2GBOA

Protein of unknown function ef2458 from enterococcus faecalis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
b'MDEGISKKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0358 protein EF2458
publication title X-ray crystal structure of conserved hypothetical protein EF_2458 from Enterococcus faecalis.
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 31
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07408 DUF1507 Protein of unknown function (DUF1507)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2gboA00
2ODMA 2NR5A 2GBOA
chains in the Genus database with same CATH superfamily
3JSLA 4JF3A 2DYRB 2N05A 2ZE8A 4J11A 2BOBC 5DM6V 4TOIA 1AVMA 1YF2A 3SPJA 5KAFZ 4PDLA 5IYDO 1HNXO 3W7UA 1YTFB 2IH1C 3JSNA 4O4JA 3UCSC 2VS0A 2GUZB 3D36A 2FTKA 5L3FA 1HP8A 1VQNV 4U3JA 4FLYA 4U7NA 1VARA 4YXWG 4ASUG 1RPOA 3CWBH 3ZJZA 1JOYA 4B08A 1S5JA 2OYQA 4UVAA 1Y74B 2OCHA 2KKWA 3CRCA 3E89A 4FMTA 2F43G 1YJ9V 1F23A 4X1IB 1L0LH 1NVPB 4X64B 3OMIB 1XI1A 1W59A 2UXCB 3SPGA 2WLIA 4F6RA 4Z2WA 3AG2C 4X66B 1W0KG 2ZIMA 1QLNA 3TXQA 3H9VA 4MVUA 4MS2A 2B5UA 2HFEC 1JA8A 3ASNC 5CBFA 4DR7O 3T1CA 2CH7B 2X7RB 3WB0A 1NH2D 2B9ZA 3ZIAG 2UU9O 5EK0A 2KG7A 3MDSA 3GWOA 4UCRA 2IJKA 1MOFA 1RP3B 4JI7B 3G4SV 1AB3A 1N36O 5KA6A 2PYLA 3O65A 4TQDA 1VMGA 1JMKC 2XHBA 1QR9A 2PUSA 4PA3A 1Z5WA 4ZBMA 1FXKB 2VQEO 1SQGA 4JYYA 4MW8A 1GRJA 3RBZA 3G6BA 1QHTA 4JYAO 1MSWD 2YXYA 4JTDB 4DK1A 1T5EA 1H2MA 1AI5A 1OCZC 2ZNJA 2Z0AA 3JARB 1EN4A 5KX5A 2E75B 3RYHB 3CRRA 2UXDB 1WNSA 3ETQA 4DUYO 3IFXA 1F51A 2B1IA 2JDIG 1MA1A 3ZBHA 4P2ZA 1ZTEA 3H1LH 4D7TA 2EIMB 4XDKA 3I56V 5LP6A 1EN6A 2AZ2A 2F93B 3T4ZA 2XAQA 3HKBA 3G80A 3HKDA 3L72H 1KBHA 4LC1A 1Q43A 1KECA 1OCCB 2YUAA 4IHJA 1NBMG 1N32B 3L75H 1CP9A 3BCCH 5BZBA 4BWAA 4DR6O 3T1YB 3AG4C 3BA9A 5LA6A 3DTUB 4JV5B 1IURA 1SQFA 4B7EA 4LFBO 3J81N 1Q6UA 3E86A 1TVKA 4DV3O 5D5QA 2BSKB 4O4LB 2QKCA 4DO2A 2LW1A 2WAMA 5LMUO 2WPDG 4OX9O 1TUBB 4DR3O 4ZKIA 1G1XB 2IJIA 4J9YB 2UXBB 1AI6A 4BIOA 2CGOA 3CCRV 2A7WA 1JR9A 1U97A 3H1IH 2QWOB 1BT8A 4JI5O 2OCCC 1IZ3A 3ABMB 4UV9A 4H13B 5IWAO 1R3KC 1LUVA 2KSDA 1OCOB 3L74H 5B3SC 2AW9A 1VEWA 4YY3B 1GAXA 4N23A 4J42A 4O4IA 3UO2A 4MT8A 2Q68A 5FL7G 5IY5B 4DV7B 5EIBD 2P5OA 1AJQA 4JI8B 3UT5B 4MTOA 4X65B 4MVQA 1OJHA 3MHHC 2QWPB 4MVRA 4DUZO 2PYJA 2QWRB 4LF7O 1D5AA 1Y76A 4P9PA 1YTFD 1M1KW 5BR8B 1HWYA 2WLIB 4CZZA 4F6RB 2QWNB 1M93A 2JJ1G 2QKAA 3JCUZ 5LBQA 3CCLV 4NTXA 5KMGA 2VWKA 1H8EG 5EC1C 3B40A 3CXCU 4IYIA 4G2KA 2XUMA 1OV9A 4X1KB 3OEEG 1L0NH 2EIKB 2ADQB 1U96A 4CS2A 4MTGA 3ZMSA 4DV0O 5IYZA 2B1GA 2KG7B 4NR1A 4LF9O 1YITV 1NVPD 2RMKB 4K0KB 1GM7A 4PA6A 1W0JG 1JJ2U 3CS5A 2YIDA 1NT2B 4DV1B 2Q7HA 3EVKA 4X88A 2Q5ZA 3ETGA 5DN6G 5J2UB 1H2NA 4LF4O 3LNMB 1Y66A 2CTRA 3QO7A 1HNZO 5EIBC 4TV8B 4U7OA 5LYJA 2QSAA 4JI0O 4UVBA 4HNAA 1Q90D 3IAYA 2DYRC 3P3NA 1I94B 1DLBA 3CJHA 1H8HG 1ZLZA 4X62O 2OIEA 2D2CB 2P22C 3F7YC 1HNWO 3QTCA 4EFBA 1R6TA 2XASA 4JI4O 2DQ0A 3LDDA 3ZRXA 1O9HA 3A2FA 1ZUQA 5LP6B 4JI2B 4LFAO 2P67A 3HKBB 2A79B 1SZTA 5L3EA 2RCVA 4A5UB 3N2KA 2ZR2A 3CCVV 2L35A 4IHJB 5LGNA 2Y69C 3RW0A 1DF4A 4FM0A 2Z3YA 1NR1A 1Q6HA 2QM8A 4X89A 2EINB 2DMXA 1B6QA 1MMMA 3E8BA 5HFMA 2F4VO 5LA6B 4GT1A 4JI3B 2AZ0A 5H5NA 4DV4B 1RPRA 2E76B 2G38A 5B1AB 1JVMA 1KQSU 3K08A 2LGWA 1NH2B 3ZRWB 4PI2A 1IDSA 3UQ8A 2N74A 4Q20A 2R9AA 4GCZA 2HP8A 1VP7A 3H1JH 1WA8A 2UUBO 4X8AA 3F7VC 1ENVA 4QJFB 1ZL8A 5IJ0B 2H8PC 2GSMB 3GWKC 4HAMA 5A2QN 1IXMA 1QLEB 3O9OA 4JI6O 5ITZA 3ZHRA 4X20B 1XNRB 3W7XA 3ZHTA 1P49A 3E35A 1FXKC 4I7ZB 4PA9A 4AHCA 4LF8B 1SS3A 2ZDIC 1I0HA 4WFBV 4NVPA 4KL1A 4UUJC 1V9PA 2GBOA 4MVOA 3JASA 1I5XA 2GV9A 1JCHA 1NQTA 1J5EB 2QTOA 2W0XA 3M99B 3FAVA 1AI7A 1D5NA 1SQBH 3K06A 2Y0PA 2OTJV 4HZ3A 2YIAA 3CMAV 2JS5A 4O4IB 1IBKB 4J9ZB 5GTIZ 3E8GA 5FPRA 2ZE7A 2BE3A 4JAAA 5CB4B 4JTAB 2LJ2A 3OTFA 1FFTB 1L1FA 4WFHA 1I08A 1P7GA 2WA3A 1AROP 4PD4F 3RN4A 1L8DA 4PELA 2EIMC 4LNUB 1PNLA 4B7KA 4FLTA 4BIZA 1Y76B 1M56B 5JJJB 3N27A 4RO2A 4DRXA 5J2TA 1OCCC 2ZM6O 2ATKC 3BA8A 3H01A 4YJ2A 5KLVH 3OUFA 4DV2O 3STZC 2DW4A 5GTHZ 2QGNA 4WFFA 2XAFA 3BPZA 3FB8C 3BAAA 2FMLA 1PD3A 1FAFA 2CGNA 5IYZB 3B8NA 3FYIB 4DV5O 3B09A 4CS4A 3RFRA 5C8YA 3FD9A 1FYJA 4DYLA 5GONB 2P4VA 3BY6A 5L3DA 3RYFA 2UXXA 1Q82W 1OHHG 4JYCA 3K3WA 4FLWA 4DR7B 2A06H 1SZXA 1NTMH 4ZIBA 3LSQA 5JH7A 1MZEA 2PTMA 4DXWA 3OMAB 2P90A 3J80N 5LYJB 2XOKG 2R70A 2FL4A 3ABMC 4CH6A 4Q6GA 1N36B 1PNKA 4UCTA 1R3IC 3ZS8C 1UJWB 3CJHB 5EBLC 1OCOC 3OW2U 2Y4TA 2DN9A 4XBFA 2YXLA 1WJZA 4NB5A 2YXHA 1DK1A 2Q7EA 3D36C 1NKDA 4JYAB 2WLJA 3SYPA 4J41A 2V4DA 3LUTB 1YI2V 3N2KB 3JALA 3D3QA 5B5EZ 1OCRB 2WLMA 3TXSA 2IBZH 1FFXA 4I0XB 2UUCO 3GVMA 3HKCA 4FFBA 4TUYA 3ZRVA 3WU2Z 1PPJH 1QVFU 4DUYB 4H0LB 1SETA 3ASOB 1F7YA 3ABKB 5E79Z 4RWUA 5IT9N 1E1QG 1VQ7V 2YICA 1VQ9V 4UCSA 3AEIA 1V54B 1MNGA 4GUNA 3ZEDA 2IM9A 1HDJA 2QA4V 1US6A 3QVNA 4TWKA 2CE4A 2W6JG 2WWWA 1ZL8B 4KP4A 2EIKC 3LNNA 4YHHO 3ZHUA 4LF5O 2MK3A 4PDVA 1GN2A 2QDOA 1XILA 3ABUA 3OD4A 1XMQO 3OTOO 4DR6B 1S5HC 1K97A 2CDYA 1HW7A 1GN4A 4DR2O 3APOA 3B77A 4E4EA 1A32A 1R1BA 1VQPV 3C3SA 3CHXA 4DV3B 4RQFA 1R6NA 2EBOA 1ZX3A 3JD0A 5E1AC 4EB6B 3FKSG 1NJIW 1P7BA 5CA0A 4FK5C 1N33O 3JCZA 3JD3A 5IYCO 3M7MX 1WB7A 4OX9B 2BTOA 1K4DC 2PF4E 1JJOA 4DR3B 3LDCA 3RYCB 1V55C 3OEHG 2BTQA 3TK1A 2ZXWB 4K8XA 2H94A 4BW9A 4JI5B 3R65A 1XL4A 1IBMB 1ZAUA 5IWAB 1WP8A 5KHGA 4PDMA 1FXVA 2GDSA 4DRXB 4GZRB 5J2TB 2RQ6A 4ZOLA 1R3JC 3AG7A 5BMVA 4J80A 4LF6B 5IJ9A 3QNEA 3IC9A 4KHPO 3AK2A 4YIOA 1BCCH 2EINC 4LFCO 1YCIA 2JGDB 4JTCB 4ZI7B 1XL6A 1URFA 5B1AC 4NXNB 4NXMO 2EULA 3SPCA 4DR1O 3CRMA 4LF7B 4DR5O 5LHIA 5C8YB 2UXCO 1IBLO 2P7TC 1VF6C 5EBMC 3B4SA 1KU9A 3Q4HB 4FPPA 3L70H 3B8MA 1K4CC 1WLEA 3ZX6A 3RYFB 3JAMN 4JGSA 1S0VA 1N8RW 5DEDA 3K5NA 2NLJC 4B3SO 4B3RB 1Y6XA 1BQ0A 2C2AA 1XMOB 4DV0B 2HJFC 2ILMA 4B3TO 1K73W 4UCOA 2AXTZ 4JI7O 1H2SB 4R7CA 2QM4A 2PGGA 3K03A 3IC7A 5JVDA 3WG7B 1AI4A 3LDEA 2YIBA 3ETDA 1GTOA 3ZHSA 4CC5A 3BVOA 3QF7A 4FJCC 5CBGA 3CCUV 4H37A 5C93A 4F6EA 2Y4UA 3ICXA 1KYOF 4CBCA 1RSOA 5L3GA 2JGUA 2XAHA 5K1XA 3L73H 2Q4PA 1HNZB 3E8HA 1CPYA 4C7UA 4O4JB 3K79A 4X9QA 1YJNV 4IIJA 1FFXB 3AK3A 4JI0B 3CE2A 4I50A 3HKCB 2EX3A 4TUYB 4U3JB 2EILB 3CX5F 4GX0A 1XNQB 1M56C 4YJ3A 4X62B 2VQFO 2D3OW 5H9CA 3SYAA 5CA3A 1HNWB 3N2GA 5FPOA 3CYOA 4JI4B 3BABA 1R73A 2YEVA 4EFEA 2QKSA 2XAJA 4LBEC 4LFAB 4LH6A 2IU0A 3RWRD 4LR3A 4CC6A 4AQYO 1DGSA 1TUEB 1PP9H 3F5WC 2YDEA 1H2LA 4I9QA 1WAZA 1FXHA 1Z2GA 3T1YO 1KUQA 1N0JA 2M6YA 3K9AA 2F4VB 2DJVA 1Q81W 1BHBA 1K8AW 4Z1MG 2HR3A 4RAIA 1S72V 3APQA 1BHAA 3K5OA 3E8FA 2N04A 3ZHVA 2AHZA 3T1HO 3CMEV 5CA0B 4MTFA 2UUBB 5KAIZ 4LCUC 3JAKA 2DYSC 4QIWF 4J10A 1Y4MA 3IGAC 2DWEC 3D8CA 5B1BB 3SJBC 4ZHQA 4JI6B 3ASNB 4WFAV 2EZOA 1N4CA 2Y48A 2BTQB 1KP3A 4KXRA 1FKAO 1THZA 4TV9A 4WBNA 5FNVA 4H33A 2EZPA 5LMNO 3ABTA 1ROPA 5KX5B 4NKGB 3MD0A 4CH3A 3OR7C 2EJ7A 4JAVA 3VBBA 4YY3O 2F1MA 1OCRC 1S76D 1LNQA 3I5DA 4ZOLB 1BMFG 2CUGA 2FB5A 1R3LC 2HLDG 1EFRG 3H1KH 4TQFA 1GN6A 3P30A 3OGIB 2DWDC 4TSFG 5BMVB 4DR4O 5IJ9B 4UCUA 3HKDB 2ITCC 2QEXV 4MVSA 2LW7A 3AG3B 2R9RB 3ASOC 4JI8O 2WLNA 4X65O 3ABKC 2UXNA 5IE9A 3G67A 3KCXA 4L87A 3EXAA 4FFKA 1V54C 1G6UA 4MTXA 3X2QB 1VQOV 1MABG 1QR8A 4IT5A 1G8MA 1S3JA 4JZGA 2ZM6B 1BQZA 4GX1A 2ZINA 5KUMA 1TVKB 5BY1A 1K9MW 2GUZA 4GX5A 1AR4A 1KC8W 4DV2B 2ZE6A 2HG5C 1QVGU 2XTAA 3E22A 2V7QG 3CCMV 4G28B 3OE7G 1M5IA 5JCOA 3BRCA 4AI8A 1N34O 3HB3B 1EZJA 1Y74A 1I5YA 1ZWIC 3AG4B 3OGCC 1AR1B 4DV5B 4X1IA 2HVKC 5JVDB 1DF5A 2IH3C 3E83A 1CEZA 3DC5A 1KMIZ 2P06A 5JJEB 2ZR3A 2F95B 2P4KA 3JATA 4N21A 2RNBA 3WFVA 1Q8IA 1H38A 1NZ6A 2BCCH 3A0RA 4PA4A 1RSOB 1WPBA 2ZXWC 3RYIA 1JX9A 1Q3EA 2X6BA 3DGEA 4QNHB 2ZE5A 4R6ZA 1H2GA 1I94O 1AJPA 5KHIA 1Y67A 3ZMVA 3QO5A 3TJTA 1FXKA 2OTLV 2ZDIA 4OGQB 3SDLA 1IXBA 3FB7C 3N2GB 1SA0A 4DK0A 2QR4A 1M57B 3CC4V 4BIUA 2PI5A 2PI4A 3FX7A 1YHQV 3D3IA 2JEUA 3SR2C 4CH4A 1HNXB 3SPIA 3CPWU 2EJRA 1VQ6V 1VIBA 1MSDA 3OAAG 5KMGB 2K1EA 4B3MO 2UUCB 5EYPA 4NYKA 3RYHA 5B66Z 3SYOA 2DQ3A 3ETEA 1JPXA 1NTZH 2LQTA 2LFSA 1YIJV 4FLZA 5B1OA 4I55A 2JS3A 1JFFA 4MW3A 1G4YB 1Z5VA 2H3OA 3G6EV 3K0DA 4UVCA 1X4TA 5D5PA 3W7WA 5KHJA 2DOSA 1E1RG 4DV6O 1XOUA 4ABMA 2CTQA 4JI1O 1TA8A 3JAKB 4YHHB 4RUEA 4YIPA 2GTSA 4LF5B 2HVJC 4J7ZA 4ZHQB 1XNRO 2E5LO 1VQ4V 1XMQB 1FJGO 1CXZB 3OTOB 3OR6C 2ITDC 3ZMZA 2Y0IA 2PY5A 4JPRA 4MSWC 2WA4A 2A3QA 4LF8O 2CAZC 2M7WA 2UU9B 3K9SA 2GTAA 1YZBA 2HHHO 3OM3B 4FLVA 5FNVB 1NI8A 2IU3A 4HNAB 1KD1W 2BSKA 4O4LA 5LXTA 1SRYA 2RN9A 3THOA 5BXZA 3WB1A 4GKJO 1N33B 2ZNIA 4FLUA 3ZN0A 2VQEB 4G27B 1PNMA 5JJNB 4UFZA 1GM9A 3C90A 1GKFA 1TUBA 4PHZA 3LSUA 4KUMA 5IY5C 4O2AA 2IW5A 4GYCB 3AG1B 2P6JA 2X0LA 1E79G 3IJ4A 3QG5A 1K33A 3K04A 4TT3G 2HEPA 1XBLA 4I5SA 3H1HH 4BR6A 1VF7A 2CTWA 3G71V 4IL6Z 1F4MA 2Q6AA 4O2BA 1SF9A 1GO3F 1WN7A 1BZKA 4KHPB 1JQ0A 4QE9A 1WA8B 2DE0X 3E22B 2UUAO 2RJZA 4LFCB 3NXSA 2Y69B 3K58A 3UT5A 1IVSA 1PKXA 3TETA 3F5TA 3SJAC 2LGQA 4NXMB 5ITZB 2OWOA 1XREA 1BE3H 2QJ1A 1W2BU 2CK3G 3KZIZ 4DR1B 4DR5B 2ZQMA 4LFBB 3SYCA 3ZRSA 1IBLB 3JATB 1K5SA 1WB8A 3E2EA 5GW7A 5B1BC 3JASB 1YDXA 3P3PA 3CCJV 1O9GA 4D6TH 4J7KA 5FLXN 4X1KA 3FAVB 4GKKO 4B3SB 5LMUB 2NR5A 3RYIB 2Q67A 4R8CA 2L6LA 3JYCA 3L9DA 4B3TB 1XUQA 3FYEB 4JAUA 1HR0O 2JK5C 1QU7A 4PJ0Z 2YIBD 2X6AA 2VWJA 2KB1A 2A9HA 3J7AU 1SQPH 1H2KA 2KQXA 3STLC 1SA0B 3L71H 3K57A 5LP6C 3RVZA 5J2UA 3ZHQA 3AG3C 3VQXA 1RM1B 4YJ2B 4TV8A 1NTKH 3ABLB 3W7SA 1VF5B 1P4RA 2FKXA 1AP5A 5LGUA 1SERA 5EYPB 2JIZG 1XHXA 2QE7G 3MAQA 1GH6A 1WPXA 3X2QC 4QPKA 4EEQA 1VQLV 2VQFB 4I55B 3DC6A 3ZCCA 1NS1A 1JFFB 1AR5A 1NU1H 3VQVA 1DTOA 3HR0A 4HBNA 4DUZB 4MVMA 4J7JA 1MZFA 2WLLA 1QQCA 4X64O 4GLXA 2WSSG 1M90W 4AQYB 2ADPA 1N0NA 4QE7A 2YS8A 5LOVA 4X66O 2Q8VA 3U10A 2EIJB 3CC7V 1QLEC 4K8ZA 2Q9LA 4I4TA 4RQEA 3SYQA 3HKEA 2A0LA 4FVMA 2WLKA 5JH7B 4OPHA 4LH7A 1ZSPA 1FD9A 2QM7A 5TISZ 3BEHA 1FPOA 1YEWA 3ZRWA 1Q6IA 4LF9B 5LHGA 5LXTB 5LL6Y 1QCEA 3VOUA 3T1HB 3CP1A 4UXNA 3R66A 2R72A 1VF6A 5IJ0A 2Q7GA 1B3QA 1P84F 5CN0A 3JD4A 4X20A 4QPJA 3S3WA 2OIGA 3KCYA 4JYBA 4LF4B 3CRAA 4O2AB 1OZ0A 4U3FH 3JALB 4LWSA 2Q0AA 1SQVH 1LUWA 3DXRA 5EBWC 3CSXA 3FB6C 1IBMO 4FFBB 4W4LA 5LMNB 4R50A 2UXDO 1M57C 2Q69A 1S77D 1M4UA 4E2LA 3RGBA 1Q7YW 1R6KA 3SGIA 2XNDG 3JAWA 5EZYA 1BL8A 3CB2A 4DW0A 4HYOA 3UO3A 4OPAA 3CEIA 3OUSA 4W4KA 4RUFA 1K3EA 4FM2A 1X59A 4O2BB 2W0FC 4LF6O 3AK1A 3OFNG 4DR4B 5JWPA 1TGOA 5HFLA 1QBZA 1XEQA 4BAYA 5CB4A 5K1PA 5KHHA 5LHHA 4JASA 1N32O 3NR7A 1VQ5V 4F4LA 1XHZA 4NXNO 2LFRA 4FZ0A 5B1NA 3PJSK 4LNUA 3K5MA 1SKVA 5JQGA 1COWG 4LP8A 1J95A 3EHBB 4JV5O 4PV1B 3UM7A 3VQWA 3HPLC 3T2MA 3EFFK 4WFGA 1ORQC 1FS0G 2F23A 4B3RO 3AG2B 1PM9A 1N34B 5F2VO 4NTYA 3OT7A 5LGTA 1WP7A 1XMOO 3CCQV 2UXBO 3FB5C 1VQMV 2XAGA 3M8AA 2Z5UA 4X1YA 5H6QA 5CA1A 2E3CA 5GONA 1SQXH 3A0HZ 1GN3A 5AG2A 4NTWA 2YI9A 3CXHF 4UB6Z 5DECA 4DW1A 4O4HA 4FM1A 4WCEV 3K0GA 4BW5A 1V55B 3AG1C 3VQYA 4DV7O 1D2DA 1XNQO 1F4NA 2ZCEA 1OCZB 1LR1A 4L8JA 2Q73A 1YSCA 2QTSA 2YC0A 2Q0OC 5KUKA 2YI8A 2LO1A 4XDLA 1I7FA 1BS3A 3T4DA 2V1DA 3ZMTA 1NR7A 5EC2C 1AP6A 1PL4A 3FFQA 2WLLB 3ZMUA 1GM8A 4D7SA 2IJJA 1KP2A 4PA7A 4Z1VA 5BR8O 1KKCA 3CCSV 3SJQC 5JCOC 5LOVB 2ZIOA 4KFMA 4I0XA 2ODMA 1TAEA 2LP7A 4PDRA 3S3XA 3C3TA 4B3MB 1BSMA 1VQ8V 3WB2A 4I4TB 3HKEB 1QNMA 1YVWA 1VQKV 4CS3A 2K9PA 4UCVA 3TGUH 4FIPC 1IX9A 2JRIA 4K0KO 4UB8Z 1GMGA 1M9NA 3DSQA 2AHYA 4DV1O 4DV6B 3LSSA 2ZD9A 1SQQH 1K92A 4JI1B 2GHYA 3CC2V 5CMUA 3U0ZA 1KB9F 1XDCA 1PL0A 1S5LZ 2ETNA 3UKMA 2YSUB 3BFRA 3W7TA 1GK9A 2E5LB 4WF9V 1FJGB 1B04A 4FLXA 2CH7A 4WFEA 2HJDA 3QO8A 2PZSA 4UV8A 4LWSB 3U11A 1XQ8A 1B06A 1EZVH 1BGYH 4IIJB 3DXRB 2HHHB 5H6RA 4I50B 2RDCA 4FZ1A 4EB6A 1Q86W 4GKJB 4I9WA 2OT5A 5L3BA 2F66C 2BOCC 4YJ3B 1SESA 4H44B 2AGAA 1SC5B 3JAWB 5EZYB 4XDJA 2OCCB 4EKWA 3JD2A 3I55V 2ARHA 1RM1C 2E74B 3ABLC 4QGPA 5IYBO 4JI2O 2YEVB 1YXBA 4P9OA 1UPGA 3RYCA 3TCUA 4K35A 5B3SB 2ZKOA 2QWQB 1AILA 2NN4A 4P30A 3A8TA 2MW2B 2JJ2G 1EN5A 3JARA 2FYUH 3SJCC 3ZN1A 3SPHA 5JQGB 3CD6V 3K59A 4JI3O 2WLHA 1MG1A 4DV4O 5KHKA 3JD1A 1UFIA 4OXSA 4IGGA 3B2EE 4MVZA 3RVYA 3ML0A 4GX2A 2EIJC 3GB7C 4K3AA 2CTPA 2JVDA 4PI0A 5A9GA 5L3CA 1RFYA 1K34A 4ICGA 3KG2A 2UUAB 3BHPA 2JGDA 4ZI7A 1YJWV 2ZT9B 1EBOA 1Q5OA 4AILC 4JZ2A 3WG7C 2VRZA 4DR2B 4X1YB 2NNUA 2R9IA 4TV9B 5CA1B 1K7DA 3Q4HA 4WBNB 5CBHA 1KKDA 4CH5A 2X6CA 2HKOA 1J5EO 3PN1A 2IJHA 4IYHA 3KKYA 3P32A 1AJNA 5IDJA 4O4HB 2XT9A 1K5QA 2DYSB 4GKKB 3RT3C 3CRQA 3K5LA 5KA5A 1IBKO 3MHSC 1PV0A 2EILC 5H2FZ 1EM1A 3CCEV 1HR0B 2W6IG 2O57A 3A0BZ 3OMNB 2JEXA 5J9PC
chains in the Genus database with same CATH topology
2ODMA 2NR5A 2GBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODM A;  2NR5 A;  2GBO A; 
#chains in the Genus database with same CATH topology
 3JSL A;  4JF3 A;  2DYR B;  2N05 A;  2ZE8 A;  4J11 A;  2BOB C;  5DM6 V;  4TOI A;  1AVM A;  1YF2 A;  3SPJ A;  5KAF Z;  4PDL A;  5IYD O;  1HNX O;  3W7U A;  1YTF B;  2IH1 C;  3JSN A;  4O4J A;  3UCS C;  2VS0 A;  2GUZ B;  3D36 A;  2FTK A;  5L3F A;  1HP8 A;  1VQN V;  4U3J A;  4FLY A;  4U7N A;  1VAR A;  4YXW G;  4ASU G;  1RPO A;  3CWB H;  3ZJZ A;  1JOY A;  4B08 A;  1S5J A;  2OYQ A;  4UVA A;  1Y74 B;  2OCH A;  2KKW A;  3CRC A;  3E89 A;  4FMT A;  2F43 G;  1YJ9 V;  1F23 A;  4X1I B;  1L0L H;  1NVP B;  4X64 B;  3OMI B;  1XI1 A;  1W59 A;  2UXC B;  3SPG A;  2WLI A;  4F6R A;  4Z2W A;  3AG2 C;  4X66 B;  1W0K G;  2ZIM A;  1QLN A;  3TXQ A;  3H9V A;  4MVU A;  4MS2 A;  2B5U A;  2HFE C;  1JA8 A;  3ASN C;  5CBF A;  4DR7 O;  3T1C A;  2CH7 B;  2X7R B;  3WB0 A;  1NH2 D;  2B9Z A;  3ZIA G;  2UU9 O;  5EK0 A;  2KG7 A;  3MDS A;  3GWO A;  4UCR A;  2IJK A;  1MOF A;  1RP3 B;  4JI7 B;  3G4S V;  1AB3 A;  1N36 O;  5KA6 A;  2PYL A;  3O65 A;  4TQD A;  1VMG A;  1JMK C;  2XHB A;  1QR9 A;  2PUS A;  4PA3 A;  1Z5W A;  4ZBM A;  1FXK B;  2VQE O;  1SQG A;  4JYY A;  4MW8 A;  1GRJ A;  3RBZ A;  3G6B A;  1QHT A;  4JYA O;  1MSW D;  2YXY A;  4JTD B;  4DK1 A;  1T5E A;  1H2M A;  1AI5 A;  1OCZ C;  2ZNJ A;  2Z0A A;  3JAR B;  1EN4 A;  5KX5 A;  2E75 B;  3RYH B;  3CRR A;  2UXD B;  1WNS A;  3ETQ A;  4DUY O;  3IFX A;  1F51 A;  2B1I A;  2JDI G;  1MA1 A;  3ZBH A;  4P2Z A;  1ZTE A;  3H1L H;  4D7T A;  2EIM B;  4XDK A;  3I56 V;  5LP6 A;  1EN6 A;  2AZ2 A;  2F93 B;  3T4Z A;  2XAQ A;  3HKB A;  3G80 A;  3HKD A;  3L72 H;  1KBH A;  4LC1 A;  1Q43 A;  1KEC A;  1OCC B;  2YUA A;  4IHJ A;  1NBM G;  1N32 B;  3L75 H;  1CP9 A;  3BCC H;  5BZB A;  4BWA A;  4DR6 O;  3T1Y B;  3AG4 C;  3BA9 A;  5LA6 A;  3DTU B;  4JV5 B;  1IUR A;  1SQF A;  4B7E A;  4LFB O;  3J81 N;  1Q6U A;  3E86 A;  1TVK A;  4DV3 O;  5D5Q A;  2BSK B;  4O4L B;  2QKC A;  4DO2 A;  2LW1 A;  2WAM A;  5LMU O;  2WPD G;  4OX9 O;  1TUB B;  4DR3 O;  4ZKI A;  1G1X B;  2IJI A;  4J9Y B;  2UXB B;  1AI6 A;  4BIO A;  2CGO A;  3CCR V;  2A7W A;  1JR9 A;  1U97 A;  3H1I H;  2QWO B;  1BT8 A;  4JI5 O;  2OCC C;  1IZ3 A;  3ABM B;  4UV9 A;  4H13 B;  5IWA O;  1R3K C;  1LUV A;  2KSD A;  1OCO B;  3L74 H;  5B3S C;  2AW9 A;  1VEW A;  4YY3 B;  1GAX A;  4N23 A;  4J42 A;  4O4I A;  3UO2 A;  4MT8 A;  2Q68 A;  5FL7 G;  5IY5 B;  4DV7 B;  5EIB D;  2P5O A;  1AJQ A;  4JI8 B;  3UT5 B;  4MTO A;  4X65 B;  4MVQ A;  1OJH A;  3MHH C;  2QWP B;  4MVR A;  4DUZ O;  2PYJ A;  2QWR B;  4LF7 O;  1D5A A;  1Y76 A;  4P9P A;  1YTF D;  1M1K W;  5BR8 B;  1HWY A;  2WLI B;  4CZZ A;  4F6R B;  2QWN B;  1M93 A;  2JJ1 G;  2QKA A;  3JCU Z;  5LBQ A;  3CCL V;  4NTX A;  5KMG A;  2VWK A;  1H8E G;  5EC1 C;  3B40 A;  3CXC U;  4IYI A;  4G2K A;  2XUM A;  1OV9 A;  4X1K B;  3OEE G;  1L0N H;  2EIK B;  2ADQ B;  1U96 A;  4CS2 A;  4MTG A;  3ZMS A;  4DV0 O;  5IYZ A;  2B1G A;  2KG7 B;  4NR1 A;  4LF9 O;  1YIT V;  1NVP D;  2RMK B;  4K0K B;  1GM7 A;  4PA6 A;  1W0J G;  1JJ2 U;  3CS5 A;  2YID A;  1NT2 B;  4DV1 B;  2Q7H A;  3EVK A;  4X88 A;  2Q5Z A;  3ETG A;  5DN6 G;  5J2U B;  1H2N A;  4LF4 O;  3LNM B;  1Y66 A;  2CTR A;  3QO7 A;  1HNZ O;  5EIB C;  4TV8 B;  4U7O A;  5LYJ A;  2QSA A;  4JI0 O;  4UVB A;  4HNA A;  1Q90 D;  3IAY A;  2DYR C;  3P3N A;  1I94 B;  1DLB A;  3CJH A;  1H8H G;  1ZLZ A;  4X62 O;  2OIE A;  2D2C B;  2P22 C;  3F7Y C;  1HNW O;  3QTC A;  4EFB A;  1R6T A;  2XAS A;  4JI4 O;  2DQ0 A;  3LDD A;  3ZRX A;  1O9H A;  3A2F A;  1ZUQ A;  5LP6 B;  4JI2 B;  4LFA O;  2P67 A;  3HKB B;  2A79 B;  1SZT A;  5L3E A;  2RCV A;  4A5U B;  3N2K A;  2ZR2 A;  3CCV V;  2L35 A;  4IHJ B;  5LGN A;  2Y69 C;  3RW0 A;  1DF4 A;  4FM0 A;  2Z3Y A;  1NR1 A;  1Q6H A;  2QM8 A;  4X89 A;  2EIN B;  2DMX A;  1B6Q A;  1MMM A;  3E8B A;  5HFM A;  2F4V O;  5LA6 B;  4GT1 A;  4JI3 B;  2AZ0 A;  5H5N A;  4DV4 B;  1RPR A;  2E76 B;  2G38 A;  5B1A B;  1JVM A;  1KQS U;  3K08 A;  2LGW A;  1NH2 B;  3ZRW B;  4PI2 A;  1IDS A;  3UQ8 A;  2N74 A;  4Q20 A;  2R9A A;  4GCZ A;  2HP8 A;  1VP7 A;  3H1J H;  1WA8 A;  2UUB O;  4X8A A;  3F7V C;  1ENV A;  4QJF B;  1ZL8 A;  5IJ0 B;  2H8P C;  2GSM B;  3GWK C;  4HAM A;  5A2Q N;  1IXM A;  1QLE B;  3O9O A;  4JI6 O;  5ITZ A;  3ZHR A;  4X20 B;  1XNR B;  3W7X A;  3ZHT A;  1P49 A;  3E35 A;  1FXK C;  4I7Z B;  4PA9 A;  4AHC A;  4LF8 B;  1SS3 A;  2ZDI C;  1I0H A;  4WFB V;  4NVP A;  4KL1 A;  4UUJ C;  1V9P A;  2GBO A;  4MVO A;  3JAS A;  1I5X A;  2GV9 A;  1JCH A;  1NQT A;  1J5E B;  2QTO A;  2W0X A;  3M99 B;  3FAV A;  1AI7 A;  1D5N A;  1SQB H;  3K06 A;  2Y0P A;  2OTJ V;  4HZ3 A;  2YIA A;  3CMA V;  2JS5 A;  4O4I B;  1IBK B;  4J9Z B;  5GTI Z;  3E8G A;  5FPR A;  2ZE7 A;  2BE3 A;  4JAA A;  5CB4 B;  4JTA B;  2LJ2 A;  3OTF A;  1FFT B;  1L1F A;  4WFH A;  1I08 A;  1P7G A;  2WA3 A;  1ARO P;  4PD4 F;  3RN4 A;  1L8D A;  4PEL A;  2EIM C;  4LNU B;  1PNL A;  4B7K A;  4FLT A;  4BIZ A;  1Y76 B;  1M56 B;  5JJJ B;  3N27 A;  4RO2 A;  4DRX A;  5J2T A;  1OCC C;  2ZM6 O;  2ATK C;  3BA8 A;  3H01 A;  4YJ2 A;  5KLV H;  3OUF A;  4DV2 O;  3STZ C;  2DW4 A;  5GTH Z;  2QGN A;  4WFF A;  2XAF A;  3BPZ A;  3FB8 C;  3BAA A;  2FML A;  1PD3 A;  1FAF A;  2CGN A;  5IYZ B;  3B8N A;  3FYI B;  4DV5 O;  3B09 A;  4CS4 A;  3RFR A;  5C8Y A;  3FD9 A;  1FYJ A;  4DYL A;  5GON B;  2P4V A;  3BY6 A;  5L3D A;  3RYF A;  2UXX A;  1Q82 W;  1OHH G;  4JYC A;  3K3W A;  4FLW A;  4DR7 B;  2A06 H;  1SZX A;  1NTM H;  4ZIB A;  3LSQ A;  5JH7 A;  1MZE A;  2PTM A;  4DXW A;  3OMA B;  2P90 A;  3J80 N;  5LYJ B;  2XOK G;  2R70 A;  2FL4 A;  3ABM C;  4CH6 A;  4Q6G A;  1N36 B;  1PNK A;  4UCT A;  1R3I C;  3ZS8 C;  1UJW B;  3CJH B;  5EBL C;  1OCO C;  3OW2 U;  2Y4T A;  2DN9 A;  4XBF A;  2YXL A;  1WJZ A;  4NB5 A;  2YXH A;  1DK1 A;  2Q7E A;  3D36 C;  1NKD A;  4JYA B;  2WLJ A;  3SYP A;  4J41 A;  2V4D A;  3LUT B;  1YI2 V;  3N2K B;  3JAL A;  3D3Q A;  5B5E Z;  1OCR B;  2WLM A;  3TXS A;  2IBZ H;  1FFX A;  4I0X B;  2UUC O;  3GVM A;  3HKC A;  4FFB A;  4TUY A;  3ZRV A;  3WU2 Z;  1PPJ H;  1QVF U;  4DUY B;  4H0L B;  1SET A;  3ASO B;  1F7Y A;  3ABK B;  5E79 Z;  4RWU A;  5IT9 N;  1E1Q G;  1VQ7 V;  2YIC A;  1VQ9 V;  4UCS A;  3AEI A;  1V54 B;  1MNG A;  4GUN A;  3ZED A;  2IM9 A;  1HDJ A;  2QA4 V;  1US6 A;  3QVN A;  4TWK A;  2CE4 A;  2W6J G;  2WWW A;  1ZL8 B;  4KP4 A;  2EIK C;  3LNN A;  4YHH O;  3ZHU A;  4LF5 O;  2MK3 A;  4PDV A;  1GN2 A;  2QDO A;  1XIL A;  3ABU A;  3OD4 A;  1XMQ O;  3OTO O;  4DR6 B;  1S5H C;  1K97 A;  2CDY A;  1HW7 A;  1GN4 A;  4DR2 O;  3APO A;  3B77 A;  4E4E A;  1A32 A;  1R1B A;  1VQP V;  3C3S A;  3CHX A;  4DV3 B;  4RQF A;  1R6N A;  2EBO A;  1ZX3 A;  3JD0 A;  5E1A C;  4EB6 B;  3FKS G;  1NJI W;  1P7B A;  5CA0 A;  4FK5 C;  1N33 O;  3JCZ A;  3JD3 A;  5IYC O;  3M7M X;  1WB7 A;  4OX9 B;  2BTO A;  1K4D C;  2PF4 E;  1JJO A;  4DR3 B;  3LDC A;  3RYC B;  1V55 C;  3OEH G;  2BTQ A;  3TK1 A;  2ZXW B;  4K8X A;  2H94 A;  4BW9 A;  4JI5 B;  3R65 A;  1XL4 A;  1IBM B;  1ZAU A;  5IWA B;  1WP8 A;  5KHG A;  4PDM A;  1FXV A;  2GDS A;  4DRX B;  4GZR B;  5J2T B;  2RQ6 A;  4ZOL A;  1R3J C;  3AG7 A;  5BMV A;  4J80 A;  4LF6 B;  5IJ9 A;  3QNE A;  3IC9 A;  4KHP O;  3AK2 A;  4YIO A;  1BCC H;  2EIN C;  4LFC O;  1YCI A;  2JGD B;  4JTC B;  4ZI7 B;  1XL6 A;  1URF A;  5B1A C;  4NXN B;  4NXM O;  2EUL A;  3SPC A;  4DR1 O;  3CRM A;  4LF7 B;  4DR5 O;  5LHI A;  5C8Y B;  2UXC O;  1IBL O;  2P7T C;  1VF6 C;  5EBM C;  3B4S A;  1KU9 A;  3Q4H B;  4FPP A;  3L70 H;  3B8M A;  1K4C C;  1WLE A;  3ZX6 A;  3RYF B;  3JAM N;  4JGS A;  1S0V A;  1N8R W;  5DED A;  3K5N A;  2NLJ C;  4B3S O;  4B3R B;  1Y6X A;  1BQ0 A;  2C2A A;  1XMO B;  4DV0 B;  2HJF C;  2ILM A;  4B3T O;  1K73 W;  4UCO A;  2AXT Z;  4JI7 O;  1H2S B;  4R7C A;  2QM4 A;  2PGG A;  3K03 A;  3IC7 A;  5JVD A;  3WG7 B;  1AI4 A;  3LDE A;  2YIB A;  3ETD A;  1GTO A;  3ZHS A;  4CC5 A;  3BVO A;  3QF7 A;  4FJC C;  5CBG A;  3CCU V;  4H37 A;  5C93 A;  4F6E A;  2Y4U A;  3ICX A;  1KYO F;  4CBC A;  1RSO A;  5L3G A;  2JGU A;  2XAH A;  5K1X A;  3L73 H;  2Q4P A;  1HNZ B;  3E8H A;  1CPY A;  4C7U A;  4O4J B;  3K79 A;  4X9Q A;  1YJN V;  4IIJ A;  1FFX B;  3AK3 A;  4JI0 B;  3CE2 A;  4I50 A;  3HKC B;  2EX3 A;  4TUY B;  4U3J B;  2EIL B;  3CX5 F;  4GX0 A;  1XNQ B;  1M56 C;  4YJ3 A;  4X62 B;  2VQF O;  2D3O W;  5H9C A;  3SYA A;  5CA3 A;  1HNW B;  3N2G A;  5FPO A;  3CYO A;  4JI4 B;  3BAB A;  1R73 A;  2YEV A;  4EFE A;  2QKS A;  2XAJ A;  4LBE C;  4LFA B;  4LH6 A;  2IU0 A;  3RWR D;  4LR3 A;  4CC6 A;  4AQY O;  1DGS A;  1TUE B;  1PP9 H;  3F5W C;  2YDE A;  1H2L A;  4I9Q A;  1WAZ A;  1FXH A;  1Z2G A;  3T1Y O;  1KUQ A;  1N0J A;  2M6Y A;  3K9A A;  2F4V B;  2DJV A;  1Q81 W;  1BHB A;  1K8A W;  4Z1M G;  2HR3 A;  4RAI A;  1S72 V;  3APQ A;  1BHA A;  3K5O A;  3E8F A;  2N04 A;  3ZHV A;  2AHZ A;  3T1H O;  3CME V;  5CA0 B;  4MTF A;  2UUB B;  5KAI Z;  4LCU C;  3JAK A;  2DYS C;  4QIW F;  4J10 A;  1Y4M A;  3IGA C;  2DWE C;  3D8C A;  5B1B B;  3SJB C;  4ZHQ A;  4JI6 B;  3ASN B;  4WFA V;  2EZO A;  1N4C A;  2Y48 A;  2BTQ B;  1KP3 A;  4KXR A;  1FKA O;  1THZ A;  4TV9 A;  4WBN A;  5FNV A;  4H33 A;  2EZP A;  5LMN O;  3ABT A;  1ROP A;  5KX5 B;  4NKG B;  3MD0 A;  4CH3 A;  3OR7 C;  2EJ7 A;  4JAV A;  3VBB A;  4YY3 O;  2F1M A;  1OCR C;  1S76 D;  1LNQ A;  3I5D A;  4ZOL B;  1BMF G;  2CUG A;  2FB5 A;  1R3L C;  2HLD G;  1EFR G;  3H1K H;  4TQF A;  1GN6 A;  3P30 A;  3OGI B;  2DWD C;  4TSF G;  5BMV B;  4DR4 O;  5IJ9 B;  4UCU A;  3HKD B;  2ITC C;  2QEX V;  4MVS A;  2LW7 A;  3AG3 B;  2R9R B;  3ASO C;  4JI8 O;  2WLN A;  4X65 O;  3ABK C;  2UXN A;  5IE9 A;  3G67 A;  3KCX A;  4L87 A;  3EXA A;  4FFK A;  1V54 C;  1G6U A;  4MTX A;  3X2Q B;  1VQO V;  1MAB G;  1QR8 A;  4IT5 A;  1G8M A;  1S3J A;  4JZG A;  2ZM6 B;  1BQZ A;  4GX1 A;  2ZIN A;  5KUM A;  1TVK B;  5BY1 A;  1K9M W;  2GUZ A;  4GX5 A;  1AR4 A;  1KC8 W;  4DV2 B;  2ZE6 A;  2HG5 C;  1QVG U;  2XTA A;  3E22 A;  2V7Q G;  3CCM V;  4G28 B;  3OE7 G;  1M5I A;  5JCO A;  3BRC A;  4AI8 A;  1N34 O;  3HB3 B;  1EZJ A;  1Y74 A;  1I5Y A;  1ZWI C;  3AG4 B;  3OGC C;  1AR1 B;  4DV5 B;  4X1I A;  2HVK C;  5JVD B;  1DF5 A;  2IH3 C;  3E83 A;  1CEZ A;  3DC5 A;  1KMI Z;  2P06 A;  5JJE B;  2ZR3 A;  2F95 B;  2P4K A;  3JAT A;  4N21 A;  2RNB A;  3WFV A;  1Q8I A;  1H38 A;  1NZ6 A;  2BCC H;  3A0R A;  4PA4 A;  1RSO B;  1WPB A;  2ZXW C;  3RYI A;  1JX9 A;  1Q3E A;  2X6B A;  3DGE A;  4QNH B;  2ZE5 A;  4R6Z A;  1H2G A;  1I94 O;  1AJP A;  5KHI A;  1Y67 A;  3ZMV A;  3QO5 A;  3TJT A;  1FXK A;  2OTL V;  2ZDI A;  4OGQ B;  3SDL A;  1IXB A;  3FB7 C;  3N2G B;  1SA0 A;  4DK0 A;  2QR4 A;  1M57 B;  3CC4 V;  4BIU A;  2PI5 A;  2PI4 A;  3FX7 A;  1YHQ V;  3D3I A;  2JEU A;  3SR2 C;  4CH4 A;  1HNX B;  3SPI A;  3CPW U;  2EJR A;  1VQ6 V;  1VIB A;  1MSD A;  3OAA G;  5KMG B;  2K1E A;  4B3M O;  2UUC B;  5EYP A;  4NYK A;  3RYH A;  5B66 Z;  3SYO A;  2DQ3 A;  3ETE A;  1JPX A;  1NTZ H;  2LQT A;  2LFS A;  1YIJ V;  4FLZ A;  5B1O A;  4I55 A;  2JS3 A;  1JFF A;  4MW3 A;  1G4Y B;  1Z5V A;  2H3O A;  3G6E V;  3K0D A;  4UVC A;  1X4T A;  5D5P A;  3W7W A;  5KHJ A;  2DOS A;  1E1R G;  4DV6 O;  1XOU A;  4ABM A;  2CTQ A;  4JI1 O;  1TA8 A;  3JAK B;  4YHH B;  4RUE A;  4YIP A;  2GTS A;  4LF5 B;  2HVJ C;  4J7Z A;  4ZHQ B;  1XNR O;  2E5L O;  1VQ4 V;  1XMQ B;  1FJG O;  1CXZ B;  3OTO B;  3OR6 C;  2ITD C;  3ZMZ A;  2Y0I A;  2PY5 A;  4JPR A;  4MSW C;  2WA4 A;  2A3Q A;  4LF8 O;  2CAZ C;  2M7W A;  2UU9 B;  3K9S A;  2GTA A;  1YZB A;  2HHH O;  3OM3 B;  4FLV A;  5FNV B;  1NI8 A;  2IU3 A;  4HNA B;  1KD1 W;  2BSK A;  4O4L A;  5LXT A;  1SRY A;  2RN9 A;  3THO A;  5BXZ A;  3WB1 A;  4GKJ O;  1N33 B;  2ZNI A;  4FLU A;  3ZN0 A;  2VQE B;  4G27 B;  1PNM A;  5JJN B;  4UFZ A;  1GM9 A;  3C90 A;  1GKF A;  1TUB A;  4PHZ A;  3LSU A;  4KUM A;  5IY5 C;  4O2A A;  2IW5 A;  4GYC B;  3AG1 B;  2P6J A;  2X0L A;  1E79 G;  3IJ4 A;  3QG5 A;  1K33 A;  3K04 A;  4TT3 G;  2HEP A;  1XBL A;  4I5S A;  3H1H H;  4BR6 A;  1VF7 A;  2CTW A;  3G71 V;  4IL6 Z;  1F4M A;  2Q6A A;  4O2B A;  1SF9 A;  1GO3 F;  1WN7 A;  1BZK A;  4KHP B;  1JQ0 A;  4QE9 A;  1WA8 B;  2DE0 X;  3E22 B;  2UUA O;  2RJZ A;  4LFC B;  3NXS A;  2Y69 B;  3K58 A;  3UT5 A;  1IVS A;  1PKX A;  3TET A;  3F5T A;  3SJA C;  2LGQ A;  4NXM B;  5ITZ B;  2OWO A;  1XRE A;  1BE3 H;  2QJ1 A;  1W2B U;  2CK3 G;  3KZI Z;  4DR1 B;  4DR5 B;  2ZQM A;  4LFB B;  3SYC A;  3ZRS A;  1IBL B;  3JAT B;  1K5S A;  1WB8 A;  3E2E A;  5GW7 A;  5B1B C;  3JAS B;  1YDX A;  3P3P A;  3CCJ V;  1O9G A;  4D6T H;  4J7K A;  5FLX N;  4X1K A;  3FAV B;  4GKK O;  4B3S B;  5LMU B;  2NR5 A;  3RYI B;  2Q67 A;  4R8C A;  2L6L A;  3JYC A;  3L9D A;  4B3T B;  1XUQ A;  3FYE B;  4JAU A;  1HR0 O;  2JK5 C;  1QU7 A;  4PJ0 Z;  2YIB D;  2X6A A;  2VWJ A;  2KB1 A;  2A9H A;  3J7A U;  1SQP H;  1H2K A;  2KQX A;  3STL C;  1SA0 B;  3L71 H;  3K57 A;  5LP6 C;  3RVZ A;  5J2U A;  3ZHQ A;  3AG3 C;  3VQX A;  1RM1 B;  4YJ2 B;  4TV8 A;  1NTK H;  3ABL B;  3W7S A;  1VF5 B;  1P4R A;  2FKX A;  1AP5 A;  5LGU A;  1SER A;  5EYP B;  2JIZ G;  1XHX A;  2QE7 G;  3MAQ A;  1GH6 A;  1WPX A;  3X2Q C;  4QPK A;  4EEQ A;  1VQL V;  2VQF B;  4I55 B;  3DC6 A;  3ZCC A;  1NS1 A;  1JFF B;  1AR5 A;  1NU1 H;  3VQV A;  1DTO A;  3HR0 A;  4HBN A;  4DUZ B;  4MVM A;  4J7J A;  1MZF A;  2WLL A;  1QQC A;  4X64 O;  4GLX A;  2WSS G;  1M90 W;  4AQY B;  2ADP A;  1N0N A;  4QE7 A;  2YS8 A;  5LOV A;  4X66 O;  2Q8V A;  3U10 A;  2EIJ B;  3CC7 V;  1QLE C;  4K8Z A;  2Q9L A;  4I4T A;  4RQE A;  3SYQ A;  3HKE A;  2A0L A;  4FVM A;  2WLK A;  5JH7 B;  4OPH A;  4LH7 A;  1ZSP A;  1FD9 A;  2QM7 A;  5TIS Z;  3BEH A;  1FPO A;  1YEW A;  3ZRW A;  1Q6I A;  4LF9 B;  5LHG A;  5LXT B;  5LL6 Y;  1QCE A;  3VOU A;  3T1H B;  3CP1 A;  4UXN A;  3R66 A;  2R72 A;  1VF6 A;  5IJ0 A;  2Q7G A;  1B3Q A;  1P84 F;  5CN0 A;  3JD4 A;  4X20 A;  4QPJ A;  3S3W A;  2OIG A;  3KCY A;  4JYB A;  4LF4 B;  3CRA A;  4O2A B;  1OZ0 A;  4U3F H;  3JAL B;  4LWS A;  2Q0A A;  1SQV H;  1LUW A;  3DXR A;  5EBW C;  3CSX A;  3FB6 C;  1IBM O;  4FFB B;  4W4L A;  5LMN B;  4R50 A;  2UXD O;  1M57 C;  2Q69 A;  1S77 D;  1M4U A;  4E2L A;  3RGB A;  1Q7Y W;  1R6K A;  3SGI A;  2XND G;  3JAW A;  5EZY A;  1BL8 A;  3CB2 A;  4DW0 A;  4HYO A;  3UO3 A;  4OPA A;  3CEI A;  3OUS A;  4W4K A;  4RUF A;  1K3E A;  4FM2 A;  1X59 A;  4O2B B;  2W0F C;  4LF6 O;  3AK1 A;  3OFN G;  4DR4 B;  5JWP A;  1TGO A;  5HFL A;  1QBZ A;  1XEQ A;  4BAY A;  5CB4 A;  5K1P A;  5KHH A;  5LHH A;  4JAS A;  1N32 O;  3NR7 A;  1VQ5 V;  4F4L A;  1XHZ A;  4NXN O;  2LFR A;  4FZ0 A;  5B1N A;  3PJS K;  4LNU A;  3K5M A;  1SKV A;  5JQG A;  1COW G;  4LP8 A;  1J95 A;  3EHB B;  4JV5 O;  4PV1 B;  3UM7 A;  3VQW A;  3HPL C;  3T2M A;  3EFF K;  4WFG A;  1ORQ C;  1FS0 G;  2F23 A;  4B3R O;  3AG2 B;  1PM9 A;  1N34 B;  5F2V O;  4NTY A;  3OT7 A;  5LGT A;  1WP7 A;  1XMO O;  3CCQ V;  2UXB O;  3FB5 C;  1VQM V;  2XAG A;  3M8A A;  2Z5U A;  4X1Y A;  5H6Q A;  5CA1 A;  2E3C A;  5GON A;  1SQX H;  3A0H Z;  1GN3 A;  5AG2 A;  4NTW A;  2YI9 A;  3CXH F;  4UB6 Z;  5DEC A;  4DW1 A;  4O4H A;  4FM1 A;  4WCE V;  3K0G A;  4BW5 A;  1V55 B;  3AG1 C;  3VQY A;  4DV7 O;  1D2D A;  1XNQ O;  1F4N A;  2ZCE A;  1OCZ B;  1LR1 A;  4L8J A;  2Q73 A;  1YSC A;  2QTS A;  2YC0 A;  2Q0O C;  5KUK A;  2YI8 A;  2LO1 A;  4XDL A;  1I7F A;  1BS3 A;  3T4D A;  2V1D A;  3ZMT A;  1NR7 A;  5EC2 C;  1AP6 A;  1PL4 A;  3FFQ A;  2WLL B;  3ZMU A;  1GM8 A;  4D7S A;  2IJJ A;  1KP2 A;  4PA7 A;  4Z1V A;  5BR8 O;  1KKC A;  3CCS V;  3SJQ C;  5JCO C;  5LOV B;  2ZIO A;  4KFM A;  4I0X A;  2ODM A;  1TAE A;  2LP7 A;  4PDR A;  3S3X A;  3C3T A;  4B3M B;  1BSM A;  1VQ8 V;  3WB2 A;  4I4T B;  3HKE B;  1QNM A;  1YVW A;  1VQK V;  4CS3 A;  2K9P A;  4UCV A;  3TGU H;  4FIP C;  1IX9 A;  2JRI A;  4K0K O;  4UB8 Z;  1GMG A;  1M9N A;  3DSQ A;  2AHY A;  4DV1 O;  4DV6 B;  3LSS A;  2ZD9 A;  1SQQ H;  1K92 A;  4JI1 B;  2GHY A;  3CC2 V;  5CMU A;  3U0Z A;  1KB9 F;  1XDC A;  1PL0 A;  1S5L Z;  2ETN A;  3UKM A;  2YSU B;  3BFR A;  3W7T A;  1GK9 A;  2E5L B;  4WF9 V;  1FJG B;  1B04 A;  4FLX A;  2CH7 A;  4WFE A;  2HJD A;  3QO8 A;  2PZS A;  4UV8 A;  4LWS B;  3U11 A;  1XQ8 A;  1B06 A;  1EZV H;  1BGY H;  4IIJ B;  3DXR B;  2HHH B;  5H6R A;  4I50 B;  2RDC A;  4FZ1 A;  4EB6 A;  1Q86 W;  4GKJ B;  4I9W A;  2OT5 A;  5L3B A;  2F66 C;  2BOC C;  4YJ3 B;  1SES A;  4H44 B;  2AGA A;  1SC5 B;  3JAW B;  5EZY B;  4XDJ A;  2OCC B;  4EKW A;  3JD2 A;  3I55 V;  2ARH A;  1RM1 C;  2E74 B;  3ABL C;  4QGP A;  5IYB O;  4JI2 O;  2YEV B;  1YXB A;  4P9O A;  1UPG A;  3RYC A;  3TCU A;  4K35 A;  5B3S B;  2ZKO A;  2QWQ B;  1AIL A;  2NN4 A;  4P30 A;  3A8T A;  2MW2 B;  2JJ2 G;  1EN5 A;  3JAR A;  2FYU H;  3SJC C;  3ZN1 A;  3SPH A;  5JQG B;  3CD6 V;  3K59 A;  4JI3 O;  2WLH A;  1MG1 A;  4DV4 O;  5KHK A;  3JD1 A;  1UFI A;  4OXS A;  4IGG A;  3B2E E;  4MVZ A;  3RVY A;  3ML0 A;  4GX2 A;  2EIJ C;  3GB7 C;  4K3A A;  2CTP A;  2JVD A;  4PI0 A;  5A9G A;  5L3C A;  1RFY A;  1K34 A;  4ICG A;  3KG2 A;  2UUA B;  3BHP A;  2JGD A;  4ZI7 A;  1YJW V;  2ZT9 B;  1EBO A;  1Q5O A;  4AIL C;  4JZ2 A;  3WG7 C;  2VRZ A;  4DR2 B;  4X1Y B;  2NNU A;  2R9I A;  4TV9 B;  5CA1 B;  1K7D A;  3Q4H A;  4WBN B;  5CBH A;  1KKD A;  4CH5 A;  2X6C A;  2HKO A;  1J5E O;  3PN1 A;  2IJH A;  4IYH A;  3KKY A;  3P32 A;  1AJN A;  5IDJ A;  4O4H B;  2XT9 A;  1K5Q A;  2DYS B;  4GKK B;  3RT3 C;  3CRQ A;  3K5L A;  5KA5 A;  1IBK O;  3MHS C;  1PV0 A;  2EIL C;  5H2F Z;  1EM1 A;  3CCE V;  1HR0 B;  2W6I G;  2O57 A;  3A0B Z;  3OMN B;  2JEX A;  5J9P C; 
#chains in the Genus database with same CATH homology
 2ODM A;  2NR5 A;  2GBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...