1Y4MA

Crystal structure of human endogenous retrovirus herv-frd envelope protein (syncitin-2)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
NIDTMAKALTTMQEQIDSLAAVVLQNRRGLDMLTAAQGGICLALDEKCCFWVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HERV-FRD_6p24.1 provirus ancestral Env polyprotein
publication title Crystal structure of a pivotal domain of human syncytin-2, a 40 million years old endogenous retrovirus fusogenic envelope gene captured by primates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 17
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1y4mA00
4G2KA 1F23A 1Y66A 4N23A 1QR8A 2M7WA 1DF4A 1K33A 5KA5A 2LP7A 1DF5A 1QCEA 4FIPC 4FK5C 3MHSC 3M99B 1I5XA 2EZPA 3MHHC 3WFVA 1MOFA 1EBOA 2X7RB 5KA6A 1SZTA 1DLBA 5CN0A 3P30A 3CP1A 1JPXA 1ENVA 3B77A 3B8NA 3H01A 5HFLA 4JF3A 5CMUA 4FJCC 1QR9A 1Y4MA 2EBOA 3GWOA 1JQ0A 3K9AA 2EZOA 1I5YA 5H9CA 5HFMA 1MG1A 4JPRA 1QBZA 4JGSA 4N21A 2OT5A 1K34A 3CYOA 3B8MA 2P6JA 4E2LA 2MK3A
chains in the Genus database with same CATH superfamily
2OWOA 4BAYA 1T5EA 3QNEA 3T1HO 1YITV 4CC6A 3CXHF 4OX9O 3X2QC 2YUAA 2E76B 4DUYB 3ZRXA 3UT5A 1NH2B 4B3RO 1W59A 3E8HA 3CC7V 4PDVA 5LP6C 3T4DA 3MDSA 1K97A 2EIJC 3HKEA 1DF4A 2N04A 5GONB 4I0XB 2JIZG 4TQDA 4QJFB 3PN1A 1YIJV 2E5LB 4RUEA 1KC8W 5LBQA 1OCOC 4Z2WA 2Y4TA 2GUZA 3HKBB 4O4JB 1CPYA 5J2TB 5DM6V 4X62O 1I7FA 1IZ3A 3FB6C 1NU1H 5LGNA 3HKDB 3E8FA 4G28B 2ZM6B 2YIAA 2CK3G 1VQ7V 1SA0A 1JJ2U 2QTOA 3OUFA 3CEIA 4JI5O 3OE7G 5EYPB 3E35A 1RM1B 1XNQO 2PGGA 1R6TA 3LSUA 4KUMA 3SPGA 3DXRA 1YJ9V 4DV1B 1N34B 2DWEC 4EKWA 4DV5B 4P9PA 3FAVB 3VQYA 1FKAO 3OEEG 3LSSA 1PM9A 1N36O 1WA8B 4L8JA 5B1AC 2IJKA 3CHXA 4B3MB 5AG2A 1EZVH 4Q20A 4TOIA 3JD0A 4AQYO 2H94A 1AI5A 4NVPA 1SKVA 4HYOA 1HNXB 1QVGU 3D8CA 3RYCB 1Q82W 3T1YO 2HHHO 2A9HA 4I50B 3MHHC 3DGEA 4JI0O 4DYLA 1M57C 1N0JA 4A5UB 3UKMA 1URFA 5KHHA 2UUBO 2RJZA 5KMGA 5BY1A 1Q90D 2UXCB 2WLIA 3TXQA 4X9QA 4PJ0Z 1FFXA 3CC2V 4DR7B 1CXZB 2W6JG 2JS5A 2R9AA 3E2EA 2CTPA 2PI4A 1VQ8V 4WFAV 4DUZO 1M9NA 4MVQA 4UFZA 3SYPA 3UQ8A 4DK1A 1E1QG 5DECA 4B7KA 2WWWA 3MD0A 4JI3B 4LFBO 2K1EA 2O57A 2LQTA 3WU2Z 2AZ0A 1KKDA 3CRQA 1K92A 2Q73A 2FKXA 5JQGA 2NR5A 1NTZH 4FLZA 1Q5OA 3SGIA 4TQFA 4R8CA 3T4ZA 4CC5A 3CCSV 3SYOA 4X1YB 1HNZB 2KG7B 2JJ1G 2A06H 4CBCA 4PA4A 2YICA 3RYHB 1CEZA 1Q8IA 3ZRVA 1SF9A 1WLEA 1DK1A 2HJDA 1FAFA 4LF8B 4MS2A 4I4TA 2WA4A 1FFTB 2F1MA 4O4LA 1HR0O 1P84F 3IC7A 3OUSA 3D36C 3IAYA 1YF2A 3LSQA 3L75H 3OFNG 1NVPB 2OIEA 4TUYB 3CCJV 1MABG 1Y76A 1YZBA 5D5PA 2AGAA 5EC2C 1X59A 5IYZA 1YVWA 4LF5O 4ASUG 1GM7A 1ZAUA 1WB8A 2Y0PA 3DC6A 1BT8A 3CRRA 2DYRB 1Z2GA 4DR1B 4GUNA 4LF7B 1NTMH 1MZEA 1GAXA 4CS2A 5L3BA 4BWAA 4P2ZA 2P22C 1VQ6V 4ZIBA 1XREA 4NTXA 5CBGA 1XDCA 2ARHA 2LP7A 5IWAO 2M6YA 1YSCA 1LUVA 4X1KA 5FNVB 1ENVA 1I08A 1ROPA 3H01A 1Q6HA 2XHBA 3RYIA 1EN4A 2YXYA 1KB9F 1IVSA 4JZGA 4W4KA 1ZTEA 5JCOC 3TCUA 3G6EV 4RAIA 3E8GA 4ZBMA 2BTOA 2CH7B 5IJ9A 4FK5C 2P5OA 3K03A 3ABMB 3OEHG 1JMKC 3W7WA 3SJQC 3OMAB 4JASA 3NR7A 3K5MA 1W0KG 4XDJA 1HWYA 1WAZA 2WSSG 1AP6A 2F23A 3ETQA 4WBNA 4JYBA 3N2KB 4CS3A 5KAIZ 5BMVA 3KKYA 1DGSA 4KHPB 2QWQB 1XEQA 4U3JB 5D5QA 1KD1W 4GX1A 1WA8A 1S77D 4MVSA 5H6QA 3JATB 2BOCC 3J80N 3ZMZA 2LJ2A 3CJHB 4DR6O 4WFHA 1RP3B 4X65O 3AG3B 1OHHG 4MVMA 4CZZA 5L3GA 4I50A 1N8RW 1AB3A 1Q43A 2VRZA 3VQWA 1VP7A 3ZRSA 4XBFA 5IY5C 2EILC 3IFXA 5KAFZ 3K04A 2EJ7A 2JJ2G 4KFMA 2ZDIA 2QA4V 3F5WC 4DV2B 5FPOA 3STZC 2VQFO 2IBZH 1XNRO 4QPKA 1WPBA 4AI8A 3ASNB 4NTYA 1EM1A 2JGDB 1WB7A 3VQXA 2GSMB 3UT5B 2F66C 2HJFC 3B2EE 1FXKA 2YDEA 2UXBO 2E75B 3CYOA 4E2LA 1US6A 2DYRC 2QWPB 3LUTB 3L9DA 3IJ4A 1XBLA 1Y74A 2XASA 3HKEB 2IW5A 3ZHVA 1FXHA 5EBMC 5K1PA 3DC5A 3AEIA 5A9GA 3ETDA 3OTOB 3OGIB 4WFBV 2QR4A 1NI8A 4X1YA 2AW9A 2GUZB 3RN4A 2RN9A 1XMQB 5L3EA 5BR8B 1V54C 4DUYO 1B04A 3LNNA 2EINB 3W7UA 2ATKC 2LW1A 1H8HG 2M7WA 5KHJA 3ABKB 3APQA 1R6KA 2QM8A 3LDDA 2X7RB 1I94B 2RNBA 1SA0B 2F95B 3WG7B 4TUYA 2EX3A 5CB4A 4AILC 1Q6UA 2BTQA 1H2GA 2QKAA 4DXWA 4DV4B 1EN6A 3WB0A 3M7MX 4CH3A 1SQFA 4YJ2A 1PNKA 2P6JA 3DXRB 4FLWA 3ABMC 3LDEA 3R66A 4FIPC 2FMLA 2YI9A 5B3SC 2X6CA 4GKKB 2QM7A 2V4DA 4B08A 1ZX3A 3K9SA 2EULA 4UUJC 1P4RA 3KCXA 4FZ1A 2A0LA 1AROP 5LA6A 4LFCB 4DV7B 1D5AA 5E79Z 1OCCB 4LF9O 1UJWB 2EZPA 4GKJO 1F7YA 1N34O 2XNDG 3AK2A 5FL7G 2V7QG 1Q86W 1S3JA 4LF6O 1S5HC 3VBBA 1IDSA 4QE7A 4MVRA 2ODMA 1IBLB 3STLC 4JI7O 1FJGB 4UCOA 5KMGB 4BIUA 4B3MO 3TK1A 2IJHA 2WLIB 2ZE7A 3I5DA 1VQPV 1KU9A 1FFXB 1VQMV 5EZYA 1R3JC 2W6IG 3BPZA 1OCZC 3CRCA 1HNXO 1PPJH 3RVYA 2XAFA 3B8NA 3LDCA 5LMNB 1VQLV 1J95A 1PNLA 2QGNA 3SR2C 3E86A 1QR8A 4J41A 3KG2A 3ZHTA 1KKCA 2ITCC 4DV3B 1I5XA 4DV6B 3JSNA 2WLJA 5JQGB 1AJPA 1NR1A 4DR7O 4YY3B 3JAWB 2UUAB 3HKCA 1IXMA 4JI6B 5ITZA 3CMAV 1HW7A 2UU9O 4HNAA 1LR1A 4JTDB 1IBMB 2Q67A 1S5JA 3A0HZ 4UVBA 2IH3C 4LWSA 3T2MA 1EN5A 4JI3O 4I4TB 4IIJA 1FPOA 4O4LB 1N0NA 2ZXWC 3AG4C 4X88A 1HNWO 4K0KO 1TUBA 1TUEB 2Z0AA 3KCYA 1VF6A 5LXTB 2YIDA 1E79G 2ADQB 3N27A 1Y76B 2QEXV 3AG1B 5IYZB 4TV8A 4LF4O 4DO2A 5KHKA 3BA8A 1FXVA 1NTKH 1MSDA 4UV8A 3ZMUA 1VQKV 2YIBD 4LF8O 2JGDA 2AXTZ 2GV9A 1NKDA 2OYQA 4FZ0A 2B5UA 3ABLB 2F93B 1H2SB 2A3QA 1PL4A 2WAMA 4JTAB 1W2BU 3ZRWA 1KP2A 1Q6IA 1Y6XA 1JFFA 2UXXA 3IGAC 1YEWA 1MMMA 2DOSA 4LR3A 5IDJA 2BSKA 4JF3A 4X1KB 2C2AA 2JRIA 4DR1O 4WFEA 3RYIB 4DRXA 4OXSA 1G8MA 3G71V 1OCCC 2HP8A 3ZMVA 2A7WA 4CH4A 2FTKA 4UVCA 4LP8A 3QF7A 5IJ9B 1JJOA 4I9QA 1G1XB 1N32B 1WPXA 3A0BZ 4GYCB 3UO3A 1XI1A 2HLDG 4J9ZB 1AILA 4DR2B 3ASOB 4J7KA 4NXNB 5LHHA 4WBNB 3SPHA 1H2LA 5BMVB 2DW4A 2QM4A 1GMGA 1W0JG 3MHSC 3FB5C 2AHYA 2UUCB 4FM2A 2XAHA 1XMOB 3I56V 1JQ0A 3K3WA 4B3TO 4O4IA 3ZN0A 5LP6A 2P4VA 1F51A 2YEVA 2YXHA 3PJSK 4U3FH 3LNMB 1JX9A 4MTOA 2VS0A 3THOA 3K59A 2CGOA 5IYCO 1YJNV 3CCEV 4UV9A 1N33B 1H2NA 3CP1A 4MT8A 3HB3B 4TV9B 4KHPO 1QR9A 1B3QA 4Z1MG 2CE4A 2H3OA 2GTSA 2EIMB 5LHGA 2DN9A 1IURA 1F23A 2YXLA 4ZI7A 4HZ3A 3SPCA 3CWBH 1H2KA 3QO7A 4LC1A 3JARB 2HG5C 4NYKA 1E1RG 1KUQA 1K9MW 2IU0A 2PTMA 2CTWA 2P67A 4GX5A 2LW7A 1JOYA 1GM9A 1QBZA 2ILMA 1FXKB 2F43G 4PA7A 3R65A 2R70A 3CRAA 3RYFB 1RPOA 2DE0X 3K08A 1ORQC 2VWKA 1Y74B 4D7TA 4KL1A 1BCCH 4DV2O 1SZXA 4JV5B 4GLXA 1AI6A 5KHGA 3ABLC 3JAWA 4FMTA 1G6UA 3K5NA 2HR3A 4LNUA 1K4CC 2DQ3A 5L3DA 1OCRB 4TWKA 5GTHZ 1QLEB 4NB5A 4BIZA 1M5IA 3CCMV 1TAEA 1XUQA 1XL4A 3L73H 1SQXH 3ZN1A 3P3PA 2X0LA 4DV0B 2UXDO 5LXTA 1ZWIC 3JAKA 4WFFA 1VQOV 1O9HA 5CB4B 2BTQB 4FVMA 4QPJA 3ZHSA 3CPWU 2CTRA 4OX9B 3H1IH 4MTFA 1WNSA 4YJ2B 1MA1A 4B3RB 3OTOO 1YTFD 3ZS8C 3H1KH 3BCCH 3EVKA 3IC9A 1XMQO 2PZSA 3BFRA 1S0VA 2ZNIA 1V55B 3G6BA 3BEHA 1IBKB 4MW8A 2X6AA 2CTQA 4YIOA 1RM1C 1BL8A 1TA8A 3ZMSA 4I9WA 4NXMB 4N21A 2ZR2A 2ZKOA 3CCUV 5LA6B 1M56B 5JH7A 3M8AA 4GT1A 2BOBC 2Y4UA 2OCCB 2YS8A 1L8DA 2JS3A 4X62B 5KHIA 3CCRV 4DK0A 3CRMA 1NH2D 4JI4O 2HVJC 5KUKA 3P3NA 4JI2O 4ICGA 1HP8A 3CB2A 4K8XA 1UPGA 4H13B 4YXWG 1M1KW 2PI5A 2DWDC 3WFVA 1PL0A 1MOFA 2Q4PA 5EZYB 4DV7O 2JEXA 4BIOA 3P30A 1B6QA 4FLUA 3K57A 2Q68A 3J81N 2JK5C 3SYCA 4YIPA 4PV1B 4XDKA 5KUMA 2Y0IA 4F6RB 3E22A 3FKSG 4EB6B 1AR5A 1IBLO 5F2VO 1FJGO 5GW7A 4KXRA 3RGBA 5BZBA 4DR3O 4QNHB 3RBZA 3FD9A 1JPXA 3TXSA 2CUGA 2JDIG 4F6EA 4IL6Z 3K58A 2HHHB 3OTFA 1BGYH 3HKCB 5ITZB 1GRJA 5LMNO 4HNAB 3ICXA 4X89A 3EHBB 2RQ6A 1VF5B 4LWSB 3SPIA 2UUBB 4IIJB 3U0ZA 1K5QA 1VARA 1NBMG 4TV9A 3JSLA 2Y69B 1TUBB 4DV6O 1MG1A 3B09A 1OCRC 2QWNB 4LBEC 2B1IA 2OTLV 2KQXA 1QLEC 3A8TA 4YY3O 4DUZB 1SQGA 1J5EO 1K73W 2P06A 5GTIZ 4TV8B 4JI6O 4RQEA 3JARA 2BE3A 4P30A 1IBMO 3VOUA 3JALB 4LFBB 2FYUH 1VQ5V 3S3XA 2AZ2A 1GH6A 5LOVA 1VMGA 5IT9N 4G27B 4JZ2A 1PNMA 4O2BB 5HFMA 2Q0OC 4WF9V 4X64O 2W0FC 3RYFA 4RWUA 4UCUA 3ZRWB 2JGUA 3EFFK 2QKCA 2XTAA 1JFFB 3RWRD 1BHAA 3A2FA 1K4DC 1SS3A 3SYAA 4IGGA 2L35A 2XUMA 3CMEV 3BVOA 4OGQB 1H38A 2BSKB 3G80A 4I55B 3EXAA 1L0LH 3CS5A 1R73A 4DRXB 2ZE8A 3J7AU 3ZJZA 1QHTA 2ZE5A 3DTUB 5LGTA 3B40A 1QCEA 5TISZ 4RUFA 2Q0AA 2DYSB 4GCZA 1R6NA 4FM1A 2HFEC 1BHBA 3OR7C 1SQBH 3O65A 3CCLV 4X20B 3K0DA 5C8YA 5L3CA 3CCVV 1S72V 2NNUA 2E5LO 4LH6A 4JI1B 3CCQV 4G2KA 5J2UB 1P49A 2HKOA 1K33A 1Q7YW 2UXNA 3QG5A 3SPJA 3DSQA 3X2QB 4JI8B 2AHZA 2ZM6O 1SQVH 4FJCC 1NVPD 3QO5A 2PF4E 1N32O 1GN3A 4O4IB 5LP6B 4FFKA 4BW9A 2YEVB 3K5OA 4ABMA 4DR2O 3CE2A 2EIJB 2YC0A 5A2QN 4NXNO 4DV1O 5JJEB 3AG3C 4DV5O 3E83A 5C93A 4GX2A 5CA3A 3H1HH 4RQFA 2YSUB 3F7VC 2UUCO 1EZJA 4K3AA 3QO8A 1XMOO 1NZ6A 5JVDA 1BQ0A 5CA0A 2N74A 4ZI7B 1DF5A 2ZNJA 4F4LA 3JD3A 3FX7A 2P90A 1JR9A 3OT7A 3BABA 4L87A 5EK0A 1VF6C 5HFLA 1LNQA 5LMUB 2IM9A 1K34A 4LFAB 4Z1VA 3UO2A 4F6RA 5JJJB 4EB6A 3TGUH 4PDRA 3W7TA 4XDLA 3ASNC 1XOUA 3C3TA 1R1BA 1BQZA 2UXCO 1ZUQA 1AVMA 5IJ0A 5B1AB 1NS1A 4X66B 2IJJA 2R72A 1Z5VA 4LNUB 4FLVA 3AG2B 3BY6A 4UB8Z 1AR4A 2Q5ZA 3L70H 1S5LZ 3I55V 2LFRA 2MW2B 2R9IA 5LYJA 1M57B 3P32A 2VQFB 4NR1A 4H33A 3JAKB 1XNRB 2EINC 1VF7A 4FFBA 4JV5O 1JCHA 2KSDA 2WPDG 3K5LA 3ABKC 2YIBA 1U97A 5J9PC 1HNZO 4BW5A 3G67A 5B5EZ 3JALA 2ZR3A 4D6TH 3WG7C 1WN7A 3JCUZ 4JYAB 3E8BA 4MW3A 4IYHA 4O2BA 3N2GA 5B66Z 4B3SB 2WLHA 4IHJA 5B1NA 1OV9A 4DV0O 3MAQA 2RDCA 1JVMA 1Z5WA 2OIGA 5JH7B 2VQEB 2L6LA 1VQ9V 3GB7C 4I55A 4JPRA 3OW2U 1IBKO 4LF7O 4JGSA 2Y48A 4IT5A 3K06A 5KX5A 1GN4A 2ETNA 4NXMO 4W4LA 2QKSA 3ETGA 1RSOA 1NT2B 1K8AW 4O4HB 5CMUA 1YJWV 4X20A 1WP8A 1IX9A 2QE7G 4FLTA 5EIBC 5J2UA 1BZKA 3K0GA 4PA3A 5B1BB 3E22B 3OD4A 4WCEV 2NLJC 1BE3H 2Q69A 2ZIMA 3AG7A 1GKFA 1L1FA 4LF9B 2Q8VA 4GZRB 3GWKC 1R3LC 4GKJB 5K1XA 1FYJA 2LO1A 4CH6A 2FL4A 1Y66A 2ZQMA 3QVNA 3U10A 4LF6B 1P7BA 1R3KC 4JI7B 2D3OW 1N4CA 1SQPH 3FFQA 1SETA 4MTXA 4ZKIA 1Q3EA 5H6RA 1TVKA 4YHHB 2H8PC 3ZCCA 5EBWC 4MVOA 3ZMTA 1SESA 1ZL8A 4QIWF 3AK1A 4DR4B 5H2FZ 3AG2C 1V9PA 1X4TA 5BXZA 4GX0A 5LHIA 3RT3C 4WFGA 4H37A 3CXCU 3UM7A 4UVAA 1EFRG 3FB7C 1FD9A 2F4VB 3L71H 2B9ZA 3U11A 4R50A 5LOVB 4PA9A 4J11A 1QQCA 3AG1C 3GVMA 1G4YB 2Q9LA 1SRYA 1BS3A 4TSFG 2HVKC 2X6BA 1MNGA 5EIBD 3ETEA 4QE9A 4HBNA 3TJTA 2CGNA 1VQNV 5KA6A 2UU9B 2OCHA 4PI0A 3TETA 3HPLC 2GBOA 3RFRA 2PUSA 1NR7A 3CSXA 2CAZC 4K35A 3ZIAG 4FLXA 2ZT9B 4ZOLA 1HNWB 4K0KB 1DTOA 5DEDA 2YI8A 4X1IA 4J7ZA 2P7TC 3RW0A 4BR6A 4DR5B 4EFEA 1COWG 3WB1A 4J80A 3SJBC 4MSWC 4O2AB 3JD1A 4LF4B 2JVDA 5IY5B 2IU3A 3T1HB 2EILB 4I7ZB 5C8YB 1I0HA 4C7UA 3JYCA 3AK3A 1MSWD 5EBLC 1U96A 4DW1A 1M93A 5BR8O 3BRCA 3C3SA 5KLVH 2XOKG 4X8AA 3T1CA 1OZ0A 2RMKB 3GWOA 1H2MA 2E3CA 3ASOC 5JJNB 1RFYA 2XAJA 1A32A 1I94O 5B1BC 2D2CB 5LGUA 2WLMA 1AI4A 3CC4V 2ZD9A 4JAUA 3JD2A 3KZIZ 1XQ8A 1QNMA 1XL6A 4DV4O 2QWRB 5CBHA 1YI2V 4JI1O 1DLBA 5FLXN 3ZEDA 3SDLA 3SJCC 4JAVA 4LH7A 2WLKA 4JI8O 4GKKO 2WA3A 1V54B 5CA1B 5GONA 4I0XA 4ZHQB 4JI5B 5JVDB 2HEPA 5CA0B 3ZHQA 3JD4A 4P9OA 1XNQB 4LFCO 4PDMA 3VQVA 5CN0A 1GM8A 3D36A 2E74B 2FB5A 4J42A 4J9YB 4O4HA 4KP4A 1VEWA 3HKBA 4O4JA 2QTSA 4JAAA 2EIMC 5J2TA 2XAQA 2ZDIC 3HKDA 1QLNA 1IXBA 4PA6A 3ABTA 4EEQA 1D2DA 1NJIW 1N36B 4OPAA 2XT9A 4PELA 2P4KA 4UCSA 3JASB 2LGWA 4B3TB 4YJ3B 1EBOA 3D3IA 1TGOA 1SZTA 1PV0A 2IJIA 3H1JH 4AQYB 5B3SB 4J7JA 5EYPA 1BSMA 1Y4MA 1O9GA 5IE9A 2WLLB 5IJ0B 1PD3A 3W7XA 1FXKC 1XILA 2ITDC 2GTAA 3T1YB 3NXSA 1AR1B 3ZX6A 1FS0G 3ABUA 3FYEB 3JCZA 5LMUO 4JI0B 3FAVA 3OR6C 1VIBA 1Y67A 4LFAO 4PDLA 3ML0A 3Q4HB 1RPRA 3JAMN 1QU7A 1B06A 5LYJB 4DV3O 4E4EA 2ZINA 4PHZA 1SC5B 2IH1C 2K9PA 4FFBB 1XHZA 2ADPA 2Q7HA 3RYCA 5JCOA 5IYBO 4MTGA 2G38A 4X66O 4H44B 2UUAO 2Z3YA 3F7YC 4Q6GA 2QSAA 1Q81W 3G4SV 1M90W 1OCZB 2QWOB 2DMXA 4NTWA 4JYCA 3K79A 1I5YA 1AP5A 3N2GB 1AJNA 2LGQA 1MZFA 2WLNA 4IHJB 2EIKB 3SYQA 1V55C 4RO2A 2VWJA 1YXBA 2ZIOA 3QTCA 1GN2A 4LCUC 2R9RB 1YHQV 2KB1A 4B7EA 3ZBHA 3L72H 1KYOF 2EZOA 1HR0B 4UXNA 1AI7A 2ZCEA 1M56C 4JYAO 5E1AC 3L74H 5KX5B 3ZHRA 2UXDB 3O9OA 2OCCC 4B3SO 2A79B 3BHPA 4DW0A 3B4SA 4U7OA 3WB2A 4O2AA 4LF5B 2ZXWB 3OM3B 3AG4B 1S76D 1RSOB 1GK9A 3K9AA 1NQTA 2KG7A 2NN4A 3S3WA 2VQEO 3RYHA 1BMFG 3H1LH 3FB8C 4HAMA 4UCVA 3M99B 4PI2A 1PP9H 2KKWA 1VQ4V 2Q7GA 3F5TA 5FPRA 1H8EG 4QGPA 3W7SA 1UFIA 3H9VA 3E89A 5EC1C 2GDSA 3RVZA 5IWAB 4AHCA 1KP3A 1ZSPA 4NKGB 2B1GA 1JA8A 4JI4B 1KQSU 4IYIA 2DQ0A 1F4MA 4JI2B 4MVZA 3B77A 4UCTA 4K8ZA 4FM0A 2W0XA 2JEUA 1TVKB 1OCOB 5H9CA 4FPPA 1KBHA 1ZL8B 1GTOA 1PKXA 1THZA 3OMIB 5L3FA 2CDYA 5CA1A 2GHYA 4N23A 1QVFU 4ZHQA 3UCSC 1WP7A 5KA5A 2QJ1A 3OAAG 1K7DA 2ZE6A 2Z5UA 5LL6Y 4I5SA 3OMNB 5FNVA 2Y69C 2BCCH 2DJVA 2EBOA 2N05A 3CD6V 4J10A 5H5NA 4DR3B 1N33O 1XHXA 4MVUA 1YCIA 1ZLZA 2MK3A 5IYDO 4YHHO 2CH7A 1F4NA 1HDJA 1GO3F 3JASA 4DR6B 4UCRA 4YJ3A 4DR4O 4X65B 4R6ZA 1KMIZ 4TT3G 4PD4F 1GN6A 1K3EA 2QDOA 2XAGA 2WLLA 4CS4A 4JTCB 1L0NH 2Q6AA 4OPHA 2EIKC 1P7GA 3N2KA 2F4VO 3D3QA 1M4UA 4ZOLB 5B1OA 1CP9A 1YDXA 4U3JA 4X1IB 4CH5A 3JATA 3Q4HA 2LFSA 3CJHA 3CX5F 2EJRA 1R3IC 1J5EB 1KECA 3FYIB 5JWPA 2Q7EA 3HR0A 2OT5A 3BA9A 2PY5A 3A0RA 3ZHUA 2RCVA 1YTFB 3OGCC 1D5NA 2PYLA 1K5SA 2OTJV 3SJAC 5CBFA 2V1DA 4H0LB 1SERA 2DYSC 1OJHA 4EFBA 4FLYA 4JYYA 4X64B 2UXBB 1SQQH 4D7SA 4R7CA 2PYJA 1LUWA 4DR5O 4U7NA 5DN6G 1WJZA 3APOA 3C90A 4UB6Z 3BAAA 3B8MA 1AJQA
chains in the Genus database with same CATH topology
4TSFG 2HVKC 4BAYA 3QNEA 2X6BA 3FKSG 1YITV 3ABMC 3LDEA 4FIPC 5GW7A 3ETEA 4QE9A 5BZBA 3X2QC 4QNHB 5B3SC 3RBZA 2X6CA 1VQNV 5KA6A 3ZRXA 3TETA 1JPXA 2QM7A 3HPLC 1NH2B 4UUJC 1P4RA 2JDIG 3E8HA 3CC7V 4PDVA 1NR7A 2A0LA 3ZIAG 1AROP 3T4DA 1DTOA 4X89A 1K97A 3EHBB 2P7TC 1OCCB 2EIJC 3RW0A 1DF4A 1UJWB 1COWG 3SPIA 2EZPA 2JIZG 4QJFB 1YIJV 1K5QA 4MSWC 1NBMG 4RUEA 2XNDG 1KC8W 5LBQA 2Y69B 1OCOC 5FL7G 2V7QG 3JD1A 1Q86W 1S3JA 1S5HC 3VBBA 5IY5B 2IU3A 4QE7A 2EILB 4MVRA 1CPYA 1MG1A 3STLC 1OCRC 5DM6V 4LBEC 2B1IA 2OTLV 3FB6C 1QLEC 5LGNA 3JYCA 3E8FA 4BIUA 3TK1A 1MSWD 4G28B 5EBLC 2IJHA 2WLIB 1VQPV 1K73W 2CK3G 1VQ7V 1VQMV 4RQEA 1R3JC 4P30A 2W6IG 1OCZC 3VOUA 1JJ2U 2QTOA 1VQ5V 2XOKG 3RVYA 2XAFA 3B8NA 3LDCA 3OUFA 4X8AA 3T1CA 1OZ0A 3OE7G 1VQLV 4G27B 3GWOA 1RM1B 3E35A 3ASOC 1J95A 1PNMA 5HFMA 2XAJA 1PNLA 4WF9V 4KUMA 3SPGA 2W0FC 1YJ9V 5B1BC 5LGUA 2WLMA 3E86A 1AI4A 1QR8A 2DWEC 4EKWA 3CC4V 2ZD9A 3KG2A 3JD2A 4JAUA 4P9PA 3ZRWB 1XL6A 3EFFK 2ITCC 3OEEG 1I5XA 3LSSA 5CBHA 1YI2V 1BHAA 1K4DC 3SYAA 1DLBA 2WLJA 1AJPA 1NR1A 5B1AC 3CMEV 2IJKA 1H38A 1IXMA 1R73A 3CMAV 4JAVA 4Q20A 3JD0A 2WLKA 2H94A 4JTDB 3ZJZA 1V54B 2Q67A 4UVBA 1AI5A 4HYOA 2IH3C 3DTUB 3T2MA 5LGTA 1QVGU 1Q82W 1QCEA 4RUFA 2A9HA 3JD4A 3MHHC 4P9OA 2ZXWC 3AG4C 4PDMA 4X88A 2DYSB 3DGEA 1R6NA 4GCZA 1GM8A 3D36A 2HFEC 1TUEB 4J9YB 5CN0A 1M57C 1BHBA 4KP4A 3OR7C 3UKMA 3CCLV 1E79G 2EIMC 2XAQA 3K0DA 5L3CA 2ZDIC 3CCVV 1S72V 2QEXV 1QLNA 3AG1B 2NNUA 4PA6A 3ABTA 2WLIA 1NJIW 3CCQV 4G2KA 4DO2A 3CC2V 4PELA 1FXVA 2HKOA 2W6JG 1K33A 4UV8A 3ZMUA 1Q7YW 2UXNA 3E2EA 1VQKV 2PI4A 1EBOA 3D3IA 1VQ8V 1SZTA 3SPJA 4WFAV 2IJIA 1M9NA 4MVQA 3X2QB 5B3SB 3SYPA 2AHZA 1NKDA 4FJCC 1E1QG 1Y4MA 2WLLB 1NVPD 3QO5A 1PD3A 3W7XA 1FXKC 2B5UA 2WWWA 2ITDC 3ABLB 3MD0A 3NXSA 1AR1B 2WAMA 1FS0G 2K1EA 3ABUA 4JTAB 3FYEB 3JCZA 1W2BU 3ZRWA 2YEVB 1KP2A 3OR6C 1KKDA 2EIJB 2UXXA 1K92A 4PDLA 3IGAC 3ML0A 5IDJA 1RPRA 4JF3A 2C2AA 3AG3C 3E83A 5C93A 4GX2A 5CA3A 3T4ZA 4R8CA 4RQFA 4WFEA 3CCSV 2YSUB 3F7VC 4OXSA 3SYOA 1EZJA 1G8MA 2JJ1G 3G71V 4CBCA 4PA4A 1OCCC 3ZMVA 2IH1C 1CEZA 3QO8A 1WLEA 3ZRVA 4MS2A 5IYBO 2FTKA 1FFTB 4MTGA 2Z3YA 3F7YC 1DF5A 4UVCA 4F4LA 3JD3A 3IC7A 4LP8A 3OUSA 3LSQA 2P90A 3G4SV 4L87A 1Q81W 1M90W 1WPXA 5EK0A 1OCZB 3OFNG 5HFLA 2HLDG 4J9ZB 1NVPB 1LNQA 3CCJV 1MABG 4JYCA 3K79A 1I5YA 5EC2C 3ASOB 1K34A 1AJNA 4ASUG 2WLNA 2EIKB 1GM7A 5LHHA 3SPHA 4PDRA 3SYQA 2DYRB 3W7TA 1V55C 2DW4A 1GMGA 4XDLA 4RO2A 1W0JG 3MHSC 3ASNC 3FB5C 2AHYA 2XAHA 4LCUC 2R9RB 1YHQV 2KB1A 5B1AB 3I56V 1JQ0A 3K3WA 5L3BA 2EZOA 3ZN0A 2IJJA 4UXNA 1AI7A 4P2ZA 1F51A 1VQ6V 1M56C 2YEVA 3PJSK 5E1AC 5CBGA 3LNMB 3AG2B 3BY6A 1JX9A 4MTOA 2OCCC 2LP7A 2A79B 5IYCO 1YJNV 1YSCA 4U7OA 3CCEV 4UV9A 3CP1A 2ZXWB 1ENVA 1ROPA 2LFRA 3AG4B 3H01A 3HB3B 3OM3B 4MT8A 3I55V 1S76D 2R9IA 1GK9A 1M57B 1QR9A 3P32A 3K9AA 1NQTA 4Z1MG 4H33A 2EINC 2EIMB 1BMFG 5LHGA 1JCHA 2WPDG 3TCUA 1F23A 3ABKC 3G6EV 3FB8C 4HAMA 4HZ3A 4RAIA 3E8GA 4ZBMA 3SPCA 5J9PC 3QO7A 4FK5C 4LC1A 3M99B 4BW5A 3K03A 3ABMB 1VQ4V 2ZR3A 2HG5C 3OEHG 3W7WA 3SJQC 3WG7C 1H8EG 3OMAB 1E1RG 3W7SA 4JASA 1K9MW 3E8BA 4MW3A 1W0KG 4XDJA 3E89A 2IU0A 5EC1C 1HWYA 2P67A 4GX5A 3RVZA 1JOYA 2WSSG 2WLHA 1GM9A 1QBZA 1FXKB 2F43G 4PA7A 1KP3A 5B1NA 4JYBA 3R65A 2B1GA 1JVMA 1KQSU 1RPOA 3K08A 1ORQC 2DQ0A 1F4MA 1KD1W 4GX1A 1S77D 4MVSA 5H6QA 2BOCC 1VQ9V 3ZMZA 4MVZA 3B77A 1AI6A 3GB7C 3ABLC 4WFHA 4FMTA 2JEUA 3AG3B 1OCOB 1OHHG 2HR3A 5H9CA 4JPRA 3OW2U 1K4CC 4JGSA 4FPPA 2Y48A 2DQ3A 1GTOA 3K06A 4MVMA 5L3DA 1PKXA 1THZA 3OMIB 1OCRB 5L3FA 4TWKA 2GHYA 4CZZA 4N23A 5L3GA 1QVFU 1QLEB 4BIZA 5KA5A 3OAAG 1K7DA 1N8RW 2Z5UA 2QKSA 3CCMV 1XL4A 3ETGA 4I5SA 3OMNB 2Y69C 3ZN1A 3ZRSA 1K8AW 4XBFA 2X0LA 5IY5C 5CMUA 1YJWV 2EILC 1ZWIC 2EBOA 3IFXA 4WFFA 1VQOV 3K04A 3CD6V 2JJ2G 4KFMA 2ZDIA 4QPJA 3CPWU 2QE7G 4MVUA 2QA4V 3F5WC 2MK3A 4MTFA 3STZC 5IYDO 3K0GA 4PA3A 1F4NA 1YTFD 5B1BB 1GO3F 1S0VA 4WCEV 4QPKA 4R6ZA 1V55B 2NLJC 3ASNB 3BEHA 4TT3G 4MW8A 2Q69A 2X6AA 1K3EA 1GKFA 2GSMB 1RM1C 2XAGA 2WLLA 1BL8A 1L1FA 3ZMSA 2HJFC 4I9WA 4JTCB 1FXKA 2Q6AA 2EIKC 4N21A 2ZR2A 1R3LC 3CYOA 4E2LA 3CCUV 2DYRC 3LUTB 5B1OA 1M56B 1CP9A 1Y66A 2ZQMA 4GT1A 2BOBC 2XASA 2IW5A 1P7BA 1R3KC 1FXHA 2OCCB 5EBMC 2D3OW 2LFSA 4MTXA 1SETA 4ZKIA 2EJRA 5H6RA 3CCRV 3AEIA 1R3IC 1NH2D 1KECA 2HVJC 2H8PC 3FYIB 3ETDA 3ZCCA 5EBWC 4MVOA 5KUKA 4WFBV 3ZMTA 1SESA 4QIWF 5L3EA 1V54C 2OT5A 3A0RA 3AG2C 2EINB 1YTFB 3OGCC 3W7UA 2ATKC 4GX0A 1H8HG 5LHIA 1K5SA 2OTJV 4WFGA 4YXWG 2M7WA 5CBFA 1M1KW 2PI5A 2DWDC 4H37A 2V1DA 3ABKB 3CXCU 3UM7A 1R6KA 1SERA 2DYSC 4UVAA 3WFVA 2QM8A 1PL0A 1MOFA 3LDDA 2X7RB 1EFRG 2JEXA 3P30A 3FB7C 4R7CA 1B6QA 3WG7B 2Q68A 4U7NA 5DN6G 2JK5C 3SYCA 4R50A 4PA9A 1H2GA 3AG1C 4DXWA 1G4YB 4XDKA 5KUMA 1PNKA 2P6JA 3B8MA 1SRYA 1AJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G2K A;  1F23 A;  1Y66 A;  4N23 A;  1QR8 A;  2M7W A;  1DF4 A;  1K33 A;  5KA5 A;  2LP7 A;  1DF5 A;  1QCE A;  4FIP C;  4FK5 C;  3MHS C;  3M99 B;  1I5X A;  2EZP A;  3MHH C;  3WFV A;  1MOF A;  1EBO A;  2X7R B;  5KA6 A;  1SZT A;  1DLB A;  5CN0 A;  3P30 A;  3CP1 A;  1JPX A;  1ENV A;  3B77 A;  3B8N A;  3H01 A;  5HFL A;  4JF3 A;  5CMU A;  4FJC C;  1QR9 A;  1Y4M A;  2EBO A;  3GWO A;  1JQ0 A;  3K9A A;  2EZO A;  1I5Y A;  5H9C A;  5HFM A;  1MG1 A;  4JPR A;  1QBZ A;  4JGS A;  4N21 A;  2OT5 A;  1K34 A;  3CYO A;  3B8M A;  2P6J A;  4E2L A;  2MK3 A; 
#chains in the Genus database with same CATH topology
 2OWO A;  4BAY A;  1T5E A;  3QNE A;  3T1H O;  1YIT V;  4CC6 A;  3CXH F;  4OX9 O;  3X2Q C;  2YUA A;  2E76 B;  4DUY B;  3ZRX A;  3UT5 A;  1NH2 B;  4B3R O;  1W59 A;  3E8H A;  3CC7 V;  4PDV A;  5LP6 C;  3T4D A;  3MDS A;  1K97 A;  2EIJ C;  3HKE A;  1DF4 A;  2N04 A;  5GON B;  4I0X B;  2JIZ G;  4TQD A;  4QJF B;  3PN1 A;  1YIJ V;  2E5L B;  4RUE A;  1KC8 W;  5LBQ A;  1OCO C;  4Z2W A;  2Y4T A;  2GUZ A;  3HKB B;  4O4J B;  1CPY A;  5J2T B;  5DM6 V;  4X62 O;  1I7F A;  1IZ3 A;  3FB6 C;  1NU1 H;  5LGN A;  3HKD B;  3E8F A;  4G28 B;  2ZM6 B;  2YIA A;  2CK3 G;  1VQ7 V;  1SA0 A;  1JJ2 U;  2QTO A;  3OUF A;  3CEI A;  4JI5 O;  3OE7 G;  5EYP B;  3E35 A;  1RM1 B;  1XNQ O;  2PGG A;  1R6T A;  3LSU A;  4KUM A;  3SPG A;  3DXR A;  1YJ9 V;  4DV1 B;  1N34 B;  2DWE C;  4EKW A;  4DV5 B;  4P9P A;  3FAV B;  3VQY A;  1FKA O;  3OEE G;  3LSS A;  1PM9 A;  1N36 O;  1WA8 B;  4L8J A;  5B1A C;  2IJK A;  3CHX A;  4B3M B;  5AG2 A;  1EZV H;  4Q20 A;  4TOI A;  3JD0 A;  4AQY O;  2H94 A;  1AI5 A;  4NVP A;  1SKV A;  4HYO A;  1HNX B;  1QVG U;  3D8C A;  3RYC B;  1Q82 W;  3T1Y O;  2HHH O;  2A9H A;  4I50 B;  3MHH C;  3DGE A;  4JI0 O;  4DYL A;  1M57 C;  1N0J A;  4A5U B;  3UKM A;  1URF A;  5KHH A;  2UUB O;  2RJZ A;  5KMG A;  5BY1 A;  1Q90 D;  2UXC B;  2WLI A;  3TXQ A;  4X9Q A;  4PJ0 Z;  1FFX A;  3CC2 V;  4DR7 B;  1CXZ B;  2W6J G;  2JS5 A;  2R9A A;  3E2E A;  2CTP A;  2PI4 A;  1VQ8 V;  4WFA V;  4DUZ O;  1M9N A;  4MVQ A;  4UFZ A;  3SYP A;  3UQ8 A;  4DK1 A;  1E1Q G;  5DEC A;  4B7K A;  2WWW A;  3MD0 A;  4JI3 B;  4LFB O;  2K1E A;  2O57 A;  2LQT A;  3WU2 Z;  2AZ0 A;  1KKD A;  3CRQ A;  1K92 A;  2Q73 A;  2FKX A;  5JQG A;  2NR5 A;  1NTZ H;  4FLZ A;  1Q5O A;  3SGI A;  4TQF A;  4R8C A;  3T4Z A;  4CC5 A;  3CCS V;  3SYO A;  4X1Y B;  1HNZ B;  2KG7 B;  2JJ1 G;  2A06 H;  4CBC A;  4PA4 A;  2YIC A;  3RYH B;  1CEZ A;  1Q8I A;  3ZRV A;  1SF9 A;  1WLE A;  1DK1 A;  2HJD A;  1FAF A;  4LF8 B;  4MS2 A;  4I4T A;  2WA4 A;  1FFT B;  2F1M A;  4O4L A;  1HR0 O;  1P84 F;  3IC7 A;  3OUS A;  3D36 C;  3IAY A;  1YF2 A;  3LSQ A;  3L75 H;  3OFN G;  1NVP B;  2OIE A;  4TUY B;  3CCJ V;  1MAB G;  1Y76 A;  1YZB A;  5D5P A;  2AGA A;  5EC2 C;  1X59 A;  5IYZ A;  1YVW A;  4LF5 O;  4ASU G;  1GM7 A;  1ZAU A;  1WB8 A;  2Y0P A;  3DC6 A;  1BT8 A;  3CRR A;  2DYR B;  1Z2G A;  4DR1 B;  4GUN A;  4LF7 B;  1NTM H;  1MZE A;  1GAX A;  4CS2 A;  5L3B A;  4BWA A;  4P2Z A;  2P22 C;  1VQ6 V;  4ZIB A;  1XRE A;  4NTX A;  5CBG A;  1XDC A;  2ARH A;  2LP7 A;  5IWA O;  2M6Y A;  1YSC A;  1LUV A;  4X1K A;  5FNV B;  1ENV A;  1I08 A;  1ROP A;  3H01 A;  1Q6H A;  2XHB A;  3RYI A;  1EN4 A;  2YXY A;  1KB9 F;  1IVS A;  4JZG A;  4W4K A;  1ZTE A;  5JCO C;  3TCU A;  3G6E V;  4RAI A;  3E8G A;  4ZBM A;  2BTO A;  2CH7 B;  5IJ9 A;  4FK5 C;  2P5O A;  3K03 A;  3ABM B;  3OEH G;  1JMK C;  3W7W A;  3SJQ C;  3OMA B;  4JAS A;  3NR7 A;  3K5M A;  1W0K G;  4XDJ A;  1HWY A;  1WAZ A;  2WSS G;  1AP6 A;  2F23 A;  3ETQ A;  4WBN A;  4JYB A;  3N2K B;  4CS3 A;  5KAI Z;  5BMV A;  3KKY A;  1DGS A;  4KHP B;  2QWQ B;  1XEQ A;  4U3J B;  5D5Q A;  1KD1 W;  4GX1 A;  1WA8 A;  1S77 D;  4MVS A;  5H6Q A;  3JAT B;  2BOC C;  3J80 N;  3ZMZ A;  2LJ2 A;  3CJH B;  4DR6 O;  4WFH A;  1RP3 B;  4X65 O;  3AG3 B;  1OHH G;  4MVM A;  4CZZ A;  5L3G A;  4I50 A;  1N8R W;  1AB3 A;  1Q43 A;  2VRZ A;  3VQW A;  1VP7 A;  3ZRS A;  4XBF A;  5IY5 C;  2EIL C;  3IFX A;  5KAF Z;  3K04 A;  2EJ7 A;  2JJ2 G;  4KFM A;  2ZDI A;  2QA4 V;  3F5W C;  4DV2 B;  5FPO A;  3STZ C;  2VQF O;  2IBZ H;  1XNR O;  4QPK A;  1WPB A;  4AI8 A;  3ASN B;  4NTY A;  1EM1 A;  2JGD B;  1WB7 A;  3VQX A;  2GSM B;  3UT5 B;  2F66 C;  2HJF C;  3B2E E;  1FXK A;  2YDE A;  2UXB O;  2E75 B;  3CYO A;  4E2L A;  1US6 A;  2DYR C;  2QWP B;  3LUT B;  3L9D A;  3IJ4 A;  1XBL A;  1Y74 A;  2XAS A;  3HKE B;  2IW5 A;  3ZHV A;  1FXH A;  5EBM C;  5K1P A;  3DC5 A;  3AEI A;  5A9G A;  3ETD A;  3OTO B;  3OGI B;  4WFB V;  2QR4 A;  1NI8 A;  4X1Y A;  2AW9 A;  2GUZ B;  3RN4 A;  2RN9 A;  1XMQ B;  5L3E A;  5BR8 B;  1V54 C;  4DUY O;  1B04 A;  3LNN A;  2EIN B;  3W7U A;  2ATK C;  2LW1 A;  1H8H G;  2M7W A;  5KHJ A;  3ABK B;  3APQ A;  1R6K A;  2QM8 A;  3LDD A;  2X7R B;  1I94 B;  2RNB A;  1SA0 B;  2F95 B;  3WG7 B;  4TUY A;  2EX3 A;  5CB4 A;  4AIL C;  1Q6U A;  2BTQ A;  1H2G A;  2QKA A;  4DXW A;  4DV4 B;  1EN6 A;  3WB0 A;  3M7M X;  4CH3 A;  1SQF A;  4YJ2 A;  1PNK A;  2P6J A;  3DXR B;  4FLW A;  3ABM C;  3LDE A;  3R66 A;  4FIP C;  2FML A;  2YI9 A;  5B3S C;  2X6C A;  4GKK B;  2QM7 A;  2V4D A;  4B08 A;  1ZX3 A;  3K9S A;  2EUL A;  4UUJ C;  1P4R A;  3KCX A;  4FZ1 A;  2A0L A;  1ARO P;  5LA6 A;  4LFC B;  4DV7 B;  1D5A A;  5E79 Z;  1OCC B;  4LF9 O;  1UJW B;  2EZP A;  4GKJ O;  1F7Y A;  1N34 O;  2XND G;  3AK2 A;  5FL7 G;  2V7Q G;  1Q86 W;  1S3J A;  4LF6 O;  1S5H C;  3VBB A;  1IDS A;  4QE7 A;  4MVR A;  2ODM A;  1IBL B;  3STL C;  4JI7 O;  1FJG B;  4UCO A;  5KMG B;  4BIU A;  4B3M O;  3TK1 A;  2IJH A;  2WLI B;  2ZE7 A;  3I5D A;  1VQP V;  1KU9 A;  1FFX B;  1VQM V;  5EZY A;  1R3J C;  2W6I G;  3BPZ A;  1OCZ C;  3CRC A;  1HNX O;  1PPJ H;  3RVY A;  2XAF A;  3B8N A;  3LDC A;  5LMN B;  1VQL V;  1J95 A;  1PNL A;  2QGN A;  3SR2 C;  3E86 A;  1QR8 A;  4J41 A;  3KG2 A;  3ZHT A;  1KKC A;  2ITC C;  4DV3 B;  1I5X A;  4DV6 B;  3JSN A;  2WLJ A;  5JQG B;  1AJP A;  1NR1 A;  4DR7 O;  4YY3 B;  3JAW B;  2UUA B;  3HKC A;  1IXM A;  4JI6 B;  5ITZ A;  3CMA V;  1HW7 A;  2UU9 O;  4HNA A;  1LR1 A;  4JTD B;  1IBM B;  2Q67 A;  1S5J A;  3A0H Z;  4UVB A;  2IH3 C;  4LWS A;  3T2M A;  1EN5 A;  4JI3 O;  4I4T B;  4IIJ A;  1FPO A;  4O4L B;  1N0N A;  2ZXW C;  3AG4 C;  4X88 A;  1HNW O;  4K0K O;  1TUB A;  1TUE B;  2Z0A A;  3KCY A;  1VF6 A;  5LXT B;  2YID A;  1E79 G;  2ADQ B;  3N27 A;  1Y76 B;  2QEX V;  3AG1 B;  5IYZ B;  4TV8 A;  4LF4 O;  4DO2 A;  5KHK A;  3BA8 A;  1FXV A;  1NTK H;  1MSD A;  4UV8 A;  3ZMU A;  1VQK V;  2YIB D;  4LF8 O;  2JGD A;  2AXT Z;  2GV9 A;  1NKD A;  2OYQ A;  4FZ0 A;  2B5U A;  3ABL B;  2F93 B;  1H2S B;  2A3Q A;  1PL4 A;  2WAM A;  4JTA B;  1W2B U;  3ZRW A;  1KP2 A;  1Q6I A;  1Y6X A;  1JFF A;  2UXX A;  3IGA C;  1YEW A;  1MMM A;  2DOS A;  4LR3 A;  5IDJ A;  2BSK A;  4JF3 A;  4X1K B;  2C2A A;  2JRI A;  4DR1 O;  4WFE A;  3RYI B;  4DRX A;  4OXS A;  1G8M A;  3G71 V;  1OCC C;  2HP8 A;  3ZMV A;  2A7W A;  4CH4 A;  2FTK A;  4UVC A;  4LP8 A;  3QF7 A;  5IJ9 B;  1JJO A;  4I9Q A;  1G1X B;  1N32 B;  1WPX A;  3A0B Z;  4GYC B;  3UO3 A;  1XI1 A;  2HLD G;  4J9Z B;  1AIL A;  4DR2 B;  3ASO B;  4J7K A;  4NXN B;  5LHH A;  4WBN B;  3SPH A;  1H2L A;  5BMV B;  2DW4 A;  2QM4 A;  1GMG A;  1W0J G;  3MHS C;  3FB5 C;  2AHY A;  2UUC B;  4FM2 A;  2XAH A;  1XMO B;  3I56 V;  1JQ0 A;  3K3W A;  4B3T O;  4O4I A;  3ZN0 A;  5LP6 A;  2P4V A;  1F51 A;  2YEV A;  2YXH A;  3PJS K;  4U3F H;  3LNM B;  1JX9 A;  4MTO A;  2VS0 A;  3THO A;  3K59 A;  2CGO A;  5IYC O;  1YJN V;  3CCE V;  4UV9 A;  1N33 B;  1H2N A;  3CP1 A;  4MT8 A;  3HB3 B;  4TV9 B;  4KHP O;  1QR9 A;  1B3Q A;  4Z1M G;  2CE4 A;  2H3O A;  2GTS A;  2EIM B;  5LHG A;  2DN9 A;  1IUR A;  1F23 A;  2YXL A;  4ZI7 A;  4HZ3 A;  3SPC A;  3CWB H;  1H2K A;  3QO7 A;  4LC1 A;  3JAR B;  2HG5 C;  4NYK A;  1E1R G;  1KUQ A;  1K9M W;  2IU0 A;  2PTM A;  2CTW A;  2P67 A;  4GX5 A;  2LW7 A;  1JOY A;  1GM9 A;  1QBZ A;  2ILM A;  1FXK B;  2F43 G;  4PA7 A;  3R65 A;  2R70 A;  3CRA A;  3RYF B;  1RPO A;  2DE0 X;  3K08 A;  1ORQ C;  2VWK A;  1Y74 B;  4D7T A;  4KL1 A;  1BCC H;  4DV2 O;  1SZX A;  4JV5 B;  4GLX A;  1AI6 A;  5KHG A;  3ABL C;  3JAW A;  4FMT A;  1G6U A;  3K5N A;  2HR3 A;  4LNU A;  1K4C C;  2DQ3 A;  5L3D A;  1OCR B;  4TWK A;  5GTH Z;  1QLE B;  4NB5 A;  4BIZ A;  1M5I A;  3CCM V;  1TAE A;  1XUQ A;  1XL4 A;  3L73 H;  1SQX H;  3ZN1 A;  3P3P A;  2X0L A;  4DV0 B;  2UXD O;  5LXT A;  1ZWI C;  3JAK A;  4WFF A;  1VQO V;  1O9H A;  5CB4 B;  2BTQ B;  4FVM A;  4QPJ A;  3ZHS A;  3CPW U;  2CTR A;  4OX9 B;  3H1I H;  4MTF A;  1WNS A;  4YJ2 B;  1MA1 A;  4B3R B;  3OTO O;  1YTF D;  3ZS8 C;  3H1K H;  3BCC H;  3EVK A;  3IC9 A;  1XMQ O;  2PZS A;  3BFR A;  1S0V A;  2ZNI A;  1V55 B;  3G6B A;  3BEH A;  1IBK B;  4MW8 A;  2X6A A;  2CTQ A;  4YIO A;  1RM1 C;  1BL8 A;  1TA8 A;  3ZMS A;  4I9W A;  4NXM B;  4N21 A;  2ZR2 A;  2ZKO A;  3CCU V;  5LA6 B;  1M56 B;  5JH7 A;  3M8A A;  4GT1 A;  2BOB C;  2Y4U A;  2OCC B;  2YS8 A;  1L8D A;  2JS3 A;  4X62 B;  5KHI A;  3CCR V;  4DK0 A;  3CRM A;  1NH2 D;  4JI4 O;  2HVJ C;  5KUK A;  3P3N A;  4JI2 O;  4ICG A;  1HP8 A;  3CB2 A;  4K8X A;  1UPG A;  4H13 B;  4YXW G;  1M1K W;  2PI5 A;  2DWD C;  3WFV A;  1PL0 A;  1MOF A;  2Q4P A;  5EZY B;  4DV7 O;  2JEX A;  4BIO A;  3P30 A;  1B6Q A;  4FLU A;  3K57 A;  2Q68 A;  3J81 N;  2JK5 C;  3SYC A;  4YIP A;  4PV1 B;  4XDK A;  5KUM A;  2Y0I A;  4F6R B;  3E22 A;  3FKS G;  4EB6 B;  1AR5 A;  1IBL O;  5F2V O;  1FJG O;  5GW7 A;  4KXR A;  3RGB A;  5BZB A;  4DR3 O;  4QNH B;  3RBZ A;  3FD9 A;  1JPX A;  3TXS A;  2CUG A;  2JDI G;  4F6E A;  4IL6 Z;  3K58 A;  2HHH B;  3OTF A;  1BGY H;  3HKC B;  5ITZ B;  1GRJ A;  5LMN O;  4HNA B;  3ICX A;  4X89 A;  3EHB B;  2RQ6 A;  1VF5 B;  4LWS B;  3SPI A;  2UUB B;  4IIJ B;  3U0Z A;  1K5Q A;  1VAR A;  1NBM G;  4TV9 A;  3JSL A;  2Y69 B;  1TUB B;  4DV6 O;  1MG1 A;  3B09 A;  1OCR C;  2QWN B;  4LBE C;  2B1I A;  2OTL V;  2KQX A;  1QLE C;  3A8T A;  4YY3 O;  4DUZ B;  1SQG A;  1J5E O;  1K73 W;  2P06 A;  5GTI Z;  4TV8 B;  4JI6 O;  4RQE A;  3JAR A;  2BE3 A;  4P30 A;  1IBM O;  3VOU A;  3JAL B;  4LFB B;  2FYU H;  1VQ5 V;  3S3X A;  2AZ2 A;  1GH6 A;  5LOV A;  1VMG A;  5IT9 N;  4G27 B;  4JZ2 A;  1PNM A;  4O2B B;  5HFM A;  2Q0O C;  4WF9 V;  4X64 O;  2W0F C;  3RYF A;  4RWU A;  4UCU A;  3ZRW B;  2JGU A;  3EFF K;  2QKC A;  2XTA A;  1JFF B;  3RWR D;  1BHA A;  3A2F A;  1K4D C;  1SS3 A;  3SYA A;  4IGG A;  2L35 A;  2XUM A;  3CME V;  3BVO A;  4OGQ B;  1H38 A;  2BSK B;  3G80 A;  4I55 B;  3EXA A;  1L0L H;  3CS5 A;  1R73 A;  4DRX B;  2ZE8 A;  3J7A U;  3ZJZ A;  1QHT A;  2ZE5 A;  3DTU B;  5LGT A;  3B40 A;  1QCE A;  5TIS Z;  4RUF A;  2Q0A A;  2DYS B;  4GCZ A;  1R6N A;  4FM1 A;  2HFE C;  1BHB A;  3OR7 C;  1SQB H;  3O65 A;  3CCL V;  4X20 B;  3K0D A;  5C8Y A;  5L3C A;  3CCV V;  1S72 V;  2NNU A;  2E5L O;  4LH6 A;  4JI1 B;  3CCQ V;  4G2K A;  5J2U B;  1P49 A;  2HKO A;  1K33 A;  1Q7Y W;  2UXN A;  3QG5 A;  3SPJ A;  3DSQ A;  3X2Q B;  4JI8 B;  2AHZ A;  2ZM6 O;  1SQV H;  4FJC C;  1NVP D;  3QO5 A;  2PF4 E;  1N32 O;  1GN3 A;  4O4I B;  5LP6 B;  4FFK A;  4BW9 A;  2YEV B;  3K5O A;  4ABM A;  4DR2 O;  3CE2 A;  2EIJ B;  2YC0 A;  5A2Q N;  4NXN O;  4DV1 O;  5JJE B;  3AG3 C;  4DV5 O;  3E83 A;  5C93 A;  4GX2 A;  5CA3 A;  3H1H H;  4RQF A;  2YSU B;  3F7V C;  2UUC O;  1EZJ A;  4K3A A;  3QO8 A;  1XMO O;  1NZ6 A;  5JVD A;  1BQ0 A;  5CA0 A;  2N74 A;  4ZI7 B;  1DF5 A;  2ZNJ A;  4F4L A;  3JD3 A;  3FX7 A;  2P90 A;  1JR9 A;  3OT7 A;  3BAB A;  4L87 A;  5EK0 A;  1VF6 C;  5HFL A;  1LNQ A;  5LMU B;  2IM9 A;  1K34 A;  4LFA B;  4Z1V A;  3UO2 A;  4F6R A;  5JJJ B;  4EB6 A;  3TGU H;  4PDR A;  3W7T A;  4XDL A;  3ASN C;  1XOU A;  3C3T A;  1R1B A;  1BQZ A;  2UXC O;  1ZUQ A;  1AVM A;  5IJ0 A;  5B1A B;  1NS1 A;  4X66 B;  2IJJ A;  2R72 A;  1Z5V A;  4LNU B;  4FLV A;  3AG2 B;  3BY6 A;  4UB8 Z;  1AR4 A;  2Q5Z A;  3L70 H;  1S5L Z;  3I55 V;  2LFR A;  2MW2 B;  2R9I A;  5LYJ A;  1M57 B;  3P32 A;  2VQF B;  4NR1 A;  4H33 A;  3JAK B;  1XNR B;  2EIN C;  1VF7 A;  4FFB A;  4JV5 O;  1JCH A;  2KSD A;  2WPD G;  3K5L A;  3ABK C;  2YIB A;  1U97 A;  5J9P C;  1HNZ O;  4BW5 A;  3G67 A;  5B5E Z;  3JAL A;  2ZR3 A;  4D6T H;  3WG7 C;  1WN7 A;  3JCU Z;  4JYA B;  3E8B A;  4MW3 A;  4IYH A;  4O2B A;  3N2G A;  5B66 Z;  4B3S B;  2WLH A;  4IHJ A;  5B1N A;  1OV9 A;  4DV0 O;  3MAQ A;  2RDC A;  1JVM A;  1Z5W A;  2OIG A;  5JH7 B;  2VQE B;  2L6L A;  1VQ9 V;  3GB7 C;  4I55 A;  4JPR A;  3OW2 U;  1IBK O;  4LF7 O;  4JGS A;  2Y48 A;  4IT5 A;  3K06 A;  5KX5 A;  1GN4 A;  2ETN A;  4NXM O;  4W4L A;  2QKS A;  3ETG A;  1RSO A;  1NT2 B;  1K8A W;  4O4H B;  5CMU A;  1YJW V;  4X20 A;  1WP8 A;  1IX9 A;  2QE7 G;  4FLT A;  5EIB C;  5J2U A;  1BZK A;  3K0G A;  4PA3 A;  5B1B B;  3E22 B;  3OD4 A;  4WCE V;  2NLJ C;  1BE3 H;  2Q69 A;  2ZIM A;  3AG7 A;  1GKF A;  1L1F A;  4LF9 B;  2Q8V A;  4GZR B;  3GWK C;  1R3L C;  4GKJ B;  5K1X A;  1FYJ A;  2LO1 A;  4CH6 A;  2FL4 A;  1Y66 A;  2ZQM A;  3QVN A;  3U10 A;  4LF6 B;  1P7B A;  1R3K C;  4JI7 B;  2D3O W;  1N4C A;  1SQP H;  3FFQ A;  1SET A;  4MTX A;  4ZKI A;  1Q3E A;  5H6R A;  1TVK A;  4YHH B;  2H8P C;  3ZCC A;  5EBW C;  4MVO A;  3ZMT A;  1SES A;  1ZL8 A;  4QIW F;  3AK1 A;  4DR4 B;  5H2F Z;  3AG2 C;  1V9P A;  1X4T A;  5BXZ A;  4GX0 A;  5LHI A;  3RT3 C;  4WFG A;  4H37 A;  3CXC U;  3UM7 A;  4UVA A;  1EFR G;  3FB7 C;  1FD9 A;  2F4V B;  3L71 H;  2B9Z A;  3U11 A;  4R50 A;  5LOV B;  4PA9 A;  4J11 A;  1QQC A;  3AG1 C;  3GVM A;  1G4Y B;  2Q9L A;  1SRY A;  1BS3 A;  4TSF G;  2HVK C;  2X6B A;  1MNG A;  5EIB D;  3ETE A;  4QE9 A;  4HBN A;  3TJT A;  2CGN A;  1VQN V;  5KA6 A;  2UU9 B;  2OCH A;  4PI0 A;  3TET A;  3HPL C;  2GBO A;  3RFR A;  2PUS A;  1NR7 A;  3CSX A;  2CAZ C;  4K35 A;  3ZIA G;  4FLX A;  2ZT9 B;  4ZOL A;  1HNW B;  4K0K B;  1DTO A;  5DED A;  2YI8 A;  4X1I A;  4J7Z A;  2P7T C;  3RW0 A;  4BR6 A;  4DR5 B;  4EFE A;  1COW G;  3WB1 A;  4J80 A;  3SJB C;  4MSW C;  4O2A B;  3JD1 A;  4LF4 B;  2JVD A;  5IY5 B;  2IU3 A;  3T1H B;  2EIL B;  4I7Z B;  5C8Y B;  1I0H A;  4C7U A;  3JYC A;  3AK3 A;  1MSW D;  5EBL C;  1U96 A;  4DW1 A;  1M93 A;  5BR8 O;  3BRC A;  3C3S A;  5KLV H;  2XOK G;  4X8A A;  3T1C A;  1OZ0 A;  2RMK B;  3GWO A;  1H2M A;  2E3C A;  3ASO C;  5JJN B;  1RFY A;  2XAJ A;  1A32 A;  1I94 O;  5B1B C;  2D2C B;  5LGU A;  2WLM A;  1AI4 A;  3CC4 V;  2ZD9 A;  4JAU A;  3JD2 A;  3KZI Z;  1XQ8 A;  1QNM A;  1XL6 A;  4DV4 O;  2QWR B;  5CBH A;  1YI2 V;  4JI1 O;  1DLB A;  5FLX N;  3ZED A;  3SDL A;  3SJC C;  4JAV A;  4LH7 A;  2WLK A;  4JI8 O;  4GKK O;  2WA3 A;  1V54 B;  5CA1 B;  5GON A;  4I0X A;  4ZHQ B;  4JI5 B;  5JVD B;  2HEP A;  5CA0 B;  3ZHQ A;  3JD4 A;  4P9O A;  1XNQ B;  4LFC O;  4PDM A;  3VQV A;  5CN0 A;  1GM8 A;  3D36 A;  2E74 B;  2FB5 A;  4J42 A;  4J9Y B;  4O4H A;  4KP4 A;  1VEW A;  3HKB A;  4O4J A;  2QTS A;  4JAA A;  2EIM C;  5J2T A;  2XAQ A;  2ZDI C;  3HKD A;  1QLN A;  1IXB A;  4PA6 A;  3ABT A;  4EEQ A;  1D2D A;  1NJI W;  1N36 B;  4OPA A;  2XT9 A;  4PEL A;  2P4K A;  4UCS A;  3JAS B;  2LGW A;  4B3T B;  4YJ3 B;  1EBO A;  3D3I A;  1TGO A;  1SZT A;  1PV0 A;  2IJI A;  3H1J H;  4AQY B;  5B3S B;  4J7J A;  5EYP A;  1BSM A;  1Y4M A;  1O9G A;  5IE9 A;  2WLL B;  5IJ0 B;  1PD3 A;  3W7X A;  1FXK C;  1XIL A;  2ITD C;  2GTA A;  3T1Y B;  3NXS A;  1AR1 B;  3ZX6 A;  1FS0 G;  3ABU A;  3FYE B;  3JCZ A;  5LMU O;  4JI0 B;  3FAV A;  3OR6 C;  1VIB A;  1Y67 A;  4LFA O;  4PDL A;  3ML0 A;  3Q4H B;  1RPR A;  3JAM N;  1QU7 A;  1B06 A;  5LYJ B;  4DV3 O;  4E4E A;  2ZIN A;  4PHZ A;  1SC5 B;  2IH1 C;  2K9P A;  4FFB B;  1XHZ A;  2ADP A;  2Q7H A;  3RYC A;  5JCO A;  5IYB O;  4MTG A;  2G38 A;  4X66 O;  4H44 B;  2UUA O;  2Z3Y A;  3F7Y C;  4Q6G A;  2QSA A;  1Q81 W;  3G4S V;  1M90 W;  1OCZ B;  2QWO B;  2DMX A;  4NTW A;  4JYC A;  3K79 A;  1I5Y A;  1AP5 A;  3N2G B;  1AJN A;  2LGQ A;  1MZF A;  2WLN A;  4IHJ B;  2EIK B;  3SYQ A;  1V55 C;  4RO2 A;  2VWJ A;  1YXB A;  2ZIO A;  3QTC A;  1GN2 A;  4LCU C;  2R9R B;  1YHQ V;  2KB1 A;  4B7E A;  3ZBH A;  3L72 H;  1KYO F;  2EZO A;  1HR0 B;  4UXN A;  1AI7 A;  2ZCE A;  1M56 C;  4JYA O;  5E1A C;  3L74 H;  5KX5 B;  3ZHR A;  2UXD B;  3O9O A;  2OCC C;  4B3S O;  2A79 B;  3BHP A;  4DW0 A;  3B4S A;  4U7O A;  3WB2 A;  4O2A A;  4LF5 B;  2ZXW B;  3OM3 B;  3AG4 B;  1S76 D;  1RSO B;  1GK9 A;  3K9A A;  1NQT A;  2KG7 A;  2NN4 A;  3S3W A;  2VQE O;  3RYH A;  1BMF G;  3H1L H;  3FB8 C;  4HAM A;  4UCV A;  3M99 B;  4PI2 A;  1PP9 H;  2KKW A;  1VQ4 V;  2Q7G A;  3F5T A;  5FPR A;  1H8E G;  4QGP A;  3W7S A;  1UFI A;  3H9V A;  3E89 A;  5EC1 C;  2GDS A;  3RVZ A;  5IWA B;  4AHC A;  1KP3 A;  1ZSP A;  4NKG B;  2B1G A;  1JA8 A;  4JI4 B;  1KQS U;  4IYI A;  2DQ0 A;  1F4M A;  4JI2 B;  4MVZ A;  3B77 A;  4UCT A;  4K8Z A;  4FM0 A;  2W0X A;  2JEU A;  1TVK B;  1OCO B;  5H9C A;  4FPP A;  1KBH A;  1ZL8 B;  1GTO A;  1PKX A;  1THZ A;  3OMI B;  5L3F A;  2CDY A;  5CA1 A;  2GHY A;  4N23 A;  1QVF U;  4ZHQ A;  3UCS C;  1WP7 A;  5KA5 A;  2QJ1 A;  3OAA G;  1K7D A;  2ZE6 A;  2Z5U A;  5LL6 Y;  4I5S A;  3OMN B;  5FNV A;  2Y69 C;  2BCC H;  2DJV A;  2EBO A;  2N05 A;  3CD6 V;  4J10 A;  5H5N A;  4DR3 B;  1N33 O;  1XHX A;  4MVU A;  1YCI A;  1ZLZ A;  2MK3 A;  5IYD O;  4YHH O;  2CH7 A;  1F4N A;  1HDJ A;  1GO3 F;  3JAS A;  4DR6 B;  4UCR A;  4YJ3 A;  4DR4 O;  4X65 B;  4R6Z A;  1KMI Z;  4TT3 G;  4PD4 F;  1GN6 A;  1K3E A;  2QDO A;  2XAG A;  2WLL A;  4CS4 A;  4JTC B;  1L0N H;  2Q6A A;  4OPH A;  2EIK C;  1P7G A;  3N2K A;  2F4V O;  3D3Q A;  1M4U A;  4ZOL B;  5B1O A;  1CP9 A;  1YDX A;  4U3J A;  4X1I B;  4CH5 A;  3JAT A;  3Q4H A;  2LFS A;  3CJH A;  3CX5 F;  2EJR A;  1R3I C;  1J5E B;  1KEC A;  3FYI B;  5JWP A;  2Q7E A;  3HR0 A;  2OT5 A;  3BA9 A;  2PY5 A;  3A0R A;  3ZHU A;  2RCV A;  1YTF B;  3OGC C;  1D5N A;  2PYL A;  1K5S A;  2OTJ V;  3SJA C;  5CBF A;  2V1D A;  4H0L B;  1SER A;  2DYS C;  1OJH A;  4EFB A;  4FLY A;  4JYY A;  4X64 B;  2UXB B;  1SQQ H;  4D7S A;  4R7C A;  2PYJ A;  1LUW A;  4DR5 O;  4U7N A;  5DN6 G;  1WJZ A;  3APO A;  3C90 A;  4UB6 Z;  3BAA A;  3B8M A;  1AJQ A; 
#chains in the Genus database with same CATH homology
 4TSF G;  2HVK C;  4BAY A;  3QNE A;  2X6B A;  3FKS G;  1YIT V;  3ABM C;  3LDE A;  4FIP C;  5GW7 A;  3ETE A;  4QE9 A;  5BZB A;  3X2Q C;  4QNH B;  5B3S C;  3RBZ A;  2X6C A;  1VQN V;  5KA6 A;  3ZRX A;  3TET A;  1JPX A;  2QM7 A;  3HPL C;  1NH2 B;  4UUJ C;  1P4R A;  2JDI G;  3E8H A;  3CC7 V;  4PDV A;  1NR7 A;  2A0L A;  3ZIA G;  1ARO P;  3T4D A;  1DTO A;  4X89 A;  1K97 A;  3EHB B;  2P7T C;  1OCC B;  2EIJ C;  3RW0 A;  1DF4 A;  1UJW B;  1COW G;  3SPI A;  2EZP A;  2JIZ G;  4QJF B;  1YIJ V;  1K5Q A;  4MSW C;  1NBM G;  4RUE A;  2XND G;  1KC8 W;  5LBQ A;  2Y69 B;  1OCO C;  5FL7 G;  2V7Q G;  3JD1 A;  1Q86 W;  1S3J A;  1S5H C;  3VBB A;  5IY5 B;  2IU3 A;  4QE7 A;  2EIL B;  4MVR A;  1CPY A;  1MG1 A;  3STL C;  1OCR C;  5DM6 V;  4LBE C;  2B1I A;  2OTL V;  3FB6 C;  1QLE C;  5LGN A;  3JYC A;  3E8F A;  4BIU A;  3TK1 A;  1MSW D;  4G28 B;  5EBL C;  2IJH A;  2WLI B;  1VQP V;  1K73 W;  2CK3 G;  1VQ7 V;  1VQM V;  4RQE A;  1R3J C;  4P30 A;  2W6I G;  1OCZ C;  3VOU A;  1JJ2 U;  2QTO A;  1VQ5 V;  2XOK G;  3RVY A;  2XAF A;  3B8N A;  3LDC A;  3OUF A;  4X8A A;  3T1C A;  1OZ0 A;  3OE7 G;  1VQL V;  4G27 B;  3GWO A;  1RM1 B;  3E35 A;  3ASO C;  1J95 A;  1PNM A;  5HFM A;  2XAJ A;  1PNL A;  4WF9 V;  4KUM A;  3SPG A;  2W0F C;  1YJ9 V;  5B1B C;  5LGU A;  2WLM A;  3E86 A;  1AI4 A;  1QR8 A;  2DWE C;  4EKW A;  3CC4 V;  2ZD9 A;  3KG2 A;  3JD2 A;  4JAU A;  4P9P A;  3ZRW B;  1XL6 A;  3EFF K;  2ITC C;  3OEE G;  1I5X A;  3LSS A;  5CBH A;  1YI2 V;  1BHA A;  1K4D C;  3SYA A;  1DLB A;  2WLJ A;  1AJP A;  1NR1 A;  5B1A C;  3CME V;  2IJK A;  1H38 A;  1IXM A;  1R73 A;  3CMA V;  4JAV A;  4Q20 A;  3JD0 A;  2WLK A;  2H94 A;  4JTD B;  3ZJZ A;  1V54 B;  2Q67 A;  4UVB A;  1AI5 A;  4HYO A;  2IH3 C;  3DTU B;  3T2M A;  5LGT A;  1QVG U;  1Q82 W;  1QCE A;  4RUF A;  2A9H A;  3JD4 A;  3MHH C;  4P9O A;  2ZXW C;  3AG4 C;  4PDM A;  4X88 A;  2DYS B;  3DGE A;  1R6N A;  4GCZ A;  1GM8 A;  3D36 A;  2HFE C;  1TUE B;  4J9Y B;  5CN0 A;  1M57 C;  1BHB A;  4KP4 A;  3OR7 C;  3UKM A;  3CCL V;  1E79 G;  2EIM C;  2XAQ A;  3K0D A;  5L3C A;  2ZDI C;  3CCV V;  1S72 V;  2QEX V;  1QLN A;  3AG1 B;  2NNU A;  4PA6 A;  3ABT A;  2WLI A;  1NJI W;  3CCQ V;  4G2K A;  4DO2 A;  3CC2 V;  4PEL A;  1FXV A;  2HKO A;  2W6J G;  1K33 A;  4UV8 A;  3ZMU A;  1Q7Y W;  2UXN A;  3E2E A;  1VQK V;  2PI4 A;  1EBO A;  3D3I A;  1VQ8 V;  1SZT A;  3SPJ A;  4WFA V;  2IJI A;  1M9N A;  4MVQ A;  3X2Q B;  5B3S B;  3SYP A;  2AHZ A;  1NKD A;  4FJC C;  1E1Q G;  1Y4M A;  2WLL B;  1NVP D;  3QO5 A;  1PD3 A;  3W7X A;  1FXK C;  2B5U A;  2WWW A;  2ITD C;  3ABL B;  3MD0 A;  3NXS A;  1AR1 B;  2WAM A;  1FS0 G;  2K1E A;  3ABU A;  4JTA B;  3FYE B;  3JCZ A;  1W2B U;  3ZRW A;  2YEV B;  1KP2 A;  3OR6 C;  1KKD A;  2EIJ B;  2UXX A;  1K92 A;  4PDL A;  3IGA C;  3ML0 A;  5IDJ A;  1RPR A;  4JF3 A;  2C2A A;  3AG3 C;  3E83 A;  5C93 A;  4GX2 A;  5CA3 A;  3T4Z A;  4R8C A;  4RQF A;  4WFE A;  3CCS V;  2YSU B;  3F7V C;  4OXS A;  3SYO A;  1EZJ A;  1G8M A;  2JJ1 G;  3G71 V;  4CBC A;  4PA4 A;  1OCC C;  3ZMV A;  2IH1 C;  1CEZ A;  3QO8 A;  1WLE A;  3ZRV A;  4MS2 A;  5IYB O;  2FTK A;  1FFT B;  4MTG A;  2Z3Y A;  3F7Y C;  1DF5 A;  4UVC A;  4F4L A;  3JD3 A;  3IC7 A;  4LP8 A;  3OUS A;  3LSQ A;  2P90 A;  3G4S V;  4L87 A;  1Q81 W;  1M90 W;  1WPX A;  5EK0 A;  1OCZ B;  3OFN G;  5HFL A;  2HLD G;  4J9Z B;  1NVP B;  1LNQ A;  3CCJ V;  1MAB G;  4JYC A;  3K79 A;  1I5Y A;  5EC2 C;  3ASO B;  1K34 A;  1AJN A;  4ASU G;  2WLN A;  2EIK B;  1GM7 A;  5LHH A;  3SPH A;  4PDR A;  3SYQ A;  2DYR B;  3W7T A;  1V55 C;  2DW4 A;  1GMG A;  4XDL A;  4RO2 A;  1W0J G;  3MHS C;  3ASN C;  3FB5 C;  2AHY A;  2XAH A;  4LCU C;  2R9R B;  1YHQ V;  2KB1 A;  5B1A B;  3I56 V;  1JQ0 A;  3K3W A;  5L3B A;  2EZO A;  3ZN0 A;  2IJJ A;  4UXN A;  1AI7 A;  4P2Z A;  1F51 A;  1VQ6 V;  1M56 C;  2YEV A;  3PJS K;  5E1A C;  5CBG A;  3LNM B;  3AG2 B;  3BY6 A;  1JX9 A;  4MTO A;  2OCC C;  2LP7 A;  2A79 B;  5IYC O;  1YJN V;  1YSC A;  4U7O A;  3CCE V;  4UV9 A;  3CP1 A;  2ZXW B;  1ENV A;  1ROP A;  2LFR A;  3AG4 B;  3H01 A;  3HB3 B;  3OM3 B;  4MT8 A;  3I55 V;  1S76 D;  2R9I A;  1GK9 A;  1M57 B;  1QR9 A;  3P32 A;  3K9A A;  1NQT A;  4Z1M G;  4H33 A;  2EIN C;  2EIM B;  1BMF G;  5LHG A;  1JCH A;  2WPD G;  3TCU A;  1F23 A;  3ABK C;  3G6E V;  3FB8 C;  4HAM A;  4HZ3 A;  4RAI A;  3E8G A;  4ZBM A;  3SPC A;  5J9P C;  3QO7 A;  4FK5 C;  4LC1 A;  3M99 B;  4BW5 A;  3K03 A;  3ABM B;  1VQ4 V;  2ZR3 A;  2HG5 C;  3OEH G;  3W7W A;  3SJQ C;  3WG7 C;  1H8E G;  3OMA B;  1E1R G;  3W7S A;  4JAS A;  1K9M W;  3E8B A;  4MW3 A;  1W0K G;  4XDJ A;  3E89 A;  2IU0 A;  5EC1 C;  1HWY A;  2P67 A;  4GX5 A;  3RVZ A;  1JOY A;  2WSS G;  2WLH A;  1GM9 A;  1QBZ A;  1FXK B;  2F43 G;  4PA7 A;  1KP3 A;  5B1N A;  4JYB A;  3R65 A;  2B1G A;  1JVM A;  1KQS U;  1RPO A;  3K08 A;  1ORQ C;  2DQ0 A;  1F4M A;  1KD1 W;  4GX1 A;  1S77 D;  4MVS A;  5H6Q A;  2BOC C;  1VQ9 V;  3ZMZ A;  4MVZ A;  3B77 A;  1AI6 A;  3GB7 C;  3ABL C;  4WFH A;  4FMT A;  2JEU A;  3AG3 B;  1OCO B;  1OHH G;  2HR3 A;  5H9C A;  4JPR A;  3OW2 U;  1K4C C;  4JGS A;  4FPP A;  2Y48 A;  2DQ3 A;  1GTO A;  3K06 A;  4MVM A;  5L3D A;  1PKX A;  1THZ A;  3OMI B;  1OCR B;  5L3F A;  4TWK A;  2GHY A;  4CZZ A;  4N23 A;  5L3G A;  1QVF U;  1QLE B;  4BIZ A;  5KA5 A;  3OAA G;  1K7D A;  1N8R W;  2Z5U A;  2QKS A;  3CCM V;  1XL4 A;  3ETG A;  4I5S A;  3OMN B;  2Y69 C;  3ZN1 A;  3ZRS A;  1K8A W;  4XBF A;  2X0L A;  5IY5 C;  5CMU A;  1YJW V;  2EIL C;  1ZWI C;  2EBO A;  3IFX A;  4WFF A;  1VQO V;  3K04 A;  3CD6 V;  2JJ2 G;  4KFM A;  2ZDI A;  4QPJ A;  3CPW U;  2QE7 G;  4MVU A;  2QA4 V;  3F5W C;  2MK3 A;  4MTF A;  3STZ C;  5IYD O;  3K0G A;  4PA3 A;  1F4N A;  1YTF D;  5B1B B;  1GO3 F;  1S0V A;  4WCE V;  4QPK A;  4R6Z A;  1V55 B;  2NLJ C;  3ASN B;  3BEH A;  4TT3 G;  4MW8 A;  2Q69 A;  2X6A A;  1K3E A;  1GKF A;  2GSM B;  1RM1 C;  2XAG A;  2WLL A;  1BL8 A;  1L1F A;  3ZMS A;  2HJF C;  4I9W A;  4JTC B;  1FXK A;  2Q6A A;  2EIK C;  4N21 A;  2ZR2 A;  1R3L C;  3CYO A;  4E2L A;  3CCU V;  2DYR C;  3LUT B;  5B1O A;  1M56 B;  1CP9 A;  1Y66 A;  2ZQM A;  4GT1 A;  2BOB C;  2XAS A;  2IW5 A;  1P7B A;  1R3K C;  1FXH A;  2OCC B;  5EBM C;  2D3O W;  2LFS A;  4MTX A;  1SET A;  4ZKI A;  2EJR A;  5H6R A;  3CCR V;  3AEI A;  1R3I C;  1NH2 D;  1KEC A;  2HVJ C;  2H8P C;  3FYI B;  3ETD A;  3ZCC A;  5EBW C;  4MVO A;  5KUK A;  4WFB V;  3ZMT A;  1SES A;  4QIW F;  5L3E A;  1V54 C;  2OT5 A;  3A0R A;  3AG2 C;  2EIN B;  1YTF B;  3OGC C;  3W7U A;  2ATK C;  4GX0 A;  1H8H G;  5LHI A;  1K5S A;  2OTJ V;  4WFG A;  4YXW G;  2M7W A;  5CBF A;  1M1K W;  2PI5 A;  2DWD C;  4H37 A;  2V1D A;  3ABK B;  3CXC U;  3UM7 A;  1R6K A;  1SER A;  2DYS C;  4UVA A;  3WFV A;  2QM8 A;  1PL0 A;  1MOF A;  3LDD A;  2X7R B;  1EFR G;  2JEX A;  3P30 A;  3FB7 C;  4R7C A;  1B6Q A;  3WG7 B;  2Q68 A;  4U7N A;  5DN6 G;  2JK5 C;  3SYC A;  4R50 A;  4PA9 A;  1H2G A;  3AG1 C;  4DXW A;  1G4Y B;  4XDK A;  5KUM A;  1PNK A;  2P6J A;  3B8M A;  1SRY A;  1AJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...