3CCRV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccrV00
1YITV 1VQPV 1YI2V 1VQ8V 1VQ6V 3CMEV 1JJ2U 3G4SV 1K9MW 2D3OW 1S72V 1YHQV 3I56V 4WF9V 1K73W 3G71V 1VQLV 3CCQV 1KC8W 2QEXV 3CCSV 1VQOV 3CCRV 4WCEV 3I55V 1M1KW 1VQNV 4WFAV 1YJWV 1VQ5V 1W2BU 1R73A 2OTLV 1KQSU 3CCVV 1QVFU 3OW2U 1N8RW 1Q81W 3CCEV 1VQMV 1Q86W 1Q82W 2OTJV 2QA4V 1VQ4V 3CCUV 1KD1W 3G6EV 3CXCU 3CCJV 1Q7YW 3CC2V 1VQ7V 3CCLV 1YJNV 1NJIW 1K8AW 5DM6V 3CC7V 4WFBV 1YIJV 3CMAV 1QVGU 3CD6V 1VQ9V 1VQKV 1YJ9V 1M90W 3CCMV 3CPWU 3CC4V
chains in the Genus database with same CATH superfamily
1WPBA 1N32B 3IJ4A 2UUCO 5LA6A 4AHCA 2QM7A 1HW7A 5IE9A 3GWOA 3O9OA 4JI4B 2P6JA 1PNLA 2EZPA 2JVDA 2CTRA 4AQYB 2JJ2G 1VMGA 5IJ9B 1R3KC 3KKYA 1HNWO 2Q8VA 4HNAB 3ABKC 2ZE6A 5LXTA 1N36B 1RPOA 2UXNA 4FM2A 2QJ1A 3E2EA 2JS3A 2LW1A 3D3QA 4NTYA 4UCUA 5EC2C 5KHJA 4X66O 4JI7B 1P7GA 3OEEG 1US6A 3ZHRA 4O2BA 1FFXA 3LSQA 3ZRSA 1H2SB 1MNGA 3UM7A 4KFMA 3ZRXA 3A0BZ 4O4IB 4DV6B 3AG7A 2ZE5A 4FVMA 4GZRB 2WLIA 2ADPA 5JWPA 4I50A 4UVAA 2GBOA 5DEDA 1MSDA 3HKEB 4JI8B 1QLNA 4ICGA 4WCEV 2QTSA 2P4KA 2XHBA 2PGGA 4FFBA 2RNBA 4I9WA 1Q3EA 4FLXA 1K97A 2WLHA 1QHTA 1PM9A 1Y74B 1RPRA 4TUYA 1YF2A 4JYCA 1ZLZA 1FXKA 4FZ0A 2UXCB 2R72A 1M4UA 1E1QG 4TV9B 2R9RB 4CBCA 3ZRVA 2B5UA 2BE3A 2BSKA 2HP8A 3N2KB 1COWG 3E89A 1NH2B 4WFBV 4B3TO 2RJZA 5EZYB 3LDDA 4X20B 1XDCA 4JTDB 3BA8A 4KHPO 4FJCC 2CH7A 3ETQA 1Q5OA 5DN6G 3ASOB 1OV9A 4MTOA 3VQVA 1L0NH 1PV0A 2G38A 2QSAA 4JPRA 3M8AA 2L35A 4GKJO 3ML0A 4J7JA 2P06A 2ITDC 5IT9N 3CRCA 2F95B 2WLKA 4DR3B 2ZM6O 4R6ZA 3AEIA 2F93B 4DV3O 1J5EB 1FS0G 4NXNB 3STZC 4JI0B 1NVPD 4X65B 1M93A 3RYHB 3BFRA 3SYPA 4DR1B 1NR1A 2EIKB 2QWPB 2HHHB 3FB7C 2PTMA 1Q81W 1AROP 1DTOA 2ATKC 4BIUA 2YEVA 1IBKB 1WP7A 1R6NA 1N32O 3ASOC 3OR6C 1GM9A 3JAWB 5BR8O 1GM7A 1F7YA 1XNQO 4UFZA 4JI4O 3JD1A 2OYQA 3GVMA 2E76B 1Q82W 3ZRWA 2V1DA 4EKWA 2JDIG 4RQFA 1NTZH 3F5TA 1K33A 3KCYA 4JI5O 1N36O 2E75B 1LUVA 2FKXA 4BAYA 3CP1A 2WWWA 4LH6A 1GMGA 1XI1A 1L8DA 3ZIAG 1XUQA 2CTQA 1JFFB 3CCEV 1V9PA 1F23A 4DV2B 1NZ6A 4FLUA 2P5OA 4H33A 3OGCC 4XDLA 4O4LA 3SYQA 1E1RG 1NQTA 4PDMA 5LP6A 3JYCA 1GN6A 2F43G 4WBNA 4JI6O 2UXBB 3E8HA 1NI8A 4B08A 1O9HA 2UXCO 1PL4A 5LA6B 1R3LC 1K9MW 1H38A 2Z5UA 2IJKA 3LDCA 2GUZA 1NTKH 2YXYA 5J2UA 4IL6Z 1G4YB 4K8ZA 3CSXA 4Q20A 1M57B 3B77A 2P4VA 2VWJA 1LR1A 1CPYA 1Q7YW 3ETGA 1YIJV 2Q9LA 5IYDO 2XAJA 1GO3F 4DO2A 1XNRO 2IU0A 5JCOA 2YXLA 1B3QA 1OZ0A 5AG2A 1XQ8A 2EJ7A 3WB2A 3L73H 1Q86W 4B7KA 4R7CA 3UO2A 2GTSA 4EEQA 3CX5F 3ZHUA 1M57C 1EN6A 4DR3O 4QE9A 2WLIB 3AG1B 1J5EO 3K9SA 4NXNO 4JI0O 4I55A 5EYPA 3APOA 5GONA 4D7SA 4HYOA 1R3IC 1XREA 4I0XA 1ZAUA 2OCCC 4GKKB 1IBKO 4OXSA 4RO2A 1Z5WA 2ADQB 4FFBB 1TVKA 4CC6A 5IYBO 3X2QB 2AXTZ 1V54B 3TXQA 4BIOA 2HVJC 5GTIZ 4TUYB 4DV4B 3A0RA 1FXKB 4RUEA 2N04A 3BRCA 4YHHO 1N34O 2GHYA 1RP3B 3AG1C 2EX3A 3ZHTA 4B3MB 4TQDA 1W59A 2VQFB 1Z5VA 2W0XA 2RCVA 3WB1A 2BSKB 2UXDB 5LOVA 3BY6A 2AZ0A 2HKOA 5KHGA 2YXHA 1FXHA 1B6QA 1U97A 3WG7B 4O4JA 2FTKA 4ZHQA 4NB5A 3K08A 4DUZO 1YJNV 1BE3H 1NBMG 2HJDA 5BY1A 2P67A 1QQCA 4I4TB 3X2QC 1S5HC 1M56C 4GUNA 2YUAA 3CCSV 1Y67A 1FXKC 5JQGA 4DV5B 2CDYA 1BS3A 4J7ZA 3OAAG 4DV2O 4BWAA 4DRXA 3SPGA 4H37A 3K5LA 2ODMA 1MOFA 2YI9A 3WG7C 1AJNA 2XAQA 1OCOB 3DTUB 3JASA 1H2LA 2IBZH 3FKSG 2VQEB 3UQ8A 2L6LA 2BTOA 1XMOB 3AG2B 3ETEA 5IDJA 2UXBO 4L87A 4AI8A 2YEVB 5LGUA 3JAMN 1HNXO 4ZOLA 5JVDA 1KU9A 3H1HH 4JI2B 1ZX3A 5H9CA 4UCTA 2EZOA 3T1HB 1L1FA 1OCOC 1P84F 1ZL8B 2FMLA 5KUKA 1LUWA 2OIGA 4JI1B 1NVPB 4LNUB 2DWDC 4GX2A 3AG2C 4FIPC 3OM3B 4B3SB 2E5LO 5HFMA 1I5XA 1HNWB 4BW5A 1OCRB 5H6QA 4U7OA 1GN2A 4MVMA 4IIJB 2ILMA 3JD3A 4U3FH 1JPXA 1NKDA 1VQNV 1VEWA 3SJBC 3RBZA 2H8PC 1QVFU 4BIZA 1K7DA 5CBGA 2GSMB 4X66B 4JV5B 5GW7A 3ZCCA 4UVBA 2R9IA 4JTAB 1QBZA 5A2QN 4PA9A 5J9PC 4X1KA 4ASUG 3IC7A 1GN4A 2JGDA 1KC8W 2GV9A 4GKKO 3TK1A 3QNEA 1OCRC 4OPAA 1R73A 2ZE7A 3JALA 3A2FA 4WBNB 3E8BA 4TOIA 4W4LA 1FPOA 2LGWA 2Z0AA 1S3JA 2WLJA 1P4RA 4F6RB 4DV4O 3AK3A 4UXNA 3OR7C 4PI2A 2GUZB 2VQFO 2ZNJA 1FAFA 1HWYA 1XL4A 4O4HA 4P9PA 3UCSC 3JARA 1AJPA 2YIDA 1K3EA 3H1KH 4X1IA 1YEWA 1KB9F 3BHPA 2QGNA 4CS4A 1V55B 2CAZC 5CA3A 4B3TB 1QR8A 1M9NA 2CTWA 2ZCEA 3T4DA 3K5OA 4ZIBA 2YDEA 3N27A 1SQPH 4KHPB 2WSSG 1PKXA 5EIBD 2QR4A 1KKDA 3K5NA 1I7FA 1NT2B 4PI0A 3CC7V 4MW8A 4G27B 4PELA 1N33O 3JATB 2QWNB 1YITV 4NXMO 4I55B 2IM9A 4GKJB 5EYPB 2VQEO 2DOSA 5KMGA 1I94O 3QVNA 4I0XB 2M6YA 4DV3B 4LF6O 1WP8A 1VQ5V 3C3TA 3OT7A 1TVKB 1KECA 3FX7A 1TUBA 1HP8A 5ITZA 3OFNG 5GTHZ 2DE0X 3U10A 2B1GA 2DYSB 3T1HO 4MVUA 2PI4A 3K04A 5BR8B 4PDRA 5LOVB 4JI1O 1XNQB 1QCEA 3AG3B 4O4JB 4JI3B 3GB7C 4BW9A 5IJ0B 1K34A 4D7TA 5A9GA 4B3SO 2YIAA 1NS1A 1FFTB 3K79A 1VF6C 3UT5B 2MK3A 4JI5B 1Q6IA 2CUGA 4LF4O 2DYSC 1SQQH 3E86A 1K92A 2FL4A 2BOBC 3E22A 4JV5O 4F6EA 1OCCB 4UCRA 1D5AA 1EZVH 1R6TA 3OD4A 4DRXB 2WLNA 2JGUA 2DJVA 2ZT9B 4CH4A 3AG3C 2IJIA 3RN4A 1SQFA 4LFCO 1GK9A 5E79Z 1Q6UA 3CXHF 3G4SV 1EFRG 3ICXA 4WF9V 1ORQC 5B3SB 4KUMA 4I9QA 4LF5O 1W0JG 3HKCB 3ZJZA 2ZDIC 3KCXA 2UUBB 1F4MA 5H5NA 3B8MA 3P30A 3CJHA 4JI6B 2XT9A 4X1YA 4PA4A 4F4LA 5LHHA 1RSOA 3CCQV 5LMUB 4MW3A 1NU1H 2FB5A 5CBFA 3RYIA 2HVKC 3TJTA 3HPLC 3SJQC 3OMNB 5B3SC 1T5EA 4QNHB 2QA4V 3W7XA 4MTXA 5LMNB 4P2ZA 1YVWA 4CC5A 2P90A 3DGEA 3CRMA 4HBNA 4N23A 1CP9A 1LNQA 1X4TA 2DN9A 3RT3C 3PJSK 1KMIZ 1XNRB 4WFHA 4IHJA 4YJ2A 4NTWA 3JSNA 3DSQA 3FAVA 3FFQA 1VQMV 4DYLA 1RFYA 4YXWG 2KG7A 2R70A 4X1KB 3L75H 1F51A 2HG5C 4XDKA 1SF9A 1B06A 1K4CC 4Z1MG 1YXBA 2UUAB 4UV8A 2CGOA 2DW4A 1BZKA 4CZZA 1YTFD 2X6BA 1BGYH 3JALB 4LR3A 3RYFB 2OTLV 2PYJA 3ZMSA 3LUTB 4Z2WA 5B66Z 4LFAO 3FB6C 4U3JA 4X88A 2EIMB 2X6AA 1VQPV 3JD0A 4QPJA 1TA8A 2ZQMA 2UU9B 3JD4A 1AI6A 1N34B 1NTMH 4CS2A 4YHHB 4JTCB 3W7TA 4FM0A 4FM1A 5FPOA 4JI3O 4DUYB 4IGGA 3GWKC 2LJ2A 2B9ZA 3CC2V 2EIKC 3O65A 2EILB 2NNUA 5KAFZ 4E4EA 2W6JG 5LYJA 1XILA 4X9QA 4DUZB 4LF9B 2ZR3A 1ZWIC 1JCHA 1Y76A 4P9OA 2EIMC 1GN3A 3UO3A 2OIEA 3H1JH 1MMMA 1SA0B 3QO5A 5TISZ 4MVOA 4OX9B 4TQFA 4MVQA 3SR2C 1MZFA 3G6EV 1BMFG 1CEZA 5C8YA 3CMAV 3HR0A 1XL6A 1DF4A 1WB8A 1FJGO 3ZMTA 1WA8A 2H3OA 4NR1A 2EILC 3ZEDA 2ETNA 5LGTA 5L3FA 3CRAA 4WFEA 5CB4A 4ZI7A 3QG5A 2LO1A 2UUBO 1BQZA 2CTPA 2X7RB 2NLJC 3M7MX 2RDCA 4QGPA 5ITZB 5IYZB 2YIBA 1SC5B 2XASA 1SETA 2LQTA 1HNXB 1Q8IA 5LMUO 2UXXA 1Q90D 2XTAA 3EHBB 3ABUA 1SQVH 1WLEA 1D5NA 5LMNO 4D6TH 1VQ4V 1BQ0A 3CEIA 1PL0A 2BTQA 1HNZO 4EFEA 5B1BB 5LXTB 3PN1A 5E1AC 4DV7B 2VWKA 1VIBA 5EK0A 1VQLV 2LW7A 4K3AA 3STLC 2E5LB 4RAIA 3E22B 2D2CB 5KX5A 5EIBC 5CBHA 3JCZA 5D5QA 3WFVA 1KBHA 4O2BB 3K0DA 1FFXB 3VBBA 4LF8B 4J41A 3T1CA 2A9HA 2K9PA 2UUAO 2ZIMA 4NYKA 3HKBA 5FLXN 4I50B 3JAKA 1OCZB 4MSWC 4U7NA 4B7EA 4FK5C 3F7YC 5B1BC 2PYLA 5L3GA 3L70H 3ZS8C 2OTJV 2N05A 1SESA 2JEXA 1GH6A 3A8TA 3CD6V 1YJ9V 2IH3C 3CCMV 1SQBH 3NR7A 1RSOB 2UU9O 4JAVA 5DECA 3K5MA 4DUYO 2XAFA 4LWSA 4UCSA 2ARHA 3KG2A 2WA4A 3DC6A 2ZR2A 3W7UA 3JSLA 1SZXA 4LF9O 4JYAB 1DLBA 4CH6A 3D36A 3CC4V 3H01A 4YY3O 3J81N 1FD9A 3E8GA 3I56V 1V54C 5CN0A 4IHJB 1VQOV 4FMTA 2DQ3A 2CH7B 3FAVB 3R65A 4OX9O 4JAUA 2KG7B 1XBLA 4MT8A 1H2MA 4GT1A 1K5SA 1F4NA 2F66C 4DW0A 4ZBMA 1N33B 1GM8A 1CXZB 4YIOA 4NXMB 2HLDG 5F2VO 1WJZA 4GLXA 1ZUQA 1QLEB 3BAAA 1I94B 1S77D 5CA0A 4LF6B 1GAXA 4U3JB 1IBMB 3MD0A 3SPIA 2QKCA 1ZTEA 3IFXA 3G71V 1H8EG 1JJOA 3ABLB 3OMAB 1FXVA 2PZSA 4J80A 1ZSPA 2QTOA 1AR4A 3ZRWB 5KA6A 5IY5B 1YTFB 1QLEC 2JEUA 3L71H 1GKFA 3QO8A 5LYJB 4DV7O 3CPWU 2AW9A 1Y76B 1Y74A 3SPHA 4YJ3A 3LSUA 1AI4A 3ZHSA 1S72V 1BCCH 3S3XA 2EIJB 1PPJH 1YJWV 4LF4B 2JRIA 4LF8O 2Q68A 1VF7A 4MS2A 3ABLC 5C8YB 1URFA 1MG1A 1TUEB 5LHGA 5J2TA 3OTOB 3B40A 3OUSA 3H1LH 4W4KA 2QKSA 4QIWF 4PHZA 5IY5C 2EJRA 3CMEV 1OJHA 2QWRB 2D3OW 4X20A 4GX1A 4LFCB 1BT8A 4O4LB 2QEXV 3EXAA 5CB4B 3KZIZ 1OHHG 1I0HA 5LP6B 5H2FZ 4WFAV 2R9AA 3G6BA 4JF3A 2ZXWB 2EIJC 2ITCC 4LF5B 4PDLA 2Q69A 3T1YB 4RWUA 4DK1A 3ASNB 2Q0AA 1G8MA 4LP8A 4R8CA 1JJ2U 1YSCA 3ZMVA 5J2UB 1E79G 2Q7HA 1A32A 1M1KW 3OTFA 4MVRA 3CCVV 2HJFC 3QO7A 4DR7B 5LP6C 4JYAO 2YC0A 2Q4PA 4K0KB 2CK3G 4QJFB 3LSSA 2ZXWC 3ZHVA 1K8AW 5HFLA 5LBQA 2QKAA 3BABA 4PA7A 4CH5A 4FFKA 1BHBA 3SJAC 3JAWA 4A5UB 4TSFG 4DR2B 3ASNC 2Q0OC 1RM1B 1P7BA 3UKMA 2Y48A 3P3PA 4UB6Z 3EFFK 3RYCA 3B09A 4EB6A 3ABTA 3N2GA 4E2LA 1YDXA 3BPZA 3AK2A 3F7VC 1S0VA 3Q4HA 4UUJC 3HKBB 1Y66A 3JAKB 3J80N 3E35A 2QE7G 4LBEC 4FLZA 1THZA 1HR0B 1H8HG 5GONB 1V55C 5CA1A 5EBMC 3DC5A 1Q6HA 3B8NA 5JCOC 3SYAA 4UVCA 1RM1C 1IBMO 2YICA 4X64O 3MAQA 2V7QG 1IX9A 2HEPA 2GDSA 1JVMA 5FNVA 4PDVA 1QVGU 4K35A 2DMXA 4LFAB 3TCUA 2RMKB 3M99B 2NR5A 4LWSB 2B1IA 3W7SA 2IH1C 2XUMA 4NVPA 3SPJA 5JJEB 3RVZA 2CGNA 1WPXA 5FL7G 1WB7A 4ZHQB 1EN4A 5EBLC 3AG4B 1DGSA 4JGSA 1W0KG 3RVYA 3SJCC 3ZMUA 3OEHG 5KHIA 2VS0A 4FPPA 2QDOA 3I55V 2EINB 5JQGB 2XAGA 3B2EE 5D5PA 4G2KA 3OTOO 4TV8A 2KKWA 2QM4A 1JX9A 2KQXA 2QWQB 1G1XB 2PUSA 1AP5A 3JASB 4H0LB 5JJJB 3D36C 1IXBA 1VARA 3AG4C 1FJGB 4KXRA 1IDSA 3CCRV 1XMQO 1BL8A 1IBLO 2AHYA 3EVKA 3T1YO 2Q67A 5CA0B 3WB0A 4PJ0Z 1PNKA 2ZE8A 4CS3A 2EINC 1O9GA 2IW5A 1VF5B 4ZOLB 1JQ0A 5JVDB 1OCCC 2WLLA 1PP9H 2XAHA 4XDJA 5LL6Y 4GCZA 4FZ1A 2E3CA 4FLYA 3U0ZA 1AP6A 2Y69B 4DR7O 4K0KO 1NR7A 1R6KA 2QWOB 3H1IH 3QTCA 3F5WC 4PA6A 1K4DC 3J7AU 2DWEC 4DV1B 4DR2O 4YJ3B 1GTOA 3MHSC 2XNDG 3TETA 1SQXH 1HNZB 1AR5A 3RFRA 2OT5A 1MZEA 4DW1A 4QE7A 1JA8A 2HFEC 4ABMA 4I7ZB 4DR5O 2DYRB 2Y69C 5J2TB 4C7UA 4LFBO 5C93A 2WPDG 1VQ7V 4NTXA 3TXSA 3OMIB 2C2AA 4J42A 1IURA 4I4TA 2A3QA 1HR0O 1N4CA 4UCOA 3CHXA 1XHXA 2BOCC 2JGDB 2N74A 2A06H 3OUFA 1S5JA 2EBOA 4AILC 1WAZA 4HAMA 2P7TC 1MSWD 5JJNB 4DR4B 1AILA 3CRRA 1KYOF 5EBWC 2DYRC 4Q6GA 2IJJA 2MW2B 2RN9A 1QR9A 3ABMB 4O4HB 4DV0B 2EULA 4J9YB 1SERA 1EBOA 1B04A 2ZKOA 2Y4UA 3JARB 5IYCO 2WAMA 4X1IB 4O2AA 1BHAA 3MDSA 1SRYA 3ZX6A 2LP7A 1WNSA 4J11A 2F23A 5DM6V 2Y0PA 2ZINA 2LFSA 1M5IA 2AHZA 1M90W 4J9ZB 4KL1A 3CYOA 1P49A 5IWAB 1D2DA 1S5LZ 3OGIB 2PI5A 4FLWA 1IZ3A 3BCCH 4YY3B 3RYCB 4AQYO 2YIBD 3RGBA 3HB3B 3ABMC 4EB6B 1ZL8A 3N2GB 1Y6XA 1KQSU 2XOKG 4DR6B 1EN5A 3G67A 2P22C 3Q4HB 4LNUA 5KA5A 1HDJA 3SYCA 3ZHQA 4YIPA 1N0NA 1DF5A 4X62B 2WLMA 1YHQV 4JI7O 5KMGB 5CA1B 4IIJA 1AVMA 2BCCH 4IYHA 5BMVA 1EZJA 3LNNA 3CS5A 4XBFA 4OPHA 2AZ2A 3E83A 1H2GA 3VQYA 1K5QA 5FNVB 4OGQB 1TUBB 4GX5A 4DV6O 2Q5ZA 5L3EA 5KAIZ 1R1BA 1VQ8V 4JI8O 3AK1A 4B3RB 1TAEA 1AI7A 4LC1A 3RW0A 5JH7A 2JIZG 3SGIA 2DQ0A 2X6CA 3OW2U 1KUQA 2LFRA 3ETDA 4J10A 1AR1B 5K1XA 3CCJV 4DV1O 3OE7G 3L72H 4F6RA 3K9AA 4BR6A 3FYEB 1K73W 5K1PA 2JK5C 2H94A 4TV8B 3I5DA 3CE2A 4WFFA 3CCUV 2F4VB 3K3WA 2Z3YA 2QM8A 3ZMZA 1VP7A 5KHHA 3K03A 2OCCB 2RQ6A 3ZBHA 2AGAA 1GRJA 4FLVA 3D3IA 4DR4O 3H9VA 5BZBA 2GTAA 5KHKA 1DK1A 3L74H 2Q73A 4MTFA 2WLLB 3CJHB 1W2BU 5L3BA 3JATA 2W0FC 4DV0O 4X1YB 2CE4A 5KUMA 4X65O 4PA3A 4DR1O 4JAAA 2HHHO 3APQA 2YS8A 4NKGB 1Y4MA 3RYIB 4JZ2A 1OCZC 2A79B 2Q6AA 3HKDA 1S76D 3K58A 1U96A 1WN7A 3DXRA 1VF6A 2V4DA 1M56B 1NJIW 5IWAO 1VQKV 4LF7B 1ENVA 3CWBH 2PY5A 2A0LA 3FYIB 3FB8C 1JMKC 3LNMB 4YJ2B 4DR6O 1JOYA 1SQGA 2IU3A 3W7WA 3U11A 5IJ0A 5IJ9A 4H44B 2Q7EA 2FYUH 5B1NA 4X62O 5B1OA 4HNAA 1SS3A 3UT5A 4UCVA 3JCUZ 4LCUC 2ZDIA 2E74B 4I5SA 4Z1VA 1UFIA 3NXSA 3A0HZ 4L8JA 2K1EA 4CH3A 4R50A 5EC1C 2OWOA 4G28B 1EM1A 5LHIA 3CCLV 4RUFA 2ZD9A 4X64B 1N0JA 2M7WA 4B3RO 4H13B 4RQEA 5L3CA 4DK0A 4O4IA 1Z2GA 2KSDA 4GYCB 3P3NA 4HZ3A 3CRQA 3HKEA 1NH2D 2W6IG 2LGQA 2OCHA 1AI5A 1N8RW 3HKCA 2VRZA 4O2AB 1SZTA 4IYIA 2F1MA 4DXWA 2ZNIA 2JS5A 1I5YA 3MHHC 4X89A 2NN4A 3ZN1A 5KLVH 5BXZA 3BEHA 2UUCB 1G6UA 4P30A 2F4VO 1IXMA 4TV9A 3BA9A 3G80A 3JD2A 3N2KA 3IAYA 3C3SA 1I08A 2IJHA 1YZBA 1WA8B 5H6RA 3C90A 5EZYA 5CMUA 3VQWA 3SDLA 4J7KA 5BMVB 4MVSA 3TGUH 3IGAC 4ZI7B 1R3JC 5FPRA 3K59A 4TWKA 1XMQB 1IBLB 3K0GA 4EFBA 1XEQA 2YI8A 1H2NA 3SPCA 1X59A 1MABG 2HR3A 1UJWB 4MTGA 1H2KA 2ZIOA 1AJQA 5JH7B 2O57A 1L0LH 1TGOA 3RYFA 5B1AB 3RYHA 3L9DA 3FD9A 1MA1A 1KKCA 2Y0IA 1KD1W 2BTQB 4LF7O 1PNMA 3T2MA 4JYBA 4UV9A 1ROPA 4PV1B 4JYYA 4ZKIA 4B3MO 1VQ6V 4TT3G 4N21A 3T4ZA 1J95A 3VOUA 5KX5B 2UXDO 5B5EZ 3B4SA 3QF7A 3SYOA 3THOA 1XOUA 1QNMA 3RWRD 4X8AA 3IC9A 2YSUB 5B1AC 1Q43A 4DR5B 3K06A 2Q7GA 3P32A 4LFBB 3ZN0A 1YI2V 4QPKA 1QU7A 3D8CA 4UB8Z 1BSMA 2WA3A 5LGNA 4JASA 4DV5O 3K57A 3BVOA 2X0LA 2PF4E 1YCIA 1SA0A 3LDEA 1UPGA 2Y4TA 1KP2A 1JFFA 1AB3A 3CB2A 3CXCU 4FLTA 1IVSA 1JR9A 1PD3A 4GX0A 3VQXA 4K8XA 4KP4A 1XHZA 1FKAO 2JJ1G 4LH7A 4IT5A 1FYJA 3E8FA 5L3DA 2A7WA 2ZM6B 1XMOO 3R66A 3HKDB 4WFGA 4MVZA 1SKVA 3DXRB 3FB5C 4PD4F 3ABKB 4JI2O 2KB1A 5IYZA 1KP3A 1VQ9V 3S3WA 4JZGA 3WU2Z
chains in the Genus database with same CATH topology
5HFMA 1I5XA 4BW5A 1OCRB 1QR9A 3ABMB 5H6QA 4U7OA 1OCZB 4MVMA 4J9YB 2QM7A 4MSWC 1EBOA 3JD3A 3F7YC 4FK5C 4U7NA 5B1BC 1SERA 5L3GA 1JPXA 1NKDA 5IYCO 1VQNV 2WAMA 3RBZA 2H8PC 3GWOA 1QVFU 2P6JA 4BIZA 1PNLA 1K7DA 2EZPA 5CBGA 2GSMB 2OTJV 1SESA 2JEXA 2JJ2G 5GW7A 3ZCCA 4UVBA 1R3KC 1BHAA 2R9IA 1SRYA 2LP7A 4JTAB 5DM6V 3CD6V 2LFSA 1QBZA 1YJ9V 2AHZA 1M90W 2IH3C 4J9ZB 3CYOA 4PA9A 5J9PC 3CCMV 3ABKC 1RPOA 4ASUG 2UXNA 3E2EA 4JAVA 2PI5A 3IC7A 1KC8W 2XAFA 5EC2C 3TK1A 3QNEA 1OCRC 3HB3B 3ABMC 3OEEG 1R73A 1KQSU 2XOKG 3KG2A 3E8BA 3LSQA 3ZRSA 2ZR2A 5KA5A 1S3JA 2WLJA 1P4RA 3SYCA 3W7UA 1DLBA 3D36A 3UM7A 4KFMA 3ZRXA 4UXNA 3OR7C 3CC4V 2WLIA 3H01A 1DF5A 2WLMA 1YHQV 3E8GA 3I56V 4UVAA 1V54C 1HWYA 1XL4A 5CN0A 4P9PA 1VQOV 4FMTA 1QLNA 2DQ3A 1EZJA 4WCEV 3R65A 4XBFA 3E83A 1H2GA 1AJPA 4JAUA 1K3EA 1K5QA 4GX5A 4MT8A 4I9WA 4GT1A 1K5SA 1F4NA 5L3EA 1K97A 2WLHA 1V55B 1RPRA 1VQ8V 4ZBMA 5CA3A 4JYCA 1QR8A 1GM8A 1M9NA 1AI7A 1FXKA 4LC1A 3RW0A 3T4DA 2HLDG 2JIZG 1QLEB 1E1QG 2DQ0A 2X6CA 2R9RB 2WSSG 3OW2U 1PKXA 3ZRVA 2B5UA 4CBCA 1S77D 2LFRA 3ETDA 1AR1B 1COWG 1KKDA 3CCJV 3OE7G 3E89A 1NH2B 3MD0A 3CC7V 4MW8A 4WFBV 4G27B 4PELA 3SPIA 1YITV 3LDDA 3K9AA 3FYEB 3IFXA 4JTDB 1K73W 3G71V 1H8EG 3ABLB 2JK5C 1FXVA 3OMAB 2H94A 4FJCC 1VQ5V 2QTOA 5DN6G 3ASOB 1KECA 3ZRWB 4MTOA 5KA6A 4WFFA 5IY5B 3CCUV 1YTFB 1QLEC 4JPRA 2JEUA 3K3WA 1GKFA 2Z3YA 3OFNG 3ML0A 3QO8A 2ITDC 2B1GA 3CPWU 2QM8A 2DYSB 2WLKA 3SPHA 3ZMZA 3K03A 3AEIA 4MVUA 4R6ZA 1AI4A 1S72V 2OCCB 2PI4A 1FS0G 2EIJB 3K04A 3STZC 4PDRA 1NVPD 3D3IA 3SYPA 5BZBA 1YJWV 1NR1A 2EIKB 1QCEA 2Q68A 3FB7C 3AG3B 1Q81W 4MS2A 3ABLC 1AROP 3GB7C 1DTOA 1K34A 2ATKC 4BIUA 1MG1A 2YEVA 1TUEB 5LHGA 4MTFA 1R6NA 3OUSA 1FFTB 2WLLB 3ASOC 3K79A 2QKSA 3OR6C 4QIWF 1W2BU 1GM9A 5IY5C 5L3BA 2W0FC 2EJRA 3CMEV 5KUMA 2MK3A 2D3OW 4PA3A 4GX1A 1GM7A 2QEXV 2DYSC 1OHHG 3JD1A 3E86A 1K92A 2BOBC 4WFAV 1Y4MA 4JF3A 1OCZC 2A79B 2EIJC 2ITCC 2Q6AA 2ZXWB 1S76D 1OCCB 1Q82W 3ZRWA 4PDLA 2Q69A 2V1DA 2WLNA 4EKWA 2JDIG 4RQFA 1M56B 1K33A 1NJIW 3AG3C 2IJIA 3ASNB 1VQKV 1GK9A 1G8MA 1ENVA 4LP8A 4R8CA 1JJ2U 3G4SV 1EFRG 4BAYA 1YSCA 2A0LA 3ZMVA 3FYIB 4WF9V 3CP1A 1E79G 1ORQC 2WWWA 5B3SB 3FB8C 4KUMA 3LNMB 1GMGA 1JOYA 3ZIAG 1M1KW 1W0JG 2IU3A 4MVRA 3CCVV 3ZJZA 2ZDIC 3CCEV 2HJFC 3QO7A 1F4MA 3W7WA 2CK3G 4QJFB 3LSSA 2ZXWC 1K8AW 5HFLA 3B8MA 5B1NA 5LBQA 1F23A 4PA7A 3P30A 5B1OA 1BHBA 4PA4A 4TSFG 4F4LA 5LHHA 4H33A 3ASNC 3OGCC 4LCUC 4XDLA 3CCQV 1RM1B 3SYQA 1P7BA 2ZDIA 3UKMA 2Y48A 4MW3A 4I5SA 1E1RG 1NQTA 4PDMA 3EFFK 5CBFA 3NXSA 2K1EA 2HVKC 3JYCA 3ABTA 4R50A 3HPLC 3SJQC 3OMNB 5EC1C 4E2LA 5B3SC 4G28B 2F43G 4QNHB 3F7VC 2QA4V 3W7XA 4MTXA 4P2ZA 1S0VA 2P90A 5LHIA 3CCLV 4RUFA 2ZD9A 4UUJC 3DGEA 3E8HA 1Y66A 2M7WA 4N23A 4RQEA 5L3CA 1CP9A 1LNQA 3E35A 1R3LC 2QE7G 4LBEC 1K9MW 1H38A 2Z5UA 2IJKA 1THZA 3LDCA 4HZ3A 3PJSK 1H8HG 1V55C 4WFHA 5EBMC 1G4YB 3B8NA 1NH2D 2W6IG 4UVCA 3SYAA 4Q20A 1M57B 1RM1C 1AI5A 1N8RW 3B77A 1VQMV 2V7QG 1SZTA 4YXWG 1CPYA 1Q7YW 1JVMA 4DXWA 4PDVA 3ETGA 1YIJV 1QVGU 1I5YA 5IYDO 1F51A 3MHHC 2HG5C 2XAJA 1GO3F 4XDKA 4X89A 3TCUA 4DO2A 1K4CC 4Z1MG 3ZN1A 2IU0A 3M99B 4UV8A 2DW4A 3BEHA 4CZZA 2B1IA 3W7SA 1OZ0A 1YTFD 2IH1C 2X6BA 3SPJA 2OTLV 3ZMSA 4P30A 1IXMA 3LUTB 3RVZA 1Q86W 4R7CA 1WPXA 5FL7G 3JD2A 3FB6C 1M57C 4X88A 2EIMB 5EBLC 3AG4B 4QE9A 2IJHA 2WLIB 3AG1B 2X6AA 1W0KG 4JGSA 3RVYA 3ZMUA 1VQPV 3OEHG 5H6RA 3JD0A 4QPJA 5CMUA 4FPPA 2ZQMA 3JD4A 1AI6A 4MVSA 2EINB 3IGAC 1R3IC 4HYOA 4JTCB 3W7TA 3I55V 1R3JC 2XAGA 2OCCC 4OXSA 4RO2A 4TWKA 4G2KA 3K0GA 5IYBO 3CC2V 1JX9A 3X2QB 2EIKC 2EILB 1V54B 2NNUA 2HVJC 2W6JG 3SPCA 2ZR3A 3A0RA 1MABG 1ZWIC 1FXKB 1JCHA 2HR3A 4P9OA 4RUEA 1UJWB 2EIMC 2GHYA 3AG4C 4MTGA 3AG1C 1AJQA 3CCRV 1BL8A 2AHYA 5B1AB 3QO5A 2Q67A 3BY6A 2HKOA 1PNKA 4MVOA 1B6QA 1FXHA 2EINC 4MVQA 3WG7B 1KD1W 2FTKA 2IW5A 3G6EV 1BMFG 1CEZA 3K08A 1PNMA 1YJNV 1NBMG 3T2MA 2P67A 1JQ0A 4JYBA 3CMAV 4UV9A 1ROPA 1XL6A 1DF4A 1OCCC 2WLLA 4ZKIA 1VQ6V 4TT3G 4N21A 3T4ZA 2XAHA 3ZMTA 1J95A 4XDJA 3X2QC 1S5HC 2EILC 1M56C 3VOUA 5LGTA 5L3FA 4GCZA 3CCSV 3SYOA 4WFEA 2Y69B 1FXKC 4X8AA 2X7RB 1NR7A 1R6KA 2NLJC 2YSUB 3OAAG 5B1AC 3F5WC 4PA6A 3SPGA 4H37A 1K4DC 2XASA 1MOFA 3K06A 2DWEC 3P32A 3ZN0A 1GTOA 3WG7C 3MHSC 1SETA 1AJNA 1YI2V 2XAQA 1OCOB 3DTUB 2XNDG 4QPKA 3TETA 5LGNA 3FKSG 2UXXA 4JASA 2OT5A 3EHBB 4QE7A 2X0LA 3ABUA 1WLEA 2HFEC 3LDEA 3AG2B 3ETEA 5IDJA 4L87A 2DYRB 1KP2A 2YEVB 1VQ4V 2Y69C 5LGUA 3CXCU 5C93A 1PL0A 2WPDG 1VQ7V 3OMIB 1PD3A 2C2AA 4GX0A 4KP4A 5B1BB 2JJ1G 5H9CA 5E1AC 2BOCC 5EK0A 3E8FA 5L3DA 1VQLV 3STLC 2EZOA 4RAIA 1L1FA 1OCOC 3OUFA 5CBHA 2EBOA 3JCZA 5KUKA 4WFGA 3WFVA 4HAMA 4MVZA 2P7TC 1MSWD 3FB5C 3K0DA 1NVPB 3VBBA 3ABKB 2DWDC 2KB1A 4GX2A 3AG2C 3T1CA 5EBWC 2A9HA 1KP3A 1VQ9V 2DYRC 4FIPC 3OM3B 2IJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT V;  1VQP V;  1YI2 V;  1VQ8 V;  1VQ6 V;  3CME V;  1JJ2 U;  3G4S V;  1K9M W;  2D3O W;  1S72 V;  1YHQ V;  3I56 V;  4WF9 V;  1K73 W;  3G71 V;  1VQL V;  3CCQ V;  1KC8 W;  2QEX V;  3CCS V;  1VQO V;  3CCR V;  4WCE V;  3I55 V;  1M1K W;  1VQN V;  4WFA V;  1YJW V;  1VQ5 V;  1W2B U;  1R73 A;  2OTL V;  1KQS U;  3CCV V;  1QVF U;  3OW2 U;  1N8R W;  1Q81 W;  3CCE V;  1VQM V;  1Q86 W;  1Q82 W;  2OTJ V;  2QA4 V;  1VQ4 V;  3CCU V;  1KD1 W;  3G6E V;  3CXC U;  3CCJ V;  1Q7Y W;  3CC2 V;  1VQ7 V;  3CCL V;  1YJN V;  1NJI W;  1K8A W;  5DM6 V;  3CC7 V;  4WFB V;  1YIJ V;  3CMA V;  1QVG U;  3CD6 V;  1VQ9 V;  1VQK V;  1YJ9 V;  1M90 W;  3CCM V;  3CPW U;  3CC4 V; 
#chains in the Genus database with same CATH topology
 1WPB A;  1N32 B;  3IJ4 A;  2UUC O;  5LA6 A;  4AHC A;  2QM7 A;  1HW7 A;  5IE9 A;  3GWO A;  3O9O A;  4JI4 B;  2P6J A;  1PNL A;  2EZP A;  2JVD A;  2CTR A;  4AQY B;  2JJ2 G;  1VMG A;  5IJ9 B;  1R3K C;  3KKY A;  1HNW O;  2Q8V A;  4HNA B;  3ABK C;  2ZE6 A;  5LXT A;  1N36 B;  1RPO A;  2UXN A;  4FM2 A;  2QJ1 A;  3E2E A;  2JS3 A;  2LW1 A;  3D3Q A;  4NTY A;  4UCU A;  5EC2 C;  5KHJ A;  4X66 O;  4JI7 B;  1P7G A;  3OEE G;  1US6 A;  3ZHR A;  4O2B A;  1FFX A;  3LSQ A;  3ZRS A;  1H2S B;  1MNG A;  3UM7 A;  4KFM A;  3ZRX A;  3A0B Z;  4O4I B;  4DV6 B;  3AG7 A;  2ZE5 A;  4FVM A;  4GZR B;  2WLI A;  2ADP A;  5JWP A;  4I50 A;  4UVA A;  2GBO A;  5DED A;  1MSD A;  3HKE B;  4JI8 B;  1QLN A;  4ICG A;  4WCE V;  2QTS A;  2P4K A;  2XHB A;  2PGG A;  4FFB A;  2RNB A;  4I9W A;  1Q3E A;  4FLX A;  1K97 A;  2WLH A;  1QHT A;  1PM9 A;  1Y74 B;  1RPR A;  4TUY A;  1YF2 A;  4JYC A;  1ZLZ A;  1FXK A;  4FZ0 A;  2UXC B;  2R72 A;  1M4U A;  1E1Q G;  4TV9 B;  2R9R B;  4CBC A;  3ZRV A;  2B5U A;  2BE3 A;  2BSK A;  2HP8 A;  3N2K B;  1COW G;  3E89 A;  1NH2 B;  4WFB V;  4B3T O;  2RJZ A;  5EZY B;  3LDD A;  4X20 B;  1XDC A;  4JTD B;  3BA8 A;  4KHP O;  4FJC C;  2CH7 A;  3ETQ A;  1Q5O A;  5DN6 G;  3ASO B;  1OV9 A;  4MTO A;  3VQV A;  1L0N H;  1PV0 A;  2G38 A;  2QSA A;  4JPR A;  3M8A A;  2L35 A;  4GKJ O;  3ML0 A;  4J7J A;  2P06 A;  2ITD C;  5IT9 N;  3CRC A;  2F95 B;  2WLK A;  4DR3 B;  2ZM6 O;  4R6Z A;  3AEI A;  2F93 B;  4DV3 O;  1J5E B;  1FS0 G;  4NXN B;  3STZ C;  4JI0 B;  1NVP D;  4X65 B;  1M93 A;  3RYH B;  3BFR A;  3SYP A;  4DR1 B;  1NR1 A;  2EIK B;  2QWP B;  2HHH B;  3FB7 C;  2PTM A;  1Q81 W;  1ARO P;  1DTO A;  2ATK C;  4BIU A;  2YEV A;  1IBK B;  1WP7 A;  1R6N A;  1N32 O;  3ASO C;  3OR6 C;  1GM9 A;  3JAW B;  5BR8 O;  1GM7 A;  1F7Y A;  1XNQ O;  4UFZ A;  4JI4 O;  3JD1 A;  2OYQ A;  3GVM A;  2E76 B;  1Q82 W;  3ZRW A;  2V1D A;  4EKW A;  2JDI G;  4RQF A;  1NTZ H;  3F5T A;  1K33 A;  3KCY A;  4JI5 O;  1N36 O;  2E75 B;  1LUV A;  2FKX A;  4BAY A;  3CP1 A;  2WWW A;  4LH6 A;  1GMG A;  1XI1 A;  1L8D A;  3ZIA G;  1XUQ A;  2CTQ A;  1JFF B;  3CCE V;  1V9P A;  1F23 A;  4DV2 B;  1NZ6 A;  4FLU A;  2P5O A;  4H33 A;  3OGC C;  4XDL A;  4O4L A;  3SYQ A;  1E1R G;  1NQT A;  4PDM A;  5LP6 A;  3JYC A;  1GN6 A;  2F43 G;  4WBN A;  4JI6 O;  2UXB B;  3E8H A;  1NI8 A;  4B08 A;  1O9H A;  2UXC O;  1PL4 A;  5LA6 B;  1R3L C;  1K9M W;  1H38 A;  2Z5U A;  2IJK A;  3LDC A;  2GUZ A;  1NTK H;  2YXY A;  5J2U A;  4IL6 Z;  1G4Y B;  4K8Z A;  3CSX A;  4Q20 A;  1M57 B;  3B77 A;  2P4V A;  2VWJ A;  1LR1 A;  1CPY A;  1Q7Y W;  3ETG A;  1YIJ V;  2Q9L A;  5IYD O;  2XAJ A;  1GO3 F;  4DO2 A;  1XNR O;  2IU0 A;  5JCO A;  2YXL A;  1B3Q A;  1OZ0 A;  5AG2 A;  1XQ8 A;  2EJ7 A;  3WB2 A;  3L73 H;  1Q86 W;  4B7K A;  4R7C A;  3UO2 A;  2GTS A;  4EEQ A;  3CX5 F;  3ZHU A;  1M57 C;  1EN6 A;  4DR3 O;  4QE9 A;  2WLI B;  3AG1 B;  1J5E O;  3K9S A;  4NXN O;  4JI0 O;  4I55 A;  5EYP A;  3APO A;  5GON A;  4D7S A;  4HYO A;  1R3I C;  1XRE A;  4I0X A;  1ZAU A;  2OCC C;  4GKK B;  1IBK O;  4OXS A;  4RO2 A;  1Z5W A;  2ADQ B;  4FFB B;  1TVK A;  4CC6 A;  5IYB O;  3X2Q B;  2AXT Z;  1V54 B;  3TXQ A;  4BIO A;  2HVJ C;  5GTI Z;  4TUY B;  4DV4 B;  3A0R A;  1FXK B;  4RUE A;  2N04 A;  3BRC A;  4YHH O;  1N34 O;  2GHY A;  1RP3 B;  3AG1 C;  2EX3 A;  3ZHT A;  4B3M B;  4TQD A;  1W59 A;  2VQF B;  1Z5V A;  2W0X A;  2RCV A;  3WB1 A;  2BSK B;  2UXD B;  5LOV A;  3BY6 A;  2AZ0 A;  2HKO A;  5KHG A;  2YXH A;  1FXH A;  1B6Q A;  1U97 A;  3WG7 B;  4O4J A;  2FTK A;  4ZHQ A;  4NB5 A;  3K08 A;  4DUZ O;  1YJN V;  1BE3 H;  1NBM G;  2HJD A;  5BY1 A;  2P67 A;  1QQC A;  4I4T B;  3X2Q C;  1S5H C;  1M56 C;  4GUN A;  2YUA A;  3CCS V;  1Y67 A;  1FXK C;  5JQG A;  4DV5 B;  2CDY A;  1BS3 A;  4J7Z A;  3OAA G;  4DV2 O;  4BWA A;  4DRX A;  3SPG A;  4H37 A;  3K5L A;  2ODM A;  1MOF A;  2YI9 A;  3WG7 C;  1AJN A;  2XAQ A;  1OCO B;  3DTU B;  3JAS A;  1H2L A;  2IBZ H;  3FKS G;  2VQE B;  3UQ8 A;  2L6L A;  2BTO A;  1XMO B;  3AG2 B;  3ETE A;  5IDJ A;  2UXB O;  4L87 A;  4AI8 A;  2YEV B;  5LGU A;  3JAM N;  1HNX O;  4ZOL A;  5JVD A;  1KU9 A;  3H1H H;  4JI2 B;  1ZX3 A;  5H9C A;  4UCT A;  2EZO A;  3T1H B;  1L1F A;  1OCO C;  1P84 F;  1ZL8 B;  2FML A;  5KUK A;  1LUW A;  2OIG A;  4JI1 B;  1NVP B;  4LNU B;  2DWD C;  4GX2 A;  3AG2 C;  4FIP C;  3OM3 B;  4B3S B;  2E5L O;  5HFM A;  1I5X A;  1HNW B;  4BW5 A;  1OCR B;  5H6Q A;  4U7O A;  1GN2 A;  4MVM A;  4IIJ B;  2ILM A;  3JD3 A;  4U3F H;  1JPX A;  1NKD A;  1VQN V;  1VEW A;  3SJB C;  3RBZ A;  2H8P C;  1QVF U;  4BIZ A;  1K7D A;  5CBG A;  2GSM B;  4X66 B;  4JV5 B;  5GW7 A;  3ZCC A;  4UVB A;  2R9I A;  4JTA B;  1QBZ A;  5A2Q N;  4PA9 A;  5J9P C;  4X1K A;  4ASU G;  3IC7 A;  1GN4 A;  2JGD A;  1KC8 W;  2GV9 A;  4GKK O;  3TK1 A;  3QNE A;  1OCR C;  4OPA A;  1R73 A;  2ZE7 A;  3JAL A;  3A2F A;  4WBN B;  3E8B A;  4TOI A;  4W4L A;  1FPO A;  2LGW A;  2Z0A A;  1S3J A;  2WLJ A;  1P4R A;  4F6R B;  4DV4 O;  3AK3 A;  4UXN A;  3OR7 C;  4PI2 A;  2GUZ B;  2VQF O;  2ZNJ A;  1FAF A;  1HWY A;  1XL4 A;  4O4H A;  4P9P A;  3UCS C;  3JAR A;  1AJP A;  2YID A;  1K3E A;  3H1K H;  4X1I A;  1YEW A;  1KB9 F;  3BHP A;  2QGN A;  4CS4 A;  1V55 B;  2CAZ C;  5CA3 A;  4B3T B;  1QR8 A;  1M9N A;  2CTW A;  2ZCE A;  3T4D A;  3K5O A;  4ZIB A;  2YDE A;  3N27 A;  1SQP H;  4KHP B;  2WSS G;  1PKX A;  5EIB D;  2QR4 A;  1KKD A;  3K5N A;  1I7F A;  1NT2 B;  4PI0 A;  3CC7 V;  4MW8 A;  4G27 B;  4PEL A;  1N33 O;  3JAT B;  2QWN B;  1YIT V;  4NXM O;  4I55 B;  2IM9 A;  4GKJ B;  5EYP B;  2VQE O;  2DOS A;  5KMG A;  1I94 O;  3QVN A;  4I0X B;  2M6Y A;  4DV3 B;  4LF6 O;  1WP8 A;  1VQ5 V;  3C3T A;  3OT7 A;  1TVK B;  1KEC A;  3FX7 A;  1TUB A;  1HP8 A;  5ITZ A;  3OFN G;  5GTH Z;  2DE0 X;  3U10 A;  2B1G A;  2DYS B;  3T1H O;  4MVU A;  2PI4 A;  3K04 A;  5BR8 B;  4PDR A;  5LOV B;  4JI1 O;  1XNQ B;  1QCE A;  3AG3 B;  4O4J B;  4JI3 B;  3GB7 C;  4BW9 A;  5IJ0 B;  1K34 A;  4D7T A;  5A9G A;  4B3S O;  2YIA A;  1NS1 A;  1FFT B;  3K79 A;  1VF6 C;  3UT5 B;  2MK3 A;  4JI5 B;  1Q6I A;  2CUG A;  4LF4 O;  2DYS C;  1SQQ H;  3E86 A;  1K92 A;  2FL4 A;  2BOB C;  3E22 A;  4JV5 O;  4F6E A;  1OCC B;  4UCR A;  1D5A A;  1EZV H;  1R6T A;  3OD4 A;  4DRX B;  2WLN A;  2JGU A;  2DJV A;  2ZT9 B;  4CH4 A;  3AG3 C;  2IJI A;  3RN4 A;  1SQF A;  4LFC O;  1GK9 A;  5E79 Z;  1Q6U A;  3CXH F;  3G4S V;  1EFR G;  3ICX A;  4WF9 V;  1ORQ C;  5B3S B;  4KUM A;  4I9Q A;  4LF5 O;  1W0J G;  3HKC B;  3ZJZ A;  2ZDI C;  3KCX A;  2UUB B;  1F4M A;  5H5N A;  3B8M A;  3P30 A;  3CJH A;  4JI6 B;  2XT9 A;  4X1Y A;  4PA4 A;  4F4L A;  5LHH A;  1RSO A;  3CCQ V;  5LMU B;  4MW3 A;  1NU1 H;  2FB5 A;  5CBF A;  3RYI A;  2HVK C;  3TJT A;  3HPL C;  3SJQ C;  3OMN B;  5B3S C;  1T5E A;  4QNH B;  2QA4 V;  3W7X A;  4MTX A;  5LMN B;  4P2Z A;  1YVW A;  4CC5 A;  2P90 A;  3DGE A;  3CRM A;  4HBN A;  4N23 A;  1CP9 A;  1LNQ A;  1X4T A;  2DN9 A;  3RT3 C;  3PJS K;  1KMI Z;  1XNR B;  4WFH A;  4IHJ A;  4YJ2 A;  4NTW A;  3JSN A;  3DSQ A;  3FAV A;  3FFQ A;  1VQM V;  4DYL A;  1RFY A;  4YXW G;  2KG7 A;  2R70 A;  4X1K B;  3L75 H;  1F51 A;  2HG5 C;  4XDK A;  1SF9 A;  1B06 A;  1K4C C;  4Z1M G;  1YXB A;  2UUA B;  4UV8 A;  2CGO A;  2DW4 A;  1BZK A;  4CZZ A;  1YTF D;  2X6B A;  1BGY H;  3JAL B;  4LR3 A;  3RYF B;  2OTL V;  2PYJ A;  3ZMS A;  3LUT B;  4Z2W A;  5B66 Z;  4LFA O;  3FB6 C;  4U3J A;  4X88 A;  2EIM B;  2X6A A;  1VQP V;  3JD0 A;  4QPJ A;  1TA8 A;  2ZQM A;  2UU9 B;  3JD4 A;  1AI6 A;  1N34 B;  1NTM H;  4CS2 A;  4YHH B;  4JTC B;  3W7T A;  4FM0 A;  4FM1 A;  5FPO A;  4JI3 O;  4DUY B;  4IGG A;  3GWK C;  2LJ2 A;  2B9Z A;  3CC2 V;  2EIK C;  3O65 A;  2EIL B;  2NNU A;  5KAF Z;  4E4E A;  2W6J G;  5LYJ A;  1XIL A;  4X9Q A;  4DUZ B;  4LF9 B;  2ZR3 A;  1ZWI C;  1JCH A;  1Y76 A;  4P9O A;  2EIM C;  1GN3 A;  3UO3 A;  2OIE A;  3H1J H;  1MMM A;  1SA0 B;  3QO5 A;  5TIS Z;  4MVO A;  4OX9 B;  4TQF A;  4MVQ A;  3SR2 C;  1MZF A;  3G6E V;  1BMF G;  1CEZ A;  5C8Y A;  3CMA V;  3HR0 A;  1XL6 A;  1DF4 A;  1WB8 A;  1FJG O;  3ZMT A;  1WA8 A;  2H3O A;  4NR1 A;  2EIL C;  3ZED A;  2ETN A;  5LGT A;  5L3F A;  3CRA A;  4WFE A;  5CB4 A;  4ZI7 A;  3QG5 A;  2LO1 A;  2UUB O;  1BQZ A;  2CTP A;  2X7R B;  2NLJ C;  3M7M X;  2RDC A;  4QGP A;  5ITZ B;  5IYZ B;  2YIB A;  1SC5 B;  2XAS A;  1SET A;  2LQT A;  1HNX B;  1Q8I A;  5LMU O;  2UXX A;  1Q90 D;  2XTA A;  3EHB B;  3ABU A;  1SQV H;  1WLE A;  1D5N A;  5LMN O;  4D6T H;  1VQ4 V;  1BQ0 A;  3CEI A;  1PL0 A;  2BTQ A;  1HNZ O;  4EFE A;  5B1B B;  5LXT B;  3PN1 A;  5E1A C;  4DV7 B;  2VWK A;  1VIB A;  5EK0 A;  1VQL V;  2LW7 A;  4K3A A;  3STL C;  2E5L B;  4RAI A;  3E22 B;  2D2C B;  5KX5 A;  5EIB C;  5CBH A;  3JCZ A;  5D5Q A;  3WFV A;  1KBH A;  4O2B B;  3K0D A;  1FFX B;  3VBB A;  4LF8 B;  4J41 A;  3T1C A;  2A9H A;  2K9P A;  2UUA O;  2ZIM A;  4NYK A;  3HKB A;  5FLX N;  4I50 B;  3JAK A;  1OCZ B;  4MSW C;  4U7N A;  4B7E A;  4FK5 C;  3F7Y C;  5B1B C;  2PYL A;  5L3G A;  3L70 H;  3ZS8 C;  2OTJ V;  2N05 A;  1SES A;  2JEX A;  1GH6 A;  3A8T A;  3CD6 V;  1YJ9 V;  2IH3 C;  3CCM V;  1SQB H;  3NR7 A;  1RSO B;  2UU9 O;  4JAV A;  5DEC A;  3K5M A;  4DUY O;  2XAF A;  4LWS A;  4UCS A;  2ARH A;  3KG2 A;  2WA4 A;  3DC6 A;  2ZR2 A;  3W7U A;  3JSL A;  1SZX A;  4LF9 O;  4JYA B;  1DLB A;  4CH6 A;  3D36 A;  3CC4 V;  3H01 A;  4YY3 O;  3J81 N;  1FD9 A;  3E8G A;  3I56 V;  1V54 C;  5CN0 A;  4IHJ B;  1VQO V;  4FMT A;  2DQ3 A;  2CH7 B;  3FAV B;  3R65 A;  4OX9 O;  4JAU A;  2KG7 B;  1XBL A;  4MT8 A;  1H2M A;  4GT1 A;  1K5S A;  1F4N A;  2F66 C;  4DW0 A;  4ZBM A;  1N33 B;  1GM8 A;  1CXZ B;  4YIO A;  4NXM B;  2HLD G;  5F2V O;  1WJZ A;  4GLX A;  1ZUQ A;  1QLE B;  3BAA A;  1I94 B;  1S77 D;  5CA0 A;  4LF6 B;  1GAX A;  4U3J B;  1IBM B;  3MD0 A;  3SPI A;  2QKC A;  1ZTE A;  3IFX A;  3G71 V;  1H8E G;  1JJO A;  3ABL B;  3OMA B;  1FXV A;  2PZS A;  4J80 A;  1ZSP A;  2QTO A;  1AR4 A;  3ZRW B;  5KA6 A;  5IY5 B;  1YTF B;  1QLE C;  2JEU A;  3L71 H;  1GKF A;  3QO8 A;  5LYJ B;  4DV7 O;  3CPW U;  2AW9 A;  1Y76 B;  1Y74 A;  3SPH A;  4YJ3 A;  3LSU A;  1AI4 A;  3ZHS A;  1S72 V;  1BCC H;  3S3X A;  2EIJ B;  1PPJ H;  1YJW V;  4LF4 B;  2JRI A;  4LF8 O;  2Q68 A;  1VF7 A;  4MS2 A;  3ABL C;  5C8Y B;  1URF A;  1MG1 A;  1TUE B;  5LHG A;  5J2T A;  3OTO B;  3B40 A;  3OUS A;  3H1L H;  4W4K A;  2QKS A;  4QIW F;  4PHZ A;  5IY5 C;  2EJR A;  3CME V;  1OJH A;  2QWR B;  2D3O W;  4X20 A;  4GX1 A;  4LFC B;  1BT8 A;  4O4L B;  2QEX V;  3EXA A;  5CB4 B;  3KZI Z;  1OHH G;  1I0H A;  5LP6 B;  5H2F Z;  4WFA V;  2R9A A;  3G6B A;  4JF3 A;  2ZXW B;  2EIJ C;  2ITC C;  4LF5 B;  4PDL A;  2Q69 A;  3T1Y B;  4RWU A;  4DK1 A;  3ASN B;  2Q0A A;  1G8M A;  4LP8 A;  4R8C A;  1JJ2 U;  1YSC A;  3ZMV A;  5J2U B;  1E79 G;  2Q7H A;  1A32 A;  1M1K W;  3OTF A;  4MVR A;  3CCV V;  2HJF C;  3QO7 A;  4DR7 B;  5LP6 C;  4JYA O;  2YC0 A;  2Q4P A;  4K0K B;  2CK3 G;  4QJF B;  3LSS A;  2ZXW C;  3ZHV A;  1K8A W;  5HFL A;  5LBQ A;  2QKA A;  3BAB A;  4PA7 A;  4CH5 A;  4FFK A;  1BHB A;  3SJA C;  3JAW A;  4A5U B;  4TSF G;  4DR2 B;  3ASN C;  2Q0O C;  1RM1 B;  1P7B A;  3UKM A;  2Y48 A;  3P3P A;  4UB6 Z;  3EFF K;  3RYC A;  3B09 A;  4EB6 A;  3ABT A;  3N2G A;  4E2L A;  1YDX A;  3BPZ A;  3AK2 A;  3F7V C;  1S0V A;  3Q4H A;  4UUJ C;  3HKB B;  1Y66 A;  3JAK B;  3J80 N;  3E35 A;  2QE7 G;  4LBE C;  4FLZ A;  1THZ A;  1HR0 B;  1H8H G;  5GON B;  1V55 C;  5CA1 A;  5EBM C;  3DC5 A;  1Q6H A;  3B8N A;  5JCO C;  3SYA A;  4UVC A;  1RM1 C;  1IBM O;  2YIC A;  4X64 O;  3MAQ A;  2V7Q G;  1IX9 A;  2HEP A;  2GDS A;  1JVM A;  5FNV A;  4PDV A;  1QVG U;  4K35 A;  2DMX A;  4LFA B;  3TCU A;  2RMK B;  3M99 B;  2NR5 A;  4LWS B;  2B1I A;  3W7S A;  2IH1 C;  2XUM A;  4NVP A;  3SPJ A;  5JJE B;  3RVZ A;  2CGN A;  1WPX A;  5FL7 G;  1WB7 A;  4ZHQ B;  1EN4 A;  5EBL C;  3AG4 B;  1DGS A;  4JGS A;  1W0K G;  3RVY A;  3SJC C;  3ZMU A;  3OEH G;  5KHI A;  2VS0 A;  4FPP A;  2QDO A;  3I55 V;  2EIN B;  5JQG B;  2XAG A;  3B2E E;  5D5P A;  4G2K A;  3OTO O;  4TV8 A;  2KKW A;  2QM4 A;  1JX9 A;  2KQX A;  2QWQ B;  1G1X B;  2PUS A;  1AP5 A;  3JAS B;  4H0L B;  5JJJ B;  3D36 C;  1IXB A;  1VAR A;  3AG4 C;  1FJG B;  4KXR A;  1IDS A;  3CCR V;  1XMQ O;  1BL8 A;  1IBL O;  2AHY A;  3EVK A;  3T1Y O;  2Q67 A;  5CA0 B;  3WB0 A;  4PJ0 Z;  1PNK A;  2ZE8 A;  4CS3 A;  2EIN C;  1O9G A;  2IW5 A;  1VF5 B;  4ZOL B;  1JQ0 A;  5JVD B;  1OCC C;  2WLL A;  1PP9 H;  2XAH A;  4XDJ A;  5LL6 Y;  4GCZ A;  4FZ1 A;  2E3C A;  4FLY A;  3U0Z A;  1AP6 A;  2Y69 B;  4DR7 O;  4K0K O;  1NR7 A;  1R6K A;  2QWO B;  3H1I H;  3QTC A;  3F5W C;  4PA6 A;  1K4D C;  3J7A U;  2DWE C;  4DV1 B;  4DR2 O;  4YJ3 B;  1GTO A;  3MHS C;  2XND G;  3TET A;  1SQX H;  1HNZ B;  1AR5 A;  3RFR A;  2OT5 A;  1MZE A;  4DW1 A;  4QE7 A;  1JA8 A;  2HFE C;  4ABM A;  4I7Z B;  4DR5 O;  2DYR B;  2Y69 C;  5J2T B;  4C7U A;  4LFB O;  5C93 A;  2WPD G;  1VQ7 V;  4NTX A;  3TXS A;  3OMI B;  2C2A A;  4J42 A;  1IUR A;  4I4T A;  2A3Q A;  1HR0 O;  1N4C A;  4UCO A;  3CHX A;  1XHX A;  2BOC C;  2JGD B;  2N74 A;  2A06 H;  3OUF A;  1S5J A;  2EBO A;  4AIL C;  1WAZ A;  4HAM A;  2P7T C;  1MSW D;  5JJN B;  4DR4 B;  1AIL A;  3CRR A;  1KYO F;  5EBW C;  2DYR C;  4Q6G A;  2IJJ A;  2MW2 B;  2RN9 A;  1QR9 A;  3ABM B;  4O4H B;  4DV0 B;  2EUL A;  4J9Y B;  1SER A;  1EBO A;  1B04 A;  2ZKO A;  2Y4U A;  3JAR B;  5IYC O;  2WAM A;  4X1I B;  4O2A A;  1BHA A;  3MDS A;  1SRY A;  3ZX6 A;  2LP7 A;  1WNS A;  4J11 A;  2F23 A;  5DM6 V;  2Y0P A;  2ZIN A;  2LFS A;  1M5I A;  2AHZ A;  1M90 W;  4J9Z B;  4KL1 A;  3CYO A;  1P49 A;  5IWA B;  1D2D A;  1S5L Z;  3OGI B;  2PI5 A;  4FLW A;  1IZ3 A;  3BCC H;  4YY3 B;  3RYC B;  4AQY O;  2YIB D;  3RGB A;  3HB3 B;  3ABM C;  4EB6 B;  1ZL8 A;  3N2G B;  1Y6X A;  1KQS U;  2XOK G;  4DR6 B;  1EN5 A;  3G67 A;  2P22 C;  3Q4H B;  4LNU A;  5KA5 A;  1HDJ A;  3SYC A;  3ZHQ A;  4YIP A;  1N0N A;  1DF5 A;  4X62 B;  2WLM A;  1YHQ V;  4JI7 O;  5KMG B;  5CA1 B;  4IIJ A;  1AVM A;  2BCC H;  4IYH A;  5BMV A;  1EZJ A;  3LNN A;  3CS5 A;  4XBF A;  4OPH A;  2AZ2 A;  3E83 A;  1H2G A;  3VQY A;  1K5Q A;  5FNV B;  4OGQ B;  1TUB B;  4GX5 A;  4DV6 O;  2Q5Z A;  5L3E A;  5KAI Z;  1R1B A;  1VQ8 V;  4JI8 O;  3AK1 A;  4B3R B;  1TAE A;  1AI7 A;  4LC1 A;  3RW0 A;  5JH7 A;  2JIZ G;  3SGI A;  2DQ0 A;  2X6C A;  3OW2 U;  1KUQ A;  2LFR A;  3ETD A;  4J10 A;  1AR1 B;  5K1X A;  3CCJ V;  4DV1 O;  3OE7 G;  3L72 H;  4F6R A;  3K9A A;  4BR6 A;  3FYE B;  1K73 W;  5K1P A;  2JK5 C;  2H94 A;  4TV8 B;  3I5D A;  3CE2 A;  4WFF A;  3CCU V;  2F4V B;  3K3W A;  2Z3Y A;  2QM8 A;  3ZMZ A;  1VP7 A;  5KHH A;  3K03 A;  2OCC B;  2RQ6 A;  3ZBH A;  2AGA A;  1GRJ A;  4FLV A;  3D3I A;  4DR4 O;  3H9V A;  5BZB A;  2GTA A;  5KHK A;  1DK1 A;  3L74 H;  2Q73 A;  4MTF A;  2WLL B;  3CJH B;  1W2B U;  5L3B A;  3JAT A;  2W0F C;  4DV0 O;  4X1Y B;  2CE4 A;  5KUM A;  4X65 O;  4PA3 A;  4DR1 O;  4JAA A;  2HHH O;  3APQ A;  2YS8 A;  4NKG B;  1Y4M A;  3RYI B;  4JZ2 A;  1OCZ C;  2A79 B;  2Q6A A;  3HKD A;  1S76 D;  3K58 A;  1U96 A;  1WN7 A;  3DXR A;  1VF6 A;  2V4D A;  1M56 B;  1NJI W;  5IWA O;  1VQK V;  4LF7 B;  1ENV A;  3CWB H;  2PY5 A;  2A0L A;  3FYI B;  3FB8 C;  1JMK C;  3LNM B;  4YJ2 B;  4DR6 O;  1JOY A;  1SQG A;  2IU3 A;  3W7W A;  3U11 A;  5IJ0 A;  5IJ9 A;  4H44 B;  2Q7E A;  2FYU H;  5B1N A;  4X62 O;  5B1O A;  4HNA A;  1SS3 A;  3UT5 A;  4UCV A;  3JCU Z;  4LCU C;  2ZDI A;  2E74 B;  4I5S A;  4Z1V A;  1UFI A;  3NXS A;  3A0H Z;  4L8J A;  2K1E A;  4CH3 A;  4R50 A;  5EC1 C;  2OWO A;  4G28 B;  1EM1 A;  5LHI A;  3CCL V;  4RUF A;  2ZD9 A;  4X64 B;  1N0J A;  2M7W A;  4B3R O;  4H13 B;  4RQE A;  5L3C A;  4DK0 A;  4O4I A;  1Z2G A;  2KSD A;  4GYC B;  3P3N A;  4HZ3 A;  3CRQ A;  3HKE A;  1NH2 D;  2W6I G;  2LGQ A;  2OCH A;  1AI5 A;  1N8R W;  3HKC A;  2VRZ A;  4O2A B;  1SZT A;  4IYI A;  2F1M A;  4DXW A;  2ZNI A;  2JS5 A;  1I5Y A;  3MHH C;  4X89 A;  2NN4 A;  3ZN1 A;  5KLV H;  5BXZ A;  3BEH A;  2UUC B;  1G6U A;  4P30 A;  2F4V O;  1IXM A;  4TV9 A;  3BA9 A;  3G80 A;  3JD2 A;  3N2K A;  3IAY A;  3C3S A;  1I08 A;  2IJH A;  1YZB A;  1WA8 B;  5H6R A;  3C90 A;  5EZY A;  5CMU A;  3VQW A;  3SDL A;  4J7K A;  5BMV B;  4MVS A;  3TGU H;  3IGA C;  4ZI7 B;  1R3J C;  5FPR A;  3K59 A;  4TWK A;  1XMQ B;  1IBL B;  3K0G A;  4EFB A;  1XEQ A;  2YI8 A;  1H2N A;  3SPC A;  1X59 A;  1MAB G;  2HR3 A;  1UJW B;  4MTG A;  1H2K A;  2ZIO A;  1AJQ A;  5JH7 B;  2O57 A;  1L0L H;  1TGO A;  3RYF A;  5B1A B;  3RYH A;  3L9D A;  3FD9 A;  1MA1 A;  1KKC A;  2Y0I A;  1KD1 W;  2BTQ B;  4LF7 O;  1PNM A;  3T2M A;  4JYB A;  4UV9 A;  1ROP A;  4PV1 B;  4JYY A;  4ZKI A;  4B3M O;  1VQ6 V;  4TT3 G;  4N21 A;  3T4Z A;  1J95 A;  3VOU A;  5KX5 B;  2UXD O;  5B5E Z;  3B4S A;  3QF7 A;  3SYO A;  3THO A;  1XOU A;  1QNM A;  3RWR D;  4X8A A;  3IC9 A;  2YSU B;  5B1A C;  1Q43 A;  4DR5 B;  3K06 A;  2Q7G A;  3P32 A;  4LFB B;  3ZN0 A;  1YI2 V;  4QPK A;  1QU7 A;  3D8C A;  4UB8 Z;  1BSM A;  2WA3 A;  5LGN A;  4JAS A;  4DV5 O;  3K57 A;  3BVO A;  2X0L A;  2PF4 E;  1YCI A;  1SA0 A;  3LDE A;  1UPG A;  2Y4T A;  1KP2 A;  1JFF A;  1AB3 A;  3CB2 A;  3CXC U;  4FLT A;  1IVS A;  1JR9 A;  1PD3 A;  4GX0 A;  3VQX A;  4K8X A;  4KP4 A;  1XHZ A;  1FKA O;  2JJ1 G;  4LH7 A;  4IT5 A;  1FYJ A;  3E8F A;  5L3D A;  2A7W A;  2ZM6 B;  1XMO O;  3R66 A;  3HKD B;  4WFG A;  4MVZ A;  1SKV A;  3DXR B;  3FB5 C;  4PD4 F;  3ABK B;  4JI2 O;  2KB1 A;  5IYZ A;  1KP3 A;  1VQ9 V;  3S3W A;  4JZG A;  3WU2 Z; 
#chains in the Genus database with same CATH homology
 5HFM A;  1I5X A;  4BW5 A;  1OCR B;  1QR9 A;  3ABM B;  5H6Q A;  4U7O A;  1OCZ B;  4MVM A;  4J9Y B;  2QM7 A;  4MSW C;  1EBO A;  3JD3 A;  3F7Y C;  4FK5 C;  4U7N A;  5B1B C;  1SER A;  5L3G A;  1JPX A;  1NKD A;  5IYC O;  1VQN V;  2WAM A;  3RBZ A;  2H8P C;  3GWO A;  1QVF U;  2P6J A;  4BIZ A;  1PNL A;  1K7D A;  2EZP A;  5CBG A;  2GSM B;  2OTJ V;  1SES A;  2JEX A;  2JJ2 G;  5GW7 A;  3ZCC A;  4UVB A;  1R3K C;  1BHA A;  2R9I A;  1SRY A;  2LP7 A;  4JTA B;  5DM6 V;  3CD6 V;  2LFS A;  1QBZ A;  1YJ9 V;  2AHZ A;  1M90 W;  2IH3 C;  4J9Z B;  3CYO A;  4PA9 A;  5J9P C;  3CCM V;  3ABK C;  1RPO A;  4ASU G;  2UXN A;  3E2E A;  4JAV A;  2PI5 A;  3IC7 A;  1KC8 W;  2XAF A;  5EC2 C;  3TK1 A;  3QNE A;  1OCR C;  3HB3 B;  3ABM C;  3OEE G;  1R73 A;  1KQS U;  2XOK G;  3KG2 A;  3E8B A;  3LSQ A;  3ZRS A;  2ZR2 A;  5KA5 A;  1S3J A;  2WLJ A;  1P4R A;  3SYC A;  3W7U A;  1DLB A;  3D36 A;  3UM7 A;  4KFM A;  3ZRX A;  4UXN A;  3OR7 C;  3CC4 V;  2WLI A;  3H01 A;  1DF5 A;  2WLM A;  1YHQ V;  3E8G A;  3I56 V;  4UVA A;  1V54 C;  1HWY A;  1XL4 A;  5CN0 A;  4P9P A;  1VQO V;  4FMT A;  1QLN A;  2DQ3 A;  1EZJ A;  4WCE V;  3R65 A;  4XBF A;  3E83 A;  1H2G A;  1AJP A;  4JAU A;  1K3E A;  1K5Q A;  4GX5 A;  4MT8 A;  4I9W A;  4GT1 A;  1K5S A;  1F4N A;  5L3E A;  1K97 A;  2WLH A;  1V55 B;  1RPR A;  1VQ8 V;  4ZBM A;  5CA3 A;  4JYC A;  1QR8 A;  1GM8 A;  1M9N A;  1AI7 A;  1FXK A;  4LC1 A;  3RW0 A;  3T4D A;  2HLD G;  2JIZ G;  1QLE B;  1E1Q G;  2DQ0 A;  2X6C A;  2R9R B;  2WSS G;  3OW2 U;  1PKX A;  3ZRV A;  2B5U A;  4CBC A;  1S77 D;  2LFR A;  3ETD A;  1AR1 B;  1COW G;  1KKD A;  3CCJ V;  3OE7 G;  3E89 A;  1NH2 B;  3MD0 A;  3CC7 V;  4MW8 A;  4WFB V;  4G27 B;  4PEL A;  3SPI A;  1YIT V;  3LDD A;  3K9A A;  3FYE B;  3IFX A;  4JTD B;  1K73 W;  3G71 V;  1H8E G;  3ABL B;  2JK5 C;  1FXV A;  3OMA B;  2H94 A;  4FJC C;  1VQ5 V;  2QTO A;  5DN6 G;  3ASO B;  1KEC A;  3ZRW B;  4MTO A;  5KA6 A;  4WFF A;  5IY5 B;  3CCU V;  1YTF B;  1QLE C;  4JPR A;  2JEU A;  3K3W A;  1GKF A;  2Z3Y A;  3OFN G;  3ML0 A;  3QO8 A;  2ITD C;  2B1G A;  3CPW U;  2QM8 A;  2DYS B;  2WLK A;  3SPH A;  3ZMZ A;  3K03 A;  3AEI A;  4MVU A;  4R6Z A;  1AI4 A;  1S72 V;  2OCC B;  2PI4 A;  1FS0 G;  2EIJ B;  3K04 A;  3STZ C;  4PDR A;  1NVP D;  3D3I A;  3SYP A;  5BZB A;  1YJW V;  1NR1 A;  2EIK B;  1QCE A;  2Q68 A;  3FB7 C;  3AG3 B;  1Q81 W;  4MS2 A;  3ABL C;  1ARO P;  3GB7 C;  1DTO A;  1K34 A;  2ATK C;  4BIU A;  1MG1 A;  2YEV A;  1TUE B;  5LHG A;  4MTF A;  1R6N A;  3OUS A;  1FFT B;  2WLL B;  3ASO C;  3K79 A;  2QKS A;  3OR6 C;  4QIW F;  1W2B U;  1GM9 A;  5IY5 C;  5L3B A;  2W0F C;  2EJR A;  3CME V;  5KUM A;  2MK3 A;  2D3O W;  4PA3 A;  4GX1 A;  1GM7 A;  2QEX V;  2DYS C;  1OHH G;  3JD1 A;  3E86 A;  1K92 A;  2BOB C;  4WFA V;  1Y4M A;  4JF3 A;  1OCZ C;  2A79 B;  2EIJ C;  2ITC C;  2Q6A A;  2ZXW B;  1S76 D;  1OCC B;  1Q82 W;  3ZRW A;  4PDL A;  2Q69 A;  2V1D A;  2WLN A;  4EKW A;  2JDI G;  4RQF A;  1M56 B;  1K33 A;  1NJI W;  3AG3 C;  2IJI A;  3ASN B;  1VQK V;  1GK9 A;  1G8M A;  1ENV A;  4LP8 A;  4R8C A;  1JJ2 U;  3G4S V;  1EFR G;  4BAY A;  1YSC A;  2A0L A;  3ZMV A;  3FYI B;  4WF9 V;  3CP1 A;  1E79 G;  1ORQ C;  2WWW A;  5B3S B;  3FB8 C;  4KUM A;  3LNM B;  1GMG A;  1JOY A;  3ZIA G;  1M1K W;  1W0J G;  2IU3 A;  4MVR A;  3CCV V;  3ZJZ A;  2ZDI C;  3CCE V;  2HJF C;  3QO7 A;  1F4M A;  3W7W A;  2CK3 G;  4QJF B;  3LSS A;  2ZXW C;  1K8A W;  5HFL A;  3B8M A;  5B1N A;  5LBQ A;  1F23 A;  4PA7 A;  3P30 A;  5B1O A;  1BHB A;  4PA4 A;  4TSF G;  4F4L A;  5LHH A;  4H33 A;  3ASN C;  3OGC C;  4LCU C;  4XDL A;  3CCQ V;  1RM1 B;  3SYQ A;  1P7B A;  2ZDI A;  3UKM A;  2Y48 A;  4MW3 A;  4I5S A;  1E1R G;  1NQT A;  4PDM A;  3EFF K;  5CBF A;  3NXS A;  2K1E A;  2HVK C;  3JYC A;  3ABT A;  4R50 A;  3HPL C;  3SJQ C;  3OMN B;  5EC1 C;  4E2L A;  5B3S C;  4G28 B;  2F43 G;  4QNH B;  3F7V C;  2QA4 V;  3W7X A;  4MTX A;  4P2Z A;  1S0V A;  2P90 A;  5LHI A;  3CCL V;  4RUF A;  2ZD9 A;  4UUJ C;  3DGE A;  3E8H A;  1Y66 A;  2M7W A;  4N23 A;  4RQE A;  5L3C A;  1CP9 A;  1LNQ A;  3E35 A;  1R3L C;  2QE7 G;  4LBE C;  1K9M W;  1H38 A;  2Z5U A;  2IJK A;  1THZ A;  3LDC A;  4HZ3 A;  3PJS K;  1H8H G;  1V55 C;  4WFH A;  5EBM C;  1G4Y B;  3B8N A;  1NH2 D;  2W6I G;  4UVC A;  3SYA A;  4Q20 A;  1M57 B;  1RM1 C;  1AI5 A;  1N8R W;  3B77 A;  1VQM V;  2V7Q G;  1SZT A;  4YXW G;  1CPY A;  1Q7Y W;  1JVM A;  4DXW A;  4PDV A;  3ETG A;  1YIJ V;  1QVG U;  1I5Y A;  5IYD O;  1F51 A;  3MHH C;  2HG5 C;  2XAJ A;  1GO3 F;  4XDK A;  4X89 A;  3TCU A;  4DO2 A;  1K4C C;  4Z1M G;  3ZN1 A;  2IU0 A;  3M99 B;  4UV8 A;  2DW4 A;  3BEH A;  4CZZ A;  2B1I A;  3W7S A;  1OZ0 A;  1YTF D;  2IH1 C;  2X6B A;  3SPJ A;  2OTL V;  3ZMS A;  4P30 A;  1IXM A;  3LUT B;  3RVZ A;  1Q86 W;  4R7C A;  1WPX A;  5FL7 G;  3JD2 A;  3FB6 C;  1M57 C;  4X88 A;  2EIM B;  5EBL C;  3AG4 B;  4QE9 A;  2IJH A;  2WLI B;  3AG1 B;  2X6A A;  1W0K G;  4JGS A;  3RVY A;  3ZMU A;  1VQP V;  3OEH G;  5H6R A;  3JD0 A;  4QPJ A;  5CMU A;  4FPP A;  2ZQM A;  3JD4 A;  1AI6 A;  4MVS A;  2EIN B;  3IGA C;  1R3I C;  4HYO A;  4JTC B;  3W7T A;  3I55 V;  1R3J C;  2XAG A;  2OCC C;  4OXS A;  4RO2 A;  4TWK A;  4G2K A;  3K0G A;  5IYB O;  3CC2 V;  1JX9 A;  3X2Q B;  2EIK C;  2EIL B;  1V54 B;  2NNU A;  2HVJ C;  2W6J G;  3SPC A;  2ZR3 A;  3A0R A;  1MAB G;  1ZWI C;  1FXK B;  1JCH A;  2HR3 A;  4P9O A;  4RUE A;  1UJW B;  2EIM C;  2GHY A;  3AG4 C;  4MTG A;  3AG1 C;  1AJQ A;  3CCR V;  1BL8 A;  2AHY A;  5B1A B;  3QO5 A;  2Q67 A;  3BY6 A;  2HKO A;  1PNK A;  4MVO A;  1B6Q A;  1FXH A;  2EIN C;  4MVQ A;  3WG7 B;  1KD1 W;  2FTK A;  2IW5 A;  3G6E V;  1BMF G;  1CEZ A;  3K08 A;  1PNM A;  1YJN V;  1NBM G;  3T2M A;  2P67 A;  1JQ0 A;  4JYB A;  3CMA V;  4UV9 A;  1ROP A;  1XL6 A;  1DF4 A;  1OCC C;  2WLL A;  4ZKI A;  1VQ6 V;  4TT3 G;  4N21 A;  3T4Z A;  2XAH A;  3ZMT A;  1J95 A;  4XDJ A;  3X2Q C;  1S5H C;  2EIL C;  1M56 C;  3VOU A;  5LGT A;  5L3F A;  4GCZ A;  3CCS V;  3SYO A;  4WFE A;  2Y69 B;  1FXK C;  4X8A A;  2X7R B;  1NR7 A;  1R6K A;  2NLJ C;  2YSU B;  3OAA G;  5B1A C;  3F5W C;  4PA6 A;  3SPG A;  4H37 A;  1K4D C;  2XAS A;  1MOF A;  3K06 A;  2DWE C;  3P32 A;  3ZN0 A;  1GTO A;  3WG7 C;  3MHS C;  1SET A;  1AJN A;  1YI2 V;  2XAQ A;  1OCO B;  3DTU B;  2XND G;  4QPK A;  3TET A;  5LGN A;  3FKS G;  2UXX A;  4JAS A;  2OT5 A;  3EHB B;  4QE7 A;  2X0L A;  3ABU A;  1WLE A;  2HFE C;  3LDE A;  3AG2 B;  3ETE A;  5IDJ A;  4L87 A;  2DYR B;  1KP2 A;  2YEV B;  1VQ4 V;  2Y69 C;  5LGU A;  3CXC U;  5C93 A;  1PL0 A;  2WPD G;  1VQ7 V;  3OMI B;  1PD3 A;  2C2A A;  4GX0 A;  4KP4 A;  5B1B B;  2JJ1 G;  5H9C A;  5E1A C;  2BOC C;  5EK0 A;  3E8F A;  5L3D A;  1VQL V;  3STL C;  2EZO A;  4RAI A;  1L1F A;  1OCO C;  3OUF A;  5CBH A;  2EBO A;  3JCZ A;  5KUK A;  4WFG A;  3WFV A;  4HAM A;  4MVZ A;  2P7T C;  1MSW D;  3FB5 C;  3K0D A;  1NVP B;  3VBB A;  3ABK B;  2DWD C;  2KB1 A;  4GX2 A;  3AG2 C;  3T1C A;  5EBW C;  2A9H A;  1KP3 A;  1VQ9 V;  2DYR C;  4FIP C;  3OM3 B;  2IJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...