2OIEA

Crystal structure of rs21-c6 core segment rscut
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
102
structure length
102
Chain Sequence
RPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RS21-C6
publication title Crystal Structure of RS21-C6, Involved in Nucleoside Triphosphate Pyrophosphohydrolysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 35
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2oieA00
2Q73A 2YXHA 1YVWA 2GTAA 2A7WA 2Q9LA 2Q5ZA 3CRCA 2OIEA 2OIGA 2A3QA 1VMGA 1Y6XA 3C90A 1YXBA 4QGPA 2P06A 3CRAA 2Q4PA 5IE9A
chains in the Genus database with same CATH superfamily
3JALB 2WLIA 1N36O 2ZM6B 3CC4V 1VF6A 1US6A 5AG2A 4DR7O 3R65A 2OT5A 5CB4B 4DR4B 2ZXWB 4GKKO 3F7VC 3VQYA 4B3TO 2BOCC 1BCCH 1NH2D 1PKXA 4FLUA 1S5JA 1PNKA 3VQXA 4DV3O 3HKEB 1A32A 1OV9A 4GX0A 2HKOA 5LP6B 1NTZH 3ASOB 4UV9A 4FIPC 3K0GA 4X65B 1EN6A 4FLVA 3LDEA 3HKCB 1Q90D 1KU9A 1QLEB 3K0DA 3K08A 2XUMA 4LFCO 5IE9A 2KG7B 1ZUQA 1MOFA 4YHHB 1YCIA 2YXHA 3H01A 3IC9A 4JAUA 1IBKB 4PD4F 4IYIA 1S72V 3LNMB 3ZMVA 3OM3B 4J7JA 4B3SB 2WWWA 4UCTA 2P90A 3OTOB 4I9QA 4CH6A 3J81N 5GW7A 2O57A 1BS3A 4MS2A 4Z1MG 4DV7B 4LF5B 2YIBD 4GYCB 1UPGA 1GM8A 1XMQB 4DR1B 2P22C 1MABG 2IJIA 2IH1C 3AG3C 2B9ZA 3BRCA 3ASNB 4W4LA 3CEIA 4ICGA 4WF9V 3N2KB 4UCUA 4JI3O 4R50A 5LL6Y 2Y4UA 1K92A 3AEIA 4LCUC 2UXDB 2ZCEA 2Y48A 2JGDA 1J95A 1HNZO 1VQ6V 5IYZB 3UT5B 1MSDA 1YSCA 2DE0X 4F6RA 1WJZA 5ITZA 1H2MA 5FNVB 4TWKA 1OCRB 4R6ZA 1BQ0A 4FFBB 2QKAA 1H38A 2KKWA 1HW7A 2HFEC 3E83A 2YDEA 1XMOB 2XTAA 4UCRA 3QO5A 4CS4A 1XHZA 2QKCA 3LSQA 1R3IC 1R3JC 1B3QA 2Q67A 4UV8A 3BCCH 1N32O 5BZBA 4O4LA 4DV5B 1H2KA 1NTKH 2JK5C 4UVAA 4LNUB 4G27B 4Z1VA 3ETQA 3H1JH 5KUMA 1GKFA 4DV0B 4NTXA 4XDKA 3CMEV 1FFXB 1LUWA 2BCCH 3CYOA 4K3AA 2UUBO 1OHHG 1JJ2U 5IT9N 2H94A 5H9CA 5CBFA 3AK1A 4X62B 2A3QA 3T4DA 2F4VB 1FXKB 5EZYA 1E1RG 4ZOLB 1P4RA 2HHHB 1HNXB 4YJ2A 3RYIA 2DYSB 4TV9A 1WPBA 1AJNA 3T4ZA 1GN3A 4K8ZA 4CH5A 2VQEB 1Q3EA 4MVUA 3JAKB 4TSFG 5KHHA 1QNMA 4X66O 3KCXA 2HEPA 1TUBB 5IJ0A 2V1DA 5JH7A 2ITCC 5JJEB 1XI1A 2EIJC 4P30A 1TAEA 3W7TA 4PDVA 2JS5A 4QE7A 3Q4HA 2XT9A 4FLTA 3WFVA 2H3OA 5C8YB 2V4DA 2GUZB 1TGOA 4X8AA 2W6JG 5KLVH 3E35A 1EN4A 2A79B 3AG4C 1AI5A 4D6TH 3OD4A 4C7UA 4FLYA 2GSMB 2ZDIC 1O9GA 2EJ7A 1Q7YW 1KB9F 4AI8A 4LFAO 5LHHA 1E79G 1M56B 1Q5OA 4TT3G 4DUZO 3VQWA 2Q68A 3CCEV 1BZKA 5B1BC 4FLWA 5LA6B 5JVDB 1J5EB 4GX5A 5LGUA 2UU9B 3U0ZA 2UUCB 1XILA 2LW7A 1IZ3A 5B1AC 1IXMA 4D7SA 1Y4MA 3PJSK 1HP8A 2EIKB 3DC5A 4F6EA 3ABLC 4KHPB 1IDSA 2KG7A 5JQGA 2HG5C 3CRMA 2OIEA 1H2SB 2OCCB 4AQYB 4ZBMA 2GV9A 3RYHB 5HFLA 2XAQA 3UKMA 3OW2U 3L75H 1AJPA 3E89A 3G67A 1BSMA 4LF8B 2EIMB 2Q7HA 3VQVA 4O4IA 3R66A 2R9IA 3FB7C 2CDYA 1N33B 3SPGA 1NS1A 4YY3B 4JYAB 1M9NA 4LF6B 1WP8A 4X1KB 2UXNA 1R6KA 4HAMA 4YJ3B 3E2EA 3E8GA 3QTCA 4PA6A 2PUSA 1SQBH 5F2VO 3G6EV 1BHBA 2UUAB 1JPXA 3CD6V 3A0HZ 3ETDA 2VQFO 1COWG 1Q86W 3ETGA 3K5NA 4G2KA 1B06A 3W7XA 4B3MO 1Z5VA 3ZHVA 4JYYA 1Y67A 2QWPB 4GUNA 1AI6A 2P67A 1L0LH 4J7KA 3L71H 5LXTA 1KC8W 2WLIB 2ZNIA 1W0KG 3TXQA 1PL0A 3FB8C 2ADPA 3ZS8C 1HNWO 2G38A 2WLHA 2YIBA 5IYCO 2Q5ZA 3BVOA 4N23A 2NR5A 1PNLA 1KBHA 1I94B 4PV1B 1W2BU 3F5WC 2OYQA 4JI0B 3ABKB 5KHKA 4WFHA 3TK1A 4JI7B 4BW9A 3JD3A 2Q7GA 3L73H 1AILA 4HBNA 2Q8VA 1EZVH 4U7OA 1DF5A 3CC2V 3CRCA 5LGNA 4X64B 2UXCB 1RFYA 4CH4A 3ZRWA 2QE7G 1V54B 3MHHC 2ZXWC 3ZHTA 1AR4A 1U96A 4G28B 3AG1B 5KA6A 4ZOLA 1K5QA 4FM0A 2E74B 3ZRXA 2A7WA 4X1YA 4KXRA 2Y69B 5LP6C 3CX5F 3JD0A 4LF4B 1R3LC 1P84F 1SETA 1OCOC 1AP5A 2BE3A 3CCJV 1VQLV 1XHXA 4PI2A 3CPWU 5EYPA 1QLEC 2E3CA 2AHYA 1SQFA 2Z0AA 4CC6A 4LWSA 2ZNJA 3OEHG 3CSXA 4ABMA 4LH7A 5BR8O 5IY5C 2Y0PA 2D2CB 2JGDB 2GUZA 3L70H 4DYLA 1NU1H 3WB2A 4QIWF 4F6RB 4DV1B 2YICA 5ITZB 5KUKA 2UXXA 2A0LA 4HNAA 4E4EA 4H0LB 1H2LA 3P30A 4KP4A 4U3JA 4QPJA 2F95B 3CXCU 2CE4A 4BIZA 2ZR3A 1OCCB 1AVMA 3I56V 2PZSA 1JX9A 3LDDA 2ZIMA 4JI1O 2DWDC 2ILMA 2UXBB 5JVDA 2ZE6A 2Q0AA 5DM6V 5KAFZ 2FL4A 3SJCC 3FB5C 2OCHA 3TETA 5EBMC 2YI8A 3RWRD 4NR1A 1BQZA 2PGGA 2P6JA 2QTOA 2FB5A 4O4LB 3M7MX 2YIDA 4NTWA 2Q6AA 1XEQA 1OCRC 4WBNA 1VF5B 4UVCA 5KMGA 2R72A 2RDCA 1XL4A 2JGUA 2F23A 3GWOA 4DV4B 4EB6A 4ZI7A 2ZT9B 2ZM6O 3K5OA 5K1PA 1GN6A 2Q7EA 5KA5A 3VBBA 2VS0A 1M1KW 1AJQA 1Q6IA 4ZKIA 4DR4O 2OIGA 5KHGA 4UB8Z 2LGWA 4MVOA 3HKBA 1JFFA 4TUYB 4YJ2B 3RYIB 3UM7A 3ZEDA 3E22A 1NJIW 3CCMV 2AXTZ 3HB3B 1FYJA 3M8AA 3IGAC 3P3PA 1YJNV 4NXNB 3OFNG 4X65O 5IJ0B 1DK1A 5JH7B 4MW3A 4KFMA 4I7ZB 1FFTB 1YHQV 1BL8A 3FFQA 2IJKA 1KP3A 1D5AA 3BA8A 1FXKC 1V55C 1YTFD 4UFZA 2PYJA 4YHHO 3E8HA 1L1FA 1D5NA 1NVPB 3N2GA 1IBKO 4MVQA 1Q81W 2DYRB 4PI0A 3ABMB 3L74H 3OR6C 4JV5O 2DYSC 2QM7A 1IVSA 4B3SO 1B04A 4DV2B 5KX5A 3OTOO 3DC6A 3C90A 5FLXN 3C3SA 4P9PA 4JI8B 4MVSA 4DV7O 3OT7A 4LF5O 3UCSC 4JI2O 1E1QG 2DW4A 1OCZC 1XMQO 3P32A 4PJ0Z 5B3SB 3KZIZ 2XAHA 1YJ9V 2FKXA 1VQOV 4X20A 3RYFB 2VRZA 5LGTA 4B3RB 2JJ1G 1ZWIC 1M57C 4BW5A 5JCOC 5JQGB 1S0VA 4JZ2A 4EFEA 4O4JA 2BTOA 2F66C 1OJHA 1M56C 1TA8A 3E8FA 1PPJH 2HJDA 4CS3A 4NYKA 1KECA 1R1BA 1CPYA 1XMOO 4RUFA 1DF4A 2YIAA 3BFRA 4LF9B 2PI4A 4JYBA 3OGIB 2XOKG 4O4IB 3A0BZ 3N27A 4MVRA 3WG7B 4DV6B 2WSSG 1NH2B 5D5QA 3UO2A 1SZTA 1Z2GA 2EIKC 2X6CA 3VOUA 1G1XB 2ATKC 2AW9A 5LOVA 2XNDG 3B8NA 2LP7A 2PTMA 4DV5O 2B5UA 1KKDA 5EC2C 3FD9A 2AHZA 1ROPA 4B3TB 1FJGO 4DV0O 1K8AW 1G4YB 2WPDG 2ETNA 1S77D 4PA9A 1S3JA 3FX7A 3OTFA 2WLLA 4HYOA 1YJWV 2CH7A 2EIMC 1YIJV 4NXMB 1MA1A 1XUQA 3BAAA 4JYCA 2QR4A 3E8BA 4I5SA 5B66Z 4CS2A 5BXZA 4KL1A 2F4VO 3HR0A 2L6LA 4JGSA 4NKGB 5LXTB 4XDLA 2IW5A 3ZHRA 5A9GA 2HHHO 1HNXO 1XREA 4B7KA 2VWJA 2QWOB 1YITV 4JI5B 4ZIBA 2WLKA 1FXHA 3QO8A 1L0NH 4YIOA 2VQEO 3B77A 1YDXA 1I0HA 2EINC 1ZL8A 1LNQA 5EBLC 4MTOA 2C2AA 2YUAA 2MK3A 2DOSA 3EVKA 3OR7C 3CRAA 1GH6A 2N05A 1XQ8A 2GHYA 4R7CA 4J41A 2IJJA 4O4HA 1G8MA 4QPKA 1JA8A 2EILB 4JI3B 3ZRWB 1I7FA 2X6BA 4JASA 1VQPV 1Y6XA 3GWKC 2LFSA 2WAMA 4DR5B 1VQ4V 1FPOA 3CP1A 4DR3B 4PELA 1UJWB 1AR1B 5LMNB 1GK9A 4PHZA 1HDJA 1EFRG 1MZEA 4X1YB 4U7NA 2XHBA 2VWKA 4TUYA 5LYJA 2JDIG 5D5PA 4BWAA 1NR1A 4DRXA 5TISZ 1DTOA 1J5EO 4H37A 4YIPA 2UU9O 5EYPB 4BIOA 1YXBA 2UUCO 1Y74B 3QF7A 4AHCA 1AP6A 4K0KO 1T5EA 3L72H 4LWSB 4DK0A 1VQ5V 4KHPO 3OMAB 3CWBH 4OPHA 4AQYO 5L3FA 1WPXA 1SS3A 1CP9A 4JI6B 4J11A 5H6RA 4LH6A 4I50A 1VIBA 2GBOA 4HNAB 3FYEB 2YEVA 4LF8O 2Q73A 4U3JB 1GN2A 4JTAB 1N4CA 2R9AA 3JATA 4YY3O 4JYAO 1QVGU 1I08A 4MTGA 1GMGA 3CHXA 4O2BA 3ABUA 1R3KC 2HVKC 3FKSG 2P06A 2K1EA 3RYFA 1SQPH 2UUAO 1WAZA 1IURA 1B6QA 3H1LH 1RP3B 4CH3A 3CJHA 4U3FH 1SQVH 3OMIB 5IDJA 1SQQH 4WBNB 5KMGB 3SPHA 4JAVA 1CXZB 1K33A 1Q43A 4X1IA 1OCCC 4EB6B 4ZI7B 3W7WA 5B1NA 3CRRA 1ZAUA 2P4KA 4R8CA 3FYIB 3ZN0A 3MDSA 2M7WA 1NQTA 1P7BA 3APOA 4XBFA 1Y76A 2RN9A 4DW0A 1I94O 1S76D 4QE9A 3THOA 3X2QC 3ZHUA 3HKBB 1JFFB 4JI0O 1AI7A 2E75B 4JI7O 4LFBO 3E22B 3A0RA 3ML0A 5CN0A 2ZE8A 2YS8A 4TQFA 4D7TA 2E5LB 3OUSA 3H1KH 4WFAV 4N21A 4LFAB 5CA0B 3ZCCA 1M5IA 1N0NA 3KG2A 2A9HA 1JJOA 2RMKB 2EJRA 4OX9B 1IBLB 2OTJV 2Y0IA 4X64O 3RVZA 1IBMB 4GX2A 4UCSA 2F1MA 1R6TA 3FB6C 5DN6G 1RPOA 1WB8A 2HVJC 4MTXA 3N2GB 3T1HB 4FPPA 3JD1A 3I55V 2WLJA 1YVWA 3AG2C 1N8RW 2PI5A 2QEXV 4H13B 1K5SA 1NT2B 5KX5B 3OMNB 3PN1A 2IM9A 3JSLA 4LF4O 3ZMZA 3G71V 4DXWA 2L35A 3MAQA 2YC0A 4OPAA 1BE3H 3ABTA 1K34A 2IBZH 3CCRV 4X20B 3SR2C 3O65A 4AILC 3BABA 2DYRC 4BIUA 2Z3YA 3CS5A 1NBMG 1QR8A 2ZIOA 4NTYA 4GCZA 1K73W 2QJ1A 3GB7C 4LC1A 1OZ0A 4O4JB 1RSOA 1VP7A 3OEEG 2VQFB 3B40A 4GKJB 1XNRB 2IJHA 4TV8A 5B3SC 3U11A 4MSWC 3K3WA 5IWAO 4WFEA 3ASOC 2EIJB 2UXBO 3DTUB 3NR7A 3BEHA 2HJFC 5H5NA 1Y74A 1SQGA 2DWEC 5LOVB 1AI4A 1N34B 1X4TA 4NVPA 1WA8A 1KP2A 2W0XA 2EX3A 3LDCA 3AG4B 2HR3A 1VQNV 3OE7G 1U97A 2IU0A 3ZMUA 1XOUA 2NLJC 5EIBC 4DV4O 1VF7A 1YZBA 3K04A 3TCUA 3K03A 2WLLB 3C3TA 5L3CA 2CH7B 5K1XA 5BY1A 5FPOA 1F7YA 2GTAA 1Q8IA 4ASUG 1KMIZ 4FZ0A 1M93A 3SPCA 3EXAA 3IFXA 4X9QA 4E2LA 3F7YC 4FM1A 2CTPA 3ASNC 4TQDA 4DR2B 4FZ1A 4LF7O 3WU2Z 3CE2A 4BR6A 3SYAA 1MMMA 3HKDB 1EN5A 5JCOA 1QHTA 3G4SV 3RT3C 4PDMA 1D2DA 2IH3C 1XNQB 2QWRB 4I9WA 3BA9A 1F51A 2Q9LA 1ZL8B 4CC5A 1SA0A 5BMVA 1QLNA 4UCOA 1MG1A 1QQCA 5IJ9A 4JI4B 1HR0B 5J2TA 4DO2A 4J42A 4H33A 1JR9A 1YI2V 1VEWA 4I4TA 4LR3A 3CXHF 4O4HB 3IAYA 4DUYB 2PF4E 3F5TA 1G6UA 5BR8B 4WFFA 1W59A 3FAVA 4DV2O 1WN7A 2RQ6A 1K9MW 2QDOA 3B2EE 1JCHA 5GTHZ 4JI8O 5H2FZ 2XAJA 4DK1A 3RVYA 1SKVA 3LSUA 4BAYA 2A06H 5LYJB 4K35A 2JEUA 4DRXB 4MTFA 4DW1A 5CA0A 3E86A 2LFRA 5CA3A 4PA7A 2XASA 3RFRA 2PYLA 2EILC 2QM8A 4B3RO 1AB3A 5J9PC 3APQA 2ZD9A 3LUTB 3OGCC 3D3QA 4Z2WA 4PA4A 3B8MA 2CAZC 5LBQA 2BSKA 4JF3A 4DR6B 3BPZA 2FMLA 4I50B 5DEDA 4IHJA 4PA3A 5LMUB 4QJFB 3K06A 2YEVB 5JJNB 4P2ZA 4MVMA 4DV6O 4OXSA 3DXRA 1LR1A 3JATB 1ZLZA 3K9SA 3MHSC 4J80A 2BTQA 4DR1O 4EEQA 3P3NA 3ZMSA 1PV0A 3TXSA 4O2BB 5EIBD 5GONA 2QSAA 2UXDO 3T1YB 4Q20A 2RJZA 3H9VA 1SZXA 3JAWA 3CJHB 2QGNA 1KUQA 1YTFB 3B09A 1KQSU 1JMKC 5KHJA 2BOBC 4NXMO 2YXYA 1I5YA 1FS0G 1FKAO 3LNNA 1OCOB 4X1IB 2ZKOA 2RCVA 3K79A 3D36C 3WB0A 3CMAV 1K7DA 5E1AC 1R6NA 3K5LA 5EBWC 3S3WA 4GZRB 4IT5A 3A8TA 4HZ3A 4JI5O 1N36B 2ODMA 1THZA 1Y76B 5L3BA 4X88A 5IY5B 3ZJZA 4JV5B 1BHAA 4PDRA 4QNHB 2N74A 3TJTA 4DR7B 1ZX3A 2H8PC 4J9YB 1KYOF 4L87A 4GKKB 1TVKA 3SYOA 2OCCC 3G80A 4J10A 1SC5B 4JI2B 2ZDIA 4LBEC 4DV3B 1FAFA 1AROP 1GTOA 1I5XA 3RW0A 4YXWG 3I5DA 5L3EA 4JTDB 3J80N 1GRJA 1XDCA 3T2MA 4X62O 3RYCA 3SJAC 4JTCB 3CRQA 4DR5O 5H6QA 4LFCB 4QGPA 2DQ3A 4MVZA 4DR3O 3SYQA 5LMNO 3STLC 1AR5A 4FK5C 3HKDA 1RM1B 3RBZA 3DGEA 3ICXA 5JJJB 4I0XA 1P7GA 5A2QN 3QO7A 2JJ2G 2X7RB 3QG5A 2KQXA 5CA1A 3OUFA 3JARA 2WA4A 3QNEA 2LO1A 4I55B 2JVDA 3U10A 3AK2A 4WFGA 1BT8A 1VF6C 3SPIA 4FFKA 2P5OA 2Y4TA 1WNSA 2RNBA 3CCVV 4JI6O 1FJGB 5B1OA 4UXNA 4X89A 1W0JG 1RSOB 2KB1A 1EM1A 1HNZB 1NR7A 2YSUB 3ABKC 2E76B 2DJVA 3SDLA 4O2AA 4TV8B 3QVNA 4XDJA 3ZX6A 2QWQB 4LP8A 3RGBA 2YI9A 3ETEA 2WLNA 1V55B 3CCSV 2CTWA 3UQ8A 2JEXA 1TUEB 3K58A 1V54C 4B08A 4FVMA 1ZSPA 3W7SA 5CMUA 2AGAA 1HWYA 1Q82W 1WA8B 5LHGA 2XAGA 3CCQV 3AG1C 1N32B 1S5HC 4K8XA 3IJ4A 1YF2A 2Y69C 1QR9A 4GLXA 3BY6A 1OCZB 3KCYA 2MW2B 1MNGA 2JRIA 3JASA 4Q6GA 2OWOA 1K3EA 4ZHQB 2ADQB 4IL6Z 1Z5WA 2UUBB 2EZOA 1CEZA 3ZHSA 2QA4V 3JALA 4IIJB 1N33O 4KUMA 3WB1A 4LF6O 5E79Z 1QVFU 3J7AU 3K5MA 1M57B 3G6BA 3H1IH 4MW8A 5CB4A 5IYDO 2Z5UA 2WA3A 2LGQA 4UVBA 4UUJC 1ZTEA 2E5LO 2Q4PA 2KSDA 3AG7A 3CC7V 3MD0A 5FL7G 3SGIA 3ZIAG 3K9AA 1SA0B 5BMVB 3ZBHA 4OX9O 1IBLO 3HKEA 3NXSA 2XAFA 5IJ9B 2CK3G 4UCVA 1QCEA 5LP6A 1LUVA 5EC1C 4J7ZA 5J2TB 1IBMO 2W0FC 5KHIA 1MSWD 4CZZA 2QTSA 1V9PA 4X66B 4I4TB 2DQ0A 3HKCA 3T1HO 4K0KB 1FD9A 1EZJA 3AG3B 1XL6A 3AK3A 2DMXA 4P9OA 3FAVB 1ENVA 1R73A 4B7EA 5B5EZ 2P4VA 2M6YA 2GDSA 2AZ0A 2R9RB 3OAAG 3SYCA 4GX1A 1EBOA 4TOIA 3LSSA 2HLDG 5J2UB 3A2FA 2YXLA 4OGQB 1GM9A 1PM9A 2ZE5A 2FYUH 1DLBA 1JVMA 3D3IA 4DUZB 3CCUV 1F23A 2UXCO 2CUGA 4WFBV 2X0LA 5IYBO 1QBZA 3N2KA 4GT1A 3TGUH 4H44B 4FLZA 1VQ8V 1SF9A 3L9DA 5IYZA 3UT5A 2BSKB 4GKJO 1XNRO 1M4UA 2EINB 2EBOA 2K9PA 5FNVA 3JCZA 2X6AA 4PDLA 4IHJB 1WP7A 4FFBA 2LW1A 2ZR2A 1PL4A 5DECA 2LJ2A 3O9OA 3DXRB 1GAXA 2CGOA 2BTQB 4A5UB 2QM4A 1N34O 3HPLC 4I55A 5GONB 1JOYA 4IGGA 3ABMC 2CGNA 4J9ZB 3ZRSA 1X59A 3B4SA 5L3DA 3DSQA 1SQXH 5LHIA 1SERA 4LFBB 3JAWB 4DV1O 4LNUA 1XBLA 1K4DC 1SESA 3JD4A 4CBCA 2ITDC 1QU7A 1VQMV 5KAIZ 3JCUZ 1FFXA 1O9HA 1Q6HA 4B3MB 1Y66A 2FTKA 4FM2A 3M99B 2EULA 2JS3A 5HFMA 4DR2O 2HP8A 3K59A 1PNMA 4RWUA 1IX9A 1M90W 2Q69A 2EZPA 1K97A 2CTRA 1FXKA 2DN9A 2AZ2A 2B1GA 1GO3F 1XNQO 1BGYH 4JPRA 2WLMA 3EFFK 3ZHQA 1H2NA 5L3GA 1HNWB 1K4CC 1TVKB 4JI4O 1VMGA 1HR0O 3JAKA 1H2GA 1SRYA 5CBHA 1FXVA 3SYPA 1TUBA 1UFIA 4RUEA 4DUYO 3CCLV 4RQEA 1IXBA 5C93A 3WG7C 5FPRA 2GTSA 1GM7A 4RQFA 5B1BB 1MZFA 3RYCB 4ZHQA 3RN4A 5C8YA 1WLEA 2NNUA 3ZMTA 2ARHA 5B1AB 4IIJA 3IC7A 1PD3A 1YEWA 4JAAA 3SJBC 1URFA 3JYCA 2OTLV 4UB6Z 2D3OW 2JIZG 3D8CA 4FJCC 5EK0A 3SPJA 3ABLB 4F4LA 3K57A 1WB7A 2P7TC 4I0XB 4RO2A 5IWAB 1F4MA 2ZQMA 4IYHA 4L8JA 4NXNO 2NN4A 1H8EG 3D36A 5CA1B 2Q0OC 2ZE7A 5LA6A 1DGSA 3JARB 3UO3A 1L8DA 1VQ7V 2CTQA 4W4KA 1BMFG 4RAIA 1GN4A 1NZ6A 2F93B 3BHPA 3KKYA 1NI8A 1ORQC 4EKWA 2QKSA 3X2QB 1KKCA 4DR6O 3JSNA 1RM1C 1PP9H 1N0JA 3GVMA 1VARA 5LMUO 2B1IA 2R70A 2PY5A 1S5LZ 2LQTA 3RYHA 5JWPA 4WCEV 4O2AB 1NVPD 4NB5A 5GTIZ 1F4NA 2IU3A 3W7UA 1VQKV 4FLXA 5J2UA 2N04A 3JD2A 3STZC 1RPRA 5EZYB 1Q6UA 3CB2A 1NTMH 3T1YO 4JI1B 4LF7B 3EHBB 4X1KA 4YJ3A 3AG2B 4TV9B 4FMTA 2F43G 5CBGA 4MT8A 1KD1W 3H1HH 3S3XA 1VQ9V 1P49A 4EFBA 2ZINA 4JZGA 2QWNB 3T1CA 3SJQC 2W6IG 1H8HG 1JQ0A 4LF9O 1NKDA 3JASB 3Q4HB 2V7QG 3JAMN 3ZN1A 3ZRVA
chains in the Genus database with same CATH topology
2Q73A 2YXHA 1YVWA 2GTAA 2A7WA 2Q9LA 2Q5ZA 3CRCA 2OIEA 2OIGA 2A3QA 1VMGA 1Y6XA 3C90A 1YXBA 4QGPA 2P06A 3CRAA 2Q4PA 5IE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q73 A;  2YXH A;  1YVW A;  2GTA A;  2A7W A;  2Q9L A;  2Q5Z A;  3CRC A;  2OIE A;  2OIG A;  2A3Q A;  1VMG A;  1Y6X A;  3C90 A;  1YXB A;  4QGP A;  2P06 A;  3CRA A;  2Q4P A;  5IE9 A; 
#chains in the Genus database with same CATH topology
 3JAL B;  2WLI A;  1N36 O;  2ZM6 B;  3CC4 V;  1VF6 A;  1US6 A;  5AG2 A;  4DR7 O;  3R65 A;  2OT5 A;  5CB4 B;  4DR4 B;  2ZXW B;  4GKK O;  3F7V C;  3VQY A;  4B3T O;  2BOC C;  1BCC H;  1NH2 D;  1PKX A;  4FLU A;  1S5J A;  1PNK A;  3VQX A;  4DV3 O;  3HKE B;  1A32 A;  1OV9 A;  4GX0 A;  2HKO A;  5LP6 B;  1NTZ H;  3ASO B;  4UV9 A;  4FIP C;  3K0G A;  4X65 B;  1EN6 A;  4FLV A;  3LDE A;  3HKC B;  1Q90 D;  1KU9 A;  1QLE B;  3K0D A;  3K08 A;  2XUM A;  4LFC O;  5IE9 A;  2KG7 B;  1ZUQ A;  1MOF A;  4YHH B;  1YCI A;  2YXH A;  3H01 A;  3IC9 A;  4JAU A;  1IBK B;  4PD4 F;  4IYI A;  1S72 V;  3LNM B;  3ZMV A;  3OM3 B;  4J7J A;  4B3S B;  2WWW A;  4UCT A;  2P90 A;  3OTO B;  4I9Q A;  4CH6 A;  3J81 N;  5GW7 A;  2O57 A;  1BS3 A;  4MS2 A;  4Z1M G;  4DV7 B;  4LF5 B;  2YIB D;  4GYC B;  1UPG A;  1GM8 A;  1XMQ B;  4DR1 B;  2P22 C;  1MAB G;  2IJI A;  2IH1 C;  3AG3 C;  2B9Z A;  3BRC A;  3ASN B;  4W4L A;  3CEI A;  4ICG A;  4WF9 V;  3N2K B;  4UCU A;  4JI3 O;  4R50 A;  5LL6 Y;  2Y4U A;  1K92 A;  3AEI A;  4LCU C;  2UXD B;  2ZCE A;  2Y48 A;  2JGD A;  1J95 A;  1HNZ O;  1VQ6 V;  5IYZ B;  3UT5 B;  1MSD A;  1YSC A;  2DE0 X;  4F6R A;  1WJZ A;  5ITZ A;  1H2M A;  5FNV B;  4TWK A;  1OCR B;  4R6Z A;  1BQ0 A;  4FFB B;  2QKA A;  1H38 A;  2KKW A;  1HW7 A;  2HFE C;  3E83 A;  2YDE A;  1XMO B;  2XTA A;  4UCR A;  3QO5 A;  4CS4 A;  1XHZ A;  2QKC A;  3LSQ A;  1R3I C;  1R3J C;  1B3Q A;  2Q67 A;  4UV8 A;  3BCC H;  1N32 O;  5BZB A;  4O4L A;  4DV5 B;  1H2K A;  1NTK H;  2JK5 C;  4UVA A;  4LNU B;  4G27 B;  4Z1V A;  3ETQ A;  3H1J H;  5KUM A;  1GKF A;  4DV0 B;  4NTX A;  4XDK A;  3CME V;  1FFX B;  1LUW A;  2BCC H;  3CYO A;  4K3A A;  2UUB O;  1OHH G;  1JJ2 U;  5IT9 N;  2H94 A;  5H9C A;  5CBF A;  3AK1 A;  4X62 B;  2A3Q A;  3T4D A;  2F4V B;  1FXK B;  5EZY A;  1E1R G;  4ZOL B;  1P4R A;  2HHH B;  1HNX B;  4YJ2 A;  3RYI A;  2DYS B;  4TV9 A;  1WPB A;  1AJN A;  3T4Z A;  1GN3 A;  4K8Z A;  4CH5 A;  2VQE B;  1Q3E A;  4MVU A;  3JAK B;  4TSF G;  5KHH A;  1QNM A;  4X66 O;  3KCX A;  2HEP A;  1TUB B;  5IJ0 A;  2V1D A;  5JH7 A;  2ITC C;  5JJE B;  1XI1 A;  2EIJ C;  4P30 A;  1TAE A;  3W7T A;  4PDV A;  2JS5 A;  4QE7 A;  3Q4H A;  2XT9 A;  4FLT A;  3WFV A;  2H3O A;  5C8Y B;  2V4D A;  2GUZ B;  1TGO A;  4X8A A;  2W6J G;  5KLV H;  3E35 A;  1EN4 A;  2A79 B;  3AG4 C;  1AI5 A;  4D6T H;  3OD4 A;  4C7U A;  4FLY A;  2GSM B;  2ZDI C;  1O9G A;  2EJ7 A;  1Q7Y W;  1KB9 F;  4AI8 A;  4LFA O;  5LHH A;  1E79 G;  1M56 B;  1Q5O A;  4TT3 G;  4DUZ O;  3VQW A;  2Q68 A;  3CCE V;  1BZK A;  5B1B C;  4FLW A;  5LA6 B;  5JVD B;  1J5E B;  4GX5 A;  5LGU A;  2UU9 B;  3U0Z A;  2UUC B;  1XIL A;  2LW7 A;  1IZ3 A;  5B1A C;  1IXM A;  4D7S A;  1Y4M A;  3PJS K;  1HP8 A;  2EIK B;  3DC5 A;  4F6E A;  3ABL C;  4KHP B;  1IDS A;  2KG7 A;  5JQG A;  2HG5 C;  3CRM A;  2OIE A;  1H2S B;  2OCC B;  4AQY B;  4ZBM A;  2GV9 A;  3RYH B;  5HFL A;  2XAQ A;  3UKM A;  3OW2 U;  3L75 H;  1AJP A;  3E89 A;  3G67 A;  1BSM A;  4LF8 B;  2EIM B;  2Q7H A;  3VQV A;  4O4I A;  3R66 A;  2R9I A;  3FB7 C;  2CDY A;  1N33 B;  3SPG A;  1NS1 A;  4YY3 B;  4JYA B;  1M9N A;  4LF6 B;  1WP8 A;  4X1K B;  2UXN A;  1R6K A;  4HAM A;  4YJ3 B;  3E2E A;  3E8G A;  3QTC A;  4PA6 A;  2PUS A;  1SQB H;  5F2V O;  3G6E V;  1BHB A;  2UUA B;  1JPX A;  3CD6 V;  3A0H Z;  3ETD A;  2VQF O;  1COW G;  1Q86 W;  3ETG A;  3K5N A;  4G2K A;  1B06 A;  3W7X A;  4B3M O;  1Z5V A;  3ZHV A;  4JYY A;  1Y67 A;  2QWP B;  4GUN A;  1AI6 A;  2P67 A;  1L0L H;  4J7K A;  3L71 H;  5LXT A;  1KC8 W;  2WLI B;  2ZNI A;  1W0K G;  3TXQ A;  1PL0 A;  3FB8 C;  2ADP A;  3ZS8 C;  1HNW O;  2G38 A;  2WLH A;  2YIB A;  5IYC O;  2Q5Z A;  3BVO A;  4N23 A;  2NR5 A;  1PNL A;  1KBH A;  1I94 B;  4PV1 B;  1W2B U;  3F5W C;  2OYQ A;  4JI0 B;  3ABK B;  5KHK A;  4WFH A;  3TK1 A;  4JI7 B;  4BW9 A;  3JD3 A;  2Q7G A;  3L73 H;  1AIL A;  4HBN A;  2Q8V A;  1EZV H;  4U7O A;  1DF5 A;  3CC2 V;  3CRC A;  5LGN A;  4X64 B;  2UXC B;  1RFY A;  4CH4 A;  3ZRW A;  2QE7 G;  1V54 B;  3MHH C;  2ZXW C;  3ZHT A;  1AR4 A;  1U96 A;  4G28 B;  3AG1 B;  5KA6 A;  4ZOL A;  1K5Q A;  4FM0 A;  2E74 B;  3ZRX A;  2A7W A;  4X1Y A;  4KXR A;  2Y69 B;  5LP6 C;  3CX5 F;  3JD0 A;  4LF4 B;  1R3L C;  1P84 F;  1SET A;  1OCO C;  1AP5 A;  2BE3 A;  3CCJ V;  1VQL V;  1XHX A;  4PI2 A;  3CPW U;  5EYP A;  1QLE C;  2E3C A;  2AHY A;  1SQF A;  2Z0A A;  4CC6 A;  4LWS A;  2ZNJ A;  3OEH G;  3CSX A;  4ABM A;  4LH7 A;  5BR8 O;  5IY5 C;  2Y0P A;  2D2C B;  2JGD B;  2GUZ A;  3L70 H;  4DYL A;  1NU1 H;  3WB2 A;  4QIW F;  4F6R B;  4DV1 B;  2YIC A;  5ITZ B;  5KUK A;  2UXX A;  2A0L A;  4HNA A;  4E4E A;  4H0L B;  1H2L A;  3P30 A;  4KP4 A;  4U3J A;  4QPJ A;  2F95 B;  3CXC U;  2CE4 A;  4BIZ A;  2ZR3 A;  1OCC B;  1AVM A;  3I56 V;  2PZS A;  1JX9 A;  3LDD A;  2ZIM A;  4JI1 O;  2DWD C;  2ILM A;  2UXB B;  5JVD A;  2ZE6 A;  2Q0A A;  5DM6 V;  5KAF Z;  2FL4 A;  3SJC C;  3FB5 C;  2OCH A;  3TET A;  5EBM C;  2YI8 A;  3RWR D;  4NR1 A;  1BQZ A;  2PGG A;  2P6J A;  2QTO A;  2FB5 A;  4O4L B;  3M7M X;  2YID A;  4NTW A;  2Q6A A;  1XEQ A;  1OCR C;  4WBN A;  1VF5 B;  4UVC A;  5KMG A;  2R72 A;  2RDC A;  1XL4 A;  2JGU A;  2F23 A;  3GWO A;  4DV4 B;  4EB6 A;  4ZI7 A;  2ZT9 B;  2ZM6 O;  3K5O A;  5K1P A;  1GN6 A;  2Q7E A;  5KA5 A;  3VBB A;  2VS0 A;  1M1K W;  1AJQ A;  1Q6I A;  4ZKI A;  4DR4 O;  2OIG A;  5KHG A;  4UB8 Z;  2LGW A;  4MVO A;  3HKB A;  1JFF A;  4TUY B;  4YJ2 B;  3RYI B;  3UM7 A;  3ZED A;  3E22 A;  1NJI W;  3CCM V;  2AXT Z;  3HB3 B;  1FYJ A;  3M8A A;  3IGA C;  3P3P A;  1YJN V;  4NXN B;  3OFN G;  4X65 O;  5IJ0 B;  1DK1 A;  5JH7 B;  4MW3 A;  4KFM A;  4I7Z B;  1FFT B;  1YHQ V;  1BL8 A;  3FFQ A;  2IJK A;  1KP3 A;  1D5A A;  3BA8 A;  1FXK C;  1V55 C;  1YTF D;  4UFZ A;  2PYJ A;  4YHH O;  3E8H A;  1L1F A;  1D5N A;  1NVP B;  3N2G A;  1IBK O;  4MVQ A;  1Q81 W;  2DYR B;  4PI0 A;  3ABM B;  3L74 H;  3OR6 C;  4JV5 O;  2DYS C;  2QM7 A;  1IVS A;  4B3S O;  1B04 A;  4DV2 B;  5KX5 A;  3OTO O;  3DC6 A;  3C90 A;  5FLX N;  3C3S A;  4P9P A;  4JI8 B;  4MVS A;  4DV7 O;  3OT7 A;  4LF5 O;  3UCS C;  4JI2 O;  1E1Q G;  2DW4 A;  1OCZ C;  1XMQ O;  3P32 A;  4PJ0 Z;  5B3S B;  3KZI Z;  2XAH A;  1YJ9 V;  2FKX A;  1VQO V;  4X20 A;  3RYF B;  2VRZ A;  5LGT A;  4B3R B;  2JJ1 G;  1ZWI C;  1M57 C;  4BW5 A;  5JCO C;  5JQG B;  1S0V A;  4JZ2 A;  4EFE A;  4O4J A;  2BTO A;  2F66 C;  1OJH A;  1M56 C;  1TA8 A;  3E8F A;  1PPJ H;  2HJD A;  4CS3 A;  4NYK A;  1KEC A;  1R1B A;  1CPY A;  1XMO O;  4RUF A;  1DF4 A;  2YIA A;  3BFR A;  4LF9 B;  2PI4 A;  4JYB A;  3OGI B;  2XOK G;  4O4I B;  3A0B Z;  3N27 A;  4MVR A;  3WG7 B;  4DV6 B;  2WSS G;  1NH2 B;  5D5Q A;  3UO2 A;  1SZT A;  1Z2G A;  2EIK C;  2X6C A;  3VOU A;  1G1X B;  2ATK C;  2AW9 A;  5LOV A;  2XND G;  3B8N A;  2LP7 A;  2PTM A;  4DV5 O;  2B5U A;  1KKD A;  5EC2 C;  3FD9 A;  2AHZ A;  1ROP A;  4B3T B;  1FJG O;  4DV0 O;  1K8A W;  1G4Y B;  2WPD G;  2ETN A;  1S77 D;  4PA9 A;  1S3J A;  3FX7 A;  3OTF A;  2WLL A;  4HYO A;  1YJW V;  2CH7 A;  2EIM C;  1YIJ V;  4NXM B;  1MA1 A;  1XUQ A;  3BAA A;  4JYC A;  2QR4 A;  3E8B A;  4I5S A;  5B66 Z;  4CS2 A;  5BXZ A;  4KL1 A;  2F4V O;  3HR0 A;  2L6L A;  4JGS A;  4NKG B;  5LXT B;  4XDL A;  2IW5 A;  3ZHR A;  5A9G A;  2HHH O;  1HNX O;  1XRE A;  4B7K A;  2VWJ A;  2QWO B;  1YIT V;  4JI5 B;  4ZIB A;  2WLK A;  1FXH A;  3QO8 A;  1L0N H;  4YIO A;  2VQE O;  3B77 A;  1YDX A;  1I0H A;  2EIN C;  1ZL8 A;  1LNQ A;  5EBL C;  4MTO A;  2C2A A;  2YUA A;  2MK3 A;  2DOS A;  3EVK A;  3OR7 C;  3CRA A;  1GH6 A;  2N05 A;  1XQ8 A;  2GHY A;  4R7C A;  4J41 A;  2IJJ A;  4O4H A;  1G8M A;  4QPK A;  1JA8 A;  2EIL B;  4JI3 B;  3ZRW B;  1I7F A;  2X6B A;  4JAS A;  1VQP V;  1Y6X A;  3GWK C;  2LFS A;  2WAM A;  4DR5 B;  1VQ4 V;  1FPO A;  3CP1 A;  4DR3 B;  4PEL A;  1UJW B;  1AR1 B;  5LMN B;  1GK9 A;  4PHZ A;  1HDJ A;  1EFR G;  1MZE A;  4X1Y B;  4U7N A;  2XHB A;  2VWK A;  4TUY A;  5LYJ A;  2JDI G;  5D5P A;  4BWA A;  1NR1 A;  4DRX A;  5TIS Z;  1DTO A;  1J5E O;  4H37 A;  4YIP A;  2UU9 O;  5EYP B;  4BIO A;  1YXB A;  2UUC O;  1Y74 B;  3QF7 A;  4AHC A;  1AP6 A;  4K0K O;  1T5E A;  3L72 H;  4LWS B;  4DK0 A;  1VQ5 V;  4KHP O;  3OMA B;  3CWB H;  4OPH A;  4AQY O;  5L3F A;  1WPX A;  1SS3 A;  1CP9 A;  4JI6 B;  4J11 A;  5H6R A;  4LH6 A;  4I50 A;  1VIB A;  2GBO A;  4HNA B;  3FYE B;  2YEV A;  4LF8 O;  2Q73 A;  4U3J B;  1GN2 A;  4JTA B;  1N4C A;  2R9A A;  3JAT A;  4YY3 O;  4JYA O;  1QVG U;  1I08 A;  4MTG A;  1GMG A;  3CHX A;  4O2B A;  3ABU A;  1R3K C;  2HVK C;  3FKS G;  2P06 A;  2K1E A;  3RYF A;  1SQP H;  2UUA O;  1WAZ A;  1IUR A;  1B6Q A;  3H1L H;  1RP3 B;  4CH3 A;  3CJH A;  4U3F H;  1SQV H;  3OMI B;  5IDJ A;  1SQQ H;  4WBN B;  5KMG B;  3SPH A;  4JAV A;  1CXZ B;  1K33 A;  1Q43 A;  4X1I A;  1OCC C;  4EB6 B;  4ZI7 B;  3W7W A;  5B1N A;  3CRR A;  1ZAU A;  2P4K A;  4R8C A;  3FYI B;  3ZN0 A;  3MDS A;  2M7W A;  1NQT A;  1P7B A;  3APO A;  4XBF A;  1Y76 A;  2RN9 A;  4DW0 A;  1I94 O;  1S76 D;  4QE9 A;  3THO A;  3X2Q C;  3ZHU A;  3HKB B;  1JFF B;  4JI0 O;  1AI7 A;  2E75 B;  4JI7 O;  4LFB O;  3E22 B;  3A0R A;  3ML0 A;  5CN0 A;  2ZE8 A;  2YS8 A;  4TQF A;  4D7T A;  2E5L B;  3OUS A;  3H1K H;  4WFA V;  4N21 A;  4LFA B;  5CA0 B;  3ZCC A;  1M5I A;  1N0N A;  3KG2 A;  2A9H A;  1JJO A;  2RMK B;  2EJR A;  4OX9 B;  1IBL B;  2OTJ V;  2Y0I A;  4X64 O;  3RVZ A;  1IBM B;  4GX2 A;  4UCS A;  2F1M A;  1R6T A;  3FB6 C;  5DN6 G;  1RPO A;  1WB8 A;  2HVJ C;  4MTX A;  3N2G B;  3T1H B;  4FPP A;  3JD1 A;  3I55 V;  2WLJ A;  1YVW A;  3AG2 C;  1N8R W;  2PI5 A;  2QEX V;  4H13 B;  1K5S A;  1NT2 B;  5KX5 B;  3OMN B;  3PN1 A;  2IM9 A;  3JSL A;  4LF4 O;  3ZMZ A;  3G71 V;  4DXW A;  2L35 A;  3MAQ A;  2YC0 A;  4OPA A;  1BE3 H;  3ABT A;  1K34 A;  2IBZ H;  3CCR V;  4X20 B;  3SR2 C;  3O65 A;  4AIL C;  3BAB A;  2DYR C;  4BIU A;  2Z3Y A;  3CS5 A;  1NBM G;  1QR8 A;  2ZIO A;  4NTY A;  4GCZ A;  1K73 W;  2QJ1 A;  3GB7 C;  4LC1 A;  1OZ0 A;  4O4J B;  1RSO A;  1VP7 A;  3OEE G;  2VQF B;  3B40 A;  4GKJ B;  1XNR B;  2IJH A;  4TV8 A;  5B3S C;  3U11 A;  4MSW C;  3K3W A;  5IWA O;  4WFE A;  3ASO C;  2EIJ B;  2UXB O;  3DTU B;  3NR7 A;  3BEH A;  2HJF C;  5H5N A;  1Y74 A;  1SQG A;  2DWE C;  5LOV B;  1AI4 A;  1N34 B;  1X4T A;  4NVP A;  1WA8 A;  1KP2 A;  2W0X A;  2EX3 A;  3LDC A;  3AG4 B;  2HR3 A;  1VQN V;  3OE7 G;  1U97 A;  2IU0 A;  3ZMU A;  1XOU A;  2NLJ C;  5EIB C;  4DV4 O;  1VF7 A;  1YZB A;  3K04 A;  3TCU A;  3K03 A;  2WLL B;  3C3T A;  5L3C A;  2CH7 B;  5K1X A;  5BY1 A;  5FPO A;  1F7Y A;  2GTA A;  1Q8I A;  4ASU G;  1KMI Z;  4FZ0 A;  1M93 A;  3SPC A;  3EXA A;  3IFX A;  4X9Q A;  4E2L A;  3F7Y C;  4FM1 A;  2CTP A;  3ASN C;  4TQD A;  4DR2 B;  4FZ1 A;  4LF7 O;  3WU2 Z;  3CE2 A;  4BR6 A;  3SYA A;  1MMM A;  3HKD B;  1EN5 A;  5JCO A;  1QHT A;  3G4S V;  3RT3 C;  4PDM A;  1D2D A;  2IH3 C;  1XNQ B;  2QWR B;  4I9W A;  3BA9 A;  1F51 A;  2Q9L A;  1ZL8 B;  4CC5 A;  1SA0 A;  5BMV A;  1QLN A;  4UCO A;  1MG1 A;  1QQC A;  5IJ9 A;  4JI4 B;  1HR0 B;  5J2T A;  4DO2 A;  4J42 A;  4H33 A;  1JR9 A;  1YI2 V;  1VEW A;  4I4T A;  4LR3 A;  3CXH F;  4O4H B;  3IAY A;  4DUY B;  2PF4 E;  3F5T A;  1G6U A;  5BR8 B;  4WFF A;  1W59 A;  3FAV A;  4DV2 O;  1WN7 A;  2RQ6 A;  1K9M W;  2QDO A;  3B2E E;  1JCH A;  5GTH Z;  4JI8 O;  5H2F Z;  2XAJ A;  4DK1 A;  3RVY A;  1SKV A;  3LSU A;  4BAY A;  2A06 H;  5LYJ B;  4K35 A;  2JEU A;  4DRX B;  4MTF A;  4DW1 A;  5CA0 A;  3E86 A;  2LFR A;  5CA3 A;  4PA7 A;  2XAS A;  3RFR A;  2PYL A;  2EIL C;  2QM8 A;  4B3R O;  1AB3 A;  5J9P C;  3APQ A;  2ZD9 A;  3LUT B;  3OGC C;  3D3Q A;  4Z2W A;  4PA4 A;  3B8M A;  2CAZ C;  5LBQ A;  2BSK A;  4JF3 A;  4DR6 B;  3BPZ A;  2FML A;  4I50 B;  5DED A;  4IHJ A;  4PA3 A;  5LMU B;  4QJF B;  3K06 A;  2YEV B;  5JJN B;  4P2Z A;  4MVM A;  4DV6 O;  4OXS A;  3DXR A;  1LR1 A;  3JAT B;  1ZLZ A;  3K9S A;  3MHS C;  4J80 A;  2BTQ A;  4DR1 O;  4EEQ A;  3P3N A;  3ZMS A;  1PV0 A;  3TXS A;  4O2B B;  5EIB D;  5GON A;  2QSA A;  2UXD O;  3T1Y B;  4Q20 A;  2RJZ A;  3H9V A;  1SZX A;  3JAW A;  3CJH B;  2QGN A;  1KUQ A;  1YTF B;  3B09 A;  1KQS U;  1JMK C;  5KHJ A;  2BOB C;  4NXM O;  2YXY A;  1I5Y A;  1FS0 G;  1FKA O;  3LNN A;  1OCO B;  4X1I B;  2ZKO A;  2RCV A;  3K79 A;  3D36 C;  3WB0 A;  3CMA V;  1K7D A;  5E1A C;  1R6N A;  3K5L A;  5EBW C;  3S3W A;  4GZR B;  4IT5 A;  3A8T A;  4HZ3 A;  4JI5 O;  1N36 B;  2ODM A;  1THZ A;  1Y76 B;  5L3B A;  4X88 A;  5IY5 B;  3ZJZ A;  4JV5 B;  1BHA A;  4PDR A;  4QNH B;  2N74 A;  3TJT A;  4DR7 B;  1ZX3 A;  2H8P C;  4J9Y B;  1KYO F;  4L87 A;  4GKK B;  1TVK A;  3SYO A;  2OCC C;  3G80 A;  4J10 A;  1SC5 B;  4JI2 B;  2ZDI A;  4LBE C;  4DV3 B;  1FAF A;  1ARO P;  1GTO A;  1I5X A;  3RW0 A;  4YXW G;  3I5D A;  5L3E A;  4JTD B;  3J80 N;  1GRJ A;  1XDC A;  3T2M A;  4X62 O;  3RYC A;  3SJA C;  4JTC B;  3CRQ A;  4DR5 O;  5H6Q A;  4LFC B;  4QGP A;  2DQ3 A;  4MVZ A;  4DR3 O;  3SYQ A;  5LMN O;  3STL C;  1AR5 A;  4FK5 C;  3HKD A;  1RM1 B;  3RBZ A;  3DGE A;  3ICX A;  5JJJ B;  4I0X A;  1P7G A;  5A2Q N;  3QO7 A;  2JJ2 G;  2X7R B;  3QG5 A;  2KQX A;  5CA1 A;  3OUF A;  3JAR A;  2WA4 A;  3QNE A;  2LO1 A;  4I55 B;  2JVD A;  3U10 A;  3AK2 A;  4WFG A;  1BT8 A;  1VF6 C;  3SPI A;  4FFK A;  2P5O A;  2Y4T A;  1WNS A;  2RNB A;  3CCV V;  4JI6 O;  1FJG B;  5B1O A;  4UXN A;  4X89 A;  1W0J G;  1RSO B;  2KB1 A;  1EM1 A;  1HNZ B;  1NR7 A;  2YSU B;  3ABK C;  2E76 B;  2DJV A;  3SDL A;  4O2A A;  4TV8 B;  3QVN A;  4XDJ A;  3ZX6 A;  2QWQ B;  4LP8 A;  3RGB A;  2YI9 A;  3ETE A;  2WLN A;  1V55 B;  3CCS V;  2CTW A;  3UQ8 A;  2JEX A;  1TUE B;  3K58 A;  1V54 C;  4B08 A;  4FVM A;  1ZSP A;  3W7S A;  5CMU A;  2AGA A;  1HWY A;  1Q82 W;  1WA8 B;  5LHG A;  2XAG A;  3CCQ V;  3AG1 C;  1N32 B;  1S5H C;  4K8X A;  3IJ4 A;  1YF2 A;  2Y69 C;  1QR9 A;  4GLX A;  3BY6 A;  1OCZ B;  3KCY A;  2MW2 B;  1MNG A;  2JRI A;  3JAS A;  4Q6G A;  2OWO A;  1K3E A;  4ZHQ B;  2ADQ B;  4IL6 Z;  1Z5W A;  2UUB B;  2EZO A;  1CEZ A;  3ZHS A;  2QA4 V;  3JAL A;  4IIJ B;  1N33 O;  4KUM A;  3WB1 A;  4LF6 O;  5E79 Z;  1QVF U;  3J7A U;  3K5M A;  1M57 B;  3G6B A;  3H1I H;  4MW8 A;  5CB4 A;  5IYD O;  2Z5U A;  2WA3 A;  2LGQ A;  4UVB A;  4UUJ C;  1ZTE A;  2E5L O;  2Q4P A;  2KSD A;  3AG7 A;  3CC7 V;  3MD0 A;  5FL7 G;  3SGI A;  3ZIA G;  3K9A A;  1SA0 B;  5BMV B;  3ZBH A;  4OX9 O;  1IBL O;  3HKE A;  3NXS A;  2XAF A;  5IJ9 B;  2CK3 G;  4UCV A;  1QCE A;  5LP6 A;  1LUV A;  5EC1 C;  4J7Z A;  5J2T B;  1IBM O;  2W0F C;  5KHI A;  1MSW D;  4CZZ A;  2QTS A;  1V9P A;  4X66 B;  4I4T B;  2DQ0 A;  3HKC A;  3T1H O;  4K0K B;  1FD9 A;  1EZJ A;  3AG3 B;  1XL6 A;  3AK3 A;  2DMX A;  4P9O A;  3FAV B;  1ENV A;  1R73 A;  4B7E A;  5B5E Z;  2P4V A;  2M6Y A;  2GDS A;  2AZ0 A;  2R9R B;  3OAA G;  3SYC A;  4GX1 A;  1EBO A;  4TOI A;  3LSS A;  2HLD G;  5J2U B;  3A2F A;  2YXL A;  4OGQ B;  1GM9 A;  1PM9 A;  2ZE5 A;  2FYU H;  1DLB A;  1JVM A;  3D3I A;  4DUZ B;  3CCU V;  1F23 A;  2UXC O;  2CUG A;  4WFB V;  2X0L A;  5IYB O;  1QBZ A;  3N2K A;  4GT1 A;  3TGU H;  4H44 B;  4FLZ A;  1VQ8 V;  1SF9 A;  3L9D A;  5IYZ A;  3UT5 A;  2BSK B;  4GKJ O;  1XNR O;  1M4U A;  2EIN B;  2EBO A;  2K9P A;  5FNV A;  3JCZ A;  2X6A A;  4PDL A;  4IHJ B;  1WP7 A;  4FFB A;  2LW1 A;  2ZR2 A;  1PL4 A;  5DEC A;  2LJ2 A;  3O9O A;  3DXR B;  1GAX A;  2CGO A;  2BTQ B;  4A5U B;  2QM4 A;  1N34 O;  3HPL C;  4I55 A;  5GON B;  1JOY A;  4IGG A;  3ABM C;  2CGN A;  4J9Z B;  3ZRS A;  1X59 A;  3B4S A;  5L3D A;  3DSQ A;  1SQX H;  5LHI A;  1SER A;  4LFB B;  3JAW B;  4DV1 O;  4LNU A;  1XBL A;  1K4D C;  1SES A;  3JD4 A;  4CBC A;  2ITD C;  1QU7 A;  1VQM V;  5KAI Z;  3JCU Z;  1FFX A;  1O9H A;  1Q6H A;  4B3M B;  1Y66 A;  2FTK A;  4FM2 A;  3M99 B;  2EUL A;  2JS3 A;  5HFM A;  4DR2 O;  2HP8 A;  3K59 A;  1PNM A;  4RWU A;  1IX9 A;  1M90 W;  2Q69 A;  2EZP A;  1K97 A;  2CTR A;  1FXK A;  2DN9 A;  2AZ2 A;  2B1G A;  1GO3 F;  1XNQ O;  1BGY H;  4JPR A;  2WLM A;  3EFF K;  3ZHQ A;  1H2N A;  5L3G A;  1HNW B;  1K4C C;  1TVK B;  4JI4 O;  1VMG A;  1HR0 O;  3JAK A;  1H2G A;  1SRY A;  5CBH A;  1FXV A;  3SYP A;  1TUB A;  1UFI A;  4RUE A;  4DUY O;  3CCL V;  4RQE A;  1IXB A;  5C93 A;  3WG7 C;  5FPR A;  2GTS A;  1GM7 A;  4RQF A;  5B1B B;  1MZF A;  3RYC B;  4ZHQ A;  3RN4 A;  5C8Y A;  1WLE A;  2NNU A;  3ZMT A;  2ARH A;  5B1A B;  4IIJ A;  3IC7 A;  1PD3 A;  1YEW A;  4JAA A;  3SJB C;  1URF A;  3JYC A;  2OTL V;  4UB6 Z;  2D3O W;  2JIZ G;  3D8C A;  4FJC C;  5EK0 A;  3SPJ A;  3ABL B;  4F4L A;  3K57 A;  1WB7 A;  2P7T C;  4I0X B;  4RO2 A;  5IWA B;  1F4M A;  2ZQM A;  4IYH A;  4L8J A;  4NXN O;  2NN4 A;  1H8E G;  3D36 A;  5CA1 B;  2Q0O C;  2ZE7 A;  5LA6 A;  1DGS A;  3JAR B;  3UO3 A;  1L8D A;  1VQ7 V;  2CTQ A;  4W4K A;  1BMF G;  4RAI A;  1GN4 A;  1NZ6 A;  2F93 B;  3BHP A;  3KKY A;  1NI8 A;  1ORQ C;  4EKW A;  2QKS A;  3X2Q B;  1KKC A;  4DR6 O;  3JSN A;  1RM1 C;  1PP9 H;  1N0J A;  3GVM A;  1VAR A;  5LMU O;  2B1I A;  2R70 A;  2PY5 A;  1S5L Z;  2LQT A;  3RYH A;  5JWP A;  4WCE V;  4O2A B;  1NVP D;  4NB5 A;  5GTI Z;  1F4N A;  2IU3 A;  3W7U A;  1VQK V;  4FLX A;  5J2U A;  2N04 A;  3JD2 A;  3STZ C;  1RPR A;  5EZY B;  1Q6U A;  3CB2 A;  1NTM H;  3T1Y O;  4JI1 B;  4LF7 B;  3EHB B;  4X1K A;  4YJ3 A;  3AG2 B;  4TV9 B;  4FMT A;  2F43 G;  5CBG A;  4MT8 A;  1KD1 W;  3H1H H;  3S3X A;  1VQ9 V;  1P49 A;  4EFB A;  2ZIN A;  4JZG A;  2QWN B;  3T1C A;  3SJQ C;  2W6I G;  1H8H G;  1JQ0 A;  4LF9 O;  1NKD A;  3JAS B;  3Q4H B;  2V7Q G;  3JAM N;  3ZN1 A;  3ZRV A; 
#chains in the Genus database with same CATH homology
 2Q73 A;  2YXH A;  1YVW A;  2GTA A;  2A7W A;  2Q9L A;  2Q5Z A;  3CRC A;  2OIE A;  2OIG A;  2A3Q A;  1VMG A;  1Y6X A;  3C90 A;  1YXB A;  4QGP A;  2P06 A;  3CRA A;  2Q4P A;  5IE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...