2GBOA

Protein of unknown function ef2458 from enterococcus faecalis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
MDEGISKKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0358 protein EF2458
publication title X-ray crystal structure of conserved hypothetical protein EF_2458 from Enterococcus faecalis.
rcsb
source organism Enterococcus faecalis
total genus 31
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07408 DUF1507 Protein of unknown function (DUF1507)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2gboA00
2ODMA 2GBOA 2NR5A
chains in the Genus database with same CATH superfamily
3ZHRA 3E2EA 2JJ1G 3KCXA 4JI0O 1EN6A 1HNXO 3CCRV 1H2LA 3K57A 4X1KA 1SZTA 1XNRB 2R9AA 1MOFA 3CCUV 1SA0A 5H2FZ 1VQOV 1WP8A 4PDMA 5D5QA 1WJZA 5LYJA 2CGOA 5EBWC 5LMNO 1I08A 4WFBV 2LW7A 3APOA 2PGGA 3G80A 3K9SA 5IYBO 3T4ZA 1ZAUA 1M56B 1RP3B 1VIBA 4UUJC 1XBLA 2ZIOA 1XUQA 3CJHA 4YJ2B 3OW2U 2KSDA 1K7DA 2F43G 3HKCA 2HLDG 3W7WA 4I4TB 3JAMN 2VQEO 2CTWA 4FLVA 3RVZA 1HNZO 4GT1A 1K97A 1US6A 1Z5WA 4PDVA 1R3KC 3I55V 4DV5B 2B5UA 5KHKA 2QJ1A 4B3SB 3Q4HA 5H5NA 3OR6C 4LF4B 2M7WA 1W0KG 4UCRA 3J80N 4P2ZA 4F6RA 3ABKC 4FMTA 2Q8VA 1KUQA 1KKCA 4CS4A 2A79B 2W6JG 3RYHB 4DR3O 1ZLZA 4LCUC 3UCSC 3EXAA 4FLYA 4FM1A 2EIJC 3N2KA 1K34A 1L8DA 2WLIA 1V55C 1YXBA 4TV8B 1KYOF 2MK3A 3JD0A 3DXRA 3H1LH 2CAZC 2DYRC 3K79A 2IJHA 2EINB 4L8JA 2XHBA 2OCCB 1FS0G 3D36C 3ASNC 1LUWA 2XOKG 2CTQA 2EJ7A 1GRJA 1Q3EA 1XNQB 4B3RB 1PL0A 1IDSA 5CBHA 2RN9A 2V1DA 2LFRA 3OTOB 2ZE8A 4G28B 4FK5C 3BFRA 1U96A 1YHQV 3STLC 2BE3A 1I7FA 4IHJA 4W4KA 2QWOB 2E75B 4O4IB 4DUYB 3A0RA 1R3LC 4YJ3A 4GCZA 5IYZB 1YI2V 5IJ0A 4FFKA 4DR2B 1K4DC 4NXNO 3IGAC 1NR1A 4KFMA 1QHTA 2LJ2A 1SERA 3CE2A 4J7KA 3JD2A 3HPLC 3L71H 5CA0B 3ETDA 4KHPO 4LWSA 3THOA 4X65B 3ABUA 2ETNA 3OD4A 3M8AA 4WFFA 1SQPH 2Q5ZA 4QJFB 3KCYA 3L9DA 1AP5A 3PN1A 4TUYA 3JATA 1MSDA 2YSUB 1ZTEA 2QGNA 2Y69B 4BW9A 3LDCA 4LF6O 4PA9A 5JCOC 4JI7B 4PV1B 4TT3G 5E79Z 1SETA 3AG4C 1PL4A 3JAWB 4PA4A 5ITZB 4YY3O 5C8YB 3SPCA 3ZMVA 3RN4A 4LFCO 3K03A 4DV2O 4DV1O 1VQ6V 2KG7A 4JI8B 2ZE5A 3KKYA 2ZNJA 3RYFB 1NT2B 3IJ4A 4QPKA 1FYJA 1KQSU 1P7GA 3OMNB 4MSWC 2F93B 5LL6Y 1CP9A 3L72H 1F4MA 1SS3A 4C7UA 5GTHZ 1IURA 3VQYA 3E22B 5BMVA 2F23A 5CB4B 4MVSA 4LFBB 3C3SA 4DV0O 2NR5A 2UUAB 1B3QA 4XBFA 2NNUA 4LF7B 1M4UA 4X20B 1TA8A 4X1IB 3S3XA 3CXHF 2R9RB 4DK0A 1PD3A 3L75H 2FYUH 1NU1H 2WA3A 1NVPD 4G2KA 3ZS8C 4WFEA 4OPHA 1JJOA 1AJNA 5GTIZ 3CC2V 4Q6GA 1AP6A 2UXBB 5FNVA 2ZQMA 5BXZA 3AK1A 4UXNA 1XHZA 2GTSA 2VS0A 1ZX3A 4PELA 4MW3A 1N33B 2Z5UA 1MSWD 3IC7A 4K8ZA 1M1KW 5EYPB 1V54B 1FXKA 3OM3B 4EFBA 3R65A 4DUZO 3E35A 5IWAB 2WSSG 1KB9F 2Z3YA 3QF7A 4JYYA 3IFXA 3CEIA 4I55B 4FLUA 4FZ1A 2EIMB 4J7JA 2AW9A 1SRYA 5EK0A 3ZEDA 1AJQA 5CA1B 1N36B 1FXHA 3P30A 2ZDIA 4HAMA 3ZHTA 3ZRWA 4EKWA 5H6QA 4G27B 2YIBA 4FLTA 2HHHB 3UO2A 4J9ZB 1H2KA 1I5YA 3OFNG 4FFBA 1VQKV 2PYLA 5B3SB 1Q82W 2YC0A 3JARB 4PDLA 3B09A 4B08A 1S76D 4RUFA 3FB5C 2ZE7A 1IXMA 1VQ5V 2N05A 4DR6B 4JASA 3LNMB 3CC7V 2L35A 1IZ3A 4KXRA 4RQFA 4X8AA 1WAZA 4WF9V 4O4HA 3ZHVA 1EZVH 3A8TA 1S5JA 4J80A 1SQGA 3WG7B 2P67A 5B1BC 5KUMA 4A5UB 1BMFG 2ZXWC 1QQCA 3ZMUA 1PKXA 4MW8A 1OCZB 3RWRD 1N34O 2F4VB 3JAKA 2A3QA 1HNWB 3EHBB 2F95B 4O2BB 5KAFZ 4HBNA 3NXSA 3T1CA 1YJWV 2R70A 4LC1A 1O9HA 2BSKA 5IE9A 4NYKA 2LP7A 1R6NA 1SC5B 5F2VO 4O2AA 4X64O 4UB6Z 3AG7A 1GO3F 2AGAA 4TV9B 2YXYA 1WPBA 1YEWA 1AILA 3OGCC 1AI7A 2Q7GA 1F4NA 3T1HB 4I9WA 1FKAO 4JI3B 3T2MA 5KAIZ 1KC8W 4UCVA 1K4CC 1VQ9V 2QEXV 2QSAA 5LHIA 4QPJA 1I94B 4MVUA 3OEEG 1P4RA 1L0LH 3B8MA 3FAVB 4ASUG 2X0LA 3G6BA 3E89A 4HNAB 1AVMA 4I4TA 1IBMO 4DR7B 3WB1A 3RGBA 1QCEA 4D7SA 2ODMA 5BZBA 1W59A 5H9CA 4FJCC 2UXDO 4DV7B 3QVNA 3CCQV 2P06A 2Y4UA 2YIDA 4RUEA 2FKXA 4UVCA 3JSLA 2DJVA 2Q4PA 5B1AB 2QA4V 3RYHA 4ZKIA 4JZ2A 4MVRA 3X2QC 2Y0IA 4FIPC 2X6CA 3D36A 3C90A 5IYDO 4JF3A 4XDJA 4HZ3A 1Q7YW 1VP7A 4DR5B 4TV8A 4L87A 2ZD9A 1YDXA 1QVGU 3LSUA 2N04A 3QG5A 4I0XB 4QE9A 2P6JA 2QWNB 3JALB 5JJJB 3RT3C 5LOVB 3JCUZ 1FXKC 5FPRA 4WBNB 4EEQA 1NTKH 1FFTB 3CMEV 4JI2B 5BR8O 3IAYA 3I5DA 2D2CB 1EZJA 2Q68A 4ZI7B 1AI5A 2QKSA 4CBCA 4DR4B 1SZXA 1NJIW 2ZDIC 1OCRC 1OZ0A 2P5OA 4PI2A 3G6EV 4DV4B 1HNZB 3VBBA 5TISZ 4NXMO 4O4IA 3WB2A 5FPOA 5L3GA 2G38A 1KECA 2UUBO 5IYZA 2Q0OC 2QKCA 5DECA 5KHHA 2LFSA 2NN4A 1W2BU 1DGSA 2OYQA 5CA0A 4CS3A 5JCOA 1G6UA 5EIBC 4DR3B 1ZUQA 2GV9A 3P32A 3SYOA 2P22C 4OPAA 1IBLB 4ZOLA 2UU9B 1XMQO 3B8NA 1K92A 1FJGO 2EBOA 3DGEA 2PYJA 1SESA 4YHHO 3F5TA 4B3MO 4UVBA 1MZEA 1VQMV 1RM1C 3AG1B 3DTUB 3JAWA 5ITZA 3TCUA 5C8YA 2Z0AA 4K0KB 2BSKB 1JVMA 4X1YA 1J5EO 5CA3A 1M5IA 1W0JG 2IH3C 4YIOA 3RYFA 1V9PA 1GN6A 2X6BA 1Q8IA 2Q67A 2B1IA 2H94A 2DWEC 3QTCA 1G8MA 2CTRA 3KG2A 4QNHB 4JI5O 3E22A 5CB4A 2Y0PA 4TSFG 4IT5A 3W7XA 2ZKOA 2AHYA 2IU3A 2YEVB 4X62O 2IW5A 4DV6B 1H38A 1JR9A 4X20A 4X1IA 3ASOB 2Q7EA 1SQVH 1URFA 4CS2A 3A2FA 4BIZA 4PA3A 1VF7A 3UT5B 1YITV 3ETQA 1R1BA 3HKDB 1M56C 4KUMA 4X88A 4JTDB 2OTJV 1N0JA 3P3NA 4GKJO 1WNSA 1OCOB 1K3EA 2ITCC 2DW4A 3E83A 2OCHA 4IYIA 1VEWA 5LHHA 2PY5A 3RVYA 4UCTA 1JPXA 3L74H 3ZJZA 5EYPA 2Q9LA 4YY3B 2CE4A 2QWRB 3TK1A 4LF5O 5EC1C 1JFFB 4OX9O 3ZRSA 4DV1B 1HDJA 4Q20A 1N32B 3PJSK 2XAGA 3QO7A 2WWWA 5LA6B 4I55A 2KKWA 1YCIA 2ZR2A 3BEHA 4ZHQB 2YIBD 5L3BA 5CA1A 3N27A 2BOBC 1JOYA 4LF8B 4AI8A 4NKGB 4PA7A 2N74A 4OXSA 1P84F 3FKSG 4U3FH 1PNKA 5DM6V 1VQLV 3CCVV 5EIBD 4DV0B 1LUVA 3J7AU 2YUAA 1S0VA 1GM7A 1BZKA 2RCVA 4J9YB 2VQFO 2EINC 5L3EA 3WU2Z 2OCCC 2WA4A 1XL4A 4CH5A 1AR5A 5B66Z 4TWKA 1FAFA 3FB6C 3JARA 3ZCCA 2KB1A 1D5AA 4NTXA 5CBFA 2K9PA 4NR1A 2HG5C 4NTWA 5J2UB 3HR0A 5KA6A 1ORQC 4GKKB 4F4LA 3SPJA 5B1OA 3DC6A 5A2QN 4DR1B 3L70H 4LNUB 1NZ6A 2FTKA 3OTFA 4N21A 2GBOA 4CH6A 2PZSA 4PI0A 5JVDB 4K8XA 2HR3A 1OCCB 1GN2A 3U0ZA 2P4KA 2V4DA 2ZM6B 4MT8A 4KP4A 4ZOLB 1XQ8A 2A0LA 1Z2GA 4DUZB 1JCHA 3HKEB 4O2BA 2X7RB 4LH6A 3CMAV 1AJPA 1B06A 1AI4A 2IBZH 5J9PC 1H2MA 1MABG 4PJ0Z 1QLEB 3ZHSA 4DV5O 1F51A 1OHHG 2IJIA 1PPJH 2DOSA 2E76B 2E74B 2Y48A 2PI5A 4X66O 4X1YB 3ABTA 3BAAA 4TV9A 4I50B 2Y69C 3OMAB 1DLBA 2ZNIA 2DQ3A 3FB7C 4MVMA 2YI9A 4N23A 3ZHQA 1QLEC 5EBMC 5GONA 1HR0B 3S3WA 4X9QA 4FZ0A 4MS2A 1NS1A 2ITDC 3LUTB 1VMGA 2RJZA 1JA8A 3D3IA 3FAVA 4NVPA 3T4DA 4HNAA 4U7NA 1KP3A 2LGWA 3M7MX 5LP6A 3BA8A 3N2GB 3ZRVA 2E3CA 3CCMV 5E1AC 2WAMA 5JQGB 2NLJC 4B3RO 1WLEA 3HB3B 3OTOO 1N34B 1GAXA 2OIEA 3TETA 1H2GA 1JQ0A 1H8HG 1KMIZ 1JJ2U 4JV5O 4P9OA 2VRZA 2VWJA 1DTOA 2XAJA 4JYBA 4FM0A 4DUYO 3RYIA 3FFQA 3ZRXA 4X64B 4DR2O 2PUSA 3JSNA 2DN9A 3ABMB 3H9VA 4WCEV 2UUCO 5L3FA 2Q73A 4I0XA 4X65O 3JALA 4LR3A 3U10A 4IIJB 1V54C 5LOVA 1SF9A 4OGQB 3BY6A 5EBLC 3JCZA 1YTFB 3ABMC 4WBNA 5LGUA 4WFHA 3K5NA 4LF9B 1GM9A 4MTGA 4MVOA 4JI7O 4EB6B 1S5LZ 2LQTA 2EIMC 2HEPA 1ZSPA 1AR4A 4ZI7A 4DRXB 4JYAB 2A7WA 1S5HC 2WLKA 4DK1A 1BQ0A 2ARHA 3SDLA 1NTMH 2YS8A 1NH2B 2IH1C 3OGIB 4I5SA 4JI8O 2UXDB 5L3CA 1TUBB 4D6TH 1XMOB 5LGNA 1BQZA 3HKBB 1M57B 1KD1W 4TQDA 5B3SC 4IGGA 2AZ2A 5LBQA 3AG3B 3DSQA 2AZ0A 3CRMA 4RAIA 4EFEA 1R3IC 1AR1B 2UXCB 2XTAA 1HW7A 1ENVA 3CRAA 3SJAC 3WFVA 2EZOA 4JI4B 4UCSA 3BABA 1RPOA 1M90W 2R72A 1QR8A 5LGTA 3O65A 4TOIA 3ZX6A 1SQFA 3JD4A 4UV9A 4IYHA 4MTOA 4I9QA 3WG7C 2V7QG 1K5QA 1PM9A 2JGDB 2LO1A 3G4SV 1OCZC 4QIWF 2UXBO 2RDCA 4NTYA 3LSQA 2YDEA 5C93A 3T1YO 1BS3A 1RFYA 2D3OW 1K8AW 2JEXA 2ZIMA 3K9AA 4BR6A 2E5LO 2QTSA 3C3TA 1SKVA 2RQ6A 1GN3A 3BVOA 2K1EA 5GONB 2X6AA 3QO8A 3ZMZA 3K3WA 3RFRA 5IWAO 1Y67A 4LFAB 4PHZA 2YEVA 1SQXH 2WLLB 1EBOA 3G71V 4JTAB 1N36O 4JI1B 1FD9A 3BPZA 2PF4E 3MD0A 4O4JB 5LP6B 1BCCH 4K3AA 4LBEC 4B3TB 4DV3B 1ROPA 3SJBC 1IBKO 2OWOA 3BCCH 3UT5A 2RNBA 1VQ4V 1YZBA 3HKDA 5A9GA 2F66C 5LXTB 2F1MA 1XMQB 4JAUA 3K5MA 2CDYA 1YF2A 4U3JB 2YIAA 5LP6C 3AG2B 1E1RG 4YHHB 4AQYB 4GX5A 5KHIA 4R50A 5B1NA 1JFFA 3RYCB 3RYIB 2OT5A 2JVDA 1J5EB 4DR6O 1E1QG 1Y74B 2A06H 3W7TA 3CD6V 5B1AC 3CS5A 1BT8A 1J95A 5LA6A 3SGIA 1Y76A 4JI0B 1GK9A 4ZHQA 1XREA 1HNXB 1THZA 3K0GA 2HFEC 4DO2A 1L1FA 3GWOA 1R3JC 4BAYA 5CBGA 5LHGA 2F4VO 1T5EA 2CTPA 5AG2A 2GDSA 4YXWG 5LMUO 3ZIAG 2XAQA 1FXVA 4LH7A 4JYCA 5LMNB 1L0NH 2QWQB 5EZYB 4XDKA 4ICGA 2YXLA 1Q6IA 4PD4F 1O9GA 2VQEB 2QKAA 1M93A 1EM1A 1PV0A 5J2UA 1XOUA 3P3PA 3WB0A 1XEQA 3SYQA 5IY5B 3KZIZ 3M99B 5CN0A 5GW7A 2WPDG 1X4TA 3CCJV 3T1HO 2DE0X 4LNUA 1Z5VA 2W6IG 4JI6O 4JI3O 1YJNV 3TJTA 1EN5A 2QM4A 4PA6A 5KX5A 4GX1A 2EIKB 3AEIA 5JVDA 3SJCC 2ZT9B 4HYOA 1F7YA 3CYOA 3FD9A 5DN6G 4LF5B 1H2NA 4BWAA 3D8CA 3OE7G 1NBMG 3D3QA 3JYCA 3BHPA 3HKEA 2FB5A 3MAQA 2YICA 2M6YA 2QWPB 1D5NA 3GB7C 4DR7O 1QBZA 2HVJC 1GN4A 4Z1MG 4DV7O 1CXZB 2CH7B 3K0DA 2A9HA 4I50A 3OEHG 4H37A 2YI8A 3VQXA 3FB8C 4GLXA 3AG1C 1KBHA 4Z1VA 2L6LA 1B6QA 1DF5A 5D5PA 1NKDA 2ZE6A 1TUEB 1XI1A 4H33A 3ZN1A 5J2TB 4DR5O 4PDRA 1YJ9V 2W0FC 1WP7A 2XNDG 1MA1A 2BTOA 3MHSC 3OT7A 4R8CA 3W7UA 5FL7G 3ZHUA 4J42A 4H44B 5IYCO 3UKMA 4NXNB 5JH7B 3SJQC 2CGNA 3N2GA 3SPGA 1BSMA 1TVKB 1E79G 5JQGA 4KHPB 4YIPA 2Y4TA 4B7KA 2PTMA 3JASB 2JJ2G 3FYEB 1A32A 4JI2O 1GH6A 1HWYA 4JAVA 5K1XA 1Q6HA 3ASOC 4J10A 3EVKA 1Q86W 3SYCA 3ABKB 1PNMA 4DR4O 2FMLA 2UXNA 4LF6B 2BTQB 3CB2A 2XAHA 5BY1A 4DV4O 4WFGA 2KQXA 1RPRA 3MDSA 1R6KA 2EIJB 4LFCB 4DV2B 4X66B 3H01A 1GKFA 3LDEA 4AHCA 1V55B 1UJWB 1OCOC 5JJNB 2OTLV 3QNEA 1K5SA 2AHZA 3ZN0A 3ZMTA 3UM7A 1Y76B 1NVPB 2DYRB 4D7TA 5KLVH 1GMGA 1QNMA 1VQPV 2GHYA 4IIJA 1KU9A 3LDDA 3CCSV 1IBLO 3ASNB 1QR9A 1MNGA 2UU9O 2Q69A 1UPGA 5IDJA 2R9IA 2XT9A 3BA9A 4EB6A 2B9ZA 1H8EG 4DRXA 3LNNA 1WA8B 2QTOA 4P9PA 1EFRG 2DYSB 1S77D 4FVMA 4K0KO 4UCOA 5HFMA 2P90A 2CK3G 3CXCU 1OV9A 1TUBA 4CH4A 4MVQA 4TQFA 1KP2A 2JDIG 1NI8A 3FYIB 1VQ7V 1BGYH 4NB5A 1WB8A 3HKBA 1FFXB 4DW1A 2DYSC 1COWG 1XNRO 4FLZA 1NQTA 1NTZH 4H13B 4JV5B 3NR7A 4UVAA 5KX5B 2DWDC 4O4LB 2IJKA 4RWUA 1IX9A 2GUZB 4F6EA 4DV6O 2VWKA 1AB3A 1ZL8B 3JD3A 4KL1A 2WLNA 2H8PC 3ICXA 2UUCB 5IJ9B 5B5EZ 3K08A 1N4CA 3E8BA 2JGDA 1OCCC 3AG4B 1OJHA 1RSOB 3AK2A 4FLXA 1Q6UA 2QE7G 4B3SO 4LF4O 5FLXN 1XHXA 3FX7A 2CUGA 3BRCA 1SQQH 4RQEA 2AXTZ 4JPRA 3OAAG 1WB7A 4WFAV 2P7TC 1I5XA 1NR7A 1VF6A 3SR2C 3L73H 4JTCB 5HFLA 2Q0AA 5KMGB 2ATKC 1N32O 2WLLA 3ETGA 4ZBMA 2QDOA 3OUSA 3EFFK 3A0HZ 4LF8O 1BL8A 4O4JA 3CCLV 1K9MW 4X1KB 2QM8A 1HP8A 2P4VA 3G67A 1SA0B 1CEZA 1XNQO 1XILA 5LXTA 5LYJB 2C2AA 4MVZA 1XL6A 2XAFA 4GYCB 4U3JA 3AK3A 3CJHB 3HKCB 2H3OA 3STZC 3VOUA 4XDLA 4LP8A 1H2SB 4CC6A 4JZGA 1YIJV 4UV8A 3CRRA 2IM9A 3RYCA 4JGSA 2XASA 3VQVA 4GKKO 1Y74A 4R6ZA 3UO3A 4BIUA 3Q4HB 1M9NA 3OMIB 1TGOA 5JWPA 4IL6Z 3H1KH 4DR1O 3T1YB 4F6RB 2PI4A 3TXSA 2HKOA 4RO2A 3B77A 3JD1A 2E5LB 4Z2WA 3CWBH 2LGQA 4GUNA 3IC9A 2ZR3A 3E8FA 1R6TA 3CX5F 4MTXA 3CPWU 3QO5A 2ZM6O 3N2KB 2WLIB 4GX0A 5EZYA 3DXRB 2BOCC 3K5OA 2MW2B 1S3JA 1D2DA 3UQ8A 4H0LB 3ETEA 4I7ZB 5JJEB 2EILB 3O9OA 2GTAA 1IBMB 2HP8A 3E8GA 3GWKC 1Y6XA 5DEDA 3CRQA 1B04A 1IBKB 1Q90D 3F5WC 3CRCA 4X89A 5CMUA 1SQBH 2W0XA 4QGPA 1X59A 3ML0A 5KHGA 1WN7A 2EILC 3K04A 5KHJA 1HR0O 4ZIBA 3CC4V 1IXBA 1LNQA 4E4EA 4K35A 4IHJB 4LFBO 5EC2C 2JEUA 2UUAO 2EJRA 4YJ3B 3ZBHA 5B1BB 2ZXWB 2YXHA 4LF7O 1M57C 1CPYA 5IJ0B 2HJDA 2LW1A 4DW0A 3RW0A 3I56V 3F7YC 3APQA 5IT9N 3AG3C 3B2EE 2WLHA 3F7VC 4LWSB 3H1JH 2CH7A 2DQ0A 4BW5A 1GM8A 3MHHC 4TUYB 3JATB 5LMUB 2UXXA 4GX2A 1EN4A 5BR8B 2JIZG 2QM7A 4P30A 4UB8Z 1N33O 1WPXA 3TXQA 3K06A 4BIOA 1Q81W 4DYLA 1S72V 5KUKA 5J2TA 1UFIA 2KG7B 2OIGA 4NXMB 1U97A 2DMXA 3GVMA 2UUBB 3E8HA 2GSMB 1JX9A 2QR4A 1JMKC 5JH7A 1DF4A 4CH3A 4JI6B 1VF6C 1TVKA 3OUFA 1N0NA 3B40A 4FPPA 1MZFA 2IU0A 2HVKC 2EULA 2JRIA 2JGUA 3J81N 3JASA 2FL4A 3E86A 5BMVB 4LF9O 2EZPA 2EX3A 2HHHO 1ZWIC 4YJ2A 4JYAO 1GTOA 1XDCA 2ILMA 1FJGB 2WLMA 4B7EA 2BTQA 1BHBA 4E2LA 4B3MB 1QVFU 3CSXA 4FM2A 4J7ZA 1F23A 3X2QB 3ABLB 1XMOO 3K58A 4MTFA 5FNVB 3OR7C 3AG2C 1YTFD 3ZMSA 1G1XB 3W7SA 1P7BA 3CCEV 1Y4MA 4GZRB 5K1PA 4FLWA 4AILC 1TAEA 3ABLC 4W4LA 2UXCO 4R7CA 1K73W 1BHAA 4JI4O 4UFZA 4CC5A 2WLJA 4JI5B 1FXKB 2RMKB 1NH2D 3VQWA 2Q7HA 1QLNA 3SPIA 1HNWO 4QE7A 1R73A 2JS3A 1AROP 5H6RA 4X62B 3R66A 2BCCH 3H1HH 1WA8A 3TGUH 1Q43A 1Y66A 4J11A 1FPOA 1YSCA 1PP9H 1PNLA 1OCRB 2ZCEA 3ZRWB 1N8RW 1K33A 3U11A 1YVWA 2Q6AA 1FFXA 1MG1A 4GKJB 3K5LA 1DK1A 1VARA 2XUMA 4FFBB 4DXWA 4ABMA 3RBZA 4O4LA 4U7OA 1AI6A 4J41A 4LFAO 1I94O 2GUZA 5IY5C 1Q5OA 1G4YB 1LR1A 4OX9B 1VQNV 2ADQB 3B4SA 5KA5A 1ZL8A 3A0BZ 5L3DA 2B1GA 4JI1O 3LSSA 5IJ9A 2O57A 2EIKC 3SYPA 3SYAA 1MMMA 4DV3O 4B3TO 4O4HB 3CP1A 1RM1B 2IJJA 2ADPA 1P49A 4JAAA 2HJFC 1RSOA 1KKDA 4CZZA 3DC5A 2JK5C 1VQ8V 1IVSA 3JAKB 4UCUA 1VF5B 4AQYO 2VQFB 2JS5A 1QU7A 2ZINA 3SPHA 3H1IH 3K59A 3CHXA 1BE3H 1I0HA 5KMGA 4O2AB
chains in the Genus database with same CATH topology
2ODMA 2GBOA 2NR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODM A;  2GBO A;  2NR5 A; 
#chains in the Genus database with same CATH topology
 3ZHR A;  3E2E A;  2JJ1 G;  3KCX A;  4JI0 O;  1EN6 A;  1HNX O;  3CCR V;  1H2L A;  3K57 A;  4X1K A;  1SZT A;  1XNR B;  2R9A A;  1MOF A;  3CCU V;  1SA0 A;  5H2F Z;  1VQO V;  1WP8 A;  4PDM A;  5D5Q A;  1WJZ A;  5LYJ A;  2CGO A;  5EBW C;  5LMN O;  1I08 A;  4WFB V;  2LW7 A;  3APO A;  2PGG A;  3G80 A;  3K9S A;  5IYB O;  3T4Z A;  1ZAU A;  1M56 B;  1RP3 B;  1VIB A;  4UUJ C;  1XBL A;  2ZIO A;  1XUQ A;  3CJH A;  4YJ2 B;  3OW2 U;  2KSD A;  1K7D A;  2F43 G;  3HKC A;  2HLD G;  3W7W A;  4I4T B;  3JAM N;  2VQE O;  2CTW A;  4FLV A;  3RVZ A;  1HNZ O;  4GT1 A;  1K97 A;  1US6 A;  1Z5W A;  4PDV A;  1R3K C;  3I55 V;  4DV5 B;  2B5U A;  5KHK A;  2QJ1 A;  4B3S B;  3Q4H A;  5H5N A;  3OR6 C;  4LF4 B;  2M7W A;  1W0K G;  4UCR A;  3J80 N;  4P2Z A;  4F6R A;  3ABK C;  4FMT A;  2Q8V A;  1KUQ A;  1KKC A;  4CS4 A;  2A79 B;  2W6J G;  3RYH B;  4DR3 O;  1ZLZ A;  4LCU C;  3UCS C;  3EXA A;  4FLY A;  4FM1 A;  2EIJ C;  3N2K A;  1K34 A;  1L8D A;  2WLI A;  1V55 C;  1YXB A;  4TV8 B;  1KYO F;  2MK3 A;  3JD0 A;  3DXR A;  3H1L H;  2CAZ C;  2DYR C;  3K79 A;  2IJH A;  2EIN B;  4L8J A;  2XHB A;  2OCC B;  1FS0 G;  3D36 C;  3ASN C;  1LUW A;  2XOK G;  2CTQ A;  2EJ7 A;  1GRJ A;  1Q3E A;  1XNQ B;  4B3R B;  1PL0 A;  1IDS A;  5CBH A;  2RN9 A;  2V1D A;  2LFR A;  3OTO B;  2ZE8 A;  4G28 B;  4FK5 C;  3BFR A;  1U96 A;  1YHQ V;  3STL C;  2BE3 A;  1I7F A;  4IHJ A;  4W4K A;  2QWO B;  2E75 B;  4O4I B;  4DUY B;  3A0R A;  1R3L C;  4YJ3 A;  4GCZ A;  5IYZ B;  1YI2 V;  5IJ0 A;  4FFK A;  4DR2 B;  1K4D C;  4NXN O;  3IGA C;  1NR1 A;  4KFM A;  1QHT A;  2LJ2 A;  1SER A;  3CE2 A;  4J7K A;  3JD2 A;  3HPL C;  3L71 H;  5CA0 B;  3ETD A;  4KHP O;  4LWS A;  3THO A;  4X65 B;  3ABU A;  2ETN A;  3OD4 A;  3M8A A;  4WFF A;  1SQP H;  2Q5Z A;  4QJF B;  3KCY A;  3L9D A;  1AP5 A;  3PN1 A;  4TUY A;  3JAT A;  1MSD A;  2YSU B;  1ZTE A;  2QGN A;  2Y69 B;  4BW9 A;  3LDC A;  4LF6 O;  4PA9 A;  5JCO C;  4JI7 B;  4PV1 B;  4TT3 G;  5E79 Z;  1SET A;  3AG4 C;  1PL4 A;  3JAW B;  4PA4 A;  5ITZ B;  4YY3 O;  5C8Y B;  3SPC A;  3ZMV A;  3RN4 A;  4LFC O;  3K03 A;  4DV2 O;  4DV1 O;  1VQ6 V;  2KG7 A;  4JI8 B;  2ZE5 A;  3KKY A;  2ZNJ A;  3RYF B;  1NT2 B;  3IJ4 A;  4QPK A;  1FYJ A;  1KQS U;  1P7G A;  3OMN B;  4MSW C;  2F93 B;  5LL6 Y;  1CP9 A;  3L72 H;  1F4M A;  1SS3 A;  4C7U A;  5GTH Z;  1IUR A;  3VQY A;  3E22 B;  5BMV A;  2F23 A;  5CB4 B;  4MVS A;  4LFB B;  3C3S A;  4DV0 O;  2NR5 A;  2UUA B;  1B3Q A;  4XBF A;  2NNU A;  4LF7 B;  1M4U A;  4X20 B;  1TA8 A;  4X1I B;  3S3X A;  3CXH F;  2R9R B;  4DK0 A;  1PD3 A;  3L75 H;  2FYU H;  1NU1 H;  2WA3 A;  1NVP D;  4G2K A;  3ZS8 C;  4WFE A;  4OPH A;  1JJO A;  1AJN A;  5GTI Z;  3CC2 V;  4Q6G A;  1AP6 A;  2UXB B;  5FNV A;  2ZQM A;  5BXZ A;  3AK1 A;  4UXN A;  1XHZ A;  2GTS A;  2VS0 A;  1ZX3 A;  4PEL A;  4MW3 A;  1N33 B;  2Z5U A;  1MSW D;  3IC7 A;  4K8Z A;  1M1K W;  5EYP B;  1V54 B;  1FXK A;  3OM3 B;  4EFB A;  3R65 A;  4DUZ O;  3E35 A;  5IWA B;  2WSS G;  1KB9 F;  2Z3Y A;  3QF7 A;  4JYY A;  3IFX A;  3CEI A;  4I55 B;  4FLU A;  4FZ1 A;  2EIM B;  4J7J A;  2AW9 A;  1SRY A;  5EK0 A;  3ZED A;  1AJQ A;  5CA1 B;  1N36 B;  1FXH A;  3P30 A;  2ZDI A;  4HAM A;  3ZHT A;  3ZRW A;  4EKW A;  5H6Q A;  4G27 B;  2YIB A;  4FLT A;  2HHH B;  3UO2 A;  4J9Z B;  1H2K A;  1I5Y A;  3OFN G;  4FFB A;  1VQK V;  2PYL A;  5B3S B;  1Q82 W;  2YC0 A;  3JAR B;  4PDL A;  3B09 A;  4B08 A;  1S76 D;  4RUF A;  3FB5 C;  2ZE7 A;  1IXM A;  1VQ5 V;  2N05 A;  4DR6 B;  4JAS A;  3LNM B;  3CC7 V;  2L35 A;  1IZ3 A;  4KXR A;  4RQF A;  4X8A A;  1WAZ A;  4WF9 V;  4O4H A;  3ZHV A;  1EZV H;  3A8T A;  1S5J A;  4J80 A;  1SQG A;  3WG7 B;  2P67 A;  5B1B C;  5KUM A;  4A5U B;  1BMF G;  2ZXW C;  1QQC A;  3ZMU A;  1PKX A;  4MW8 A;  1OCZ B;  3RWR D;  1N34 O;  2F4V B;  3JAK A;  2A3Q A;  1HNW B;  3EHB B;  2F95 B;  4O2B B;  5KAF Z;  4HBN A;  3NXS A;  3T1C A;  1YJW V;  2R70 A;  4LC1 A;  1O9H A;  2BSK A;  5IE9 A;  4NYK A;  2LP7 A;  1R6N A;  1SC5 B;  5F2V O;  4O2A A;  4X64 O;  4UB6 Z;  3AG7 A;  1GO3 F;  2AGA A;  4TV9 B;  2YXY A;  1WPB A;  1YEW A;  1AIL A;  3OGC C;  1AI7 A;  2Q7G A;  1F4N A;  3T1H B;  4I9W A;  1FKA O;  4JI3 B;  3T2M A;  5KAI Z;  1KC8 W;  4UCV A;  1K4C C;  1VQ9 V;  2QEX V;  2QSA A;  5LHI A;  4QPJ A;  1I94 B;  4MVU A;  3OEE G;  1P4R A;  1L0L H;  3B8M A;  3FAV B;  4ASU G;  2X0L A;  3G6B A;  3E89 A;  4HNA B;  1AVM A;  4I4T A;  1IBM O;  4DR7 B;  3WB1 A;  3RGB A;  1QCE A;  4D7S A;  2ODM A;  5BZB A;  1W59 A;  5H9C A;  4FJC C;  2UXD O;  4DV7 B;  3QVN A;  3CCQ V;  2P06 A;  2Y4U A;  2YID A;  4RUE A;  2FKX A;  4UVC A;  3JSL A;  2DJV A;  2Q4P A;  5B1A B;  2QA4 V;  3RYH A;  4ZKI A;  4JZ2 A;  4MVR A;  3X2Q C;  2Y0I A;  4FIP C;  2X6C A;  3D36 A;  3C90 A;  5IYD O;  4JF3 A;  4XDJ A;  4HZ3 A;  1Q7Y W;  1VP7 A;  4DR5 B;  4TV8 A;  4L87 A;  2ZD9 A;  1YDX A;  1QVG U;  3LSU A;  2N04 A;  3QG5 A;  4I0X B;  4QE9 A;  2P6J A;  2QWN B;  3JAL B;  5JJJ B;  3RT3 C;  5LOV B;  3JCU Z;  1FXK C;  5FPR A;  4WBN B;  4EEQ A;  1NTK H;  1FFT B;  3CME V;  4JI2 B;  5BR8 O;  3IAY A;  3I5D A;  2D2C B;  1EZJ A;  2Q68 A;  4ZI7 B;  1AI5 A;  2QKS A;  4CBC A;  4DR4 B;  1SZX A;  1NJI W;  2ZDI C;  1OCR C;  1OZ0 A;  2P5O A;  4PI2 A;  3G6E V;  4DV4 B;  1HNZ B;  3VBB A;  5TIS Z;  4NXM O;  4O4I A;  3WB2 A;  5FPO A;  5L3G A;  2G38 A;  1KEC A;  2UUB O;  5IYZ A;  2Q0O C;  2QKC A;  5DEC A;  5KHH A;  2LFS A;  2NN4 A;  1W2B U;  1DGS A;  2OYQ A;  5CA0 A;  4CS3 A;  5JCO A;  1G6U A;  5EIB C;  4DR3 B;  1ZUQ A;  2GV9 A;  3P32 A;  3SYO A;  2P22 C;  4OPA A;  1IBL B;  4ZOL A;  2UU9 B;  1XMQ O;  3B8N A;  1K92 A;  1FJG O;  2EBO A;  3DGE A;  2PYJ A;  1SES A;  4YHH O;  3F5T A;  4B3M O;  4UVB A;  1MZE A;  1VQM V;  1RM1 C;  3AG1 B;  3DTU B;  3JAW A;  5ITZ A;  3TCU A;  5C8Y A;  2Z0A A;  4K0K B;  2BSK B;  1JVM A;  4X1Y A;  1J5E O;  5CA3 A;  1M5I A;  1W0J G;  2IH3 C;  4YIO A;  3RYF A;  1V9P A;  1GN6 A;  2X6B A;  1Q8I A;  2Q67 A;  2B1I A;  2H94 A;  2DWE C;  3QTC A;  1G8M A;  2CTR A;  3KG2 A;  4QNH B;  4JI5 O;  3E22 A;  5CB4 A;  2Y0P A;  4TSF G;  4IT5 A;  3W7X A;  2ZKO A;  2AHY A;  2IU3 A;  2YEV B;  4X62 O;  2IW5 A;  4DV6 B;  1H38 A;  1JR9 A;  4X20 A;  4X1I A;  3ASO B;  2Q7E A;  1SQV H;  1URF A;  4CS2 A;  3A2F A;  4BIZ A;  4PA3 A;  1VF7 A;  3UT5 B;  1YIT V;  3ETQ A;  1R1B A;  3HKD B;  1M56 C;  4KUM A;  4X88 A;  4JTD B;  2OTJ V;  1N0J A;  3P3N A;  4GKJ O;  1WNS A;  1OCO B;  1K3E A;  2ITC C;  2DW4 A;  3E83 A;  2OCH A;  4IYI A;  1VEW A;  5LHH A;  2PY5 A;  3RVY A;  4UCT A;  1JPX A;  3L74 H;  3ZJZ A;  5EYP A;  2Q9L A;  4YY3 B;  2CE4 A;  2QWR B;  3TK1 A;  4LF5 O;  5EC1 C;  1JFF B;  4OX9 O;  3ZRS A;  4DV1 B;  1HDJ A;  4Q20 A;  1N32 B;  3PJS K;  2XAG A;  3QO7 A;  2WWW A;  5LA6 B;  4I55 A;  2KKW A;  1YCI A;  2ZR2 A;  3BEH A;  4ZHQ B;  2YIB D;  5L3B A;  5CA1 A;  3N27 A;  2BOB C;  1JOY A;  4LF8 B;  4AI8 A;  4NKG B;  4PA7 A;  2N74 A;  4OXS A;  1P84 F;  3FKS G;  4U3F H;  1PNK A;  5DM6 V;  1VQL V;  3CCV V;  5EIB D;  4DV0 B;  1LUV A;  3J7A U;  2YUA A;  1S0V A;  1GM7 A;  1BZK A;  2RCV A;  4J9Y B;  2VQF O;  2EIN C;  5L3E A;  3WU2 Z;  2OCC C;  2WA4 A;  1XL4 A;  4CH5 A;  1AR5 A;  5B66 Z;  4TWK A;  1FAF A;  3FB6 C;  3JAR A;  3ZCC A;  2KB1 A;  1D5A A;  4NTX A;  5CBF A;  2K9P A;  4NR1 A;  2HG5 C;  4NTW A;  5J2U B;  3HR0 A;  5KA6 A;  1ORQ C;  4GKK B;  4F4L A;  3SPJ A;  5B1O A;  3DC6 A;  5A2Q N;  4DR1 B;  3L70 H;  4LNU B;  1NZ6 A;  2FTK A;  3OTF A;  4N21 A;  2GBO A;  4CH6 A;  2PZS A;  4PI0 A;  5JVD B;  4K8X A;  2HR3 A;  1OCC B;  1GN2 A;  3U0Z A;  2P4K A;  2V4D A;  2ZM6 B;  4MT8 A;  4KP4 A;  4ZOL B;  1XQ8 A;  2A0L A;  1Z2G A;  4DUZ B;  1JCH A;  3HKE B;  4O2B A;  2X7R B;  4LH6 A;  3CMA V;  1AJP A;  1B06 A;  1AI4 A;  2IBZ H;  5J9P C;  1H2M A;  1MAB G;  4PJ0 Z;  1QLE B;  3ZHS A;  4DV5 O;  1F51 A;  1OHH G;  2IJI A;  1PPJ H;  2DOS A;  2E76 B;  2E74 B;  2Y48 A;  2PI5 A;  4X66 O;  4X1Y B;  3ABT A;  3BAA A;  4TV9 A;  4I50 B;  2Y69 C;  3OMA B;  1DLB A;  2ZNI A;  2DQ3 A;  3FB7 C;  4MVM A;  2YI9 A;  4N23 A;  3ZHQ A;  1QLE C;  5EBM C;  5GON A;  1HR0 B;  3S3W A;  4X9Q A;  4FZ0 A;  4MS2 A;  1NS1 A;  2ITD C;  3LUT B;  1VMG A;  2RJZ A;  1JA8 A;  3D3I A;  3FAV A;  4NVP A;  3T4D A;  4HNA A;  4U7N A;  1KP3 A;  2LGW A;  3M7M X;  5LP6 A;  3BA8 A;  3N2G B;  3ZRV A;  2E3C A;  3CCM V;  5E1A C;  2WAM A;  5JQG B;  2NLJ C;  4B3R O;  1WLE A;  3HB3 B;  3OTO O;  1N34 B;  1GAX A;  2OIE A;  3TET A;  1H2G A;  1JQ0 A;  1H8H G;  1KMI Z;  1JJ2 U;  4JV5 O;  4P9O A;  2VRZ A;  2VWJ A;  1DTO A;  2XAJ A;  4JYB A;  4FM0 A;  4DUY O;  3RYI A;  3FFQ A;  3ZRX A;  4X64 B;  4DR2 O;  2PUS A;  3JSN A;  2DN9 A;  3ABM B;  3H9V A;  4WCE V;  2UUC O;  5L3F A;  2Q73 A;  4I0X A;  4X65 O;  3JAL A;  4LR3 A;  3U10 A;  4IIJ B;  1V54 C;  5LOV A;  1SF9 A;  4OGQ B;  3BY6 A;  5EBL C;  3JCZ A;  1YTF B;  3ABM C;  4WBN A;  5LGU A;  4WFH A;  3K5N A;  4LF9 B;  1GM9 A;  4MTG A;  4MVO A;  4JI7 O;  4EB6 B;  1S5L Z;  2LQT A;  2EIM C;  2HEP A;  1ZSP A;  1AR4 A;  4ZI7 A;  4DRX B;  4JYA B;  2A7W A;  1S5H C;  2WLK A;  4DK1 A;  1BQ0 A;  2ARH A;  3SDL A;  1NTM H;  2YS8 A;  1NH2 B;  2IH1 C;  3OGI B;  4I5S A;  4JI8 O;  2UXD B;  5L3C A;  1TUB B;  4D6T H;  1XMO B;  5LGN A;  1BQZ A;  3HKB B;  1M57 B;  1KD1 W;  4TQD A;  5B3S C;  4IGG A;  2AZ2 A;  5LBQ A;  3AG3 B;  3DSQ A;  2AZ0 A;  3CRM A;  4RAI A;  4EFE A;  1R3I C;  1AR1 B;  2UXC B;  2XTA A;  1HW7 A;  1ENV A;  3CRA A;  3SJA C;  3WFV A;  2EZO A;  4JI4 B;  4UCS A;  3BAB A;  1RPO A;  1M90 W;  2R72 A;  1QR8 A;  5LGT A;  3O65 A;  4TOI A;  3ZX6 A;  1SQF A;  3JD4 A;  4UV9 A;  4IYH A;  4MTO A;  4I9Q A;  3WG7 C;  2V7Q G;  1K5Q A;  1PM9 A;  2JGD B;  2LO1 A;  3G4S V;  1OCZ C;  4QIW F;  2UXB O;  2RDC A;  4NTY A;  3LSQ A;  2YDE A;  5C93 A;  3T1Y O;  1BS3 A;  1RFY A;  2D3O W;  1K8A W;  2JEX A;  2ZIM A;  3K9A A;  4BR6 A;  2E5L O;  2QTS A;  3C3T A;  1SKV A;  2RQ6 A;  1GN3 A;  3BVO A;  2K1E A;  5GON B;  2X6A A;  3QO8 A;  3ZMZ A;  3K3W A;  3RFR A;  5IWA O;  1Y67 A;  4LFA B;  4PHZ A;  2YEV A;  1SQX H;  2WLL B;  1EBO A;  3G71 V;  4JTA B;  1N36 O;  4JI1 B;  1FD9 A;  3BPZ A;  2PF4 E;  3MD0 A;  4O4J B;  5LP6 B;  1BCC H;  4K3A A;  4LBE C;  4B3T B;  4DV3 B;  1ROP A;  3SJB C;  1IBK O;  2OWO A;  3BCC H;  3UT5 A;  2RNB A;  1VQ4 V;  1YZB A;  3HKD A;  5A9G A;  2F66 C;  5LXT B;  2F1M A;  1XMQ B;  4JAU A;  3K5M A;  2CDY A;  1YF2 A;  4U3J B;  2YIA A;  5LP6 C;  3AG2 B;  1E1R G;  4YHH B;  4AQY B;  4GX5 A;  5KHI A;  4R50 A;  5B1N A;  1JFF A;  3RYC B;  3RYI B;  2OT5 A;  2JVD A;  1J5E B;  4DR6 O;  1E1Q G;  1Y74 B;  2A06 H;  3W7T A;  3CD6 V;  5B1A C;  3CS5 A;  1BT8 A;  1J95 A;  5LA6 A;  3SGI A;  1Y76 A;  4JI0 B;  1GK9 A;  4ZHQ A;  1XRE A;  1HNX B;  1THZ A;  3K0G A;  2HFE C;  4DO2 A;  1L1F A;  3GWO A;  1R3J C;  4BAY A;  5CBG A;  5LHG A;  2F4V O;  1T5E A;  2CTP A;  5AG2 A;  2GDS A;  4YXW G;  5LMU O;  3ZIA G;  2XAQ A;  1FXV A;  4LH7 A;  4JYC A;  5LMN B;  1L0N H;  2QWQ B;  5EZY B;  4XDK A;  4ICG A;  2YXL A;  1Q6I A;  4PD4 F;  1O9G A;  2VQE B;  2QKA A;  1M93 A;  1EM1 A;  1PV0 A;  5J2U A;  1XOU A;  3P3P A;  3WB0 A;  1XEQ A;  3SYQ A;  5IY5 B;  3KZI Z;  3M99 B;  5CN0 A;  5GW7 A;  2WPD G;  1X4T A;  3CCJ V;  3T1H O;  2DE0 X;  4LNU A;  1Z5V A;  2W6I G;  4JI6 O;  4JI3 O;  1YJN V;  3TJT A;  1EN5 A;  2QM4 A;  4PA6 A;  5KX5 A;  4GX1 A;  2EIK B;  3AEI A;  5JVD A;  3SJC C;  2ZT9 B;  4HYO A;  1F7Y A;  3CYO A;  3FD9 A;  5DN6 G;  4LF5 B;  1H2N A;  4BWA A;  3D8C A;  3OE7 G;  1NBM G;  3D3Q A;  3JYC A;  3BHP A;  3HKE A;  2FB5 A;  3MAQ A;  2YIC A;  2M6Y A;  2QWP B;  1D5N A;  3GB7 C;  4DR7 O;  1QBZ A;  2HVJ C;  1GN4 A;  4Z1M G;  4DV7 O;  1CXZ B;  2CH7 B;  3K0D A;  2A9H A;  4I50 A;  3OEH G;  4H37 A;  2YI8 A;  3VQX A;  3FB8 C;  4GLX A;  3AG1 C;  1KBH A;  4Z1V A;  2L6L A;  1B6Q A;  1DF5 A;  5D5P A;  1NKD A;  2ZE6 A;  1TUE B;  1XI1 A;  4H33 A;  3ZN1 A;  5J2T B;  4DR5 O;  4PDR A;  1YJ9 V;  2W0F C;  1WP7 A;  2XND G;  1MA1 A;  2BTO A;  3MHS C;  3OT7 A;  4R8C A;  3W7U A;  5FL7 G;  3ZHU A;  4J42 A;  4H44 B;  5IYC O;  3UKM A;  4NXN B;  5JH7 B;  3SJQ C;  2CGN A;  3N2G A;  3SPG A;  1BSM A;  1TVK B;  1E79 G;  5JQG A;  4KHP B;  4YIP A;  2Y4T A;  4B7K A;  2PTM A;  3JAS B;  2JJ2 G;  3FYE B;  1A32 A;  4JI2 O;  1GH6 A;  1HWY A;  4JAV A;  5K1X A;  1Q6H A;  3ASO C;  4J10 A;  3EVK A;  1Q86 W;  3SYC A;  3ABK B;  1PNM A;  4DR4 O;  2FML A;  2UXN A;  4LF6 B;  2BTQ B;  3CB2 A;  2XAH A;  5BY1 A;  4DV4 O;  4WFG A;  2KQX A;  1RPR A;  3MDS A;  1R6K A;  2EIJ B;  4LFC B;  4DV2 B;  4X66 B;  3H01 A;  1GKF A;  3LDE A;  4AHC A;  1V55 B;  1UJW B;  1OCO C;  5JJN B;  2OTL V;  3QNE A;  1K5S A;  2AHZ A;  3ZN0 A;  3ZMT A;  3UM7 A;  1Y76 B;  1NVP B;  2DYR B;  4D7T A;  5KLV H;  1GMG A;  1QNM A;  1VQP V;  2GHY A;  4IIJ A;  1KU9 A;  3LDD A;  3CCS V;  1IBL O;  3ASN B;  1QR9 A;  1MNG A;  2UU9 O;  2Q69 A;  1UPG A;  5IDJ A;  2R9I A;  2XT9 A;  3BA9 A;  4EB6 A;  2B9Z A;  1H8E G;  4DRX A;  3LNN A;  1WA8 B;  2QTO A;  4P9P A;  1EFR G;  2DYS B;  1S77 D;  4FVM A;  4K0K O;  4UCO A;  5HFM A;  2P90 A;  2CK3 G;  3CXC U;  1OV9 A;  1TUB A;  4CH4 A;  4MVQ A;  4TQF A;  1KP2 A;  2JDI G;  1NI8 A;  3FYI B;  1VQ7 V;  1BGY H;  4NB5 A;  1WB8 A;  3HKB A;  1FFX B;  4DW1 A;  2DYS C;  1COW G;  1XNR O;  4FLZ A;  1NQT A;  1NTZ H;  4H13 B;  4JV5 B;  3NR7 A;  4UVA A;  5KX5 B;  2DWD C;  4O4L B;  2IJK A;  4RWU A;  1IX9 A;  2GUZ B;  4F6E A;  4DV6 O;  2VWK A;  1AB3 A;  1ZL8 B;  3JD3 A;  4KL1 A;  2WLN A;  2H8P C;  3ICX A;  2UUC B;  5IJ9 B;  5B5E Z;  3K08 A;  1N4C A;  3E8B A;  2JGD A;  1OCC C;  3AG4 B;  1OJH A;  1RSO B;  3AK2 A;  4FLX A;  1Q6U A;  2QE7 G;  4B3S O;  4LF4 O;  5FLX N;  1XHX A;  3FX7 A;  2CUG A;  3BRC A;  1SQQ H;  4RQE A;  2AXT Z;  4JPR A;  3OAA G;  1WB7 A;  4WFA V;  2P7T C;  1I5X A;  1NR7 A;  1VF6 A;  3SR2 C;  3L73 H;  4JTC B;  5HFL A;  2Q0A A;  5KMG B;  2ATK C;  1N32 O;  2WLL A;  3ETG A;  4ZBM A;  2QDO A;  3OUS A;  3EFF K;  3A0H Z;  4LF8 O;  1BL8 A;  4O4J A;  3CCL V;  1K9M W;  4X1K B;  2QM8 A;  1HP8 A;  2P4V A;  3G67 A;  1SA0 B;  1CEZ A;  1XNQ O;  1XIL A;  5LXT A;  5LYJ B;  2C2A A;  4MVZ A;  1XL6 A;  2XAF A;  4GYC B;  4U3J A;  3AK3 A;  3CJH B;  3HKC B;  2H3O A;  3STZ C;  3VOU A;  4XDL A;  4LP8 A;  1H2S B;  4CC6 A;  4JZG A;  1YIJ V;  4UV8 A;  3CRR A;  2IM9 A;  3RYC A;  4JGS A;  2XAS A;  3VQV A;  4GKK O;  1Y74 A;  4R6Z A;  3UO3 A;  4BIU A;  3Q4H B;  1M9N A;  3OMI B;  1TGO A;  5JWP A;  4IL6 Z;  3H1K H;  4DR1 O;  3T1Y B;  4F6R B;  2PI4 A;  3TXS A;  2HKO A;  4RO2 A;  3B77 A;  3JD1 A;  2E5L B;  4Z2W A;  3CWB H;  2LGQ A;  4GUN A;  3IC9 A;  2ZR3 A;  3E8F A;  1R6T A;  3CX5 F;  4MTX A;  3CPW U;  3QO5 A;  2ZM6 O;  3N2K B;  2WLI B;  4GX0 A;  5EZY A;  3DXR B;  2BOC C;  3K5O A;  2MW2 B;  1S3J A;  1D2D A;  3UQ8 A;  4H0L B;  3ETE A;  4I7Z B;  5JJE B;  2EIL B;  3O9O A;  2GTA A;  1IBM B;  2HP8 A;  3E8G A;  3GWK C;  1Y6X A;  5DED A;  3CRQ A;  1B04 A;  1IBK B;  1Q90 D;  3F5W C;  3CRC A;  4X89 A;  5CMU A;  1SQB H;  2W0X A;  4QGP A;  1X59 A;  3ML0 A;  5KHG A;  1WN7 A;  2EIL C;  3K04 A;  5KHJ A;  1HR0 O;  4ZIB A;  3CC4 V;  1IXB A;  1LNQ A;  4E4E A;  4K35 A;  4IHJ B;  4LFB O;  5EC2 C;  2JEU A;  2UUA O;  2EJR A;  4YJ3 B;  3ZBH A;  5B1B B;  2ZXW B;  2YXH A;  4LF7 O;  1M57 C;  1CPY A;  5IJ0 B;  2HJD A;  2LW1 A;  4DW0 A;  3RW0 A;  3I56 V;  3F7Y C;  3APQ A;  5IT9 N;  3AG3 C;  3B2E E;  2WLH A;  3F7V C;  4LWS B;  3H1J H;  2CH7 A;  2DQ0 A;  4BW5 A;  1GM8 A;  3MHH C;  4TUY B;  3JAT B;  5LMU B;  2UXX A;  4GX2 A;  1EN4 A;  5BR8 B;  2JIZ G;  2QM7 A;  4P30 A;  4UB8 Z;  1N33 O;  1WPX A;  3TXQ A;  3K06 A;  4BIO A;  1Q81 W;  4DYL A;  1S72 V;  5KUK A;  5J2T A;  1UFI A;  2KG7 B;  2OIG A;  4NXM B;  1U97 A;  2DMX A;  3GVM A;  2UUB B;  3E8H A;  2GSM B;  1JX9 A;  2QR4 A;  1JMK C;  5JH7 A;  1DF4 A;  4CH3 A;  4JI6 B;  1VF6 C;  1TVK A;  3OUF A;  1N0N A;  3B40 A;  4FPP A;  1MZF A;  2IU0 A;  2HVK C;  2EUL A;  2JRI A;  2JGU A;  3J81 N;  3JAS A;  2FL4 A;  3E86 A;  5BMV B;  4LF9 O;  2EZP A;  2EX3 A;  2HHH O;  1ZWI C;  4YJ2 A;  4JYA O;  1GTO A;  1XDC A;  2ILM A;  1FJG B;  2WLM A;  4B7E A;  2BTQ A;  1BHB A;  4E2L A;  4B3M B;  1QVF U;  3CSX A;  4FM2 A;  4J7Z A;  1F23 A;  3X2Q B;  3ABL B;  1XMO O;  3K58 A;  4MTF A;  5FNV B;  3OR7 C;  3AG2 C;  1YTF D;  3ZMS A;  1G1X B;  3W7S A;  1P7B A;  3CCE V;  1Y4M A;  4GZR B;  5K1P A;  4FLW A;  4AIL C;  1TAE A;  3ABL C;  4W4L A;  2UXC O;  4R7C A;  1K73 W;  1BHA A;  4JI4 O;  4UFZ A;  4CC5 A;  2WLJ A;  4JI5 B;  1FXK B;  2RMK B;  1NH2 D;  3VQW A;  2Q7H A;  1QLN A;  3SPI A;  1HNW O;  4QE7 A;  1R73 A;  2JS3 A;  1ARO P;  5H6R A;  4X62 B;  3R66 A;  2BCC H;  3H1H H;  1WA8 A;  3TGU H;  1Q43 A;  1Y66 A;  4J11 A;  1FPO A;  1YSC A;  1PP9 H;  1PNL A;  1OCR B;  2ZCE A;  3ZRW B;  1N8R W;  1K33 A;  3U11 A;  1YVW A;  2Q6A A;  1FFX A;  1MG1 A;  4GKJ B;  3K5L A;  1DK1 A;  1VAR A;  2XUM A;  4FFB B;  4DXW A;  4ABM A;  3RBZ A;  4O4L A;  4U7O A;  1AI6 A;  4J41 A;  4LFA O;  1I94 O;  2GUZ A;  5IY5 C;  1Q5O A;  1G4Y B;  1LR1 A;  4OX9 B;  1VQN V;  2ADQ B;  3B4S A;  5KA5 A;  1ZL8 A;  3A0B Z;  5L3D A;  2B1G A;  4JI1 O;  3LSS A;  5IJ9 A;  2O57 A;  2EIK C;  3SYP A;  3SYA A;  1MMM A;  4DV3 O;  4B3T O;  4O4H B;  3CP1 A;  1RM1 B;  2IJJ A;  2ADP A;  1P49 A;  4JAA A;  2HJF C;  1RSO A;  1KKD A;  4CZZ A;  3DC5 A;  2JK5 C;  1VQ8 V;  1IVS A;  3JAK B;  4UCU A;  1VF5 B;  4AQY O;  2VQF B;  2JS5 A;  1QU7 A;  2ZIN A;  3SPH A;  3H1I H;  3K59 A;  3CHX A;  1BE3 H;  1I0H A;  5KMG A;  4O2A B; 
#chains in the Genus database with same CATH homology
 2ODM A;  2GBO A;  2NR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...