2OIEA

Crystal structure of rs21-c6 core segment rscut
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
102
structure length
102
Chain Sequence
RPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RS21-C6
publication title Crystal Structure of RS21-C6, Involved in Nucleoside Triphosphate Pyrophosphohydrolysis
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2oieA00
2Q5ZA 3CRCA 4QGPA 2YXHA 5IE9A 2GTAA 2Q4PA 2P06A 1YVWA 2Q9LA 2OIEA 1YXBA 2A3QA 3C90A 3CRAA 2Q73A 2A7WA 2OIGA 1VMGA 1Y6XA
chains in the Genus database with same CATH superfamily
2ZDIC 4DRXA 4X1KB 3JSLA 1NR7A 2ZE7A 3BY6A 1MSWD 4DW0A 1ZUQA 3DSQA 2OIGA 2QE7G 1JJ2U 1XL4A 3E8GA 4Z1MG 3OR7C 4JI4B 1DTOA 1I0HA 3JCUZ 2PGGA 2RN9A 2QDOA 1YTFD 4DV1B 2M7WA 2JGDA 3ZRXA 4LH7A 2EJ7A 3ZHQA 1PV0A 3S3XA 4TV8A 2DN9A 1H8EG 1R3KC 3P30A 1PNMA 1EM1A 1S76D 3A0HZ 3F5WC 4QGPA 4AQYB 3ASNB 3CS5A 3K08A 1SKVA 1XMOB 3CX5F 1EZJA 4X1KA 3G80A 4X88A 5H6RA 5JCOC 4R6ZA 1IURA 3GWKC 2JJ2G 1B06A 4DV2O 1IBMB 2WA4A 1VMGA 4YIOA 1WP7A 5H6QA 1Q90D 3T1YB 2ZE8A 2RMKB 2IW5A 2EINB 2UXXA 2P90A 2YC0A 2BSKB 1FD9A 2ZKOA 5EYPB 4RAIA 3QVNA 5C8YA 3SJQC 4DUZB 5DN6G 2OCCC 3BFRA 5EC1C 3D3IA 5B3SB 1Q6UA 3SPJA 1QQCA 1RPOA 1SQBH 2XAJA 2WLIA 5KHIA 2D3OW 4Z2WA 4I0XB 3UO2A 4G28B 3N2KA 3JALA 5A2QN 1BGYH 2DOSA 2DW4A 3T4ZA 2EIMB 2OT5A 3K5MA 1QHTA 5EC2C 4FZ0A 1S77D 1IBLO 1YHQV 5B1BB 1BE3H 5LYJB 4DV5B 3UM7A 1XQ8A 2OWOA 4XDJA 2WLMA 2EIJC 3CRRA 1VQMV 1L1FA 1LUWA 2CDYA 3D36A 1XOUA 2WSSG 4IGGA 4L8JA 2BSKA 5IWAB 5IYDO 2EBOA 3OEHG 1SESA 1ZL8B 5BY1A 2HR3A 1NI8A 2UXBO 4PI2A 4X64B 1K3EA 4KUMA 2F95B 5EZYB 5GTIZ 3B8NA 2CGOA 3U10A 5EBMC 2X6AA 1EFRG 4I0XA 3OTOB 3CRQA 5L3DA 2YUAA 2Y0IA 2QM4A 3SDLA 4B08A 3ZBHA 1Q81W 1PD3A 4Q6GA 1B04A 1J95A 2GDSA 1H2NA 1DK1A 5LYJA 2ZXWB 3NR7A 1VARA 4DR3O 5ITZA 3AK2A 2P06A 2HJDA 1Z5WA 5CA3A 4FLTA 4DV0B 2PUSA 1E1QG 3ABLB 3CB2A 4JAAA 5C93A 3HR0A 2OTJV 3B40A 3ETQA 4G27B 2JK5C 1KU9A 1YEWA 4PDMA 5EZYA 1D5AA 3IJ4A 2UUCB 1PL4A 1R6KA 3I5DA 3R65A 1VF6C 1OCCC 1MSDA 3BPZA 2AZ0A 4UV9A 2JEUA 2GBOA 2ZINA 2Q68A 1L0LH 4JYBA 3HB3B 3TJTA 4WBNB 3M7MX 2B1IA 1HWYA 5KAIZ 4LF6O 1LR1A 4JI0B 1QLEB 2P67A 4NKGB 1VIBA 2QWNB 3HKBA 5BZBA 4GKJO 5J2UB 1XHZA 5H9CA 4JI8B 4O4HA 2YDEA 3HKEB 3H01A 5GONA 2P4VA 1KECA 2KB1A 4N23A 2E5LO 4A5UB 1PNKA 1SRYA 5J9PC 2JS3A 3EFFK 4KXRA 1KMIZ 1IDSA 2RDCA 3AG2B 2BE3A 4QE7A 2ZM6O 4HNAA 4PI0A 5L3EA 1A32A 1RPRA 3OW2U 5LMUO 3D8CA 4CH4A 2CTRA 4CS3A 4ZHQB 1BMFG 4P30A 4IL6Z 2W6IG 4U3FH 3PJSK 4WBNA 4X1YB 4X20B 5IE9A 3U11A 3P3PA 1F7YA 2LGWA 4TQDA 4JAUA 1GM7A 4FM2A 4O4IB 4JZ2A 1UPGA 2ODMA 2XAGA 4FZ1A 4TOIA 5L3BA 5J2UA 3X2QC 3HKEA 1DF4A 3JAMN 2HKOA 2H8PC 3K57A 2NLJC 1KKCA 1P4RA 1YJ9V 3CE2A 2WWWA 2VQEO 1EBOA 2EULA 1ORQC 2N74A 2FB5A 3LSUA 3CCUV 4DV2B 1N8RW 3WG7B 2HEPA 4UCTA 2WLKA 4KFMA 1QVGU 1I08A 4OXSA 3VOUA 1V55B 1W59A 4K8ZA 1D5NA 2Q8VA 3WB2A 1K4DC 4IHJA 4KL1A 3ZHTA 4JZGA 1YITV 1KC8W 4GX2A 3FB7C 3LUTB 2DE0X 4IYIA 3J7AU 2PTMA 3BRCA 1WA8A 1V54C 4NXNO 1V9PA 4O4IA 2ZE6A 1QU7A 1GRJA 3SYPA 2LW7A 3ZX6A 4EB6B 1MNGA 2ITCC 1M9NA 4JV5O 4NTXA 5KHGA 4AILC 3FYIB 3ZS8C 4DV7O 2ZT9B 3KG2A 1HDJA 1ROPA 4X65B 4GX0A 1GN3A 1URFA 3ETEA 4JTDB 1QLEC 3K06A 5DEDA 4B7KA 1IBLB 4F6RA 2B5UA 4UB8Z 3OM3B 2FTKA 2P6JA 2ARHA 1MG1A 4ICGA 1VEWA 1BZKA 3JATA 1FFXB 2IU0A 3T2MA 1OV9A 4FLWA 3SPIA 1AVMA 1MZEA 2QEXV 5LGTA 2R9IA 2X0LA 2Q9LA 2QKCA 5LA6B 2UXBB 1G8MA 1AILA 1M57C 1KBHA 1LNQA 2IJIA 4J80A 4K0KO 4FIPC 4EB6A 5B1AC 5KUMA 1NH2B 1OCZB 3KZIZ 3CD6V 4OPAA 4QE9A 5F2VO 4DR4O 3JD1A 1T5EA 4WCEV 3EXAA 4GLXA 5KA5A 2Q0AA 2AW9A 3MAQA 3N2GA 4X8AA 3K0DA 3ZHRA 2B1GA 1PL0A 1R6TA 3CWBH 4P2ZA 2DMXA 2CTWA 1Q8IA 2BTQB 2A79B 3AG3B 2YIAA 1YVWA 4DR1O 4JYAO 1F51A 4BIZA 3K3WA 2A7WA 3ETGA 1KKDA 2H94A 4JI5O 2CGNA 4YIPA 3CC2V 5H2FZ 1FFTB 4QNHB 3IGAC 3QNEA 3VBBA 1B6QA 3ABMB 4X9QA 1K4CC 1H2GA 1HNWO 2ZIMA 4R50A 4DV6O 4JF3A 2R9AA 4J9YB 2Q67A 4FFKA 1YCIA 2Y4TA 1N0JA 2CTPA 3ASOB 4LF6B 4DO2A 4E2LA 1SS3A 2YXLA 4FPPA 4GKJB 1Z2GA 1NTKH 5IYZB 4O2AA 3CEIA 2FYUH 5FNVB 4TSFG 1NU1H 2VRZA 1GM8A 2BTQA 3FB6C 2V7QG 1W2BU 3KCXA 1Q7YW 4PELA 3R66A 2E5LB 3U0ZA 4I55B 2ZCEA 4DR7O 3WB1A 3CYOA 2LW1A 4GKKO 2F4VO 2L35A 1W0JG 4HBNA 2ZM6B 3ZMTA 1U96A 1AJNA 4J9ZB 5LMUB 1JPXA 2GHYA 1GM9A 4MVUA 1GN4A 1NKDA 3TXQA 3LDCA 1SQQH 4X62O 4JTCB 3IC9A 3LNNA 5IYZA 2GTAA 3ZHVA 4D7SA 2Y69B 1Q5OA 2Z5UA 1M56B 2XTAA 3A0RA 5FNVA 3S3WA 1P7GA 4YY3O 4LWSB 4B3TO 5E1AC 2VQEB 3G71V 2Q69A 4ABMA 1RP3B 4I55A 3E8HA 1NTMH 4TUYB 3JASB 1J5EO 3AG4C 2UXCO 5KMGB 1K7DA 3TGUH 2UU9O 3D3QA 4LF5O 2HVKC 4CH5A 2QWRB 3E86A 4YJ3A 5IYBO 4HZ3A 2BOCC 4QIWF 2M6YA 1PPJH 2JJ1G 1I5YA 4BW5A 2ZE5A 4H33A 1AJQA 4NXNB 1X59A 4UXNA 3JYCA 1N36O 3I56V 3K58A 4LFAO 1ZTEA 1XREA 1K5QA 1WPXA 2WAMA 2X7RB 5IY5B 3BVOA 4MSWC 1F4MA 4LWSA 1PKXA 4H37A 4DV7B 4I5SA 1US6A 5K1XA 4FMTA 4IT5A 3OAAG 4TUYA 3JASA 3CP1A 2QGNA 3CCJV 2IJKA 4GX1A 1M5IA 4B3RO 1AI5A 2PY5A 4YJ2B 4IYHA 4LBEC 1N32O 1OJHA 3EVKA 4LCUC 3RYCB 1KP3A 2KQXA 5H5NA 1NVPB 5EIBD 1KD1W 5CBFA 2DYRB 5IDJA 1NS1A 2GV9A 4FVMA 4UUJC 5JJEB 5B1OA 3QF7A 4QJFB 3BEHA 4GCZA 1LUVA 3IAYA 1JCHA 2F23A 4E4EA 4K0KB 2DQ0A 4LR3A 1Y6XA 3ZJZA 2E75B 4LF7B 2VWKA 5LBQA 4AI8A 3APOA 4DR4B 3JARB 4Q20A 4H13B 1QR9A 1NVPD 3CXHF 3VQWA 4DUYO 2ADQB 3ABKB 2GUZB 3ZMZA 1Q3EA 5EYPA 1XILA 3K0GA 1TA8A 1DGSA 1GMGA 1OCRB 2WLJA 2HP8A 1TVKB 1WPBA 1E79G 3SYQA 3RYCA 4R8CA 3WB0A 2Z3YA 2K1EA 4DR1B 2HG5C 4JYAB 1YJNV 3B77A 4JI2O 1P7BA 3CSXA 2R72A 3SR2C 2H3OA 1SQXH 4JI5B 2RCVA 3RT3C 4EFBA 2WLLB 4K8XA 3RYIB 1IBKO 2LQTA 1MZFA 5LP6B 5LGUA 1OCOB 3DGEA 1HNWB 1GH6A 1ZX3A 1IZ3A 2Q7GA 3JARA 4UVBA 1Y76B 5FL7G 1FXKB 3CCLV 5K1PA 2LJ2A 2DQ3A 3ASNC 1NJIW 4UCOA 2Q73A 5FPOA 3K5OA 4H44B 1HNZO 1XMQO 3LSQA 1ZL8A 1K97A 4WFEA 5KA6A 3JCZA 1Q6HA 3ZRVA 3CCEV 1U97A 4B3MO 4MVOA 3F5TA 2KSDA 2OIEA 4DR7B 3D36C 2IU3A 2VS0A 3C90A 1S5HC 3RBZA 1YJWV 2UUBO 2EINC 1WP8A 4GKKB 3T1HB 4JPRA 2F4VB 2WLLA 2GSMB 3QG5A 3CCRV 3CC7V 2YS8A 4TV9B 2NNUA 5LP6A 3CPWU 1DLBA 4GZRB 2QM8A 1SQVH 5B3SC 1XDCA 1W0KG 2X6BA 1CP9A 1FXKA 1SC5B 4X62B 1VQ6V 3E22B 2LP7A 5CBHA 2FL4A 3T4DA 1H2SB 3ETDA 2EIMC 1G6UA 1RM1B 2ITDC 1SZXA 4UCRA 1Q86W 1N33O 1GAXA 4YXWG 1EN6A 4MW8A 4YY3B 5B1BC 4GT1A 4B3TB 4OGQB 5LXTB 1N0NA 2XNDG 3CMAV 1NBMG 3B09A 3MHSC 1JVMA 4MTFA 5CA0B 1J5EB 1AR4A 2XHBA 1QVFU 2UXCB 2UU9B 4LF5B 4TV9A 2LGQA 3G6BA 1TUBB 3E2EA 3DTUB 1VF7A 1L0NH 1JA8A 1K73W 4JI7O 2AHYA 3HPLC 3P32A 4FK5C 2Q7EA 3BA9A 1HNXO 2JVDA 2A0LA 2CE4A 3E22A 1NR1A 4FM1A 1N36B 4ZOLB 5CBGA 3JD0A 4LFAB 4PHZA 3RYFB 1JMKC 2WLNA 2ZXWC 3ZMUA 4QPJA 3K04A 2W0FC 1IVSA 3RYHB 4ZKIA 2QA4V 1R3LC 2P7TC 2WLHA 2XOKG 4JGSA 3CCMV 1AJPA 2YXHA 4O4JB 5CA0A 5B5EZ 4FFBB 4ZHQA 3ABLC 4DR2O 3KKYA 2KG7B 4X1YA 4X20A 4B3RB 1OHHG 3TCUA 1SERA 4IIJB 4LP8A 5KHJA 1N32B 2ZIOA 1TUBA 4ZBMA 2DWDC 1VP7A 1HW7A 3Q4HB 1FAFA 4DK1A 4KHPO 5GTHZ 2XT9A 2QTSA 1X4TA 4CH3A 1OZ0A 4ZOLA 4ZI7B 5DM6V 3RN4A 3JD3A 2AGAA 2EZPA 3JSNA 3RYFA 3HKCB 2QTOA 1GTOA 1M90W 3RYHA 1Y74B 4JI1O 4DUYB 4O4JA 4RQFA 4W4KA 4DXWA 2L6LA 4JI3O 1H2MA 4NVPA 1MABG 2AZ2A 2BCCH 5CB4B 3OUSA 4B7EA 3AG1B 4I9WA 1MA1A 1KYOF 4BWAA 4PA6A 3AG2C 1VF5B 4PDRA 3UT5B 4LFCO 4JI2B 1KB9F 1SQGA 1TUEB 1FPOA 1Q43A 2Q4PA 3SYAA 2HFEC 4DR5O 4G2KA 5CA1B 1M4UA 4JAVA 1Y4MA 4ZI7A 5JQGB 4K3AA 1IBKB 1Q82W 3G67A 3UQ8A 3B4SA 5L3CA 4YHHO 2D2CB 1F4NA 1K33A 2DYSB 2JIZG 1PM9A 2DJVA 3HKCA 3H1IH 2HLDG 3FB5C 4DR3B 2LFSA 3QTCA 1Y74A 1VQ9V 1FFXA 5L3GA 2JS5A 1NH2D 1BQZA 4PJ0Z 1Q6IA 1HNZB 4PD4F 3SYOA 4DV3O 1VQ8V 1XMQB 1XNQO 5LA6A 5DECA 3WG7C 3LNMB 5CB4A 1N4CA 3GWOA 2PF4E 2Y4UA 2Q0OC 4B3MB 4XBFA 1V55C 3FYEB 4TWKA 2PI4A 2XAQA 2UUBB 5D5QA 4MVZA 2IBZH 2UXNA 1VQPV 3RGBA 1Z5VA 5JQGA 1RSOB 1CPYA 2PYLA 1G1XB 1G4YB 1I94O 3CRCA 3CJHB 1XHXA 2PYJA 1MOFA 4D7TA 2EILB 3RFRA 1UFIA 4LNUB 3AK3A 2R70A 4JASA 2JRIA 3CCVV 3UO3A 4UVCA 1YXBA 1I7FA 3O65A 2ZQMA 5JH7B 3L70H 1K9MW 3CCSV 4DV0O 1THZA 3ZHUA 1N33B 2QKSA 5D5PA 4MTOA 1YF2A 4U7NA 4MVSA 3PN1A 3E83A 1WNSA 4JI6O 2OCCB 1R6NA 3JD2A 4OX9O 3DC5A 3W7UA 2HHHO 3E35A 3E8FA 4UFZA 2HJFC 2K9PA 3CRAA 4CC6A 3ML0A 2B9ZA 2ZNIA 4K35A 4P9PA 5LGNA 1BQ0A 2Q5ZA 3A8TA 5JCOA 4ASUG 5KHHA 1VQOV 4ZIBA 3AG1C 2JGDB 4CC5A 1H2KA 4Z1VA 2F93B 1TAEA 3ZMSA 2G38A 1P49A 4LNUA 1IX9A 4JI7B 1RFYA 1HNXB 4TQFA 1XNRO 5HFLA 3F7VC 2EIJB 3FFQA 1FYJA 1OCZC 1QNMA 4J7JA 4BIUA 3TK1A 1O9HA 1WN7A 3ZRSA 3NXSA 1YTFB 4BW9A 5B1NA 3BCCH 2DYSC 1K5SA 4MTXA 4NXMO 2EIKB 3FD9A 4UCSA 4CS2A 5KAFZ 1HR0O 1WAZA 2YICA 1VQNV 2ZR3A 4PA3A 2QSAA 1SQPH 3ZMVA 1F23A 1K92A 1FKAO 1NZ6A 2E76B 3AG3C 4DR2B 2VQFO 5JJNB 4MW3A 5LHHA 1QCEA 3H1HH 4X89A 3OEEG 2ZNJA 3OUFA 3J80N 3MD0A 2Y0PA 5C8YB 4MS2A 4HYOA 1BS3A 1NT2B 1PP9H 1KUQA 4X66O 1NQTA 2V4DA 3RW0A 4KHPB 4JV5B 3UKMA 3BA8A 3EHBB 3ABMC 5EK0A 5KUKA 2WLIB 5KLVH 3LSSA 3APQA 3CXCU 3N2KB 1WJZA 3JALB 3T1CA 4W4LA 3STZC 3ASOC 2YSUB 3L72H 4LF9O 4WF9V 3ICXA 1ZLZA 2P4KA 1QLNA 3C3TA 4NYKA 3OE7G 3UCSC 5KMGA 1JQ0A 1FJGO 2EILC 4JI1B 4LF4O 4I9QA 3B2EE 4JI3B 2IH1C 1OCCB 3FX7A 1CXZB 2W0XA 1UJWB 4PA4A 4X1IB 2YIDA 4EKWA 3A0BZ 3CRMA 2IJHA 2QM7A 1YSCA 1R1BA 3C3SA 2XAHA 3H1JH 4BIOA 1AR1B 4LFCB 1XI1A 2UUAO 1H2LA 1AI7A 2QR4A 4CBCA 2AXTZ 4DR5B 1Y66A 3OD4A 4J41A 1Y67A 2EZOA 4FLYA 3J81N 3ZN0A 2CAZC 4DR6O 4YHHB 1COWG 2E3CA 2YIBD 4RO2A 4X65O 1SA0B 2OCHA 4I7ZB 2QWOB 2Y69C 4YJ2A 1M56C 5BR8O 3CHXA 1XBLA 4OPHA 3SPCA 5ITZB 3L71H 3CC4V 1VF6A 1AI4A 3AK1A 4PDVA 1KQSU 4DV3B 1MMMA 1XNQB 4FJCC 3H1LH 2YIBA 1K34A 4X1IA 4F4LA 2N05A 3IC7A 4FLXA 4XDKA 4H0LB 2EIKC 3RWRD 3MDSA 3HKDB 5LMNO 4JTAB 1XUQA 3CCQV 1P84F 3X2QB 1WB8A 2BOBC 3JD4A 2Y48A 2C2AA 4GYCB 4DV6B 4NTWA 2MK3A 4CS4A 3RVYA 2X6CA 4UV8A 1D2DA 3LDEA 3K03A 1S72V 3ZHSA 1I94B 1SA0A 2GUZA 5J2TB 1EN4A 5IJ9B 1B3QA 1H8HG 3HKBB 4LFBO 3WU2Z 4JYCA 3QO7A 4O4HB 1KP2A 5IY5C 1EZVH 1BL8A 1TVKA 5EIBC 4UCUA 1O9GA 2ATKC 3B8MA 4HAMA 3SPHA 3QO5A 5GONB 1AI6A 1FS0G 1JX9A 1M1KW 3DC6A 3M99B 3DXRB 4LF8O 1AROP 4JI6B 3GVMA 1BSMA 3RYIA 4OX9B 1V54B 3HKDA 5FLXN 1GKFA 2DWEC 2HHHB 4KP4A 2V1DA 3L74H 4B3SO 4HNAB 4MVMA 2YEVB 4TT3G 2RJZA 3VQXA 3SYCA 3OFNG 4UCVA 1Y76A 2RNBA 2DYRC 3K5LA 4FLVA 4J11A 4AHCA 4FLZA 5J2TA 2GTSA 5IJ9A 5FPRA 2UXDO 1GN6A 5LOVB 2CTQA 1XNRB 1JFFB 1BHBA 4NR1A 4BR6A 3K9SA 3G6EV 3L9DA 2LFRA 4J42A 3DXRA 2P5OA 2W6JG 4NXMB 3ABKC 4R7CA 1N34O 1HR0B 1M57B 2YI9A 1OCRC 3OMAB 1VQKV 2YEVA 3OGIB 5B1AB 2A3QA 4PA7A 3JAWB 2VQFB 4FM0A 4DV4O 3LDDA 5CN0A 4IHJB 1H38A 2Q6AA 3I55V 1ZAUA 2ILMA 3OR6C 3P3NA 4J10A 5HFMA 2LO1A 1S3JA 2F66C 1WA8B 3ABTA 4O2BB 4N21A 2VWJA 2F1MA 4LH6A 4X66B 4MVRA 2CUGA 5LP6C 1OCOC 5LOVA 2P22C 2O57A 3OMIB 3W7SA 2IJJA 1JFFA 4C7UA 2Q7HA 4FLUA 5LXTA 2NN4A 2YXYA 5LHIA 1R3IC 3IFXA 3THOA 1FXKC 4GUNA 4MT8A 4LF9B 1YZBA 2A06H 4MTGA 2PI5A 3WFVA 4L87A 4WFGA 5L3FA 5EBLC 3H9VA 4JI4O 1FJGB 2CH7B 2XASA 1S0VA 4F6RB 2QJ1A 2XAFA 5JJJB 4CZZA 4LF4B 2EJRA 4DV1O 1QBZA 4WFAV 3FB8C 2E74B 1VQ7V 3JATB 3JAWA 1I5XA 5CMUA 3W7WA 4WFFA 3FKSG 1DF5A 1TGOA 3VQYA 2EX3A 3ZIAG 2MW2B 4AQYO 1BT8A 1CEZA 4O2BA 5KHKA 1XMOO 2UUAB 3ZN1A 2IM9A 4I50B 3TXSA 2IH3C 3TETA 2PZSA 2BTOA 3GB7C 1IBMO 4J7ZA 4DK0A 3O9OA 1JR9A 1JJOA 1WB7A 3F7YC 2N04A 4DR6B 1NTZH 3CMEV 2OTLV 3OTFA 3T1YO 1S5LZ 3E8BA 4FFBA 4P9OA 1AP5A 2KG7A 2CH7A 3N2GB 3K59A 4WFBV 1RM1C 4U7OA 5JWPA 5BR8B 4IIJA 2JEXA 1QR8A 2R9RB 4D6TH 3Q4HA 1FXVA 1BHAA 1ZSPA 5LL6Y 4UB6Z 4DUZO 3W7XA 4RQEA 4GX5A 4PDLA 4LC1A 1K8AW 2FKXA 2QKAA 5IYCO 3KCYA 1VQLV 3MHHC 5BMVB 1VQ5V 5LMNB 4I50A 4QPKA 1IXBA 4NB5A 3RVZA 1VQ4V 2KKWA 2NR5A 1R3JC 4LF7O 1SZTA 3JAKB 2WA3A 4XDLA 1XL6A 4DV5O 3BHPA 2CK3G 4RUFA 1L8DA 1WLEA 5KX5B 2A9HA 3K9AA 3QO8A 2OYQA 3OMNB 4U3JB 4LFBB 3AG4B 5IJ0B 5IWAO 3SJAC 4O2AB 1YI2V 1ZWIC 2FMLA 4PV1B 4X64O 4J7KA 4DW1A 3UT5A 3ZRWB 3ABUA 1FXHA 4EFEA 1SQFA 1R73A 1AB3A 3ZCCA 1GO3F 1JOYA 4LF8B 3BAAA 3L75H 4O4LB 1YDXA 5CA1A 2QWQB 3OTOO 2ZDIA 2XUMA 1ENVA 1AR5A 1EN5A 4CH6A 5BMVA 2HVJC 3FAVB 5B66Z 3E89A 4JYYA 1HP8A 4B3SB 3AG7A 1SETA 3SPGA 1SF9A 2JGUA 5JVDB 3A2FA 4I4TB 2ETNA 5GW7A 3JAKA 3SJCC 2YI8A 5A9GA 5KX5A 3BABA 4F6EA 4DRXB 2UXDB 1PNLA 2WPDG 3AEIA 4U3JA 3ZEDA 4DYLA 3K79A 5IJ0A 3G4SV 3VQVA 5AG2A 2RQ6A 3M8AA 1BCCH 1XEQA 1GN2A 4WFHA 2ZR2A 5LHGA 3K5NA 1IXMA 3ZRWA 4BAYA 1GK9A 2AHZA 3SGIA 2UUCO 3SJBC 4O4LA 2Z0AA 1N34B 5TISZ 2ZD9A 2ADPA 2F43G 1RSOA 5IT9N 3T1HO 5E79Z 4UVAA 3FAVA 3H1KH 3STLC 4MVQA 2QWPB 3W7TA 3CJHA 4JI0O 2JDIG 5EBWC 4YJ3B 5JVDA 1YIJV 3OGCC 4PA9A 3N27A 4I4TA 5BXZA 4TV8B 4DV4B 4RUEA 4EEQA 1M93A 4JI8O 1AP6A 3L73H 1E1RG 3OT7A 4NTYA 1S5JA 4RWUA 5JH7A
chains in the Genus database with same CATH topology
2Q5ZA 3CRCA 4QGPA 2YXHA 5IE9A 2GTAA 2Q4PA 2P06A 1YVWA 2Q9LA 2OIEA 1YXBA 2A3QA 3C90A 3CRAA 2Q73A 2A7WA 2OIGA 1VMGA 1Y6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5Z A;  3CRC A;  4QGP A;  2YXH A;  5IE9 A;  2GTA A;  2Q4P A;  2P06 A;  1YVW A;  2Q9L A;  2OIE A;  1YXB A;  2A3Q A;  3C90 A;  3CRA A;  2Q73 A;  2A7W A;  2OIG A;  1VMG A;  1Y6X A; 
#chains in the Genus database with same CATH topology
 2ZDI C;  4DRX A;  4X1K B;  3JSL A;  1NR7 A;  2ZE7 A;  3BY6 A;  1MSW D;  4DW0 A;  1ZUQ A;  3DSQ A;  2OIG A;  2QE7 G;  1JJ2 U;  1XL4 A;  3E8G A;  4Z1M G;  3OR7 C;  4JI4 B;  1DTO A;  1I0H A;  3JCU Z;  2PGG A;  2RN9 A;  2QDO A;  1YTF D;  4DV1 B;  2M7W A;  2JGD A;  3ZRX A;  4LH7 A;  2EJ7 A;  3ZHQ A;  1PV0 A;  3S3X A;  4TV8 A;  2DN9 A;  1H8E G;  1R3K C;  3P30 A;  1PNM A;  1EM1 A;  1S76 D;  3A0H Z;  3F5W C;  4QGP A;  4AQY B;  3ASN B;  3CS5 A;  3K08 A;  1SKV A;  1XMO B;  3CX5 F;  1EZJ A;  4X1K A;  3G80 A;  4X88 A;  5H6R A;  5JCO C;  4R6Z A;  1IUR A;  3GWK C;  2JJ2 G;  1B06 A;  4DV2 O;  1IBM B;  2WA4 A;  1VMG A;  4YIO A;  1WP7 A;  5H6Q A;  1Q90 D;  3T1Y B;  2ZE8 A;  2RMK B;  2IW5 A;  2EIN B;  2UXX A;  2P90 A;  2YC0 A;  2BSK B;  1FD9 A;  2ZKO A;  5EYP B;  4RAI A;  3QVN A;  5C8Y A;  3SJQ C;  4DUZ B;  5DN6 G;  2OCC C;  3BFR A;  5EC1 C;  3D3I A;  5B3S B;  1Q6U A;  3SPJ A;  1QQC A;  1RPO A;  1SQB H;  2XAJ A;  2WLI A;  5KHI A;  2D3O W;  4Z2W A;  4I0X B;  3UO2 A;  4G28 B;  3N2K A;  3JAL A;  5A2Q N;  1BGY H;  2DOS A;  2DW4 A;  3T4Z A;  2EIM B;  2OT5 A;  3K5M A;  1QHT A;  5EC2 C;  4FZ0 A;  1S77 D;  1IBL O;  1YHQ V;  5B1B B;  1BE3 H;  5LYJ B;  4DV5 B;  3UM7 A;  1XQ8 A;  2OWO A;  4XDJ A;  2WLM A;  2EIJ C;  3CRR A;  1VQM V;  1L1F A;  1LUW A;  2CDY A;  3D36 A;  1XOU A;  2WSS G;  4IGG A;  4L8J A;  2BSK A;  5IWA B;  5IYD O;  2EBO A;  3OEH G;  1SES A;  1ZL8 B;  5BY1 A;  2HR3 A;  1NI8 A;  2UXB O;  4PI2 A;  4X64 B;  1K3E A;  4KUM A;  2F95 B;  5EZY B;  5GTI Z;  3B8N A;  2CGO A;  3U10 A;  5EBM C;  2X6A A;  1EFR G;  4I0X A;  3OTO B;  3CRQ A;  5L3D A;  2YUA A;  2Y0I A;  2QM4 A;  3SDL A;  4B08 A;  3ZBH A;  1Q81 W;  1PD3 A;  4Q6G A;  1B04 A;  1J95 A;  2GDS A;  1H2N A;  1DK1 A;  5LYJ A;  2ZXW B;  3NR7 A;  1VAR A;  4DR3 O;  5ITZ A;  3AK2 A;  2P06 A;  2HJD A;  1Z5W A;  5CA3 A;  4FLT A;  4DV0 B;  2PUS A;  1E1Q G;  3ABL B;  3CB2 A;  4JAA A;  5C93 A;  3HR0 A;  2OTJ V;  3B40 A;  3ETQ A;  4G27 B;  2JK5 C;  1KU9 A;  1YEW A;  4PDM A;  5EZY A;  1D5A A;  3IJ4 A;  2UUC B;  1PL4 A;  1R6K A;  3I5D A;  3R65 A;  1VF6 C;  1OCC C;  1MSD A;  3BPZ A;  2AZ0 A;  4UV9 A;  2JEU A;  2GBO A;  2ZIN A;  2Q68 A;  1L0L H;  4JYB A;  3HB3 B;  3TJT A;  4WBN B;  3M7M X;  2B1I A;  1HWY A;  5KAI Z;  4LF6 O;  1LR1 A;  4JI0 B;  1QLE B;  2P67 A;  4NKG B;  1VIB A;  2QWN B;  3HKB A;  5BZB A;  4GKJ O;  5J2U B;  1XHZ A;  5H9C A;  4JI8 B;  4O4H A;  2YDE A;  3HKE B;  3H01 A;  5GON A;  2P4V A;  1KEC A;  2KB1 A;  4N23 A;  2E5L O;  4A5U B;  1PNK A;  1SRY A;  5J9P C;  2JS3 A;  3EFF K;  4KXR A;  1KMI Z;  1IDS A;  2RDC A;  3AG2 B;  2BE3 A;  4QE7 A;  2ZM6 O;  4HNA A;  4PI0 A;  5L3E A;  1A32 A;  1RPR A;  3OW2 U;  5LMU O;  3D8C A;  4CH4 A;  2CTR A;  4CS3 A;  4ZHQ B;  1BMF G;  4P30 A;  4IL6 Z;  2W6I G;  4U3F H;  3PJS K;  4WBN A;  4X1Y B;  4X20 B;  5IE9 A;  3U11 A;  3P3P A;  1F7Y A;  2LGW A;  4TQD A;  4JAU A;  1GM7 A;  4FM2 A;  4O4I B;  4JZ2 A;  1UPG A;  2ODM A;  2XAG A;  4FZ1 A;  4TOI A;  5L3B A;  5J2U A;  3X2Q C;  3HKE A;  1DF4 A;  3JAM N;  2HKO A;  2H8P C;  3K57 A;  2NLJ C;  1KKC A;  1P4R A;  1YJ9 V;  3CE2 A;  2WWW A;  2VQE O;  1EBO A;  2EUL A;  1ORQ C;  2N74 A;  2FB5 A;  3LSU A;  3CCU V;  4DV2 B;  1N8R W;  3WG7 B;  2HEP A;  4UCT A;  2WLK A;  4KFM A;  1QVG U;  1I08 A;  4OXS A;  3VOU A;  1V55 B;  1W59 A;  4K8Z A;  1D5N A;  2Q8V A;  3WB2 A;  1K4D C;  4IHJ A;  4KL1 A;  3ZHT A;  4JZG A;  1YIT V;  1KC8 W;  4GX2 A;  3FB7 C;  3LUT B;  2DE0 X;  4IYI A;  3J7A U;  2PTM A;  3BRC A;  1WA8 A;  1V54 C;  4NXN O;  1V9P A;  4O4I A;  2ZE6 A;  1QU7 A;  1GRJ A;  3SYP A;  2LW7 A;  3ZX6 A;  4EB6 B;  1MNG A;  2ITC C;  1M9N A;  4JV5 O;  4NTX A;  5KHG A;  4AIL C;  3FYI B;  3ZS8 C;  4DV7 O;  2ZT9 B;  3KG2 A;  1HDJ A;  1ROP A;  4X65 B;  4GX0 A;  1GN3 A;  1URF A;  3ETE A;  4JTD B;  1QLE C;  3K06 A;  5DED A;  4B7K A;  1IBL B;  4F6R A;  2B5U A;  4UB8 Z;  3OM3 B;  2FTK A;  2P6J A;  2ARH A;  1MG1 A;  4ICG A;  1VEW A;  1BZK A;  3JAT A;  1FFX B;  2IU0 A;  3T2M A;  1OV9 A;  4FLW A;  3SPI A;  1AVM A;  1MZE A;  2QEX V;  5LGT A;  2R9I A;  2X0L A;  2Q9L A;  2QKC A;  5LA6 B;  2UXB B;  1G8M A;  1AIL A;  1M57 C;  1KBH A;  1LNQ A;  2IJI A;  4J80 A;  4K0K O;  4FIP C;  4EB6 A;  5B1A C;  5KUM A;  1NH2 B;  1OCZ B;  3KZI Z;  3CD6 V;  4OPA A;  4QE9 A;  5F2V O;  4DR4 O;  3JD1 A;  1T5E A;  4WCE V;  3EXA A;  4GLX A;  5KA5 A;  2Q0A A;  2AW9 A;  3MAQ A;  3N2G A;  4X8A A;  3K0D A;  3ZHR A;  2B1G A;  1PL0 A;  1R6T A;  3CWB H;  4P2Z A;  2DMX A;  2CTW A;  1Q8I A;  2BTQ B;  2A79 B;  3AG3 B;  2YIA A;  1YVW A;  4DR1 O;  4JYA O;  1F51 A;  4BIZ A;  3K3W A;  2A7W A;  3ETG A;  1KKD A;  2H94 A;  4JI5 O;  2CGN A;  4YIP A;  3CC2 V;  5H2F Z;  1FFT B;  4QNH B;  3IGA C;  3QNE A;  3VBB A;  1B6Q A;  3ABM B;  4X9Q A;  1K4C C;  1H2G A;  1HNW O;  2ZIM A;  4R50 A;  4DV6 O;  4JF3 A;  2R9A A;  4J9Y B;  2Q67 A;  4FFK A;  1YCI A;  2Y4T A;  1N0J A;  2CTP A;  3ASO B;  4LF6 B;  4DO2 A;  4E2L A;  1SS3 A;  2YXL A;  4FPP A;  4GKJ B;  1Z2G A;  1NTK H;  5IYZ B;  4O2A A;  3CEI A;  2FYU H;  5FNV B;  4TSF G;  1NU1 H;  2VRZ A;  1GM8 A;  2BTQ A;  3FB6 C;  2V7Q G;  1W2B U;  3KCX A;  1Q7Y W;  4PEL A;  3R66 A;  2E5L B;  3U0Z A;  4I55 B;  2ZCE A;  4DR7 O;  3WB1 A;  3CYO A;  2LW1 A;  4GKK O;  2F4V O;  2L35 A;  1W0J G;  4HBN A;  2ZM6 B;  3ZMT A;  1U96 A;  1AJN A;  4J9Z B;  5LMU B;  1JPX A;  2GHY A;  1GM9 A;  4MVU A;  1GN4 A;  1NKD A;  3TXQ A;  3LDC A;  1SQQ H;  4X62 O;  4JTC B;  3IC9 A;  3LNN A;  5IYZ A;  2GTA A;  3ZHV A;  4D7S A;  2Y69 B;  1Q5O A;  2Z5U A;  1M56 B;  2XTA A;  3A0R A;  5FNV A;  3S3W A;  1P7G A;  4YY3 O;  4LWS B;  4B3T O;  5E1A C;  2VQE B;  3G71 V;  2Q69 A;  4ABM A;  1RP3 B;  4I55 A;  3E8H A;  1NTM H;  4TUY B;  3JAS B;  1J5E O;  3AG4 C;  2UXC O;  5KMG B;  1K7D A;  3TGU H;  2UU9 O;  3D3Q A;  4LF5 O;  2HVK C;  4CH5 A;  2QWR B;  3E86 A;  4YJ3 A;  5IYB O;  4HZ3 A;  2BOC C;  4QIW F;  2M6Y A;  1PPJ H;  2JJ1 G;  1I5Y A;  4BW5 A;  2ZE5 A;  4H33 A;  1AJQ A;  4NXN B;  1X59 A;  4UXN A;  3JYC A;  1N36 O;  3I56 V;  3K58 A;  4LFA O;  1ZTE A;  1XRE A;  1K5Q A;  1WPX A;  2WAM A;  2X7R B;  5IY5 B;  3BVO A;  4MSW C;  1F4M A;  4LWS A;  1PKX A;  4H37 A;  4DV7 B;  4I5S A;  1US6 A;  5K1X A;  4FMT A;  4IT5 A;  3OAA G;  4TUY A;  3JAS A;  3CP1 A;  2QGN A;  3CCJ V;  2IJK A;  4GX1 A;  1M5I A;  4B3R O;  1AI5 A;  2PY5 A;  4YJ2 B;  4IYH A;  4LBE C;  1N32 O;  1OJH A;  3EVK A;  4LCU C;  3RYC B;  1KP3 A;  2KQX A;  5H5N A;  1NVP B;  5EIB D;  1KD1 W;  5CBF A;  2DYR B;  5IDJ A;  1NS1 A;  2GV9 A;  4FVM A;  4UUJ C;  5JJE B;  5B1O A;  3QF7 A;  4QJF B;  3BEH A;  4GCZ A;  1LUV A;  3IAY A;  1JCH A;  2F23 A;  4E4E A;  4K0K B;  2DQ0 A;  4LR3 A;  1Y6X A;  3ZJZ A;  2E75 B;  4LF7 B;  2VWK A;  5LBQ A;  4AI8 A;  3APO A;  4DR4 B;  3JAR B;  4Q20 A;  4H13 B;  1QR9 A;  1NVP D;  3CXH F;  3VQW A;  4DUY O;  2ADQ B;  3ABK B;  2GUZ B;  3ZMZ A;  1Q3E A;  5EYP A;  1XIL A;  3K0G A;  1TA8 A;  1DGS A;  1GMG A;  1OCR B;  2WLJ A;  2HP8 A;  1TVK B;  1WPB A;  1E79 G;  3SYQ A;  3RYC A;  4R8C A;  3WB0 A;  2Z3Y A;  2K1E A;  4DR1 B;  2HG5 C;  4JYA B;  1YJN V;  3B77 A;  4JI2 O;  1P7B A;  3CSX A;  2R72 A;  3SR2 C;  2H3O A;  1SQX H;  4JI5 B;  2RCV A;  3RT3 C;  4EFB A;  2WLL B;  4K8X A;  3RYI B;  1IBK O;  2LQT A;  1MZF A;  5LP6 B;  5LGU A;  1OCO B;  3DGE A;  1HNW B;  1GH6 A;  1ZX3 A;  1IZ3 A;  2Q7G A;  3JAR A;  4UVB A;  1Y76 B;  5FL7 G;  1FXK B;  3CCL V;  5K1P A;  2LJ2 A;  2DQ3 A;  3ASN C;  1NJI W;  4UCO A;  2Q73 A;  5FPO A;  3K5O A;  4H44 B;  1HNZ O;  1XMQ O;  3LSQ A;  1ZL8 A;  1K97 A;  4WFE A;  5KA6 A;  3JCZ A;  1Q6H A;  3ZRV A;  3CCE V;  1U97 A;  4B3M O;  4MVO A;  3F5T A;  2KSD A;  2OIE A;  4DR7 B;  3D36 C;  2IU3 A;  2VS0 A;  3C90 A;  1S5H C;  3RBZ A;  1YJW V;  2UUB O;  2EIN C;  1WP8 A;  4GKK B;  3T1H B;  4JPR A;  2F4V B;  2WLL A;  2GSM B;  3QG5 A;  3CCR V;  3CC7 V;  2YS8 A;  4TV9 B;  2NNU A;  5LP6 A;  3CPW U;  1DLB A;  4GZR B;  2QM8 A;  1SQV H;  5B3S C;  1XDC A;  1W0K G;  2X6B A;  1CP9 A;  1FXK A;  1SC5 B;  4X62 B;  1VQ6 V;  3E22 B;  2LP7 A;  5CBH A;  2FL4 A;  3T4D A;  1H2S B;  3ETD A;  2EIM C;  1G6U A;  1RM1 B;  2ITD C;  1SZX A;  4UCR A;  1Q86 W;  1N33 O;  1GAX A;  4YXW G;  1EN6 A;  4MW8 A;  4YY3 B;  5B1B C;  4GT1 A;  4B3T B;  4OGQ B;  5LXT B;  1N0N A;  2XND G;  3CMA V;  1NBM G;  3B09 A;  3MHS C;  1JVM A;  4MTF A;  5CA0 B;  1J5E B;  1AR4 A;  2XHB A;  1QVF U;  2UXC B;  2UU9 B;  4LF5 B;  4TV9 A;  2LGQ A;  3G6B A;  1TUB B;  3E2E A;  3DTU B;  1VF7 A;  1L0N H;  1JA8 A;  1K73 W;  4JI7 O;  2AHY A;  3HPL C;  3P32 A;  4FK5 C;  2Q7E A;  3BA9 A;  1HNX O;  2JVD A;  2A0L A;  2CE4 A;  3E22 A;  1NR1 A;  4FM1 A;  1N36 B;  4ZOL B;  5CBG A;  3JD0 A;  4LFA B;  4PHZ A;  3RYF B;  1JMK C;  2WLN A;  2ZXW C;  3ZMU A;  4QPJ A;  3K04 A;  2W0F C;  1IVS A;  3RYH B;  4ZKI A;  2QA4 V;  1R3L C;  2P7T C;  2WLH A;  2XOK G;  4JGS A;  3CCM V;  1AJP A;  2YXH A;  4O4J B;  5CA0 A;  5B5E Z;  4FFB B;  4ZHQ A;  3ABL C;  4DR2 O;  3KKY A;  2KG7 B;  4X1Y A;  4X20 A;  4B3R B;  1OHH G;  3TCU A;  1SER A;  4IIJ B;  4LP8 A;  5KHJ A;  1N32 B;  2ZIO A;  1TUB A;  4ZBM A;  2DWD C;  1VP7 A;  1HW7 A;  3Q4H B;  1FAF A;  4DK1 A;  4KHP O;  5GTH Z;  2XT9 A;  2QTS A;  1X4T A;  4CH3 A;  1OZ0 A;  4ZOL A;  4ZI7 B;  5DM6 V;  3RN4 A;  3JD3 A;  2AGA A;  2EZP A;  3JSN A;  3RYF A;  3HKC B;  2QTO A;  1GTO A;  1M90 W;  3RYH A;  1Y74 B;  4JI1 O;  4DUY B;  4O4J A;  4RQF A;  4W4K A;  4DXW A;  2L6L A;  4JI3 O;  1H2M A;  4NVP A;  1MAB G;  2AZ2 A;  2BCC H;  5CB4 B;  3OUS A;  4B7E A;  3AG1 B;  4I9W A;  1MA1 A;  1KYO F;  4BWA A;  4PA6 A;  3AG2 C;  1VF5 B;  4PDR A;  3UT5 B;  4LFC O;  4JI2 B;  1KB9 F;  1SQG A;  1TUE B;  1FPO A;  1Q43 A;  2Q4P A;  3SYA A;  2HFE C;  4DR5 O;  4G2K A;  5CA1 B;  1M4U A;  4JAV A;  1Y4M A;  4ZI7 A;  5JQG B;  4K3A A;  1IBK B;  1Q82 W;  3G67 A;  3UQ8 A;  3B4S A;  5L3C A;  4YHH O;  2D2C B;  1F4N A;  1K33 A;  2DYS B;  2JIZ G;  1PM9 A;  2DJV A;  3HKC A;  3H1I H;  2HLD G;  3FB5 C;  4DR3 B;  2LFS A;  3QTC A;  1Y74 A;  1VQ9 V;  1FFX A;  5L3G A;  2JS5 A;  1NH2 D;  1BQZ A;  4PJ0 Z;  1Q6I A;  1HNZ B;  4PD4 F;  3SYO A;  4DV3 O;  1VQ8 V;  1XMQ B;  1XNQ O;  5LA6 A;  5DEC A;  3WG7 C;  3LNM B;  5CB4 A;  1N4C A;  3GWO A;  2PF4 E;  2Y4U A;  2Q0O C;  4B3M B;  4XBF A;  1V55 C;  3FYE B;  4TWK A;  2PI4 A;  2XAQ A;  2UUB B;  5D5Q A;  4MVZ A;  2IBZ H;  2UXN A;  1VQP V;  3RGB A;  1Z5V A;  5JQG A;  1RSO B;  1CPY A;  2PYL A;  1G1X B;  1G4Y B;  1I94 O;  3CRC A;  3CJH B;  1XHX A;  2PYJ A;  1MOF A;  4D7T A;  2EIL B;  3RFR A;  1UFI A;  4LNU B;  3AK3 A;  2R70 A;  4JAS A;  2JRI A;  3CCV V;  3UO3 A;  4UVC A;  1YXB A;  1I7F A;  3O65 A;  2ZQM A;  5JH7 B;  3L70 H;  1K9M W;  3CCS V;  4DV0 O;  1THZ A;  3ZHU A;  1N33 B;  2QKS A;  5D5P A;  4MTO A;  1YF2 A;  4U7N A;  4MVS A;  3PN1 A;  3E83 A;  1WNS A;  4JI6 O;  2OCC B;  1R6N A;  3JD2 A;  4OX9 O;  3DC5 A;  3W7U A;  2HHH O;  3E35 A;  3E8F A;  4UFZ A;  2HJF C;  2K9P A;  3CRA A;  4CC6 A;  3ML0 A;  2B9Z A;  2ZNI A;  4K35 A;  4P9P A;  5LGN A;  1BQ0 A;  2Q5Z A;  3A8T A;  5JCO A;  4ASU G;  5KHH A;  1VQO V;  4ZIB A;  3AG1 C;  2JGD B;  4CC5 A;  1H2K A;  4Z1V A;  2F93 B;  1TAE A;  3ZMS A;  2G38 A;  1P49 A;  4LNU A;  1IX9 A;  4JI7 B;  1RFY A;  1HNX B;  4TQF A;  1XNR O;  5HFL A;  3F7V C;  2EIJ B;  3FFQ A;  1FYJ A;  1OCZ C;  1QNM A;  4J7J A;  4BIU A;  3TK1 A;  1O9H A;  1WN7 A;  3ZRS A;  3NXS A;  1YTF B;  4BW9 A;  5B1N A;  3BCC H;  2DYS C;  1K5S A;  4MTX A;  4NXM O;  2EIK B;  3FD9 A;  4UCS A;  4CS2 A;  5KAF Z;  1HR0 O;  1WAZ A;  2YIC A;  1VQN V;  2ZR3 A;  4PA3 A;  2QSA A;  1SQP H;  3ZMV A;  1F23 A;  1K92 A;  1FKA O;  1NZ6 A;  2E76 B;  3AG3 C;  4DR2 B;  2VQF O;  5JJN B;  4MW3 A;  5LHH A;  1QCE A;  3H1H H;  4X89 A;  3OEE G;  2ZNJ A;  3OUF A;  3J80 N;  3MD0 A;  2Y0P A;  5C8Y B;  4MS2 A;  4HYO A;  1BS3 A;  1NT2 B;  1PP9 H;  1KUQ A;  4X66 O;  1NQT A;  2V4D A;  3RW0 A;  4KHP B;  4JV5 B;  3UKM A;  3BA8 A;  3EHB B;  3ABM C;  5EK0 A;  5KUK A;  2WLI B;  5KLV H;  3LSS A;  3APQ A;  3CXC U;  3N2K B;  1WJZ A;  3JAL B;  3T1C A;  4W4L A;  3STZ C;  3ASO C;  2YSU B;  3L72 H;  4LF9 O;  4WF9 V;  3ICX A;  1ZLZ A;  2P4K A;  1QLN A;  3C3T A;  4NYK A;  3OE7 G;  3UCS C;  5KMG A;  1JQ0 A;  1FJG O;  2EIL C;  4JI1 B;  4LF4 O;  4I9Q A;  3B2E E;  4JI3 B;  2IH1 C;  1OCC B;  3FX7 A;  1CXZ B;  2W0X A;  1UJW B;  4PA4 A;  4X1I B;  2YID A;  4EKW A;  3A0B Z;  3CRM A;  2IJH A;  2QM7 A;  1YSC A;  1R1B A;  3C3S A;  2XAH A;  3H1J H;  4BIO A;  1AR1 B;  4LFC B;  1XI1 A;  2UUA O;  1H2L A;  1AI7 A;  2QR4 A;  4CBC A;  2AXT Z;  4DR5 B;  1Y66 A;  3OD4 A;  4J41 A;  1Y67 A;  2EZO A;  4FLY A;  3J81 N;  3ZN0 A;  2CAZ C;  4DR6 O;  4YHH B;  1COW G;  2E3C A;  2YIB D;  4RO2 A;  4X65 O;  1SA0 B;  2OCH A;  4I7Z B;  2QWO B;  2Y69 C;  4YJ2 A;  1M56 C;  5BR8 O;  3CHX A;  1XBL A;  4OPH A;  3SPC A;  5ITZ B;  3L71 H;  3CC4 V;  1VF6 A;  1AI4 A;  3AK1 A;  4PDV A;  1KQS U;  4DV3 B;  1MMM A;  1XNQ B;  4FJC C;  3H1L H;  2YIB A;  1K34 A;  4X1I A;  4F4L A;  2N05 A;  3IC7 A;  4FLX A;  4XDK A;  4H0L B;  2EIK C;  3RWR D;  3MDS A;  3HKD B;  5LMN O;  4JTA B;  1XUQ A;  3CCQ V;  1P84 F;  3X2Q B;  1WB8 A;  2BOB C;  3JD4 A;  2Y48 A;  2C2A A;  4GYC B;  4DV6 B;  4NTW A;  2MK3 A;  4CS4 A;  3RVY A;  2X6C A;  4UV8 A;  1D2D A;  3LDE A;  3K03 A;  1S72 V;  3ZHS A;  1I94 B;  1SA0 A;  2GUZ A;  5J2T B;  1EN4 A;  5IJ9 B;  1B3Q A;  1H8H G;  3HKB B;  4LFB O;  3WU2 Z;  4JYC A;  3QO7 A;  4O4H B;  1KP2 A;  5IY5 C;  1EZV H;  1BL8 A;  1TVK A;  5EIB C;  4UCU A;  1O9G A;  2ATK C;  3B8M A;  4HAM A;  3SPH A;  3QO5 A;  5GON B;  1AI6 A;  1FS0 G;  1JX9 A;  1M1K W;  3DC6 A;  3M99 B;  3DXR B;  4LF8 O;  1ARO P;  4JI6 B;  3GVM A;  1BSM A;  3RYI A;  4OX9 B;  1V54 B;  3HKD A;  5FLX N;  1GKF A;  2DWE C;  2HHH B;  4KP4 A;  2V1D A;  3L74 H;  4B3S O;  4HNA B;  4MVM A;  2YEV B;  4TT3 G;  2RJZ A;  3VQX A;  3SYC A;  3OFN G;  4UCV A;  1Y76 A;  2RNB A;  2DYR C;  3K5L A;  4FLV A;  4J11 A;  4AHC A;  4FLZ A;  5J2T A;  2GTS A;  5IJ9 A;  5FPR A;  2UXD O;  1GN6 A;  5LOV B;  2CTQ A;  1XNR B;  1JFF B;  1BHB A;  4NR1 A;  4BR6 A;  3K9S A;  3G6E V;  3L9D A;  2LFR A;  4J42 A;  3DXR A;  2P5O A;  2W6J G;  4NXM B;  3ABK C;  4R7C A;  1N34 O;  1HR0 B;  1M57 B;  2YI9 A;  1OCR C;  3OMA B;  1VQK V;  2YEV A;  3OGI B;  5B1A B;  2A3Q A;  4PA7 A;  3JAW B;  2VQF B;  4FM0 A;  4DV4 O;  3LDD A;  5CN0 A;  4IHJ B;  1H38 A;  2Q6A A;  3I55 V;  1ZAU A;  2ILM A;  3OR6 C;  3P3N A;  4J10 A;  5HFM A;  2LO1 A;  1S3J A;  2F66 C;  1WA8 B;  3ABT A;  4O2B B;  4N21 A;  2VWJ A;  2F1M A;  4LH6 A;  4X66 B;  4MVR A;  2CUG A;  5LP6 C;  1OCO C;  5LOV A;  2P22 C;  2O57 A;  3OMI B;  3W7S A;  2IJJ A;  1JFF A;  4C7U A;  2Q7H A;  4FLU A;  5LXT A;  2NN4 A;  2YXY A;  5LHI A;  1R3I C;  3IFX A;  3THO A;  1FXK C;  4GUN A;  4MT8 A;  4LF9 B;  1YZB A;  2A06 H;  4MTG A;  2PI5 A;  3WFV A;  4L87 A;  4WFG A;  5L3F A;  5EBL C;  3H9V A;  4JI4 O;  1FJG B;  2CH7 B;  2XAS A;  1S0V A;  4F6R B;  2QJ1 A;  2XAF A;  5JJJ B;  4CZZ A;  4LF4 B;  2EJR A;  4DV1 O;  1QBZ A;  4WFA V;  3FB8 C;  2E74 B;  1VQ7 V;  3JAT B;  3JAW A;  1I5X A;  5CMU A;  3W7W A;  4WFF A;  3FKS G;  1DF5 A;  1TGO A;  3VQY A;  2EX3 A;  3ZIA G;  2MW2 B;  4AQY O;  1BT8 A;  1CEZ A;  4O2B A;  5KHK A;  1XMO O;  2UUA B;  3ZN1 A;  2IM9 A;  4I50 B;  3TXS A;  2IH3 C;  3TET A;  2PZS A;  2BTO A;  3GB7 C;  1IBM O;  4J7Z A;  4DK0 A;  3O9O A;  1JR9 A;  1JJO A;  1WB7 A;  3F7Y C;  2N04 A;  4DR6 B;  1NTZ H;  3CME V;  2OTL V;  3OTF A;  3T1Y O;  1S5L Z;  3E8B A;  4FFB A;  4P9O A;  1AP5 A;  2KG7 A;  2CH7 A;  3N2G B;  3K59 A;  4WFB V;  1RM1 C;  4U7O A;  5JWP A;  5BR8 B;  4IIJ A;  2JEX A;  1QR8 A;  2R9R B;  4D6T H;  3Q4H A;  1FXV A;  1BHA A;  1ZSP A;  5LL6 Y;  4UB6 Z;  4DUZ O;  3W7X A;  4RQE A;  4GX5 A;  4PDL A;  4LC1 A;  1K8A W;  2FKX A;  2QKA A;  5IYC O;  3KCY A;  1VQL V;  3MHH C;  5BMV B;  1VQ5 V;  5LMN B;  4I50 A;  4QPK A;  1IXB A;  4NB5 A;  3RVZ A;  1VQ4 V;  2KKW A;  2NR5 A;  1R3J C;  4LF7 O;  1SZT A;  3JAK B;  2WA3 A;  4XDL A;  1XL6 A;  4DV5 O;  3BHP A;  2CK3 G;  4RUF A;  1L8D A;  1WLE A;  5KX5 B;  2A9H A;  3K9A A;  3QO8 A;  2OYQ A;  3OMN B;  4U3J B;  4LFB B;  3AG4 B;  5IJ0 B;  5IWA O;  3SJA C;  4O2A B;  1YI2 V;  1ZWI C;  2FML A;  4PV1 B;  4X64 O;  4J7K A;  4DW1 A;  3UT5 A;  3ZRW B;  3ABU A;  1FXH A;  4EFE A;  1SQF A;  1R73 A;  1AB3 A;  3ZCC A;  1GO3 F;  1JOY A;  4LF8 B;  3BAA A;  3L75 H;  4O4L B;  1YDX A;  5CA1 A;  2QWQ B;  3OTO O;  2ZDI A;  2XUM A;  1ENV A;  1AR5 A;  1EN5 A;  4CH6 A;  5BMV A;  2HVJ C;  3FAV B;  5B66 Z;  3E89 A;  4JYY A;  1HP8 A;  4B3S B;  3AG7 A;  1SET A;  3SPG A;  1SF9 A;  2JGU A;  5JVD B;  3A2F A;  4I4T B;  2ETN A;  5GW7 A;  3JAK A;  3SJC C;  2YI8 A;  5A9G A;  5KX5 A;  3BAB A;  4F6E A;  4DRX B;  2UXD B;  1PNL A;  2WPD G;  3AEI A;  4U3J A;  3ZED A;  4DYL A;  3K79 A;  5IJ0 A;  3G4S V;  3VQV A;  5AG2 A;  2RQ6 A;  3M8A A;  1BCC H;  1XEQ A;  1GN2 A;  4WFH A;  2ZR2 A;  5LHG A;  3K5N A;  1IXM A;  3ZRW A;  4BAY A;  1GK9 A;  2AHZ A;  3SGI A;  2UUC O;  3SJB C;  4O4L A;  2Z0A A;  1N34 B;  5TIS Z;  2ZD9 A;  2ADP A;  2F43 G;  1RSO A;  5IT9 N;  3T1H O;  5E79 Z;  4UVA A;  3FAV A;  3H1K H;  3STL C;  4MVQ A;  2QWP B;  3W7T A;  3CJH A;  4JI0 O;  2JDI G;  5EBW C;  4YJ3 B;  5JVD A;  1YIJ V;  3OGC C;  4PA9 A;  3N27 A;  4I4T A;  5BXZ A;  4TV8 B;  4DV4 B;  4RUE A;  4EEQ A;  1M93 A;  4JI8 O;  1AP6 A;  3L73 H;  1E1R G;  3OT7 A;  4NTY A;  1S5J A;  4RWU A;  5JH7 A; 
#chains in the Genus database with same CATH homology
 2Q5Z A;  3CRC A;  4QGP A;  2YXH A;  5IE9 A;  2GTA A;  2Q4P A;  2P06 A;  1YVW A;  2Q9L A;  2OIE A;  1YXB A;  2A3Q A;  3C90 A;  3CRA A;  2Q73 A;  2A7W A;  2OIG A;  1VMG A;  1Y6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...