3RWRD

Crystal structure of the human xrcc4-xlf complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
227
structure length
227
Chain Sequence
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein XRCC4
publication title Structure of human XLF-XRCC4: assembly of a functional DNA repair complex
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
total genus 49
structure length 227
sequence length 227
chains with identical sequence E, H, I, L, M, O, Q, S, T, W, X
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rwrD02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 3rwrD01
3RWRD 4XA4A 2R9AA 5CHXA 2QM4A 5CJ4A 3SR2A 1FU1A 1M5IA 3II6A 3SR2C 1KU9A 3MUDA 1IK9A 3RWRA 5CJ0A
chains in the Genus database with same CATH superfamily
4IYHA 2HR3A 1N33O 4CZZA 2IJIA 5EIBD 2EINC 4CH5A 2C2AA 4BR6A 1JQ0A 1XL4A 4KFMA 4U7OA 2ZQMA 1Q8IA 2GTAA 2YC0A 1FXKC 1XOUA 3BCCH 3CCQV 1R3KC 3CXCU 2UXXA 5FNVB 2IJKA 5CA3A 4LF6B 4J10A 4GEXA 3B8MA 1UJWB 4GFAA 2WLNA 4FJCC 1GN3A 4IGGA 3B8NA 2PF4E 1PNMA 2Q73A 2WLKA 3ZJZA 3AEIA 3OUSA 3D8CA 2XTAA 1KB9F 1KU9A 3SPJA 4DV4O 1I08A 1MNGA 1G8MA 4K3AA 5EBMC 2YXLA 3HPLC 2B1GA 4FVMA 4DR7O 4WFEA 2AZ2A 4ZI7A 2Q7HA 1FKAO 3BA8A 3JD0A 4GEUA 2DW4A 1P7GA 2UUAO 4OX9O 4WFBV 3EVKA 1IVSA 1YXBA 1E79G 4DR3B 4UFZA 4BWAA 1N32B 5LGTA 2FMLA 2BTQB 5EYPA 5KHGA 3SYOA 2DQ0A 4LBEC 2EINB 2OTJV 4J9ZB 1O9GA 5E79Z 4TV8B 5GTHZ 1HR0B 1PL0A 3ABTA 1FXKB 1AI5A 1SESA 3K3WA 1OCOB 1SZXA 1K92A 3A0BZ 3WG7B 2E76B 4MVUA 4J7ZA 1VF7A 1MG1A 1EZVH 4DV6B 1YF2A 4DV0B 4DR2B 1U97A 2CDYA 2WWWA 2JIZG 3E22A 3BVOA 3ZMZA 2CTRA 1D5NA 3D3QA 4NXNB 3DXRA 1MZFA 1Y74A 3LUTB 3JD1A 1ZUQA 3QNEA 3OEEG 4MTOA 5EC1C 4DV3B 1B6QA 1IK9A 1KBHA 3ETEA 2YXHA 1ZSPA 5L3BA 3JSLA 3RYHB 1HNWB 3QG5A 1WLEA 4UB6Z 4JASA 2JJ2G 2ZE5A 2UXNA 1E1QG 1RSOB 5L3DA 1X4TA 5GW7A 2K1EA 4TT3G 2UUBB 2A3QA 4FM0A 1WP8A 1H2NA 4DV2B 2XNDG 2EZPA 1TUEB 4O4LA 1YJ9V 3CCRV 1YITV 3ASNC 2YI9A 4PA3A 4GUNA 2QKSA 5LMUB 2MW2B 2NLJC 3TGUH 1MABG 3NR7A 4MTFA 5BR8B 3OT7A 5LHGA 2WA3A 4B3SO 3ZX6A 5EIBC 5F2VO 1XILA 1OZ0A 3EFFK 4O4JB 4D7SA 2F93B 3JD2A 2OIEA 5D5PA 3UO2A 3CYOA 4AQYB 2QTSA 3FFQA 2ZDIC 1YEWA 2E3CA 4MTGA 2IJHA 4FLXA 4JI5O 2FYUH 1IZ3A 2VQFB 1GN4A 1FU1A 1YZBA 5KMGB 4N21A 2HJFC 1KMIZ 2MK3A 1QLEC 3T1HO 3QO7A 4ICGA 4LF6O 4DV1O 2XAFA 1J95A 4LF7O 4JF3A 5BXZA 2DWEC 4GCZA 1S5JA 2UU9B 4X65B 4MSWC 1YHQV 4O4IB 3ZMVA 4F6EA 4JI7B 1Q5OA 1SA0B 1NQTA 1W59A 5LA6A 4U3JB 2QJ1A 1I5XA 2HHHB 4JI1O 4ZI7B 1IBMB 1XUQA 1Z5VA 5JWPA 3G6EV 4LNUB 3VOUA 4NTYA 2CGNA 1X59A 2X7RB 4BIUA 5EYPB 3JAWB 3CS5A 5EBWC 2G38A 2ITCC 2XHBA 1VQ8V 4P2ZA 4IT5A 1WB8A 3G71V 2QM7A 1J5EO 4X9QA 3JAKA 1VQ9V 3D36C 1N0NA 1S76D 3Q0XA 1AI7A 3WB2A 3ZCCA 2DMXA 5LMNO 3SYQA 4DR1O 4CS2A 5B3SC 4KHPO 1NI8A 3JCZA 1NVPD 4JAVA 4O2AB 4ZIBA 3E22B 2ZINA 4QE7A 1LUVA 4DV6O 3LSUA 5BZBA 4DV0O 2XAQA 2JS5A 3DXRB 3RYFB 2P7TC 1HW7A 4GX0A 3AG7A 4G79A 1Z2GA 3K59A 3P3NA 4K0KB 3UCSC 3ABUA 3FYIB 2IW5A 5C8YA 1VARA 4FK5C 4W4LA 3M7MX 5B1NA 3E8BA 3N2GA 4OXSA 4RQEA 1NR1A 1Q86W 1AILA 4UUJC 1XNQO 4QPKA 1I94B 3BA9A 2E5LO 3E35A 1A32A 1F23A 3CEIA 1CXZB 4YJ3A 1VF6C 5LXTB 1UPGA 2WLLB 2LFRA 3FB8C 4NYKA 2N05A 2ZE8A 3B4SA 1JJ2U 1I0HA 3CMAV 3HKCB 5IYZB 2QWNB 4QE9A 5KLVH 4ABMA 3U11A 2Q68A 4GX2A 2W6JG 1NTMH 4FMTA 4PI0A 2DWDC 2GBOA 2Q9LA 4F6RB 5B3SB 1COWG 3FAVA 2HKOA 4DV5O 1NS1A 4GKKB 5FL7G 5IWAB 2A79B 5H2FZ 3QO8A 4FLUA 1GN6A 2IH1C 2CH7A 3RYIA 5BR8O 1BHAA 3A8TA 1R6KA 3CCMV 3CHXA 3BY6A 4LF4B 2Y3VA 4LF8O 1PV0A 2LP7A 2VWJA 1MSDA 3OEHG 1M56C 4UVBA 3E89A 1Q81W 2UXCB 4WF9V 1THZA 5JCOC 5FLXN 2DYRB 3OMAB 1WP7A 4X8AA 3G6BA 2Z5UA 3SJQC 3WB0A 2YICA 1BE3H 2ZIMA 1D2DA 4IIJA 4WFHA 2KSDA 5J9PC 1F4NA 3AK2A 1V55C 4TQDA 3C3SA 4QNHB 1JR9A 4Z2WA 4DR4O 4J9YB 3SYAA 4K35A 4MW8A 4BW9A 1GO3F 4AI8A 2P4VA 1VF5B 4YXWG 1VMGA 4DRXA 4LFAB 4O2BB 5LGNA 3G67A 2PYLA 2YI8A 4HAMA 2UU9O 4GKJO 1VEWA 4MT8A 3RBZA 3ZMTA 2UXBO 1AP5A 1V9PA 2GSMB 2VQEB 1QR8A 2NNUA 4DR6B 2AHZA 4E2LA 1XMQB 1VIBA 4TV9B 1FXVA 2CUGA 1VQ7V 2DOSA 1ORQC 3BRCA 1YJWV 2WAMA 3CD6V 1YDXA 4GX1A 1H8EG 4LH6A 3RFRA 3K5OA 2W6IG 2N04A 3AG1C 1V54C 1R3LC 5J2TA 2BSKA 3SPHA 3CP1A 3RWRA 2Q4PA 1WAZA 5IJ9B 2F23A 3ZIAG 4EB6B 3T1YO 1G6UA 4CC5A 2ZKOA 4MVQA 4JI6B 2E74B 2N74A 2YIBA 3U10A 2Q69A 1VQKV 1K34A 1OCCB 3L70H 4LFBB 3OMNB 4BAYA 1KP2A 3W7SA 1IBKB 3A0RA 3FYEB 3M8AA 3KZIZ 3HKEA 4K8XA 3M99B 4B3TO 5LHIA 3RYCA 3FX7A 4YY3B 1RP3B 1K33A 1H2GA 2WLIA 4GFCA 3K5LA 1KECA 4PA9A 3SYPA 3K5NA 2JS3A 3SR2A 4H13B 1Q3EA 2LJ2A 4X66B 1WPBA 4JTAB 3I5DA 5KX5A 4IHJA 1SQBH 1W2BU 2M6YA 2CTWA 1ZL8B 2K9PA 2X6CA 4A5UB 2YEVB 5ITZB 1NVPB 4JI8B 4X62B 3JATA 2OCCC 3AG1B 1G1XB 1Q6IA 1V54B 1JFFB 4F4LA 3FB5C 1IBLB 5C93A 2PYJA 4JAAA 2OTLV 4K8ZA 1OCOC 3WG7C 1XNRB 2QM4A 2P06A 3FAVB 2ITDC 4JYAB 1SQPH 3WFVA 2PI5A 4BIZA 3JALA 1M9NA 2ZM6O 1AI4A 3TXQA 4FM2A 1XDCA 3OTOB 5DECA 1F51A 3LNNA 4NB5A 2CGOA 1BGYH 1KKDA 3CE2A 3CXHF 1N36B 2Q7GA 2ZXWB 3K04A 2YSUB 1HNZO 5CHXA 1LNQA 4G2KA 2HFEC 4HNAB 3K9SA 3ZN0A 4DYLA 4NXMB 1MMMA 1P7BA 1OV9A 2WA4A 2XUMA 2JVDA 1QVFU 4RAIA 3UKMA 1FFXB 5J2UA 4YJ2B 1PM9A 2OCCB 4J80A 3CMEV 4CH3A 4FIPC 2GUZB 5KHKA 1Q90D 1AR5A 5KAIZ 1AJPA 5JVDA 4R50A 2QR4A 3CCEV 4X20B 4MVRA 2JGDA 3CC7V 4NKGB 1MZEA 4UCOA 5H9CA 5CJ0A 1JX9A 3JAMN 1HP8A 5EZYA 2EIMB 4QJFB 4WBNA 2DJVA 4UV9A 1P4RA 4J42A 3K79A 4TUYB 1K3EA 5CBFA 3CRCA 3RGBA 4JI3B 4DR5O 1EFRG 2Z0AA 2UUCB 1IDSA 2EULA 2HG5C 3SJAC 3CC4V 2OIGA 3GVMA 2Y48A 1L0NH 3AG4C 4FFBA 1QNMA 3JARA 2IU3A 1JOYA 5B1AB 2ZT9B 4DW0A 3LDDA 3BABA 4CS3A 5L3FA 3CB2A 4X64O 4UCVA 1FPOA 1XMOB 1GM8A 3HKBA 2X6BA 1OCZB 3K06A 5JJJB 4JI2B 2F95B 3OE7G 4X1KA 5IJ0B 2BOBC 3N2KB 1BHBA 1K4DC 1QHTA 2W0FC 5CB4B 1N8RW 4CBCA 1TVKA 3Q4HB 4YHHO 5IYDO 1TGOA 3HB3B 3W7UA 4FLWA 1WB7A 2RQ6A 3VQVA 1B3QA 2RNBA 4J7KA 1AJQA 2DQ3A 4LFCO 4ZKIA 1SQGA 3FKSG 3BPZA 1SERA 4XDKA 1BS3A 1F4MA 3JASA 4GZRB 4HBNA 1HNXB 1NTKH 5LP6A 3Q0YA 4LF9B 2A06H 3HKEB 4C7UA 1DK1A 3AG4B 2JGUA 3HKDB 4LFBO 3A2FA 4DUZB 3GB7C 3ZRWA 5B66Z 1RFYA 3GWKC 1GK9A 4JYYA 1BQ0A 3E2EA 5B5EZ 4JI4O 4AILC 4WFGA 1R73A 2LO1A 3IJ4A 3CCSV 2P4KA 4IHJB 1YSCA 3OTFA 2X0LA 3MAQA 2F4VO 5HFLA 2LQTA 3ZMUA 4WFAV 4J7JA 3SPCA 4E4EA 1YCIA 3JATB 3R66A 5BMVA 3L74H 3ABLB 4LF5B 4JI0B 2JJ1G 5KA6A 1EN4A 4H33A 2XAJA 1WA8A 3RVYA 1OJHA 3K03A 4X1IA 3G4SV 2Y0IA 5FPOA 5JJEB 4P9PA 3ABKB 2DYSC 3ETDA 2PI4A 1NKDA 3JALB 1CP9A 3II6A 1TUBA 2P90A 1OHHG 1WJZA 1WPXA 5LYJA 4DV7B 2GV9A 4JV5B 3E8GA 4JZ2A 1KUQA 4I0XA 2QKCA 1GKFA 4LR3A 5CA0A 1I5YA 3OTOO 4L87A 2H8PC 1Y76A 1Q6UA 5LOVA 3G80A 3ICXA 3AK3A 4MVSA 5B1OA 4I50A 1YTFB 3WU2Z 1BZKA 3J80N 2XAGA 1FFTB 3H01A 3VBBA 3D3IA 4DR3O 3B40A 4PDMA 1N32O 1BQZA 4FLTA 4IYIA 1K97A 1VQNV 2LW1A 5JQGA 5CBGA 1K8AW 1HR0O 5DM6V 1S72V 1QBZA 1S5LZ 3EXAA 2KG7A 1PP9H 5KHJA 4XBFA 1N34B 1Y6XA 1QLNA 2HJDA 4Q20A 2PTMA 1SQFA 3SGIA 5A9GA 5K1XA 4RQFA 4DK0A 2IH3C 2DYSB 1XQ8A 4MVOA 3LDCA 1WN7A 3L75H 1DF5A 2E75B 4MW3A 4Z1MG 2WLHA 2Q0AA 2X6AA 3KCYA 5L3CA 3S3XA 2ZE7A 4DR2O 2L35A 2UXDB 1XHXA 4TWKA 3E86A 1CEZA 4JPRA 3ETQA 1SS3A 1Y74B 1ZTEA 4PDRA 4B3MB 2QWQB 3CRMA 4DUYB 4NXNO 2YDEA 4ZHQA 2EILB 1S5HC 2F66C 2ODMA 3APQA 4LWSA 4X1KB 4DV3O 3FB7C 1D5AA 2EJ7A 2QDOA 4FZ1A 1QVGU 3FB6C 2FL4A 2LW7A 4BIOA 2DYRC 4OGQB 1HNWO 1K5SA 3TCUA 2A7WA 5GONA 4PA4A 5AG2A 4AHCA 2PY5A 1N33B 4G27B 2UUBO 2ETNA 4O4LB 2AXTZ 4DV2O 4MS2A 5E1AC 4ZOLA 1GM9A 1PNKA 3RW0A 3TXSA 1SKVA 1G4YB 5TISZ 5FPRA 3VQYA 3CCVV 5LMUO 2HVJC 3CC2V 1KYOF 3ZRWB 5FNVA 1SC5B 1XL6A 1DTOA 3VQXA 2CTQA 3MD0A 2HP8A 3MHHC 1NH2B 3MHSC 5H6RA 1JPXA 3I55V 2P6JA 5CA1A 1VQPV 2HVKC 3OMIB 2AGAA 1Q43A 3L71H 4FFKA 2D3OW 4QGPA 3JYCA 4DV4B 4UCUA 2VS0A 4PDLA 4AQYO 3ZHTA 3JSNA 5BMVB 2DN9A 4X1YA 4DR7B 3SDLA 4I55A 3AG2B 1GAXA 3AG3C 3RT3C 4B7KA 1DLBA 4EKWA 1TAEA 2UUAB 1F7YA 4OX9B 1AI6A 1M93A 3QTCA 4GYCB 2DE0X 1XEQA 1H2MA 2H3OA 3E8HA 3SYCA 2VQFO 4CH4A 3UT5A 1HWYA 4H44B 4FM1A 2L6LA 3RVZA 3F7VC 2BTQA 3B09A 1XBLA 2R72A 2F1MA 1GRJA 2HEPA 4TV8A 5LYJB 1PD3A 1FXKA 4CS4A 1OCCC 3OM3B 3IC7A 1NBMG 3CRRA 4X65O 2QEXV 3IFXA 3OD4A 4JI7O 2R9AA 5LA6B 2V1DA 1SRYA 2ZE6A 4PA6A 3U0ZA 1M57B 3VQWA 1GM7A 1YJNV 2HHHO 3QF7A 3PYIA 1NZ6A 1IBMO 3JD4A 1R3IC 4H0LB 3JCUZ 1JVMA 4QIWF 3IAYA 3K5MA 2EX3A 2VWKA 2ADQB 2FTKA 2NR5A 2YUAA 1VQ5V 3AG3B 2Y69C 3CSXA 1L1FA 1SETA 3LSSA 1UFIA 3LSQA 3JAKB 2A9HA 3TK1A 3OFNG 3QO5A 4FLVA 1PPJH 2FB5A 3RYHA 4I9WA 5IDJA 1SF9A 2O57A 2EBOA 4X88A 3ZHQA 3F5WC 4B3RB 1R6TA 1M90W 3CRQA 4BW5A 4D6TH 1RSOA 2YS8A 5EBLC 1H2KA 3RN4A 5CBHA 4YIPA 1ZLZA 3CJHA 3IC9A 4J41A 1IXBA 3ZHSA 5C8YB 4LWSB 2ZXWC 3LNMB 4K0KO 4B3SB 4HYOA 4XDJA 3N2GB 2Y4UA 4ASUG 1XHZA 3DC6A 1M4UA 4WCEV 4D7TA 4LC1A 4O4JA 4HZ3A 3I56V 2HLDG 1RM1C 2Y69B 4YJ3B 1XI1A 1I94O 4UB8Z 2KQXA 4P30A 3K58A 2QM8A 3CWBH 2QWRB 2WLMA 3T2MA 3W7WA 4FZ0A 3FD9A 3ZMSA 1FD9A 3T4DA 3SPGA 5IT9N 3X2QC 1YTFD 3W7TA 4ZOLB 5L3GA 5IYCO 2EIMC 4JI5B 2Z3YA 4JZGA 1CPYA 5KUMA 2RN9A 4PV1B 3LDEA 3A0HZ 3DGEA 3K57A 4GKKO 3WB1A 3B2EE 5KMGA 3T1HB 3RYIB 2CH7B 2OT5A 5EK0A 5IWAO 2YIAA 1S0VA 4KXRA 4DV1B 2Y4TA 2XOKG 3ABMC 4LF7B 5B1AC 4OPHA 3EHBB 4GLXA 4KUMA 2EIJB 5CA1B 1WNSA 2R9IA 1FJGB 4I4TA 4LF4O 1OCZC 1T5EA 4Q6GA 4O4IA 4PD4F 1VQ4V 2UXCO 2VRZA 4X1YB 4JI1B 1IXMA 3L72H 1QQCA 4I55B 1RM1B 2PZSA 1BCCH 1SA0A 5IY5C 4U3JA 2ARHA 4OPAA 3KCXA 2LFSA 2QE7G 4IIJB 2JRIA 2M7WA 1LR1A 2YXYA 4LNUA 3UT5B 3S3WA 4EFBA 2PGGA 3X2QB 2ZDIA 4TSFG 3JAWA 1US6A 1J5EB 1JJOA 4DRXB 1FXHA 3STLC 4PA7A 3CCLV 4LH7A 3ZRVA 3QVNA 4LFAO 4RUEA 3O9OA 1EZJA 2YIDA 5KA5A 1EN6A 3UM7A 2P22C 5LMNB 2BTOA 3OUFA 3ABMB 1Y4MA 3THOA 1E1RG 5IE9A 4DR1B 5DN6G 4KHPB 4UCRA 2VQEO 5JJNB 2Q8VA 3SR2C 4DR6O 3DTUB 1H2SB 1XMQO 2BE3A 1JCHA 3ZRXA 4R6ZA 4UVAA 4CH6A 2ZR2A 3H1LH 4O2AA 1KQSU 1N0JA 3ZN1A 2ZD9A 3H1JH 4JGSA 1EN5A 4GX5A 2H94A 3RYFA 2QTOA 3APOA 5IY5B 1MA1A 2D2CB 5KUKA 5J2TB 1RPOA 2BSKB 4DK1A 3ABLC 5LBQA 1NH2D 5JH7A 1XNQB 2RJZA 2E5LB 3BEHA 3H1HH 4RWUA 1QU7A 2AW9A 4W4KA 1URFA 3ABKC 1GTOA 4JI6O 3SJBC 1NU1H 2WLLA 5LXTA 1PL4A 4B3RO 2OWOA 2ZIOA 2OCHA 3D36A 2P67A 3L9DA 3RYCB 5CJ4A 1IBKO 3DSQA 3HKCA 1FAFA 2LGQA 2WLIB 4PJ0Z 5IYZA 3CJHB 4YY3O 2Y3WA 4DV5B 2CTPA 2JEUA 1FYJA 4PELA 4F6RA 3ZHVA 4G28B 4DXWA 1SZTA 5KX5B 4X66O 2FKXA 1K4CC 2JK5C 2QKAA 5BY1A 4R8CA 3E8FA 3N27A 1AJNA 4UCSA 3ASOC 2Q0OC 1L0LH 4LF8B 3KKYA 1AR4A 1GN2A 4JI8O 4X62O 2PUSA 3E83A 1IBLO 1SQXH 4JTDB 3ZEDA 1GH6A 4YIOA 3CRAA 1Q82W 2EIKC 4KP4A 1XNRO 1BL8A 1VF6A 5EC2C 1K5QA 2XT9A 1GMGA 1IURA 4JYAO 5H5NA 2QWPB 2KKWA 3ZBHA 4DR4B 2XAHA 1NJIW 1AROP 2ZNIA 2OYQA 2Q67A 3K9AA 3ASNB 1R6NA 2Y0PA 3MDSA 3OR6C 1VQOV 2EILC 4I4TB 2AHYA 4GKJB 1N36O 3BHPA 4O2BA 4UVCA 1FJGO 2UXBB 1PNLA 1DF4A 1KKCA 3ETGA 4NXMO 5J2UB 3B77A 3ASOB 4O4HA 3OGCC 3C3TA 5JVDB 1U96A 4TV9A 3MUDA 4EEQA 3SPIA 3ZS8C 1IX9A 2JGDB 1HDJA 4I9QA 3K08A 3ZRSA 1Y66A 2EIKB 5JCOA 2JDIG 4R7CA 5EZYB 3JD3A 4FLYA 4WBNB 2WPDG 2V7QG 1ZWIC 4PDVA 5K1PA 1SQQH 2QSAA 3OR7C 1AP6A 5LP6C 3J81N 2IU0A 4NR1A 2GTSA 4JI3O 3T1YB 2UUCO 4MVZA 2KB1A 1R3JC 4FFBB 3JARB 1QLEB 5IJ9A 1H2LA 1XREA 4Z1VA 4EB6A 1JMKC 1W0KG 1P84F 3O65A 3P30A 2P5OA 3F5TA 4B08A 4NTXA 4JTCB 1Q7YW 3IGAC 2Q5ZA 3R65A 3HKBB 3CPWU 4CKNA 5H6QA 4B3TB 4UCTA 3STZC 1XMOO 3ML0A 2JEXA 5B1BC 4GT1A 4H37A 4JI2O 3AK1A 1W0JG 1H8HG 3UO3A 2CE4A 1TVKB 2LGWA 1B06A 3F7YC 1N4CA 3AG2C 3OAAG 4IL6Z 4CC6A 3ZHUA 2F43G 4X89A 5JH7B 2NN4A 4DW1A 1O9HA 4QPJA 4XA4A 4PI2A 2R70A 1FS0G 4CKMA 3JASB 1BSMA 3P3PA 4P9OA 1L8DA 1ZL8A 2YEVA 5ITZA 4ZBMA 5LP6B 4TOIA 4NTWA 1ROPA 3OGIB 1BMFG 1HNXO 1JFFA 2RMKB 1ZX3A 1QR9A 1LUWA 1NT2B 4LF9O 4RUFA 2BOCC 1PKXA 1H38A 5LL6Y 3UQ8A 1KC8W 4DUZO 4JYCA 2AZ0A 3TJTA 1RPRA 1M57C 3HR0A 4JAUA 2ZM6B 4FPPA 3BAAA 2XASA 2WLJA 3BFRA 5B1BB 1DGSA 2ILMA 3DC5A 3CCUV 4UV8A 1P49A 3H9VA 1YIJV 2B9ZA 3W7XA 1HNZB 1VQLV 4U7NA 1AVMA 1BT8A 5CN0A 3H1IH 2IJJA 4UXNA 5DEDA 2ATKC 4LCUC 1VQMV 1S3JA 1KP3A 2IBZH 4HNAA 4LF5O 4JI0O 1WA8B 2IM9A 1ENVA 4X1IB 2R9RB 2EZOA 1SQVH 5A2QN 3K0GA 3SJCC 1FFXA 4YJ2A 3GWOA 5L3EA 1TUBB 2GUZA 1EBOA 3H1KH 1MOFA 2ZR3A 4X20A 1TA8A 1MSWD 4I0XB 4DV7O 1OCRC 2GHYA 5CA0B 5KHHA 4JV5O 3RWRD 2Q7EA 5LGUA 3C90A 1VP7A 1Y76B 1K7DA 4DR5B 1YI2V 4TUYA 5LOVB 1NR7A 2QWOB 3OW2U 5HFMA 1B04A 2ZCEA 2RDCA 2YIBD 3L73H 4I50B 1ZAUA 5IYBO 1M5IA 4B7EA 2B1IA 1AR1B 4MTXA 4LP8A 4O4HB 2RCVA 2EJRA 3ZHRA 3P32A 4X64B 2A0LA 1K9MW 1NTZH 5JQGB 3KG2A 3T4ZA 1M56B 3K0DA 2KG7B 1YVWA 3CX5F 3PN1A 1AB3A 2BCCH 4JYBA 4DO2A 2QGNA 1S77D 4MVMA 5IJ0A 4J11A 1Z5WA 4YHHB 5D5QA 3N2KA 4KL1A 1N34O 4I7ZB 5CB4A 4TQFA 3Q4HA 3TETA 2GDSA 2QA4V 2W0XA 4LFCB 5CMUA 2ADPA 1V55B 1Q6HA 4PHZA 1OCRB 4EFEA 1M1KW 1JA8A 5LHHA 2UXDO 1R1BA 4XDLA 3T1CA 4ZHQB 3PJSK 3CCJV 2CK3G 2CAZC 1KD1W 4N23A 4B3MO 4FLZA 4DUYO 2EIJC 4I5SA 2Q6AA 3NXSA 1EM1A 5GTIZ 4NVPA 1Y67A 3HKDA 1I7FA 2WSSG 5KAFZ 4WFFA 1QCEA 2B5UA 4JI4B 4U3FH 4RO2A 3J7AU 1K73W 5GONB 4CKPA 1VQ6V 4L8JA 2V4DA 2F4VB 2ZNJA 5KHIA
chains in the Genus database with same CATH topology
5JH7A 5JQGA 3WB0A 1XNQB 5EIBD 2RJZA 2ZIMA 2E5LB 4IIJA 5KHJA 4CH5A 1N34B 4TQDA 1Q8IA 2PTMA 1SQFA 3SGIA 5K1XA 3SJBC 4DK0A 5LXTA 1XQ8A 2OWOA 2ZIOA 5FNVB 1WN7A 4LF6B 3RYCB 4BW9A 5CJ4A 3DSQA 3HKCA 2Q0AA 5IYZA 4DRXA 4LFAB 4O2BB 2UXDB 1XHXA 2PYLA 4DV5B 2YI8A 3ETQA 4B3MB 4F6RA 4DUYB 1KU9A 1V9PA 4ZHQA 2VQEB 4DR6B 2F66C 1XMQB 5KX5B 4TV9B 4X1KB 2YXLA 1D5AA 4FVMA 4UCSA 3BRCA 4ZI7A 4LF8B 2Q7HA 3BA8A 2PUSA 4LH6A 3RFRA 5GONA 3K5OA 4DR3B 3ZEDA 4UFZA 4BWAA 4AHCA 1N32B 2BTQB 5EYPA 5KHGA 2PY5A 1N33B 1O9GA 5J2TA 4TV8B 1HR0B 3RWRA 4O4LB 5IJ9B 4EB6B 1G6UA 4ZOLA 4CC5A 1SKVA 4JI6B 2YIBA 2KKWA 3U10A 1VF7A 5FPRA 3VQYA 4DR4B 2ZNIA 2OYQA 4LFBB 1IBKB 5FNVA 4DV6B 3VQXA 3HKEA 4DV0B 4K8XA 4DR2B 3RYCA 4YY3B 3E22A 4I4TB 4GKJB 3BHPA 3K5LA 4O2BA 4NXNB 2UXBB 5CA1A 3K5NA 3SR2A 1Q43A 1Q3EA 4X66B 4DV4B 1WPBA 5J2UB 4UCUA 4O4HA 4DV3B 1IK9A 5KX5A 4IHJA 3JSNA 5BMVB 4X1YA 4DR7B 5JVDB 4TV9A 4I55A 3MUDA 4EEQA 3JSLA 5ITZB 3ZS8C 3RYHB 4JI8B 4X62B 1HNWB 4I9QA 3JATA 3QG5A 1TAEA 2UUAB 4OX9B 1JFFB 1M93A 3QTCA 4GYCB 5JCOA 1IBLB 5EZYB 2PYJA 4FLYA 4WBNB 4CH4A 3UT5A 5K1PA 1X4TA 4FM1A 5LP6C 2BTQA 2UUBB 4K8ZA 2R72A 2F1MA 1XNRB 2QM4A 4FM0A 2HEPA 4DV2B 3T1YB 4TV8A 5LYJB 4FFBB 3JARB 4O4LA 4JYAB 4CS4A 5IJ9A 4EB6A 1JMKC 2YI9A 3JALA 2P5OA 4B08A 5LMUB 2R9AA 5LA6B 4FM2A 3OTOB 3HKBB 3U0ZA 3VQWA 5BR8B 3LNNA 5EIBC 4B3TB 4UCTA 4O4JB 3QF7A 4D7SA 2F93B 1N36B 2Q7GA 5CHXA 4HNAB 3IAYA 1TVKB 5D5PA 3K5MA 4NXMB 2EX3A 4CC6A 2VWKA 2JVDA 4AQYB 5JH7B 3CSXA 1FFXB 5J2UA 1O9HA 4YJ2B 3JAKB 3FFQA 4CH3A 4XA4A 4PI2A 2R70A 5KHKA 1YEWA 4FLVA 5JVDA 2E3CA 3JASB 1L8DA 4FLXA 4X20B 5ITZA 3RYHA 5LP6B 4TOIA 2VQFB 4UCOA 1FU1A 1JFFA 5KMGB 5CJ0A 5EZYA 4B3RB 1KMIZ 1NT2B 4WBNA 4TUYB 1RSOA 3RGBA 4JI3B 3UQ8A 2UUCB 3SJAC 1S5JA 2UU9B 4FFBA 3JARA 4X65B 2ZM6B 3BAAA 4O4IB 4JI7B 1Q5OA 5C8YB 1DGSA 3BABA 4CS3A 4B3SB 1SA0B 3N2GB 5LA6A 3CB2A 4U3JB 2QJ1A 4UCVA 2HHHB 1XMOB 3HKBA 5JJJB 1P49A 1XHZA 4ZI7B 1IBMB 4JI2B 2F95B 4X1KA 1HNZB 1M4UA 1Z5VA 4D7TA 4O4JA 5IJ0B 4LNUB 3N2KB 4YJ3B 1XI1A 1QHTA 5CB4B 4HNAA 5EYPB 3K58A 1TVKA 3JAWB 2IM9A 1TGOA 4FLWA 4X1IB 2RQ6A 3VQVA 2XHBA 3SJCC 1FFXA 4YJ2A 3JAKA 4ZOLB 1SQGA 1TUBB 4JI5B 3BPZA 3JASA 4HBNA 1HNXB 3WB2A 4X20A 1TA8A 5LP6A 3K57A 5CA0B 5KHHA 4LF9B 3WB1A 3B2EE 3RWRD 5KMGA 3T1HB 2Q7EA 3RYIB 4CS2A 3HKEB 2YIAA 4DR5B 4DV1B 4O2AB 2JGUA 3HKDB 3E22B 2ZINA 3A2FA 4TUYA 4ZIBA 5LOVB 4DUZB 4LF7B 1B04A 2ZCEA 2YIBD 4GLXA 4I50B 1ZAUA 5CA1B 1WNSA 1M5IA 2JS5A 1FJGB 3RYFB 4I4TA 1HW7A 4AILC 1T5EA 3K59A 4O4HB 4Q6GA 4K0KB 4O4IA 4IHJB 4X64B 5C8YA 4X1YB 3OTFA 4JI1B 3MAQA 5JQGB 1QQCA 4I55B 3M7MX 2PZSA 1SA0A 3N2GA 4U3JA 3JATB 5BMVA 3PN1A 4IIJB 1I94B 3BA9A 5IJ0A 1Z5WA 4LNUA 4YHHB 3UT5B 5D5QA 3N2KA 4JI0B 4LF5B 4KL1A 4YJ3A 4EFBA 2PGGA 5LXTB 5CB4A 4TQFA 3JAWA 4X1IA 4LFCB 1J5EB 5FPOA 3HKCB 5IYZB 5JJEB 1JJOA 4DRXB 4LH7A 4PHZA 3U11A 4EFEA 4PI0A 3JALB 3II6A 1TUBA 4F6RB 5LYJA 4DV7B 4ZHQB 2P22C 2GV9A 2BTOA 5LMNB 4GKKB 4JV5B 3THOA 2CAZC 4FLZA 4DR1B 4KHPB 5IWAB 4LR3A 5CA0A 4UCRA 5JJNB 3SR2C 4FLUA 1H2SB 3RYIA 4NVPA 4CH6A 3CHXA 4O2AA 3HKDA 1I7FA 5LOVA 3ICXA 4LF4B 4JI4B 4I50A 5GONB 3RYFA 2VWJA 2UXCB 4L8JA 2V4DA 5JCOC 5J2TB 2F4VB 2ZNJA 5KHIA 4DK1A 4FLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RWR D;  4XA4 A;  2R9A A;  5CHX A;  2QM4 A;  5CJ4 A;  3SR2 A;  1FU1 A;  1M5I A;  3II6 A;  3SR2 C;  1KU9 A;  3MUD A;  1IK9 A;  3RWR A;  5CJ0 A; 
#chains in the Genus database with same CATH topology
 4IYH A;  2HR3 A;  1N33 O;  4CZZ A;  2IJI A;  5EIB D;  2EIN C;  4CH5 A;  2C2A A;  4BR6 A;  1JQ0 A;  1XL4 A;  4KFM A;  4U7O A;  2ZQM A;  1Q8I A;  2GTA A;  2YC0 A;  1FXK C;  1XOU A;  3BCC H;  3CCQ V;  1R3K C;  3CXC U;  2UXX A;  5FNV B;  2IJK A;  5CA3 A;  4LF6 B;  4J10 A;  4GEX A;  3B8M A;  1UJW B;  4GFA A;  2WLN A;  4FJC C;  1GN3 A;  4IGG A;  3B8N A;  2PF4 E;  1PNM A;  2Q73 A;  2WLK A;  3ZJZ A;  3AEI A;  3OUS A;  3D8C A;  2XTA A;  1KB9 F;  1KU9 A;  3SPJ A;  4DV4 O;  1I08 A;  1MNG A;  1G8M A;  4K3A A;  5EBM C;  2YXL A;  3HPL C;  2B1G A;  4FVM A;  4DR7 O;  4WFE A;  2AZ2 A;  4ZI7 A;  2Q7H A;  1FKA O;  3BA8 A;  3JD0 A;  4GEU A;  2DW4 A;  1P7G A;  2UUA O;  4OX9 O;  4WFB V;  3EVK A;  1IVS A;  1YXB A;  1E79 G;  4DR3 B;  4UFZ A;  4BWA A;  1N32 B;  5LGT A;  2FML A;  2BTQ B;  5EYP A;  5KHG A;  3SYO A;  2DQ0 A;  4LBE C;  2EIN B;  2OTJ V;  4J9Z B;  1O9G A;  5E79 Z;  4TV8 B;  5GTH Z;  1HR0 B;  1PL0 A;  3ABT A;  1FXK B;  1AI5 A;  1SES A;  3K3W A;  1OCO B;  1SZX A;  1K92 A;  3A0B Z;  3WG7 B;  2E76 B;  4MVU A;  4J7Z A;  1VF7 A;  1MG1 A;  1EZV H;  4DV6 B;  1YF2 A;  4DV0 B;  4DR2 B;  1U97 A;  2CDY A;  2WWW A;  2JIZ G;  3E22 A;  3BVO A;  3ZMZ A;  2CTR A;  1D5N A;  3D3Q A;  4NXN B;  3DXR A;  1MZF A;  1Y74 A;  3LUT B;  3JD1 A;  1ZUQ A;  3QNE A;  3OEE G;  4MTO A;  5EC1 C;  4DV3 B;  1B6Q A;  1IK9 A;  1KBH A;  3ETE A;  2YXH A;  1ZSP A;  5L3B A;  3JSL A;  3RYH B;  1HNW B;  3QG5 A;  1WLE A;  4UB6 Z;  4JAS A;  2JJ2 G;  2ZE5 A;  2UXN A;  1E1Q G;  1RSO B;  5L3D A;  1X4T A;  5GW7 A;  2K1E A;  4TT3 G;  2UUB B;  2A3Q A;  4FM0 A;  1WP8 A;  1H2N A;  4DV2 B;  2XND G;  2EZP A;  1TUE B;  4O4L A;  1YJ9 V;  3CCR V;  1YIT V;  3ASN C;  2YI9 A;  4PA3 A;  4GUN A;  2QKS A;  5LMU B;  2MW2 B;  2NLJ C;  3TGU H;  1MAB G;  3NR7 A;  4MTF A;  5BR8 B;  3OT7 A;  5LHG A;  2WA3 A;  4B3S O;  3ZX6 A;  5EIB C;  5F2V O;  1XIL A;  1OZ0 A;  3EFF K;  4O4J B;  4D7S A;  2F93 B;  3JD2 A;  2OIE A;  5D5P A;  3UO2 A;  3CYO A;  4AQY B;  2QTS A;  3FFQ A;  2ZDI C;  1YEW A;  2E3C A;  4MTG A;  2IJH A;  4FLX A;  4JI5 O;  2FYU H;  1IZ3 A;  2VQF B;  1GN4 A;  1FU1 A;  1YZB A;  5KMG B;  4N21 A;  2HJF C;  1KMI Z;  2MK3 A;  1QLE C;  3T1H O;  3QO7 A;  4ICG A;  4LF6 O;  4DV1 O;  2XAF A;  1J95 A;  4LF7 O;  4JF3 A;  5BXZ A;  2DWE C;  4GCZ A;  1S5J A;  2UU9 B;  4X65 B;  4MSW C;  1YHQ V;  4O4I B;  3ZMV A;  4F6E A;  4JI7 B;  1Q5O A;  1SA0 B;  1NQT A;  1W59 A;  5LA6 A;  4U3J B;  2QJ1 A;  1I5X A;  2HHH B;  4JI1 O;  4ZI7 B;  1IBM B;  1XUQ A;  1Z5V A;  5JWP A;  3G6E V;  4LNU B;  3VOU A;  4NTY A;  2CGN A;  1X59 A;  2X7R B;  4BIU A;  5EYP B;  3JAW B;  3CS5 A;  5EBW C;  2G38 A;  2ITC C;  2XHB A;  1VQ8 V;  4P2Z A;  4IT5 A;  1WB8 A;  3G71 V;  2QM7 A;  1J5E O;  4X9Q A;  3JAK A;  1VQ9 V;  3D36 C;  1N0N A;  1S76 D;  3Q0X A;  1AI7 A;  3WB2 A;  3ZCC A;  2DMX A;  5LMN O;  3SYQ A;  4DR1 O;  4CS2 A;  5B3S C;  4KHP O;  1NI8 A;  3JCZ A;  1NVP D;  4JAV A;  4O2A B;  4ZIB A;  3E22 B;  2ZIN A;  4QE7 A;  1LUV A;  4DV6 O;  3LSU A;  5BZB A;  4DV0 O;  2XAQ A;  2JS5 A;  3DXR B;  3RYF B;  2P7T C;  1HW7 A;  4GX0 A;  3AG7 A;  4G79 A;  1Z2G A;  3K59 A;  3P3N A;  4K0K B;  3UCS C;  3ABU A;  3FYI B;  2IW5 A;  5C8Y A;  1VAR A;  4FK5 C;  4W4L A;  3M7M X;  5B1N A;  3E8B A;  3N2G A;  4OXS A;  4RQE A;  1NR1 A;  1Q86 W;  1AIL A;  4UUJ C;  1XNQ O;  4QPK A;  1I94 B;  3BA9 A;  2E5L O;  3E35 A;  1A32 A;  1F23 A;  3CEI A;  1CXZ B;  4YJ3 A;  1VF6 C;  5LXT B;  1UPG A;  2WLL B;  2LFR A;  3FB8 C;  4NYK A;  2N05 A;  2ZE8 A;  3B4S A;  1JJ2 U;  1I0H A;  3CMA V;  3HKC B;  5IYZ B;  2QWN B;  4QE9 A;  5KLV H;  4ABM A;  3U11 A;  2Q68 A;  4GX2 A;  2W6J G;  1NTM H;  4FMT A;  4PI0 A;  2DWD C;  2GBO A;  2Q9L A;  4F6R B;  5B3S B;  1COW G;  3FAV A;  2HKO A;  4DV5 O;  1NS1 A;  4GKK B;  5FL7 G;  5IWA B;  2A79 B;  5H2F Z;  3QO8 A;  4FLU A;  1GN6 A;  2IH1 C;  2CH7 A;  3RYI A;  5BR8 O;  1BHA A;  3A8T A;  1R6K A;  3CCM V;  3CHX A;  3BY6 A;  4LF4 B;  2Y3V A;  4LF8 O;  1PV0 A;  2LP7 A;  2VWJ A;  1MSD A;  3OEH G;  1M56 C;  4UVB A;  3E89 A;  1Q81 W;  2UXC B;  4WF9 V;  1THZ A;  5JCO C;  5FLX N;  2DYR B;  3OMA B;  1WP7 A;  4X8A A;  3G6B A;  2Z5U A;  3SJQ C;  3WB0 A;  2YIC A;  1BE3 H;  2ZIM A;  1D2D A;  4IIJ A;  4WFH A;  2KSD A;  5J9P C;  1F4N A;  3AK2 A;  1V55 C;  4TQD A;  3C3S A;  4QNH B;  1JR9 A;  4Z2W A;  4DR4 O;  4J9Y B;  3SYA A;  4K35 A;  4MW8 A;  4BW9 A;  1GO3 F;  4AI8 A;  2P4V A;  1VF5 B;  4YXW G;  1VMG A;  4DRX A;  4LFA B;  4O2B B;  5LGN A;  3G67 A;  2PYL A;  2YI8 A;  4HAM A;  2UU9 O;  4GKJ O;  1VEW A;  4MT8 A;  3RBZ A;  3ZMT A;  2UXB O;  1AP5 A;  1V9P A;  2GSM B;  2VQE B;  1QR8 A;  2NNU A;  4DR6 B;  2AHZ A;  4E2L A;  1XMQ B;  1VIB A;  4TV9 B;  1FXV A;  2CUG A;  1VQ7 V;  2DOS A;  1ORQ C;  3BRC A;  1YJW V;  2WAM A;  3CD6 V;  1YDX A;  4GX1 A;  1H8E G;  4LH6 A;  3RFR A;  3K5O A;  2W6I G;  2N04 A;  3AG1 C;  1V54 C;  1R3L C;  5J2T A;  2BSK A;  3SPH A;  3CP1 A;  3RWR A;  2Q4P A;  1WAZ A;  5IJ9 B;  2F23 A;  3ZIA G;  4EB6 B;  3T1Y O;  1G6U A;  4CC5 A;  2ZKO A;  4MVQ A;  4JI6 B;  2E74 B;  2N74 A;  2YIB A;  3U10 A;  2Q69 A;  1VQK V;  1K34 A;  1OCC B;  3L70 H;  4LFB B;  3OMN B;  4BAY A;  1KP2 A;  3W7S A;  1IBK B;  3A0R A;  3FYE B;  3M8A A;  3KZI Z;  3HKE A;  4K8X A;  3M99 B;  4B3T O;  5LHI A;  3RYC A;  3FX7 A;  4YY3 B;  1RP3 B;  1K33 A;  1H2G A;  2WLI A;  4GFC A;  3K5L A;  1KEC A;  4PA9 A;  3SYP A;  3K5N A;  2JS3 A;  3SR2 A;  4H13 B;  1Q3E A;  2LJ2 A;  4X66 B;  1WPB A;  4JTA B;  3I5D A;  5KX5 A;  4IHJ A;  1SQB H;  1W2B U;  2M6Y A;  2CTW A;  1ZL8 B;  2K9P A;  2X6C A;  4A5U B;  2YEV B;  5ITZ B;  1NVP B;  4JI8 B;  4X62 B;  3JAT A;  2OCC C;  3AG1 B;  1G1X B;  1Q6I A;  1V54 B;  1JFF B;  4F4L A;  3FB5 C;  1IBL B;  5C93 A;  2PYJ A;  4JAA A;  2OTL V;  4K8Z A;  1OCO C;  3WG7 C;  1XNR B;  2QM4 A;  2P06 A;  3FAV B;  2ITD C;  4JYA B;  1SQP H;  3WFV A;  2PI5 A;  4BIZ A;  3JAL A;  1M9N A;  2ZM6 O;  1AI4 A;  3TXQ A;  4FM2 A;  1XDC A;  3OTO B;  5DEC A;  1F51 A;  3LNN A;  4NB5 A;  2CGO A;  1BGY H;  1KKD A;  3CE2 A;  3CXH F;  1N36 B;  2Q7G A;  2ZXW B;  3K04 A;  2YSU B;  1HNZ O;  5CHX A;  1LNQ A;  4G2K A;  2HFE C;  4HNA B;  3K9S A;  3ZN0 A;  4DYL A;  4NXM B;  1MMM A;  1P7B A;  1OV9 A;  2WA4 A;  2XUM A;  2JVD A;  1QVF U;  4RAI A;  3UKM A;  1FFX B;  5J2U A;  4YJ2 B;  1PM9 A;  2OCC B;  4J80 A;  3CME V;  4CH3 A;  4FIP C;  2GUZ B;  5KHK A;  1Q90 D;  1AR5 A;  5KAI Z;  1AJP A;  5JVD A;  4R50 A;  2QR4 A;  3CCE V;  4X20 B;  4MVR A;  2JGD A;  3CC7 V;  4NKG B;  1MZE A;  4UCO A;  5H9C A;  5CJ0 A;  1JX9 A;  3JAM N;  1HP8 A;  5EZY A;  2EIM B;  4QJF B;  4WBN A;  2DJV A;  4UV9 A;  1P4R A;  4J42 A;  3K79 A;  4TUY B;  1K3E A;  5CBF A;  3CRC A;  3RGB A;  4JI3 B;  4DR5 O;  1EFR G;  2Z0A A;  2UUC B;  1IDS A;  2EUL A;  2HG5 C;  3SJA C;  3CC4 V;  2OIG A;  3GVM A;  2Y48 A;  1L0N H;  3AG4 C;  4FFB A;  1QNM A;  3JAR A;  2IU3 A;  1JOY A;  5B1A B;  2ZT9 B;  4DW0 A;  3LDD A;  3BAB A;  4CS3 A;  5L3F A;  3CB2 A;  4X64 O;  4UCV A;  1FPO A;  1XMO B;  1GM8 A;  3HKB A;  2X6B A;  1OCZ B;  3K06 A;  5JJJ B;  4JI2 B;  2F95 B;  3OE7 G;  4X1K A;  5IJ0 B;  2BOB C;  3N2K B;  1BHB A;  1K4D C;  1QHT A;  2W0F C;  5CB4 B;  1N8R W;  4CBC A;  1TVK A;  3Q4H B;  4YHH O;  5IYD O;  1TGO A;  3HB3 B;  3W7U A;  4FLW A;  1WB7 A;  2RQ6 A;  3VQV A;  1B3Q A;  2RNB A;  4J7K A;  1AJQ A;  2DQ3 A;  4LFC O;  4ZKI A;  1SQG A;  3FKS G;  3BPZ A;  1SER A;  4XDK A;  1BS3 A;  1F4M A;  3JAS A;  4GZR B;  4HBN A;  1HNX B;  1NTK H;  5LP6 A;  3Q0Y A;  4LF9 B;  2A06 H;  3HKE B;  4C7U A;  1DK1 A;  3AG4 B;  2JGU A;  3HKD B;  4LFB O;  3A2F A;  4DUZ B;  3GB7 C;  3ZRW A;  5B66 Z;  1RFY A;  3GWK C;  1GK9 A;  4JYY A;  1BQ0 A;  3E2E A;  5B5E Z;  4JI4 O;  4AIL C;  4WFG A;  1R73 A;  2LO1 A;  3IJ4 A;  3CCS V;  2P4K A;  4IHJ B;  1YSC A;  3OTF A;  2X0L A;  3MAQ A;  2F4V O;  5HFL A;  2LQT A;  3ZMU A;  4WFA V;  4J7J A;  3SPC A;  4E4E A;  1YCI A;  3JAT B;  3R66 A;  5BMV A;  3L74 H;  3ABL B;  4LF5 B;  4JI0 B;  2JJ1 G;  5KA6 A;  1EN4 A;  4H33 A;  2XAJ A;  1WA8 A;  3RVY A;  1OJH A;  3K03 A;  4X1I A;  3G4S V;  2Y0I A;  5FPO A;  5JJE B;  4P9P A;  3ABK B;  2DYS C;  3ETD A;  2PI4 A;  1NKD A;  3JAL B;  1CP9 A;  3II6 A;  1TUB A;  2P90 A;  1OHH G;  1WJZ A;  1WPX A;  5LYJ A;  4DV7 B;  2GV9 A;  4JV5 B;  3E8G A;  4JZ2 A;  1KUQ A;  4I0X A;  2QKC A;  1GKF A;  4LR3 A;  5CA0 A;  1I5Y A;  3OTO O;  4L87 A;  2H8P C;  1Y76 A;  1Q6U A;  5LOV A;  3G80 A;  3ICX A;  3AK3 A;  4MVS A;  5B1O A;  4I50 A;  1YTF B;  3WU2 Z;  1BZK A;  3J80 N;  2XAG A;  1FFT B;  3H01 A;  3VBB A;  3D3I A;  4DR3 O;  3B40 A;  4PDM A;  1N32 O;  1BQZ A;  4FLT A;  4IYI A;  1K97 A;  1VQN V;  2LW1 A;  5JQG A;  5CBG A;  1K8A W;  1HR0 O;  5DM6 V;  1S72 V;  1QBZ A;  1S5L Z;  3EXA A;  2KG7 A;  1PP9 H;  5KHJ A;  4XBF A;  1N34 B;  1Y6X A;  1QLN A;  2HJD A;  4Q20 A;  2PTM A;  1SQF A;  3SGI A;  5A9G A;  5K1X A;  4RQF A;  4DK0 A;  2IH3 C;  2DYS B;  1XQ8 A;  4MVO A;  3LDC A;  1WN7 A;  3L75 H;  1DF5 A;  2E75 B;  4MW3 A;  4Z1M G;  2WLH A;  2Q0A A;  2X6A A;  3KCY A;  5L3C A;  3S3X A;  2ZE7 A;  4DR2 O;  2L35 A;  2UXD B;  1XHX A;  4TWK A;  3E86 A;  1CEZ A;  4JPR A;  3ETQ A;  1SS3 A;  1Y74 B;  1ZTE A;  4PDR A;  4B3M B;  2QWQ B;  3CRM A;  4DUY B;  4NXN O;  2YDE A;  4ZHQ A;  2EIL B;  1S5H C;  2F66 C;  2ODM A;  3APQ A;  4LWS A;  4X1K B;  4DV3 O;  3FB7 C;  1D5A A;  2EJ7 A;  2QDO A;  4FZ1 A;  1QVG U;  3FB6 C;  2FL4 A;  2LW7 A;  4BIO A;  2DYR C;  4OGQ B;  1HNW O;  1K5S A;  3TCU A;  2A7W A;  5GON A;  4PA4 A;  5AG2 A;  4AHC A;  2PY5 A;  1N33 B;  4G27 B;  2UUB O;  2ETN A;  4O4L B;  2AXT Z;  4DV2 O;  4MS2 A;  5E1A C;  4ZOL A;  1GM9 A;  1PNK A;  3RW0 A;  3TXS A;  1SKV A;  1G4Y B;  5TIS Z;  5FPR A;  3VQY A;  3CCV V;  5LMU O;  2HVJ C;  3CC2 V;  1KYO F;  3ZRW B;  5FNV A;  1SC5 B;  1XL6 A;  1DTO A;  3VQX A;  2CTQ A;  3MD0 A;  2HP8 A;  3MHH C;  1NH2 B;  3MHS C;  5H6R A;  1JPX A;  3I55 V;  2P6J A;  5CA1 A;  1VQP V;  2HVK C;  3OMI B;  2AGA A;  1Q43 A;  3L71 H;  4FFK A;  2D3O W;  4QGP A;  3JYC A;  4DV4 B;  4UCU A;  2VS0 A;  4PDL A;  4AQY O;  3ZHT A;  3JSN A;  5BMV B;  2DN9 A;  4X1Y A;  4DR7 B;  3SDL A;  4I55 A;  3AG2 B;  1GAX A;  3AG3 C;  3RT3 C;  4B7K A;  1DLB A;  4EKW A;  1TAE A;  2UUA B;  1F7Y A;  4OX9 B;  1AI6 A;  1M93 A;  3QTC A;  4GYC B;  2DE0 X;  1XEQ A;  1H2M A;  2H3O A;  3E8H A;  3SYC A;  2VQF O;  4CH4 A;  3UT5 A;  1HWY A;  4H44 B;  4FM1 A;  2L6L A;  3RVZ A;  3F7V C;  2BTQ A;  3B09 A;  1XBL A;  2R72 A;  2F1M A;  1GRJ A;  2HEP A;  4TV8 A;  5LYJ B;  1PD3 A;  1FXK A;  4CS4 A;  1OCC C;  3OM3 B;  3IC7 A;  1NBM G;  3CRR A;  4X65 O;  2QEX V;  3IFX A;  3OD4 A;  4JI7 O;  2R9A A;  5LA6 B;  2V1D A;  1SRY A;  2ZE6 A;  4PA6 A;  3U0Z A;  1M57 B;  3VQW A;  1GM7 A;  1YJN V;  2HHH O;  3QF7 A;  3PYI A;  1NZ6 A;  1IBM O;  3JD4 A;  1R3I C;  4H0L B;  3JCU Z;  1JVM A;  4QIW F;  3IAY A;  3K5M A;  2EX3 A;  2VWK A;  2ADQ B;  2FTK A;  2NR5 A;  2YUA A;  1VQ5 V;  3AG3 B;  2Y69 C;  3CSX A;  1L1F A;  1SET A;  3LSS A;  1UFI A;  3LSQ A;  3JAK B;  2A9H A;  3TK1 A;  3OFN G;  3QO5 A;  4FLV A;  1PPJ H;  2FB5 A;  3RYH A;  4I9W A;  5IDJ A;  1SF9 A;  2O57 A;  2EBO A;  4X88 A;  3ZHQ A;  3F5W C;  4B3R B;  1R6T A;  1M90 W;  3CRQ A;  4BW5 A;  4D6T H;  1RSO A;  2YS8 A;  5EBL C;  1H2K A;  3RN4 A;  5CBH A;  4YIP A;  1ZLZ A;  3CJH A;  3IC9 A;  4J41 A;  1IXB A;  3ZHS A;  5C8Y B;  4LWS B;  2ZXW C;  3LNM B;  4K0K O;  4B3S B;  4HYO A;  4XDJ A;  3N2G B;  2Y4U A;  4ASU G;  1XHZ A;  3DC6 A;  1M4U A;  4WCE V;  4D7T A;  4LC1 A;  4O4J A;  4HZ3 A;  3I56 V;  2HLD G;  1RM1 C;  2Y69 B;  4YJ3 B;  1XI1 A;  1I94 O;  4UB8 Z;  2KQX A;  4P30 A;  3K58 A;  2QM8 A;  3CWB H;  2QWR B;  2WLM A;  3T2M A;  3W7W A;  4FZ0 A;  3FD9 A;  3ZMS A;  1FD9 A;  3T4D A;  3SPG A;  5IT9 N;  3X2Q C;  1YTF D;  3W7T A;  4ZOL B;  5L3G A;  5IYC O;  2EIM C;  4JI5 B;  2Z3Y A;  4JZG A;  1CPY A;  5KUM A;  2RN9 A;  4PV1 B;  3LDE A;  3A0H Z;  3DGE A;  3K57 A;  4GKK O;  3WB1 A;  3B2E E;  5KMG A;  3T1H B;  3RYI B;  2CH7 B;  2OT5 A;  5EK0 A;  5IWA O;  2YIA A;  1S0V A;  4KXR A;  4DV1 B;  2Y4T A;  2XOK G;  3ABM C;  4LF7 B;  5B1A C;  4OPH A;  3EHB B;  4GLX A;  4KUM A;  2EIJ B;  5CA1 B;  1WNS A;  2R9I A;  1FJG B;  4I4T A;  4LF4 O;  1OCZ C;  1T5E A;  4Q6G A;  4O4I A;  4PD4 F;  1VQ4 V;  2UXC O;  2VRZ A;  4X1Y B;  4JI1 B;  1IXM A;  3L72 H;  1QQC A;  4I55 B;  1RM1 B;  2PZS A;  1BCC H;  1SA0 A;  5IY5 C;  4U3J A;  2ARH A;  4OPA A;  3KCX A;  2LFS A;  2QE7 G;  4IIJ B;  2JRI A;  2M7W A;  1LR1 A;  2YXY A;  4LNU A;  3UT5 B;  3S3W A;  4EFB A;  2PGG A;  3X2Q B;  2ZDI A;  4TSF G;  3JAW A;  1US6 A;  1J5E B;  1JJO A;  4DRX B;  1FXH A;  3STL C;  4PA7 A;  3CCL V;  4LH7 A;  3ZRV A;  3QVN A;  4LFA O;  4RUE A;  3O9O A;  1EZJ A;  2YID A;  5KA5 A;  1EN6 A;  3UM7 A;  2P22 C;  5LMN B;  2BTO A;  3OUF A;  3ABM B;  1Y4M A;  3THO A;  1E1R G;  5IE9 A;  4DR1 B;  5DN6 G;  4KHP B;  4UCR A;  2VQE O;  5JJN B;  2Q8V A;  3SR2 C;  4DR6 O;  3DTU B;  1H2S B;  1XMQ O;  2BE3 A;  1JCH A;  3ZRX A;  4R6Z A;  4UVA A;  4CH6 A;  2ZR2 A;  3H1L H;  4O2A A;  1KQS U;  1N0J A;  3ZN1 A;  2ZD9 A;  3H1J H;  4JGS A;  1EN5 A;  4GX5 A;  2H94 A;  3RYF A;  2QTO A;  3APO A;  5IY5 B;  1MA1 A;  2D2C B;  5KUK A;  5J2T B;  1RPO A;  2BSK B;  4DK1 A;  3ABL C;  5LBQ A;  1NH2 D;  5JH7 A;  1XNQ B;  2RJZ A;  2E5L B;  3BEH A;  3H1H H;  4RWU A;  1QU7 A;  2AW9 A;  4W4K A;  1URF A;  3ABK C;  1GTO A;  4JI6 O;  3SJB C;  1NU1 H;  2WLL A;  5LXT A;  1PL4 A;  4B3R O;  2OWO A;  2ZIO A;  2OCH A;  3D36 A;  2P67 A;  3L9D A;  3RYC B;  5CJ4 A;  1IBK O;  3DSQ A;  3HKC A;  1FAF A;  2LGQ A;  2WLI B;  4PJ0 Z;  5IYZ A;  3CJH B;  4YY3 O;  2Y3W A;  4DV5 B;  2CTP A;  2JEU A;  1FYJ A;  4PEL A;  4F6R A;  3ZHV A;  4G28 B;  4DXW A;  1SZT A;  5KX5 B;  4X66 O;  2FKX A;  1K4C C;  2JK5 C;  2QKA A;  5BY1 A;  4R8C A;  3E8F A;  3N27 A;  1AJN A;  4UCS A;  3ASO C;  2Q0O C;  1L0L H;  4LF8 B;  3KKY A;  1AR4 A;  1GN2 A;  4JI8 O;  4X62 O;  2PUS A;  3E83 A;  1IBL O;  1SQX H;  4JTD B;  3ZED A;  1GH6 A;  4YIO A;  3CRA A;  1Q82 W;  2EIK C;  4KP4 A;  1XNR O;  1BL8 A;  1VF6 A;  5EC2 C;  1K5Q A;  2XT9 A;  1GMG A;  1IUR A;  4JYA O;  5H5N A;  2QWP B;  2KKW A;  3ZBH A;  4DR4 B;  2XAH A;  1NJI W;  1ARO P;  2ZNI A;  2OYQ A;  2Q67 A;  3K9A A;  3ASN B;  1R6N A;  2Y0P A;  3MDS A;  3OR6 C;  1VQO V;  2EIL C;  4I4T B;  2AHY A;  4GKJ B;  1N36 O;  3BHP A;  4O2B A;  4UVC A;  1FJG O;  2UXB B;  1PNL A;  1DF4 A;  1KKC A;  3ETG A;  4NXM O;  5J2U B;  3B77 A;  3ASO B;  4O4H A;  3OGC C;  3C3T A;  5JVD B;  1U96 A;  4TV9 A;  3MUD A;  4EEQ A;  3SPI A;  3ZS8 C;  1IX9 A;  2JGD B;  1HDJ A;  4I9Q A;  3K08 A;  3ZRS A;  1Y66 A;  2EIK B;  5JCO A;  2JDI G;  4R7C A;  5EZY B;  3JD3 A;  4FLY A;  4WBN B;  2WPD G;  2V7Q G;  1ZWI C;  4PDV A;  5K1P A;  1SQQ H;  2QSA A;  3OR7 C;  1AP6 A;  5LP6 C;  3J81 N;  2IU0 A;  4NR1 A;  2GTS A;  4JI3 O;  3T1Y B;  2UUC O;  4MVZ A;  2KB1 A;  1R3J C;  4FFB B;  3JAR B;  1QLE B;  5IJ9 A;  1H2L A;  1XRE A;  4Z1V A;  4EB6 A;  1JMK C;  1W0K G;  1P84 F;  3O65 A;  3P30 A;  2P5O A;  3F5T A;  4B08 A;  4NTX A;  4JTC B;  1Q7Y W;  3IGA C;  2Q5Z A;  3R65 A;  3HKB B;  3CPW U;  4CKN A;  5H6Q A;  4B3T B;  4UCT A;  3STZ C;  1XMO O;  3ML0 A;  2JEX A;  5B1B C;  4GT1 A;  4H37 A;  4JI2 O;  3AK1 A;  1W0J G;  1H8H G;  3UO3 A;  2CE4 A;  1TVK B;  2LGW A;  1B06 A;  3F7Y C;  1N4C A;  3AG2 C;  3OAA G;  4IL6 Z;  4CC6 A;  3ZHU A;  2F43 G;  4X89 A;  5JH7 B;  2NN4 A;  4DW1 A;  1O9H A;  4QPJ A;  4XA4 A;  4PI2 A;  2R70 A;  1FS0 G;  4CKM A;  3JAS B;  1BSM A;  3P3P A;  4P9O A;  1L8D A;  1ZL8 A;  2YEV A;  5ITZ A;  4ZBM A;  5LP6 B;  4TOI A;  4NTW A;  1ROP A;  3OGI B;  1BMF G;  1HNX O;  1JFF A;  2RMK B;  1ZX3 A;  1QR9 A;  1LUW A;  1NT2 B;  4LF9 O;  4RUF A;  2BOC C;  1PKX A;  1H38 A;  5LL6 Y;  3UQ8 A;  1KC8 W;  4DUZ O;  4JYC A;  2AZ0 A;  3TJT A;  1RPR A;  1M57 C;  3HR0 A;  4JAU A;  2ZM6 B;  4FPP A;  3BAA A;  2XAS A;  2WLJ A;  3BFR A;  5B1B B;  1DGS A;  2ILM A;  3DC5 A;  3CCU V;  4UV8 A;  1P49 A;  3H9V A;  1YIJ V;  2B9Z A;  3W7X A;  1HNZ B;  1VQL V;  4U7N A;  1AVM A;  1BT8 A;  5CN0 A;  3H1I H;  2IJJ A;  4UXN A;  5DED A;  2ATK C;  4LCU C;  1VQM V;  1S3J A;  1KP3 A;  2IBZ H;  4HNA A;  4LF5 O;  4JI0 O;  1WA8 B;  2IM9 A;  1ENV A;  4X1I B;  2R9R B;  2EZO A;  1SQV H;  5A2Q N;  3K0G A;  3SJC C;  1FFX A;  4YJ2 A;  3GWO A;  5L3E A;  1TUB B;  2GUZ A;  1EBO A;  3H1K H;  1MOF A;  2ZR3 A;  4X20 A;  1TA8 A;  1MSW D;  4I0X B;  4DV7 O;  1OCR C;  2GHY A;  5CA0 B;  5KHH A;  4JV5 O;  3RWR D;  2Q7E A;  5LGU A;  3C90 A;  1VP7 A;  1Y76 B;  1K7D A;  4DR5 B;  1YI2 V;  4TUY A;  5LOV B;  1NR7 A;  2QWO B;  3OW2 U;  5HFM A;  1B04 A;  2ZCE A;  2RDC A;  2YIB D;  3L73 H;  4I50 B;  1ZAU A;  5IYB O;  1M5I A;  4B7E A;  2B1I A;  1AR1 B;  4MTX A;  4LP8 A;  4O4H B;  2RCV A;  2EJR A;  3ZHR A;  3P32 A;  4X64 B;  2A0L A;  1K9M W;  1NTZ H;  5JQG B;  3KG2 A;  3T4Z A;  1M56 B;  3K0D A;  2KG7 B;  1YVW A;  3CX5 F;  3PN1 A;  1AB3 A;  2BCC H;  4JYB A;  4DO2 A;  2QGN A;  1S77 D;  4MVM A;  5IJ0 A;  4J11 A;  1Z5W A;  4YHH B;  5D5Q A;  3N2K A;  4KL1 A;  1N34 O;  4I7Z B;  5CB4 A;  4TQF A;  3Q4H A;  3TET A;  2GDS A;  2QA4 V;  2W0X A;  4LFC B;  5CMU A;  2ADP A;  1V55 B;  1Q6H A;  4PHZ A;  1OCR B;  4EFE A;  1M1K W;  1JA8 A;  5LHH A;  2UXD O;  1R1B A;  4XDL A;  3T1C A;  4ZHQ B;  3PJS K;  3CCJ V;  2CK3 G;  2CAZ C;  1KD1 W;  4N23 A;  4B3M O;  4FLZ A;  4DUY O;  2EIJ C;  4I5S A;  2Q6A A;  3NXS A;  1EM1 A;  5GTI Z;  4NVP A;  1Y67 A;  3HKD A;  1I7F A;  2WSS G;  5KAF Z;  4WFF A;  1QCE A;  2B5U A;  4JI4 B;  4U3F H;  4RO2 A;  3J7A U;  1K73 W;  5GON B;  4CKP A;  1VQ6 V;  4L8J A;  2V4D A;  2F4V B;  2ZNJ A;  5KHI A; 
#chains in the Genus database with same CATH homology
 5JH7 A;  5JQG A;  3WB0 A;  1XNQ B;  5EIB D;  2RJZ A;  2ZIM A;  2E5L B;  4IIJ A;  5KHJ A;  4CH5 A;  1N34 B;  4TQD A;  1Q8I A;  2PTM A;  1SQF A;  3SGI A;  5K1X A;  3SJB C;  4DK0 A;  5LXT A;  1XQ8 A;  2OWO A;  2ZIO A;  5FNV B;  1WN7 A;  4LF6 B;  3RYC B;  4BW9 A;  5CJ4 A;  3DSQ A;  3HKC A;  2Q0A A;  5IYZ A;  4DRX A;  4LFA B;  4O2B B;  2UXD B;  1XHX A;  2PYL A;  4DV5 B;  2YI8 A;  3ETQ A;  4B3M B;  4F6R A;  4DUY B;  1KU9 A;  1V9P A;  4ZHQ A;  2VQE B;  4DR6 B;  2F66 C;  1XMQ B;  5KX5 B;  4TV9 B;  4X1K B;  2YXL A;  1D5A A;  4FVM A;  4UCS A;  3BRC A;  4ZI7 A;  4LF8 B;  2Q7H A;  3BA8 A;  2PUS A;  4LH6 A;  3RFR A;  5GON A;  3K5O A;  4DR3 B;  3ZED A;  4UFZ A;  4BWA A;  4AHC A;  1N32 B;  2BTQ B;  5EYP A;  5KHG A;  2PY5 A;  1N33 B;  1O9G A;  5J2T A;  4TV8 B;  1HR0 B;  3RWR A;  4O4L B;  5IJ9 B;  4EB6 B;  1G6U A;  4ZOL A;  4CC5 A;  1SKV A;  4JI6 B;  2YIB A;  2KKW A;  3U10 A;  1VF7 A;  5FPR A;  3VQY A;  4DR4 B;  2ZNI A;  2OYQ A;  4LFB B;  1IBK B;  5FNV A;  4DV6 B;  3VQX A;  3HKE A;  4DV0 B;  4K8X A;  4DR2 B;  3RYC A;  4YY3 B;  3E22 A;  4I4T B;  4GKJ B;  3BHP A;  3K5L A;  4O2B A;  4NXN B;  2UXB B;  5CA1 A;  3K5N A;  3SR2 A;  1Q43 A;  1Q3E A;  4X66 B;  4DV4 B;  1WPB A;  5J2U B;  4UCU A;  4O4H A;  4DV3 B;  1IK9 A;  5KX5 A;  4IHJ A;  3JSN A;  5BMV B;  4X1Y A;  4DR7 B;  5JVD B;  4TV9 A;  4I55 A;  3MUD A;  4EEQ A;  3JSL A;  5ITZ B;  3ZS8 C;  3RYH B;  4JI8 B;  4X62 B;  1HNW B;  4I9Q A;  3JAT A;  3QG5 A;  1TAE A;  2UUA B;  4OX9 B;  1JFF B;  1M93 A;  3QTC A;  4GYC B;  5JCO A;  1IBL B;  5EZY B;  2PYJ A;  4FLY A;  4WBN B;  4CH4 A;  3UT5 A;  5K1P A;  1X4T A;  4FM1 A;  5LP6 C;  2BTQ A;  2UUB B;  4K8Z A;  2R72 A;  2F1M A;  1XNR B;  2QM4 A;  4FM0 A;  2HEP A;  4DV2 B;  3T1Y B;  4TV8 A;  5LYJ B;  4FFB B;  3JAR B;  4O4L A;  4JYA B;  4CS4 A;  5IJ9 A;  4EB6 A;  1JMK C;  2YI9 A;  3JAL A;  2P5O A;  4B08 A;  5LMU B;  2R9A A;  5LA6 B;  4FM2 A;  3OTO B;  3HKB B;  3U0Z A;  3VQW A;  5BR8 B;  3LNN A;  5EIB C;  4B3T B;  4UCT A;  4O4J B;  3QF7 A;  4D7S A;  2F93 B;  1N36 B;  2Q7G A;  5CHX A;  4HNA B;  3IAY A;  1TVK B;  5D5P A;  3K5M A;  4NXM B;  2EX3 A;  4CC6 A;  2VWK A;  2JVD A;  4AQY B;  5JH7 B;  3CSX A;  1FFX B;  5J2U A;  1O9H A;  4YJ2 B;  3JAK B;  3FFQ A;  4CH3 A;  4XA4 A;  4PI2 A;  2R70 A;  5KHK A;  1YEW A;  4FLV A;  5JVD A;  2E3C A;  3JAS B;  1L8D A;  4FLX A;  4X20 B;  5ITZ A;  3RYH A;  5LP6 B;  4TOI A;  2VQF B;  4UCO A;  1FU1 A;  1JFF A;  5KMG B;  5CJ0 A;  5EZY A;  4B3R B;  1KMI Z;  1NT2 B;  4WBN A;  4TUY B;  1RSO A;  3RGB A;  4JI3 B;  3UQ8 A;  2UUC B;  3SJA C;  1S5J A;  2UU9 B;  4FFB A;  3JAR A;  4X65 B;  2ZM6 B;  3BAA A;  4O4I B;  4JI7 B;  1Q5O A;  5C8Y B;  1DGS A;  3BAB A;  4CS3 A;  4B3S B;  1SA0 B;  3N2G B;  5LA6 A;  3CB2 A;  4U3J B;  2QJ1 A;  4UCV A;  2HHH B;  1XMO B;  3HKB A;  5JJJ B;  1P49 A;  1XHZ A;  4ZI7 B;  1IBM B;  4JI2 B;  2F95 B;  4X1K A;  1HNZ B;  1M4U A;  1Z5V A;  4D7T A;  4O4J A;  5IJ0 B;  4LNU B;  3N2K B;  4YJ3 B;  1XI1 A;  1QHT A;  5CB4 B;  4HNA A;  5EYP B;  3K58 A;  1TVK A;  3JAW B;  2IM9 A;  1TGO A;  4FLW A;  4X1I B;  2RQ6 A;  3VQV A;  2XHB A;  3SJC C;  1FFX A;  4YJ2 A;  3JAK A;  4ZOL B;  1SQG A;  1TUB B;  4JI5 B;  3BPZ A;  3JAS A;  4HBN A;  1HNX B;  3WB2 A;  4X20 A;  1TA8 A;  5LP6 A;  3K57 A;  5CA0 B;  5KHH A;  4LF9 B;  3WB1 A;  3B2E E;  3RWR D;  5KMG A;  3T1H B;  2Q7E A;  3RYI B;  4CS2 A;  3HKE B;  2YIA A;  4DR5 B;  4DV1 B;  4O2A B;  2JGU A;  3HKD B;  3E22 B;  2ZIN A;  3A2F A;  4TUY A;  4ZIB A;  5LOV B;  4DUZ B;  4LF7 B;  1B04 A;  2ZCE A;  2YIB D;  4GLX A;  4I50 B;  1ZAU A;  5CA1 B;  1WNS A;  1M5I A;  2JS5 A;  1FJG B;  3RYF B;  4I4T A;  1HW7 A;  4AIL C;  1T5E A;  3K59 A;  4O4H B;  4Q6G A;  4K0K B;  4O4I A;  4IHJ B;  4X64 B;  5C8Y A;  4X1Y B;  3OTF A;  4JI1 B;  3MAQ A;  5JQG B;  1QQC A;  4I55 B;  3M7M X;  2PZS A;  1SA0 A;  3N2G A;  4U3J A;  3JAT B;  5BMV A;  3PN1 A;  4IIJ B;  1I94 B;  3BA9 A;  5IJ0 A;  1Z5W A;  4LNU A;  4YHH B;  3UT5 B;  5D5Q A;  3N2K A;  4JI0 B;  4LF5 B;  4KL1 A;  4YJ3 A;  4EFB A;  2PGG A;  5LXT B;  5CB4 A;  4TQF A;  3JAW A;  4X1I A;  4LFC B;  1J5E B;  5FPO A;  3HKC B;  5IYZ B;  5JJE B;  1JJO A;  4DRX B;  4LH7 A;  4PHZ A;  3U11 A;  4EFE A;  4PI0 A;  3JAL B;  3II6 A;  1TUB A;  4F6R B;  5LYJ A;  4DV7 B;  4ZHQ B;  2P22 C;  2GV9 A;  2BTO A;  5LMN B;  4GKK B;  4JV5 B;  3THO A;  2CAZ C;  4FLZ A;  4DR1 B;  4KHP B;  5IWA B;  4LR3 A;  5CA0 A;  4UCR A;  5JJN B;  3SR2 C;  4FLU A;  1H2S B;  3RYI A;  4NVP A;  4CH6 A;  3CHX A;  4O2A A;  3HKD A;  1I7F A;  5LOV A;  3ICX A;  4LF4 B;  4JI4 B;  4I50 A;  5GON B;  3RYF A;  2VWJ A;  2UXC B;  4L8J A;  2V4D A;  5JCO C;  5J2T B;  2F4V B;  2ZNJ A;  5KHI A;  4DK1 A;  4FLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...