3CCRV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccrV00
3G6EV 1K73W 3CCVV 4WFAV 3CD6V 3CCLV 4WCEV 3CMEV 1YI2V 1Q7YW 1K9MW 1JJ2U 1VQNV 1VQKV 2QEXV 3G71V 3OW2U 2QA4V 1K8AW 1M1KW 1M90W 3CC7V 3CC2V 3G4SV 1VQ5V 1Q81W 2OTJV 3CPWU 1YJWV 1Q82W 3CCQV 1N8RW 5DM6V 3CCJV 1VQLV 4WFBV 1VQMV 1YHQV 1YJ9V 1S72V 1Q86W 1QVGU 1VQ8V 3CXCU 1KQSU 3CMAV 3CCUV 1QVFU 3CCMV 1YITV 3CCEV 1R73A 3CC4V 1YIJV 3CCRV 3CCSV 1YJNV 1VQOV 1KC8W 1KD1W 1VQ4V 4WF9V 1NJIW 1VQ6V 1VQPV 1VQ7V 2D3OW 1VQ9V 3I56V 1W2BU 3I55V 2OTLV
chains in the Genus database with same CATH superfamily
1TUBA 2V7QG 1SC5B 1EZVH 4BW9A 1M57C 3ZMVA 5KHJA 4PHZA 2QA4V 2N74A 1JMKC 1R6TA 4FZ1A 3B8NA 3BVOA 3TXSA 1EZJA 2A9HA 1HR0O 5IJ0B 4U3JA 1MMMA 3GWOA 1VQNV 4LH7A 4JF3A 3KCYA 3VBBA 2Y48A 4WFBV 2E3CA 3OR6C 5CBFA 1IVSA 4RUFA 2UUCO 1V9PA 4UVAA 4X8AA 4R50A 2AW9A 3N2GA 2UXDO 2BOBC 2ZIOA 4FFBB 2W6JG 3S3WA 1N0JA 3E8HA 4BIZA 2IBZH 4MVRA 2QEXV 4MVOA 3RYIB 1MG1A 4J9ZB 1EBOA 1HNZO 3UT5B 4IYIA 3B2EE 1H2GA 3JD3A 3CPWU 1S5HC 2KG7B 3JD0A 3ZEDA 1YSCA 1OCCB 1R1BA 1OV9A 4PJ0Z 5GONB 1M56B 4TOIA 2WA4A 3PN1A 4G27B 3G4SV 3JAMN 4LR3A 4QPKA 1FXKA 4X1YB 3ZMZA 3JCZA 4JAUA 1ZSPA 2XNDG 1NVPB 1RM1C 5KAIZ 4GKJO 3I55V 3TXQA 1WPXA 5IYCO 2X6CA 1V55C 3LNNA 2HHHO 1AI5A 3OAAG 4TV9A 3K0DA 5IJ9A 3ABUA 3CRQA 1J5EB 4B3SO 1RSOA 3H01A 4DYLA 1R73A 2VWJA 1I0HA 5LP6B 2F1MA 2QE7G 2NR5A 3L72H 2BTQA 2H94A 4U7OA 4OPHA 2BCCH 1O9GA 4X64B 3ETGA 4WBNA 3BY6A 3OT7A 2QKCA 3SPGA 1NZ6A 1WNSA 1N36B 2WLHA 2ZR3A 4N21A 3A0BZ 4FLTA 4W4LA 1PP9H 1K5SA 1GK9A 3ZHRA 4IT5A 4NTXA 3DTUB 1AI6A 5B1AB 3SYAA 3ETDA 1FJGB 3L70H 1XOUA 2PYJA 4A5UB 4IYHA 4WFHA 1AI4A 3N27A 2E5LB 4RQFA 1GN4A 1TGOA 1VF7A 1NQTA 1AJPA 1Q90D 2BE3A 1CXZB 4GX5A 4K3AA 2ZDIA 4DR5B 1SZTA 4H37A 4GLXA 2DMXA 4MVQA 2B1GA 2GTSA 4FM1A 1GN6A 2BTOA 3CRMA 3SDLA 2PGGA 3R66A 3N2KA 3DC6A 4I4TB 1NH2D 3FB7C 1BGYH 1GM9A 1GKFA 4O2AB 4Q20A 4QJFB 1KKCA 4JTCB 5KHKA 1QLEC 4NTYA 2LJ2A 2KQXA 1VQ6V 3ETEA 4DXWA 4GX0A 4O4IB 5DECA 3D3QA 4LF7B 2JGDB 1P4RA 1NS1A 2PYLA 1IBKO 1W0JG 2R9IA 2WLIA 5LOVA 3JAWA 3SYCA 4FLWA 4O4JB 3WFVA 1KP2A 1JFFA 4CH6A 2JEUA 1D5AA 1IX9A 2A7WA 5FNVB 2K9PA 2P90A 1J5EO 4LF9B 4P9PA 2DN9A 1V54B 1ZWIC 4FM0A 4DR3B 3RVZA 1N32B 4JI0B 1S77D 5H6QA 4X64O 4DV2O 4YJ3B 4UV9A 1BCCH 5LHGA 3K58A 2BSKA 2HKOA 5C8YA 4B08A 5LMNB 2QSAA 1B06A 1YZBA 2W0FC 3T1HB 1N36O 1RFYA 3G71V 5H9CA 3ZHSA 4JZGA 4O4LA 3QO8A 1XREA 1M57B 4BW5A 3E35A 2B9ZA 5CMUA 3K5MA 1Q82W 1G1XB 1KUQA 4MVSA 2LFRA 5JH7B 1VQLV 1S72V 5CN0A 1S76D 5H6RA 1VF6A 1PD3A 2DQ3A 1Q6UA 4C7UA 1Q43A 2ZM6O 3VQXA 3JATA 2YI8A 2PI5A 3LNMB 3HB3B 5L3BA 3E8FA 1S3JA 2NN4A 5IJ0A 5LGUA 2VQEB 2UUAB 3I5DA 4J7JA 4JPRA 5ITZB 5LMUO 1AJNA 4DR7B 5BR8B 4ASUG 3K59A 4DR5O 3SGIA 5BMVB 4UUJC 2EULA 5LHIA 4Q6GA 4NKGB 2ZE7A 4TT3G 1F4MA 3LSQA 1XBLA 3QG5A 4DV6O 1T5EA 3U11A 4FFBA 1BHAA 4GZRB 1DTOA 3RYIA 4X20A 4XBFA 4DW1A 2ETNA 2YEVB 1VIBA 2HVKC 4MTGA 3P32A 2KG7A 3OR7C 2IH1C 4DK1A 1S0VA 4NVPA 4J7KA 3RYCB 3EHBB 3T4ZA 2EZPA 5K1PA 1HW7A 1P49A 1FD9A 2EZOA 2Y69B 4LF7O 3GWKC 2ZD9A 3HKBA 3CCJV 3D3IA 5GONA 1IURA 4BIUA 1YITV 4PA4A 4JI1B 4OXSA 4X1YA 2OTLV 1RM1B 2ILMA 4GKKB 2E74B 3AG1C 3JSLA 1M9NA 1DF5A 3RT3C 4NXMB 3K0GA 5JQGA 1JQ0A 1K7DA 3UM7A 1V55B 3ZIAG 5BY1A 1OZ0A 4DR3O 2VWKA 2XTAA 4DUZB 2CGOA 1KP3A 1N32O 4JI0O 4B3MB 1IZ3A 3BEHA 3M99B 3KZIZ 1SQPH 1R6KA 4X1KB 1Y76A 1JJ2U 4X1IB 2GHYA 5LP6A 1AP5A 3ABMC 4MSWC 1FFXB 2YIAA 3KG2A 3A2FA 4N23A 1ZTEA 4QPJA 3CCRV 1AJQA 1Z5VA 2HG5C 2CTRA 3D8CA 2IW5A 3QVNA 2HP8A 3L71H 4B7EA 4LWSA 3HKEB 2ZQMA 1XNRB 1JOYA 2L35A 4UCVA 1FPOA 1XL6A 4I5SA 2HEPA 4DK0A 3F7YC 2VQEO 2Q0OC 1VQ7V 2D3OW 3U10A 4DO2A 4JI6B 3FD9A 4AI8A 4DR7O 4GYCB 2W0XA 5BR8O 3CCLV 4CS3A 3G67A 5EYPB 1Q6HA 4G28B 1VEWA 1EN4A 2ADQB 3SPCA 1IBLB 4ZIBA 4Z1MG 3ZRSA 1H2NA 4HZ3A 3OMIB 2QM8A 1NR1A 3STZC 1U97A 1VMGA 2AHZA 4UB8Z 2Q7GA 1H2SB 1XMOB 5LL6Y 2WSSG 3CP1A 3ZHUA 3FB5C 3CC7V 1KKDA 1ROPA 4QGPA 4PI0A 4QE9A 2P7TC 3STLC 2ZNIA 5B1BB 4CBCA 3D36C 4DR6B 2XASA 1N34B 3WU2Z 3IC7A 4O2AA 1AP6A 4I50B 1QLEB 2GUZB 4DV7O 2M6YA 3EXAA 2WLLB 1MNGA 2JS5A 5DEDA 3G6BA 3M8AA 4JV5B 2QTSA 4JI1O 3LSSA 3IFXA 2JGDA 3HKCA 1XEQA 4NXMO 5KA5A 1PL0A 1D2DA 2E75B 4FK5C 4ZI7B 4QE7A 1AI7A 1W0KG 3LDDA 4TV8A 3ASOC 3ZHQA 2FKXA 3GB7C 5FNVA 4ZKIA 1B6QA 4AQYB 2Y0IA 1G4YB 2P4KA 3CCQV 1YJ9V 1QHTA 2X0LA 3O9OA 3K06A 3CCUV 3OEHG 2ZIMA 4KUMA 3MD0A 3K08A 2JIZG 2PTMA 1K4DC 3UO3A 1TVKB 2ZXWC 4TUYB 5BXZA 3RN4A 3K5NA 4B7KA 1SETA 2WLNA 2DOSA 3A8TA 2DWEC 3CX5F 1VF5B 1VQ5V 4DV4B 4EFBA 4PI2A 1M4UA 1FYJA 5KHHA 1XILA 1YDXA 4YY3B 1XNRO 1H38A 4PA6A 1Y74B 5JJEB 4NTWA 3ZRXA 3ZRWB 4UVCA 5J2UB 5B66Z 3RYFA 5B5EZ 4LF5B 3W7SA 4FPPA 3A0HZ 2UXBB 2UXCB 1JX9A 3QTCA 3AG4C 3S3XA 4HNAB 1CP9A 1Q81W 4JI6O 5IYZB 2OTJV 5LA6B 2P5OA 4O2BB 3CC4V 4ABMA 1U96A 5IYDO 1PKXA 1SZXA 3BCCH 5A2QN 1UFIA 2VQFB 3OUFA 4JI7B 2Y69C 1BQ0A 1KBHA 2GV9A 2YXYA 4PD4F 4UV8A 4G2KA 2EX3A 5BMVA 1XMOO 2JEXA 4RUEA 3DXRB 1XHZA 1PNMA 4B3RB 4IIJA 4DRXB 1I94B 5JJJB 3CJHB 5J2TB 3BA8A 1PNKA 4JASA 3CD6V 4DR6O 3ZMSA 2Q6AA 1N34O 2AZ0A 2YEVA 1J95A 5LYJB 1N0NA 5JVDB 3ASNC 4GUNA 1TAEA 4JI3B 3RYCA 4LNUB 4DR2B 3FYEB 4DV5B 4F4LA 5KMGB 5LGNA 5KAFZ 3ETQA 4J42A 4PDVA 4NR1A 1WA8A 3T2MA 2CH7B 4O4HB 3SR2C 1K34A 3AG1B 3MAQA 2F93B 3IAYA 2LFSA 3PJSK 1S5LZ 2DE0X 5EBMC 1SERA 2JJ2G 4AQYO 2DYRC 1G6UA 4PA7A 2IJKA 3L74H 4FLVA 2WLMA 3TK1A 3MHHC 1OJHA 5LBQA 3MHSC 3WB2A 4JI4B 3K57A 2YIDA 2WPDG 3LDEA 4X1IA 4EKWA 2RMKB 3ABMB 5IYBO 1US6A 1K33A 1AILA 3JAKB 4DW0A 4RQEA 1QR9A 1GO3F 3OGIB 3SPIA 1FFXA 1YTFD 4YY3O 3OM3B 3SPJA 4UCOA 1N4CA 1H2LA 1UJWB 4K0KB 1UPGA 2YC0A 5EC1C 3OMAB 2QWNB 2Z5UA 4LF5O 2WA3A 2YDEA 4R6ZA 2ITDC 4E4EA 2UXBO 1EM1A 4DV0B 2LGQA 2XAGA 3HKEA 3LSUA 1EFRG 2GSMB 1VQ9V 1YVWA 1R3KC 5EZYB 2OIEA 4JGSA 4FLYA 1Q6IA 1R3JC 4DV1B 2EBOA 3EFFK 2XUMA 4MW3A 5HFMA 4WFFA 2UU9B 2Q73A 2DQ0A 2D2CB 5B1BC 2CTPA 3P30A 3OTOB 2VQFO 2AHYA 5IDJA 5EYPA 2QWRB 1OCOC 3TETA 3FYIB 1M5IA 3BHPA 2X6BA 1K97A 3I56V 2QKAA 4QIWF 4FLUA 1VQKV 4PDLA 4I55B 5B3SC 4D7SA 3SJQC 3ZN0A 4K8ZA 1AR4A 3ABKC 1KMIZ 4MS2A 5B1OA 1SQXH 1MOFA 1WP7A 5FLXN 4HAMA 1PV0A 4P30A 4YHHB 1SS3A 4E2LA 4DV3B 4DUYB 1K73W 1B3QA 4JI3O 5EBWC 4DR2O 1GN3A 3Q4HA 3CS5A 4BR6A 4DV5O 1NTZH 2CTWA 4I50A 1OCRC 1TUBB 2WLLA 4LH6A 1SESA 3ZMTA 3E83A 2Q7HA 1QR8A 3OE7G 4ICGA 1MZEA 1ZLZA 2ODMA 4UFZA 2YUAA 4CH3A 4LFCB 2A79B 3SYQA 5IY5C 4X65B 4ZI7A 1QCEA 3C3TA 1KB9F 3W7UA 4ZBMA 3ASOB 2WAMA 3ZRVA 1NKDA 1Q86W 1NVPD 5KX5B 4JI2B 2ADPA 2ARHA 2QWQB 5EIBC 2HJFC 1FJGO 3UO2A 1FXHA 1YCIA 4LF4B 1SQQH 1JR9A 1IXBA 1MA1A 2JJ1G 2UXNA 2ZXWB 2RN9A 2WWWA 4TWKA 4F6RB 2E5LO 4JZ2A 3RGBA 4OX9B 3R65A 1BL8A 1VQMV 3CRRA 1MABG 3SYPA 4K0KO 4R7CA 5KLVH 2P4VA 2W6IG 4WFAV 4LC1A 4DV0O 2EILC 2EIMC 1Y74A 2FL4A 4CC5A 3ZRWA 5J2UA 1E79G 3VQYA 4ZOLB 2QM4A 3AG4B 4KXRA 4LFAB 1SQFA 2ZE5A 2M7WA 3UT5A 3AK3A 3E22B 5IYZA 1H8EG 3OTOO 3FKSG 3H1IH 3GVMA 5LA6A 4O2BA 1JPXA 1ZL8B 3DSQA 1S5JA 3K9SA 1K3EA 3OMNB 3T4DA 1RPRA 4MVMA 4XDJA 4L87A 4FIPC 3JASB 5KUMA 4UXNA 4LCUC 3AG7A 2Q8VA 2Q7EA 4JI5B 4X9QA 3SJAC 1N33B 5IT9N 4WFGA 3OGCC 1SKVA 2ZT9B 3WB0A 2PZSA 4FJCC 3G80A 5H5NA 2FMLA 1NBMG 4JAVA 2DYSC 4JI8B 3B77A 4DRXA 1MZFA 4YHHO 4DV3O 5J2TA 3CJHA 1IBMB 3ABLC 5GW7A 2BTQB 1XL4A 1E1QG 2G38A 2OCCC 4GX2A 3CXCU 3FB6C 2EJ7A 4LF6B 4LF9O 3B8MA 3ASNB 3E2EA 4P2ZA 5LYJA 4BAYA 4CH5A 2ZCEA 2K1EA 1K5QA 4WBNB 3T1YB 3QF7A 3K5LA 3AG3C 1K8AW 2N04A 4YJ2B 4X66B 3ZMUA 5LMNO 4I0XB 3J81N 4DR4B 3K79A 2HJDA 2PF4E 2CH7A 3T1HO 2IJIA 2XAQA 1YJNV 3BPZA 5F2VO 1QLNA 1VQPV 3ZHVA 2DYRB 4J7ZA 1Y6XA 3APQA 1H2MA 1I08A 2RQ6A 2F95B 4LF4O 2Z0AA 3X2QC 4YIOA 1FXVA 1WLEA 4JTAB 3CB2A 1PPJH 1SQGA 2UUAO 2MK3A 3JARB 4B3TB 2CDYA 3H1JH 2OIGA 2XHBA 4NB5A 5L3EA 2ZKOA 3OW2U 1COWG 3JAKA 5K1XA 1YJWV 1JCHA 3K5OA 2A06H 2FTKA 3RVYA 3MDSA 3AK2A 4J11A 5AG2A 4UCSA 4JYBA 4LFAO 4AHCA 5A9GA 3JCUZ 1GMGA 2CK3G 5B1NA 5EZYA 3O65A 3HKDB 5GTHZ 1GM8A 1LR1A 5D5QA 4I4TA 4WFEA 2XAJA 4K8XA 5FL7G 2WLIB 1QU7A 3DC5A 4X62B 1OCOB 1W2BU 2LO1A 2LW7A 5LGTA 2FYUH 4TQFA 4JI5O 1WPBA 2Q0AA 3OD4A 5CA0B 3RW0A 4GKJB 5JCOA 4O4IA 1JVMA 4FLXA 4GKKO 5B3SB 1JJOA 2P22C 2YSUB 2JVDA 2Q4PA 5CB4B 4JI8O 3ABKB 1FKAO 2RCVA 1YIJV 2JK5C 3FFQA 4O4JA 2GBOA 4J9YB 1CPYA 3AG2C 4LFBB 4LF6O 4KP4A 2A3QA 4WCEV 3OEEG 5JWPA 2O57A 5EC2C 4Z1VA 3D36A 4DUZO 2UUBB 2BSKB 4B3MO 3T1YO 5DM6V 3H1KH 1Y66A 1HDJA 1JA8A 2X6AA 1OCRB 1H2KA 3UKMA 4J10A 5L3DA 3BRCA 1A32A 5FPOA 5BZBA 4YJ3A 1MSWD 1YI2V 2NNUA 4UB6Z 1Q3EA 3RFRA 3K04A 4U7NA 1NH2B 1N8RW 5IY5B 1ZAUA 3JATB 3HPLC 3BAAA 4JYAB 2Y4TA 3VOUA 2Q67A 1L0NH 2R9AA 1P84F 5JH7A 2NLJC 5CA3A 1QNMA 5KX5A 2CAZC 1QBZA 4PV1B 4PELA 2P06A 3SPHA 1L1FA 3JALB 4MW8A 4I7ZB 4NXNB 3CYOA 4B3TO 1EN6A 2R72A 4J41A 2ATKC 4F6RA 3ZN1A 3F7VC 3P3PA 3K3WA 1FXKC 3B4SA 1W59A 5ITZA 3FX7A 1IBLO 3CRAA 3G6EV 1G8MA 4UCTA 4DR1B 3P3NA 2QR4A 4X20B 3OTFA 4JTDB 2KKWA 1P7BA 3A0RA 3T1CA 2DWDC 2QWOB 1L0LH 1NR7A 1NI8A 2QM7A 2EILB 2EIMB 3QO7A 2GDSA 1I5YA 3ZX6A 3B09A 1GTOA 2EINC 2JDIG 4ZOLA 2F4VB 1K4CC 2F66C 3HKBB 1X4TA 4JAAA 4LBEC 1ZUQA 4H44B 2YIBD 3J80N 3E22A 2VS0A 1URFA 5EK0A 4L8JA 1YF2A 3BABA 4X62O 1AR1B 1FAFA 1SRYA 4EB6B 1BMFG 1SA0B 4X88A 4LF8B 1VQ8V 1ZL8A 1AB3A 3E86A 3W7WA 1IBKB 2EIJC 5J9PC 4RAIA 3C90A 1OCZC 3OUSA 1KC8W 4JV5O 5JQGB 1SQBH 1L8DA 2PI4A 3JASA 4HBNA 3ABTA 4KL1A 3HR0A 3ZHTA 2DYSB 4LFBO 1FS0G 1XMQB 5E1AC 1Y76B 3JD4A 3FAVB 3CCMV 1Q5OA 3ABLB 2UUBO 1BS3A 2OCCB 1F51A 3ICXA 3WG7C 4DV2B 5KUKA 4IHJB 1HP8A 1M1KW 1F23A 4H33A 3VQVA 3AG3B 2XAHA 5GTIZ 4X1KA 1HNXB 1M93A 1E1RG 1ORQC 4YJ2A 2UXXA 2ZDIC 1IXMA 4I0XA 4LWSB 1NJIW 5JJNB 1WN7A 4DV4O 1XHXA 4Z2WA 4JYCA 3B40A 2XAFA 1D5NA 1IDSA 2F23A 4W4KA 3IJ4A 1H8HG 2B5UA 2ITCC 3CWBH 4AILC 4JYAO 2N05A 1THZA 3UQ8A 1BZKA 4XDLA 2ZM6B 5CA1B 1QVGU 4OGQB 1EN5A 2UXCO 3X2QB 1XI1A 4NXNO 4NYKA 2YIBA 3JSNA 4IL6Z 3AK1A 4MTFA 1LNQA 5LMUB 3H9VA 1XNQB 1DK1A 3CSXA 2ZNJA 4ZHQB 2OCHA 2OT5A 3JARA 5IWAB 2BOCC 3RYHB 4DR1O 2H8PC 5L3GA 4JI7O 4HYOA 3QO5A 2IJJA 4UCUA 3L9DA 4H13B 3F5WC 1O9HA 3H1HH 2ZE6A 2QTOA 2JS3A 1FFTB 4DV6B 1TA8A 1Q7YW 2RNBA 3VQWA 2FB5A 1Y67A 4GT1A 3CC2V 1RPOA 4B3RO 3TGUH 2F4VO 1XUQA 1I94O 4MVUA 5L3CA 2MW2B 4X89A 1HNWB 3IGAC 2CE4A 4MT8A 4J80A 2V1DA 1X59A 5EIBD 2KSDA 3HKDA 2AGAA 5H2FZ 5E79Z 4LF8O 2HVJC 3HKCB 5LXTB 5EBLC 3EVKA 1XQ8A 3CXHF 3BA9A 4P9OA 2EIKC 5KHGA 2GUZA 2B1IA 3W7TA 2IU3A 3L73H 4TV8B 3LUTB 3L75H 4MTXA 5CA0A 1GRJA 5LHHA 4YXWG 1MSDA 1XMQO 1VF6C 2YXHA 2Q5ZA 1RP3B 5CB4A 1NTKH 1WP8A 3AG2B 3NR7A 4KFMA 4EEQA 4TSFG 3KKYA 2P6JA 1KU9A 4U3JB 3ZS8C 1AR5A 2RDCA 3APOA 2EJRA 1Y4MA 3CE2A 4JI4O 3NXSA 2V4DA 1HNXO 3ZCCA 1I7FA 1TUEB 3CEIA 5HFLA 1LUVA 1TVKA 2C2AA 2X7RB 2LP7A 3N2GB 4TUYA 3RYFB 5CBHA 1YHQV 1F7YA 1GH6A 2VRZA 2PUSA 3JYCA 3JD2A 2WLJA 2CTQA 1ZX3A 2E76B 3DGEA 2JGUA 1SQVH 3K03A 2HR3A 3CMEV 2PY5A 4FLZA 1OCCC 1NU1H 4FVMA 1XNQO 4DV1O 2WLKA 3THOA 4PA9A 1BQZA 2R9RB 1PM9A 3JALA 4HNAA 2UU9O 2L6LA 5IWAO 4TQDA 4RWUA 1M56C 3H1LH 4JYYA 4CZZA 4H0LB 3TJTA 1FXKB 2Q69A 2Q9LA 2DJVA 5IE9A 1F4NA 1GM7A 4IIJB 4QNHB 3LDCA 3CMAV 2R70A 2YXLA 5KHIA 1Z5WA 4BIOA 4R8CA 2OWOA 4GCZA 1VQOV 2IU0A 3KCXA 2GTAA 4FFKA 2EINB 3DXRA 1HNWO 2CGNA 4TV9B 2XOKG 5IJ9B 4PA3A 1NTMH 1R3IC 1RSOB 2Y4UA 4MVZA 1XDCA 2AZ2A 1AROP 3RWRD 4DUYO 2YICA 4DV7B 5LP6C 1WA8B 2QKSA 4YIPA 1DGSA 3F5TA 4KHPB 4EB6A 1SA0A 1WAZA 2EIJB 5TISZ 3UCSC 5JVDA 1OCZB 2H3OA 2LQTA 3ZBHA 4D6TH 5C93A 4LNUA 1BSMA 3TCUA 1QQCA 1BT8A 2QDOA 5KMGA 2ZR2A 3QNEA 4D7TA 4EFEA 1KQSU 2P67A 4LFCO 4IGGA 4X65O 4O4HA 4CS4A 4CC6A 2YI9A 1Q8IA 2QWPB 1KYOF 2QJ1A 1DLBA 3FAVA 3WG7B 2IM9A 4FM2A 4UVBA 2HFEC 4FZ0A 4JI2O 1CEZA 5B1AC 1M90W 2KB1A 1WB8A 1WB7A 1YXBA 3ZJZA 1PL4A 4FMTA 1HR0B 4IHJA 1YEWA 3E8GA 2Z3YA 2Y0PA 1VQ4V 4WF9V 4OX9O 2RJZA 1P7GA 4CH4A 4I9QA 1K9MW 1I5XA 2XT9A 1WJZA 3FB8C 2UUCB 1NT2B 1R3LC 1SF9A 2UXDB 4OPAA 4LP8A 4I9WA 3E89A 1ENVA 2LGWA 3N2KB 1HWYA 3RBZA 3CHXA 3CCEV 3K9AA 3CCSV 4PDRA 5DN6G 1LUWA 1HNZB 5CA1A 3C3SA 3SJBC 1GN2A 2LW1A 4K35A 3AEIA 3M7MX 5FPRA 1VARA 1AVMA 2F43G 4XDKA 1R6NA 1K92A 1VP7A 1OHHG 4BWAA 1BHBA 1Z2GA 1QVFU 2ZINA 5JCOC 4ZHQA 4U3FH 5LOVB 3JAWB 3SYOA 3RYHA 1B04A 1BE3H 3JD1A 3CCVV 5D5PA 1JFFB 5L3FA 4GX1A 3SJCC 1KECA 1N33O 1DF4A 4F6EA 3CRCA 2JRIA 2CUGA 2Q68A 3W7XA 2IJHA 2AXTZ 4I55A 3Q4HB 1PNLA 2HHHB 3WB1A 3IC9A 1IBMO 3E8BA 3BFRA 1V54C 2YS8A 4CS2A 1YTFB 4B3SB 4KHPO 2QGNA 2HLDG 4PDMA 5C8YB 3OFNG 2DW4A 5LXTA 2IH3C 2ZE8A 1GAXA 4RO2A 5KA6A 2EIKB 3J7AU 4MTOA 4X66O 1KD1W 2OYQA 4O4LB 3U0ZA 3ML0A 5CBGA 4DR4O 2A0LA 4UCRA
chains in the Genus database with same CATH topology
2V7QG 1R6KA 1JJ2U 1M57C 3ZMVA 5KUKA 2A79B 3SYQA 2QA4V 1M1KW 5IY5C 1F23A 4H33A 2GHYA 1QCEA 3W7UA 4ZBMA 3AG3B 3ASOB 2WAMA 2XAHA 3ABMC 3ZRVA 1NKDA 1Q86W 4MSWC 1NVPD 1E1RG 1ORQC 3B8NA 3KG2A 1EZJA 2UXXA 4N23A 2ZDIC 4QPJA 1IXMA 3CCRV 1NJIW 1AJQA 2HG5C 2HJFC 2A9HA 4JYCA 2IW5A 2XAFA 1FXHA 3GWOA 2JJ1G 2UXNA 1VQNV 2ZXWB 1H8HG 2B5UA 2ITCC 2WWWA 4JF3A 4TWKA 1THZA 3VBBA 2ZQMA 1JOYA 4XDLA 3R65A 2Y48A 4I5SA 1XL6A 1QVGU 1BL8A 4WFBV 1VQMV 3OR6C 5CBFA 4RUFA 1MABG 3F7YC 3SYPA 4UVAA 3X2QB 4R7CA 4X8AA 4R50A 1VQ7V 2D3OW 4MTFA 2BOBC 4DO2A 1LNQA 2W6JG 2W6IG 4WFAV 4LC1A 3E8HA 4BIZA 3CCLV 2EILC 4MVRA 2EIMC 2QEXV 4MVOA 1MG1A 4J9ZB 1EBOA 4G28B 3ZRWA 1E79G 1H2GA 3JD3A 3CPWU 2OT5A 3SPCA 1S5HC 2BOCC 3AG4B 2H8PC 4Z1MG 5L3GA 3ZRSA 4HZ3A 3OMIB 2QM8A 4HYOA 3JD0A 3QO5A 1NR1A 2IJJA 2M7WA 3STZC 1YSCA 1OCCB 3F5WC 1H8EG 2QTOA 3FKSG 1FFTB 2AHZA 1Q7YW 1JPXA 2WSSG 1K3EA 3CP1A 1M56B 3FB5C 3CC7V 4GT1A 3CC2V 3OMNB 1RPOA 3T4DA 3G4SV 4G27B 1RPRA 1KKDA 4QPKA 4MVMA 4XDJA 1ROPA 4L87A 4FIPC 4QE9A 2P7TC 4MVUA 3STLC 5L3CA 1FXKA 5B1BB 3ZMZA 3JCZA 4CBCA 4JAUA 4X89A 2XNDG 5KUMA 2XASA 3IGAC 4LCUC 4UXNA 4MT8A 1RM1C 1NVPB 2V1DA 3IC7A 4WFGA 3OGCC 1QLEB 3I55V 4FJCC 2HVJC 2WLLB 5EBLC 1WPXA 5IYCO 1NBMG 4JAVA 2DYSC 2X6CA 1V55C 3B77A 3LSSA 3IFXA 1AI5A 4P9OA 3OAAG 2EIKC 3ABLC 5GW7A 2B1IA 1XL4A 3W7TA 2IU3A 1E1QG 3K0DA 4GX2A 2OCCC 3ABUA 3CXCU 3FB6C 3LUTB 3H01A 4MTXA 3B8MA 1R73A 5KA5A 1PL0A 3ASNB 3E2EA 4P2ZA 4FK5C 4BAYA 2K1EA 4QE7A 4YXWG 5LHHA 2QE7G 1K5QA 2H94A 4U7OA 1AI7A 1W0KG 3LDDA 3AG3C 3ASOC 1K8AW 3AG2B 3GB7C 4KFMA 4ZKIA 1B6QA 3ZMUA 3ETGA 4TSFG 2P6JA 3BY6A 1G4YB 3CCQV 3K79A 1YJ9V 3SPGA 2X0LA 3K06A 3CCUV 3OEHG 2IJIA 2EJRA 2XAQA 2WLHA 4KUMA 3MD0A 1YJNV 3K08A 1QLNA 1Y4MA 2JIZG 2ZR3A 1K4DC 1VQPV 2ZXWC 3NXSA 4N21A 2DYRB 3ZCCA 1K5SA 1GK9A 1SETA 2WLNA 1TUEB 5HFLA 2DWEC 1VQ5V 2C2AA 3DTUB 2X7RB 1AI6A 2LP7A 5B1AB 3SYAA 3ETDA 3X2QC 5CBHA 1YHQV 1FXVA 1WLEA 4JTAB 1H38A 3JYCA 4PA6A 3JD2A 4WFHA 1AI4A 2WLJA 4RQFA 3ZRXA 3ZRWB 3DGEA 4UVCA 2MK3A 3K03A 3W7SA 2HR3A 4FPPA 3CMEV 1NQTA 5L3EA 1AJPA 3OW2U 1JX9A 3AG4C 1COWG 1CP9A 1Q81W 2OTJV 1YJWV 1JCHA 4GX5A 2ZDIA 1SZTA 4H37A 2FTKA 4MVQA 3RVYA 2B1GA 1OCCC 2WLKA 4PA9A 2R9RB 3CC4V 5IYDO 1PKXA 4JYBA 1M56C 3OUFA 4CZZA 1FXKB 2Q69A 2Y69C 1NH2D 3FB7C 1F4NA 1GM7A 4UV8A 1GMGA 1GM9A 2CK3G 4G2KA 5B1NA 4QNHB 1GKFA 1GM8A 4Q20A 2JEXA 4RUEA 4QJFB 3LDCA 3CMAV 4WFEA 2XAJA 4JTCB 4R8CA 5FL7G 1QLEC 4GCZA 2WLIB 1PNMA 1VQOV 2IU0A 1VQ6V 3ETEA 4DXWA 4GX0A 1OCOB 1W2BU 2EINB 1PNKA 4JASA 3CD6V 1P4RA 5LGTA 1W0JG 2XOKG 3ZMSA 2Q6AA 4PA3A 2R9IA 2WLIA 1R3IC 2YEVA 3SYCA 4MVZA 3RW0A 1J95A 3WFVA 1KP2A 1JVMA 1AROP 5B3SB 3ASNC 2JEUA 2YSUB 3ABKB 1YIJV 2JK5C 2QKSA 3FYEB 4F4LA 4J9YB 2EIJB 5LGNA 2P90A 1CPYA 3AG2C 1OCZB 4KP4A 5C93A 4PDVA 4WCEV 3OEEG 3TCUA 3T2MA 5EC2C 4P9PA 1V54B 1ZWIC 3D36A 3RVZA 1K34A 3AG1B 2ZR2A 3QNEA 1S77D 5DM6V 2LFSA 5H6QA 1Y66A 3PJSK 1KQSU 4UV9A 2P67A 5EBMC 2X6AA 1OCRB 5LHGA 2JJ2G 1SERA 2DYRC 2HKOA 4PA7A 2IJKA 3UKMA 5L3DA 1DLBA 2WLMA 5BZBA 3TK1A 3MHHC 3WG7B 1MSWD 1YI2V 2W0FC 4UVBA 2HFEC 2NNUA 1CEZA 5B1AC 5LBQA 3G71V 2KB1A 5H9CA 1M90W 3K04A 3QO8A 3ZJZA 3MHSC 1M57B 4BW5A 3E35A 5CMUA 1Q82W 4U7NA 1NH2B 4FMTA 2LFRA 4MVSA 1N8RW 5IY5B 1VQLV 1S72V 2WPDG 5CN0A 1S76D 3LDEA 4EKWA 5H6RA 3HPLC 3ABMB 3E8GA 2Z3YA 5IYBO 1PD3A 1K33A 1VQ4V 3VOUA 2DQ3A 4WF9V 2Q67A 4RQEA 1QR9A 1GO3F 3SPIA 2NLJC 5CA3A 1YTFD 1K9MW 3OM3B 3LNMB 3SPJA 2PI5A 1QBZA 1I5XA 3HB3B 5L3BA 3FB8C 3E8FA 4PELA 1UJWB 3SPHA 1L1FA 1S3JA 4MW8A 5EC1C 1R3LC 3CYOA 5LGUA 3OMAB 4JPRA 2Z5UA 4R6ZA 4LP8A 2ITDC 4I9WA 3E89A 1AJNA 1ENVA 2ATKC 4ASUG 1HWYA 2XAGA 3ZN1A 3RBZA 3CCEV 3F7VC 3K9AA 3CCSV 4PDRA 5DN6G 1EFRG 3K3WA 2GSMB 1FXKC 1VQ9V 4UUJC 1R3KC 4JGSA 5LHIA 3G6EV 3AEIA 1G8MA 1R3JC 2EBOA 4JTDB 1P7BA 3A0RA 3T1CA 2DWDC 3EFFK 4MW3A 4TT3G 1F4MA 1NR7A 3LSQA 4WFFA 5HFMA 2QM7A 2DQ0A 2F43G 4XDKA 2EILB 5B1BC 2EIMB 3QO7A 3P30A 1R6NA 1K92A 1BHAA 2AHYA 1OHHG 1BHBA 1DTOA 5IDJA 1QVFU 1I5YA 1OCOC 3TETA 3FYIB 4XBFA 1GTOA 2EINC 3SYOA 2YEVB 2JDIG 2X6BA 1K97A 3I56V 2HVKC 4MTGA 3P32A 1K4CC 3JD1A 3CCVV 3OR7C 2IH1C 1S0VA 5L3FA 4LBEC 4GX1A 4QIWF 1VQKV 4PDLA 1KECA 3EHBB 3T4ZA 2EZPA 5B3SC 5EK0A 2EZOA 3SJQC 1DF4A 2Y69B 1AR1B 3ZN0A 3W7XA 1SRYA 2Q68A 2ZD9A 3ABKC 4MS2A 1BMFG 3CCJV 4X88A 5B1OA 2IJHA 1VQ8V 1MOFA 3D3IA 3E86A 3W7WA 4HAMA 2EIJC 4BIUA 5J9PC 4P30A 4RAIA 1YITV 1OCZC 3OUSA 4PA4A 1KC8W 1PNLA 4E2LA 4OXSA 3E8BA 2OTLV 1RM1B 1V54C 1K73W 5EBWC 2PI4A 3AG1C 1M9NA 1YTFB 1DF5A 3ABTA 3K0GA 2HLDG 1JQ0A 4PDMA 1K7DA 3OFNG 3UM7A 2DYSB 1OCRC 1V55B 3ZIAG 1FS0G 2DW4A 2IH3C 5E1AC 1OZ0A 2WLLA 3ZMTA 1SESA 3JD4A 4RO2A 5KA6A 2EIKB 3CCMV 3ABLB 3E83A 4MTOA 1KD1W 2OCCB 1KP3A 1F51A 1QR8A 3WG7C 3OE7G 3ML0A 5CBGA 3BEHA 2A0LA 3M99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E V;  1K73 W;  3CCV V;  4WFA V;  3CD6 V;  3CCL V;  4WCE V;  3CME V;  1YI2 V;  1Q7Y W;  1K9M W;  1JJ2 U;  1VQN V;  1VQK V;  2QEX V;  3G71 V;  3OW2 U;  2QA4 V;  1K8A W;  1M1K W;  1M90 W;  3CC7 V;  3CC2 V;  3G4S V;  1VQ5 V;  1Q81 W;  2OTJ V;  3CPW U;  1YJW V;  1Q82 W;  3CCQ V;  1N8R W;  5DM6 V;  3CCJ V;  1VQL V;  4WFB V;  1VQM V;  1YHQ V;  1YJ9 V;  1S72 V;  1Q86 W;  1QVG U;  1VQ8 V;  3CXC U;  1KQS U;  3CMA V;  3CCU V;  1QVF U;  3CCM V;  1YIT V;  3CCE V;  1R73 A;  3CC4 V;  1YIJ V;  3CCR V;  3CCS V;  1YJN V;  1VQO V;  1KC8 W;  1KD1 W;  1VQ4 V;  4WF9 V;  1NJI W;  1VQ6 V;  1VQP V;  1VQ7 V;  2D3O W;  1VQ9 V;  3I56 V;  1W2B U;  3I55 V;  2OTL V; 
#chains in the Genus database with same CATH topology
 1TUB A;  2V7Q G;  1SC5 B;  1EZV H;  4BW9 A;  1M57 C;  3ZMV A;  5KHJ A;  4PHZ A;  2QA4 V;  2N74 A;  1JMK C;  1R6T A;  4FZ1 A;  3B8N A;  3BVO A;  3TXS A;  1EZJ A;  2A9H A;  1HR0 O;  5IJ0 B;  4U3J A;  1MMM A;  3GWO A;  1VQN V;  4LH7 A;  4JF3 A;  3KCY A;  3VBB A;  2Y48 A;  4WFB V;  2E3C A;  3OR6 C;  5CBF A;  1IVS A;  4RUF A;  2UUC O;  1V9P A;  4UVA A;  4X8A A;  4R50 A;  2AW9 A;  3N2G A;  2UXD O;  2BOB C;  2ZIO A;  4FFB B;  2W6J G;  3S3W A;  1N0J A;  3E8H A;  4BIZ A;  2IBZ H;  4MVR A;  2QEX V;  4MVO A;  3RYI B;  1MG1 A;  4J9Z B;  1EBO A;  1HNZ O;  3UT5 B;  4IYI A;  3B2E E;  1H2G A;  3JD3 A;  3CPW U;  1S5H C;  2KG7 B;  3JD0 A;  3ZED A;  1YSC A;  1OCC B;  1R1B A;  1OV9 A;  4PJ0 Z;  5GON B;  1M56 B;  4TOI A;  2WA4 A;  3PN1 A;  4G27 B;  3G4S V;  3JAM N;  4LR3 A;  4QPK A;  1FXK A;  4X1Y B;  3ZMZ A;  3JCZ A;  4JAU A;  1ZSP A;  2XND G;  1NVP B;  1RM1 C;  5KAI Z;  4GKJ O;  3I55 V;  3TXQ A;  1WPX A;  5IYC O;  2X6C A;  1V55 C;  3LNN A;  2HHH O;  1AI5 A;  3OAA G;  4TV9 A;  3K0D A;  5IJ9 A;  3ABU A;  3CRQ A;  1J5E B;  4B3S O;  1RSO A;  3H01 A;  4DYL A;  1R73 A;  2VWJ A;  1I0H A;  5LP6 B;  2F1M A;  2QE7 G;  2NR5 A;  3L72 H;  2BTQ A;  2H94 A;  4U7O A;  4OPH A;  2BCC H;  1O9G A;  4X64 B;  3ETG A;  4WBN A;  3BY6 A;  3OT7 A;  2QKC A;  3SPG A;  1NZ6 A;  1WNS A;  1N36 B;  2WLH A;  2ZR3 A;  4N21 A;  3A0B Z;  4FLT A;  4W4L A;  1PP9 H;  1K5S A;  1GK9 A;  3ZHR A;  4IT5 A;  4NTX A;  3DTU B;  1AI6 A;  5B1A B;  3SYA A;  3ETD A;  1FJG B;  3L70 H;  1XOU A;  2PYJ A;  4A5U B;  4IYH A;  4WFH A;  1AI4 A;  3N27 A;  2E5L B;  4RQF A;  1GN4 A;  1TGO A;  1VF7 A;  1NQT A;  1AJP A;  1Q90 D;  2BE3 A;  1CXZ B;  4GX5 A;  4K3A A;  2ZDI A;  4DR5 B;  1SZT A;  4H37 A;  4GLX A;  2DMX A;  4MVQ A;  2B1G A;  2GTS A;  4FM1 A;  1GN6 A;  2BTO A;  3CRM A;  3SDL A;  2PGG A;  3R66 A;  3N2K A;  3DC6 A;  4I4T B;  1NH2 D;  3FB7 C;  1BGY H;  1GM9 A;  1GKF A;  4O2A B;  4Q20 A;  4QJF B;  1KKC A;  4JTC B;  5KHK A;  1QLE C;  4NTY A;  2LJ2 A;  2KQX A;  1VQ6 V;  3ETE A;  4DXW A;  4GX0 A;  4O4I B;  5DEC A;  3D3Q A;  4LF7 B;  2JGD B;  1P4R A;  1NS1 A;  2PYL A;  1IBK O;  1W0J G;  2R9I A;  2WLI A;  5LOV A;  3JAW A;  3SYC A;  4FLW A;  4O4J B;  3WFV A;  1KP2 A;  1JFF A;  4CH6 A;  2JEU A;  1D5A A;  1IX9 A;  2A7W A;  5FNV B;  2K9P A;  2P90 A;  1J5E O;  4LF9 B;  4P9P A;  2DN9 A;  1V54 B;  1ZWI C;  4FM0 A;  4DR3 B;  3RVZ A;  1N32 B;  4JI0 B;  1S77 D;  5H6Q A;  4X64 O;  4DV2 O;  4YJ3 B;  4UV9 A;  1BCC H;  5LHG A;  3K58 A;  2BSK A;  2HKO A;  5C8Y A;  4B08 A;  5LMN B;  2QSA A;  1B06 A;  1YZB A;  2W0F C;  3T1H B;  1N36 O;  1RFY A;  3G71 V;  5H9C A;  3ZHS A;  4JZG A;  4O4L A;  3QO8 A;  1XRE A;  1M57 B;  4BW5 A;  3E35 A;  2B9Z A;  5CMU A;  3K5M A;  1Q82 W;  1G1X B;  1KUQ A;  4MVS A;  2LFR A;  5JH7 B;  1VQL V;  1S72 V;  5CN0 A;  1S76 D;  5H6R A;  1VF6 A;  1PD3 A;  2DQ3 A;  1Q6U A;  4C7U A;  1Q43 A;  2ZM6 O;  3VQX A;  3JAT A;  2YI8 A;  2PI5 A;  3LNM B;  3HB3 B;  5L3B A;  3E8F A;  1S3J A;  2NN4 A;  5IJ0 A;  5LGU A;  2VQE B;  2UUA B;  3I5D A;  4J7J A;  4JPR A;  5ITZ B;  5LMU O;  1AJN A;  4DR7 B;  5BR8 B;  4ASU G;  3K59 A;  4DR5 O;  3SGI A;  5BMV B;  4UUJ C;  2EUL A;  5LHI A;  4Q6G A;  4NKG B;  2ZE7 A;  4TT3 G;  1F4M A;  3LSQ A;  1XBL A;  3QG5 A;  4DV6 O;  1T5E A;  3U11 A;  4FFB A;  1BHA A;  4GZR B;  1DTO A;  3RYI A;  4X20 A;  4XBF A;  4DW1 A;  2ETN A;  2YEV B;  1VIB A;  2HVK C;  4MTG A;  3P32 A;  2KG7 A;  3OR7 C;  2IH1 C;  4DK1 A;  1S0V A;  4NVP A;  4J7K A;  3RYC B;  3EHB B;  3T4Z A;  2EZP A;  5K1P A;  1HW7 A;  1P49 A;  1FD9 A;  2EZO A;  2Y69 B;  4LF7 O;  3GWK C;  2ZD9 A;  3HKB A;  3CCJ V;  3D3I A;  5GON A;  1IUR A;  4BIU A;  1YIT V;  4PA4 A;  4JI1 B;  4OXS A;  4X1Y A;  2OTL V;  1RM1 B;  2ILM A;  4GKK B;  2E74 B;  3AG1 C;  3JSL A;  1M9N A;  1DF5 A;  3RT3 C;  4NXM B;  3K0G A;  5JQG A;  1JQ0 A;  1K7D A;  3UM7 A;  1V55 B;  3ZIA G;  5BY1 A;  1OZ0 A;  4DR3 O;  2VWK A;  2XTA A;  4DUZ B;  2CGO A;  1KP3 A;  1N32 O;  4JI0 O;  4B3M B;  1IZ3 A;  3BEH A;  3M99 B;  3KZI Z;  1SQP H;  1R6K A;  4X1K B;  1Y76 A;  1JJ2 U;  4X1I B;  2GHY A;  5LP6 A;  1AP5 A;  3ABM C;  4MSW C;  1FFX B;  2YIA A;  3KG2 A;  3A2F A;  4N23 A;  1ZTE A;  4QPJ A;  3CCR V;  1AJQ A;  1Z5V A;  2HG5 C;  2CTR A;  3D8C A;  2IW5 A;  3QVN A;  2HP8 A;  3L71 H;  4B7E A;  4LWS A;  3HKE B;  2ZQM A;  1XNR B;  1JOY A;  2L35 A;  4UCV A;  1FPO A;  1XL6 A;  4I5S A;  2HEP A;  4DK0 A;  3F7Y C;  2VQE O;  2Q0O C;  1VQ7 V;  2D3O W;  3U10 A;  4DO2 A;  4JI6 B;  3FD9 A;  4AI8 A;  4DR7 O;  4GYC B;  2W0X A;  5BR8 O;  3CCL V;  4CS3 A;  3G67 A;  5EYP B;  1Q6H A;  4G28 B;  1VEW A;  1EN4 A;  2ADQ B;  3SPC A;  1IBL B;  4ZIB A;  4Z1M G;  3ZRS A;  1H2N A;  4HZ3 A;  3OMI B;  2QM8 A;  1NR1 A;  3STZ C;  1U97 A;  1VMG A;  2AHZ A;  4UB8 Z;  2Q7G A;  1H2S B;  1XMO B;  5LL6 Y;  2WSS G;  3CP1 A;  3ZHU A;  3FB5 C;  3CC7 V;  1KKD A;  1ROP A;  4QGP A;  4PI0 A;  4QE9 A;  2P7T C;  3STL C;  2ZNI A;  5B1B B;  4CBC A;  3D36 C;  4DR6 B;  2XAS A;  1N34 B;  3WU2 Z;  3IC7 A;  4O2A A;  1AP6 A;  4I50 B;  1QLE B;  2GUZ B;  4DV7 O;  2M6Y A;  3EXA A;  2WLL B;  1MNG A;  2JS5 A;  5DED A;  3G6B A;  3M8A A;  4JV5 B;  2QTS A;  4JI1 O;  3LSS A;  3IFX A;  2JGD A;  3HKC A;  1XEQ A;  4NXM O;  5KA5 A;  1PL0 A;  1D2D A;  2E75 B;  4FK5 C;  4ZI7 B;  4QE7 A;  1AI7 A;  1W0K G;  3LDD A;  4TV8 A;  3ASO C;  3ZHQ A;  2FKX A;  3GB7 C;  5FNV A;  4ZKI A;  1B6Q A;  4AQY B;  2Y0I A;  1G4Y B;  2P4K A;  3CCQ V;  1YJ9 V;  1QHT A;  2X0L A;  3O9O A;  3K06 A;  3CCU V;  3OEH G;  2ZIM A;  4KUM A;  3MD0 A;  3K08 A;  2JIZ G;  2PTM A;  1K4D C;  3UO3 A;  1TVK B;  2ZXW C;  4TUY B;  5BXZ A;  3RN4 A;  3K5N A;  4B7K A;  1SET A;  2WLN A;  2DOS A;  3A8T A;  2DWE C;  3CX5 F;  1VF5 B;  1VQ5 V;  4DV4 B;  4EFB A;  4PI2 A;  1M4U A;  1FYJ A;  5KHH A;  1XIL A;  1YDX A;  4YY3 B;  1XNR O;  1H38 A;  4PA6 A;  1Y74 B;  5JJE B;  4NTW A;  3ZRX A;  3ZRW B;  4UVC A;  5J2U B;  5B66 Z;  3RYF A;  5B5E Z;  4LF5 B;  3W7S A;  4FPP A;  3A0H Z;  2UXB B;  2UXC B;  1JX9 A;  3QTC A;  3AG4 C;  3S3X A;  4HNA B;  1CP9 A;  1Q81 W;  4JI6 O;  5IYZ B;  2OTJ V;  5LA6 B;  2P5O A;  4O2B B;  3CC4 V;  4ABM A;  1U96 A;  5IYD O;  1PKX A;  1SZX A;  3BCC H;  5A2Q N;  1UFI A;  2VQF B;  3OUF A;  4JI7 B;  2Y69 C;  1BQ0 A;  1KBH A;  2GV9 A;  2YXY A;  4PD4 F;  4UV8 A;  4G2K A;  2EX3 A;  5BMV A;  1XMO O;  2JEX A;  4RUE A;  3DXR B;  1XHZ A;  1PNM A;  4B3R B;  4IIJ A;  4DRX B;  1I94 B;  5JJJ B;  3CJH B;  5J2T B;  3BA8 A;  1PNK A;  4JAS A;  3CD6 V;  4DR6 O;  3ZMS A;  2Q6A A;  1N34 O;  2AZ0 A;  2YEV A;  1J95 A;  5LYJ B;  1N0N A;  5JVD B;  3ASN C;  4GUN A;  1TAE A;  4JI3 B;  3RYC A;  4LNU B;  4DR2 B;  3FYE B;  4DV5 B;  4F4L A;  5KMG B;  5LGN A;  5KAF Z;  3ETQ A;  4J42 A;  4PDV A;  4NR1 A;  1WA8 A;  3T2M A;  2CH7 B;  4O4H B;  3SR2 C;  1K34 A;  3AG1 B;  3MAQ A;  2F93 B;  3IAY A;  2LFS A;  3PJS K;  1S5L Z;  2DE0 X;  5EBM C;  1SER A;  2JJ2 G;  4AQY O;  2DYR C;  1G6U A;  4PA7 A;  2IJK A;  3L74 H;  4FLV A;  2WLM A;  3TK1 A;  3MHH C;  1OJH A;  5LBQ A;  3MHS C;  3WB2 A;  4JI4 B;  3K57 A;  2YID A;  2WPD G;  3LDE A;  4X1I A;  4EKW A;  2RMK B;  3ABM B;  5IYB O;  1US6 A;  1K33 A;  1AIL A;  3JAK B;  4DW0 A;  4RQE A;  1QR9 A;  1GO3 F;  3OGI B;  3SPI A;  1FFX A;  1YTF D;  4YY3 O;  3OM3 B;  3SPJ A;  4UCO A;  1N4C A;  1H2L A;  1UJW B;  4K0K B;  1UPG A;  2YC0 A;  5EC1 C;  3OMA B;  2QWN B;  2Z5U A;  4LF5 O;  2WA3 A;  2YDE A;  4R6Z A;  2ITD C;  4E4E A;  2UXB O;  1EM1 A;  4DV0 B;  2LGQ A;  2XAG A;  3HKE A;  3LSU A;  1EFR G;  2GSM B;  1VQ9 V;  1YVW A;  1R3K C;  5EZY B;  2OIE A;  4JGS A;  4FLY A;  1Q6I A;  1R3J C;  4DV1 B;  2EBO A;  3EFF K;  2XUM A;  4MW3 A;  5HFM A;  4WFF A;  2UU9 B;  2Q73 A;  2DQ0 A;  2D2C B;  5B1B C;  2CTP A;  3P30 A;  3OTO B;  2VQF O;  2AHY A;  5IDJ A;  5EYP A;  2QWR B;  1OCO C;  3TET A;  3FYI B;  1M5I A;  3BHP A;  2X6B A;  1K97 A;  3I56 V;  2QKA A;  4QIW F;  4FLU A;  1VQK V;  4PDL A;  4I55 B;  5B3S C;  4D7S A;  3SJQ C;  3ZN0 A;  4K8Z A;  1AR4 A;  3ABK C;  1KMI Z;  4MS2 A;  5B1O A;  1SQX H;  1MOF A;  1WP7 A;  5FLX N;  4HAM A;  1PV0 A;  4P30 A;  4YHH B;  1SS3 A;  4E2L A;  4DV3 B;  4DUY B;  1K73 W;  1B3Q A;  4JI3 O;  5EBW C;  4DR2 O;  1GN3 A;  3Q4H A;  3CS5 A;  4BR6 A;  4DV5 O;  1NTZ H;  2CTW A;  4I50 A;  1OCR C;  1TUB B;  2WLL A;  4LH6 A;  1SES A;  3ZMT A;  3E83 A;  2Q7H A;  1QR8 A;  3OE7 G;  4ICG A;  1MZE A;  1ZLZ A;  2ODM A;  4UFZ A;  2YUA A;  4CH3 A;  4LFC B;  2A79 B;  3SYQ A;  5IY5 C;  4X65 B;  4ZI7 A;  1QCE A;  3C3T A;  1KB9 F;  3W7U A;  4ZBM A;  3ASO B;  2WAM A;  3ZRV A;  1NKD A;  1Q86 W;  1NVP D;  5KX5 B;  4JI2 B;  2ADP A;  2ARH A;  2QWQ B;  5EIB C;  2HJF C;  1FJG O;  3UO2 A;  1FXH A;  1YCI A;  4LF4 B;  1SQQ H;  1JR9 A;  1IXB A;  1MA1 A;  2JJ1 G;  2UXN A;  2ZXW B;  2RN9 A;  2WWW A;  4TWK A;  4F6R B;  2E5L O;  4JZ2 A;  3RGB A;  4OX9 B;  3R65 A;  1BL8 A;  1VQM V;  3CRR A;  1MAB G;  3SYP A;  4K0K O;  4R7C A;  5KLV H;  2P4V A;  2W6I G;  4WFA V;  4LC1 A;  4DV0 O;  2EIL C;  2EIM C;  1Y74 A;  2FL4 A;  4CC5 A;  3ZRW A;  5J2U A;  1E79 G;  3VQY A;  4ZOL B;  2QM4 A;  3AG4 B;  4KXR A;  4LFA B;  1SQF A;  2ZE5 A;  2M7W A;  3UT5 A;  3AK3 A;  3E22 B;  5IYZ A;  1H8E G;  3OTO O;  3FKS G;  3H1I H;  3GVM A;  5LA6 A;  4O2B A;  1JPX A;  1ZL8 B;  3DSQ A;  1S5J A;  3K9S A;  1K3E A;  3OMN B;  3T4D A;  1RPR A;  4MVM A;  4XDJ A;  4L87 A;  4FIP C;  3JAS B;  5KUM A;  4UXN A;  4LCU C;  3AG7 A;  2Q8V A;  2Q7E A;  4JI5 B;  4X9Q A;  3SJA C;  1N33 B;  5IT9 N;  4WFG A;  3OGC C;  1SKV A;  2ZT9 B;  3WB0 A;  2PZS A;  4FJC C;  3G80 A;  5H5N A;  2FML A;  1NBM G;  4JAV A;  2DYS C;  4JI8 B;  3B77 A;  4DRX A;  1MZF A;  4YHH O;  4DV3 O;  5J2T A;  3CJH A;  1IBM B;  3ABL C;  5GW7 A;  2BTQ B;  1XL4 A;  1E1Q G;  2G38 A;  2OCC C;  4GX2 A;  3CXC U;  3FB6 C;  2EJ7 A;  4LF6 B;  4LF9 O;  3B8M A;  3ASN B;  3E2E A;  4P2Z A;  5LYJ A;  4BAY A;  4CH5 A;  2ZCE A;  2K1E A;  1K5Q A;  4WBN B;  3T1Y B;  3QF7 A;  3K5L A;  3AG3 C;  1K8A W;  2N04 A;  4YJ2 B;  4X66 B;  3ZMU A;  5LMN O;  4I0X B;  3J81 N;  4DR4 B;  3K79 A;  2HJD A;  2PF4 E;  2CH7 A;  3T1H O;  2IJI A;  2XAQ A;  1YJN V;  3BPZ A;  5F2V O;  1QLN A;  1VQP V;  3ZHV A;  2DYR B;  4J7Z A;  1Y6X A;  3APQ A;  1H2M A;  1I08 A;  2RQ6 A;  2F95 B;  4LF4 O;  2Z0A A;  3X2Q C;  4YIO A;  1FXV A;  1WLE A;  4JTA B;  3CB2 A;  1PPJ H;  1SQG A;  2UUA O;  2MK3 A;  3JAR B;  4B3T B;  2CDY A;  3H1J H;  2OIG A;  2XHB A;  4NB5 A;  5L3E A;  2ZKO A;  3OW2 U;  1COW G;  3JAK A;  5K1X A;  1YJW V;  1JCH A;  3K5O A;  2A06 H;  2FTK A;  3RVY A;  3MDS A;  3AK2 A;  4J11 A;  5AG2 A;  4UCS A;  4JYB A;  4LFA O;  4AHC A;  5A9G A;  3JCU Z;  1GMG A;  2CK3 G;  5B1N A;  5EZY A;  3O65 A;  3HKD B;  5GTH Z;  1GM8 A;  1LR1 A;  5D5Q A;  4I4T A;  4WFE A;  2XAJ A;  4K8X A;  5FL7 G;  2WLI B;  1QU7 A;  3DC5 A;  4X62 B;  1OCO B;  1W2B U;  2LO1 A;  2LW7 A;  5LGT A;  2FYU H;  4TQF A;  4JI5 O;  1WPB A;  2Q0A A;  3OD4 A;  5CA0 B;  3RW0 A;  4GKJ B;  5JCO A;  4O4I A;  1JVM A;  4FLX A;  4GKK O;  5B3S B;  1JJO A;  2P22 C;  2YSU B;  2JVD A;  2Q4P A;  5CB4 B;  4JI8 O;  3ABK B;  1FKA O;  2RCV A;  1YIJ V;  2JK5 C;  3FFQ A;  4O4J A;  2GBO A;  4J9Y B;  1CPY A;  3AG2 C;  4LFB B;  4LF6 O;  4KP4 A;  2A3Q A;  4WCE V;  3OEE G;  5JWP A;  2O57 A;  5EC2 C;  4Z1V A;  3D36 A;  4DUZ O;  2UUB B;  2BSK B;  4B3M O;  3T1Y O;  5DM6 V;  3H1K H;  1Y66 A;  1HDJ A;  1JA8 A;  2X6A A;  1OCR B;  1H2K A;  3UKM A;  4J10 A;  5L3D A;  3BRC A;  1A32 A;  5FPO A;  5BZB A;  4YJ3 A;  1MSW D;  1YI2 V;  2NNU A;  4UB6 Z;  1Q3E A;  3RFR A;  3K04 A;  4U7N A;  1NH2 B;  1N8R W;  5IY5 B;  1ZAU A;  3JAT B;  3HPL C;  3BAA A;  4JYA B;  2Y4T A;  3VOU A;  2Q67 A;  1L0N H;  2R9A A;  1P84 F;  5JH7 A;  2NLJ C;  5CA3 A;  1QNM A;  5KX5 A;  2CAZ C;  1QBZ A;  4PV1 B;  4PEL A;  2P06 A;  3SPH A;  1L1F A;  3JAL B;  4MW8 A;  4I7Z B;  4NXN B;  3CYO A;  4B3T O;  1EN6 A;  2R72 A;  4J41 A;  2ATK C;  4F6R A;  3ZN1 A;  3F7V C;  3P3P A;  3K3W A;  1FXK C;  3B4S A;  1W59 A;  5ITZ A;  3FX7 A;  1IBL O;  3CRA A;  3G6E V;  1G8M A;  4UCT A;  4DR1 B;  3P3N A;  2QR4 A;  4X20 B;  3OTF A;  4JTD B;  2KKW A;  1P7B A;  3A0R A;  3T1C A;  2DWD C;  2QWO B;  1L0L H;  1NR7 A;  1NI8 A;  2QM7 A;  2EIL B;  2EIM B;  3QO7 A;  2GDS A;  1I5Y A;  3ZX6 A;  3B09 A;  1GTO A;  2EIN C;  2JDI G;  4ZOL A;  2F4V B;  1K4C C;  2F66 C;  3HKB B;  1X4T A;  4JAA A;  4LBE C;  1ZUQ A;  4H44 B;  2YIB D;  3J80 N;  3E22 A;  2VS0 A;  1URF A;  5EK0 A;  4L8J A;  1YF2 A;  3BAB A;  4X62 O;  1AR1 B;  1FAF A;  1SRY A;  4EB6 B;  1BMF G;  1SA0 B;  4X88 A;  4LF8 B;  1VQ8 V;  1ZL8 A;  1AB3 A;  3E86 A;  3W7W A;  1IBK B;  2EIJ C;  5J9P C;  4RAI A;  3C90 A;  1OCZ C;  3OUS A;  1KC8 W;  4JV5 O;  5JQG B;  1SQB H;  1L8D A;  2PI4 A;  3JAS A;  4HBN A;  3ABT A;  4KL1 A;  3HR0 A;  3ZHT A;  2DYS B;  4LFB O;  1FS0 G;  1XMQ B;  5E1A C;  1Y76 B;  3JD4 A;  3FAV B;  3CCM V;  1Q5O A;  3ABL B;  2UUB O;  1BS3 A;  2OCC B;  1F51 A;  3ICX A;  3WG7 C;  4DV2 B;  5KUK A;  4IHJ B;  1HP8 A;  1M1K W;  1F23 A;  4H33 A;  3VQV A;  3AG3 B;  2XAH A;  5GTI Z;  4X1K A;  1HNX B;  1M93 A;  1E1R G;  1ORQ C;  4YJ2 A;  2UXX A;  2ZDI C;  1IXM A;  4I0X A;  4LWS B;  1NJI W;  5JJN B;  1WN7 A;  4DV4 O;  1XHX A;  4Z2W A;  4JYC A;  3B40 A;  2XAF A;  1D5N A;  1IDS A;  2F23 A;  4W4K A;  3IJ4 A;  1H8H G;  2B5U A;  2ITC C;  3CWB H;  4AIL C;  4JYA O;  2N05 A;  1THZ A;  3UQ8 A;  1BZK A;  4XDL A;  2ZM6 B;  5CA1 B;  1QVG U;  4OGQ B;  1EN5 A;  2UXC O;  3X2Q B;  1XI1 A;  4NXN O;  4NYK A;  2YIB A;  3JSN A;  4IL6 Z;  3AK1 A;  4MTF A;  1LNQ A;  5LMU B;  3H9V A;  1XNQ B;  1DK1 A;  3CSX A;  2ZNJ A;  4ZHQ B;  2OCH A;  2OT5 A;  3JAR A;  5IWA B;  2BOC C;  3RYH B;  4DR1 O;  2H8P C;  5L3G A;  4JI7 O;  4HYO A;  3QO5 A;  2IJJ A;  4UCU A;  3L9D A;  4H13 B;  3F5W C;  1O9H A;  3H1H H;  2ZE6 A;  2QTO A;  2JS3 A;  1FFT B;  4DV6 B;  1TA8 A;  1Q7Y W;  2RNB A;  3VQW A;  2FB5 A;  1Y67 A;  4GT1 A;  3CC2 V;  1RPO A;  4B3R O;  3TGU H;  2F4V O;  1XUQ A;  1I94 O;  4MVU A;  5L3C A;  2MW2 B;  4X89 A;  1HNW B;  3IGA C;  2CE4 A;  4MT8 A;  4J80 A;  2V1D A;  1X59 A;  5EIB D;  2KSD A;  3HKD A;  2AGA A;  5H2F Z;  5E79 Z;  4LF8 O;  2HVJ C;  3HKC B;  5LXT B;  5EBL C;  3EVK A;  1XQ8 A;  3CXH F;  3BA9 A;  4P9O A;  2EIK C;  5KHG A;  2GUZ A;  2B1I A;  3W7T A;  2IU3 A;  3L73 H;  4TV8 B;  3LUT B;  3L75 H;  4MTX A;  5CA0 A;  1GRJ A;  5LHH A;  4YXW G;  1MSD A;  1XMQ O;  1VF6 C;  2YXH A;  2Q5Z A;  1RP3 B;  5CB4 A;  1NTK H;  1WP8 A;  3AG2 B;  3NR7 A;  4KFM A;  4EEQ A;  4TSF G;  3KKY A;  2P6J A;  1KU9 A;  4U3J B;  3ZS8 C;  1AR5 A;  2RDC A;  3APO A;  2EJR A;  1Y4M A;  3CE2 A;  4JI4 O;  3NXS A;  2V4D A;  1HNX O;  3ZCC A;  1I7F A;  1TUE B;  3CEI A;  5HFL A;  1LUV A;  1TVK A;  2C2A A;  2X7R B;  2LP7 A;  3N2G B;  4TUY A;  3RYF B;  5CBH A;  1YHQ V;  1F7Y A;  1GH6 A;  2VRZ A;  2PUS A;  3JYC A;  3JD2 A;  2WLJ A;  2CTQ A;  1ZX3 A;  2E76 B;  3DGE A;  2JGU A;  1SQV H;  3K03 A;  2HR3 A;  3CME V;  2PY5 A;  4FLZ A;  1OCC C;  1NU1 H;  4FVM A;  1XNQ O;  4DV1 O;  2WLK A;  3THO A;  4PA9 A;  1BQZ A;  2R9R B;  1PM9 A;  3JAL A;  4HNA A;  2UU9 O;  2L6L A;  5IWA O;  4TQD A;  4RWU A;  1M56 C;  3H1L H;  4JYY A;  4CZZ A;  4H0L B;  3TJT A;  1FXK B;  2Q69 A;  2Q9L A;  2DJV A;  5IE9 A;  1F4N A;  1GM7 A;  4IIJ B;  4QNH B;  3LDC A;  3CMA V;  2R70 A;  2YXL A;  5KHI A;  1Z5W A;  4BIO A;  4R8C A;  2OWO A;  4GCZ A;  1VQO V;  2IU0 A;  3KCX A;  2GTA A;  4FFK A;  2EIN B;  3DXR A;  1HNW O;  2CGN A;  4TV9 B;  2XOK G;  5IJ9 B;  4PA3 A;  1NTM H;  1R3I C;  1RSO B;  2Y4U A;  4MVZ A;  1XDC A;  2AZ2 A;  1ARO P;  3RWR D;  4DUY O;  2YIC A;  4DV7 B;  5LP6 C;  1WA8 B;  2QKS A;  4YIP A;  1DGS A;  3F5T A;  4KHP B;  4EB6 A;  1SA0 A;  1WAZ A;  2EIJ B;  5TIS Z;  3UCS C;  5JVD A;  1OCZ B;  2H3O A;  2LQT A;  3ZBH A;  4D6T H;  5C93 A;  4LNU A;  1BSM A;  3TCU A;  1QQC A;  1BT8 A;  2QDO A;  5KMG A;  2ZR2 A;  3QNE A;  4D7T A;  4EFE A;  1KQS U;  2P67 A;  4LFC O;  4IGG A;  4X65 O;  4O4H A;  4CS4 A;  4CC6 A;  2YI9 A;  1Q8I A;  2QWP B;  1KYO F;  2QJ1 A;  1DLB A;  3FAV A;  3WG7 B;  2IM9 A;  4FM2 A;  4UVB A;  2HFE C;  4FZ0 A;  4JI2 O;  1CEZ A;  5B1A C;  1M90 W;  2KB1 A;  1WB8 A;  1WB7 A;  1YXB A;  3ZJZ A;  1PL4 A;  4FMT A;  1HR0 B;  4IHJ A;  1YEW A;  3E8G A;  2Z3Y A;  2Y0P A;  1VQ4 V;  4WF9 V;  4OX9 O;  2RJZ A;  1P7G A;  4CH4 A;  4I9Q A;  1K9M W;  1I5X A;  2XT9 A;  1WJZ A;  3FB8 C;  2UUC B;  1NT2 B;  1R3L C;  1SF9 A;  2UXD B;  4OPA A;  4LP8 A;  4I9W A;  3E89 A;  1ENV A;  2LGW A;  3N2K B;  1HWY A;  3RBZ A;  3CHX A;  3CCE V;  3K9A A;  3CCS V;  4PDR A;  5DN6 G;  1LUW A;  1HNZ B;  5CA1 A;  3C3S A;  3SJB C;  1GN2 A;  2LW1 A;  4K35 A;  3AEI A;  3M7M X;  5FPR A;  1VAR A;  1AVM A;  2F43 G;  4XDK A;  1R6N A;  1K92 A;  1VP7 A;  1OHH G;  4BWA A;  1BHB A;  1Z2G A;  1QVF U;  2ZIN A;  5JCO C;  4ZHQ A;  4U3F H;  5LOV B;  3JAW B;  3SYO A;  3RYH A;  1B04 A;  1BE3 H;  3JD1 A;  3CCV V;  5D5P A;  1JFF B;  5L3F A;  4GX1 A;  3SJC C;  1KEC A;  1N33 O;  1DF4 A;  4F6E A;  3CRC A;  2JRI A;  2CUG A;  2Q68 A;  3W7X A;  2IJH A;  2AXT Z;  4I55 A;  3Q4H B;  1PNL A;  2HHH B;  3WB1 A;  3IC9 A;  1IBM O;  3E8B A;  3BFR A;  1V54 C;  2YS8 A;  4CS2 A;  1YTF B;  4B3S B;  4KHP O;  2QGN A;  2HLD G;  4PDM A;  5C8Y B;  3OFN G;  2DW4 A;  5LXT A;  2IH3 C;  2ZE8 A;  1GAX A;  4RO2 A;  5KA6 A;  2EIK B;  3J7A U;  4MTO A;  4X66 O;  1KD1 W;  2OYQ A;  4O4L B;  3U0Z A;  3ML0 A;  5CBG A;  4DR4 O;  2A0L A;  4UCR A; 
#chains in the Genus database with same CATH homology
 2V7Q G;  1R6K A;  1JJ2 U;  1M57 C;  3ZMV A;  5KUK A;  2A79 B;  3SYQ A;  2QA4 V;  1M1K W;  5IY5 C;  1F23 A;  4H33 A;  2GHY A;  1QCE A;  3W7U A;  4ZBM A;  3AG3 B;  3ASO B;  2WAM A;  2XAH A;  3ABM C;  3ZRV A;  1NKD A;  1Q86 W;  4MSW C;  1NVP D;  1E1R G;  1ORQ C;  3B8N A;  3KG2 A;  1EZJ A;  2UXX A;  4N23 A;  2ZDI C;  4QPJ A;  1IXM A;  3CCR V;  1NJI W;  1AJQ A;  2HG5 C;  2HJF C;  2A9H A;  4JYC A;  2IW5 A;  2XAF A;  1FXH A;  3GWO A;  2JJ1 G;  2UXN A;  1VQN V;  2ZXW B;  1H8H G;  2B5U A;  2ITC C;  2WWW A;  4JF3 A;  4TWK A;  1THZ A;  3VBB A;  2ZQM A;  1JOY A;  4XDL A;  3R65 A;  2Y48 A;  4I5S A;  1XL6 A;  1QVG U;  1BL8 A;  4WFB V;  1VQM V;  3OR6 C;  5CBF A;  4RUF A;  1MAB G;  3F7Y C;  3SYP A;  4UVA A;  3X2Q B;  4R7C A;  4X8A A;  4R50 A;  1VQ7 V;  2D3O W;  4MTF A;  2BOB C;  4DO2 A;  1LNQ A;  2W6J G;  2W6I G;  4WFA V;  4LC1 A;  3E8H A;  4BIZ A;  3CCL V;  2EIL C;  4MVR A;  2EIM C;  2QEX V;  4MVO A;  1MG1 A;  4J9Z B;  1EBO A;  4G28 B;  3ZRW A;  1E79 G;  1H2G A;  3JD3 A;  3CPW U;  2OT5 A;  3SPC A;  1S5H C;  2BOC C;  3AG4 B;  2H8P C;  4Z1M G;  5L3G A;  3ZRS A;  4HZ3 A;  3OMI B;  2QM8 A;  4HYO A;  3JD0 A;  3QO5 A;  1NR1 A;  2IJJ A;  2M7W A;  3STZ C;  1YSC A;  1OCC B;  3F5W C;  1H8E G;  2QTO A;  3FKS G;  1FFT B;  2AHZ A;  1Q7Y W;  1JPX A;  2WSS G;  1K3E A;  3CP1 A;  1M56 B;  3FB5 C;  3CC7 V;  4GT1 A;  3CC2 V;  3OMN B;  1RPO A;  3T4D A;  3G4S V;  4G27 B;  1RPR A;  1KKD A;  4QPK A;  4MVM A;  4XDJ A;  1ROP A;  4L87 A;  4FIP C;  4QE9 A;  2P7T C;  4MVU A;  3STL C;  5L3C A;  1FXK A;  5B1B B;  3ZMZ A;  3JCZ A;  4CBC A;  4JAU A;  4X89 A;  2XND G;  5KUM A;  2XAS A;  3IGA C;  4LCU C;  4UXN A;  4MT8 A;  1RM1 C;  1NVP B;  2V1D A;  3IC7 A;  4WFG A;  3OGC C;  1QLE B;  3I55 V;  4FJC C;  2HVJ C;  2WLL B;  5EBL C;  1WPX A;  5IYC O;  1NBM G;  4JAV A;  2DYS C;  2X6C A;  1V55 C;  3B77 A;  3LSS A;  3IFX A;  1AI5 A;  4P9O A;  3OAA G;  2EIK C;  3ABL C;  5GW7 A;  2B1I A;  1XL4 A;  3W7T A;  2IU3 A;  1E1Q G;  3K0D A;  4GX2 A;  2OCC C;  3ABU A;  3CXC U;  3FB6 C;  3LUT B;  3H01 A;  4MTX A;  3B8M A;  1R73 A;  5KA5 A;  1PL0 A;  3ASN B;  3E2E A;  4P2Z A;  4FK5 C;  4BAY A;  2K1E A;  4QE7 A;  4YXW G;  5LHH A;  2QE7 G;  1K5Q A;  2H94 A;  4U7O A;  1AI7 A;  1W0K G;  3LDD A;  3AG3 C;  3ASO C;  1K8A W;  3AG2 B;  3GB7 C;  4KFM A;  4ZKI A;  1B6Q A;  3ZMU A;  3ETG A;  4TSF G;  2P6J A;  3BY6 A;  1G4Y B;  3CCQ V;  3K79 A;  1YJ9 V;  3SPG A;  2X0L A;  3K06 A;  3CCU V;  3OEH G;  2IJI A;  2EJR A;  2XAQ A;  2WLH A;  4KUM A;  3MD0 A;  1YJN V;  3K08 A;  1QLN A;  1Y4M A;  2JIZ G;  2ZR3 A;  1K4D C;  1VQP V;  2ZXW C;  3NXS A;  4N21 A;  2DYR B;  3ZCC A;  1K5S A;  1GK9 A;  1SET A;  2WLN A;  1TUE B;  5HFL A;  2DWE C;  1VQ5 V;  2C2A A;  3DTU B;  2X7R B;  1AI6 A;  2LP7 A;  5B1A B;  3SYA A;  3ETD A;  3X2Q C;  5CBH A;  1YHQ V;  1FXV A;  1WLE A;  4JTA B;  1H38 A;  3JYC A;  4PA6 A;  3JD2 A;  4WFH A;  1AI4 A;  2WLJ A;  4RQF A;  3ZRX A;  3ZRW B;  3DGE A;  4UVC A;  2MK3 A;  3K03 A;  3W7S A;  2HR3 A;  4FPP A;  3CME V;  1NQT A;  5L3E A;  1AJP A;  3OW2 U;  1JX9 A;  3AG4 C;  1COW G;  1CP9 A;  1Q81 W;  2OTJ V;  1YJW V;  1JCH A;  4GX5 A;  2ZDI A;  1SZT A;  4H37 A;  2FTK A;  4MVQ A;  3RVY A;  2B1G A;  1OCC C;  2WLK A;  4PA9 A;  2R9R B;  3CC4 V;  5IYD O;  1PKX A;  4JYB A;  1M56 C;  3OUF A;  4CZZ A;  1FXK B;  2Q69 A;  2Y69 C;  1NH2 D;  3FB7 C;  1F4N A;  1GM7 A;  4UV8 A;  1GMG A;  1GM9 A;  2CK3 G;  4G2K A;  5B1N A;  4QNH B;  1GKF A;  1GM8 A;  4Q20 A;  2JEX A;  4RUE A;  4QJF B;  3LDC A;  3CMA V;  4WFE A;  2XAJ A;  4JTC B;  4R8C A;  5FL7 G;  1QLE C;  4GCZ A;  2WLI B;  1PNM A;  1VQO V;  2IU0 A;  1VQ6 V;  3ETE A;  4DXW A;  4GX0 A;  1OCO B;  1W2B U;  2EIN B;  1PNK A;  4JAS A;  3CD6 V;  1P4R A;  5LGT A;  1W0J G;  2XOK G;  3ZMS A;  2Q6A A;  4PA3 A;  2R9I A;  2WLI A;  1R3I C;  2YEV A;  3SYC A;  4MVZ A;  3RW0 A;  1J95 A;  3WFV A;  1KP2 A;  1JVM A;  1ARO P;  5B3S B;  3ASN C;  2JEU A;  2YSU B;  3ABK B;  1YIJ V;  2JK5 C;  2QKS A;  3FYE B;  4F4L A;  4J9Y B;  2EIJ B;  5LGN A;  2P90 A;  1CPY A;  3AG2 C;  1OCZ B;  4KP4 A;  5C93 A;  4PDV A;  4WCE V;  3OEE G;  3TCU A;  3T2M A;  5EC2 C;  4P9P A;  1V54 B;  1ZWI C;  3D36 A;  3RVZ A;  1K34 A;  3AG1 B;  2ZR2 A;  3QNE A;  1S77 D;  5DM6 V;  2LFS A;  5H6Q A;  1Y66 A;  3PJS K;  1KQS U;  4UV9 A;  2P67 A;  5EBM C;  2X6A A;  1OCR B;  5LHG A;  2JJ2 G;  1SER A;  2DYR C;  2HKO A;  4PA7 A;  2IJK A;  3UKM A;  5L3D A;  1DLB A;  2WLM A;  5BZB A;  3TK1 A;  3MHH C;  3WG7 B;  1MSW D;  1YI2 V;  2W0F C;  4UVB A;  2HFE C;  2NNU A;  1CEZ A;  5B1A C;  5LBQ A;  3G71 V;  2KB1 A;  5H9C A;  1M90 W;  3K04 A;  3QO8 A;  3ZJZ A;  3MHS C;  1M57 B;  4BW5 A;  3E35 A;  5CMU A;  1Q82 W;  4U7N A;  1NH2 B;  4FMT A;  2LFR A;  4MVS A;  1N8R W;  5IY5 B;  1VQL V;  1S72 V;  2WPD G;  5CN0 A;  1S76 D;  3LDE A;  4EKW A;  5H6R A;  3HPL C;  3ABM B;  3E8G A;  2Z3Y A;  5IYB O;  1PD3 A;  1K33 A;  1VQ4 V;  3VOU A;  2DQ3 A;  4WF9 V;  2Q67 A;  4RQE A;  1QR9 A;  1GO3 F;  3SPI A;  2NLJ C;  5CA3 A;  1YTF D;  1K9M W;  3OM3 B;  3LNM B;  3SPJ A;  2PI5 A;  1QBZ A;  1I5X A;  3HB3 B;  5L3B A;  3FB8 C;  3E8F A;  4PEL A;  1UJW B;  3SPH A;  1L1F A;  1S3J A;  4MW8 A;  5EC1 C;  1R3L C;  3CYO A;  5LGU A;  3OMA B;  4JPR A;  2Z5U A;  4R6Z A;  4LP8 A;  2ITD C;  4I9W A;  3E89 A;  1AJN A;  1ENV A;  2ATK C;  4ASU G;  1HWY A;  2XAG A;  3ZN1 A;  3RBZ A;  3CCE V;  3F7V C;  3K9A A;  3CCS V;  4PDR A;  5DN6 G;  1EFR G;  3K3W A;  2GSM B;  1FXK C;  1VQ9 V;  4UUJ C;  1R3K C;  4JGS A;  5LHI A;  3G6E V;  3AEI A;  1G8M A;  1R3J C;  2EBO A;  4JTD B;  1P7B A;  3A0R A;  3T1C A;  2DWD C;  3EFF K;  4MW3 A;  4TT3 G;  1F4M A;  1NR7 A;  3LSQ A;  4WFF A;  5HFM A;  2QM7 A;  2DQ0 A;  2F43 G;  4XDK A;  2EIL B;  5B1B C;  2EIM B;  3QO7 A;  3P30 A;  1R6N A;  1K92 A;  1BHA A;  2AHY A;  1OHH G;  1BHB A;  1DTO A;  5IDJ A;  1QVF U;  1I5Y A;  1OCO C;  3TET A;  3FYI B;  4XBF A;  1GTO A;  2EIN C;  3SYO A;  2YEV B;  2JDI G;  2X6B A;  1K97 A;  3I56 V;  2HVK C;  4MTG A;  3P32 A;  1K4C C;  3JD1 A;  3CCV V;  3OR7 C;  2IH1 C;  1S0V A;  5L3F A;  4LBE C;  4GX1 A;  4QIW F;  1VQK V;  4PDL A;  1KEC A;  3EHB B;  3T4Z A;  2EZP A;  5B3S C;  5EK0 A;  2EZO A;  3SJQ C;  1DF4 A;  2Y69 B;  1AR1 B;  3ZN0 A;  3W7X A;  1SRY A;  2Q68 A;  2ZD9 A;  3ABK C;  4MS2 A;  1BMF G;  3CCJ V;  4X88 A;  5B1O A;  2IJH A;  1VQ8 V;  1MOF A;  3D3I A;  3E86 A;  3W7W A;  4HAM A;  2EIJ C;  4BIU A;  5J9P C;  4P30 A;  4RAI A;  1YIT V;  1OCZ C;  3OUS A;  4PA4 A;  1KC8 W;  1PNL A;  4E2L A;  4OXS A;  3E8B A;  2OTL V;  1RM1 B;  1V54 C;  1K73 W;  5EBW C;  2PI4 A;  3AG1 C;  1M9N A;  1YTF B;  1DF5 A;  3ABT A;  3K0G A;  2HLD G;  1JQ0 A;  4PDM A;  1K7D A;  3OFN G;  3UM7 A;  2DYS B;  1OCR C;  1V55 B;  3ZIA G;  1FS0 G;  2DW4 A;  2IH3 C;  5E1A C;  1OZ0 A;  2WLL A;  3ZMT A;  1SES A;  3JD4 A;  4RO2 A;  5KA6 A;  2EIK B;  3CCM V;  3ABL B;  3E83 A;  4MTO A;  1KD1 W;  2OCC B;  1KP3 A;  1F51 A;  1QR8 A;  3WG7 C;  3OE7 G;  3ML0 A;  5CBG A;  3BEH A;  2A0L A;  3M99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...