1VQLV

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqlV00
1JJ2U 1VQ4V 3CD6V 3CCVV 1YJNV 3CMAV 3CCEV 3CCMV 3CCJV 4WF9V 3CCSV 3CCLV 1YI2V 1K73W 1M1KW 3CCQV 1VQLV 1KQSU 3G4SV 3CMEV 1N8RW 2QA4V 1VQOV 4WFAV 4WCEV 1R73A 1Q86W 3CPWU 1W2BU 1K9MW 1Q81W 3OW2U 1VQKV 1VQPV 1S72V 1M90W 2OTLV 1YITV 1VQNV 1VQ5V 1NJIW 3CCUV 1Q82W 1VQMV 1KD1W 1VQ8V 3CC7V 2QEXV 4WFBV 3CCRV 1QVGU 3CC4V 1YHQV 1QVFU 1VQ7V 3CXCU 1VQ6V 1KC8W 3G71V 1YIJV 3I56V 3I55V 1K8AW 1Q7YW 1YJ9V 3CC2V 5DM6V 2D3OW 2OTJV 1YJWV 3G6EV 1VQ9V
chains in the Genus database with same CATH superfamily
1I94B 3E86A 2KG7B 2A0LA 3CMEV 4WCEV 1PNKA 5FPOA 1YTFD 1K9MW 3K03A 1F7YA 1AP5A 3RVZA 4H13B 1BHAA 2UU9O 1MSDA 2F4VO 5C8YA 3AK1A 1NBMG 2QWPB 1GTOA 5H5NA 2L35A 2OCHA 3JAWB 4JTCB 3ZRXA 3HR0A 3ZMTA 5EK0A 1SA0A 1Y4MA 3P3NA 4GX5A 4CH5A 2Q5ZA 3TK1A 5JWPA 2NN4A 4MW3A 1US6A 2OT5A 1NT2B 1Z2GA 1AR4A 2ZR2A 5EIBD 2UXNA 4LNUB 4D7TA 4DR6O 1SQPH 1P4RA 4YIOA 5KHIA 1VQLV 1G8MA 3FX7A 5GTIZ 2Q0OC 3ZRSA 1IXBA 4WFAV 2Y0PA 5B3SC 1QU7A 1I0HA 1FS0G 5JQGA 3SYAA 4JI7O 3B8MA 4JI3B 3K9AA 4DR5B 4JI6O 4H37A 1BL8A 4JYBA 4GKJB 1VQ5V 4I9WA 1EN6A 1Z5WA 1N0NA 4G2KA 1XREA 5L3DA 4PA9A 4D6TH 1OZ0A 2IH1C 3RWRD 4DV5O 1I5XA 1OCZB 3Q4HB 3K3WA 1NKDA 1QQCA 1Q6IA 2CGNA 3K08A 5IJ0A 4LF6B 1YF2A 4IIJA 3APQA 1SC5B 2XNDG 4I7ZB 1DTOA 2WAMA 4J7ZA 4X1IB 2UXDB 4LWSB 3AG1B 2GUZB 2A06H 3CD6V 3BFRA 2AXTZ 3SYCA 4Q20A 3B2EE 4X9QA 1AR1B 3ZMVA 5FNVB 3QO7A 2GBOA 2BOCC 2ZXWB 4PA4A 5IJ0B 1SF9A 4LF8O 4DV4B 5DM6V 1HDJA 3M7MX 5J2UB 3L75H 5KA5A 4CS3A 2ETNA 3TJTA 3ETEA 3F7YC 4LFBO 3KCXA 5J9PC 1TVKA 3RYFB 5LBQA 2ZM6B 1JFFA 1KU9A 5KHGA 1AVMA 1ZWIC 3K59A 3ZBHA 1OCZC 2V7QG 1XI1A 2P22C 5EZYA 2QKCA 2UXXA 3L71H 2B9ZA 1M90W 3CS5A 1GAXA 5CBFA 1HNWB 3ZHQA 1X4TA 4UUJC 3DTUB 4LF6O 3JD2A 1TVKB 3GWOA 3ZMZA 4JI2B 1H2NA 3KCYA 4UB6Z 2Y69B 2GSMB 3CCVV 2UXCB 2QGNA 3OEEG 3CCSV 3K5MA 2CUGA 2EIMB 2UUAO 2AW9A 1ZTEA 4NTXA 5DN6G 1I08A 1PKXA 3AG4C 2A7WA 4DV5B 3SPIA 4ZHQA 4CBCA 4ZOLB 1IXMA 5IYZA 1SQBH 3ZN0A 3AG1C 5CB4A 4JI1O 1R6NA 3VQYA 1MA1A 2YUAA 3OUSA 1JJOA 3D3IA 2HG5C 3CCMV 2GTAA 1OCRC 4CH6A 4I50B 2EZPA 2EINB 2E5LO 1HR0O 3RYIA 5GW7A 1DGSA 3WB2A 5KX5A 4DV7O 3HKEB 2CK3G 1JMKC 3B77A 1Y6XA 2Y69C 3JSLA 2O57A 5BR8O 1K4DC 3HPLC 3QO8A 1LR1A 4MTGA 2Q4PA 2VQEB 3JAKA 2DW4A 5LXTA 3SJCC 1NVPB 3OEHG 4JI4B 2ZCEA 4JV5B 3FB7C 1M5IA 2ZINA 4YHHO 3L72H 1XILA 4BR6A 4JZ2A 5HFMA 3L70H 1QCEA 3S3XA 4DV1O 1PM9A 3VBBA 2QTOA 4HYOA 4X20A 4UVBA 4R50A 2CH7B 4YJ3B 4FLWA 2HFEC 4J10A 2PY5A 1GH6A 4GYCB 2HLDG 3APOA 4JI8B 1RM1C 2QR4A 1SQQH 1RFYA 3O9OA 2BTOA 1AP6A 2JJ2G 2LFRA 4W4KA 1JR9A 2K1EA 3E89A 5B1BC 2ZE5A 2FKXA 4FZ0A 4PA6A 4UV8A 5EC1C 5BMVA 5EBWC 1VF6A 2QDOA 4MTXA 3K04A 3ZMSA 4I55A 3IC9A 1BMFG 2HVKC 2JGDB 2QJ1A 2P4KA 2X7RB 5A2QN 3JD0A 1W0JG 4H0LB 4F6RA 1GM9A 5BR8B 3SJQC 3G67A 4Z1MG 1M4UA 4WBNB 2JEUA 1GO3F 4ZKIA 4J42A 5EBLC 2JJ1G 1BQ0A 4RQFA 4B3TO 2DYRC 2P6JA 1F51A 4DR3O 4O2BA 1D2DA 1JOYA 1VF5B 2OTJV 5EIBC 1WA8B 5LGTA 2KQXA 4MVQA 1AR5A 1R3LC 1VP7A 1N34B 4NXMO 1LUVA 4F6RB 3HKDB 2IU0A 3RYCB 4DV6O 4XDLA 3BCCH 4TOIA 4EB6A 5LYJA 4RUEA 4GKKO 2X6BA 3FAVB 3T1HO 4KHPB 3B09A 3H01A 1F4NA 1QR9A 3FB5C 2DYRB 3RW0A 1FXVA 4BIZA 1IX9A 2CGOA 3E35A 1JVMA 2ITDC 4I0XA 4RWUA 3BRCA 2WLIB 1GK9A 1QVFU 2QKSA 4EB6B 4DYLA 5LMNO 4R6ZA 3AG3B 3ASNC 1XNRO 2Y4UA 1VEWA 1XDCA 1G4YB 2N05A 1E1RG 4DR6B 3J7AU 2OYQA 2QWNB 3RVYA 1R6KA 4U7NA 3ETGA 3ZJZA 3JATA 2KSDA 3U10A 2WWWA 1SZXA 4LC1A 4R8CA 4MVRA 4WFFA 1AI4A 4J7JA 2JS5A 1S5JA 1V55B 3JYCA 1G6UA 2P90A 5B1OA 5L3CA 1S76D 2QE7G 1YDXA 2LFSA 3AK3A 3W7WA 1HNXB 3RYHA 3UO2A 4WFBV 3SPGA 3A2FA 3K5LA 3Q4HA 2EIMC 3I56V 3SDLA 2A9HA 1PNMA 1SQGA 2YIBD 2LO1A 2ZT9B 3T4DA 1XMQO 2ZE7A 5TISZ 1FJGB 4PI2A 1N8RW 2IJHA 1VQOV 1IBMB 5A9GA 2Q8VA 4NXMB 4JI4O 2EILC 2R9IA 3DSQA 3ZHTA 1XMOB 2PF4E 2LQTA 4JGSA 2CAZC 3LSQA 5CMUA 5LP6B 3MHHC 1Q7YW 4MVZA 4X1YB 1B06A 1K73W 4QPJA 3OR7C 4JAUA 1AJNA 3UO3A 3BVOA 3H1LH 3CYOA 2W0FC 4UVAA 4DXWA 3CCUV 2ZE6A 2MW2B 2GDSA 4LFAB 1DF4A 3X2QC 3M99B 4B3RO 1GN2A 3RYFA 1Z5VA 1AJPA 1MZEA 3CB2A 2DWDC 3RYIB 4KHPO 3SGIA 2ZQMA 4FLTA 1ZAUA 4U3JB 3A0RA 2EJRA 4XDKA 3AG7A 3JASA 3RN4A 3CWBH 1E1QG 1ZL8B 1N33O 1OCCB 1W0KG 4JZGA 1KBHA 3ASOC 2BSKB 5DEDA 4JI5B 1SQFA 3ZN1A 2YI9A 1OCOB 1M56C 4O4HB 5KMGB 2HP8A 5KHHA 4CH3A 3OT7A 4BWAA 3JALB 4HNAA 1KD1W 1VQ8V 3DC6A 4FK5C 5CBHA 1HWYA 3CE2A 1I94O 1FAFA 1ENVA 4TSFG 4F4LA 3NXSA 4UCTA 5L3EA 1NH2B 3E2EA 3CP1A 5IY5B 4FIPC 2ZNIA 2GHYA 2YS8A 1YXBA 2N04A 2Y0IA 2AZ0A 4ZBMA 1J5EB 1FXKB 1Q3EA 4TUYA 1S5LZ 3ASNB 3VQXA 2DN9A 5B1BB 5LMUB 3JD3A 1VF7A 4DV0O 2PI5A 4LFCO 4YJ2A 1L1FA 5IWAO 3ABMB 2JGDA 4NKGB 3OW2U 4U3FH 2H94A 2R72A 3N2KA 1SQXH 3OGIB 3OMAB 4QE9A 3SR2C 1IZ3A 3JAMN 4B3SO 4FM2A 2FB5A 4NTWA 2QWRB 5IWAB 1H2SB 4K3AA 2KKWA 2UUCO 4KL1A 2QWQB 3BPZA 2KB1A 1D5NA 3T1YB 2W0XA 1MZFA 4AQYO 3B4SA 5KX5B 1NH2D 2PI4A 3CRMA 1J5EO 5JJNB 3CJHA 1B6QA 3UT5A 1N34O 3C3SA 1QVGU 2VRZA 2YDEA 3GVMA 3N2KB 3A8TA 4B3SB 3D3QA 1BHBA 1HNXO 1GN6A 5LOVB 1EN5A 1FXHA 5ITZB 1FFXB 5F2VO 1UJWB 1YI2V 4JTAB 2HJDA 1Q6UA 4ZIBA 1I5YA 3L73H 3M8AA 3T1CA 3K5NA 1R73A 1SRYA 1KP2A 3FAVA 3KG2A 1EN4A 2EINC 3EVKA 4LNUA 2CTRA 1IBLB 3SYPA 1QNMA 1OHHG 1DLBA 2Q9LA 4J80A 3SPHA 1NVPD 1MNGA 4XBFA 2HVJC 3OR6C 2KG7A 3B8NA 4JYYA 2ZIMA 4O4IB 2RN9A 4CH4A 1HP8A 1LUWA 2JRIA 2UUAB 3R65A 1K5SA 3G71V 4P2ZA 1AI7A 3PN1A 1HW7A 2ZD9A 1NTMH 4FLYA 5DECA 2IJJA 2ARHA 1VARA 1WA8A 3WU2Z 3CX5F 3W7UA 4JF3A 3ZIAG 1FFTB 5CA3A 3HKDA 3KKYA 1XHXA 3RYCA 4DW0A 2OCCC 4O4IA 2B5UA 3LDEA 2LW7A 3KZIZ 1TAEA 4MVSA 4OPHA 5LYJB 2DE0X 3IGAC 1XNQB 4JTDB 4BW5A 3CCJV 2XHBA 1SKVA 3ETDA 4JYAO 3SJAC 2RNBA 4H33A 3ABLB 1FXKC 2ZM6O 1B3QA 1L8DA 4LF9O 3AG2B 3L74H 2YICA 4J9YB 4NR1A 1X59A 3SPJA 2WLLB 3OE7G 1YZBA 3U11A 4QE7A 1IBLO 3DGEA 3BA9A 4FMTA 4DV2O 4B7KA 3LUTB 2A3QA 3BY6A 4W4LA 1WPBA 2CE4A 2E5LB 3LDDA 2E3CA 4IT5A 5LA6A 1JFFB 2Q7GA 3J80N 3D36C 3E8HA 1MG1A 1N33B 5KA6A 5IYCO 1MMMA 1OV9A 1YJ9V 4IIJB 2D3OW 1H2GA 4XDJA 1M1KW 2WA3A 1JCHA 1FJGO 2PUSA 1Y76A 3T1YO 2ZR3A 4O2AB 2HHHB 3LNNA 3UKMA 4X8AA 3ZRVA 3ZRWB 3CC2V 4LFAO 4HAMA 1BS3A 3E22B 4JI3O 1THZA 2VS0A 4WF9V 4B3TB 2YXYA 4AILC 2YIDA 1XHZA 2YC0A 2RQ6A 4ZOLA 4KXRA 2IU3A 4G27B 4TQFA 3C90A 4PA3A 2MK3A 1EM1A 4A5UB 4YHHB 3WG7B 2IJKA 2NNUA 5KHKA 3H1KH 4O4HA 2CTQA 4MVOA 1XMOO 2H8PC 3LSUA 1YCIA 5CA0A 1GN3A 4MT8A 2Q6AA 2QA4V 1WNSA 1L0NH 2BOBC 5LL6Y 3T1HB 3RYHB 4X66O 3IC7A 3BABA 1S77D 1CEZA 2BTQB 1YEWA 2QM8A 1M9NA 1XNQO 1KB9F 5IT9N 4OPAA 1K33A 2ZXWC 1TUEB 2YEVA 1RM1B 4DR3B 5B5EZ 3G6BA 4DK1A 1Q6HA 4QGPA 1H8EG 1SS3A 2P67A 5JVDB 4DR7O 1R3JC 2UUBB 4LF7B 4PDVA 4FLVA 1PPJH 3I55V 5IYZB 1XOUA 3G6EV 1EFRG 2F95B 2DJVA 1RSOB 4EKWA 1SESA 2R9AA 4J41A 2WLNA 2UUCB 4UVCA 4UXNA 5H9CA 4FM0A 1XUQA 4DUZO 2RCVA 4LP8A 4FM1A 1NU1H 4DRXA 2JGUA 4LCUC 3HKEA 5LHIA 5LHHA 1AB3A 2RJZA 4BIUA 4PELA 2FTKA 3B40A 3CJHB 4FZ1A 5D5PA 1K97A 2F1MA 2ZDIC 1NR7A 2ZDIA 4PV1B 4GLXA 4DV2B 2V4DA 4RUFA 1GMGA 1HNZO 4P9PA 2QWOB 4UCRA 4J9ZB 3CXCU 2X6AA 4LF5B 4J7KA 1GN4A 4K8ZA 1K5QA 4AHCA 4TV9B 5KMGA 4I5SA 4I4TB 2IW5A 4CS4A 1BQZA 2Q7EA 5GTHZ 3FYEB 3OGCC 3ZX6A 1V54C 1AILA 2E74B 3P30A 4LR3A 2PZSA 1TGOA 4MVMA 1WLEA 2XAJA 1WJZA 1IURA 3QO5A 3H1IH 1UFIA 2PGGA 4FFKA 1WPXA 2XAQA 3QVNA 1VQPV 1XEQA 2DYSB 5BMVB 3K58A 1PNLA 4OXSA 3K79A 3JARA 4PDLA 3K0DA 3WB0A 2XAHA 1PL0A 4WFHA 2AZ2A 4TV8A 5LHGA 3STLC 3CMAV 5HFLA 3CCQV 3TXSA 4LF4O 4TWKA 2DQ3A 3FD9A 5ITZA 5K1XA 3LSSA 1XNRB 1VMGA 2VWJA 1P84F 3LNMB 2YXLA 2GTSA 2NLJC 4AI8A 4FLZA 3BEHA 3OMNB 5AG2A 1QHTA 5FPRA 4E2LA 3QF7A 5J2TA 5JCOA 2CTPA 3JARB 1FPOA 4PJ0Z 3F5TA 3K0GA 4ABMA 5IDJA 1NS1A 2IJIA 2D2CB 1KQSU 1K92A 3G4SV 4TV8B 3FB6C 3JAKB 3JATB 5B1NA 3JAWA 2EULA 3N2GA 1URFA 1YITV 1F23A 4TT3G 2HKOA 4MTFA 2QEXV 4X1IA 3ETQA 4QIWF 4BIOA 1COWG 1H2LA 1BCCH 1R3IC 4P9OA 5B1AC 4DR1O 4JI1B 3SJBC 3IFXA 4L8JA 3STZC 2HHHO 2Q7HA 5KAIZ 2A79B 4X1KA 1NI8A 3VQVA 3ZHSA 3GWKC 2B1IA 4LH7A 4FFBA 4I0XB 4MSWC 1I7FA 4GX1A 2JK5C 2WLIA 3ZEDA 5CBGA 1Y74B 5IJ9A 3ASOB 2WLHA 1XQ8A 5KUMA 3AG2C 2Q73A 1BSMA 1KYOF 1Y67A 1HR0B 4LFCB 3CXHF 3MAQA 4YIPA 2BCCH 4QJFB 3AEIA 4RQEA 1KC8W 4JAVA 1O9HA 1EZJA 1YTFB 2XOKG 5FL7G 1IBMO 4LWSA 1DF5A 3AG4B 4LFBB 2WLKA 2W6JG 4DR4O 4R7CA 3CRCA 4NXNB 4RO2A 3O65A 1V55C 4DV3O 1VQMV 4X65O 1PV0A 3BHPA 1KMIZ 4B3MO 2YI8A 4HZ3A 3IAYA 3OTOB 2HJFC 3T4ZA 2OIEA 3N27A 2IM9A 5JJJB 1QLNA 4JI8O 3MHSC 4E4EA 2YXHA 1YJNV 2E76B 5LP6C 5C8YB 4U7OA 4N23A 2UUBO 4I9QA 2K9PA 5J2UA 3TETA 2Z3YA 4GCZA 4JASA 3F7VC 1SA0B 2Y48A 4QNHB 2ODMA 2P4VA 3CCRV 2JIZG 1NZ6A 2H3OA 3OD4A 3CCEV 3CSXA 2F66C 2JDIG 2HR3A 2DYSC 4HNAB 1W2BU 3FKSG 4DW1A 3P3PA 4X64B 1VIBA 5EZYB 2FL4A 3HKBB 2EIJB 3L9DA 3OFNG 5KHJA 1K7DA 3CHXA 2ZKOA 1YSCA 2AHYA 3H9VA 2DWEC 3D8CA 1MABG 2YSUB 5JQGB 2XTAA 4H44B 1JJ2U 5JJEB 2WPDG 4RAIA 1QLEC 1O9GA 1W59A 4X88A 3OTFA 2Z0AA 2WSSG 1FYJA 1JQ0A 4OX9B 1ZX3A 4X89A 5LP6A 3ZRWA 4JI5O 3OM3B 1N4CA 1RPOA 2BTQA 5BY1A 2UXBB 3C3TA 3ZHVA 4PI0A 4DUYB 4O4JA 3JSNA 1EBOA 1TUBB 3QG5A 2BSKA 2GUZA 4DV6B 2P06A 3K9SA 4X65B 2B1GA 1Q43A 4IL6Z 3A0HZ 5EBMC 3ZHRA 5EYPB 3P32A 5KLVH 4DUYO 1BT8A 3ZMUA 4DR2B 3X2QB 2HEPA 4LF5O 2QM4A 3LDCA 3UM7A 2XASA 5FLXN 1IVSA 4ZHQB 3JASB 2PYJA 1J95A 4P30A 5IY5C 5IYBO 4JI0B 4DO2A 1S5HC 1NJIW 2EX3A 5CN0A 1NTKH 4JI0O 4DV0B 1SETA 2JEXA 5LMUO 2EIKC 1T5EA 3DXRB 3E83A 2CDYA 1RP3B 2OCCB 1MOFA 5LGUA 5KUKA 1ROPA 4I50A 3EXAA 4MS2A 3AK2A 4DRXB 4GT1A 3ZS8C 1P7BA 4X1YA 3BA8A 2PYLA 1D5AA 3PJSK 4Z2WA 2R70A 4IHJB 4X64O 3HKCB 4ZI7B 2QKAA 3CRAA 1IBKO 3ABMC 1M56B 4GX2A 1H2KA 4UCUA 4KFMA 2GV9A 4EFBA 3ML0A 4JYAB 3WG7C 1NTZH 5KAFZ 1PP9H 4QPKA 1KECA 1DK1A 4HBNA 1WAZA 4LF7O 1P49A 2OIGA 5K1PA 1Q8IA 3ABKB 1IDSA 2P7TC 2Y4TA 4DV1B 4IHJA 2EBOA 3RGBA 2YIAA 3I5DA 5L3BA 4PHZA 2C2AA 3W7XA 4FLUA 5H6RA 3W7SA 2OWOA 2QM7A 1YJWV 3CEIA 4JV5O 4NB5A 2LP7A 5BXZA 2WLJA 1V54B 1N36B 3ZHUA 3SYOA 4GKJO 2BE3A 2UXCO 4J11A 1VQNV 1OCOC 2V1DA 2Z5UA 4MTOA 4KUMA 1S3JA 1Q5OA 4TV9A 3JD4A 1VQ7V 1F4MA 4LF4B 5LMNB 1TA8A 1WB7A 1WB8A 4X1KB 4OX9O 3E8GA 2ZE8A 2RMKB 3H1JH 2IH3C 2XAGA 4WFEA 4FFBB 4CS2A 2WLLA 1PD3A 4MW8A 1VQKV 1WP8A 3VOUA 1R1BA 3NR7A 3H1HH 4K0KO 4DK0A 1E79G 3HB3B 1AJQA 4TUYB 1CP9A 4GKKB 1QR8A 1N32O 3EHBB 4AQYB 4NTYA 5B66Z 4O4LA 2PTMA 3CRRA 3MD0A 3OTOO 4OGQB 1ZLZA 5CA1A 1S72V 1Y66A 3ABLC 4LF8B 4KP4A 5D5QA 4G28B 1WP7A 2X6CA 4DR4B 1YHQV 4Z1VA 1Y76B 1VQ4V 2G38A 1AI6A 2EILB 4JPRA 1Q90D 5JH7B 2UXBO 2WA4A 3ABKC 3CPWU 2XUMA 3AG3C 4YY3O 3JD1A 5H6QA 5CA1B 2L6LA 4CC6A 1A32A 4IGGA 1VQ6V 3UT5B 1GKFA 4C7UA 4PD4F 4MVUA 5LOVA 3R66A 3ZCCA 1N0JA 5IE9A 3U0ZA 4K8XA 1H38A 4GZRB 2ATKC 1AI5A 5BZBA 3J81N 5CA0B 1ORQC 4O2BB 2FMLA 1G1XB 3F5WC 3HKBA 3K06A 5JCOC 1ZL8A 1Q82W 2DOSA 3RT3C 4UCOA 1Y74A 5IJ9B 3G80A 1YVWA 1YIJV 3RBZA 1OJHA 2F93B 5EC2C 2DQ0A 4FVMA 1UPGA 4IYIA 4JYCA 1XL6A 5H2FZ 2VQFO 1LNQA 3VQWA 3E8BA 5L3GA 2OTLV 4YXWG 2JVDA 4UFZA 2DMXA 1CXZB 1H2MA 1KUQA 2EJ7A 2VQEO 4B3RB 2F43G 4NXNO 2FYUH 3K57A 1QBZA 2R9RB 2LGQA 1BGYH 1HNWO 4DV7B 3ICXA 4PDMA 3WB1A 4O2AA 3T2MA 4LBEC 4PA7A 1U97A 1BE3H 1FXKA 1Q81W 3S3WA 1GRJA 3QTCA 3SYQA 2X0LA 1SQVH 2RDCA 1FKAO 4X62O 4B7EA 3CC4V 4ICGA 2QSAA 1VF6C 4FJCC 1U96A 1AROP 4UCSA 1GM7A 3THOA 4DR2O 3CCLV 4TQDA 4UB8Z 2ADQB 1XMQB 1NR1A 1N36O 4GX0A 1L0LH 1SERA 2Q69A 1R3KC 1PL4A 3DXRA 1M57C 1KKCA 2Q68A 3UCSC 1K4CC 2F23A 2VQFB 3ABUA 4PDRA 2F4VB 1JA8A 2N74A 5FNVA 5JVDA 1WN7A 2LW1A 2LJ2A 5B1AB 4YY3B 4DR1B 3D36A 5E79Z 1MSWD 2QTSA 4O4JB 1NQTA 4NVPA 4JAAA 5GONA 4DR7B 4Q6GA 5C93A 5LXTB 2UXDO 3RFRA 4D7SA 2Q67A 4L87A 2E75B 1FFXA 5IYDO 1K3EA 1CPYA 1JPXA 4B3MB 2JS3A 1M93A 4NYKA 1H8HG 1M57B 4YJ2B 3E22A 4DV3B 3GB7C 3JALA 2EIJC 1IBKB 3OAAG 4JI6B 4DR5O 5GONB 2CH7A 3MDSA 4ASUG 4CC5A 2VWKA 1RSOA 3W7TA 1TUBA 3WFVA 1SZTA 5LGNA 1FD9A 3OMIB 4CZZA 2XAFA 2CTWA 4UV9A 3TGUH 3SPCA 4BW9A 1ZSPA 1P7GA 5EYPA 5J2TB 4F6EA 4U3JA 3FFQA 4GUNA 1BZKA 3JCUZ 3BAAA 1XBLA 2ITCC 2IBZH 4UCVA 4X20B 3TCUA 3EFFK 5CB4B 3ABTA 2AHZA 2LGWA 1Q86W 2YEVB 2P5OA 1OCRB 4WBNA 1N32B 4JI2O 2ILMA 4WFGA 5E1AC 4N21A 2YIBA 4FPPA 3TXQA 4BAYA 3FB8C 4K35A 4JI7B 4EFEA 4I4TA 2Q0AA 2AGAA 4O4LB 4K0KB 3QNEA 3HKCA 4ZI7A 1XL4A 2ADPA 2EZOA 4I55B 3K5OA 5L3FA 1HNZB 2XT9A 1EZVH 1QLEB 4B08A 2M7WA 2NR5A 3JCZA 2W6IG 1R6TA 2M6YA 1ZUQA 4EEQA 3CRQA 4FLXA 5JH7A 1K8AW 1KKDA 1VQ9V 3OUFA 1RPRA 3E8FA 1V9PA 1JX9A 4LH6A 1GM8A 4DUZB 1K34A 4X66B 5LA6B 4LF9B 4DV4O 3DC5A 1S0VA 3UQ8A 3CC7V 3N2GB 3IJ4A 1OCCC 2WLMA 5B3SB 1KP3A 4YJ3A 1B04A 3FYIB 4X62B 2ZNJA 2EIKB 4IYHA 2UU9B 2ZIOA 3A0BZ
chains in the Genus database with same CATH topology
4WFFA 1AI4A 1TUEB 4QPKA 3E86A 1KECA 2YEVA 1RM1B 1V55B 2A0LA 3CMEV 3JYCA 4WCEV 1PNKA 1YTFD 2P90A 5B1OA 3ABKB 3K03A 5L3CA 1K9MW 1S76D 2QE7G 2P7TC 2LFSA 1H8EG 3W7WA 2P67A 2EBOA 4WFBV 3SPGA 3RVZA 5L3BA 1BHAA 3W7XA 2C2AA 1R3JC 4PDVA 2EIMC 5H6RA 3W7SA 3I55V 3I56V 1VQ9V 2A9HA 1PNMA 1NBMG 1GTOA 2QM7A 1YJWV 3G6EV 1EFRG 2LP7A 3T4DA 4JTCB 3ZRXA 4EKWA 2WLJA 1V54B 3ZMTA 1SESA 5EK0A 1N8RW 2IJHA 1Y4MA 1VQOV 3SYOA 2WLNA 4GX5A 3TK1A 1VQNV 4UVCA 4UXNA 1OCOC 2EILC 2V1DA 2R9IA 2Z5UA 4MTOA 4MW3A 4KUMA 5H9CA 1S3JA 2OT5A 4JGSA 3JD4A 1VQ7V 1F4MA 2ZR2A 4LP8A 2UXNA 3LSQA 5CMUA 1P4RA 4LCUC 3MHHC 5LHIA 5LHHA 1Q7YW 4MVZA 4BIUA 3E8GA 4PELA 1K73W 2FTKA 4QPJA 1VQLV 3OR7C 1G8MA 2IH3C 2XAGA 3ZRSA 1K97A 4JAUA 4WFAV 4WFEA 2ZDIC 1AJNA 5B3SC 2WLLA 1PD3A 4MW8A 1NR7A 2ZDIA 1VQKV 3CYOA 3VOUA 2W0FC 4RUFA 4UVAA 1GMGA 4DXWA 3CCUV 4P9PA 1FS0G 1DF4A 3SYAA 3X2QC 3M99B 4J9ZB 3B8MA 3CXCU 2X6AA 3K9AA 1E79G 3HB3B 1AJQA 4H37A 1BL8A 1K5QA 4JYBA 1AJPA 1CP9A 4I5SA 1VQ5V 2DWDC 1QR8A 4I9WA 3EHBB 4G2KA 2IW5A 2ZQMA 5L3DA 3MD0A 4PA9A 3FYEB 1S72V 1OZ0A 1Y66A 2IH1C 3A0RA 3ABLC 2EJRA 1I5XA 1OCZB 3OGCC 4XDKA 3K3WA 1V54C 4KP4A 1NKDA 4G28B 2X6CA 1E1QG 3K08A 3P30A 1YHQV 4MVMA 1WLEA 2XNDG 1OCCB 1DTOA 1W0KG 2XAJA 2WAMA 3QO5A 3ASOC 3AG1B 3ZN1A 1VQ4V 3CD6V 3SYCA 1AI6A 4Q20A 1OCOB 2EILB 4JPRA 3ABKC 1M56C 1WPXA 1AR1B 2XAQA 3CPWU 3ZMVA 1VQPV 3QO7A 2DYSB 3AG3C 1PNLA 4OXSA 1KD1W 3K79A 1VQ8V 3JD1A 5H6QA 2BOCC 4FK5C 5CBHA 1HWYA 4PDLA 3K0DA 2ZXWB 4PA4A 1VQ6V 1ENVA 4TSFG 4F4LA 3NXSA 2XAHA 1PL0A 4WFHA 1GKFA 5DM6V 5L3EA 5LHGA 1NH2B 3E2EA 3CP1A 3STLC 3CMAV 5IY5B 5HFLA 4FIPC 3CCQV 4TWKA 5KA5A 4MVUA 2DQ3A 2GHYA 3ZCCA 3ETEA 3F7YC 3LSSA 3LNMB 5J9PC 4ZBMA 2NLJC 5LBQA 1FXKB 3BEHA 3OMNB 1H38A 3ASNB 4E2LA 5B1BB 5BZBA 2ATKC 1AI5A 3JD3A 2PI5A 3K0GA 1ZWIC 1ORQC 1L1FA 5IDJA 2IJIA 1KQSU 1OCZC 2V7QG 1K92A 3G4SV 3ABMB 3FB6C 2UXXA 3F5WC 3K06A 5B1NA 3OW2U 1M90W 1YITV 1F23A 2H94A 5CBFA 4TT3G 1Q82W 2HKOA 3OMAB 4QE9A 4MTFA 2QEXV 4QIWF 1COWG 4UUJC 3DTUB 1R3IC 4P9OA 5B1AC 3JD2A 3GWOA 3ZMZA 1YIJV 3RBZA 5EC2C 2DQ0A 3IFXA 2Y69B 2GSMB 3STZC 3CCVV 3CCSV 3OEEG 4JYCA 1XL6A 2KB1A 2EIMB 2A79B 1LNQA 3E8BA 1NH2D 2PI4A 5DN6G 5L3GA 2OTLV 1PKXA 4YXWG 1B6QA 2B1IA 3AG4C 3SPIA 4CBCA 1IXMA 2F43G 1QVGU 4MSWC 3ZN0A 1QBZA 2R9RB 3AG1C 4GX1A 1R6NA 2JK5C 1BHBA 2WLIA 3OUSA 3D3IA 5CBGA 4PDMA 2HG5C 1FXHA 3CCMV 3ASOB 2WLHA 1UJWB 1YI2V 1OCRC 5KUMA 3AG2C 4JTAB 4LBEC 3T2MA 1I5YA 4PA7A 2EZPA 3T1CA 1R73A 1SRYA 2EINB 1FXKA 1KP2A 1Q81W 5GW7A 3SYQA 2X0LA 3KG2A 2EINC 4QJFB 3AEIA 4RQEA 3CC4V 2CK3G 3B77A 2Y69C 3SYPA 1KC8W 4FJCC 4JAVA 1K4DC 3HPLC 1OHHG 3QO8A 1AROP 4MTGA 1GM7A 1DLBA 1EZJA 1YTFB 2XOKG 2DW4A 3CCLV 5FL7G 1DF5A 3AG4B 3SPHA 1NVPD 2WLKA 1NVPB 1NR1A 3OEHG 2W6JG 4XBFA 4R7CA 2HVJC 4RO2A 4GX0A 3OR6C 1SERA 2Q69A 1R3KC 1V55C 3B8NA 1M57C 2Q68A 1VQMV 1K4CC 3ABUA 4HZ3A 3FB7C 4PDRA 2HJFC 3T4ZA 3R65A 1K5SA 3G71V 4P2ZA 1AI7A 1QLNA 3MHSC 5B1AB 2ZD9A 1YJNV 5HFMA 1QCEA 3D36A 2IJJA 4U7OA 1MSWD 4N23A 3VBBA 2QTOA 4HYOA 1NQTA 4UVBA 4R50A 3TETA 2Z3YA 5C93A 4GCZA 4JASA 3F7VC 3W7UA 4JF3A 2Y48A 3ZIAG 4QNHB 1FFTB 5CA3A 2HFEC 3CCRV 2HLDG 2Q67A 4L87A 2JIZG 2OCCC 1RM1C 2B5UA 3LDEA 4MVSA 5IYDO 3IGAC 1K3EA 2JJ2G 2LFRA 1CPYA 1JPXA 4JTDB 3CCEV 2K1EA 4BW5A 3CCJV 3E89A 5B1BC 3ETDA 1H8HG 1M57B 4H33A 4PA6A 4UV8A 2JDIG 5EC1C 3ABLB 2HR3A 1FXKC 3GB7C 2DYSC 5EBWC 2EIJC 1W2BU 3FKSG 4MTXA 3AG2B 3K04A 4J9YB 3ZMSA 3OAAG 2EIJB 1BMFG 2HVKC 3OFNG 3SPJA 1K7DA 2WLLB 1YSCA 2X7RB 3OE7G 4ASUG 2AHYA 3JD0A 2DWEC 3W7TA 4QE7A 3DGEA 1MABG 2YSUB 1W0JG 3WFVA 1SZTA 4FMTA 1GM9A 1JJ2U 5LGNA 3SJQC 4Z1MG 3LUTB 3OMIB 2WPDG 4RAIA 4CZZA 1QLEC 2XAFA 3BY6A 2JEUA 4UV9A 4X88A 1GO3F 3LDDA 4ZKIA 2WSSG 5EBLC 3SPCA 1JQ0A 2JJ1G 4X89A 3ZRWA 3E8HA 4RQFA 3OM3B 2DYRC 2P6JA 1F51A 1MG1A 1RPOA 5KA6A 5IYCO 2ITCC 1JOYA 1YJ9V 2D3OW 2OTJV 1H2GA 3TCUA 5LGTA 3EFFK 1EBOA 4XDJA 1M1KW 3ABTA 4MVQA 1R3LC 2AHZA 1JCHA 1Q86W 2ZR3A 2YEVB 2IU0A 4XDLA 3UKMA 1OCRB 2B1GA 4RUEA 4WFGA 2X6BA 5EBMC 4X8AA 5E1AC 4N21A 4FPPA 3P32A 3ZRVA 4BAYA 3FB8C 3ZRWB 3ZMUA 3CC2V 3H01A 1F4NA 3X2QB 4HAMA 1QR9A 3FB5C 2DYRB 3RW0A 1THZA 3QNEA 4WF9V 1FXVA 1XL4A 3LDCA 4BIZA 3UM7A 2EZOA 2XASA 3E35A 5L3FA 1J95A 4P30A 5IY5C 1JVMA 2ITDC 5IYBO 4DO2A 1S5HC 2IU3A 4G27B 1NJIW 5CN0A 1QLEB 2M7WA 1SETA 2JEXA 4PA3A 3JCZA 2MK3A 2W6IG 2WLIB 2EIKC 1GK9A 1QVFU 2QKSA 3E83A 2IJKA 3WG7B 2NNUA 4R6ZA 3AG3B 2OCCB 1MOFA 1K8AW 1KKDA 5LGUA 3ASNC 1ROPA 3OUFA 5KUKA 1RPRA 4MVOA 2H8PC 3E8FA 4MS2A 1JX9A 1G4YB 1GM8A 1P7BA 4GT1A 1E1RG 4MT8A 2Q6AA 2QA4V 1K34A 3RVYA 2BOBC 3PJSK 1R6KA 4U7NA 3ABMC 3IC7A 1M56B 4GX2A 3ETGA 3ZJZA 4KFMA 1S0VA 1S77D 1CEZA 2WWWA 3CC7V 2QM8A 1OCCC 2WLMA 5B3SB 1M9NA 1KP3A 3FYIB 4LC1A 3ML0A 2EIKB 4R8CA 4MVRA 1K33A 3WG7C 2ZXWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 U;  1VQ4 V;  3CD6 V;  3CCV V;  1YJN V;  3CMA V;  3CCE V;  3CCM V;  3CCJ V;  4WF9 V;  3CCS V;  3CCL V;  1YI2 V;  1K73 W;  1M1K W;  3CCQ V;  1VQL V;  1KQS U;  3G4S V;  3CME V;  1N8R W;  2QA4 V;  1VQO V;  4WFA V;  4WCE V;  1R73 A;  1Q86 W;  3CPW U;  1W2B U;  1K9M W;  1Q81 W;  3OW2 U;  1VQK V;  1VQP V;  1S72 V;  1M90 W;  2OTL V;  1YIT V;  1VQN V;  1VQ5 V;  1NJI W;  3CCU V;  1Q82 W;  1VQM V;  1KD1 W;  1VQ8 V;  3CC7 V;  2QEX V;  4WFB V;  3CCR V;  1QVG U;  3CC4 V;  1YHQ V;  1QVF U;  1VQ7 V;  3CXC U;  1VQ6 V;  1KC8 W;  3G71 V;  1YIJ V;  3I56 V;  3I55 V;  1K8A W;  1Q7Y W;  1YJ9 V;  3CC2 V;  5DM6 V;  2D3O W;  2OTJ V;  1YJW V;  3G6E V;  1VQ9 V; 
#chains in the Genus database with same CATH topology
 1I94 B;  3E86 A;  2KG7 B;  2A0L A;  3CME V;  4WCE V;  1PNK A;  5FPO A;  1YTF D;  1K9M W;  3K03 A;  1F7Y A;  1AP5 A;  3RVZ A;  4H13 B;  1BHA A;  2UU9 O;  1MSD A;  2F4V O;  5C8Y A;  3AK1 A;  1NBM G;  2QWP B;  1GTO A;  5H5N A;  2L35 A;  2OCH A;  3JAW B;  4JTC B;  3ZRX A;  3HR0 A;  3ZMT A;  5EK0 A;  1SA0 A;  1Y4M A;  3P3N A;  4GX5 A;  4CH5 A;  2Q5Z A;  3TK1 A;  5JWP A;  2NN4 A;  4MW3 A;  1US6 A;  2OT5 A;  1NT2 B;  1Z2G A;  1AR4 A;  2ZR2 A;  5EIB D;  2UXN A;  4LNU B;  4D7T A;  4DR6 O;  1SQP H;  1P4R A;  4YIO A;  5KHI A;  1VQL V;  1G8M A;  3FX7 A;  5GTI Z;  2Q0O C;  3ZRS A;  1IXB A;  4WFA V;  2Y0P A;  5B3S C;  1QU7 A;  1I0H A;  1FS0 G;  5JQG A;  3SYA A;  4JI7 O;  3B8M A;  4JI3 B;  3K9A A;  4DR5 B;  4JI6 O;  4H37 A;  1BL8 A;  4JYB A;  4GKJ B;  1VQ5 V;  4I9W A;  1EN6 A;  1Z5W A;  1N0N A;  4G2K A;  1XRE A;  5L3D A;  4PA9 A;  4D6T H;  1OZ0 A;  2IH1 C;  3RWR D;  4DV5 O;  1I5X A;  1OCZ B;  3Q4H B;  3K3W A;  1NKD A;  1QQC A;  1Q6I A;  2CGN A;  3K08 A;  5IJ0 A;  4LF6 B;  1YF2 A;  4IIJ A;  3APQ A;  1SC5 B;  2XND G;  4I7Z B;  1DTO A;  2WAM A;  4J7Z A;  4X1I B;  2UXD B;  4LWS B;  3AG1 B;  2GUZ B;  2A06 H;  3CD6 V;  3BFR A;  2AXT Z;  3SYC A;  4Q20 A;  3B2E E;  4X9Q A;  1AR1 B;  3ZMV A;  5FNV B;  3QO7 A;  2GBO A;  2BOC C;  2ZXW B;  4PA4 A;  5IJ0 B;  1SF9 A;  4LF8 O;  4DV4 B;  5DM6 V;  1HDJ A;  3M7M X;  5J2U B;  3L75 H;  5KA5 A;  4CS3 A;  2ETN A;  3TJT A;  3ETE A;  3F7Y C;  4LFB O;  3KCX A;  5J9P C;  1TVK A;  3RYF B;  5LBQ A;  2ZM6 B;  1JFF A;  1KU9 A;  5KHG A;  1AVM A;  1ZWI C;  3K59 A;  3ZBH A;  1OCZ C;  2V7Q G;  1XI1 A;  2P22 C;  5EZY A;  2QKC A;  2UXX A;  3L71 H;  2B9Z A;  1M90 W;  3CS5 A;  1GAX A;  5CBF A;  1HNW B;  3ZHQ A;  1X4T A;  4UUJ C;  3DTU B;  4LF6 O;  3JD2 A;  1TVK B;  3GWO A;  3ZMZ A;  4JI2 B;  1H2N A;  3KCY A;  4UB6 Z;  2Y69 B;  2GSM B;  3CCV V;  2UXC B;  2QGN A;  3OEE G;  3CCS V;  3K5M A;  2CUG A;  2EIM B;  2UUA O;  2AW9 A;  1ZTE A;  4NTX A;  5DN6 G;  1I08 A;  1PKX A;  3AG4 C;  2A7W A;  4DV5 B;  3SPI A;  4ZHQ A;  4CBC A;  4ZOL B;  1IXM A;  5IYZ A;  1SQB H;  3ZN0 A;  3AG1 C;  5CB4 A;  4JI1 O;  1R6N A;  3VQY A;  1MA1 A;  2YUA A;  3OUS A;  1JJO A;  3D3I A;  2HG5 C;  3CCM V;  2GTA A;  1OCR C;  4CH6 A;  4I50 B;  2EZP A;  2EIN B;  2E5L O;  1HR0 O;  3RYI A;  5GW7 A;  1DGS A;  3WB2 A;  5KX5 A;  4DV7 O;  3HKE B;  2CK3 G;  1JMK C;  3B77 A;  1Y6X A;  2Y69 C;  3JSL A;  2O57 A;  5BR8 O;  1K4D C;  3HPL C;  3QO8 A;  1LR1 A;  4MTG A;  2Q4P A;  2VQE B;  3JAK A;  2DW4 A;  5LXT A;  3SJC C;  1NVP B;  3OEH G;  4JI4 B;  2ZCE A;  4JV5 B;  3FB7 C;  1M5I A;  2ZIN A;  4YHH O;  3L72 H;  1XIL A;  4BR6 A;  4JZ2 A;  5HFM A;  3L70 H;  1QCE A;  3S3X A;  4DV1 O;  1PM9 A;  3VBB A;  2QTO A;  4HYO A;  4X20 A;  4UVB A;  4R50 A;  2CH7 B;  4YJ3 B;  4FLW A;  2HFE C;  4J10 A;  2PY5 A;  1GH6 A;  4GYC B;  2HLD G;  3APO A;  4JI8 B;  1RM1 C;  2QR4 A;  1SQQ H;  1RFY A;  3O9O A;  2BTO A;  1AP6 A;  2JJ2 G;  2LFR A;  4W4K A;  1JR9 A;  2K1E A;  3E89 A;  5B1B C;  2ZE5 A;  2FKX A;  4FZ0 A;  4PA6 A;  4UV8 A;  5EC1 C;  5BMV A;  5EBW C;  1VF6 A;  2QDO A;  4MTX A;  3K04 A;  3ZMS A;  4I55 A;  3IC9 A;  1BMF G;  2HVK C;  2JGD B;  2QJ1 A;  2P4K A;  2X7R B;  5A2Q N;  3JD0 A;  1W0J G;  4H0L B;  4F6R A;  1GM9 A;  5BR8 B;  3SJQ C;  3G67 A;  4Z1M G;  1M4U A;  4WBN B;  2JEU A;  1GO3 F;  4ZKI A;  4J42 A;  5EBL C;  2JJ1 G;  1BQ0 A;  4RQF A;  4B3T O;  2DYR C;  2P6J A;  1F51 A;  4DR3 O;  4O2B A;  1D2D A;  1JOY A;  1VF5 B;  2OTJ V;  5EIB C;  1WA8 B;  5LGT A;  2KQX A;  4MVQ A;  1AR5 A;  1R3L C;  1VP7 A;  1N34 B;  4NXM O;  1LUV A;  4F6R B;  3HKD B;  2IU0 A;  3RYC B;  4DV6 O;  4XDL A;  3BCC H;  4TOI A;  4EB6 A;  5LYJ A;  4RUE A;  4GKK O;  2X6B A;  3FAV B;  3T1H O;  4KHP B;  3B09 A;  3H01 A;  1F4N A;  1QR9 A;  3FB5 C;  2DYR B;  3RW0 A;  1FXV A;  4BIZ A;  1IX9 A;  2CGO A;  3E35 A;  1JVM A;  2ITD C;  4I0X A;  4RWU A;  3BRC A;  2WLI B;  1GK9 A;  1QVF U;  2QKS A;  4EB6 B;  4DYL A;  5LMN O;  4R6Z A;  3AG3 B;  3ASN C;  1XNR O;  2Y4U A;  1VEW A;  1XDC A;  1G4Y B;  2N05 A;  1E1R G;  4DR6 B;  3J7A U;  2OYQ A;  2QWN B;  3RVY A;  1R6K A;  4U7N A;  3ETG A;  3ZJZ A;  3JAT A;  2KSD A;  3U10 A;  2WWW A;  1SZX A;  4LC1 A;  4R8C A;  4MVR A;  4WFF A;  1AI4 A;  4J7J A;  2JS5 A;  1S5J A;  1V55 B;  3JYC A;  1G6U A;  2P90 A;  5B1O A;  5L3C A;  1S76 D;  2QE7 G;  1YDX A;  2LFS A;  3AK3 A;  3W7W A;  1HNX B;  3RYH A;  3UO2 A;  4WFB V;  3SPG A;  3A2F A;  3K5L A;  3Q4H A;  2EIM C;  3I56 V;  3SDL A;  2A9H A;  1PNM A;  1SQG A;  2YIB D;  2LO1 A;  2ZT9 B;  3T4D A;  1XMQ O;  2ZE7 A;  5TIS Z;  1FJG B;  4PI2 A;  1N8R W;  2IJH A;  1VQO V;  1IBM B;  5A9G A;  2Q8V A;  4NXM B;  4JI4 O;  2EIL C;  2R9I A;  3DSQ A;  3ZHT A;  1XMO B;  2PF4 E;  2LQT A;  4JGS A;  2CAZ C;  3LSQ A;  5CMU A;  5LP6 B;  3MHH C;  1Q7Y W;  4MVZ A;  4X1Y B;  1B06 A;  1K73 W;  4QPJ A;  3OR7 C;  4JAU A;  1AJN A;  3UO3 A;  3BVO A;  3H1L H;  3CYO A;  2W0F C;  4UVA A;  4DXW A;  3CCU V;  2ZE6 A;  2MW2 B;  2GDS A;  4LFA B;  1DF4 A;  3X2Q C;  3M99 B;  4B3R O;  1GN2 A;  3RYF A;  1Z5V A;  1AJP A;  1MZE A;  3CB2 A;  2DWD C;  3RYI B;  4KHP O;  3SGI A;  2ZQM A;  4FLT A;  1ZAU A;  4U3J B;  3A0R A;  2EJR A;  4XDK A;  3AG7 A;  3JAS A;  3RN4 A;  3CWB H;  1E1Q G;  1ZL8 B;  1N33 O;  1OCC B;  1W0K G;  4JZG A;  1KBH A;  3ASO C;  2BSK B;  5DED A;  4JI5 B;  1SQF A;  3ZN1 A;  2YI9 A;  1OCO B;  1M56 C;  4O4H B;  5KMG B;  2HP8 A;  5KHH A;  4CH3 A;  3OT7 A;  4BWA A;  3JAL B;  4HNA A;  1KD1 W;  1VQ8 V;  3DC6 A;  4FK5 C;  5CBH A;  1HWY A;  3CE2 A;  1I94 O;  1FAF A;  1ENV A;  4TSF G;  4F4L A;  3NXS A;  4UCT A;  5L3E A;  1NH2 B;  3E2E A;  3CP1 A;  5IY5 B;  4FIP C;  2ZNI A;  2GHY A;  2YS8 A;  1YXB A;  2N04 A;  2Y0I A;  2AZ0 A;  4ZBM A;  1J5E B;  1FXK B;  1Q3E A;  4TUY A;  1S5L Z;  3ASN B;  3VQX A;  2DN9 A;  5B1B B;  5LMU B;  3JD3 A;  1VF7 A;  4DV0 O;  2PI5 A;  4LFC O;  4YJ2 A;  1L1F A;  5IWA O;  3ABM B;  2JGD A;  4NKG B;  3OW2 U;  4U3F H;  2H94 A;  2R72 A;  3N2K A;  1SQX H;  3OGI B;  3OMA B;  4QE9 A;  3SR2 C;  1IZ3 A;  3JAM N;  4B3S O;  4FM2 A;  2FB5 A;  4NTW A;  2QWR B;  5IWA B;  1H2S B;  4K3A A;  2KKW A;  2UUC O;  4KL1 A;  2QWQ B;  3BPZ A;  2KB1 A;  1D5N A;  3T1Y B;  2W0X A;  1MZF A;  4AQY O;  3B4S A;  5KX5 B;  1NH2 D;  2PI4 A;  3CRM A;  1J5E O;  5JJN B;  3CJH A;  1B6Q A;  3UT5 A;  1N34 O;  3C3S A;  1QVG U;  2VRZ A;  2YDE A;  3GVM A;  3N2K B;  3A8T A;  4B3S B;  3D3Q A;  1BHB A;  1HNX O;  1GN6 A;  5LOV B;  1EN5 A;  1FXH A;  5ITZ B;  1FFX B;  5F2V O;  1UJW B;  1YI2 V;  4JTA B;  2HJD A;  1Q6U A;  4ZIB A;  1I5Y A;  3L73 H;  3M8A A;  3T1C A;  3K5N A;  1R73 A;  1SRY A;  1KP2 A;  3FAV A;  3KG2 A;  1EN4 A;  2EIN C;  3EVK A;  4LNU A;  2CTR A;  1IBL B;  3SYP A;  1QNM A;  1OHH G;  1DLB A;  2Q9L A;  4J80 A;  3SPH A;  1NVP D;  1MNG A;  4XBF A;  2HVJ C;  3OR6 C;  2KG7 A;  3B8N A;  4JYY A;  2ZIM A;  4O4I B;  2RN9 A;  4CH4 A;  1HP8 A;  1LUW A;  2JRI A;  2UUA B;  3R65 A;  1K5S A;  3G71 V;  4P2Z A;  1AI7 A;  3PN1 A;  1HW7 A;  2ZD9 A;  1NTM H;  4FLY A;  5DEC A;  2IJJ A;  2ARH A;  1VAR A;  1WA8 A;  3WU2 Z;  3CX5 F;  3W7U A;  4JF3 A;  3ZIA G;  1FFT B;  5CA3 A;  3HKD A;  3KKY A;  1XHX A;  3RYC A;  4DW0 A;  2OCC C;  4O4I A;  2B5U A;  3LDE A;  2LW7 A;  3KZI Z;  1TAE A;  4MVS A;  4OPH A;  5LYJ B;  2DE0 X;  3IGA C;  1XNQ B;  4JTD B;  4BW5 A;  3CCJ V;  2XHB A;  1SKV A;  3ETD A;  4JYA O;  3SJA C;  2RNB A;  4H33 A;  3ABL B;  1FXK C;  2ZM6 O;  1B3Q A;  1L8D A;  4LF9 O;  3AG2 B;  3L74 H;  2YIC A;  4J9Y B;  4NR1 A;  1X59 A;  3SPJ A;  2WLL B;  3OE7 G;  1YZB A;  3U11 A;  4QE7 A;  1IBL O;  3DGE A;  3BA9 A;  4FMT A;  4DV2 O;  4B7K A;  3LUT B;  2A3Q A;  3BY6 A;  4W4L A;  1WPB A;  2CE4 A;  2E5L B;  3LDD A;  2E3C A;  4IT5 A;  5LA6 A;  1JFF B;  2Q7G A;  3J80 N;  3D36 C;  3E8H A;  1MG1 A;  1N33 B;  5KA6 A;  5IYC O;  1MMM A;  1OV9 A;  1YJ9 V;  4IIJ B;  2D3O W;  1H2G A;  4XDJ A;  1M1K W;  2WA3 A;  1JCH A;  1FJG O;  2PUS A;  1Y76 A;  3T1Y O;  2ZR3 A;  4O2A B;  2HHH B;  3LNN A;  3UKM A;  4X8A A;  3ZRV A;  3ZRW B;  3CC2 V;  4LFA O;  4HAM A;  1BS3 A;  3E22 B;  4JI3 O;  1THZ A;  2VS0 A;  4WF9 V;  4B3T B;  2YXY A;  4AIL C;  2YID A;  1XHZ A;  2YC0 A;  2RQ6 A;  4ZOL A;  4KXR A;  2IU3 A;  4G27 B;  4TQF A;  3C90 A;  4PA3 A;  2MK3 A;  1EM1 A;  4A5U B;  4YHH B;  3WG7 B;  2IJK A;  2NNU A;  5KHK A;  3H1K H;  4O4H A;  2CTQ A;  4MVO A;  1XMO O;  2H8P C;  3LSU A;  1YCI A;  5CA0 A;  1GN3 A;  4MT8 A;  2Q6A A;  2QA4 V;  1WNS A;  1L0N H;  2BOB C;  5LL6 Y;  3T1H B;  3RYH B;  4X66 O;  3IC7 A;  3BAB A;  1S77 D;  1CEZ A;  2BTQ B;  1YEW A;  2QM8 A;  1M9N A;  1XNQ O;  1KB9 F;  5IT9 N;  4OPA A;  1K33 A;  2ZXW C;  1TUE B;  2YEV A;  1RM1 B;  4DR3 B;  5B5E Z;  3G6B A;  4DK1 A;  1Q6H A;  4QGP A;  1H8E G;  1SS3 A;  2P67 A;  5JVD B;  4DR7 O;  1R3J C;  2UUB B;  4LF7 B;  4PDV A;  4FLV A;  1PPJ H;  3I55 V;  5IYZ B;  1XOU A;  3G6E V;  1EFR G;  2F95 B;  2DJV A;  1RSO B;  4EKW A;  1SES A;  2R9A A;  4J41 A;  2WLN A;  2UUC B;  4UVC A;  4UXN A;  5H9C A;  4FM0 A;  1XUQ A;  4DUZ O;  2RCV A;  4LP8 A;  4FM1 A;  1NU1 H;  4DRX A;  2JGU A;  4LCU C;  3HKE A;  5LHI A;  5LHH A;  1AB3 A;  2RJZ A;  4BIU A;  4PEL A;  2FTK A;  3B40 A;  3CJH B;  4FZ1 A;  5D5P A;  1K97 A;  2F1M A;  2ZDI C;  1NR7 A;  2ZDI A;  4PV1 B;  4GLX A;  4DV2 B;  2V4D A;  4RUF A;  1GMG A;  1HNZ O;  4P9P A;  2QWO B;  4UCR A;  4J9Z B;  3CXC U;  2X6A A;  4LF5 B;  4J7K A;  1GN4 A;  4K8Z A;  1K5Q A;  4AHC A;  4TV9 B;  5KMG A;  4I5S A;  4I4T B;  2IW5 A;  4CS4 A;  1BQZ A;  2Q7E A;  5GTH Z;  3FYE B;  3OGC C;  3ZX6 A;  1V54 C;  1AIL A;  2E74 B;  3P30 A;  4LR3 A;  2PZS A;  1TGO A;  4MVM A;  1WLE A;  2XAJ A;  1WJZ A;  1IUR A;  3QO5 A;  3H1I H;  1UFI A;  2PGG A;  4FFK A;  1WPX A;  2XAQ A;  3QVN A;  1VQP V;  1XEQ A;  2DYS B;  5BMV B;  3K58 A;  1PNL A;  4OXS A;  3K79 A;  3JAR A;  4PDL A;  3K0D A;  3WB0 A;  2XAH A;  1PL0 A;  4WFH A;  2AZ2 A;  4TV8 A;  5LHG A;  3STL C;  3CMA V;  5HFL A;  3CCQ V;  3TXS A;  4LF4 O;  4TWK A;  2DQ3 A;  3FD9 A;  5ITZ A;  5K1X A;  3LSS A;  1XNR B;  1VMG A;  2VWJ A;  1P84 F;  3LNM B;  2YXL A;  2GTS A;  2NLJ C;  4AI8 A;  4FLZ A;  3BEH A;  3OMN B;  5AG2 A;  1QHT A;  5FPR A;  4E2L A;  3QF7 A;  5J2T A;  5JCO A;  2CTP A;  3JAR B;  1FPO A;  4PJ0 Z;  3F5T A;  3K0G A;  4ABM A;  5IDJ A;  1NS1 A;  2IJI A;  2D2C B;  1KQS U;  1K92 A;  3G4S V;  4TV8 B;  3FB6 C;  3JAK B;  3JAT B;  5B1N A;  3JAW A;  2EUL A;  3N2G A;  1URF A;  1YIT V;  1F23 A;  4TT3 G;  2HKO A;  4MTF A;  2QEX V;  4X1I A;  3ETQ A;  4QIW F;  4BIO A;  1COW G;  1H2L A;  1BCC H;  1R3I C;  4P9O A;  5B1A C;  4DR1 O;  4JI1 B;  3SJB C;  3IFX A;  4L8J A;  3STZ C;  2HHH O;  2Q7H A;  5KAI Z;  2A79 B;  4X1K A;  1NI8 A;  3VQV A;  3ZHS A;  3GWK C;  2B1I A;  4LH7 A;  4FFB A;  4I0X B;  4MSW C;  1I7F A;  4GX1 A;  2JK5 C;  2WLI A;  3ZED A;  5CBG A;  1Y74 B;  5IJ9 A;  3ASO B;  2WLH A;  1XQ8 A;  5KUM A;  3AG2 C;  2Q73 A;  1BSM A;  1KYO F;  1Y67 A;  1HR0 B;  4LFC B;  3CXH F;  3MAQ A;  4YIP A;  2BCC H;  4QJF B;  3AEI A;  4RQE A;  1KC8 W;  4JAV A;  1O9H A;  1EZJ A;  1YTF B;  2XOK G;  5FL7 G;  1IBM O;  4LWS A;  1DF5 A;  3AG4 B;  4LFB B;  2WLK A;  2W6J G;  4DR4 O;  4R7C A;  3CRC A;  4NXN B;  4RO2 A;  3O65 A;  1V55 C;  4DV3 O;  1VQM V;  4X65 O;  1PV0 A;  3BHP A;  1KMI Z;  4B3M O;  2YI8 A;  4HZ3 A;  3IAY A;  3OTO B;  2HJF C;  3T4Z A;  2OIE A;  3N27 A;  2IM9 A;  5JJJ B;  1QLN A;  4JI8 O;  3MHS C;  4E4E A;  2YXH A;  1YJN V;  2E76 B;  5LP6 C;  5C8Y B;  4U7O A;  4N23 A;  2UUB O;  4I9Q A;  2K9P A;  5J2U A;  3TET A;  2Z3Y A;  4GCZ A;  4JAS A;  3F7V C;  1SA0 B;  2Y48 A;  4QNH B;  2ODM A;  2P4V A;  3CCR V;  2JIZ G;  1NZ6 A;  2H3O A;  3OD4 A;  3CCE V;  3CSX A;  2F66 C;  2JDI G;  2HR3 A;  2DYS C;  4HNA B;  1W2B U;  3FKS G;  4DW1 A;  3P3P A;  4X64 B;  1VIB A;  5EZY B;  2FL4 A;  3HKB B;  2EIJ B;  3L9D A;  3OFN G;  5KHJ A;  1K7D A;  3CHX A;  2ZKO A;  1YSC A;  2AHY A;  3H9V A;  2DWE C;  3D8C A;  1MAB G;  2YSU B;  5JQG B;  2XTA A;  4H44 B;  1JJ2 U;  5JJE B;  2WPD G;  4RAI A;  1QLE C;  1O9G A;  1W59 A;  4X88 A;  3OTF A;  2Z0A A;  2WSS G;  1FYJ A;  1JQ0 A;  4OX9 B;  1ZX3 A;  4X89 A;  5LP6 A;  3ZRW A;  4JI5 O;  3OM3 B;  1N4C A;  1RPO A;  2BTQ A;  5BY1 A;  2UXB B;  3C3T A;  3ZHV A;  4PI0 A;  4DUY B;  4O4J A;  3JSN A;  1EBO A;  1TUB B;  3QG5 A;  2BSK A;  2GUZ A;  4DV6 B;  2P06 A;  3K9S A;  4X65 B;  2B1G A;  1Q43 A;  4IL6 Z;  3A0H Z;  5EBM C;  3ZHR A;  5EYP B;  3P32 A;  5KLV H;  4DUY O;  1BT8 A;  3ZMU A;  4DR2 B;  3X2Q B;  2HEP A;  4LF5 O;  2QM4 A;  3LDC A;  3UM7 A;  2XAS A;  5FLX N;  1IVS A;  4ZHQ B;  3JAS B;  2PYJ A;  1J95 A;  4P30 A;  5IY5 C;  5IYB O;  4JI0 B;  4DO2 A;  1S5H C;  1NJI W;  2EX3 A;  5CN0 A;  1NTK H;  4JI0 O;  4DV0 B;  1SET A;  2JEX A;  5LMU O;  2EIK C;  1T5E A;  3DXR B;  3E83 A;  2CDY A;  1RP3 B;  2OCC B;  1MOF A;  5LGU A;  5KUK A;  1ROP A;  4I50 A;  3EXA A;  4MS2 A;  3AK2 A;  4DRX B;  4GT1 A;  3ZS8 C;  1P7B A;  4X1Y A;  3BA8 A;  2PYL A;  1D5A A;  3PJS K;  4Z2W A;  2R70 A;  4IHJ B;  4X64 O;  3HKC B;  4ZI7 B;  2QKA A;  3CRA A;  1IBK O;  3ABM C;  1M56 B;  4GX2 A;  1H2K A;  4UCU A;  4KFM A;  2GV9 A;  4EFB A;  3ML0 A;  4JYA B;  3WG7 C;  1NTZ H;  5KAF Z;  1PP9 H;  4QPK A;  1KEC A;  1DK1 A;  4HBN A;  1WAZ A;  4LF7 O;  1P49 A;  2OIG A;  5K1P A;  1Q8I A;  3ABK B;  1IDS A;  2P7T C;  2Y4T A;  4DV1 B;  4IHJ A;  2EBO A;  3RGB A;  2YIA A;  3I5D A;  5L3B A;  4PHZ A;  2C2A A;  3W7X A;  4FLU A;  5H6R A;  3W7S A;  2OWO A;  2QM7 A;  1YJW V;  3CEI A;  4JV5 O;  4NB5 A;  2LP7 A;  5BXZ A;  2WLJ A;  1V54 B;  1N36 B;  3ZHU A;  3SYO A;  4GKJ O;  2BE3 A;  2UXC O;  4J11 A;  1VQN V;  1OCO C;  2V1D A;  2Z5U A;  4MTO A;  4KUM A;  1S3J A;  1Q5O A;  4TV9 A;  3JD4 A;  1VQ7 V;  1F4M A;  4LF4 B;  5LMN B;  1TA8 A;  1WB7 A;  1WB8 A;  4X1K B;  4OX9 O;  3E8G A;  2ZE8 A;  2RMK B;  3H1J H;  2IH3 C;  2XAG A;  4WFE A;  4FFB B;  4CS2 A;  2WLL A;  1PD3 A;  4MW8 A;  1VQK V;  1WP8 A;  3VOU A;  1R1B A;  3NR7 A;  3H1H H;  4K0K O;  4DK0 A;  1E79 G;  3HB3 B;  1AJQ A;  4TUY B;  1CP9 A;  4GKK B;  1QR8 A;  1N32 O;  3EHB B;  4AQY B;  4NTY A;  5B66 Z;  4O4L A;  2PTM A;  3CRR A;  3MD0 A;  3OTO O;  4OGQ B;  1ZLZ A;  5CA1 A;  1S72 V;  1Y66 A;  3ABL C;  4LF8 B;  4KP4 A;  5D5Q A;  4G28 B;  1WP7 A;  2X6C A;  4DR4 B;  1YHQ V;  4Z1V A;  1Y76 B;  1VQ4 V;  2G38 A;  1AI6 A;  2EIL B;  4JPR A;  1Q90 D;  5JH7 B;  2UXB O;  2WA4 A;  3ABK C;  3CPW U;  2XUM A;  3AG3 C;  4YY3 O;  3JD1 A;  5H6Q A;  5CA1 B;  2L6L A;  4CC6 A;  1A32 A;  4IGG A;  1VQ6 V;  3UT5 B;  1GKF A;  4C7U A;  4PD4 F;  4MVU A;  5LOV A;  3R66 A;  3ZCC A;  1N0J A;  5IE9 A;  3U0Z A;  4K8X A;  1H38 A;  4GZR B;  2ATK C;  1AI5 A;  5BZB A;  3J81 N;  5CA0 B;  1ORQ C;  4O2B B;  2FML A;  1G1X B;  3F5W C;  3HKB A;  3K06 A;  5JCO C;  1ZL8 A;  1Q82 W;  2DOS A;  3RT3 C;  4UCO A;  1Y74 A;  5IJ9 B;  3G80 A;  1YVW A;  1YIJ V;  3RBZ A;  1OJH A;  2F93 B;  5EC2 C;  2DQ0 A;  4FVM A;  1UPG A;  4IYI A;  4JYC A;  1XL6 A;  5H2F Z;  2VQF O;  1LNQ A;  3VQW A;  3E8B A;  5L3G A;  2OTL V;  4YXW G;  2JVD A;  4UFZ A;  2DMX A;  1CXZ B;  1H2M A;  1KUQ A;  2EJ7 A;  2VQE O;  4B3R B;  2F43 G;  4NXN O;  2FYU H;  3K57 A;  1QBZ A;  2R9R B;  2LGQ A;  1BGY H;  1HNW O;  4DV7 B;  3ICX A;  4PDM A;  3WB1 A;  4O2A A;  3T2M A;  4LBE C;  4PA7 A;  1U97 A;  1BE3 H;  1FXK A;  1Q81 W;  3S3W A;  1GRJ A;  3QTC A;  3SYQ A;  2X0L A;  1SQV H;  2RDC A;  1FKA O;  4X62 O;  4B7E A;  3CC4 V;  4ICG A;  2QSA A;  1VF6 C;  4FJC C;  1U96 A;  1ARO P;  4UCS A;  1GM7 A;  3THO A;  4DR2 O;  3CCL V;  4TQD A;  4UB8 Z;  2ADQ B;  1XMQ B;  1NR1 A;  1N36 O;  4GX0 A;  1L0L H;  1SER A;  2Q69 A;  1R3K C;  1PL4 A;  3DXR A;  1M57 C;  1KKC A;  2Q68 A;  3UCS C;  1K4C C;  2F23 A;  2VQF B;  3ABU A;  4PDR A;  2F4V B;  1JA8 A;  2N74 A;  5FNV A;  5JVD A;  1WN7 A;  2LW1 A;  2LJ2 A;  5B1A B;  4YY3 B;  4DR1 B;  3D36 A;  5E79 Z;  1MSW D;  2QTS A;  4O4J B;  1NQT A;  4NVP A;  4JAA A;  5GON A;  4DR7 B;  4Q6G A;  5C93 A;  5LXT B;  2UXD O;  3RFR A;  4D7S A;  2Q67 A;  4L87 A;  2E75 B;  1FFX A;  5IYD O;  1K3E A;  1CPY A;  1JPX A;  4B3M B;  2JS3 A;  1M93 A;  4NYK A;  1H8H G;  1M57 B;  4YJ2 B;  3E22 A;  4DV3 B;  3GB7 C;  3JAL A;  2EIJ C;  1IBK B;  3OAA G;  4JI6 B;  4DR5 O;  5GON B;  2CH7 A;  3MDS A;  4ASU G;  4CC5 A;  2VWK A;  1RSO A;  3W7T A;  1TUB A;  3WFV A;  1SZT A;  5LGN A;  1FD9 A;  3OMI B;  4CZZ A;  2XAF A;  2CTW A;  4UV9 A;  3TGU H;  3SPC A;  4BW9 A;  1ZSP A;  1P7G A;  5EYP A;  5J2T B;  4F6E A;  4U3J A;  3FFQ A;  4GUN A;  1BZK A;  3JCU Z;  3BAA A;  1XBL A;  2ITC C;  2IBZ H;  4UCV A;  4X20 B;  3TCU A;  3EFF K;  5CB4 B;  3ABT A;  2AHZ A;  2LGW A;  1Q86 W;  2YEV B;  2P5O A;  1OCR B;  4WBN A;  1N32 B;  4JI2 O;  2ILM A;  4WFG A;  5E1A C;  4N21 A;  2YIB A;  4FPP A;  3TXQ A;  4BAY A;  3FB8 C;  4K35 A;  4JI7 B;  4EFE A;  4I4T A;  2Q0A A;  2AGA A;  4O4L B;  4K0K B;  3QNE A;  3HKC A;  4ZI7 A;  1XL4 A;  2ADP A;  2EZO A;  4I55 B;  3K5O A;  5L3F A;  1HNZ B;  2XT9 A;  1EZV H;  1QLE B;  4B08 A;  2M7W A;  2NR5 A;  3JCZ A;  2W6I G;  1R6T A;  2M6Y A;  1ZUQ A;  4EEQ A;  3CRQ A;  4FLX A;  5JH7 A;  1K8A W;  1KKD A;  1VQ9 V;  3OUF A;  1RPR A;  3E8F A;  1V9P A;  1JX9 A;  4LH6 A;  1GM8 A;  4DUZ B;  1K34 A;  4X66 B;  5LA6 B;  4LF9 B;  4DV4 O;  3DC5 A;  1S0V A;  3UQ8 A;  3CC7 V;  3N2G B;  3IJ4 A;  1OCC C;  2WLM A;  5B3S B;  1KP3 A;  4YJ3 A;  1B04 A;  3FYI B;  4X62 B;  2ZNJ A;  2EIK B;  4IYH A;  2UU9 B;  2ZIO A;  3A0B Z; 
#chains in the Genus database with same CATH homology
 4WFF A;  1AI4 A;  1TUE B;  4QPK A;  3E86 A;  1KEC A;  2YEV A;  1RM1 B;  1V55 B;  2A0L A;  3CME V;  3JYC A;  4WCE V;  1PNK A;  1YTF D;  2P90 A;  5B1O A;  3ABK B;  3K03 A;  5L3C A;  1K9M W;  1S76 D;  2QE7 G;  2P7T C;  2LFS A;  1H8E G;  3W7W A;  2P67 A;  2EBO A;  4WFB V;  3SPG A;  3RVZ A;  5L3B A;  1BHA A;  3W7X A;  2C2A A;  1R3J C;  4PDV A;  2EIM C;  5H6R A;  3W7S A;  3I55 V;  3I56 V;  1VQ9 V;  2A9H A;  1PNM A;  1NBM G;  1GTO A;  2QM7 A;  1YJW V;  3G6E V;  1EFR G;  2LP7 A;  3T4D A;  4JTC B;  3ZRX A;  4EKW A;  2WLJ A;  1V54 B;  3ZMT A;  1SES A;  5EK0 A;  1N8R W;  2IJH A;  1Y4M A;  1VQO V;  3SYO A;  2WLN A;  4GX5 A;  3TK1 A;  1VQN V;  4UVC A;  4UXN A;  1OCO C;  2EIL C;  2V1D A;  2R9I A;  2Z5U A;  4MTO A;  4MW3 A;  4KUM A;  5H9C A;  1S3J A;  2OT5 A;  4JGS A;  3JD4 A;  1VQ7 V;  1F4M A;  2ZR2 A;  4LP8 A;  2UXN A;  3LSQ A;  5CMU A;  1P4R A;  4LCU C;  3MHH C;  5LHI A;  5LHH A;  1Q7Y W;  4MVZ A;  4BIU A;  3E8G A;  4PEL A;  1K73 W;  2FTK A;  4QPJ A;  1VQL V;  3OR7 C;  1G8M A;  2IH3 C;  2XAG A;  3ZRS A;  1K97 A;  4JAU A;  4WFA V;  4WFE A;  2ZDI C;  1AJN A;  5B3S C;  2WLL A;  1PD3 A;  4MW8 A;  1NR7 A;  2ZDI A;  1VQK V;  3CYO A;  3VOU A;  2W0F C;  4RUF A;  4UVA A;  1GMG A;  4DXW A;  3CCU V;  4P9P A;  1FS0 G;  1DF4 A;  3SYA A;  3X2Q C;  3M99 B;  4J9Z B;  3B8M A;  3CXC U;  2X6A A;  3K9A A;  1E79 G;  3HB3 B;  1AJQ A;  4H37 A;  1BL8 A;  1K5Q A;  4JYB A;  1AJP A;  1CP9 A;  4I5S A;  1VQ5 V;  2DWD C;  1QR8 A;  4I9W A;  3EHB B;  4G2K A;  2IW5 A;  2ZQM A;  5L3D A;  3MD0 A;  4PA9 A;  3FYE B;  1S72 V;  1OZ0 A;  1Y66 A;  2IH1 C;  3A0R A;  3ABL C;  2EJR A;  1I5X A;  1OCZ B;  3OGC C;  4XDK A;  3K3W A;  1V54 C;  4KP4 A;  1NKD A;  4G28 B;  2X6C A;  1E1Q G;  3K08 A;  3P30 A;  1YHQ V;  4MVM A;  1WLE A;  2XND G;  1OCC B;  1DTO A;  1W0K G;  2XAJ A;  2WAM A;  3QO5 A;  3ASO C;  3AG1 B;  3ZN1 A;  1VQ4 V;  3CD6 V;  3SYC A;  1AI6 A;  4Q20 A;  1OCO B;  2EIL B;  4JPR A;  3ABK C;  1M56 C;  1WPX A;  1AR1 B;  2XAQ A;  3CPW U;  3ZMV A;  1VQP V;  3QO7 A;  2DYS B;  3AG3 C;  1PNL A;  4OXS A;  1KD1 W;  3K79 A;  1VQ8 V;  3JD1 A;  5H6Q A;  2BOC C;  4FK5 C;  5CBH A;  1HWY A;  4PDL A;  3K0D A;  2ZXW B;  4PA4 A;  1VQ6 V;  1ENV A;  4TSF G;  4F4L A;  3NXS A;  2XAH A;  1PL0 A;  4WFH A;  1GKF A;  5DM6 V;  5L3E A;  5LHG A;  1NH2 B;  3E2E A;  3CP1 A;  3STL C;  3CMA V;  5IY5 B;  5HFL A;  4FIP C;  3CCQ V;  4TWK A;  5KA5 A;  4MVU A;  2DQ3 A;  2GHY A;  3ZCC A;  3ETE A;  3F7Y C;  3LSS A;  3LNM B;  5J9P C;  4ZBM A;  2NLJ C;  5LBQ A;  1FXK B;  3BEH A;  3OMN B;  1H38 A;  3ASN B;  4E2L A;  5B1B B;  5BZB A;  2ATK C;  1AI5 A;  3JD3 A;  2PI5 A;  3K0G A;  1ZWI C;  1ORQ C;  1L1F A;  5IDJ A;  2IJI A;  1KQS U;  1OCZ C;  2V7Q G;  1K92 A;  3G4S V;  3ABM B;  3FB6 C;  2UXX A;  3F5W C;  3K06 A;  5B1N A;  3OW2 U;  1M90 W;  1YIT V;  1F23 A;  2H94 A;  5CBF A;  4TT3 G;  1Q82 W;  2HKO A;  3OMA B;  4QE9 A;  4MTF A;  2QEX V;  4QIW F;  1COW G;  4UUJ C;  3DTU B;  1R3I C;  4P9O A;  5B1A C;  3JD2 A;  3GWO A;  3ZMZ A;  1YIJ V;  3RBZ A;  5EC2 C;  2DQ0 A;  3IFX A;  2Y69 B;  2GSM B;  3STZ C;  3CCV V;  3CCS V;  3OEE G;  4JYC A;  1XL6 A;  2KB1 A;  2EIM B;  2A79 B;  1LNQ A;  3E8B A;  1NH2 D;  2PI4 A;  5DN6 G;  5L3G A;  2OTL V;  1PKX A;  4YXW G;  1B6Q A;  2B1I A;  3AG4 C;  3SPI A;  4CBC A;  1IXM A;  2F43 G;  1QVG U;  4MSW C;  3ZN0 A;  1QBZ A;  2R9R B;  3AG1 C;  4GX1 A;  1R6N A;  2JK5 C;  1BHB A;  2WLI A;  3OUS A;  3D3I A;  5CBG A;  4PDM A;  2HG5 C;  1FXH A;  3CCM V;  3ASO B;  2WLH A;  1UJW B;  1YI2 V;  1OCR C;  5KUM A;  3AG2 C;  4JTA B;  4LBE C;  3T2M A;  1I5Y A;  4PA7 A;  2EZP A;  3T1C A;  1R73 A;  1SRY A;  2EIN B;  1FXK A;  1KP2 A;  1Q81 W;  5GW7 A;  3SYQ A;  2X0L A;  3KG2 A;  2EIN C;  4QJF B;  3AEI A;  4RQE A;  3CC4 V;  2CK3 G;  3B77 A;  2Y69 C;  3SYP A;  1KC8 W;  4FJC C;  4JAV A;  1K4D C;  3HPL C;  1OHH G;  3QO8 A;  1ARO P;  4MTG A;  1GM7 A;  1DLB A;  1EZJ A;  1YTF B;  2XOK G;  2DW4 A;  3CCL V;  5FL7 G;  1DF5 A;  3AG4 B;  3SPH A;  1NVP D;  2WLK A;  1NVP B;  1NR1 A;  3OEH G;  2W6J G;  4XBF A;  4R7C A;  2HVJ C;  4RO2 A;  4GX0 A;  3OR6 C;  1SER A;  2Q69 A;  1R3K C;  1V55 C;  3B8N A;  1M57 C;  2Q68 A;  1VQM V;  1K4C C;  3ABU A;  4HZ3 A;  3FB7 C;  4PDR A;  2HJF C;  3T4Z A;  3R65 A;  1K5S A;  3G71 V;  4P2Z A;  1AI7 A;  1QLN A;  3MHS C;  5B1A B;  2ZD9 A;  1YJN V;  5HFM A;  1QCE A;  3D36 A;  2IJJ A;  4U7O A;  1MSW D;  4N23 A;  3VBB A;  2QTO A;  4HYO A;  1NQT A;  4UVB A;  4R50 A;  3TET A;  2Z3Y A;  5C93 A;  4GCZ A;  4JAS A;  3F7V C;  3W7U A;  4JF3 A;  2Y48 A;  3ZIA G;  4QNH B;  1FFT B;  5CA3 A;  2HFE C;  3CCR V;  2HLD G;  2Q67 A;  4L87 A;  2JIZ G;  2OCC C;  1RM1 C;  2B5U A;  3LDE A;  4MVS A;  5IYD O;  3IGA C;  1K3E A;  2JJ2 G;  2LFR A;  1CPY A;  1JPX A;  4JTD B;  3CCE V;  2K1E A;  4BW5 A;  3CCJ V;  3E89 A;  5B1B C;  3ETD A;  1H8H G;  1M57 B;  4H33 A;  4PA6 A;  4UV8 A;  2JDI G;  5EC1 C;  3ABL B;  2HR3 A;  1FXK C;  3GB7 C;  2DYS C;  5EBW C;  2EIJ C;  1W2B U;  3FKS G;  4MTX A;  3AG2 B;  3K04 A;  4J9Y B;  3ZMS A;  3OAA G;  2EIJ B;  1BMF G;  2HVK C;  3OFN G;  3SPJ A;  1K7D A;  2WLL B;  1YSC A;  2X7R B;  3OE7 G;  4ASU G;  2AHY A;  3JD0 A;  2DWE C;  3W7T A;  4QE7 A;  3DGE A;  1MAB G;  2YSU B;  1W0J G;  3WFV A;  1SZT A;  4FMT A;  1GM9 A;  1JJ2 U;  5LGN A;  3SJQ C;  4Z1M G;  3LUT B;  3OMI B;  2WPD G;  4RAI A;  4CZZ A;  1QLE C;  2XAF A;  3BY6 A;  2JEU A;  4UV9 A;  4X88 A;  1GO3 F;  3LDD A;  4ZKI A;  2WSS G;  5EBL C;  3SPC A;  1JQ0 A;  2JJ1 G;  4X89 A;  3ZRW A;  3E8H A;  4RQF A;  3OM3 B;  2DYR C;  2P6J A;  1F51 A;  1MG1 A;  1RPO A;  5KA6 A;  5IYC O;  2ITC C;  1JOY A;  1YJ9 V;  2D3O W;  2OTJ V;  1H2G A;  3TCU A;  5LGT A;  3EFF K;  1EBO A;  4XDJ A;  1M1K W;  3ABT A;  4MVQ A;  1R3L C;  2AHZ A;  1JCH A;  1Q86 W;  2ZR3 A;  2YEV B;  2IU0 A;  4XDL A;  3UKM A;  1OCR B;  2B1G A;  4RUE A;  4WFG A;  2X6B A;  5EBM C;  4X8A A;  5E1A C;  4N21 A;  4FPP A;  3P32 A;  3ZRV A;  4BAY A;  3FB8 C;  3ZRW B;  3ZMU A;  3CC2 V;  3H01 A;  1F4N A;  3X2Q B;  4HAM A;  1QR9 A;  3FB5 C;  2DYR B;  3RW0 A;  1THZ A;  3QNE A;  4WF9 V;  1FXV A;  1XL4 A;  3LDC A;  4BIZ A;  3UM7 A;  2EZO A;  2XAS A;  3E35 A;  5L3F A;  1J95 A;  4P30 A;  5IY5 C;  1JVM A;  2ITD C;  5IYB O;  4DO2 A;  1S5H C;  2IU3 A;  4G27 B;  1NJI W;  5CN0 A;  1QLE B;  2M7W A;  1SET A;  2JEX A;  4PA3 A;  3JCZ A;  2MK3 A;  2W6I G;  2WLI B;  2EIK C;  1GK9 A;  1QVF U;  2QKS A;  3E83 A;  2IJK A;  3WG7 B;  2NNU A;  4R6Z A;  3AG3 B;  2OCC B;  1MOF A;  1K8A W;  1KKD A;  5LGU A;  3ASN C;  1ROP A;  3OUF A;  5KUK A;  1RPR A;  4MVO A;  2H8P C;  3E8F A;  4MS2 A;  1JX9 A;  1G4Y B;  1GM8 A;  1P7B A;  4GT1 A;  1E1R G;  4MT8 A;  2Q6A A;  2QA4 V;  1K34 A;  3RVY A;  2BOB C;  3PJS K;  1R6K A;  4U7N A;  3ABM C;  3IC7 A;  1M56 B;  4GX2 A;  3ETG A;  3ZJZ A;  4KFM A;  1S0V A;  1S77 D;  1CEZ A;  2WWW A;  3CC7 V;  2QM8 A;  1OCC C;  2WLM A;  5B3S B;  1M9N A;  1KP3 A;  3FYI B;  4LC1 A;  3ML0 A;  2EIK B;  4R8C A;  4MVR A;  1K33 A;  3WG7 C;  2ZXW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...