3RWRD

Crystal structure of the human xrcc4-xlf complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
227
structure length
227
Chain Sequence
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/protein binding
molecule keywords DNA repair protein XRCC4
publication title Structure of human XLF-XRCC4: assembly of a functional DNA repair complex
rcsb
source organism Homo sapiens
total genus 49
structure length 227
sequence length 227
chains with identical sequence E, H, I, L, M, O, Q, S, T, W, X
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rwrD02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 3rwrD01
1FU1A 2QM4A 1M5IA 1IK9A 5CJ0A 3SR2A 1KU9A 4XA4A 5CHXA 3II6A 3RWRA 5CJ4A 3MUDA 3RWRD 2R9AA 3SR2C
chains in the Genus database with same CATH superfamily
1WPXA 3RFRA 2Q9LA 1JX9A 5FPOA 5DN6G 4FM1A 5JH7A 1IVSA 1Y4MA 1G6UA 1R73A 4IGGA 3CCVV 2ZINA 1AILA 1E1RG 3ETQA 4FMTA 4K0KB 4PA7A 4I9QA 3BABA 1LUVA 1K73W 3E8BA 3L70H 4JI2O 4NXNO 1SESA 1JJOA 3LDEA 5LXTA 1I94B 5B5EZ 2EINC 4CKPA 3LSQA 2EJ7A 4UCOA 3K5NA 1FPOA 4MVMA 4D7TA 1QNMA 1FD9A 5B1NA 3K79A 3SJCC 3CRRA 5H6QA 2ZKOA 1K97A 3WFVA 4DR1O 1HDJA 3ZRSA 4WF9V 3JD1A 2WA3A 1NVPD 4JV5O 3ZRWA 2E74B 1LNQA 1GTOA 1SQQH 4PA3A 4CS2A 3BA8A 2IM9A 4Z1VA 4PI2A 3ZCCA 4CH5A 1N36O 4JI2B 4NXNB 4DUZO 4EFEA 4LP8A 2N74A 4GKKO 2X6AA 4LFBO 3B8MA 4H44B 1ROPA 1IBMB 2A9HA 3S3XA 3RGBA 2ADQB 1MNGA 4TWKA 4DR1B 1DK1A 1J95A 3SDLA 2CGOA 1JA8A 1HWYA 2NR5A 4JV5B 3WU2Z 3CSXA 4AQYO 1GO3F 5H9CA 2XOKG 3AK1A 1R1BA 1KMIZ 4GX2A 1Q8IA 2B5UA 3C3TA 2R9IA 2UUAB 1US6A 4PDRA 1N36B 3CRQA 1OJHA 1ZX3A 5BY1A 1HNZO 1R3LC 4LFCO 3AG1C 4XBFA 3UQ8A 2L6LA 4X88A 3UCSC 4DR2O 1JOYA 2RMKB 4LH6A 4LFBB 1QBZA 4PDVA 2V4DA 4YY3B 1FJGB 2ZIOA 1QLNA 3L75H 3CJHB 1KQSU 2PI4A 2CE4A 3CWBH 1M5IA 3VQYA 2R9RB 2X7RB 5B1AC 2DQ0A 3HKDB 1BHAA 2YC0A 3CRMA 1K9MW 4U3FH 2ETNA 5GTHZ 1YSCA 2PY5A 4AQYB 3CB2A 3ZMUA 2LFRA 4I0XB 4GFAA 2BOBC 1K3EA 2JDIG 2BSKB 2QTOA 1XBLA 2CAZC 2E3CA 2VWKA 2GSMB 2PGGA 1XNQO 1SA0B 1HNZB 1QQCA 4LFCB 1H8HG 1P4RA 4DR2B 3TGUH 1PM9A 3ZHRA 1VF6C 1VMGA 3AG4B 1AJNA 2NNUA 3ML0A 2JVDA 4B3TO 4R8CA 1CEZA 4MW3A 2OWOA 5LP6C 4PA6A 2LW1A 2KSDA 1QCEA 4PI0A 3ZHTA 3K58A 2ITDC 3JD2A 2LO1A 2EILC 2IH1C 3L74H 1NJIW 5LHIA 3R66A 2HVJC 4CS3A 1HNXO 3P30A 3K9SA 1GMGA 3D3IA 3H01A 4YJ3B 3ZHQA 3CS5A 2CH7B 3CJHA 2GBOA 1XNQB 3HKDA 1H2GA 3LSSA 1XMQO 3JATB 1BCCH 2HVKC 4B3TB 1Y76B 4TUYB 3WB2A 1KKDA 3A0BZ 3CCMV 4I0XA 3P32A 1QR8A 2BSKA 4N21A 1TUBB 4N23A 3DXRB 4J11A 5JWPA 5LGUA 1SA0A 4FM2A 3OUFA 1MMMA 3SYOA 5HFLA 4ASUG 2DE0X 3WB0A 2ZE6A 1RPRA 5L3BA 1F7YA 1JVMA 3AEIA 3S3WA 1YITV 2F4VO 4MS2A 1ZL8B 4BIZA 2Y4TA 3M8AA 3MUDA 1IX9A 2VQFO 2W0FC 3JD0A 2QR4A 2Q69A 1H8EG 4HZ3A 2KKWA 3R65A 4J41A 3K57A 1I5XA 1SZTA 2PYLA 1QLEC 3BHPA 1GH6A 1OCOC 4J7ZA 3RYHB 4DR6B 3CRCA 4YJ3A 4K3AA 2CUGA 2CH7A 2Q4PA 1M9NA 2H3OA 2EIMB 2QM8A 1IURA 3II6A 1ZTEA 1H38A 3JATA 2Y0IA 1Y76A 2ADPA 4TUYA 3ETEA 2B9ZA 1HP8A 2F4VB 1P84F 1HNWO 1GAXA 1TUBA 2EIMC 1V54B 3DXRA 1CP9A 1EN6A 1WN7A 1IK9A 4JI5O 4I9WA 1AR1B 1VQ8V 2ZE5A 2R70A 1EFRG 1IBLO 4MVUA 3I55V 3D3QA 5B1BB 1R6TA 4K8ZA 4GX5A 1S77D 4X65B 1XQ8A 1PV0A 1SQXH 2CTQA 2GDSA 1PNMA 4HYOA 3W7XA 1ZL8A 1IBKO 3OTFA 2JEXA 4FIPC 5DM6V 4FVMA 3SR2C 1HNWB 2UXXA 3GWOA 4JI6O 3SYAA 1NH2B 3RYFB 3RYHA 2JRIA 4DV1O 4JAAA 4JI5B 3SJQC 3IFXA 2ITCC 2ZCEA 4LF5O 1NTKH 2Z0AA 1GKFA 3HKBB 5KUKA 2VQEO 3MD0A 4TQFA 2ZE7A 3DC6A 2ARHA 3ZIAG 5H5NA 2X0LA 4J9ZB 2Y4UA 1OCRC 2A0LA 3DSQA 4B3RB 4JZGA 3HR0A 2CTWA 3E8GA 3H1JH 1IBKB 3LNNA 4OGQB 3ZRXA 1BHBA 4B7EA 1JMKC 3PJSK 5CN0A 1YZBA 1SERA 4PELA 1M4UA 1VQKV 4L8JA 1PL4A 4FM0A 1I7FA 2E76B 4JI6B 2P4KA 4EKWA 1FU1A 4DV1B 3O65A 2XAHA 5L3FA 3E86A 3T1HB 4LF5B 4ZI7B 2VQEB 2UXBO 2D3OW 5B3SC 4NB5A 2EBOA 5IWAO 5H6RA 1JR9A 1GM8A 2QDOA 2ZR3A 2FMLA 2IJIA 3A2FA 3VQXA 3VBBA 3RYFA 1NH2D 4BIUA 3HPLC 1EN4A 3G80A 3HKBA 5IYZB 1M93A 1YCIA 3H1KH 3OGIB 4CC6A 3CCJV 5E79Z 5CBHA 4DV6O 4X1KB 4DV3B 2EIJC 2ZXWC 5LGTA 4J7KA 1F51A 5CA1B 2UXBB 5BR8O 5IWAB 4QIWF 1RSOB 3TK1A 1K5SA 1N34B 4PV1B 1BQ0A 4KUMA 3FD9A 3G6EV 1Q43A 5CMUA 4LFAB 4OX9O 5K1XA 4O2AB 4ZI7A 1WAZA 2GUZB 5KHKA 1GN3A 4DUYO 4F6EA 1AB3A 3OMNB 4DYLA 5IT9N 4MVOA 2NN4A 1K92A 1AJQA 5EIBC 2YIDA 1F4NA 3IGAC 2A3QA 2K1EA 5BR8B 4B3MO 5IYDO 3OM3B 2WLIB 1SQBH 4RWUA 5FL7G 3H9VA 5IYZA 3AG7A 3QF7A 1NR7A 4X1KA 2R72A 3BAAA 5A9GA 1AI7A 4OX9B 3MHHC 1KD1W 5EYPB 5CA1A 5CA3A 4WCEV 5LMNB 2OYQA 4DUYB 1PD3A 3JCZA 1XDCA 2Y69B 1RSOA 3W7SA 1FXKB 3ASNB 4LWSB 4CH6A 4P9OA 5FNVB 2P90A 5KX5B 2OCHA 3JARB 4X20B 3UO3A 3A8TA 2DYSC 3FB7C 1JFFB 4B3MB 1KUQA 1QVFU 2WLNA 4O2AA 2DJVA 1RPOA 2GUZA 3ZMTA 1GN2A 1WP7A 2EIKC 1O9HA 3JD3A 4NYKA 1GM9A 1BGYH 2YI9A 4X66B 4Q20A 1AJPA 3BA9A 5JCOC 4EFBA 4DR7O 1ZLZA 3B40A 4OPHA 2ZDIA 2GV9A 2WLIA 4DK0A 2KB1A 4ZKIA 1BS3A 1PL0A 4TV8B 4CBCA 3N2GB 3JD4A 2UXCB 2WSSG 3SJBC 1UFIA 3FB5C 1COWG 3LDDA 1I94O 1NVPB 4J42A 1OCZC 1YTFB 2Q5ZA 5F2VO 3F5WC 1Q7YW 5EYPA 1J5EO 4LH7A 2DOSA 1N0JA 1H2LA 2IU3A 2JEUA 2NLJC 3C3SA 1FXKA 4FZ0A 4LWSA 5FNVA 5KX5A 4X20A 3JARA 1XL6A 4O4LB 3BY6A 1NQTA 1JFFA 2OT5A 4DR7B 3RN4A 3W7WA 4HNAB 2EINB 1JQ0A 3QNEA 5D5QA 4QE7A 1UJWB 1JCHA 3FAVB 1DF4A 2C2AA 3CC4V 1KYOF 5ITZB 2WLMA 3SPJA 1HR0O 1J5EB 1K4DC 4GYCB 4BWAA 3T1CA 4RAIA 3CCSV 1IBMO 1PNKA 2HJDA 3OGCC 5KLVH 2F43G 3OD4A 4FLXA 4TV8A 3N2GA 1B6QA 3RVYA 2Q0OC 3K0DA 3CE2A 3JYCA 1VQPV 5L3DA 3AG3C 1YTFD 4DRXB 1Y6XA 3L9DA 3Q0YA 4GZRB 1K7DA 1VQ4V 4DR4O 3L71H 5JJNB 1AR5A 3ASOC 4B3SB 2UUAO 2H94A 3J7AU 3FKSG 1TVKB 3OTOO 1VP7A 1HR0B 4O4LA 4TV9B 3CD6V 3ZMSA 5LGNA 4HNAA 2AZ0A 2GTSA 3OAAG 1D5NA 4YY3O 4X8AA 1FJGO 3FAVA 5JJEB 2M7WA 3CC2V 3K5MA 2CTPA 2DN9A 1P7GA 5ITZA 2YEVB 3K59A 1SF9A 2WPDG 3AG1B 3ZJZA 4W4KA 1L8DA 4DR4B 2A79B 3AK2A 4AHCA 4XA4A 4DV0O 5IYBO 1N0NA 1I5YA 2AHYA 4X1IB 2Y3WA 4LF8O 2ZNIA 3OTOB 1VARA 3OMIB 5EZYB 2OCCC 4JGSA 5JVDB 5B1AB 1QR9A 4GX0A 4G2KA 2L35A 2JS3A 2CDYA 2GTAA 2F23A 3RWRA 3RWRD 3CP1A 4DRXA 3OEHG 4IL6Z 4GFCA 2Y0PA 4HAMA 4B08A 2QKCA 2JJ2G 5DEDA 4J9YB 4JF3A 3T1YO 2XUMA 4JI8O 4FJCC 4JI0O 1TVKA 3H1LH 1S76D 1RP3B 4TV9A 3CCQV 3K03A 1V55C 4X1YB 3VQWA 2PZSA 2DQ3A 2QWQB 3SPCA 5LP6B 1XNRO 4DV0B 3ZN0A 4UCRA 4LF8B 2LJ2A 4I5SA 3K9AA 1P7BA 3MAQA 2YEVA 1YF2A 3MDSA 2EILB 3BFRA 3IAYA 1KC8W 4R7CA 2ZR2A 4L87A 1EZJA 5BZBA 3A0RA 3ABKC 4KL1A 3T1YB 4JI8B 4FFBB 3HKEB 4X1IA 5A2QN 2OIEA 2YICA 4JI0B 1SKVA 1Q6IA 5EZYA 5JVDA 1S3JA 2K9PA 2AW9A 2E75B 1Y67A 2MK3A 3KKYA 1XNRB 2EJRA 2BCCH 4DV7O 3RYCB 1GM7A 1QU7A 1AI5A 4LF9O 2Q7GA 1K4CC 3ZBHA 4QPKA 4IT5A 4X1YA 1VF6A 5KHGA 5LP6A 4B7KA 4DR6O 4I4TB 4X9QA 3FFQA 2FTKA 1OCCC 4PJ0Z 5IYCO 2OIGA 1UPGA 3ZMVA 5L3GA 1R3IC 3CEIA 4HBNA 2DYRC 4WFFA 4DW1A 1RM1B 3TCUA 4UV8A 5BXZA 3THOA 4DV7B 1QLEB 5LMUO 1M57B 1ENVA 3ABUA 1SC5B 1OCOB 3JASB 3PYIA 4FFBA 3HB3B 4I50B 3HKEA 4LF9B 1R6NA 2WLHA 3E8FA 1RM1C 1TUEB 5EC1C 3ZX6A 1M57C 2XASA 1MSWD 4X65O 1MOFA 2LFSA 1FXHA 3LNMB 5J2UB 3RYCA 3EXAA 3CCRV 1W2BU 3OE7G 1EN5A 2BOCC 2W0XA 2Q7HA 1SETA 4DR3B 3C90A 2XHBA 1M90W 2Q8VA 5LMUB 1X59A 2B1GA 4J80A 1FYJA 4H37A 4I4TA 2QWOB 3MHSC 2QA4V 2AXTZ 3E22B 3JALB 1LUWA 4TT3G 2H8PC 1OHHG 3FYEB 1VF5B 3OEEG 2IW5A 4J7JA 1K33A 1Q86W 4QNHB 1EZVH 2YI8A 2RQ6A 4B3RO 4D6TH 4H33A 2Q0AA 5DECA 3EHBB 3G67A 3JASA 4I50A 1N32B 4UFZA 4FZ1A 2B1IA 4MVZA 5K1PA 4IYIA 1I08A 5KUMA 3EFFK 3U10A 3EVKA 3OMAB 3RYIB 4A5UB 3KG2A 5KHIA 1Y74B 4JAVA 2JK5C 2VS0A 2BTQB 1OCRB 3E83A 3L73H 1M56C 3STLC 3KCXA 5J2UA 4MVSA 3T1HO 4YHHO 2Q68A 2KG7B 1OZ0A 4UXNA 4DXWA 4JI3B 3QO7A 1NU1H 2F1MA 3WG7C 2ILMA 1GN6A 3BRCA 1TA8A 2PTMA 3CXCU 4KXRA 1FFXB 3B09A 5TISZ 1M1KW 4BR6A 4NKGB 3TXQA 1ORQC 3ZRVA 1U97A 1VQ9V 4Q6GA 1E79G 2Y3VA 3E22A 3JALA 2ZIMA 1VIBA 1NTZH 1X4TA 3AG2B 1VF7A 3IC7A 1K8AW 4CH4A 4UVAA 5B3SB 3U0ZA 2HJFC 3FX7A 4IHJB 1RFYA 2VRZA 1Z2GA 4X62B 4DV3O 3SR2A 3Q4HB 5EBLC 1DF5A 2G38A 4YHHB 4D7SA 5L3EA 5C8YB 3AG2C 1S72V 3P3PA 2Q7EA 3BEHA 2AHZA 1N34O 2YXYA 1WPBA 4U7OA 1Y74A 5LOVB 1D2DA 2RNBA 4UV9A 2BTQA 2EIJB 4ZIBA 2UXNA 4LFAO 2ZXWB 5LHHA 5JJJB 4GEXA 1BSMA 2KG7A 1MABG 5KA5A 4NTYA 1KB9F 1XHZA 3SYPA 4G28B 2EX3A 3QTCA 4QE9A 1FFXA 3W7UA 3LSUA 4LNUB 1NKDA 1BE3H 2QKAA 3TXSA 5CJ4A 3X2QC 1GN4A 1N4CA 2PUSA 1YEWA 3PN1A 1D5AA 3CXHF 1N33B 2IBZH 3CCUV 1DLBA 1BQZA 1KU9A 4IHJA 2YXHA 1G8MA 4JYBA 4JI4O 3Q4HA 4RQEA 2D2CB 1XILA 1FAFA 2WAMA 2JGDB 2BTOA 5LMNO 1CPYA 5C8YA 4MVRA 5C93A 1NZ6A 5IE9A 3OUSA 4UCVA 1H2MA 5LOVA 3APQA 3F7YC 4C7UA 2QWRB 4RUFA 3ZN1A 3M7MX 5CA0B 3BCCH 4QJFB 1NBMG 2XAFA 1JPXA 1R3KC 4X66O 3G4SV 5GONB 4JI4B 1FXVA 3I5DA 4LNUA 5J9PC 2DYSB 5J2TB 4IYHA 1BZKA 4QGPA 4JYCA 1SQPH 4XDLA 3OFNG 2EIKB 2UXCO 3JAKB 1B3QA 1MA1A 4I7ZB 4K35A 1NT2B 2ZT9B 5EIBD 2OTJV 2JGDA 4H13B 2F95B 2RJZA 1VEWA 4MTFA 1ZWIC 5FLXN 1PP9H 5AG2A 2EZOA 2LW7A 3M99B 4UVBA 1PKXA 1AI4A 1B04A 5IJ0B 1DGSA 3B77A 1Q3EA 1OCZB 3RW0A 4JASA 2FYUH 1TGOA 5CA0A 1S5JA 3QO8A 1W59A 3E8HA 4JTAB 5GONA 2P5OA 3W7TA 4CZZA 2QJ1A 3JAWB 4CH3A 1WB7A 1YI2V 5CHXA 2LGWA 5J2TA 3ZS8C 2RDCA 1XOUA 4UCSA 4TOIA 4YXWG 1V9PA 1FS0G 4MTXA 4DO2A 3JAKA 5FPRA 1SQGA 5EC2C 1IDSA 3KZIZ 2DW4A 2UUCO 4PHZA 2A06H 4MT8A 2ZM6O 5JCOA 1KBHA 1R3JC 2FL4A 3L72H 3N27A 3ZMZA 3U11A 4B3SO 1KECA 4J10A 2CK3G 1E1QG 2YUAA 1XI1A 4WFEA 3ABMC 4WBNB 3UT5B 4YJ2B 1K34A 2Z5UA 3SPGA 5IJ0A 3QVNA 3AG3B 4FLZA 1S0VA 1CXZB 2JGUA 4RQFA 1F23A 1EBOA 1P49A 5B1OA 2F66C 3ASOB 2WA4A 2GHYA 1F4MA 4ZHQB 3A0HZ 2UUCB 1PNLA 3FB8C 2ZM6B 3JAWA 4ZOLB 1NTMH 2Z3YA 3TETA 2QKSA 5CJ0A 3F7VC 4JAUA 4GT1A 2ATKC 4DR5O 4GLXA 2HR3A 5KMGB 1R6KA 4Z2WA 3T4DA 4GCZA 1GRJA 4JPRA 1KP2A 4MTOA 4EEQA 4LF4O 1SS3A 2RN9A 2XNDG 2ZE8A 4P9PA 5IDJA 3D36C 4FPPA 4BAYA 4MW8A 4WBNA 3UT5A 4YJ2A 2IH3C 2OCCB 3K06A 3ZHSA 3CMEV 1Q6UA 2XT9A 1VQ6V 4FLWA 2WLKA 1THZA 5EK0A 3IC9A 3WB1A 1VQMV 2IJHA 1Q82W 4DR5B 2YXLA 3ABLB 1QVGU 1VQLV 4ZHQA 4OXSA 1JJ2U 3QG5A 2LGQA 4ZOLA 5CB4B 5CBGA 4PD4F 4DV5O 1V55B 4LF4B 1Z5WA 5E1AC 3ABLC 2QGNA 3SYCA 3ICXA 3OW2U 3SPIA 4DUZB 4X64O 4CC5A 5JQGB 1N8RW 4ICGA 4JTDB 5KMGA 3D36A 1H2NA 4GKKB 1YIJV 3HKCB 1YJ9V 3CCEV 3K08A 4ABMA 4PA4A 4JI7O 3LUTB 2HKOA 4UCUA 1IXMA 5IY5B 3ABKB 1FKAO 4LF6O 1BT8A 2R9AA 4P2ZA 4UB8Z 4WFGA 3APOA 3J81N 4DV5B 3H1IH 5IY5C 4P30A 2O57A 4X64B 3Q0XA 1ZAUA 2VWJA 4JYYA 4ZBMA 3I56V 3E2EA 4GEUA 3IJ4A 4X89A 2WLLB 1SQVH 5BMVB 5CB4A 2ZNJA 3K0GA 4JI7B 4FLUA 1L0NH 4LF6B 2P22C 3AG4C 4O4IB 5JQGA 4PA9A 1ZSPA 3DGEA 1OCCB 4QPJA 3OT7A 3HKCA 3VQVA 2EULA 4KHPO 2DYRB 3BPZA 1Z5VA 2HG5C 4GKJO 4DV4O 2YIAA 5EBWC 1MSDA 2YIBA 2YIBD 3FYIB 4R50A 2DMXA 3GVMA 1YJNV 3CYOA 4LBEC 3FB6C 3VOUA 2EZPA 3D8CA 4DR3O 3CC7V 3N2KB 4K8XA 1FFTB 1S5HC 3G6BA 3T2MA 2P67A 2IU0A 4MSWC 1B06A 4DK1A 3LDCA 3UO2A 4KHPB 2WLLA 2YSUB 4MVQA 1HNXB 5BMVA 2YDEA 1H2KA 1ZUQA 3SGIA 4FLYA 4GKJB 3ETDA 4R6ZA 4DV4B 5KAIZ 4WFHA 2F93B 1Q5OA 2DWEC 3QO5A 1XMQB 2ZQMA 1N32O 4O4IA 1WA8B 1YHQV 4GUNA 4IIJB 5D5PA 2W6JG 4WFBV 4H0LB 1SRYA 1I0HA 4NTXA 2PI5A 2P4VA 4DV2O 3CHXA 5KHJA 1XL4A 5KA6A 4JI3O 5LA6B 2ODMA 1G1XB 2X6CA 4G27B 3N2KA 3JSNA 4O2BB 2QWNB 2XAGA 5LL6Y 4W4LA 1AROP 4FLTA 2VQFB 1M56B 1YXBA 1W0JG 4LCUC 3ZEDA 1URFA 2FKXA 1SZXA 3WG7B 1WP8A 3DTUB 1V54C 4U7NA 3K04A 2PF4E 4X62O 1IZ3A 3NXSA 2RCVA 4DV2B 5B66Z 1XEQA 1WA8A 2W6IG 1AP5A 5B1BC 1Q6HA 2N05A 4BIOA 4KFMA 2MW2B 4IIJA 3DC5A 4XDKA 2IJKA 4O4HB 2Q6AA 4WFAV 3G71V 1BMFG 5H2FZ 2PYJA 2XAJA 2X6BA 1IBLB 4NTWA 4O4JB 1K5QA 3CRAA 2HEPA 5LA6A 4JYAO 4O2BA 1VQOV 1MG1A 5CBFA 2UUBO 2OTLV 4AILC 5GW7A 2P6JA 4YIOA 1WB8A 3K3WA 3GB7C 2JJ1G 1PPJH 1W0KG 3RYIA 1N33O 2KQXA 3KCYA 3P3NA 4Z1MG 2QM7A 5GTIZ 2JIZG 3J80N 1AR4A 2E5LO 4LC1A 4U3JB 5KHHA 4E2LA 1OV9A 3OR6C 3JSLA 1Y66A 3B4SA 1NI8A 3X2QB 1WNSA 4JYAB 3F5TA 2ZD9A 1Q81W 4RO2A 1KKCA 5IJ9B 4XDJA 4UCTA 4EB6B 1AI6A 1MZEA 4E4EA 2UUBB 1NR1A 1VQNV 4O4HA 3ETGA 1U96A 2IJJA 4GX1A 2CTRA 4G79A 1SQFA 3GWKC 4F4LA 4O4JA 3H1HH 1TAEA 2Q67A 4BW9A 4NR1A 5LHGA 4JI1O 4KP4A 3RT3C 4PDMA 3STZC 2E5LB 3UKMA 2QTSA 2A7WA 1HW7A 2AGAA 2AZ2A 4NVPA 1MZFA 2WWWA 3K5OA 1WLEA 1XHXA 3B2EE 4UB6Z 1AVMA 4DW0A 1IXBA 2LP7A 2QWPB 2XAQA 1L1FA 2M6YA 1DTOA 1S5LZ 1QHTA 2CGNA 4FK5C 4TQDA 2WLJA 1WJZA 4U3JA 5LBQA 1H2SB 2P06A 2HP8A 4PDLA 2DWDC 4F6RB 4DV6B 1NS1A 2HHHO 1GK9A 4I55B 4LF7O 4BW5A 4JI1B 5IJ9A 4EB6A 3CCLV 4JTCB 5LYJB 3SPHA 1YJWV 2HFEC 1G4YB 3RBZA 1YVWA 1XMOO 3JAMN 1A32A 3SYQA 1O9GA 2LQTA 2ZDIC 2UXDO 4CKNA 1L0LH 3BVOA 1VQ5V 3T4ZA 4FLVA 2XTAA 3RVZA 3CMAV 2HHHB 2YS8A 3E35A 4UUJC 4LF7B 4NXMO 4FFKA 2FB5A 1T5EA 2V1DA 3TJTA 1LR1A 2QE7G 3CX5F 5JH7B 1Q90D 4YIPA 1BL8A 2BE3A 4LR3A 1EM1A 2UU9O 2Y69C 2N04A 4AI8A 1XMOB 1FXKC 2Q73A 2QM4A 3ASNC 2P7TC 4MTGA 3B8NA 4F6RA 1AP6A 1VQ7V 4CS4A 4I55A 4CKMA 5LXTB 2V7QG 3ABTA 3UM7A 2UXDB 5LYJA 2HLDG 2QEXV 4OPAA 3CPWU 3O9OA 4TSFG 4UVCA 3ZHVA 3JCUZ 4K0KO 2QSAA 3AK3A 1XREA 3OR7C 1XUQA 1YDXA 4NXMB 1KP3A 5L3CA 5EBMC 4JZ2A 2JS5A 3SJAC 3K5LA 2Y48A 3E89A 5HFMA 5KAFZ 3ZRWB 3ABMB 3ZHUA 2UU9B 3NR7A 4RUEA
chains in the Genus database with same CATH topology
3RFRA 5IWAB 3E22B 3JALB 1N34B 2R9AA 5FPOA 4FM1A 5JH7A 4DV5B 2YI8A 2RQ6A 1G6UA 1Q43A 4LFAB 5K1XA 2Q0AA 2ZINA 4O2AB 3ETQA 4ZI7A 4K0KB 3JASA 4I50A 5KHKA 1N32B 4UFZA 4X64B 5K1PA 4I9QA 3BABA 3U10A 1ZAUA 2VWJA 3RYIB 1JJOA 5LXTA 1I94B 5EIBC 5KHIA 5BMVB 5CB4A 2ZNJA 2BTQB 5BR8B 4JI7B 4FLUA 4UCOA 5J2UA 3K5NA 4LF6B 4D7TA 2P22C 4JI3B 5IYZA 4O4IB 5JQGA 3QF7A 3SJCC 2F1MA 3BRCA 4X1KA 1TA8A 2R72A 3HKCA 3BAAA 3VQVA 2PTMA 4OX9B 1FFXB 3BPZA 1Z5VA 5EYPB 5CA1A 2OYQA 5LMNB 4CS2A 3BA8A 4DUYB 2IM9A 2YIAA 4Q6GA 3E22A 4PI2A 2YIBA 4CH5A 1RSOA 3JALA 2YIBD 2ZIMA 4JI2B 4NXNB 1X4TA 1VF7A 4CH6A 4EFEA 4CH4A 3U0ZA 5FNVB 5KX5B 4X20B 3JARB 4IHJB 1JFFB 3N2KB 4K8XA 4X62B 4B3MB 1IBMB 3SR2A 4O2AA 4YHHB 3RGBA 4D7SA 5C8YB 4DK1A 2Q7EA 4DR1B 1O9HA 2YI9A 4KHPB 4X66B 1WPBA 4JV5B 3CSXA 1HNXB 3BA9A 5LOVB 5BMVA 5JCOC 4EFBA 2BTQA 4ZIBA 3SGIA 4FLYA 1KMIZ 4GKJB 4DV4B 1Q8IA 2GV9A 5JJJB 4DK0A 2UUAB 2F93B 1Q5OA 1N36B 1XMQB 4O4IA 4TV8B 3N2GB 1XHZA 2UXCB 3UQ8A 3SJBC 2EX3A 4LH6A 3QTCA 4IIJB 5D5PA 4LFBB 1FFXA 4LNUB 2V4DA 5EYPA 4YY3B 4LH7A 1FJGB 2ZIOA 5CJ4A 1M5IA 3CHXA 2PUSA 3VQYA 5KHJA 1YEWA 3PN1A 1D5AA 3HKDB 1N33B 5LA6B 5FNVA 5KX5A 4X20A 3JARA 1KU9A 4O4LB 2PY5A 4IHJA 1JFFA 3N2KA 3CB2A 3JSNA 4AQYB 4DR7B 4O2BB 4HNAB 5D5QA 4FLTA 2CAZC 2BTOA 2E3CA 2VQFB 2VWKA 5C8YA 2PGGA 1SA0B 1HNZB 1QQCA 4LFCB 3ZEDA 4DR2B 5ITZB 4UCVA 2JVDA 5LOVA 2OWOA 5LP6C 1J5EB 4GYCB 4BWAA 4PI0A 3K58A 4DV2B 3M7MX 4FLXA 4TV8A 5CA0B 3N2GA 4IIJA 5GONB 4JI4B 4LNUA 4CS3A 4DRXB 4O4HB 4YJ3B 5J2TB 2PYJA 1XNQB 5JJNB 1IBLB 4B3SB 4O4JB 3HKDA 3JATB 5LA6A 2HEPA 1TVKB 1HR0B 3JAKB 4O4LA 4B3TB 4TV9B 4TUYB 3WB2A 1NT2B 4O2BA 4HNAA 5EIBD 1TUBB 4AILC 5JJEB 2F95B 2RJZA 1SA0A 3K5MA 4FM2A 3RYIA 5ITZA 3K59A 3WB0A 1B04A 5IJ0B 1DGSA 1L8DA 1Q3EA 4DR4B 4AHCA 4XA4A 4U3JB 5KHHA 3MUDA 1TGOA 3JSLA 5CA0A 4X1IB 1S5JA 2ZNIA 3OTOB 5EZYB 2KKWA 5JVDB 1WNSA 4JYAB 3K57A 5IJ9B 3RWRA 4UCTA 4EB6B 5GONA 3RWRD 2PYLA 2P5OA 4DRXA 3BHPA 2UUBB 2QJ1A 4O4HA 3JAWB 3RYHB 4CH3A 4DR6B 4YJ3A 5CHXA 5J2TA 4B08A 3ZS8C 1SQFA 4UCSA 4O4JA 4TOIA 3II6A 1V9PA 1TAEA 3JATA 1TVKA 4BW9A 3JAKA 4TV9A 5FPRA 4TUYA 1SQGA 4X1YB 3VQWA 2PZSA 4PHZA 2F4VB 5JCOA 2E5LB 1TUBA 5LP6B 4DV0B 1WN7A 1IK9A 1HW7A 4UCRA 4NVPA 4LF8B 2R70A 3U11A 3K5OA 3MAQA 1XHXA 3B2EE 1XI1A 4K8ZA 4WBNB 3UT5B 4YJ2B 3IAYA 4X65B 1XQ8A 5IJ0A 1QHTA 4FLZA 4TQDA 4U3JA 4KL1A 1H2SB 3T1YB 2JGUA 3OTFA 4JI8B 4FFBB 3HKEB 4X1IA 1P49A 4JI0B 2F66C 4F6RB 1SKVA 4DV6B 5EZYA 4ZHQB 5JVDA 4I55B 2UUCB 4JI1B 5IJ9A 4FVMA 4EB6A 3SR2C 1HNWB 5LYJB 2ZM6B 3JAWA 4ZOLB 3RYHA 3RYFB 1XNRB 4JI5B 3RYCB 2ZCEA 5CJ0A 3HKBB 4TQFA 2Q7GA 4GLXA 5KMGB 1O9GA 4X1YA 4B3RB 3DSQA 5KHGA 4EEQA 5LP6A 1IBKB 3LNNA 4FLVA 4I4TB 3FFQA 1JMKC 2HHHB 1M4UA 4HBNA 4L8JA 4LF7B 4FM0A 1T5EA 4WBNA 1I7FA 3UT5A 4JI6B 4YJ2A 5JH7B 3THOA 1FU1A 4DV1B 4FLWA 4DV7B 4LR3A 3T1HB 4LF5B 4ZI7B 2VQEB 1XMOB 3JASB 2QM4A 3WB1A 4FFBA 4I50B 3HKEA 4LF9B 4DR5B 2YXLA 4F6RA 4CS4A 4ZHQA 4I55A 5LXTB 3QG5A 3A2FA 3VQXA 2UXDB 5LYJA 5CB4B 4ZOLA 3RYFA 4LF4B 1Z5WA 3RYCA 5J2UB 3HKBA 3ICXA 5IYZB 1M93A 4DUZB 4CC5A 5JQGB 4NXMB 4CC6A 2Q7HA 4DR3B 5KMGA 4GKKB 4X1KB 2XHBA 2JS5A 3HKCB 3SJAC 3K5LA 4DV3B 5LMUB 5CA1B 2UU9B 2UXBB 4I4TA 4UCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FU1 A;  2QM4 A;  1M5I A;  1IK9 A;  5CJ0 A;  3SR2 A;  1KU9 A;  4XA4 A;  5CHX A;  3II6 A;  3RWR A;  5CJ4 A;  3MUD A;  3RWR D;  2R9A A;  3SR2 C; 
#chains in the Genus database with same CATH topology
 1WPX A;  3RFR A;  2Q9L A;  1JX9 A;  5FPO A;  5DN6 G;  4FM1 A;  5JH7 A;  1IVS A;  1Y4M A;  1G6U A;  1R73 A;  4IGG A;  3CCV V;  2ZIN A;  1AIL A;  1E1R G;  3ETQ A;  4FMT A;  4K0K B;  4PA7 A;  4I9Q A;  3BAB A;  1LUV A;  1K73 W;  3E8B A;  3L70 H;  4JI2 O;  4NXN O;  1SES A;  1JJO A;  3LDE A;  5LXT A;  1I94 B;  5B5E Z;  2EIN C;  4CKP A;  3LSQ A;  2EJ7 A;  4UCO A;  3K5N A;  1FPO A;  4MVM A;  4D7T A;  1QNM A;  1FD9 A;  5B1N A;  3K79 A;  3SJC C;  3CRR A;  5H6Q A;  2ZKO A;  1K97 A;  3WFV A;  4DR1 O;  1HDJ A;  3ZRS A;  4WF9 V;  3JD1 A;  2WA3 A;  1NVP D;  4JV5 O;  3ZRW A;  2E74 B;  1LNQ A;  1GTO A;  1SQQ H;  4PA3 A;  4CS2 A;  3BA8 A;  2IM9 A;  4Z1V A;  4PI2 A;  3ZCC A;  4CH5 A;  1N36 O;  4JI2 B;  4NXN B;  4DUZ O;  4EFE A;  4LP8 A;  2N74 A;  4GKK O;  2X6A A;  4LFB O;  3B8M A;  4H44 B;  1ROP A;  1IBM B;  2A9H A;  3S3X A;  3RGB A;  2ADQ B;  1MNG A;  4TWK A;  4DR1 B;  1DK1 A;  1J95 A;  3SDL A;  2CGO A;  1JA8 A;  1HWY A;  2NR5 A;  4JV5 B;  3WU2 Z;  3CSX A;  4AQY O;  1GO3 F;  5H9C A;  2XOK G;  3AK1 A;  1R1B A;  1KMI Z;  4GX2 A;  1Q8I A;  2B5U A;  3C3T A;  2R9I A;  2UUA B;  1US6 A;  4PDR A;  1N36 B;  3CRQ A;  1OJH A;  1ZX3 A;  5BY1 A;  1HNZ O;  1R3L C;  4LFC O;  3AG1 C;  4XBF A;  3UQ8 A;  2L6L A;  4X88 A;  3UCS C;  4DR2 O;  1JOY A;  2RMK B;  4LH6 A;  4LFB B;  1QBZ A;  4PDV A;  2V4D A;  4YY3 B;  1FJG B;  2ZIO A;  1QLN A;  3L75 H;  3CJH B;  1KQS U;  2PI4 A;  2CE4 A;  3CWB H;  1M5I A;  3VQY A;  2R9R B;  2X7R B;  5B1A C;  2DQ0 A;  3HKD B;  1BHA A;  2YC0 A;  3CRM A;  1K9M W;  4U3F H;  2ETN A;  5GTH Z;  1YSC A;  2PY5 A;  4AQY B;  3CB2 A;  3ZMU A;  2LFR A;  4I0X B;  4GFA A;  2BOB C;  1K3E A;  2JDI G;  2BSK B;  2QTO A;  1XBL A;  2CAZ C;  2E3C A;  2VWK A;  2GSM B;  2PGG A;  1XNQ O;  1SA0 B;  1HNZ B;  1QQC A;  4LFC B;  1H8H G;  1P4R A;  4DR2 B;  3TGU H;  1PM9 A;  3ZHR A;  1VF6 C;  1VMG A;  3AG4 B;  1AJN A;  2NNU A;  3ML0 A;  2JVD A;  4B3T O;  4R8C A;  1CEZ A;  4MW3 A;  2OWO A;  5LP6 C;  4PA6 A;  2LW1 A;  2KSD A;  1QCE A;  4PI0 A;  3ZHT A;  3K58 A;  2ITD C;  3JD2 A;  2LO1 A;  2EIL C;  2IH1 C;  3L74 H;  1NJI W;  5LHI A;  3R66 A;  2HVJ C;  4CS3 A;  1HNX O;  3P30 A;  3K9S A;  1GMG A;  3D3I A;  3H01 A;  4YJ3 B;  3ZHQ A;  3CS5 A;  2CH7 B;  3CJH A;  2GBO A;  1XNQ B;  3HKD A;  1H2G A;  3LSS A;  1XMQ O;  3JAT B;  1BCC H;  2HVK C;  4B3T B;  1Y76 B;  4TUY B;  3WB2 A;  1KKD A;  3A0B Z;  3CCM V;  4I0X A;  3P32 A;  1QR8 A;  2BSK A;  4N21 A;  1TUB B;  4N23 A;  3DXR B;  4J11 A;  5JWP A;  5LGU A;  1SA0 A;  4FM2 A;  3OUF A;  1MMM A;  3SYO A;  5HFL A;  4ASU G;  2DE0 X;  3WB0 A;  2ZE6 A;  1RPR A;  5L3B A;  1F7Y A;  1JVM A;  3AEI A;  3S3W A;  1YIT V;  2F4V O;  4MS2 A;  1ZL8 B;  4BIZ A;  2Y4T A;  3M8A A;  3MUD A;  1IX9 A;  2VQF O;  2W0F C;  3JD0 A;  2QR4 A;  2Q69 A;  1H8E G;  4HZ3 A;  2KKW A;  3R65 A;  4J41 A;  3K57 A;  1I5X A;  1SZT A;  2PYL A;  1QLE C;  3BHP A;  1GH6 A;  1OCO C;  4J7Z A;  3RYH B;  4DR6 B;  3CRC A;  4YJ3 A;  4K3A A;  2CUG A;  2CH7 A;  2Q4P A;  1M9N A;  2H3O A;  2EIM B;  2QM8 A;  1IUR A;  3II6 A;  1ZTE A;  1H38 A;  3JAT A;  2Y0I A;  1Y76 A;  2ADP A;  4TUY A;  3ETE A;  2B9Z A;  1HP8 A;  2F4V B;  1P84 F;  1HNW O;  1GAX A;  1TUB A;  2EIM C;  1V54 B;  3DXR A;  1CP9 A;  1EN6 A;  1WN7 A;  1IK9 A;  4JI5 O;  4I9W A;  1AR1 B;  1VQ8 V;  2ZE5 A;  2R70 A;  1EFR G;  1IBL O;  4MVU A;  3I55 V;  3D3Q A;  5B1B B;  1R6T A;  4K8Z A;  4GX5 A;  1S77 D;  4X65 B;  1XQ8 A;  1PV0 A;  1SQX H;  2CTQ A;  2GDS A;  1PNM A;  4HYO A;  3W7X A;  1ZL8 A;  1IBK O;  3OTF A;  2JEX A;  4FIP C;  5DM6 V;  4FVM A;  3SR2 C;  1HNW B;  2UXX A;  3GWO A;  4JI6 O;  3SYA A;  1NH2 B;  3RYF B;  3RYH A;  2JRI A;  4DV1 O;  4JAA A;  4JI5 B;  3SJQ C;  3IFX A;  2ITC C;  2ZCE A;  4LF5 O;  1NTK H;  2Z0A A;  1GKF A;  3HKB B;  5KUK A;  2VQE O;  3MD0 A;  4TQF A;  2ZE7 A;  3DC6 A;  2ARH A;  3ZIA G;  5H5N A;  2X0L A;  4J9Z B;  2Y4U A;  1OCR C;  2A0L A;  3DSQ A;  4B3R B;  4JZG A;  3HR0 A;  2CTW A;  3E8G A;  3H1J H;  1IBK B;  3LNN A;  4OGQ B;  3ZRX A;  1BHB A;  4B7E A;  1JMK C;  3PJS K;  5CN0 A;  1YZB A;  1SER A;  4PEL A;  1M4U A;  1VQK V;  4L8J A;  1PL4 A;  4FM0 A;  1I7F A;  2E76 B;  4JI6 B;  2P4K A;  4EKW A;  1FU1 A;  4DV1 B;  3O65 A;  2XAH A;  5L3F A;  3E86 A;  3T1H B;  4LF5 B;  4ZI7 B;  2VQE B;  2UXB O;  2D3O W;  5B3S C;  4NB5 A;  2EBO A;  5IWA O;  5H6R A;  1JR9 A;  1GM8 A;  2QDO A;  2ZR3 A;  2FML A;  2IJI A;  3A2F A;  3VQX A;  3VBB A;  3RYF A;  1NH2 D;  4BIU A;  3HPL C;  1EN4 A;  3G80 A;  3HKB A;  5IYZ B;  1M93 A;  1YCI A;  3H1K H;  3OGI B;  4CC6 A;  3CCJ V;  5E79 Z;  5CBH A;  4DV6 O;  4X1K B;  4DV3 B;  2EIJ C;  2ZXW C;  5LGT A;  4J7K A;  1F51 A;  5CA1 B;  2UXB B;  5BR8 O;  5IWA B;  4QIW F;  1RSO B;  3TK1 A;  1K5S A;  1N34 B;  4PV1 B;  1BQ0 A;  4KUM A;  3FD9 A;  3G6E V;  1Q43 A;  5CMU A;  4LFA B;  4OX9 O;  5K1X A;  4O2A B;  4ZI7 A;  1WAZ A;  2GUZ B;  5KHK A;  1GN3 A;  4DUY O;  4F6E A;  1AB3 A;  3OMN B;  4DYL A;  5IT9 N;  4MVO A;  2NN4 A;  1K92 A;  1AJQ A;  5EIB C;  2YID A;  1F4N A;  3IGA C;  2A3Q A;  2K1E A;  5BR8 B;  4B3M O;  5IYD O;  3OM3 B;  2WLI B;  1SQB H;  4RWU A;  5FL7 G;  3H9V A;  5IYZ A;  3AG7 A;  3QF7 A;  1NR7 A;  4X1K A;  2R72 A;  3BAA A;  5A9G A;  1AI7 A;  4OX9 B;  3MHH C;  1KD1 W;  5EYP B;  5CA1 A;  5CA3 A;  4WCE V;  5LMN B;  2OYQ A;  4DUY B;  1PD3 A;  3JCZ A;  1XDC A;  2Y69 B;  1RSO A;  3W7S A;  1FXK B;  3ASN B;  4LWS B;  4CH6 A;  4P9O A;  5FNV B;  2P90 A;  5KX5 B;  2OCH A;  3JAR B;  4X20 B;  3UO3 A;  3A8T A;  2DYS C;  3FB7 C;  1JFF B;  4B3M B;  1KUQ A;  1QVF U;  2WLN A;  4O2A A;  2DJV A;  1RPO A;  2GUZ A;  3ZMT A;  1GN2 A;  1WP7 A;  2EIK C;  1O9H A;  3JD3 A;  4NYK A;  1GM9 A;  1BGY H;  2YI9 A;  4X66 B;  4Q20 A;  1AJP A;  3BA9 A;  5JCO C;  4EFB A;  4DR7 O;  1ZLZ A;  3B40 A;  4OPH A;  2ZDI A;  2GV9 A;  2WLI A;  4DK0 A;  2KB1 A;  4ZKI A;  1BS3 A;  1PL0 A;  4TV8 B;  4CBC A;  3N2G B;  3JD4 A;  2UXC B;  2WSS G;  3SJB C;  1UFI A;  3FB5 C;  1COW G;  3LDD A;  1I94 O;  1NVP B;  4J42 A;  1OCZ C;  1YTF B;  2Q5Z A;  5F2V O;  3F5W C;  1Q7Y W;  5EYP A;  1J5E O;  4LH7 A;  2DOS A;  1N0J A;  1H2L A;  2IU3 A;  2JEU A;  2NLJ C;  3C3S A;  1FXK A;  4FZ0 A;  4LWS A;  5FNV A;  5KX5 A;  4X20 A;  3JAR A;  1XL6 A;  4O4L B;  3BY6 A;  1NQT A;  1JFF A;  2OT5 A;  4DR7 B;  3RN4 A;  3W7W A;  4HNA B;  2EIN B;  1JQ0 A;  3QNE A;  5D5Q A;  4QE7 A;  1UJW B;  1JCH A;  3FAV B;  1DF4 A;  2C2A A;  3CC4 V;  1KYO F;  5ITZ B;  2WLM A;  3SPJ A;  1HR0 O;  1J5E B;  1K4D C;  4GYC B;  4BWA A;  3T1C A;  4RAI A;  3CCS V;  1IBM O;  1PNK A;  2HJD A;  3OGC C;  5KLV H;  2F43 G;  3OD4 A;  4FLX A;  4TV8 A;  3N2G A;  1B6Q A;  3RVY A;  2Q0O C;  3K0D A;  3CE2 A;  3JYC A;  1VQP V;  5L3D A;  3AG3 C;  1YTF D;  4DRX B;  1Y6X A;  3L9D A;  3Q0Y A;  4GZR B;  1K7D A;  1VQ4 V;  4DR4 O;  3L71 H;  5JJN B;  1AR5 A;  3ASO C;  4B3S B;  2UUA O;  2H94 A;  3J7A U;  3FKS G;  1TVK B;  3OTO O;  1VP7 A;  1HR0 B;  4O4L A;  4TV9 B;  3CD6 V;  3ZMS A;  5LGN A;  4HNA A;  2AZ0 A;  2GTS A;  3OAA G;  1D5N A;  4YY3 O;  4X8A A;  1FJG O;  3FAV A;  5JJE B;  2M7W A;  3CC2 V;  3K5M A;  2CTP A;  2DN9 A;  1P7G A;  5ITZ A;  2YEV B;  3K59 A;  1SF9 A;  2WPD G;  3AG1 B;  3ZJZ A;  4W4K A;  1L8D A;  4DR4 B;  2A79 B;  3AK2 A;  4AHC A;  4XA4 A;  4DV0 O;  5IYB O;  1N0N A;  1I5Y A;  2AHY A;  4X1I B;  2Y3W A;  4LF8 O;  2ZNI A;  3OTO B;  1VAR A;  3OMI B;  5EZY B;  2OCC C;  4JGS A;  5JVD B;  5B1A B;  1QR9 A;  4GX0 A;  4G2K A;  2L35 A;  2JS3 A;  2CDY A;  2GTA A;  2F23 A;  3RWR A;  3RWR D;  3CP1 A;  4DRX A;  3OEH G;  4IL6 Z;  4GFC A;  2Y0P A;  4HAM A;  4B08 A;  2QKC A;  2JJ2 G;  5DED A;  4J9Y B;  4JF3 A;  3T1Y O;  2XUM A;  4JI8 O;  4FJC C;  4JI0 O;  1TVK A;  3H1L H;  1S76 D;  1RP3 B;  4TV9 A;  3CCQ V;  3K03 A;  1V55 C;  4X1Y B;  3VQW A;  2PZS A;  2DQ3 A;  2QWQ B;  3SPC A;  5LP6 B;  1XNR O;  4DV0 B;  3ZN0 A;  4UCR A;  4LF8 B;  2LJ2 A;  4I5S A;  3K9A A;  1P7B A;  3MAQ A;  2YEV A;  1YF2 A;  3MDS A;  2EIL B;  3BFR A;  3IAY A;  1KC8 W;  4R7C A;  2ZR2 A;  4L87 A;  1EZJ A;  5BZB A;  3A0R A;  3ABK C;  4KL1 A;  3T1Y B;  4JI8 B;  4FFB B;  3HKE B;  4X1I A;  5A2Q N;  2OIE A;  2YIC A;  4JI0 B;  1SKV A;  1Q6I A;  5EZY A;  5JVD A;  1S3J A;  2K9P A;  2AW9 A;  2E75 B;  1Y67 A;  2MK3 A;  3KKY A;  1XNR B;  2EJR A;  2BCC H;  4DV7 O;  3RYC B;  1GM7 A;  1QU7 A;  1AI5 A;  4LF9 O;  2Q7G A;  1K4C C;  3ZBH A;  4QPK A;  4IT5 A;  4X1Y A;  1VF6 A;  5KHG A;  5LP6 A;  4B7K A;  4DR6 O;  4I4T B;  4X9Q A;  3FFQ A;  2FTK A;  1OCC C;  4PJ0 Z;  5IYC O;  2OIG A;  1UPG A;  3ZMV A;  5L3G A;  1R3I C;  3CEI A;  4HBN A;  2DYR C;  4WFF A;  4DW1 A;  1RM1 B;  3TCU A;  4UV8 A;  5BXZ A;  3THO A;  4DV7 B;  1QLE B;  5LMU O;  1M57 B;  1ENV A;  3ABU A;  1SC5 B;  1OCO B;  3JAS B;  3PYI A;  4FFB A;  3HB3 B;  4I50 B;  3HKE A;  4LF9 B;  1R6N A;  2WLH A;  3E8F A;  1RM1 C;  1TUE B;  5EC1 C;  3ZX6 A;  1M57 C;  2XAS A;  1MSW D;  4X65 O;  1MOF A;  2LFS A;  1FXH A;  3LNM B;  5J2U B;  3RYC A;  3EXA A;  3CCR V;  1W2B U;  3OE7 G;  1EN5 A;  2BOC C;  2W0X A;  2Q7H A;  1SET A;  4DR3 B;  3C90 A;  2XHB A;  1M90 W;  2Q8V A;  5LMU B;  1X59 A;  2B1G A;  4J80 A;  1FYJ A;  4H37 A;  4I4T A;  2QWO B;  3MHS C;  2QA4 V;  2AXT Z;  3E22 B;  3JAL B;  1LUW A;  4TT3 G;  2H8P C;  1OHH G;  3FYE B;  1VF5 B;  3OEE G;  2IW5 A;  4J7J A;  1K33 A;  1Q86 W;  4QNH B;  1EZV H;  2YI8 A;  2RQ6 A;  4B3R O;  4D6T H;  4H33 A;  2Q0A A;  5DEC A;  3EHB B;  3G67 A;  3JAS A;  4I50 A;  1N32 B;  4UFZ A;  4FZ1 A;  2B1I A;  4MVZ A;  5K1P A;  4IYI A;  1I08 A;  5KUM A;  3EFF K;  3U10 A;  3EVK A;  3OMA B;  3RYI B;  4A5U B;  3KG2 A;  5KHI A;  1Y74 B;  4JAV A;  2JK5 C;  2VS0 A;  2BTQ B;  1OCR B;  3E83 A;  3L73 H;  1M56 C;  3STL C;  3KCX A;  5J2U A;  4MVS A;  3T1H O;  4YHH O;  2Q68 A;  2KG7 B;  1OZ0 A;  4UXN A;  4DXW A;  4JI3 B;  3QO7 A;  1NU1 H;  2F1M A;  3WG7 C;  2ILM A;  1GN6 A;  3BRC A;  1TA8 A;  2PTM A;  3CXC U;  4KXR A;  1FFX B;  3B09 A;  5TIS Z;  1M1K W;  4BR6 A;  4NKG B;  3TXQ A;  1ORQ C;  3ZRV A;  1U97 A;  1VQ9 V;  4Q6G A;  1E79 G;  2Y3V A;  3E22 A;  3JAL A;  2ZIM A;  1VIB A;  1NTZ H;  1X4T A;  3AG2 B;  1VF7 A;  3IC7 A;  1K8A W;  4CH4 A;  4UVA A;  5B3S B;  3U0Z A;  2HJF C;  3FX7 A;  4IHJ B;  1RFY A;  2VRZ A;  1Z2G A;  4X62 B;  4DV3 O;  3SR2 A;  3Q4H B;  5EBL C;  1DF5 A;  2G38 A;  4YHH B;  4D7S A;  5L3E A;  5C8Y B;  3AG2 C;  1S72 V;  3P3P A;  2Q7E A;  3BEH A;  2AHZ A;  1N34 O;  2YXY A;  1WPB A;  4U7O A;  1Y74 A;  5LOV B;  1D2D A;  2RNB A;  4UV9 A;  2BTQ A;  2EIJ B;  4ZIB A;  2UXN A;  4LFA O;  2ZXW B;  5LHH A;  5JJJ B;  4GEX A;  1BSM A;  2KG7 A;  1MAB G;  5KA5 A;  4NTY A;  1KB9 F;  1XHZ A;  3SYP A;  4G28 B;  2EX3 A;  3QTC A;  4QE9 A;  1FFX A;  3W7U A;  3LSU A;  4LNU B;  1NKD A;  1BE3 H;  2QKA A;  3TXS A;  5CJ4 A;  3X2Q C;  1GN4 A;  1N4C A;  2PUS A;  1YEW A;  3PN1 A;  1D5A A;  3CXH F;  1N33 B;  2IBZ H;  3CCU V;  1DLB A;  1BQZ A;  1KU9 A;  4IHJ A;  2YXH A;  1G8M A;  4JYB A;  4JI4 O;  3Q4H A;  4RQE A;  2D2C B;  1XIL A;  1FAF A;  2WAM A;  2JGD B;  2BTO A;  5LMN O;  1CPY A;  5C8Y A;  4MVR A;  5C93 A;  1NZ6 A;  5IE9 A;  3OUS A;  4UCV A;  1H2M A;  5LOV A;  3APQ A;  3F7Y C;  4C7U A;  2QWR B;  4RUF A;  3ZN1 A;  3M7M X;  5CA0 B;  3BCC H;  4QJF B;  1NBM G;  2XAF A;  1JPX A;  1R3K C;  4X66 O;  3G4S V;  5GON B;  4JI4 B;  1FXV A;  3I5D A;  4LNU A;  5J9P C;  2DYS B;  5J2T B;  4IYH A;  1BZK A;  4QGP A;  4JYC A;  1SQP H;  4XDL A;  3OFN G;  2EIK B;  2UXC O;  3JAK B;  1B3Q A;  1MA1 A;  4I7Z B;  4K35 A;  1NT2 B;  2ZT9 B;  5EIB D;  2OTJ V;  2JGD A;  4H13 B;  2F95 B;  2RJZ A;  1VEW A;  4MTF A;  1ZWI C;  5FLX N;  1PP9 H;  5AG2 A;  2EZO A;  2LW7 A;  3M99 B;  4UVB A;  1PKX A;  1AI4 A;  1B04 A;  5IJ0 B;  1DGS A;  3B77 A;  1Q3E A;  1OCZ B;  3RW0 A;  4JAS A;  2FYU H;  1TGO A;  5CA0 A;  1S5J A;  3QO8 A;  1W59 A;  3E8H A;  4JTA B;  5GON A;  2P5O A;  3W7T A;  4CZZ A;  2QJ1 A;  3JAW B;  4CH3 A;  1WB7 A;  1YI2 V;  5CHX A;  2LGW A;  5J2T A;  3ZS8 C;  2RDC A;  1XOU A;  4UCS A;  4TOI A;  4YXW G;  1V9P A;  1FS0 G;  4MTX A;  4DO2 A;  3JAK A;  5FPR A;  1SQG A;  5EC2 C;  1IDS A;  3KZI Z;  2DW4 A;  2UUC O;  4PHZ A;  2A06 H;  4MT8 A;  2ZM6 O;  5JCO A;  1KBH A;  1R3J C;  2FL4 A;  3L72 H;  3N27 A;  3ZMZ A;  3U11 A;  4B3S O;  1KEC A;  4J10 A;  2CK3 G;  1E1Q G;  2YUA A;  1XI1 A;  4WFE A;  3ABM C;  4WBN B;  3UT5 B;  4YJ2 B;  1K34 A;  2Z5U A;  3SPG A;  5IJ0 A;  3QVN A;  3AG3 B;  4FLZ A;  1S0V A;  1CXZ B;  2JGU A;  4RQF A;  1F23 A;  1EBO A;  1P49 A;  5B1O A;  2F66 C;  3ASO B;  2WA4 A;  2GHY A;  1F4M A;  4ZHQ B;  3A0H Z;  2UUC B;  1PNL A;  3FB8 C;  2ZM6 B;  3JAW A;  4ZOL B;  1NTM H;  2Z3Y A;  3TET A;  2QKS A;  5CJ0 A;  3F7V C;  4JAU A;  4GT1 A;  2ATK C;  4DR5 O;  4GLX A;  2HR3 A;  5KMG B;  1R6K A;  4Z2W A;  3T4D A;  4GCZ A;  1GRJ A;  4JPR A;  1KP2 A;  4MTO A;  4EEQ A;  4LF4 O;  1SS3 A;  2RN9 A;  2XND G;  2ZE8 A;  4P9P A;  5IDJ A;  3D36 C;  4FPP A;  4BAY A;  4MW8 A;  4WBN A;  3UT5 A;  4YJ2 A;  2IH3 C;  2OCC B;  3K06 A;  3ZHS A;  3CME V;  1Q6U A;  2XT9 A;  1VQ6 V;  4FLW A;  2WLK A;  1THZ A;  5EK0 A;  3IC9 A;  3WB1 A;  1VQM V;  2IJH A;  1Q82 W;  4DR5 B;  2YXL A;  3ABL B;  1QVG U;  1VQL V;  4ZHQ A;  4OXS A;  1JJ2 U;  3QG5 A;  2LGQ A;  4ZOL A;  5CB4 B;  5CBG A;  4PD4 F;  4DV5 O;  1V55 B;  4LF4 B;  1Z5W A;  5E1A C;  3ABL C;  2QGN A;  3SYC A;  3ICX A;  3OW2 U;  3SPI A;  4DUZ B;  4X64 O;  4CC5 A;  5JQG B;  1N8R W;  4ICG A;  4JTD B;  5KMG A;  3D36 A;  1H2N A;  4GKK B;  1YIJ V;  3HKC B;  1YJ9 V;  3CCE V;  3K08 A;  4ABM A;  4PA4 A;  4JI7 O;  3LUT B;  2HKO A;  4UCU A;  1IXM A;  5IY5 B;  3ABK B;  1FKA O;  4LF6 O;  1BT8 A;  2R9A A;  4P2Z A;  4UB8 Z;  4WFG A;  3APO A;  3J81 N;  4DV5 B;  3H1I H;  5IY5 C;  4P30 A;  2O57 A;  4X64 B;  3Q0X A;  1ZAU A;  2VWJ A;  4JYY A;  4ZBM A;  3I56 V;  3E2E A;  4GEU A;  3IJ4 A;  4X89 A;  2WLL B;  1SQV H;  5BMV B;  5CB4 A;  2ZNJ A;  3K0G A;  4JI7 B;  4FLU A;  1L0N H;  4LF6 B;  2P22 C;  3AG4 C;  4O4I B;  5JQG A;  4PA9 A;  1ZSP A;  3DGE A;  1OCC B;  4QPJ A;  3OT7 A;  3HKC A;  3VQV A;  2EUL A;  4KHP O;  2DYR B;  3BPZ A;  1Z5V A;  2HG5 C;  4GKJ O;  4DV4 O;  2YIA A;  5EBW C;  1MSD A;  2YIB A;  2YIB D;  3FYI B;  4R50 A;  2DMX A;  3GVM A;  1YJN V;  3CYO A;  4LBE C;  3FB6 C;  3VOU A;  2EZP A;  3D8C A;  4DR3 O;  3CC7 V;  3N2K B;  4K8X A;  1FFT B;  1S5H C;  3G6B A;  3T2M A;  2P67 A;  2IU0 A;  4MSW C;  1B06 A;  4DK1 A;  3LDC A;  3UO2 A;  4KHP B;  2WLL A;  2YSU B;  4MVQ A;  1HNX B;  5BMV A;  2YDE A;  1H2K A;  1ZUQ A;  3SGI A;  4FLY A;  4GKJ B;  3ETD A;  4R6Z A;  4DV4 B;  5KAI Z;  4WFH A;  2F93 B;  1Q5O A;  2DWE C;  3QO5 A;  1XMQ B;  2ZQM A;  1N32 O;  4O4I A;  1WA8 B;  1YHQ V;  4GUN A;  4IIJ B;  5D5P A;  2W6J G;  4WFB V;  4H0L B;  1SRY A;  1I0H A;  4NTX A;  2PI5 A;  2P4V A;  4DV2 O;  3CHX A;  5KHJ A;  1XL4 A;  5KA6 A;  4JI3 O;  5LA6 B;  2ODM A;  1G1X B;  2X6C A;  4G27 B;  3N2K A;  3JSN A;  4O2B B;  2QWN B;  2XAG A;  5LL6 Y;  4W4L A;  1ARO P;  4FLT A;  2VQF B;  1M56 B;  1YXB A;  1W0J G;  4LCU C;  3ZED A;  1URF A;  2FKX A;  1SZX A;  3WG7 B;  1WP8 A;  3DTU B;  1V54 C;  4U7N A;  3K04 A;  2PF4 E;  4X62 O;  1IZ3 A;  3NXS A;  2RCV A;  4DV2 B;  5B66 Z;  1XEQ A;  1WA8 A;  2W6I G;  1AP5 A;  5B1B C;  1Q6H A;  2N05 A;  4BIO A;  4KFM A;  2MW2 B;  4IIJ A;  3DC5 A;  4XDK A;  2IJK A;  4O4H B;  2Q6A A;  4WFA V;  3G71 V;  1BMF G;  5H2F Z;  2PYJ A;  2XAJ A;  2X6B A;  1IBL B;  4NTW A;  4O4J B;  1K5Q A;  3CRA A;  2HEP A;  5LA6 A;  4JYA O;  4O2B A;  1VQO V;  1MG1 A;  5CBF A;  2UUB O;  2OTL V;  4AIL C;  5GW7 A;  2P6J A;  4YIO A;  1WB8 A;  3K3W A;  3GB7 C;  2JJ1 G;  1PPJ H;  1W0K G;  3RYI A;  1N33 O;  2KQX A;  3KCY A;  3P3N A;  4Z1M G;  2QM7 A;  5GTI Z;  2JIZ G;  3J80 N;  1AR4 A;  2E5L O;  4LC1 A;  4U3J B;  5KHH A;  4E2L A;  1OV9 A;  3OR6 C;  3JSL A;  1Y66 A;  3B4S A;  1NI8 A;  3X2Q B;  1WNS A;  4JYA B;  3F5T A;  2ZD9 A;  1Q81 W;  4RO2 A;  1KKC A;  5IJ9 B;  4XDJ A;  4UCT A;  4EB6 B;  1AI6 A;  1MZE A;  4E4E A;  2UUB B;  1NR1 A;  1VQN V;  4O4H A;  3ETG A;  1U96 A;  2IJJ A;  4GX1 A;  2CTR A;  4G79 A;  1SQF A;  3GWK C;  4F4L A;  4O4J A;  3H1H H;  1TAE A;  2Q67 A;  4BW9 A;  4NR1 A;  5LHG A;  4JI1 O;  4KP4 A;  3RT3 C;  4PDM A;  3STZ C;  2E5L B;  3UKM A;  2QTS A;  2A7W A;  1HW7 A;  2AGA A;  2AZ2 A;  4NVP A;  1MZF A;  2WWW A;  3K5O A;  1WLE A;  1XHX A;  3B2E E;  4UB6 Z;  1AVM A;  4DW0 A;  1IXB A;  2LP7 A;  2QWP B;  2XAQ A;  1L1F A;  2M6Y A;  1DTO A;  1S5L Z;  1QHT A;  2CGN A;  4FK5 C;  4TQD A;  2WLJ A;  1WJZ A;  4U3J A;  5LBQ A;  1H2S B;  2P06 A;  2HP8 A;  4PDL A;  2DWD C;  4F6R B;  4DV6 B;  1NS1 A;  2HHH O;  1GK9 A;  4I55 B;  4LF7 O;  4BW5 A;  4JI1 B;  5IJ9 A;  4EB6 A;  3CCL V;  4JTC B;  5LYJ B;  3SPH A;  1YJW V;  2HFE C;  1G4Y B;  3RBZ A;  1YVW A;  1XMO O;  3JAM N;  1A32 A;  3SYQ A;  1O9G A;  2LQT A;  2ZDI C;  2UXD O;  4CKN A;  1L0L H;  3BVO A;  1VQ5 V;  3T4Z A;  4FLV A;  2XTA A;  3RVZ A;  3CMA V;  2HHH B;  2YS8 A;  3E35 A;  4UUJ C;  4LF7 B;  4NXM O;  4FFK A;  2FB5 A;  1T5E A;  2V1D A;  3TJT A;  1LR1 A;  2QE7 G;  3CX5 F;  5JH7 B;  1Q90 D;  4YIP A;  1BL8 A;  2BE3 A;  4LR3 A;  1EM1 A;  2UU9 O;  2Y69 C;  2N04 A;  4AI8 A;  1XMO B;  1FXK C;  2Q73 A;  2QM4 A;  3ASN C;  2P7T C;  4MTG A;  3B8N A;  4F6R A;  1AP6 A;  1VQ7 V;  4CS4 A;  4I55 A;  4CKM A;  5LXT B;  2V7Q G;  3ABT A;  3UM7 A;  2UXD B;  5LYJ A;  2HLD G;  2QEX V;  4OPA A;  3CPW U;  3O9O A;  4TSF G;  4UVC A;  3ZHV A;  3JCU Z;  4K0K O;  2QSA A;  3AK3 A;  1XRE A;  3OR7 C;  1XUQ A;  1YDX A;  4NXM B;  1KP3 A;  5L3C A;  5EBM C;  4JZ2 A;  2JS5 A;  3SJA C;  3K5L A;  2Y48 A;  3E89 A;  5HFM A;  5KAF Z;  3ZRW B;  3ABM B;  3ZHU A;  2UU9 B;  3NR7 A;  4RUE A; 
#chains in the Genus database with same CATH homology
 3RFR A;  5IWA B;  3E22 B;  3JAL B;  1N34 B;  2R9A A;  5FPO A;  4FM1 A;  5JH7 A;  4DV5 B;  2YI8 A;  2RQ6 A;  1G6U A;  1Q43 A;  4LFA B;  5K1X A;  2Q0A A;  2ZIN A;  4O2A B;  3ETQ A;  4ZI7 A;  4K0K B;  3JAS A;  4I50 A;  5KHK A;  1N32 B;  4UFZ A;  4X64 B;  5K1P A;  4I9Q A;  3BAB A;  3U10 A;  1ZAU A;  2VWJ A;  3RYI B;  1JJO A;  5LXT A;  1I94 B;  5EIB C;  5KHI A;  5BMV B;  5CB4 A;  2ZNJ A;  2BTQ B;  5BR8 B;  4JI7 B;  4FLU A;  4UCO A;  5J2U A;  3K5N A;  4LF6 B;  4D7T A;  2P22 C;  4JI3 B;  5IYZ A;  4O4I B;  5JQG A;  3QF7 A;  3SJC C;  2F1M A;  3BRC A;  4X1K A;  1TA8 A;  2R72 A;  3HKC A;  3BAA A;  3VQV A;  2PTM A;  4OX9 B;  1FFX B;  3BPZ A;  1Z5V A;  5EYP B;  5CA1 A;  2OYQ A;  5LMN B;  4CS2 A;  3BA8 A;  4DUY B;  2IM9 A;  2YIA A;  4Q6G A;  3E22 A;  4PI2 A;  2YIB A;  4CH5 A;  1RSO A;  3JAL A;  2YIB D;  2ZIM A;  4JI2 B;  4NXN B;  1X4T A;  1VF7 A;  4CH6 A;  4EFE A;  4CH4 A;  3U0Z A;  5FNV B;  5KX5 B;  4X20 B;  3JAR B;  4IHJ B;  1JFF B;  3N2K B;  4K8X A;  4X62 B;  4B3M B;  1IBM B;  3SR2 A;  4O2A A;  4YHH B;  3RGB A;  4D7S A;  5C8Y B;  4DK1 A;  2Q7E A;  4DR1 B;  1O9H A;  2YI9 A;  4KHP B;  4X66 B;  1WPB A;  4JV5 B;  3CSX A;  1HNX B;  3BA9 A;  5LOV B;  5BMV A;  5JCO C;  4EFB A;  2BTQ A;  4ZIB A;  3SGI A;  4FLY A;  1KMI Z;  4GKJ B;  4DV4 B;  1Q8I A;  2GV9 A;  5JJJ B;  4DK0 A;  2UUA B;  2F93 B;  1Q5O A;  1N36 B;  1XMQ B;  4O4I A;  4TV8 B;  3N2G B;  1XHZ A;  2UXC B;  3UQ8 A;  3SJB C;  2EX3 A;  4LH6 A;  3QTC A;  4IIJ B;  5D5P A;  4LFB B;  1FFX A;  4LNU B;  2V4D A;  5EYP A;  4YY3 B;  4LH7 A;  1FJG B;  2ZIO A;  5CJ4 A;  1M5I A;  3CHX A;  2PUS A;  3VQY A;  5KHJ A;  1YEW A;  3PN1 A;  1D5A A;  3HKD B;  1N33 B;  5LA6 B;  5FNV A;  5KX5 A;  4X20 A;  3JAR A;  1KU9 A;  4O4L B;  2PY5 A;  4IHJ A;  1JFF A;  3N2K A;  3CB2 A;  3JSN A;  4AQY B;  4DR7 B;  4O2B B;  4HNA B;  5D5Q A;  4FLT A;  2CAZ C;  2BTO A;  2E3C A;  2VQF B;  2VWK A;  5C8Y A;  2PGG A;  1SA0 B;  1HNZ B;  1QQC A;  4LFC B;  3ZED A;  4DR2 B;  5ITZ B;  4UCV A;  2JVD A;  5LOV A;  2OWO A;  5LP6 C;  1J5E B;  4GYC B;  4BWA A;  4PI0 A;  3K58 A;  4DV2 B;  3M7M X;  4FLX A;  4TV8 A;  5CA0 B;  3N2G A;  4IIJ A;  5GON B;  4JI4 B;  4LNU A;  4CS3 A;  4DRX B;  4O4H B;  4YJ3 B;  5J2T B;  2PYJ A;  1XNQ B;  5JJN B;  1IBL B;  4B3S B;  4O4J B;  3HKD A;  3JAT B;  5LA6 A;  2HEP A;  1TVK B;  1HR0 B;  3JAK B;  4O4L A;  4B3T B;  4TV9 B;  4TUY B;  3WB2 A;  1NT2 B;  4O2B A;  4HNA A;  5EIB D;  1TUB B;  4AIL C;  5JJE B;  2F95 B;  2RJZ A;  1SA0 A;  3K5M A;  4FM2 A;  3RYI A;  5ITZ A;  3K59 A;  3WB0 A;  1B04 A;  5IJ0 B;  1DGS A;  1L8D A;  1Q3E A;  4DR4 B;  4AHC A;  4XA4 A;  4U3J B;  5KHH A;  3MUD A;  1TGO A;  3JSL A;  5CA0 A;  4X1I B;  1S5J A;  2ZNI A;  3OTO B;  5EZY B;  2KKW A;  5JVD B;  1WNS A;  4JYA B;  3K57 A;  5IJ9 B;  3RWR A;  4UCT A;  4EB6 B;  5GON A;  3RWR D;  2PYL A;  2P5O A;  4DRX A;  3BHP A;  2UUB B;  2QJ1 A;  4O4H A;  3JAW B;  3RYH B;  4CH3 A;  4DR6 B;  4YJ3 A;  5CHX A;  5J2T A;  4B08 A;  3ZS8 C;  1SQF A;  4UCS A;  4O4J A;  4TOI A;  3II6 A;  1V9P A;  1TAE A;  3JAT A;  1TVK A;  4BW9 A;  3JAK A;  4TV9 A;  5FPR A;  4TUY A;  1SQG A;  4X1Y B;  3VQW A;  2PZS A;  4PHZ A;  2F4V B;  5JCO A;  2E5L B;  1TUB A;  5LP6 B;  4DV0 B;  1WN7 A;  1IK9 A;  1HW7 A;  4UCR A;  4NVP A;  4LF8 B;  2R70 A;  3U11 A;  3K5O A;  3MAQ A;  1XHX A;  3B2E E;  1XI1 A;  4K8Z A;  4WBN B;  3UT5 B;  4YJ2 B;  3IAY A;  4X65 B;  1XQ8 A;  5IJ0 A;  1QHT A;  4FLZ A;  4TQD A;  4U3J A;  4KL1 A;  1H2S B;  3T1Y B;  2JGU A;  3OTF A;  4JI8 B;  4FFB B;  3HKE B;  4X1I A;  1P49 A;  4JI0 B;  2F66 C;  4F6R B;  1SKV A;  4DV6 B;  5EZY A;  4ZHQ B;  5JVD A;  4I55 B;  2UUC B;  4JI1 B;  5IJ9 A;  4FVM A;  4EB6 A;  3SR2 C;  1HNW B;  5LYJ B;  2ZM6 B;  3JAW A;  4ZOL B;  3RYH A;  3RYF B;  1XNR B;  4JI5 B;  3RYC B;  2ZCE A;  5CJ0 A;  3HKB B;  4TQF A;  2Q7G A;  4GLX A;  5KMG B;  1O9G A;  4X1Y A;  4B3R B;  3DSQ A;  5KHG A;  4EEQ A;  5LP6 A;  1IBK B;  3LNN A;  4FLV A;  4I4T B;  3FFQ A;  1JMK C;  2HHH B;  1M4U A;  4HBN A;  4L8J A;  4LF7 B;  4FM0 A;  1T5E A;  4WBN A;  1I7F A;  3UT5 A;  4JI6 B;  4YJ2 A;  5JH7 B;  3THO A;  1FU1 A;  4DV1 B;  4FLW A;  4DV7 B;  4LR3 A;  3T1H B;  4LF5 B;  4ZI7 B;  2VQE B;  1XMO B;  3JAS B;  2QM4 A;  3WB1 A;  4FFB A;  4I50 B;  3HKE A;  4LF9 B;  4DR5 B;  2YXL A;  4F6R A;  4CS4 A;  4ZHQ A;  4I55 A;  5LXT B;  3QG5 A;  3A2F A;  3VQX A;  2UXD B;  5LYJ A;  5CB4 B;  4ZOL A;  3RYF A;  4LF4 B;  1Z5W A;  3RYC A;  5J2U B;  3HKB A;  3ICX A;  5IYZ B;  1M93 A;  4DUZ B;  4CC5 A;  5JQG B;  4NXM B;  4CC6 A;  2Q7H A;  4DR3 B;  5KMG A;  4GKK B;  4X1K B;  2XHB A;  2JS5 A;  3HKC B;  3SJA C;  3K5L A;  4DV3 B;  5LMU B;  5CA1 B;  2UU9 B;  2UXB B;  4I4T A;  4UCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...