2GBOA

Protein of unknown function ef2458 from enterococcus faecalis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
MDEGISKKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0358 protein EF2458
publication title X-ray crystal structure of conserved hypothetical protein EF_2458 from Enterococcus faecalis.
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 31
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07408 DUF1507 Protein of unknown function (DUF1507)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2gboA00
2GBOA 2ODMA 2NR5A
chains in the Genus database with same CATH superfamily
3ZBHA 1H8EG 3W7UA 4JI3O 1IXBA 2YEVB 3KG2A 4K8ZA 1V54B 3QF7A 5LP6C 1M90W 1XNRO 1H8HG 1IDSA 3OE7G 3X2QC 3FYIB 4WFHA 1P7GA 3RBZA 4P9OA 3L75H 4YJ2A 1KYOF 4UCUA 4WFAV 1LNQA 2HJFC 4G27B 1N34O 1NVPB 1GM7A 2Y48A 1PKXA 2UUAO 4PI0A 1Q43A 2FL4A 2P22C 4JI5O 5JVDA 4UVAA 1KKCA 1YF2A 2EZPA 4ASUG 4X1IB 2EBOA 2XOKG 5IDJA 3CRRA 3CX5F 1IBKB 5KHJA 1P84F 3C3SA 1SQVH 4NKGB 4GT1A 3UT5B 1SA0B 4I55B 3WU2Z 4GKJB 2QSAA 2D3OW 1K92A 3IC7A 1V55B 4DR1B 2A06H 2X6AA 2QTOA 5EZYA 2OTLV 2LQTA 2JGDB 3ZMVA 3K04A 1WPBA 2QA4V 1Y67A 2DYSB 3CCEV 1GTOA 4I50B 1Z2GA 2NNUA 3F5WC 1FD9A 4JZGA 4CZZA 3W7WA 1GM8A 3VOUA 2BTQA 3K08A 1NTKH 2DJVA 2RQ6A 3RW0A 3MAQA 2WA4A 1XNQB 3NR7A 2P06A 1YJ9V 1FXKC 1Q8IA 3JAWA 3ZHVA 5H9CA 4QPJA 4X1KB 2A3QA 3KCYA 3I5DA 3T4ZA 3KCXA 2F1MA 1S5JA 1HNWO 1AI7A 1Q6HA 5EC2C 3ETEA 4LFCB 1W2BU 1SF9A 4X1YB 2JVDA 2UXBB 1WB7A 1NH2D 3DXRA 4X89A 4BR6A 4ZOLB 2UXXA 5CN0A 2EILB 4HAMA 5LMNO 3QO5A 4D6TH 4EKWA 5EBLC 4B3SB 2PTMA 3ABLC 3LDEA 4KUMA 2C2AA 2UU9B 3M99B 1OCCB 3T1YB 1J5EO 1JA8A 3JD3A 3CRMA 2Q5ZA 1OJHA 2E5LO 5ITZB 4DV1B 4R6ZA 1WP8A 1KB9F 4UB8Z 3JD1A 4DR2B 4DO2A 2HHHB 5CA3A 2M7WA 1B6QA 2XAQA 1Q5OA 3T1HB 4MSWC 1PV0A 1VARA 1BCCH 2QDOA 3ZX6A 5CA0B 3HR0A 3MHHC 3HKCB 2EZOA 1I08A 2JGUA 3DSQA 3CP1A 4FLZA 3ZN0A 4O2BA 2MK3A 1XNRB 4I0XB 2KB1A 4I9WA 5IJ9B 3AEIA 2YUAA 2LP7A 3JSLA 1WA8B 3CCLV 3U10A 4I4TB 4ZHQB 3A0RA 4PA3A 2XAHA 2VWJA 1VQLV 4FLUA 3TGUH 4OPHA 5IWAO 3HKBA 2DE0X 3JAKA 1OCRC 3K9AA 1N34B 1IBMO 1SS3A 3QG5A 2E75B 4YXWG 3HKDA 2XUMA 4BAYA 1GN6A 1W0KG 5EK0A 4MTOA 4O4LA 2GBOA 1EZJA 5KLVH 3K59A 5KHKA 3CCVV 2JRIA 1GAXA 3OEEG 4LF8O 2UXCO 4TWKA 3ZMZA 4FLWA 4B3RB 4TV8A 1OCOC 3N2GB 2Q7HA 3JALA 5TISZ 2QR4A 3FAVB 2EULA 2F66C 3VBBA 3L71H 3OTOB 2QE7G 4DV6O 3ZHRA 3OR6C 4EB6B 2CGNA 4NTWA 4AI8A 4JAUA 5LYJA 1LUVA 5IT9N 2Y0PA 3QNEA 1L0LH 3B77A 1ENVA 1Q90D 2ODMA 3S3XA 1YVWA 4WFGA 3B09A 1SQQH 4ZI7A 4FFBB 5B1NA 1VQKV 4FM0A 2Q0AA 1AJQA 1EN4A 5L3GA 2DYRC 1DF4A 3JSNA 2D2CB 3OM3B 4DYLA 1RM1B 2HKOA 3VQXA 3FB8C 1AB3A 4QNHB 1XHXA 4K0KO 3AK3A 2XAFA 4DK0A 2IU3A 1HNWB 1YDXA 3BEHA 4CS4A 4QPKA 2OCHA 2FTKA 5GONA 1M56C 4KFMA 5LP6B 2CTWA 5EC1C 3UKMA 1NI8A 3B8MA 1KD1W 3X2QB 3O65A 3RYIA 4DR6O 4DR5O 3BAAA 2GDSA 1YITV 2ADPA 1J5EB 1SETA 1GK9A 3JARA 1XMOB 2WLLB 4BIZA 2E5LB 1E1RG 1Q3EA 4MTFA 1EN5A 1ORQC 4J9YB 3DXRB 5KAIZ 1IVSA 5L3FA 4RUFA 2JJ1G 3MD0A 1FXVA 3L73H 2Q68A 1VQ7V 4O2AA 5KMGB 2H94A 3M7MX 3AG4C 3CCRV 5BR8O 3QTCA 2V4DA 4O4JB 2EJRA 1MSWD 1MA1A 3QVNA 3CCUV 3D36C 1YSCA 1R1BA 1E79G 1NS1A 4WCEV 2GUZA 3JATB 3OMAB 1ZWIC 4DR3O 1ROPA 3ZHQA 1N36O 1XDCA 3CB2A 4GUNA 3JASB 2ATKC 3DC5A 5CBHA 2BE3A 3FKSG 1IBLB 3CMEV 2VQEB 1WN7A 1WPXA 2P90A 3B4SA 4X66O 4EEQA 4MVOA 3SGIA 5LOVB 1K5QA 4FVMA 2HR3A 4BW9A 1Y76A 1MZEA 4XDKA 4HBNA 4NTXA 3APQA 5AG2A 4CS2A 2HLDG 2X7RB 2PZSA 2QM4A 4LF7O 4JASA 1H2NA 3D3QA 2QJ1A 4JI1B 1FXKB 4NXNO 1EZVH 3IAYA 1NTZH 1NTMH 1AJPA 1S72V 4EFBA 4UVBA 1N8RW 4NTYA 4GKKO 2IH3C 3TCUA 2X6BA 2OIGA 1UJWB 4ZKIA 3JAKB 4X62O 2F4VB 3BHPA 4DV6B 4JGSA 2ZDIC 4UV8A 1B3QA 1I0HA 1BHAA 4FFKA 5H6RA 2EIMC 2CAZC 4PV1B 5CBFA 3ABLB 3HKEB 3K0DA 3EFFK 1EM1A 4YJ3A 3BA9A 3VQVA 3A8TA 4J80A 4B3MB 2Q7EA 5LGNA 2OCCC 2LFSA 1XI1A 4CH4A 1YEWA 2RN9A 2DW4A 4CH3A 1SERA 2PY5A 3E8GA 2LFRA 2N04A 4FM1A 4MVQA 5LHGA 1G1XB 4O4IA 1D5NA 2Q0OC 2ZE5A 2FB5A 1G4YB 4LWSA 3IJ4A 1H2GA 5J9PC 2YC0A 3FX7A 2QKCA 4GYCB 3E2EA 3IC9A 4UFZA 3FB7C 1P7BA 1Y6XA 5LXTB 4TV9A 1YXBA 4LF4B 1S77D 1HNXO 2EX3A 1FFTB 4P9PA 5L3BA 2PYJA 1R3IC 4KXRA 3CCQV 1GRJA 1VQOV 4U7NA 1RFYA 4OX9O 2LGQA 2LO1A 2Q67A 4FLTA 1XEQA 4X20A 4MVSA 5LL6Y 2CUGA 3ASOC 1GN2A 1K7DA 5EIBD 4LH7A 4QGPA 1SQPH 2WPDG 4PA7A 4OGQB 2NN4A 3K58A 1S3JA 4JPRA 4DRXA 1FJGB 1OCRB 3NXSA 2B9ZA 4JYYA 1U97A 4LFAB 4JF3A 2Y4UA 5KX5B 2WLHA 3WFVA 4F6RB 2EIJC 3VQWA 1NR1A 2NR5A 2F43G 2XAGA 3KZIZ 2LW1A 3JAMN 1WJZA 3J7AU 5B5EZ 1OCOB 1JVMA 3OMIB 3GWOA 4FIPC 3RYHA 2N05A 3TXQA 4X65O 1MOFA 3SJCC 4DR3B 2AHYA 3G6EV 1N36B 4MW3A 1IX9A 4JAVA 1TUBA 2B1GA 2JK5C 2RJZA 1YIJV 3DTUB 4JI4O 3H1KH 4I9QA 3GVMA 2XHBA 3C3TA 4X66B 5H2FZ 1QNMA 3ZRXA 1VF7A 2XNDG 2L6LA 3T4DA 4TSFG 4CC5A 1Y74B 1F7YA 3OUFA 4JI8B 2DYRB 2QWOB 5KA6A 4LF7B 4OPAA 2ZE6A 5CBGA 4LP8A 4X8AA 4NXNB 4HNAA 4Q20A 4FLXA 1T5EA 4JTDB 4DV2B 1QU7A 3I56V 4GKKB 1WLEA 1N33B 5D5PA 2RDCA 1BE3H 2UUCO 1L0NH 4WBNA 3E8BA 4X62B 4JI7O 1I7FA 2BSKA 4MVMA 1K73W 3OUSA 2P4VA 2DQ3A 1M56B 2ARHA 5F2VO 3Q4HA 2B5UA 1NBMG 5KHHA 1BSMA 4KHPO 1SZTA 1XMQO 5BY1A 4LF6O 2JJ2G 3RYFA 1Z5WA 1X59A 4K35A 3K5NA 4QE7A 1N32O 2ZM6O 1G8MA 3AG1C 4LNUB 1WAZA 4PDLA 4FM2A 3O9OA 4GZRB 3SDLA 3ZRWA 4MT8A 1SZXA 1JPXA 1JQ0A 4DR7B 3AG4B 3ETGA 1S5HC 1XL6A 3ZCCA 5IYZA 1YTFB 1YJWV 4JI0B 4HYOA 3G4SV 4LH6A 4YJ3B 2QM8A 1HW7A 2ZCEA 3G80A 4LF9O 1AR4A 2JEUA 5CB4A 3RYCB 2Q6AA 1DF5A 4MS2A 2Y69B 1VQPV 4DV0O 1R3KC 4X64O 1R6KA 2ILMA 3DC6A 1LUWA 4GX1A 4J42A 4GX5A 4QE9A 3FD9A 4O4IB 2CDYA 2QGNA 1IURA 2XT9A 1GN3A 2OWOA 1FAFA 3CWBH 2YXLA 2YI9A 5BMVB 5IE9A 1AP6A 3ZRVA 4XBFA 3ZN1A 1R3LC 4J7KA 4W4KA 4X9QA 3ETQA 4LCUC 1VEWA 3SR2C 4O4HA 2Q4PA 5E1AC 1NU1H 2W6IG 4YY3O 1ZL8B 2HG5C 2V1DA 3W7SA 2UXDO 1RP3B 1B06A 1I5YA 2ZE7A 4UCVA 1FFXB 4J11A 4ZBMA 1M1KW 4JTCB 5J2TB 1L8DA 3ICXA 4JI3B 1K8AW 2UXNA 1YI2V 3SYAA 4X65B 1Q6IA 3VQYA 1M57C 4UCSA 2PGGA 2XTAA 4DXWA 1FXHA 5LA6A 5B3SC 3E22B 2QWNB 2WLKA 3RT3C 3SPCA 2PUSA 1AILA 2EIMB 3ETDA 2Z5UA 3BA8A 1H2KA 2UUAB 4LFBO 4JI5B 4DK1A 4Z1MG 3PJSK 4J7ZA 1JCHA 3OAAG 2GTAA 1AROP 3BABA 1DGSA 3CC2V 1KC8W 4NB5A 2OCCB 2P67A 2H3OA 2YICA 1M93A 5FNVA 2YIBD 4YJ2B 4IYHA 1SRYA 2QWPB 2M6YA 1F23A 1JMKC 1M4UA 2R9RB 3I55V 3RVYA 5JVDB 2UUCB 5H5NA 3ASNC 4JI7B 1QCEA 1DLBA 3THOA 1VQ9V 5EYPA 3RGBA 3ZHUA 4U3JA 2BTOA 2ZNIA 4DUYO 4X88A 4MTXA 4FZ1A 5FL7G 1Q86W 1VQ6V 4RQFA 1HP8A 1L1FA 3ASOB 1JFFA 1N4CA 5CA1A 1H2LA 1N32B 2ZM6B 1URFA 4I7ZB 4C7UA 5EZYB 1VF6A 4P30A 3SJBC 1VMGA 5KHGA 2KG7A 3D8CA 2JIZG 4IHJA 1FS0G 4FZ0A 3CEIA 3Q4HB 1KMIZ 2CH7A 4TUYA 2HVKC 1WP7A 1MNGA 1BHBA 4G28B 1D5AA 2EIJB 1VQNV 2IJKA 1EFRG 3TK1A 2WLIA 4WF9V 2BTQB 2ZR3A 1O9GA 1IXMA 4J10A 1WB8A 4JI2O 4YIPA 3AG3C 3P30A 2IH1C 2HVJC 5LMNB 4DV0B 1CPYA 2WAMA 2YI8A 5JJEB 2QEXV 2IM9A 3JAWB 5J2UA 1RSOA 2ZD9A 1PM9A 4RQEA 5B1BC 5JQGA 1N0JA 2PI4A 3RN4A 2ZIMA 4UCRA 1SKVA 3STLC 4RAIA 2WWWA 3BRCA 2ZT9B 3E89A 4BIUA 2DOSA 4J9ZB 3B8NA 2YEVA 4B7EA 3RWRD 3F5TA 4JYAO 3PN1A 2UXDB 4ICGA 1I94O 3SYPA 1HNZO 3EVKA 3E8FA 4TT3G 4F4LA 2E76B 4WFFA 1VQ4V 2ETNA 4QJFB 2IJIA 2R9AA 1VP7A 4RO2A 4E2LA 3SPHA 5CMUA 1SQFA 3OW2U 1S76D 3B2EE 2X0LA 5KHIA 4X1IA 1OV9A 4JZ2A 1NZ6A 4H44B 4UV9A 2L35A 2EINC 5IWAB 1IBMB 3JYCA 3ABMC 2ZXWC 2H8PC 1X4TA 1PNLA 4JAAA 3UT5A 4O2BB 4I55A 3CRCA 4PA4A 3AG1B 1VF5B 2MW2B 4L87A 1ZTEA 3LDDA 3B40A 1KQSU 3JD0A 4LF8B 2UXCB 4CH5A 3H1HH 1YJNV 3R66A 3TJTA 2JGDA 1XBLA 3STZC 3E8HA 3ZEDA 3HKBB 1IBKO 2YIBA 4I50A 3UO3A 4DV3O 1OCZC 2R9IA 3L9DA 3HKDB 1DTOA 3E83A 4GKJO 4EFEA 3K5LA 3G67A 3SPGA 4O4LB 4UCOA 5IYCO 4PDVA 4DUYB 1Q82W 2WLNA 5FNVB 1QLNA 2Z3YA 3W7XA 4TV8B 3S3WA 1B04A 1JJOA 2ZE8A 3JALB 1CP9A 5JJJB 3H1LH 1HR0O 1BS3A 4IGGA 4PA6A 3SJAC 1D2DA 5EBWC 2CGOA 2OIEA 2ZQMA 5LYJB 2A7WA 4X1YA 3CC4V 1KP3A 1RPRA 2YIDA 4FLVA 2KQXA 3UQ8A 4K0KB 3F7YC 1VQ8V 1BMFG 2AZ0A 1JFFB 2G38A 3ZHTA 4ZI7B 4GLXA 3P3PA 4NYKA 3WG7C 4LF5O 5FPOA 3U0ZA 1MABG 1QR8A 3CE2A 4KP4A 4JI2B 2FYUH 1NQTA 5K1XA 4A5UB 5L3CA 5A9GA 4TQFA 5ITZA 4DR6B 1S5LZ 1H2SB 3AK1A 4IHJB 2O57A 1M57B 4DR5B 5IJ0A 4MTGA 4DW1A 3KKYA 5B3SB 2HJDA 1I5XA 1JR9A 2N74A 5GTIZ 2YS8A 3A0HZ 2DN9A 3J81N 4U3FH 3CHXA 2OTJV 3CSXA 3SJQC 5JCOA 2B1IA 2DWEC 4CH6A 2K9PA 2OT5A 3K5MA 5CA0A 2W6JG 5GONB 3HKCA 3N27A 4TOIA 2ZNJA 4NXMO 5DEDA 3C90A 1F4MA 4DV1O 3RYIB 1SQXH 3CC7V 5BR8B 1NH2B 4DR2O 2F95B 4I0XA 3RVZA 2HHHO 3GB7C 1I94B 1MZFA 3JARB 1WA8A 4I4TA 2FKXA 4K3AA 1PP9H 3ASNB 4RWUA 5B1AC 3K57A 2EIKC 2ADQB 4O2AB 5IYBO 3TXSA 3H1JH 3UCSC 2YSUB 4XDLA 2QTSA 2XAJA 2YXYA 3K0GA 1SC5B 2BOBC 2Q8VA 3MHSC 3E86A 2E74B 2GUZB 3FB6C 3ZMUA 3N2GA 3N2KA 3FAVA 5K1PA 3G6BA 1VQ5V 4IYIA 1W0JG 3P3NA 4JI6O 5LMUO 4EB6A 1FPOA 3UO2A 1P4RA 2UUBO 3CCJV 3G71V 2CE4A 4IT5A 5L3EA 1Y66A 3IFXA 2AXTZ 1US6A 4UVCA 1Y76B 1F4NA 1ZUQA 4J41A 4DV3B 3MDSA 1QLEC 5EIBC 3SPJA 5IY5C 1S0VA 4B3RO 2CTQA 4PI2A 2QWRB 3L72H 4RUEA 5KUMA 3AG3B 4N21A 1PPJH 4FFBA 4D7SA 1AP5A 3OTOO 1GMGA 4TQDA 3OD4A 4DUZO 5DM6V 1DK1A 1MMMA 4BWAA 5B1BB 1COWG 1K5SA 1GKFA 1THZA 3WB2A 2CTRA 1QQCA 2AW9A 1HR0B 2QWQB 1EN6A 4H33A 5C93A 5D5QA 5FPRA 3ZJZA 3SYCA 3CJHA 1W59A 4P2ZA 4GX0A 4N23A 1CXZB 2GV9A 5LP6A 3QO7A 3LDCA 4G2KA 2HP8A 4Z2WA 1UPGA 4ABMA 4DR4O 4L8JA 2QM7A 4F6EA 2VWKA 4CBCA 4YHHO 5EBMC 2A9HA 1PD3A 1U96A 2WLJA 1OHHG 2PYLA 4UXNA 4LF5B 2JS3A 3AG2C 1HNXB 1R6TA 2HEPA 2GHYA 3FYEB 3WB0A 4DV5O 4H0LB 1HWYA 1PL0A 2Q73A 5JH7A 2WLLA 4OX9B 3E35A 4MW8A 3SYOA 1MG1A 5LGUA 2LW7A 4LWSB 4H13B 1SQGA 3ZIAG 2GSMB 3JCZA 3H01A 5KMGA 1TUEB 2EINB 4FLYA 3T1CA 4Z1VA 3ML0A 4O4JA 2P7TC 4DV7O 3ABMB 1K33A 2ZXWB 3CS5A 4AHCA 4TV9B 1VIBA 4R50A 2ZIOA 1SESA 4JV5O 1VQMV 4H37A 3CCMV 4NXMB 1XMOO 3R65A 5HFMA 3D3IA 3FFQA 5A2QN 3A2FA 3JATA 3K03A 4X20B 2ZKOA 5IJ0B 2IW5A 5JWPA 1NVPD 3JASA 1BZKA 3GWKC 5H6QA 3CXHF 4IL6Z 4DRXB 1GN4A 1Z5VA 5KAFZ 1VF6C 1BQZA 5LHIA 2Z0AA 1OCZB 4LC1A 1AI4A 5LOVA 3ABTA 3ABKC 1GO3F 3ZMSA 4DV4O 2IU0A 1JOYA 3P32A 4JI4B 3CXCU 5L3DA 1FYJA 1FXKA 1LR1A 1FKAO 4K8XA 1TAEA 3RYHB 1IBLO 2VQEO 1NJIW 2W0FC 1NT2B 3SYQA 3H1IH 1GM9A 2JEXA 4NR1A 1BT8A 1MSDA 1TUBB 2NLJC 4WFEA 2A79B 4JI6B 5LMUB 4CC6A 2UUBB 4E4EA 4IIJA 1G6UA 2P4KA 3LUTB 4LR3A 3CPWU 3OFNG 4JI1O 3JD4A 2VQFO 4MVUA 2CTPA 3HKEA 1CEZA 3OEHG 3WG7B 1KUQA 1R3JC 1RPOA 2Y4TA 3N2KB 1V54C 2F93B 3LNMB 3A0BZ 2F4VO 1PNKA 3IGAC 4KHPB 3BPZA 1KU9A 4HNAB 5DECA 1XMQB 2WA3A 4UCTA 4DUZB 4LF6B 3W7TA 1YTFD 2ZR2A 2JDIG 3H9VA 4XDJA 1XOUA 4WBNB 1BL8A 3U11A 2BSKB 3JCUZ 5FLXN 2ITDC 2IJJA 2RCVA 3BFRA 1K4DC 2W0XA 1XL4A 3OR7C 4HZ3A 1XHZA 2OYQA 1TGOA 3M8AA 2R70A 4U7OA 1KP2A 4B3MO 5LXTA 1OZ0A 4QIWF 1QVFU 1K4CC 1JJ2U 1QVGU 1ZAUA 3UM7A 1K9MW 5LBQA 3APOA 2DQ0A 3RYFB 1Q6UA 4B08A 4DR4B 3T2MA 4LF9B 4YHHB 2Q9LA 2AHZA 1E1QG 1YCIA 1TVKA 4X64B 1V55C 4DV5B 3ZRWB 5B1AB 3ZRSA 2EIKB 3CJHB 1Q7YW 2KSDA 4JYBA 5C8YA 4LF4O 3QO8A 3K06A 1YZBA 1F51A 2DYSC 5IYZB 4B3TO 4MVRA 2PI5A 3RFRA 5KX5A 1IZ3A 2YDEA 4F6RA 2RMKB 5CB4B 4DV7B 4AQYO 4B7KA 4JV5B 4YY3B 4YIOA 3ZS8C 3J80N 4W4LA 3EXAA 3BVOA 5GTHZ 5JH7B 5LGTA 1FJGO 3OT7A 1UFIA 4FJCC 4KL1A 1KECA 2AGAA 4PA9A 2JS5A 1BQ0A 1M9NA 1XILA 1HDJA 1NR7A 4LFAO 1ZX3A 2VS0A 1EBOA 3AG7A 1SQBH 3BCCH 3CYOA 2LGWA 3HB3B 4MVZA 1QLEB 5IY5B 2FMLA 2E3CA 4O4HB 5E79Z 3K3WA 1K3EA 2ITCC 4DV4B 2Y69C 2EILC 1Y74A 3HPLC 4R8CA 2A0LA 3ABUA 3ZHSA 5BXZA 3ZMTA 2WSSG 1QHTA 4LFBB 4LBEC 4BW5A 1OCCC 1SA0A 2QKSA 3OGCC 2Q7GA 4FMTA 1K97A 2WLMA 5LA6B 5BZBA 2F23A 2P5OA 1K34A 1H2MA 4AILC 4JI8O 5JCOC 5DN6G 3CCSV 4Q6GA 1AR1B 1QBZA 1M5IA 4PHZA 4UUJC 3L74H 4FPPA 2AZ2A 1KKDA 2XASA 2R72A 4NVPA 2VQFB 4DV2O 2V7QG 3SPIA 3AG2B 1N33O 2ZINA 5JJNB 1Q81W 1Y4MA 4DR1O 4R7CA 2X6CA 3WB1A 2BOCC 4LNUA 3F7VC 1XUQA 5B66Z 4IIJB 1AR5A 5KUKA 3EHBB 2CK3G 4X1KA 3OGIB 2HFEC 2PF4E 3BY6A 3CMAV 3K9SA 1AJNA 2DWDC 4ZIBA 4PJ0Z 5EYPB 1ZSPA 1O9HA 4PD4F 3D36A 4U3JB 4ZOLA 3RYCA 1XNQO 3DGEA 1PNMA 1ZLZA 2KKWA 5B1OA 2K1EA 3TETA 1NKDA 4OXSA 5CA1B 1AVMA 1YHQV 2RNBA 3LSQA 3LSUA 2YIAA 4PDMA 4DR7O 2LJ2A 5BMVA 1GH6A 1XREA 4LFCO 1PL4A 4JI0O 2KG7B 5HFLA 3FB5C 2DMXA 4JYCA 2UXBO 2P6JA 4PDRA 4WFBV 3LNNA 5LHHA 3OTFA 2CH7B 1KBHA 4TUYB 2IJHA 4JTAB 3ABKB 3AK2A 4FK5C 3K5OA 3OMNB 1J95A 1ZL8A 1V9PA 4B3TB 4D7TA 2WLIB 4B3SO 2BCCH 5IYDO 2QKAA 2UU9O 1BGYH 1R73A 1WNSA 2Q69A 5KA5A 1P49A 2Y0IA 3T1YO 4AQYB 1FFXA 4GCZA 1JX9A 1TA8A 1TVKB 5J2TA 2GTSA 1H38A 2IBZH 1N0NA 5J2UB 1RSOB 1AI5A 1XQ8A 4UB6Z 4BIOA 4GX2A 5IJ9A 4JYAB 5C8YB 3JD2A 3T1HO 5JQGB 1RM1C 1A32A 4DW0A 1HNZB 1AI6A 4PELA 2EJ7A 3K79A 4J7JA 3CRAA 2VRZA 4ZHQA 2ZDIA 2YXHA 4I5SA 3LSSA 1R6NA 3E22A 4CS3A 3L70H 3CD6V 3CRQA 1QR9A 5GW7A
chains in the Genus database with same CATH topology
2GBOA 2ODMA 2NR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBO A;  2ODM A;  2NR5 A; 
#chains in the Genus database with same CATH topology
 3ZBH A;  1H8E G;  3W7U A;  4JI3 O;  1IXB A;  2YEV B;  3KG2 A;  4K8Z A;  1V54 B;  3QF7 A;  5LP6 C;  1M90 W;  1XNR O;  1H8H G;  1IDS A;  3OE7 G;  3X2Q C;  3FYI B;  4WFH A;  1P7G A;  3RBZ A;  4P9O A;  3L75 H;  4YJ2 A;  1KYO F;  4UCU A;  4WFA V;  1LNQ A;  2HJF C;  4G27 B;  1N34 O;  1NVP B;  1GM7 A;  2Y48 A;  1PKX A;  2UUA O;  4PI0 A;  1Q43 A;  2FL4 A;  2P22 C;  4JI5 O;  5JVD A;  4UVA A;  1KKC A;  1YF2 A;  2EZP A;  4ASU G;  4X1I B;  2EBO A;  2XOK G;  5IDJ A;  3CRR A;  3CX5 F;  1IBK B;  5KHJ A;  1P84 F;  3C3S A;  1SQV H;  4NKG B;  4GT1 A;  3UT5 B;  1SA0 B;  4I55 B;  3WU2 Z;  4GKJ B;  2QSA A;  2D3O W;  1K92 A;  3IC7 A;  1V55 B;  4DR1 B;  2A06 H;  2X6A A;  2QTO A;  5EZY A;  2OTL V;  2LQT A;  2JGD B;  3ZMV A;  3K04 A;  1WPB A;  2QA4 V;  1Y67 A;  2DYS B;  3CCE V;  1GTO A;  4I50 B;  1Z2G A;  2NNU A;  3F5W C;  1FD9 A;  4JZG A;  4CZZ A;  3W7W A;  1GM8 A;  3VOU A;  2BTQ A;  3K08 A;  1NTK H;  2DJV A;  2RQ6 A;  3RW0 A;  3MAQ A;  2WA4 A;  1XNQ B;  3NR7 A;  2P06 A;  1YJ9 V;  1FXK C;  1Q8I A;  3JAW A;  3ZHV A;  5H9C A;  4QPJ A;  4X1K B;  2A3Q A;  3KCY A;  3I5D A;  3T4Z A;  3KCX A;  2F1M A;  1S5J A;  1HNW O;  1AI7 A;  1Q6H A;  5EC2 C;  3ETE A;  4LFC B;  1W2B U;  1SF9 A;  4X1Y B;  2JVD A;  2UXB B;  1WB7 A;  1NH2 D;  3DXR A;  4X89 A;  4BR6 A;  4ZOL B;  2UXX A;  5CN0 A;  2EIL B;  4HAM A;  5LMN O;  3QO5 A;  4D6T H;  4EKW A;  5EBL C;  4B3S B;  2PTM A;  3ABL C;  3LDE A;  4KUM A;  2C2A A;  2UU9 B;  3M99 B;  1OCC B;  3T1Y B;  1J5E O;  1JA8 A;  3JD3 A;  3CRM A;  2Q5Z A;  1OJH A;  2E5L O;  5ITZ B;  4DV1 B;  4R6Z A;  1WP8 A;  1KB9 F;  4UB8 Z;  3JD1 A;  4DR2 B;  4DO2 A;  2HHH B;  5CA3 A;  2M7W A;  1B6Q A;  2XAQ A;  1Q5O A;  3T1H B;  4MSW C;  1PV0 A;  1VAR A;  1BCC H;  2QDO A;  3ZX6 A;  5CA0 B;  3HR0 A;  3MHH C;  3HKC B;  2EZO A;  1I08 A;  2JGU A;  3DSQ A;  3CP1 A;  4FLZ A;  3ZN0 A;  4O2B A;  2MK3 A;  1XNR B;  4I0X B;  2KB1 A;  4I9W A;  5IJ9 B;  3AEI A;  2YUA A;  2LP7 A;  3JSL A;  1WA8 B;  3CCL V;  3U10 A;  4I4T B;  4ZHQ B;  3A0R A;  4PA3 A;  2XAH A;  2VWJ A;  1VQL V;  4FLU A;  3TGU H;  4OPH A;  5IWA O;  3HKB A;  2DE0 X;  3JAK A;  1OCR C;  3K9A A;  1N34 B;  1IBM O;  1SS3 A;  3QG5 A;  2E75 B;  4YXW G;  3HKD A;  2XUM A;  4BAY A;  1GN6 A;  1W0K G;  5EK0 A;  4MTO A;  4O4L A;  2GBO A;  1EZJ A;  5KLV H;  3K59 A;  5KHK A;  3CCV V;  2JRI A;  1GAX A;  3OEE G;  4LF8 O;  2UXC O;  4TWK A;  3ZMZ A;  4FLW A;  4B3R B;  4TV8 A;  1OCO C;  3N2G B;  2Q7H A;  3JAL A;  5TIS Z;  2QR4 A;  3FAV B;  2EUL A;  2F66 C;  3VBB A;  3L71 H;  3OTO B;  2QE7 G;  4DV6 O;  3ZHR A;  3OR6 C;  4EB6 B;  2CGN A;  4NTW A;  4AI8 A;  4JAU A;  5LYJ A;  1LUV A;  5IT9 N;  2Y0P A;  3QNE A;  1L0L H;  3B77 A;  1ENV A;  1Q90 D;  2ODM A;  3S3X A;  1YVW A;  4WFG A;  3B09 A;  1SQQ H;  4ZI7 A;  4FFB B;  5B1N A;  1VQK V;  4FM0 A;  2Q0A A;  1AJQ A;  1EN4 A;  5L3G A;  2DYR C;  1DF4 A;  3JSN A;  2D2C B;  3OM3 B;  4DYL A;  1RM1 B;  2HKO A;  3VQX A;  3FB8 C;  1AB3 A;  4QNH B;  1XHX A;  4K0K O;  3AK3 A;  2XAF A;  4DK0 A;  2IU3 A;  1HNW B;  1YDX A;  3BEH A;  4CS4 A;  4QPK A;  2OCH A;  2FTK A;  5GON A;  1M56 C;  4KFM A;  5LP6 B;  2CTW A;  5EC1 C;  3UKM A;  1NI8 A;  3B8M A;  1KD1 W;  3X2Q B;  3O65 A;  3RYI A;  4DR6 O;  4DR5 O;  3BAA A;  2GDS A;  1YIT V;  2ADP A;  1J5E B;  1SET A;  1GK9 A;  3JAR A;  1XMO B;  2WLL B;  4BIZ A;  2E5L B;  1E1R G;  1Q3E A;  4MTF A;  1EN5 A;  1ORQ C;  4J9Y B;  3DXR B;  5KAI Z;  1IVS A;  5L3F A;  4RUF A;  2JJ1 G;  3MD0 A;  1FXV A;  3L73 H;  2Q68 A;  1VQ7 V;  4O2A A;  5KMG B;  2H94 A;  3M7M X;  3AG4 C;  3CCR V;  5BR8 O;  3QTC A;  2V4D A;  4O4J B;  2EJR A;  1MSW D;  1MA1 A;  3QVN A;  3CCU V;  3D36 C;  1YSC A;  1R1B A;  1E79 G;  1NS1 A;  4WCE V;  2GUZ A;  3JAT B;  3OMA B;  1ZWI C;  4DR3 O;  1ROP A;  3ZHQ A;  1N36 O;  1XDC A;  3CB2 A;  4GUN A;  3JAS B;  2ATK C;  3DC5 A;  5CBH A;  2BE3 A;  3FKS G;  1IBL B;  3CME V;  2VQE B;  1WN7 A;  1WPX A;  2P90 A;  3B4S A;  4X66 O;  4EEQ A;  4MVO A;  3SGI A;  5LOV B;  1K5Q A;  4FVM A;  2HR3 A;  4BW9 A;  1Y76 A;  1MZE A;  4XDK A;  4HBN A;  4NTX A;  3APQ A;  5AG2 A;  4CS2 A;  2HLD G;  2X7R B;  2PZS A;  2QM4 A;  4LF7 O;  4JAS A;  1H2N A;  3D3Q A;  2QJ1 A;  4JI1 B;  1FXK B;  4NXN O;  1EZV H;  3IAY A;  1NTZ H;  1NTM H;  1AJP A;  1S72 V;  4EFB A;  4UVB A;  1N8R W;  4NTY A;  4GKK O;  2IH3 C;  3TCU A;  2X6B A;  2OIG A;  1UJW B;  4ZKI A;  3JAK B;  4X62 O;  2F4V B;  3BHP A;  4DV6 B;  4JGS A;  2ZDI C;  4UV8 A;  1B3Q A;  1I0H A;  1BHA A;  4FFK A;  5H6R A;  2EIM C;  2CAZ C;  4PV1 B;  5CBF A;  3ABL B;  3HKE B;  3K0D A;  3EFF K;  1EM1 A;  4YJ3 A;  3BA9 A;  3VQV A;  3A8T A;  4J80 A;  4B3M B;  2Q7E A;  5LGN A;  2OCC C;  2LFS A;  1XI1 A;  4CH4 A;  1YEW A;  2RN9 A;  2DW4 A;  4CH3 A;  1SER A;  2PY5 A;  3E8G A;  2LFR A;  2N04 A;  4FM1 A;  4MVQ A;  5LHG A;  1G1X B;  4O4I A;  1D5N A;  2Q0O C;  2ZE5 A;  2FB5 A;  1G4Y B;  4LWS A;  3IJ4 A;  1H2G A;  5J9P C;  2YC0 A;  3FX7 A;  2QKC A;  4GYC B;  3E2E A;  3IC9 A;  4UFZ A;  3FB7 C;  1P7B A;  1Y6X A;  5LXT B;  4TV9 A;  1YXB A;  4LF4 B;  1S77 D;  1HNX O;  2EX3 A;  1FFT B;  4P9P A;  5L3B A;  2PYJ A;  1R3I C;  4KXR A;  3CCQ V;  1GRJ A;  1VQO V;  4U7N A;  1RFY A;  4OX9 O;  2LGQ A;  2LO1 A;  2Q67 A;  4FLT A;  1XEQ A;  4X20 A;  4MVS A;  5LL6 Y;  2CUG A;  3ASO C;  1GN2 A;  1K7D A;  5EIB D;  4LH7 A;  4QGP A;  1SQP H;  2WPD G;  4PA7 A;  4OGQ B;  2NN4 A;  3K58 A;  1S3J A;  4JPR A;  4DRX A;  1FJG B;  1OCR B;  3NXS A;  2B9Z A;  4JYY A;  1U97 A;  4LFA B;  4JF3 A;  2Y4U A;  5KX5 B;  2WLH A;  3WFV A;  4F6R B;  2EIJ C;  3VQW A;  1NR1 A;  2NR5 A;  2F43 G;  2XAG A;  3KZI Z;  2LW1 A;  3JAM N;  1WJZ A;  3J7A U;  5B5E Z;  1OCO B;  1JVM A;  3OMI B;  3GWO A;  4FIP C;  3RYH A;  2N05 A;  3TXQ A;  4X65 O;  1MOF A;  3SJC C;  4DR3 B;  2AHY A;  3G6E V;  1N36 B;  4MW3 A;  1IX9 A;  4JAV A;  1TUB A;  2B1G A;  2JK5 C;  2RJZ A;  1YIJ V;  3DTU B;  4JI4 O;  3H1K H;  4I9Q A;  3GVM A;  2XHB A;  3C3T A;  4X66 B;  5H2F Z;  1QNM A;  3ZRX A;  1VF7 A;  2XND G;  2L6L A;  3T4D A;  4TSF G;  4CC5 A;  1Y74 B;  1F7Y A;  3OUF A;  4JI8 B;  2DYR B;  2QWO B;  5KA6 A;  4LF7 B;  4OPA A;  2ZE6 A;  5CBG A;  4LP8 A;  4X8A A;  4NXN B;  4HNA A;  4Q20 A;  4FLX A;  1T5E A;  4JTD B;  4DV2 B;  1QU7 A;  3I56 V;  4GKK B;  1WLE A;  1N33 B;  5D5P A;  2RDC A;  1BE3 H;  2UUC O;  1L0N H;  4WBN A;  3E8B A;  4X62 B;  4JI7 O;  1I7F A;  2BSK A;  4MVM A;  1K73 W;  3OUS A;  2P4V A;  2DQ3 A;  1M56 B;  2ARH A;  5F2V O;  3Q4H A;  2B5U A;  1NBM G;  5KHH A;  1BSM A;  4KHP O;  1SZT A;  1XMQ O;  5BY1 A;  4LF6 O;  2JJ2 G;  3RYF A;  1Z5W A;  1X59 A;  4K35 A;  3K5N A;  4QE7 A;  1N32 O;  2ZM6 O;  1G8M A;  3AG1 C;  4LNU B;  1WAZ A;  4PDL A;  4FM2 A;  3O9O A;  4GZR B;  3SDL A;  3ZRW A;  4MT8 A;  1SZX A;  1JPX A;  1JQ0 A;  4DR7 B;  3AG4 B;  3ETG A;  1S5H C;  1XL6 A;  3ZCC A;  5IYZ A;  1YTF B;  1YJW V;  4JI0 B;  4HYO A;  3G4S V;  4LH6 A;  4YJ3 B;  2QM8 A;  1HW7 A;  2ZCE A;  3G80 A;  4LF9 O;  1AR4 A;  2JEU A;  5CB4 A;  3RYC B;  2Q6A A;  1DF5 A;  4MS2 A;  2Y69 B;  1VQP V;  4DV0 O;  1R3K C;  4X64 O;  1R6K A;  2ILM A;  3DC6 A;  1LUW A;  4GX1 A;  4J42 A;  4GX5 A;  4QE9 A;  3FD9 A;  4O4I B;  2CDY A;  2QGN A;  1IUR A;  2XT9 A;  1GN3 A;  2OWO A;  1FAF A;  3CWB H;  2YXL A;  2YI9 A;  5BMV B;  5IE9 A;  1AP6 A;  3ZRV A;  4XBF A;  3ZN1 A;  1R3L C;  4J7K A;  4W4K A;  4X9Q A;  3ETQ A;  4LCU C;  1VEW A;  3SR2 C;  4O4H A;  2Q4P A;  5E1A C;  1NU1 H;  2W6I G;  4YY3 O;  1ZL8 B;  2HG5 C;  2V1D A;  3W7S A;  2UXD O;  1RP3 B;  1B06 A;  1I5Y A;  2ZE7 A;  4UCV A;  1FFX B;  4J11 A;  4ZBM A;  1M1K W;  4JTC B;  5J2T B;  1L8D A;  3ICX A;  4JI3 B;  1K8A W;  2UXN A;  1YI2 V;  3SYA A;  4X65 B;  1Q6I A;  3VQY A;  1M57 C;  4UCS A;  2PGG A;  2XTA A;  4DXW A;  1FXH A;  5LA6 A;  5B3S C;  3E22 B;  2QWN B;  2WLK A;  3RT3 C;  3SPC A;  2PUS A;  1AIL A;  2EIM B;  3ETD A;  2Z5U A;  3BA8 A;  1H2K A;  2UUA B;  4LFB O;  4JI5 B;  4DK1 A;  4Z1M G;  3PJS K;  4J7Z A;  1JCH A;  3OAA G;  2GTA A;  1ARO P;  3BAB A;  1DGS A;  3CC2 V;  1KC8 W;  4NB5 A;  2OCC B;  2P67 A;  2H3O A;  2YIC A;  1M93 A;  5FNV A;  2YIB D;  4YJ2 B;  4IYH A;  1SRY A;  2QWP B;  2M6Y A;  1F23 A;  1JMK C;  1M4U A;  2R9R B;  3I55 V;  3RVY A;  5JVD B;  2UUC B;  5H5N A;  3ASN C;  4JI7 B;  1QCE A;  1DLB A;  3THO A;  1VQ9 V;  5EYP A;  3RGB A;  3ZHU A;  4U3J A;  2BTO A;  2ZNI A;  4DUY O;  4X88 A;  4MTX A;  4FZ1 A;  5FL7 G;  1Q86 W;  1VQ6 V;  4RQF A;  1HP8 A;  1L1F A;  3ASO B;  1JFF A;  1N4C A;  5CA1 A;  1H2L A;  1N32 B;  2ZM6 B;  1URF A;  4I7Z B;  4C7U A;  5EZY B;  1VF6 A;  4P30 A;  3SJB C;  1VMG A;  5KHG A;  2KG7 A;  3D8C A;  2JIZ G;  4IHJ A;  1FS0 G;  4FZ0 A;  3CEI A;  3Q4H B;  1KMI Z;  2CH7 A;  4TUY A;  2HVK C;  1WP7 A;  1MNG A;  1BHB A;  4G28 B;  1D5A A;  2EIJ B;  1VQN V;  2IJK A;  1EFR G;  3TK1 A;  2WLI A;  4WF9 V;  2BTQ B;  2ZR3 A;  1O9G A;  1IXM A;  4J10 A;  1WB8 A;  4JI2 O;  4YIP A;  3AG3 C;  3P30 A;  2IH1 C;  2HVJ C;  5LMN B;  4DV0 B;  1CPY A;  2WAM A;  2YI8 A;  5JJE B;  2QEX V;  2IM9 A;  3JAW B;  5J2U A;  1RSO A;  2ZD9 A;  1PM9 A;  4RQE A;  5B1B C;  5JQG A;  1N0J A;  2PI4 A;  3RN4 A;  2ZIM A;  4UCR A;  1SKV A;  3STL C;  4RAI A;  2WWW A;  3BRC A;  2ZT9 B;  3E89 A;  4BIU A;  2DOS A;  4J9Z B;  3B8N A;  2YEV A;  4B7E A;  3RWR D;  3F5T A;  4JYA O;  3PN1 A;  2UXD B;  4ICG A;  1I94 O;  3SYP A;  1HNZ O;  3EVK A;  3E8F A;  4TT3 G;  4F4L A;  2E76 B;  4WFF A;  1VQ4 V;  2ETN A;  4QJF B;  2IJI A;  2R9A A;  1VP7 A;  4RO2 A;  4E2L A;  3SPH A;  5CMU A;  1SQF A;  3OW2 U;  1S76 D;  3B2E E;  2X0L A;  5KHI A;  4X1I A;  1OV9 A;  4JZ2 A;  1NZ6 A;  4H44 B;  4UV9 A;  2L35 A;  2EIN C;  5IWA B;  1IBM B;  3JYC A;  3ABM C;  2ZXW C;  2H8P C;  1X4T A;  1PNL A;  4JAA A;  3UT5 A;  4O2B B;  4I55 A;  3CRC A;  4PA4 A;  3AG1 B;  1VF5 B;  2MW2 B;  4L87 A;  1ZTE A;  3LDD A;  3B40 A;  1KQS U;  3JD0 A;  4LF8 B;  2UXC B;  4CH5 A;  3H1H H;  1YJN V;  3R66 A;  3TJT A;  2JGD A;  1XBL A;  3STZ C;  3E8H A;  3ZED A;  3HKB B;  1IBK O;  2YIB A;  4I50 A;  3UO3 A;  4DV3 O;  1OCZ C;  2R9I A;  3L9D A;  3HKD B;  1DTO A;  3E83 A;  4GKJ O;  4EFE A;  3K5L A;  3G67 A;  3SPG A;  4O4L B;  4UCO A;  5IYC O;  4PDV A;  4DUY B;  1Q82 W;  2WLN A;  5FNV B;  1QLN A;  2Z3Y A;  3W7X A;  4TV8 B;  3S3W A;  1B04 A;  1JJO A;  2ZE8 A;  3JAL B;  1CP9 A;  5JJJ B;  3H1L H;  1HR0 O;  1BS3 A;  4IGG A;  4PA6 A;  3SJA C;  1D2D A;  5EBW C;  2CGO A;  2OIE A;  2ZQM A;  5LYJ B;  2A7W A;  4X1Y A;  3CC4 V;  1KP3 A;  1RPR A;  2YID A;  4FLV A;  2KQX A;  3UQ8 A;  4K0K B;  3F7Y C;  1VQ8 V;  1BMF G;  2AZ0 A;  1JFF B;  2G38 A;  3ZHT A;  4ZI7 B;  4GLX A;  3P3P A;  4NYK A;  3WG7 C;  4LF5 O;  5FPO A;  3U0Z A;  1MAB G;  1QR8 A;  3CE2 A;  4KP4 A;  4JI2 B;  2FYU H;  1NQT A;  5K1X A;  4A5U B;  5L3C A;  5A9G A;  4TQF A;  5ITZ A;  4DR6 B;  1S5L Z;  1H2S B;  3AK1 A;  4IHJ B;  2O57 A;  1M57 B;  4DR5 B;  5IJ0 A;  4MTG A;  4DW1 A;  3KKY A;  5B3S B;  2HJD A;  1I5X A;  1JR9 A;  2N74 A;  5GTI Z;  2YS8 A;  3A0H Z;  2DN9 A;  3J81 N;  4U3F H;  3CHX A;  2OTJ V;  3CSX A;  3SJQ C;  5JCO A;  2B1I A;  2DWE C;  4CH6 A;  2K9P A;  2OT5 A;  3K5M A;  5CA0 A;  2W6J G;  5GON B;  3HKC A;  3N27 A;  4TOI A;  2ZNJ A;  4NXM O;  5DED A;  3C90 A;  1F4M A;  4DV1 O;  3RYI B;  1SQX H;  3CC7 V;  5BR8 B;  1NH2 B;  4DR2 O;  2F95 B;  4I0X A;  3RVZ A;  2HHH O;  3GB7 C;  1I94 B;  1MZF A;  3JAR B;  1WA8 A;  4I4T A;  2FKX A;  4K3A A;  1PP9 H;  3ASN B;  4RWU A;  5B1A C;  3K57 A;  2EIK C;  2ADQ B;  4O2A B;  5IYB O;  3TXS A;  3H1J H;  3UCS C;  2YSU B;  4XDL A;  2QTS A;  2XAJ A;  2YXY A;  3K0G A;  1SC5 B;  2BOB C;  2Q8V A;  3MHS C;  3E86 A;  2E74 B;  2GUZ B;  3FB6 C;  3ZMU A;  3N2G A;  3N2K A;  3FAV A;  5K1P A;  3G6B A;  1VQ5 V;  4IYI A;  1W0J G;  3P3N A;  4JI6 O;  5LMU O;  4EB6 A;  1FPO A;  3UO2 A;  1P4R A;  2UUB O;  3CCJ V;  3G71 V;  2CE4 A;  4IT5 A;  5L3E A;  1Y66 A;  3IFX A;  2AXT Z;  1US6 A;  4UVC A;  1Y76 B;  1F4N A;  1ZUQ A;  4J41 A;  4DV3 B;  3MDS A;  1QLE C;  5EIB C;  3SPJ A;  5IY5 C;  1S0V A;  4B3R O;  2CTQ A;  4PI2 A;  2QWR B;  3L72 H;  4RUE A;  5KUM A;  3AG3 B;  4N21 A;  1PPJ H;  4FFB A;  4D7S A;  1AP5 A;  3OTO O;  1GMG A;  4TQD A;  3OD4 A;  4DUZ O;  5DM6 V;  1DK1 A;  1MMM A;  4BWA A;  5B1B B;  1COW G;  1K5S A;  1GKF A;  1THZ A;  3WB2 A;  2CTR A;  1QQC A;  2AW9 A;  1HR0 B;  2QWQ B;  1EN6 A;  4H33 A;  5C93 A;  5D5Q A;  5FPR A;  3ZJZ A;  3SYC A;  3CJH A;  1W59 A;  4P2Z A;  4GX0 A;  4N23 A;  1CXZ B;  2GV9 A;  5LP6 A;  3QO7 A;  3LDC A;  4G2K A;  2HP8 A;  4Z2W A;  1UPG A;  4ABM A;  4DR4 O;  4L8J A;  2QM7 A;  4F6E A;  2VWK A;  4CBC A;  4YHH O;  5EBM C;  2A9H A;  1PD3 A;  1U96 A;  2WLJ A;  1OHH G;  2PYL A;  4UXN A;  4LF5 B;  2JS3 A;  3AG2 C;  1HNX B;  1R6T A;  2HEP A;  2GHY A;  3FYE B;  3WB0 A;  4DV5 O;  4H0L B;  1HWY A;  1PL0 A;  2Q73 A;  5JH7 A;  2WLL A;  4OX9 B;  3E35 A;  4MW8 A;  3SYO A;  1MG1 A;  5LGU A;  2LW7 A;  4LWS B;  4H13 B;  1SQG A;  3ZIA G;  2GSM B;  3JCZ A;  3H01 A;  5KMG A;  1TUE B;  2EIN B;  4FLY A;  3T1C A;  4Z1V A;  3ML0 A;  4O4J A;  2P7T C;  4DV7 O;  3ABM B;  1K33 A;  2ZXW B;  3CS5 A;  4AHC A;  4TV9 B;  1VIB A;  4R50 A;  2ZIO A;  1SES A;  4JV5 O;  1VQM V;  4H37 A;  3CCM V;  4NXM B;  1XMO O;  3R65 A;  5HFM A;  3D3I A;  3FFQ A;  5A2Q N;  3A2F A;  3JAT A;  3K03 A;  4X20 B;  2ZKO A;  5IJ0 B;  2IW5 A;  5JWP A;  1NVP D;  3JAS A;  1BZK A;  3GWK C;  5H6Q A;  3CXH F;  4IL6 Z;  4DRX B;  1GN4 A;  1Z5V A;  5KAF Z;  1VF6 C;  1BQZ A;  5LHI A;  2Z0A A;  1OCZ B;  4LC1 A;  1AI4 A;  5LOV A;  3ABT A;  3ABK C;  1GO3 F;  3ZMS A;  4DV4 O;  2IU0 A;  1JOY A;  3P32 A;  4JI4 B;  3CXC U;  5L3D A;  1FYJ A;  1FXK A;  1LR1 A;  1FKA O;  4K8X A;  1TAE A;  3RYH B;  1IBL O;  2VQE O;  1NJI W;  2W0F C;  1NT2 B;  3SYQ A;  3H1I H;  1GM9 A;  2JEX A;  4NR1 A;  1BT8 A;  1MSD A;  1TUB B;  2NLJ C;  4WFE A;  2A79 B;  4JI6 B;  5LMU B;  4CC6 A;  2UUB B;  4E4E A;  4IIJ A;  1G6U A;  2P4K A;  3LUT B;  4LR3 A;  3CPW U;  3OFN G;  4JI1 O;  3JD4 A;  2VQF O;  4MVU A;  2CTP A;  3HKE A;  1CEZ A;  3OEH G;  3WG7 B;  1KUQ A;  1R3J C;  1RPO A;  2Y4T A;  3N2K B;  1V54 C;  2F93 B;  3LNM B;  3A0B Z;  2F4V O;  1PNK A;  3IGA C;  4KHP B;  3BPZ A;  1KU9 A;  4HNA B;  5DEC A;  1XMQ B;  2WA3 A;  4UCT A;  4DUZ B;  4LF6 B;  3W7T A;  1YTF D;  2ZR2 A;  2JDI G;  3H9V A;  4XDJ A;  1XOU A;  4WBN B;  1BL8 A;  3U11 A;  2BSK B;  3JCU Z;  5FLX N;  2ITD C;  2IJJ A;  2RCV A;  3BFR A;  1K4D C;  2W0X A;  1XL4 A;  3OR7 C;  4HZ3 A;  1XHZ A;  2OYQ A;  1TGO A;  3M8A A;  2R70 A;  4U7O A;  1KP2 A;  4B3M O;  5LXT A;  1OZ0 A;  4QIW F;  1QVF U;  1K4C C;  1JJ2 U;  1QVG U;  1ZAU A;  3UM7 A;  1K9M W;  5LBQ A;  3APO A;  2DQ0 A;  3RYF B;  1Q6U A;  4B08 A;  4DR4 B;  3T2M A;  4LF9 B;  4YHH B;  2Q9L A;  2AHZ A;  1E1Q G;  1YCI A;  1TVK A;  4X64 B;  1V55 C;  4DV5 B;  3ZRW B;  5B1A B;  3ZRS A;  2EIK B;  3CJH B;  1Q7Y W;  2KSD A;  4JYB A;  5C8Y A;  4LF4 O;  3QO8 A;  3K06 A;  1YZB A;  1F51 A;  2DYS C;  5IYZ B;  4B3T O;  4MVR A;  2PI5 A;  3RFR A;  5KX5 A;  1IZ3 A;  2YDE A;  4F6R A;  2RMK B;  5CB4 B;  4DV7 B;  4AQY O;  4B7K A;  4JV5 B;  4YY3 B;  4YIO A;  3ZS8 C;  3J80 N;  4W4L A;  3EXA A;  3BVO A;  5GTH Z;  5JH7 B;  5LGT A;  1FJG O;  3OT7 A;  1UFI A;  4FJC C;  4KL1 A;  1KEC A;  2AGA A;  4PA9 A;  2JS5 A;  1BQ0 A;  1M9N A;  1XIL A;  1HDJ A;  1NR7 A;  4LFA O;  1ZX3 A;  2VS0 A;  1EBO A;  3AG7 A;  1SQB H;  3BCC H;  3CYO A;  2LGW A;  3HB3 B;  4MVZ A;  1QLE B;  5IY5 B;  2FML A;  2E3C A;  4O4H B;  5E79 Z;  3K3W A;  1K3E A;  2ITC C;  4DV4 B;  2Y69 C;  2EIL C;  1Y74 A;  3HPL C;  4R8C A;  2A0L A;  3ABU A;  3ZHS A;  5BXZ A;  3ZMT A;  2WSS G;  1QHT A;  4LFB B;  4LBE C;  4BW5 A;  1OCC C;  1SA0 A;  2QKS A;  3OGC C;  2Q7G A;  4FMT A;  1K97 A;  2WLM A;  5LA6 B;  5BZB A;  2F23 A;  2P5O A;  1K34 A;  1H2M A;  4AIL C;  4JI8 O;  5JCO C;  5DN6 G;  3CCS V;  4Q6G A;  1AR1 B;  1QBZ A;  1M5I A;  4PHZ A;  4UUJ C;  3L74 H;  4FPP A;  2AZ2 A;  1KKD A;  2XAS A;  2R72 A;  4NVP A;  2VQF B;  4DV2 O;  2V7Q G;  3SPI A;  3AG2 B;  1N33 O;  2ZIN A;  5JJN B;  1Q81 W;  1Y4M A;  4DR1 O;  4R7C A;  2X6C A;  3WB1 A;  2BOC C;  4LNU A;  3F7V C;  1XUQ A;  5B66 Z;  4IIJ B;  1AR5 A;  5KUK A;  3EHB B;  2CK3 G;  4X1K A;  3OGI B;  2HFE C;  2PF4 E;  3BY6 A;  3CMA V;  3K9S A;  1AJN A;  2DWD C;  4ZIB A;  4PJ0 Z;  5EYP B;  1ZSP A;  1O9H A;  4PD4 F;  3D36 A;  4U3J B;  4ZOL A;  3RYC A;  1XNQ O;  3DGE A;  1PNM A;  1ZLZ A;  2KKW A;  5B1O A;  2K1E A;  3TET A;  1NKD A;  4OXS A;  5CA1 B;  1AVM A;  1YHQ V;  2RNB A;  3LSQ A;  3LSU A;  2YIA A;  4PDM A;  4DR7 O;  2LJ2 A;  5BMV A;  1GH6 A;  1XRE A;  4LFC O;  1PL4 A;  4JI0 O;  2KG7 B;  5HFL A;  3FB5 C;  2DMX A;  4JYC A;  2UXB O;  2P6J A;  4PDR A;  4WFB V;  3LNN A;  5LHH A;  3OTF A;  2CH7 B;  1KBH A;  4TUY B;  2IJH A;  4JTA B;  3ABK B;  3AK2 A;  4FK5 C;  3K5O A;  3OMN B;  1J95 A;  1ZL8 A;  1V9P A;  4B3T B;  4D7T A;  2WLI B;  4B3S O;  2BCC H;  5IYD O;  2QKA A;  2UU9 O;  1BGY H;  1R73 A;  1WNS A;  2Q69 A;  5KA5 A;  1P49 A;  2Y0I A;  3T1Y O;  4AQY B;  1FFX A;  4GCZ A;  1JX9 A;  1TA8 A;  1TVK B;  5J2T A;  2GTS A;  1H38 A;  2IBZ H;  1N0N A;  5J2U B;  1RSO B;  1AI5 A;  1XQ8 A;  4UB6 Z;  4BIO A;  4GX2 A;  5IJ9 A;  4JYA B;  5C8Y B;  3JD2 A;  3T1H O;  5JQG B;  1RM1 C;  1A32 A;  4DW0 A;  1HNZ B;  1AI6 A;  4PEL A;  2EJ7 A;  3K79 A;  4J7J A;  3CRA A;  2VRZ A;  4ZHQ A;  2ZDI A;  2YXH A;  4I5S A;  3LSS A;  1R6N A;  3E22 A;  4CS3 A;  3L70 H;  3CD6 V;  3CRQ A;  1QR9 A;  5GW7 A; 
#chains in the Genus database with same CATH homology
 2GBO A;  2ODM A;  2NR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...