3CCRV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccrV00
1Q81W 3CD6V 1YJ9V 1R73A 1YJNV 1Q82W 1KD1W 1VQNV 1Q7YW 1N8RW 1JJ2U 4WCEV 1VQLV 1KQSU 2OTLV 1VQ6V 3CPWU 5DM6V 1M90W 3CCUV 3CCSV 3CC2V 3I55V 3CMAV 1K8AW 1VQOV 1VQKV 1YIJV 1VQ5V 3OW2U 1VQ8V 1YHQV 1W2BU 1NJIW 3CCRV 3CCJV 3I56V 3CXCU 3CMEV 1K73W 4WFAV 4WF9V 1YITV 3CC7V 2D3OW 2QEXV 4WFBV 3CCVV 3G71V 1Q86W 3G4SV 1VQPV 1S72V 3CCLV 1YI2V 1QVGU 1VQ4V 1VQ9V 1QVFU 2QA4V 3CCMV 1KC8W 1K9MW 1M1KW 3CCQV 2OTJV 3CC4V 1YJWV 1VQ7V 3CCEV 3G6EV 1VQMV
chains in the Genus database with same CATH superfamily
2IU3A 2IJJA 1THZA 4MTFA 4YIPA 4OGQB 1YDXA 4WFGA 4UCVA 3G6BA 3JCUZ 2ZINA 3RFRA 2XAQA 3JCZA 1JVMA 1M57B 4KUMA 1Y66A 2YXLA 5KX5B 5E1AC 1ZAUA 2PF4E 1GN4A 5CB4B 1WB7A 1OCCB 3OTFA 4HAMA 1GAXA 1GM7A 3STLC 4X1YB 1NI8A 3JD2A 4PDRA 4DV5B 2JS5A 1IURA 2YC0A 1XREA 4IYIA 3RYCA 2OT5A 3OEEG 1NTKH 1XDCA 2PY5A 2KQXA 4JV5O 5B1AB 2X6AA 3C90A 4GCZA 2QR4A 2ITCC 4PA7A 3RBZA 3CCVV 3N2GB 3ZBHA 1NH2B 4DR4O 1ZSPA 2B1GA 1NZ6A 1FD9A 1XMQB 2LW1A 4MW3A 1Y76B 2EJRA 3X2QC 5KHJA 4JYAO 3BEHA 5FLXN 2DOSA 3CSXA 3STZC 1I94B 1I08A 5IT9N 1NTMH 1ORQC 4OX9B 4O2BA 1G4YB 2DYSB 1K4DC 1AR4A 2ZNIA 1WA8A 2AZ2A 3E89A 1XNRO 2YDEA 5BY1A 1YSCA 2EZPA 4JAUA 1OCOC 1QBZA 2AGAA 5CN0A 2Z5UA 1K3EA 4FM1A 4CBCA 2AHYA 4HZ3A 1BL8A 4O2BB 3AG1B 4FK5C 4PA6A 4FZ1A 1HR0O 1Q6HA 3B40A 1N33O 5TISZ 4D7SA 2EINB 2QJ1A 4JI4B 4JV5B 2G38A 3ZIAG 1Q82W 1OCRC 3K5OA 2UXBB 4K0KO 2EJ7A 4MS2A 2EIKB 4ZKIA 1W2BU 3B8NA 2ZQMA 4JTCB 4R6ZA 1AVMA 3O9OA 2DJVA 1ZWIC 2LJ2A 4ZHQB 3JSNA 2V7QG 1CEZA 5CA1B 5D5PA 2C2AA 1V55C 3FAVA 3AG4C 4P30A 4MSWC 3HKCB 5CA0A 5JCOC 3K5NA 2R9RB 1B3QA 4FIPC 2JIZG 4OXSA 1XQ8A 3VQVA 2P7TC 2JJ1G 2KG7B 1HP8A 1ROPA 2EILB 4AI8A 5H5NA 2P4VA 3E22A 2GHYA 4U3JB 4W4KA 1W59A 1OCCC 1MA1A 1VMGA 4PELA 1QU7A 5ITZB 1FJGB 3ZJZA 1FXKB 1R73A 2FYUH 2ZIOA 4NB5A 4LBEC 2BTQB 4R50A 4MVSA 1ZLZA 3CCRV 2XAGA 2GTAA 2WA4A 4WFAV 1MSDA 2H94A 4HNAB 4O4HB 5KHHA 2VQEO 2Z3YA 1N34O 4JI4O 4J9ZB 1NR7A 4LF6B 4PA3A 1N34B 4UCUA 2A06H 4LCUC 2OCCB 2HEPA 5LGNA 2V1DA 2HR3A 4O4LB 2WLLB 2CH7B 3E8BA 2LGQA 1NKDA 4DUZB 4FJCC 2DWDC 2V4DA 1WP8A 3LDEA 4JI3O 3SPHA 3G6EV 2CGOA 3RYCB 1R6NA 2RDCA 3LDDA 4DUYB 3U0ZA 1BE3H 5EBMC 4NVPA 5IYBO 2LO1A 1GM9A 4LF8O 3BFRA 2M6YA 3CE2A 1XMOB 1IBLO 3HKDB 1K4CC 4JI0O 4X20B 1IVSA 1AI7A 3E35A 3E83A 2YICA 4ABMA 3WFVA 2Y0PA 1GN3A 1AI6A 2LQTA 2PGGA 5KHGA 3EFFK 4U7OA 2CTPA 3ZHUA 5LXTA 2EIMC 2P5OA 3NR7A 1M4UA 3HKCA 3TXQA 4I4TA 1BSMA 4NKGB 2ZCEA 1N36O 1FXHA 3K03A 1KC8W 3CJHA 5LP6C 1RFYA 5LMNO 4JI1O 1D2DA 2PYJA 3SGIA 2D2CB 4MTGA 3QG5A 4K35A 5J9PC 2WSSG 3QO7A 4B08A 4GX1A 3JAKB 4MVRA 5KA5A 1RM1B 4B7EA 1VF5B 1HNWO 2UXCB 1OZ0A 2XHBA 3OMNB 3CCQV 3F5WC 1HNWB 1KD1W 3P3PA 1RPOA 3ABUA 5GONB 1QR9A 3AK1A 5JVDB 1IBLB 1MG1A 1OCOB 1SA0B 4UUJC 2QWPB 3JD0A 4JYBA 4E2LA 3BA9A 3CJHB 3CMAV 4GZRB 4I0XA 1VF6A 2YS8A 3I56V 1MNGA 1M9NA 4XDKA 1K92A 2DE0X 3ETDA 4X1IB 4O4JB 4O4IB 3T1CA 1BQ0A 3TXSA 5GW7A 4B3TB 3U10A 3W7WA 4IIJB 2RJZA 3TCUA 4KFMA 1L1FA 4PHZA 4CH4A 3SPGA 1BT8A 4LF7B 2WLHA 2YI9A 1X4TA 1GN6A 2QM8A 3T1YB 1QVGU 2EULA 2IW5A 4MTOA 1F7YA 2A0LA 2XAHA 2UUBO 1WLEA 3JARA 2VWJA 1M5IA 1S5LZ 4FFBA 4X65B 1F51A 1JJOA 4BIOA 4MVOA 4YIOA 4B7KA 2W6IG 4EFEA 3AK3A 2WAMA 4YXWG 1G6UA 1HNZB 1XUQA 1WAZA 1ENVA 5L3FA 3PJSK 4NXNB 3Q4HA 3C3TA 3CRQA 1I7FA 4TUYA 4JI5O 4DR6O 4EB6A 1VQ6V 4JF3A 3N2KB 4P9PA 3W7SA 3CXCU 3OR6C 4DR5B 3RYIA 1P49A 4LH6A 1MMMA 1U97A 2BOBC 2NNUA 1JFFA 5KLVH 3VBBA 3BA8A 1FXKA 2DWEC 4LFBB 4FLUA 2DQ3A 2Q9LA 1KB9F 3OEHG 4QE9A 4TV8A 5IYDO 2Q6AA 3ETGA 1DF5A 3D3IA 1IBMB 5IYCO 3FKSG 1LNQA 1SQBH 4DR2B 3ASNB 5BMVB 3JALB 1KP2A 4GX5A 2YIAA 4K0KB 3D36A 2JGUA 4BWAA 5LXTB 1M90W 2GBOA 1HNZO 2CAZC 2PZSA 2YSUB 3RYHB 2NLJC 3SJCC 3D36C 4R8CA 2KSDA 4DR1O 1BHBA 3R65A 3BCCH 1QVFU 4EEQA 2AHZA 4TSFG 2K1EA 1VARA 3ABMC 3E22B 3OGIB 2QKCA 3B09A 4FLTA 3K0DA 1MSWD 2FL4A 2QM4A 1EZJA 4X89A 4LR3A 4DW0A 1XHZA 1B06A 2QGNA 3LDCA 5IDJA 3HB3B 3SYQA 2AZ0A 3CRCA 4QJFB 4PI2A 1FXKC 5E79Z 2IH1C 4MVZA 1FJGO 2ZM6O 3UKMA 4RQEA 4ASUG 5GONA 5EIBC 2UXXA 4GX2A 1LUVA 4JPRA 5IYZA 1HWYA 4TT3G 1IZ3A 1SERA 3LSUA 2Q8VA 3WG7B 4JI2B 3ZX6A 2MK3A 4I4TB 1AI4A 4PDLA 2DN9A 4JI2O 1HR0B 1NTZH 2H3OA 2VS0A 3K5LA 2ZR3A 5LOVA 1K5QA 4G27B 4JZ2A 2ZD9A 3ICXA 3SPCA 4LP8A 2JGDA 4H44B 1EBOA 4DUZO 4WFHA 1F23A 5LMUO 5C8YA 5FNVB 1WPXA 3GVMA 3DXRB 4DV7B 4JI3B 2Y4TA 4JYAB 1AB3A 2EX3A 5LP6B 2DMXA 5LBQA 1ZUQA 2Q0OC 1MABG 3H1JH 1FYJA 2GUZA 2GTSA 2YEVB 5L3BA 2LGWA 1WJZA 2ARHA 1LR1A 2UUAO 2PTMA 2KB1A 5IJ9B 3UO3A 3JYCA 4Z1VA 1VF7A 1SQFA 2UUAB 3PN1A 4DRXB 1VF6C 2UXBO 4JTDB 3IGAC 3ASNC 2HJFC 4J7ZA 4MTXA 4O4LA 2F4VB 2X6CA 3ETEA 4X1KA 4FM2A 3FYEB 1PM9A 1BGYH 1S5JA 1YZBA 4ZI7A 3R66A 4YJ2A 4ICGA 4RO2A 4B3RO 2ETNA 4QE7A 5EYPA 2QSAA 5CBGA 3T2MA 4TQFA 4X66B 3ABLC 4CZZA 5LOVB 4DRXA 2ZT9B 5LHIA 1I94O 2R9IA 2EZOA 4EB6B 4UFZA 2ZDIA 5H9CA 5IWAB 4WFFA 4DV6O 3OT7A 3WB0A 1VEWA 4DK0A 5IWAO 5B1BC 5B1OA 4ZHQA 3K79A 3ZS8C 1R6KA 2PI4A 4JTAB 4AQYO 3ZHVA 2YIDA 4U3JA 4AQYB 4UXNA 2UXDB 1PNMA 1GM8A 3K04A 3CD6V 3J81N 2LW7A 5EC1C 2QTOA 1Y76A 4PA9A 1IBKO 3CRAA 4TV8B 3FD9A 1K34A 3F7YC 2A3QA 5JJJB 4HYOA 1M93A 2OIEA 4WF9V 1U96A 2EIJB 5LMNB 2M7WA 1F4NA 3JATA 4H13B 4KL1A 4JYYA 2ZKOA 3ZRSA 1TGOA 2RCVA 4A5UB 2OIGA 1YJNV 1Q43A 3M7MX 5L3DA 4DW1A 3ASOB 1IXBA 2LFRA 3G80A 3LNMB 4W4LA 1PD3A 3JSLA 2P67A 2P6JA 2ZXWB 3CCLV 1QLEC 4X1YA 4O2AB 4UCRA 4LNUA 4P2ZA 3F5TA 2ZE5A 4J42A 1JFFB 4GKJB 3CPWU 4D7TA 4PDMA 3CCUV 2QKAA 1JCHA 1QNMA 2UUCB 1WB8A 2XAJA 1AR1B 1Q3EA 4AHCA 4FVMA 3CP1A 4NTWA 4PD4F 4DK1A 4JASA 1K9MW 5HFLA 4KHPB 2VQEB 1A32A 1N36B 1FFTB 3AG2C 2F23A 1Z2GA 2RMKB 1PL4A 1SQQH 4IYHA 4I0XB 4R7CA 4IIJA 4LF7O 2W0XA 1Y4MA 3CWBH 1SZTA 2ITDC 2XOKG 1S76D 4FMTA 5LYJB 1MZFA 3OM3B 1Q6IA 3JALA 2ODMA 4Q6GA 5JH7A 5KAIZ 4DV3B 3EXAA 1SESA 1SQGA 3JARB 4H37A 5B1BB 2BSKB 1FXVA 1Q7YW 3X2QB 3QO8A 3OAAG 4WBNA 3ZN1A 2X6BA 3JD4A 1Q90D 4DR1B 3OR7C 1H2NA 1H2SB 1SF9A 1Z5WA 2YIBD 1N4CA 5CA3A 2N05A 4MVUA 3Q4HB 5B1NA 1BQZA 1ZX3A 1BHAA 5L3GA 1NH2D 5FPRA 4DV1B 5KX5A 3D8CA 2QKSA 1H8HG 3SPJA 1BMFG 4DV1O 1CPYA 2ZDIC 2XNDG 3SYAA 2IJKA 2XTAA 3M8AA 3CCJV 1K73W 4BAYA 1HDJA 4J80A 4MW8A 3QVNA 2IM9A 2YXYA 3G71V 4LNUB 1XNQO 4PI0A 1SA0A 5LYJA 1AJQA 3SJBC 2CTQA 4JI6O 1R1BA 2HJDA 4TV9B 4X8AA 1G1XB 1KBHA 1GKFA 4UV9A 1QR8A 3MHHC 3VQYA 1OJHA 3FB6C 1N32O 3CRMA 2FKXA 4IT5A 4CC6A 2ADQB 1NVPD 1S5HC 2JJ2G 2YIBA 3JAMN 4LFCO 3H1LH 3SJQC 4L8JA 2QTSA 3APQA 1PKXA 5JJNB 4ZOLB 4LFCB 3JD1A 4DV7O 2Z0AA 2N04A 1AILA 2QWRB 1P7GA 4LFAO 3EVKA 1KECA 4LH7A 4JAVA 3GB7C 3ZRVA 2B1IA 4K3AA 3IC9A 2IJHA 3SJAC 3ZMSA 2BSKA 3OUSA 3E8HA 2JEUA 2NN4A 4Z1MG 2QE7G 3ZCCA 1MZEA 2UU9B 2HVKC 1NT2B 3VQWA 5B66Z 3TETA 4JZGA 4FLVA 1OCRB 2P90A 3ZMZA 1SQVH 1X59A 1XNQB 4DR3B 3HKDA 3E8GA 2BE3A 1J5EO 4GUNA 4O2AA 1L0NH 2F95B 1J5EB 4KXRA 2WLIA 4JI6B 4UCOA 3WU2Z 1H8EG 2CTRA 1M57C 4NTYA 4DV5O 4UCTA 4X62B 3ZRXA 1JX9A 1NJIW 4O4JA 4O4IA 5DN6G 2XAFA 3OMAB 2QM7A 3C3SA 1EN6A 3ETQA 2E3CA 3JD3A 2EIJC 4IGGA 1YCIA 2WPDG 2XUMA 5ITZA 4FLYA 2WLNA 1K33A 1WPBA 2JRIA 1VP7A 4H33A 2ZE8A 3B8MA 1EM1A 2Y69B 1DK1A 3K08A 1G8MA 4LF4O 3KZIZ 1H38A 1UJWB 3A0RA 3AG4B 5JH7B 5IY5B 1FFXB 4QIWF 2ZE7A 4TWKA 4AILC 3OE7G 3BY6A 2WA3A 1V54C 3B2EE 1PNLA 2F66C 1JJ2U 1P84F 3JAWA 2Y48A 3QTCA 3LSSA 3H1KH 5H6RA 3W7XA 1T5EA 4RQFA 3ML0A 3MDSA 1QLEB 1QCEA 2UXDO 5K1XA 5LGUA 4OPHA 3IAYA 4ZIBA 3WB2A 4Q20A 1I0HA 3K0GA 1I5YA 2VWKA 4DV0O 2KG7A 5J2UA 2HKOA 2F4VO 4FLXA 2DYRB 4CC5A 2Q5ZA 4FLZA 1VQPV 2PI5A 1R3KC 1YXBA 5BXZA 4YY3B 2UXNA 2CE4A 3ZRWA 4DO2A 1YEWA 1YVWA 4YY3O 4I9QA 4B3RB 1TUBB 1FKAO 1PP9H 5J2UB 4J10A 4LF4B 5GTIZ 5EK0A 1NVPB 1R6TA 2R72A 4LF8B 4OX9O 1DF4A 3AG3B 1XMOO 4X1KB 3OGCC 3N2GA 1VQ7V 1XNRB 4HBNA 1KKDA 1EN5A 3H1HH 4FFKA 3HKEB 1ZL8B 2IU0A 3VQXA 1WN7A 5DM6V 2HG5C 4D6TH 3I5DA 4P9OA 3L71H 3AK2A 3T4ZA 1SETA 2JDIG 4UB8Z 2RQ6A 2OWOA 2ADPA 1SQPH 1ZTEA 4LF6O 4EFBA 3BRCA 3UO2A 2E76B 4CS2A 1UFIA 3I55V 2CTWA 4BR6A 4CS4A 3IFXA 2JVDA 3GWKC 1BCCH 3E8FA 1JA8A 5B3SC 4DR7O 2ATKC 2XT9A 1TUBA 1NS1A 4U7NA 3W7TA 1TA8A 2A7WA 2JS3A 1KKCA 5D5QA 2JGDB 4B3MB 4YJ2B 4ZI7B 5CB4A 3MHSC 3BVOA 5L3EA 3ZN0A 5CA0B 1JR9A 1O9GA 1KUQA 1IDSA 3LSQA 1GH6A 5LL6Y 4DYLA 2P4KA 5CA1A 1PL0A 3OD4A 4H0LB 4XDLA 4FLWA 1K5SA 5BR8O 1N8RW 1E79G 3OTOB 2ZE6A 3T4DA 3H01A 3MAQA 1YHQV 1NU1H 1XILA 4U3FH 1OV9A 1XBLA 3RW0A 3OTOO 4XBFA 1WP7A 4B3SB 4CH5A 1E1RG 2BTQA 4MT8A 3ZMVA 3SYCA 1ZL8A 4GYCB 2BOCC 1KYOF 1RP3B 3L9DA 5JVDA 4YHHO 2O57A 3TK1A 2Q7HA 5C8YB 1GMGA 1OHHG 2L35A 5A9GA 1NBMG 4YHHB 1AI5A 3DC5A 3D3QA 5LP6A 2D3OW 1PV0A 2DYSC 1V9PA 3HKBB 2HVJC 2DW4A 3CRRA 3CX5F 3L72H 1YTFB 3TGUH 4I50A 1S0VA 2F1MA 2EBOA 3WG7C 4FFBB 2F43G 5IJ0A 2YXHA 1EFRG 3CC2V 1VQOV 2HLDG 5LGTA 4YJ3B 4X64B 3O65A 4B3TO 3B4SA 5FPOA 4UVAA 4X64O 4F6RB 2QA4V 2Q69A 4X1IA 3NXSA 4KP4A 3S3XA 2R70A 3BAAA 3ZEDA 4RAIA 4FM0A 2YUAA 3CXHF 4KHPO 1XL4A 2Y69C 2QWQB 1VQ5V 5BZBA 2A9HA 3K3WA 1B04A 5IE9A 1IBKB 5LA6B 1Z5VA 1CP9A 4CS3A 3H9VA 2A79B 5KHIA 4N23A 1S72V 3AG3C 2ILMA 5KMGA 4DR2O 1TVKB 4IHJB 1S3JA 4L87A 4RUEA 3CCSV 3AG7A 4X65O 1K7DA 1DLBA 1GRJA 1N0JA 2UXCO 4I9WA 2YI8A 1L8DA 3RGBA 4BW5A 1OCZB 5LHGA 4WFEA 1XMQO 1H2GA 4I55A 1KP3A 2B5UA 2CDYA 2P22C 2E74B 3A8TA 4JI8B 2CGNA 2QWOB 2UUCO 1V55B 3UCSC 1US6A 1Q86W 4I50B 4JI8O 1VQ4V 4GKKO 1FPOA 2ZNJA 5H6QA 4DR5O 1QHTA 1N0NA 5JWPA 3ZHRA 2UU9O 4JYCA 2AXTZ 1SC5B 2CH7A 1EZVH 5JCOA 2QWNB 3CYOA 4JGSA 3N2KA 5JJEB 2IJIA 4UVBA 2IBZH 1O9HA 5CBFA 3APOA 3KCXA 5EC2C 1M1KW 3ABLB 1TVKA 4IHJA 5H2FZ 4QNHB 4X88A 1QLNA 3U11A 1JPXA 4DV3O 2OCCC 3AEIA 1Y74B 4MVQA 5EZYB 1H2MA 4JAAA 3RVZA 1S77D 4JI5B 4DR6B 4JI7O 3J80N 2VQFO 4LFAB 5GTHZ 5LA6A 3K57A 3E2EA 5JQGB 2EILC 3ZMUA 2W6JG 5FL7G 2FTKA 2NR5A 1VQ8V 3IC7A 4GKKB 1OCZC 4HNAA 5FNVA 3LNNA 3K9AA 2Y4UA 4DR3O 2BCCH 2Q67A 3JASB 3P3NA 3BPZA 4I5SA 4K8XA 5B1AC 2ZM6B 5B5EZ 1BZKA 1RM1C 1GO3F 4OPAA 2LFSA 1AJNA 1V54B 2H8PC 1J95A 4NXMO 3RWRD 1CXZB 1E1QG 3OMIB 1RSOA 1N33B 3G4SV 3K5MA 1AP5A 1EN4A 4NXMB 1AJPA 3ZHQA 3E86A 3H1IH 3HKBA 4FPPA 1Q81W 4BW9A 4EKWA 4CH6A 1Y67A 2WLLA 3CS5A 4PA4A 4BIUA 4DR4B 4TQDA 1Q5OA 2IH3C 3SYPA 2X0LA 1SRYA 3SPIA 4LF5O 2R9AA 4J7JA 2ZR2A 1GTOA 2L6LA 4G28B 1Q8IA 5EIBD 5LMUB 1YI2V 3UT5A 3KCYA 4X66O 1DTOA 4O4HA 1DGSA 2Q7EA 3ZRWB 5L3CA 1VQLV 2XASA 2YEVA 3G67A 4N21A 3T1HO 4DV6B 3HKEA 3OFNG 1HNXB 4ZBMA 4NYKA 2Q0AA 1B6QA 4F6EA 3B77A 4UVCA 2OTJV 1YJWV 4X9QA 1M56B 2ZXWC 1JQ0A 4UCSA 2KKWA 5DEDA 4UV8A 5DECA 3K06A 4F4LA 3RN4A 5EYPB 5KUMA 3SYOA 1YIJV 3OW2U 3FX7A 2Q7GA 1JMKC 5IJ9A 1R3LC 1MOFA 1JOYA 4JI1B 1NQTA 3W7UA 4NTXA 1TUEB 5C93A 3F7VC 3JAWB 2Q73A 2FMLA 1XL6A 4XDJA 5KHKA 2E5LO 1P4RA 3ABTA 1SKVA 5J2TB 2VRZA 3RYIB 3WB1A 3UQ8A 1HW7A 2F93B 1URFA 5BMVA 1K97A 2B9ZA 2AW9A 2QDOA 5B3SB 5CBHA 1W0JG 1VQMV 3RYHA 4PV1B 1BS3A 3T1HB 3JASA 1AROP 3L75H 1VQKV 1HNXO 3HPLC 4TOIA 2PYLA 3DSQA 2E75B 3ABMB 3ABKB 1XOUA 3GWOA 3FB5C 3QF7A 1FFXA 3LUTB 1YTFD 2X7RB 1KU9A 4MVMA 4FZ0A 3P32A 1VIBA 2PUSA 1KQSU 4ZOLA 3K58A 1PNKA 3ZHTA 3UT5B 4DV0B 3QNEA 2OYQA 2GUZB 1M56C 3CB2A 1D5AA 1Y6XA 3BABA 2DQ0A 2N74A 3S3WA 1QQCA 1LUWA 2HFEC 3CC4V 4DR7B 3DTUB 2E5LB 5KAFZ 3SR2C 2EIKC 4Z2WA 1AP6A 1Y74A 2EINC 4QPKA 2BTOA 4DUYO 3DGEA 3DXRA 3CMEV 5JQGA 4NXNO 2GSMB 1R3IC 3FAVB 3FB7C 2RNBA 3L73H 2WLMA 3CCMV 4JI0B 1PPJH 3A0BZ 4J11A 3CHXA 4UB6Z 4PJ0Z 2GV9A 4DV4O 5IYZB 3FFQA 3K59A 4QGPA 2RN9A 1YJ9V 4DV2O 4DV4B 5KUKA 3RYFA 5HFMA 4CH3A 2Q68A 4GKJO 4LC1A 1YITV 3CC7V 2Y0IA 4LWSB 5EBLC 2K9PA 2FB5A 2DYRC 2P06A 4TV9A 3OUFA 2WLKA 3HR0A 2HP8A 4RUFA 3CCEV 2JEXA 1UPGA 1RSOB 1L0LH 5IY5C 2CUGA 2WLIB 3FYIB 1VQNV 1H2KA 4LF9O 3L70H 1D5NA 1TAEA 4BIZA 4GLXA 1FS0G 1GN2A 2UUBB 4PDVA 1WNSA 3IJ4A 3M99B 4K8ZA 1Q6UA 1F4MA 3VOUA 3J7AU 5F2VO 4G2KA 4WCEV 3UM7A 2MW2B 2GDSA 3BHPA 2HHHB 4I55B 4GX0A 3FB8C 2WLJA 4X20A 4B3MO 2VQFB 3AG1C 4E4EA 3THOA 3ZHSA 4RWUA 4DV2B 3MD0A 2OCHA 1WA8B 1IX9A 3P30A 1YF2A 4IL6Z 4C7UA 3RYFB 1W0KG 5A2QN 1AR5A 3A0HZ 1K8AW 1IXMA 1XI1A 5K1PA 5BR8B 4LWSA 2ZIMA 1FAFA 2LP7A 5AG2A 4YJ3A 3CEIA 3L74H 1H2LA 1I5XA 3K9SA 4I7ZB 2WWWA 2W0FC 4LFBO 4F6RA 5IJ0B 4B3SO 4LF9B 3T1YO 3QO5A 4QPJA 1COWG 3SDLA 1XHXA 2JK5C 4WBNB 1NR1A 1IBMO 4X62O 3ASOC 4J7KA 2QEXV 1SQXH 5J2TA 3RVYA 1N32B 3EHBB 3ABKC 3KKYA 5CMUA 3DC6A 1XEQA 4NR1A 3RT3C 5KMGB 2CK3G 3JAKA 2HHHO 3A2FA 2OTLV 2EIMB 3TJTA 3JATB 1KMIZ 4LF5B 5EBWC 5LHHA 3N27A 1GK9A 4J41A 3ZMTA 4JI7B 5EZYA 3KG2A 5KA6A 4WFBV 4TUYB 2Q4PA 1R3JC 3AG2B 4GT1A 1VQ9V 4DXWA 1SZXA 1SS3A 1P7BA 4J9YB 1RPRA
chains in the Genus database with same CATH topology
3OUSA 2IU3A 2JEUA 3E8HA 4Z1MG 2IJJA 1THZA 2QE7G 4MTFA 4QNHB 3D36A 4X88A 3ZCCA 1QLNA 4WFGA 1JPXA 2HVKC 1M90W 2OCCC 3AEIA 3TETA 1OCRB 2XAQA 1JVMA 2YSUB 3JCZA 4MVQA 1M57B 4KUMA 1Y66A 2P90A 5E1AC 3ZMZA 2NLJC 3E8GA 3RVZA 1OCCB 4HAMA 4R8CA 1S77D 1BHBA 3R65A 1QVFU 1GM7A 2AHZA 4TSFG 2K1EA 3STLC 3ABMC 3JD2A 2WLIA 4PDRA 3K0DA 1H8EG 1MSWD 3E2EA 2EILC 3ZMUA 2OT5A 3OEEG 1M57C 2W6JG 5FL7G 1EZJA 2FTKA 4X89A 3ZRXA 1VQ8V 1JX9A 1NJIW 5B1AB 2X6AA 3IC7A 4GCZA 1OCZC 5DN6G 2ITCC 4PA7A 2XAFA 3RBZA 3OMAB 2QM7A 3LDCA 5IDJA 3CCVV 3HB3B 3K9AA 3SYQA 4QJFB 1FXKC 3JD3A 2EIJC 2IH1C 4MVZA 3UKMA 4RQEA 2Q67A 4ASUG 2WPDG 4I5SA 1NH2B 2UXXA 4GX2A 5B1AC 4JPRA 1HWYA 2B1GA 2WLNA 4TT3G 1K33A 1SERA 1RM1C 1GO3F 4H33A 4MW3A 2LFSA 3B8MA 3WG7B 2EJRA 1AJNA 2Y69B 1V54B 3X2QC 2H8PC 1J95A 3K08A 2MK3A 1AI4A 1G8MA 4PDLA 1E1QG 3BEHA 3OMIB 1H38A 3G4SV 3STZC 1UJWB 3A0RA 3AG4B 5IY5B 1ORQC 1AJPA 2ZR3A 4QIWF 1G4YB 2DYSB 3E86A 1K4DC 4FPPA 4TWKA 1Q81W 4EKWA 3OE7G 1K5QA 3BY6A 4G27B 1V54C 3E89A 1PNLA 2ZD9A 1JJ2U 2WLLA 3SPCA 2Y48A 4PA4A 4LP8A 3LSSA 5H6RA 4BIUA 1EBOA 1YSCA 2EZPA 3W7XA 4WFHA 2IH3C 4JAUA 3SYPA 1OCOC 4RQFA 2X0LA 1F23A 1QBZA 3ML0A 5CN0A 1SRYA 2Z5UA 3SPIA 1QLEB 1WPXA 1K3EA 1QCEA 4CBCA 2AHYA 2ZR2A 1GTOA 4G28B 4HZ3A 1BL8A 1YI2V 5LGUA 3AG1B 4FK5C 4PA6A 1DTOA 4Q20A 3K0GA 1I5YA 2EINB 3ZRWB 1Q82W 3ZIAG 1OCRC 5LBQA 5L3CA 1VQLV 4MS2A 1MABG 2EIKB 2XASA 2YEVA 4N21A 4ZKIA 1W2BU 2HKOA 3B8NA 2ZQMA 4JTCB 4R6ZA 2DYRB 3OFNG 1ZWIC 4ZBMA 1VQPV 1B6QA 2YEVB 1R3KC 2PI5A 2V7QG 3B77A 1CEZA 2UXNA 4UVCA 5L3BA 2C2AA 1V55C 2OTJV 1YJWV 1M56B 3AG4C 2ZXWC 4P30A 1JQ0A 3ZRWA 4MSWC 4DO2A 2R9RB 2KB1A 4UV8A 3K06A 4F4LA 3JYCA 4FIPC 2JIZG 4OXSA 5KUMA 3SYOA 1YIJV 2P7TC 3OW2U 2JJ1G 5EK0A 4JTDB 1NVPB 1ROPA 2EILB 3IGAC 1R3LC 1MOFA 3ASNC 1DF4A 2HJFC 3AG3B 1JOYA 4MTXA 1NQTA 2GHYA 2X6CA 3OGCC 3ETEA 3W7UA 1TUEB 5C93A 1OCCC 3F7VC 1VQ7V 3FYEB 1KKDA 4PELA 1XL6A 4XDJA 1FXKB 3ZJZA 1R73A 2IU0A 5DM6V 2HG5C 4LBEC 4RO2A 1P4RA 3ABTA 4R50A 4MVSA 4QE7A 3CCRV 2XAGA 4WFAV 5CBGA 3T2MA 2H94A 4P9OA 3ABLC 4CZZA 2Z3YA 3T4ZA 1SETA 4J9ZB 1NR7A 1K97A 2JDIG 5B3SB 1W0JG 4PA3A 5CBHA 5LHIA 1VQMV 2R9IA 2EZOA 4LCUC 2OCCB 2ZDIA 5H9CA 4WFFA 5LGNA 2V1DA 1AROP 3I55V 1VQKV 2HR3A 2WLLB 3E8BA 3HPLC 3IFXA 5B1BC 5B1OA 3K79A 3E8FA 1R6KA 1NKDA 5B3SC 2PI4A 4JTAB 3ABMB 3ABKB 4FJCC 3GWOA 2DWDC 3FB5C 3LDEA 2ATKC 3LUTB 3SPHA 3G6EV 4UXNA 2X7RB 1YTFD 1PNMA 1GM8A 3K04A 1R6NA 4MVMA 3CD6V 4U7NA 3P32A 3W7TA 3LDDA 5EC1C 2QTOA 1KQSU 4PA9A 5EBMC 5IYBO 1PNKA 1GM9A 1K34A 3F7YC 3QNEA 1K4CC 3MHSC 4HYOA 5L3EA 4WF9V 3ZN0A 2EIJB 1M56C 3LSQA 2M7WA 1F4NA 1AI7A 2DQ0A 3E35A 3E83A 2HFEC 1PL0A 3CC4V 3WFVA 3DTUB 1AI6A 4XDLA 2EIKC 3ZRSA 1YJNV 1K5SA 3EFFK 1N8RW 4U7OA 5L3DA 2EINC 1E79G 3T4DA 3H01A 4QPKA 3ASOB 1YHQV 2EIMC 2LFRA 3DGEA 3CMEV 3LNMB 3RW0A 2GSMB 4XBFA 1PD3A 1R3IC 2P67A 2P6JA 2ZXWB 3FB7C 1FXHA 3CCLV 1E1RG 1QLEC 3K03A 4MT8A 1KC8W 2WLMA 3ZMVA 3CCMV 3SYCA 2BOCC 4P2ZA 3TK1A 1YJ9V 1GMGA 1OHHG 4MTGA 1NBMG 5KUKA 3CPWU 4PDMA 5J9PC 3CCUV 2WSSG 3QO7A 1JCHA 1AI5A 4GX1A 2XAJA 5HFMA 4MVRA 2Q68A 4LC1A 5KA5A 1YITV 1RM1B 3CC7V 2D3OW 1AR1B 2DYSC 5EBLC 3CP1A 2HVJC 2DW4A 2DYRC 1OZ0A 4JASA 3OMNB 1K9MW 3OUFA 2WLKA 4RUFA 3CCQV 3F5WC 1YTFB 5HFLA 3CCEV 1KD1W 1S0VA 2JEXA 1FFTB 2EBOA 3WG7C 3AG2C 1RPOA 2F43G 3ABUA 5IY5C 1QR9A 1MG1A 1OCOB 2WLIB 3FYIB 3JD0A 4UUJC 1VQNV 4JYBA 4E2LA 1EFRG 3CC2V 3CMAV 4R7CA 1VQOV 2HLDG 4BIZA 3I56V 5LGTA 1Y4MA 1M9NA 4XDKA 1K92A 1FS0G 1SZTA 3ETDA 2ITDC 2XOKG 1S76D 4UVAA 3T1CA 4FMTA 4PDVA 3M99B 3OM3B 2QA4V 5GW7A 2Q69A 1F4MA 3NXSA 3VOUA 1SESA 4KP4A 4G2KA 4H37A 5B1BB 4RAIA 1FXVA 1Q7YW 3X2QB 3QO8A 3W7WA 4WCEV 1XL4A 2Y69C 3OAAG 3UM7A 3TCUA 1VQ5V 4KFMA 1L1FA 3ZN1A 5BZBA 2X6BA 3JD4A 2A9HA 3SPGA 3K3WA 4GX0A 3OR7C 3FB8C 2WLJA 1CP9A 2WLHA 3AG1C 2A79B 2QM8A 4N23A 1S72V 5CA3A 4MVUA 1QVGU 2IW5A 3AG3C 4MTOA 2A0LA 2XAHA 5B1NA 3MD0A 1BHAA 1WLEA 5L3GA 1NH2D 2QKSA 1F51A 1S3JA 3P30A 4L87A 1H8HG 4MVOA 3SPJA 4RUEA 1W0KG 2W6IG 1BMFG 3CCSV 1CPYA 2WAMA 4YXWG 1K8AW 2ZDIC 1IXMA 2XNDG 2IJKA 1K7DA 3SYAA 1DLBA 3CCJV 1K73W 4BAYA 4MW8A 4I9WA 2LP7A 1ENVA 5L3FA 3PJSK 3G71V 1I5XA 4BW5A 2WWWA 1OCZB 5LHGA 2W0FC 4WFEA 1AJQA 1H2GA 3QO5A 4QPJA 1VQ6V 1COWG 4JF3A 2JK5C 1KP3A 4P9PA 4X8AA 2B5UA 1NR1A 3W7SA 1GKFA 4UV9A 1QR8A 3MHHC 3CXCU 3FB6C 3ASOC 3OR6C 2QEXV 1V55B 1Q86W 1VQ4V 3RVYA 5H6QA 3EHBB 2BOBC 2NNUA 3ABKC 1S5HC 1NVPD 5CMUA 2JJ2G 3VBBA 1FXKA 4JYCA 2DWEC 2DQ3A 2CK3G 3SJQC 2OTLV 2EIMB 3OEHG 1PKXA 4QE9A 3CYOA 4JGSA 5EBWC 3JD1A 5LHHA 5IYDO 2IJIA 3ETGA 1GK9A 2Q6AA 4UVBA 1DF5A 3ZMTA 3D3IA 3KG2A 5KA6A 4WFBV 5IYCO 3FKSG 1KECA 1R3JC 5CBFA 1LNQA 3AG2B 3ASNB 4GT1A 1VQ9V 4JAVA 1KP2A 3GB7C 2B1IA 4GX5A 5EC2C 3ZRVA 4DXWA 1M1KW 1P7BA 2IJHA 3ABLB 3ZMSA 4J9YB 1RPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 W;  3CD6 V;  1YJ9 V;  1R73 A;  1YJN V;  1Q82 W;  1KD1 W;  1VQN V;  1Q7Y W;  1N8R W;  1JJ2 U;  4WCE V;  1VQL V;  1KQS U;  2OTL V;  1VQ6 V;  3CPW U;  5DM6 V;  1M90 W;  3CCU V;  3CCS V;  3CC2 V;  3I55 V;  3CMA V;  1K8A W;  1VQO V;  1VQK V;  1YIJ V;  1VQ5 V;  3OW2 U;  1VQ8 V;  1YHQ V;  1W2B U;  1NJI W;  3CCR V;  3CCJ V;  3I56 V;  3CXC U;  3CME V;  1K73 W;  4WFA V;  4WF9 V;  1YIT V;  3CC7 V;  2D3O W;  2QEX V;  4WFB V;  3CCV V;  3G71 V;  1Q86 W;  3G4S V;  1VQP V;  1S72 V;  3CCL V;  1YI2 V;  1QVG U;  1VQ4 V;  1VQ9 V;  1QVF U;  2QA4 V;  3CCM V;  1KC8 W;  1K9M W;  1M1K W;  3CCQ V;  2OTJ V;  3CC4 V;  1YJW V;  1VQ7 V;  3CCE V;  3G6E V;  1VQM V; 
#chains in the Genus database with same CATH topology
 2IU3 A;  2IJJ A;  1THZ A;  4MTF A;  4YIP A;  4OGQ B;  1YDX A;  4WFG A;  4UCV A;  3G6B A;  3JCU Z;  2ZIN A;  3RFR A;  2XAQ A;  3JCZ A;  1JVM A;  1M57 B;  4KUM A;  1Y66 A;  2YXL A;  5KX5 B;  5E1A C;  1ZAU A;  2PF4 E;  1GN4 A;  5CB4 B;  1WB7 A;  1OCC B;  3OTF A;  4HAM A;  1GAX A;  1GM7 A;  3STL C;  4X1Y B;  1NI8 A;  3JD2 A;  4PDR A;  4DV5 B;  2JS5 A;  1IUR A;  2YC0 A;  1XRE A;  4IYI A;  3RYC A;  2OT5 A;  3OEE G;  1NTK H;  1XDC A;  2PY5 A;  2KQX A;  4JV5 O;  5B1A B;  2X6A A;  3C90 A;  4GCZ A;  2QR4 A;  2ITC C;  4PA7 A;  3RBZ A;  3CCV V;  3N2G B;  3ZBH A;  1NH2 B;  4DR4 O;  1ZSP A;  2B1G A;  1NZ6 A;  1FD9 A;  1XMQ B;  2LW1 A;  4MW3 A;  1Y76 B;  2EJR A;  3X2Q C;  5KHJ A;  4JYA O;  3BEH A;  5FLX N;  2DOS A;  3CSX A;  3STZ C;  1I94 B;  1I08 A;  5IT9 N;  1NTM H;  1ORQ C;  4OX9 B;  4O2B A;  1G4Y B;  2DYS B;  1K4D C;  1AR4 A;  2ZNI A;  1WA8 A;  2AZ2 A;  3E89 A;  1XNR O;  2YDE A;  5BY1 A;  1YSC A;  2EZP A;  4JAU A;  1OCO C;  1QBZ A;  2AGA A;  5CN0 A;  2Z5U A;  1K3E A;  4FM1 A;  4CBC A;  2AHY A;  4HZ3 A;  1BL8 A;  4O2B B;  3AG1 B;  4FK5 C;  4PA6 A;  4FZ1 A;  1HR0 O;  1Q6H A;  3B40 A;  1N33 O;  5TIS Z;  4D7S A;  2EIN B;  2QJ1 A;  4JI4 B;  4JV5 B;  2G38 A;  3ZIA G;  1Q82 W;  1OCR C;  3K5O A;  2UXB B;  4K0K O;  2EJ7 A;  4MS2 A;  2EIK B;  4ZKI A;  1W2B U;  3B8N A;  2ZQM A;  4JTC B;  4R6Z A;  1AVM A;  3O9O A;  2DJV A;  1ZWI C;  2LJ2 A;  4ZHQ B;  3JSN A;  2V7Q G;  1CEZ A;  5CA1 B;  5D5P A;  2C2A A;  1V55 C;  3FAV A;  3AG4 C;  4P30 A;  4MSW C;  3HKC B;  5CA0 A;  5JCO C;  3K5N A;  2R9R B;  1B3Q A;  4FIP C;  2JIZ G;  4OXS A;  1XQ8 A;  3VQV A;  2P7T C;  2JJ1 G;  2KG7 B;  1HP8 A;  1ROP A;  2EIL B;  4AI8 A;  5H5N A;  2P4V A;  3E22 A;  2GHY A;  4U3J B;  4W4K A;  1W59 A;  1OCC C;  1MA1 A;  1VMG A;  4PEL A;  1QU7 A;  5ITZ B;  1FJG B;  3ZJZ A;  1FXK B;  1R73 A;  2FYU H;  2ZIO A;  4NB5 A;  4LBE C;  2BTQ B;  4R50 A;  4MVS A;  1ZLZ A;  3CCR V;  2XAG A;  2GTA A;  2WA4 A;  4WFA V;  1MSD A;  2H94 A;  4HNA B;  4O4H B;  5KHH A;  2VQE O;  2Z3Y A;  1N34 O;  4JI4 O;  4J9Z B;  1NR7 A;  4LF6 B;  4PA3 A;  1N34 B;  4UCU A;  2A06 H;  4LCU C;  2OCC B;  2HEP A;  5LGN A;  2V1D A;  2HR3 A;  4O4L B;  2WLL B;  2CH7 B;  3E8B A;  2LGQ A;  1NKD A;  4DUZ B;  4FJC C;  2DWD C;  2V4D A;  1WP8 A;  3LDE A;  4JI3 O;  3SPH A;  3G6E V;  2CGO A;  3RYC B;  1R6N A;  2RDC A;  3LDD A;  4DUY B;  3U0Z A;  1BE3 H;  5EBM C;  4NVP A;  5IYB O;  2LO1 A;  1GM9 A;  4LF8 O;  3BFR A;  2M6Y A;  3CE2 A;  1XMO B;  1IBL O;  3HKD B;  1K4C C;  4JI0 O;  4X20 B;  1IVS A;  1AI7 A;  3E35 A;  3E83 A;  2YIC A;  4ABM A;  3WFV A;  2Y0P A;  1GN3 A;  1AI6 A;  2LQT A;  2PGG A;  5KHG A;  3EFF K;  4U7O A;  2CTP A;  3ZHU A;  5LXT A;  2EIM C;  2P5O A;  3NR7 A;  1M4U A;  3HKC A;  3TXQ A;  4I4T A;  1BSM A;  4NKG B;  2ZCE A;  1N36 O;  1FXH A;  3K03 A;  1KC8 W;  3CJH A;  5LP6 C;  1RFY A;  5LMN O;  4JI1 O;  1D2D A;  2PYJ A;  3SGI A;  2D2C B;  4MTG A;  3QG5 A;  4K35 A;  5J9P C;  2WSS G;  3QO7 A;  4B08 A;  4GX1 A;  3JAK B;  4MVR A;  5KA5 A;  1RM1 B;  4B7E A;  1VF5 B;  1HNW O;  2UXC B;  1OZ0 A;  2XHB A;  3OMN B;  3CCQ V;  3F5W C;  1HNW B;  1KD1 W;  3P3P A;  1RPO A;  3ABU A;  5GON B;  1QR9 A;  3AK1 A;  5JVD B;  1IBL B;  1MG1 A;  1OCO B;  1SA0 B;  4UUJ C;  2QWP B;  3JD0 A;  4JYB A;  4E2L A;  3BA9 A;  3CJH B;  3CMA V;  4GZR B;  4I0X A;  1VF6 A;  2YS8 A;  3I56 V;  1MNG A;  1M9N A;  4XDK A;  1K92 A;  2DE0 X;  3ETD A;  4X1I B;  4O4J B;  4O4I B;  3T1C A;  1BQ0 A;  3TXS A;  5GW7 A;  4B3T B;  3U10 A;  3W7W A;  4IIJ B;  2RJZ A;  3TCU A;  4KFM A;  1L1F A;  4PHZ A;  4CH4 A;  3SPG A;  1BT8 A;  4LF7 B;  2WLH A;  2YI9 A;  1X4T A;  1GN6 A;  2QM8 A;  3T1Y B;  1QVG U;  2EUL A;  2IW5 A;  4MTO A;  1F7Y A;  2A0L A;  2XAH A;  2UUB O;  1WLE A;  3JAR A;  2VWJ A;  1M5I A;  1S5L Z;  4FFB A;  4X65 B;  1F51 A;  1JJO A;  4BIO A;  4MVO A;  4YIO A;  4B7K A;  2W6I G;  4EFE A;  3AK3 A;  2WAM A;  4YXW G;  1G6U A;  1HNZ B;  1XUQ A;  1WAZ A;  1ENV A;  5L3F A;  3PJS K;  4NXN B;  3Q4H A;  3C3T A;  3CRQ A;  1I7F A;  4TUY A;  4JI5 O;  4DR6 O;  4EB6 A;  1VQ6 V;  4JF3 A;  3N2K B;  4P9P A;  3W7S A;  3CXC U;  3OR6 C;  4DR5 B;  3RYI A;  1P49 A;  4LH6 A;  1MMM A;  1U97 A;  2BOB C;  2NNU A;  1JFF A;  5KLV H;  3VBB A;  3BA8 A;  1FXK A;  2DWE C;  4LFB B;  4FLU A;  2DQ3 A;  2Q9L A;  1KB9 F;  3OEH G;  4QE9 A;  4TV8 A;  5IYD O;  2Q6A A;  3ETG A;  1DF5 A;  3D3I A;  1IBM B;  5IYC O;  3FKS G;  1LNQ A;  1SQB H;  4DR2 B;  3ASN B;  5BMV B;  3JAL B;  1KP2 A;  4GX5 A;  2YIA A;  4K0K B;  3D36 A;  2JGU A;  4BWA A;  5LXT B;  1M90 W;  2GBO A;  1HNZ O;  2CAZ C;  2PZS A;  2YSU B;  3RYH B;  2NLJ C;  3SJC C;  3D36 C;  4R8C A;  2KSD A;  4DR1 O;  1BHB A;  3R65 A;  3BCC H;  1QVF U;  4EEQ A;  2AHZ A;  4TSF G;  2K1E A;  1VAR A;  3ABM C;  3E22 B;  3OGI B;  2QKC A;  3B09 A;  4FLT A;  3K0D A;  1MSW D;  2FL4 A;  2QM4 A;  1EZJ A;  4X89 A;  4LR3 A;  4DW0 A;  1XHZ A;  1B06 A;  2QGN A;  3LDC A;  5IDJ A;  3HB3 B;  3SYQ A;  2AZ0 A;  3CRC A;  4QJF B;  4PI2 A;  1FXK C;  5E79 Z;  2IH1 C;  4MVZ A;  1FJG O;  2ZM6 O;  3UKM A;  4RQE A;  4ASU G;  5GON A;  5EIB C;  2UXX A;  4GX2 A;  1LUV A;  4JPR A;  5IYZ A;  1HWY A;  4TT3 G;  1IZ3 A;  1SER A;  3LSU A;  2Q8V A;  3WG7 B;  4JI2 B;  3ZX6 A;  2MK3 A;  4I4T B;  1AI4 A;  4PDL A;  2DN9 A;  4JI2 O;  1HR0 B;  1NTZ H;  2H3O A;  2VS0 A;  3K5L A;  2ZR3 A;  5LOV A;  1K5Q A;  4G27 B;  4JZ2 A;  2ZD9 A;  3ICX A;  3SPC A;  4LP8 A;  2JGD A;  4H44 B;  1EBO A;  4DUZ O;  4WFH A;  1F23 A;  5LMU O;  5C8Y A;  5FNV B;  1WPX A;  3GVM A;  3DXR B;  4DV7 B;  4JI3 B;  2Y4T A;  4JYA B;  1AB3 A;  2EX3 A;  5LP6 B;  2DMX A;  5LBQ A;  1ZUQ A;  2Q0O C;  1MAB G;  3H1J H;  1FYJ A;  2GUZ A;  2GTS A;  2YEV B;  5L3B A;  2LGW A;  1WJZ A;  2ARH A;  1LR1 A;  2UUA O;  2PTM A;  2KB1 A;  5IJ9 B;  3UO3 A;  3JYC A;  4Z1V A;  1VF7 A;  1SQF A;  2UUA B;  3PN1 A;  4DRX B;  1VF6 C;  2UXB O;  4JTD B;  3IGA C;  3ASN C;  2HJF C;  4J7Z A;  4MTX A;  4O4L A;  2F4V B;  2X6C A;  3ETE A;  4X1K A;  4FM2 A;  3FYE B;  1PM9 A;  1BGY H;  1S5J A;  1YZB A;  4ZI7 A;  3R66 A;  4YJ2 A;  4ICG A;  4RO2 A;  4B3R O;  2ETN A;  4QE7 A;  5EYP A;  2QSA A;  5CBG A;  3T2M A;  4TQF A;  4X66 B;  3ABL C;  4CZZ A;  5LOV B;  4DRX A;  2ZT9 B;  5LHI A;  1I94 O;  2R9I A;  2EZO A;  4EB6 B;  4UFZ A;  2ZDI A;  5H9C A;  5IWA B;  4WFF A;  4DV6 O;  3OT7 A;  3WB0 A;  1VEW A;  4DK0 A;  5IWA O;  5B1B C;  5B1O A;  4ZHQ A;  3K79 A;  3ZS8 C;  1R6K A;  2PI4 A;  4JTA B;  4AQY O;  3ZHV A;  2YID A;  4U3J A;  4AQY B;  4UXN A;  2UXD B;  1PNM A;  1GM8 A;  3K04 A;  3CD6 V;  3J81 N;  2LW7 A;  5EC1 C;  2QTO A;  1Y76 A;  4PA9 A;  1IBK O;  3CRA A;  4TV8 B;  3FD9 A;  1K34 A;  3F7Y C;  2A3Q A;  5JJJ B;  4HYO A;  1M93 A;  2OIE A;  4WF9 V;  1U96 A;  2EIJ B;  5LMN B;  2M7W A;  1F4N A;  3JAT A;  4H13 B;  4KL1 A;  4JYY A;  2ZKO A;  3ZRS A;  1TGO A;  2RCV A;  4A5U B;  2OIG A;  1YJN V;  1Q43 A;  3M7M X;  5L3D A;  4DW1 A;  3ASO B;  1IXB A;  2LFR A;  3G80 A;  3LNM B;  4W4L A;  1PD3 A;  3JSL A;  2P67 A;  2P6J A;  2ZXW B;  3CCL V;  1QLE C;  4X1Y A;  4O2A B;  4UCR A;  4LNU A;  4P2Z A;  3F5T A;  2ZE5 A;  4J42 A;  1JFF B;  4GKJ B;  3CPW U;  4D7T A;  4PDM A;  3CCU V;  2QKA A;  1JCH A;  1QNM A;  2UUC B;  1WB8 A;  2XAJ A;  1AR1 B;  1Q3E A;  4AHC A;  4FVM A;  3CP1 A;  4NTW A;  4PD4 F;  4DK1 A;  4JAS A;  1K9M W;  5HFL A;  4KHP B;  2VQE B;  1A32 A;  1N36 B;  1FFT B;  3AG2 C;  2F23 A;  1Z2G A;  2RMK B;  1PL4 A;  1SQQ H;  4IYH A;  4I0X B;  4R7C A;  4IIJ A;  4LF7 O;  2W0X A;  1Y4M A;  3CWB H;  1SZT A;  2ITD C;  2XOK G;  1S76 D;  4FMT A;  5LYJ B;  1MZF A;  3OM3 B;  1Q6I A;  3JAL A;  2ODM A;  4Q6G A;  5JH7 A;  5KAI Z;  4DV3 B;  3EXA A;  1SES A;  1SQG A;  3JAR B;  4H37 A;  5B1B B;  2BSK B;  1FXV A;  1Q7Y W;  3X2Q B;  3QO8 A;  3OAA G;  4WBN A;  3ZN1 A;  2X6B A;  3JD4 A;  1Q90 D;  4DR1 B;  3OR7 C;  1H2N A;  1H2S B;  1SF9 A;  1Z5W A;  2YIB D;  1N4C A;  5CA3 A;  2N05 A;  4MVU A;  3Q4H B;  5B1N A;  1BQZ A;  1ZX3 A;  1BHA A;  5L3G A;  1NH2 D;  5FPR A;  4DV1 B;  5KX5 A;  3D8C A;  2QKS A;  1H8H G;  3SPJ A;  1BMF G;  4DV1 O;  1CPY A;  2ZDI C;  2XND G;  3SYA A;  2IJK A;  2XTA A;  3M8A A;  3CCJ V;  1K73 W;  4BAY A;  1HDJ A;  4J80 A;  4MW8 A;  3QVN A;  2IM9 A;  2YXY A;  3G71 V;  4LNU B;  1XNQ O;  4PI0 A;  1SA0 A;  5LYJ A;  1AJQ A;  3SJB C;  2CTQ A;  4JI6 O;  1R1B A;  2HJD A;  4TV9 B;  4X8A A;  1G1X B;  1KBH A;  1GKF A;  4UV9 A;  1QR8 A;  3MHH C;  3VQY A;  1OJH A;  3FB6 C;  1N32 O;  3CRM A;  2FKX A;  4IT5 A;  4CC6 A;  2ADQ B;  1NVP D;  1S5H C;  2JJ2 G;  2YIB A;  3JAM N;  4LFC O;  3H1L H;  3SJQ C;  4L8J A;  2QTS A;  3APQ A;  1PKX A;  5JJN B;  4ZOL B;  4LFC B;  3JD1 A;  4DV7 O;  2Z0A A;  2N04 A;  1AIL A;  2QWR B;  1P7G A;  4LFA O;  3EVK A;  1KEC A;  4LH7 A;  4JAV A;  3GB7 C;  3ZRV A;  2B1I A;  4K3A A;  3IC9 A;  2IJH A;  3SJA C;  3ZMS A;  2BSK A;  3OUS A;  3E8H A;  2JEU A;  2NN4 A;  4Z1M G;  2QE7 G;  3ZCC A;  1MZE A;  2UU9 B;  2HVK C;  1NT2 B;  3VQW A;  5B66 Z;  3TET A;  4JZG A;  4FLV A;  1OCR B;  2P90 A;  3ZMZ A;  1SQV H;  1X59 A;  1XNQ B;  4DR3 B;  3HKD A;  3E8G A;  2BE3 A;  1J5E O;  4GUN A;  4O2A A;  1L0N H;  2F95 B;  1J5E B;  4KXR A;  2WLI A;  4JI6 B;  4UCO A;  3WU2 Z;  1H8E G;  2CTR A;  1M57 C;  4NTY A;  4DV5 O;  4UCT A;  4X62 B;  3ZRX A;  1JX9 A;  1NJI W;  4O4J A;  4O4I A;  5DN6 G;  2XAF A;  3OMA B;  2QM7 A;  3C3S A;  1EN6 A;  3ETQ A;  2E3C A;  3JD3 A;  2EIJ C;  4IGG A;  1YCI A;  2WPD G;  2XUM A;  5ITZ A;  4FLY A;  2WLN A;  1K33 A;  1WPB A;  2JRI A;  1VP7 A;  4H33 A;  2ZE8 A;  3B8M A;  1EM1 A;  2Y69 B;  1DK1 A;  3K08 A;  1G8M A;  4LF4 O;  3KZI Z;  1H38 A;  1UJW B;  3A0R A;  3AG4 B;  5JH7 B;  5IY5 B;  1FFX B;  4QIW F;  2ZE7 A;  4TWK A;  4AIL C;  3OE7 G;  3BY6 A;  2WA3 A;  1V54 C;  3B2E E;  1PNL A;  2F66 C;  1JJ2 U;  1P84 F;  3JAW A;  2Y48 A;  3QTC A;  3LSS A;  3H1K H;  5H6R A;  3W7X A;  1T5E A;  4RQF A;  3ML0 A;  3MDS A;  1QLE B;  1QCE A;  2UXD O;  5K1X A;  5LGU A;  4OPH A;  3IAY A;  4ZIB A;  3WB2 A;  4Q20 A;  1I0H A;  3K0G A;  1I5Y A;  2VWK A;  4DV0 O;  2KG7 A;  5J2U A;  2HKO A;  2F4V O;  4FLX A;  2DYR B;  4CC5 A;  2Q5Z A;  4FLZ A;  1VQP V;  2PI5 A;  1R3K C;  1YXB A;  5BXZ A;  4YY3 B;  2UXN A;  2CE4 A;  3ZRW A;  4DO2 A;  1YEW A;  1YVW A;  4YY3 O;  4I9Q A;  4B3R B;  1TUB B;  1FKA O;  1PP9 H;  5J2U B;  4J10 A;  4LF4 B;  5GTI Z;  5EK0 A;  1NVP B;  1R6T A;  2R72 A;  4LF8 B;  4OX9 O;  1DF4 A;  3AG3 B;  1XMO O;  4X1K B;  3OGC C;  3N2G A;  1VQ7 V;  1XNR B;  4HBN A;  1KKD A;  1EN5 A;  3H1H H;  4FFK A;  3HKE B;  1ZL8 B;  2IU0 A;  3VQX A;  1WN7 A;  5DM6 V;  2HG5 C;  4D6T H;  3I5D A;  4P9O A;  3L71 H;  3AK2 A;  3T4Z A;  1SET A;  2JDI G;  4UB8 Z;  2RQ6 A;  2OWO A;  2ADP A;  1SQP H;  1ZTE A;  4LF6 O;  4EFB A;  3BRC A;  3UO2 A;  2E76 B;  4CS2 A;  1UFI A;  3I55 V;  2CTW A;  4BR6 A;  4CS4 A;  3IFX A;  2JVD A;  3GWK C;  1BCC H;  3E8F A;  1JA8 A;  5B3S C;  4DR7 O;  2ATK C;  2XT9 A;  1TUB A;  1NS1 A;  4U7N A;  3W7T A;  1TA8 A;  2A7W A;  2JS3 A;  1KKC A;  5D5Q A;  2JGD B;  4B3M B;  4YJ2 B;  4ZI7 B;  5CB4 A;  3MHS C;  3BVO A;  5L3E A;  3ZN0 A;  5CA0 B;  1JR9 A;  1O9G A;  1KUQ A;  1IDS A;  3LSQ A;  1GH6 A;  5LL6 Y;  4DYL A;  2P4K A;  5CA1 A;  1PL0 A;  3OD4 A;  4H0L B;  4XDL A;  4FLW A;  1K5S A;  5BR8 O;  1N8R W;  1E79 G;  3OTO B;  2ZE6 A;  3T4D A;  3H01 A;  3MAQ A;  1YHQ V;  1NU1 H;  1XIL A;  4U3F H;  1OV9 A;  1XBL A;  3RW0 A;  3OTO O;  4XBF A;  1WP7 A;  4B3S B;  4CH5 A;  1E1R G;  2BTQ A;  4MT8 A;  3ZMV A;  3SYC A;  1ZL8 A;  4GYC B;  2BOC C;  1KYO F;  1RP3 B;  3L9D A;  5JVD A;  4YHH O;  2O57 A;  3TK1 A;  2Q7H A;  5C8Y B;  1GMG A;  1OHH G;  2L35 A;  5A9G A;  1NBM G;  4YHH B;  1AI5 A;  3DC5 A;  3D3Q A;  5LP6 A;  2D3O W;  1PV0 A;  2DYS C;  1V9P A;  3HKB B;  2HVJ C;  2DW4 A;  3CRR A;  3CX5 F;  3L72 H;  1YTF B;  3TGU H;  4I50 A;  1S0V A;  2F1M A;  2EBO A;  3WG7 C;  4FFB B;  2F43 G;  5IJ0 A;  2YXH A;  1EFR G;  3CC2 V;  1VQO V;  2HLD G;  5LGT A;  4YJ3 B;  4X64 B;  3O65 A;  4B3T O;  3B4S A;  5FPO A;  4UVA A;  4X64 O;  4F6R B;  2QA4 V;  2Q69 A;  4X1I A;  3NXS A;  4KP4 A;  3S3X A;  2R70 A;  3BAA A;  3ZED A;  4RAI A;  4FM0 A;  2YUA A;  3CXH F;  4KHP O;  1XL4 A;  2Y69 C;  2QWQ B;  1VQ5 V;  5BZB A;  2A9H A;  3K3W A;  1B04 A;  5IE9 A;  1IBK B;  5LA6 B;  1Z5V A;  1CP9 A;  4CS3 A;  3H9V A;  2A79 B;  5KHI A;  4N23 A;  1S72 V;  3AG3 C;  2ILM A;  5KMG A;  4DR2 O;  1TVK B;  4IHJ B;  1S3J A;  4L87 A;  4RUE A;  3CCS V;  3AG7 A;  4X65 O;  1K7D A;  1DLB A;  1GRJ A;  1N0J A;  2UXC O;  4I9W A;  2YI8 A;  1L8D A;  3RGB A;  4BW5 A;  1OCZ B;  5LHG A;  4WFE A;  1XMQ O;  1H2G A;  4I55 A;  1KP3 A;  2B5U A;  2CDY A;  2P22 C;  2E74 B;  3A8T A;  4JI8 B;  2CGN A;  2QWO B;  2UUC O;  1V55 B;  3UCS C;  1US6 A;  1Q86 W;  4I50 B;  4JI8 O;  1VQ4 V;  4GKK O;  1FPO A;  2ZNJ A;  5H6Q A;  4DR5 O;  1QHT A;  1N0N A;  5JWP A;  3ZHR A;  2UU9 O;  4JYC A;  2AXT Z;  1SC5 B;  2CH7 A;  1EZV H;  5JCO A;  2QWN B;  3CYO A;  4JGS A;  3N2K A;  5JJE B;  2IJI A;  4UVB A;  2IBZ H;  1O9H A;  5CBF A;  3APO A;  3KCX A;  5EC2 C;  1M1K W;  3ABL B;  1TVK A;  4IHJ A;  5H2F Z;  4QNH B;  4X88 A;  1QLN A;  3U11 A;  1JPX A;  4DV3 O;  2OCC C;  3AEI A;  1Y74 B;  4MVQ A;  5EZY B;  1H2M A;  4JAA A;  3RVZ A;  1S77 D;  4JI5 B;  4DR6 B;  4JI7 O;  3J80 N;  2VQF O;  4LFA B;  5GTH Z;  5LA6 A;  3K57 A;  3E2E A;  5JQG B;  2EIL C;  3ZMU A;  2W6J G;  5FL7 G;  2FTK A;  2NR5 A;  1VQ8 V;  3IC7 A;  4GKK B;  1OCZ C;  4HNA A;  5FNV A;  3LNN A;  3K9A A;  2Y4U A;  4DR3 O;  2BCC H;  2Q67 A;  3JAS B;  3P3N A;  3BPZ A;  4I5S A;  4K8X A;  5B1A C;  2ZM6 B;  5B5E Z;  1BZK A;  1RM1 C;  1GO3 F;  4OPA A;  2LFS A;  1AJN A;  1V54 B;  2H8P C;  1J95 A;  4NXM O;  3RWR D;  1CXZ B;  1E1Q G;  3OMI B;  1RSO A;  1N33 B;  3G4S V;  3K5M A;  1AP5 A;  1EN4 A;  4NXM B;  1AJP A;  3ZHQ A;  3E86 A;  3H1I H;  3HKB A;  4FPP A;  1Q81 W;  4BW9 A;  4EKW A;  4CH6 A;  1Y67 A;  2WLL A;  3CS5 A;  4PA4 A;  4BIU A;  4DR4 B;  4TQD A;  1Q5O A;  2IH3 C;  3SYP A;  2X0L A;  1SRY A;  3SPI A;  4LF5 O;  2R9A A;  4J7J A;  2ZR2 A;  1GTO A;  2L6L A;  4G28 B;  1Q8I A;  5EIB D;  5LMU B;  1YI2 V;  3UT5 A;  3KCY A;  4X66 O;  1DTO A;  4O4H A;  1DGS A;  2Q7E A;  3ZRW B;  5L3C A;  1VQL V;  2XAS A;  2YEV A;  3G67 A;  4N21 A;  3T1H O;  4DV6 B;  3HKE A;  3OFN G;  1HNX B;  4ZBM A;  4NYK A;  2Q0A A;  1B6Q A;  4F6E A;  3B77 A;  4UVC A;  2OTJ V;  1YJW V;  4X9Q A;  1M56 B;  2ZXW C;  1JQ0 A;  4UCS A;  2KKW A;  5DED A;  4UV8 A;  5DEC A;  3K06 A;  4F4L A;  3RN4 A;  5EYP B;  5KUM A;  3SYO A;  1YIJ V;  3OW2 U;  3FX7 A;  2Q7G A;  1JMK C;  5IJ9 A;  1R3L C;  1MOF A;  1JOY A;  4JI1 B;  1NQT A;  3W7U A;  4NTX A;  1TUE B;  5C93 A;  3F7V C;  3JAW B;  2Q73 A;  2FML A;  1XL6 A;  4XDJ A;  5KHK A;  2E5L O;  1P4R A;  3ABT A;  1SKV A;  5J2T B;  2VRZ A;  3RYI B;  3WB1 A;  3UQ8 A;  1HW7 A;  2F93 B;  1URF A;  5BMV A;  1K97 A;  2B9Z A;  2AW9 A;  2QDO A;  5B3S B;  5CBH A;  1W0J G;  1VQM V;  3RYH A;  4PV1 B;  1BS3 A;  3T1H B;  3JAS A;  1ARO P;  3L75 H;  1VQK V;  1HNX O;  3HPL C;  4TOI A;  2PYL A;  3DSQ A;  2E75 B;  3ABM B;  3ABK B;  1XOU A;  3GWO A;  3FB5 C;  3QF7 A;  1FFX A;  3LUT B;  1YTF D;  2X7R B;  1KU9 A;  4MVM A;  4FZ0 A;  3P32 A;  1VIB A;  2PUS A;  1KQS U;  4ZOL A;  3K58 A;  1PNK A;  3ZHT A;  3UT5 B;  4DV0 B;  3QNE A;  2OYQ A;  2GUZ B;  1M56 C;  3CB2 A;  1D5A A;  1Y6X A;  3BAB A;  2DQ0 A;  2N74 A;  3S3W A;  1QQC A;  1LUW A;  2HFE C;  3CC4 V;  4DR7 B;  3DTU B;  2E5L B;  5KAF Z;  3SR2 C;  2EIK C;  4Z2W A;  1AP6 A;  1Y74 A;  2EIN C;  4QPK A;  2BTO A;  4DUY O;  3DGE A;  3DXR A;  3CME V;  5JQG A;  4NXN O;  2GSM B;  1R3I C;  3FAV B;  3FB7 C;  2RNB A;  3L73 H;  2WLM A;  3CCM V;  4JI0 B;  1PPJ H;  3A0B Z;  4J11 A;  3CHX A;  4UB6 Z;  4PJ0 Z;  2GV9 A;  4DV4 O;  5IYZ B;  3FFQ A;  3K59 A;  4QGP A;  2RN9 A;  1YJ9 V;  4DV2 O;  4DV4 B;  5KUK A;  3RYF A;  5HFM A;  4CH3 A;  2Q68 A;  4GKJ O;  4LC1 A;  1YIT V;  3CC7 V;  2Y0I A;  4LWS B;  5EBL C;  2K9P A;  2FB5 A;  2DYR C;  2P06 A;  4TV9 A;  3OUF A;  2WLK A;  3HR0 A;  2HP8 A;  4RUF A;  3CCE V;  2JEX A;  1UPG A;  1RSO B;  1L0L H;  5IY5 C;  2CUG A;  2WLI B;  3FYI B;  1VQN V;  1H2K A;  4LF9 O;  3L70 H;  1D5N A;  1TAE A;  4BIZ A;  4GLX A;  1FS0 G;  1GN2 A;  2UUB B;  4PDV A;  1WNS A;  3IJ4 A;  3M99 B;  4K8Z A;  1Q6U A;  1F4M A;  3VOU A;  3J7A U;  5F2V O;  4G2K A;  4WCE V;  3UM7 A;  2MW2 B;  2GDS A;  3BHP A;  2HHH B;  4I55 B;  4GX0 A;  3FB8 C;  2WLJ A;  4X20 A;  4B3M O;  2VQF B;  3AG1 C;  4E4E A;  3THO A;  3ZHS A;  4RWU A;  4DV2 B;  3MD0 A;  2OCH A;  1WA8 B;  1IX9 A;  3P30 A;  1YF2 A;  4IL6 Z;  4C7U A;  3RYF B;  1W0K G;  5A2Q N;  1AR5 A;  3A0H Z;  1K8A W;  1IXM A;  1XI1 A;  5K1P A;  5BR8 B;  4LWS A;  2ZIM A;  1FAF A;  2LP7 A;  5AG2 A;  4YJ3 A;  3CEI A;  3L74 H;  1H2L A;  1I5X A;  3K9S A;  4I7Z B;  2WWW A;  2W0F C;  4LFB O;  4F6R A;  5IJ0 B;  4B3S O;  4LF9 B;  3T1Y O;  3QO5 A;  4QPJ A;  1COW G;  3SDL A;  1XHX A;  2JK5 C;  4WBN B;  1NR1 A;  1IBM O;  4X62 O;  3ASO C;  4J7K A;  2QEX V;  1SQX H;  5J2T A;  3RVY A;  1N32 B;  3EHB B;  3ABK C;  3KKY A;  5CMU A;  3DC6 A;  1XEQ A;  4NR1 A;  3RT3 C;  5KMG B;  2CK3 G;  3JAK A;  2HHH O;  3A2F A;  2OTL V;  2EIM B;  3TJT A;  3JAT B;  1KMI Z;  4LF5 B;  5EBW C;  5LHH A;  3N27 A;  1GK9 A;  4J41 A;  3ZMT A;  4JI7 B;  5EZY A;  3KG2 A;  5KA6 A;  4WFB V;  4TUY B;  2Q4P A;  1R3J C;  3AG2 B;  4GT1 A;  1VQ9 V;  4DXW A;  1SZX A;  1SS3 A;  1P7B A;  4J9Y B;  1RPR A; 
#chains in the Genus database with same CATH homology
 3OUS A;  2IU3 A;  2JEU A;  3E8H A;  4Z1M G;  2IJJ A;  1THZ A;  2QE7 G;  4MTF A;  4QNH B;  3D36 A;  4X88 A;  3ZCC A;  1QLN A;  4WFG A;  1JPX A;  2HVK C;  1M90 W;  2OCC C;  3AEI A;  3TET A;  1OCR B;  2XAQ A;  1JVM A;  2YSU B;  3JCZ A;  4MVQ A;  1M57 B;  4KUM A;  1Y66 A;  2P90 A;  5E1A C;  3ZMZ A;  2NLJ C;  3E8G A;  3RVZ A;  1OCC B;  4HAM A;  4R8C A;  1S77 D;  1BHB A;  3R65 A;  1QVF U;  1GM7 A;  2AHZ A;  4TSF G;  2K1E A;  3STL C;  3ABM C;  3JD2 A;  2WLI A;  4PDR A;  3K0D A;  1H8E G;  1MSW D;  3E2E A;  2EIL C;  3ZMU A;  2OT5 A;  3OEE G;  1M57 C;  2W6J G;  5FL7 G;  1EZJ A;  2FTK A;  4X89 A;  3ZRX A;  1VQ8 V;  1JX9 A;  1NJI W;  5B1A B;  2X6A A;  3IC7 A;  4GCZ A;  1OCZ C;  5DN6 G;  2ITC C;  4PA7 A;  2XAF A;  3RBZ A;  3OMA B;  2QM7 A;  3LDC A;  5IDJ A;  3CCV V;  3HB3 B;  3K9A A;  3SYQ A;  4QJF B;  1FXK C;  3JD3 A;  2EIJ C;  2IH1 C;  4MVZ A;  3UKM A;  4RQE A;  2Q67 A;  4ASU G;  2WPD G;  4I5S A;  1NH2 B;  2UXX A;  4GX2 A;  5B1A C;  4JPR A;  1HWY A;  2B1G A;  2WLN A;  4TT3 G;  1K33 A;  1SER A;  1RM1 C;  1GO3 F;  4H33 A;  4MW3 A;  2LFS A;  3B8M A;  3WG7 B;  2EJR A;  1AJN A;  2Y69 B;  1V54 B;  3X2Q C;  2H8P C;  1J95 A;  3K08 A;  2MK3 A;  1AI4 A;  1G8M A;  4PDL A;  1E1Q G;  3BEH A;  3OMI B;  1H38 A;  3G4S V;  3STZ C;  1UJW B;  3A0R A;  3AG4 B;  5IY5 B;  1ORQ C;  1AJP A;  2ZR3 A;  4QIW F;  1G4Y B;  2DYS B;  3E86 A;  1K4D C;  4FPP A;  4TWK A;  1Q81 W;  4EKW A;  3OE7 G;  1K5Q A;  3BY6 A;  4G27 B;  1V54 C;  3E89 A;  1PNL A;  2ZD9 A;  1JJ2 U;  2WLL A;  3SPC A;  2Y48 A;  4PA4 A;  4LP8 A;  3LSS A;  5H6R A;  4BIU A;  1EBO A;  1YSC A;  2EZP A;  3W7X A;  4WFH A;  2IH3 C;  4JAU A;  3SYP A;  1OCO C;  4RQF A;  2X0L A;  1F23 A;  1QBZ A;  3ML0 A;  5CN0 A;  1SRY A;  2Z5U A;  3SPI A;  1QLE B;  1WPX A;  1K3E A;  1QCE A;  4CBC A;  2AHY A;  2ZR2 A;  1GTO A;  4G28 B;  4HZ3 A;  1BL8 A;  1YI2 V;  5LGU A;  3AG1 B;  4FK5 C;  4PA6 A;  1DTO A;  4Q20 A;  3K0G A;  1I5Y A;  2EIN B;  3ZRW B;  1Q82 W;  3ZIA G;  1OCR C;  5LBQ A;  5L3C A;  1VQL V;  4MS2 A;  1MAB G;  2EIK B;  2XAS A;  2YEV A;  4N21 A;  4ZKI A;  1W2B U;  2HKO A;  3B8N A;  2ZQM A;  4JTC B;  4R6Z A;  2DYR B;  3OFN G;  1ZWI C;  4ZBM A;  1VQP V;  1B6Q A;  2YEV B;  1R3K C;  2PI5 A;  2V7Q G;  3B77 A;  1CEZ A;  2UXN A;  4UVC A;  5L3B A;  2C2A A;  1V55 C;  2OTJ V;  1YJW V;  1M56 B;  3AG4 C;  2ZXW C;  4P30 A;  1JQ0 A;  3ZRW A;  4MSW C;  4DO2 A;  2R9R B;  2KB1 A;  4UV8 A;  3K06 A;  4F4L A;  3JYC A;  4FIP C;  2JIZ G;  4OXS A;  5KUM A;  3SYO A;  1YIJ V;  2P7T C;  3OW2 U;  2JJ1 G;  5EK0 A;  4JTD B;  1NVP B;  1ROP A;  2EIL B;  3IGA C;  1R3L C;  1MOF A;  3ASN C;  1DF4 A;  2HJF C;  3AG3 B;  1JOY A;  4MTX A;  1NQT A;  2GHY A;  2X6C A;  3OGC C;  3ETE A;  3W7U A;  1TUE B;  5C93 A;  1OCC C;  3F7V C;  1VQ7 V;  3FYE B;  1KKD A;  4PEL A;  1XL6 A;  4XDJ A;  1FXK B;  3ZJZ A;  1R73 A;  2IU0 A;  5DM6 V;  2HG5 C;  4LBE C;  4RO2 A;  1P4R A;  3ABT A;  4R50 A;  4MVS A;  4QE7 A;  3CCR V;  2XAG A;  4WFA V;  5CBG A;  3T2M A;  2H94 A;  4P9O A;  3ABL C;  4CZZ A;  2Z3Y A;  3T4Z A;  1SET A;  4J9Z B;  1NR7 A;  1K97 A;  2JDI G;  5B3S B;  1W0J G;  4PA3 A;  5CBH A;  5LHI A;  1VQM V;  2R9I A;  2EZO A;  4LCU C;  2OCC B;  2ZDI A;  5H9C A;  4WFF A;  5LGN A;  2V1D A;  1ARO P;  3I55 V;  1VQK V;  2HR3 A;  2WLL B;  3E8B A;  3HPL C;  3IFX A;  5B1B C;  5B1O A;  3K79 A;  3E8F A;  1R6K A;  1NKD A;  5B3S C;  2PI4 A;  4JTA B;  3ABM B;  3ABK B;  4FJC C;  3GWO A;  2DWD C;  3FB5 C;  3LDE A;  2ATK C;  3LUT B;  3SPH A;  3G6E V;  4UXN A;  2X7R B;  1YTF D;  1PNM A;  1GM8 A;  3K04 A;  1R6N A;  4MVM A;  3CD6 V;  4U7N A;  3P32 A;  3W7T A;  3LDD A;  5EC1 C;  2QTO A;  1KQS U;  4PA9 A;  5EBM C;  5IYB O;  1PNK A;  1GM9 A;  1K34 A;  3F7Y C;  3QNE A;  1K4C C;  3MHS C;  4HYO A;  5L3E A;  4WF9 V;  3ZN0 A;  2EIJ B;  1M56 C;  3LSQ A;  2M7W A;  1F4N A;  1AI7 A;  2DQ0 A;  3E35 A;  3E83 A;  2HFE C;  1PL0 A;  3CC4 V;  3WFV A;  3DTU B;  1AI6 A;  4XDL A;  2EIK C;  3ZRS A;  1YJN V;  1K5S A;  3EFF K;  1N8R W;  4U7O A;  5L3D A;  2EIN C;  1E79 G;  3T4D A;  3H01 A;  4QPK A;  3ASO B;  1YHQ V;  2EIM C;  2LFR A;  3DGE A;  3CME V;  3LNM B;  3RW0 A;  2GSM B;  4XBF A;  1PD3 A;  1R3I C;  2P67 A;  2P6J A;  2ZXW B;  3FB7 C;  1FXH A;  3CCL V;  1E1R G;  1QLE C;  3K03 A;  4MT8 A;  1KC8 W;  2WLM A;  3ZMV A;  3CCM V;  3SYC A;  2BOC C;  4P2Z A;  3TK1 A;  1YJ9 V;  1GMG A;  1OHH G;  4MTG A;  1NBM G;  5KUK A;  3CPW U;  4PDM A;  5J9P C;  3CCU V;  2WSS G;  3QO7 A;  1JCH A;  1AI5 A;  4GX1 A;  2XAJ A;  5HFM A;  4MVR A;  2Q68 A;  4LC1 A;  5KA5 A;  1YIT V;  1RM1 B;  3CC7 V;  2D3O W;  1AR1 B;  2DYS C;  5EBL C;  3CP1 A;  2HVJ C;  2DW4 A;  2DYR C;  1OZ0 A;  4JAS A;  3OMN B;  1K9M W;  3OUF A;  2WLK A;  4RUF A;  3CCQ V;  3F5W C;  1YTF B;  5HFL A;  3CCE V;  1KD1 W;  1S0V A;  2JEX A;  1FFT B;  2EBO A;  3WG7 C;  3AG2 C;  1RPO A;  2F43 G;  3ABU A;  5IY5 C;  1QR9 A;  1MG1 A;  1OCO B;  2WLI B;  3FYI B;  3JD0 A;  4UUJ C;  1VQN V;  4JYB A;  4E2L A;  1EFR G;  3CC2 V;  3CMA V;  4R7C A;  1VQO V;  2HLD G;  4BIZ A;  3I56 V;  5LGT A;  1Y4M A;  1M9N A;  4XDK A;  1K92 A;  1FS0 G;  1SZT A;  3ETD A;  2ITD C;  2XOK G;  1S76 D;  4UVA A;  3T1C A;  4FMT A;  4PDV A;  3M99 B;  3OM3 B;  2QA4 V;  5GW7 A;  2Q69 A;  1F4M A;  3NXS A;  3VOU A;  1SES A;  4KP4 A;  4G2K A;  4H37 A;  5B1B B;  4RAI A;  1FXV A;  1Q7Y W;  3X2Q B;  3QO8 A;  3W7W A;  4WCE V;  1XL4 A;  2Y69 C;  3OAA G;  3UM7 A;  3TCU A;  1VQ5 V;  4KFM A;  1L1F A;  3ZN1 A;  5BZB A;  2X6B A;  3JD4 A;  2A9H A;  3SPG A;  3K3W A;  4GX0 A;  3OR7 C;  3FB8 C;  2WLJ A;  1CP9 A;  2WLH A;  3AG1 C;  2A79 B;  2QM8 A;  4N23 A;  1S72 V;  5CA3 A;  4MVU A;  1QVG U;  2IW5 A;  3AG3 C;  4MTO A;  2A0L A;  2XAH A;  5B1N A;  3MD0 A;  1BHA A;  1WLE A;  5L3G A;  1NH2 D;  2QKS A;  1F51 A;  1S3J A;  3P30 A;  4L87 A;  1H8H G;  4MVO A;  3SPJ A;  4RUE A;  1W0K G;  2W6I G;  1BMF G;  3CCS V;  1CPY A;  2WAM A;  4YXW G;  1K8A W;  2ZDI C;  1IXM A;  2XND G;  2IJK A;  1K7D A;  3SYA A;  1DLB A;  3CCJ V;  1K73 W;  4BAY A;  4MW8 A;  4I9W A;  2LP7 A;  1ENV A;  5L3F A;  3PJS K;  3G71 V;  1I5X A;  4BW5 A;  2WWW A;  1OCZ B;  5LHG A;  2W0F C;  4WFE A;  1AJQ A;  1H2G A;  3QO5 A;  4QPJ A;  1VQ6 V;  1COW G;  4JF3 A;  2JK5 C;  1KP3 A;  4P9P A;  4X8A A;  2B5U A;  1NR1 A;  3W7S A;  1GKF A;  4UV9 A;  1QR8 A;  3MHH C;  3CXC U;  3FB6 C;  3ASO C;  3OR6 C;  2QEX V;  1V55 B;  1Q86 W;  1VQ4 V;  3RVY A;  5H6Q A;  3EHB B;  2BOB C;  2NNU A;  3ABK C;  1S5H C;  1NVP D;  5CMU A;  2JJ2 G;  3VBB A;  1FXK A;  4JYC A;  2DWE C;  2DQ3 A;  2CK3 G;  3SJQ C;  2OTL V;  2EIM B;  3OEH G;  1PKX A;  4QE9 A;  3CYO A;  4JGS A;  5EBW C;  3JD1 A;  5LHH A;  5IYD O;  2IJI A;  3ETG A;  1GK9 A;  2Q6A A;  4UVB A;  1DF5 A;  3ZMT A;  3D3I A;  3KG2 A;  5KA6 A;  4WFB V;  5IYC O;  3FKS G;  1KEC A;  1R3J C;  5CBF A;  1LNQ A;  3AG2 B;  3ASN B;  4GT1 A;  1VQ9 V;  4JAV A;  1KP2 A;  3GB7 C;  2B1I A;  4GX5 A;  5EC2 C;  3ZRV A;  4DXW A;  1M1K W;  1P7B A;  2IJH A;  3ABL B;  3ZMS A;  4J9Y B;  1RPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...