3CCRV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccrV00
4WFBV 1VQLV 3CCJV 1VQ5V 3CCLV 1YITV 1M90W 3CD6V 3CCMV 1K73W 1K8AW 1M1KW 1YI2V 1VQ4V 3CCRV 5DM6V 1NJIW 1VQNV 1VQ7V 1YJ9V 3CMAV 1W2BU 1VQOV 1N8RW 1KD1W 4WFAV 2D3OW 1YJWV 3CC7V 1K9MW 1JJ2U 1VQMV 3OW2U 1VQ9V 3CC4V 1QVGU 3CCQV 1VQ8V 1VQKV 3CPWU 3CCUV 1KQSU 2QEXV 3CMEV 1QVFU 1YHQV 1VQ6V 2OTLV 3CXCU 3CC2V 2OTJV 3I56V 3G4SV 1VQPV 1Q7YW 3CCEV 3G6EV 3I55V 1Q86W 1Q81W 1R73A 1YIJV 1Q82W 1KC8W 3G71V 1S72V 3CCSV 3CCVV 4WCEV 1YJNV 2QA4V 4WF9V
chains in the Genus database with same CATH superfamily
2HJDA 5IYBO 3CCRV 5KA5A 1NTMH 2A06H 3P3NA 4JI6B 2YXHA 4I50A 5JVDA 2A0LA 4B3TB 1N36O 2OCCB 5LHHA 1V54C 4CH3A 3E2EA 1VF7A 1D5AA 2K1EA 2E5LB 3ETDA 2EIJC 3OR6C 5B1BB 2Y4TA 1IXBA 5DECA 4F6RA 1P7BA 1VF5B 2Q73A 3A2FA 5K1XA 4JI2O 1I5YA 4LP8A 4JGSA 5H5NA 2VRZA 1K4DC 4DV6O 4ZIBA 1N8RW 2EILB 5HFLA 3OEEG 3E8HA 3W7UA 1H2LA 2F66C 4MTXA 2EIKB 1YDXA 1Z5WA 3ZRWB 1TGOA 3CRAA 3OGIB 5CA0A 2E3CA 1RSOA 4ZOLB 5IJ9B 3A0BZ 4X66O 3J7AU 1NKDA 4B3RB 3FB5C 4FZ1A 2LO1A 2V4DA 2VS0A 4UFZA 5IJ0B 1WB8A 2L35A 5IJ9A 3STZC 3TGUH 4RO2A 3B77A 2LGWA 4H44B 1BL8A 1Q6UA 5LA6B 4I4TA 5KUKA 2ZIOA 2ZDIC 1R6NA 3RBZA 4CH5A 3B09A 3AG2C 4DV1B 4OPAA 5L3FA 2B1IA 2FTKA 5EZYA 4J11A 4X1YA 1N0JA 3APOA 2ZD9A 3GVMA 1JMKC 5BMVA 4IYIA 4NR1A 2QM7A 2BCCH 2ZE5A 2EIMB 2XAJA 3IFXA 4PDVA 3MHHC 2DQ0A 2F93B 4NVPA 3SYOA 2IM9A 1KKCA 1I7FA 2D3OW 4GKKB 3UQ8A 3K79A 1OJHA 2WA3A 2JJ2G 4AHCA 2EJ7A 3FAVA 1GTOA 3SGIA 4PJ0Z 4DW1A 3CCLV 3HR0A 4XBFA 1S0VA 2FMLA 3OGCC 2PI5A 1Z2GA 1L0LH 4Z1MG 3CHXA 3CPWU 2QEXV 3OD4A 1FKAO 5IT9N 1PL4A 3EHBB 2K9PA 1PPJH 2HVKC 4I9WA 3G71V 4F4LA 4IIJB 4DV5B 2G38A 3SJAC 4AILC 2FYUH 4DV5O 4DV4B 1H2KA 1XNQO 3JD4A 1PP9H 1JVMA 3UT5B 4R8CA 4U7OA 1M9NA 3L75H 4LNUB 2DYSC 4DR4B 3QVNA 2IBZH 4NB5A 2ITDC 3JYCA 3H1JH 5LOVA 5GONA 3OMNB 2R9RB 3MDSA 5C8YB 1N4CA 3ZHVA 1XI1A 3KZIZ 4LFAB 4NKGB 4FFBA 4CC6A 3ETGA 4PA4A 3IGAC 4YXWG 3P32A 3BHPA 3CS5A 3OEHG 3T1HB 3ZMVA 2RN9A 1GH6A 4J7KA 1A32A 3T1YO 4DR7O 1AROP 3AG3C 1JX9A 3CRRA 3D3QA 4B08A 3M99B 3ZN1A 1K9MW 1ZAUA 2F1MA 4DUYO 1F7YA 3K0DA 3P30A 2BSKA 3VOUA 2B1GA 2HJFC 1AI5A 3AG7A 4IT5A 4QPJA 5KX5A 1GAXA 4JAUA 2QR4A 4UVBA 1BHBA 4U3FH 5CMUA 2UXNA 3SPHA 2ZE7A 5FNVA 1M93A 4FK5C 3MHSC 1VQ7V 1Q8IA 4CZZA 3T1CA 5LGUA 2ZNJA 4H33A 4MTFA 3EXAA 1F4MA 4GZRB 4JTDB 5D5QA 1WPBA 4WBNB 1FD9A 4DXWA 1QLEC 3OT7A 3OUFA 4LFCO 1FFXA 1XMQO 1SESA 1I94B 2RMKB 2ZCEA 5J2UA 1QLNA 1F23A 1QR8A 2QSAA 3A8TA 4FM0A 1AJNA 2WAMA 2YIBD 1NH2B 3H1IH 4HAMA 2YICA 4JYAO 2WLNA 3OE7G 5KHKA 5EC1C 1JFFB 2LW1A 1Y76A 1WB7A 2YS8A 3ASNB 5TISZ 4JYBA 3Q4HA 4DV1O 1YJNV 4ABMA 4LF9B 4UCRA 2JGDA 1SA0B 3BVOA 4N23A 3E83A 5L3DA 1D5NA 3OR7C 3ZHSA 4K8XA 3U0ZA 1AB3A 2YXYA 4EKWA 3AG4B 4YY3O 2O57A 1E1RG 1HR0B 4QE9A 3A0RA 4LCUC 1MG1A 4TUYB 2EIMC 3OTOO 1NZ6A 1FXHA 5DM6V 3W7TA 4JYCA 4U3JA 1SQQH 3HKDA 3E22B 3B2EE 3OUSA 3SYAA 4HBNA 5E79Z 2N04A 5EZYB 1NI8A 2EX3A 4F6RB 4JV5O 2CUGA 1IBMB 2NR5A 1EN5A 1BQ0A 2D2CB 4EB6B 3Q4HB 1Q6IA 5LYJA 1DF5A 2QJ1A 3AG1C 3VQWA 1JJ2U 1XNRB 1H2NA 4PELA 3IJ4A 1FJGO 2IJHA 2JVDA 1P49A 4MTOA 2CH7B 2DYSB 3STLC 2A79B 1WA8A 4FPPA 1DF4A 3N27A 3D8CA 4LFBB 1MMMA 2QTOA 3BABA 2NN4A 4IIJA 1GN3A 2UUBB 4GX5A 3K5MA 4O4JB 3OTOB 3ABLC 1Q3EA 1FXKB 2YI9A 2E74B 4BR6A 1VQKV 3SPCA 2GHYA 2GTSA 1KP3A 2YIBA 3LDEA 1OCZB 5J9PC 3D36C 4DR3B 2QE7G 3ZHTA 2ZXWB 2M7WA 2LFRA 3PJSK 4DR5B 1H38A 2JEXA 4RUFA 3FD9A 4X62B 1S5LZ 1VQMV 1XHZA 1V54B 3VQYA 1K3EA 4DR6B 4LF7O 2HR3A 3O65A 5ITZA 3AK2A 3K58A 3ABMC 1JOYA 3DTUB 3VQVA 2P5OA 1R3JC 3LNNA 2XAQA 1HW7A 2EZPA 2F4VB 3CWBH 5B66Z 1FXKC 1KB9F 2ZIMA 3CEIA 5L3BA 5BMVB 4X1KB 4LWSA 3TJTA 4KP4A 3DXRB 4IL6Z 2Q67A 4I0XA 4MVSA 5JQGA 3N2GA 3FB8C 4LWSB 5IY5B 1G4YB 2IH3C 1X59A 1Q81W 1RM1B 2QKAA 4UV9A 4PHZA 3ABKC 3DXRA 1WLEA 1J95A 4X66B 2PYLA 5LXTB 3L70H 3AG1B 4ZHQA 4LH6A 4TV9B 3KKYA 1SERA 1AR5A 1URFA 5IJ0A 1MOFA 1E79G 3QG5A 2ZE8A 2UUCB 2PGGA 3H9VA 3S3XA 3GWKC 3CRQA 2Z0AA 3K06A 4UCSA 3JARA 2QWPB 1GN2A 2DN9A 2Q4PA 5JCOA 4DV3B 2PZSA 4ASUG 3BFRA 4DV2B 2QKSA 2BOBC 3T4ZA 5KAFZ 2X6BA 4AQYB 1WP8A 3L73H 4B3TO 4NTWA 1YIJV 1EFRG 3UO2A 3T2MA 3HKBB 4X89A 4GCZA 3JAMN 2CTQA 1H2GA 4PA3A 4KL1A 3LSSA 5EIBC 4OXSA 4I9QA 2Q0AA 2HFEC 3BA9A 4EB6A 3EVKA 4ZHQB 1KU9A 2UXCB 4DUZB 3LSQA 1N0NA 1UJWB 1K5QA 2EIJB 1KUQA 4UCTA 3CCEV 1JQ0A 1N36B 1CP9A 2W0XA 1HP8A 2ZE6A 1I94O 3E89A 1VMGA 4JAAA 2XAFA 4YIPA 4D7TA 4DRXA 4DR2O 2LFSA 1K34A 4BAYA 2EINB 4UUJC 1IBKB 2UUCO 2HLDG 4MVZA 2XHBA 4LF7B 4BW9A 5JWPA 1EN6A 2AXTZ 3FB7C 2UUAO 5C93A 4Z2WA 2AGAA 3ASNC 3SPGA 3THOA 3E86A 1SQVH 1WNSA 1R3LC 1Y74B 2Q7GA 1T5EA 1H2MA 3X2QC 4J80A 3SDLA 1WP7A 3RFRA 1IZ3A 3ZRXA 2RQ6A 2YC0A 5B5EZ 4J9ZB 2E75B 1OCZC 4I4TB 5B3SB 2R72A 1R73A 3QF7A 4O2BB 3MAQA 2C2AA 2KQXA 1M90W 4NTYA 4J42A 1RFYA 1SZTA 2JS3A 2X0LA 1LNQA 1YEWA 1XDCA 1RM1C 1ROPA 5EK0A 2RJZA 1VF6C 4CS4A 1QQCA 4OGQB 4H37A 3K57A 1RSOB 2KKWA 3JASB 5FL7G 2OTJV 4PV1B 4JI4B 1BQZA 1IBKO 3CCSV 3JD1A 4MSWC 5CA1A 2GTAA 3CD6V 1NU1H 4TOIA 3DC6A 4RQEA 4JI2B 4GKJO 3BPZA 4CC5A 4TV8A 4JTAB 3CSXA 4JPRA 3HKEB 3O9OA 3JATA 1W0JG 3WB0A 3ZCCA 4Q6GA 4X88A 1KMIZ 2BSKB 1FYJA 4FLYA 4XDKA 1WN7A 3HPLC 2EIKC 3KG2A 4I5SA 3B4SA 2WLHA 4DR1O 4FVMA 5IYZA 2EJRA 4CH6A 1K92A 5FNVB 1OCOB 4U7NA 1NBMG 2GBOA 5B1OA 4O2AB 4R6ZA 4EFBA 1HNZO 1SF9A 2YXLA 4IHJB 4UB6Z 2H94A 1O9GA 4I55A 2LQTA 1N32B 2N74A 5EYPB 4DR1B 1Y66A 4ICGA 5L3CA 2ADQB 3MD0A 2Q0OC 3FB6C 1OV9A 2CTPA 4GX2A 5BZBA 1TA8A 2VQFB 2DMXA 1QCEA 1AP6A 4IGGA 2Y0PA 2PTMA 3HKCA 1VQ5V 1F51A 4FZ0A 3CCMV 1S5JA 2DE0X 2P4KA 4Z1VA 5FPRA 4WFFA 1YJWV 1O9HA 3SJCC 4DR6O 1NQTA 3G67A 1YHQV 3HB3B 1THZA 4O4IB 2CGOA 5BR8B 2ZM6B 1Z5VA 4AI8A 4K3AA 4JZGA 3SR2C 2FB5A 2R70A 5IYCO 3AG2B 1Q6HA 4LF9O 3JAWA 3UKMA 2IJIA 4BW5A 4N21A 4HZ3A 3ETQA 1HNXO 4E4EA 4I55B 1YTFB 4X8AA 1BS3A 4JI5B 1L8DA 3RYHA 5FLXN 3LUTB 3FKSG 3E8BA 4MVUA 3CCVV 1YVWA 5ITZB 1VQLV 1MA1A 1FPOA 1NTKH 4LF5B 2VQFO 1EM1A 2H3OA 1I5XA 4KHPO 3LDCA 1Q43A 5JQGB 3B8NA 4DW0A 1BZKA 1K97A 5LMNO 3H1LH 1PM9A 1XMOB 5LP6B 4WFBV 4F6EA 2LJ2A 1K8AW 2ZKOA 2EBOA 2YEVB 2L6LA 2A9HA 3UO3A 3RYFA 1H8HG 5C8YA 4PA6A 2CTWA 3CXHF 1CEZA 5CA1B 1PV0A 4JI8B 1UPGA 1LUWA 3ZRVA 3F7VC 5JJJB 1VIBA 1WAZA 1VQ6V 1ENVA 3CC2V 3N2KB 3G4SV 2OWOA 4LC1A 4B7EA 5JH7A 4ZI7B 1R6TA 2WLJA 3ZN0A 2CH7A 1S72V 1DLBA 1MABG 3CJHA 3JARB 3RYHB 1ZL8B 4QPKA 3NR7A 2DWDC 2QGNA 2QWNB 1QLEB 2QKCA 4RWUA 1Y6XA 4P30A 4JYAB 4OX9O 1NVPD 1SRYA 4JI0O 3CP1A 2DYRC 2JIZG 5KMGB 1V55C 1AI6A 2GDSA 2UXBO 3DSQA 2ITCC 1MZFA 4JI4O 1IBMO 3ZBHA 4FIPC 3WB1A 2Y69C 1YF2A 4FLUA 2E5LO 1HNWB 3I5DA 1IURA 2LW7A 2QWOB 4QGPA 4JF3A 3G6EV 3A0HZ 4X65B 2WSSG 4DRXB 1JJOA 1TVKA 3ZJZA 4PI0A 4LFCB 1SQXH 2A3QA 4JI1B 1VF6A 5IDJA 2X6CA 1U97A 3CCQV 2YEVA 2Q68A 3N2GB 4TQFA 1KP2A 2QDOA 4KXRA 1BSMA 4L87A 2OIEA 1JPXA 1ZTEA 4NYKA 5B1AB 5L3GA 4EEQA 1V55B 3HKDB 3JASA 1J5EB 2DWEC 2BTQB 4HYOA 4PI2A 1YI2V 4K35A 2X6AA 1XL4A 1I0HA 4YJ3B 3SPJA 4H0LB 4FLWA 4XDLA 5B3SC 1MSWD 1K33A 5A9GA 1VQ9V 1XEQA 1QVGU 5KMGA 3AG4C 1IDSA 2P6JA 1RP3B 4B3MO 1OHHG 2QM8A 3ETEA 4FM2A 2UU9O 2M6YA 1B3QA 5CBHA 4B3RO 3G6BA 4JI7B 4JAVA 4FLTA 1N33B 1P7GA 4DV0O 5LBQA 2ZR3A 1D2DA 3D36A 1FFTB 4QIWF 5LMUB 1LUVA 1HNZB 4X1IA 1QBZA 3BEHA 3ZIAG 4WFGA 1GN4A 3EFFK 3M8AA 4RAIA 3RN4A 5K1PA 4JASA 2JJ1G 3FAVB 1AJPA 4B3SO 1SQBH 1EZJA 3C3TA 5LP6A 5JJEB 3GWOA 4LF8O 4KUMA 4PA9A 1NT2B 3RYCA 4FM1A 1YTFD 3CXCU 4KFMA 3CRMA 4TSFG 4NXNB 1XUQA 2GUZA 5EIBD 1OCRB 2QTSA 2W0FC 4C7UA 1BHAA 1K7DA 3T1HO 1G8MA 4X64O 3SYPA 1K4CC 4QJFB 2B9ZA 4H13B 1HDJA 2EZOA 3W7SA 3SYQA 4MS2A 2VWJA 1NVPB 1HWYA 2QA4V 2RCVA 1XMQB 4DV4O 4HNAA 1M1KW 2PY5A 2WLIA 1VQNV 3CMAV 1V9PA 2Y0IA 3CRCA 2UU9B 1XREA 1XMOO 2XT9A 4B3MB 2CGNA 4BIOA 5KHIA 1KQSU 1QR9A 3ABUA 1HR0O 4YY3B 5LHIA 1NR7A 2WLLB 2XNDG 4JI8O 4X20A 1ZUQA 2JK5C 1SQPH 4X1IB 4LF5O 2AZ0A 2Y69B 5GONB 2AHZA 4GKJB 4WFAV 1S3JA 1ZL8A 4DV7B 3ABTA 3CX5F 1VQ8V 1M5IA 1WA8B 5E1AC 1EN4A 4O4IA 4P9OA 5JCOC 3T4DA 3N2KA 1AVMA 5LXTA 4PDRA 2VQEB 4J41A 2BE3A 1MNGA 2F95B 5GW7A 1NH2D 1IX9A 4E2LA 2HVJC 4YJ3A 3OW2U 4PA7A 2B5UA 4DUYB 1AJQA 3TCUA 1S76D 1W59A 2HEPA 4HNAB 4L8JA 4BIUA 1M56B 2P90A 1YXBA 3I56V 4JI5O 1QNMA 2FKXA 2QWRB 2CDYA 3SJQC 1G6UA 2P4VA 2XAHA 3T1YB 3SYCA 1VQ4V 4DR4O 1ZLZA 5EYPA 1P84F 4O2AA 4JI3O 3BAAA 1Q5OA 3RT3C 4FLZA 4D6TH 4AQYO 5IYZB 2WLIB 4UVAA 2ZR2A 4MW3A 1TAEA 4JI6O 4OPHA 1XNQB 2ARHA 2GSMB 2P7TC 5LP6C 1IBLB 4YJ2A 1KD1W 4TQDA 3AK3A 4QE7A 4TV8B 4GYCB 3TXQA 4LBEC 4FMTA 2HP8A 1XHXA 3E8FA 4DR7B 5H6RA 2WLKA 1JCHA 2JGDB 1SQGA 4R50A 2P06A 5JH7B 3ZRSA 4MVRA 4WCEV 2W6IG 2WPDG 5LA6A 1BT8A 2EULA 4LR3A 3H1HH 2XUMA 2ADPA 2OT5A 4Q20A 5LMNB 1AP5A 1QU7A 2V1DA 3NXSA 2IU3A 2ATKC 4J10A 4JI3B 3HKBA 4LF6B 3GB7C 3JD2A 1VP7A 4OX9B 1Q86W 2KG7A 4UXNA 2Z5UA 2Q5ZA 4LF8B 3UCSC 4O2BA 2AZ2A 1E1QG 1W0KG 1N34B 3DGEA 2UXXA 2YIAA 4TT3G 5H6QA 3B40A 1YZBA 3TETA 2MK3A 4FLVA 4IHJA 2Q6AA 1B04A 3FYEB 2Y4UA 3RGBA 2DW4A 1KBHA 3JCUZ 4I0XB 3OM3B 3BRCA 4EFEA 2UUAB 1PKXA 1GRJA 3OMIB 3CB2A 4KHPB 3C3SA 3RYCB 4PDMA 4JI1O 3TK1A 1Q82W 2DOSA 4CS2A 2EILC 3OMAB 1AI7A 3R66A 1BCCH 3VBBA 2F23A 4GT1A 3IAYA 2IW5A 3ASOB 3HKEA 1SETA 1J5EO 1YCIA 5JVDB 2BTOA 1S77D 4U3JB 5DEDA 2RNBA 4LFAO 3SJBC 3K5OA 3JAKA 3K9AA 5IYDO 4FFKA 1KKDA 2YI8A 2QM4A 2HHHB 3K5LA 2IH1C 4DR5O 3OFNG 2KB1A 1US6A 3H1KH 3WB2A 2R9AA 4GX0A 5LGTA 1XOUA 4DR3O 3WG7C 1HNWO 1SC5B 5CN0A 3OAAG 1X4TA 2LGQA 4RQFA 1OCCB 2WLLA 1TUBA 5L3EA 2UXDO 1S5HC 4YJ2B 3CCJV 2CTRA 3K0GA 1IBLO 2JDIG 1NJIW 1P4RA 1WJZA 5IE9A 1GK9A 1QVFU 5KHHA 3WG7B 4UCOA 4X64B 4DV2O 4FLXA 4MVMA 2XOKG 3TXSA 4DV6B 4R7CA 1QHTA 5KAIZ 1YJ9V 2Q8VA 5AG2A 3ZS8C 1VEWA 3CCUV 3JD0A 2CE4A 3RYIA 5KA6A 2XAGA 2DYRB 5EBWC 5EC2C 1KC8W 1BMFG 4BWAA 2ZXWC 4JZ2A 3ASOC 2GV9A 1XILA 1VQOV 5A2QN 1SQFA 4UVCA 4LF4B 4TUYA 3U11A 3W7XA 3P3PA 1HNXB 5J2TA 5KHJA 2P67A 1PL0A 4J7JA 1Y76B 3LSUA 1SZXA 4DO2A 4WFHA 2XASA 5IWAO 4X65O 1W2BU 1NTZH 2HG5C 4GX1A 3BA8A 3K08A 1BGYH 2CK3G 5J2UB 4W4KA 5B1NA 1SA0A 2YSUB 1Y74A 1L1FA 4PDLA 2ZNIA 1FAFA 1PNKA 3HKCB 2IJJA 3LNMB 5KX5B 4ZI7A 2UUBO 2KG7B 4K0KB 3UM7A 3L71H 1N32O 3WFVA 4NXMO 5IWAB 1SS3A 1OCOC 1Y4MA 2R9IA 4UCUA 1IXMA 4JI0B 1YSCA 3AEIA 4WFEA 1U96A 3L72H 5CBFA 4MVOA 1PNMA 2UXCO 4G28B 2ZDIA 3K9SA 4QNHB 3RWRD 4CS3A 1ZWIC 3FYIB 4X62O 1DTOA 1K5SA 2PI4A 4O4LB 3C90A 2JS5A 5KLVH 5LYJB 3J80N 4RUEA 5F2VO 3CC7V 3CYOA 2JEUA 5FPOA 5LHGA 4W4LA 2OIGA 3JSLA 5EBLC 2OTLV 4PD4F 4JTCB 3ZX6A 5CA3A 2AW9A 5B1BC 2ODMA 1GO3F 5D5PA 2NNUA 3WU2Z 1TVKB 1G1XB 2UXBB 1Q90D 3ZEDA 2DQ3A 5CB4A 2EINC 1F4NA 4JV5B 1OCCC 1ZX3A 2IJKA 5KUMA 2F43G 4YHHO 1R1BA 3L74H 5H9CA 4B7KA 1PD3A 1DK1A 3W7WA 3KCXA 1M57B 1FJGB 5HFMA 2V7QG 3QNEA 4O4HA 3E8GA 4DV0B 4ZOLA 1XNRO 3ABKB 5CA0B 5LGNA 3M7MX 3F5WC 3SPIA 2RDCA 2OYQA 1R3IC 4BIZA 5IY5C 2PF4E 4J7ZA 3JATB 2NLJC 4UB8Z 1XQ8A 1L0NH 4K8ZA 2Q69A 4YHHB 3ZMUA 1KECA 2XTAA 5EBMC 3JALB 4GKKO 3I55V 3ZHQA 2BTQA 1GM7A 2JGUA 2WLMA 4GLXA 5CBGA 1GN6A 1JA8A 2YDEA 1FS0G 4P9PA 3OTFA 4X1KA 3ZHUA 2E76B 2VWKA 4P2ZA 4O4LA 3APQA 3ZMTA 3BCCH 4DV7O 2JRIA 1LR1A 3E35A 3IC9A 2ZINA 3VQXA 1NS1A 1VARA 3AG3B 4CBCA 2ETNA 5J2TB 4NTXA 3JCZA 2MW2B 3QO7A 1AILA 4I50B 4MVQA 2F4VO 3RW0A 4TV9A 3K03A 5BR8O 1XL6A 2IU0A 3CMEV 1B6QA 3PN1A 4CH4A 3ABLB 4FFBB 3U10A 1OZ0A 4DK1A 4LF4O 1BE3H 2H8PC 1ORQC 4UCVA 2LP7A 4DR2B 1RPRA 1WPXA 3KCYA 4K0KO 2QWQB 4LF6O 3K3WA 4ZBMA 2Q7HA 5GTIZ 3CC4V 2HKOA 2W6JG 2ZM6O 4D7SA 1AR1B 3RVZA 4O4JA 3JAKB 1CPYA 2ZT9B 2Z3YA 5KHGA 4YIOA 3ABMB 4DK0A 3JSNA 1ZSPA 3QO5A 3J81N 1GMGA 3F7YC 1JR9A 2WA4A 4LNUA 4WBNA 3AK1A 3X2QB 3G80A 4DV3O 2KSDA 3L9DA 4IYHA 5JJNB 1TUBB 5LL6Y 1AR4A 4X20B 1KYOF 3K59A 1FFXB 1XBLA 4WF9V 1I08A 5BXZA 1K73W 1H2SB 4X9QA 3ZHRA 3F5TA 3ICXA 4NXNO 4LFBO 1UFIA 2Q7EA 5CB4B 3FFQA 3ZRWA 4G2KA 1GM8A 2PUSA 1OCRC 3DC5A 3RVYA 1PNLA 3S3WA 3QTCA 3LDDA 4FJCC 5GTHZ 2P22C 2X7RB 1B06A 3CE2A 3ZMSA 4MT8A 3JD3A 1YITV 1GKFA 4JI7O 2YIDA 4G27B 1EZVH 4ZKIA 1M4UA 2UXDB 4DYLA 2PYJA 3JAWB 3QO8A 4UV8A 4MTGA 2YUAA 3K5NA 1TUEB 4MW8A 1M56C 2ZQMA 4LH7A 1Q7YW 1MSDA 2GUZB 5LOVB 4B3SB 3B8MA 3RYIB 4X1YB 2WWWA 3JALA 3E22A 1MZEA 2Y48A 2BOCC 4GUNA 1DGSA 1GM9A 2FL4A 5H2FZ 5LMUO 1N34O 1SKVA 2N05A 1R6KA 1Y67A 4O4HB 3ZMZA 5DN6G 3ML0A 4NXMB 2HHHO 1N33O 3UT5A 1FXVA 4XDJA 3RYFB 2AHYA 4J9YB 1RPOA 4DUZO 1CXZB 3H01A 2DJVA 3FX7A 2ILMA 1IVSA 1VQPV 2OCHA 5BY1A 3D3IA 2Q9LA 1NR1A 5B1AC 1JFFA 1H8EG 1AI4A 2OCCC 4I7ZB 3R65A 4TWKA 2VQEO 1FXKA 1COWG 4A5UB 1R3KC 4JYYA 2CAZC 3CJHB 3K04A 1EBOA 2A7WA 1M57C 3BY6A 3IC7A
chains in the Genus database with same CATH topology
3ZJZA 1FXKC 4R7CA 5IYBO 5L3BA 3CCRV 1YJ9V 5KA5A 5IDJA 4KP4A 2X6CA 2A0LA 2OCCB 5LHHA 3CCQV 1V54C 3CCUV 3E2EA 3JD0A 2Q67A 2YEVA 2Q68A 2K1EA 1KP2A 4MVSA 3ETDA 2EIJC 5KA6A 2XAGA 4L87A 2DYRB 3OR6C 5EBWC 3FB8C 5IY5B 1G4YB 2IH3C 5B1BB 1Q81W 1RM1B 1JPXA 5EC2C 5B1AB 5L3GA 1BMFG 4UV9A 1KC8W 1P7BA 3ABKC 1V55B 2ZXWC 1WLEA 1I5YA 1J95A 2DWEC 4HYOA 4LP8A 4JGSA 1YI2V 1K4DC 3AG1B 3ASOC 1VQOV 1N8RW 2X6AA 1XL4A 3SPJA 4XDLA 2EILB 4UVCA 5B3SC 1MSWD 1K33A 3OEEG 5HFLA 1VQ9V 3E8HA 1QVGU 1SERA 3W7UA 1MOFA 3AG4C 3W7XA 2P6JA 4MTXA 1E79G 2EIKB 1OHHG 2QM8A 3ETEA 2P67A 1PL0A 3ZRWB 5CBHA 4DO2A 4JAVA 4WFHA 2XASA 1NKDA 3K06A 5LBQA 1W2BU 3FB5C 2ZR3A 3D36A 1FFTB 4QIWF 4ASUG 2QKSA 2HG5C 2BOBC 3K08A 4GX1A 3T4ZA 2CK3G 2X6BA 5B1NA 3STZC 1QBZA 2YSUB 1L1FA 4PDLA 3B77A 4RO2A 1PNKA 1BL8A 3BEHA 3ZIAG 4WFGA 2IJJA 3LNMB 5KUKA 1YIJV 1EFRG 3EFFK 4RAIA 3T2MA 3UM7A 2ZDIC 4X89A 4GCZA 3WFVA 4JASA 1R6NA 2JJ1G 1H2GA 4PA3A 3RBZA 1AJPA 3AG2C 3LSSA 1OCOC 1Y4MA 4OXSA 1EZJA 2R9IA 2HFEC 1IXMA 1YSCA 3GWOA 3AEIA 4KUMA 4PA9A 4WFEA 5L3FA 2B1IA 2FTKA 5CBFA 3LSQA 4MVOA 1PNMA 1UJWB 1K5QA 4G28B 1YTFD 2ZDIA 2EIJB 3CXCU 2ZD9A 4QNHB 3CCEV 4KFMA 1JQ0A 2QM7A 1CP9A 4TSFG 2EIMB 2XAJA 3IFXA 3E89A 4PDVA 3MHHC 2DQ0A 1ZWIC 2XAFA 3FYIB 1DTOA 3SYOA 1K5SA 1K34A 1OCRB 2LFSA 2PI4A 4BAYA 4RUEA 2W0FC 2D3OW 3CC7V 3CYOA 2JEUA 2EINB 3K79A 1BHAA 1K7DA 4UUJC 5LHGA 1G8MA 2HLDG 4MVZA 2JJ2G 3SYPA 1K4CC 5EBLC 4QJFB 2OTLV 4JTCB 3FB7C 5CA3A 2EZOA 3W7SA 5C93A 3SYQA 4MS2A 3ASNC 3SPGA 5B1BC 1NVPB 1HWYA 3E86A 1GTOA 1GO3F 2NNUA 1R3LC 2QA4V 3CCLV 1M1KW 4XBFA 1S0VA 2WLIA 1VQNV 3OGCC 3CMAV 3X2QC 2PI5A 4Z1MG 2DQ3A 2EINC 1F4NA 3ZRXA 1OCCC 3CPWU 1KQSU 2IJKA 2QEXV 1QR9A 3ABUA 2F43G 5KUMA 3EHBB 4J9ZB 5H9CA 1PD3A 1OCZC 5LHIA 1NR7A 2WLLB 2HVKC 3W7WA 2XNDG 4I9WA 5B3SB 1M57B 5HFMA 1R73A 3G71V 2JK5C 2V7QG 4F4LA 2C2AA 3QNEA 3E8GA 3ABKB 1M90W 5LGNA 2Y69B 2AHZA 3F5WC 1SZTA 2X0LA 3SPIA 1LNQA 1R3IC 4BIZA 5IY5C 4WFAV 3JD4A 1RM1C 1ROPA 1JVMA 1S3JA 2NLJC 4R8CA 3ABTA 5EK0A 4U7OA 1VQ8V 4H37A 1M9NA 2Q69A 5FL7G 3ZMUA 5E1AC 1KECA 5EBMC 2OTJV 4P9OA 2DYSC 3I55V 3T4DA 3CCSV 3JD1A 4MSWC 1GM7A 4PDRA 2WLMA 5CBGA 3CD6V 2ITDC 4RQEA 3JYCA 1FS0G 5GW7A 1NH2D 4JTAB 4P9PA 3OMNB 4E2LA 2R9RB 2HVJC 4JPRA 3OW2U 4PA7A 2B5UA 4P2ZA 1W0JG 1AJQA 3TCUA 3ZMTA 1S76D 3ZCCA 4X88A 4BIUA 4PA4A 3ETGA 1M56B 2P90A 4YXWG 3IGAC 3I56V 3P32A 3E35A 3OEHG 3ZMVA 3AG3B 4XDKA 3SJQC 1AROP 3AG3C 1JX9A 3HPLC 2EIKC 4CBCA 3KG2A 3JCZA 4I5SA 2XAHA 3QO7A 2WLHA 3SYCA 1VQ4V 2EJRA 3M99B 3ZN1A 1K92A 1K9MW 4MVQA 3RW0A 1OCOB 4U7NA 3K03A 1NBMG 5B1OA 4R6ZA 1XL6A 2IU0A 3K0DA 3P30A 2WLIB 4UVAA 1B6QA 2ZR2A 3VOUA 3CMEV 2B1GA 2HJFC 1AI5A 3ABLB 4MW3A 1OZ0A 2H94A 4QPJA 4JAUA 2H8PC 2GSMB 4UVBA 1BHBA 2P7TC 5CMUA 2UXNA 1ORQC 3SPHA 1KD1W 2LP7A 1RPRA 1WPXA 4QE7A 4FK5C 1Y66A 3MHSC 1VQ7V 4CZZA 3T1CA 5LGUA 4LBEC 4FMTA 5L3CA 3E8FA 4H33A 3MD0A 4MTFA 5H6RA 3K3WA 4ZBMA 3CC4V 2WLKA 1F4MA 4JTDB 1JCHA 3FB6C 4GX2A 2HKOA 2W6JG 5BZBA 1AR1B 3RVZA 4R50A 3ZRSA 1QCEA 4DXWA 1CPYA 4MVRA 1QLEC 2Z3YA 4WCEV 2W6IG 2WPDG 3OUFA 3ABMB 1VQ5V 1F51A 1SESA 3CCMV 4Q20A 2OT5A 3QO5A 1QLNA 4WFFA 1GMGA 1F23A 1YJWV 3F7YC 1QR8A 1AJNA 2WAMA 1NH2B 2V1DA 3NXSA 1NQTA 1YHQV 4HAMA 2IU3A 3HB3B 1THZA 2ATKC 3X2QB 2WLNA 3GB7C 3JD2A 1Q86W 2Z5UA 3OE7G 4UXNA 5EC1C 3ASNB 4JYBA 1YJNV 4WF9V 5IYCO 1K73W 3AG2B 4N23A 3E83A 1E1QG 1W0KG 3DGEA 5L3DA 3UKMA 3OR7C 2IJIA 2UXXA 4BW5A 4TT3G 4N21A 4HZ3A 5H6QA 4EKWA 3ZRWA 4X8AA 1YTFB 3TETA 2MK3A 3AG4B 4G2KA 1GM8A 3LUTB 1OCRC 1E1RG 3RVYA 1PNLA 3FKSG 3E8BA 4QE9A 4MVUA 3LDDA 2Q6AA 3A0RA 1MG1A 3FYEB 4FJCC 4LCUC 2DW4A 3CCVV 2X7RB 3ZMSA 4MT8A 2EIMC 1VQLV 3JD3A 1YITV 1GKFA 1FXHA 5DM6V 3OM3B 3W7TA 4JYCA 4G27B 4ZKIA 1PKXA 1I5XA 3QO8A 4UV8A 4MTGA 3LDCA 3OMIB 1TUEB 3OUSA 3SYAA 4MW8A 3B8NA 1M56C 2ZQMA 1Q7YW 1K97A 4PDMA 3TK1A 1Q82W 2EILC 3OMAB 4WFBV 1AI7A 3B8MA 1K8AW 2EBOA 2YEVB 3VBBA 4GT1A 1DF5A 2A9HA 2WWWA 1H8HG 2IW5A 3AG1C 1SETA 3ASOB 4PA6A 1JJ2U 1CEZA 4PELA 2Y48A 1S77D 2IJHA 2BOCC 3ZRVA 3F7VC 4MTOA 1GM9A 2DYSB 1ENVA 1VQ6V 3CC2V 3G4SV 3STLC 2A79B 4LC1A 4FPPA 1DF4A 3K9AA 5IYDO 2WLJA 1KKDA 3ZN0A 1S72V 1DLBA 1R6KA 2QTOA 1MABG 3ZMZA 2IH1C 5DN6G 3ML0A 3OFNG 2KB1A 4GX5A 1FXVA 4QPKA 4XDJA 3ABLC 2DWDC 1QLEB 1FXKB 4P30A 2AHYA 4J9YB 1RPOA 4GX0A 5LGTA 1VQKV 3SPCA 2GHYA 1NVPD 3H01A 3WG7C 1SRYA 1KP3A 3LDEA 1OCZB 5J9PC 3CP1A 2DYRC 5CN0A 3OAAG 2QE7G 1VQPV 3D3IA 2JIZG 4RQFA 1NR1A 5B1AC 1OCCB 2WLLA 1H8EG 1AI4A 1V55C 2ZXWB 5L3EA 1S5HC 3CCJV 2OCCC 2M7WA 1AI6A 2LFRA 3PJSK 3K0GA 1H38A 2JDIG 1NJIW 3R65A 4TWKA 2JEXA 1P4RA 4RUFA 2ITCC 1FXKA 1VQMV 1COWG 1V54B 1R3KC 1K3EA 4FIPC 1GK9A 1QVFU 2Y69C 2HR3A 3WG7B 3ABMC 3K04A 4JF3A 1EBOA 3DTUB 3G6EV 1JOYA 1M57C 1R3JC 2XAQA 3BY6A 4MVMA 2WSSG 2XOKG 3IC7A 2EZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB V;  1VQL V;  3CCJ V;  1VQ5 V;  3CCL V;  1YIT V;  1M90 W;  3CD6 V;  3CCM V;  1K73 W;  1K8A W;  1M1K W;  1YI2 V;  1VQ4 V;  3CCR V;  5DM6 V;  1NJI W;  1VQN V;  1VQ7 V;  1YJ9 V;  3CMA V;  1W2B U;  1VQO V;  1N8R W;  1KD1 W;  4WFA V;  2D3O W;  1YJW V;  3CC7 V;  1K9M W;  1JJ2 U;  1VQM V;  3OW2 U;  1VQ9 V;  3CC4 V;  1QVG U;  3CCQ V;  1VQ8 V;  1VQK V;  3CPW U;  3CCU V;  1KQS U;  2QEX V;  3CME V;  1QVF U;  1YHQ V;  1VQ6 V;  2OTL V;  3CXC U;  3CC2 V;  2OTJ V;  3I56 V;  3G4S V;  1VQP V;  1Q7Y W;  3CCE V;  3G6E V;  3I55 V;  1Q86 W;  1Q81 W;  1R73 A;  1YIJ V;  1Q82 W;  1KC8 W;  3G71 V;  1S72 V;  3CCS V;  3CCV V;  4WCE V;  1YJN V;  2QA4 V;  4WF9 V; 
#chains in the Genus database with same CATH topology
 2HJD A;  5IYB O;  3CCR V;  5KA5 A;  1NTM H;  2A06 H;  3P3N A;  4JI6 B;  2YXH A;  4I50 A;  5JVD A;  2A0L A;  4B3T B;  1N36 O;  2OCC B;  5LHH A;  1V54 C;  4CH3 A;  3E2E A;  1VF7 A;  1D5A A;  2K1E A;  2E5L B;  3ETD A;  2EIJ C;  3OR6 C;  5B1B B;  2Y4T A;  1IXB A;  5DEC A;  4F6R A;  1P7B A;  1VF5 B;  2Q73 A;  3A2F A;  5K1X A;  4JI2 O;  1I5Y A;  4LP8 A;  4JGS A;  5H5N A;  2VRZ A;  1K4D C;  4DV6 O;  4ZIB A;  1N8R W;  2EIL B;  5HFL A;  3OEE G;  3E8H A;  3W7U A;  1H2L A;  2F66 C;  4MTX A;  2EIK B;  1YDX A;  1Z5W A;  3ZRW B;  1TGO A;  3CRA A;  3OGI B;  5CA0 A;  2E3C A;  1RSO A;  4ZOL B;  5IJ9 B;  3A0B Z;  4X66 O;  3J7A U;  1NKD A;  4B3R B;  3FB5 C;  4FZ1 A;  2LO1 A;  2V4D A;  2VS0 A;  4UFZ A;  5IJ0 B;  1WB8 A;  2L35 A;  5IJ9 A;  3STZ C;  3TGU H;  4RO2 A;  3B77 A;  2LGW A;  4H44 B;  1BL8 A;  1Q6U A;  5LA6 B;  4I4T A;  5KUK A;  2ZIO A;  2ZDI C;  1R6N A;  3RBZ A;  4CH5 A;  3B09 A;  3AG2 C;  4DV1 B;  4OPA A;  5L3F A;  2B1I A;  2FTK A;  5EZY A;  4J11 A;  4X1Y A;  1N0J A;  3APO A;  2ZD9 A;  3GVM A;  1JMK C;  5BMV A;  4IYI A;  4NR1 A;  2QM7 A;  2BCC H;  2ZE5 A;  2EIM B;  2XAJ A;  3IFX A;  4PDV A;  3MHH C;  2DQ0 A;  2F93 B;  4NVP A;  3SYO A;  2IM9 A;  1KKC A;  1I7F A;  2D3O W;  4GKK B;  3UQ8 A;  3K79 A;  1OJH A;  2WA3 A;  2JJ2 G;  4AHC A;  2EJ7 A;  3FAV A;  1GTO A;  3SGI A;  4PJ0 Z;  4DW1 A;  3CCL V;  3HR0 A;  4XBF A;  1S0V A;  2FML A;  3OGC C;  2PI5 A;  1Z2G A;  1L0L H;  4Z1M G;  3CHX A;  3CPW U;  2QEX V;  3OD4 A;  1FKA O;  5IT9 N;  1PL4 A;  3EHB B;  2K9P A;  1PPJ H;  2HVK C;  4I9W A;  3G71 V;  4F4L A;  4IIJ B;  4DV5 B;  2G38 A;  3SJA C;  4AIL C;  2FYU H;  4DV5 O;  4DV4 B;  1H2K A;  1XNQ O;  3JD4 A;  1PP9 H;  1JVM A;  3UT5 B;  4R8C A;  4U7O A;  1M9N A;  3L75 H;  4LNU B;  2DYS C;  4DR4 B;  3QVN A;  2IBZ H;  4NB5 A;  2ITD C;  3JYC A;  3H1J H;  5LOV A;  5GON A;  3OMN B;  2R9R B;  3MDS A;  5C8Y B;  1N4C A;  3ZHV A;  1XI1 A;  3KZI Z;  4LFA B;  4NKG B;  4FFB A;  4CC6 A;  3ETG A;  4PA4 A;  3IGA C;  4YXW G;  3P32 A;  3BHP A;  3CS5 A;  3OEH G;  3T1H B;  3ZMV A;  2RN9 A;  1GH6 A;  4J7K A;  1A32 A;  3T1Y O;  4DR7 O;  1ARO P;  3AG3 C;  1JX9 A;  3CRR A;  3D3Q A;  4B08 A;  3M99 B;  3ZN1 A;  1K9M W;  1ZAU A;  2F1M A;  4DUY O;  1F7Y A;  3K0D A;  3P30 A;  2BSK A;  3VOU A;  2B1G A;  2HJF C;  1AI5 A;  3AG7 A;  4IT5 A;  4QPJ A;  5KX5 A;  1GAX A;  4JAU A;  2QR4 A;  4UVB A;  1BHB A;  4U3F H;  5CMU A;  2UXN A;  3SPH A;  2ZE7 A;  5FNV A;  1M93 A;  4FK5 C;  3MHS C;  1VQ7 V;  1Q8I A;  4CZZ A;  3T1C A;  5LGU A;  2ZNJ A;  4H33 A;  4MTF A;  3EXA A;  1F4M A;  4GZR B;  4JTD B;  5D5Q A;  1WPB A;  4WBN B;  1FD9 A;  4DXW A;  1QLE C;  3OT7 A;  3OUF A;  4LFC O;  1FFX A;  1XMQ O;  1SES A;  1I94 B;  2RMK B;  2ZCE A;  5J2U A;  1QLN A;  1F23 A;  1QR8 A;  2QSA A;  3A8T A;  4FM0 A;  1AJN A;  2WAM A;  2YIB D;  1NH2 B;  3H1I H;  4HAM A;  2YIC A;  4JYA O;  2WLN A;  3OE7 G;  5KHK A;  5EC1 C;  1JFF B;  2LW1 A;  1Y76 A;  1WB7 A;  2YS8 A;  3ASN B;  5TIS Z;  4JYB A;  3Q4H A;  4DV1 O;  1YJN V;  4ABM A;  4LF9 B;  4UCR A;  2JGD A;  1SA0 B;  3BVO A;  4N23 A;  3E83 A;  5L3D A;  1D5N A;  3OR7 C;  3ZHS A;  4K8X A;  3U0Z A;  1AB3 A;  2YXY A;  4EKW A;  3AG4 B;  4YY3 O;  2O57 A;  1E1R G;  1HR0 B;  4QE9 A;  3A0R A;  4LCU C;  1MG1 A;  4TUY B;  2EIM C;  3OTO O;  1NZ6 A;  1FXH A;  5DM6 V;  3W7T A;  4JYC A;  4U3J A;  1SQQ H;  3HKD A;  3E22 B;  3B2E E;  3OUS A;  3SYA A;  4HBN A;  5E79 Z;  2N04 A;  5EZY B;  1NI8 A;  2EX3 A;  4F6R B;  4JV5 O;  2CUG A;  1IBM B;  2NR5 A;  1EN5 A;  1BQ0 A;  2D2C B;  4EB6 B;  3Q4H B;  1Q6I A;  5LYJ A;  1DF5 A;  2QJ1 A;  3AG1 C;  3VQW A;  1JJ2 U;  1XNR B;  1H2N A;  4PEL A;  3IJ4 A;  1FJG O;  2IJH A;  2JVD A;  1P49 A;  4MTO A;  2CH7 B;  2DYS B;  3STL C;  2A79 B;  1WA8 A;  4FPP A;  1DF4 A;  3N27 A;  3D8C A;  4LFB B;  1MMM A;  2QTO A;  3BAB A;  2NN4 A;  4IIJ A;  1GN3 A;  2UUB B;  4GX5 A;  3K5M A;  4O4J B;  3OTO B;  3ABL C;  1Q3E A;  1FXK B;  2YI9 A;  2E74 B;  4BR6 A;  1VQK V;  3SPC A;  2GHY A;  2GTS A;  1KP3 A;  2YIB A;  3LDE A;  1OCZ B;  5J9P C;  3D36 C;  4DR3 B;  2QE7 G;  3ZHT A;  2ZXW B;  2M7W A;  2LFR A;  3PJS K;  4DR5 B;  1H38 A;  2JEX A;  4RUF A;  3FD9 A;  4X62 B;  1S5L Z;  1VQM V;  1XHZ A;  1V54 B;  3VQY A;  1K3E A;  4DR6 B;  4LF7 O;  2HR3 A;  3O65 A;  5ITZ A;  3AK2 A;  3K58 A;  3ABM C;  1JOY A;  3DTU B;  3VQV A;  2P5O A;  1R3J C;  3LNN A;  2XAQ A;  1HW7 A;  2EZP A;  2F4V B;  3CWB H;  5B66 Z;  1FXK C;  1KB9 F;  2ZIM A;  3CEI A;  5L3B A;  5BMV B;  4X1K B;  4LWS A;  3TJT A;  4KP4 A;  3DXR B;  4IL6 Z;  2Q67 A;  4I0X A;  4MVS A;  5JQG A;  3N2G A;  3FB8 C;  4LWS B;  5IY5 B;  1G4Y B;  2IH3 C;  1X59 A;  1Q81 W;  1RM1 B;  2QKA A;  4UV9 A;  4PHZ A;  3ABK C;  3DXR A;  1WLE A;  1J95 A;  4X66 B;  2PYL A;  5LXT B;  3L70 H;  3AG1 B;  4ZHQ A;  4LH6 A;  4TV9 B;  3KKY A;  1SER A;  1AR5 A;  1URF A;  5IJ0 A;  1MOF A;  1E79 G;  3QG5 A;  2ZE8 A;  2UUC B;  2PGG A;  3H9V A;  3S3X A;  3GWK C;  3CRQ A;  2Z0A A;  3K06 A;  4UCS A;  3JAR A;  2QWP B;  1GN2 A;  2DN9 A;  2Q4P A;  5JCO A;  4DV3 B;  2PZS A;  4ASU G;  3BFR A;  4DV2 B;  2QKS A;  2BOB C;  3T4Z A;  5KAF Z;  2X6B A;  4AQY B;  1WP8 A;  3L73 H;  4B3T O;  4NTW A;  1YIJ V;  1EFR G;  3UO2 A;  3T2M A;  3HKB B;  4X89 A;  4GCZ A;  3JAM N;  2CTQ A;  1H2G A;  4PA3 A;  4KL1 A;  3LSS A;  5EIB C;  4OXS A;  4I9Q A;  2Q0A A;  2HFE C;  3BA9 A;  4EB6 A;  3EVK A;  4ZHQ B;  1KU9 A;  2UXC B;  4DUZ B;  3LSQ A;  1N0N A;  1UJW B;  1K5Q A;  2EIJ B;  1KUQ A;  4UCT A;  3CCE V;  1JQ0 A;  1N36 B;  1CP9 A;  2W0X A;  1HP8 A;  2ZE6 A;  1I94 O;  3E89 A;  1VMG A;  4JAA A;  2XAF A;  4YIP A;  4D7T A;  4DRX A;  4DR2 O;  2LFS A;  1K34 A;  4BAY A;  2EIN B;  4UUJ C;  1IBK B;  2UUC O;  2HLD G;  4MVZ A;  2XHB A;  4LF7 B;  4BW9 A;  5JWP A;  1EN6 A;  2AXT Z;  3FB7 C;  2UUA O;  5C93 A;  4Z2W A;  2AGA A;  3ASN C;  3SPG A;  3THO A;  3E86 A;  1SQV H;  1WNS A;  1R3L C;  1Y74 B;  2Q7G A;  1T5E A;  1H2M A;  3X2Q C;  4J80 A;  3SDL A;  1WP7 A;  3RFR A;  1IZ3 A;  3ZRX A;  2RQ6 A;  2YC0 A;  5B5E Z;  4J9Z B;  2E75 B;  1OCZ C;  4I4T B;  5B3S B;  2R72 A;  1R73 A;  3QF7 A;  4O2B B;  3MAQ A;  2C2A A;  2KQX A;  1M90 W;  4NTY A;  4J42 A;  1RFY A;  1SZT A;  2JS3 A;  2X0L A;  1LNQ A;  1YEW A;  1XDC A;  1RM1 C;  1ROP A;  5EK0 A;  2RJZ A;  1VF6 C;  4CS4 A;  1QQC A;  4OGQ B;  4H37 A;  3K57 A;  1RSO B;  2KKW A;  3JAS B;  5FL7 G;  2OTJ V;  4PV1 B;  4JI4 B;  1BQZ A;  1IBK O;  3CCS V;  3JD1 A;  4MSW C;  5CA1 A;  2GTA A;  3CD6 V;  1NU1 H;  4TOI A;  3DC6 A;  4RQE A;  4JI2 B;  4GKJ O;  3BPZ A;  4CC5 A;  4TV8 A;  4JTA B;  3CSX A;  4JPR A;  3HKE B;  3O9O A;  3JAT A;  1W0J G;  3WB0 A;  3ZCC A;  4Q6G A;  4X88 A;  1KMI Z;  2BSK B;  1FYJ A;  4FLY A;  4XDK A;  1WN7 A;  3HPL C;  2EIK C;  3KG2 A;  4I5S A;  3B4S A;  2WLH A;  4DR1 O;  4FVM A;  5IYZ A;  2EJR A;  4CH6 A;  1K92 A;  5FNV B;  1OCO B;  4U7N A;  1NBM G;  2GBO A;  5B1O A;  4O2A B;  4R6Z A;  4EFB A;  1HNZ O;  1SF9 A;  2YXL A;  4IHJ B;  4UB6 Z;  2H94 A;  1O9G A;  4I55 A;  2LQT A;  1N32 B;  2N74 A;  5EYP B;  4DR1 B;  1Y66 A;  4ICG A;  5L3C A;  2ADQ B;  3MD0 A;  2Q0O C;  3FB6 C;  1OV9 A;  2CTP A;  4GX2 A;  5BZB A;  1TA8 A;  2VQF B;  2DMX A;  1QCE A;  1AP6 A;  4IGG A;  2Y0P A;  2PTM A;  3HKC A;  1VQ5 V;  1F51 A;  4FZ0 A;  3CCM V;  1S5J A;  2DE0 X;  2P4K A;  4Z1V A;  5FPR A;  4WFF A;  1YJW V;  1O9H A;  3SJC C;  4DR6 O;  1NQT A;  3G67 A;  1YHQ V;  3HB3 B;  1THZ A;  4O4I B;  2CGO A;  5BR8 B;  2ZM6 B;  1Z5V A;  4AI8 A;  4K3A A;  4JZG A;  3SR2 C;  2FB5 A;  2R70 A;  5IYC O;  3AG2 B;  1Q6H A;  4LF9 O;  3JAW A;  3UKM A;  2IJI A;  4BW5 A;  4N21 A;  4HZ3 A;  3ETQ A;  1HNX O;  4E4E A;  4I55 B;  1YTF B;  4X8A A;  1BS3 A;  4JI5 B;  1L8D A;  3RYH A;  5FLX N;  3LUT B;  3FKS G;  3E8B A;  4MVU A;  3CCV V;  1YVW A;  5ITZ B;  1VQL V;  1MA1 A;  1FPO A;  1NTK H;  4LF5 B;  2VQF O;  1EM1 A;  2H3O A;  1I5X A;  4KHP O;  3LDC A;  1Q43 A;  5JQG B;  3B8N A;  4DW0 A;  1BZK A;  1K97 A;  5LMN O;  3H1L H;  1PM9 A;  1XMO B;  5LP6 B;  4WFB V;  4F6E A;  2LJ2 A;  1K8A W;  2ZKO A;  2EBO A;  2YEV B;  2L6L A;  2A9H A;  3UO3 A;  3RYF A;  1H8H G;  5C8Y A;  4PA6 A;  2CTW A;  3CXH F;  1CEZ A;  5CA1 B;  1PV0 A;  4JI8 B;  1UPG A;  1LUW A;  3ZRV A;  3F7V C;  5JJJ B;  1VIB A;  1WAZ A;  1VQ6 V;  1ENV A;  3CC2 V;  3N2K B;  3G4S V;  2OWO A;  4LC1 A;  4B7E A;  5JH7 A;  4ZI7 B;  1R6T A;  2WLJ A;  3ZN0 A;  2CH7 A;  1S72 V;  1DLB A;  1MAB G;  3CJH A;  3JAR B;  3RYH B;  1ZL8 B;  4QPK A;  3NR7 A;  2DWD C;  2QGN A;  2QWN B;  1QLE B;  2QKC A;  4RWU A;  1Y6X A;  4P30 A;  4JYA B;  4OX9 O;  1NVP D;  1SRY A;  4JI0 O;  3CP1 A;  2DYR C;  2JIZ G;  5KMG B;  1V55 C;  1AI6 A;  2GDS A;  2UXB O;  3DSQ A;  2ITC C;  1MZF A;  4JI4 O;  1IBM O;  3ZBH A;  4FIP C;  3WB1 A;  2Y69 C;  1YF2 A;  4FLU A;  2E5L O;  1HNW B;  3I5D A;  1IUR A;  2LW7 A;  2QWO B;  4QGP A;  4JF3 A;  3G6E V;  3A0H Z;  4X65 B;  2WSS G;  4DRX B;  1JJO A;  1TVK A;  3ZJZ A;  4PI0 A;  4LFC B;  1SQX H;  2A3Q A;  4JI1 B;  1VF6 A;  5IDJ A;  2X6C A;  1U97 A;  3CCQ V;  2YEV A;  2Q68 A;  3N2G B;  4TQF A;  1KP2 A;  2QDO A;  4KXR A;  1BSM A;  4L87 A;  2OIE A;  1JPX A;  1ZTE A;  4NYK A;  5B1A B;  5L3G A;  4EEQ A;  1V55 B;  3HKD B;  3JAS A;  1J5E B;  2DWE C;  2BTQ B;  4HYO A;  4PI2 A;  1YI2 V;  4K35 A;  2X6A A;  1XL4 A;  1I0H A;  4YJ3 B;  3SPJ A;  4H0L B;  4FLW A;  4XDL A;  5B3S C;  1MSW D;  1K33 A;  5A9G A;  1VQ9 V;  1XEQ A;  1QVG U;  5KMG A;  3AG4 C;  1IDS A;  2P6J A;  1RP3 B;  4B3M O;  1OHH G;  2QM8 A;  3ETE A;  4FM2 A;  2UU9 O;  2M6Y A;  1B3Q A;  5CBH A;  4B3R O;  3G6B A;  4JI7 B;  4JAV A;  4FLT A;  1N33 B;  1P7G A;  4DV0 O;  5LBQ A;  2ZR3 A;  1D2D A;  3D36 A;  1FFT B;  4QIW F;  5LMU B;  1LUV A;  1HNZ B;  4X1I A;  1QBZ A;  3BEH A;  3ZIA G;  4WFG A;  1GN4 A;  3EFF K;  3M8A A;  4RAI A;  3RN4 A;  5K1P A;  4JAS A;  2JJ1 G;  3FAV B;  1AJP A;  4B3S O;  1SQB H;  1EZJ A;  3C3T A;  5LP6 A;  5JJE B;  3GWO A;  4LF8 O;  4KUM A;  4PA9 A;  1NT2 B;  3RYC A;  4FM1 A;  1YTF D;  3CXC U;  4KFM A;  3CRM A;  4TSF G;  4NXN B;  1XUQ A;  2GUZ A;  5EIB D;  1OCR B;  2QTS A;  2W0F C;  4C7U A;  1BHA A;  1K7D A;  3T1H O;  1G8M A;  4X64 O;  3SYP A;  1K4C C;  4QJF B;  2B9Z A;  4H13 B;  1HDJ A;  2EZO A;  3W7S A;  3SYQ A;  4MS2 A;  2VWJ A;  1NVP B;  1HWY A;  2QA4 V;  2RCV A;  1XMQ B;  4DV4 O;  4HNA A;  1M1K W;  2PY5 A;  2WLI A;  1VQN V;  3CMA V;  1V9P A;  2Y0I A;  3CRC A;  2UU9 B;  1XRE A;  1XMO O;  2XT9 A;  4B3M B;  2CGN A;  4BIO A;  5KHI A;  1KQS U;  1QR9 A;  3ABU A;  1HR0 O;  4YY3 B;  5LHI A;  1NR7 A;  2WLL B;  2XND G;  4JI8 O;  4X20 A;  1ZUQ A;  2JK5 C;  1SQP H;  4X1I B;  4LF5 O;  2AZ0 A;  2Y69 B;  5GON B;  2AHZ A;  4GKJ B;  4WFA V;  1S3J A;  1ZL8 A;  4DV7 B;  3ABT A;  3CX5 F;  1VQ8 V;  1M5I A;  1WA8 B;  5E1A C;  1EN4 A;  4O4I A;  4P9O A;  5JCO C;  3T4D A;  3N2K A;  1AVM A;  5LXT A;  4PDR A;  2VQE B;  4J41 A;  2BE3 A;  1MNG A;  2F95 B;  5GW7 A;  1NH2 D;  1IX9 A;  4E2L A;  2HVJ C;  4YJ3 A;  3OW2 U;  4PA7 A;  2B5U A;  4DUY B;  1AJQ A;  3TCU A;  1S76 D;  1W59 A;  2HEP A;  4HNA B;  4L8J A;  4BIU A;  1M56 B;  2P90 A;  1YXB A;  3I56 V;  4JI5 O;  1QNM A;  2FKX A;  2QWR B;  2CDY A;  3SJQ C;  1G6U A;  2P4V A;  2XAH A;  3T1Y B;  3SYC A;  1VQ4 V;  4DR4 O;  1ZLZ A;  5EYP A;  1P84 F;  4O2A A;  4JI3 O;  3BAA A;  1Q5O A;  3RT3 C;  4FLZ A;  4D6T H;  4AQY O;  5IYZ B;  2WLI B;  4UVA A;  2ZR2 A;  4MW3 A;  1TAE A;  4JI6 O;  4OPH A;  1XNQ B;  2ARH A;  2GSM B;  2P7T C;  5LP6 C;  1IBL B;  4YJ2 A;  1KD1 W;  4TQD A;  3AK3 A;  4QE7 A;  4TV8 B;  4GYC B;  3TXQ A;  4LBE C;  4FMT A;  2HP8 A;  1XHX A;  3E8F A;  4DR7 B;  5H6R A;  2WLK A;  1JCH A;  2JGD B;  1SQG A;  4R50 A;  2P06 A;  5JH7 B;  3ZRS A;  4MVR A;  4WCE V;  2W6I G;  2WPD G;  5LA6 A;  1BT8 A;  2EUL A;  4LR3 A;  3H1H H;  2XUM A;  2ADP A;  2OT5 A;  4Q20 A;  5LMN B;  1AP5 A;  1QU7 A;  2V1D A;  3NXS A;  2IU3 A;  2ATK C;  4J10 A;  4JI3 B;  3HKB A;  4LF6 B;  3GB7 C;  3JD2 A;  1VP7 A;  4OX9 B;  1Q86 W;  2KG7 A;  4UXN A;  2Z5U A;  2Q5Z A;  4LF8 B;  3UCS C;  4O2B A;  2AZ2 A;  1E1Q G;  1W0K G;  1N34 B;  3DGE A;  2UXX A;  2YIA A;  4TT3 G;  5H6Q A;  3B40 A;  1YZB A;  3TET A;  2MK3 A;  4FLV A;  4IHJ A;  2Q6A A;  1B04 A;  3FYE B;  2Y4U A;  3RGB A;  2DW4 A;  1KBH A;  3JCU Z;  4I0X B;  3OM3 B;  3BRC A;  4EFE A;  2UUA B;  1PKX A;  1GRJ A;  3OMI B;  3CB2 A;  4KHP B;  3C3S A;  3RYC B;  4PDM A;  4JI1 O;  3TK1 A;  1Q82 W;  2DOS A;  4CS2 A;  2EIL C;  3OMA B;  1AI7 A;  3R66 A;  1BCC H;  3VBB A;  2F23 A;  4GT1 A;  3IAY A;  2IW5 A;  3ASO B;  3HKE A;  1SET A;  1J5E O;  1YCI A;  5JVD B;  2BTO A;  1S77 D;  4U3J B;  5DED A;  2RNB A;  4LFA O;  3SJB C;  3K5O A;  3JAK A;  3K9A A;  5IYD O;  4FFK A;  1KKD A;  2YI8 A;  2QM4 A;  2HHH B;  3K5L A;  2IH1 C;  4DR5 O;  3OFN G;  2KB1 A;  1US6 A;  3H1K H;  3WB2 A;  2R9A A;  4GX0 A;  5LGT A;  1XOU A;  4DR3 O;  3WG7 C;  1HNW O;  1SC5 B;  5CN0 A;  3OAA G;  1X4T A;  2LGQ A;  4RQF A;  1OCC B;  2WLL A;  1TUB A;  5L3E A;  2UXD O;  1S5H C;  4YJ2 B;  3CCJ V;  2CTR A;  3K0G A;  1IBL O;  2JDI G;  1NJI W;  1P4R A;  1WJZ A;  5IE9 A;  1GK9 A;  1QVF U;  5KHH A;  3WG7 B;  4UCO A;  4X64 B;  4DV2 O;  4FLX A;  4MVM A;  2XOK G;  3TXS A;  4DV6 B;  4R7C A;  1QHT A;  5KAI Z;  1YJ9 V;  2Q8V A;  5AG2 A;  3ZS8 C;  1VEW A;  3CCU V;  3JD0 A;  2CE4 A;  3RYI A;  5KA6 A;  2XAG A;  2DYR B;  5EBW C;  5EC2 C;  1KC8 W;  1BMF G;  4BWA A;  2ZXW C;  4JZ2 A;  3ASO C;  2GV9 A;  1XIL A;  1VQO V;  5A2Q N;  1SQF A;  4UVC A;  4LF4 B;  4TUY A;  3U11 A;  3W7X A;  3P3P A;  1HNX B;  5J2T A;  5KHJ A;  2P67 A;  1PL0 A;  4J7J A;  1Y76 B;  3LSU A;  1SZX A;  4DO2 A;  4WFH A;  2XAS A;  5IWA O;  4X65 O;  1W2B U;  1NTZ H;  2HG5 C;  4GX1 A;  3BA8 A;  3K08 A;  1BGY H;  2CK3 G;  5J2U B;  4W4K A;  5B1N A;  1SA0 A;  2YSU B;  1Y74 A;  1L1F A;  4PDL A;  2ZNI A;  1FAF A;  1PNK A;  3HKC B;  2IJJ A;  3LNM B;  5KX5 B;  4ZI7 A;  2UUB O;  2KG7 B;  4K0K B;  3UM7 A;  3L71 H;  1N32 O;  3WFV A;  4NXM O;  5IWA B;  1SS3 A;  1OCO C;  1Y4M A;  2R9I A;  4UCU A;  1IXM A;  4JI0 B;  1YSC A;  3AEI A;  4WFE A;  1U96 A;  3L72 H;  5CBF A;  4MVO A;  1PNM A;  2UXC O;  4G28 B;  2ZDI A;  3K9S A;  4QNH B;  3RWR D;  4CS3 A;  1ZWI C;  3FYI B;  4X62 O;  1DTO A;  1K5S A;  2PI4 A;  4O4L B;  3C90 A;  2JS5 A;  5KLV H;  5LYJ B;  3J80 N;  4RUE A;  5F2V O;  3CC7 V;  3CYO A;  2JEU A;  5FPO A;  5LHG A;  4W4L A;  2OIG A;  3JSL A;  5EBL C;  2OTL V;  4PD4 F;  4JTC B;  3ZX6 A;  5CA3 A;  2AW9 A;  5B1B C;  2ODM A;  1GO3 F;  5D5P A;  2NNU A;  3WU2 Z;  1TVK B;  1G1X B;  2UXB B;  1Q90 D;  3ZED A;  2DQ3 A;  5CB4 A;  2EIN C;  1F4N A;  4JV5 B;  1OCC C;  1ZX3 A;  2IJK A;  5KUM A;  2F43 G;  4YHH O;  1R1B A;  3L74 H;  5H9C A;  4B7K A;  1PD3 A;  1DK1 A;  3W7W A;  3KCX A;  1M57 B;  1FJG B;  5HFM A;  2V7Q G;  3QNE A;  4O4H A;  3E8G A;  4DV0 B;  4ZOL A;  1XNR O;  3ABK B;  5CA0 B;  5LGN A;  3M7M X;  3F5W C;  3SPI A;  2RDC A;  2OYQ A;  1R3I C;  4BIZ A;  5IY5 C;  2PF4 E;  4J7Z A;  3JAT B;  2NLJ C;  4UB8 Z;  1XQ8 A;  1L0N H;  4K8Z A;  2Q69 A;  4YHH B;  3ZMU A;  1KEC A;  2XTA A;  5EBM C;  3JAL B;  4GKK O;  3I55 V;  3ZHQ A;  2BTQ A;  1GM7 A;  2JGU A;  2WLM A;  4GLX A;  5CBG A;  1GN6 A;  1JA8 A;  2YDE A;  1FS0 G;  4P9P A;  3OTF A;  4X1K A;  3ZHU A;  2E76 B;  2VWK A;  4P2Z A;  4O4L A;  3APQ A;  3ZMT A;  3BCC H;  4DV7 O;  2JRI A;  1LR1 A;  3E35 A;  3IC9 A;  2ZIN A;  3VQX A;  1NS1 A;  1VAR A;  3AG3 B;  4CBC A;  2ETN A;  5J2T B;  4NTX A;  3JCZ A;  2MW2 B;  3QO7 A;  1AIL A;  4I50 B;  4MVQ A;  2F4V O;  3RW0 A;  4TV9 A;  3K03 A;  5BR8 O;  1XL6 A;  2IU0 A;  3CME V;  1B6Q A;  3PN1 A;  4CH4 A;  3ABL B;  4FFB B;  3U10 A;  1OZ0 A;  4DK1 A;  4LF4 O;  1BE3 H;  2H8P C;  1ORQ C;  4UCV A;  2LP7 A;  4DR2 B;  1RPR A;  1WPX A;  3KCY A;  4K0K O;  2QWQ B;  4LF6 O;  3K3W A;  4ZBM A;  2Q7H A;  5GTI Z;  3CC4 V;  2HKO A;  2W6J G;  2ZM6 O;  4D7S A;  1AR1 B;  3RVZ A;  4O4J A;  3JAK B;  1CPY A;  2ZT9 B;  2Z3Y A;  5KHG A;  4YIO A;  3ABM B;  4DK0 A;  3JSN A;  1ZSP A;  3QO5 A;  3J81 N;  1GMG A;  3F7Y C;  1JR9 A;  2WA4 A;  4LNU A;  4WBN A;  3AK1 A;  3X2Q B;  3G80 A;  4DV3 O;  2KSD A;  3L9D A;  4IYH A;  5JJN B;  1TUB B;  5LL6 Y;  1AR4 A;  4X20 B;  1KYO F;  3K59 A;  1FFX B;  1XBL A;  4WF9 V;  1I08 A;  5BXZ A;  1K73 W;  1H2S B;  4X9Q A;  3ZHR A;  3F5T A;  3ICX A;  4NXN O;  4LFB O;  1UFI A;  2Q7E A;  5CB4 B;  3FFQ A;  3ZRW A;  4G2K A;  1GM8 A;  2PUS A;  1OCR C;  3DC5 A;  3RVY A;  1PNL A;  3S3W A;  3QTC A;  3LDD A;  4FJC C;  5GTH Z;  2P22 C;  2X7R B;  1B06 A;  3CE2 A;  3ZMS A;  4MT8 A;  3JD3 A;  1YIT V;  1GKF A;  4JI7 O;  2YID A;  4G27 B;  1EZV H;  4ZKI A;  1M4U A;  2UXD B;  4DYL A;  2PYJ A;  3JAW B;  3QO8 A;  4UV8 A;  4MTG A;  2YUA A;  3K5N A;  1TUE B;  4MW8 A;  1M56 C;  2ZQM A;  4LH7 A;  1Q7Y W;  1MSD A;  2GUZ B;  5LOV B;  4B3S B;  3B8M A;  3RYI B;  4X1Y B;  2WWW A;  3JAL A;  3E22 A;  1MZE A;  2Y48 A;  2BOC C;  4GUN A;  1DGS A;  1GM9 A;  2FL4 A;  5H2F Z;  5LMU O;  1N34 O;  1SKV A;  2N05 A;  1R6K A;  1Y67 A;  4O4H B;  3ZMZ A;  5DN6 G;  3ML0 A;  4NXM B;  2HHH O;  1N33 O;  3UT5 A;  1FXV A;  4XDJ A;  3RYF B;  2AHY A;  4J9Y B;  1RPO A;  4DUZ O;  1CXZ B;  3H01 A;  2DJV A;  3FX7 A;  2ILM A;  1IVS A;  1VQP V;  2OCH A;  5BY1 A;  3D3I A;  2Q9L A;  1NR1 A;  5B1A C;  1JFF A;  1H8E G;  1AI4 A;  2OCC C;  4I7Z B;  3R65 A;  4TWK A;  2VQE O;  1FXK A;  1COW G;  4A5U B;  1R3K C;  4JYY A;  2CAZ C;  3CJH B;  3K04 A;  1EBO A;  2A7W A;  1M57 C;  3BY6 A;  3IC7 A; 
#chains in the Genus database with same CATH homology
 3ZJZ A;  1FXK C;  4R7C A;  5IYB O;  5L3B A;  3CCR V;  1YJ9 V;  5KA5 A;  5IDJ A;  4KP4 A;  2X6C A;  2A0L A;  2OCC B;  5LHH A;  3CCQ V;  1V54 C;  3CCU V;  3E2E A;  3JD0 A;  2Q67 A;  2YEV A;  2Q68 A;  2K1E A;  1KP2 A;  4MVS A;  3ETD A;  2EIJ C;  5KA6 A;  2XAG A;  4L87 A;  2DYR B;  3OR6 C;  5EBW C;  3FB8 C;  5IY5 B;  1G4Y B;  2IH3 C;  5B1B B;  1Q81 W;  1RM1 B;  1JPX A;  5EC2 C;  5B1A B;  5L3G A;  1BMF G;  4UV9 A;  1KC8 W;  1P7B A;  3ABK C;  1V55 B;  2ZXW C;  1WLE A;  1I5Y A;  1J95 A;  2DWE C;  4HYO A;  4LP8 A;  4JGS A;  1YI2 V;  1K4D C;  3AG1 B;  3ASO C;  1VQO V;  1N8R W;  2X6A A;  1XL4 A;  3SPJ A;  4XDL A;  2EIL B;  4UVC A;  5B3S C;  1MSW D;  1K33 A;  3OEE G;  5HFL A;  1VQ9 V;  3E8H A;  1QVG U;  1SER A;  3W7U A;  1MOF A;  3AG4 C;  3W7X A;  2P6J A;  4MTX A;  1E79 G;  2EIK B;  1OHH G;  2QM8 A;  3ETE A;  2P67 A;  1PL0 A;  3ZRW B;  5CBH A;  4DO2 A;  4JAV A;  4WFH A;  2XAS A;  1NKD A;  3K06 A;  5LBQ A;  1W2B U;  3FB5 C;  2ZR3 A;  3D36 A;  1FFT B;  4QIW F;  4ASU G;  2QKS A;  2HG5 C;  2BOB C;  3K08 A;  4GX1 A;  3T4Z A;  2CK3 G;  2X6B A;  5B1N A;  3STZ C;  1QBZ A;  2YSU B;  1L1F A;  4PDL A;  3B77 A;  4RO2 A;  1PNK A;  1BL8 A;  3BEH A;  3ZIA G;  4WFG A;  2IJJ A;  3LNM B;  5KUK A;  1YIJ V;  1EFR G;  3EFF K;  4RAI A;  3T2M A;  3UM7 A;  2ZDI C;  4X89 A;  4GCZ A;  3WFV A;  4JAS A;  1R6N A;  2JJ1 G;  1H2G A;  4PA3 A;  3RBZ A;  1AJP A;  3AG2 C;  3LSS A;  1OCO C;  1Y4M A;  4OXS A;  1EZJ A;  2R9I A;  2HFE C;  1IXM A;  1YSC A;  3GWO A;  3AEI A;  4KUM A;  4PA9 A;  4WFE A;  5L3F A;  2B1I A;  2FTK A;  5CBF A;  3LSQ A;  4MVO A;  1PNM A;  1UJW B;  1K5Q A;  4G28 B;  1YTF D;  2ZDI A;  2EIJ B;  3CXC U;  2ZD9 A;  4QNH B;  3CCE V;  4KFM A;  1JQ0 A;  2QM7 A;  1CP9 A;  4TSF G;  2EIM B;  2XAJ A;  3IFX A;  3E89 A;  4PDV A;  3MHH C;  2DQ0 A;  1ZWI C;  2XAF A;  3FYI B;  1DTO A;  3SYO A;  1K5S A;  1K34 A;  1OCR B;  2LFS A;  2PI4 A;  4BAY A;  4RUE A;  2W0F C;  2D3O W;  3CC7 V;  3CYO A;  2JEU A;  2EIN B;  3K79 A;  1BHA A;  1K7D A;  4UUJ C;  5LHG A;  1G8M A;  2HLD G;  4MVZ A;  2JJ2 G;  3SYP A;  1K4C C;  5EBL C;  4QJF B;  2OTL V;  4JTC B;  3FB7 C;  5CA3 A;  2EZO A;  3W7S A;  5C93 A;  3SYQ A;  4MS2 A;  3ASN C;  3SPG A;  5B1B C;  1NVP B;  1HWY A;  3E86 A;  1GTO A;  1GO3 F;  2NNU A;  1R3L C;  2QA4 V;  3CCL V;  1M1K W;  4XBF A;  1S0V A;  2WLI A;  1VQN V;  3OGC C;  3CMA V;  3X2Q C;  2PI5 A;  4Z1M G;  2DQ3 A;  2EIN C;  1F4N A;  3ZRX A;  1OCC C;  3CPW U;  1KQS U;  2IJK A;  2QEX V;  1QR9 A;  3ABU A;  2F43 G;  5KUM A;  3EHB B;  4J9Z B;  5H9C A;  1PD3 A;  1OCZ C;  5LHI A;  1NR7 A;  2WLL B;  2HVK C;  3W7W A;  2XND G;  4I9W A;  5B3S B;  1M57 B;  5HFM A;  1R73 A;  3G71 V;  2JK5 C;  2V7Q G;  4F4L A;  2C2A A;  3QNE A;  3E8G A;  3ABK B;  1M90 W;  5LGN A;  2Y69 B;  2AHZ A;  3F5W C;  1SZT A;  2X0L A;  3SPI A;  1LNQ A;  1R3I C;  4BIZ A;  5IY5 C;  4WFA V;  3JD4 A;  1RM1 C;  1ROP A;  1JVM A;  1S3J A;  2NLJ C;  4R8C A;  3ABT A;  5EK0 A;  4U7O A;  1VQ8 V;  4H37 A;  1M9N A;  2Q69 A;  5FL7 G;  3ZMU A;  5E1A C;  1KEC A;  5EBM C;  2OTJ V;  4P9O A;  2DYS C;  3I55 V;  3T4D A;  3CCS V;  3JD1 A;  4MSW C;  1GM7 A;  4PDR A;  2WLM A;  5CBG A;  3CD6 V;  2ITD C;  4RQE A;  3JYC A;  1FS0 G;  5GW7 A;  1NH2 D;  4JTA B;  4P9P A;  3OMN B;  4E2L A;  2R9R B;  2HVJ C;  4JPR A;  3OW2 U;  4PA7 A;  2B5U A;  4P2Z A;  1W0J G;  1AJQ A;  3TCU A;  3ZMT A;  1S76 D;  3ZCC A;  4X88 A;  4BIU A;  4PA4 A;  3ETG A;  1M56 B;  2P90 A;  4YXW G;  3IGA C;  3I56 V;  3P32 A;  3E35 A;  3OEH G;  3ZMV A;  3AG3 B;  4XDK A;  3SJQ C;  1ARO P;  3AG3 C;  1JX9 A;  3HPL C;  2EIK C;  4CBC A;  3KG2 A;  3JCZ A;  4I5S A;  2XAH A;  3QO7 A;  2WLH A;  3SYC A;  1VQ4 V;  2EJR A;  3M99 B;  3ZN1 A;  1K92 A;  1K9M W;  4MVQ A;  3RW0 A;  1OCO B;  4U7N A;  3K03 A;  1NBM G;  5B1O A;  4R6Z A;  1XL6 A;  2IU0 A;  3K0D A;  3P30 A;  2WLI B;  4UVA A;  1B6Q A;  2ZR2 A;  3VOU A;  3CME V;  2B1G A;  2HJF C;  1AI5 A;  3ABL B;  4MW3 A;  1OZ0 A;  2H94 A;  4QPJ A;  4JAU A;  2H8P C;  2GSM B;  4UVB A;  1BHB A;  2P7T C;  5CMU A;  2UXN A;  1ORQ C;  3SPH A;  1KD1 W;  2LP7 A;  1RPR A;  1WPX A;  4QE7 A;  4FK5 C;  1Y66 A;  3MHS C;  1VQ7 V;  4CZZ A;  3T1C A;  5LGU A;  4LBE C;  4FMT A;  5L3C A;  3E8F A;  4H33 A;  3MD0 A;  4MTF A;  5H6R A;  3K3W A;  4ZBM A;  3CC4 V;  2WLK A;  1F4M A;  4JTD B;  1JCH A;  3FB6 C;  4GX2 A;  2HKO A;  2W6J G;  5BZB A;  1AR1 B;  3RVZ A;  4R50 A;  3ZRS A;  1QCE A;  4DXW A;  1CPY A;  4MVR A;  1QLE C;  2Z3Y A;  4WCE V;  2W6I G;  2WPD G;  3OUF A;  3ABM B;  1VQ5 V;  1F51 A;  1SES A;  3CCM V;  4Q20 A;  2OT5 A;  3QO5 A;  1QLN A;  4WFF A;  1GMG A;  1F23 A;  1YJW V;  3F7Y C;  1QR8 A;  1AJN A;  2WAM A;  1NH2 B;  2V1D A;  3NXS A;  1NQT A;  1YHQ V;  4HAM A;  2IU3 A;  3HB3 B;  1THZ A;  2ATK C;  3X2Q B;  2WLN A;  3GB7 C;  3JD2 A;  1Q86 W;  2Z5U A;  3OE7 G;  4UXN A;  5EC1 C;  3ASN B;  4JYB A;  1YJN V;  4WF9 V;  5IYC O;  1K73 W;  3AG2 B;  4N23 A;  3E83 A;  1E1Q G;  1W0K G;  3DGE A;  5L3D A;  3UKM A;  3OR7 C;  2IJI A;  2UXX A;  4BW5 A;  4TT3 G;  4N21 A;  4HZ3 A;  5H6Q A;  4EKW A;  3ZRW A;  4X8A A;  1YTF B;  3TET A;  2MK3 A;  3AG4 B;  4G2K A;  1GM8 A;  3LUT B;  1OCR C;  1E1R G;  3RVY A;  1PNL A;  3FKS G;  3E8B A;  4QE9 A;  4MVU A;  3LDD A;  2Q6A A;  3A0R A;  1MG1 A;  3FYE B;  4FJC C;  4LCU C;  2DW4 A;  3CCV V;  2X7R B;  3ZMS A;  4MT8 A;  2EIM C;  1VQL V;  3JD3 A;  1YIT V;  1GKF A;  1FXH A;  5DM6 V;  3OM3 B;  3W7T A;  4JYC A;  4G27 B;  4ZKI A;  1PKX A;  1I5X A;  3QO8 A;  4UV8 A;  4MTG A;  3LDC A;  3OMI B;  1TUE B;  3OUS A;  3SYA A;  4MW8 A;  3B8N A;  1M56 C;  2ZQM A;  1Q7Y W;  1K97 A;  4PDM A;  3TK1 A;  1Q82 W;  2EIL C;  3OMA B;  4WFB V;  1AI7 A;  3B8M A;  1K8A W;  2EBO A;  2YEV B;  3VBB A;  4GT1 A;  1DF5 A;  2A9H A;  2WWW A;  1H8H G;  2IW5 A;  3AG1 C;  1SET A;  3ASO B;  4PA6 A;  1JJ2 U;  1CEZ A;  4PEL A;  2Y48 A;  1S77 D;  2IJH A;  2BOC C;  3ZRV A;  3F7V C;  4MTO A;  1GM9 A;  2DYS B;  1ENV A;  1VQ6 V;  3CC2 V;  3G4S V;  3STL C;  2A79 B;  4LC1 A;  4FPP A;  1DF4 A;  3K9A A;  5IYD O;  2WLJ A;  1KKD A;  3ZN0 A;  1S72 V;  1DLB A;  1R6K A;  2QTO A;  1MAB G;  3ZMZ A;  2IH1 C;  5DN6 G;  3ML0 A;  3OFN G;  2KB1 A;  4GX5 A;  1FXV A;  4QPK A;  4XDJ A;  3ABL C;  2DWD C;  1QLE B;  1FXK B;  4P30 A;  2AHY A;  4J9Y B;  1RPO A;  4GX0 A;  5LGT A;  1VQK V;  3SPC A;  2GHY A;  1NVP D;  3H01 A;  3WG7 C;  1SRY A;  1KP3 A;  3LDE A;  1OCZ B;  5J9P C;  3CP1 A;  2DYR C;  5CN0 A;  3OAA G;  2QE7 G;  1VQP V;  3D3I A;  2JIZ G;  4RQF A;  1NR1 A;  5B1A C;  1OCC B;  2WLL A;  1H8E G;  1AI4 A;  1V55 C;  2ZXW B;  5L3E A;  1S5H C;  3CCJ V;  2OCC C;  2M7W A;  1AI6 A;  2LFR A;  3PJS K;  3K0G A;  1H38 A;  2JDI G;  1NJI W;  3R65 A;  4TWK A;  2JEX A;  1P4R A;  4RUF A;  2ITC C;  1FXK A;  1VQM V;  1COW G;  1V54 B;  1R3K C;  1K3E A;  4FIP C;  1GK9 A;  1QVF U;  2Y69 C;  2HR3 A;  3WG7 B;  3ABM C;  3K04 A;  4JF3 A;  1EBO A;  3DTU B;  3G6E V;  1JOY A;  1M57 C;  1R3J C;  2XAQ A;  3BY6 A;  4MVM A;  2WSS G;  2XOK G;  3IC7 A;  2EZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...