1VQLV

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqlV00
3OW2U 1KQSU 3CPWU 1VQ6V 2QA4V 1W2BU 2QEXV 3CCMV 1K73W 1VQNV 1Q82W 1VQLV 1KD1W 3CCRV 1Q81W 3CCVV 1Q86W 1VQ7V 1VQMV 3CCSV 1YHQV 3CCLV 4WFBV 1VQ5V 1KC8W 1YJNV 1M90W 3CCUV 3I56V 1S72V 3CCEV 1VQPV 3CC7V 1JJ2U 3CC4V 3CXCU 1K9MW 3G6EV 1YJWV 1R73A 1VQOV 1N8RW 3CMAV 1VQ8V 4WF9V 3CCJV 1QVFU 2D3OW 1YITV 1VQKV 1QVGU 1K8AW 1NJIW 3G4SV 3CC2V 5DM6V 3G71V 3CMEV 4WFAV 1VQ4V 1VQ9V 2OTLV 1M1KW 2OTJV 1YJ9V 3I55V 1Q7YW 3CCQV 4WCEV 1YI2V 3CD6V 1YIJV
chains in the Genus database with same CATH superfamily
2CGOA 3UCSC 4I50B 2HR3A 2CDYA 3CCRV 1IDSA 3ZMSA 5CA0B 4LF8B 1HNWO 1S72V 1RP3B 4J9YB 5IDJA 5GONB 3IC9A 4LF5O 4DR3B 4F6RA 1GMGA 4X62B 4E2LA 2QDOA 4DV3O 4O4HB 4K8XA 2UUCO 1GN3A 2CTWA 4JAUA 1FAFA 2VQFB 2IJKA 4JI4O 1VQ7V 1OHHG 2ZR2A 2Q67A 2Q6AA 4D6TH 4EFBA 5CBGA 4FM2A 3ZMUA 2P6JA 3F5TA 1HNXB 1DGSA 4B08A 1N0JA 1V54C 3L75H 3T4ZA 2OTJV 3N27A 3QO5A 2P06A 3BY6A 1M56B 1S5HC 5EBWC 1Q43A 1HDJA 5AG2A 3T1CA 2UXBO 1AVMA 1WA8A 5H9CA 5J2UA 1M5IA 3DSQA 4KFMA 4UFZA 4Z1MG 2Q0AA 1RPOA 4LFCB 4JYAB 2EILC 2ZE6A 4HZ3A 5K1XA 2LQTA 3PJSK 1GM8A 5E79Z 2PI5A 4WCEV 1HP8A 3R66A 2FTKA 2CUGA 4MVRA 3ZHVA 3WB1A 1K4DC 3DGEA 3I56V 4O4LA 5IT9N 4DR1B 4B7EA 3ABKC 3LSUA 1QR9A 3CB2A 5A9GA 1OCZB 2PZSA 3JALB 2HEPA 5LMUO 1ZAUA 4YIOA 1Y76B 2GUZB 1GKFA 1L0NH 1XL6A 1Z5VA 1M93A 3AG7A 3K06A 2FKXA 1VQMV 2DYSC 2EIJC 3K58A 1PL0A 4D7TA 5B1OA 3E83A 4FFBB 1BT8A 5CB4B 1B3QA 1KKCA 5IY5B 4Q20A 5FPOA 1VQ4V 4L8JA 4ZI7A 5BY1A 1UJWB 1FFXB 4JI8B 4MVSA 1YCIA 1Q81W 4GCZA 2F1MA 4R8CA 3RVZA 4JI1B 4F4LA 3ABMC 2XTAA 1WN7A 4E4EA 1M4UA 4JI6O 3QVNA 3HPLC 3E22A 1YJ9V 1M57B 2P4KA 1ENVA 4DUZO 5LGNA 2YXLA 5B1BC 4R50A 2QKSA 3L73H 5LOVA 3K03A 2Q7HA 1JCHA 3UM7A 4P2ZA 1XDCA 1XNRO 2K9PA 3VQVA 2GTSA 5LMNO 4MVQA 5FLXN 2EJ7A 3VBBA 1JPXA 4DV1O 1KP2A 3BA9A 1S5LZ 3CD6V 5EC2C 1S3JA 1V9PA 4PA4A 4CS4A 5H6QA 1N0NA 4DV2B 4IIJA 4NTWA 1J5EB 2ADQB 3GB7C 4IHJB 5JCOA 1IBMB 2OCCB 1VF6A 1NH2B 2WLNA 4DV0O 1BSMA 2AZ2A 2KSDA 2LW7A 1SQFA 4DR6O 2QWQB 2ZKOA 2CE4A 3D3QA 4UUJC 5EBLC 2HFEC 4HAMA 1XOUA 3RYFB 3G67A 5E1AC 1YJWV 2EX3A 3ASOB 4DV7O 4YY3O 4B3TB 1IURA 2YIBA 4JI2B 1YIJV 1K7DA 4FLTA 2XAHA 4UCRA 2B1GA 4J7JA 1N32B 4X1KA 1JMKC 2JJ1G 5J2TA 1K34A 1K97A 4XDLA 4YJ3B 2N04A 3DC6A 5JH7A 1KECA 3G6EV 1FKAO 3N2GA 4X1IA 4FZ1A 2D3OW 1S77D 3G4SV 2LGWA 1PNMA 3STZC 1PV0A 4UB6Z 1P4RA 3ETGA 2BOBC 2WLKA 3MDSA 1IXBA 4OPAA 3OE7G 2JEXA 4J80A 4LBEC 5BZBA 4X20B 1ZL8B 4FLYA 3WFVA 5LP6B 4BIUA 1Y6XA 2HJDA 2Y4UA 1MNGA 4DR4O 4N23A 3JARB 3ZN0A 4X66B 3FB5C 4JV5B 1G4YB 2E5LB 4JAAA 4JGSA 4YJ2A 3T1HO 5BR8B 2ZNJA 3STLC 5L3DA 1VARA 2IJHA 3E86A 5B5EZ 3RW0A 1UPGA 4U3JB 2EIKB 2RN9A 3RYHB 3FKSG 3HKCB 4FIPC 5B1AB 1N36O 1IVSA 2RCVA 4OX9B 4LF9B 4TSFG 2W6JG 5KHHA 2FL4A 5KHGA 4X1YA 3MHSC 3T1YB 2WLHA 5B3SC 1G6UA 3BABA 4NXNO 4WFGA 4I50A 2Q5ZA 3J81N 1XMQO 5KUMA 4P9PA 4R7CA 1BMFG 3J80N 2RNBA 4K0KO 3LDCA 4L87A 5L3GA 4U7NA 1SQXH 5GONA 1V55B 1YJNV 1HNZO 1PNKA 3QTCA 1KKDA 2Q9LA 2DJVA 4IYIA 4O4HA 5FNVA 1AI6A 1H8HG 2QWPB 3GWKC 5BXZA 2ADPA 3QF7A 3UO3A 2IJJA 2OTLV 4KHPB 2LFRA 2NLJC 1EN4A 5CA3A 2OWOA 1WAZA 3ASNB 1TAEA 4TWKA 1L0LH 3JAWB 4UVCA 1HNWB 2XASA 1OCRB 3MHHC 1NZ6A 5B1NA 4LF5B 2PYLA 2EZOA 1S76D 1LUVA 4N21A 3OTFA 5JWPA 4BR6A 2ZE5A 4GKKO 4I7ZB 3WB0A 2H3OA 3A8TA 2EINC 4DV4B 4NVPA 2KG7B 2EBOA 3ZRVA 4LFAO 4KL1A 1NTZH 1AP5A 1PPJH 2JEUA 3K3WA 1IBLB 2CTPA 1MSWD 2QWOB 1S5JA 3VQWA 2NR5A 1GK9A 2YDEA 1EN5A 3QG5A 1PKXA 4R6ZA 5IYDO 1OZ0A 1YZBA 2UXBB 3CHXA 3JALA 3SPJA 2ILMA 1Y76A 5A2QN 3JD2A 3K04A 2GUZA 3OMIB 2YSUB 4W4LA 4GT1A 3W7UA 4MS2A 3CRRA 4I4TA 4P30A 2PYJA 3ABUA 3OR7C 3JCZA 3H9VA 2ZR3A 2F93B 4FFBA 3B2EE 5CB4A 3SPHA 4B3RO 3A2FA 4AILC 3JCUZ 3WG7C 1GO3F 1FFXA 2Q7GA 1VQKV 1KBHA 1MZFA 1S0VA 2R70A 2QM8A 2A3QA 4TT3G 4NR1A 4I9WA 4ZBMA 4MVMA 1VEWA 3OTOO 4AQYB 3CEIA 5JVDA 2RJZA 2HHHO 3OUFA 4MVOA 2QM7A 5HFLA 3QO7A 2X6CA 3MAQA 3RYIB 4JTCB 3ZEDA 2ZXWC 4EB6A 3CMAV 1I94O 1QBZA 1I0HA 4JI0O 1R3KC 2AHZA 5CA1B 1JFFB 4G27B 1A32A 4X65O 4WFFA 5KUKA 1EN6A 3E8GA 3LDDA 1IBKO 2CH7B 3CCVV 4NB5A 4JYYA 2JS5A 1EZJA 4LH7A 1MMMA 1NI8A 3SYQA 1SETA 2ETNA 2AZ0A 3D36A 4MW3A 1R3IC 2QE7G 4JI6B 1M1KW 1T5EA 3ZCCA 4LP8A 4GX5A 3G80A 4O2AB 4IHJA 4DK1A 4DUZB 1ZLZA 1KD1W 1N33O 1AI5A 3FAVB 4ASUG 2W0XA 1H2LA 2A0LA 2PTMA 3ZIAG 3K5LA 1XNRB 1AJPA 2FMLA 5LMNB 1AI4A 1BL8A 1D5AA 1OV9A 4JI7O 1V54B 5DM6V 3FB8C 4RQEA 1TA8A 4DV1B 4IL6Z 3TXQA 1HR0B 2XUMA 5KHIA 4TQDA 3CXHF 4DK0A 3RYFA 3LSQA 1Q82W 1Q86W 1ORQC 1SQVH 1WLEA 2Y69C 4ABMA 2P5OA 3CCEV 3SPGA 4FLUA 1R1BA 3OEHG 2ZM6O 3RWRD 4DR5O 4DV0B 3I5DA 2EILB 2QM4A 1Y66A 2L35A 5LL6Y 4LH6A 3JD4A 1K9MW 1H2KA 4PELA 4AI8A 3MD0A 1BQZA 1YSCA 4U7OA 3E8BA 4JI5O 5ITZA 3ABTA 3JATB 4YY3B 2BTQB 3ABKB 4FK5C 4IT5A 1OCOC 4X20A 1US6A 1ZL8A 2KQXA 2B1IA 3DXRB 5LP6A 3JAKB 4YHHB 1YTFD 2ZQMA 2DQ0A 5LA6A 4H44B 2IM9A 3ZBHA 3THOA 2DYSB 2EIJB 4AHCA 1E79G 1FYJA 1XNQB 3QO8A 2Z0AA 1K8AW 2A9HA 4FLVA 2UXXA 2KKWA 3IFXA 4MTGA 3E89A 4W4KA 4U3JA 3RYHA 3HKCA 3L72H 2G38A 2L6LA 3ZRWB 4DW1A 1IXMA 2WLJA 3GWOA 5FPRA 2VWJA 1H8EG 1XILA 1XBLA 2Y0IA 5HFMA 3ZHRA 1AR5A 1F23A 3ABMB 2Q7EA 2HP8A 3E8HA 1D5NA 3ZHSA 5IE9A 3ETQA 2JGDA 2QTSA 4LF4B 5LHGA 4NTYA 3T1HB 3CCMV 2W0FC 2QSAA 5KX5B 1QHTA 1FPOA 2UUBO 5B1BB 4UV9A 1XHZA 1N36B 4P9OA 2X6BA 2WWWA 3ZRXA 2A79B 1ZWIC 4CS3A 1PM9A 4NXNB 2Z5UA 3AG2C 3JAWA 4XDJA 3OW2U 5K1PA 3CPWU 3BRCA 1QLNA 4NKGB 2WLLB 1WPBA 4I55B 4K0KB 3FX7A 1XQ8A 4WFEA 4DR2O 3E8FA 5JJEB 5D5PA 1YXBA 3ETDA 3CJHB 4JPRA 1JJ2U 5LBQA 2JS3A 5IYBO 3FB7C 1SERA 4I0XB 2A7WA 3SR2C 5KA6A 2F66C 4UCSA 4LF6O 2FYUH 1Q8IA 1K33A 5LHHA 2XAJA 3FYEB 3ZX6A 4C7UA 3BHPA 2ZE7A 4X88A 2KG7A 2H94A 1CP9A 1AI7A 1K92A 4J42A 4CH6A 1VQPV 3HKEB 1KMIZ 2F95B 3VQXA 4PV1B 3VQYA 2XAGA 1Y67A 1P7BA 2F4VB 1K5QA 1JX9A 1KQSU 4TOIA 4WFHA 4I5SA 4RUEA 4TV8B 2Q68A 2QWRB 2N74A 1QQCA 2E76B 3NXSA 4TV9B 4J9ZB 2Z3YA 2YIBD 4LFAB 1TVKA 2JK5C 4DXWA 2OCHA 2WAMA 1SKVA 4RWUA 3SYPA 3AG3C 3FYIB 3OFNG 4LF7O 1GRJA 3HKDB 4GKJO 3FB6C 3JD0A 4UCTA 3CRMA 1RSOB 2IJIA 1FXHA 2XNDG 2E75B 3KCYA 5EBMC 1N8RW 4GZRB 4K8ZA 1MOFA 4YXWG 1NS1A 1QNMA 3AK1A 1U96A 4J41A 2WA4A 3IC7A 1H2GA 4NXMO 4PA9A 3RYIA 3EFFK 5EIBD 1VMGA 4JI3B 1SS3A 2GTAA 2HLDG 4B3RB 1QLEB 4FFKA 3ZN1A 5B66Z 5CA1A 2UU9O 1VP7A 1EFRG 1JFFA 1MG1A 5IWAO 2CH7A 5B3SB 1WB8A 2DOSA 5LYJB 2YEVB 3OTOB 3K5MA 2YC0A 2R72A 3VOUA 3OM3B 2RQ6A 2CAZC 3EXAA 2V4DA 4DR3O 3CWBH 2MK3A 4O2AA 4FVMA 1NU1H 4JI0B 4BW9A 1P49A 1SQGA 2DN9A 3FAVA 2ZCEA 1ZTEA 4JZ2A 4X65B 2IH1C 4BAYA 4UVAA 2VQFO 4KXRA 1IBKB 3BA8A 1R6KA 4D7SA 4O2BA 1SA0B 1F4MA 1I08A 3CCJV 2ZDIC 1NJIW 4JYBA 1NVPD 2GBOA 4J11A 1BCCH 3ETEA 2CTQA 1SQPH 1SQQH 3H1IH 5L3EA 2XAQA 3OGIB 2JVDA 3D8CA 1H38A 1GM7A 1VF7A 5H5NA 5GTIZ 1QLEC 3UT5B 4PHZA 3OAAG 4JYAO 2EINB 2K1EA 4QE9A 1DF5A 2N05A 2ZINA 2P7TC 3TXSA 1RFYA 4B3MB 4WFAV 3HB3B 4LFBB 5L3BA 3ZMTA 2QEXV 2OIEA 5CA0A 2V1DA 1SESA 1BHAA 2YXYA 3KKYA 3AG1C 3JATA 2JRIA 4OGQB 2BTQA 4LR3A 3T4DA 4QJFB 2ZM6B 3DXRA 1AJQA 3JAKA 2QKAA 3R65A 3GVMA 1W0KG 1FXKC 3JYCA 2Y4TA 1XREA 1YVWA 4GUNA 2NNUA 4PA3A 1NKDA 3F5WC 1NT2B 2XT9A 1JA8A 1VF5B 3SYCA 1XUQA 1WPXA 4JI5B 3K57A 3SYAA 4FMTA 3P3PA 3WG7B 3O9OA 3ZRWA 5D5QA 1YTFB 4JI8O 4BIZA 4DV3B 3OMNB 2UUCB 3B40A 4HYOA 1NQTA 3CP1A 4GX0A 3OEEG 1Q3EA 1Q90D 3HKBB 2P90A 1KYOF 3C3SA 1I5YA 4JI4B 2VQEO 2HKOA 4WBNB 3H1JH 5DEDA 4ZOLB 2ZXWB 5KX5A 3IAYA 2JDIG 3TCUA 4EEQA 1NTMH 2PUSA 2EIMC 4KP4A 5DECA 5KHKA 3BCCH 3RGBA 1XEQA 4CC5A 1J95A 3LDEA 1R73A 1VQOV 1N34O 2AXTZ 1Z5WA 2WLLA 3OD4A 4I55A 2PI4A 4DW0A 3W7TA 3CJHA 5JQGB 4DV2O 3ZJZA 1J5EO 2A06H 3RYCB 3BEHA 2UUBB 4OXSA 1KC8W 4I0XA 3RBZA 3X2QC 1AROP 2YUAA 1IX9A 1ZUQA 1W59A 4NTXA 5TISZ 3A0RA 3KCXA 1P7GA 5LMUB 2PF4E 4LCUC 1NH2D 4FZ0A 1K73W 2LGQA 2B5UA 3HKEA 5IYZB 4DR2B 3SJQC 2Y69B 4FM1A 2PY5A 3EVKA 3IJ4A 4FLWA 5IJ9B 3ABLC 1NR1A 1Q5OA 4TV8A 1N32O 3KG2A 2JJ2G 4DR7O 4TV9A 4IGGA 3HR0A 3ZMZA 2BCCH 3B8MA 1XL4A 1BE3H 5EYPB 2H8PC 3E35A 2OT5A 4PA7A 3QNEA 4QE7A 3APQA 2LO1A 1XMOO 5KMGB 1I5XA 1VQ9V 4XDKA 3HKDA 4Z1VA 3JSNA 1OCOB 1XI1A 2YXHA 1RSOA 5H6RA 2ZT9B 1R6NA 2DW4A 3OGCC 2ATKC 2UXCO 4WFBV 3C3TA 2Q69A 1M90W 5IYCO 1SZTA 1DF4A 3AG4C 4B3SO 5C8YB 4H0LB 4EKWA 2P22C 1Q6UA 1MSDA 2LJ2A 1AP6A 2E5LO 3K5NA 2LFSA 3SJAC 5BR8O 1EZVH 1SF9A 3P32A 4GKJB 4LF9O 1ROPA 3T1YO 5CBHA 4QPJA 4YIPA 5LYJA 4BIOA 5JCOC 2YEVA 4ZKIA 1VF6C 4RAIA 1TUBB 3N2KB 1D2DA 1KU9A 3E2EA 2QGNA 4DR6B 4YJ3A 4JASA 3H1LH 1GAXA 2UUAO 5IJ0B 4NXMB 5F2VO 3B4SA 2DWDC 5DN6G 5C93A 3CC7V 2DYRC 3TETA 1DK1A 2DMXA 1BS3A 3K9AA 4KHPO 4DV7B 3CMEV 1OCCC 1RPRA 2HJFC 1B6QA 4X1YB 1YEWA 3AG2B 4DV5O 1COWG 3L70H 2GV9A 1SA0A 4JTDB 1BQ0A 2QTOA 3FD9A 3U0ZA 3JARA 4J7ZA 1H2SB 4GYCB 4MVUA 5FL7G 3T2MA 1WB7A 3RVYA 2RDCA 1SQBH 4MTFA 2IW5A 2LW1A 5FNVB 2YS8A 3BAAA 5L3CA 4G28B 3UT5A 2Q8VA 2QR4A 2DWEC 1CEZA 4DV4O 1GN6A 1FFTB 2W6IG 1NVPB 1G1XB 2M6YA 3L74H 4UCOA 1PD3A 5EZYB 3B8NA 1QR8A 4ZHQB 1IBLO 4DR4B 5EIBC 3B09A 2UXDO 5EC1C 3B77A 4LNUB 4G2KA 1FD9A 3BPZA 1SC5B 3LNNA 2AW9A 2EJRA 3ZS8C 1NBMG 1RM1C 2WSSG 4PDVA 3ZMVA 4CH5A 2C2AA 5J9PC 4PDRA 2NN4A 2Q4PA 2F43G 3RFRA 3ICXA 3K9SA 1XMQB 1W2BU 2EULA 3W7SA 4HNAB 4O4JB 3AG3B 1OJHA 2ZE8A 3EHBB 3K79A 4TUYB 5KAIZ 2WLIB 2BSKB 1HNZB 3ZRSA 4NYKA 4OPHA 4DRXB 3CYOA 3Q4HB 1G8MA 4PDLA 5JJJB 3CRAA 3HKBA 4PD4F 4AQYO 2ZD9A 4QNHB 1JQ0A 2X6AA 4WBNA 2QA4V 3SJBC 2Q0OC 4ZOLA 3TGUH 4I4TB 1FXVA 3M99B 2E74B 1HW7A 1Y4MA 1WP7A 1GTOA 1KUQA 1P84F 2WPDG 1CXZB 1JOYA 1QVGU 1L8DA 5IWAB 4B7KA 2HVJC 1M56C 2IBZH 4O4IB 3I55V 1VIBA 1JR9A 3S3XA 2GHYA 5LXTB 1URFA 3CCSV 4GKKB 4DUYO 3OT7A 4CH4A 1B06A 4LC1A 5JVDB 2VQEB 3K0DA 4GX2A 1UFIA 3G6BA 1FJGO 4EFEA 1DLBA 1WJZA 4MVZA 4UXNA 5CBFA 3M7MX 5JQGA 2IU3A 4A5UB 2GDSA 4EB6B 1AILA 3UKMA 3RYCA 1MABG 2BE3A 3BVOA 3DTUB 1KB9F 4H33A 3ZHTA 5GTHZ 4H13B 1M9NA 3TJTA 4DV6O 3CE2A 3AEIA 3K08A 1OCZC 1AR4A 4JTAB 3SGIA 2DE0X 1N34B 1HR0O 1Z2GA 5IYZA 2XAFA 1Q7YW 4DYLA 1F51A 1Y74B 3CSXA 4X64O 3CS5A 5BMVB 5IJ9A 1SZXA 5IY5C 3C90A 2PGGA 4MTXA 2D2CB 4J7KA 1YI2V 2LP7A 5EYPA 1YDXA 4UCUA 4FJCC 1PP9H 4CH3A 2XOKG 2HHHB 2YI8A 2IU0A 2B9ZA 3CX5F 4LF8O 5KMGA 3AG1B 3JASB 3D3IA 1LNQA 1WNSA 3F7YC 1I94B 4UCVA 4X62O 4FM0A 4LWSB 1SRYA 2HVKC 1M57C 2VRZA 1VQ5V 1R6TA 1K5SA 1FXKB 4YHHO 1L1FA 4DR7B 2ARHA 3M8AA 1K3EA 5C8YA 4XBFA 1HNXO 2Y0PA 1XNQO 4QIWF 4X89A 3DC5A 1XMOB 3OUSA 1QCEA 1GN2A 3D36C 5ITZB 3OR6C 4RO2A 5LHIA 2WLMA 5KLVH 2F23A 4F6RB 4JZGA 2ITCC 2CTRA 1YF2A 2P67A 3JD3A 2M7WA 4UB8Z 3J7AU 3SPIA 1N33B 2UXCB 2MW2B 2OCCC 3BFRA 3CCUV 5H2FZ 2BTOA 1TUBA 3N2KA 5LA6B 2HG5C 4LFCO 4B3SB 1U97A 3H1HH 4MTOA 3AK3A 4MT8A 4JI7B 3K5OA 5IJ0A 4LF4O 3JD1A 4QGPA 2ODMA 1F4NA 1VQLV 2EIMB 3ASOC 4DR1O 4CZZA 1O9GA 2O57A 3P30A 1BGYH 1WA8B 2X0LA 5J2UB 4DR5B 1BHBA 1TUEB 1HWYA 2P4VA 4Z2WA 2X7RB 4H37A 3AK2A 1R3LC 4CC6A 2UUAB 2JGDB 2EZPA 1LUWA 4JAVA 4MW8A 4FPPA 2ITDC 2JGUA 3TK1A 2R9IA 2DQ3A 1GM9A 4JF3A 3X2QB 1VQ8V 1FS0G 4JYCA 4TQFA 4X9QA 2IH3C 4O4LB 1Q6IA 1E1QG 2AHYA 3UQ8A 3O65A 4DV5B 4UV8A 3WU2Z 2YIDA 5LP6C 1JVMA 5EZYA 1JJOA 4ZHQA 4JI1O 4LNUA 1ZX3A 5CMUA 2F4VO 3G71V 4QPKA 2ZNIA 1E1RG 3ABLB 4F6EA 1GN4A 2KB1A 4MSWC 1PL4A 2Y48A 2EIKC 4ZI7B 3A0HZ 5B1AC 4PDMA 3CCLV 5KAFZ 4PI2A 2OYQA 1BZKA 3RT3C 4ICGA 1QVFU 1YITV 1CPYA 3U11A 1KP3A 4HNAA 1O9HA 2UXDB 4O4JA 4K3AA 1EM1A 1EBOA 3JAMN 4TUYA 2WLIA 2BSKA 2E3CA 3E22B 4DRXA 1V55C 2ZIMA 3SPCA 3PN1A 3L71H 3Q4HA 4UVBA 2WA3A 1X59A 1IBMO 2UXNA 2Q73A 3CC4V 3H1KH 2GSMB 5LOVB 3AG4B 3KZIZ 3P3NA 4GLXA 1DTOA 2YICA 1TVKB 2V7QG 3ASNC 2VWKA 2AGAA 3H01A 3WB2A 4JI3O 1WP8A 3LNMB 1OCRC 1AR1B 1IZ3A 4O4IA 4DO2A 3CXCU 4PI0A 2YI9A 4IIJB 3JSLA 1W0JG 3LSSA 4B3TO 4CBCA 5CN0A 4JI2O 5KHJA 4RUFA 5LXTA 4LF6B 3ZHQA 1F7YA 2ZIOA 4CS2A 3IGAC 1YHQV 1R3JC 4PJ0Z 5LGUA 2QKCA 1Q6HA 2VS0A 1QU7A 4Q6GA 4K35A 1N4CA 2DYRB 3APOA 4I9QA 1XHXA 4ZIBA 3ML0A 4RQFA 1OCCB 3OMAB 1LR1A 3LUTB 1VQ6V 3ZHUA 1I7FA 2R9AA 5L3FA 2R9RB 4X8AA 5EK0A 1X4TA 4DUYB 4X1KB 2ZDIA 1PNLA 5J2TB 1MA1A 1FJGB 2CK3G 4WF9V 5JJNB 1Y74A 3K59A 4BWAA 4X66O 1H2NA 3CC2V 4JV5O 5JH7B 1AB3A 3L9DA 4KUMA 5KA5A 4GX1A 5BMVA 3N2GB 4X1IB 1K4CC 3A0BZ 1VQNV 5LGTA 3FFQA 3RN4A 3F7VC 4LF7B 3SYOA 4DV6B 4OX9O 1TGOA 3CRCA 1ZSPA 4B3MO 4O2BB 3U10A 2YIAA 1NTKH 2CGNA 2RMKB 3CRQA 4LFBO 3S3WA 1MZEA 4J10A 3SJCC 3W7XA 2JIZG 4X64B 3JASA 3NR7A 1NR7A 4YJ2B 4FLZA 1GH6A 5GW7A 2BOCC 3UO2A 4LWSA 3K0GA 4IYHA 2OIGA 1THZA 3W7WA 1RM1B 2UU9B 2QJ1A 2XHBA 4FLXA 1AJNA 1FXKA 2FB5A 1B04A 1H2MA 4BW5A 3SDLA 4HBNA 3CCQV 2QWNB 4PA6A 4U3FH
chains in the Genus database with same CATH topology
3OR7C 5L3EA 3JCZA 2XAQA 2ZR3A 2HR3A 1H38A 3CCRV 1GM7A 2GHYA 3SPHA 3CCSV 1QLEC 3ZMSA 4LC1A 3K0DA 4GX2A 1S72V 3OAAG 2EINB 4J9YB 3WG7C 1GO3F 1DLBA 2K1EA 4QE9A 1DF5A 5IDJA 1VQKV 4MVZA 4UXNA 5CBFA 1S0VA 1GMGA 2P7TC 4E2LA 2QM8A 2IU3A 4TT3G 4I9WA 4ZBMA 4MVMA 4WFAV 3UKMA 3HB3B 1MABG 5L3BA 3DTUB 4JAUA 4H33A 3ZMTA 2QEXV 2V1DA 1SESA 1BHAA 3OUFA 4MVOA 2IJKA 1M9NA 1VQ7V 1OHHG 2QM7A 2Q67A 2Q6AA 2ZR2A 3AG1C 3QO7A 5HFLA 5CBGA 3ZMUA 2P6JA 2X6CA 3AEIA 1V54C 3K08A 1OCZC 4JTCB 3T4DA 2ZXWC 3CMAV 4QJFB 4JTAB 1QBZA 3T4ZA 1AJQA 3R65A 1R3KC 2OTJV 1W0KG 2AHZA 3QO5A 1FXKC 3JYCA 3BY6A 1Q7YW 2XAFA 1M56B 1S5HC 5EBWC 4G27B 1F51A 4WFFA 2NNUA 5KUKA 4PA3A 3E8GA 3LDDA 3T1CA 1NKDA 3F5WC 3CCVV 5H9CA 1EZJA 4KFMA 3SYCA 1WPXA 3SYQA 4Z1MG 1SETA 5IY5C 1RPOA 3D36A 4MW3A 3SYAA 2EILC 1R3IC 4FMTA 4HZ3A 3WG7B 3ZRWA 2QE7G 1YTFB 3PJSK 1M1KW 1GM8A 4MTXA 4BIZA 3ZCCA 2PI5A 4WCEV 3OMNB 1YI2V 4HYOA 4LP8A 4GX5A 2LP7A 1NQTA 3CP1A 4GX0A 2FTKA 4FJCC 3OEEG 1KD1W 2P90A 2XOKG 1AI5A 2IU0A 4ASUG 1I5YA 2A0LA 3ZIAG 2HKOA 4MVRA 1K4DC 3DGEA 3I56V 3AG1B 1AJPA 1AI4A 1BL8A 3ABKC 3D3IA 1LNQA 3F7YC 1QR9A 1V54B 1OCZB 2ZXWB 5DM6V 3FB8C 1SRYA 4RQEA 2JDIG 2HVKC 1M57C 3TCUA 1VQ5V 1K5SA 1FXKB 1GKFA 4KP4A 1XL6A 2EIMC 3LSQA 1Q82W 1L1FA 3K06A 1Q86W 1ORQC 1VQMV 2DYSC 2EIJC 2Y69C 1WLEA 1K3EA 4XBFA 1J95A 1PL0A 3CCEV 3SPGA 4QIWF 5B1OA 3LDEA 3E83A 4X89A 1R73A 3OEHG 1VQOV 3OUSA 5IY5B 1QCEA 4Q20A 2EILB 1VQ4V 2WLLA 3OR6C 1Y66A 4RO2A 2PI4A 1UJWB 3JD4A 1K9MW 4MVSA 5LHIA 2WLMA 4PELA 3W7TA 3MD0A 2ITCC 2P67A 3JD3A 2M7WA 3ZJZA 1Q81W 1YSCA 4GCZA 4U7OA 3SPIA 4R8CA 3E8BA 3BEHA 4OXSA 1KC8W 3RVZA 3RBZA 2OCCC 3CCUV 3X2QC 1AROP 4F4LA 3ABMC 2HG5C 3ABTA 4MTOA 3ABKB 4MT8A 3HPLC 4FK5C 1YJ9V 1OCOC 3A0RA 3JD1A 4LCUC 2B1IA 1NH2D 1M57B 1ENVA 1F4NA 1K73W 5LGNA 2B5UA 1VQLV 1YTFD 5B1BC 4R50A 2QKSA 2ZQMA 2DQ0A 2EIMB 3K03A 3UM7A 1JCHA 4P2ZA 2DYSB 2EIJB 3SJQC 2Y69B 3ASOC 1E79G 4CZZA 4MVQA 3QO8A 3P30A 2X0LA 1K8AW 2A9HA 3ABLC 3VBBA 1BHBA 2UXXA 1JPXA 1NR1A 3IFXA 4MTGA 1KP2A 1TUEB 3E89A 3CD6V 1HWYA 5EC2C 3KG2A 2JJ2G 1S3JA 2X7RB 3ZRWB 4H37A 4PA4A 1IXMA 1R3LC 2WLJA 3GWOA 5H6QA 2EZPA 3ZMZA 4JAVA 4MW8A 1H8EG 1XL4A 3B8MA 4FPPA 2ITDC 2H8PC 3GB7C 3TK1A 3E35A 2R9IA 2OT5A 4PA7A 2DQ3A 5HFMA 1GM9A 4JF3A 2OCCB 3QNEA 3X2QB 4QE7A 1VQ8V 1FS0G 4JYCA 3ABMB 1F23A 1NH2B 2WLNA 2IH3C 3E8HA 1I5XA 1VQ9V 4XDKA 1E1QG 2AHYA 5LHGA 1OCOB 5H6RA 3CCMV 2W0FC 1R6NA 4UUJC 5EBLC 2DW4A 3OGCC 2HFEC 4UV8A 4HAMA 2ATKC 1JVMA 4WFBV 5B1BB 2Q69A 1M90W 4UV9A 5IYCO 1SZTA 1DF4A 5E1AC 4P9OA 1YJWV 2X6BA 2WWWA 3ZRXA 3AG4C 2A79B 3ASOB 5CMUA 4EKWA 3G71V 1ZWIC 4QPKA 1E1RG 2LFSA 2Z5UA 3ABLB 3AG2C 1YIJV 1K7DA 2XAHA 2KB1A 4XDJA 3OW2U 3CPWU 2B1GA 1QLNA 4MSWC 2WLLB 2JJ1G 2Y48A 2EIKC 1K34A 5B1AC 1K97A 4XDLA 3P32A 4PDMA 4WFEA 3CCLV 3E8FA 3ETDA 4JPRA 1KECA 1JJ2U 1ROPA 3G6EV 5LBQA 5CBHA 4QPJA 5IYBO 3FB7C 1QVFU 2D3OW 1YITV 1SERA 2YEVA 1S77D 4ZKIA 1CPYA 3G4SV 4RAIA 5KA6A 1KP3A 1PNMA 3STZC 3E2EA 1EBOA 1P4RA 1K33A 5LHHA 3ETGA 2XAJA 3FYEB 2BOBC 2WLKA 4JASA 2WLIA 4X88A 3OE7G 2JEXA 1V55C 4LBEC 5BZBA 3SPCA 2H94A 1CP9A 2DWDC 4UVBA 3WFVA 1AI7A 1K92A 4BIUA 5DN6G 5C93A 2UXNA 1VQPV 3CC4V 3CC7V 2DYRC 3TETA 2GSMB 4N23A 3K9AA 3AG4B 2XAGA 3ZN0A 3FB5C 1OCCC 1P7BA 1RPRA 2HJFC 3CMEV 1G4YB 1DTOA 1B6QA 3ASNC 2V7QG 4JGSA 1K5QA 1JX9A 1KQSU 3AG2B 4WFHA 1COWG 4I5SA 3STLC 4RUEA 5L3DA 3H01A 2IJHA 3E86A 4JTDB 2Q68A 3RW0A 2QTOA 2EIKB 3FKSG 5B1AB 4FIPC 3LNMB 3NXSA 1OCRC 1AR1B 3CXCU 4J9ZB 4TSFG 4DO2A 2Z3YA 4MVUA 5FL7G 3T2MA 2W6JG 2JK5C 3MHSC 3RVYA 4DXWA 1W0JG 3LSSA 2WLHA 4MTFA 5B3SC 2IW5A 4WFGA 4CBCA 5CN0A 5KUMA 4P9PA 2WAMA 4RUFA 4R7CA 1BMFG 5L3CA 4G28B 3SYPA 3AG3C 3FYIB 3OFNG 2DWEC 3LDCA 4L87A 3IGAC 1CEZA 5L3GA 4U7NA 1YHQV 3FB6C 1V55B 1FFTB 1R3JC 2W6IG 1PNKA 3JD0A 1YJNV 1NVPB 5LGUA 1KKDA 2IJIA 1FXHA 2XNDG 5EBMC 1AI6A 1H8HG 1N8RW 1PD3A 2DYRB 3B8NA 1QR8A 1MOFA 4YXWG 2IJJA 2OTLV 3ML0A 5EC1C 2LFRA 2NLJC 3B77A 5CA3A 4RQFA 1OCCB 3OMAB 4G2KA 3LUTB 1VQ6V 3ASNB 3IC7A 1H2GA 4PA9A 5L3FA 2R9RB 3EFFK 4X8AA 5EK0A 2EJRA 4TWKA 2HLDG 1NBMG 4UVCA 2ZDIA 1QLEB 1RM1C 2XASA 2WSSG 3ZN1A 1PNLA 4PDVA 3ZMVA 1EFRG 2C2AA 1OCRB 5J9PC 2CK3G 3MHHC 4PDRA 4WF9V 2F43G 5B1NA 3CC2V 2EZOA 1MG1A 4KUMA 5KA5A 1S76D 4GX1A 5B3SB 1K4CC 2YEVB 4N21A 1W2BU 1VQNV 5LGTA 3W7SA 3AG3B 3EHBB 3F7VC 3K79A 2EINC 3VOUA 3SYOA 3OM3B 2WLIB 3ZRSA 2EBOA 3ZRVA 3CYOA 2MK3A 1G8MA 4PDLA 2JEUA 3K3WA 1MSWD 2ZD9A 4QNHB 1JQ0A 2X6AA 3W7XA 2QA4V 2JIZG 2IH1C 1GK9A 4UVAA 4BAYA 1FXVA 3M99B 1PKXA 1Y4MA 1NR7A 4R6ZA 1R6KA 1OZ0A 5IYDO 1GTOA 5GW7A 2BOCC 2WPDG 3K0GA 1F4MA 1THZA 3W7WA 3SPJA 1RM1B 3CCJV 2ZDIC 1JOYA 1AJNA 3JD2A 1FXKA 3K04A 1QVGU 1NJIW 3OMIB 4JYBA 2HVJC 2YSUB 1NVPD 1M56C 4GT1A 4BW5A 3W7UA 4MS2A 4P30A 3ETEA 3I55V 3CCQV 3ABUA 4PA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 U;  1KQS U;  3CPW U;  1VQ6 V;  2QA4 V;  1W2B U;  2QEX V;  3CCM V;  1K73 W;  1VQN V;  1Q82 W;  1VQL V;  1KD1 W;  3CCR V;  1Q81 W;  3CCV V;  1Q86 W;  1VQ7 V;  1VQM V;  3CCS V;  1YHQ V;  3CCL V;  4WFB V;  1VQ5 V;  1KC8 W;  1YJN V;  1M90 W;  3CCU V;  3I56 V;  1S72 V;  3CCE V;  1VQP V;  3CC7 V;  1JJ2 U;  3CC4 V;  3CXC U;  1K9M W;  3G6E V;  1YJW V;  1R73 A;  1VQO V;  1N8R W;  3CMA V;  1VQ8 V;  4WF9 V;  3CCJ V;  1QVF U;  2D3O W;  1YIT V;  1VQK V;  1QVG U;  1K8A W;  1NJI W;  3G4S V;  3CC2 V;  5DM6 V;  3G71 V;  3CME V;  4WFA V;  1VQ4 V;  1VQ9 V;  2OTL V;  1M1K W;  2OTJ V;  1YJ9 V;  3I55 V;  1Q7Y W;  3CCQ V;  4WCE V;  1YI2 V;  3CD6 V;  1YIJ V; 
#chains in the Genus database with same CATH topology
 2CGO A;  3UCS C;  4I50 B;  2HR3 A;  2CDY A;  3CCR V;  1IDS A;  3ZMS A;  5CA0 B;  4LF8 B;  1HNW O;  1S72 V;  1RP3 B;  4J9Y B;  5IDJ A;  5GON B;  3IC9 A;  4LF5 O;  4DR3 B;  4F6R A;  1GMG A;  4X62 B;  4E2L A;  2QDO A;  4DV3 O;  4O4H B;  4K8X A;  2UUC O;  1GN3 A;  2CTW A;  4JAU A;  1FAF A;  2VQF B;  2IJK A;  4JI4 O;  1VQ7 V;  1OHH G;  2ZR2 A;  2Q67 A;  2Q6A A;  4D6T H;  4EFB A;  5CBG A;  4FM2 A;  3ZMU A;  2P6J A;  3F5T A;  1HNX B;  1DGS A;  4B08 A;  1N0J A;  1V54 C;  3L75 H;  3T4Z A;  2OTJ V;  3N27 A;  3QO5 A;  2P06 A;  3BY6 A;  1M56 B;  1S5H C;  5EBW C;  1Q43 A;  1HDJ A;  5AG2 A;  3T1C A;  2UXB O;  1AVM A;  1WA8 A;  5H9C A;  5J2U A;  1M5I A;  3DSQ A;  4KFM A;  4UFZ A;  4Z1M G;  2Q0A A;  1RPO A;  4LFC B;  4JYA B;  2EIL C;  2ZE6 A;  4HZ3 A;  5K1X A;  2LQT A;  3PJS K;  1GM8 A;  5E79 Z;  2PI5 A;  4WCE V;  1HP8 A;  3R66 A;  2FTK A;  2CUG A;  4MVR A;  3ZHV A;  3WB1 A;  1K4D C;  3DGE A;  3I56 V;  4O4L A;  5IT9 N;  4DR1 B;  4B7E A;  3ABK C;  3LSU A;  1QR9 A;  3CB2 A;  5A9G A;  1OCZ B;  2PZS A;  3JAL B;  2HEP A;  5LMU O;  1ZAU A;  4YIO A;  1Y76 B;  2GUZ B;  1GKF A;  1L0N H;  1XL6 A;  1Z5V A;  1M93 A;  3AG7 A;  3K06 A;  2FKX A;  1VQM V;  2DYS C;  2EIJ C;  3K58 A;  1PL0 A;  4D7T A;  5B1O A;  3E83 A;  4FFB B;  1BT8 A;  5CB4 B;  1B3Q A;  1KKC A;  5IY5 B;  4Q20 A;  5FPO A;  1VQ4 V;  4L8J A;  4ZI7 A;  5BY1 A;  1UJW B;  1FFX B;  4JI8 B;  4MVS A;  1YCI A;  1Q81 W;  4GCZ A;  2F1M A;  4R8C A;  3RVZ A;  4JI1 B;  4F4L A;  3ABM C;  2XTA A;  1WN7 A;  4E4E A;  1M4U A;  4JI6 O;  3QVN A;  3HPL C;  3E22 A;  1YJ9 V;  1M57 B;  2P4K A;  1ENV A;  4DUZ O;  5LGN A;  2YXL A;  5B1B C;  4R50 A;  2QKS A;  3L73 H;  5LOV A;  3K03 A;  2Q7H A;  1JCH A;  3UM7 A;  4P2Z A;  1XDC A;  1XNR O;  2K9P A;  3VQV A;  2GTS A;  5LMN O;  4MVQ A;  5FLX N;  2EJ7 A;  3VBB A;  1JPX A;  4DV1 O;  1KP2 A;  3BA9 A;  1S5L Z;  3CD6 V;  5EC2 C;  1S3J A;  1V9P A;  4PA4 A;  4CS4 A;  5H6Q A;  1N0N A;  4DV2 B;  4IIJ A;  4NTW A;  1J5E B;  2ADQ B;  3GB7 C;  4IHJ B;  5JCO A;  1IBM B;  2OCC B;  1VF6 A;  1NH2 B;  2WLN A;  4DV0 O;  1BSM A;  2AZ2 A;  2KSD A;  2LW7 A;  1SQF A;  4DR6 O;  2QWQ B;  2ZKO A;  2CE4 A;  3D3Q A;  4UUJ C;  5EBL C;  2HFE C;  4HAM A;  1XOU A;  3RYF B;  3G67 A;  5E1A C;  1YJW V;  2EX3 A;  3ASO B;  4DV7 O;  4YY3 O;  4B3T B;  1IUR A;  2YIB A;  4JI2 B;  1YIJ V;  1K7D A;  4FLT A;  2XAH A;  4UCR A;  2B1G A;  4J7J A;  1N32 B;  4X1K A;  1JMK C;  2JJ1 G;  5J2T A;  1K34 A;  1K97 A;  4XDL A;  4YJ3 B;  2N04 A;  3DC6 A;  5JH7 A;  1KEC A;  3G6E V;  1FKA O;  3N2G A;  4X1I A;  4FZ1 A;  2D3O W;  1S77 D;  3G4S V;  2LGW A;  1PNM A;  3STZ C;  1PV0 A;  4UB6 Z;  1P4R A;  3ETG A;  2BOB C;  2WLK A;  3MDS A;  1IXB A;  4OPA A;  3OE7 G;  2JEX A;  4J80 A;  4LBE C;  5BZB A;  4X20 B;  1ZL8 B;  4FLY A;  3WFV A;  5LP6 B;  4BIU A;  1Y6X A;  2HJD A;  2Y4U A;  1MNG A;  4DR4 O;  4N23 A;  3JAR B;  3ZN0 A;  4X66 B;  3FB5 C;  4JV5 B;  1G4Y B;  2E5L B;  4JAA A;  4JGS A;  4YJ2 A;  3T1H O;  5BR8 B;  2ZNJ A;  3STL C;  5L3D A;  1VAR A;  2IJH A;  3E86 A;  5B5E Z;  3RW0 A;  1UPG A;  4U3J B;  2EIK B;  2RN9 A;  3RYH B;  3FKS G;  3HKC B;  4FIP C;  5B1A B;  1N36 O;  1IVS A;  2RCV A;  4OX9 B;  4LF9 B;  4TSF G;  2W6J G;  5KHH A;  2FL4 A;  5KHG A;  4X1Y A;  3MHS C;  3T1Y B;  2WLH A;  5B3S C;  1G6U A;  3BAB A;  4NXN O;  4WFG A;  4I50 A;  2Q5Z A;  3J81 N;  1XMQ O;  5KUM A;  4P9P A;  4R7C A;  1BMF G;  3J80 N;  2RNB A;  4K0K O;  3LDC A;  4L87 A;  5L3G A;  4U7N A;  1SQX H;  5GON A;  1V55 B;  1YJN V;  1HNZ O;  1PNK A;  3QTC A;  1KKD A;  2Q9L A;  2DJV A;  4IYI A;  4O4H A;  5FNV A;  1AI6 A;  1H8H G;  2QWP B;  3GWK C;  5BXZ A;  2ADP A;  3QF7 A;  3UO3 A;  2IJJ A;  2OTL V;  4KHP B;  2LFR A;  2NLJ C;  1EN4 A;  5CA3 A;  2OWO A;  1WAZ A;  3ASN B;  1TAE A;  4TWK A;  1L0L H;  3JAW B;  4UVC A;  1HNW B;  2XAS A;  1OCR B;  3MHH C;  1NZ6 A;  5B1N A;  4LF5 B;  2PYL A;  2EZO A;  1S76 D;  1LUV A;  4N21 A;  3OTF A;  5JWP A;  4BR6 A;  2ZE5 A;  4GKK O;  4I7Z B;  3WB0 A;  2H3O A;  3A8T A;  2EIN C;  4DV4 B;  4NVP A;  2KG7 B;  2EBO A;  3ZRV A;  4LFA O;  4KL1 A;  1NTZ H;  1AP5 A;  1PPJ H;  2JEU A;  3K3W A;  1IBL B;  2CTP A;  1MSW D;  2QWO B;  1S5J A;  3VQW A;  2NR5 A;  1GK9 A;  2YDE A;  1EN5 A;  3QG5 A;  1PKX A;  4R6Z A;  5IYD O;  1OZ0 A;  1YZB A;  2UXB B;  3CHX A;  3JAL A;  3SPJ A;  2ILM A;  1Y76 A;  5A2Q N;  3JD2 A;  3K04 A;  2GUZ A;  3OMI B;  2YSU B;  4W4L A;  4GT1 A;  3W7U A;  4MS2 A;  3CRR A;  4I4T A;  4P30 A;  2PYJ A;  3ABU A;  3OR7 C;  3JCZ A;  3H9V A;  2ZR3 A;  2F93 B;  4FFB A;  3B2E E;  5CB4 A;  3SPH A;  4B3R O;  3A2F A;  4AIL C;  3JCU Z;  3WG7 C;  1GO3 F;  1FFX A;  2Q7G A;  1VQK V;  1KBH A;  1MZF A;  1S0V A;  2R70 A;  2QM8 A;  2A3Q A;  4TT3 G;  4NR1 A;  4I9W A;  4ZBM A;  4MVM A;  1VEW A;  3OTO O;  4AQY B;  3CEI A;  5JVD A;  2RJZ A;  2HHH O;  3OUF A;  4MVO A;  2QM7 A;  5HFL A;  3QO7 A;  2X6C A;  3MAQ A;  3RYI B;  4JTC B;  3ZED A;  2ZXW C;  4EB6 A;  3CMA V;  1I94 O;  1QBZ A;  1I0H A;  4JI0 O;  1R3K C;  2AHZ A;  5CA1 B;  1JFF B;  4G27 B;  1A32 A;  4X65 O;  4WFF A;  5KUK A;  1EN6 A;  3E8G A;  3LDD A;  1IBK O;  2CH7 B;  3CCV V;  4NB5 A;  4JYY A;  2JS5 A;  1EZJ A;  4LH7 A;  1MMM A;  1NI8 A;  3SYQ A;  1SET A;  2ETN A;  2AZ0 A;  3D36 A;  4MW3 A;  1R3I C;  2QE7 G;  4JI6 B;  1M1K W;  1T5E A;  3ZCC A;  4LP8 A;  4GX5 A;  3G80 A;  4O2A B;  4IHJ A;  4DK1 A;  4DUZ B;  1ZLZ A;  1KD1 W;  1N33 O;  1AI5 A;  3FAV B;  4ASU G;  2W0X A;  1H2L A;  2A0L A;  2PTM A;  3ZIA G;  3K5L A;  1XNR B;  1AJP A;  2FML A;  5LMN B;  1AI4 A;  1BL8 A;  1D5A A;  1OV9 A;  4JI7 O;  1V54 B;  5DM6 V;  3FB8 C;  4RQE A;  1TA8 A;  4DV1 B;  4IL6 Z;  3TXQ A;  1HR0 B;  2XUM A;  5KHI A;  4TQD A;  3CXH F;  4DK0 A;  3RYF A;  3LSQ A;  1Q82 W;  1Q86 W;  1ORQ C;  1SQV H;  1WLE A;  2Y69 C;  4ABM A;  2P5O A;  3CCE V;  3SPG A;  4FLU A;  1R1B A;  3OEH G;  2ZM6 O;  3RWR D;  4DR5 O;  4DV0 B;  3I5D A;  2EIL B;  2QM4 A;  1Y66 A;  2L35 A;  5LL6 Y;  4LH6 A;  3JD4 A;  1K9M W;  1H2K A;  4PEL A;  4AI8 A;  3MD0 A;  1BQZ A;  1YSC A;  4U7O A;  3E8B A;  4JI5 O;  5ITZ A;  3ABT A;  3JAT B;  4YY3 B;  2BTQ B;  3ABK B;  4FK5 C;  4IT5 A;  1OCO C;  4X20 A;  1US6 A;  1ZL8 A;  2KQX A;  2B1I A;  3DXR B;  5LP6 A;  3JAK B;  4YHH B;  1YTF D;  2ZQM A;  2DQ0 A;  5LA6 A;  4H44 B;  2IM9 A;  3ZBH A;  3THO A;  2DYS B;  2EIJ B;  4AHC A;  1E79 G;  1FYJ A;  1XNQ B;  3QO8 A;  2Z0A A;  1K8A W;  2A9H A;  4FLV A;  2UXX A;  2KKW A;  3IFX A;  4MTG A;  3E89 A;  4W4K A;  4U3J A;  3RYH A;  3HKC A;  3L72 H;  2G38 A;  2L6L A;  3ZRW B;  4DW1 A;  1IXM A;  2WLJ A;  3GWO A;  5FPR A;  2VWJ A;  1H8E G;  1XIL A;  1XBL A;  2Y0I A;  5HFM A;  3ZHR A;  1AR5 A;  1F23 A;  3ABM B;  2Q7E A;  2HP8 A;  3E8H A;  1D5N A;  3ZHS A;  5IE9 A;  3ETQ A;  2JGD A;  2QTS A;  4LF4 B;  5LHG A;  4NTY A;  3T1H B;  3CCM V;  2W0F C;  2QSA A;  5KX5 B;  1QHT A;  1FPO A;  2UUB O;  5B1B B;  4UV9 A;  1XHZ A;  1N36 B;  4P9O A;  2X6B A;  2WWW A;  3ZRX A;  2A79 B;  1ZWI C;  4CS3 A;  1PM9 A;  4NXN B;  2Z5U A;  3AG2 C;  3JAW A;  4XDJ A;  3OW2 U;  5K1P A;  3CPW U;  3BRC A;  1QLN A;  4NKG B;  2WLL B;  1WPB A;  4I55 B;  4K0K B;  3FX7 A;  1XQ8 A;  4WFE A;  4DR2 O;  3E8F A;  5JJE B;  5D5P A;  1YXB A;  3ETD A;  3CJH B;  4JPR A;  1JJ2 U;  5LBQ A;  2JS3 A;  5IYB O;  3FB7 C;  1SER A;  4I0X B;  2A7W A;  3SR2 C;  5KA6 A;  2F66 C;  4UCS A;  4LF6 O;  2FYU H;  1Q8I A;  1K33 A;  5LHH A;  2XAJ A;  3FYE B;  3ZX6 A;  4C7U A;  3BHP A;  2ZE7 A;  4X88 A;  2KG7 A;  2H94 A;  1CP9 A;  1AI7 A;  1K92 A;  4J42 A;  4CH6 A;  1VQP V;  3HKE B;  1KMI Z;  2F95 B;  3VQX A;  4PV1 B;  3VQY A;  2XAG A;  1Y67 A;  1P7B A;  2F4V B;  1K5Q A;  1JX9 A;  1KQS U;  4TOI A;  4WFH A;  4I5S A;  4RUE A;  4TV8 B;  2Q68 A;  2QWR B;  2N74 A;  1QQC A;  2E76 B;  3NXS A;  4TV9 B;  4J9Z B;  2Z3Y A;  2YIB D;  4LFA B;  1TVK A;  2JK5 C;  4DXW A;  2OCH A;  2WAM A;  1SKV A;  4RWU A;  3SYP A;  3AG3 C;  3FYI B;  3OFN G;  4LF7 O;  1GRJ A;  3HKD B;  4GKJ O;  3FB6 C;  3JD0 A;  4UCT A;  3CRM A;  1RSO B;  2IJI A;  1FXH A;  2XND G;  2E75 B;  3KCY A;  5EBM C;  1N8R W;  4GZR B;  4K8Z A;  1MOF A;  4YXW G;  1NS1 A;  1QNM A;  3AK1 A;  1U96 A;  4J41 A;  2WA4 A;  3IC7 A;  1H2G A;  4NXM O;  4PA9 A;  3RYI A;  3EFF K;  5EIB D;  1VMG A;  4JI3 B;  1SS3 A;  2GTA A;  2HLD G;  4B3R B;  1QLE B;  4FFK A;  3ZN1 A;  5B66 Z;  5CA1 A;  2UU9 O;  1VP7 A;  1EFR G;  1JFF A;  1MG1 A;  5IWA O;  2CH7 A;  5B3S B;  1WB8 A;  2DOS A;  5LYJ B;  2YEV B;  3OTO B;  3K5M A;  2YC0 A;  2R72 A;  3VOU A;  3OM3 B;  2RQ6 A;  2CAZ C;  3EXA A;  2V4D A;  4DR3 O;  3CWB H;  2MK3 A;  4O2A A;  4FVM A;  1NU1 H;  4JI0 B;  4BW9 A;  1P49 A;  1SQG A;  2DN9 A;  3FAV A;  2ZCE A;  1ZTE A;  4JZ2 A;  4X65 B;  2IH1 C;  4BAY A;  4UVA A;  2VQF O;  4KXR A;  1IBK B;  3BA8 A;  1R6K A;  4D7S A;  4O2B A;  1SA0 B;  1F4M A;  1I08 A;  3CCJ V;  2ZDI C;  1NJI W;  4JYB A;  1NVP D;  2GBO A;  4J11 A;  1BCC H;  3ETE A;  2CTQ A;  1SQP H;  1SQQ H;  3H1I H;  5L3E A;  2XAQ A;  3OGI B;  2JVD A;  3D8C A;  1H38 A;  1GM7 A;  1VF7 A;  5H5N A;  5GTI Z;  1QLE C;  3UT5 B;  4PHZ A;  3OAA G;  4JYA O;  2EIN B;  2K1E A;  4QE9 A;  1DF5 A;  2N05 A;  2ZIN A;  2P7T C;  3TXS A;  1RFY A;  4B3M B;  4WFA V;  3HB3 B;  4LFB B;  5L3B A;  3ZMT A;  2QEX V;  2OIE A;  5CA0 A;  2V1D A;  1SES A;  1BHA A;  2YXY A;  3KKY A;  3AG1 C;  3JAT A;  2JRI A;  4OGQ B;  2BTQ A;  4LR3 A;  3T4D A;  4QJF B;  2ZM6 B;  3DXR A;  1AJQ A;  3JAK A;  2QKA A;  3R65 A;  3GVM A;  1W0K G;  1FXK C;  3JYC A;  2Y4T A;  1XRE A;  1YVW A;  4GUN A;  2NNU A;  4PA3 A;  1NKD A;  3F5W C;  1NT2 B;  2XT9 A;  1JA8 A;  1VF5 B;  3SYC A;  1XUQ A;  1WPX A;  4JI5 B;  3K57 A;  3SYA A;  4FMT A;  3P3P A;  3WG7 B;  3O9O A;  3ZRW A;  5D5Q A;  1YTF B;  4JI8 O;  4BIZ A;  4DV3 B;  3OMN B;  2UUC B;  3B40 A;  4HYO A;  1NQT A;  3CP1 A;  4GX0 A;  3OEE G;  1Q3E A;  1Q90 D;  3HKB B;  2P90 A;  1KYO F;  3C3S A;  1I5Y A;  4JI4 B;  2VQE O;  2HKO A;  4WBN B;  3H1J H;  5DED A;  4ZOL B;  2ZXW B;  5KX5 A;  3IAY A;  2JDI G;  3TCU A;  4EEQ A;  1NTM H;  2PUS A;  2EIM C;  4KP4 A;  5DEC A;  5KHK A;  3BCC H;  3RGB A;  1XEQ A;  4CC5 A;  1J95 A;  3LDE A;  1R73 A;  1VQO V;  1N34 O;  2AXT Z;  1Z5W A;  2WLL A;  3OD4 A;  4I55 A;  2PI4 A;  4DW0 A;  3W7T A;  3CJH A;  5JQG B;  4DV2 O;  3ZJZ A;  1J5E O;  2A06 H;  3RYC B;  3BEH A;  2UUB B;  4OXS A;  1KC8 W;  4I0X A;  3RBZ A;  3X2Q C;  1ARO P;  2YUA A;  1IX9 A;  1ZUQ A;  1W59 A;  4NTX A;  5TIS Z;  3A0R A;  3KCX A;  1P7G A;  5LMU B;  2PF4 E;  4LCU C;  1NH2 D;  4FZ0 A;  1K73 W;  2LGQ A;  2B5U A;  3HKE A;  5IYZ B;  4DR2 B;  3SJQ C;  2Y69 B;  4FM1 A;  2PY5 A;  3EVK A;  3IJ4 A;  4FLW A;  5IJ9 B;  3ABL C;  1NR1 A;  1Q5O A;  4TV8 A;  1N32 O;  3KG2 A;  2JJ2 G;  4DR7 O;  4TV9 A;  4IGG A;  3HR0 A;  3ZMZ A;  2BCC H;  3B8M A;  1XL4 A;  1BE3 H;  5EYP B;  2H8P C;  3E35 A;  2OT5 A;  4PA7 A;  3QNE A;  4QE7 A;  3APQ A;  2LO1 A;  1XMO O;  5KMG B;  1I5X A;  1VQ9 V;  4XDK A;  3HKD A;  4Z1V A;  3JSN A;  1OCO B;  1XI1 A;  2YXH A;  1RSO A;  5H6R A;  2ZT9 B;  1R6N A;  2DW4 A;  3OGC C;  2ATK C;  2UXC O;  4WFB V;  3C3T A;  2Q69 A;  1M90 W;  5IYC O;  1SZT A;  1DF4 A;  3AG4 C;  4B3S O;  5C8Y B;  4H0L B;  4EKW A;  2P22 C;  1Q6U A;  1MSD A;  2LJ2 A;  1AP6 A;  2E5L O;  3K5N A;  2LFS A;  3SJA C;  5BR8 O;  1EZV H;  1SF9 A;  3P32 A;  4GKJ B;  4LF9 O;  1ROP A;  3T1Y O;  5CBH A;  4QPJ A;  4YIP A;  5LYJ A;  4BIO A;  5JCO C;  2YEV A;  4ZKI A;  1VF6 C;  4RAI A;  1TUB B;  3N2K B;  1D2D A;  1KU9 A;  3E2E A;  2QGN A;  4DR6 B;  4YJ3 A;  4JAS A;  3H1L H;  1GAX A;  2UUA O;  5IJ0 B;  4NXM B;  5F2V O;  3B4S A;  2DWD C;  5DN6 G;  5C93 A;  3CC7 V;  2DYR C;  3TET A;  1DK1 A;  2DMX A;  1BS3 A;  3K9A A;  4KHP O;  4DV7 B;  3CME V;  1OCC C;  1RPR A;  2HJF C;  1B6Q A;  4X1Y B;  1YEW A;  3AG2 B;  4DV5 O;  1COW G;  3L70 H;  2GV9 A;  1SA0 A;  4JTD B;  1BQ0 A;  2QTO A;  3FD9 A;  3U0Z A;  3JAR A;  4J7Z A;  1H2S B;  4GYC B;  4MVU A;  5FL7 G;  3T2M A;  1WB7 A;  3RVY A;  2RDC A;  1SQB H;  4MTF A;  2IW5 A;  2LW1 A;  5FNV B;  2YS8 A;  3BAA A;  5L3C A;  4G28 B;  3UT5 A;  2Q8V A;  2QR4 A;  2DWE C;  1CEZ A;  4DV4 O;  1GN6 A;  1FFT B;  2W6I G;  1NVP B;  1G1X B;  2M6Y A;  3L74 H;  4UCO A;  1PD3 A;  5EZY B;  3B8N A;  1QR8 A;  4ZHQ B;  1IBL O;  4DR4 B;  5EIB C;  3B09 A;  2UXD O;  5EC1 C;  3B77 A;  4LNU B;  4G2K A;  1FD9 A;  3BPZ A;  1SC5 B;  3LNN A;  2AW9 A;  2EJR A;  3ZS8 C;  1NBM G;  1RM1 C;  2WSS G;  4PDV A;  3ZMV A;  4CH5 A;  2C2A A;  5J9P C;  4PDR A;  2NN4 A;  2Q4P A;  2F43 G;  3RFR A;  3ICX A;  3K9S A;  1XMQ B;  1W2B U;  2EUL A;  3W7S A;  4HNA B;  4O4J B;  3AG3 B;  1OJH A;  2ZE8 A;  3EHB B;  3K79 A;  4TUY B;  5KAI Z;  2WLI B;  2BSK B;  1HNZ B;  3ZRS A;  4NYK A;  4OPH A;  4DRX B;  3CYO A;  3Q4H B;  1G8M A;  4PDL A;  5JJJ B;  3CRA A;  3HKB A;  4PD4 F;  4AQY O;  2ZD9 A;  4QNH B;  1JQ0 A;  2X6A A;  4WBN A;  2QA4 V;  3SJB C;  2Q0O C;  4ZOL A;  3TGU H;  4I4T B;  1FXV A;  3M99 B;  2E74 B;  1HW7 A;  1Y4M A;  1WP7 A;  1GTO A;  1KUQ A;  1P84 F;  2WPD G;  1CXZ B;  1JOY A;  1QVG U;  1L8D A;  5IWA B;  4B7K A;  2HVJ C;  1M56 C;  2IBZ H;  4O4I B;  3I55 V;  1VIB A;  1JR9 A;  3S3X A;  2GHY A;  5LXT B;  1URF A;  3CCS V;  4GKK B;  4DUY O;  3OT7 A;  4CH4 A;  1B06 A;  4LC1 A;  5JVD B;  2VQE B;  3K0D A;  4GX2 A;  1UFI A;  3G6B A;  1FJG O;  4EFE A;  1DLB A;  1WJZ A;  4MVZ A;  4UXN A;  5CBF A;  3M7M X;  5JQG A;  2IU3 A;  4A5U B;  2GDS A;  4EB6 B;  1AIL A;  3UKM A;  3RYC A;  1MAB G;  2BE3 A;  3BVO A;  3DTU B;  1KB9 F;  4H33 A;  3ZHT A;  5GTH Z;  4H13 B;  1M9N A;  3TJT A;  4DV6 O;  3CE2 A;  3AEI A;  3K08 A;  1OCZ C;  1AR4 A;  4JTA B;  3SGI A;  2DE0 X;  1N34 B;  1HR0 O;  1Z2G A;  5IYZ A;  2XAF A;  1Q7Y W;  4DYL A;  1F51 A;  1Y74 B;  3CSX A;  4X64 O;  3CS5 A;  5BMV B;  5IJ9 A;  1SZX A;  5IY5 C;  3C90 A;  2PGG A;  4MTX A;  2D2C B;  4J7K A;  1YI2 V;  2LP7 A;  5EYP A;  1YDX A;  4UCU A;  4FJC C;  1PP9 H;  4CH3 A;  2XOK G;  2HHH B;  2YI8 A;  2IU0 A;  2B9Z A;  3CX5 F;  4LF8 O;  5KMG A;  3AG1 B;  3JAS B;  3D3I A;  1LNQ A;  1WNS A;  3F7Y C;  1I94 B;  4UCV A;  4X62 O;  4FM0 A;  4LWS B;  1SRY A;  2HVK C;  1M57 C;  2VRZ A;  1VQ5 V;  1R6T A;  1K5S A;  1FXK B;  4YHH O;  1L1F A;  4DR7 B;  2ARH A;  3M8A A;  1K3E A;  5C8Y A;  4XBF A;  1HNX O;  2Y0P A;  1XNQ O;  4QIW F;  4X89 A;  3DC5 A;  1XMO B;  3OUS A;  1QCE A;  1GN2 A;  3D36 C;  5ITZ B;  3OR6 C;  4RO2 A;  5LHI A;  2WLM A;  5KLV H;  2F23 A;  4F6R B;  4JZG A;  2ITC C;  2CTR A;  1YF2 A;  2P67 A;  3JD3 A;  2M7W A;  4UB8 Z;  3J7A U;  3SPI A;  1N33 B;  2UXC B;  2MW2 B;  2OCC C;  3BFR A;  3CCU V;  5H2F Z;  2BTO A;  1TUB A;  3N2K A;  5LA6 B;  2HG5 C;  4LFC O;  4B3S B;  1U97 A;  3H1H H;  4MTO A;  3AK3 A;  4MT8 A;  4JI7 B;  3K5O A;  5IJ0 A;  4LF4 O;  3JD1 A;  4QGP A;  2ODM A;  1F4N A;  1VQL V;  2EIM B;  3ASO C;  4DR1 O;  4CZZ A;  1O9G A;  2O57 A;  3P30 A;  1BGY H;  1WA8 B;  2X0L A;  5J2U B;  4DR5 B;  1BHB A;  1TUE B;  1HWY A;  2P4V A;  4Z2W A;  2X7R B;  4H37 A;  3AK2 A;  1R3L C;  4CC6 A;  2UUA B;  2JGD B;  2EZP A;  1LUW A;  4JAV A;  4MW8 A;  4FPP A;  2ITD C;  2JGU A;  3TK1 A;  2R9I A;  2DQ3 A;  1GM9 A;  4JF3 A;  3X2Q B;  1VQ8 V;  1FS0 G;  4JYC A;  4TQF A;  4X9Q A;  2IH3 C;  4O4L B;  1Q6I A;  1E1Q G;  2AHY A;  3UQ8 A;  3O65 A;  4DV5 B;  4UV8 A;  3WU2 Z;  2YID A;  5LP6 C;  1JVM A;  5EZY A;  1JJO A;  4ZHQ A;  4JI1 O;  4LNU A;  1ZX3 A;  5CMU A;  2F4V O;  3G71 V;  4QPK A;  2ZNI A;  1E1R G;  3ABL B;  4F6E A;  1GN4 A;  2KB1 A;  4MSW C;  1PL4 A;  2Y48 A;  2EIK C;  4ZI7 B;  3A0H Z;  5B1A C;  4PDM A;  3CCL V;  5KAF Z;  4PI2 A;  2OYQ A;  1BZK A;  3RT3 C;  4ICG A;  1QVF U;  1YIT V;  1CPY A;  3U11 A;  1KP3 A;  4HNA A;  1O9H A;  2UXD B;  4O4J A;  4K3A A;  1EM1 A;  1EBO A;  3JAM N;  4TUY A;  2WLI A;  2BSK A;  2E3C A;  3E22 B;  4DRX A;  1V55 C;  2ZIM A;  3SPC A;  3PN1 A;  3L71 H;  3Q4H A;  4UVB A;  2WA3 A;  1X59 A;  1IBM O;  2UXN A;  2Q73 A;  3CC4 V;  3H1K H;  2GSM B;  5LOV B;  3AG4 B;  3KZI Z;  3P3N A;  4GLX A;  1DTO A;  2YIC A;  1TVK B;  2V7Q G;  3ASN C;  2VWK A;  2AGA A;  3H01 A;  3WB2 A;  4JI3 O;  1WP8 A;  3LNM B;  1OCR C;  1AR1 B;  1IZ3 A;  4O4I A;  4DO2 A;  3CXC U;  4PI0 A;  2YI9 A;  4IIJ B;  3JSL A;  1W0J G;  3LSS A;  4B3T O;  4CBC A;  5CN0 A;  4JI2 O;  5KHJ A;  4RUF A;  5LXT A;  4LF6 B;  3ZHQ A;  1F7Y A;  2ZIO A;  4CS2 A;  3IGA C;  1YHQ V;  1R3J C;  4PJ0 Z;  5LGU A;  2QKC A;  1Q6H A;  2VS0 A;  1QU7 A;  4Q6G A;  4K35 A;  1N4C A;  2DYR B;  3APO A;  4I9Q A;  1XHX A;  4ZIB A;  3ML0 A;  4RQF A;  1OCC B;  3OMA B;  1LR1 A;  3LUT B;  1VQ6 V;  3ZHU A;  1I7F A;  2R9A A;  5L3F A;  2R9R B;  4X8A A;  5EK0 A;  1X4T A;  4DUY B;  4X1K B;  2ZDI A;  1PNL A;  5J2T B;  1MA1 A;  1FJG B;  2CK3 G;  4WF9 V;  5JJN B;  1Y74 A;  3K59 A;  4BWA A;  4X66 O;  1H2N A;  3CC2 V;  4JV5 O;  5JH7 B;  1AB3 A;  3L9D A;  4KUM A;  5KA5 A;  4GX1 A;  5BMV A;  3N2G B;  4X1I B;  1K4C C;  3A0B Z;  1VQN V;  5LGT A;  3FFQ A;  3RN4 A;  3F7V C;  4LF7 B;  3SYO A;  4DV6 B;  4OX9 O;  1TGO A;  3CRC A;  1ZSP A;  4B3M O;  4O2B B;  3U10 A;  2YIA A;  1NTK H;  2CGN A;  2RMK B;  3CRQ A;  4LFB O;  3S3W A;  1MZE A;  4J10 A;  3SJC C;  3W7X A;  2JIZ G;  4X64 B;  3JAS A;  3NR7 A;  1NR7 A;  4YJ2 B;  4FLZ A;  1GH6 A;  5GW7 A;  2BOC C;  3UO2 A;  4LWS A;  3K0G A;  4IYH A;  2OIG A;  1THZ A;  3W7W A;  1RM1 B;  2UU9 B;  2QJ1 A;  2XHB A;  4FLX A;  1AJN A;  1FXK A;  2FB5 A;  1B04 A;  1H2M A;  4BW5 A;  3SDL A;  4HBN A;  3CCQ V;  2QWN B;  4PA6 A;  4U3F H; 
#chains in the Genus database with same CATH homology
 3OR7 C;  5L3E A;  3JCZ A;  2XAQ A;  2ZR3 A;  2HR3 A;  1H38 A;  3CCR V;  1GM7 A;  2GHY A;  3SPH A;  3CCS V;  1QLE C;  3ZMS A;  4LC1 A;  3K0D A;  4GX2 A;  1S72 V;  3OAA G;  2EIN B;  4J9Y B;  3WG7 C;  1GO3 F;  1DLB A;  2K1E A;  4QE9 A;  1DF5 A;  5IDJ A;  1VQK V;  4MVZ A;  4UXN A;  5CBF A;  1S0V A;  1GMG A;  2P7T C;  4E2L A;  2QM8 A;  2IU3 A;  4TT3 G;  4I9W A;  4ZBM A;  4MVM A;  4WFA V;  3UKM A;  3HB3 B;  1MAB G;  5L3B A;  3DTU B;  4JAU A;  4H33 A;  3ZMT A;  2QEX V;  2V1D A;  1SES A;  1BHA A;  3OUF A;  4MVO A;  2IJK A;  1M9N A;  1VQ7 V;  1OHH G;  2QM7 A;  2Q67 A;  2Q6A A;  2ZR2 A;  3AG1 C;  3QO7 A;  5HFL A;  5CBG A;  3ZMU A;  2P6J A;  2X6C A;  3AEI A;  1V54 C;  3K08 A;  1OCZ C;  4JTC B;  3T4D A;  2ZXW C;  3CMA V;  4QJF B;  4JTA B;  1QBZ A;  3T4Z A;  1AJQ A;  3R65 A;  1R3K C;  2OTJ V;  1W0K G;  2AHZ A;  3QO5 A;  1FXK C;  3JYC A;  3BY6 A;  1Q7Y W;  2XAF A;  1M56 B;  1S5H C;  5EBW C;  4G27 B;  1F51 A;  4WFF A;  2NNU A;  5KUK A;  4PA3 A;  3E8G A;  3LDD A;  3T1C A;  1NKD A;  3F5W C;  3CCV V;  5H9C A;  1EZJ A;  4KFM A;  3SYC A;  1WPX A;  3SYQ A;  4Z1M G;  1SET A;  5IY5 C;  1RPO A;  3D36 A;  4MW3 A;  3SYA A;  2EIL C;  1R3I C;  4FMT A;  4HZ3 A;  3WG7 B;  3ZRW A;  2QE7 G;  1YTF B;  3PJS K;  1M1K W;  1GM8 A;  4MTX A;  4BIZ A;  3ZCC A;  2PI5 A;  4WCE V;  3OMN B;  1YI2 V;  4HYO A;  4LP8 A;  4GX5 A;  2LP7 A;  1NQT A;  3CP1 A;  4GX0 A;  2FTK A;  4FJC C;  3OEE G;  1KD1 W;  2P90 A;  2XOK G;  1AI5 A;  2IU0 A;  4ASU G;  1I5Y A;  2A0L A;  3ZIA G;  2HKO A;  4MVR A;  1K4D C;  3DGE A;  3I56 V;  3AG1 B;  1AJP A;  1AI4 A;  1BL8 A;  3ABK C;  3D3I A;  1LNQ A;  3F7Y C;  1QR9 A;  1V54 B;  1OCZ B;  2ZXW B;  5DM6 V;  3FB8 C;  1SRY A;  4RQE A;  2JDI G;  2HVK C;  1M57 C;  3TCU A;  1VQ5 V;  1K5S A;  1FXK B;  1GKF A;  4KP4 A;  1XL6 A;  2EIM C;  3LSQ A;  1Q82 W;  1L1F A;  3K06 A;  1Q86 W;  1ORQ C;  1VQM V;  2DYS C;  2EIJ C;  2Y69 C;  1WLE A;  1K3E A;  4XBF A;  1J95 A;  1PL0 A;  3CCE V;  3SPG A;  4QIW F;  5B1O A;  3LDE A;  3E83 A;  4X89 A;  1R73 A;  3OEH G;  1VQO V;  3OUS A;  5IY5 B;  1QCE A;  4Q20 A;  2EIL B;  1VQ4 V;  2WLL A;  3OR6 C;  1Y66 A;  4RO2 A;  2PI4 A;  1UJW B;  3JD4 A;  1K9M W;  4MVS A;  5LHI A;  2WLM A;  4PEL A;  3W7T A;  3MD0 A;  2ITC C;  2P67 A;  3JD3 A;  2M7W A;  3ZJZ A;  1Q81 W;  1YSC A;  4GCZ A;  4U7O A;  3SPI A;  4R8C A;  3E8B A;  3BEH A;  4OXS A;  1KC8 W;  3RVZ A;  3RBZ A;  2OCC C;  3CCU V;  3X2Q C;  1ARO P;  4F4L A;  3ABM C;  2HG5 C;  3ABT A;  4MTO A;  3ABK B;  4MT8 A;  3HPL C;  4FK5 C;  1YJ9 V;  1OCO C;  3A0R A;  3JD1 A;  4LCU C;  2B1I A;  1NH2 D;  1M57 B;  1ENV A;  1F4N A;  1K73 W;  5LGN A;  2B5U A;  1VQL V;  1YTF D;  5B1B C;  4R50 A;  2QKS A;  2ZQM A;  2DQ0 A;  2EIM B;  3K03 A;  3UM7 A;  1JCH A;  4P2Z A;  2DYS B;  2EIJ B;  3SJQ C;  2Y69 B;  3ASO C;  1E79 G;  4CZZ A;  4MVQ A;  3QO8 A;  3P30 A;  2X0L A;  1K8A W;  2A9H A;  3ABL C;  3VBB A;  1BHB A;  2UXX A;  1JPX A;  1NR1 A;  3IFX A;  4MTG A;  1KP2 A;  1TUE B;  3E89 A;  3CD6 V;  1HWY A;  5EC2 C;  3KG2 A;  2JJ2 G;  1S3J A;  2X7R B;  3ZRW B;  4H37 A;  4PA4 A;  1IXM A;  1R3L C;  2WLJ A;  3GWO A;  5H6Q A;  2EZP A;  3ZMZ A;  4JAV A;  4MW8 A;  1H8E G;  1XL4 A;  3B8M A;  4FPP A;  2ITD C;  2H8P C;  3GB7 C;  3TK1 A;  3E35 A;  2R9I A;  2OT5 A;  4PA7 A;  2DQ3 A;  5HFM A;  1GM9 A;  4JF3 A;  2OCC B;  3QNE A;  3X2Q B;  4QE7 A;  1VQ8 V;  1FS0 G;  4JYC A;  3ABM B;  1F23 A;  1NH2 B;  2WLN A;  2IH3 C;  3E8H A;  1I5X A;  1VQ9 V;  4XDK A;  1E1Q G;  2AHY A;  5LHG A;  1OCO B;  5H6R A;  3CCM V;  2W0F C;  1R6N A;  4UUJ C;  5EBL C;  2DW4 A;  3OGC C;  2HFE C;  4UV8 A;  4HAM A;  2ATK C;  1JVM A;  4WFB V;  5B1B B;  2Q69 A;  1M90 W;  4UV9 A;  5IYC O;  1SZT A;  1DF4 A;  5E1A C;  4P9O A;  1YJW V;  2X6B A;  2WWW A;  3ZRX A;  3AG4 C;  2A79 B;  3ASO B;  5CMU A;  4EKW A;  3G71 V;  1ZWI C;  4QPK A;  1E1R G;  2LFS A;  2Z5U A;  3ABL B;  3AG2 C;  1YIJ V;  1K7D A;  2XAH A;  2KB1 A;  4XDJ A;  3OW2 U;  3CPW U;  2B1G A;  1QLN A;  4MSW C;  2WLL B;  2JJ1 G;  2Y48 A;  2EIK C;  1K34 A;  5B1A C;  1K97 A;  4XDL A;  3P32 A;  4PDM A;  4WFE A;  3CCL V;  3E8F A;  3ETD A;  4JPR A;  1KEC A;  1JJ2 U;  1ROP A;  3G6E V;  5LBQ A;  5CBH A;  4QPJ A;  5IYB O;  3FB7 C;  1QVF U;  2D3O W;  1YIT V;  1SER A;  2YEV A;  1S77 D;  4ZKI A;  1CPY A;  3G4S V;  4RAI A;  5KA6 A;  1KP3 A;  1PNM A;  3STZ C;  3E2E A;  1EBO A;  1P4R A;  1K33 A;  5LHH A;  3ETG A;  2XAJ A;  3FYE B;  2BOB C;  2WLK A;  4JAS A;  2WLI A;  4X88 A;  3OE7 G;  2JEX A;  1V55 C;  4LBE C;  5BZB A;  3SPC A;  2H94 A;  1CP9 A;  2DWD C;  4UVB A;  3WFV A;  1AI7 A;  1K92 A;  4BIU A;  5DN6 G;  5C93 A;  2UXN A;  1VQP V;  3CC4 V;  3CC7 V;  2DYR C;  3TET A;  2GSM B;  4N23 A;  3K9A A;  3AG4 B;  2XAG A;  3ZN0 A;  3FB5 C;  1OCC C;  1P7B A;  1RPR A;  2HJF C;  3CME V;  1G4Y B;  1DTO A;  1B6Q A;  3ASN C;  2V7Q G;  4JGS A;  1K5Q A;  1JX9 A;  1KQS U;  3AG2 B;  4WFH A;  1COW G;  4I5S A;  3STL C;  4RUE A;  5L3D A;  3H01 A;  2IJH A;  3E86 A;  4JTD B;  2Q68 A;  3RW0 A;  2QTO A;  2EIK B;  3FKS G;  5B1A B;  4FIP C;  3LNM B;  3NXS A;  1OCR C;  1AR1 B;  3CXC U;  4J9Z B;  4TSF G;  4DO2 A;  2Z3Y A;  4MVU A;  5FL7 G;  3T2M A;  2W6J G;  2JK5 C;  3MHS C;  3RVY A;  4DXW A;  1W0J G;  3LSS A;  2WLH A;  4MTF A;  5B3S C;  2IW5 A;  4WFG A;  4CBC A;  5CN0 A;  5KUM A;  4P9P A;  2WAM A;  4RUF A;  4R7C A;  1BMF G;  5L3C A;  4G28 B;  3SYP A;  3AG3 C;  3FYI B;  3OFN G;  2DWE C;  3LDC A;  4L87 A;  3IGA C;  1CEZ A;  5L3G A;  4U7N A;  1YHQ V;  3FB6 C;  1V55 B;  1FFT B;  1R3J C;  2W6I G;  1PNK A;  3JD0 A;  1YJN V;  1NVP B;  5LGU A;  1KKD A;  2IJI A;  1FXH A;  2XND G;  5EBM C;  1AI6 A;  1H8H G;  1N8R W;  1PD3 A;  2DYR B;  3B8N A;  1QR8 A;  1MOF A;  4YXW G;  2IJJ A;  2OTL V;  3ML0 A;  5EC1 C;  2LFR A;  2NLJ C;  3B77 A;  5CA3 A;  4RQF A;  1OCC B;  3OMA B;  4G2K A;  3LUT B;  1VQ6 V;  3ASN B;  3IC7 A;  1H2G A;  4PA9 A;  5L3F A;  2R9R B;  3EFF K;  4X8A A;  5EK0 A;  2EJR A;  4TWK A;  2HLD G;  1NBM G;  4UVC A;  2ZDI A;  1QLE B;  1RM1 C;  2XAS A;  2WSS G;  3ZN1 A;  1PNL A;  4PDV A;  3ZMV A;  1EFR G;  2C2A A;  1OCR B;  5J9P C;  2CK3 G;  3MHH C;  4PDR A;  4WF9 V;  2F43 G;  5B1N A;  3CC2 V;  2EZO A;  1MG1 A;  4KUM A;  5KA5 A;  1S76 D;  4GX1 A;  5B3S B;  1K4C C;  2YEV B;  4N21 A;  1W2B U;  1VQN V;  5LGT A;  3W7S A;  3AG3 B;  3EHB B;  3F7V C;  3K79 A;  2EIN C;  3VOU A;  3SYO A;  3OM3 B;  2WLI B;  3ZRS A;  2EBO A;  3ZRV A;  3CYO A;  2MK3 A;  1G8M A;  4PDL A;  2JEU A;  3K3W A;  1MSW D;  2ZD9 A;  4QNH B;  1JQ0 A;  2X6A A;  3W7X A;  2QA4 V;  2JIZ G;  2IH1 C;  1GK9 A;  4UVA A;  4BAY A;  1FXV A;  3M99 B;  1PKX A;  1Y4M A;  1NR7 A;  4R6Z A;  1R6K A;  1OZ0 A;  5IYD O;  1GTO A;  5GW7 A;  2BOC C;  2WPD G;  3K0G A;  1F4M A;  1THZ A;  3W7W A;  3SPJ A;  1RM1 B;  3CCJ V;  2ZDI C;  1JOY A;  1AJN A;  3JD2 A;  1FXK A;  3K04 A;  1QVG U;  1NJI W;  3OMI B;  4JYB A;  2HVJ C;  2YSU B;  1NVP D;  1M56 C;  4GT1 A;  4BW5 A;  3W7U A;  4MS2 A;  4P30 A;  3ETE A;  3I55 V;  3CCQ V;  3ABU A;  4PA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...