3CCRV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccrV00
1YITV 2OTLV 3G4SV 1KD1W 1Q7YW 3CC7V 1VQ8V 1K73W 3G6EV 3CCUV 2D3OW 1K8AW 1JJ2U 1VQ9V 2OTJV 4WCEV 3CCVV 1S72V 1Q82W 3CCMV 4WF9V 1VQNV 3I55V 3G71V 3CCSV 3CD6V 4WFBV 3CC4V 1VQ7V 1VQLV 5DM6V 3CCQV 2QA4V 3CPWU 1Q81W 1NJIW 1YIJV 1Q86W 3CMEV 1KQSU 1YHQV 1W2BU 1VQ6V 3CCEV 1QVGU 3CMAV 3I56V 1YJNV 3CCLV 1N8RW 1KC8W 1M1KW 1YJ9V 1QVFU 4WFAV 3CXCU 1VQ5V 1YJWV 1M90W 1VQ4V 1VQOV 1VQKV 3CCRV 2QEXV 1R73A 3CCJV 1VQPV 3OW2U 1K9MW 1VQMV 3CC2V 1YI2V
chains in the Genus database with same CATH superfamily
4DR5O 2UU9O 1AR5A 2XAJA 3ASOB 3DC5A 1VQNV 3ZX6A 3LSUA 4RUEA 1URFA 1X59A 1P4RA 4U3FH 4G28B 5L3GA 1JVMA 2KSDA 4FLVA 2YIBA 5FL7G 1ZX3A 1BSMA 3LDDA 5EIBC 4CH5A 3DXRB 2CE4A 5JWPA 5B1AB 5GTHZ 1KUQA 1AI7A 4I7ZB 1Y4MA 5LYJA 2HVJC 5FLXN 2PYJA 4DR5B 1HNWO 2UU9B 2IJIA 2ZXWB 3OMIB 1SETA 3H1JH 4LP8A 1V55C 1FYJA 2ITDC 3ZIAG 5EZYA 3CRMA 1LR1A 3FX7A 4OX9O 1JJ2U 1UPGA 2WA3A 5EBWC 1JA8A 2DQ3A 2MK3A 1N0JA 2QGNA 4GKKO 1G4YB 1WNSA 3SPJA 3CSXA 1P49A 4Q6GA 1VQ6V 4RUFA 5LYJB 4RAIA 1YF2A 2CDYA 2V1DA 4JASA 1HNWB 2IH3C 4AHCA 2E5LO 1Q6UA 2Q5ZA 1XQ8A 2PTMA 1ZL8A 4JYCA 3U10A 1VQ7V 1SQPH 2JIZG 4WFFA 3RVYA 2OIGA 4ZBMA 3ML0A 4X65O 1HR0O 3HKEA 2E74B 2Q0AA 1FJGO 4EEQA 1VQOV 4X1KA 3WB2A 2VQEB 4H13B 3LDEA 1QHTA 4PD4F 3J80N 1MA1A 2CTQA 2M7WA 1Q82W 2Y4UA 2R9RB 1ORQC 4TWKA 2QA4V 5KUMA 1BT8A 1NKDA 3BA8A 1ZL8B 1M57B 2QSAA 1OZ0A 2AHZA 2DYRB 2G38A 2EILC 1WB8A 4X65B 4X1KB 3HKCA 1QQCA 4X9QA 2B9ZA 1KP3A 5L3EA 1FJGB 4TV9A 5IJ9A 1QCEA 3OE7G 5EIBD 1I08A 4U7OA 1E79G 3TGUH 1VQ4V 3SR2C 1SQBH 1NVPB 2ZE8A 1WLEA 2YXYA 2X6AA 3VQYA 2UUCB 1RM1B 1G8MA 3ABMC 1XMOO 1KB9F 4D6TH 4DUYO 5IDJA 2JJ2G 5L3DA 3L74H 3HKCB 1S77D 4BW5A 2XTAA 4DR7O 1F4NA 3KG2A 2QKAA 1Z5WA 2EINB 4KHPO 4F6EA 3G80A 1VMGA 2Y69B 4ZI7A 1YCIA 4X20A 2DYSB 2GTAA 1AROP 4JZ2A 3VBBA 4FLTA 1QBZA 2PY5A 3UM7A 2DMXA 1XEQA 4DUYB 3CMAV 1ZSPA 3A0HZ 3WB1A 1VF7A 3WU2Z 5B1BB 5KHHA 3SGIA 1Q6HA 2H94A 3E22A 2P4VA 2BTQB 3D8CA 4H0LB 4CC5A 4B3RB 5EYPA 4KHPB 4ZI7B 1M56C 4X20B 3OGIB 4AQYO 2EULA 3ABTA 4R8CA 2F23A 5JH7A 4P9PA 3OD4A 2XASA 2CAZC 1AP5A 1VQMV 5EBMC 1NH2B 4FLWA 2OTLV 4JI0B 2B1GA 1GN3A 3RT3C 4WCEV 1I5XA 3E22B 4F4LA 4MVRA 4N23A 2EIKB 3I5DA 1FKAO 2Q7HA 4R50A 4DK1A 2JJ1G 4MW8A 3L70H 3BHPA 1SESA 5JCOA 1D5AA 2K9PA 5BR8B 5JH7B 3E86A 3K9SA 2BE3A 2QWQB 4X1YA 4UUJC 5CA0A 2UUAO 1HNXO 3RFRA 1WA8A 2XAGA 4ASUG 2V7QG 4ZOLA 1P7BA 5LL6Y 1Q43A 1DF4A 1R6KA 2ADPA 2X6BA 3NR7A 5IT9N 3FFQA 1THZA 3U0ZA 4P2ZA 5GTIZ 1FS0G 3X2QB 1QU7A 3CYOA 5HFLA 4DR4O 4X1YB 4QGPA 1Q3EA 4JI8B 1NS1A 1N36O 3O65A 5CA0B 4FLYA 2RQ6A 1WA8B 5CA1A 1DGSA 2UUAB 4ZOLB 5KHGA 3AG3C 3L75H 2B5UA 4MVOA 2DWEC 2QEXV 5EK0A 1J5EO 2LJ2A 3K57A 3THOA 1L0NH 1K34A 1CP9A 3JCZA 5IJ0A 1Q90D 2MW2B 4K35A 1YHQV 1W2BU 2WLNA 1MNGA 4NVPA 5F2VO 4MVQA 1OCOB 2F43G 5CA1B 1XNQB 1N36B 5DECA 4P30A 4MVZA 3M8AA 2DWDC 3JAMN 4LF6O 3AK2A 2P5OA 1BZKA 2UXBO 4WF9V 4NXMO 4B3SB 1J5EB 1B06A 3TJTA 2WLMA 3OMNB 4O4HA 3K79A 2W6IG 2RN9A 1KU9A 4JPRA 1XHZA 3GB7C 4JI4O 4X1IA 4HAMA 1KD1W 4FFKA 1OCCC 4HYOA 2PI4A 3CRRA 3OFNG 5KAFZ 4K3AA 4UCRA 2OCCC 1N33O 3JASA 4YIPA 4FM2A 1AP6A 3K03A 3B8NA 4ABMA 5FNVA 3DGEA 2RDCA 3SYOA 2UXBB 4WFAV 4NXMB 4O4HB 1WP7A 4FPPA 4B3MO 2JDIG 2CTRA 1I94O 3QO5A 3F5WC 3CCUV 5TISZ 2W0FC 4DV5O 4X1IB 4DV4O 5IY5B 1FXKC 1EN5A 4GX0A 1AI5A 2Q6AA 3JASB 2ZIOA 3RYCA 4I55A 3UKMA 1YJNV 1N33B 4X8AA 5FNVB 5KA5A 1AI6A 1OCRB 3OTOB 3ZMSA 4LFBO 4MS2A 3UT5B 1I94B 2QKSA 1XUQA 4DK0A 5AG2A 4IL6Z 1EZJA 4DV5B 4UCUA 4DYLA 2IU3A 5L3CA 3T4ZA 5CBFA 4J7ZA 3OGCC 3RYCB 4I55B 3ZS8C 3A2FA 1JMKC 3SPHA 3CXHF 4LFAO 1W0JG 4JI5O 2YUAA 1SA0A 3ZHRA 3K06A 2ZIMA 1F23A 1NI8A 4LFBB 3AG2B 5B1OA 2GBOA 2JEUA 2YEVA 3IJ4A 5LXTB 3K0GA 4YY3B 4LF9B 1GMGA 1H38A 4ZIBA 3H1LH 4DV1O 2NLJC 1H8HG 4I0XA 4TUYA 4LFAB 1H2SB 1N34O 1OHHG 4Z1VA 3K5MA 4JI1O 2WLLA 1VQKV 3CCRV 1OV9A 4DV3O 1WB7A 4DV0O 1R3KC 5KX5A 1XHXA 3E8FA 4N21A 3EHBB 4KXRA 2QKCA 1V9PA 1U96A 1K33A 2CUGA 1L1FA 1RPOA 1YEWA 4DR2B 2EBOA 5K1PA 4I0XB 4TUYB 3L9DA 4J10A 1TVKB 1BL8A 5B3SB 4MTFA 1YTFB 4FLZA 2Y48A 4YXWG 1S5HC 1Q6IA 2VRZA 1N34B 2YC0A 2OYQA 4L87A 4JYAO 3WG7B 1V54B 4JI1B 2LGQA 1KKCA 3L72H 4DR3O 3GWKC 5KX5B 3ZHQA 3T1HB 1Y66A 3ABKB 2HLDG 1GAXA 1MOFA 4NXNB 3MAQA 2OIEA 3D36C 4OGQB 2X7RB 3IC7A 1R3LC 4FM0A 2ADQB 2OWOA 5L3FA 3BRCA 2P67A 1S3JA 1I5YA 1J95A 1VF5B 1GK9A 4JYAB 1QNMA 2LW1A 1MZFA 2YSUB 4DR3B 1MMMA 4MTXA 5ITZA 2PZSA 2H3OA 2QM7A 3ASOC 1US6A 2XOKG 3ZN1A 1K8AW 4X66O 4JGSA 1XREA 2ZDIC 2PI5A 2EX3A 4WFBV 5IYZB 3T4DA 3O9OA 1NBMG 2FB5A 3HPLC 1TUEB 2IBZH 4PA4A 1AI4A 1I0HA 2JGUA 1AJNA 1FFXA 5B1AC 2DE0X 2P6JA 1X4TA 5KLVH 2CH7A 1Y76A 5CN0A 4TV8A 3G6EV 4F6RA 1OCZB 5ITZB 2XHBA 4R6ZA 4D7SA 2IJJA 3BVOA 3KZIZ 4J11A 4JV5O 2QM4A 3CRAA 2WWWA 4YJ3A 4X66B 4FLUA 1N32O 1FFXB 4JI2O 3SYQA 1VIBA 3EXAA 5K1XA 3P3NA 1AVMA 2CH7B 1Y76B 3P30A 3JAKA 3QNEA 3SJQC 3K9AA 4TV8B 5J2TA 4F6RB 2EIJB 4FZ0A 3LSSA 3BPZA 1GKFA 4OX9B 4YIOA 1PNLA 2ZQMA 3VQXA 2FL4A 4ZHQA 4YJ3B 1QR9A 3BCCH 4GKKB 1AB3A 5KA6A 3SYCA 4JV5B 1NTMH 2E76B 3OUFA 3OR6C 1L8DA 1KBHA 3C3TA 3A8TA 1O9HA 5B5EZ 2Y0PA 3JSLA 2Z5UA 3R66A 2YIDA 4CH6A 1N32B 5A2QN 3JAKB 1F51A 2E5LB 2FYUH 1BGYH 2A7WA 5J2TB 1Y67A 3FB8C 1H2MA 1ZTEA 3BA9A 1QLEB 3F7YC 5FPRA 3N2KA 1HWYA 4LH7A 2C2AA 1HR0B 4ZHQB 2BOBC 3M7MX 5JJNB 1FXHA 2Q7GA 4X62O 2WLIA 1IXMA 3ASNB 2ZD9A 2VWJA 3UCSC 2AW9A 4TT3G 5E1AC 3MHSC 1M57C 3E8HA 1GM8A 2AXTZ 1PPJH 3AG1B 1YSCA 1YJ9V 2ETNA 2M6YA 2DYRC 3JSNA 3K04A 2XUMA 2YI8A 3ABUA 3D3IA 1K4CC 2CGOA 2PGGA 3VOUA 5B66Z 2JGDA 2YIAA 1PD3A 3W7WA 1PV0A 2HJDA 2ZINA 3N2KB 4MTOA 4KL1A 4DR1O 3J7AU 3STLC 3KCXA 4UCSA 2LW7A 2WLIB 3BFRA 3FYIB 4G2KA 4J9ZB 4UCOA 1BS3A 2PYLA 2Y4TA 1PP9H 5LHHA 4X62B 2CTWA 1VF6A 1XBLA 5JQGA 1RM1C 1DLBA 2BTQA 3QTCA 2NR5A 1S5JA 1SZTA 1K73W 3CWBH 2YIBD 2WA4A 1LUWA 2P90A 2A0LA 1QR8A 2D2CB 2CK3G 2JGDB 4FZ1A 1BCCH 2ZE7A 1XMOB 2EINC 4IIJB 3SYAA 2HEPA 4DR1B 4K8ZA 2Y69C 1NR7A 3CJHA 1BHBA 2DYSC 2BOCC 3A0RA 1GN6A 3BY6A 5JQGB 1Q7YW 4LF8O 3UO2A 4DR7B 2FKXA 3ABLB 2AZ0A 1YZBA 5IWAO 3G67A 5HFMA 3RVZA 3CPWU 1M56B 3TXSA 2IW5A 2L35A 1W0KG 5B1BC 3JD3A 1QVFU 3CXCU 5A9GA 1VP7A 1E1QG 1VQPV 4IT5A 3RN4A 1KP2A 3C3SA 3CJHB 3S3WA 1ROPA 1U97A 3U11A 1JCHA 2UXCO 1R1BA 1BE3H 2P06A 3JYCA 4B7KA 1Q5OA 2P4KA 2GDSA 1XL4A 5IWAB 3ETGA 2QDOA 2GV9A 1GN4A 3B40A 4UCTA 4AQYB 3E8GA 1ZLZA 4O4LA 3OMAB 4AILC 1OJHA 4XDLA 1DTOA 2EIKC 3AK1A 5LP6A 4A5UB 4XDJA 3BEHA 1G1XB 3RYHA 4RQFA 4QPJA 2R70A 1W59A 3GVMA 3SPIA 1MSDA 2KQXA 4WFHA 2ODMA 2W0XA 5BXZA 5EC2C 5E79Z 4CBCA 4O4LB 1NVPD 1D5NA 2GSMB 1FPOA 4OPAA 4UCVA 3ETDA 1WN7A 4DW1A 2JS5A 4G27B 5LP6B 1YDXA 1VQ5V 1HNXB 2HFEC 1UJWB 3RYHB 2FTKA 5JCOC 3NXSA 3X2QC 1ZAUA 4IYIA 1AILA 4LH6A 5EBLC 3E83A 4TQDA 4FFBA 2Q4PA 2Q7EA 3JD1A 3FKSG 4H44B 1KECA 4O2BA 1R6NA 4UB6Z 1GM7A 2A9HA 1VEWA 4ZKIA 1RP3B 1NZ6A 4UFZA 4DR4B 4L8JA 1K97A 1TGOA 4DV6O 3CC2V 2WAMA 2DQ0A 4BW9A 4PDMA 1IX9A 1WPXA 4FFBB 1XOUA 5JVDA 2XT9A 3CCEV 1OCOC 5LA6A 5KMGA 3B09A 4O2BB 4QIWF 2AGAA 3ZCCA 2JEXA 4JAAA 4FJCC 3CP1A 4PHZA 1PL4A 4I4TA 2O57A 1FD9A 3JARA 1IBMO 1K4DC 2OCCB 4DV6B 1NH2D 1EN4A 3CMEV 4GX1A 3K5NA 4LF6B 4UV8A 3QF7A 5GONA 2IM9A 1IVSA 3ZMVA 5JVDB 1DF5A 1K9MW 5LA6B 3SJCC 5KMGB 3N2GA 3HKBA 1CEZA 2LO1A 2IJHA 3TCUA 3UT5A 4I4TB 4BWAA 2AZ2A 2Z0AA 5FPOA 3JCUZ 3K58A 1IBKO 2ZE5A 2HG5C 3JARB 3E35A 4JI4B 4LWSA 1XMQO 1YVWA 2KB1A 3QVNA 4DXWA 4FLXA 4W4KA 3FYEB 5GONB 2DJVA 1AJPA 5IY5C 2HJFC 4GUNA 3CS5A 3N2GB 1S72V 3HKBB 4K0KO 3G71V 2X6CA 3JAWA 4B3MB 2UXNA 4D7TA 3B77A 1OCRC 2GUZA 1IBKB 1PKXA 1M4UA 1YJWV 4DV4B 4IHJA 4LWSB 5LXTA 2N74A 2EZOA 1IBLO 2LGWA 3CRQA 4PA3A 1H8EG 4MSWC 1XMQB 4NB5A 4PJ0Z 2D3OW 1DK1A 2QWRB 3CCQV 4JAVA 3ZEDA 5LMNO 3BABA 1B6QA 3K5LA 2UUBO 3QG5A 3MDSA 2QWPB 4DW0A 3JAWB 4K0KB 2NN4A 2Z3YA 4P9OA 3W7XA 2GUZB 2F66C 2VQFO 5EC1C 3CE2A 4IHJB 4DUZO 1CXZB 4GKJO 3AG4B 1IBLB 1RFYA 5IYDO 2JVDA 4J7KA 4CS3A 3T1YO 5C93A 1TVKA 3AG2C 4X89A 4I50A 4TOIA 4JI5B 2EIMB 5CA3A 2BSKA 5LMNB 4JYBA 2UUBB 1YITV 1XL6A 4LC1A 4Z2WA 2H8PC 2A06H 5H6QA 4IYHA 1IDSA 1JX9A 1YIJV 2P22C 3RBZA 4DUZB 5KHJA 3CCLV 4EB6A 2ZKOA 3ZHTA 4DV1B 1SC5B 1R73A 3T1YB 3RGBA 4I50B 2IH1C 2Y0IA 3L71H 1LNQA 1GTOA 3APOA 1GRJA 5LGUA 2BSKB 4RO2A 2X0LA 1VQ8V 4KUMA 4MVUA 1F4MA 4DV3B 1COWG 4DV0B 3K59A 3TXQA 2HHHO 5B3SC 3I56V 3FAVA 4BIZA 2E3CA 4WFEA 4BIUA 4FMTA 5LBQA 3WG7C 1V54C 4EB6B 4O2AA 4BIOA 5KHKA 4UB8Z 4LCUC 3B2EE 5IYZA 1VQ9V 1RPRA 3T2MA 5JJEB 3STZC 2R72A 3CD6V 1L0LH 4H33A 1H2GA 5IYBO 2RMKB 4QE9A 4E2LA 5BMVA 5IE9A 2GHYA 1M90W 1NTZH 1SRYA 2JS3A 1BQ0A 1Z5VA 2R9IA 4LNUB 3OW2U 1KKDA 2V4DA 3OTFA 4YHHO 3FAVB 4CH4A 3T1CA 1VARA 2ZCEA 3JD0A 2HHHB 2VWKA 3RWRD 4O2AB 4FK5C 4U3JA 2DW4A 1SQXH 2ARHA 4J41A 4O4JB 4HBNA 2PUSA 5BMVB 1V55B 2WSSG 3H1IH 1SERA 1SQFA 2WLKA 3RW0A 4JAUA 3OEHG 4QJFB 3B8MA 4YHHB 1NJIW 4PI2A 4PV1B 1MZEA 2ZXWC 4WFGA 1TAEA 1QVGU 3ZHUA 1M1KW 4U3JB 2RJZA 1SS3A 1AR1B 1A32A 3IC9A 3MHHC 1OCZC 2VQEO 2K1EA 1F7YA 1D2DA 4DRXA 2Q69A 2R9AA 2W6JG 2QWOB 1PL0A 3C90A 2ZR3A 5H9CA 2FMLA 4CC6A 1G6UA 4MW3A 4NKGB 1YI2V 3FB5C 3F7VC 3MD0A 1SKVA 4OXSA 5EZYB 4PDLA 1YTFD 2EIJC 5KHIA 1VQLV 2LFSA 1TA8A 4JI2B 1I7FA 3EVKA 3EFFK 5D5PA 4DRXB 3TK1A 1FFTB 2EJ7A 4QPKA 1K7DA 4UVBA 3JATA 2ZM6O 3K0DA 1FXVA 3IAYA 2WLHA 2EILB 2YI9A 3RYIA 4WBNA 1EBOA 2F95B 5DEDA 3CC4V 5D5QA 3OT7A 2UUCO 2OT5A 3W7TA 1SF9A 5LGTA 5CBHA 1NT2B 2QM8A 4MT8A 4TSFG 1QLEC 1K5SA 3HKEB 4RQEA 1H2NA 2EJRA 3A0BZ 1B04A 1UFIA 1PM9A 3JALA 5J2UA 3JATB 3ASNC 4E4EA 4QNHB 2OTJV 1IXBA 4Q20A 1WAZA 2Q68A 3ABMB 3OR7C 4UV9A 2ZM6B 4IIJA 3WFVA 3RYIB 4WBNB 3AG1C 3CRCA 2XAQA 3IFXA 5LHIA 1WJZA 3BAAA 2F93B 5LMUO 2ATKC 4C7UA 2E75B 3G4SV 4GCZA 4PDVA 4JI6O 2ITCC 4Z1MG 5JJJB 1JJOA 2ZT9B 3OEEG 4W4LA 3AG7A 3JALB 1BHAA 5J2UB 4TV9B 2QTSA 5IJ9B 2CTPA 2F1MA 5H6RA 4IGGA 1N8RW 3ETEA 1KC8W 2QTOA 4B3RO 3SYPA 4JTDB 2B1IA 4JI3O 3ICXA 4DR6O 4NTWA 3ZBHA 4NYKA 1P84F 5LMUB 3LSQA 4U7NA 3HR0A 1Q81W 3H1HH 2PF4E 1SQGA 2A3QA 2HKOA 4JI0O 1Y74A 4JI6B 4GLXA 4I5SA 4EKWA 2YXLA 4DV2O 4YJ2A 3SJBC 4LF5O 1VF6C 4KP4A 1ENVA 3H1KH 1XDCA 3ZRWA 3ABLC 4LFCO 1NTKH 2L6LA 3F5TA 5H5NA 1GM9A 1IURA 1EZVH 3CEIA 3DC6A 3CB2A 4JI3B 1M93A 5BR8O 3AEIA 3HKDA 3K08A 3SPGA 3UO3A 4DR6B 4PA7A 1EM1A 1SQVH 4LF8B 4HZ3A 1EFRG 3LNNA 3SJAC 4JYYA 3PN1A 1YXBA 1KMIZ 1Y74B 3JD4A 1R3IC 4YJ2B 4X88A 3E8BA 4JTCB 5J9PC 3PJSK 2LFRA 4DV2B 4LF5B 3ZRWB 2P7TC 1N4CA 4LFCB 4QE7A 5EYPB 1K3EA 1HW7A 1LUVA 5LGNA 2N05A 3HKDB 4EFEA 2UXCB 4O4IA 1KYOF 4JI8O 5BY1A 4B7EA 4K8XA 3W7SA 3ZMUA 3ZN0A 4FM1A 3OUSA 3ZMZA 3LNMB 4GT1A 3LUTB 5CBGA 1MSWD 1MG1A 3FB6C 4R7CA 1FAFA 1WP8A 1T5EA 2RCVA 2Q73A 4PA6A 5KAIZ 3SPCA 3VQVA 1WPBA 3AG3B 2BCCH 3H01A 2Q0OC 5DN6G 4O4IB 3R65A 4PA9A 4MTGA 3ZHSA 2YS8A 3RYFA 3CCVV 4CS4A 1H2LA 1XNQO 5LP6C 4FVMA 3ETQA 2EZPA 4JF3A 4LR3A 4CH3A 4NTYA 4PI0A 4B3SO 4B3TO 2DN9A 5CMUA 5C8YA 2ZNJA 4GX2A 4MVSA 2XAHA 2YXHA 3CHXA 2WPDG 3GWOA 4RWUA 1XI1A 2JRIA 3JD2A 1JFFA 2WLJA 3SDLA 1NU1H 3RYFB 3DTUB 1NQTA 4NTXA 2JK5C 3L73H 3FD9A 5CB4A 1AR4A 1B3QA 2IU0A 2Q8VA 2QWNB 4LBEC 1RSOA 2DOSA 1FXKA 1OCCB 3I55V 5C8YB 3CX5F 3M99B 4B3TB 4DV7O 2XAFA 5IJ0B 4GYCB 4OPHA 1JFFB 1GO3F 1PNMA 1N0NA 3KCYA 1XNRO 1S76D 1R6TA 2A79B 4EFBA 2QE7G 3OM3B 2QR4A 5CB4B 5B1NA 3CCMV 3P32A 3OTOO 3B4SA 2N04A 1RSOB 1FXKB 5LHGA 1NR1A 2GTSA 1KQSU 2OCHA 3FB7C 4HNAA 1IBMB 2UXDO 1R3JC 1ZUQA 1IZ3A 3HB3B 4NR1A 3G6BA 4DV7B 3UQ8A 2HVKC 1JR9A 3AK3A 3ZJZA 1GN2A 1Y6XA 1XNRB 4X64O 3ZRVA 1K5QA 4KFMA 3K5OA 4GX5A 4J7JA 5GW7A 4LF7O 4HNAB 4B08A 2KKWA 4XDKA 4I9WA 2UXDB 1QLNA 4GZRB 3J81N 2F4VO 3E2EA 4H37A 1S0VA 3DSQA 3CCSV 3N27A 4J9YB 4CS2A 1O9GA 1P7GA 4BAYA 2CGNA 3H9VA 1MABG 2HP8A 4BR6A 4LF4O 4YY3O 1Q8IA 1JPXA 4LF9O 3OAAG 4X64B 2LQTA 3P3PA 5KUKA 2UXXA 1BMFG 2IJKA 2LP7A 2ZNIA 3APQA 1S5LZ 2KG7A 3W7UA 1M9NA 3LDCA 3QO7A 4LF7B 1HP8A 5DM6V 4CZZA 2AHYA 4J80A 4UVAA 4FIPC 1HDJA 2VS0A 2YICA 2F4VB 4MVMA 4AI8A 3ZHVA 3E89A 3S3XA 4DR2O 4UXNA 5BZBA 1HNZO 1ZWIC 4LF4B 1SQQH 1K92A 3AG4C 4JI7O 2KG7B 3TETA 1XILA 2VQFB 1SA0B 2EIMC 2HR3A 1JQ0A 2ZE6A 4JTAB 2ZR2A 4GKJB 4JZGA 5IYCO 3D36A 5H2FZ 3T1HO 5LOVA 3CC7V 4NXNO 3ZRSA 2YEVB 4XBFA 1PNKA 3VQWA 1Z2GA 3Q4HA 4PELA 1SZXA 1JOYA 1CPYA 1HNZB 3KKYA 3ZMTA 2XNDG 1TUBA 2YDEA 1AJQA 4LNUA 3K3WA 2NNUA 4JI7B 3ZRXA 1EN6A 2RNBA 4DO2A 3CCJV 2QJ1A 2WLLB 4UVCA 2Q67A 1E1RG 4ICGA 4I9QA 2ZDIA 1M5IA 3WB0A 2ILMA 5LOVB 2BTOA 3ABKC 4TQFA 4J42A 4O4JA 1Q86W 1GH6A 2Q9LA 3Q4HB 3DXRA 3D3QA 3IGAC 1H2KA 4PDRA 1TUBB 1BQZA 3QO8A 5L3BA
chains in the Genus database with same CATH topology
5EC2C 4QNHB 3ASNC 2OTJV 2XAJA 3ASOB 4Q20A 2Q68A 3ABMB 3OR7C 4CBCA 1NVPD 1VQNV 4UV9A 2GSMB 4MS2A 4RUEA 1P4RA 5L3GA 4G28B 1JVMA 2QKSA 3ETDA 3WFVA 3AG1C 2XAQA 5FL7G 4G27B 3IFXA 5LHIA 1EZJA 1VQ5V 2IU3A 3LDDA 5L3CA 3T4ZA 2HFEC 5CBFA 1UJWB 3OGCC 2ATKC 2FTKA 3NXSA 3X2QC 3SPHA 5B1AB 3G4SV 4GCZA 4PDVA 1AI7A 5EBLC 3E83A 1W0JG 2ITCC 4Z1MG 1Y4MA 3JD1A 3OEEG 3FKSG 2HVJC 1KECA 1BHAA 3K06A 1R6NA 1GM7A 2A9HA 2IJIA 2ZXWB 1F23A 1SETA 3OMIB 5H6RA 4ZKIA 1N8RW 3ETEA 1KC8W 2QTOA 3AG2B 4LP8A 1V55C 5B1OA 3SYPA 4JTDB 2JEUA 2B1IA 1K97A 2ITDC 3CC2V 2YEVA 3ZIAG 3K0GA 2WAMA 1JJ2U 1GMGA 2DQ0A 1H38A 5EBWC 3LSQA 2NLJC 2DQ3A 2MK3A 1H8HG 4U7NA 4PDMA 1G4YB 1Q81W 1WPXA 3SPJA 1OHHG 4RUFA 2HKOA 1VQ6V 3CCEV 1OCOC 4I5SA 4RAIA 4EKWA 4QIWF 3ZCCA 2WLLA 1VQKV 3CCRV 2V1DA 2JEXA 4KP4A 1ENVA 4FJCC 3CP1A 4JASA 3ZRWA 2IH3C 3ABLC 1R3KC 3E8FA 4N21A 3EHBB 1K4DC 1GM9A 2OCCB 1K33A 1VQ7V 4JYCA 3AEIA 3K08A 1L1FA 3SPGA 2JIZG 1NH2D 4WFFA 1RPOA 3CMEV 4PA7A 3RVYA 4ZBMA 2EBOA 4GX1A 3ML0A 4HZ3A 4UV8A 1EFRG 3ZMVA 1BL8A 5B3SB 1VQOV 4MTFA 1YTFB 3JD4A 1DF5A 1K9MW 2Y48A 4YXWG 3LDEA 1S5HC 1R3IC 4X88A 3E8BA 1CEZA 4L87A 4JTCB 5J9PC 3PJSK 3WG7B 2IJHA 3TCUA 1V54B 2LFRA 2M7WA 3ZRWB 1Q82W 2P7TC 2R9RB 2HG5C 1ORQC 4TWKA 1Y66A 3ABKB 2QA4V 4QE7A 3E35A 1K3EA 2HLDG 5KUMA 1NKDA 5LGNA 1MOFA 2KB1A 4DXWA 1M57B 1OZ0A 2AHZA 2DYRB 3FYEB 2EILC 3ZMUA 3W7SA 1AJPA 2X7RB 3IC7A 3ZN0A 5IY5C 2HJFC 1R3LC 5L3EA 1KP3A 3OUSA 3ZMZA 1S72V 5L3FA 3LNMB 4GT1A 3G71V 2X6CA 2P67A 1S3JA 3LUTB 5CBGA 1QCEA 1I5YA 1J95A 3OE7G 1MSWD 1GK9A 1MG1A 2UXNA 3FB6C 4R7CA 4U7OA 3B77A 2YSUB 1OCRC 4PA6A 1PKXA 1E79G 3SPCA 1YJWV 1VQ4V 1NVPB 4MTXA 1WLEA 2EZOA 3AG3B 2X6AA 4PA3A 1H8EG 4MSWC 1RM1B 2QM7A 3ASOC 1G8MA 3H01A 5DN6G 3ABMC 2XOKG 3R65A 4PA9A 4MTGA 3ZN1A 2D3OW 5IDJA 1K8AW 2JJ2G 5L3DA 4JGSA 3CCVV 2ZDIC 2PI5A 4WFBV 3T4DA 3CCQV 4JAVA 1S77D 1NBMG 3HPLC 4BW5A 1TUEB 1B6QA 2EZPA 4PA4A 1F4NA 3KG2A 4JF3A 1AI4A 2EINB 1AJNA 5B1AC 2Z3YA 4P9OA 2P6JA 3W7XA 2Y69B 5CMUA 4GX2A 5EC1C 2DYSB 2XAHA 4MVSA 5CN0A 3G6EV 2WPDG 1AROP 1OCZB 3GWOA 4R6ZA 3VBBA 3AG4B 1QBZA 3JD2A 2IJJA 3UM7A 2WLJA 5IYDO 3DTUB 5C93A 3AG2C 1NQTA 3CMAV 2WWWA 4X89A 2JK5C 2EIMB 5CA3A 5B1BB 2H94A 4JYBA 2IU0A 1YITV 1XL6A 3SYQA 4LBEC 4LC1A 2H8PC 1FXKA 1OCCB 5H6QA 3I55V 1M56C 3P30A 3QNEA 1JX9A 3SJQC 3K9AA 3M99B 1YIJV 2EIJB 3RBZA 2XAFA 3LSSA 3ABTA 4R8CA 1GKFA 4P9PA 3CCLV 1GO3F 1PNMA 1PNLA 2ZQMA 2XASA 1S76D 1R73A 2A79B 1QR9A 2IH1C 2QE7G 5EBMC 1VQMV 1LNQA 5KA6A 1GTOA 1NH2B 3SYCA 2OTLV 3OM3B 5LGUA 4RO2A 2B1GA 3OUFA 2X0LA 3OR6C 1VQ8V 4KUMA 5B1NA 4MVUA 4WCEV 3CCMV 1F4MA 3P32A 1I5XA 1COWG 2Z5UA 4F4LA 4MVRA 4N23A 2EIKB 1FXKB 5LHGA 4R50A 1NR1A 1KQSU 3FB7C 2JJ1G 4MW8A 5B3SC 1F51A 3I56V 1R3JC 1SESA 4BIZA 4WFEA 4BIUA 4FMTA 3HB3B 3E86A 5LBQA 3FB8C 3WG7C 1V54C 1QLEB 2HVKC 3F7YC 1HWYA 4UUJC 3ZJZA 2C2AA 4LCUC 2BOBC 1VQ9V 1RPRA 3T2MA 1FXHA 2XAGA 2WLIA 3STZC 1IXMA 3ASNB 3ZRVA 4ASUG 3CD6V 2V7QG 2ZD9A 1P7BA 4H33A 1K5QA 1H2GA 4TT3G 5E1AC 3MHSC 5IYBO 1DF4A 1M57C 3E8HA 1GM8A 4QE9A 4KFMA 4E2LA 4GX5A 3AG1B 1YJ9V 1YSCA 2GHYA 5GW7A 2DYRC 1SRYA 3K04A 1R6KA 1M90W 2X6BA 1THZA 2R9IA 3ABUA 3D3IA 3OW2U 1KKDA 1K4CC 4XDKA 3T1CA 4P2ZA 3JD0A 4I9WA 1FS0G 3VOUA 3X2QB 1QLNA 3CYOA 3E2EA 4H37A 1S0VA 1PD3A 5HFLA 3W7WA 4FK5C 4MTOA 3CCSV 4J9YB 2DW4A 4BAYA 3STLC 1MABG 4J9ZB 2WLIB 3FYIB 4G2KA 5LHHA 1JPXA 3AG3C 3OAAG 2B5UA 4MVOA 2DWEC 1DLBA 2UXXA 5EK0A 1BMFG 5KUKA 1RM1C 2QEXV 2IJKA 1V55B 2LP7A 2WSSG 1SERA 3W7UA 1SZTA 2WLKA 1K73W 1M9NA 3RW0A 3LDCA 4JAUA 3OEHG 1K34A 3QO7A 1CP9A 3JCZA 4QJFB 3B8MA 2P90A 2A0LA 5DM6V 1QR8A 4CZZA 2AHYA 2CK3G 4UVAA 1NJIW 4FIPC 2ZXWC 4WFGA 1YHQV 1W2BU 2EINC 2WLNA 1QVGU 4MVMA 3SYAA 1M1KW 3E89A 4MVQA 1OCOB 2F43G 2Y69C 1NR7A 1AR1B 1BHBA 2DYSC 4P30A 2BOCC 3A0RA 4MVZA 3BY6A 3MHHC 4UXNA 5BZBA 1OCZC 2DWDC 1ZWIC 1Q7YW 1K92A 3AG4C 3ABLB 4WF9V 5HFMA 2K1EA 3RVZA 3TETA 2Q69A 3CPWU 1M56B 2WLMA 2IW5A 3K79A 3OMNB 2W6JG 2W6IG 1W0KG 2EIMC 2HR3A 1JQ0A 1PL0A 4JTAB 2ZR2A 5B1BC 3JD3A 2ZR3A 4JPRA 1QVFU 5H9CA 3CXCU 5IYCO 3D36A 1E1QG 1VQPV 3GB7C 4MW3A 1KP2A 1YI2V 4HAMA 3FB5C 3F7VC 1KD1W 1OCCC 4HYOA 2PI4A 3OFNG 3MD0A 3CC7V 3ZRSA 2YEVB 2OCCC 4XBFA 1PNKA 4OXSA 1ROPA 1JCHA 4PELA 4PDLA 1YTFD 2EIJC 3K03A 3B8NA 1VQLV 1JOYA 1CPYA 3JYCA 3DGEA 2LFSA 3ZMTA 2XNDG 3SYOA 1XL4A 3EFFK 1AJQA 3TK1A 3K3WA 2NNUA 4WFAV 1FFTB 3ETGA 3ZRXA 4QPKA 1K7DA 4UVBA 4DO2A 3CCJV 3E8GA 4FPPA 2JDIG 2WLLB 4UVCA 3K0DA 2Q67A 3OMAB 1E1RG 1FXVA 3QO5A 2WLHA 3F5WC 3CCUV 4XDLA 2EILB 2ZDIA 2W0FC 1DTOA 2EIKC 3ABKC 1EBOA 5IY5B 1FXKC 3CC4V 4XDJA 4GX0A 1AI5A 1Q86W 3BEHA 2OT5A 2Q6AA 3W7TA 4RQFA 5LGTA 4QPJA 5CBHA 3UKMA 1YJNV 3IGAC 4X8AA 4PDRA 5KA5A 1AI6A 2QM8A 1OCRB 4MT8A 1QLEC 4TSFG 3SPIA 1K5SA 4WFHA 4RQEA 3ZMSA 3QO8A 5L3BA 2EJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT V;  2OTL V;  3G4S V;  1KD1 W;  1Q7Y W;  3CC7 V;  1VQ8 V;  1K73 W;  3G6E V;  3CCU V;  2D3O W;  1K8A W;  1JJ2 U;  1VQ9 V;  2OTJ V;  4WCE V;  3CCV V;  1S72 V;  1Q82 W;  3CCM V;  4WF9 V;  1VQN V;  3I55 V;  3G71 V;  3CCS V;  3CD6 V;  4WFB V;  3CC4 V;  1VQ7 V;  1VQL V;  5DM6 V;  3CCQ V;  2QA4 V;  3CPW U;  1Q81 W;  1NJI W;  1YIJ V;  1Q86 W;  3CME V;  1KQS U;  1YHQ V;  1W2B U;  1VQ6 V;  3CCE V;  1QVG U;  3CMA V;  3I56 V;  1YJN V;  3CCL V;  1N8R W;  1KC8 W;  1M1K W;  1YJ9 V;  1QVF U;  4WFA V;  3CXC U;  1VQ5 V;  1YJW V;  1M90 W;  1VQ4 V;  1VQO V;  1VQK V;  3CCR V;  2QEX V;  1R73 A;  3CCJ V;  1VQP V;  3OW2 U;  1K9M W;  1VQM V;  3CC2 V;  1YI2 V; 
#chains in the Genus database with same CATH topology
 4DR5 O;  2UU9 O;  1AR5 A;  2XAJ A;  3ASO B;  3DC5 A;  1VQN V;  3ZX6 A;  3LSU A;  4RUE A;  1URF A;  1X59 A;  1P4R A;  4U3F H;  4G28 B;  5L3G A;  1JVM A;  2KSD A;  4FLV A;  2YIB A;  5FL7 G;  1ZX3 A;  1BSM A;  3LDD A;  5EIB C;  4CH5 A;  3DXR B;  2CE4 A;  5JWP A;  5B1A B;  5GTH Z;  1KUQ A;  1AI7 A;  4I7Z B;  1Y4M A;  5LYJ A;  2HVJ C;  5FLX N;  2PYJ A;  4DR5 B;  1HNW O;  2UU9 B;  2IJI A;  2ZXW B;  3OMI B;  1SET A;  3H1J H;  4LP8 A;  1V55 C;  1FYJ A;  2ITD C;  3ZIA G;  5EZY A;  3CRM A;  1LR1 A;  3FX7 A;  4OX9 O;  1JJ2 U;  1UPG A;  2WA3 A;  5EBW C;  1JA8 A;  2DQ3 A;  2MK3 A;  1N0J A;  2QGN A;  4GKK O;  1G4Y B;  1WNS A;  3SPJ A;  3CSX A;  1P49 A;  4Q6G A;  1VQ6 V;  4RUF A;  5LYJ B;  4RAI A;  1YF2 A;  2CDY A;  2V1D A;  4JAS A;  1HNW B;  2IH3 C;  4AHC A;  2E5L O;  1Q6U A;  2Q5Z A;  1XQ8 A;  2PTM A;  1ZL8 A;  4JYC A;  3U10 A;  1VQ7 V;  1SQP H;  2JIZ G;  4WFF A;  3RVY A;  2OIG A;  4ZBM A;  3ML0 A;  4X65 O;  1HR0 O;  3HKE A;  2E74 B;  2Q0A A;  1FJG O;  4EEQ A;  1VQO V;  4X1K A;  3WB2 A;  2VQE B;  4H13 B;  3LDE A;  1QHT A;  4PD4 F;  3J80 N;  1MA1 A;  2CTQ A;  2M7W A;  1Q82 W;  2Y4U A;  2R9R B;  1ORQ C;  4TWK A;  2QA4 V;  5KUM A;  1BT8 A;  1NKD A;  3BA8 A;  1ZL8 B;  1M57 B;  2QSA A;  1OZ0 A;  2AHZ A;  2DYR B;  2G38 A;  2EIL C;  1WB8 A;  4X65 B;  4X1K B;  3HKC A;  1QQC A;  4X9Q A;  2B9Z A;  1KP3 A;  5L3E A;  1FJG B;  4TV9 A;  5IJ9 A;  1QCE A;  3OE7 G;  5EIB D;  1I08 A;  4U7O A;  1E79 G;  3TGU H;  1VQ4 V;  3SR2 C;  1SQB H;  1NVP B;  2ZE8 A;  1WLE A;  2YXY A;  2X6A A;  3VQY A;  2UUC B;  1RM1 B;  1G8M A;  3ABM C;  1XMO O;  1KB9 F;  4D6T H;  4DUY O;  5IDJ A;  2JJ2 G;  5L3D A;  3L74 H;  3HKC B;  1S77 D;  4BW5 A;  2XTA A;  4DR7 O;  1F4N A;  3KG2 A;  2QKA A;  1Z5W A;  2EIN B;  4KHP O;  4F6E A;  3G80 A;  1VMG A;  2Y69 B;  4ZI7 A;  1YCI A;  4X20 A;  2DYS B;  2GTA A;  1ARO P;  4JZ2 A;  3VBB A;  4FLT A;  1QBZ A;  2PY5 A;  3UM7 A;  2DMX A;  1XEQ A;  4DUY B;  3CMA V;  1ZSP A;  3A0H Z;  3WB1 A;  1VF7 A;  3WU2 Z;  5B1B B;  5KHH A;  3SGI A;  1Q6H A;  2H94 A;  3E22 A;  2P4V A;  2BTQ B;  3D8C A;  4H0L B;  4CC5 A;  4B3R B;  5EYP A;  4KHP B;  4ZI7 B;  1M56 C;  4X20 B;  3OGI B;  4AQY O;  2EUL A;  3ABT A;  4R8C A;  2F23 A;  5JH7 A;  4P9P A;  3OD4 A;  2XAS A;  2CAZ C;  1AP5 A;  1VQM V;  5EBM C;  1NH2 B;  4FLW A;  2OTL V;  4JI0 B;  2B1G A;  1GN3 A;  3RT3 C;  4WCE V;  1I5X A;  3E22 B;  4F4L A;  4MVR A;  4N23 A;  2EIK B;  3I5D A;  1FKA O;  2Q7H A;  4R50 A;  4DK1 A;  2JJ1 G;  4MW8 A;  3L70 H;  3BHP A;  1SES A;  5JCO A;  1D5A A;  2K9P A;  5BR8 B;  5JH7 B;  3E86 A;  3K9S A;  2BE3 A;  2QWQ B;  4X1Y A;  4UUJ C;  5CA0 A;  2UUA O;  1HNX O;  3RFR A;  1WA8 A;  2XAG A;  4ASU G;  2V7Q G;  4ZOL A;  1P7B A;  5LL6 Y;  1Q43 A;  1DF4 A;  1R6K A;  2ADP A;  2X6B A;  3NR7 A;  5IT9 N;  3FFQ A;  1THZ A;  3U0Z A;  4P2Z A;  5GTI Z;  1FS0 G;  3X2Q B;  1QU7 A;  3CYO A;  5HFL A;  4DR4 O;  4X1Y B;  4QGP A;  1Q3E A;  4JI8 B;  1NS1 A;  1N36 O;  3O65 A;  5CA0 B;  4FLY A;  2RQ6 A;  1WA8 B;  5CA1 A;  1DGS A;  2UUA B;  4ZOL B;  5KHG A;  3AG3 C;  3L75 H;  2B5U A;  4MVO A;  2DWE C;  2QEX V;  5EK0 A;  1J5E O;  2LJ2 A;  3K57 A;  3THO A;  1L0N H;  1K34 A;  1CP9 A;  3JCZ A;  5IJ0 A;  1Q90 D;  2MW2 B;  4K35 A;  1YHQ V;  1W2B U;  2WLN A;  1MNG A;  4NVP A;  5F2V O;  4MVQ A;  1OCO B;  2F43 G;  5CA1 B;  1XNQ B;  1N36 B;  5DEC A;  4P30 A;  4MVZ A;  3M8A A;  2DWD C;  3JAM N;  4LF6 O;  3AK2 A;  2P5O A;  1BZK A;  2UXB O;  4WF9 V;  4NXM O;  4B3S B;  1J5E B;  1B06 A;  3TJT A;  2WLM A;  3OMN B;  4O4H A;  3K79 A;  2W6I G;  2RN9 A;  1KU9 A;  4JPR A;  1XHZ A;  3GB7 C;  4JI4 O;  4X1I A;  4HAM A;  1KD1 W;  4FFK A;  1OCC C;  4HYO A;  2PI4 A;  3CRR A;  3OFN G;  5KAF Z;  4K3A A;  4UCR A;  2OCC C;  1N33 O;  3JAS A;  4YIP A;  4FM2 A;  1AP6 A;  3K03 A;  3B8N A;  4ABM A;  5FNV A;  3DGE A;  2RDC A;  3SYO A;  2UXB B;  4WFA V;  4NXM B;  4O4H B;  1WP7 A;  4FPP A;  4B3M O;  2JDI G;  2CTR A;  1I94 O;  3QO5 A;  3F5W C;  3CCU V;  5TIS Z;  2W0F C;  4DV5 O;  4X1I B;  4DV4 O;  5IY5 B;  1FXK C;  1EN5 A;  4GX0 A;  1AI5 A;  2Q6A A;  3JAS B;  2ZIO A;  3RYC A;  4I55 A;  3UKM A;  1YJN V;  1N33 B;  4X8A A;  5FNV B;  5KA5 A;  1AI6 A;  1OCR B;  3OTO B;  3ZMS A;  4LFB O;  4MS2 A;  3UT5 B;  1I94 B;  2QKS A;  1XUQ A;  4DK0 A;  5AG2 A;  4IL6 Z;  1EZJ A;  4DV5 B;  4UCU A;  4DYL A;  2IU3 A;  5L3C A;  3T4Z A;  5CBF A;  4J7Z A;  3OGC C;  3RYC B;  4I55 B;  3ZS8 C;  3A2F A;  1JMK C;  3SPH A;  3CXH F;  4LFA O;  1W0J G;  4JI5 O;  2YUA A;  1SA0 A;  3ZHR A;  3K06 A;  2ZIM A;  1F23 A;  1NI8 A;  4LFB B;  3AG2 B;  5B1O A;  2GBO A;  2JEU A;  2YEV A;  3IJ4 A;  5LXT B;  3K0G A;  4YY3 B;  4LF9 B;  1GMG A;  1H38 A;  4ZIB A;  3H1L H;  4DV1 O;  2NLJ C;  1H8H G;  4I0X A;  4TUY A;  4LFA B;  1H2S B;  1N34 O;  1OHH G;  4Z1V A;  3K5M A;  4JI1 O;  2WLL A;  1VQK V;  3CCR V;  1OV9 A;  4DV3 O;  1WB7 A;  4DV0 O;  1R3K C;  5KX5 A;  1XHX A;  3E8F A;  4N21 A;  3EHB B;  4KXR A;  2QKC A;  1V9P A;  1U96 A;  1K33 A;  2CUG A;  1L1F A;  1RPO A;  1YEW A;  4DR2 B;  2EBO A;  5K1P A;  4I0X B;  4TUY B;  3L9D A;  4J10 A;  1TVK B;  1BL8 A;  5B3S B;  4MTF A;  1YTF B;  4FLZ A;  2Y48 A;  4YXW G;  1S5H C;  1Q6I A;  2VRZ A;  1N34 B;  2YC0 A;  2OYQ A;  4L87 A;  4JYA O;  3WG7 B;  1V54 B;  4JI1 B;  2LGQ A;  1KKC A;  3L72 H;  4DR3 O;  3GWK C;  5KX5 B;  3ZHQ A;  3T1H B;  1Y66 A;  3ABK B;  2HLD G;  1GAX A;  1MOF A;  4NXN B;  3MAQ A;  2OIE A;  3D36 C;  4OGQ B;  2X7R B;  3IC7 A;  1R3L C;  4FM0 A;  2ADQ B;  2OWO A;  5L3F A;  3BRC A;  2P67 A;  1S3J A;  1I5Y A;  1J95 A;  1VF5 B;  1GK9 A;  4JYA B;  1QNM A;  2LW1 A;  1MZF A;  2YSU B;  4DR3 B;  1MMM A;  4MTX A;  5ITZ A;  2PZS A;  2H3O A;  2QM7 A;  3ASO C;  1US6 A;  2XOK G;  3ZN1 A;  1K8A W;  4X66 O;  4JGS A;  1XRE A;  2ZDI C;  2PI5 A;  2EX3 A;  4WFB V;  5IYZ B;  3T4D A;  3O9O A;  1NBM G;  2FB5 A;  3HPL C;  1TUE B;  2IBZ H;  4PA4 A;  1AI4 A;  1I0H A;  2JGU A;  1AJN A;  1FFX A;  5B1A C;  2DE0 X;  2P6J A;  1X4T A;  5KLV H;  2CH7 A;  1Y76 A;  5CN0 A;  4TV8 A;  3G6E V;  4F6R A;  1OCZ B;  5ITZ B;  2XHB A;  4R6Z A;  4D7S A;  2IJJ A;  3BVO A;  3KZI Z;  4J11 A;  4JV5 O;  2QM4 A;  3CRA A;  2WWW A;  4YJ3 A;  4X66 B;  4FLU A;  1N32 O;  1FFX B;  4JI2 O;  3SYQ A;  1VIB A;  3EXA A;  5K1X A;  3P3N A;  1AVM A;  2CH7 B;  1Y76 B;  3P30 A;  3JAK A;  3QNE A;  3SJQ C;  3K9A A;  4TV8 B;  5J2T A;  4F6R B;  2EIJ B;  4FZ0 A;  3LSS A;  3BPZ A;  1GKF A;  4OX9 B;  4YIO A;  1PNL A;  2ZQM A;  3VQX A;  2FL4 A;  4ZHQ A;  4YJ3 B;  1QR9 A;  3BCC H;  4GKK B;  1AB3 A;  5KA6 A;  3SYC A;  4JV5 B;  1NTM H;  2E76 B;  3OUF A;  3OR6 C;  1L8D A;  1KBH A;  3C3T A;  3A8T A;  1O9H A;  5B5E Z;  2Y0P A;  3JSL A;  2Z5U A;  3R66 A;  2YID A;  4CH6 A;  1N32 B;  5A2Q N;  3JAK B;  1F51 A;  2E5L B;  2FYU H;  1BGY H;  2A7W A;  5J2T B;  1Y67 A;  3FB8 C;  1H2M A;  1ZTE A;  3BA9 A;  1QLE B;  3F7Y C;  5FPR A;  3N2K A;  1HWY A;  4LH7 A;  2C2A A;  1HR0 B;  4ZHQ B;  2BOB C;  3M7M X;  5JJN B;  1FXH A;  2Q7G A;  4X62 O;  2WLI A;  1IXM A;  3ASN B;  2ZD9 A;  2VWJ A;  3UCS C;  2AW9 A;  4TT3 G;  5E1A C;  3MHS C;  1M57 C;  3E8H A;  1GM8 A;  2AXT Z;  1PPJ H;  3AG1 B;  1YSC A;  1YJ9 V;  2ETN A;  2M6Y A;  2DYR C;  3JSN A;  3K04 A;  2XUM A;  2YI8 A;  3ABU A;  3D3I A;  1K4C C;  2CGO A;  2PGG A;  3VOU A;  5B66 Z;  2JGD A;  2YIA A;  1PD3 A;  3W7W A;  1PV0 A;  2HJD A;  2ZIN A;  3N2K B;  4MTO A;  4KL1 A;  4DR1 O;  3J7A U;  3STL C;  3KCX A;  4UCS A;  2LW7 A;  2WLI B;  3BFR A;  3FYI B;  4G2K A;  4J9Z B;  4UCO A;  1BS3 A;  2PYL A;  2Y4T A;  1PP9 H;  5LHH A;  4X62 B;  2CTW A;  1VF6 A;  1XBL A;  5JQG A;  1RM1 C;  1DLB A;  2BTQ A;  3QTC A;  2NR5 A;  1S5J A;  1SZT A;  1K73 W;  3CWB H;  2YIB D;  2WA4 A;  1LUW A;  2P90 A;  2A0L A;  1QR8 A;  2D2C B;  2CK3 G;  2JGD B;  4FZ1 A;  1BCC H;  2ZE7 A;  1XMO B;  2EIN C;  4IIJ B;  3SYA A;  2HEP A;  4DR1 B;  4K8Z A;  2Y69 C;  1NR7 A;  3CJH A;  1BHB A;  2DYS C;  2BOC C;  3A0R A;  1GN6 A;  3BY6 A;  5JQG B;  1Q7Y W;  4LF8 O;  3UO2 A;  4DR7 B;  2FKX A;  3ABL B;  2AZ0 A;  1YZB A;  5IWA O;  3G67 A;  5HFM A;  3RVZ A;  3CPW U;  1M56 B;  3TXS A;  2IW5 A;  2L35 A;  1W0K G;  5B1B C;  3JD3 A;  1QVF U;  3CXC U;  5A9G A;  1VP7 A;  1E1Q G;  1VQP V;  4IT5 A;  3RN4 A;  1KP2 A;  3C3S A;  3CJH B;  3S3W A;  1ROP A;  1U97 A;  3U11 A;  1JCH A;  2UXC O;  1R1B A;  1BE3 H;  2P06 A;  3JYC A;  4B7K A;  1Q5O A;  2P4K A;  2GDS A;  1XL4 A;  5IWA B;  3ETG A;  2QDO A;  2GV9 A;  1GN4 A;  3B40 A;  4UCT A;  4AQY B;  3E8G A;  1ZLZ A;  4O4L A;  3OMA B;  4AIL C;  1OJH A;  4XDL A;  1DTO A;  2EIK C;  3AK1 A;  5LP6 A;  4A5U B;  4XDJ A;  3BEH A;  1G1X B;  3RYH A;  4RQF A;  4QPJ A;  2R70 A;  1W59 A;  3GVM A;  3SPI A;  1MSD A;  2KQX A;  4WFH A;  2ODM A;  2W0X A;  5BXZ A;  5EC2 C;  5E79 Z;  4CBC A;  4O4L B;  1NVP D;  1D5N A;  2GSM B;  1FPO A;  4OPA A;  4UCV A;  3ETD A;  1WN7 A;  4DW1 A;  2JS5 A;  4G27 B;  5LP6 B;  1YDX A;  1VQ5 V;  1HNX B;  2HFE C;  1UJW B;  3RYH B;  2FTK A;  5JCO C;  3NXS A;  3X2Q C;  1ZAU A;  4IYI A;  1AIL A;  4LH6 A;  5EBL C;  3E83 A;  4TQD A;  4FFB A;  2Q4P A;  2Q7E A;  3JD1 A;  3FKS G;  4H44 B;  1KEC A;  4O2B A;  1R6N A;  4UB6 Z;  1GM7 A;  2A9H A;  1VEW A;  4ZKI A;  1RP3 B;  1NZ6 A;  4UFZ A;  4DR4 B;  4L8J A;  1K97 A;  1TGO A;  4DV6 O;  3CC2 V;  2WAM A;  2DQ0 A;  4BW9 A;  4PDM A;  1IX9 A;  1WPX A;  4FFB B;  1XOU A;  5JVD A;  2XT9 A;  3CCE V;  1OCO C;  5LA6 A;  5KMG A;  3B09 A;  4O2B B;  4QIW F;  2AGA A;  3ZCC A;  2JEX A;  4JAA A;  4FJC C;  3CP1 A;  4PHZ A;  1PL4 A;  4I4T A;  2O57 A;  1FD9 A;  3JAR A;  1IBM O;  1K4D C;  2OCC B;  4DV6 B;  1NH2 D;  1EN4 A;  3CME V;  4GX1 A;  3K5N A;  4LF6 B;  4UV8 A;  3QF7 A;  5GON A;  2IM9 A;  1IVS A;  3ZMV A;  5JVD B;  1DF5 A;  1K9M W;  5LA6 B;  3SJC C;  5KMG B;  3N2G A;  3HKB A;  1CEZ A;  2LO1 A;  2IJH A;  3TCU A;  3UT5 A;  4I4T B;  4BWA A;  2AZ2 A;  2Z0A A;  5FPO A;  3JCU Z;  3K58 A;  1IBK O;  2ZE5 A;  2HG5 C;  3JAR B;  3E35 A;  4JI4 B;  4LWS A;  1XMQ O;  1YVW A;  2KB1 A;  3QVN A;  4DXW A;  4FLX A;  4W4K A;  3FYE B;  5GON B;  2DJV A;  1AJP A;  5IY5 C;  2HJF C;  4GUN A;  3CS5 A;  3N2G B;  1S72 V;  3HKB B;  4K0K O;  3G71 V;  2X6C A;  3JAW A;  4B3M B;  2UXN A;  4D7T A;  3B77 A;  1OCR C;  2GUZ A;  1IBK B;  1PKX A;  1M4U A;  1YJW V;  4DV4 B;  4IHJ A;  4LWS B;  5LXT A;  2N74 A;  2EZO A;  1IBL O;  2LGW A;  3CRQ A;  4PA3 A;  1H8E G;  4MSW C;  1XMQ B;  4NB5 A;  4PJ0 Z;  2D3O W;  1DK1 A;  2QWR B;  3CCQ V;  4JAV A;  3ZED A;  5LMN O;  3BAB A;  1B6Q A;  3K5L A;  2UUB O;  3QG5 A;  3MDS A;  2QWP B;  4DW0 A;  3JAW B;  4K0K B;  2NN4 A;  2Z3Y A;  4P9O A;  3W7X A;  2GUZ B;  2F66 C;  2VQF O;  5EC1 C;  3CE2 A;  4IHJ B;  4DUZ O;  1CXZ B;  4GKJ O;  3AG4 B;  1IBL B;  1RFY A;  5IYD O;  2JVD A;  4J7K A;  4CS3 A;  3T1Y O;  5C93 A;  1TVK A;  3AG2 C;  4X89 A;  4I50 A;  4TOI A;  4JI5 B;  2EIM B;  5CA3 A;  2BSK A;  5LMN B;  4JYB A;  2UUB B;  1YIT V;  1XL6 A;  4LC1 A;  4Z2W A;  2H8P C;  2A06 H;  5H6Q A;  4IYH A;  1IDS A;  1JX9 A;  1YIJ V;  2P22 C;  3RBZ A;  4DUZ B;  5KHJ A;  3CCL V;  4EB6 A;  2ZKO A;  3ZHT A;  4DV1 B;  1SC5 B;  1R73 A;  3T1Y B;  3RGB A;  4I50 B;  2IH1 C;  2Y0I A;  3L71 H;  1LNQ A;  1GTO A;  3APO A;  1GRJ A;  5LGU A;  2BSK B;  4RO2 A;  2X0L A;  1VQ8 V;  4KUM A;  4MVU A;  1F4M A;  4DV3 B;  1COW G;  4DV0 B;  3K59 A;  3TXQ A;  2HHH O;  5B3S C;  3I56 V;  3FAV A;  4BIZ A;  2E3C A;  4WFE A;  4BIU A;  4FMT A;  5LBQ A;  3WG7 C;  1V54 C;  4EB6 B;  4O2A A;  4BIO A;  5KHK A;  4UB8 Z;  4LCU C;  3B2E E;  5IYZ A;  1VQ9 V;  1RPR A;  3T2M A;  5JJE B;  3STZ C;  2R72 A;  3CD6 V;  1L0L H;  4H33 A;  1H2G A;  5IYB O;  2RMK B;  4QE9 A;  4E2L A;  5BMV A;  5IE9 A;  2GHY A;  1M90 W;  1NTZ H;  1SRY A;  2JS3 A;  1BQ0 A;  1Z5V A;  2R9I A;  4LNU B;  3OW2 U;  1KKD A;  2V4D A;  3OTF A;  4YHH O;  3FAV B;  4CH4 A;  3T1C A;  1VAR A;  2ZCE A;  3JD0 A;  2HHH B;  2VWK A;  3RWR D;  4O2A B;  4FK5 C;  4U3J A;  2DW4 A;  1SQX H;  2ARH A;  4J41 A;  4O4J B;  4HBN A;  2PUS A;  5BMV B;  1V55 B;  2WSS G;  3H1I H;  1SER A;  1SQF A;  2WLK A;  3RW0 A;  4JAU A;  3OEH G;  4QJF B;  3B8M A;  4YHH B;  1NJI W;  4PI2 A;  4PV1 B;  1MZE A;  2ZXW C;  4WFG A;  1TAE A;  1QVG U;  3ZHU A;  1M1K W;  4U3J B;  2RJZ A;  1SS3 A;  1AR1 B;  1A32 A;  3IC9 A;  3MHH C;  1OCZ C;  2VQE O;  2K1E A;  1F7Y A;  1D2D A;  4DRX A;  2Q69 A;  2R9A A;  2W6J G;  2QWO B;  1PL0 A;  3C90 A;  2ZR3 A;  5H9C A;  2FML A;  4CC6 A;  1G6U A;  4MW3 A;  4NKG B;  1YI2 V;  3FB5 C;  3F7V C;  3MD0 A;  1SKV A;  4OXS A;  5EZY B;  4PDL A;  1YTF D;  2EIJ C;  5KHI A;  1VQL V;  2LFS A;  1TA8 A;  4JI2 B;  1I7F A;  3EVK A;  3EFF K;  5D5P A;  4DRX B;  3TK1 A;  1FFT B;  2EJ7 A;  4QPK A;  1K7D A;  4UVB A;  3JAT A;  2ZM6 O;  3K0D A;  1FXV A;  3IAY A;  2WLH A;  2EIL B;  2YI9 A;  3RYI A;  4WBN A;  1EBO A;  2F95 B;  5DED A;  3CC4 V;  5D5Q A;  3OT7 A;  2UUC O;  2OT5 A;  3W7T A;  1SF9 A;  5LGT A;  5CBH A;  1NT2 B;  2QM8 A;  4MT8 A;  4TSF G;  1QLE C;  1K5S A;  3HKE B;  4RQE A;  1H2N A;  2EJR A;  3A0B Z;  1B04 A;  1UFI A;  1PM9 A;  3JAL A;  5J2U A;  3JAT B;  3ASN C;  4E4E A;  4QNH B;  2OTJ V;  1IXB A;  4Q20 A;  1WAZ A;  2Q68 A;  3ABM B;  3OR7 C;  4UV9 A;  2ZM6 B;  4IIJ A;  3WFV A;  3RYI B;  4WBN B;  3AG1 C;  3CRC A;  2XAQ A;  3IFX A;  5LHI A;  1WJZ A;  3BAA A;  2F93 B;  5LMU O;  2ATK C;  4C7U A;  2E75 B;  3G4S V;  4GCZ A;  4PDV A;  4JI6 O;  2ITC C;  4Z1M G;  5JJJ B;  1JJO A;  2ZT9 B;  3OEE G;  4W4L A;  3AG7 A;  3JAL B;  1BHA A;  5J2U B;  4TV9 B;  2QTS A;  5IJ9 B;  2CTP A;  2F1M A;  5H6R A;  4IGG A;  1N8R W;  3ETE A;  1KC8 W;  2QTO A;  4B3R O;  3SYP A;  4JTD B;  2B1I A;  4JI3 O;  3ICX A;  4DR6 O;  4NTW A;  3ZBH A;  4NYK A;  1P84 F;  5LMU B;  3LSQ A;  4U7N A;  3HR0 A;  1Q81 W;  3H1H H;  2PF4 E;  1SQG A;  2A3Q A;  2HKO A;  4JI0 O;  1Y74 A;  4JI6 B;  4GLX A;  4I5S A;  4EKW A;  2YXL A;  4DV2 O;  4YJ2 A;  3SJB C;  4LF5 O;  1VF6 C;  4KP4 A;  1ENV A;  3H1K H;  1XDC A;  3ZRW A;  3ABL C;  4LFC O;  1NTK H;  2L6L A;  3F5T A;  5H5N A;  1GM9 A;  1IUR A;  1EZV H;  3CEI A;  3DC6 A;  3CB2 A;  4JI3 B;  1M93 A;  5BR8 O;  3AEI A;  3HKD A;  3K08 A;  3SPG A;  3UO3 A;  4DR6 B;  4PA7 A;  1EM1 A;  1SQV H;  4LF8 B;  4HZ3 A;  1EFR G;  3LNN A;  3SJA C;  4JYY A;  3PN1 A;  1YXB A;  1KMI Z;  1Y74 B;  3JD4 A;  1R3I C;  4YJ2 B;  4X88 A;  3E8B A;  4JTC B;  5J9P C;  3PJS K;  2LFR A;  4DV2 B;  4LF5 B;  3ZRW B;  2P7T C;  1N4C A;  4LFC B;  4QE7 A;  5EYP B;  1K3E A;  1HW7 A;  1LUV A;  5LGN A;  2N05 A;  3HKD B;  4EFE A;  2UXC B;  4O4I A;  1KYO F;  4JI8 O;  5BY1 A;  4B7E A;  4K8X A;  3W7S A;  3ZMU A;  3ZN0 A;  4FM1 A;  3OUS A;  3ZMZ A;  3LNM B;  4GT1 A;  3LUT B;  5CBG A;  1MSW D;  1MG1 A;  3FB6 C;  4R7C A;  1FAF A;  1WP8 A;  1T5E A;  2RCV A;  2Q73 A;  4PA6 A;  5KAI Z;  3SPC A;  3VQV A;  1WPB A;  3AG3 B;  2BCC H;  3H01 A;  2Q0O C;  5DN6 G;  4O4I B;  3R65 A;  4PA9 A;  4MTG A;  3ZHS A;  2YS8 A;  3RYF A;  3CCV V;  4CS4 A;  1H2L A;  1XNQ O;  5LP6 C;  4FVM A;  3ETQ A;  2EZP A;  4JF3 A;  4LR3 A;  4CH3 A;  4NTY A;  4PI0 A;  4B3S O;  4B3T O;  2DN9 A;  5CMU A;  5C8Y A;  2ZNJ A;  4GX2 A;  4MVS A;  2XAH A;  2YXH A;  3CHX A;  2WPD G;  3GWO A;  4RWU A;  1XI1 A;  2JRI A;  3JD2 A;  1JFF A;  2WLJ A;  3SDL A;  1NU1 H;  3RYF B;  3DTU B;  1NQT A;  4NTX A;  2JK5 C;  3L73 H;  3FD9 A;  5CB4 A;  1AR4 A;  1B3Q A;  2IU0 A;  2Q8V A;  2QWN B;  4LBE C;  1RSO A;  2DOS A;  1FXK A;  1OCC B;  3I55 V;  5C8Y B;  3CX5 F;  3M99 B;  4B3T B;  4DV7 O;  2XAF A;  5IJ0 B;  4GYC B;  4OPH A;  1JFF B;  1GO3 F;  1PNM A;  1N0N A;  3KCY A;  1XNR O;  1S76 D;  1R6T A;  2A79 B;  4EFB A;  2QE7 G;  3OM3 B;  2QR4 A;  5CB4 B;  5B1N A;  3CCM V;  3P32 A;  3OTO O;  3B4S A;  2N04 A;  1RSO B;  1FXK B;  5LHG A;  1NR1 A;  2GTS A;  1KQS U;  2OCH A;  3FB7 C;  4HNA A;  1IBM B;  2UXD O;  1R3J C;  1ZUQ A;  1IZ3 A;  3HB3 B;  4NR1 A;  3G6B A;  4DV7 B;  3UQ8 A;  2HVK C;  1JR9 A;  3AK3 A;  3ZJZ A;  1GN2 A;  1Y6X A;  1XNR B;  4X64 O;  3ZRV A;  1K5Q A;  4KFM A;  3K5O A;  4GX5 A;  4J7J A;  5GW7 A;  4LF7 O;  4HNA B;  4B08 A;  2KKW A;  4XDK A;  4I9W A;  2UXD B;  1QLN A;  4GZR B;  3J81 N;  2F4V O;  3E2E A;  4H37 A;  1S0V A;  3DSQ A;  3CCS V;  3N27 A;  4J9Y B;  4CS2 A;  1O9G A;  1P7G A;  4BAY A;  2CGN A;  3H9V A;  1MAB G;  2HP8 A;  4BR6 A;  4LF4 O;  4YY3 O;  1Q8I A;  1JPX A;  4LF9 O;  3OAA G;  4X64 B;  2LQT A;  3P3P A;  5KUK A;  2UXX A;  1BMF G;  2IJK A;  2LP7 A;  2ZNI A;  3APQ A;  1S5L Z;  2KG7 A;  3W7U A;  1M9N A;  3LDC A;  3QO7 A;  4LF7 B;  1HP8 A;  5DM6 V;  4CZZ A;  2AHY A;  4J80 A;  4UVA A;  4FIP C;  1HDJ A;  2VS0 A;  2YIC A;  2F4V B;  4MVM A;  4AI8 A;  3ZHV A;  3E89 A;  3S3X A;  4DR2 O;  4UXN A;  5BZB A;  1HNZ O;  1ZWI C;  4LF4 B;  1SQQ H;  1K92 A;  3AG4 C;  4JI7 O;  2KG7 B;  3TET A;  1XIL A;  2VQF B;  1SA0 B;  2EIM C;  2HR3 A;  1JQ0 A;  2ZE6 A;  4JTA B;  2ZR2 A;  4GKJ B;  4JZG A;  5IYC O;  3D36 A;  5H2F Z;  3T1H O;  5LOV A;  3CC7 V;  4NXN O;  3ZRS A;  2YEV B;  4XBF A;  1PNK A;  3VQW A;  1Z2G A;  3Q4H A;  4PEL A;  1SZX A;  1JOY A;  1CPY A;  1HNZ B;  3KKY A;  3ZMT A;  2XND G;  1TUB A;  2YDE A;  1AJQ A;  4LNU A;  3K3W A;  2NNU A;  4JI7 B;  3ZRX A;  1EN6 A;  2RNB A;  4DO2 A;  3CCJ V;  2QJ1 A;  2WLL B;  4UVC A;  2Q67 A;  1E1R G;  4ICG A;  4I9Q A;  2ZDI A;  1M5I A;  3WB0 A;  2ILM A;  5LOV B;  2BTO A;  3ABK C;  4TQF A;  4J42 A;  4O4J A;  1Q86 W;  1GH6 A;  2Q9L A;  3Q4H B;  3DXR A;  3D3Q A;  3IGA C;  1H2K A;  4PDR A;  1TUB B;  1BQZ A;  3QO8 A;  5L3B A; 
#chains in the Genus database with same CATH homology
 5EC2 C;  4QNH B;  3ASN C;  2OTJ V;  2XAJ A;  3ASO B;  4Q20 A;  2Q68 A;  3ABM B;  3OR7 C;  4CBC A;  1NVP D;  1VQN V;  4UV9 A;  2GSM B;  4MS2 A;  4RUE A;  1P4R A;  5L3G A;  4G28 B;  1JVM A;  2QKS A;  3ETD A;  3WFV A;  3AG1 C;  2XAQ A;  5FL7 G;  4G27 B;  3IFX A;  5LHI A;  1EZJ A;  1VQ5 V;  2IU3 A;  3LDD A;  5L3C A;  3T4Z A;  2HFE C;  5CBF A;  1UJW B;  3OGC C;  2ATK C;  2FTK A;  3NXS A;  3X2Q C;  3SPH A;  5B1A B;  3G4S V;  4GCZ A;  4PDV A;  1AI7 A;  5EBL C;  3E83 A;  1W0J G;  2ITC C;  4Z1M G;  1Y4M A;  3JD1 A;  3OEE G;  3FKS G;  2HVJ C;  1KEC A;  1BHA A;  3K06 A;  1R6N A;  1GM7 A;  2A9H A;  2IJI A;  2ZXW B;  1F23 A;  1SET A;  3OMI B;  5H6R A;  4ZKI A;  1N8R W;  3ETE A;  1KC8 W;  2QTO A;  3AG2 B;  4LP8 A;  1V55 C;  5B1O A;  3SYP A;  4JTD B;  2JEU A;  2B1I A;  1K97 A;  2ITD C;  3CC2 V;  2YEV A;  3ZIA G;  3K0G A;  2WAM A;  1JJ2 U;  1GMG A;  2DQ0 A;  1H38 A;  5EBW C;  3LSQ A;  2NLJ C;  2DQ3 A;  2MK3 A;  1H8H G;  4U7N A;  4PDM A;  1G4Y B;  1Q81 W;  1WPX A;  3SPJ A;  1OHH G;  4RUF A;  2HKO A;  1VQ6 V;  3CCE V;  1OCO C;  4I5S A;  4RAI A;  4EKW A;  4QIW F;  3ZCC A;  2WLL A;  1VQK V;  3CCR V;  2V1D A;  2JEX A;  4KP4 A;  1ENV A;  4FJC C;  3CP1 A;  4JAS A;  3ZRW A;  2IH3 C;  3ABL C;  1R3K C;  3E8F A;  4N21 A;  3EHB B;  1K4D C;  1GM9 A;  2OCC B;  1K33 A;  1VQ7 V;  4JYC A;  3AEI A;  3K08 A;  1L1F A;  3SPG A;  2JIZ G;  1NH2 D;  4WFF A;  1RPO A;  3CME V;  4PA7 A;  3RVY A;  4ZBM A;  2EBO A;  4GX1 A;  3ML0 A;  4HZ3 A;  4UV8 A;  1EFR G;  3ZMV A;  1BL8 A;  5B3S B;  1VQO V;  4MTF A;  1YTF B;  3JD4 A;  1DF5 A;  1K9M W;  2Y48 A;  4YXW G;  3LDE A;  1S5H C;  1R3I C;  4X88 A;  3E8B A;  1CEZ A;  4L87 A;  4JTC B;  5J9P C;  3PJS K;  3WG7 B;  2IJH A;  3TCU A;  1V54 B;  2LFR A;  2M7W A;  3ZRW B;  1Q82 W;  2P7T C;  2R9R B;  2HG5 C;  1ORQ C;  4TWK A;  1Y66 A;  3ABK B;  2QA4 V;  4QE7 A;  3E35 A;  1K3E A;  2HLD G;  5KUM A;  1NKD A;  5LGN A;  1MOF A;  2KB1 A;  4DXW A;  1M57 B;  1OZ0 A;  2AHZ A;  2DYR B;  3FYE B;  2EIL C;  3ZMU A;  3W7S A;  1AJP A;  2X7R B;  3IC7 A;  3ZN0 A;  5IY5 C;  2HJF C;  1R3L C;  5L3E A;  1KP3 A;  3OUS A;  3ZMZ A;  1S72 V;  5L3F A;  3LNM B;  4GT1 A;  3G71 V;  2X6C A;  2P67 A;  1S3J A;  3LUT B;  5CBG A;  1QCE A;  1I5Y A;  1J95 A;  3OE7 G;  1MSW D;  1GK9 A;  1MG1 A;  2UXN A;  3FB6 C;  4R7C A;  4U7O A;  3B77 A;  2YSU B;  1OCR C;  4PA6 A;  1PKX A;  1E79 G;  3SPC A;  1YJW V;  1VQ4 V;  1NVP B;  4MTX A;  1WLE A;  2EZO A;  3AG3 B;  2X6A A;  4PA3 A;  1H8E G;  4MSW C;  1RM1 B;  2QM7 A;  3ASO C;  1G8M A;  3H01 A;  5DN6 G;  3ABM C;  2XOK G;  3R65 A;  4PA9 A;  4MTG A;  3ZN1 A;  2D3O W;  5IDJ A;  1K8A W;  2JJ2 G;  5L3D A;  4JGS A;  3CCV V;  2ZDI C;  2PI5 A;  4WFB V;  3T4D A;  3CCQ V;  4JAV A;  1S77 D;  1NBM G;  3HPL C;  4BW5 A;  1TUE B;  1B6Q A;  2EZP A;  4PA4 A;  1F4N A;  3KG2 A;  4JF3 A;  1AI4 A;  2EIN B;  1AJN A;  5B1A C;  2Z3Y A;  4P9O A;  2P6J A;  3W7X A;  2Y69 B;  5CMU A;  4GX2 A;  5EC1 C;  2DYS B;  2XAH A;  4MVS A;  5CN0 A;  3G6E V;  2WPD G;  1ARO P;  1OCZ B;  3GWO A;  4R6Z A;  3VBB A;  3AG4 B;  1QBZ A;  3JD2 A;  2IJJ A;  3UM7 A;  2WLJ A;  5IYD O;  3DTU B;  5C93 A;  3AG2 C;  1NQT A;  3CMA V;  2WWW A;  4X89 A;  2JK5 C;  2EIM B;  5CA3 A;  5B1B B;  2H94 A;  4JYB A;  2IU0 A;  1YIT V;  1XL6 A;  3SYQ A;  4LBE C;  4LC1 A;  2H8P C;  1FXK A;  1OCC B;  5H6Q A;  3I55 V;  1M56 C;  3P30 A;  3QNE A;  1JX9 A;  3SJQ C;  3K9A A;  3M99 B;  1YIJ V;  2EIJ B;  3RBZ A;  2XAF A;  3LSS A;  3ABT A;  4R8C A;  1GKF A;  4P9P A;  3CCL V;  1GO3 F;  1PNM A;  1PNL A;  2ZQM A;  2XAS A;  1S76 D;  1R73 A;  2A79 B;  1QR9 A;  2IH1 C;  2QE7 G;  5EBM C;  1VQM V;  1LNQ A;  5KA6 A;  1GTO A;  1NH2 B;  3SYC A;  2OTL V;  3OM3 B;  5LGU A;  4RO2 A;  2B1G A;  3OUF A;  2X0L A;  3OR6 C;  1VQ8 V;  4KUM A;  5B1N A;  4MVU A;  4WCE V;  3CCM V;  1F4M A;  3P32 A;  1I5X A;  1COW G;  2Z5U A;  4F4L A;  4MVR A;  4N23 A;  2EIK B;  1FXK B;  5LHG A;  4R50 A;  1NR1 A;  1KQS U;  3FB7 C;  2JJ1 G;  4MW8 A;  5B3S C;  1F51 A;  3I56 V;  1R3J C;  1SES A;  4BIZ A;  4WFE A;  4BIU A;  4FMT A;  3HB3 B;  3E86 A;  5LBQ A;  3FB8 C;  3WG7 C;  1V54 C;  1QLE B;  2HVK C;  3F7Y C;  1HWY A;  4UUJ C;  3ZJZ A;  2C2A A;  4LCU C;  2BOB C;  1VQ9 V;  1RPR A;  3T2M A;  1FXH A;  2XAG A;  2WLI A;  3STZ C;  1IXM A;  3ASN B;  3ZRV A;  4ASU G;  3CD6 V;  2V7Q G;  2ZD9 A;  1P7B A;  4H33 A;  1K5Q A;  1H2G A;  4TT3 G;  5E1A C;  3MHS C;  5IYB O;  1DF4 A;  1M57 C;  3E8H A;  1GM8 A;  4QE9 A;  4KFM A;  4E2L A;  4GX5 A;  3AG1 B;  1YJ9 V;  1YSC A;  2GHY A;  5GW7 A;  2DYR C;  1SRY A;  3K04 A;  1R6K A;  1M90 W;  2X6B A;  1THZ A;  2R9I A;  3ABU A;  3D3I A;  3OW2 U;  1KKD A;  1K4C C;  4XDK A;  3T1C A;  4P2Z A;  3JD0 A;  4I9W A;  1FS0 G;  3VOU A;  3X2Q B;  1QLN A;  3CYO A;  3E2E A;  4H37 A;  1S0V A;  1PD3 A;  5HFL A;  3W7W A;  4FK5 C;  4MTO A;  3CCS V;  4J9Y B;  2DW4 A;  4BAY A;  3STL C;  1MAB G;  4J9Z B;  2WLI B;  3FYI B;  4G2K A;  5LHH A;  1JPX A;  3AG3 C;  3OAA G;  2B5U A;  4MVO A;  2DWE C;  1DLB A;  2UXX A;  5EK0 A;  1BMF G;  5KUK A;  1RM1 C;  2QEX V;  2IJK A;  1V55 B;  2LP7 A;  2WSS G;  1SER A;  3W7U A;  1SZT A;  2WLK A;  1K73 W;  1M9N A;  3RW0 A;  3LDC A;  4JAU A;  3OEH G;  1K34 A;  3QO7 A;  1CP9 A;  3JCZ A;  4QJF B;  3B8M A;  2P90 A;  2A0L A;  5DM6 V;  1QR8 A;  4CZZ A;  2AHY A;  2CK3 G;  4UVA A;  1NJI W;  4FIP C;  2ZXW C;  4WFG A;  1YHQ V;  1W2B U;  2EIN C;  2WLN A;  1QVG U;  4MVM A;  3SYA A;  1M1K W;  3E89 A;  4MVQ A;  1OCO B;  2F43 G;  2Y69 C;  1NR7 A;  1AR1 B;  1BHB A;  2DYS C;  4P30 A;  2BOC C;  3A0R A;  4MVZ A;  3BY6 A;  3MHH C;  4UXN A;  5BZB A;  1OCZ C;  2DWD C;  1ZWI C;  1Q7Y W;  1K92 A;  3AG4 C;  3ABL B;  4WF9 V;  5HFM A;  2K1E A;  3RVZ A;  3TET A;  2Q69 A;  3CPW U;  1M56 B;  2WLM A;  2IW5 A;  3K79 A;  3OMN B;  2W6J G;  2W6I G;  1W0K G;  2EIM C;  2HR3 A;  1JQ0 A;  1PL0 A;  4JTA B;  2ZR2 A;  5B1B C;  3JD3 A;  2ZR3 A;  4JPR A;  1QVF U;  5H9C A;  3CXC U;  5IYC O;  3D36 A;  1E1Q G;  1VQP V;  3GB7 C;  4MW3 A;  1KP2 A;  1YI2 V;  4HAM A;  3FB5 C;  3F7V C;  1KD1 W;  1OCC C;  4HYO A;  2PI4 A;  3OFN G;  3MD0 A;  3CC7 V;  3ZRS A;  2YEV B;  2OCC C;  4XBF A;  1PNK A;  4OXS A;  1ROP A;  1JCH A;  4PEL A;  4PDL A;  1YTF D;  2EIJ C;  3K03 A;  3B8N A;  1VQL V;  1JOY A;  1CPY A;  3JYC A;  3DGE A;  2LFS A;  3ZMT A;  2XND G;  3SYO A;  1XL4 A;  3EFF K;  1AJQ A;  3TK1 A;  3K3W A;  2NNU A;  4WFA V;  1FFT B;  3ETG A;  3ZRX A;  4QPK A;  1K7D A;  4UVB A;  4DO2 A;  3CCJ V;  3E8G A;  4FPP A;  2JDI G;  2WLL B;  4UVC A;  3K0D A;  2Q67 A;  3OMA B;  1E1R G;  1FXV A;  3QO5 A;  2WLH A;  3F5W C;  3CCU V;  4XDL A;  2EIL B;  2ZDI A;  2W0F C;  1DTO A;  2EIK C;  3ABK C;  1EBO A;  5IY5 B;  1FXK C;  3CC4 V;  4XDJ A;  4GX0 A;  1AI5 A;  1Q86 W;  3BEH A;  2OT5 A;  2Q6A A;  3W7T A;  4RQF A;  5LGT A;  4QPJ A;  5CBH A;  3UKM A;  1YJN V;  3IGA C;  4X8A A;  4PDR A;  5KA5 A;  1AI6 A;  2QM8 A;  1OCR B;  4MT8 A;  1QLE C;  4TSF G;  3SPI A;  1K5S A;  4WFH A;  4RQE A;  3ZMS A;  3QO8 A;  5L3B A;  2EJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...