1Y4MA

Crystal structure of human endogenous retrovirus herv-frd envelope protein (syncitin-2)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
NIDTMAKALTTMQEQIDSLAAVVLQNRRGLDMLTAAQGGICLALDEKCCFWVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords HERV-FRD_6p24.1 provirus ancestral Env polyprotein
publication title Crystal structure of a pivotal domain of human syncytin-2, a 40 million years old endogenous retrovirus fusogenic envelope gene captured by primates.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1y4mA00
1SZTA 4E2LA 3GWOA 1K34A 1I5YA 5HFMA 2X7RB 5H9CA 2LP7A 3B8MA 4FK5C 1I5XA 1ENVA 2M7WA 5CN0A 1QBZA 1Y4MA 2EBOA 3P30A 4FIPC 3B77A 1MG1A 3WFVA 4JGSA 4JF3A 2OT5A 4N21A 3MHHC 4G2KA 1QR8A 5KA6A 3CYOA 3K9AA 4N23A 3MHSC 2P6JA 1F23A 1QR9A 1MOFA 1Y66A 3M99B 4FJCC 5HFLA 5KA5A 2MK3A 5CMUA 1DF5A 1JPXA 1DF4A 3B8NA 2EZPA 1EBOA 2EZOA 1JQ0A 3CP1A 3H01A 4JPRA 1QCEA 1K33A 1DLBA
chains in the Genus database with same CATH superfamily
2NN4A 1OCCC 4J11A 2HLDG 3ABMB 1WJZA 1FFTB 2LGWA 1K34A 1YJ9V 2AGAA 2ZKOA 1N8RW 1OCCB 5K1PA 3EHBB 4HAMA 4DV7O 5KAIZ 5LMUB 1FS0G 5C8YA 4UCUA 3OMIB 1H8HG 1F23A 2A06H 3A0BZ 1N33B 4DW1A 4DR2B 3J7AU 1VQ8V 3GWOA 4D6TH 4F4LA 3RYCA 2JIZG 4BW9A 1I5XA 4GKJB 1YXBA 2ZDIC 4ZHQB 4Z1MG 3M8AA 2Q7HA 1B06A 1ZSPA 1U96A 3ZS8C 1H38A 2Y0PA 1R3KC 4J7KA 2XHBA 3BCCH 3E22A 4BW5A 4CC5A 2JEXA 1FKAO 1Q82W 1BT8A 3E8BA 4DV2B 1S5HC 2MW2B 2BTQB 3MHHC 1Y74A 4O4LB 3K79A 3SPJA 5JJEB 1KKCA 4H37A 4XBFA 4ZI7A 4I9QA 1B6QA 1FXHA 1NH2B 5IDJA 1SC5B 2PZSA 4J80A 5JWPA 1PPJH 3BA8A 5CA3A 3CMEV 1QVFU 5B3SC 1KYOF 3FKSG 2QWQB 2YDEA 3AK2A 1SS3A 2YC0A 3UQ8A 4HZ3A 1JR9A 2P6JA 1AI6A 4X88A 5L3CA 3CCRV 2B1IA 1FPOA 2EZOA 2IW5A 1BSMA 4WBNB 4I0XB 4WCEV 1RSOB 3ABKB 4PD4F 4UVCA 2GUZB 1JFFB 3JSLA 3OW2U 3CC2V 2XAQA 4FIPC 5LP6A 4DV5O 2PY5A 4I4TB 2DWDC 1BE3H 2QJ1A 1SERA 5K1XA 3FYIB 3LSQA 1PV0A 4DV4B 1HNXB 1NI8A 1LUVA 5EBWC 2ZIOA 5IJ9A 1Y76A 3ETDA 4BIUA 2A9HA 2Q6AA 2CTPA 1I94B 1AJPA 2ZE5A 2VQEO 3CXCU 4IT5A 4GLXA 3QNEA 2PI4A 5EZYA 3VOUA 3E86A 3UM7A 1E1RG 3JCZA 5E1AC 1GMGA 2EX3A 3K9AA 1TUBB 4DR7O 4UB8Z 3CX5F 4QIWF 3VQWA 3VQVA 4JTDB 3H01A 3B2EE 2F23A 4J7JA 1K4CC 2IJJA 1P7BA 2QWRB 4JTAB 2EIKB 2KG7A 1ZWIC 4IIJB 1IX9A 4JI1B 3E35A 2QA4V 2XUMA 2UXXA 4LP8A 3ZHQA 4X1KB 3OMAB 3TJTA 1R6TA 1ROPA 2DN9A 5EK0A 1D5NA 1T5EA 3TXQA 1SQBH 2QWNB 3SYOA 3I5DA 1D2DA 5EYPA 2RJZA 1ORQC 3FB8C 2DYSC 2YXLA 1OCOC 4YHHB 5JH7A 1IBLO 2WLLB 2VWKA 3B4SA 1XNQO 1AR1B 2RDCA 1S76D 4DR3O 2FYUH 2YUAA 3CRCA 1NR1A 3KKYA 1XI1A 1K8AW 4DV7B 1HNWO 4O4JA 1YSCA 1AI7A 3SDLA 2WLMA 2PI5A 5ITZB 1MZFA 4CS3A 3QO7A 4JI3O 1AB3A 1ZTEA 2YIBA 4DV3O 4MTFA 2JGDB 5LHIA 2GSMB 5LHHA 1YJWV 4DUYO 4W4KA 1KKDA 4AQYO 4O4HB 2WAMA 3HKDA 1H2NA 3OR6C 4QGPA 1H8EG 4IYIA 1R3LC 5HFMA 5FNVB 3W7TA 4X1IA 5EC2C 1WA8A 3O9OA 2QKCA 2EINB 4IHJB 1VQLV 5IT9N 2Z5UA 1PL4A 3G80A 3JAKA 1LNQA 2XNDG 5CBFA 4FVMA 4I50A 1AI4A 4NYKA 3L9DA 2HFEC 2WSSG 4XDLA 4RUFA 1G1XB 3RYIB 5CA1B 4I7ZB 1F51A 2Z0AA 3SJQC 2KB1A 4ABMA 1J5EB 4MVMA 4PA3A 3RBZA 4ASUG 3ASNC 3ZRWB 5LMNO 2F43G 4I55A 5H2FZ 4OPHA 4GYCB 5LOVA 2WLHA 3JD4A 4YIOA 4MTGA 2L6LA 2UXDO 5TISZ 3N2KA 5FPRA 4X64O 1MA1A 1NS1A 1SA0A 4RO2A 4FZ0A 4LF5B 1Z5WA 1K73W 2M6YA 2VS0A 2YI8A 1VQPV 1QNMA 3IFXA 3WB2A 2E5LO 3OEHG 1AILA 1YHQV 2QGNA 3TXSA 1ZL8B 3DXRA 2CAZC 2LW1A 5C8YB 5KUMA 1QU7A 3T4ZA 4PA7A 4JI7O 4UCSA 2OTLV 3DC5A 1NR7A 1GKFA 4GX5A 1AROP 4DR6O 4DV0O 5IJ0B 4ZBMA 3PN1A 5CBGA 3IC7A 2A79B 3HKBA 4F6RA 3U10A 1MOFA 3RYCB 2VQEB 3NR7A 1NQTA 5IYBO 2EZPA 2EJ7A 1H2SB 1V55C 1BZKA 3FB7C 4NXMO 1M57B 4DR7B 4DR1O 3AG7A 2QKSA 4E4EA 4FK5C 4FLUA 1H2LA 5L3DA 1SRYA 1CP9A 3FAVA 4C7UA 5KA6A 4X65O 1XHXA 1DF5A 4J9ZB 2JEUA 5J2TA 2JK5C 1O9HA 3AG1C 1IXMA 5EBMC 3AG4C 1Y74B 3G6EV 1HNZO 1P7GA 2Y69C 3AG3C 3HB3B 2LGQA 4YY3O 1QQCA 2N04A 2FL4A 1DF4A 5JQGB 1IBLB 2H3OA 2HVJC 4GKJO 1KB9F 1XNQB 1KP2A 1MABG 4DR3B 4AI8A 3M7MX 1GO3F 3JALB 1HNWB 3ABTA 1R3JC 1V54C 3ZHUA 1MSDA 4AILC 4UB6Z 5A9GA 3LNMB 4YJ2A 4JI3B 1XILA 5KA5A 1KQSU 3O65A 1I7FA 1GN3A 4DUYB 5A2QN 3LDDA 1COWG 1XDCA 1S3JA 3JCUZ 4PI2A 5IJ9B 4YXWG 2Q8VA 4EFEA 1L1FA 2OWOA 4JYBA 3KG2A 4TSFG 1S77D 1FAFA 2F95B 2ETNA 5GTIZ 3SJCC 2RMKB 5LGNA 2DQ0A 4YJ3A 5EZYB 2ZNIA 3JD1A 4LH6A 1S0VA 4IYHA 1SQQH 2RNBA 2W6JG 4D7SA 2HR3A 1NBMG 3UO2A 3AEIA 4X9QA 3OEEG 4PA6A 1K97A 1IBMB 4U3JB 4L8JA 1R3IC 1SQGA 4LH7A 2ZT9B 5LMNB 1VP7A 1DTOA 5KUKA 4U7OA 2ZXWC 2UXDB 2FTKA 3BY6A 1EN4A 1P49A 4RUEA 4DV4O 4DV6B 1YTFD 4DXWA 1HP8A 2IM9A 1YTFB 5B1BC 2ITDC 5EYPB 4LWSB 4GUNA 4GZRB 5B5EZ 3W7WA 3CS5A 5EC1C 4FZ1A 4WFFA 4U3FH 3T1CA 2D2CB 5LHGA 2ODMA 3E89A 5LL6Y 2A3QA 1Z5VA 2DYRC 2Q73A 4UCOA 1ZAUA 1THZA 2DYRB 2PF4E 1YDXA 1JA8A 1YZBA 4GKKO 4DR6B 4DV0B 2WWWA 5LGUA 4JV5O 4FM1A 4X8AA 2CUGA 2CH7B 2DE0X 5LA6B 3TETA 4O2BB 4X1YB 3D3QA 1XUQA 2X6BA 3JASB 2BSKB 4R8CA 3S3XA 3WB0A 3ZBHA 3MAQA 4KFMA 2M7WA 2XT9A 1NZ6A 3BVOA 4UXNA 4PV1B 3P30A 2ZE8A 5BXZA 2PTMA 2NLJC 4K0KO 3T1HO 1RPOA 5B1AB 4DR1B 2HG5C 2ZQMA 4N23A 1MZEA 4GX2A 1NTKH 3ZHRA 4P9OA 4UFZA 2Q4PA 1NTZH 3CP1A 4YHHO 4TUYB 2ZINA 1WB7A 1VQ5V 4FLXA 2YXYA 5DN6G 2IBZH 4TOIA 3ZMSA 1MG1A 4LFBO 4MS2A 4JI6B 3TGUH 1HNZB 3ZX6A 5FL7G 3BFRA 2WLNA 2XASA 4YY3B 2RCVA 1D5AA 4HYOA 1XNRO 3LDEA 4MVQA 3PJSK 4DRXB 1BCCH 4CH3A 1FXKA 1OCZC 4DUZB 1M4UA 3N2KB 4UV8A 1AJQA 2QM4A 2ATKC 1OCZB 3JD3A 1VQ9V 4Z2WA 1SA0B 1SQPH 3CCJV 3HKCB 4OX9O 5LXTB 1NKDA 4O2AA 3F7VC 1KMIZ 3X2QC 1OV9A 4NTXA 4Q6GA 3I55V 3UKMA 3AG2B 3DTUB 3X2QB 2JGUA 1AR5A 3DXRB 3WG7B 3E83A 3G6BA 4MSWC 1VQ4V 4MT8A 2LW7A 2JS3A 4CS2A 4LF9O 1WPBA 2P4VA 4UCVA 4EB6B 1VF6C 5KX5A 3UCSC 1QR9A 1J5EO 2CTQA 2JJ1G 2QWPB 3D36A 2DMXA 1NH2D 2JRIA 4FMTA 3CPWU 3ZMZA 5IYZA 4TT3G 2LQTA 3A0HZ 4F6RB 3QVNA 1VQNV 1PNKA 3F5TA 4JI8B 3H1IH 3FFQA 2OT5A 3UT5A 4H44B 3OTOO 3SYCA 2PYJA 1XREA 4JZ2A 3R66A 2HP8A 4LF5O 4TV8B 1KU9A 5JCOA 3ABKC 4KP4A 2DWEC 2Q0AA 2LFRA 4UCTA 4HNAB 5J2TB 3LSUA 1YF2A 3BEHA 2E3CA 3OE7G 1OZ0A 2YI9A 5BMVA 1W59A 1M90W 4JAUA 2FMLA 2OYQA 5HFLA 1F4NA 4BWAA 4TV9A 1K7DA 3Q4HB 2P7TC 3CE2A 3HKEA 4XDJA 1N36B 4X66B 4FFKA 2GV9A 3K0DA 4IL6Z 3QO8A 4ICGA 3ETGA 1VARA 5IWAO 1BQZA 4WFGA 4LBEC 2A0LA 1Q90D 4PDRA 4GX1A 2EIKC 4D7TA 4MVZA 3ZRXA 4JI2O 1HDJA 4GKKB 4NTYA 2XAHA 3SPCA 4NB5A 2D3OW 4XDKA 4JV5B 2OIEA 4JF3A 2UU9O 1NU1H 4P2ZA 1JMKC 2WLIA 5DM6V 4NKGB 1FFXA 5H6QA 3D8CA 4MW3A 4K0KB 2ZR3A 1DLBA 2LO1A 3T1HB 1PNLA 3ETQA 4GCZA 3RWRD 4TQDA 2YIDA 4K35A 2R9RB 4FLYA 3WB1A 4BAYA 1RPRA 2YXHA 2QTOA 3H9VA 1N0JA 2IH1C 4JGSA 2IU0A 2P67A 3M99B 3SJBC 3BABA 3DSQA 4JYYA 1DK1A 3JARB 4PELA 3SYAA 3LUTB 3RVYA 3WU2Z 3JATA 4LFBB 2EIMC 2ADQB 3CCVV 5CA0A 2EIMB 2H94A 1EFRG 2XTAA 2ARHA 2AHYA 1K9MW 2JS5A 5IE9A 3SPHA 3E8GA 1XNRB 5LBQA 1JJ2U 2ZCEA 3T4DA 5L3GA 5BR8O 2YEVA 3B8NA 3IGAC 2QR4A 3RYHA 3H1KH 3UO3A 4DR5O 1PKXA 2EINC 1LUWA 1H2KA 1TVKA 1EZJA 1E79G 2B9ZA 3K5LA 4G27B 4OX9B 3K03A 2QM8A 1NT2B 5KMGB 1M5IA 1JJOA 4FLWA 3C3TA 5KHHA 1K5QA 3T1YO 5B1NA 4FLVA 1M9NA 1M1KW 5GONB 4LF9B 4CH4A 4NTWA 3JAMN 4X20A 1EZVH 1M93A 1IBMO 5CB4A 3ZMVA 1QBZA 3K9SA 5BY1A 5KLVH 3G4SV 2HEPA 5EIBD 3QO5A 1QLNA 4L87A 4KXRA 3CRAA 3K06A 4DV6O 4ZOLB 4JPRA 1UJWB 4JTCB 3ZEDA 1QVGU 3OTOB 2H8PC 2QDOA 1Q3EA 3CC4V 3B77A 1Z2GA 1XEQA 3L75H 2Y48A 2ITCC 3ASOB 1BMFG 4ZHQA 5KHKA 4EKWA 3RT3C 2ZDIA 2LFSA 2KSDA 3B09A 4DW0A 4GT1A 4RQFA 3CCMV 3FX7A 4RQEA 2F4VB 4F6EA 4FLZA 4JI4B 1OCRB 1EBOA 1FXKB 1M57C 1URFA 1WB8A 3RW0A 2BTQA 1M56B 2WLJA 1PM9A 1S5LZ 2AXTZ 3ABLC 2ADPA 1TUEB 3OD4A 3FB6C 5IWAB 1R1BA 5LYJA 3ABLB 3E22B 1GN2A 2Q67A 3CJHA 2P5OA 4JI2B 4PHZA 3DGEA 3OM3B 2HHHB 2DW4A 2Q7EA 2EULA 1G8MA 2B5UA 3CHXA 3ZRSA 2UUAO 2UU9B 3MDSA 4JI6O 4J41A 4B3MB 2GTAA 1UFIA 4DV1B 4PDMA 1OJHA 3DC6A 4ZI7B 2CGOA 1N32O 3VQYA 4MVSA 4WBNA 1EM1A 1XQ8A 4I0XA 4Z1VA 3STLC 2GUZA 1JFFA 1P4RA 4BR6A 4R50A 4KL1A 2AZ2A 1YVWA 4DUZO 1PNMA 3CB2A 2UXCO 4CZZA 2N74A 2EIJB 3G71V 4LF6O 3JAWA 1SF9A 1BL8A 5JVDA 2QEXV 3OR7C 5LGTA 5LP6C 3BRCA 3K5MA 4K8XA 2P22C 2F1MA 3ZMTA 5LP6B 1ZUQA 1TUBA 3N2GA 1XL4A 3A2FA 5BR8B 1AVMA 3BAAA 2IJHA 5CN0A 1Y76B 4DR5B 2WA4A 4H0LB 3C3SA 1B3QA 3HKEB 4JI0O 3SPGA 2QKAA 1NVPD 3L73H 4IIJA 2C2AA 4JI8O 2CTRA 1PD3A 1NVPB 1K92A 4X1KA 1BGYH 1Q5OA 3T1YB 3VQXA 1XHZA 1HR0O 3GWKC 4DYLA 4B7EA 2JVDA 4LNUA 1WAZA 2OCCC 3E8FA 3J81N 1VQ6V 1HWYA 1KECA 3K59A 4U7NA 1GM7A 3NXSA 2OCCB 3VBBA 2F93B 3CSXA 1YIJV 4JYAO 4JASA 2BE3A 2W0XA 2WLLA 2KG7B 4GX0A 1SQXH 5IYDO 5B1OA 2WLIB 4KUMA 1XOUA 2ZE7A 2Q68A 3SGIA 3JD0A 2ZD9A 3GVMA 1FFXB 5GTHZ 1SKVA 5ITZA 4NVPA 3J80N 4BIOA 4J10A 3K0GA 5JJJB 1N0NA 2R70A 1VF5B 1RFYA 2IU3A 1N36O 3QTCA 3APQA 4X66O 1PP9H 2JGDA 1YEWA 5JH7B 4O4HA 1IZ3A 3P32A 1GK9A 1MSWD 1BS3A 5KHJA 4FLTA 4O4JB 1IBKB 2BCCH 3JATB 4MVRA 5FNVA 1X59A 2R9IA 5KHGA 3OTFA 5EBLC 2YIBD 3W7UA 4ZKIA 1ZX3A 3HPLC 4MW8A 4FM2A 4FPPA 4QPKA 1TA8A 2WPDG 2V4DA 3HKDB 3FD9A 3RYHB 3KCYA 3RYIA 2Y4TA 5B1AC 3RFRA 5CA1A 2CK3G 4CBCA 2B1GA 1TVKB 4X1IB 3GB7C 1WA8B 3L70H 1SZXA 1GAXA 1F4MA 1JQ0A 2CTWA 3K58A 3T2MA 3IC9A 3R65A 3JAKB 1W2BU 4I50B 3LSSA 1G4YB 4B3SO 2IJIA 2UUAB 2Z3YA 5F2VO 1XMQB 2E75B 4B3TO 3C90A 2MK3A 2OIGA 3EXAA 1N32B 3CRMA 1SZTA 1VQKV 4I55B 1JX9A 1KUQA 5LOVB 1SQFA 1ZL8A 5IY5C 5L3EA 4DK1A 1L0NH 5IY5B 2UXCB 1EN6A 4LF6B 1TGOA 2X6CA 1YI2V 1SESA 2OCHA 5IJ0A 3AG2C 1Q6HA 4FFBA 4QE9A 1F7YA 2CDYA 3WG7C 1JCHA 2QSAA 2AZ0A 3LDCA 3H1JH 1BHBA 1GM9A 4HBNA 1WNSA 3H1LH 4QPJA 2N05A 4PDVA 4X89A 4UUJC 4DK0A 3U11A 1BQ0A 1I08A 2YIAA 3ZRVA 1R6KA 1CEZA 3OUSA 1KD1W 3CEIA 4WFBV 2CGNA 3HKBB 4JI0B 2FB5A 5H6RA 3B40A 1IVSA 1VQOV 2ILMA 5GW7A 4WFHA 2ZM6O 2E76B 1HR0B 1K5SA 2R9AA 3OUFA 5LYJB 3JD2A 3CXHF 1VEWA 4LF4B 2O57A 3FAVB 3CCUV 3H1HH 3CJHB 3D3IA 3LNNA 5JQGA 4OPAA 4JYAB 1VQ7V 3WFVA 3ZHTA 5B3SB 4PDLA 1XMOO 3JALA 1GH6A 3STZC 3OAAG 5IYCO 4OXSA 3OFNG 2PYLA 2NNUA 1ZLZA 2R72A 4LF8O 3AK1A 5FPOA 2F4VO 3RYFA 4KHPO 4JI4O 2EBOA 3AK3A 1LR1A 1N34B 1Y67A 3G67A 1Y66A 3JAWB 1JPXA 3CCQV 1W0KG 4J9YB 5KHIA 2Q7GA 2E74B 5JVDB 3RVZA 4YJ2B 3L74H 1Q86W 1YJNV 2HHHO 1AJNA 2KKWA 3E2EA 3CRRA 1H2MA 2F66C 1QR8A 3N2GB 5DECA 1DGSA 4JI5B 4B3MO 1JOYA 2DQ3A 1GN4A 3QF7A 4DV1O 4EFBA 2HJFC 3CCEV 1G6UA 2FKXA 2P06A 3ZHVA 4U3JA 3A0RA 2IJKA 4YJ3B 4PA9A 4I9WA 3K08A 3FYEB 2YICA 4O4IA 2HJDA 4LNUB 4B3SB 4RAIA 1AP5A 1J95A 3CCSV 4B3TB 1NJIW 1FXVA 4LWSA 4J7ZA 4UVAA 4E2LA 4JAVA 1AP6A 2K9PA 2V1DA 1TAEA 3MD0A 2Q5ZA 2DYSB 2UUBO 2V7QG 4H33A 1OCOB 4TQFA 1S72V 3ZJZA 1WP8A 2GBOA 1RM1C 2CE4A 3SYQA 2Y4UA 5J2UA 2XAFA 1RM1B 1Y4MA 3CMAV 2PGGA 5H9CA 1A32A 3TK1A 5DEDA 1QLEC 3APOA 1R73A 1FD9A 1QLEB 2CH7A 1O9GA 4G2KA 5LA6A 3CD6V 3MHSC 4O2BA 4X1YA 3SYPA 3JASA 2BSKA 3QG5A 2DOSA 5JJNB 3ZCCA 1CXZB 3TCUA 3ZMUA 3OMNB 1K4DC 3E8HA 2K1EA 3ETEA 2VRZA 4W4LA 1VQMV 4TUYA 2X6AA 3L71H 4J42A 1CPYA 2W0FC 1B04A 4WFEA 1GM8A 2XOKG 5EIBC 3N27A 4BIZA 4B08A 4ZIBA 1K33A 2ZM6B 3P3NA 3K3WA 3B8MA 4K8ZA 1WLEA 4PA4A 2KQXA 2XAJA 3ASNB 4N21A 2PUSA 3EVKA 2UXBO 4CH5A 3ASOC 3S3WA 4DRXA 4B3RO 3EFFK 1Q81W 3BHPA 2A7WA 2NR5A 3OT7A 1IBKO 3CYOA 3IJ4A 4CC6A 3SJAC 3CC7V 1XMOB 1E1QG 3W7XA 3HKCA 2LP7A 5LXTA 2AHZA 1L8DA 1YCIA 2BTOA 1KC8W 5J9PC 1R6NA 2ZR2A 1VMGA 4WFAV 4LF8B 4IGGA 1OCRC 1PL0A 1FXKC 1FJGO 1MMMA 1KBHA 4LFAO 2L35A 3L72H 4KHPB 1M56C 2BOCC 4DV5B 1I0HA 1QCEA 5D5QA 4EB6A 4UCRA 1US6A 4H13B 4O4LA 2JDIG 4LFCO 1VF6A 4K3AA 3CWBH 4O2AB 4LR3A 1GN6A 2P90A 4FFBB 5CBHA 4FJCC 2UUCO 4YIPA 4DR4O 1IXBA 3BA9A 1Q43A 3D36C 1V55B 1XMQO 1GRJA 3HR0A 2Q69A 5KX5B 1OHHG 4X62O 2VQFO 4NXNO 2DJVA 1WP7A 4TV8A 4EEQA 5IYZB 3ZN1A 2LJ2A 2XAGA 1Q8IA 4LF7O 3JSNA 3FB5C 1RSOA 1K3EA 4HNAA 1IURA 2WLKA 3RN4A 5LMUO 2EIJC 2ZE6A 4I4TA 5BZBA 1N4CA 3AG1B 1X4TA 3UT5B 3AG4B 4QJFB 4JYCA 4UV9A 2RQ6A 3THOA 5JCOC 1N33O 1YITV 2ZIMA 4DR2O 2UXNA 4JAAA 3Q4HA 2Y69B 3AG3B 1WPXA 2HVKC 1AI5A 3W7SA 4R6ZA 5FLXN 2GTSA 1BHAA 5D5PA 1IDSA 2EJRA 4RWUA 2UUBB 1VIBA 3I56V 2QE7G 3ICXA 2VWJA 1QHTA 2W6IG 5BMVB 3K5NA 3OGIB 1ENVA 4FM0A 4JZGA 1AR4A 2Q9LA 1Q6IA 4MTOA 4B7KA 4TV9B 2BOBC 1H2GA 1V54B 3SR2C 1HW7A 1RP3B 2QM7A 4DV3B 3F5WC 4DO2A 3RYFB 4DV2O 4TWKA 1SQVH 1EN5A 1L0LH 4AQYB 5CMUA 2EILC 3ML0A 3F7YC 3KCXA 5E79Z 1XL6A 4LC1A 3P3PA 2EILB 2Y0IA 2OTJV 2HKOA 4LF4O 1WN7A 4MTXA 1FYJA 1NTMH 4NR1A 4QNHB 4G28B 3IAYA 4PJ0Z 4Q20A 5C93A 1U97A 1Y6XA 1Q7YW 3JARA 1MNGA 2P4KA 5L3BA 4MVOA 1W0JG 3CCLV 5KAFZ 3A8TA 2ZNJA 3JYCA 2QTSA 3ABUA 1S5JA 5AG2A 4QE7A 2IH3C 4PI0A 4P9PA 1UPGA 1GTOA 3ZIAG 4R7CA 2UXBB 4AHCA 4B3RB 4I5SA 1N34O 1HNXO 4MVUA 2RN9A 4O4IB 1Q6UA 2ZXWB 4WF9V 2WA3A 4X64B 2YS8A 1SETA 3U0ZA 1I94O 5B1BB 1JVMA 5CA0B 1XBLA 4IHJA 2AW9A 5L3FA 5KMGA 3BPZA 2GHYA 3CRQA 3K57A 2E5LB 1FJGB 4LFAB 3K5OA 3K04A 4A5UB 4JI5O 5J2UB 2YEVB 5GONA 4LCUC 3SPIA 3RGBA 2Q0OC 4JI7B 4LFCB 3KZIZ 2JJ2G 3ZRWA 1P84F 1V9PA 2GDSA 4P30A 4JI1O 4CS4A 1I5YA 2QWOB 2X7RB 2UUCB 4OGQB 4DR4B 4ZOLA 4CH6A 4NXMB 5H5NA 3ZHSA 4UVBA 1KP3A 5B66Z 4X20B 2YSUB 4X62B 2VQFB 4NXNB 3ABMC 1VF7A 3ZN0A 5CB4B 3OGCC 2G38A 2X0LA 4LF7B 4X65B
chains in the Genus database with same CATH topology
1OCCC 2HLDG 3ABMB 4JTCB 1FFTB 3RVZA 1K34A 1YJ9V 3LDDA 1QVGU 1COWG 1S3JA 1N8RW 1Q86W 1OCCB 2H8PC 3EHBB 4HAMA 1YJNV 1FS0G 3CC4V 1AJNA 4YXWG 3E2EA 1L1FA 3B77A 4JYBA 3KG2A 4TSFG 1S77D 1QR8A 3OMIB 1H8HG 1F23A 2Y48A 2QA4V 2ITCC 1JOYA 3ASOB 5LGNA 2DQ3A 2DQ0A 1BMFG 2HJFC 3CCEV 4EKWA 1VQ8V 2ZDIA 3JD1A 2LFSA 3GWOA 3A0RA 4F4LA 1S0VA 4GT1A 4RQFA 2IJKA 2JIZG 3CCMV 1I5XA 2W6JG 2HR3A 2ZDIC 1NBMG 4PA9A 4RQEA 4Z1MG 3AEIA 4I9WA 1H38A 3K08A 1R3KC 3OEEG 4PA6A 1K97A 3FYEB 1R3IC 1OCRB 1EBOA 1FXKB 1M57C 4BW5A 3RW0A 4RAIA 2JEXA 1DTOA 5KUKA 1J95A 4U7OA 1M56B 2WLJA 3CCSV 3ABLC 1FXVA 1Q82W 1TUEB 1NJIW 3FB6C 4UVAA 4E2LA 2ZXWC 2FTKA 3BY6A 4RUEA 3ABLB 4JAVA 3E8BA 1YTFD 2V1DA 1S5HC 3MD0A 2DYSB 2V7QG 4DXWA 4H33A 1YTFB 5B1BC 1OCOB 3MHHC 2ITDC 1S72V 3ZJZA 2Q67A 3K79A 1RM1C 3SPJA 3DGEA 3OM3B 3SYQA 2DW4A 4H37A 3W7WA 4XBFA 2XAFA 1B6QA 5EC1C 1FXHA 1RM1B 1NH2B 1Y4MA 4WFFA 1G8MA 2B5UA 3ZRSA 5IDJA 3CMAV 3T1CA 5LHGA 5H9CA 3TK1A 5CA3A 3E89A 3CMEV 1QLEC 2DYRC 5B3SC 1QVFU 3FKSG 4PDMA 1R73A 1THZA 1QLEB 4MVSA 4HZ3A 2DYRB 4G2KA 3CD6V 3MHSC 2P6JA 3SYPA 1AI6A 3STLC 1P4RA 4X88A 5L3CA 3CCRV 2B1IA 3ZCCA 4R50A 2WWWA 5LGUA 2EZOA 2IW5A 3TCUA 4X8AA 1PNMA 3ZMUA 4CZZA 2EIJB 3G71V 3OMNB 4WCEV 3TETA 3ABKB 1K4DC 3E8HA 4R8CA 2X6BA 4UVCA 2K1EA 3OW2U 3CC2V 3ETEA 4KFMA 2M7WA 4UXNA 1BL8A 2XAQA 3P30A 4FIPC 1VQMV 2NLJC 2X6AA 2DWDC 1CPYA 1RPOA 5B1AB 2HG5C 2W0FC 2ZQMA 4N23A 2QEXV 4WFEA 1SERA 1GM8A 2XOKG 3FYIB 3LSQA 3OR7C 4GX2A 4BIZA 5LGTA 5EBWC 4P9OA 3CP1A 1K33A 3ZMTA 3ETDA 4BIUA 2A9HA 2Q6AA 1VQ5V 1XL4A 3K3WA 5DN6G 1AJPA 3B8MA 3CXCU 1WLEA 2IJHA 3ZMSA 5CN0A 3QNEA 2PI4A 4PA4A 3VOUA 3E86A 1MG1A 1E1RG 3UM7A 3JCZA 4MS2A 3ASNB 2XAJA 4N21A 1GMGA 5E1AC 3K9AA 3ASOC 4QIWF 5FL7G 3EFFK 3SPGA 1Q81W 1NVPD 2WLNA 2C2AA 4JTDB 3H01A 2XASA 3CYOA 1PD3A 1NVPB 1K4CC 2IJJA 1P7BA 3CC7V 1K92A 1E1QG 3W7XA 4HYOA 3LDEA 4MVQA 4JTAB 2EIKB 2LP7A 3PJSK 2AHZA 1FXKA 1OCZC 1KC8W 1ZWIC 2OCCC 3E8FA 3E35A 4UV8A 1VQ6V 1AJQA 1HWYA 1KECA 1R6NA 2ZR2A 5J9PC 2UXXA 2ATKC 1OCZB 3JD3A 4LP8A 4U7NA 1GM7A 3NXSA 4WFAV 1OCRC 1VQ9V 2OCCB 1PL0A 1FXKC 3OMAB 3VBBA 1ROPA 5EK0A 3CCJV 1NKDA 1YIJV 1M56C 4JASA 2BOCC 3F7VC 1QCEA 2WLLA 3SYOA 3X2QC 4GX0A 3I55V 3UKMA 5IYDO 3AG2B 5B1OA 1ORQC 2WLIB 3DTUB 3FB8C 2Q68A 4KUMA 2JDIG 3X2QB 3JD0A 2DYSC 2ZD9A 3WG7B 3E83A 1OCOC 4MSWC 1VQ4V 4MT8A 2WLLB 2P90A 1AR1B 3K0GA 1S76D 1QR9A 5CBHA 1NR1A 4FJCC 2JJ1G 1K8AW 2IU3A 3D36A 1YSCA 1NH2D 4FMTA 3CPWU 1AI7A 3ZMZA 2WLMA 4TT3G 2PI5A 1V55B 3QO7A 2Q69A 1VQNV 3P32A 1PNKA 1GK9A 1OHHG 1MSWD 4MTFA 4MVRA 3ZN1A 5LHIA 2GSMB 2R9IA 2XAGA 5LHHA 1YJWV 2OT5A 1KKDA 5EBLC 2WAMA 3FB5C 1K3EA 3W7UA 3SYCA 4ZKIA 3OR6C 2WLKA 1H8EG 1R3LC 2EIJC 5HFMA 3ABKC 3HPLC 4MW8A 3W7TA 4KP4A 5BZBA 4FPPA 3AG1B 4QPKA 2DWEC 5EC2C 2LFRA 3AG4B 2WPDG 4QJFB 2EINB 4JYCA 4UV9A 1VQLV 5B1AC 1YITV 2Z5UA 3BEHA 2CK3G 2UXNA 2Y69B 1OZ0A 3AG3B 3OE7G 1WPXA 2B1GA 1LNQA 2HVKC 4CBCA 1AI5A 2XNDG 4R6ZA 5CBFA 4JAUA 3W7SA 1M90W 3GB7C 5HFLA 1AI4A 1BHAA 2HFEC 2WSSG 4XDLA 1F4NA 2EJRA 1F4MA 4RUFA 1JQ0A 3I56V 2QE7G 3T2MA 1K7DA 3R65A 1F51A 3SJQC 2KB1A 2P7TC 2W6IG 4MVMA 4PA3A 4XDJA 1W2BU 3RBZA 1ENVA 1G4YB 3LSSA 4ASUG 3ASNC 3ZRWB 2IJIA 2F43G 2Z3YA 4MTOA 3K0DA 2BOBC 1H2GA 1V54B 3QO8A 3ETGA 2QM7A 2WLHA 3F5WC 3JD4A 4WFGA 4MTGA 4DO2A 2MK3A 4LBEC 2A0LA 4TWKA 4PDRA 5CMUA 1SZTA 1VQKV 2EILC 1JX9A 3ML0A 4GX1A 3F7YC 2EIKC 1XL6A 4LC1A 4MVZA 3ZRXA 4RO2A 2EILB 5IY5C 5L3EA 2XAHA 2OTJV 3SPCA 2D3OW 4XDKA 1K73W 5IY5B 2HKOA 4JF3A 1VQPV 4P2ZA 3IFXA 5DM6V 2WLIA 4MTXA 2X6CA 3OEHG 1YI2V 1SESA 1YHQV 4QNHB 4G28B 4Q20A 5H6QA 5C93A 3AG2C 4MW3A 2ZR3A 1DLBA 5KUMA 1PNLA 4GCZA 4QE9A 3T4ZA 3WG7C 2R9RB 1JCHA 1Q7YW 4PA7A 2OTLV 1NR7A 1GKFA 3LDCA 1RPRA 1AROP 4GX5A 4BAYA 5L3BA 2QTOA 1BHBA 1GM9A 4MVOA 1W0JG 3CCLV 2IH1C 4ZBMA 4JGSA 5CBGA 3IC7A 4QPJA 4PDVA 2IU0A 2P67A 4X89A 4UUJC 2A79B 3JYCA 1MOFA 3M99B 3ABUA 1NQTA 5IYBO 2EZPA 4PELA 3SYAA 3LUTB 3RVYA 4QE7A 2IH3C 3ZRVA 1R6KA 1CEZA 1V55C 3FB7C 3OUSA 2EIMC 4P9PA 1M57B 1KD1W 1GTOA 3ZIAG 4R7CA 4WFBV 3CCVV 2QKSA 4I5SA 2EIMB 2H94A 4MVUA 5H6RA 1EFRG 4FK5C 4WF9V 2ZXWB 2AHYA 1K9MW 1VQOV 5L3DA 1SRYA 1CP9A 3SPHA 5GW7A 4WFHA 1SETA 3E8GA 5KA6A 5LBQA 1JJ2U 5B1BB 1K5SA 1JVMA 3OUFA 1DF5A 3T4DA 5L3GA 4J9ZB 2JEUA 2YEVA 3B8NA 3IGAC 3JD2A 2JK5C 5L3FA 2GHYA 3AG1C 1IXMA 5EBMC 3CCUV 3AG4C 1PKXA 2EINC 3G6EV 1EZJA 1E79G 3D3IA 3K04A 4G27B 3K03A 2QM8A 2YEVB 2Y69C 4LCUC 3AG3C 1VQ7V 3SPIA 3WFVA 5B3SB 3HB3B 4PDLA 1K5QA 5B1NA 1DF4A 1M9NA 3STZC 1M1KW 2JJ2G 3OAAG 3ZRWA 5IYCO 2HVJC 4OXSA 3OFNG 4P30A 2NNUA 1KP2A 1MABG 1I5YA 1GO3F 2X7RB 3ABTA 1R3JC 3ZMVA 1QBZA 2EBOA 1V54C 3G4SV 4UVBA 3LNMB 1KP3A 1Y66A 5KA5A 3QO5A 1QLNA 4L87A 2YSUB 1JPXA 1KQSU 3ABMC 3CCQV 1W0KG 3K06A 4J9YB 3ZN0A 3OGCC 4JPRA 2X0LA 1UJWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZT A;  4E2L A;  3GWO A;  1K34 A;  1I5Y A;  5HFM A;  2X7R B;  5H9C A;  2LP7 A;  3B8M A;  4FK5 C;  1I5X A;  1ENV A;  2M7W A;  5CN0 A;  1QBZ A;  1Y4M A;  2EBO A;  3P30 A;  4FIP C;  3B77 A;  1MG1 A;  3WFV A;  4JGS A;  4JF3 A;  2OT5 A;  4N21 A;  3MHH C;  4G2K A;  1QR8 A;  5KA6 A;  3CYO A;  3K9A A;  4N23 A;  3MHS C;  2P6J A;  1F23 A;  1QR9 A;  1MOF A;  1Y66 A;  3M99 B;  4FJC C;  5HFL A;  5KA5 A;  2MK3 A;  5CMU A;  1DF5 A;  1JPX A;  1DF4 A;  3B8N A;  2EZP A;  1EBO A;  2EZO A;  1JQ0 A;  3CP1 A;  3H01 A;  4JPR A;  1QCE A;  1K33 A;  1DLB A; 
#chains in the Genus database with same CATH topology
 2NN4 A;  1OCC C;  4J11 A;  2HLD G;  3ABM B;  1WJZ A;  1FFT B;  2LGW A;  1K34 A;  1YJ9 V;  2AGA A;  2ZKO A;  1N8R W;  1OCC B;  5K1P A;  3EHB B;  4HAM A;  4DV7 O;  5KAI Z;  5LMU B;  1FS0 G;  5C8Y A;  4UCU A;  3OMI B;  1H8H G;  1F23 A;  2A06 H;  3A0B Z;  1N33 B;  4DW1 A;  4DR2 B;  3J7A U;  1VQ8 V;  3GWO A;  4D6T H;  4F4L A;  3RYC A;  2JIZ G;  4BW9 A;  1I5X A;  4GKJ B;  1YXB A;  2ZDI C;  4ZHQ B;  4Z1M G;  3M8A A;  2Q7H A;  1B06 A;  1ZSP A;  1U96 A;  3ZS8 C;  1H38 A;  2Y0P A;  1R3K C;  4J7K A;  2XHB A;  3BCC H;  3E22 A;  4BW5 A;  4CC5 A;  2JEX A;  1FKA O;  1Q82 W;  1BT8 A;  3E8B A;  4DV2 B;  1S5H C;  2MW2 B;  2BTQ B;  3MHH C;  1Y74 A;  4O4L B;  3K79 A;  3SPJ A;  5JJE B;  1KKC A;  4H37 A;  4XBF A;  4ZI7 A;  4I9Q A;  1B6Q A;  1FXH A;  1NH2 B;  5IDJ A;  1SC5 B;  2PZS A;  4J80 A;  5JWP A;  1PPJ H;  3BA8 A;  5CA3 A;  3CME V;  1QVF U;  5B3S C;  1KYO F;  3FKS G;  2QWQ B;  2YDE A;  3AK2 A;  1SS3 A;  2YC0 A;  3UQ8 A;  4HZ3 A;  1JR9 A;  2P6J A;  1AI6 A;  4X88 A;  5L3C A;  3CCR V;  2B1I A;  1FPO A;  2EZO A;  2IW5 A;  1BSM A;  4WBN B;  4I0X B;  4WCE V;  1RSO B;  3ABK B;  4PD4 F;  4UVC A;  2GUZ B;  1JFF B;  3JSL A;  3OW2 U;  3CC2 V;  2XAQ A;  4FIP C;  5LP6 A;  4DV5 O;  2PY5 A;  4I4T B;  2DWD C;  1BE3 H;  2QJ1 A;  1SER A;  5K1X A;  3FYI B;  3LSQ A;  1PV0 A;  4DV4 B;  1HNX B;  1NI8 A;  1LUV A;  5EBW C;  2ZIO A;  5IJ9 A;  1Y76 A;  3ETD A;  4BIU A;  2A9H A;  2Q6A A;  2CTP A;  1I94 B;  1AJP A;  2ZE5 A;  2VQE O;  3CXC U;  4IT5 A;  4GLX A;  3QNE A;  2PI4 A;  5EZY A;  3VOU A;  3E86 A;  3UM7 A;  1E1R G;  3JCZ A;  5E1A C;  1GMG A;  2EX3 A;  3K9A A;  1TUB B;  4DR7 O;  4UB8 Z;  3CX5 F;  4QIW F;  3VQW A;  3VQV A;  4JTD B;  3H01 A;  3B2E E;  2F23 A;  4J7J A;  1K4C C;  2IJJ A;  1P7B A;  2QWR B;  4JTA B;  2EIK B;  2KG7 A;  1ZWI C;  4IIJ B;  1IX9 A;  4JI1 B;  3E35 A;  2QA4 V;  2XUM A;  2UXX A;  4LP8 A;  3ZHQ A;  4X1K B;  3OMA B;  3TJT A;  1R6T A;  1ROP A;  2DN9 A;  5EK0 A;  1D5N A;  1T5E A;  3TXQ A;  1SQB H;  2QWN B;  3SYO A;  3I5D A;  1D2D A;  5EYP A;  2RJZ A;  1ORQ C;  3FB8 C;  2DYS C;  2YXL A;  1OCO C;  4YHH B;  5JH7 A;  1IBL O;  2WLL B;  2VWK A;  3B4S A;  1XNQ O;  1AR1 B;  2RDC A;  1S76 D;  4DR3 O;  2FYU H;  2YUA A;  3CRC A;  1NR1 A;  3KKY A;  1XI1 A;  1K8A W;  4DV7 B;  1HNW O;  4O4J A;  1YSC A;  1AI7 A;  3SDL A;  2WLM A;  2PI5 A;  5ITZ B;  1MZF A;  4CS3 A;  3QO7 A;  4JI3 O;  1AB3 A;  1ZTE A;  2YIB A;  4DV3 O;  4MTF A;  2JGD B;  5LHI A;  2GSM B;  5LHH A;  1YJW V;  4DUY O;  4W4K A;  1KKD A;  4AQY O;  4O4H B;  2WAM A;  3HKD A;  1H2N A;  3OR6 C;  4QGP A;  1H8E G;  4IYI A;  1R3L C;  5HFM A;  5FNV B;  3W7T A;  4X1I A;  5EC2 C;  1WA8 A;  3O9O A;  2QKC A;  2EIN B;  4IHJ B;  1VQL V;  5IT9 N;  2Z5U A;  1PL4 A;  3G80 A;  3JAK A;  1LNQ A;  2XND G;  5CBF A;  4FVM A;  4I50 A;  1AI4 A;  4NYK A;  3L9D A;  2HFE C;  2WSS G;  4XDL A;  4RUF A;  1G1X B;  3RYI B;  5CA1 B;  4I7Z B;  1F51 A;  2Z0A A;  3SJQ C;  2KB1 A;  4ABM A;  1J5E B;  4MVM A;  4PA3 A;  3RBZ A;  4ASU G;  3ASN C;  3ZRW B;  5LMN O;  2F43 G;  4I55 A;  5H2F Z;  4OPH A;  4GYC B;  5LOV A;  2WLH A;  3JD4 A;  4YIO A;  4MTG A;  2L6L A;  2UXD O;  5TIS Z;  3N2K A;  5FPR A;  4X64 O;  1MA1 A;  1NS1 A;  1SA0 A;  4RO2 A;  4FZ0 A;  4LF5 B;  1Z5W A;  1K73 W;  2M6Y A;  2VS0 A;  2YI8 A;  1VQP V;  1QNM A;  3IFX A;  3WB2 A;  2E5L O;  3OEH G;  1AIL A;  1YHQ V;  2QGN A;  3TXS A;  1ZL8 B;  3DXR A;  2CAZ C;  2LW1 A;  5C8Y B;  5KUM A;  1QU7 A;  3T4Z A;  4PA7 A;  4JI7 O;  4UCS A;  2OTL V;  3DC5 A;  1NR7 A;  1GKF A;  4GX5 A;  1ARO P;  4DR6 O;  4DV0 O;  5IJ0 B;  4ZBM A;  3PN1 A;  5CBG A;  3IC7 A;  2A79 B;  3HKB A;  4F6R A;  3U10 A;  1MOF A;  3RYC B;  2VQE B;  3NR7 A;  1NQT A;  5IYB O;  2EZP A;  2EJ7 A;  1H2S B;  1V55 C;  1BZK A;  3FB7 C;  4NXM O;  1M57 B;  4DR7 B;  4DR1 O;  3AG7 A;  2QKS A;  4E4E A;  4FK5 C;  4FLU A;  1H2L A;  5L3D A;  1SRY A;  1CP9 A;  3FAV A;  4C7U A;  5KA6 A;  4X65 O;  1XHX A;  1DF5 A;  4J9Z B;  2JEU A;  5J2T A;  2JK5 C;  1O9H A;  3AG1 C;  1IXM A;  5EBM C;  3AG4 C;  1Y74 B;  3G6E V;  1HNZ O;  1P7G A;  2Y69 C;  3AG3 C;  3HB3 B;  2LGQ A;  4YY3 O;  1QQC A;  2N04 A;  2FL4 A;  1DF4 A;  5JQG B;  1IBL B;  2H3O A;  2HVJ C;  4GKJ O;  1KB9 F;  1XNQ B;  1KP2 A;  1MAB G;  4DR3 B;  4AI8 A;  3M7M X;  1GO3 F;  3JAL B;  1HNW B;  3ABT A;  1R3J C;  1V54 C;  3ZHU A;  1MSD A;  4AIL C;  4UB6 Z;  5A9G A;  3LNM B;  4YJ2 A;  4JI3 B;  1XIL A;  5KA5 A;  1KQS U;  3O65 A;  1I7F A;  1GN3 A;  4DUY B;  5A2Q N;  3LDD A;  1COW G;  1XDC A;  1S3J A;  3JCU Z;  4PI2 A;  5IJ9 B;  4YXW G;  2Q8V A;  4EFE A;  1L1F A;  2OWO A;  4JYB A;  3KG2 A;  4TSF G;  1S77 D;  1FAF A;  2F95 B;  2ETN A;  5GTI Z;  3SJC C;  2RMK B;  5LGN A;  2DQ0 A;  4YJ3 A;  5EZY B;  2ZNI A;  3JD1 A;  4LH6 A;  1S0V A;  4IYH A;  1SQQ H;  2RNB A;  2W6J G;  4D7S A;  2HR3 A;  1NBM G;  3UO2 A;  3AEI A;  4X9Q A;  3OEE G;  4PA6 A;  1K97 A;  1IBM B;  4U3J B;  4L8J A;  1R3I C;  1SQG A;  4LH7 A;  2ZT9 B;  5LMN B;  1VP7 A;  1DTO A;  5KUK A;  4U7O A;  2ZXW C;  2UXD B;  2FTK A;  3BY6 A;  1EN4 A;  1P49 A;  4RUE A;  4DV4 O;  4DV6 B;  1YTF D;  4DXW A;  1HP8 A;  2IM9 A;  1YTF B;  5B1B C;  2ITD C;  5EYP B;  4LWS B;  4GUN A;  4GZR B;  5B5E Z;  3W7W A;  3CS5 A;  5EC1 C;  4FZ1 A;  4WFF A;  4U3F H;  3T1C A;  2D2C B;  5LHG A;  2ODM A;  3E89 A;  5LL6 Y;  2A3Q A;  1Z5V A;  2DYR C;  2Q73 A;  4UCO A;  1ZAU A;  1THZ A;  2DYR B;  2PF4 E;  1YDX A;  1JA8 A;  1YZB A;  4GKK O;  4DR6 B;  4DV0 B;  2WWW A;  5LGU A;  4JV5 O;  4FM1 A;  4X8A A;  2CUG A;  2CH7 B;  2DE0 X;  5LA6 B;  3TET A;  4O2B B;  4X1Y B;  3D3Q A;  1XUQ A;  2X6B A;  3JAS B;  2BSK B;  4R8C A;  3S3X A;  3WB0 A;  3ZBH A;  3MAQ A;  4KFM A;  2M7W A;  2XT9 A;  1NZ6 A;  3BVO A;  4UXN A;  4PV1 B;  3P30 A;  2ZE8 A;  5BXZ A;  2PTM A;  2NLJ C;  4K0K O;  3T1H O;  1RPO A;  5B1A B;  4DR1 B;  2HG5 C;  2ZQM A;  4N23 A;  1MZE A;  4GX2 A;  1NTK H;  3ZHR A;  4P9O A;  4UFZ A;  2Q4P A;  1NTZ H;  3CP1 A;  4YHH O;  4TUY B;  2ZIN A;  1WB7 A;  1VQ5 V;  4FLX A;  2YXY A;  5DN6 G;  2IBZ H;  4TOI A;  3ZMS A;  1MG1 A;  4LFB O;  4MS2 A;  4JI6 B;  3TGU H;  1HNZ B;  3ZX6 A;  5FL7 G;  3BFR A;  2WLN A;  2XAS A;  4YY3 B;  2RCV A;  1D5A A;  4HYO A;  1XNR O;  3LDE A;  4MVQ A;  3PJS K;  4DRX B;  1BCC H;  4CH3 A;  1FXK A;  1OCZ C;  4DUZ B;  1M4U A;  3N2K B;  4UV8 A;  1AJQ A;  2QM4 A;  2ATK C;  1OCZ B;  3JD3 A;  1VQ9 V;  4Z2W A;  1SA0 B;  1SQP H;  3CCJ V;  3HKC B;  4OX9 O;  5LXT B;  1NKD A;  4O2A A;  3F7V C;  1KMI Z;  3X2Q C;  1OV9 A;  4NTX A;  4Q6G A;  3I55 V;  3UKM A;  3AG2 B;  3DTU B;  3X2Q B;  2JGU A;  1AR5 A;  3DXR B;  3WG7 B;  3E83 A;  3G6B A;  4MSW C;  1VQ4 V;  4MT8 A;  2LW7 A;  2JS3 A;  4CS2 A;  4LF9 O;  1WPB A;  2P4V A;  4UCV A;  4EB6 B;  1VF6 C;  5KX5 A;  3UCS C;  1QR9 A;  1J5E O;  2CTQ A;  2JJ1 G;  2QWP B;  3D36 A;  2DMX A;  1NH2 D;  2JRI A;  4FMT A;  3CPW U;  3ZMZ A;  5IYZ A;  4TT3 G;  2LQT A;  3A0H Z;  4F6R B;  3QVN A;  1VQN V;  1PNK A;  3F5T A;  4JI8 B;  3H1I H;  3FFQ A;  2OT5 A;  3UT5 A;  4H44 B;  3OTO O;  3SYC A;  2PYJ A;  1XRE A;  4JZ2 A;  3R66 A;  2HP8 A;  4LF5 O;  4TV8 B;  1KU9 A;  5JCO A;  3ABK C;  4KP4 A;  2DWE C;  2Q0A A;  2LFR A;  4UCT A;  4HNA B;  5J2T B;  3LSU A;  1YF2 A;  3BEH A;  2E3C A;  3OE7 G;  1OZ0 A;  2YI9 A;  5BMV A;  1W59 A;  1M90 W;  4JAU A;  2FML A;  2OYQ A;  5HFL A;  1F4N A;  4BWA A;  4TV9 A;  1K7D A;  3Q4H B;  2P7T C;  3CE2 A;  3HKE A;  4XDJ A;  1N36 B;  4X66 B;  4FFK A;  2GV9 A;  3K0D A;  4IL6 Z;  3QO8 A;  4ICG A;  3ETG A;  1VAR A;  5IWA O;  1BQZ A;  4WFG A;  4LBE C;  2A0L A;  1Q90 D;  4PDR A;  4GX1 A;  2EIK C;  4D7T A;  4MVZ A;  3ZRX A;  4JI2 O;  1HDJ A;  4GKK B;  4NTY A;  2XAH A;  3SPC A;  4NB5 A;  2D3O W;  4XDK A;  4JV5 B;  2OIE A;  4JF3 A;  2UU9 O;  1NU1 H;  4P2Z A;  1JMK C;  2WLI A;  5DM6 V;  4NKG B;  1FFX A;  5H6Q A;  3D8C A;  4MW3 A;  4K0K B;  2ZR3 A;  1DLB A;  2LO1 A;  3T1H B;  1PNL A;  3ETQ A;  4GCZ A;  3RWR D;  4TQD A;  2YID A;  4K35 A;  2R9R B;  4FLY A;  3WB1 A;  4BAY A;  1RPR A;  2YXH A;  2QTO A;  3H9V A;  1N0J A;  2IH1 C;  4JGS A;  2IU0 A;  2P67 A;  3M99 B;  3SJB C;  3BAB A;  3DSQ A;  4JYY A;  1DK1 A;  3JAR B;  4PEL A;  3SYA A;  3LUT B;  3RVY A;  3WU2 Z;  3JAT A;  4LFB B;  2EIM C;  2ADQ B;  3CCV V;  5CA0 A;  2EIM B;  2H94 A;  1EFR G;  2XTA A;  2ARH A;  2AHY A;  1K9M W;  2JS5 A;  5IE9 A;  3SPH A;  3E8G A;  1XNR B;  5LBQ A;  1JJ2 U;  2ZCE A;  3T4D A;  5L3G A;  5BR8 O;  2YEV A;  3B8N A;  3IGA C;  2QR4 A;  3RYH A;  3H1K H;  3UO3 A;  4DR5 O;  1PKX A;  2EIN C;  1LUW A;  1H2K A;  1TVK A;  1EZJ A;  1E79 G;  2B9Z A;  3K5L A;  4G27 B;  4OX9 B;  3K03 A;  2QM8 A;  1NT2 B;  5KMG B;  1M5I A;  1JJO A;  4FLW A;  3C3T A;  5KHH A;  1K5Q A;  3T1Y O;  5B1N A;  4FLV A;  1M9N A;  1M1K W;  5GON B;  4LF9 B;  4CH4 A;  4NTW A;  3JAM N;  4X20 A;  1EZV H;  1M93 A;  1IBM O;  5CB4 A;  3ZMV A;  1QBZ A;  3K9S A;  5BY1 A;  5KLV H;  3G4S V;  2HEP A;  5EIB D;  3QO5 A;  1QLN A;  4L87 A;  4KXR A;  3CRA A;  3K06 A;  4DV6 O;  4ZOL B;  4JPR A;  1UJW B;  4JTC B;  3ZED A;  1QVG U;  3OTO B;  2H8P C;  2QDO A;  1Q3E A;  3CC4 V;  3B77 A;  1Z2G A;  1XEQ A;  3L75 H;  2Y48 A;  2ITC C;  3ASO B;  1BMF G;  4ZHQ A;  5KHK A;  4EKW A;  3RT3 C;  2ZDI A;  2LFS A;  2KSD A;  3B09 A;  4DW0 A;  4GT1 A;  4RQF A;  3CCM V;  3FX7 A;  4RQE A;  2F4V B;  4F6E A;  4FLZ A;  4JI4 B;  1OCR B;  1EBO A;  1FXK B;  1M57 C;  1URF A;  1WB8 A;  3RW0 A;  2BTQ A;  1M56 B;  2WLJ A;  1PM9 A;  1S5L Z;  2AXT Z;  3ABL C;  2ADP A;  1TUE B;  3OD4 A;  3FB6 C;  5IWA B;  1R1B A;  5LYJ A;  3ABL B;  3E22 B;  1GN2 A;  2Q67 A;  3CJH A;  2P5O A;  4JI2 B;  4PHZ A;  3DGE A;  3OM3 B;  2HHH B;  2DW4 A;  2Q7E A;  2EUL A;  1G8M A;  2B5U A;  3CHX A;  3ZRS A;  2UUA O;  2UU9 B;  3MDS A;  4JI6 O;  4J41 A;  4B3M B;  2GTA A;  1UFI A;  4DV1 B;  4PDM A;  1OJH A;  3DC6 A;  4ZI7 B;  2CGO A;  1N32 O;  3VQY A;  4MVS A;  4WBN A;  1EM1 A;  1XQ8 A;  4I0X A;  4Z1V A;  3STL C;  2GUZ A;  1JFF A;  1P4R A;  4BR6 A;  4R50 A;  4KL1 A;  2AZ2 A;  1YVW A;  4DUZ O;  1PNM A;  3CB2 A;  2UXC O;  4CZZ A;  2N74 A;  2EIJ B;  3G71 V;  4LF6 O;  3JAW A;  1SF9 A;  1BL8 A;  5JVD A;  2QEX V;  3OR7 C;  5LGT A;  5LP6 C;  3BRC A;  3K5M A;  4K8X A;  2P22 C;  2F1M A;  3ZMT A;  5LP6 B;  1ZUQ A;  1TUB A;  3N2G A;  1XL4 A;  3A2F A;  5BR8 B;  1AVM A;  3BAA A;  2IJH A;  5CN0 A;  1Y76 B;  4DR5 B;  2WA4 A;  4H0L B;  3C3S A;  1B3Q A;  3HKE B;  4JI0 O;  3SPG A;  2QKA A;  1NVP D;  3L73 H;  4IIJ A;  2C2A A;  4JI8 O;  2CTR A;  1PD3 A;  1NVP B;  1K92 A;  4X1K A;  1BGY H;  1Q5O A;  3T1Y B;  3VQX A;  1XHZ A;  1HR0 O;  3GWK C;  4DYL A;  4B7E A;  2JVD A;  4LNU A;  1WAZ A;  2OCC C;  3E8F A;  3J81 N;  1VQ6 V;  1HWY A;  1KEC A;  3K59 A;  4U7N A;  1GM7 A;  3NXS A;  2OCC B;  3VBB A;  2F93 B;  3CSX A;  1YIJ V;  4JYA O;  4JAS A;  2BE3 A;  2W0X A;  2WLL A;  2KG7 B;  4GX0 A;  1SQX H;  5IYD O;  5B1O A;  2WLI B;  4KUM A;  1XOU A;  2ZE7 A;  2Q68 A;  3SGI A;  3JD0 A;  2ZD9 A;  3GVM A;  1FFX B;  5GTH Z;  1SKV A;  5ITZ A;  4NVP A;  3J80 N;  4BIO A;  4J10 A;  3K0G A;  5JJJ B;  1N0N A;  2R70 A;  1VF5 B;  1RFY A;  2IU3 A;  1N36 O;  3QTC A;  3APQ A;  4X66 O;  1PP9 H;  2JGD A;  1YEW A;  5JH7 B;  4O4H A;  1IZ3 A;  3P32 A;  1GK9 A;  1MSW D;  1BS3 A;  5KHJ A;  4FLT A;  4O4J B;  1IBK B;  2BCC H;  3JAT B;  4MVR A;  5FNV A;  1X59 A;  2R9I A;  5KHG A;  3OTF A;  5EBL C;  2YIB D;  3W7U A;  4ZKI A;  1ZX3 A;  3HPL C;  4MW8 A;  4FM2 A;  4FPP A;  4QPK A;  1TA8 A;  2WPD G;  2V4D A;  3HKD B;  3FD9 A;  3RYH B;  3KCY A;  3RYI A;  2Y4T A;  5B1A C;  3RFR A;  5CA1 A;  2CK3 G;  4CBC A;  2B1G A;  1TVK B;  4X1I B;  3GB7 C;  1WA8 B;  3L70 H;  1SZX A;  1GAX A;  1F4M A;  1JQ0 A;  2CTW A;  3K58 A;  3T2M A;  3IC9 A;  3R65 A;  3JAK B;  1W2B U;  4I50 B;  3LSS A;  1G4Y B;  4B3S O;  2IJI A;  2UUA B;  2Z3Y A;  5F2V O;  1XMQ B;  2E75 B;  4B3T O;  3C90 A;  2MK3 A;  2OIG A;  3EXA A;  1N32 B;  3CRM A;  1SZT A;  1VQK V;  4I55 B;  1JX9 A;  1KUQ A;  5LOV B;  1SQF A;  1ZL8 A;  5IY5 C;  5L3E A;  4DK1 A;  1L0N H;  5IY5 B;  2UXC B;  1EN6 A;  4LF6 B;  1TGO A;  2X6C A;  1YI2 V;  1SES A;  2OCH A;  5IJ0 A;  3AG2 C;  1Q6H A;  4FFB A;  4QE9 A;  1F7Y A;  2CDY A;  3WG7 C;  1JCH A;  2QSA A;  2AZ0 A;  3LDC A;  3H1J H;  1BHB A;  1GM9 A;  4HBN A;  1WNS A;  3H1L H;  4QPJ A;  2N05 A;  4PDV A;  4X89 A;  4UUJ C;  4DK0 A;  3U11 A;  1BQ0 A;  1I08 A;  2YIA A;  3ZRV A;  1R6K A;  1CEZ A;  3OUS A;  1KD1 W;  3CEI A;  4WFB V;  2CGN A;  3HKB B;  4JI0 B;  2FB5 A;  5H6R A;  3B40 A;  1IVS A;  1VQO V;  2ILM A;  5GW7 A;  4WFH A;  2ZM6 O;  2E76 B;  1HR0 B;  1K5S A;  2R9A A;  3OUF A;  5LYJ B;  3JD2 A;  3CXH F;  1VEW A;  4LF4 B;  2O57 A;  3FAV B;  3CCU V;  3H1H H;  3CJH B;  3D3I A;  3LNN A;  5JQG A;  4OPA A;  4JYA B;  1VQ7 V;  3WFV A;  3ZHT A;  5B3S B;  4PDL A;  1XMO O;  3JAL A;  1GH6 A;  3STZ C;  3OAA G;  5IYC O;  4OXS A;  3OFN G;  2PYL A;  2NNU A;  1ZLZ A;  2R72 A;  4LF8 O;  3AK1 A;  5FPO A;  2F4V O;  3RYF A;  4KHP O;  4JI4 O;  2EBO A;  3AK3 A;  1LR1 A;  1N34 B;  1Y67 A;  3G67 A;  1Y66 A;  3JAW B;  1JPX A;  3CCQ V;  1W0K G;  4J9Y B;  5KHI A;  2Q7G A;  2E74 B;  5JVD B;  3RVZ A;  4YJ2 B;  3L74 H;  1Q86 W;  1YJN V;  2HHH O;  1AJN A;  2KKW A;  3E2E A;  3CRR A;  1H2M A;  2F66 C;  1QR8 A;  3N2G B;  5DEC A;  1DGS A;  4JI5 B;  4B3M O;  1JOY A;  2DQ3 A;  1GN4 A;  3QF7 A;  4DV1 O;  4EFB A;  2HJF C;  3CCE V;  1G6U A;  2FKX A;  2P06 A;  3ZHV A;  4U3J A;  3A0R A;  2IJK A;  4YJ3 B;  4PA9 A;  4I9W A;  3K08 A;  3FYE B;  2YIC A;  4O4I A;  2HJD A;  4LNU B;  4B3S B;  4RAI A;  1AP5 A;  1J95 A;  3CCS V;  4B3T B;  1NJI W;  1FXV A;  4LWS A;  4J7Z A;  4UVA A;  4E2L A;  4JAV A;  1AP6 A;  2K9P A;  2V1D A;  1TAE A;  3MD0 A;  2Q5Z A;  2DYS B;  2UUB O;  2V7Q G;  4H33 A;  1OCO B;  4TQF A;  1S72 V;  3ZJZ A;  1WP8 A;  2GBO A;  1RM1 C;  2CE4 A;  3SYQ A;  2Y4U A;  5J2U A;  2XAF A;  1RM1 B;  1Y4M A;  3CMA V;  2PGG A;  5H9C A;  1A32 A;  3TK1 A;  5DED A;  1QLE C;  3APO A;  1R73 A;  1FD9 A;  1QLE B;  2CH7 A;  1O9G A;  4G2K A;  5LA6 A;  3CD6 V;  3MHS C;  4O2B A;  4X1Y A;  3SYP A;  3JAS A;  2BSK A;  3QG5 A;  2DOS A;  5JJN B;  3ZCC A;  1CXZ B;  3TCU A;  3ZMU A;  3OMN B;  1K4D C;  3E8H A;  2K1E A;  3ETE A;  2VRZ A;  4W4L A;  1VQM V;  4TUY A;  2X6A A;  3L71 H;  4J42 A;  1CPY A;  2W0F C;  1B04 A;  4WFE A;  1GM8 A;  2XOK G;  5EIB C;  3N27 A;  4BIZ A;  4B08 A;  4ZIB A;  1K33 A;  2ZM6 B;  3P3N A;  3K3W A;  3B8M A;  4K8Z A;  1WLE A;  4PA4 A;  2KQX A;  2XAJ A;  3ASN B;  4N21 A;  2PUS A;  3EVK A;  2UXB O;  4CH5 A;  3ASO C;  3S3W A;  4DRX A;  4B3R O;  3EFF K;  1Q81 W;  3BHP A;  2A7W A;  2NR5 A;  3OT7 A;  1IBK O;  3CYO A;  3IJ4 A;  4CC6 A;  3SJA C;  3CC7 V;  1XMO B;  1E1Q G;  3W7X A;  3HKC A;  2LP7 A;  5LXT A;  2AHZ A;  1L8D A;  1YCI A;  2BTO A;  1KC8 W;  5J9P C;  1R6N A;  2ZR2 A;  1VMG A;  4WFA V;  4LF8 B;  4IGG A;  1OCR C;  1PL0 A;  1FXK C;  1FJG O;  1MMM A;  1KBH A;  4LFA O;  2L35 A;  3L72 H;  4KHP B;  1M56 C;  2BOC C;  4DV5 B;  1I0H A;  1QCE A;  5D5Q A;  4EB6 A;  4UCR A;  1US6 A;  4H13 B;  4O4L A;  2JDI G;  4LFC O;  1VF6 A;  4K3A A;  3CWB H;  4O2A B;  4LR3 A;  1GN6 A;  2P90 A;  4FFB B;  5CBH A;  4FJC C;  2UUC O;  4YIP A;  4DR4 O;  1IXB A;  3BA9 A;  1Q43 A;  3D36 C;  1V55 B;  1XMQ O;  1GRJ A;  3HR0 A;  2Q69 A;  5KX5 B;  1OHH G;  4X62 O;  2VQF O;  4NXN O;  2DJV A;  1WP7 A;  4TV8 A;  4EEQ A;  5IYZ B;  3ZN1 A;  2LJ2 A;  2XAG A;  1Q8I A;  4LF7 O;  3JSN A;  3FB5 C;  1RSO A;  1K3E A;  4HNA A;  1IUR A;  2WLK A;  3RN4 A;  5LMU O;  2EIJ C;  2ZE6 A;  4I4T A;  5BZB A;  1N4C A;  3AG1 B;  1X4T A;  3UT5 B;  3AG4 B;  4QJF B;  4JYC A;  4UV9 A;  2RQ6 A;  3THO A;  5JCO C;  1N33 O;  1YIT V;  2ZIM A;  4DR2 O;  2UXN A;  4JAA A;  3Q4H A;  2Y69 B;  3AG3 B;  1WPX A;  2HVK C;  1AI5 A;  3W7S A;  4R6Z A;  5FLX N;  2GTS A;  1BHA A;  5D5P A;  1IDS A;  2EJR A;  4RWU A;  2UUB B;  1VIB A;  3I56 V;  2QE7 G;  3ICX A;  2VWJ A;  1QHT A;  2W6I G;  5BMV B;  3K5N A;  3OGI B;  1ENV A;  4FM0 A;  4JZG A;  1AR4 A;  2Q9L A;  1Q6I A;  4MTO A;  4B7K A;  4TV9 B;  2BOB C;  1H2G A;  1V54 B;  3SR2 C;  1HW7 A;  1RP3 B;  2QM7 A;  4DV3 B;  3F5W C;  4DO2 A;  3RYF B;  4DV2 O;  4TWK A;  1SQV H;  1EN5 A;  1L0L H;  4AQY B;  5CMU A;  2EIL C;  3ML0 A;  3F7Y C;  3KCX A;  5E79 Z;  1XL6 A;  4LC1 A;  3P3P A;  2EIL B;  2Y0I A;  2OTJ V;  2HKO A;  4LF4 O;  1WN7 A;  4MTX A;  1FYJ A;  1NTM H;  4NR1 A;  4QNH B;  4G28 B;  3IAY A;  4PJ0 Z;  4Q20 A;  5C93 A;  1U97 A;  1Y6X A;  1Q7Y W;  3JAR A;  1MNG A;  2P4K A;  5L3B A;  4MVO A;  1W0J G;  3CCL V;  5KAF Z;  3A8T A;  2ZNJ A;  3JYC A;  2QTS A;  3ABU A;  1S5J A;  5AG2 A;  4QE7 A;  2IH3 C;  4PI0 A;  4P9P A;  1UPG A;  1GTO A;  3ZIA G;  4R7C A;  2UXB B;  4AHC A;  4B3R B;  4I5S A;  1N34 O;  1HNX O;  4MVU A;  2RN9 A;  4O4I B;  1Q6U A;  2ZXW B;  4WF9 V;  2WA3 A;  4X64 B;  2YS8 A;  1SET A;  3U0Z A;  1I94 O;  5B1B B;  1JVM A;  5CA0 B;  1XBL A;  4IHJ A;  2AW9 A;  5L3F A;  5KMG A;  3BPZ A;  2GHY A;  3CRQ A;  3K57 A;  2E5L B;  1FJG B;  4LFA B;  3K5O A;  3K04 A;  4A5U B;  4JI5 O;  5J2U B;  2YEV B;  5GON A;  4LCU C;  3SPI A;  3RGB A;  2Q0O C;  4JI7 B;  4LFC B;  3KZI Z;  2JJ2 G;  3ZRW A;  1P84 F;  1V9P A;  2GDS A;  4P30 A;  4JI1 O;  4CS4 A;  1I5Y A;  2QWO B;  2X7R B;  2UUC B;  4OGQ B;  4DR4 B;  4ZOL A;  4CH6 A;  4NXM B;  5H5N A;  3ZHS A;  4UVB A;  1KP3 A;  5B66 Z;  4X20 B;  2YSU B;  4X62 B;  2VQF B;  4NXN B;  3ABM C;  1VF7 A;  3ZN0 A;  5CB4 B;  3OGC C;  2G38 A;  2X0L A;  4LF7 B;  4X65 B; 
#chains in the Genus database with same CATH homology
 1OCC C;  2HLD G;  3ABM B;  4JTC B;  1FFT B;  3RVZ A;  1K34 A;  1YJ9 V;  3LDD A;  1QVG U;  1COW G;  1S3J A;  1N8R W;  1Q86 W;  1OCC B;  2H8P C;  3EHB B;  4HAM A;  1YJN V;  1FS0 G;  3CC4 V;  1AJN A;  4YXW G;  3E2E A;  1L1F A;  3B77 A;  4JYB A;  3KG2 A;  4TSF G;  1S77 D;  1QR8 A;  3OMI B;  1H8H G;  1F23 A;  2Y48 A;  2QA4 V;  2ITC C;  1JOY A;  3ASO B;  5LGN A;  2DQ3 A;  2DQ0 A;  1BMF G;  2HJF C;  3CCE V;  4EKW A;  1VQ8 V;  2ZDI A;  3JD1 A;  2LFS A;  3GWO A;  3A0R A;  4F4L A;  1S0V A;  4GT1 A;  4RQF A;  2IJK A;  2JIZ G;  3CCM V;  1I5X A;  2W6J G;  2HR3 A;  2ZDI C;  1NBM G;  4PA9 A;  4RQE A;  4Z1M G;  3AEI A;  4I9W A;  1H38 A;  3K08 A;  1R3K C;  3OEE G;  4PA6 A;  1K97 A;  3FYE B;  1R3I C;  1OCR B;  1EBO A;  1FXK B;  1M57 C;  4BW5 A;  3RW0 A;  4RAI A;  2JEX A;  1DTO A;  5KUK A;  1J95 A;  4U7O A;  1M56 B;  2WLJ A;  3CCS V;  3ABL C;  1FXV A;  1Q82 W;  1TUE B;  1NJI W;  3FB6 C;  4UVA A;  4E2L A;  2ZXW C;  2FTK A;  3BY6 A;  4RUE A;  3ABL B;  4JAV A;  3E8B A;  1YTF D;  2V1D A;  1S5H C;  3MD0 A;  2DYS B;  2V7Q G;  4DXW A;  4H33 A;  1YTF B;  5B1B C;  1OCO B;  3MHH C;  2ITD C;  1S72 V;  3ZJZ A;  2Q67 A;  3K79 A;  1RM1 C;  3SPJ A;  3DGE A;  3OM3 B;  3SYQ A;  2DW4 A;  4H37 A;  3W7W A;  4XBF A;  2XAF A;  1B6Q A;  5EC1 C;  1FXH A;  1RM1 B;  1NH2 B;  1Y4M A;  4WFF A;  1G8M A;  2B5U A;  3ZRS A;  5IDJ A;  3CMA V;  3T1C A;  5LHG A;  5H9C A;  3TK1 A;  5CA3 A;  3E89 A;  3CME V;  1QLE C;  2DYR C;  5B3S C;  1QVF U;  3FKS G;  4PDM A;  1R73 A;  1THZ A;  1QLE B;  4MVS A;  4HZ3 A;  2DYR B;  4G2K A;  3CD6 V;  3MHS C;  2P6J A;  3SYP A;  1AI6 A;  3STL C;  1P4R A;  4X88 A;  5L3C A;  3CCR V;  2B1I A;  3ZCC A;  4R50 A;  2WWW A;  5LGU A;  2EZO A;  2IW5 A;  3TCU A;  4X8A A;  1PNM A;  3ZMU A;  4CZZ A;  2EIJ B;  3G71 V;  3OMN B;  4WCE V;  3TET A;  3ABK B;  1K4D C;  3E8H A;  4R8C A;  2X6B A;  4UVC A;  2K1E A;  3OW2 U;  3CC2 V;  3ETE A;  4KFM A;  2M7W A;  4UXN A;  1BL8 A;  2XAQ A;  3P30 A;  4FIP C;  1VQM V;  2NLJ C;  2X6A A;  2DWD C;  1CPY A;  1RPO A;  5B1A B;  2HG5 C;  2W0F C;  2ZQM A;  4N23 A;  2QEX V;  4WFE A;  1SER A;  1GM8 A;  2XOK G;  3FYI B;  3LSQ A;  3OR7 C;  4GX2 A;  4BIZ A;  5LGT A;  5EBW C;  4P9O A;  3CP1 A;  1K33 A;  3ZMT A;  3ETD A;  4BIU A;  2A9H A;  2Q6A A;  1VQ5 V;  1XL4 A;  3K3W A;  5DN6 G;  1AJP A;  3B8M A;  3CXC U;  1WLE A;  2IJH A;  3ZMS A;  5CN0 A;  3QNE A;  2PI4 A;  4PA4 A;  3VOU A;  3E86 A;  1MG1 A;  1E1R G;  3UM7 A;  3JCZ A;  4MS2 A;  3ASN B;  2XAJ A;  4N21 A;  1GMG A;  5E1A C;  3K9A A;  3ASO C;  4QIW F;  5FL7 G;  3EFF K;  3SPG A;  1Q81 W;  1NVP D;  2WLN A;  2C2A A;  4JTD B;  3H01 A;  2XAS A;  3CYO A;  1PD3 A;  1NVP B;  1K4C C;  2IJJ A;  1P7B A;  3CC7 V;  1K92 A;  1E1Q G;  3W7X A;  4HYO A;  3LDE A;  4MVQ A;  4JTA B;  2EIK B;  2LP7 A;  3PJS K;  2AHZ A;  1FXK A;  1OCZ C;  1KC8 W;  1ZWI C;  2OCC C;  3E8F A;  3E35 A;  4UV8 A;  1VQ6 V;  1AJQ A;  1HWY A;  1KEC A;  1R6N A;  2ZR2 A;  5J9P C;  2UXX A;  2ATK C;  1OCZ B;  3JD3 A;  4LP8 A;  4U7N A;  1GM7 A;  3NXS A;  4WFA V;  1OCR C;  1VQ9 V;  2OCC B;  1PL0 A;  1FXK C;  3OMA B;  3VBB A;  1ROP A;  5EK0 A;  3CCJ V;  1NKD A;  1YIJ V;  1M56 C;  4JAS A;  2BOC C;  3F7V C;  1QCE A;  2WLL A;  3SYO A;  3X2Q C;  4GX0 A;  3I55 V;  3UKM A;  5IYD O;  3AG2 B;  5B1O A;  1ORQ C;  2WLI B;  3DTU B;  3FB8 C;  2Q68 A;  4KUM A;  2JDI G;  3X2Q B;  3JD0 A;  2DYS C;  2ZD9 A;  3WG7 B;  3E83 A;  1OCO C;  4MSW C;  1VQ4 V;  4MT8 A;  2WLL B;  2P90 A;  1AR1 B;  3K0G A;  1S76 D;  1QR9 A;  5CBH A;  1NR1 A;  4FJC C;  2JJ1 G;  1K8A W;  2IU3 A;  3D36 A;  1YSC A;  1NH2 D;  4FMT A;  3CPW U;  1AI7 A;  3ZMZ A;  2WLM A;  4TT3 G;  2PI5 A;  1V55 B;  3QO7 A;  2Q69 A;  1VQN V;  3P32 A;  1PNK A;  1GK9 A;  1OHH G;  1MSW D;  4MTF A;  4MVR A;  3ZN1 A;  5LHI A;  2GSM B;  2R9I A;  2XAG A;  5LHH A;  1YJW V;  2OT5 A;  1KKD A;  5EBL C;  2WAM A;  3FB5 C;  1K3E A;  3W7U A;  3SYC A;  4ZKI A;  3OR6 C;  2WLK A;  1H8E G;  1R3L C;  2EIJ C;  5HFM A;  3ABK C;  3HPL C;  4MW8 A;  3W7T A;  4KP4 A;  5BZB A;  4FPP A;  3AG1 B;  4QPK A;  2DWE C;  5EC2 C;  2LFR A;  3AG4 B;  2WPD G;  4QJF B;  2EIN B;  4JYC A;  4UV9 A;  1VQL V;  5B1A C;  1YIT V;  2Z5U A;  3BEH A;  2CK3 G;  2UXN A;  2Y69 B;  1OZ0 A;  3AG3 B;  3OE7 G;  1WPX A;  2B1G A;  1LNQ A;  2HVK C;  4CBC A;  1AI5 A;  2XND G;  4R6Z A;  5CBF A;  4JAU A;  3W7S A;  1M90 W;  3GB7 C;  5HFL A;  1AI4 A;  1BHA A;  2HFE C;  2WSS G;  4XDL A;  1F4N A;  2EJR A;  1F4M A;  4RUF A;  1JQ0 A;  3I56 V;  2QE7 G;  3T2M A;  1K7D A;  3R65 A;  1F51 A;  3SJQ C;  2KB1 A;  2P7T C;  2W6I G;  4MVM A;  4PA3 A;  4XDJ A;  1W2B U;  3RBZ A;  1ENV A;  1G4Y B;  3LSS A;  4ASU G;  3ASN C;  3ZRW B;  2IJI A;  2F43 G;  2Z3Y A;  4MTO A;  3K0D A;  2BOB C;  1H2G A;  1V54 B;  3QO8 A;  3ETG A;  2QM7 A;  2WLH A;  3F5W C;  3JD4 A;  4WFG A;  4MTG A;  4DO2 A;  2MK3 A;  4LBE C;  2A0L A;  4TWK A;  4PDR A;  5CMU A;  1SZT A;  1VQK V;  2EIL C;  1JX9 A;  3ML0 A;  4GX1 A;  3F7Y C;  2EIK C;  1XL6 A;  4LC1 A;  4MVZ A;  3ZRX A;  4RO2 A;  2EIL B;  5IY5 C;  5L3E A;  2XAH A;  2OTJ V;  3SPC A;  2D3O W;  4XDK A;  1K73 W;  5IY5 B;  2HKO A;  4JF3 A;  1VQP V;  4P2Z A;  3IFX A;  5DM6 V;  2WLI A;  4MTX A;  2X6C A;  3OEH G;  1YI2 V;  1SES A;  1YHQ V;  4QNH B;  4G28 B;  4Q20 A;  5H6Q A;  5C93 A;  3AG2 C;  4MW3 A;  2ZR3 A;  1DLB A;  5KUM A;  1PNL A;  4GCZ A;  4QE9 A;  3T4Z A;  3WG7 C;  2R9R B;  1JCH A;  1Q7Y W;  4PA7 A;  2OTL V;  1NR7 A;  1GKF A;  3LDC A;  1RPR A;  1ARO P;  4GX5 A;  4BAY A;  5L3B A;  2QTO A;  1BHB A;  1GM9 A;  4MVO A;  1W0J G;  3CCL V;  2IH1 C;  4ZBM A;  4JGS A;  5CBG A;  3IC7 A;  4QPJ A;  4PDV A;  2IU0 A;  2P67 A;  4X89 A;  4UUJ C;  2A79 B;  3JYC A;  1MOF A;  3M99 B;  3ABU A;  1NQT A;  5IYB O;  2EZP A;  4PEL A;  3SYA A;  3LUT B;  3RVY A;  4QE7 A;  2IH3 C;  3ZRV A;  1R6K A;  1CEZ A;  1V55 C;  3FB7 C;  3OUS A;  2EIM C;  4P9P A;  1M57 B;  1KD1 W;  1GTO A;  3ZIA G;  4R7C A;  4WFB V;  3CCV V;  2QKS A;  4I5S A;  2EIM B;  2H94 A;  4MVU A;  5H6R A;  1EFR G;  4FK5 C;  4WF9 V;  2ZXW B;  2AHY A;  1K9M W;  1VQO V;  5L3D A;  1SRY A;  1CP9 A;  3SPH A;  5GW7 A;  4WFH A;  1SET A;  3E8G A;  5KA6 A;  5LBQ A;  1JJ2 U;  5B1B B;  1K5S A;  1JVM A;  3OUF A;  1DF5 A;  3T4D A;  5L3G A;  4J9Z B;  2JEU A;  2YEV A;  3B8N A;  3IGA C;  3JD2 A;  2JK5 C;  5L3F A;  2GHY A;  3AG1 C;  1IXM A;  5EBM C;  3CCU V;  3AG4 C;  1PKX A;  2EIN C;  3G6E V;  1EZJ A;  1E79 G;  3D3I A;  3K04 A;  4G27 B;  3K03 A;  2QM8 A;  2YEV B;  2Y69 C;  4LCU C;  3AG3 C;  1VQ7 V;  3SPI A;  3WFV A;  5B3S B;  3HB3 B;  4PDL A;  1K5Q A;  5B1N A;  1DF4 A;  1M9N A;  3STZ C;  1M1K W;  2JJ2 G;  3OAA G;  3ZRW A;  5IYC O;  2HVJ C;  4OXS A;  3OFN G;  4P30 A;  2NNU A;  1KP2 A;  1MAB G;  1I5Y A;  1GO3 F;  2X7R B;  3ABT A;  1R3J C;  3ZMV A;  1QBZ A;  2EBO A;  1V54 C;  3G4S V;  4UVB A;  3LNM B;  1KP3 A;  1Y66 A;  5KA5 A;  3QO5 A;  1QLN A;  4L87 A;  2YSU B;  1JPX A;  1KQS U;  3ABM C;  3CCQ V;  1W0K G;  3K06 A;  4J9Y B;  3ZN0 A;  3OGC C;  4JPR A;  2X0L A;  1UJW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...