1Y4MA

Crystal structure of human endogenous retrovirus herv-frd envelope protein (syncitin-2)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
b'NIDTMAKALTTMQEQIDSLAAVVLQNRRGLDMLTAAQGGICLALDEKCCFWVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HERV-FRD_6p24.1 provirus ancestral Env polyprotein
publication title Crystal structure of a pivotal domain of human syncytin-2, a 40 million years old endogenous retrovirus fusogenic envelope gene captured by primates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 17
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1y4mA00
1QR8A 2EZOA 1QR9A 2LP7A 2P6JA 2MK3A 3H01A 4N21A 4N23A 1MG1A 3B77A 5KA5A 2EBOA 1MOFA 1K33A 3B8NA 3GWOA 3K9AA 4FJCC 5CMUA 1Y66A 2OT5A 4E2LA 1DF5A 1I5YA 4JGSA 4JPRA 1QCEA 2M7WA 2EZPA 1JQ0A 1Y4MA 3CYOA 3B8MA 5HFLA 3P30A 4JF3A 1ENVA 2X7RB 4FIPC 5H9CA 1JPXA 1I5XA 3M99B 3WFVA 5HFMA 1DLBA 5CN0A 4G2KA 1QBZA 3CP1A 1F23A 5KA6A 1DF4A 1EBOA 1K34A 3MHHC 4FK5C 3MHSC 1SZTA
chains in the Genus database with same CATH superfamily
5B1AC 2E74B 3T1HO 2Q9LA 5CB4B 1W0KG 1V55C 1SQFA 5FNVA 1MSDA 1AI7A 1ZTEA 2A0LA 3VBBA 2YXLA 4LFCO 2H94A 5H9CA 3DTUB 4G2KA 4OPHA 4MVRA 3IC7A 1SA0A 4YIPA 3M8AA 1IBMB 3IFXA 3OD4A 5EK0A 1PM9A 3OE7G 2CH7B 2PI5A 2ITDC 2AZ2A 1HWYA 2ITCC 3G80A 3P30A 3STZC 4DR4O 1KU9A 2BE3A 1TAEA 4WFGA 3CRCA 3ZN1A 4JI2B 2P4KA 1PNKA 1K5QA 1M9NA 4G27B 3JD4A 4GX5A 4X9QA 1KYOF 5CB4A 2Y4UA 2M6YA 2HEPA 1RFYA 2B5UA 3JD1A 2EBOA 2WLJA 4J7KA 3RYFB 1W0JG 2YI9A 1IXMA 4D6TH 3RYCB 2YICA 3D3IA 4DRXB 4EEQA 4RQFA 3CMAV 1K34A 3CCJV 3BAAA 3M7MX 1HNWO 4NXNB 4BWAA 3K0DA 1AI5A 3KZIZ 2UXNA 3CS5A 2XAHA 4Z1VA 4FM2A 4J41A 1S77D 2XASA 1TVKB 2UXDO 4CS4A 4WFFA 1WA8B 3UT5B 1QBZA 1W59A 5KHJA 4U3FH 4FZ1A 4LF8O 1L0LH 4F6RB 2JK5C 4B3MB 2P6JA 3RYFA 1S76D 2ZXWC 4KXRA 2WA3A 1EZVH 2DYRB 4FFBA 3ZRWA 1I7FA 4QE7A 3R66A 1JX9A 1YCIA 5EYPB 2RJZA 4UB8Z 1Y76B 3RWRD 3CXCU 4HBNA 2RNBA 3ZRXA 3WB2A 5A9GA 3SYOA 5EBMC 2F1MA 1LNQA 1B04A 4JZ2A 3E8FA 3HKCB 1BL8A 1TVKA 1WA8A 4FIPC 3P3NA 3UT5A 4DV2B 5B3SB 5DEDA 4DV0O 2XOKG 3ASNC 4F6RA 1L1FA 4NXMO 2JJ1G 2EINB 2XNDG 2V7QG 3CRRA 1L0NH 4IGGA 1OCZC 5LHIA 4RUFA 1O9HA 3DC6A 2XAGA 2E76B 4J9YB 1NH2B 4LF5O 5EYPA 4JYAO 2CGNA 1JQ0A 1FS0G 1Z5WA 4WBNB 1M57C 2YXYA 3PN1A 3HKDB 3OGIB 4LH6A 1I0HA 4DR1O 1E1QG 4XDJA 4PA3A 4QJFB 1UPGA 2OIGA 1RPRA 3ASOC 4NKGB 4JI6O 1GH6A 2XUMA 3U11A 1FAFA 3K58A 4GLXA 3HKCA 2UXCO 2QWOB 5EZYA 4EFBA 1XMOO 2IM9A 5IJ0B 2LGWA 4XDLA 1KECA 2ZR3A 3K59A 4L8JA 4FLUA 3H01A 1Q5OA 1MG1A 2E3CA 3W7TA 5EIBC 3ZHTA 2ZM6O 1HP8A 2Q7HA 4DR6B 4WBNA 1VQNV 3LSQA 4W4LA 1QVFU 3CYOA 5HFLA 1FXKB 2Z0AA 3D36A 4LFBB 1ROPA 3A0HZ 3I5DA 2DYSC 3K79A 4B7KA 3D8CA 1WJZA 1IBLB 1N36O 3SPCA 5IDJA 4WFHA 4PDVA 2VQEO 4AILC 1Q81W 1MOFA 2GTSA 4B3RO 2DWEC 2RMKB 1Q43A 2DE0X 4R7CA 3CRQA 3F5TA 3WB1A 2QR4A 4LF4B 4J11A 4UCRA 4DR3O 1QLEB 3BVOA 3TETA 1OCRC 5KHGA 4C7UA 2E5LO 2IH1C 2UUAB 4YY3O 1ORQC 3JARB 2F66C 2A06H 2YS8A 1KD1W 4RWUA 4CS3A 3H1HH 3OW2U 2VS0A 1FXKA 4JPRA 1QLNA 3BA9A 1XNRO 1S5JA 1GMGA 2P4VA 4QPJA 3GVMA 1OCCB 3B40A 4K0KB 3EVKA 3TK1A 3LSSA 1K7DA 1CXZB 4UXNA 3G71V 4LBEC 3I55V 1QR8A 3BABA 1ZSPA 3C3SA 1B6QA 3SJCC 5JJJB 4K35A 4DV4B 2Y48A 2YDEA 3I56V 2CUGA 4KUMA 1MMMA 1XHZA 4NTXA 2WLNA 3OGCC 3H1KH 1H2LA 4LFCB 3CCEV 2CTQA 4PA6A 3ZX6A 1J95A 2UXXA 3HKEB 1QVGU 3N2GB 2O57A 4UCSA 3J80N 1Q90D 1VEWA 1M93A 5KUKA 5KA6A 3SJBC 2BOCC 4X20B 4DR4B 1B06A 4PHZA 2ILMA 4DK0A 1M90W 3AG3B 3KKYA 5EC1C 1HR0O 5KA5A 3T4ZA 1RM1C 2R70A 3ZHQA 4KHPO 2L6LA 4MVZA 1XBLA 1EN6A 2JRIA 4DXWA 2M7WA 1D5AA 1NS1A 1Y67A 3E2EA 4B3TO 2YC0A 4DUYO 1OV9A 2PYJA 5FL7G 1MNGA 4JAAA 4U7NA 5IYBO 1Q82W 3HKEA 3N2GA 4JAUA 3QO5A 3K08A 5B1BB 5CMUA 3CB2A 4R8CA 4O4JB 1HNWB 1H2NA 4UV9A 5AG2A 1CPYA 2HHHO 2EX3A 4X20A 3THOA 4U7OA 5JQGA 2CK3G 4YJ2B 1AR5A 2UXDB 4CS2A 4TQDA 3K9SA 4O4LB 5LP6B 2DQ3A 2ZE6A 4LF8B 3DSQA 3TXSA 3A0RA 5L3BA 1WB7A 3E83A 2NNUA 3CCSV 4MS2A 2BCCH 2F95B 4ZKIA 4MVSA 1KB9F 4O4JA 3OEEG 4HYOA 1G8MA 3IJ4A 4I4TB 3ML0A 4PDLA 1WLEA 1JOYA 5ITZB 2ZIMA 1DLBA 3SR2C 1Q6UA 3BA8A 3BFRA 4K3AA 1AJPA 1NT2B 3ETDA 3A0BZ 5DM6V 4O4LA 4PDRA 3U10A 3RN4A 4DV0B 2K1EA 1XHXA 1R3JC 4NXMB 2K9PA 1Y4MA 1D2DA 1GAXA 2DYRC 4X1KB 3WFVA 3CCLV 4LF5B 4JYAB 1S5LZ 4NYKA 2PI4A 2AGAA 5LGNA 1R3KC 2A9HA 3MHHC 1KQSU 2AW9A 4HNAB 4DR1B 1SQGA 2LW1A 1H8HG 5JH7B 3KCXA 4I4TA 1R3IC 1O9GA 2YUAA 3FYIB 2CTRA 2EIMB 3K5LA 1EZJA 2IJHA 5ITZA 1AVMA 3CC4V 4JI6B 1AI6A 3K5MA 1W2BU 2UXCB 3QVNA 5F2VO 3OUFA 1XMOB 1VF5B 3E8GA 2QWQB 1YIJV 1KKDA 4LF4O 4NVPA 3BEHA 4MTFA 4J9ZB 3VQVA 4GX2A 3AK2A 2EINC 2VQFO 4X8AA 3CJHB 2AHZA 1FFXB 4GCZA 3VQWA 5A2QN 4DUZO 1GN3A 2AXTZ 2CTWA 3ZMTA 1H38A 1VP7A 2EZOA 2OIEA 2Q69A 5JH7A 4N21A 3L70H 1M1KW 3OMIB 4JTCB 1M56B 1YVWA 1N36B 2VQEB 2ZKOA 4PA4A 2Z5UA 3ICXA 3EHBB 2PTMA 4B3RB 4D7TA 3F7YC 3ABMB 2F23A 1I08A 2E5LB 3EFFK 2V4DA 1AJNA 4YY3B 1AR1B 2GUZA 2Q73A 4X1IA 3CJHA 1FFXA 3B8MA 2EJ7A 2YEVA 4JF3A 1X4TA 1NKDA 1PV0A 1XNRB 1FXKC 4GKJO 3ZJZA 5KHKA 3JSNA 5C8YB 3ABLB 5E79Z 1NU1H 5IY5B 1Y66A 4J7ZA 1DF5A 1BS3A 1URFA 2HJDA 5J2UB 3CWBH 1BCCH 2FYUH 2Y4TA 4DV3O 3RGBA 1NR1A 4G28B 2P7TC 1QLEC 3OR7C 1XEQA 4K8ZA 4X89A 4B3SB 1VQPV 4YIOA 4DV6O 2YIDA 1SZXA 1EM1A 4TV9B 2WLHA 1QNMA 1SETA 4CH3A 4RAIA 4AQYO 2RQ6A 1I94O 2UXBO 4R6ZA 4FFBB 3ZRWB 3QO7A 1MZFA 1OJHA 1ZWIC 4MVQA 4JASA 3OEHG 4OX9O 1SQVH 4K8XA 1BMFG 5C8YA 5B1NA 4J80A 3N2KB 5EC2C 1SQXH 1OCCC 2Y0IA 3QO8A 1V9PA 2JS5A 2IBZH 2PUSA 4JI0O 4DYLA 4B7EA 3GWOA 5J2UA 3CEIA 2HKOA 1I5YA 3JAMN 2Y0PA 1K9MW 2Z3YA 5D5PA 1HR0B 5K1XA 3N27A 2QTOA 1PNMA 3RFRA 4KHPB 2HR3A 2FL4A 1CP9A 5BXZA 2EIJB 5LGUA 3AG1B 1PP9H 5HFMA 4TV9A 4DR2O 4B3TB 3AG4B 4MTOA 2CAZC 3QTCA 2X0LA 4DUYB 4TSFG 1T5EA 1V54B 5L3GA 1PL0A 2LO1A 3K3WA 1GM8A 1P49A 2HLDG 3GWKC 2RCVA 4YHHO 2Q5ZA 5LBQA 4JYBA 4UCVA 3N2KA 2GBOA 2PZSA 2DMXA 3VOUA 3MHSC 3LSUA 2HHHB 2LGQA 2QKSA 4IHJB 3FFQA 1WPBA 1K33A 4PA9A 4DR5O 3AG3C 1QQCA 2KG7B 5KUMA 3SJQC 5EZYB 1OZ0A 4LR3A 5CBHA 4TUYB 1YJ9V 2IH3C 3BHPA 3ZN0A 1S5HC 1JA8A 2FB5A 5JCOC 2IW5A 3K04A 3T4DA 4RQEA 4CH4A 4GX0A 1ZAUA 4WCEV 2EILB 1VQOV 5B1BC 3D3QA 4JZGA 2OCCB 2GTAA 4PI0A 1S3JA 3LNNA 1R6NA 1K5SA 3PJSK 4OXSA 4IHJA 3AG7A 5D5QA 2WLMA 1RSOB 1Y74B 1FFTB 4LNUB 5K1PA 2KG7A 2V1DA 3WG7B 5LP6C 2X7RB 3ZHRA 4ZHQA 1JFFB 4TUYA 1WB8A 2X6CA 4PA7A 3CHXA 3E8BA 2ETNA 1Z5VA 2EIKB 1M4UA 3Q4HB 4LFAO 1GN2A 2P22C 4ZI7B 1AJQA 1K4CC 3AG2B 4CC6A 4ZOLB 2N05A 2RN9A 3S3WA 2FTKA 4QPKA 2ZD9A 3W7SA 4FVMA 1VF6A 4MVMA 2JDIG 1NTZH 3GB7C 3JYCA 1S0VA 1K4DC 3APOA 2CDYA 1RSOA 1Y74A 2LFSA 4LNUA 2QTSA 2XAJA 5BY1A 1VMGA 3K9AA 5JVDB 2JVDA 4OPAA 1COWG 1JFFA 1R6KA 1TUEB 3FKSG 5L3DA 1GKFA 4JI8O 2JS3A 3HB3B 4H44B 4LP8A 2VQFB 1AR4A 4WFBV 5C93A 4PDMA 1YI2V 3Q4HA 5LGTA 1F4MA 4ABMA 3UO3A 4YJ3B 1BSMA 3JCUZ 4DUZB 4ZI7A 4MW8A 3ZMUA 2FMLA 1M5IA 1YEWA 4ZOLA 3K0GA 3L9DA 4IYHA 2R9IA 5L3CA 1WP7A 4O2AA 1WP8A 2EIMC 4LF9O 4O2BB 3FB5C 1YDXA 3L73H 2JIZG 1IZ3A 1AP6A 1BZKA 1XOUA 2QJ1A 4ZBMA 5JVDA 5BZBA 1VQ6V 2NLJC 1N33O 1NI8A 4NTWA 2QEXV 4B3SO 4CH6A 2ZR2A 1ZX3A 4YJ3A 3CCUV 4O4HA 3JD3A 4Z1MG 3STLC 3RVYA 4GKJB 2ARHA 3UM7A 2LFRA 2Q7EA 2HVJC 4JTAB 4FMTA 4O2BA 1HNXO 1BQZA 1BHBA 4GUNA 4MT8A 3SDLA 3LDDA 2ZT9B 3RBZA 2DN9A 4OGQB 2RDCA 2ATKC 1BHAA 1BE3H 4DV3B 5JQGB 1ZLZA 1K8AW 3ABMC 5BR8B 4A5UB 2OT5A 4P9OA 2WA4A 4PI2A 4DV6B 2YIAA 3OTOO 3LNMB 2VWJA 5IT9N 4AQYB 2UUBO 4LWSA 5B1OA 5KHIA 1I94B 2UXBB 1KP2A 5KX5B 1LUWA 2Q8VA 4OX9B 2QWNB 2ZQMA 2ZDIA 4FM1A 2UUCO 4BAYA 4GYCB 3ABLC 4MVUA 3ZIAG 2P06A 5IY5C 5LHHA 4JI0B 1XI1A 4JAVA 4MVOA 1F51A 2DJVA 1MABG 1G6UA 3E8HA 1X59A 4X62O 1M57B 3H1JH 4J42A 4I9WA 2ZNIA 1P7GA 1KP3A 4DR2B 3OT7A 2JGUA 4LF6O 2HG5C 4H33A 1IBKO 4UVBA 1N4CA 3BCCH 4TV8B 5KX5A 2N74A 1N34O 5KAIZ 1Y6XA 1ZL8B 2OYQA 2PYLA 2VWKA 3RVZA 2UU9O 5BMVB 4YHHB 5IJ9A 5LXTB 3L72H 1BQ0A 2QM7A 5J2TA 4UFZA 1HDJA 5GTIZ 3ZHUA 3O65A 1G4YB 4D7SA 4Q20A 1YTFB 3FB7C 2A79B 3K5NA 4DR5B 2W0XA 1LR1A 4PV1B 2E75B 3JALB 2B1GA 2WAMA 1LUVA 2JEUA 2KB1A 1Q8IA 2Q0OC 4DV5B 3DGEA 1WPXA 4ASUG 2WWWA 2OTJV 3T1YO 2ZINA 1VQ4V 2IJJA 4TV8A 1MA1A 2ADQB 2KSDA 1YITV 4FFKA 1ZL8A 1OCOB 1VQKV 5JJEB 5BMVA 3SGIA 1VQ8V 4MSWC 5LXTA 4FM0A 4P9PA 4ICGA 1OCRB 1SF9A 1NQTA 2AHYA 3CRAA 1J5EO 2Q7GA 4DV7O 1DTOA 3JALA 1MZEA 2HFEC 4TOIA 2P5OA 4JI4O 2JEXA 3QG5A 5B3SC 1QR9A 1H2GA 1PL4A 2F4VB 1YF2A 4KP4A 5J9PC 5LMUB 2QM8A 3DXRB 4DK1A 4LFAB 2P90A 1FD9A 2XHBA 2GUZB 2Q68A 4X1IB 1B3QA 4CH5A 2YEVB 3OAAG 2XAQA 4FLXA 4UCTA 2QKAA 4O4IB 3HKBB 4QNHB 4JI5O 1EBOA 2W6JG 4DO2A 1XDCA 3D36C 3ETEA 2KQXA 3A8TA 4IYIA 4BR6A 2QA4V 4Z2WA 4X65B 1ZUQA 1KBHA 2R9AA 1YTFD 4CBCA 3ZBHA 2QGNA 4B08A 4JV5O 4MW3A 5EIBD 4W4KA 1F23A 3WG7C 3W7WA 2ZNJA 4LC1A 4JI8B 5LOVB 1H2SB 4WFEA 3WU2Z 4GKKB 1OHHG 3B8NA 3DXRA 5CA3A 2QM4A 2Q67A 3G6EV 2EIKC 3F7VC 4FZ0A 5IYZB 3JAKB 4BW5A 2XTAA 3SPJA 3A2FA 2XT9A 2F93B 2GDSA 2QSAA 3HKBA 4O4IA 5FPRA 1FXHA 3AG2C 4KFMA 3CP1A 3KCYA 1BT8A 3RYHB 1P4RA 3HR0A 1NZ6A 1VQ7V 4R50A 3T1CA 4LF9B 3JD2A 2HP8A 3ZMSA 3ZS8C 1MSWD 2X6BA 2DOSA 5FPOA 3CXHF 3L71H 3G4SV 1PD3A 1N33B 1THZA 4X66O 5BR8O 5LOVA 3K06A 5DN6G 2NR5A 2R9RB 3B4SA 2IJIA 5IYZA 5LL6Y 5FLXN 3JAKA 5IWAO 3ZHSA 1EFRG 3SYQA 1XMQB 3B2EE 1UJWB 1YXBA 1NVPD 1WAZA 1U97A 1NTKH 4WFAV 1K3EA 3RYHA 5B5EZ 1VARA 1SQPH 5IE9A 3RT3C 4UCUA 1P84F 1HNXB 4UUJC 2R72A 1VIBA 3UKMA 4EB6B 5TISZ 3W7UA 4EKWA 4FJCC 1JJOA 5LMNO 2Y69B 4E4EA 2WLKA 3CPWU 1FJGO 3TCUA 2C2AA 3ZEDA 4X64O 2X6AA 3E22B 3ABUA 4EFEA 1XQ8A 1GM7A 2PGGA 2OTLV 3OTOB 5KLVH 2CH7A 5IYDO 2UUBB 2QKCA 3C3TA 5CA1B 5JWPA 3OR6C 3P3PA 2F43G 1TUBB 3ZMVA 2ZDIC 3L74H 1E79G 2UUCB 2ZE8A 3E35A 4LF7O 1KC8W 3U0ZA 2JGDB 4JI7O 2MW2B 4EB6A 4PD4F 4JI3O 5CA0B 1N32O 2QWRB 4U3JB 4X62B 3RYCA 2A7WA 1G1XB 4GX1A 5CBFA 4TWKA 1VF7A 3UCSC 4DRXA 5L3EA 2DWDC 3E22A 1SQBH 2WLIB 1HNZO 4ZHQB 4P2ZA 3CCMV 1SC5B 3X2QB 4DV5O 1Q7YW 3CRMA 4KL1A 4BW9A 4LF6B 3UO2A 3SPGA 1IBKB 5CA1A 4UCOA 3BPZA 2L35A 1PKXA 3MD0A 4I0XB 1SKVA 1TUBA 1N34B 1IVSA 1XUQA 4TQFA 1XNQO 2UU9B 1GN6A 4XDKA 3E89A 2LJ2A 1NBMG 2XAFA 2YXHA 2EJRA 2JGDA 5LYJB 4JI1O 1SZTA 5CA0A 2PF4E 3FAVB 4F4LA 1CEZA 4U3JA 1FPOA 2IJKA 1JJ2U 1FXVA 2JJ2G 1DGSA 1WNSA 4FPPA 1Y76A 3SYCA 4J10A 2D2CB 2WLIA 5L3FA 2IU0A 3T1YB 2BTQB 2D3OW 2F4VO 5LMUO 4IIJB 5DECA 4I0XA 3W7XA 4LH7A 1IURA 1GM9A 4DV1O 3OFNG 1WN7A 3IC9A 1D5NA 4GZRB 3ABKB 4WF9V 5B1AB 1YSCA 3RYIB 5LYJA 1VQ5V 4O2AB 2P67A 1RP3B 1SS3A 2EULA 3SPHA 1J5EB 1V55B 3FAVA 3QNEA 1SRYA 4DV7B 4X65O 1XL4A 5KMGB 1H8EG 4J7JA 2AZ0A 1GO3F 5H6RA 1KMIZ 3HKDA 1FKAO 5KHHA 1VQMV 4JI4B 4DR7O 3FB8C 1SERA 1QCEA 3CSXA 2EZPA 5E1AC 1FYJA 1A32A 4HZ3A 3CC7V 2BTQA 2Q6AA 4IL6Z 3JATB 2A3QA 4IIJA 4GKKO 3DC5A 4XBFA 4LCUC 2ADPA 4N23A 4NR1A 1OCOC 2PY5A 4O4HB 1Q6HA 5GW7A 4JI5B 3LDEA 3OUSA 5IJ0A 4ZIBA 4QIWF 2NN4A 1R6TA 3M99B 3RYIA 1RPOA 2W0FC 5LA6B 1HW7A 4JV5B 2QWPB 1YJWV 3JCZA 5KMGA 4P30A 5JJNB 1NH2D 3FD9A 4L87A 3BRCA 3NR7A 1E1RG 4JGSA 3P32A 2H3OA 1N8RW 1ENVA 3CMEV 1IBMO 3C90A 3J81N 3JATA 4RUEA 1DF4A 3SYPA 4LWSB 3JASB 2CTPA 1SQQH 4I7ZB 3CCQV 1H2MA 1XMQO 1XILA 1AI4A 4QE9A 2WSSG 4FLWA 4JI2O 1R3LC 3EXAA 3T1HB 3SJAC 3CC2V 4I5SA 3K03A 3L75H 3IAYA 1M56C 1JVMA 5LA6A 3JARA 5KAFZ 2ZXWB 1GK9A 3HPLC 1R1BA 2B9ZA 4JYCA 4FLVA 2VRZA 4MTGA 3B77A 4X66B 4JYYA 4BIOA 3AK1A 3QF7A 5H5NA 2IU3A 1BGYH 2ZIOA 4UVCA 2WPDG 1DK1A 3ETQA 1N0NA 4PJ0Z 1KKCA 2HJFC 1IXBA 3OM3B 3TJTA 1U96A 3JSLA 3IGAC 5IWAB 2B1IA 4NXNO 3JASA 1YZBA 3CX5F 4FK5C 3CD6V 2BTOA 2MK3A 3CCRV 3KG2A 1F7YA 4RO2A 5IJ9B 4I9QA 5J2TB 3R65A 1NR7A 3ASNB 4HAMA 1JPXA 2N04A 3ZCCA 4AHCA 4B3MO 1N0JA 5CN0A 1KUQA 2QE7G 1OCZB 5LMNB 1YHQV 4CC5A 1UFIA 4X88A 3S3XA 3TXQA 1FJGB 2LQTA 5GTHZ 4X64B 4QGPA 3K5OA 1GRJA 1P7BA 2H8PC 5GONB 1NJIW 1JR9A 2DQ0A 5LHGA 3AK3A 1AB3A 3LUTB 3MDSA 3ASOB 3J7AU 1XL6A 3H1LH 4UVAA 4UB6Z 3UQ8A 1VQ9V 2BOBC 1AILA 4DW0A 2G38A 4LF7B 4DV2O 4YXWG 4JI7B 4DW1A 1K73W 4X1YB 4JI3B 3ZMZA 1AROP 1Q86W 1I5XA 1Z2GA 2HVKC 1N32B 5JCOA 1Q3EA 4H37A 1IX9A 2Y69C 2Q4PA 2GV9A 1TGOA 4UV8A 2LP7A 2KKWA 3O9OA 3VQXA 1HNZB 5GONA 2EIJC 3AG1C 4H13B 2DYSB 2Q0AA 5H2FZ 1QHTA 1VQLV 3AG4C 4AI8A 4Q6GA 2CE4A 4GT1A 1V54C 4YJ2A 1XNQB 2CGOA 3WB0A 3SPIA 1PPJH 3FYEB 3T2MA 3E86A 5LP6A 1K92A 2LW7A 1QU7A 4I55B 2QDOA 3APQA 2ZCEA 4JI1B 4E2LA 1US6A 4X1YA 1S72V 4MTXA 2GSMB 1TA8A 2BSKB 2OWOA 5H6QA 3ABTA 3CCVV 1IDSA 1SESA 3JAWB 1JCHA 2YI8A 4DR6O 1F4NA 1GN4A 2DW4A 1Q6IA 4TT3G 1EN5A 3X2QC 3OMAB 4LFBO 4PELA 4BIUA 1H2KA 4H0LB 4IT5A 2WLLB 4I50B 2W6IG 3OMNB 1NTMH 1IBLO 4F6EA 2YSUB 2ZE5A 1YJNV 2YIBA 4DV1B 1NVPB 3ZRVA 2EILC 4FLTA 4FLYA 5IYCO 2OCCC 4I55A 3G67A 3NXSA 3SYAA 1GTOA 3TGUH 2UUAO 4X1KA 1VF6C 2BSKA 4BIZA 2ZM6B 4FLZA 5FNVB 2FKXA 1PNLA 1EN4A 3H9VA 4DR7B 3H1IH 3JAWA 3VQYA 3AEIA 3G6BA 4HNAA 1AP5A 3ETGA 3ZRSA 3JD0A 1SA0B 1JMKC 4NB5A 4CZZA 3OTFA 5EBWC 2OCHA 2WLLA 3K57A 4I50A 3FB6C 4K0KO 5EBLC 1XREA 3F5WC 3MAQA 3BY6A 1R73A 3CE2A 3FX7A 3RW0A 3ZHVA 2ZE7A 2YIBD 4JTDB 3B09A 1K97A 5B66Z 4DR3B 1RM1B 3ABKC 2GHYA 4NTYA 5CBGA 2ODMA 4DV4O 1L8DA 3LDCA
chains in the Genus database with same CATH topology
5B1AC 4ZKIA 4MVSA 4ZBMA 1PKXA 3MD0A 5BZBA 1W0KG 1VQ6V 1V55C 2NLJC 3OEEG 4HYOA 1G8MA 4XDKA 3E89A 1AI7A 2A0LA 1NBMG 3VBBA 3ML0A 4PDLA 2H94A 5H9CA 1WLEA 1JOYA 2QEXV 2XAFA 1DLBA 2EJRA 3DTUB 4G2KA 4MVRA 3IC7A 1AJPA 2ZR2A 3CCUV 1SZTA 3ETDA 3IFXA 3JD3A 5EK0A 5DM6V 1CEZA 4PDRA 4F4LA 3OE7G 4Z1MG 3STLC 3RVYA 2K1EA 1R3JC 2IJKA 2PI5A 1JJ2U 1FXVA 2JJ2G 4FPPA 2ITDC 3UM7A 3SYCA 1HWYA 2LFRA 1Y4MA 2ITCC 3P30A 3STZC 2DYRC 3WFVA 2HVJC 4JTAB 4FMTA 2WLIA 4WFGA 1BHBA 3ZN1A 5L3FA 2IU0A 3CCLV 4MT8A 3LDDA 3RBZA 1PNKA 1K5QA 1M9NA 2D3OW 4G27B 2PI4A 2ATKC 3JD4A 1BHAA 5LGNA 1R3KC 2A9HA 3MHHC 4GX5A 1KQSU 2B5UA 3ABMC 1K8AW 3JD1A 3W7XA 2EBOA 1H8HG 2WLJA 1R3IC 1W0JG 2OT5A 3FYIB 1IXMA 2EIMB 4P9OA 1GM9A 1EZJA 3OFNG 2IJHA 3CC4V 3LNMB 3ABKB 1AI6A 4WF9V 3D3IA 5B1AB 1W2BU 1YSCA 5B1OA 1VQ5V 4RQFA 2P67A 3OUFA 3CMAV 1KP2A 3E8GA 1YIJV 1K34A 3SPHA 1V55B 3QNEA 1SRYA 1KKDA 3CCJV 2ZQMA 2ZDIA 3BEHA 1XL4A 4MTFA 1H8EG 3K0DA 1GO3F 4J9ZB 1AI5A 5H6RA 4BAYA 2UXNA 4GX2A 1VQMV 3ABLC 3FB8C 2EINC 2XAHA 1SERA 1QCEA 5E1AC 2EZPA 4X8AA 4MVUA 3ZIAG 5IY5C 5LHHA 2AHZA 1S77D 4HZ3A 2XASA 4GCZA 3CC7V 4WFFA 4JAVA 2Q6AA 1F51A 4MVOA 1MABG 1QBZA 3ZMTA 3E8HA 1H38A 4XBFA 4LCUC 2JK5C 2EZOA 2P6JA 2Q69A 1M57B 4N21A 4N23A 1S76D 1OCOC 2ZXWC 1M1KW 3OMIB 2DYRB 5GW7A 4I9WA 1M56B 4JTCB 3ZRWA 3LDEA 3OUSA 1KP3A 4QE7A 4PA4A 2Z5UA 1JX9A 3EHBB 4QIWF 3M99B 2HG5C 4H33A 3CXCU 3ZRXA 1RPOA 4UVBA 2W0FC 3F7YC 3ABMB 3RVZA 1YJWV 3SYOA 3EFFK 5EBMC 3JCZA 4P30A 1AJNA 2QM7A 1LNQA 1NH2D 1AR1B 4L87A 1E1RG 4JGSA 3P32A 3E8FA 1BL8A 3B8MA 1N8RW 2YEVA 4JF3A 1ENVA 4FIPC 1G4YB 3CMEV 4Q20A 1NKDA 5B3SB 1YTFB 3FB7C 2A79B 4RUEA 1FXKC 2XOKG 3ASNC 3ZJZA 1DF4A 3SYPA 1L1FA 2B1GA 2JJ1G 2WAMA 3ABLB 2EINB 2JEUA 2KB1A 2V7QG 2XNDG 3CCQV 1OCZC 1AI4A 4QE9A 3DGEA 1WPXA 2WSSG 5IY5B 4ASUG 1Y66A 5LHIA 1R3LC 4RUFA 1DF5A 2WWWA 2XAGA 4J9YB 1NH2B 2OTJV 1JQ0A 1FS0G 1VQ4V 1M57C 3CC2V 4I5SA 3K03A 2IJJA 1M56C 1YITV 1JVMA 1NR1A 4G28B 2P7TC 1E1QG 1QLEC 1OCOB 2ZXWB 1VQKV 1GK9A 4XDJA 3OR7C 3HPLC 4PA3A 4MSWC 1VQ8V 4QJFB 4P9PA 4X89A 1VQPV 4JYCA 1RPRA 3ASOC 4MTGA 3B77A 1OCRB 2WLHA 1SETA 1NQTA 4RAIA 2AHYA 2IU3A 4UVCA 2WPDG 4R6ZA 3ZRWB 3QO7A 2HJFC 1ZWIC 3OM3B 4MVQA 4JASA 3OEHG 4XDLA 1KECA 3IGAC 1DTOA 2B1IA 2HFEC 1BMFG 5B1NA 5EC2C 4FK5C 2ZR3A 1OCCC 3QO8A 2JEXA 5B3SC 1QR9A 3CD6V 2MK3A 3H01A 3CCRV 1MG1A 3KG2A 1H2GA 3W7TA 4RO2A 3GWOA 4KP4A 2HKOA 5J9PC 1VQNV 1I5YA 2QM8A 3LSQA 1QVFU 3CYOA 2Z3YA 1K9MW 5HFLA 3R65A 1FXKB 1NR7A 2P90A 3ASNB 3D36A 4HAMA 2Q68A 1JPXA 1PNMA 2QTOA 2HR3A 1ROPA 3ZCCA 2DYSC 2YEVB 3OAAG 2XAQA 3K79A 5CN0A 1CP9A 2QE7G 4QNHB 1OCZB 2EIJB 5LGUA 1EBOA 2W6JG 4DO2A 1YHQV 3AG1B 4X88A 3SPCA 5IDJA 4WFHA 4PDVA 5HFMA 3ETEA 3AG4B 4MTOA 1Q81W 2X0LA 1MOFA 1P7BA 2H8PC 2DWEC 4TSFG 2QA4V 4R7CA 1V54B 1NJIW 2DQ0A 5LHGA 5L3GA 1QLEB 1PL0A 3TETA 3K3WA 1GM8A 1OCRC 2HLDG 1YTFD 4CBCA 3LUTB 2IH1C 4MW3A 4JYBA 5LBQA 3ASOB 1ORQC 1F23A 1XL6A 3WG7C 4UVAA 3W7WA 1VQ9V 3VOUA 4LC1A 1KD1W 3MHSC 2BOBC 2QKSA 4WFEA 3OW2U 1OHHG 1K33A 3B8NA 5CA3A 4PA9A 4YXWG 2Q67A 3G6EV 2EIKC 3F7VC 1FXKA 4JPRA 1QLNA 3AG3C 1GMGA 4BW5A 3SPJA 4QPJA 1K73W 3ZMZA 1AROP 5KUMA 3SJQC 1Q86W 1I5XA 2HVKC 1OZ0A 1OCCB 1FXHA 3AG2C 4H37A 4KFMA 3TK1A 3CP1A 5CBHA 2Y69C 3LSSA 1YJ9V 2IH3C 1P4RA 1K7DA 3G71V 4UXNA 1VQ7V 4LBEC 4R50A 3I55V 1QR8A 3T1CA 4UV8A 2LP7A 3ZN0A 1S5HC 1B6QA 2EIJC 2IW5A 3JD2A 3AG1C 3K04A 3T4DA 2Y48A 4RQEA 2DYSB 3I56V 4GX0A 3ZMSA 1VQLV 3AG4C 4WCEV 2EILB 4KUMA 1VQOV 5B1BC 1MSWD 2OCCB 2X6BA 4GT1A 1V54C 1S3JA 2WLNA 3G4SV 1PD3A 3OGCC 1THZA 3SPIA 1R6NA 1K5SA 3PJSK 4OXSA 3K06A 3FYEB 3T2MA 3E86A 5DN6G 2R9RB 3CCEV 1K92A 4PA6A 1J95A 2WLMA 2IJIA 2UXXA 1FFTB 4E2LA 1QVGU 1S72V 4MTXA 2V1DA 1EFRG 3SYQA 2GSMB 3WG7B 2X7RB 1UJWB 5H6QA 1NVPD 4WFAV 1K3EA 3ABTA 2X6CA 5KUKA 5KA6A 3CCVV 1SESA 2BOCC 4PA7A 1JCHA 3E8BA 1F4NA 2DW4A 4UUJC 2EIKB 1M90W 4TT3G 3AG3B 5EC1C 3X2QC 3OMAB 5KA5A 3UKMA 3T4ZA 1RM1C 3W7UA 4EKWA 4PELA 4FJCC 4BIUA 4MVZA 1AJQA 4DXWA 2M7WA 2WLLB 1K4CC 3AG2B 2W6IG 3OMNB 2Y69B 2WLKA 3CPWU 2YSUB 3E2EA 3TCUA 2C2AA 1YJNV 2FTKA 2X6AA 4QPKA 1NVPB 3ABUA 3ZRVA 2ZD9A 3W7SA 1GM7A 2OTLV 2EILC 5FL7G 4MVMA 5IYCO 2JDIG 3GB7C 5IYDO 3JYCA 1S0VA 1K4DC 2OCCC 4U7NA 2LFSA 5IYBO 3NXSA 1Q82W 2XAJA 4JAUA 3QO5A 3K08A 5B1BB 3K9AA 3OR6C 5CMUA 3SYAA 2F43G 1GTOA 3ZMVA 4R8CA 1COWG 4BIZA 1R6KA 1TUEB 3FKSG 2ZDIC 4UV9A 1E79G 1PNLA 1CPYA 1GKFA 5L3DA 3E35A 3HB3B 4LP8A 1KC8W 3AEIA 4U7OA 4WFBV 5C93A 4PDMA 1YI2V 2CK3G 5LGTA 1F4MA 3ETGA 3ZRSA 3JD0A 4CZZA 4MW8A 3ZMUA 5EBWC 2DQ3A 2WLLA 3FB6C 3K0GA 4GX1A 5CBFA 3A0RA 5EBLC 2R9IA 3E83A 3F5WC 4TWKA 5L3CA 5L3BA 3BY6A 1R73A 3RW0A 5L3EA 2DWDC 2EIMC 2NNUA 3CCSV 2WLIB 3FB5C 4MS2A 4JTDB 1K97A 4P2ZA 3CCMV 3X2QB 1Q7YW 1RM1B 2JIZG 3ABKC 2GHYA 5CBGA 3SPGA 3LDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QR8 A;  2EZO A;  1QR9 A;  2LP7 A;  2P6J A;  2MK3 A;  3H01 A;  4N21 A;  4N23 A;  1MG1 A;  3B77 A;  5KA5 A;  2EBO A;  1MOF A;  1K33 A;  3B8N A;  3GWO A;  3K9A A;  4FJC C;  5CMU A;  1Y66 A;  2OT5 A;  4E2L A;  1DF5 A;  1I5Y A;  4JGS A;  4JPR A;  1QCE A;  2M7W A;  2EZP A;  1JQ0 A;  1Y4M A;  3CYO A;  3B8M A;  5HFL A;  3P30 A;  4JF3 A;  1ENV A;  2X7R B;  4FIP C;  5H9C A;  1JPX A;  1I5X A;  3M99 B;  3WFV A;  5HFM A;  1DLB A;  5CN0 A;  4G2K A;  1QBZ A;  3CP1 A;  1F23 A;  5KA6 A;  1DF4 A;  1EBO A;  1K34 A;  3MHH C;  4FK5 C;  3MHS C;  1SZT A; 
#chains in the Genus database with same CATH topology
 5B1A C;  2E74 B;  3T1H O;  2Q9L A;  5CB4 B;  1W0K G;  1V55 C;  1SQF A;  5FNV A;  1MSD A;  1AI7 A;  1ZTE A;  2A0L A;  3VBB A;  2YXL A;  4LFC O;  2H94 A;  5H9C A;  3DTU B;  4G2K A;  4OPH A;  4MVR A;  3IC7 A;  1SA0 A;  4YIP A;  3M8A A;  1IBM B;  3IFX A;  3OD4 A;  5EK0 A;  1PM9 A;  3OE7 G;  2CH7 B;  2PI5 A;  2ITD C;  2AZ2 A;  1HWY A;  2ITC C;  3G80 A;  3P30 A;  3STZ C;  4DR4 O;  1KU9 A;  2BE3 A;  1TAE A;  4WFG A;  3CRC A;  3ZN1 A;  4JI2 B;  2P4K A;  1PNK A;  1K5Q A;  1M9N A;  4G27 B;  3JD4 A;  4GX5 A;  4X9Q A;  1KYO F;  5CB4 A;  2Y4U A;  2M6Y A;  2HEP A;  1RFY A;  2B5U A;  3JD1 A;  2EBO A;  2WLJ A;  4J7K A;  3RYF B;  1W0J G;  2YI9 A;  1IXM A;  4D6T H;  3RYC B;  2YIC A;  3D3I A;  4DRX B;  4EEQ A;  4RQF A;  3CMA V;  1K34 A;  3CCJ V;  3BAA A;  3M7M X;  1HNW O;  4NXN B;  4BWA A;  3K0D A;  1AI5 A;  3KZI Z;  2UXN A;  3CS5 A;  2XAH A;  4Z1V A;  4FM2 A;  4J41 A;  1S77 D;  2XAS A;  1TVK B;  2UXD O;  4CS4 A;  4WFF A;  1WA8 B;  3UT5 B;  1QBZ A;  1W59 A;  5KHJ A;  4U3F H;  4FZ1 A;  4LF8 O;  1L0L H;  4F6R B;  2JK5 C;  4B3M B;  2P6J A;  3RYF A;  1S76 D;  2ZXW C;  4KXR A;  2WA3 A;  1EZV H;  2DYR B;  4FFB A;  3ZRW A;  1I7F A;  4QE7 A;  3R66 A;  1JX9 A;  1YCI A;  5EYP B;  2RJZ A;  4UB8 Z;  1Y76 B;  3RWR D;  3CXC U;  4HBN A;  2RNB A;  3ZRX A;  3WB2 A;  5A9G A;  3SYO A;  5EBM C;  2F1M A;  1LNQ A;  1B04 A;  4JZ2 A;  3E8F A;  3HKC B;  1BL8 A;  1TVK A;  1WA8 A;  4FIP C;  3P3N A;  3UT5 A;  4DV2 B;  5B3S B;  5DED A;  4DV0 O;  2XOK G;  3ASN C;  4F6R A;  1L1F A;  4NXM O;  2JJ1 G;  2EIN B;  2XND G;  2V7Q G;  3CRR A;  1L0N H;  4IGG A;  1OCZ C;  5LHI A;  4RUF A;  1O9H A;  3DC6 A;  2XAG A;  2E76 B;  4J9Y B;  1NH2 B;  4LF5 O;  5EYP A;  4JYA O;  2CGN A;  1JQ0 A;  1FS0 G;  1Z5W A;  4WBN B;  1M57 C;  2YXY A;  3PN1 A;  3HKD B;  3OGI B;  4LH6 A;  1I0H A;  4DR1 O;  1E1Q G;  4XDJ A;  4PA3 A;  4QJF B;  1UPG A;  2OIG A;  1RPR A;  3ASO C;  4NKG B;  4JI6 O;  1GH6 A;  2XUM A;  3U11 A;  1FAF A;  3K58 A;  4GLX A;  3HKC A;  2UXC O;  2QWO B;  5EZY A;  4EFB A;  1XMO O;  2IM9 A;  5IJ0 B;  2LGW A;  4XDL A;  1KEC A;  2ZR3 A;  3K59 A;  4L8J A;  4FLU A;  3H01 A;  1Q5O A;  1MG1 A;  2E3C A;  3W7T A;  5EIB C;  3ZHT A;  2ZM6 O;  1HP8 A;  2Q7H A;  4DR6 B;  4WBN A;  1VQN V;  3LSQ A;  4W4L A;  1QVF U;  3CYO A;  5HFL A;  1FXK B;  2Z0A A;  3D36 A;  4LFB B;  1ROP A;  3A0H Z;  3I5D A;  2DYS C;  3K79 A;  4B7K A;  3D8C A;  1WJZ A;  1IBL B;  1N36 O;  3SPC A;  5IDJ A;  4WFH A;  4PDV A;  2VQE O;  4AIL C;  1Q81 W;  1MOF A;  2GTS A;  4B3R O;  2DWE C;  2RMK B;  1Q43 A;  2DE0 X;  4R7C A;  3CRQ A;  3F5T A;  3WB1 A;  2QR4 A;  4LF4 B;  4J11 A;  4UCR A;  4DR3 O;  1QLE B;  3BVO A;  3TET A;  1OCR C;  5KHG A;  4C7U A;  2E5L O;  2IH1 C;  2UUA B;  4YY3 O;  1ORQ C;  3JAR B;  2F66 C;  2A06 H;  2YS8 A;  1KD1 W;  4RWU A;  4CS3 A;  3H1H H;  3OW2 U;  2VS0 A;  1FXK A;  4JPR A;  1QLN A;  3BA9 A;  1XNR O;  1S5J A;  1GMG A;  2P4V A;  4QPJ A;  3GVM A;  1OCC B;  3B40 A;  4K0K B;  3EVK A;  3TK1 A;  3LSS A;  1K7D A;  1CXZ B;  4UXN A;  3G71 V;  4LBE C;  3I55 V;  1QR8 A;  3BAB A;  1ZSP A;  3C3S A;  1B6Q A;  3SJC C;  5JJJ B;  4K35 A;  4DV4 B;  2Y48 A;  2YDE A;  3I56 V;  2CUG A;  4KUM A;  1MMM A;  1XHZ A;  4NTX A;  2WLN A;  3OGC C;  3H1K H;  1H2L A;  4LFC B;  3CCE V;  2CTQ A;  4PA6 A;  3ZX6 A;  1J95 A;  2UXX A;  3HKE B;  1QVG U;  3N2G B;  2O57 A;  4UCS A;  3J80 N;  1Q90 D;  1VEW A;  1M93 A;  5KUK A;  5KA6 A;  3SJB C;  2BOC C;  4X20 B;  4DR4 B;  1B06 A;  4PHZ A;  2ILM A;  4DK0 A;  1M90 W;  3AG3 B;  3KKY A;  5EC1 C;  1HR0 O;  5KA5 A;  3T4Z A;  1RM1 C;  2R70 A;  3ZHQ A;  4KHP O;  2L6L A;  4MVZ A;  1XBL A;  1EN6 A;  2JRI A;  4DXW A;  2M7W A;  1D5A A;  1NS1 A;  1Y67 A;  3E2E A;  4B3T O;  2YC0 A;  4DUY O;  1OV9 A;  2PYJ A;  5FL7 G;  1MNG A;  4JAA A;  4U7N A;  5IYB O;  1Q82 W;  3HKE A;  3N2G A;  4JAU A;  3QO5 A;  3K08 A;  5B1B B;  5CMU A;  3CB2 A;  4R8C A;  4O4J B;  1HNW B;  1H2N A;  4UV9 A;  5AG2 A;  1CPY A;  2HHH O;  2EX3 A;  4X20 A;  3THO A;  4U7O A;  5JQG A;  2CK3 G;  4YJ2 B;  1AR5 A;  2UXD B;  4CS2 A;  4TQD A;  3K9S A;  4O4L B;  5LP6 B;  2DQ3 A;  2ZE6 A;  4LF8 B;  3DSQ A;  3TXS A;  3A0R A;  5L3B A;  1WB7 A;  3E83 A;  2NNU A;  3CCS V;  4MS2 A;  2BCC H;  2F95 B;  4ZKI A;  4MVS A;  1KB9 F;  4O4J A;  3OEE G;  4HYO A;  1G8M A;  3IJ4 A;  4I4T B;  3ML0 A;  4PDL A;  1WLE A;  1JOY A;  5ITZ B;  2ZIM A;  1DLB A;  3SR2 C;  1Q6U A;  3BA8 A;  3BFR A;  4K3A A;  1AJP A;  1NT2 B;  3ETD A;  3A0B Z;  5DM6 V;  4O4L A;  4PDR A;  3U10 A;  3RN4 A;  4DV0 B;  2K1E A;  1XHX A;  1R3J C;  4NXM B;  2K9P A;  1Y4M A;  1D2D A;  1GAX A;  2DYR C;  4X1K B;  3WFV A;  3CCL V;  4LF5 B;  4JYA B;  1S5L Z;  4NYK A;  2PI4 A;  2AGA A;  5LGN A;  1R3K C;  2A9H A;  3MHH C;  1KQS U;  2AW9 A;  4HNA B;  4DR1 B;  1SQG A;  2LW1 A;  1H8H G;  5JH7 B;  3KCX A;  4I4T A;  1R3I C;  1O9G A;  2YUA A;  3FYI B;  2CTR A;  2EIM B;  3K5L A;  1EZJ A;  2IJH A;  5ITZ A;  1AVM A;  3CC4 V;  4JI6 B;  1AI6 A;  3K5M A;  1W2B U;  2UXC B;  3QVN A;  5F2V O;  3OUF A;  1XMO B;  1VF5 B;  3E8G A;  2QWQ B;  1YIJ V;  1KKD A;  4LF4 O;  4NVP A;  3BEH A;  4MTF A;  4J9Z B;  3VQV A;  4GX2 A;  3AK2 A;  2EIN C;  2VQF O;  4X8A A;  3CJH B;  2AHZ A;  1FFX B;  4GCZ A;  3VQW A;  5A2Q N;  4DUZ O;  1GN3 A;  2AXT Z;  2CTW A;  3ZMT A;  1H38 A;  1VP7 A;  2EZO A;  2OIE A;  2Q69 A;  5JH7 A;  4N21 A;  3L70 H;  1M1K W;  3OMI B;  4JTC B;  1M56 B;  1YVW A;  1N36 B;  2VQE B;  2ZKO A;  4PA4 A;  2Z5U A;  3ICX A;  3EHB B;  2PTM A;  4B3R B;  4D7T A;  3F7Y C;  3ABM B;  2F23 A;  1I08 A;  2E5L B;  3EFF K;  2V4D A;  1AJN A;  4YY3 B;  1AR1 B;  2GUZ A;  2Q73 A;  4X1I A;  3CJH A;  1FFX A;  3B8M A;  2EJ7 A;  2YEV A;  4JF3 A;  1X4T A;  1NKD A;  1PV0 A;  1XNR B;  1FXK C;  4GKJ O;  3ZJZ A;  5KHK A;  3JSN A;  5C8Y B;  3ABL B;  5E79 Z;  1NU1 H;  5IY5 B;  1Y66 A;  4J7Z A;  1DF5 A;  1BS3 A;  1URF A;  2HJD A;  5J2U B;  3CWB H;  1BCC H;  2FYU H;  2Y4T A;  4DV3 O;  3RGB A;  1NR1 A;  4G28 B;  2P7T C;  1QLE C;  3OR7 C;  1XEQ A;  4K8Z A;  4X89 A;  4B3S B;  1VQP V;  4YIO A;  4DV6 O;  2YID A;  1SZX A;  1EM1 A;  4TV9 B;  2WLH A;  1QNM A;  1SET A;  4CH3 A;  4RAI A;  4AQY O;  2RQ6 A;  1I94 O;  2UXB O;  4R6Z A;  4FFB B;  3ZRW B;  3QO7 A;  1MZF A;  1OJH A;  1ZWI C;  4MVQ A;  4JAS A;  3OEH G;  4OX9 O;  1SQV H;  4K8X A;  1BMF G;  5C8Y A;  5B1N A;  4J80 A;  3N2K B;  5EC2 C;  1SQX H;  1OCC C;  2Y0I A;  3QO8 A;  1V9P A;  2JS5 A;  2IBZ H;  2PUS A;  4JI0 O;  4DYL A;  4B7E A;  3GWO A;  5J2U A;  3CEI A;  2HKO A;  1I5Y A;  3JAM N;  2Y0P A;  1K9M W;  2Z3Y A;  5D5P A;  1HR0 B;  5K1X A;  3N27 A;  2QTO A;  1PNM A;  3RFR A;  4KHP B;  2HR3 A;  2FL4 A;  1CP9 A;  5BXZ A;  2EIJ B;  5LGU A;  3AG1 B;  1PP9 H;  5HFM A;  4TV9 A;  4DR2 O;  4B3T B;  3AG4 B;  4MTO A;  2CAZ C;  3QTC A;  2X0L A;  4DUY B;  4TSF G;  1T5E A;  1V54 B;  5L3G A;  1PL0 A;  2LO1 A;  3K3W A;  1GM8 A;  1P49 A;  2HLD G;  3GWK C;  2RCV A;  4YHH O;  2Q5Z A;  5LBQ A;  4JYB A;  4UCV A;  3N2K A;  2GBO A;  2PZS A;  2DMX A;  3VOU A;  3MHS C;  3LSU A;  2HHH B;  2LGQ A;  2QKS A;  4IHJ B;  3FFQ A;  1WPB A;  1K33 A;  4PA9 A;  4DR5 O;  3AG3 C;  1QQC A;  2KG7 B;  5KUM A;  3SJQ C;  5EZY B;  1OZ0 A;  4LR3 A;  5CBH A;  4TUY B;  1YJ9 V;  2IH3 C;  3BHP A;  3ZN0 A;  1S5H C;  1JA8 A;  2FB5 A;  5JCO C;  2IW5 A;  3K04 A;  3T4D A;  4RQE A;  4CH4 A;  4GX0 A;  1ZAU A;  4WCE V;  2EIL B;  1VQO V;  5B1B C;  3D3Q A;  4JZG A;  2OCC B;  2GTA A;  4PI0 A;  1S3J A;  3LNN A;  1R6N A;  1K5S A;  3PJS K;  4OXS A;  4IHJ A;  3AG7 A;  5D5Q A;  2WLM A;  1RSO B;  1Y74 B;  1FFT B;  4LNU B;  5K1P A;  2KG7 A;  2V1D A;  3WG7 B;  5LP6 C;  2X7R B;  3ZHR A;  4ZHQ A;  1JFF B;  4TUY A;  1WB8 A;  2X6C A;  4PA7 A;  3CHX A;  3E8B A;  2ETN A;  1Z5V A;  2EIK B;  1M4U A;  3Q4H B;  4LFA O;  1GN2 A;  2P22 C;  4ZI7 B;  1AJQ A;  1K4C C;  3AG2 B;  4CC6 A;  4ZOL B;  2N05 A;  2RN9 A;  3S3W A;  2FTK A;  4QPK A;  2ZD9 A;  3W7S A;  4FVM A;  1VF6 A;  4MVM A;  2JDI G;  1NTZ H;  3GB7 C;  3JYC A;  1S0V A;  1K4D C;  3APO A;  2CDY A;  1RSO A;  1Y74 A;  2LFS A;  4LNU A;  2QTS A;  2XAJ A;  5BY1 A;  1VMG A;  3K9A A;  5JVD B;  2JVD A;  4OPA A;  1COW G;  1JFF A;  1R6K A;  1TUE B;  3FKS G;  5L3D A;  1GKF A;  4JI8 O;  2JS3 A;  3HB3 B;  4H44 B;  4LP8 A;  2VQF B;  1AR4 A;  4WFB V;  5C93 A;  4PDM A;  1YI2 V;  3Q4H A;  5LGT A;  1F4M A;  4ABM A;  3UO3 A;  4YJ3 B;  1BSM A;  3JCU Z;  4DUZ B;  4ZI7 A;  4MW8 A;  3ZMU A;  2FML A;  1M5I A;  1YEW A;  4ZOL A;  3K0G A;  3L9D A;  4IYH A;  2R9I A;  5L3C A;  1WP7 A;  4O2A A;  1WP8 A;  2EIM C;  4LF9 O;  4O2B B;  3FB5 C;  1YDX A;  3L73 H;  2JIZ G;  1IZ3 A;  1AP6 A;  1BZK A;  1XOU A;  2QJ1 A;  4ZBM A;  5JVD A;  5BZB A;  1VQ6 V;  2NLJ C;  1N33 O;  1NI8 A;  4NTW A;  2QEX V;  4B3S O;  4CH6 A;  2ZR2 A;  1ZX3 A;  4YJ3 A;  3CCU V;  4O4H A;  3JD3 A;  4Z1M G;  3STL C;  3RVY A;  4GKJ B;  2ARH A;  3UM7 A;  2LFR A;  2Q7E A;  2HVJ C;  4JTA B;  4FMT A;  4O2B A;  1HNX O;  1BQZ A;  1BHB A;  4GUN A;  4MT8 A;  3SDL A;  3LDD A;  2ZT9 B;  3RBZ A;  2DN9 A;  4OGQ B;  2RDC A;  2ATK C;  1BHA A;  1BE3 H;  4DV3 B;  5JQG B;  1ZLZ A;  1K8A W;  3ABM C;  5BR8 B;  4A5U B;  2OT5 A;  4P9O A;  2WA4 A;  4PI2 A;  4DV6 B;  2YIA A;  3OTO O;  3LNM B;  2VWJ A;  5IT9 N;  4AQY B;  2UUB O;  4LWS A;  5B1O A;  5KHI A;  1I94 B;  2UXB B;  1KP2 A;  5KX5 B;  1LUW A;  2Q8V A;  4OX9 B;  2QWN B;  2ZQM A;  2ZDI A;  4FM1 A;  2UUC O;  4BAY A;  4GYC B;  3ABL C;  4MVU A;  3ZIA G;  2P06 A;  5IY5 C;  5LHH A;  4JI0 B;  1XI1 A;  4JAV A;  4MVO A;  1F51 A;  2DJV A;  1MAB G;  1G6U A;  3E8H A;  1X59 A;  4X62 O;  1M57 B;  3H1J H;  4J42 A;  4I9W A;  2ZNI A;  1P7G A;  1KP3 A;  4DR2 B;  3OT7 A;  2JGU A;  4LF6 O;  2HG5 C;  4H33 A;  1IBK O;  4UVB A;  1N4C A;  3BCC H;  4TV8 B;  5KX5 A;  2N74 A;  1N34 O;  5KAI Z;  1Y6X A;  1ZL8 B;  2OYQ A;  2PYL A;  2VWK A;  3RVZ A;  2UU9 O;  5BMV B;  4YHH B;  5IJ9 A;  5LXT B;  3L72 H;  1BQ0 A;  2QM7 A;  5J2T A;  4UFZ A;  1HDJ A;  5GTI Z;  3ZHU A;  3O65 A;  1G4Y B;  4D7S A;  4Q20 A;  1YTF B;  3FB7 C;  2A79 B;  3K5N A;  4DR5 B;  2W0X A;  1LR1 A;  4PV1 B;  2E75 B;  3JAL B;  2B1G A;  2WAM A;  1LUV A;  2JEU A;  2KB1 A;  1Q8I A;  2Q0O C;  4DV5 B;  3DGE A;  1WPX A;  4ASU G;  2WWW A;  2OTJ V;  3T1Y O;  2ZIN A;  1VQ4 V;  2IJJ A;  4TV8 A;  1MA1 A;  2ADQ B;  2KSD A;  1YIT V;  4FFK A;  1ZL8 A;  1OCO B;  1VQK V;  5JJE B;  5BMV A;  3SGI A;  1VQ8 V;  4MSW C;  5LXT A;  4FM0 A;  4P9P A;  4ICG A;  1OCR B;  1SF9 A;  1NQT A;  2AHY A;  3CRA A;  1J5E O;  2Q7G A;  4DV7 O;  1DTO A;  3JAL A;  1MZE A;  2HFE C;  4TOI A;  2P5O A;  4JI4 O;  2JEX A;  3QG5 A;  5B3S C;  1QR9 A;  1H2G A;  1PL4 A;  2F4V B;  1YF2 A;  4KP4 A;  5J9P C;  5LMU B;  2QM8 A;  3DXR B;  4DK1 A;  4LFA B;  2P90 A;  1FD9 A;  2XHB A;  2GUZ B;  2Q68 A;  4X1I B;  1B3Q A;  4CH5 A;  2YEV B;  3OAA G;  2XAQ A;  4FLX A;  4UCT A;  2QKA A;  4O4I B;  3HKB B;  4QNH B;  4JI5 O;  1EBO A;  2W6J G;  4DO2 A;  1XDC A;  3D36 C;  3ETE A;  2KQX A;  3A8T A;  4IYI A;  4BR6 A;  2QA4 V;  4Z2W A;  4X65 B;  1ZUQ A;  1KBH A;  2R9A A;  1YTF D;  4CBC A;  3ZBH A;  2QGN A;  4B08 A;  4JV5 O;  4MW3 A;  5EIB D;  4W4K A;  1F23 A;  3WG7 C;  3W7W A;  2ZNJ A;  4LC1 A;  4JI8 B;  5LOV B;  1H2S B;  4WFE A;  3WU2 Z;  4GKK B;  1OHH G;  3B8N A;  3DXR A;  5CA3 A;  2QM4 A;  2Q67 A;  3G6E V;  2EIK C;  3F7V C;  4FZ0 A;  5IYZ B;  3JAK B;  4BW5 A;  2XTA A;  3SPJ A;  3A2F A;  2XT9 A;  2F93 B;  2GDS A;  2QSA A;  3HKB A;  4O4I A;  5FPR A;  1FXH A;  3AG2 C;  4KFM A;  3CP1 A;  3KCY A;  1BT8 A;  3RYH B;  1P4R A;  3HR0 A;  1NZ6 A;  1VQ7 V;  4R50 A;  3T1C A;  4LF9 B;  3JD2 A;  2HP8 A;  3ZMS A;  3ZS8 C;  1MSW D;  2X6B A;  2DOS A;  5FPO A;  3CXH F;  3L71 H;  3G4S V;  1PD3 A;  1N33 B;  1THZ A;  4X66 O;  5BR8 O;  5LOV A;  3K06 A;  5DN6 G;  2NR5 A;  2R9R B;  3B4S A;  2IJI A;  5IYZ A;  5LL6 Y;  5FLX N;  3JAK A;  5IWA O;  3ZHS A;  1EFR G;  3SYQ A;  1XMQ B;  3B2E E;  1UJW B;  1YXB A;  1NVP D;  1WAZ A;  1U97 A;  1NTK H;  4WFA V;  1K3E A;  3RYH A;  5B5E Z;  1VAR A;  1SQP H;  5IE9 A;  3RT3 C;  4UCU A;  1P84 F;  1HNX B;  4UUJ C;  2R72 A;  1VIB A;  3UKM A;  4EB6 B;  5TIS Z;  3W7U A;  4EKW A;  4FJC C;  1JJO A;  5LMN O;  2Y69 B;  4E4E A;  2WLK A;  3CPW U;  1FJG O;  3TCU A;  2C2A A;  3ZED A;  4X64 O;  2X6A A;  3E22 B;  3ABU A;  4EFE A;  1XQ8 A;  1GM7 A;  2PGG A;  2OTL V;  3OTO B;  5KLV H;  2CH7 A;  5IYD O;  2UUB B;  2QKC A;  3C3T A;  5CA1 B;  5JWP A;  3OR6 C;  3P3P A;  2F43 G;  1TUB B;  3ZMV A;  2ZDI C;  3L74 H;  1E79 G;  2UUC B;  2ZE8 A;  3E35 A;  4LF7 O;  1KC8 W;  3U0Z A;  2JGD B;  4JI7 O;  2MW2 B;  4EB6 A;  4PD4 F;  4JI3 O;  5CA0 B;  1N32 O;  2QWR B;  4U3J B;  4X62 B;  3RYC A;  2A7W A;  1G1X B;  4GX1 A;  5CBF A;  4TWK A;  1VF7 A;  3UCS C;  4DRX A;  5L3E A;  2DWD C;  3E22 A;  1SQB H;  2WLI B;  1HNZ O;  4ZHQ B;  4P2Z A;  3CCM V;  1SC5 B;  3X2Q B;  4DV5 O;  1Q7Y W;  3CRM A;  4KL1 A;  4BW9 A;  4LF6 B;  3UO2 A;  3SPG A;  1IBK B;  5CA1 A;  4UCO A;  3BPZ A;  2L35 A;  1PKX A;  3MD0 A;  4I0X B;  1SKV A;  1TUB A;  1N34 B;  1IVS A;  1XUQ A;  4TQF A;  1XNQ O;  2UU9 B;  1GN6 A;  4XDK A;  3E89 A;  2LJ2 A;  1NBM G;  2XAF A;  2YXH A;  2EJR A;  2JGD A;  5LYJ B;  4JI1 O;  1SZT A;  5CA0 A;  2PF4 E;  3FAV B;  4F4L A;  1CEZ A;  4U3J A;  1FPO A;  2IJK A;  1JJ2 U;  1FXV A;  2JJ2 G;  1DGS A;  1WNS A;  4FPP A;  1Y76 A;  3SYC A;  4J10 A;  2D2C B;  2WLI A;  5L3F A;  2IU0 A;  3T1Y B;  2BTQ B;  2D3O W;  2F4V O;  5LMU O;  4IIJ B;  5DEC A;  4I0X A;  3W7X A;  4LH7 A;  1IUR A;  1GM9 A;  4DV1 O;  3OFN G;  1WN7 A;  3IC9 A;  1D5N A;  4GZR B;  3ABK B;  4WF9 V;  5B1A B;  1YSC A;  3RYI B;  5LYJ A;  1VQ5 V;  4O2A B;  2P67 A;  1RP3 B;  1SS3 A;  2EUL A;  3SPH A;  1J5E B;  1V55 B;  3FAV A;  3QNE A;  1SRY A;  4DV7 B;  4X65 O;  1XL4 A;  5KMG B;  1H8E G;  4J7J A;  2AZ0 A;  1GO3 F;  5H6R A;  1KMI Z;  3HKD A;  1FKA O;  5KHH A;  1VQM V;  4JI4 B;  4DR7 O;  3FB8 C;  1SER A;  1QCE A;  3CSX A;  2EZP A;  5E1A C;  1FYJ A;  1A32 A;  4HZ3 A;  3CC7 V;  2BTQ A;  2Q6A A;  4IL6 Z;  3JAT B;  2A3Q A;  4IIJ A;  4GKK O;  3DC5 A;  4XBF A;  4LCU C;  2ADP A;  4N23 A;  4NR1 A;  1OCO C;  2PY5 A;  4O4H B;  1Q6H A;  5GW7 A;  4JI5 B;  3LDE A;  3OUS A;  5IJ0 A;  4ZIB A;  4QIW F;  2NN4 A;  1R6T A;  3M99 B;  3RYI A;  1RPO A;  2W0F C;  5LA6 B;  1HW7 A;  4JV5 B;  2QWP B;  1YJW V;  3JCZ A;  5KMG A;  4P30 A;  5JJN B;  1NH2 D;  3FD9 A;  4L87 A;  3BRC A;  3NR7 A;  1E1R G;  4JGS A;  3P32 A;  2H3O A;  1N8R W;  1ENV A;  3CME V;  1IBM O;  3C90 A;  3J81 N;  3JAT A;  4RUE A;  1DF4 A;  3SYP A;  4LWS B;  3JAS B;  2CTP A;  1SQQ H;  4I7Z B;  3CCQ V;  1H2M A;  1XMQ O;  1XIL A;  1AI4 A;  4QE9 A;  2WSS G;  4FLW A;  4JI2 O;  1R3L C;  3EXA A;  3T1H B;  3SJA C;  3CC2 V;  4I5S A;  3K03 A;  3L75 H;  3IAY A;  1M56 C;  1JVM A;  5LA6 A;  3JAR A;  5KAF Z;  2ZXW B;  1GK9 A;  3HPL C;  1R1B A;  2B9Z A;  4JYC A;  4FLV A;  2VRZ A;  4MTG A;  3B77 A;  4X66 B;  4JYY A;  4BIO A;  3AK1 A;  3QF7 A;  5H5N A;  2IU3 A;  1BGY H;  2ZIO A;  4UVC A;  2WPD G;  1DK1 A;  3ETQ A;  1N0N A;  4PJ0 Z;  1KKC A;  2HJF C;  1IXB A;  3OM3 B;  3TJT A;  1U96 A;  3JSL A;  3IGA C;  5IWA B;  2B1I A;  4NXN O;  3JAS A;  1YZB A;  3CX5 F;  4FK5 C;  3CD6 V;  2BTO A;  2MK3 A;  3CCR V;  3KG2 A;  1F7Y A;  4RO2 A;  5IJ9 B;  4I9Q A;  5J2T B;  3R65 A;  1NR7 A;  3ASN B;  4HAM A;  1JPX A;  2N04 A;  3ZCC A;  4AHC A;  4B3M O;  1N0J A;  5CN0 A;  1KUQ A;  2QE7 G;  1OCZ B;  5LMN B;  1YHQ V;  4CC5 A;  1UFI A;  4X88 A;  3S3X A;  3TXQ A;  1FJG B;  2LQT A;  5GTH Z;  4X64 B;  4QGP A;  3K5O A;  1GRJ A;  1P7B A;  2H8P C;  5GON B;  1NJI W;  1JR9 A;  2DQ0 A;  5LHG A;  3AK3 A;  1AB3 A;  3LUT B;  3MDS A;  3ASO B;  3J7A U;  1XL6 A;  3H1L H;  4UVA A;  4UB6 Z;  3UQ8 A;  1VQ9 V;  2BOB C;  1AIL A;  4DW0 A;  2G38 A;  4LF7 B;  4DV2 O;  4YXW G;  4JI7 B;  4DW1 A;  1K73 W;  4X1Y B;  4JI3 B;  3ZMZ A;  1ARO P;  1Q86 W;  1I5X A;  1Z2G A;  2HVK C;  1N32 B;  5JCO A;  1Q3E A;  4H37 A;  1IX9 A;  2Y69 C;  2Q4P A;  2GV9 A;  1TGO A;  4UV8 A;  2LP7 A;  2KKW A;  3O9O A;  3VQX A;  1HNZ B;  5GON A;  2EIJ C;  3AG1 C;  4H13 B;  2DYS B;  2Q0A A;  5H2F Z;  1QHT A;  1VQL V;  3AG4 C;  4AI8 A;  4Q6G A;  2CE4 A;  4GT1 A;  1V54 C;  4YJ2 A;  1XNQ B;  2CGO A;  3WB0 A;  3SPI A;  1PPJ H;  3FYE B;  3T2M A;  3E86 A;  5LP6 A;  1K92 A;  2LW7 A;  1QU7 A;  4I55 B;  2QDO A;  3APQ A;  2ZCE A;  4JI1 B;  4E2L A;  1US6 A;  4X1Y A;  1S72 V;  4MTX A;  2GSM B;  1TA8 A;  2BSK B;  2OWO A;  5H6Q A;  3ABT A;  3CCV V;  1IDS A;  1SES A;  3JAW B;  1JCH A;  2YI8 A;  4DR6 O;  1F4N A;  1GN4 A;  2DW4 A;  1Q6I A;  4TT3 G;  1EN5 A;  3X2Q C;  3OMA B;  4LFB O;  4PEL A;  4BIU A;  1H2K A;  4H0L B;  4IT5 A;  2WLL B;  4I50 B;  2W6I G;  3OMN B;  1NTM H;  1IBL O;  4F6E A;  2YSU B;  2ZE5 A;  1YJN V;  2YIB A;  4DV1 B;  1NVP B;  3ZRV A;  2EIL C;  4FLT A;  4FLY A;  5IYC O;  2OCC C;  4I55 A;  3G67 A;  3NXS A;  3SYA A;  1GTO A;  3TGU H;  2UUA O;  4X1K A;  1VF6 C;  2BSK A;  4BIZ A;  2ZM6 B;  4FLZ A;  5FNV B;  2FKX A;  1PNL A;  1EN4 A;  3H9V A;  4DR7 B;  3H1I H;  3JAW A;  3VQY A;  3AEI A;  3G6B A;  4HNA A;  1AP5 A;  3ETG A;  3ZRS A;  3JD0 A;  1SA0 B;  1JMK C;  4NB5 A;  4CZZ A;  3OTF A;  5EBW C;  2OCH A;  2WLL A;  3K57 A;  4I50 A;  3FB6 C;  4K0K O;  5EBL C;  1XRE A;  3F5W C;  3MAQ A;  3BY6 A;  1R73 A;  3CE2 A;  3FX7 A;  3RW0 A;  3ZHV A;  2ZE7 A;  2YIB D;  4JTD B;  3B09 A;  1K97 A;  5B66 Z;  4DR3 B;  1RM1 B;  3ABK C;  2GHY A;  4NTY A;  5CBG A;  2ODM A;  4DV4 O;  1L8D A;  3LDC A; 
#chains in the Genus database with same CATH homology
 5B1A C;  4ZKI A;  4MVS A;  4ZBM A;  1PKX A;  3MD0 A;  5BZB A;  1W0K G;  1VQ6 V;  1V55 C;  2NLJ C;  3OEE G;  4HYO A;  1G8M A;  4XDK A;  3E89 A;  1AI7 A;  2A0L A;  1NBM G;  3VBB A;  3ML0 A;  4PDL A;  2H94 A;  5H9C A;  1WLE A;  1JOY A;  2QEX V;  2XAF A;  1DLB A;  2EJR A;  3DTU B;  4G2K A;  4MVR A;  3IC7 A;  1AJP A;  2ZR2 A;  3CCU V;  1SZT A;  3ETD A;  3IFX A;  3JD3 A;  5EK0 A;  5DM6 V;  1CEZ A;  4PDR A;  4F4L A;  3OE7 G;  4Z1M G;  3STL C;  3RVY A;  2K1E A;  1R3J C;  2IJK A;  2PI5 A;  1JJ2 U;  1FXV A;  2JJ2 G;  4FPP A;  2ITD C;  3UM7 A;  3SYC A;  1HWY A;  2LFR A;  1Y4M A;  2ITC C;  3P30 A;  3STZ C;  2DYR C;  3WFV A;  2HVJ C;  4JTA B;  4FMT A;  2WLI A;  4WFG A;  1BHB A;  3ZN1 A;  5L3F A;  2IU0 A;  3CCL V;  4MT8 A;  3LDD A;  3RBZ A;  1PNK A;  1K5Q A;  1M9N A;  2D3O W;  4G27 B;  2PI4 A;  2ATK C;  3JD4 A;  1BHA A;  5LGN A;  1R3K C;  2A9H A;  3MHH C;  4GX5 A;  1KQS U;  2B5U A;  3ABM C;  1K8A W;  3JD1 A;  3W7X A;  2EBO A;  1H8H G;  2WLJ A;  1R3I C;  1W0J G;  2OT5 A;  3FYI B;  1IXM A;  2EIM B;  4P9O A;  1GM9 A;  1EZJ A;  3OFN G;  2IJH A;  3CC4 V;  3LNM B;  3ABK B;  1AI6 A;  4WF9 V;  3D3I A;  5B1A B;  1W2B U;  1YSC A;  5B1O A;  1VQ5 V;  4RQF A;  2P67 A;  3OUF A;  3CMA V;  1KP2 A;  3E8G A;  1YIJ V;  1K34 A;  3SPH A;  1V55 B;  3QNE A;  1SRY A;  1KKD A;  3CCJ V;  2ZQM A;  2ZDI A;  3BEH A;  1XL4 A;  4MTF A;  1H8E G;  3K0D A;  1GO3 F;  4J9Z B;  1AI5 A;  5H6R A;  4BAY A;  2UXN A;  4GX2 A;  1VQM V;  3ABL C;  3FB8 C;  2EIN C;  2XAH A;  1SER A;  1QCE A;  5E1A C;  2EZP A;  4X8A A;  4MVU A;  3ZIA G;  5IY5 C;  5LHH A;  2AHZ A;  1S77 D;  4HZ3 A;  2XAS A;  4GCZ A;  3CC7 V;  4WFF A;  4JAV A;  2Q6A A;  1F51 A;  4MVO A;  1MAB G;  1QBZ A;  3ZMT A;  3E8H A;  1H38 A;  4XBF A;  4LCU C;  2JK5 C;  2EZO A;  2P6J A;  2Q69 A;  1M57 B;  4N21 A;  4N23 A;  1S76 D;  1OCO C;  2ZXW C;  1M1K W;  3OMI B;  2DYR B;  5GW7 A;  4I9W A;  1M56 B;  4JTC B;  3ZRW A;  3LDE A;  3OUS A;  1KP3 A;  4QE7 A;  4PA4 A;  2Z5U A;  1JX9 A;  3EHB B;  4QIW F;  3M99 B;  2HG5 C;  4H33 A;  3CXC U;  3ZRX A;  1RPO A;  4UVB A;  2W0F C;  3F7Y C;  3ABM B;  3RVZ A;  1YJW V;  3SYO A;  3EFF K;  5EBM C;  3JCZ A;  4P30 A;  1AJN A;  2QM7 A;  1LNQ A;  1NH2 D;  1AR1 B;  4L87 A;  1E1R G;  4JGS A;  3P32 A;  3E8F A;  1BL8 A;  3B8M A;  1N8R W;  2YEV A;  4JF3 A;  1ENV A;  4FIP C;  1G4Y B;  3CME V;  4Q20 A;  1NKD A;  5B3S B;  1YTF B;  3FB7 C;  2A79 B;  4RUE A;  1FXK C;  2XOK G;  3ASN C;  3ZJZ A;  1DF4 A;  3SYP A;  1L1F A;  2B1G A;  2JJ1 G;  2WAM A;  3ABL B;  2EIN B;  2JEU A;  2KB1 A;  2V7Q G;  2XND G;  3CCQ V;  1OCZ C;  1AI4 A;  4QE9 A;  3DGE A;  1WPX A;  2WSS G;  5IY5 B;  4ASU G;  1Y66 A;  5LHI A;  1R3L C;  4RUF A;  1DF5 A;  2WWW A;  2XAG A;  4J9Y B;  1NH2 B;  2OTJ V;  1JQ0 A;  1FS0 G;  1VQ4 V;  1M57 C;  3CC2 V;  4I5S A;  3K03 A;  2IJJ A;  1M56 C;  1YIT V;  1JVM A;  1NR1 A;  4G28 B;  2P7T C;  1E1Q G;  1QLE C;  1OCO B;  2ZXW B;  1VQK V;  1GK9 A;  4XDJ A;  3OR7 C;  3HPL C;  4PA3 A;  4MSW C;  1VQ8 V;  4QJF B;  4P9P A;  4X89 A;  1VQP V;  4JYC A;  1RPR A;  3ASO C;  4MTG A;  3B77 A;  1OCR B;  2WLH A;  1SET A;  1NQT A;  4RAI A;  2AHY A;  2IU3 A;  4UVC A;  2WPD G;  4R6Z A;  3ZRW B;  3QO7 A;  2HJF C;  1ZWI C;  3OM3 B;  4MVQ A;  4JAS A;  3OEH G;  4XDL A;  1KEC A;  3IGA C;  1DTO A;  2B1I A;  2HFE C;  1BMF G;  5B1N A;  5EC2 C;  4FK5 C;  2ZR3 A;  1OCC C;  3QO8 A;  2JEX A;  5B3S C;  1QR9 A;  3CD6 V;  2MK3 A;  3H01 A;  3CCR V;  1MG1 A;  3KG2 A;  1H2G A;  3W7T A;  4RO2 A;  3GWO A;  4KP4 A;  2HKO A;  5J9P C;  1VQN V;  1I5Y A;  2QM8 A;  3LSQ A;  1QVF U;  3CYO A;  2Z3Y A;  1K9M W;  5HFL A;  3R65 A;  1FXK B;  1NR7 A;  2P90 A;  3ASN B;  3D36 A;  4HAM A;  2Q68 A;  1JPX A;  1PNM A;  2QTO A;  2HR3 A;  1ROP A;  3ZCC A;  2DYS C;  2YEV B;  3OAA G;  2XAQ A;  3K79 A;  5CN0 A;  1CP9 A;  2QE7 G;  4QNH B;  1OCZ B;  2EIJ B;  5LGU A;  1EBO A;  2W6J G;  4DO2 A;  1YHQ V;  3AG1 B;  4X88 A;  3SPC A;  5IDJ A;  4WFH A;  4PDV A;  5HFM A;  3ETE A;  3AG4 B;  4MTO A;  1Q81 W;  2X0L A;  1MOF A;  1P7B A;  2H8P C;  2DWE C;  4TSF G;  2QA4 V;  4R7C A;  1V54 B;  1NJI W;  2DQ0 A;  5LHG A;  5L3G A;  1QLE B;  1PL0 A;  3TET A;  3K3W A;  1GM8 A;  1OCR C;  2HLD G;  1YTF D;  4CBC A;  3LUT B;  2IH1 C;  4MW3 A;  4JYB A;  5LBQ A;  3ASO B;  1ORQ C;  1F23 A;  1XL6 A;  3WG7 C;  4UVA A;  3W7W A;  1VQ9 V;  3VOU A;  4LC1 A;  1KD1 W;  3MHS C;  2BOB C;  2QKS A;  4WFE A;  3OW2 U;  1OHH G;  1K33 A;  3B8N A;  5CA3 A;  4PA9 A;  4YXW G;  2Q67 A;  3G6E V;  2EIK C;  3F7V C;  1FXK A;  4JPR A;  1QLN A;  3AG3 C;  1GMG A;  4BW5 A;  3SPJ A;  4QPJ A;  1K73 W;  3ZMZ A;  1ARO P;  5KUM A;  3SJQ C;  1Q86 W;  1I5X A;  2HVK C;  1OZ0 A;  1OCC B;  1FXH A;  3AG2 C;  4H37 A;  4KFM A;  3TK1 A;  3CP1 A;  5CBH A;  2Y69 C;  3LSS A;  1YJ9 V;  2IH3 C;  1P4R A;  1K7D A;  3G71 V;  4UXN A;  1VQ7 V;  4LBE C;  4R50 A;  3I55 V;  1QR8 A;  3T1C A;  4UV8 A;  2LP7 A;  3ZN0 A;  1S5H C;  1B6Q A;  2EIJ C;  2IW5 A;  3JD2 A;  3AG1 C;  3K04 A;  3T4D A;  2Y48 A;  4RQE A;  2DYS B;  3I56 V;  4GX0 A;  3ZMS A;  1VQL V;  3AG4 C;  4WCE V;  2EIL B;  4KUM A;  1VQO V;  5B1B C;  1MSW D;  2OCC B;  2X6B A;  4GT1 A;  1V54 C;  1S3J A;  2WLN A;  3G4S V;  1PD3 A;  3OGC C;  1THZ A;  3SPI A;  1R6N A;  1K5S A;  3PJS K;  4OXS A;  3K06 A;  3FYE B;  3T2M A;  3E86 A;  5DN6 G;  2R9R B;  3CCE V;  1K92 A;  4PA6 A;  1J95 A;  2WLM A;  2IJI A;  2UXX A;  1FFT B;  4E2L A;  1QVG U;  1S72 V;  4MTX A;  2V1D A;  1EFR G;  3SYQ A;  2GSM B;  3WG7 B;  2X7R B;  1UJW B;  5H6Q A;  1NVP D;  4WFA V;  1K3E A;  3ABT A;  2X6C A;  5KUK A;  5KA6 A;  3CCV V;  1SES A;  2BOC C;  4PA7 A;  1JCH A;  3E8B A;  1F4N A;  2DW4 A;  4UUJ C;  2EIK B;  1M90 W;  4TT3 G;  3AG3 B;  5EC1 C;  3X2Q C;  3OMA B;  5KA5 A;  3UKM A;  3T4Z A;  1RM1 C;  3W7U A;  4EKW A;  4PEL A;  4FJC C;  4BIU A;  4MVZ A;  1AJQ A;  4DXW A;  2M7W A;  2WLL B;  1K4C C;  3AG2 B;  2W6I G;  3OMN B;  2Y69 B;  2WLK A;  3CPW U;  2YSU B;  3E2E A;  3TCU A;  2C2A A;  1YJN V;  2FTK A;  2X6A A;  4QPK A;  1NVP B;  3ABU A;  3ZRV A;  2ZD9 A;  3W7S A;  1GM7 A;  2OTL V;  2EIL C;  5FL7 G;  4MVM A;  5IYC O;  2JDI G;  3GB7 C;  5IYD O;  3JYC A;  1S0V A;  1K4D C;  2OCC C;  4U7N A;  2LFS A;  5IYB O;  3NXS A;  1Q82 W;  2XAJ A;  4JAU A;  3QO5 A;  3K08 A;  5B1B B;  3K9A A;  3OR6 C;  5CMU A;  3SYA A;  2F43 G;  1GTO A;  3ZMV A;  4R8C A;  1COW G;  4BIZ A;  1R6K A;  1TUE B;  3FKS G;  2ZDI C;  4UV9 A;  1E79 G;  1PNL A;  1CPY A;  1GKF A;  5L3D A;  3E35 A;  3HB3 B;  4LP8 A;  1KC8 W;  3AEI A;  4U7O A;  4WFB V;  5C93 A;  4PDM A;  1YI2 V;  2CK3 G;  5LGT A;  1F4M A;  3ETG A;  3ZRS A;  3JD0 A;  4CZZ A;  4MW8 A;  3ZMU A;  5EBW C;  2DQ3 A;  2WLL A;  3FB6 C;  3K0G A;  4GX1 A;  5CBF A;  3A0R A;  5EBL C;  2R9I A;  3E83 A;  3F5W C;  4TWK A;  5L3C A;  5L3B A;  3BY6 A;  1R73 A;  3RW0 A;  5L3E A;  2DWD C;  2EIM C;  2NNU A;  3CCS V;  2WLI B;  3FB5 C;  4MS2 A;  4JTD B;  1K97 A;  4P2Z A;  3CCM V;  3X2Q B;  1Q7Y W;  1RM1 B;  2JIZ G;  3ABK C;  2GHY A;  5CBG A;  3SPG A;  3LDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...