2GBOA

Protein of unknown function ef2458 from enterococcus faecalis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
b'MDEGISKKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0358 protein EF2458
molecule tags Structural genomics, unknown function
source organism Enterococcus faecalis
publication title X-ray crystal structure of conserved hypothetical protein EF_2458 from Enterococcus faecalis.
rcsb
total genus 31
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07408 DUF1507 Protein of unknown function (DUF1507)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2gboA00
2NR5A 2GBOA 2ODMA
chains in the Genus database with same CATH superfamily
2VWKA 4KL1A 4TV9B 1MOFA 3L73H 4O2AA 2F23A 4JI4B 1FJGO 3BY6A 4ASUG 3BFRA 4U3FH 3C3TA 2ZXWB 1K5SA 1SQPH 5KA6A 3ETEA 2ZE5A 4ICGA 4JZGA 4OPHA 1V55B 1WJZA 4LF6O 2LGWA 5IDJA 3TK1A 3W7XA 2DW4A 3ZHSA 1NTZH 4R6ZA 3CD6V 2CAZC 2F4VB 3M7MX 3ABLC 2CTWA 2Q6AA 3SPCA 2IU0A 2EINB 1W2BU 1BL8A 4CH6A 2BTOA 1TA8A 4FFBA 1X4TA 4NTWA 4BW5A 1N0JA 4CC6A 3RGBA 3FB6C 2QEXV 2UXBB 4KHPO 3OTFA 4GLXA 4B7KA 3CCRV 4W4LA 2BSKB 4CC5A 1AJPA 5JQGA 2V7QG 4O4LB 2OTLV 4G28B 2K1EA 1VQ9V 5H6RA 4AQYB 1D2DA 5HFMA 3G71V 1SRYA 4X1KA 3IJ4A 1NZ6A 4D7SA 2G38A 1O9HA 4BWAA 4OX9B 2XNDG 4FFKA 2RNBA 2EIJB 4WFFA 4CBCA 3N27A 3DXRB 3O9OA 1N36B 1OHHG 4LC1A 4KHPB 5EIBD 2OCCC 2F66C 4PA3A 4GX5A 1XREA 3A0RA 1KYOF 1NTKH 1SQFA 4DK1A 4GT1A 1YITV 4X66O 5BMVA 4YJ2A 5CBFA 2IBZH 1MMMA 4EFBA 3GWKC 1FXHA 2Y4TA 1H8HG 3H9VA 3AG1B 4O4HA 3T1YB 4LF4O 4NXNO 2OTJV 2QWOB 1OCOC 5L3FA 3JARA 3OUSA 3LSSA 4IHJA 3E22B 1Y74A 3FAVA 5L3DA 2QM7A 1I08A 4WF9V 4X20A 4F6RA 1FFTB 2Q7HA 2YC0A 2UXXA 3WB0A 1PM9A 3N2KB 3KZIZ 3RBZA 1XMOO 2YIDA 1PP9H 4QIWF 5A9GA 1MG1A 4G27B 3LUTB 4DO2A 1OCRC 2R72A 5JCOC 4JI7O 5IWAO 3CS5A 2WLIB 1R6TA 2EIKB 2VS0A 4CS3A 1R1BA 3ASOC 4MVSA 5C93A 4TV8A 3G67A 4LR3A 4DV6B 2UXCO 4B3TO 3MD0A 1MA1A 2BE3A 4H33A 4NB5A 2OIGA 4YIPA 1NKDA 1SESA 4PDLA 1TUBB 4X9QA 4DYLA 5IE9A 3CCUV 1XL4A 3HPLC 3R65A 4L87A 4LF5B 1Y66A 2UUAO 1R3LC 4UXNA 1YZBA 2UXDO 4YXWG 3UCSC 1US6A 3EXAA 2HHHO 4NVPA 1GTOA 5D5QA 2YDEA 3RN4A 2EIKC 2Q69A 5LXTA 3ZEDA 2RMKB 1NT2B 1TVKA 2EILC 2P4VA 2Y69C 3AK2A 3B2EE 4JI8O 4JV5B 4LF5O 1VF6A 2UUAB 3D36A 5LOVB 1BQ0A 3ZRSA 4I9QA 4QPJA 5FLXN 4MVOA 4TOIA 4DUZB 5LMUB 5IJ9B 5LL6Y 3QF7A 3UO2A 4Q20A 5J2TA 3FKSG 3GB7C 3THOA 2DYSB 1GM7A 3OMAB 4WFGA 1N33O 2X7RB 3KG2A 1N32O 1MZFA 3PN1A 2QWPB 2JJ2G 3DC5A 2O57A 4ZIBA 4O2AB 2ZIOA 3W7WA 4DR3B 4LFBO 5H5NA 2E5LB 2KKWA 5GONA 1F23A 1M56B 2WLJA 2ZR2A 3R66A 3CCVV 1WB7A 5IYBO 3JAKA 1GK9A 4DV0B 1YSCA 1L1FA 1OJHA 1JMKC 1XNQB 1KP2A 2ZCEA 2JDIG 2QR4A 1JFFB 3P30A 4KXRA 2WWWA 3QO7A 4FM0A 4RUEA 2ZE7A 2FKXA 1QLNA 4O4JA 1S5LZ 4U7NA 3FB7C 1K33A 5D5PA 2QM8A 3ZBHA 5LP6C 2ITDC 1KBHA 4JASA 4JGSA 2UXBO 2DQ3A 1QLEC 2N74A 2MW2B 2A7WA 3JARB 1VQLV 4WFHA 4UCRA 1EZVH 5B1AC 4NYKA 1VQKV 1KB9F 1VQOV 5J9PC 4CZZA 1THZA 1XQ8A 4DV4B 2AHYA 1QVFU 3SR2C 1NH2B 2IH3C 5LYJA 3E8BA 1BHBA 4DW0A 4HBNA 1FXKC 2P06A 4HAMA 1Q43A 4BIOA 3N2GA 3K57A 2FMLA 1N34B 1FD9A 2EINC 3DXRA 3K3WA 3ZRWB 3WFVA 1SQXH 3HKEA 1PD3A 1JA8A 1QU7A 2K9PA 3CX5F 1Y6XA 2ZIMA 4FPPA 2F43G 3IFXA 5LHHA 4QE7A 4DV2B 1VQ8V 3ZMVA 3FB8C 5CA3A 1RM1C 4K0KB 2ADQB 1IBMB 1HW7A 4IYIA 1KD1W 4DR2B 4PA6A 2QE7G 4F4LA 5B1NA 1YXBA 5B1AB 2WPDG 1UPGA 1NR7A 4MW8A 1ROPA 3OGIB 3T1YO 2UUBO 4LF4B 4NXNB 2ZD9A 2WA4A 1IBKO 1ZUQA 1RM1B 1OV9A 1QLEB 2QGNA 3ETGA 2QKAA 1XDCA 1VP7A 3MAQA 2RJZA 1IBLB 4EEQA 3UKMA 5LHGA 2Q8VA 3CPWU 1QCEA 4X62O 1S72V 2KSDA 4P30A 1EFRG 4MW3A 3E8FA 1M9NA 3ZRXA 4I7ZB 4X1IB 1JVMA 3BRCA 5EYPB 1YDXA 4DR7B 1AP6A 5E1AC 5AG2A 1N8RW 1OCCB 1WA8A 1FS0G 1SQQH 3BEHA 1VF6C 1PL4A 3ABTA 3OW2U 2B5UA 3RYIB 4FM1A 2WAMA 2DMXA 1D5NA 1YIJV 5GTIZ 3HB3B 2Q9LA 2L6LA 2WLNA 2XT9A 5IJ0A 2A79B 2CGNA 1NH2D 4DV3B 4I9WA 3FX7A 2HJFC 3RYHA 2QTOA 2CDYA 3VQWA 1F4NA 3FFQA 1FXVA 4J7KA 1K4DC 4I50A 1JPXA 2XASA 4DK0A 4B08A 4XBFA 3STLC 1YJNV 1H2SB 1NQTA 4MSWC 4YY3B 5LOVA 3JD2A 5GW7A 2RDCA 1E79G 5IJ9A 2UUCB 1N4CA 2P7TC 5B66Z 4JI8B 4JI0O 1ENVA 3T4ZA 1HNZO 3JSNA 3WB1A 4DW1A 1KP3A 3CCLV 2IM9A 4MTOA 5J2TB 3JSLA 4RQFA 3FD9A 2Q67A 4LH7A 1KMIZ 4JI1O 4TQFA 3G6EV 4FLTA 4B7EA 3JALB 2ILMA 5C8YB 3K06A 3E8HA 5LYJB 1W0JG 1VQNV 3NR7A 1D5AA 3AG3B 2PUSA 5KHHA 4X66B 4HNAA 4UFZA 3X2QC 1L0LH 5LA6A 3CCMV 4R8CA 5ITZB 5IYDO 1ZL8A 5LMNO 1Q7YW 4A5UB 3OMNB 3JAMN 4FFBB 1X59A 4DXWA 4PDMA 1RPRA 4WBNA 5IYZB 3ASNC 2CGOA 4MTXA 1IXBA 3LNMB 4RWUA 4DV5O 1NI8A 2HVJC 3HKDB 3LNNA 4O4LA 3CRQA 4K8ZA 2A06H 3ZMTA 3OD4A 4FZ1A 4I55B 2D3OW 2Y0PA 1R3JC 4OXSA 1J5EB 2HFEC 2VQFO 4PI2A 1SA0A 3OTOB 2X6AA 2PTMA 2XAJA 3JAWA 4IL6Z 1H2NA 2Q5ZA 2UXCB 4LNUA 5B5EZ 1Q5OA 1XMQO 1R6KA 1AP5A 3QNEA 4EFEA 1M1KW 4Z2WA 4I4TB 4XDKA 3C3SA 3SJBC 5CN0A 3AG2C 1BCCH 3ZRWA 3DC6A 2ATKC 2ETNA 3HKEB 4FK5C 1E1RG 4O4HB 4WFEA 3STZC 3BABA 3D3IA 3OGCC 1HNXO 1H2LA 3W7TA 4EB6A 5L3EA 3E22A 1G6UA 2V1DA 2JGDA 5HFLA 4TUYB 3K08A 2JRIA 1CP9A 1BSMA 1OCZC 1YJ9V 4LCUC 3F7YC 1GMGA 2Z3YA 4JYAO 3DGEA 2E74B 4TWKA 5IJ0B 2OWOA 2E76B 1NR1A 4DV2O 1SF9A 2H8PC 3CC4V 2IJKA 2ZXWC 3QO5A 1JJOA 2VRZA 1W59A 1WN7A 2XAHA 3HR0A 5B1OA 2VQEB 4B3SB 4B3RB 4LWSA 1Q6IA 2PI5A 2QTSA 3CXHF 2YSUB 3DTUB 2Y69B 4J41A 3AG4B 1XBLA 4J9ZB 2Q7GA 5EK0A 2XAQA 4QNHB 3L74H 3J7AU 4UB8Z 3UQ8A 4NTYA 2AGAA 1BZKA 5IY5B 1BQZA 4JYBA 4FIPC 1NJIW 2PF4E 1S5HC 3OR7C 4JI7B 4HYOA 1XNRB 1UFIA 3BPZA 5LXTB 2WA3A 3JD4A 2CTRA 4ZOLB 5CBGA 1PV0A 4DUYO 1Y76B 4FLXA 4JI3B 1A32A 3K04A 3ML0A 3OMIB 4HNAB 4I50B 1BE3H 2OIEA 1OCOB 1LUWA 2A3QA 2UUCO 1BGYH 4JTDB 4DV3O 2GHYA 1HNZB 4JI0B 2ZQMA 2B9ZA 4GX2A 4DR1B 3JCZA 3AK3A 1IXMA 1AR1B 3T4DA 3TJTA 5IYCO 2UU9O 1Q86W 3SYAA 4D6TH 4DV6O 2Y0IA 3VQYA 4JAVA 4DR5B 5B1BB 1V55C 4IYHA 4JI1B 5L3GA 1PKXA 3L75H 2Q73A 4PJ0Z 4I5SA 4LF7O 3HKDA 1U96A 3KKYA 4P9OA 1AI4A 3BVOA 3ZJZA 4CS2A 5BZBA 3JALA 4FLYA 2DJVA 2ODMA 5C8YA 1XHZA 4W4KA 4AI8A 1N34O 3JAKB 4DRXB 3ABKC 5CA1B 3H1JH 1H8EG 1H2GA 4E2LA 3T1HB 3JYCA 5BR8O 4OX9O 3VQXA 4GKKB 1NVPB 3AG4C 3CB2A 2LP7A 2R70A 4L8JA 3ZHTA 3CJHA 2BOCC 4R7CA 3RVYA 3E35A 2PY5A 3ABUA 3AG1C 3ZHQA 1GN6A 1GRJA 1TUEB 4FZ0A 4YJ3A 2Q7EA 1LR1A 4PDRA 2ZKOA 1SQVH 2OCHA 2ARHA 3LDDA 3MHSC 4FLVA 5E79Z 2JGUA 2X0LA 2E5LO 1PNMA 1QBZA 3H1KH 3AG2B 2BCCH 4UCSA 1AR5A 2DN9A 4MTFA 4K8XA 2JGDB 3A0HZ 2GUZA 1NS1A 1XHXA 1VF5B 3ZX6A 2YEVA 4H37A 3ZRVA 5B3SC 4JI5O 1WPXA 1B3QA 3P32A 4N21A 3CRAA 2LW7A 4TV9A 1XOUA 2WLHA 1Y67A 2QJ1A 3SDLA 1AB3A 2NN4A 2H3OA 1ZLZA 5JJEB 4CS4A 5IWAB 1Q6UA 2JEXA 3GVMA 2JS3A 1OCRB 3OTOO 4I4TA 3E86A 4GUNA 5DN6G 4LBEC 4RO2A 1VEWA 4TT3G 4DR4O 3W7UA 2HG5C 3EVKA 5LHIA 1AROP 1K4CC 5KUMA 3L71H 5KLVH 3K79A 5CBHA 2F1MA 2EZOA 3CWBH 1QR8A 4DV4O 2F4VO 2N05A 2DE0X 4WFAV 4J10A 1MNGA 4X64B 3B8NA 1EM1A 1GN4A 1EN5A 2ITCC 3O65A 2YXYA 3OUFA 3AG3C 4JF3A 4J9YB 1F7YA 3CP1A 1Y76A 1ZWIC 1AI7A 4CH5A 2JEUA 1GN3A 1MZEA 3APOA 1T5EA 5LGUA 1GM8A 3AK1A 1L8DA 4TSFG 5LP6B 3C90A 2N04A 4X64O 3RFRA 5EYPA 3ETQA 1BHAA 4X1YA 1P7BA 3F5WC 3H1IH 4J7ZA 4DUZO 3BAAA 3IAYA 2AXTZ 3L9DA 5EBWC 1PPJH 2UUBB 3RYIA 1BS3A 2NLJC 3ZN0A 3CC7V 4K35A 4DV7B 3Q4HB 2HR3A 3ZS8C 5BMVB 1KU9A 1BT8A 2PYJA 3SPJA 2Y48A 2YICA 4FMTA 3IC7A 2P4KA 3E83A 4B3MB 4RQEA 3RYHB 4KUMA 4ABMA 3G4SV 2Q68A 2OYQA 1RP3B 2IW5A 4LF8B 1K92A 4MVMA 4YHHB 2LO1A 1MABG 3SJQC 2W0FC 1WB8A 3ZMZA 4DR7O 5LMNB 4LH6A 3N2KA 2AZ0A 2RCVA 3D3QA 3T2MA 3D36C 2QWQB 4G2KA 4MVZA 1L0NH 4K3AA 1DGSA 4TQDA 2LGQA 3M99B 1OCCC 4FLWA 2QSAA 4ZI7B 3CRCA 3OEHG 4H44B 1JOYA 2X6CA 4P2ZA 5L3CA 4JPRA 3ABMC 2WLLA 3B40A 3K58A 1G1XB 1K8AW 2YEVB 2BSKA 3SJCC 4XDJA 5EC1C 5EC2C 1BMFG 4GZRB 1GKFA 3I5DA 2W6IG 1IURA 1EN4A 3T1CA 2UXDB 1M90W 5KX5A 4DRXA 3L70H 1XEQA 3CRMA 3RVZA 3SYOA 1J95A 3OAAG 4LP8A 5KMGA 4O2BA 1S76D 2E75B 4WCEV 1FFXB 2GTSA 1LNQA 5ITZA 3WG7C 2WLKA 1YJWV 1H38A 2X6BA 3CSXA 3P3PA 1TVKB 5JCOA 4E4EA 4UV9A 3RT3C 4LF9B 4ZKIA 1VQMV 2AZ2A 1I7FA 3QG5A 4WBNB 3T1HO 4LFAO 1EBOA 3RYCB 1YTFD 3VQVA 3WU2Z 1I5XA 5JVDA 4IHJB 3RYFB 2PI4A 1PL0A 5GTHZ 4IT5A 3BA8A 3AG7A 2GUZB 1PNLA 4F6RB 4I55A 3BA9A 2C2AA 1AILA 5CB4A 1XMOB 4FM2A 2WLMA 3HKBB 2FB5A 4CH4A 1SQGA 1RFYA 3KCYA 2ZT9B 3OR6C 2LW1A 2F93B 2R9IA 1P84F 3K03A 5L3BA 4QGPA 1ORQC 4LNUB 1HR0B 1K5QA 2QM4A 2DWEC 2ZNJA 2QWRB 1GO3F 2QKSA 2EULA 1VIBA 3IGAC 4JZ2A 1KECA 4B3TB 3CHXA 2YXLA 4JAAA 4NR1A 1GM9A 1JFFA 1FXKB 2HEPA 1TUBA 3SGIA 5BY1A 2XAGA 1XNRO 4P9PA 4BIZA 3G6BA 5LBQA 5DECA 4N23A 2YI9A 3CXCU 1B04A 4DUYB 5A2QN 1JJ2U 3H1LH 2EILB 2KG7B 3VOUA 2HJDA 5EZYB 4JI6O 2R9AA 3H1HH 1Q90D 3APQA 2Q0OC 3WB2A 3TGUH 1N0NA 3H01A 3JD3A 4MTGA 1Q3EA 5JWPA 2A0LA 2UU9B 1WPBA 2ZR3A 4QE9A 5KHGA 1E1QG 3B77A 1DTOA 1COWG 1JR9A 4DR5O 1FAFA 2LFRA 3FYEB 1UJWB 1Z5WA 4RAIA 5JH7A 1K9MW 3K5OA 3GWOA 3P3NA 1QR9A 1RPOA 3N2GB 5EBLC 4U3JB 3ZMUA 4UCUA 1PNKA 5KHJA 4ZI7A 1Q8IA 2YXHA 2EBOA 2CH7A 4LFCO 1VARA 4ZBMA 2ZE6A 2P6JA 4O4IA 2WLLB 2YI8A 3Q4HA 1WLEA 4UVCA 2WSSG 4PV1B 2CK3G 4PA4A 3CCQV 3SYQA 4JYAB 2HP8A 4J11A 4JI2O 1RSOB 5GONB 4ZHQA 5BR8B 4K0KO 3JASA 2NR5A 4YIOA 4UUJC 3SYCA 1DF5A 1Q82W 1VMGA 3A0BZ 3K5MA 1B06A 2H94A 4B3MO 4GX1A 4O2BB 3K9AA 4X65B 5CA0A 1KUQA 2DQ0A 1SQBH 1HWYA 1DF4A 4JI2B 2CUGA 4HZ3A 3RYCA 4X62B 4C7UA 4H13B 1QVGU 3DSQA 4JI5B 5FPRA 3E2EA 3BHPA 1K7DA 4X8AA 3E89A 4IIJA 4OPAA 3UT5A 3ETDA 2JIZG 3KCXA 2EJ7A 3B8MA 1AJQA 4DR1O 5JJNB 4BIUA 2NNUA 2EX3A 2YS8A 2XHBA 4UCTA 2QKCA 4KP4A 4QPKA 3IC9A 5KMGB 4GKJO 3JD1A 4XDLA 2XOKG 4Z1MG 4YJ3B 4JAUA 1R73A 3S3WA 1M57C 3JCUZ 2QA4V 1OZ0A 1QNMA 1VQ6V 5DEDA 5LMUO 3A2FA 1GH6A 2Z5UA 2EIMB 4YY3O 4DR2O 2JK5C 3G80A 4LF7B 3RYFA 1ZTEA 2P5OA 2ZDIC 4GKJB 2ZM6B 4LF9O 4GX0A 4QJFB 1SZTA 1F4MA 2KB1A 4PELA 3K5NA 2Z0AA 4PA7A 1IBKB 4KFMA 3SJAC 4MVUA 4JYCA 2EIMC 1I0HA 3D8CA 2XAFA 2E3CA 1SETA 2QDOA 4GKKO 1JCHA 5JQGB 2BOBC 4GYCB 2B1IA 2CE4A 4B3SO 4B3RO 1P7GA 2YIAA 3UO3A 5J2UB 1M4UA 5JH7B 4X88A 4DR6B 1GAXA 3X2QB 1IZ3A 1FXKA 1Z5VA 3ZCCA 2ZNIA 2IU3A 2JVDA 3F5TA 3ICXA 3OT7A 1ZL8B 1FKAO 3EFFK 1SS3A 2DWDC 2IJJA 4D7TA 1HP8A 4NTXA 5H2FZ 1XILA 3FB5C 1MSWD 1IX9A 2EZPA 1NTMH 4FLZA 1IVSA 4DR6O 1RSOA 2W6JG 4ZHQB 1K34A 2KG7A 3RW0A 3M8AA 3WG7B 2CTPA 2HHHB 2D2CB 2IJHA 2ADPA 3ABLB 1H2KA 1AI5A 2HVKC 2HLDG 5LP6A 4DR4B 4MVQA 3CMAV 2LQTA 1DK1A 4BAYA 2JS5A 4U7OA 1YI2V 1YTFB 1M57B 1SA0B 1J5EO 2VQFB 1WAZA 2UXNA 2P67A 3QVNA 4X1YB 2FYUH 2OCCB 2QWNB 2YIBA 3JATB 2XTAA 3JAWB 1M56C 3VBBA 4BR6A 1S5JA 1O9GA 1WP7A 1FYJA 2M7WA 4Z1VA 3J81N 2PGGA 2AW9A 1KQSU 2WLIA 1SKVA 1ZX3A 3HKCB 5B1BC 2DOSA 1XMQB 3ASNB 3L72H 1M5IA 2IH1C 5KHKA 2FTKA 1MSDA 3OEEG 4NXMO 2DYSC 2JJ1G 5EIBC 4IIJB 2HKOA 3UT5B 1FPOA 5BXZA 4EB6B 5LGNA 4OGQB 5LGTA 4J80A 2GBOA 4TUYA 4JTAB 5K1XA 1N32B 1VF7A 3JASB 4BW9A 4NKGB 3LSQA 4I0XA 3I55V 1S77D 1K73W 3MDSA 5LA6B 1EN6A 2IJIA 3QO8A 1LUVA 2PYLA 1F51A 1SZXA 3CEIA 5KAIZ 2CTQA 1VQ7V 5CA0B 4LWSB 1M93A 4DR3O 3K0DA 4LFBB 4PHZA 1URFA 5H9CA 1VQ4V 3ASOB 5IYZA 4X65O 5K1PA 2VWJA 3TXQA 2EJRA 4DV7O 3CRRA 5FNVB 3K0GA 3AEIA 3MHHC 4LF8O 2DYRB 1B6QA 1XNQO 1AJNA 4YHHO 1YF2A 2GSMB 2YUAA 4PI0A 3S3XA 3OFNG 2P90A 3CCJV 2PZSA 5KX5B 2B1GA 1U97A 1Q6HA 1VQ5V 3PJSK 4UVAA 2GV9A 1FFXA 3K9SA 1QHTA 3CCSV 4JI4O 4GCZA 4R50A 4X89A 4ZOLA 1KKDA 1KC8W 1Y4MA 5J2UA 1FJGB 2AHZA 5IT9N 2RQ6A 3U11A 3CYOA 1XUQA 1V54B 4J7JA 4JI3O 3B09A 1SC5B 5JVDB 2V4DA 3SPHA 1AR4A 2FL4A 4Q6GA 4O4JB 2Y4UA 1YVWA 1R3KC 3UM7A 1W0KG 4DV1B 2BTQA 5CB4B 1GN2A 1DLBA 1TAEA 3K59A 3HKBA 1HDJA 3TCUA 1IBMO 3LDCA 3NXSA 5F2VO 1ZSPA 4UCVA 1S3JA 2ZM6O 1N36O 1P4RA 5JJJB 4LFAB 1N33B 1YCIA 3JD0A 4X1KB 2EIJC 1K3EA 4DV1O 1OCZB 3ZHUA 5EBMC 3EHBB 1V9PA 2Q4PA 1R3IC 4AQYO 3RWRD 1EZJA 5B3SB 4F6EA 3TETA 4UB6Z 1TGOA 3A8TA 4DV0O 3TXSA 4JTCB 4MVRA 1AI6A 1IBLO 1G4YB 2ZINA 4FVMA 4MT8A 5H6QA 1CEZA 3ZHRA 1KKCA 1HR0O 1S0VA 2LJ2A 4DV5B 1I94O 5EZYA 2GTAA 1IDSA 2ZDIA 3U0ZA 4X20B 1SERA 3QTCA 3ZIAG 2DYRC 4CH3A 2F95B 3SPGA 1WP8A 4PDVA 2R9RB 5KA5A 2OT5A 3CMEV 2LFSA 4J42A 2MK3A 2A9HA 2P22C 3ZN1A 3ABKB 3OE7G 3CCEV 1CXZB 4PA9A 1V54C 4U3JA 3CE2A 1WNSA 1YHQV 1I94B 3I56V 1R6NA 3JATA 2CH7B 1HNWB 1YEWA 3ABMB 3FYIB 4TV8B 3B4SA 3SYPA 1Z2GA 4O4IB 4WFBV 2Q0AA 1QQCA 1VQPV 1G8MA 3HKCA 1HNXB 4UCOA 5DM6V 4UV8A 4YJ2B 3ZHVA 4FLUA 5FNVA 3K5LA 4JI6B 4X1IA 5FL7G 1P49A 3ZMSA 3J80N 1WA8B 4AILC 2W0XA 4JYYA 1Y74B 3FAVB 5FPOA 5CA1A 2M6YA 4NXMB 1HNWO 3W7SA 4JV5O 2KQXA 3LDEA 3E8GA 3U10A 1NVPD 1XL6A 1K97A 3SPIA 1I5YA 3BCCH 4I0XB 4LFCB 1CPYA 2VQEO 4IGGA 1ZAUA 3CJHB 1XI1A 4PD4F 4H0LB 5KAFZ 1NU1H 1NBMG 4MS2A 5KHIA 1AVMA 1H2MA 4RUFA 4FJCC 4AHCA 5KUKA 1Q81W 2GDSA 3OM3B 4UVBA 5TISZ 3LSUA 5IY5C 2RN9A 1JQ0A 4EKWA 1JX9A 3F7VC 2BTQB 2XUMA 5CMUA 2YIBD 3CC2V 4LF6B 2L35A 2ZE8A
chains in the Genus database with same CATH topology
2NR5A 2GBOA 2ODMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NR5 A;  2GBO A;  2ODM A; 
#chains in the Genus database with same CATH topology
 2VWK A;  4KL1 A;  4TV9 B;  1MOF A;  3L73 H;  4O2A A;  2F23 A;  4JI4 B;  1FJG O;  3BY6 A;  4ASU G;  3BFR A;  4U3F H;  3C3T A;  2ZXW B;  1K5S A;  1SQP H;  5KA6 A;  3ETE A;  2ZE5 A;  4ICG A;  4JZG A;  4OPH A;  1V55 B;  1WJZ A;  4LF6 O;  2LGW A;  5IDJ A;  3TK1 A;  3W7X A;  2DW4 A;  3ZHS A;  1NTZ H;  4R6Z A;  3CD6 V;  2CAZ C;  2F4V B;  3M7M X;  3ABL C;  2CTW A;  2Q6A A;  3SPC A;  2IU0 A;  2EIN B;  1W2B U;  1BL8 A;  4CH6 A;  2BTO A;  1TA8 A;  4FFB A;  1X4T A;  4NTW A;  4BW5 A;  1N0J A;  4CC6 A;  3RGB A;  3FB6 C;  2QEX V;  2UXB B;  4KHP O;  3OTF A;  4GLX A;  4B7K A;  3CCR V;  4W4L A;  2BSK B;  4CC5 A;  1AJP A;  5JQG A;  2V7Q G;  4O4L B;  2OTL V;  4G28 B;  2K1E A;  1VQ9 V;  5H6R A;  4AQY B;  1D2D A;  5HFM A;  3G71 V;  1SRY A;  4X1K A;  3IJ4 A;  1NZ6 A;  4D7S A;  2G38 A;  1O9H A;  4BWA A;  4OX9 B;  2XND G;  4FFK A;  2RNB A;  2EIJ B;  4WFF A;  4CBC A;  3N27 A;  3DXR B;  3O9O A;  1N36 B;  1OHH G;  4LC1 A;  4KHP B;  5EIB D;  2OCC C;  2F66 C;  4PA3 A;  4GX5 A;  1XRE A;  3A0R A;  1KYO F;  1NTK H;  1SQF A;  4DK1 A;  4GT1 A;  1YIT V;  4X66 O;  5BMV A;  4YJ2 A;  5CBF A;  2IBZ H;  1MMM A;  4EFB A;  3GWK C;  1FXH A;  2Y4T A;  1H8H G;  3H9V A;  3AG1 B;  4O4H A;  3T1Y B;  4LF4 O;  4NXN O;  2OTJ V;  2QWO B;  1OCO C;  5L3F A;  3JAR A;  3OUS A;  3LSS A;  4IHJ A;  3E22 B;  1Y74 A;  3FAV A;  5L3D A;  2QM7 A;  1I08 A;  4WF9 V;  4X20 A;  4F6R A;  1FFT B;  2Q7H A;  2YC0 A;  2UXX A;  3WB0 A;  1PM9 A;  3N2K B;  3KZI Z;  3RBZ A;  1XMO O;  2YID A;  1PP9 H;  4QIW F;  5A9G A;  1MG1 A;  4G27 B;  3LUT B;  4DO2 A;  1OCR C;  2R72 A;  5JCO C;  4JI7 O;  5IWA O;  3CS5 A;  2WLI B;  1R6T A;  2EIK B;  2VS0 A;  4CS3 A;  1R1B A;  3ASO C;  4MVS A;  5C93 A;  4TV8 A;  3G67 A;  4LR3 A;  4DV6 B;  2UXC O;  4B3T O;  3MD0 A;  1MA1 A;  2BE3 A;  4H33 A;  4NB5 A;  2OIG A;  4YIP A;  1NKD A;  1SES A;  4PDL A;  1TUB B;  4X9Q A;  4DYL A;  5IE9 A;  3CCU V;  1XL4 A;  3HPL C;  3R65 A;  4L87 A;  4LF5 B;  1Y66 A;  2UUA O;  1R3L C;  4UXN A;  1YZB A;  2UXD O;  4YXW G;  3UCS C;  1US6 A;  3EXA A;  2HHH O;  4NVP A;  1GTO A;  5D5Q A;  2YDE A;  3RN4 A;  2EIK C;  2Q69 A;  5LXT A;  3ZED A;  2RMK B;  1NT2 B;  1TVK A;  2EIL C;  2P4V A;  2Y69 C;  3AK2 A;  3B2E E;  4JI8 O;  4JV5 B;  4LF5 O;  1VF6 A;  2UUA B;  3D36 A;  5LOV B;  1BQ0 A;  3ZRS A;  4I9Q A;  4QPJ A;  5FLX N;  4MVO A;  4TOI A;  4DUZ B;  5LMU B;  5IJ9 B;  5LL6 Y;  3QF7 A;  3UO2 A;  4Q20 A;  5J2T A;  3FKS G;  3GB7 C;  3THO A;  2DYS B;  1GM7 A;  3OMA B;  4WFG A;  1N33 O;  2X7R B;  3KG2 A;  1N32 O;  1MZF A;  3PN1 A;  2QWP B;  2JJ2 G;  3DC5 A;  2O57 A;  4ZIB A;  4O2A B;  2ZIO A;  3W7W A;  4DR3 B;  4LFB O;  5H5N A;  2E5L B;  2KKW A;  5GON A;  1F23 A;  1M56 B;  2WLJ A;  2ZR2 A;  3R66 A;  3CCV V;  1WB7 A;  5IYB O;  3JAK A;  1GK9 A;  4DV0 B;  1YSC A;  1L1F A;  1OJH A;  1JMK C;  1XNQ B;  1KP2 A;  2ZCE A;  2JDI G;  2QR4 A;  1JFF B;  3P30 A;  4KXR A;  2WWW A;  3QO7 A;  4FM0 A;  4RUE A;  2ZE7 A;  2FKX A;  1QLN A;  4O4J A;  1S5L Z;  4U7N A;  3FB7 C;  1K33 A;  5D5P A;  2QM8 A;  3ZBH A;  5LP6 C;  2ITD C;  1KBH A;  4JAS A;  4JGS A;  2UXB O;  2DQ3 A;  1QLE C;  2N74 A;  2MW2 B;  2A7W A;  3JAR B;  1VQL V;  4WFH A;  4UCR A;  1EZV H;  5B1A C;  4NYK A;  1VQK V;  1KB9 F;  1VQO V;  5J9P C;  4CZZ A;  1THZ A;  1XQ8 A;  4DV4 B;  2AHY A;  1QVF U;  3SR2 C;  1NH2 B;  2IH3 C;  5LYJ A;  3E8B A;  1BHB A;  4DW0 A;  4HBN A;  1FXK C;  2P06 A;  4HAM A;  1Q43 A;  4BIO A;  3N2G A;  3K57 A;  2FML A;  1N34 B;  1FD9 A;  2EIN C;  3DXR A;  3K3W A;  3ZRW B;  3WFV A;  1SQX H;  3HKE A;  1PD3 A;  1JA8 A;  1QU7 A;  2K9P A;  3CX5 F;  1Y6X A;  2ZIM A;  4FPP A;  2F43 G;  3IFX A;  5LHH A;  4QE7 A;  4DV2 B;  1VQ8 V;  3ZMV A;  3FB8 C;  5CA3 A;  1RM1 C;  4K0K B;  2ADQ B;  1IBM B;  1HW7 A;  4IYI A;  1KD1 W;  4DR2 B;  4PA6 A;  2QE7 G;  4F4L A;  5B1N A;  1YXB A;  5B1A B;  2WPD G;  1UPG A;  1NR7 A;  4MW8 A;  1ROP A;  3OGI B;  3T1Y O;  2UUB O;  4LF4 B;  4NXN B;  2ZD9 A;  2WA4 A;  1IBK O;  1ZUQ A;  1RM1 B;  1OV9 A;  1QLE B;  2QGN A;  3ETG A;  2QKA A;  1XDC A;  1VP7 A;  3MAQ A;  2RJZ A;  1IBL B;  4EEQ A;  3UKM A;  5LHG A;  2Q8V A;  3CPW U;  1QCE A;  4X62 O;  1S72 V;  2KSD A;  4P30 A;  1EFR G;  4MW3 A;  3E8F A;  1M9N A;  3ZRX A;  4I7Z B;  4X1I B;  1JVM A;  3BRC A;  5EYP B;  1YDX A;  4DR7 B;  1AP6 A;  5E1A C;  5AG2 A;  1N8R W;  1OCC B;  1WA8 A;  1FS0 G;  1SQQ H;  3BEH A;  1VF6 C;  1PL4 A;  3ABT A;  3OW2 U;  2B5U A;  3RYI B;  4FM1 A;  2WAM A;  2DMX A;  1D5N A;  1YIJ V;  5GTI Z;  3HB3 B;  2Q9L A;  2L6L A;  2WLN A;  2XT9 A;  5IJ0 A;  2A79 B;  2CGN A;  1NH2 D;  4DV3 B;  4I9W A;  3FX7 A;  2HJF C;  3RYH A;  2QTO A;  2CDY A;  3VQW A;  1F4N A;  3FFQ A;  1FXV A;  4J7K A;  1K4D C;  4I50 A;  1JPX A;  2XAS A;  4DK0 A;  4B08 A;  4XBF A;  3STL C;  1YJN V;  1H2S B;  1NQT A;  4MSW C;  4YY3 B;  5LOV A;  3JD2 A;  5GW7 A;  2RDC A;  1E79 G;  5IJ9 A;  2UUC B;  1N4C A;  2P7T C;  5B66 Z;  4JI8 B;  4JI0 O;  1ENV A;  3T4Z A;  1HNZ O;  3JSN A;  3WB1 A;  4DW1 A;  1KP3 A;  3CCL V;  2IM9 A;  4MTO A;  5J2T B;  3JSL A;  4RQF A;  3FD9 A;  2Q67 A;  4LH7 A;  1KMI Z;  4JI1 O;  4TQF A;  3G6E V;  4FLT A;  4B7E A;  3JAL B;  2ILM A;  5C8Y B;  3K06 A;  3E8H A;  5LYJ B;  1W0J G;  1VQN V;  3NR7 A;  1D5A A;  3AG3 B;  2PUS A;  5KHH A;  4X66 B;  4HNA A;  4UFZ A;  3X2Q C;  1L0L H;  5LA6 A;  3CCM V;  4R8C A;  5ITZ B;  5IYD O;  1ZL8 A;  5LMN O;  1Q7Y W;  4A5U B;  3OMN B;  3JAM N;  4FFB B;  1X59 A;  4DXW A;  4PDM A;  1RPR A;  4WBN A;  5IYZ B;  3ASN C;  2CGO A;  4MTX A;  1IXB A;  3LNM B;  4RWU A;  4DV5 O;  1NI8 A;  2HVJ C;  3HKD B;  3LNN A;  4O4L A;  3CRQ A;  4K8Z A;  2A06 H;  3ZMT A;  3OD4 A;  4FZ1 A;  4I55 B;  2D3O W;  2Y0P A;  1R3J C;  4OXS A;  1J5E B;  2HFE C;  2VQF O;  4PI2 A;  1SA0 A;  3OTO B;  2X6A A;  2PTM A;  2XAJ A;  3JAW A;  4IL6 Z;  1H2N A;  2Q5Z A;  2UXC B;  4LNU A;  5B5E Z;  1Q5O A;  1XMQ O;  1R6K A;  1AP5 A;  3QNE A;  4EFE A;  1M1K W;  4Z2W A;  4I4T B;  4XDK A;  3C3S A;  3SJB C;  5CN0 A;  3AG2 C;  1BCC H;  3ZRW A;  3DC6 A;  2ATK C;  2ETN A;  3HKE B;  4FK5 C;  1E1R G;  4O4H B;  4WFE A;  3STZ C;  3BAB A;  3D3I A;  3OGC C;  1HNX O;  1H2L A;  3W7T A;  4EB6 A;  5L3E A;  3E22 A;  1G6U A;  2V1D A;  2JGD A;  5HFL A;  4TUY B;  3K08 A;  2JRI A;  1CP9 A;  1BSM A;  1OCZ C;  1YJ9 V;  4LCU C;  3F7Y C;  1GMG A;  2Z3Y A;  4JYA O;  3DGE A;  2E74 B;  4TWK A;  5IJ0 B;  2OWO A;  2E76 B;  1NR1 A;  4DV2 O;  1SF9 A;  2H8P C;  3CC4 V;  2IJK A;  2ZXW C;  3QO5 A;  1JJO A;  2VRZ A;  1W59 A;  1WN7 A;  2XAH A;  3HR0 A;  5B1O A;  2VQE B;  4B3S B;  4B3R B;  4LWS A;  1Q6I A;  2PI5 A;  2QTS A;  3CXH F;  2YSU B;  3DTU B;  2Y69 B;  4J41 A;  3AG4 B;  1XBL A;  4J9Z B;  2Q7G A;  5EK0 A;  2XAQ A;  4QNH B;  3L74 H;  3J7A U;  4UB8 Z;  3UQ8 A;  4NTY A;  2AGA A;  1BZK A;  5IY5 B;  1BQZ A;  4JYB A;  4FIP C;  1NJI W;  2PF4 E;  1S5H C;  3OR7 C;  4JI7 B;  4HYO A;  1XNR B;  1UFI A;  3BPZ A;  5LXT B;  2WA3 A;  3JD4 A;  2CTR A;  4ZOL B;  5CBG A;  1PV0 A;  4DUY O;  1Y76 B;  4FLX A;  4JI3 B;  1A32 A;  3K04 A;  3ML0 A;  3OMI B;  4HNA B;  4I50 B;  1BE3 H;  2OIE A;  1OCO B;  1LUW A;  2A3Q A;  2UUC O;  1BGY H;  4JTD B;  4DV3 O;  2GHY A;  1HNZ B;  4JI0 B;  2ZQM A;  2B9Z A;  4GX2 A;  4DR1 B;  3JCZ A;  3AK3 A;  1IXM A;  1AR1 B;  3T4D A;  3TJT A;  5IYC O;  2UU9 O;  1Q86 W;  3SYA A;  4D6T H;  4DV6 O;  2Y0I A;  3VQY A;  4JAV A;  4DR5 B;  5B1B B;  1V55 C;  4IYH A;  4JI1 B;  5L3G A;  1PKX A;  3L75 H;  2Q73 A;  4PJ0 Z;  4I5S A;  4LF7 O;  3HKD A;  1U96 A;  3KKY A;  4P9O A;  1AI4 A;  3BVO A;  3ZJZ A;  4CS2 A;  5BZB A;  3JAL A;  4FLY A;  2DJV A;  2ODM A;  5C8Y A;  1XHZ A;  4W4K A;  4AI8 A;  1N34 O;  3JAK B;  4DRX B;  3ABK C;  5CA1 B;  3H1J H;  1H8E G;  1H2G A;  4E2L A;  3T1H B;  3JYC A;  5BR8 O;  4OX9 O;  3VQX A;  4GKK B;  1NVP B;  3AG4 C;  3CB2 A;  2LP7 A;  2R70 A;  4L8J A;  3ZHT A;  3CJH A;  2BOC C;  4R7C A;  3RVY A;  3E35 A;  2PY5 A;  3ABU A;  3AG1 C;  3ZHQ A;  1GN6 A;  1GRJ A;  1TUE B;  4FZ0 A;  4YJ3 A;  2Q7E A;  1LR1 A;  4PDR A;  2ZKO A;  1SQV H;  2OCH A;  2ARH A;  3LDD A;  3MHS C;  4FLV A;  5E79 Z;  2JGU A;  2X0L A;  2E5L O;  1PNM A;  1QBZ A;  3H1K H;  3AG2 B;  2BCC H;  4UCS A;  1AR5 A;  2DN9 A;  4MTF A;  4K8X A;  2JGD B;  3A0H Z;  2GUZ A;  1NS1 A;  1XHX A;  1VF5 B;  3ZX6 A;  2YEV A;  4H37 A;  3ZRV A;  5B3S C;  4JI5 O;  1WPX A;  1B3Q A;  3P32 A;  4N21 A;  3CRA A;  2LW7 A;  4TV9 A;  1XOU A;  2WLH A;  1Y67 A;  2QJ1 A;  3SDL A;  1AB3 A;  2NN4 A;  2H3O A;  1ZLZ A;  5JJE B;  4CS4 A;  5IWA B;  1Q6U A;  2JEX A;  3GVM A;  2JS3 A;  1OCR B;  3OTO O;  4I4T A;  3E86 A;  4GUN A;  5DN6 G;  4LBE C;  4RO2 A;  1VEW A;  4TT3 G;  4DR4 O;  3W7U A;  2HG5 C;  3EVK A;  5LHI A;  1ARO P;  1K4C C;  5KUM A;  3L71 H;  5KLV H;  3K79 A;  5CBH A;  2F1M A;  2EZO A;  3CWB H;  1QR8 A;  4DV4 O;  2F4V O;  2N05 A;  2DE0 X;  4WFA V;  4J10 A;  1MNG A;  4X64 B;  3B8N A;  1EM1 A;  1GN4 A;  1EN5 A;  2ITC C;  3O65 A;  2YXY A;  3OUF A;  3AG3 C;  4JF3 A;  4J9Y B;  1F7Y A;  3CP1 A;  1Y76 A;  1ZWI C;  1AI7 A;  4CH5 A;  2JEU A;  1GN3 A;  1MZE A;  3APO A;  1T5E A;  5LGU A;  1GM8 A;  3AK1 A;  1L8D A;  4TSF G;  5LP6 B;  3C90 A;  2N04 A;  4X64 O;  3RFR A;  5EYP A;  3ETQ A;  1BHA A;  4X1Y A;  1P7B A;  3F5W C;  3H1I H;  4J7Z A;  4DUZ O;  3BAA A;  3IAY A;  2AXT Z;  3L9D A;  5EBW C;  1PPJ H;  2UUB B;  3RYI A;  1BS3 A;  2NLJ C;  3ZN0 A;  3CC7 V;  4K35 A;  4DV7 B;  3Q4H B;  2HR3 A;  3ZS8 C;  5BMV B;  1KU9 A;  1BT8 A;  2PYJ A;  3SPJ A;  2Y48 A;  2YIC A;  4FMT A;  3IC7 A;  2P4K A;  3E83 A;  4B3M B;  4RQE A;  3RYH B;  4KUM A;  4ABM A;  3G4S V;  2Q68 A;  2OYQ A;  1RP3 B;  2IW5 A;  4LF8 B;  1K92 A;  4MVM A;  4YHH B;  2LO1 A;  1MAB G;  3SJQ C;  2W0F C;  1WB8 A;  3ZMZ A;  4DR7 O;  5LMN B;  4LH6 A;  3N2K A;  2AZ0 A;  2RCV A;  3D3Q A;  3T2M A;  3D36 C;  2QWQ B;  4G2K A;  4MVZ A;  1L0N H;  4K3A A;  1DGS A;  4TQD A;  2LGQ A;  3M99 B;  1OCC C;  4FLW A;  2QSA A;  4ZI7 B;  3CRC A;  3OEH G;  4H44 B;  1JOY A;  2X6C A;  4P2Z A;  5L3C A;  4JPR A;  3ABM C;  2WLL A;  3B40 A;  3K58 A;  1G1X B;  1K8A W;  2YEV B;  2BSK A;  3SJC C;  4XDJ A;  5EC1 C;  5EC2 C;  1BMF G;  4GZR B;  1GKF A;  3I5D A;  2W6I G;  1IUR A;  1EN4 A;  3T1C A;  2UXD B;  1M90 W;  5KX5 A;  4DRX A;  3L70 H;  1XEQ A;  3CRM A;  3RVZ A;  3SYO A;  1J95 A;  3OAA G;  4LP8 A;  5KMG A;  4O2B A;  1S76 D;  2E75 B;  4WCE V;  1FFX B;  2GTS A;  1LNQ A;  5ITZ A;  3WG7 C;  2WLK A;  1YJW V;  1H38 A;  2X6B A;  3CSX A;  3P3P A;  1TVK B;  5JCO A;  4E4E A;  4UV9 A;  3RT3 C;  4LF9 B;  4ZKI A;  1VQM V;  2AZ2 A;  1I7F A;  3QG5 A;  4WBN B;  3T1H O;  4LFA O;  1EBO A;  3RYC B;  1YTF D;  3VQV A;  3WU2 Z;  1I5X A;  5JVD A;  4IHJ B;  3RYF B;  2PI4 A;  1PL0 A;  5GTH Z;  4IT5 A;  3BA8 A;  3AG7 A;  2GUZ B;  1PNL A;  4F6R B;  4I55 A;  3BA9 A;  2C2A A;  1AIL A;  5CB4 A;  1XMO B;  4FM2 A;  2WLM A;  3HKB B;  2FB5 A;  4CH4 A;  1SQG A;  1RFY A;  3KCY A;  2ZT9 B;  3OR6 C;  2LW1 A;  2F93 B;  2R9I A;  1P84 F;  3K03 A;  5L3B A;  4QGP A;  1ORQ C;  4LNU B;  1HR0 B;  1K5Q A;  2QM4 A;  2DWE C;  2ZNJ A;  2QWR B;  1GO3 F;  2QKS A;  2EUL A;  1VIB A;  3IGA C;  4JZ2 A;  1KEC A;  4B3T B;  3CHX A;  2YXL A;  4JAA A;  4NR1 A;  1GM9 A;  1JFF A;  1FXK B;  2HEP A;  1TUB A;  3SGI A;  5BY1 A;  2XAG A;  1XNR O;  4P9P A;  4BIZ A;  3G6B A;  5LBQ A;  5DEC A;  4N23 A;  2YI9 A;  3CXC U;  1B04 A;  4DUY B;  5A2Q N;  1JJ2 U;  3H1L H;  2EIL B;  2KG7 B;  3VOU A;  2HJD A;  5EZY B;  4JI6 O;  2R9A A;  3H1H H;  1Q90 D;  3APQ A;  2Q0O C;  3WB2 A;  3TGU H;  1N0N A;  3H01 A;  3JD3 A;  4MTG A;  1Q3E A;  5JWP A;  2A0L A;  2UU9 B;  1WPB A;  2ZR3 A;  4QE9 A;  5KHG A;  1E1Q G;  3B77 A;  1DTO A;  1COW G;  1JR9 A;  4DR5 O;  1FAF A;  2LFR A;  3FYE B;  1UJW B;  1Z5W A;  4RAI A;  5JH7 A;  1K9M W;  3K5O A;  3GWO A;  3P3N A;  1QR9 A;  1RPO A;  3N2G B;  5EBL C;  4U3J B;  3ZMU A;  4UCU A;  1PNK A;  5KHJ A;  4ZI7 A;  1Q8I A;  2YXH A;  2EBO A;  2CH7 A;  4LFC O;  1VAR A;  4ZBM A;  2ZE6 A;  2P6J A;  4O4I A;  2WLL B;  2YI8 A;  3Q4H A;  1WLE A;  4UVC A;  2WSS G;  4PV1 B;  2CK3 G;  4PA4 A;  3CCQ V;  3SYQ A;  4JYA B;  2HP8 A;  4J11 A;  4JI2 O;  1RSO B;  5GON B;  4ZHQ A;  5BR8 B;  4K0K O;  3JAS A;  2NR5 A;  4YIO A;  4UUJ C;  3SYC A;  1DF5 A;  1Q82 W;  1VMG A;  3A0B Z;  3K5M A;  1B06 A;  2H94 A;  4B3M O;  4GX1 A;  4O2B B;  3K9A A;  4X65 B;  5CA0 A;  1KUQ A;  2DQ0 A;  1SQB H;  1HWY A;  1DF4 A;  4JI2 B;  2CUG A;  4HZ3 A;  3RYC A;  4X62 B;  4C7U A;  4H13 B;  1QVG U;  3DSQ A;  4JI5 B;  5FPR A;  3E2E A;  3BHP A;  1K7D A;  4X8A A;  3E89 A;  4IIJ A;  4OPA A;  3UT5 A;  3ETD A;  2JIZ G;  3KCX A;  2EJ7 A;  3B8M A;  1AJQ A;  4DR1 O;  5JJN B;  4BIU A;  2NNU A;  2EX3 A;  2YS8 A;  2XHB A;  4UCT A;  2QKC A;  4KP4 A;  4QPK A;  3IC9 A;  5KMG B;  4GKJ O;  3JD1 A;  4XDL A;  2XOK G;  4Z1M G;  4YJ3 B;  4JAU A;  1R73 A;  3S3W A;  1M57 C;  3JCU Z;  2QA4 V;  1OZ0 A;  1QNM A;  1VQ6 V;  5DED A;  5LMU O;  3A2F A;  1GH6 A;  2Z5U A;  2EIM B;  4YY3 O;  4DR2 O;  2JK5 C;  3G80 A;  4LF7 B;  3RYF A;  1ZTE A;  2P5O A;  2ZDI C;  4GKJ B;  2ZM6 B;  4LF9 O;  4GX0 A;  4QJF B;  1SZT A;  1F4M A;  2KB1 A;  4PEL A;  3K5N A;  2Z0A A;  4PA7 A;  1IBK B;  4KFM A;  3SJA C;  4MVU A;  4JYC A;  2EIM C;  1I0H A;  3D8C A;  2XAF A;  2E3C A;  1SET A;  2QDO A;  4GKK O;  1JCH A;  5JQG B;  2BOB C;  4GYC B;  2B1I A;  2CE4 A;  4B3S O;  4B3R O;  1P7G A;  2YIA A;  3UO3 A;  5J2U B;  1M4U A;  5JH7 B;  4X88 A;  4DR6 B;  1GAX A;  3X2Q B;  1IZ3 A;  1FXK A;  1Z5V A;  3ZCC A;  2ZNI A;  2IU3 A;  2JVD A;  3F5T A;  3ICX A;  3OT7 A;  1ZL8 B;  1FKA O;  3EFF K;  1SS3 A;  2DWD C;  2IJJ A;  4D7T A;  1HP8 A;  4NTX A;  5H2F Z;  1XIL A;  3FB5 C;  1MSW D;  1IX9 A;  2EZP A;  1NTM H;  4FLZ A;  1IVS A;  4DR6 O;  1RSO A;  2W6J G;  4ZHQ B;  1K34 A;  2KG7 A;  3RW0 A;  3M8A A;  3WG7 B;  2CTP A;  2HHH B;  2D2C B;  2IJH A;  2ADP A;  3ABL B;  1H2K A;  1AI5 A;  2HVK C;  2HLD G;  5LP6 A;  4DR4 B;  4MVQ A;  3CMA V;  2LQT A;  1DK1 A;  4BAY A;  2JS5 A;  4U7O A;  1YI2 V;  1YTF B;  1M57 B;  1SA0 B;  1J5E O;  2VQF B;  1WAZ A;  2UXN A;  2P67 A;  3QVN A;  4X1Y B;  2FYU H;  2OCC B;  2QWN B;  2YIB A;  3JAT B;  2XTA A;  3JAW B;  1M56 C;  3VBB A;  4BR6 A;  1S5J A;  1O9G A;  1WP7 A;  1FYJ A;  2M7W A;  4Z1V A;  3J81 N;  2PGG A;  2AW9 A;  1KQS U;  2WLI A;  1SKV A;  1ZX3 A;  3HKC B;  5B1B C;  2DOS A;  1XMQ B;  3ASN B;  3L72 H;  1M5I A;  2IH1 C;  5KHK A;  2FTK A;  1MSD A;  3OEE G;  4NXM O;  2DYS C;  2JJ1 G;  5EIB C;  4IIJ B;  2HKO A;  3UT5 B;  1FPO A;  5BXZ A;  4EB6 B;  5LGN A;  4OGQ B;  5LGT A;  4J80 A;  2GBO A;  4TUY A;  4JTA B;  5K1X A;  1N32 B;  1VF7 A;  3JAS B;  4BW9 A;  4NKG B;  3LSQ A;  4I0X A;  3I55 V;  1S77 D;  1K73 W;  3MDS A;  5LA6 B;  1EN6 A;  2IJI A;  3QO8 A;  1LUV A;  2PYL A;  1F51 A;  1SZX A;  3CEI A;  5KAI Z;  2CTQ A;  1VQ7 V;  5CA0 B;  4LWS B;  1M93 A;  4DR3 O;  3K0D A;  4LFB B;  4PHZ A;  1URF A;  5H9C A;  1VQ4 V;  3ASO B;  5IYZ A;  4X65 O;  5K1P A;  2VWJ A;  3TXQ A;  2EJR A;  4DV7 O;  3CRR A;  5FNV B;  3K0G A;  3AEI A;  3MHH C;  4LF8 O;  2DYR B;  1B6Q A;  1XNQ O;  1AJN A;  4YHH O;  1YF2 A;  2GSM B;  2YUA A;  4PI0 A;  3S3X A;  3OFN G;  2P90 A;  3CCJ V;  2PZS A;  5KX5 B;  2B1G A;  1U97 A;  1Q6H A;  1VQ5 V;  3PJS K;  4UVA A;  2GV9 A;  1FFX A;  3K9S A;  1QHT A;  3CCS V;  4JI4 O;  4GCZ A;  4R50 A;  4X89 A;  4ZOL A;  1KKD A;  1KC8 W;  1Y4M A;  5J2U A;  1FJG B;  2AHZ A;  5IT9 N;  2RQ6 A;  3U11 A;  3CYO A;  1XUQ A;  1V54 B;  4J7J A;  4JI3 O;  3B09 A;  1SC5 B;  5JVD B;  2V4D A;  3SPH A;  1AR4 A;  2FL4 A;  4Q6G A;  4O4J B;  2Y4U A;  1YVW A;  1R3K C;  3UM7 A;  1W0K G;  4DV1 B;  2BTQ A;  5CB4 B;  1GN2 A;  1DLB A;  1TAE A;  3K59 A;  3HKB A;  1HDJ A;  3TCU A;  1IBM O;  3LDC A;  3NXS A;  5F2V O;  1ZSP A;  4UCV A;  1S3J A;  2ZM6 O;  1N36 O;  1P4R A;  5JJJ B;  4LFA B;  1N33 B;  1YCI A;  3JD0 A;  4X1K B;  2EIJ C;  1K3E A;  4DV1 O;  1OCZ B;  3ZHU A;  5EBM C;  3EHB B;  1V9P A;  2Q4P A;  1R3I C;  4AQY O;  3RWR D;  1EZJ A;  5B3S B;  4F6E A;  3TET A;  4UB6 Z;  1TGO A;  3A8T A;  4DV0 O;  3TXS A;  4JTC B;  4MVR A;  1AI6 A;  1IBL O;  1G4Y B;  2ZIN A;  4FVM A;  4MT8 A;  5H6Q A;  1CEZ A;  3ZHR A;  1KKC A;  1HR0 O;  1S0V A;  2LJ2 A;  4DV5 B;  1I94 O;  5EZY A;  2GTA A;  1IDS A;  2ZDI A;  3U0Z A;  4X20 B;  1SER A;  3QTC A;  3ZIA G;  2DYR C;  4CH3 A;  2F95 B;  3SPG A;  1WP8 A;  4PDV A;  2R9R B;  5KA5 A;  2OT5 A;  3CME V;  2LFS A;  4J42 A;  2MK3 A;  2A9H A;  2P22 C;  3ZN1 A;  3ABK B;  3OE7 G;  3CCE V;  1CXZ B;  4PA9 A;  1V54 C;  4U3J A;  3CE2 A;  1WNS A;  1YHQ V;  1I94 B;  3I56 V;  1R6N A;  3JAT A;  2CH7 B;  1HNW B;  1YEW A;  3ABM B;  3FYI B;  4TV8 B;  3B4S A;  3SYP A;  1Z2G A;  4O4I B;  4WFB V;  2Q0A A;  1QQC A;  1VQP V;  1G8M A;  3HKC A;  1HNX B;  4UCO A;  5DM6 V;  4UV8 A;  4YJ2 B;  3ZHV A;  4FLU A;  5FNV A;  3K5L A;  4JI6 B;  4X1I A;  5FL7 G;  1P49 A;  3ZMS A;  3J80 N;  1WA8 B;  4AIL C;  2W0X A;  4JYY A;  1Y74 B;  3FAV B;  5FPO A;  5CA1 A;  2M6Y A;  4NXM B;  1HNW O;  3W7S A;  4JV5 O;  2KQX A;  3LDE A;  3E8G A;  3U10 A;  1NVP D;  1XL6 A;  1K97 A;  3SPI A;  1I5Y A;  3BCC H;  4I0X B;  4LFC B;  1CPY A;  2VQE O;  4IGG A;  1ZAU A;  3CJH B;  1XI1 A;  4PD4 F;  4H0L B;  5KAF Z;  1NU1 H;  1NBM G;  4MS2 A;  5KHI A;  1AVM A;  1H2M A;  4RUF A;  4FJC C;  4AHC A;  5KUK A;  1Q81 W;  2GDS A;  3OM3 B;  4UVB A;  5TIS Z;  3LSU A;  5IY5 C;  2RN9 A;  1JQ0 A;  4EKW A;  1JX9 A;  3F7V C;  2BTQ B;  2XUM A;  5CMU A;  2YIB D;  3CC2 V;  4LF6 B;  2L35 A;  2ZE8 A; 
#chains in the Genus database with same CATH homology
 2NR5 A;  2GBO A;  2ODM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...