;  5ITZ A;  4WF9 V;  3T1C A;  2PTM A;  1AP6 A;  4CBC A;  2CH7 A;  1S5L Z;  2WLI A;  3K5M A;  1PM9 A;  3R66 A;  2LFS A;  4X66 O;  1G6U A;  1TUB A;  2Y0P A;  1M9N A;  1ENV A;  3KG2 A;  2L35 A;  1M56 C;  2DYR C;  4MTO A;  5F2V O;  5IYC O;  3L73 H;  1FAF A;  4BR6 A;  1R6T A;  5EIB C;  2HJF C;  3ETQ A;  1FXH A;  1GN6 A;  1YDX A;  4B7E A;  1HNX O;  4J80 A;  1YTF D;  1M93 A;  3TJT A;  2FKX A;  1HNZ O;  1DK1 A;  1H2S B;  2RMK B;  3ZMV A;  4JI2 O;  4DV6 B;  4L87 A;  4KXR A;  1K92 A;  4D7T A;  5C93 A;  4NR1 A;  1WB8 A;  1KD1 W;  5H6Q A;  3T1Y B;  3PN1 A;  1P4R A;  2DE0 X;  2NNU A;  2V1D A;  3CRC A;  5IWA O;  4DV6 O;  1SRY A;  2EJR A;  4FFB A;  1FD9 A;  4IT5 A;  1Y67 A;  4LF8 B;  4I0X B;  1YXB A;  4XDJ A;  2YI9 A;  1F23 A;  5LA6 B;  1SQP H;  2G38 A;  2UUC B;  2AZ2 A;  2UU9 B;  4O4L A;  3Q4H B;  4ABM A;  2ZT9 B;  1N0N A;  1UPG A;  2QTS A;  3RYC B;  4FLU A;  3ICX A;  4JI7 B;  5IYB O;  2N05 A;  2YID A;  3CE2 A;  1M4U A;  1QR8 A;  4DR5 B;  3S3W A;  3IAY A;  2QWN B;  3HKB B;  4N23 A;  3K0D A;  2XT9 A;  2VS0 A;  3F7V C;  2YEV A;  5CB4 B;  1VQ8 V;  3GWK C;  2P4K A;  3BAA A;  1K5Q A;  3A2F A;  4JI7 O;  1Q7Y W;  4UCS A;  4H0L B;  5DEC A;  3IJ4 A;  2QGN A;  3UQ8 A;  4HAM A;  3K9A A;  2EIN C;  1BHB A;  3F7Y C;  5KX5 B;  3E8F A;  1MMM A;  1K9M W;  4JAU A;  3ASO B;  4AHC A;  2DW4 A;  3I55 V;  4AI8 A;  4IIJ B;  3UO3 A;  1NTM H;  4CH6 A;  4MS2 A;  1K3E A;  4LF5 B;  2Q6A A;  3T4Z A;  5JH7 A;  5LXT B;  4PDR A;  5JJN B;  4WBN A;  3QG5 A;  4DUZ B;  3STZ C;  4CH5 A;  4JI5 O;  4QE9 A;  4ZKI A;  2M7W A;  5L3B A;  2X0L A;  2IU3 A;  3MHS C;  4LH6 A;  3HKD B;  5LYJ A;  3SYC A;  4XA4 A;  5KHJ A;  1N33 B;  3SPC A;  1KP3 A;  4D6T H;  1AI6 A;  2PGG A;  3WB0 A;  1ZLZ A;  5DN6 G;  2XAH A;  1S5J A;  1L0N H;  3O9O A;  1JA8 A;  2ZDI C;  4BW5 A;  2XTA A;  1YJW V;  2FYU H;  4CC6 A;  2ZDI A;  4CH3 A;  1QLE C;  1RPO A;  4G27 B;  4K3A A;  3J80 N;  1FJG B;  2VQE O;  2ARH A;  1IBM B;  2OWO A;  3MD0 A;  1IZ3 A;  2QJ1 A;  1AP5 A;  3BAB A;  4PHZ A;  4ZI7 A;  1Q6U A;  5J2T B;  1TVK B;  5IYD O;  2DWD C;  1G4Y B;  2CTP A;  4LF9 B;  2GBO A;  4TSF G;  2UXC O;  1QR9 A;  1MSW D;  2XHB A;  1JPX A;  3IGA C;  1GM8 A;  4OPA A;  4DK0 A;  3EXA A;  3JAW A;  2DQ3 A;  1VF6 A;  1THZ A;  3K5N A;  1COW G;  4JI8 B;  4W4K A;  4UVC A;  2VWK A;  1PKX A;  3CCV V;  3BEH A;  1VQ4 V;  4GEU A;  1XL6 A;  3SR2 C;  1Q86 W;  1NU1 H;  3CB2 A;  5LP6 B;  3W7T A;  1K4C C;  5CBF A;  1IUR A;  4JI0 O;  3WU2 Z;  3RYH B;  4RUF A;  1XQ8 A;  3SR2 A;  3LNN A;  2WA4 A;  3CCS V;  3AG4 B;  1R3K C;  2F93 B;  5AG2 A;  2C2A A;  1IX9 A;  2CK3 G;  2A9H A;  4J41 A;  1OV9 A;  1Q90 D;  3ZED A;  5CN0 A;  4NB5 A;  4KHP O;  2ETN A;  3D3Q A;  1P7G A;  1OCC C;  3FAV B;  5B1B C;  4O2B A;  1EZJ A;  1FXK B;  4LF6 B;  2PF4 E;  3JAR B;  4K0K B;  1HR0 B;  1BHA A;  1LR1 A;  1JJO A;  2ZIN A;  4FZ0 A;  2H3O A;  1M57 B;  5D5Q A;  4DXW A;  3AK2 A;  3JAT A;  4ZOL A;  3OR7 C;  1JCH A;  3K08 A;  2KSD A;  5ITZ B;  1HNW O;  2WWW A;  4CC5 A;  4GUN A;  4NKG B;  2WLI B;  3ABL B;  4Q20 A;  3ZHS A;  1AVM A;  4X1Y A;  4DO2 A;  3ZMU A;  4J7Z A;  3W7W A;  1K73 W;  1N36 B;  1TUB B;  1IVS A;  5IDJ A;  1F51 A;  5L3F A;  3E89 A;  3UT5 A;  1QLN A;  1XNQ B;  4GT1 A;  3L75 H;  3MAQ A;  1M56 B;  2DYR B;  1FYJ A;  1URF A;  5KUK A;  1WLE A;  4P30 A;  1FXV A;  3ABM C;  3D8C A;  5EBL C;  4PJ0 Z;  5LGU A;  4DV0 O;  3O65 A;  5IE9 A;  5FPO A;  4FZ1 A;  3K58 A;  2UXX A;  4RQF A;  3ZMS A;  3H1K H;  2E5L O;  2Q68 A;  3EHB B;  2LW7 A;  2QM7 A;  4LF7 O;  3SPH A;  5LOV B;  3I56 V;  3AG1 C;  1B04 A;  2ZR3 A;  3QO5 A;  4YXW G;  1ZWI C;  4GKK O;  2OIE A;  4U7N A;  5EC2 C;  4B3T O;  2OCH A;  5FNV A;  3G67 A;  1V9P A;  1QCE A;  3Q4H A;  4FFB B;  2F95 B;  1LUW A;  3OMN B;  3RYC A;  4K35 A;  3SPG A;  3EVK A;  4EFB A;  3ZRV A;  4CS2 A;  3OGC C;  5B1A C;  4RAI A;  5IYZ B;  4PI0 A;  1VQP V;  3WG7 B;  2EZP A;  2CDY A;  2W0F C;  3M7M X;  2VQF O;  3EFF K;  4PA3 A;  1JX9 A;  4QNH B;  1ZL8 A;  2Q67 A;  4DV5 B;  3FD9 A;  5IJ9 B;  3TXQ A;  2RN9 A;  2YEV B;  2UUB O;  1G1X B;  1NZ6 A;  3SJA C;  2WA3 A;  1HDJ A;  4GYC B;  4C7U A;  4PDL A;  5IT9 N;  2LO1 A;  1J5E O;  1JJ2 U;  3C3S A;  1VP7 A;  5KHI A;  4MVU A;  2JJ1 G;  1KKC A;  2P6J A;  2L6L A;  4FK5 C;  2Y3V A;  2Q69 A;  1EN6 A;  1NR1 A;  5KA5 A;  2EIN B;  3T2M A;  3VQY A;  4ZHQ A;  4XDL A;  1EZV H;  5L3E A;  4X88 A;  3B8N A;  3OE7 G;  5JH7 B;  5FPR A;  2IH3 C;  4TQD A;  1WP8 A;  4WBN B;  1W0J G;  3Q0Y A;  5BR8 O;  4X64 O;  3TXS A;  1XNR B;  4DV3 O;  3BPZ A;  2QWO B;  2V4D A;  1E1Q G;  4LR3 A;  1Q5O A;  3CX5 F;  2CGO A;  4JZ2 A;  5B5E Z;  1E1R G;  5LYJ B;  4JI6 B;  4MTG A;  3FX7 A;  4P9P A;  1XDC A;  4TUY A;  2QKA A;  1BGY H;  1VQK V;  2Q7H A;  2ZKO A;  1VQ7 V;  4MT8 A;  4EEQ A;  2GUZ A;  3BFR A;  2B1I A;  5EBW C;  2HG5 C;  1H2N A;  1Q6I A;  1VQN V;  2ITC C;  1IBK B;  3B77 A;  1FFT B;  2EIK C;  1GH6 A;  3ABK C;  1QLE B;  2Z3Y A;  5GW7 A;  4B3S O;  1Q82 W;  4LFA O;  3J7A U;  1ZX3 A;  2BTO A;  2WPD G;  5B1O A;  4ZI7 B;  4DR7 B;  4AQY B;  3OTO B;  3H9V A;  2UXB B;  4UB8 Z;  1N32 B;  1NTK H;  3CRR A;  1Z2G A;  1RFY A;  1R3L C;  3JAW B;  3RYH A;  3T4D A;  3VQX A;  3PYI A;  4NXM B;  4DW0 A;  3F5W C;  2XAF A;  3PJS K;  2WLM A;  5D5P A;  3GB7 C;  2ADP A;  4DV4 B;  1BCC H;  2R9A A;  3W7S A;  4F6R B;  4JYC A;  2RDC A;  3CP1 A;  2OIG A;  2E3C A;  2X7R B;  2HVJ C;  3CCU V;  1ARO P;  3FAV A;  1MZF A;  1I08 A;  3ZHV A;  2RNB A;  3DTU B;  1AR1 B;  5FLX N;  1WN7 A;  3L9D A;  4MVR A;  3JAR A;  3BA9 A;  2JK5 C;  1DF5 A;  4WFG A;  3K57 A;  1NH2 B;  2AXT Z;  4DK1 A;  1RM1 C;  1YZB A;  4OX9 O;  1PL4 A;  1Z5W A;  5BZB A;  3K5L A;  2CTQ A;  4AIL C;  4O2B B;  1OCC B;  1XUQ A;  4X66 B;  1VMG A;  4X20 B;  3F5T A;  5B1B B;  3K59 A;  4HZ3 A;  2NR5 A;  2QKS A;  1K97 A;  4QJF B;  4JI4 O;  4GFA A;  3OR6 C;  1GMG A;  3FKS G;  4BAY A;  3CME V;  3SYQ A;  1QVF U;  5EZY A;  3FB8 C;  1HNX B;  5EK0 A;  3JAT B;  4ZOL B;  4JI3 B;  3BRC A;  1IDS A;  1HNZ B;  1FS0 G;  4JI2 B;  5LMN O;  1Q8I A;  3BCC H;  3E86 A;  1OCZ C;  4OPH A;  4ICG A;  4X1Y B;  3CC7 V;  1MSD A;  2XAG A;  2IJJ A;  4DW1 A;  1BQ0 A;  3ZHR A;  1XHX A;  2CTW A;  4P9O A;  2E75 B;  3GVM A;  4JI3 O;  5EC1 C;  3AK1 A;  3UT5 B;  5LHG A;  3L71 H;  2R72 A;  5IWA B;  2QM8 A;  3AG2 C;  4G2K A;  4LFC B;  1X4T A;  5JQG A;  3CEI A;  3OT7 A;  1AI4 A;  1M90 W;  1YF2 A;  3J81 N;  1VQ9 V;  5LOV A;  3II6 A;  1YHQ V;  3ABM B;  5CA0 A;  1CPY A;  1S0V A;  4JAV A;  2EX3 A;  4JV5 B;  4UCO A;  1L0L H;  4DR6 O;  3E83 A;  4KFM A;  4LFC O;  3SYA A;  3AG7 A;  2A79 B;  1QBZ A;  3SYO A;  3RVZ A;  5FL7 G;  3ETG A;  1H2G A;  1OZ0 A;  5CMU A;  1DTO A;  5CA3 A;  1U96 A;  4FLY A;  2YC0 A;  1ZSP A;  3ZJZ A;  3FB7 C;  4JV5 O;  3AG1 B;  1FKA O;  3FFQ A;  2Z5U A;  3KZI Z;  1PP9 H;  2DOS A;  2EJ7 A;  3WG7 C;  1AJN A;  2BOC C;  2BTQ B;  2WLJ A;  2P5O A;  2PY5 A;  3G80 A;  5IYZ A;  5FNV B;  4WFA V;  2ZNI A;  2QA4 V;  1WJZ A;  3AG3 C;  4LF4 B;  3H1H H;  1R3J C;  1B3Q A;  1O9H A;  1SET A;  1N34 O;  5JJE B;  2WLK A;  3CCM V;  1QQC A;  5KLV H;  4GX1 A;  5IJ9 A;  3CC2 V;  3SDL A;  4EKW A;  3QTC A;  4DR2 O;  3CRQ A;  1Q43 A;  2YUA A;  2B1G A;  4PI2 A;  4LF4 O;  1LNQ A;  4JYA O;  5B1A B;  2B9Z A;  4GX0 A;  3JAL A;  1ZL8 B;  4FLT A;  4LC1 A;  3RYI A;  1QU7 A;  1NVP D;  3OAA G;  2HKO A;  2WLN A;  3B09 A;  2JGD A;  1BL8 A;  4JI5 B;  4GLX A;  3LUT B;  2QWR B;  5LHI A;  3OMA B;  2YXY A;  1R73 A;  3CD6 V;  1SZT A;  2ZE5 A;  4X62 O;  1G8M A;  3UCS C;  5L3C A;  3ZMZ A;  2ZM6 B;  5TIS Z;  4O4J A;  3STL C;  4DYL A;  1I5X A;  4GX2 A;  3TK1 A;  3AK3 A;  1GN3 A;  1K4D C;  5BY1 A;  4ZHQ B;  3M8A A;  5GON A;  4J10 A;  1M5I A;  2ZM6 O;  3CHX A;  3LNM B;  1K33 A;  3ZHT A;  2VQE B;  1GM9 A;  1JQ0 A;  4H37 A;  4YHH O;  4RQE A;  4FLZ A;  2Y4U A;  3N2K A;  2HJD A;  3CJH A;  1KYO F;  3H1I H;  4HYO A;  4W4L A;  3MUD A;  3IFX A;  5EYP B;  4GKJ O;  4KP4 A;  5B66 Z;  4OXS A;  3D3I A;  3RWR A;  2UXC B;  1YTF B;  1XI1 A;  2OYQ A;  1R1B A;  5L3D A;  4Z1V A;  4JPR A;  4TUY B;  5EIB D;  2Y4T A;  4OGQ B;  1YJN V;  1NI8 A;  1JOY A;  2QE7 G;  4UV8 A;  2GUZ B;  1YIT V;  2JGU A;  4I9Q A;  4IHJ A;  3E22 A;  1NJI W;  4DR3 O;  2W0X A;  4IYI A;  2Q8V A;  1K8A W;  4B3R O;  4JI0 B;  4E4E A;  3MDS A;  3ABU A;  2HHH O;  2EIK B;  2WLH A;  3ABK B;  1CEZ A;  4NTY A;  1GO3 F;  1RPR A;  3AEI A;  4MTX A;  2PZS A;  2Q0A A;  5H9C A;  4H13 B;  4F6R A;  1FFX A;  4YIO A;  5HFL A;  4KHP B;  2IU0 A;  1Y74 A;  2CE4 A;  2LJ2 A;  1GN4 A;  3JAK A;  3ABT A;  2DQ0 A;  1IXB A;  3QF7 A;  2AHY A;  4Z1M G;  3JD0 A;  3LSS A;  4F6E A;  3JSL A;  1DF4 A;  2A3Q A;  1IXM A;  1PNK A;  1ZTE A;  3KKY A;  4U3J A;  4LP8 A;  3G6B A;  4X20 A;  3OTF A;  2HEP A;  1N8R W;  3TGU H;  1J95 A;  2WLL A;  3RBZ A;  4DR1 B;  1Q81 W;  1HNW B;  2QR4 A;  3BVO A;  3ZHQ A;  1N4C A;  1RM1 B;  5A9G A;  2UXN A;  1O9G A;  3U10 A;  4DV1 B;  3DXR A;  2D2C B;  4J9Z B;  2F23 A;  4DR1 O;  1EN5 A;  2Q7G A;  2PI5 A;  1AB3 A;  1WP7 A;  2JRI A;  5EZY B;  1MG1 A;  1XHZ A;  4DV0 B;  4YY3 O;  2WAM A;  4O2A B;  4JAA A;  1H2L A;  1ORQ C;  4DV1 O;  4JI1 O;  4LNU A;  1YSC A;  4H44 B;  1SZX A;  2E5L B;  4PDV A;  1SC5 B;  3LDD A;  3ASN C;  2E76 B;  1SQV H;  2F1M A;  3B4S A;  4LF7 B;  3E8B A;  1OCZ B;  1JMK C;  1MNG A;  4GKK B;  3OGI B;  1P49 A;  1Y4M A;  3HPL C;  2YIB A;  4B3T B;  4FPP A;  1NQT A;  5JQG B;  4TQF A;  2A06 H;  1BZK A;  5KMG A;  2XAQ A;  1I94 O;  3AG2 B;  3E2E A;  1H2K A;  3UM7 A;  5CA0 B;  1NT2 B;  1PL0 A;  1US6 A;  4J9Y B;  3CXC U;  1SQX H;  3CC4 V;  2BTQ A;  2CGN A;  4X65 O;  4LH7 A;  1IBL O;  1P7B A;  1LUV A;  2VQF B;  2A0L A;  3L72 H;  1XEQ A;  1PNM A;  2ITD C;  5KHG A;  4DUY O;  2XUM A;  4D7S A;  2UUB B;  2ZR2 A;  4KL1 A;  4CKP A;  1T5E A;  2KQX A;  2Q7E A;  1J5E B;  1Y66 A;  3AG3 B;  1F7Y A;  4PEL A;  4FM1 A;  1ZAU A;  4CS3 A;  4B08 A;  1SQG A;  1XIL A;  1KQS U;  3HR0 A;  4RO2 A;  3DSQ A;  3SGI A;  3JAL B;  3SPJ A;  2JVD A;  1NH2 D;  3RYF A;  3RYI B;  4FFK A;  3RGB A;  1VEW A;  4R7C A;  1A32 A;  2JGD B;  4X64 B;  4I55 A;  5BR8 B;  4Q6G A;  3UO2 A;  4DV3 B;  3ZN1 A;  5BXZ A;  1NR7 A;  2ILM A;  4X89 A;  1FPO A;  4O4I A;  4O4J B;  2EZO A;  1S76 D;  3CCE V;  3THO A;  2UXD O;  3FB5 C;  2CAZ C;  5GON B;  1EN4 A;  2Y69 B;  4PA6 A;  3OEH G;  2ZQM A;  5EYP A;  1I7F A;  1SKV A;  1ROP A;  1GRJ A;  1H8E G;  1YVW A;  3N2K B;  4B3S B;  4LFA B;  5KAF Z;  3CJH B;  4Z2W A;  2WSS G;  4IL6 Z;  4CZZ A;  5IY5 C;  3TET A;  4MTF A;  2V7Q G;  2F66 C;  1H38 A;  1GKF A;  3G4S V;  4B3M B;  4U7O A;  4MVM A;  3D36 C;  3SPI A;  3R65 A;  4I9W A;  4X9Q A;  3K0G A;  1L1F A;  1YEW A;  4MVS A;  4BW9 A;  5KUM A;  2IJH A;  1SQQ H;  1P84 F;  4TV8 B;  4BIO A;  1D5N A;  3CRM A;  4IHJ B;  3E22 B;  3P3P A;  4B3M O;  2F4V O;  2YS8 A;  4J7J A;  4J7K A;  1MOF A;  3K79 A;  3DGE A;  2EIJ C;  4H33 A;  3N27 A;  1YJ9 V;  4RUE A;  4LBE C;  3K9S A;  4UVA A;  4CH4 A;  1E79 G;  3G71 V;  4X1I A;  2W6I G;  1XMO O;  1FFX B;  3E8H A;  1YIJ V;  5K1P A;  4DR4 O;  4OX9 B;  1Y74 B;  1KUQ A;  3JAK B;  3RN4 A;  3OMI B;  4EFE A;  2CTR A;  3CCL V;  2H94 A;  3I5D A;  1XMQ O;  4JI4 B;  1S3J A;  3X2Q C;  1WAZ A;  5JJJ B;  5IJ0 A;  3JD4 A;  3K3W A;  2IM9 A;  4U3J B;  4XDK A;  3ETE A;  5C8Y A;  1SQB H;  2QTO A;  2A7W A;  4DV2 O;  5DED A;  1F4N A;  2ODM A;  3VOU A;  5E79 Z;  2EIM C;  2WLL B;  4FLV A;  3P3N A;  5LMN B;  2UUA O;  2DJV A;  2LP7 A;  4FIP C;  2HP8 A;  1GTO A;  4UCT A;  2JDI G;  4WFH A;  5L3G A;  4O2A A;  1VAR A;  4UVB A;  4NTX A;  3IC7 A;  1KMI Z;  3DXR B;  1X59 A;  4WFF A;  2QSA A;  4XBF A;  4JGS A;  1TAE A;  1I0H A;  3H1L H;  5BMV B;  4TV9 A;  4N21 A;  3A0R A;  3RW0 A;  1W0K G;  3CYO A;  4E2L A;  1VQ6 V;  1K5S A;  4LNU B;  1N0J A;  5JVD B;  4DR6 B;  2XOK G;  3LSU A;  2LW1 A;  4FMT A;  3ZS8 C;  4O4H A;  1Z5V A;  2XND G;  1R6N A;  3BY6 A;  4GEX A;  2GSM B;  5CHX A;  3N2G A;  3ASN B;  4U3F H;  3LDC A;  4YJ3 B;  5H5N A;  1D2D A;  4TT3 G;  1W2B U;  4PA7 A;  1OCR C;  5GTI Z;  1F4M A;  4I5S A;  5KMG B;  5B3S C;  2N04 A;  1WB7 A;  1SA0 A;  1N34 B;  4KUM A;  3T1H B;  3LDE A;  2M6Y A;  2K1E A;  4WFB V;  2BSK B;  4MVZ A;  3SJQ C;  3ZBH A;  5LGT A;  4DR2 B;  3OD4 A;  1BQZ A;  2HFE C;  4YJ2 A;  3K5O A;  3FYE B;  2KB1 A;  4RWU A;  4DRX B;  1AR4 A;  4BIZ A;  5JWP A;  4JYA B;  3Q0X A;  2H8P C;  3WB2 A;  2DYS C;  1TGO A;  3T1H O;  3JCZ A;  4I7Z B;  3T1Y O;  3JAS B;  3HKE A;  2AHZ A;  4FJC C;  1OCO C;  2ZE7 A;  3A0H Z;  1V55 B;  2E74 B;  1MAB G;  3ZCC A;  1NBM G;  2RCV A;  3SJC C;  2LGW A;  4UCR A;  1B06 A;  3U0Z A;  4TOI A;  4CS4 A;  2QM4 A;  3KCY A;  1BMF G;  4JZG A;  2JS3 A;  2JEU A;  2YDE A;  2Y0I A;  4LF8 O;  2BE3 A;  3WFV A;  5LBQ A;  4X62 B;  4FM2 A;  3SYP A;  3B40 A;  1OHH G;  4FVM A;  2ZXW C;  2F43 G;  2DN9 A;  1Q6H A;  3OW2 U;  2Y48 A;  5LL6 Y;  2UUC O;  2UU9 O;  4UCV A;  3S3X A;  2B5U A;  3C3T A;  2FL4 A;  4QPK A;  1AJQ A;  3RYF B;  2EBO A;  4MSW C;  2OT5 A;  3OUF A;  4LWS B;  4NVP A;  4DR5 O;  2EUL A;  4FLW A;  4MVQ A;  2ZNJ A;  1GN2 A;  5CBG A;  2PYL A;  2Y69 C;  4I55 B;  2YXL A;  1HW7 A;  4YHH B;  2R70 A;  1UJW B;  1TUE B;  3JAM N; 
#chains in the Genus database with same CATH homology
 2PTM A;  2Q7G A;  5J2U A;  4EB6 A;  4GKJ B;  3K5M A;  5JH7 B;  4O4I B;  5FPR A;  4TQD A;  5EZY B;  4WBN B;  1XHZ A;  1G6U A;  1TUB A;  4DV0 B;  4O2A B;  1XNR B;  3HKC A;  3BPZ A;  4FLX A;  2V4D A;  4HNA B;  4LNU A;  4LR3 A;  1Q5O A;  2E5L B;  4X1K B;  5EIB C;  3ETQ A;  5LYJ B;  4JI6 B;  2F1M A;  2P22 C;  4LF7 B;  4DR3 B;  4B3R B;  4TUY A;  3RFR A;  1JMK C;  1M93 A;  4GKK B;  1P49 A;  2HHH B;  1DGS A;  1H2S B;  2Q7H A;  2YIB A;  4B3T B;  4TV8 A;  4EEQ A;  5JQG B;  4DV6 B;  4TQF A;  5KMG A;  4D7T A;  1IBK B;  4NXN B;  5CA0 B;  1NT2 B;  3PN1 A;  3T1Y B;  3B2E E;  4DV7 B;  2BTO A;  2BTQ A;  3WB1 A;  4HBN A;  4ZI7 B;  4DR7 B;  4LH7 A;  4AQY B;  4ZIB A;  3OTO B;  2UXB B;  4L8J A;  1N32 B;  2VQF B;  4FFB A;  1KU9 A;  1JFF B;  2RQ6 A;  4I4T B;  4LF8 B;  3JAW B;  3RYH A;  5KHG A;  3VQX A;  2YI9 A;  4NXM B;  5CJ4 A;  4D7S A;  2UUB B;  5LA6 B;  4KL1 A;  1T5E A;  5D5P A;  4DV4 B;  2UUC B;  4X1I B;  2UU9 B;  4O4L A;  2Q7E A;  1J5E B;  2R9A A;  4F6R B;  3RYC B;  4FLU A;  3ICX A;  4JI7 B;  2E3C A;  1M4U A;  4FM1 A;  4DR5 B;  3IAY A;  1ZAU A;  4CS3 A;  3HKB B;  4B08 A;  1WN7 A;  5CB4 B;  1D5A A;  4LFB B;  1SQG A;  3JAR A;  3BA9 A;  3BAA A;  3K57 A;  3DSQ A;  3SGI A;  3JAL B;  3A2F A;  4DK1 A;  1RSO A;  2JVD A;  3RYF A;  4UCS A;  5IJ0 B;  3RYI B;  1TA8 A;  1Z5W A;  3K5L A;  4AIL C;  5C8Y B;  3RGB A;  4O2B B;  4X66 B;  3UQ8 A;  4X20 B;  4YY3 B;  5BR8 B;  4X64 B;  4I55 A;  5KX5 B;  4Q6G A;  3K59 A;  4DV3 B;  1WPB A;  4JI1 B;  4AHC A;  4IIJ B;  4I50 B;  4CH6 A;  4LF5 B;  5JH7 A;  5LXT B;  5CA1 B;  4O4I A;  4O4J B;  5JJN B;  5BMV A;  5EZY A;  4WBN A;  3QG5 A;  1HNX B;  4DUZ B;  3JAT B;  4ZOL B;  4JI3 B;  3BRC A;  4CH5 A;  3THO A;  2CAZ C;  1HNZ B;  5GON B;  5JVD A;  3U11 A;  4JI2 B;  5EYP A;  1Q8I A;  3SJB C;  1I7F A;  4LH6 A;  3HKD B;  5LYJ A;  1SKV A;  2KKW A;  4X1Y B;  4XA4 A;  5KHJ A;  1N33 B;  1I94 B;  2VWJ A;  4TV9 B;  2JS5 A;  1XHX A;  3WB0 A;  2PGG A;  3BHP A;  3UT5 B;  3N2K B;  1S5J A;  4B3S B;  4LFA B;  4YJ3 A;  2R72 A;  5IWA B;  4X65 B;  4O4H B;  4LFC B;  1IBL B;  1X4T A;  2F66 C;  5JQG A;  4CC6 A;  4B3M B;  4CH3 A;  5LOV A;  3II6 A;  3RWR D;  1FJG B;  3N2G B;  5LMU B;  5CA0 A;  2YIA A;  1IBM B;  2OWO A;  1YEW A;  2EX3 A;  4JV5 B;  4DUY B;  2QJ1 A;  4BW9 A;  4UCO A;  4TV8 B;  3BAB A;  4PHZ A;  4ZI7 A;  1IK9 A;  5J2T B;  4IHJ B;  3E22 B;  4DRX A;  1TVK B;  4LF9 B;  1SA0 B;  2XHB A;  4FLY A;  4DK0 A;  3JAS A;  5CJ0 A;  3JAW A;  3FFQ A;  2BTQ B;  2P5O A;  3K5N A;  2PY5 A;  5IYZ A;  4JI8 B;  4YJ2 B;  5FNV B;  5LA6 A;  2ZNI A;  2VWK A;  4CH4 A;  4X1I A;  4LF4 B;  1O9H A;  1FFX B;  5K1X A;  3SR2 C;  3CB2 A;  5LP6 B;  5K1P A;  4OX9 B;  5JJE B;  3RYH B;  1XQ8 A;  3HKE B;  1QQC A;  3SR2 A;  3LNN A;  3HKB A;  5IJ9 A;  3JAK B;  2F93 B;  3QTC A;  1Q43 A;  5CB4 A;  1QHT A;  4EFE A;  4PI2 A;  4O4L B;  5JCO C;  3ZED A;  3JAL A;  4JI4 B;  4FLT A;  5JJJ B;  4FM0 A;  5IJ0 A;  5JCO A;  3RYI A;  1SQF A;  2IM9 A;  4U3J B;  5C8Y A;  4O2B A;  1VF7 A;  4LF6 B;  5KX5 A;  3JAR B;  1Q3E A;  4JI5 B;  1FU1 A;  2UXD B;  4K0K B;  4GLX A;  1HR0 B;  3CSX A;  4FLV A;  1JJO A;  4IIJ A;  5LMN B;  5KHK A;  2PYJ A;  2ZIN A;  2ZM6 B;  5LXT A;  4O4J A;  4UCT A;  5D5Q A;  4O2A A;  3JAT A;  4ZOL A;  4ZHQ A;  1KMI Z;  4HNA A;  4ZHQ B;  5ITZ B;  5GON A;  4CC5 A;  1TAE A;  4X1K A;  5J2U B;  1M5I A;  4EB6 B;  3HKD A;  4X1Y A;  3CHX A;  1N36 B;  5BMV B;  1TUB B;  2PUS A;  4TV9 A;  2VQE B;  3HKC B;  3UT5 A;  4FLZ A;  3N2K A;  1XNQ B;  3BA8 A;  4LNU B;  5JVD B;  4K8X A;  4DR6 B;  3MAQ A;  2RJZ A;  3MUD A;  3ZS8 C;  5EYP B;  4O4H A;  1Z5V A;  2F4V B;  3RWR A;  2UXC B;  1XI1 A;  2OYQ A;  4K8Z A;  5CHX A;  4TUY B;  5EIB D;  3N2G A;  5FPO A;  2YI8 A;  4YJ3 B;  3VQW A;  3K58 A;  2GV9 A;  2YIB D;  2JGU A;  4I9Q A;  5J2T A;  4IHJ A;  3E22 A;  5KMG B;  1XMO B;  1TVK A;  4BWA A;  1SA0 A;  5LOV B;  1N34 B;  1JFF A;  1B04 A;  4I4T A;  3T1H B;  4DR4 B;  3JSN A;  4JI0 B;  4DR2 B;  5FNV A;  4YJ2 A;  3K5O A;  1V9P A;  5LP6 C;  2PZS A;  2ZIO A;  4DRX B;  4JYA B;  3WB2 A;  2Q0A A;  4FFB B;  2F95 B;  1TGO A;  1FFX A;  4F6R A;  1XMQ B;  1WNS A;  3RYC A;  4KHP B;  5KHH A;  5LP6 A;  3JAS B;  4UCU A;  4EFB A;  3HKE A;  4CS2 A;  2ZCE A;  3JAK A;  4DV2 B;  5IYZ B;  3VQV A;  3QF7 A;  3SJC C;  4PI0 A;  4UCR A;  3U0Z A;  4TOI A;  4CS4 A;  2QM4 A;  3M7M X;  3JSL A;  4DV5 B;  2UUA B;  4X62 B;  4FM2 A;  4U3J A;  5IJ9 B;  4FVM A;  4X20 A;  3SJA C;  3OTF A;  4GYC B;  2HEP A;  4UCV A;  1HNW B;  3RYF B;  4DR1 B;  4UFZ A;  4I50 A;  1L8D A;  4NVP A;  5KHI A;  4FLW A;  5CA1 A;  2ZIM A;  2ZNJ A;  1O9G A;  2PYL A;  3U10 A;  4I55 B;  2YXL A;  1HW7 A;  4YHH B;  2R70 A;  4DV1 B;  3VQY A;  5ITZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...