2OIEA

Crystal structure of rs21-c6 core segment rscut
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
102
structure length
102
Chain Sequence
RPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RS21-C6, Involved in Nucleoside Triphosphate Pyrophosphohydrolysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords RS21-C6
total genus 35
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2oieA00
3C90A 2GTAA 1YXBA 1Y6XA 2A7WA 2P06A 2Q4PA 1VMGA 3CRAA 5IE9A 2A3QA 2Q9LA 4QGPA 2Q5ZA 2Q73A 2OIEA 2YXHA 3CRCA 1YVWA 2OIGA
chains in the Genus database with same CATH superfamily
4E4EA 2KQXA 4D6TH 3LDEA 1RSOA 2DWEC 5LMNO 5LOVA 1KU9A 3K5NA 3RYIB 1QLEB 2O57A 3U11A 3E8FA 1OHHG 1N33O 5FNVA 1IZ3A 2AW9A 4BWAA 3X2QC 4O2AA 2JVDA 1GH6A 4DR7O 4UCOA 1BQZA 1BHAA 5IWAO 4Q20A 4DW0A 1V9PA 3ZRXA 4DV1O 4JI4O 5CA0B 2ZQMA 3P3PA 1AI7A 3HKCA 4I50B 2CH7B 1WB7A 3IC9A 1JMKC 3TGUH 5LYJA 3BAAA 3K5MA 3S3WA 3CCRV 5L3FA 3OFNG 4FFKA 4BAYA 4DR2O 4JF3A 4WFAV 1G1XB 1Y4MA 4X66O 1AJQA 2BTQB 3FB6C 2RN9A 3FB5C 1XNQB 4J42A 4JTCB 2IW5A 1YTFD 2CTRA 4UFZA 1YJNV 3CJHB 2Q0AA 4WBNB 2R70A 3JD2A 4GX2A 2YC0A 4DO2A 2BOCC 3J80N 4I9QA 1GM7A 3CCJV 1NU1H 4ZOLA 2PF4E 3E8GA 3RVZA 2E76B 3C90A 4R6ZA 4LF5B 2WLIB 5J9PC 2ZNIA 1J95A 2HR3A 2XT9A 1FFXA 1JFFB 2QKAA 2YEVB 3ABMC 1PM9A 4QE9A 4JYAB 2YIBA 4MVQA 1KD1W 1XMQO 2V7QG 2XAHA 3CXHF 2YXLA 3CC4V 1D2DA 1Q90D 3P32A 4IGGA 5LOVB 3ZMZA 4JAAA 1NKDA 2Q6AA 3LNMB 2QJ1A 4KUMA 1YTFB 5E79Z 4EFEA 4DXWA 2RCVA 2ZCEA 2OT5A 4LFAB 4U3FH 3T1CA 3W7SA 3OEEG 4GX0A 4WF9V 2CTWA 4FLYA 1PPJH 1V54C 2F43G 4DV2B 3CSXA 1DTOA 4UUJC 2ZM6O 1Q6HA 2DJVA 1VQPV 2EIMC 1WA8A 2GUZB 3QTCA 3OT7A 5FLXN 1XILA 2UXBO 4MTFA 1H2KA 4N21A 4TOIA 4IHJB 3LSSA 2WPDG 3OUFA 3OMAB 1SZTA 1GN6A 4MW3A 4X20A 5ITZA 2QE7G 2QWRB 1XNRB 1NR7A 4JYBA 3B8NA 2FTKA 1HR0B 1RSOB 1AB3A 4EB6B 5KLVH 2ATKC 3SPIA 4MVSA 4IYHA 1S77D 4JI2O 1F4NA 4YJ3A 4JI1B 1YCIA 3JATA 1N0NA 1QR9A 3SJQC 4J7ZA 4O4JB 4RWUA 5L3DA 1JOYA 4RUFA 1Q8IA 2ZIOA 3U0ZA 3STZC 3RW0A 1Z2GA 4HZ3A 2ADQB 1J5EO 5ITZB 2YEVA 3ASNC 5IE9A 5LBQA 3VQYA 4NXNB 1YZBA 1L0LH 2PYJA 1PNMA 3AG1C 5IDJA 1AI5A 2KKWA 5FPRA 2Q69A 1DGSA 1RM1B 1VQ9V 4DR2B 3JD1A 4PI0A 3TETA 1EN4A 3EHBB 4K8XA 4F6RA 3RYHB 4DR1B 5JJEB 1GM8A 1RP3B 2YXYA 1Y74A 2KB1A 2LQTA 4WFBV 4UV9A 1XBLA 2H8PC 5GONB 4DUZB 2OIGA 1P4RA 5FNVB 4XDJA 4JI7O 1S3JA 5C8YB 3IAYA 4FPPA 5B1BB 1IBLO 4I5SA 4XDLA 3OAAG 2ODMA 1HNZB 1S5HC 4J7KA 1XMOO 3ABKC 1F7YA 3F7VC 3RBZA 4DV5O 3JYCA 1Y67A 5B1AC 1HDJA 3CCVV 2FB5A 4NTXA 2DW4A 4K0KO 2EBOA 5L3EA 2YIDA 1N36B 3NXSA 5H2FZ 2WLJA 4B3RB 3SJCC 1GRJA 1OCZB 4EEQA 1SERA 3A0HZ 2JEUA 4K8ZA 1XMOB 3JAWB 1YHQV 2VWJA 1QHTA 1U96A 1I08A 3TK1A 2Z0AA 3CXCU 3HKDA 2GHYA 2ZT9B 1W0KG 1SQQH 1QNMA 1GN4A 3CJHA 1RFYA 3SR2C 4NB5A 1H2NA 5B3SC 4I55B 4GUNA 1NTKH 1DK1A 1ZAUA 4K3AA 2IU3A 2V4DA 2M6YA 1EN6A 3CE2A 1JFFA 5JJNB 2QWNB 4UB6Z 4G2KA 1LUVA 4FLWA 5EYPB 1VP7A 1L0NH 1MABG 1FD9A 3P3NA 1VQNV 4ZI7A 1QBZA 3N2GA 3K9AA 5BMVB 1FFTB 4FVMA 2BTOA 3AK1A 3Q4HB 3G6BA 4UCTA 4MTOA 3K03A 2OCHA 2ZNJA 3P30A 4A5UB 4TQDA 2IU0A 2UXXA 4LF6O 2EINB 1W2BU 2YI8A 2JS3A 1F51A 2ZXWC 1TUEB 2EJ7A 3H1KH 4CH6A 3CC2V 3AG1B 3GWOA 1K33A 5EIBD 2Y4UA 2H94A 3ZN0A 5LMUB 4PA3A 2A0LA 1YEWA 1GAXA 2B1GA 3CPWU 1ZL8A 4FZ1A 3N2GB 3JASA 1EN5A 4UCVA 1L1FA 5KAIZ 4LFCO 1RM1C 4R7CA 2JEXA 2Y48A 3R65A 5IYDO 4LF4O 4FM2A 4DR7B 3AK2A 5B1OA 2P4KA 3W7UA 1UFIA 3BRCA 4GKJB 4PA4A 2ILMA 2ZE8A 4AQYO 3ASOB 3EFFK 3ZRWA 1MOFA 3AG3C 1MA1A 1K7DA 4I50A 4CBCA 2VQFO 2QTSA 2Q73A 1N32B 1OCCB 3H1LH 1HNZO 5B66Z 5CA1A 3ZEDA 4FIPC 4BIOA 1BQ0A 4XBFA 1Y66A 4XDKA 3ABLC 3RYFA 4LFAO 1LR1A 1HP8A 2DQ3A 3RYCB 2WLLB 2ZINA 4TV9B 5A2QN 1JX9A 1THZA 1BL8A 3K08A 2VQEO 2EILC 3JD0A 2EX3A 4DRXB 3OTOB 2QGNA 1XREA 1GK9A 1VF7A 4JAVA 4X89A 1YSCA 1KB9F 1IXBA 4LWSB 3D36C 3HKEB 1LUWA 2F95B 5D5PA 3ZN1A 4TV8B 4JI5B 4YJ3B 2ITCC 3CRCA 4X64B 3SYAA 4JI8O 2PUSA 2XUMA 1VQLV 1I5XA 1PKXA 1US6A 1M56C 4J7JA 4O4HB 1SRYA 5LHIA 3D8CA 5DM6V 1AP5A 4PDLA 1XL4A 3VOUA 2CAZC 2F66C 4HYOA 3WB2A 3CWBH 4EFBA 3L72H 2EZOA 4D7SA 5HFLA 4H37A 1VQOV 3BCCH 3CRQA 4LNUA 4JYCA 5LGTA 5J2TB 1TUBB 4EKWA 1HR0O 2DYSB 1SZXA 2A3QA 4RQFA 3BVOA 5C93A 1FFXB 2F23A 3OGIB 5LHGA 3SPGA 4WFHA 4GKKB 4DR4O 4DV0B 2Y0IA 1KP2A 5LMNB 1CP9A 4FFBB 4NTWA 3ZHVA 1B3QA 4I4TB 3S3XA 1R6KA 2X0LA 5B1BC 1GMGA 3ZMSA 5B3SB 4B3SB 2AZ2A 1NBMG 4DRXA 1FKAO 1H2GA 5EZYA 3UCSC 1SQGA 4I0XB 3K57A 5IWAB 1SQBH 1XDCA 4J9ZB 4QIWF 4DV4B 1OCRB 4NR1A 2IH3C 4LH7A 1GN2A 4DR1O 2HJDA 1SETA 4ZHQB 4TUYB 4FFBA 5CA1B 4NXMB 2PI4A 2JDIG 4ABMA 5KHJA 2OWOA 4JYAO 1SQVH 2N74A 5EIBC 3H9VA 4TQFA 1SA0B 3CB2A 2E5LO 2XHBA 5BXZA 1MSWD 4LF5O 5CBGA 4H0LB 4OPAA 1YI2V 2UU9B 3DXRB 3PN1A 4YIOA 1QR8A 4NYKA 3LDDA 2UXDO 5J2TA 4GX5A 4CZZA 2WA4A 4DR6B 3E8BA 2YI9A 4CH4A 2ZD9A 4FLTA 5LP6C 5LGUA 4F6EA 2RQ6A 4GT1A 5BR8B 5LXTA 4B7EA 3M99B 1XQ8A 4I9WA 4MVUA 4B7KA 3SJAC 2OTJV 2JIZG 1PNLA 1K97A 4LF7O 1NH2D 1KYOF 4X1IB 4JI8B 2WA3A 1FXVA 3SPJA 3RN4A 1ROPA 1M1KW 1HWYA 4DR5B 2W0FC 5JH7A 4JI0O 4JGSA 3L73H 1H8EG 2ZE6A 1SESA 4B3RO 1M9NA 1JJ2U 3OMIB 2OCCB 4U7NA 1H2SB 2M7WA 2HEPA 3WFVA 3HKDB 3BA8A 4IYIA 1WJZA 4EB6A 4MT8A 3L70H 1Q7YW 3CS5A 5KAFZ 3CRAA 2EJRA 3SYPA 3ETGA 3FD9A 4DR3O 2P7TC 4DV2O 4GLXA 2A06H 1WP8A 3AEIA 4DR5O 1S76D 1Q43A 3UT5B 5JVDA 3APOA 2QEXV 2DOSA 2QTOA 5LP6A 2A79B 1VF6A 4PV1B 3T2MA 4MTGA 4GCZA 2CUGA 1ZLZA 3W7WA 5LMUO 1Q86W 4H44B 2E74B 2EIKC 2IJJA 3IC7A 1XL6A 1Y6XA 1K5QA 4LF8B 3WU2Z 1WB8A 3K5LA 3ZMVA 1YVWA 3K06A 5EZYB 2Q67A 2AHZA 3E35A 4J10A 3EVKA 3CMAV 1BSMA 1BS3A 3I5DA 2P22C 1O9HA 4PA7A 5DECA 4DUYO 1S72V 1J5EB 2E5LB 1Z5WA 3CRRA 2ZE5A 3K5OA 5LL6Y 1Q3EA 2R9RB 1TGOA 2JGDB 3CCEV 1XNQO 4DUZO 4L87A 1AI6A 1JA8A 1H38A 3VQXA 3SDLA 4PDMA 4PA9A 2QKSA 4JI6B 1IDSA 5H6RA 2JGUA 1R6NA 1SA0A 3LSUA 4ZBMA 2NR5A 1NTZH 1O9GA 1K92A 2IJKA 2PY5A 3JSNA 1WLEA 3G71V 3K0DA 4CH3A 1I94O 4X1YA 3FB8C 2UUCO 4R8CA 5H5NA 5E1AC 2JS5A 4FLUA 1L8DA 5BY1A 5L3BA 2HVKC 4JAUA 3SYCA 4YY3O 4O2BB 2XAFA 2N04A 5GONA 1D5NA 2WSSG 4DV6B 3CRMA 5IY5B 5LP6B 2Q8VA 2Y69B 1GN3A 4K0KB 2VQEB 3T1HO 5BZBA 1EZVH 2EILB 1VQ4V 4Z1MG 1X4TA 1NR1A 4KHPB 4X20B 5JH7B 5D5QA 3G80A 3DGEA 3WG7B 3ZRVA 2YUAA 5A9GA 3ZX6A 1SQFA 3D3QA 1Z5VA 4C7UA 4ZKIA 3L75H 4Q6GA 1FAFA 1IBMB 1S5JA 2JK5C 2UXBB 4DV7B 4J41A 4P9OA 1V55C 1OV9A 2GTAA 4BIZA 3ABMB 2NN4A 5JCOA 5JVDB 3HB3B 3RYFB 3OEHG 3B09A 5KUMA 3TJTA 2QKCA 1F23A 1BZKA 3G67A 4HNAA 2W6JG 2XNDG 5KHIA 2CTPA 4IIJB 4X88A 1HNWB 3FAVA 5B1NA 4DW1A 2UUAO 4DV7O 4D7TA 1MSDA 4MS2A 4O4IB 1CEZA 5LA6A 4FZ0A 1ZSPA 4E2LA 3ZRSA 1WN7A 2VS0A 3HKEA 4B3MO 4FLZA 4IT5A 1EBOA 3ASOC 3B40A 1QU7A 2B9ZA 3UM7A 2Q7GA 5IY5C 4CS3A 1BCCH 4LCUC 5B5EZ 2QWPB 4DUYB 2ZR2A 4DV1B 4JI4B 2OYQA 2LJ2A 4RQEA 5CN0A 1KP3A 2DE0X 5GW7A 1MMMA 3FAVB 1NQTA 3ABLB 1K8AW 2PZSA 1WPBA 1N33B 1OZ0A 2CK3G 1BE3H 5FL7G 2PYLA 1NT2B 1N32O 2PI5A 5CB4A 1MNGA 4WFEA 1XHXA 4DV6O 3CCQV 3T1YO 2RJZA 1JPXA 1Y74B 2DWDC 1FS0G 4YJ2B 1YF2A 3MHSC 4FJCC 4AQYB 4TT3G 4LF4B 4GKJO 4DV4O 4UVCA 1HW7A 4UXNA 1KUQA 2YIAA 2UXCO 4WCEV 1NTMH 4RAIA 4YHHB 1N0JA 3K58A 1AR5A 4PA6A 1ZUQA 3E83A 5K1PA 4PDVA 1K4DC 4LWSA 2VQFB 1N8RW 3E22B 3VQVA 1P7BA 4O2BA 5GTHZ 5EC2C 1DLBA 1EFRG 3UT5A 3J7AU 2LFRA 2HLDG 4J11A 4YJ2A 3SPHA 4I4TA 2WLKA 2FMLA 5KUKA 1U97A 3CCMV 3A0RA 1AR4A 3PJSK 1JJOA 1HNXO 1D5AA 1FXKB 1LNQA 1R3IC 3FFQA 3HPLC 1H2MA 3ZHRA 2ZE7A 3K79A 3T4DA 5KA6A 1QVGU 5IJ0A 3CP1A 1JCHA 1YXBA 4I0XA 3QNEA 1RPOA 4GYCB 3E8HA 1TUBA 2A9HA 1PL0A 3H1HH 4FM1A 4H13B 2DYSC 1G6UA 4JYYA 5C8YA 3AG4C 3F5WC 4KFMA 4U3JA 2FKXA 3HR0A 3CD6V 3QO5A 3JALB 1VARA 5KA5A 1P49A 1R1BA 2KSDA 3OE7G 5HFMA 1TVKA 4WFFA 1R3KC 2KG7B 1ZL8B 1S5LZ 3DXRA 3OGCC 5TISZ 3K59A 2IJHA 3CC7V 5IT9N 1G4YB 1VQKV 3GB7C 4QE7A 4HNAB 3RT3C 4W4KA 3M7MX 1JR9A 2A7WA 3ETDA 4JI5O 1PV0A 3AG2B 3ZBHA 3FB7C 5IYBO 4MTXA 2HHHO 1TAEA 3C3SA 4B3SO 1AP6A 4DR3B 4LNUB 4R50A 2QM4A 1EM1A 2X7RB 1KBHA 1GO3F 3UQ8A 1NVPD 2DMXA 3FKSG 1K34A 3L71H 2Q4PA 4YIPA 4DV0O 5JQGA 1OCOB 5LXTB 2YS8A 4GKKO 1PD3A 2VWKA 1M93A 1VQ7V 4KXRA 1IURA 2AGAA 2D3OW 4HAMA 2Q0OC 4G27B 4OXSA 3FYIB 2CDYA 1F4MA 1YITV 1Y76A 1KECA 1PNKA 3THOA 2P5OA 3JSLA 1Q81W 4JZGA 3T1YB 3WB0A 2JGDA 3GVMA 3BY6A 5J2UA 1AROP 3QVNA 1GM9A 2ITDC 4X62O 1ENVA 3K04A 1V54B 1JVMA 1H2LA 2UUCB 5LHHA 4YHHO 4N23A 3MHHC 1GKFA 2WLHA 2WLLA 3SYOA 3JALA 4JI7B 2AHYA 1K5SA 3IGAC 1IBLB 2BE3A 3B77A 5F2VO 1I5YA 1VIBA 2CGNA 5KX5A 3OR6C 1AR1B 2BCCH 4X1IA 3L74H 1WP7A 2QM8A 1H8HG 2R9IA 3IFXA 4WFGA 5CB4B 3A0BZ 1AI4A 4DR6O 3BFRA 4CH5A 1YJWV 3CEIA 2EIJC 2DQ0A 1FXKC 4MVOA 1VF5B 2Y4TA 1SF9A 2ZIMA 4LP8A 3OUSA 3I55V 3RFRA 2PTMA 4O4JA 1R3LC 4FK5C 3GWKC 2UUBB 3BA9A 2OIEA 5CBFA 2WLIA 4YXWG 2XOKG 1W0JG 3JCUZ 3BPZA 4PJ0Z 1QVFU 4RUEA 3AG4B 2GUZA 4CS2A 2LFSA 1M90W 1N34O 2HFEC 1ZTEA 4QPJA 4DR4B 2Z3YA 4QNHB 4I7ZB 2P6JA 1NH2B 4H33A 4J80A 1XNRO 2YXHA 1BHBA 2GBOA 4QJFB 2E75B 3RWRD 4DV3O 1MG1A 2WWWA 1T5EA 4QGPA 2DYRB 2X6AA 2IJIA 1RPRA 3JD4A 2ZDIC 3B8MA 3QO8A 4X9QA 2WLMA 5JWPA 4AILC 4ZIBA 3KKYA 1FPOA 1IXMA 3U10A 2Y69C 4NTYA 4O4HA 1QLEC 1M57B 2JJ2G 1KQSU 1DF5A 4LR3A 4B08A 4X1KA 4W4LA 2P67A 2QWQB 3AK3A 3A8TA 4G28B 3ZIAG 3K0GA 1NJIW 3D3IA 4TV9A 2N05A 4PELA 1XEQA 3CCLV 4LFCB 2F4VO 5IJ9A 4HBNA 3OW2U 3ZJZA 3O9OA 3OMNB 4DYLA 2DYRC 3LSQA 3STLC 2V1DA 3N2KB 2F93B 2NNUA 3OTFA 5KMGA 4X65O 4NVPA 2F1MA 2YIBD 3X2QB 3CX5F 4X65B 1AVMA 4LFBO 3JAKB 1VMGA 2PGGA 3OR7C 1WPXA 1NS1A 4JI6O 1BGYH 1Q6UA 2HHHB 3F5TA 4X8AA 1OCRC 4KL1A 3K3WA 4AI8A 3NR7A 2GDSA 4CC5A 2ADPA 5CA3A 1XOUA 1E1RG 3KG2A 1K3EA 3MAQA 2RDCA 4LF9B 4PHZA 1R3JC 1R73A 2CTQA 3K9SA 3KZIZ 3TCUA 1VF6C 1YJ9V 3G6EV 5L3CA 2LGQA 2OTLV 2P90A 4X64O 5EYPA 1OCOC 3HKBA 4J9YB 4PI2A 2W0XA 1ZWIC 1SQPH 4ZI7B 2GV9A 3ML0A 4JPRA 3ZHUA 3OTOO 4Z2WA 1N36O 4RO2A 3WG7C 1IBKB 3BEHA 1IBMO 3BHPA 4AHCA 1Q5OA 4ZOLB 4O2AB 1SQXH 2E3CA 4JZ2A 1ZX3A 2QM7A 4CS4A 3UO3A 2YICA 2ZXWB 1Q6IA 1UJWB 1PL4A 3C3TA 4BIUA 2LP7A 2HKOA 2FL4A 4UVAA 3FX7A 2GSMB 4CC6A 1FYJA 2CGOA 4ICGA 3CYOA 4FMTA 4B3TO 1M57C 5CA0A 5KX5B 1COWG 2OCCC 5BR8O 4P30A 3HKCB 4PD4F 3DSQA 4DK0A 5IYCO 2QSAA 2B5UA 2VRZA 3ZS8C 2X6BA 3ICXA 4LF6B 3JATB 4JI3O 1FJGB 3ZCCA 3E86A 2RMKB 2XAGA 5EBWC 5AG2A 3JAWA 4FM0A 3B4SA 4GX1A 1WNSA 4JI0B 4LF7B 3CMEV 4PDRA 1JQ0A 3E22A 4UCSA 5LGNA 2EZPA 5EC1C 4MVMA 1CXZB 2EINC 3BABA 4B3MB 4I55A 4WBNA 2KG7A 5J2UB 1K73W 1NVPB 4OPHA 1UPGA 3SYQA 3QF7A 1AJPA 1B04A 1VEWA 4OX9B 5EK0A 3ZHSA 1G8MA 1HNWO 5GTIZ 3RYHA 4NXNO 1FXKA 2CH7A 1GTOA 3CCUV 5BMVA 4MVRA 4LF9O 2Z5UA 2IM9A 5LYJB 1SC5B 1P84F 3AG7A 3N2KA 2BTQA 4UCUA 3O65A 3WB1A 1CPYA 4LFBB 1E79G 3EXAA 2GTSA 4X66B 2Q9LA 2QR4A 1M56B 4TWKA 3ZMTA 2QA4V 1NI8A 1VQ8V 3DC5A 4IHJA 2YSUB 5H9CA 1YIJV 2ARHA 4LH6A 5JCOC 1K4CC 3H1JH 2F4VB 2UU9O 2RNBA 1MZFA 3TXQA 1SS3A 4LC1A 1WAZA 4P9PA 3KCXA 2UXCB 2HG5C 3HKBB 5FPOA 1KKCA 3RYCA 3I56V 4K35A 4BW9A 5IJ0B 4NXMO 1FXHA 5L3GA 2IBZH 2ZDIA 1W59A 3W7TA 1IBKO 2ETNA 3E89A 5JQGB 3ZMUA 2G38A 2C2AA 2L35A 1P7GA 1SKVA 3SPCA 4BW5A 4YY3B 3R66A 5KMGB 2JJ1G 3ASNB 3JAKA 5DEDA 2UUBO 1KMIZ 4ASUG 3OD4A 1B06A 4DV5B 2W6IG 1M5IA 4F4LA 2DN9A 2P4VA 1I94B 3OM3B 4KHPO 3JCZA 5H6QA 2LW7A 3JARA 2XTAA 2HP8A 4MSWC 1MZEA 3T1HB 1QLNA 4X1KB 1N34B 3RVYA 1XUQA 1VQ5V 2MW2B 2UUAB 2HJFC 1QQCA 2H3OA 4TSFG 3LUTB 4JI1O 4FLXA 3FYEB 1Q82W 4JI2B 2UXNA 1IX9A 3SGIA 4QPKA 1AJNA 1OJHA 3AG2C 3MDSA 3ABTA 1K9MW 3N27A 1DF4A 4TUYA 4MVZA 3TXSA 1VQMV 2ZR3A 1V55B 4O4LB 2LO1A 3ETQA 4U3JB 2Q7HA 3F7YC 1XHZA 1ORQC 2FYUH 2EULA 2XAQA 2Y0PA 1R6TA 5B1AB 4NKGB 3L9DA 3JD3A 3CCSV 4L8JA 5CBHA 1OCZC 3J81N 3LNNA 3QO7A 1NZ6A 1EZJA 5JJJB 2R9AA 4FLVA 4P2ZA 1VQ6V 2LGWA 4DV3B 2JRIA 3D36A 1BT8A 5EBLC 2R72A 3A2FA 1OCCC 2WAMA 2MK3A 3JAMN 5IYZB 2Q68A 2ZKOA 4JV5O 4IL6Z 2AZ0A 4X62B 2LW1A 2D2CB 3ETEA 3M8AA 3UKMA 4UVBA 1PP9H 3APQA 3ABUA 3JARB 3VQWA 4ZHQA 1XI1A 1KKDA 4U7OA 3IJ4A 2QDOA 4IIJA 5KHGA 2BSKA 2ZM6B 5KHHA 4KP4A 4JV5B 4O4IA 1QCEA 1Y76B 3H01A 4UV8A 1URFA 4LBEC 1S0VA 2K1EA 4UCRA 5K1XA 1I0HA 4TV8A 2HVJC 3G4SV 3E2EA 3W7XA 3T4ZA 4OGQB 1I7FA 3Q4HA 1X59A 3VBBA 2Q5ZA 4JTDB 2NLJC 1KC8W 4UB8Z 1BMFG 1N4CA 3QG5A 2IH1C 2AXTZ 2EIJB 2EIKB 4GZRB 1A32A 4BR6A 2B1IA 1YDXA 4DK1A 3RGBA 2Q7EA 1XMQB 3KCYA 1TVKB 5EBMC 5CMUA 5KHKA 5IJ9B 3SJBC 4F6RB 2CE4A 1M4UA 4JASA 2XAJA 1TA8A 3H1IH 1E1QG 1HNXB 3JASB 3DC6A 5DN6G 3ZHQA 4X1YB 4MW8A 4JTAB 1FJGO 4JI3B 4Z1VA 3DTUB 5LA6B 2BOBC 4OX9O 5IYZA 1B6QA 3LDCA 2L6LA 2WLNA 3RYIA 3ABKB 1AILA 4LF8O 3ZHTA 2P06A 1WA8B 2QWOB 2YDEA 2EIMB 2UXDB 3AG3B 2K9PA 3MD0A 3ZRWB 4O4LA 4B3TB 3CHXA 2X6CA 1IVSA 3B2EE 3UO2A 2XASA 2BSKB
chains in the Genus database with same CATH topology
3C90A 2GTAA 1YXBA 1Y6XA 2A7WA 2P06A 2Q4PA 1VMGA 3CRAA 5IE9A 2A3QA 2Q9LA 4QGPA 2Q5ZA 2Q73A 2OIEA 2YXHA 3CRCA 1YVWA 2OIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C90 A;  2GTA A;  1YXB A;  1Y6X A;  2A7W A;  2P06 A;  2Q4P A;  1VMG A;  3CRA A;  5IE9 A;  2A3Q A;  2Q9L A;  4QGP A;  2Q5Z A;  2Q73 A;  2OIE A;  2YXH A;  3CRC A;  1YVW A;  2OIG A; 
#chains in the Genus database with same CATH topology
 4E4E A;  2KQX A;  4D6T H;  3LDE A;  1RSO A;  2DWE C;  5LMN O;  5LOV A;  1KU9 A;  3K5N A;  3RYI B;  1QLE B;  2O57 A;  3U11 A;  3E8F A;  1OHH G;  1N33 O;  5FNV A;  1IZ3 A;  2AW9 A;  4BWA A;  3X2Q C;  4O2A A;  2JVD A;  1GH6 A;  4DR7 O;  4UCO A;  1BQZ A;  1BHA A;  5IWA O;  4Q20 A;  4DW0 A;  1V9P A;  3ZRX A;  4DV1 O;  4JI4 O;  5CA0 B;  2ZQM A;  3P3P A;  1AI7 A;  3HKC A;  4I50 B;  2CH7 B;  1WB7 A;  3IC9 A;  1JMK C;  3TGU H;  5LYJ A;  3BAA A;  3K5M A;  3S3W A;  3CCR V;  5L3F A;  3OFN G;  4FFK A;  4BAY A;  4DR2 O;  4JF3 A;  4WFA V;  1G1X B;  1Y4M A;  4X66 O;  1AJQ A;  2BTQ B;  3FB6 C;  2RN9 A;  3FB5 C;  1XNQ B;  4J42 A;  4JTC B;  2IW5 A;  1YTF D;  2CTR A;  4UFZ A;  1YJN V;  3CJH B;  2Q0A A;  4WBN B;  2R70 A;  3JD2 A;  4GX2 A;  2YC0 A;  4DO2 A;  2BOC C;  3J80 N;  4I9Q A;  1GM7 A;  3CCJ V;  1NU1 H;  4ZOL A;  2PF4 E;  3E8G A;  3RVZ A;  2E76 B;  3C90 A;  4R6Z A;  4LF5 B;  2WLI B;  5J9P C;  2ZNI A;  1J95 A;  2HR3 A;  2XT9 A;  1FFX A;  1JFF B;  2QKA A;  2YEV B;  3ABM C;  1PM9 A;  4QE9 A;  4JYA B;  2YIB A;  4MVQ A;  1KD1 W;  1XMQ O;  2V7Q G;  2XAH A;  3CXH F;  2YXL A;  3CC4 V;  1D2D A;  1Q90 D;  3P32 A;  4IGG A;  5LOV B;  3ZMZ A;  4JAA A;  1NKD A;  2Q6A A;  3LNM B;  2QJ1 A;  4KUM A;  1YTF B;  5E79 Z;  4EFE A;  4DXW A;  2RCV A;  2ZCE A;  2OT5 A;  4LFA B;  4U3F H;  3T1C A;  3W7S A;  3OEE G;  4GX0 A;  4WF9 V;  2CTW A;  4FLY A;  1PPJ H;  1V54 C;  2F43 G;  4DV2 B;  3CSX A;  1DTO A;  4UUJ C;  2ZM6 O;  1Q6H A;  2DJV A;  1VQP V;  2EIM C;  1WA8 A;  2GUZ B;  3QTC A;  3OT7 A;  5FLX N;  1XIL A;  2UXB O;  4MTF A;  1H2K A;  4N21 A;  4TOI A;  4IHJ B;  3LSS A;  2WPD G;  3OUF A;  3OMA B;  1SZT A;  1GN6 A;  4MW3 A;  4X20 A;  5ITZ A;  2QE7 G;  2QWR B;  1XNR B;  1NR7 A;  4JYB A;  3B8N A;  2FTK A;  1HR0 B;  1RSO B;  1AB3 A;  4EB6 B;  5KLV H;  2ATK C;  3SPI A;  4MVS A;  4IYH A;  1S77 D;  4JI2 O;  1F4N A;  4YJ3 A;  4JI1 B;  1YCI A;  3JAT A;  1N0N A;  1QR9 A;  3SJQ C;  4J7Z A;  4O4J B;  4RWU A;  5L3D A;  1JOY A;  4RUF A;  1Q8I A;  2ZIO A;  3U0Z A;  3STZ C;  3RW0 A;  1Z2G A;  4HZ3 A;  2ADQ B;  1J5E O;  5ITZ B;  2YEV A;  3ASN C;  5IE9 A;  5LBQ A;  3VQY A;  4NXN B;  1YZB A;  1L0L H;  2PYJ A;  1PNM A;  3AG1 C;  5IDJ A;  1AI5 A;  2KKW A;  5FPR A;  2Q69 A;  1DGS A;  1RM1 B;  1VQ9 V;  4DR2 B;  3JD1 A;  4PI0 A;  3TET A;  1EN4 A;  3EHB B;  4K8X A;  4F6R A;  3RYH B;  4DR1 B;  5JJE B;  1GM8 A;  1RP3 B;  2YXY A;  1Y74 A;  2KB1 A;  2LQT A;  4WFB V;  4UV9 A;  1XBL A;  2H8P C;  5GON B;  4DUZ B;  2OIG A;  1P4R A;  5FNV B;  4XDJ A;  4JI7 O;  1S3J A;  5C8Y B;  3IAY A;  4FPP A;  5B1B B;  1IBL O;  4I5S A;  4XDL A;  3OAA G;  2ODM A;  1HNZ B;  1S5H C;  4J7K A;  1XMO O;  3ABK C;  1F7Y A;  3F7V C;  3RBZ A;  4DV5 O;  3JYC A;  1Y67 A;  5B1A C;  1HDJ A;  3CCV V;  2FB5 A;  4NTX A;  2DW4 A;  4K0K O;  2EBO A;  5L3E A;  2YID A;  1N36 B;  3NXS A;  5H2F Z;  2WLJ A;  4B3R B;  3SJC C;  1GRJ A;  1OCZ B;  4EEQ A;  1SER A;  3A0H Z;  2JEU A;  4K8Z A;  1XMO B;  3JAW B;  1YHQ V;  2VWJ A;  1QHT A;  1U96 A;  1I08 A;  3TK1 A;  2Z0A A;  3CXC U;  3HKD A;  2GHY A;  2ZT9 B;  1W0K G;  1SQQ H;  1QNM A;  1GN4 A;  3CJH A;  1RFY A;  3SR2 C;  4NB5 A;  1H2N A;  5B3S C;  4I55 B;  4GUN A;  1NTK H;  1DK1 A;  1ZAU A;  4K3A A;  2IU3 A;  2V4D A;  2M6Y A;  1EN6 A;  3CE2 A;  1JFF A;  5JJN B;  2QWN B;  4UB6 Z;  4G2K A;  1LUV A;  4FLW A;  5EYP B;  1VP7 A;  1L0N H;  1MAB G;  1FD9 A;  3P3N A;  1VQN V;  4ZI7 A;  1QBZ A;  3N2G A;  3K9A A;  5BMV B;  1FFT B;  4FVM A;  2BTO A;  3AK1 A;  3Q4H B;  3G6B A;  4UCT A;  4MTO A;  3K03 A;  2OCH A;  2ZNJ A;  3P30 A;  4A5U B;  4TQD A;  2IU0 A;  2UXX A;  4LF6 O;  2EIN B;  1W2B U;  2YI8 A;  2JS3 A;  1F51 A;  2ZXW C;  1TUE B;  2EJ7 A;  3H1K H;  4CH6 A;  3CC2 V;  3AG1 B;  3GWO A;  1K33 A;  5EIB D;  2Y4U A;  2H94 A;  3ZN0 A;  5LMU B;  4PA3 A;  2A0L A;  1YEW A;  1GAX A;  2B1G A;  3CPW U;  1ZL8 A;  4FZ1 A;  3N2G B;  3JAS A;  1EN5 A;  4UCV A;  1L1F A;  5KAI Z;  4LFC O;  1RM1 C;  4R7C A;  2JEX A;  2Y48 A;  3R65 A;  5IYD O;  4LF4 O;  4FM2 A;  4DR7 B;  3AK2 A;  5B1O A;  2P4K A;  3W7U A;  1UFI A;  3BRC A;  4GKJ B;  4PA4 A;  2ILM A;  2ZE8 A;  4AQY O;  3ASO B;  3EFF K;  3ZRW A;  1MOF A;  3AG3 C;  1MA1 A;  1K7D A;  4I50 A;  4CBC A;  2VQF O;  2QTS A;  2Q73 A;  1N32 B;  1OCC B;  3H1L H;  1HNZ O;  5B66 Z;  5CA1 A;  3ZED A;  4FIP C;  4BIO A;  1BQ0 A;  4XBF A;  1Y66 A;  4XDK A;  3ABL C;  3RYF A;  4LFA O;  1LR1 A;  1HP8 A;  2DQ3 A;  3RYC B;  2WLL B;  2ZIN A;  4TV9 B;  5A2Q N;  1JX9 A;  1THZ A;  1BL8 A;  3K08 A;  2VQE O;  2EIL C;  3JD0 A;  2EX3 A;  4DRX B;  3OTO B;  2QGN A;  1XRE A;  1GK9 A;  1VF7 A;  4JAV A;  4X89 A;  1YSC A;  1KB9 F;  1IXB A;  4LWS B;  3D36 C;  3HKE B;  1LUW A;  2F95 B;  5D5P A;  3ZN1 A;  4TV8 B;  4JI5 B;  4YJ3 B;  2ITC C;  3CRC A;  4X64 B;  3SYA A;  4JI8 O;  2PUS A;  2XUM A;  1VQL V;  1I5X A;  1PKX A;  1US6 A;  1M56 C;  4J7J A;  4O4H B;  1SRY A;  5LHI A;  3D8C A;  5DM6 V;  1AP5 A;  4PDL A;  1XL4 A;  3VOU A;  2CAZ C;  2F66 C;  4HYO A;  3WB2 A;  3CWB H;  4EFB A;  3L72 H;  2EZO A;  4D7S A;  5HFL A;  4H37 A;  1VQO V;  3BCC H;  3CRQ A;  4LNU A;  4JYC A;  5LGT A;  5J2T B;  1TUB B;  4EKW A;  1HR0 O;  2DYS B;  1SZX A;  2A3Q A;  4RQF A;  3BVO A;  5C93 A;  1FFX B;  2F23 A;  3OGI B;  5LHG A;  3SPG A;  4WFH A;  4GKK B;  4DR4 O;  4DV0 B;  2Y0I A;  1KP2 A;  5LMN B;  1CP9 A;  4FFB B;  4NTW A;  3ZHV A;  1B3Q A;  4I4T B;  3S3X A;  1R6K A;  2X0L A;  5B1B C;  1GMG A;  3ZMS A;  5B3S B;  4B3S B;  2AZ2 A;  1NBM G;  4DRX A;  1FKA O;  1H2G A;  5EZY A;  3UCS C;  1SQG A;  4I0X B;  3K57 A;  5IWA B;  1SQB H;  1XDC A;  4J9Z B;  4QIW F;  4DV4 B;  1OCR B;  4NR1 A;  2IH3 C;  4LH7 A;  1GN2 A;  4DR1 O;  2HJD A;  1SET A;  4ZHQ B;  4TUY B;  4FFB A;  5CA1 B;  4NXM B;  2PI4 A;  2JDI G;  4ABM A;  5KHJ A;  2OWO A;  4JYA O;  1SQV H;  2N74 A;  5EIB C;  3H9V A;  4TQF A;  1SA0 B;  3CB2 A;  2E5L O;  2XHB A;  5BXZ A;  1MSW D;  4LF5 O;  5CBG A;  4H0L B;  4OPA A;  1YI2 V;  2UU9 B;  3DXR B;  3PN1 A;  4YIO A;  1QR8 A;  4NYK A;  3LDD A;  2UXD O;  5J2T A;  4GX5 A;  4CZZ A;  2WA4 A;  4DR6 B;  3E8B A;  2YI9 A;  4CH4 A;  2ZD9 A;  4FLT A;  5LP6 C;  5LGU A;  4F6E A;  2RQ6 A;  4GT1 A;  5BR8 B;  5LXT A;  4B7E A;  3M99 B;  1XQ8 A;  4I9W A;  4MVU A;  4B7K A;  3SJA C;  2OTJ V;  2JIZ G;  1PNL A;  1K97 A;  4LF7 O;  1NH2 D;  1KYO F;  4X1I B;  4JI8 B;  2WA3 A;  1FXV A;  3SPJ A;  3RN4 A;  1ROP A;  1M1K W;  1HWY A;  4DR5 B;  2W0F C;  5JH7 A;  4JI0 O;  4JGS A;  3L73 H;  1H8E G;  2ZE6 A;  1SES A;  4B3R O;  1M9N A;  1JJ2 U;  3OMI B;  2OCC B;  4U7N A;  1H2S B;  2M7W A;  2HEP A;  3WFV A;  3HKD B;  3BA8 A;  4IYI A;  1WJZ A;  4EB6 A;  4MT8 A;  3L70 H;  1Q7Y W;  3CS5 A;  5KAF Z;  3CRA A;  2EJR A;  3SYP A;  3ETG A;  3FD9 A;  4DR3 O;  2P7T C;  4DV2 O;  4GLX A;  2A06 H;  1WP8 A;  3AEI A;  4DR5 O;  1S76 D;  1Q43 A;  3UT5 B;  5JVD A;  3APO A;  2QEX V;  2DOS A;  2QTO A;  5LP6 A;  2A79 B;  1VF6 A;  4PV1 B;  3T2M A;  4MTG A;  4GCZ A;  2CUG A;  1ZLZ A;  3W7W A;  5LMU O;  1Q86 W;  4H44 B;  2E74 B;  2EIK C;  2IJJ A;  3IC7 A;  1XL6 A;  1Y6X A;  1K5Q A;  4LF8 B;  3WU2 Z;  1WB8 A;  3K5L A;  3ZMV A;  1YVW A;  3K06 A;  5EZY B;  2Q67 A;  2AHZ A;  3E35 A;  4J10 A;  3EVK A;  3CMA V;  1BSM A;  1BS3 A;  3I5D A;  2P22 C;  1O9H A;  4PA7 A;  5DEC A;  4DUY O;  1S72 V;  1J5E B;  2E5L B;  1Z5W A;  3CRR A;  2ZE5 A;  3K5O A;  5LL6 Y;  1Q3E A;  2R9R B;  1TGO A;  2JGD B;  3CCE V;  1XNQ O;  4DUZ O;  4L87 A;  1AI6 A;  1JA8 A;  1H38 A;  3VQX A;  3SDL A;  4PDM A;  4PA9 A;  2QKS A;  4JI6 B;  1IDS A;  5H6R A;  2JGU A;  1R6N A;  1SA0 A;  3LSU A;  4ZBM A;  2NR5 A;  1NTZ H;  1O9G A;  1K92 A;  2IJK A;  2PY5 A;  3JSN A;  1WLE A;  3G71 V;  3K0D A;  4CH3 A;  1I94 O;  4X1Y A;  3FB8 C;  2UUC O;  4R8C A;  5H5N A;  5E1A C;  2JS5 A;  4FLU A;  1L8D A;  5BY1 A;  5L3B A;  2HVK C;  4JAU A;  3SYC A;  4YY3 O;  4O2B B;  2XAF A;  2N04 A;  5GON A;  1D5N A;  2WSS G;  4DV6 B;  3CRM A;  5IY5 B;  5LP6 B;  2Q8V A;  2Y69 B;  1GN3 A;  4K0K B;  2VQE B;  3T1H O;  5BZB A;  1EZV H;  2EIL B;  1VQ4 V;  4Z1M G;  1X4T A;  1NR1 A;  4KHP B;  4X20 B;  5JH7 B;  5D5Q A;  3G80 A;  3DGE A;  3WG7 B;  3ZRV A;  2YUA A;  5A9G A;  3ZX6 A;  1SQF A;  3D3Q A;  1Z5V A;  4C7U A;  4ZKI A;  3L75 H;  4Q6G A;  1FAF A;  1IBM B;  1S5J A;  2JK5 C;  2UXB B;  4DV7 B;  4J41 A;  4P9O A;  1V55 C;  1OV9 A;  2GTA A;  4BIZ A;  3ABM B;  2NN4 A;  5JCO A;  5JVD B;  3HB3 B;  3RYF B;  3OEH G;  3B09 A;  5KUM A;  3TJT A;  2QKC A;  1F23 A;  1BZK A;  3G67 A;  4HNA A;  2W6J G;  2XND G;  5KHI A;  2CTP A;  4IIJ B;  4X88 A;  1HNW B;  3FAV A;  5B1N A;  4DW1 A;  2UUA O;  4DV7 O;  4D7T A;  1MSD A;  4MS2 A;  4O4I B;  1CEZ A;  5LA6 A;  4FZ0 A;  1ZSP A;  4E2L A;  3ZRS A;  1WN7 A;  2VS0 A;  3HKE A;  4B3M O;  4FLZ A;  4IT5 A;  1EBO A;  3ASO C;  3B40 A;  1QU7 A;  2B9Z A;  3UM7 A;  2Q7G A;  5IY5 C;  4CS3 A;  1BCC H;  4LCU C;  5B5E Z;  2QWP B;  4DUY B;  2ZR2 A;  4DV1 B;  4JI4 B;  2OYQ A;  2LJ2 A;  4RQE A;  5CN0 A;  1KP3 A;  2DE0 X;  5GW7 A;  1MMM A;  3FAV B;  1NQT A;  3ABL B;  1K8A W;  2PZS A;  1WPB A;  1N33 B;  1OZ0 A;  2CK3 G;  1BE3 H;  5FL7 G;  2PYL A;  1NT2 B;  1N32 O;  2PI5 A;  5CB4 A;  1MNG A;  4WFE A;  1XHX A;  4DV6 O;  3CCQ V;  3T1Y O;  2RJZ A;  1JPX A;  1Y74 B;  2DWD C;  1FS0 G;  4YJ2 B;  1YF2 A;  3MHS C;  4FJC C;  4AQY B;  4TT3 G;  4LF4 B;  4GKJ O;  4DV4 O;  4UVC A;  1HW7 A;  4UXN A;  1KUQ A;  2YIA A;  2UXC O;  4WCE V;  1NTM H;  4RAI A;  4YHH B;  1N0J A;  3K58 A;  1AR5 A;  4PA6 A;  1ZUQ A;  3E83 A;  5K1P A;  4PDV A;  1K4D C;  4LWS A;  2VQF B;  1N8R W;  3E22 B;  3VQV A;  1P7B A;  4O2B A;  5GTH Z;  5EC2 C;  1DLB A;  1EFR G;  3UT5 A;  3J7A U;  2LFR A;  2HLD G;  4J11 A;  4YJ2 A;  3SPH A;  4I4T A;  2WLK A;  2FML A;  5KUK A;  1U97 A;  3CCM V;  3A0R A;  1AR4 A;  3PJS K;  1JJO A;  1HNX O;  1D5A A;  1FXK B;  1LNQ A;  1R3I C;  3FFQ A;  3HPL C;  1H2M A;  3ZHR A;  2ZE7 A;  3K79 A;  3T4D A;  5KA6 A;  1QVG U;  5IJ0 A;  3CP1 A;  1JCH A;  1YXB A;  4I0X A;  3QNE A;  1RPO A;  4GYC B;  3E8H A;  1TUB A;  2A9H A;  1PL0 A;  3H1H H;  4FM1 A;  4H13 B;  2DYS C;  1G6U A;  4JYY A;  5C8Y A;  3AG4 C;  3F5W C;  4KFM A;  4U3J A;  2FKX A;  3HR0 A;  3CD6 V;  3QO5 A;  3JAL B;  1VAR A;  5KA5 A;  1P49 A;  1R1B A;  2KSD A;  3OE7 G;  5HFM A;  1TVK A;  4WFF A;  1R3K C;  2KG7 B;  1ZL8 B;  1S5L Z;  3DXR A;  3OGC C;  5TIS Z;  3K59 A;  2IJH A;  3CC7 V;  5IT9 N;  1G4Y B;  1VQK V;  3GB7 C;  4QE7 A;  4HNA B;  3RT3 C;  4W4K A;  3M7M X;  1JR9 A;  2A7W A;  3ETD A;  4JI5 O;  1PV0 A;  3AG2 B;  3ZBH A;  3FB7 C;  5IYB O;  4MTX A;  2HHH O;  1TAE A;  3C3S A;  4B3S O;  1AP6 A;  4DR3 B;  4LNU B;  4R50 A;  2QM4 A;  1EM1 A;  2X7R B;  1KBH A;  1GO3 F;  3UQ8 A;  1NVP D;  2DMX A;  3FKS G;  1K34 A;  3L71 H;  2Q4P A;  4YIP A;  4DV0 O;  5JQG A;  1OCO B;  5LXT B;  2YS8 A;  4GKK O;  1PD3 A;  2VWK A;  1M93 A;  1VQ7 V;  4KXR A;  1IUR A;  2AGA A;  2D3O W;  4HAM A;  2Q0O C;  4G27 B;  4OXS A;  3FYI B;  2CDY A;  1F4M A;  1YIT V;  1Y76 A;  1KEC A;  1PNK A;  3THO A;  2P5O A;  3JSL A;  1Q81 W;  4JZG A;  3T1Y B;  3WB0 A;  2JGD A;  3GVM A;  3BY6 A;  5J2U A;  1ARO P;  3QVN A;  1GM9 A;  2ITD C;  4X62 O;  1ENV A;  3K04 A;  1V54 B;  1JVM A;  1H2L A;  2UUC B;  5LHH A;  4YHH O;  4N23 A;  3MHH C;  1GKF A;  2WLH A;  2WLL A;  3SYO A;  3JAL A;  4JI7 B;  2AHY A;  1K5S A;  3IGA C;  1IBL B;  2BE3 A;  3B77 A;  5F2V O;  1I5Y A;  1VIB A;  2CGN A;  5KX5 A;  3OR6 C;  1AR1 B;  2BCC H;  4X1I A;  3L74 H;  1WP7 A;  2QM8 A;  1H8H G;  2R9I A;  3IFX A;  4WFG A;  5CB4 B;  3A0B Z;  1AI4 A;  4DR6 O;  3BFR A;  4CH5 A;  1YJW V;  3CEI A;  2EIJ C;  2DQ0 A;  1FXK C;  4MVO A;  1VF5 B;  2Y4T A;  1SF9 A;  2ZIM A;  4LP8 A;  3OUS A;  3I55 V;  3RFR A;  2PTM A;  4O4J A;  1R3L C;  4FK5 C;  3GWK C;  2UUB B;  3BA9 A;  2OIE A;  5CBF A;  2WLI A;  4YXW G;  2XOK G;  1W0J G;  3JCU Z;  3BPZ A;  4PJ0 Z;  1QVF U;  4RUE A;  3AG4 B;  2GUZ A;  4CS2 A;  2LFS A;  1M90 W;  1N34 O;  2HFE C;  1ZTE A;  4QPJ A;  4DR4 B;  2Z3Y A;  4QNH B;  4I7Z B;  2P6J A;  1NH2 B;  4H33 A;  4J80 A;  1XNR O;  2YXH A;  1BHB A;  2GBO A;  4QJF B;  2E75 B;  3RWR D;  4DV3 O;  1MG1 A;  2WWW A;  1T5E A;  4QGP A;  2DYR B;  2X6A A;  2IJI A;  1RPR A;  3JD4 A;  2ZDI C;  3B8M A;  3QO8 A;  4X9Q A;  2WLM A;  5JWP A;  4AIL C;  4ZIB A;  3KKY A;  1FPO A;  1IXM A;  3U10 A;  2Y69 C;  4NTY A;  4O4H A;  1QLE C;  1M57 B;  2JJ2 G;  1KQS U;  1DF5 A;  4LR3 A;  4B08 A;  4X1K A;  4W4L A;  2P67 A;  2QWQ B;  3AK3 A;  3A8T A;  4G28 B;  3ZIA G;  3K0G A;  1NJI W;  3D3I A;  4TV9 A;  2N05 A;  4PEL A;  1XEQ A;  3CCL V;  4LFC B;  2F4V O;  5IJ9 A;  4HBN A;  3OW2 U;  3ZJZ A;  3O9O A;  3OMN B;  4DYL A;  2DYR C;  3LSQ A;  3STL C;  2V1D A;  3N2K B;  2F93 B;  2NNU A;  3OTF A;  5KMG A;  4X65 O;  4NVP A;  2F1M A;  2YIB D;  3X2Q B;  3CX5 F;  4X65 B;  1AVM A;  4LFB O;  3JAK B;  1VMG A;  2PGG A;  3OR7 C;  1WPX A;  1NS1 A;  4JI6 O;  1BGY H;  1Q6U A;  2HHH B;  3F5T A;  4X8A A;  1OCR C;  4KL1 A;  3K3W A;  4AI8 A;  3NR7 A;  2GDS A;  4CC5 A;  2ADP A;  5CA3 A;  1XOU A;  1E1R G;  3KG2 A;  1K3E A;  3MAQ A;  2RDC A;  4LF9 B;  4PHZ A;  1R3J C;  1R73 A;  2CTQ A;  3K9S A;  3KZI Z;  3TCU A;  1VF6 C;  1YJ9 V;  3G6E V;  5L3C A;  2LGQ A;  2OTL V;  2P90 A;  4X64 O;  5EYP A;  1OCO C;  3HKB A;  4J9Y B;  4PI2 A;  2W0X A;  1ZWI C;  1SQP H;  4ZI7 B;  2GV9 A;  3ML0 A;  4JPR A;  3ZHU A;  3OTO O;  4Z2W A;  1N36 O;  4RO2 A;  3WG7 C;  1IBK B;  3BEH A;  1IBM O;  3BHP A;  4AHC A;  1Q5O A;  4ZOL B;  4O2A B;  1SQX H;  2E3C A;  4JZ2 A;  1ZX3 A;  2QM7 A;  4CS4 A;  3UO3 A;  2YIC A;  2ZXW B;  1Q6I A;  1UJW B;  1PL4 A;  3C3T A;  4BIU A;  2LP7 A;  2HKO A;  2FL4 A;  4UVA A;  3FX7 A;  2GSM B;  4CC6 A;  1FYJ A;  2CGO A;  4ICG A;  3CYO A;  4FMT A;  4B3T O;  1M57 C;  5CA0 A;  5KX5 B;  1COW G;  2OCC C;  5BR8 O;  4P30 A;  3HKC B;  4PD4 F;  3DSQ A;  4DK0 A;  5IYC O;  2QSA A;  2B5U A;  2VRZ A;  3ZS8 C;  2X6B A;  3ICX A;  4LF6 B;  3JAT B;  4JI3 O;  1FJG B;  3ZCC A;  3E86 A;  2RMK B;  2XAG A;  5EBW C;  5AG2 A;  3JAW A;  4FM0 A;  3B4S A;  4GX1 A;  1WNS A;  4JI0 B;  4LF7 B;  3CME V;  4PDR A;  1JQ0 A;  3E22 A;  4UCS A;  5LGN A;  2EZP A;  5EC1 C;  4MVM A;  1CXZ B;  2EIN C;  3BAB A;  4B3M B;  4I55 A;  4WBN A;  2KG7 A;  5J2U B;  1K73 W;  1NVP B;  4OPH A;  1UPG A;  3SYQ A;  3QF7 A;  1AJP A;  1B04 A;  1VEW A;  4OX9 B;  5EK0 A;  3ZHS A;  1G8M A;  1HNW O;  5GTI Z;  3RYH A;  4NXN O;  1FXK A;  2CH7 A;  1GTO A;  3CCU V;  5BMV A;  4MVR A;  4LF9 O;  2Z5U A;  2IM9 A;  5LYJ B;  1SC5 B;  1P84 F;  3AG7 A;  3N2K A;  2BTQ A;  4UCU A;  3O65 A;  3WB1 A;  1CPY A;  4LFB B;  1E79 G;  3EXA A;  2GTS A;  4X66 B;  2Q9L A;  2QR4 A;  1M56 B;  4TWK A;  3ZMT A;  2QA4 V;  1NI8 A;  1VQ8 V;  3DC5 A;  4IHJ A;  2YSU B;  5H9C A;  1YIJ V;  2ARH A;  4LH6 A;  5JCO C;  1K4C C;  3H1J H;  2F4V B;  2UU9 O;  2RNB A;  1MZF A;  3TXQ A;  1SS3 A;  4LC1 A;  1WAZ A;  4P9P A;  3KCX A;  2UXC B;  2HG5 C;  3HKB B;  5FPO A;  1KKC A;  3RYC A;  3I56 V;  4K35 A;  4BW9 A;  5IJ0 B;  4NXM O;  1FXH A;  5L3G A;  2IBZ H;  2ZDI A;  1W59 A;  3W7T A;  1IBK O;  2ETN A;  3E89 A;  5JQG B;  3ZMU A;  2G38 A;  2C2A A;  2L35 A;  1P7G A;  1SKV A;  3SPC A;  4BW5 A;  4YY3 B;  3R66 A;  5KMG B;  2JJ1 G;  3ASN B;  3JAK A;  5DED A;  2UUB O;  1KMI Z;  4ASU G;  3OD4 A;  1B06 A;  4DV5 B;  2W6I G;  1M5I A;  4F4L A;  2DN9 A;  2P4V A;  1I94 B;  3OM3 B;  4KHP O;  3JCZ A;  5H6Q A;  2LW7 A;  3JAR A;  2XTA A;  2HP8 A;  4MSW C;  1MZE A;  3T1H B;  1QLN A;  4X1K B;  1N34 B;  3RVY A;  1XUQ A;  1VQ5 V;  2MW2 B;  2UUA B;  2HJF C;  1QQC A;  2H3O A;  4TSF G;  3LUT B;  4JI1 O;  4FLX A;  3FYE B;  1Q82 W;  4JI2 B;  2UXN A;  1IX9 A;  3SGI A;  4QPK A;  1AJN A;  1OJH A;  3AG2 C;  3MDS A;  3ABT A;  1K9M W;  3N27 A;  1DF4 A;  4TUY A;  4MVZ A;  3TXS A;  1VQM V;  2ZR3 A;  1V55 B;  4O4L B;  2LO1 A;  3ETQ A;  4U3J B;  2Q7H A;  3F7Y C;  1XHZ A;  1ORQ C;  2FYU H;  2EUL A;  2XAQ A;  2Y0P A;  1R6T A;  5B1A B;  4NKG B;  3L9D A;  3JD3 A;  3CCS V;  4L8J A;  5CBH A;  1OCZ C;  3J81 N;  3LNN A;  3QO7 A;  1NZ6 A;  1EZJ A;  5JJJ B;  2R9A A;  4FLV A;  4P2Z A;  1VQ6 V;  2LGW A;  4DV3 B;  2JRI A;  3D36 A;  1BT8 A;  5EBL C;  2R72 A;  3A2F A;  1OCC C;  2WAM A;  2MK3 A;  3JAM N;  5IYZ B;  2Q68 A;  2ZKO A;  4JV5 O;  4IL6 Z;  2AZ0 A;  4X62 B;  2LW1 A;  2D2C B;  3ETE A;  3M8A A;  3UKM A;  4UVB A;  1PP9 H;  3APQ A;  3ABU A;  3JAR B;  3VQW A;  4ZHQ A;  1XI1 A;  1KKD A;  4U7O A;  3IJ4 A;  2QDO A;  4IIJ A;  5KHG A;  2BSK A;  2ZM6 B;  5KHH A;  4KP4 A;  4JV5 B;  4O4I A;  1QCE A;  1Y76 B;  3H01 A;  4UV8 A;  1URF A;  4LBE C;  1S0V A;  2K1E A;  4UCR A;  5K1X A;  1I0H A;  4TV8 A;  2HVJ C;  3G4S V;  3E2E A;  3W7X A;  3T4Z A;  4OGQ B;  1I7F A;  3Q4H A;  1X59 A;  3VBB A;  2Q5Z A;  4JTD B;  2NLJ C;  1KC8 W;  4UB8 Z;  1BMF G;  1N4C A;  3QG5 A;  2IH1 C;  2AXT Z;  2EIJ B;  2EIK B;  4GZR B;  1A32 A;  4BR6 A;  2B1I A;  1YDX A;  4DK1 A;  3RGB A;  2Q7E A;  1XMQ B;  3KCY A;  1TVK B;  5EBM C;  5CMU A;  5KHK A;  5IJ9 B;  3SJB C;  4F6R B;  2CE4 A;  1M4U A;  4JAS A;  2XAJ A;  1TA8 A;  3H1I H;  1E1Q G;  1HNX B;  3JAS B;  3DC6 A;  5DN6 G;  3ZHQ A;  4X1Y B;  4MW8 A;  4JTA B;  1FJG O;  4JI3 B;  4Z1V A;  3DTU B;  5LA6 B;  2BOB C;  4OX9 O;  5IYZ A;  1B6Q A;  3LDC A;  2L6L A;  2WLN A;  3RYI A;  3ABK B;  1AIL A;  4LF8 O;  3ZHT A;  2P06 A;  1WA8 B;  2QWO B;  2YDE A;  2EIM B;  2UXD B;  3AG3 B;  2K9P A;  3MD0 A;  3ZRW B;  4O4L A;  4B3T B;  3CHX A;  2X6C A;  1IVS A;  3B2E E;  3UO2 A;  2XAS A;  2BSK B; 
#chains in the Genus database with same CATH homology
 3C90 A;  2GTA A;  1YXB A;  1Y6X A;  2A7W A;  2P06 A;  2Q4P A;  1VMG A;  3CRA A;  5IE9 A;  2A3Q A;  2Q9L A;  4QGP A;  2Q5Z A;  2Q73 A;  2OIE A;  2YXH A;  3CRC A;  1YVW A;  2OIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...