1VQLV

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqlV00
1Q7YW 1YHQV 3CCUV 1VQPV 2QEXV 1QVGU 1YJ9V 1YIJV 1YJWV 2OTJV 1R73A 4WFAV 1S72V 4WFBV 3CC4V 1VQMV 1VQOV 1VQ7V 1Q82W 3CMAV 3CCVV 1VQNV 1VQ5V 1YJNV 3CMEV 1VQLV 1KQSU 1VQ8V 2OTLV 3CCEV 3G71V 3G4SV 1Q86W 1M90W 1K9MW 1KD1W 3CCLV 1QVFU 3I55V 1K73W 1YITV 3CCJV 3G6EV 3OW2U 1YI2V 1W2BU 1K8AW 1KC8W 3CCMV 1NJIW 4WF9V 3CPWU 3CCQV 1N8RW 2QA4V 1M1KW 3CXCU 3CC2V 1VQ4V 3CC7V 1VQKV 3CCSV 1JJ2U 3CCRV 5DM6V 1Q81W 3CD6V 4WCEV 1VQ6V 1VQ9V 3I56V 2D3OW
chains in the Genus database with same CATH superfamily
1YCIA 4U3JB 4CBCA 4JYAB 2K9PA 4DR4O 3DXRB 1K97A 4LF6O 2X6CA 3DTUB 1T5EA 3W7UA 1Q86W 1FPOA 1Z5WA 5IYZB 1TUEB 3LNMB 4LFCB 4B7EA 2JEXA 1WPXA 3W7SA 1K33A 2KKWA 2VRZA 1P7BA 5CBHA 1QCEA 1JFFB 4FLUA 1AJNA 1IBMB 2WSSG 4DR4B 2CAZC 4OGQB 5K1XA 4LF6B 5JCOC 4QJFB 2IM9A 1YI2V 1VEWA 3FAVB 5J2TB 4DW1A 3OUFA 1NTZH 2QKCA 5JH7B 2YXYA 4CC6A 3AG3B 2ZINA 4LCUC 1MZFA 3IGAC 2RQ6A 3OUSA 4ZI7B 1VQMV 3JSNA 4TUYB 3RWRD 2Q67A 5LL6Y 1P49A 3QNEA 5CA0B 4NTYA 1Y67A 3CRCA 4K3AA 3VQWA 3AG3C 2EIJC 3JAKA 4DR1O 1K4DC 2B1IA 5EC1C 1LNQA 2ADPA 5KX5B 4B7KA 5C8YB 2CTRA 2UU9B 4DR5B 4LF7O 1D2DA 2RNBA 4PI0A 1FJGO 3GWOA 1E79G 3OEEG 2P06A 2OCHA 5JJEB 5GTHZ 1K9MW 2JIZG 2ZR3A 3RYIA 4WFGA 5LXTB 5HFMA 3JAWA 5LA6B 5LMNB 5KUMA 2WLNA 2XUMA 4YJ3A 1WN7A 4BIZA 1XMQB 2DE0X 1GKFA 5EK0A 5EBLC 4LF7B 1YJNV 1FJGB 3ZRSA 2F1MA 5CBGA 5LHGA 1XQ8A 2WLIA 4FFBA 4NXMB 4J9YB 2LGWA 5CB4A 1XI1A 1YXBA 4IIJA 5FPOA 1URFA 3CEIA 4UCTA 2YI8A 2XAFA 1BHBA 4DUZO 4PDRA 4EFEA 4UB8Z 3SJBC 3OM3B 2NR5A 5EBWC 1B6QA 2B9ZA 2M6YA 3ABTA 2DYSB 3AK3A 3CC2V 1IBKO 4AHCA 4KL1A 2D3OW 2ILMA 2Y4TA 3HKCB 3K58A 1Q7YW 1QVGU 4ICGA 1TVKA 1WA8B 2RJZA 2CH7B 2CK3G 2CGNA 1AR5A 4I5SA 4N23A 3IC9A 1VMGA 1P84F 3E22B 4QGPA 2R9AA 5L3BA 1BT8A 3LDDA 1IBKB 3BVOA 2VQEO 2V4DA 5KHHA 3A2FA 5H2FZ 3ZMUA 1QBZA 3ETDA 2OTJV 1NH2B 1VQOV 1Q3EA 1V54C 3W7XA 4TV9B 4JI1B 4BR6A 1W0KG 4C7UA 4DV3O 4IYIA 1XMOO 1YVWA 5B3SB 4GKJO 3N2KA 3SGIA 4MS2A 1M57B 3BY6A 3B8MA 4X88A 3X2QB 3AEIA 3BA9A 2QTSA 2LO1A 4IHJB 2ZKOA 1BHAA 3SPIA 3R66A 4PELA 2C2AA 4RQFA 4CC5A 5B5EZ 3JARB 4P30A 5H6QA 3E8GA 2EZOA 3CCQV 1E1QG 1SQBH 4YXWG 2WPDG 5J2UB 5GW7A 3X2QC 3MHHC 5L3EA 4ZHQA 2Q68A 2PI4A 3UT5B 3U11A 1FXVA 5KA6A 1IXBA 2PYLA 1EZVH 4JYBA 4UVAA 2OTLV 2XAQA 3VQXA 3GWKC 2QWQB 5JQGB 2CTQA 1N36B 2P67A 3HKEB 3UKMA 1H2GA 3WB1A 3JD3A 2F95B 1SERA 1I08A 1OCCB 2XHBA 2Z3YA 3FYIB 2V7QG 1L1FA 4TV8A 4PDLA 4LF5O 4CH3A 4MVQA 2ITCC 1S5LZ 1NTMH 1PNLA 2PGGA 1GRJA 5EYPA 3ZN1A 1XNRO 1AB3A 4DV1B 4GUNA 1YTFB 3F7YC 2F23A 1R6KA 2GV9A 3W7WA 3JD2A 1XL4A 2AZ0A 3VOUA 5IJ9B 2K1EA 1SC5B 1O9HA 3ETQA 5KHKA 4PHZA 2CDYA 4JF3A 1S3JA 4RO2A 2EIMB 3OR7C 1Q82W 5B1AC 1FD9A 5B1BC 3CHXA 1JMKC 1XREA 3G6BA 5CA1B 1M90W 4DUYB 4JV5B 3K59A 4GX5A 4DR2O 4ZOLB 2Q73A 4X89A 2YEVB 2VWJA 4WFEA 3AG1C 2HEPA 4LFBO 3E86A 4J41A 3EHBB 3ZMSA 1OZ0A 1GN6A 2GTAA 2KSDA 3ZHQA 3DC5A 1SETA 1K5QA 3L72H 2QR4A 1J5EB 3E8HA 3P30A 1XHZA 3RGBA 3CCLV 3N2GA 4DR2B 5LYJB 3FFQA 2EULA 3FX7A 2ZM6O 3LUTB 3FYEB 4FLXA 3OE7G 4X1KA 3SPCA 2WLKA 3ZEDA 3T4ZA 3ZS8C 3Q4HB 1HNXO 1GMGA 3UCSC 1SQVH 2ADQB 2ZE8A 2EBOA 4WFAV 2A79B 1XNQO 4HNAA 4O2BA 3ZHUA 4I4TB 1JVMA 3L75H 3STZC 1KKDA 1OCZB 5JVDA 1NKDA 1HW7A 3K0DA 4UCUA 1KBHA 4B3SO 3JYCA 1ZSPA 2IH3C 3K06A 1MSWD 2IH1C 1RSOA 5B1NA 1SQPH 3E2EA 1EFRG 4YJ2A 1HNXB 1YJWV 3HKBA 3O9OA 2UUAO 1HNZO 3H1LH 4D7SA 4JAAA 2LJ2A 1L0LH 3RYCB 1GM7A 1OCZC 4JI2O 4G27B 2A0LA 1S77D 1NTKH 3I55V 5LGUA 4W4KA 4PD4F 4DV2O 3CYOA 1VQ4V 4B3SB 1RFYA 4B3MO 1KQSU 1RM1C 4R7CA 3AG7A 2UUAB 1HNZB 2OWOA 5C93A 4K35A 3EXAA 2QWRB 4JI2B 3GB7C 2F4VO 2GHYA 5KA5A 1K73W 3AG2C 3T1YO 3ZHTA 1HNWB 3RFRA 1YEWA 1DK1A 3TCUA 1QLEC 4UV9A 1EM1A 1MNGA 4X65B 2GSMB 4UB6Z 1BQ0A 1F51A 3QF7A 5IYCO 2KG7A 4UVCA 3L9DA 2UXXA 3CS5A 2UUBO 5FPRA 1XOUA 2FKXA 5K1PA 2F4VB 5LP6A 4UCVA 4X62B 2ZE5A 1SS3A 2W6IG 4KHPB 4E2LA 1Q8IA 4JZGA 2RCVA 3CD6V 2QDOA 4JI4O 3IAYA 5HFLA 4U3JA 2A9HA 2EIKC 4TT3G 3DXRA 4MT8A 1VQ5V 1IBLB 3D36C 1H8EG 3LDEA 5IYZA 3CCJV 3T1HO 1DF5A 5JCOA 4DR6B 1XL6A 1M56B 2NNUA 3J81N 1ZL8B 4JI4B 2JJ2G 3K5MA 2YXLA 1MZEA 3UO3A 1MOFA 3E89A 1IURA 3C3SA 3GVMA 2HG5C 4GYCB 3QO8A 4DR3O 1V55B 2WLLA 1NQTA 2E76B 1M56C 1WNSA 3C3TA 3FAVA 3ABMC 3MAQA 5GONB 5A2QN 5FLXN 3CRRA 5BY1A 4UFZA 1H2LA 1COWG 2R70A 1V55C 4ZI7A 3K57A 4AI8A 1R6NA 4TUYA 3H9VA 5CA0A 5J9PC 2Q7GA 1I94O 3BCCH 3SJQC 2ZE6A 4JI6O 1NVPD 4BAYA 1AP6A 2Y0PA 4MW3A 3D3QA 1YZBA 2MW2B 1TA8A 2BOCC 2A3QA 1FFXA 2YXHA 4GT1A 2GDSA 4ABMA 3ZIAG 1JR9A 3K9AA 5LA6A 3H1KH 5DM6V 3WG7B 4MVRA 5E1AC 4QE9A 4O4JB 2BSKB 3SR2C 3BAAA 1K4CC 4J80A 1Q6UA 1KUQA 5LGTA 4O4IA 3RT3C 3L71H 2FYUH 1OV9A 4R50A 1PV0A 5LBQA 1DF4A 2WLHA 3LSUA 1LUWA 4I55B 4X66O 4K0KB 3RYFB 1JJ2U 5KHIA 1IXMA 3AK2A 2X7RB 3QO5A 1R73A 2ZXWB 2HJDA 3ICXA 4DV0O 2EZPA 4FLYA 1PD3A 1Q90D 2AXTZ 3CRMA 2ITDC 4X66B 2YSUB 1NT2B 3U10A 4KFMA 2ZXWC 3HKCA 1MSDA 1NR1A 2EJRA 1R3LC 4LC1A 3B8NA 3BPZA 2CUGA 3TXSA 5ITZA 1H2MA 5LHHA 3L74H 4UV8A 2GUZB 3HKDA 1QHTA 3CSXA 1F4NA 1OHHG 4N21A 4O4HB 2EJ7A 1LUVA 1VF6C 1BZKA 3KKYA 2JEUA 4O4LA 2PYJA 2P90A 1SQFA 5KAFZ 4O2AB 3VQVA 1RP3B 2HP8A 1CPYA 1Q5OA 4X1YB 3NXSA 2JS3A 2QA4V 1SZXA 2YIBD 2QJ1A 5L3DA 1UFIA 3FB6C 4DR1B 3TGUH 2BTOA 4IHJA 3N27A 3ML0A 4YY3O 4IT5A 1Y6XA 3T1CA 2AW9A 4KXRA 1R1BA 1Q43A 4JPRA 1Z5VA 1Y4MA 2RMKB 5DEDA 3JALA 1BMFG 4R6ZA 4WBNA 3RYHA 3SYCA 1JJOA 3H1JH 1VIBA 3L70H 3VQYA 2R9RB 1VF7A 4MVUA 5JQGA 4EEQA 4JYCA 3HKEA 4YY3B 4H33A 4JI0O 2IJKA 4QPKA 1Y76B 5L3FA 1E1RG 3WB2A 3BEHA 5L3CA 1AILA 4J7JA 1ZTEA 1QR8A 2GBOA 1XHXA 2JGDA 4DUZB 2DYSC 1FAFA 1AVMA 2G38A 4JI0B 5IJ9A 1G4YB 1K3EA 3S3WA 1NI8A 3CRQA 4GLXA 2IBZH 4LNUA 2BCCH 5FNVB 1ZWIC 4MW8A 2B5UA 4LFAO 4H0LB 3BRCA 4CS3A 2WA3A 4FM1A 1JA8A 3A0HZ 5CA1A 1FXKB 3TETA 1AR4A 3RVZA 2ETNA 4MVSA 2UUCO 3P3NA 3SYPA 2YEVA 4EB6A 2AHYA 1WPBA 1N8RW 5IYDO 2YICA 1R3KC 3JAKB 1WAZA 4NTXA 1K7DA 2VQEB 1EN4A 4FK5C 2OIEA 4PJ0Z 4LFAB 5H9CA 3CE2A 1FXKC 4JAUA 4WFFA 3RYIB 5B3SC 1THZA 2YS8A 3ETEA 2Q4PA 4DV3B 2IW5A 2RDCA 1M57C 1XMOB 2BTQB 4GKJB 1DLBA 4YJ3B 4JI7O 3K9SA 3Q4HA 2FB5A 3SPHA 3R65A 4DV6O 4DV4O 4JI3O 4ZBMA 2OIGA 3W7TA 4D7TA 1YF2A 2Z5UA 2WLIB 3BFRA 2JS5A 3SYQA 2HR3A 4IIJB 1MG1A 2P22C 1I0HA 4ZIBA 4DV7O 3VBBA 3IFXA 3F5TA 4I9WA 4GKKO 3CX5F 1YDXA 3RYCA 4MSWC 3MD0A 1OCCC 2WAMA 1HR0O 4RAIA 3ZRWA 3QTCA 2H3OA 3D8CA 3JATB 4DXWA 4LF5B 3CXCU 2JJ1G 1PNKA 4ZKIA 2Q69A 4I0XB 4DV7B 4R8CA 1MABG 1DTOA 2R9IA 1XNRB 2KQXA 1VF5B 3K5OA 1HR0B 5KHJA 2ZIOA 2E3CA 4RUFA 4NVPA 1JOYA 2E74B 3ASNB 2N04A 3CCUV 4PA7A 2EIMC 3S3XA 2R72A 4U7OA 4PV1B 1H2NA 2WA4A 2NN4A 5AG2A 4DYLA 5DN6G 3D36A 4LF4O 4DV5O 1DGSA 3CPWU 4DK1A 3ZMVA 3N2KB 2Q0OC 4LFBB 2Q0AA 4UVBA 1QNMA 3F5WC 5IDJA 4XDKA 2LW7A 3J7AU 4JYYA 4DR7O 3I5DA 1U96A 3SYOA 1TUBB 5LOVA 1KP3A 4L8JA 1NH2D 1UPGA 1TGOA 5BR8O 2ZM6B 4TQDA 1VQ6V 4ZHQB 3A8TA 2P7TC 3JASA 4NXNO 2QE7G 4B08A 1NZ6A 4D6TH 1B3QA 2CTWA 1VQLV 1XNQB 1M4UA 3QG5A 4NYKA 1M93A 4P9PA 2YIBA 3M7MX 2BE3A 1KP2A 1I7FA 4P9OA 4XBFA 4DRXA 3K04A 1PNMA 2BOBC 4TV8B 1AJQA 1SQXH 2MK3A 4K8XA 1SQGA 1GN4A 4YIPA 4FM2A 1N33O 3A0RA 4OX9O 3CC4V 1SA0A 3ABLB 4JAVA 1VQ8V 1HP8A 2DWEC 4PDMA 1S76D 4NR1A 1Y74A 4UXNA 4DV2B 1GN3A 3IC7A 4QE7A 3K08A 4LWSB 4ASUG 4MTFA 3B40A 3ZN0A 4BW5A 4B3RO 3ABLC 1GAXA 5CA3A 4B3MB 4X20B 5CBFA 4OX9B 3KCYA 1L8DA 3CJHA 1JCHA 3SPGA 2X6AA 2XAJA 4Q6GA 2DYRB 3T1YB 3E8BA 4PA3A 1YTFD 4QPJA 1Q81W 4O4JA 2GTSA 3OAAG 1NU1H 3OTOO 3ZBHA 4HZ3A 4H13B 2B1GA 1L0NH 3SJCC 4G28B 2UUBB 3DSQA 4FLWA 3N2GB 2Q8VA 1SF9A 1K8AW 2XOKG 1SESA 4XDLA 4X1KB 4LP8A 1Q6IA 1JFFA 4GX1A 2HFEC 5IE9A 2WWWA 4I50B 3OTOB 4U3FH 1QU7A 4HNAB 3B77A 4O2BB 2PZSA 3OMNB 4YHHO 1LR1A 5EZYB 4BIUA 3AG4B 1QVFU 4AQYO 4MTXA 5LMUO 1W2BU 3T1HB 3QVNA 4U7NA 3L73H 5J2TA 3CCSV 5JH7A 2LFSA 1XDCA 3MHSC 1RSOB 2DQ3A 4YJ2B 3ZRVA 1K92A 3HKBB 1XEQA 3M99B 5E79Z 2W6JG 2ZDIC 4FZ0A 4LF8O 1VF6A 3BHPA 2YUAA 4JTCB 5CN0A 4DR3B 1CEZA 4AQYB 4FVMA 3UO2A 4FLVA 4J10A 2CTPA 2Q9LA 4GZRB 3C90A 4RUEA 4UCRA 2LQTA 3DC6A 2EILB 2QSAA 3B4SA 4JI5O 3CCRV 1M5IA 1GM9A 3JAMN 3WU2Z 2P6JA 1KECA 5KX5A 2QM8A 5IY5B 5C8YA 4TOIA 3P3PA 4TQFA 1K5SA 2QWPB 1AP5A 4PA6A 2RN9A 1KYOF 2FTKA 2FMLA 4OXSA 3E83A 4O2AA 3IJ4A 3OW2U 4JI8O 1I94B 1A32A 4L87A 5LXTA 1AI6A 2O57A 4CZZA 4JI6B 2Q5ZA 2UXCO 3QO7A 1WB8A 2OYQA 4JYAO 1QLNA 4H44B 2W0XA 2ZD9A 3K79A 4LH7A 5LP6B 3ETGA 2DN9A 2YC0A 5H5NA 2EX3A 3T2MA 4B3TO 3WG7C 5KHGA 3M8AA 3JCZA 2F66C 3ZMTA 2DMXA 1IBMO 1NR7A 1OCRB 2JVDA 5JJNB 3KZIZ 4YIOA 5LP6C 1ZAUA 2WLJA 4MTOA 4FMTA 5B1OA 1BSMA 4MVMA 2AGAA 5IJ0B 3OGIB 4B3TB 4FM0A 2LFRA 2ZCEA 1OCRC 5LHIA 1Y76A 3H1HH 2FL4A 2ZIMA 4Z1VA 3U0ZA 4IGGA 5FL7G 3NR7A 1WA8A 3CCVV 1R6TA 1WLEA 4GX0A 2CH7A 2WLLB 5JJJB 4DV0B 5KAIZ 2E5LO 1ROPA 3E22A 1OCOB 4NKGB 4F6RB 2AZ2A 3MDSA 2ATKC 5FNVA 2EINB 2EIJB 4X1IB 3H1IH 5BMVB 1K34A 5KMGB 1YIJV 2UU9O 3RVYA 3FB8C 4LH6A 4DR5O 4I9QA 1SKVA 4LR3A 4FPPA 3BABA 4TWKA 4TV9A 1FXKA 1FXHA 1OCOC 3K5NA 1HWYA 3WB0A 2E5LB 2Q7HA 5LMNO 2EINC 2HLDG 1KU9A 1XMQO 5LGNA 2YIDA 1M9NA 5CMUA 2XASA 2PF4E 3UQ8A 1BE3H 1VQ7V 1FFXB 2PI5A 1GK9A 5TISZ 4JZ2A 2YI9A 1AJPA 3H01A 2JRIA 3BA8A 1YITV 1WP8A 1ZX3A 3JARA 4NXMO 2HJFC 2QWOB 4FLTA 3WFVA 1IZ3A 2BTQA 2YDEA 3JD0A 5BZBA 5J2UA 4LBEC 4CS4A 3E35A 2Q7EA 1PP9H 3RBZA 3UT5A 4K8ZA 4MVOA 3LSSA 2F43G 3RW0A 1GH6A 3A0BZ 3CMAV 5B66Z 4O4IB 2OCCB 5EBMC 1J95A 2Z0AA 5KUKA 2QKSA 3ZHRA 2IJJA 1M1KW 1US6A 1I5YA 5EC2C 3ZHSA 3OGCC 2P4VA 1EBOA 2OCCC 1BL8A 2UXBO 2PUSA 1I5XA 1PKXA 2Y69B 2Y48A 1QQCA 1AI4A 1KC8W 3OR6C 4WF9V 3FB7C 1D5NA 3JATA 1N34O 1SZTA 3THOA 4I0XA 2M7WA 1SRYA 2Y69C 4JI1O 2UXBB 2CE4A 1D5AA 3JSLA 1V54B 2QM4A 4OPAA 2LGQA 1UJWB 1X59A 5ITZB 4ZOLA 5D5QA 4BWAA 3HKDB 3CRAA 2CGOA 2L35A 1AI7A 2D2CB 3CB2A 3EVKA 3J80N 2AHZA 1N34B 2PTMA 3OT7A 3JD4A 3ZX6A 1X4TA 2VWKA 1N0NA 3OTFA 1NS1A 4O4LB 4Q20A 1WJZA 1Q6HA 2YIAA 2ZE7A 1F7YA 2UUCB 1JPXA 1N0JA 1N4CA 2P4KA 4FFKA 5LYJA 2XAHA 3OFNG 4X8AA 1BS3A 3JAWB 1IDSA 3ZMZA 2N05A 5IT9N 3STLC 1RPRA 3ZCCA 1VARA 3OD4A 1GTOA 1GO3F 1AI5A 4BIOA 4J11A 1TUBA 3B2EE 3G67A 3CCEV 1N36O 4I4TA 1HDJA 1S5JA 4GCZA 3LNNA 4FFBB 3CCMV 1CXZB 3JALB 5CB4B 4WBNB 4UCOA 3F7VC 4PA4A 3ZHVA 1XBLA 1OJHA 3CP1A 3RYHB 4JI7B 2A7WA 5D5PA 1MMMA 3TJTA 4DV1O 4DV6B 4KUMA 1RPOA 4DV4B 2ZNJA 4JI3B 1IVSA 1PPJH 3KCXA 4FLZA 3SDLA 4GX2A 2ARHA 4BW9A 2QKAA 3ABKB 3APOA 1SQQH 4KP4A 4RQEA 1H8HG 4HAMA 3LSQA 2LW1A 2IU0A 2JGUA 4HYOA 3UM7A 2IJIA 1TVKB 4J42A 2JGDB 2WLMA 2W0FC 1N32O 4CH6A 4GKKB 4DUYO 4JV5O 4QNHB 2OT5A 5B1AB 2KB1A 5B1BB 3K0GA 5EIBC 4NB5A 2HHHO 4NTWA 3ABKC 4J9ZB 4LWSA 4LNUB 2N74A 3AG1B 2P5OA 1Y66A 4JGSA 1YHQV 5KLVH 4X20A 2XT9A 4EKWA 4Z2WA 2QTOA 2Q6AA 1VQNV 1J5EO 1N32B 3TK1A 1NBMG 2VQFO 3ASOB 1KMIZ 4EB6B 1V9PA 2HHHB 1CP9A 3CXHF 3ASNC 2X0LA 1WB7A 4E4EA 3OMAB 3SYAA 4UCSA 4G2KA 1GM8A 4PDVA 4JTAB 1MA1A 2NLJC 3ASOC 1FKAO 1GN2A 4DW0A 1Z2GA 2VQFB 5GTIZ 1P4RA 4FIPC 3G6EV 4F6EA 2IU3A 2VS0A 3E8FA 1H2SB 4LF4B 4DV5B 4HBNA 4PI2A 4IL6Z 1ZL8A 1TAEA 1VP7A 4I50A 3OMIB 1B06A 4TSFG 1B04A 3K3WA 4DR7B 3DGEA 1NVPB 2ZDIA 5EZYA 4PA9A 4F4LA 1F23A 4X9QA 5IYBO 2DOSA 4A5UB 4W4LA 5F2VO 1AR1B 1R3IC 5GONA 4OPHA 4JTDB 5BR8B 1EN5A 2QM7A 1ZLZA 3I56V 3HR0A 4NXNB 1BQZA 1FS0G 5EYPB 1RM1B 3K03A 3JCUZ 3G71V 1F4MA 3G4SV 1H38A 2QGNA 5BXZA 1HNWO 3ZRWB 3O65A 5A9GA 3AG2B 2L6LA 4CH4A 4DO2A 4FZ1A 5L3GA 4FJCC 1QLEB 4X65O 4XDJA 2ZT9B 3HPLC 2A06H 1N33B 4RWUA 4P2ZA 3G80A 3RN4A 2ZNIA 1R3JC 4X62O 2Y0IA 2XNDG 4KHPO 1FYJA 2DW4A 4I7ZB 1U97A 2HKOA 1PL0A 3ABUA 2DWDC 2IJHA 2H8PC 2QEXV 5EIBD 1KB9F 2BSKA 4B3RB 2PY5A 4CS2A 1S72V 2UXDO 3AK1A 3OEHG 1PL4A 4X64O 1IBLO 2EIKB 1KD1W 2JDIG 2ZR2A 3B09A 4EFBA 2DYRC 3PJSK 4DR6O 4AILC 1O9GA 4I55A 4JASA 3KG2A 1YSCA 2X6BA 2UXNA 3RYFA 1W0JG 2XAGA 3K5LA 2UXDB 2DJVA 4X64B 3CMEV 2ODMA 5LOVB 5IWAO 5H6RA 2HVJC 5IJ0A 3LDCA 5JVDB 1S0VA 1JQ0A 1PM9A 3ABMB 5DECA 1G8MA 1XILA 1ZUQA 3JASB 1FFTB 3FKSG 1AROP 2H94A 3AG4C 4WFHA 2ZQMA 4LF9O 3P32A 5IWAB 4YHHB 3EFFK 3PN1A 1QR9A 3CWBH 4DRXB 3T4DA 5LMUB 1XUQA 1ENVA 2GUZA 4J7ZA 1P7GA 2F93B 4F6RA 3FB5C 4J7KA 1VQ9V 4X1IA 4O4HA 5BMVA 3APQA 1VQPV 5KMGA 1YJ9V 1IX9A 3SJAC 1SA0B 4LF9B 1BCCH 4QIWF 4LF8B 1JX9A 3SPJA 1G1XB 1EZJA 1Y74B 4MTGA 2EILC 2XTAA 4X1YA 1BGYH 1WP7A 3TXQA 1W59A 3FD9A 2DQ0A 3ZRXA 4JI5B 4WCEV 5IY5C 1KKCA 4H37A 3HB3B 1G6UA 5JWPA 3D3IA 2JK5C 4CH5A 2KG7B 4WFBV 4UUJC 1H2KA 2E75B 1EN6A 2Y4UA 4IYHA 1ORQC 3CJHB 4LFCO 1NJIW 4JI8B 1S5HC 4MVZA 4K0KO 4DK0A 4Z1MG 3ZJZA 3CC7V 1VQKV 2HVKC 2UXCB 2QWNB 2V1DA 2LP7A 3JD1A
chains in the Genus database with same CATH topology
2GSMB 1F51A 1PNKA 4CBCA 4ZKIA 2Q69A 1EBOA 4R8CA 5IYCO 2OCCC 4UVCA 1K97A 1MABG 1DTOA 1BL8A 2UXXA 2R9IA 2X6CA 3DTUB 1I5XA 3W7UA 1Q86W 1PKXA 2Y69B 2Y48A 1TUEB 2W6IG 1AI4A 1KC8W 3LNMB 3OR6C 4WF9V 4E2LA 2JEXA 1WPXA 4RUFA 3W7SA 1JOYA 1K33A 3FB7C 3ASNB 3CD6V 1P7BA 5CBHA 5HFLA 1QCEA 1SZTA 3CCUV 4PA7A 2EIMC 1AJNA 2A9HA 2M7WA 2EIKC 2WSSG 4TT3G 1SRYA 4MT8A 4U7OA 2Y69C 1VQ5V 5DN6G 1H8EG 3LDEA 1V54B 4QJFB 1UJWB 3CCJV 1YI2V 1DF5A 3D36A 1XL6A 3CPWU 1M56B 3ZMVA 1AI7A 3OUFA 2NNUA 4UVBA 3F5WC 5IDJA 2AHZA 3AG3B 4XDKA 2JJ2G 4LCUC 3IGAC 3JD4A 1MOFA 3E89A 3OUSA 1VQMV 2HG5C 2Q67A 3SYOA 3QNEA 3QO8A 4Q20A 1V55B 2WLLA 1NQTA 1M56C 1KP3A 1NH2D 1JPXA 2XAHA 3OFNG 4X8AA 3ABMC 3AG3C 3ZMZA 2EIJC 3STLC 1RPRA 1VQ6V 2P7TC 1K4DC 3ZCCA 2B1IA 5EC1C 1LNQA 2QE7G 1GTOA 1GO3F 1AI5A 1COWG 1V55C 1R6NA 1VQLV 3GWOA 3CCEV 1E79G 3OEEG 5J9PC 1K9MW 3OGCC 4P9PA 2JIZG 2ZR3A 4GCZA 1KP2A 4P9OA 4XBFA 4WFGA 3CCMV 3K04A 3SJQC 5HFMA 1PNMA 2BOBC 1NVPD 1AJQA 3F7VC 4PA4A 5KUMA 4BAYA 2WLNA 3CP1A 4MW3A 2MK3A 4BIZA 1GKFA 5EK0A 5EBLC 2BOCC 3A0RA 3CC4V 3ABLB 4KUMA 4JAVA 1RPOA 1YJNV 1VQ8V 3ZRSA 5CBGA 5LHGA 4GT1A 2DWEC 3ZIAG 4PDMA 2WLIA 1S76D 4UXNA 4J9YB 3K9AA 3IC7A 4GX2A 4QE7A 3K08A 4ASUG 4MTFA 5DM6V 3ABKB 4KP4A 4MVRA 3WG7B 4RQEA 3ZN0A 1H8HG 5E1AC 4BW5A 4QE9A 2XAFA 3ABLC 4HAMA 3LSQA 5CA3A 2IU0A 4HYOA 3UM7A 1K4CC 2IJIA 1BHBA 5CBFA 2WLMA 2W0FC 4PDRA 5LGTA 4QNHB 2OT5A 5B1AB 2KB1A 5B1BB 3K0GA 3OM3B 1JCHA 3SPGA 5EBWC 2X6AA 2XAJA 4R50A 1B6QA 5LBQA 2DYRB 1DF4A 3ABKC 2WLHA 3ABTA 2DYSB 3E8BA 4J9ZB 4PA3A 1YTFD 3CC2V 4QPJA 1JJ2U 3AG1B 1IXMA 1Q81W 1Y66A 2X7RB 2D3OW 4JGSA 1YHQV 3OAAG 1Q7YW 1QVGU 3QO5A 4HZ3A 1R73A 2ZXWB 4EKWA 2QTOA 2Q6AA 1VQNV 2B1GA 3TK1A 4G28B 1NBMG 2CK3G 3ASOB 4I5SA 2EZPA 4N23A 1PD3A 1K8AW 1CP9A 2XOKG 1SESA 5L3BA 3ASNC 2X0LA 4XDLA 2ITDC 3LDDA 2YSUB 4LP8A 3OMAB 3SYAA 4KFMA 2ZXWC 4G2KA 1NR1A 1GM8A 2EJRA 3ZMUA 4PDVA 4GX1A 1R3LC 2HFEC 4JTAB 2WWWA 1QBZA 3ETDA 2OTJV 2NLJC 4LC1A 1NH2B 1VQOV 3ASOC 3B77A 3B8NA 1V54C 3W7XA 3OMNB 4BIUA 3AG4B 1QVFU 4MTXA 1P4RA 4FIPC 3G6EV 1W0KG 1W2BU 5LHHA 2IU3A 4UV8A 3E8FA 4U7NA 5B3SB 1F4NA 1OHHG 4N21A 3CCSV 2LFSA 3MHSC 4MS2A 1M57B 3BY6A 3B8MA 2DQ3A 4X88A 3ZRVA 1K92A 3X2QB 3OMIB 3M99B 4TSFG 2W6JG 2ZDIC 3AEIA 3K3WA 2JEUA 1BHAA 3DGEA 4PELA 3SPIA 1NVPB 2ZDIA 4JTCB 5CN0A 4PA9A 4F4LA 2P90A 2C2AA 1CEZA 1F23A 4RQFA 4P30A 5IYBO 1CPYA 5H6QA 3E8GA 2EZOA 3NXSA 3CCQV 2QA4V 1E1QG 4YXWG 1AR1B 1R3IC 4RUEA 2WPDG 4JTDB 2EILB 5GW7A 3CCRV 3X2QC 2QM7A 1GM9A 3MHHC 5L3EA 5L3DA 3I56V 2Q68A 3FB6C 2PI4A 2P6JA 1KECA 1FXVA 2QM8A 5IY5B 5KA6A 1FS0G 1RM1B 3K03A 1K5SA 4JYBA 4UVAA 2OTLV 4PA6A 3ML0A 2FTKA 1F4MA 2XAQA 3G71V 4OXSA 3G4SV 1H38A 3E83A 2P67A 3T1CA 3UKMA 1H2GA 3OW2U 3JD3A 3ZRWB 4L87A 1SERA 1OCCB 4JPRA 1Y4MA 2Z3YA 3FYIB 3AG2B 1AI6A 2V7QG 1L1FA 4CZZA 4PDLA 1BMFG 4R6ZA 4DO2A 3QO7A 5L3GA 4FJCC 1QLEB 4MVQA 4XDJA 2ITCC 3SYCA 3HPLC 1QLNA 1PNLA 3ZN1A 4P2ZA 2ZD9A 2R9RB 3K79A 1YTFB 3F7YC 1R3JC 1R6KA 4MVUA 3W7WA 4JYCA 2XNDG 3ETGA 3JD2A 1XL4A 2DW4A 4H33A 3T2MA 3VOUA 3WG7C 2HKOA 1PL0A 2K1EA 2IJKA 3ABUA 3JCZA 2DWDC 2IJHA 3ZMTA 4QPKA 2H8PC 5L3FA 1E1RG 3BEHA 2QEXV 1NR7A 1OCRB 5L3CA 1QR8A 4JF3A 1S3JA 4RO2A 1S72V 2EIMB 3OEHG 3OR7C 1Q82W 5B1AC 2EIKB 5B1BC 2WLJA 4MTOA 1M90W 1KD1W 2JDIG 2ZR2A 2DYRC 3PJSK 4FMTA 4GX5A 2DYSC 5B1OA 4MVMA 4X89A 2YEVB 4WFEA 3AG1C 1G4YB 1K3EA 3E86A 2LFRA 4JASA 1OCRC 1YSCA 3KG2A 2X6BA 2UXNA 5LHIA 3EHBB 3ZMSA 2XAGA 1W0JG 1ZWIC 4MW8A 2B5UA 1OZ0A 5FL7G 1SETA 3CCVV 4GX0A 1WLEA 3CMEV 1K5QA 2WLLB 3E8HA 1FXKB 3P30A 3RVZA 3TETA 4MVSA 3CCLV 3SYPA 5H6RA 2HVJC 1ROPA 2YEVA 2AHYA 3LDCA 1OCOB 1N8RW 5IYDO 3LUTB 3FYEB 1S0VA 1JQ0A 3OE7G 3ABMB 1R3KC 1G8MA 1K7DA 2ATKC 2WLKA 3SPCA 1FFTB 2EINB 2EIJB 3T4ZA 4FK5C 3FKSG 1K34A 1GMGA 1AROP 5H9CA 1YIJV 3RVYA 2EBOA 3FB8C 4WFAV 2A79B 1FXKC 2H94A 4JAUA 3AG4C 4WFHA 2ZQMA 4FPPA 3P32A 4TWKA 1FXKA 1FXHA 1JVMA 1OCOC 3EFFK 4WFFA 1QR9A 1HWYA 3STZC 1KKDA 5B3SC 1OCZB 3T4DA 1NKDA 1THZA 1ENVA 3ETEA 3K0DA 2EINC 2HLDG 2IW5A 1M57C 3JYCA 3FB5C 3K06A 2IH3C 1DLBA 1MSWD 2IH1C 5B1NA 1VQ9V 5LGNA 3SPHA 3E2EA 1EFRG 1VQPV 1M9NA 3R65A 1YJ9V 5CMUA 1YJWV 2XASA 1VQ7V 4ZBMA 2PI5A 1GK9A 1GM7A 1OCZC 4QIWF 4G27B 1AJPA 1JX9A 2A0LA 3W7TA 1S77D 3H01A 3SPJA 3I55V 1YITV 2Z5UA 5LGUA 2WLIB 1EZJA 2HJFC 4MTGA 3SYQA 2EILC 2HR3A 3CYOA 1VQ4V 3WFVA 1MG1A 5BZBA 3JD0A 2DQ0A 3ZRXA 4WCEV 5IY5C 1KQSU 4LBEC 4H37A 3HB3B 3E35A 1RM1C 4R7CA 3RBZA 3D3IA 2JK5C 3VBBA 3IFXA 4MVOA 3LSSA 2F43G 3RW0A 4WFBV 4UUJC 4I9WA 5C93A 3CMAV 2OCCB 5EBMC 4MSWC 1ORQC 3MD0A 1J95A 3GB7C 1OCCC 2WAMA 2GHYA 5KUKA 5KA5A 1K73W 3AG2C 2QKSA 4RAIA 3ZRWA 1NJIW 1S5HC 4MVZA 4Z1MG 2IJJA 1M1KW 3TCUA 3ZJZA 1QLEC 4UV9A 3CC7V 1VQKV 1I5YA 2HVKC 5EC2C 4DXWA 2V1DA 2LP7A 3CXCU 3JD1A 2JJ1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y W;  1YHQ V;  3CCU V;  1VQP V;  2QEX V;  1QVG U;  1YJ9 V;  1YIJ V;  1YJW V;  2OTJ V;  1R73 A;  4WFA V;  1S72 V;  4WFB V;  3CC4 V;  1VQM V;  1VQO V;  1VQ7 V;  1Q82 W;  3CMA V;  3CCV V;  1VQN V;  1VQ5 V;  1YJN V;  3CME V;  1VQL V;  1KQS U;  1VQ8 V;  2OTL V;  3CCE V;  3G71 V;  3G4S V;  1Q86 W;  1M90 W;  1K9M W;  1KD1 W;  3CCL V;  1QVF U;  3I55 V;  1K73 W;  1YIT V;  3CCJ V;  3G6E V;  3OW2 U;  1YI2 V;  1W2B U;  1K8A W;  1KC8 W;  3CCM V;  1NJI W;  4WF9 V;  3CPW U;  3CCQ V;  1N8R W;  2QA4 V;  1M1K W;  3CXC U;  3CC2 V;  1VQ4 V;  3CC7 V;  1VQK V;  3CCS V;  1JJ2 U;  3CCR V;  5DM6 V;  1Q81 W;  3CD6 V;  4WCE V;  1VQ6 V;  1VQ9 V;  3I56 V;  2D3O W; 
#chains in the Genus database with same CATH topology
 1YCI A;  4U3J B;  4CBC A;  4JYA B;  2K9P A;  4DR4 O;  3DXR B;  1K97 A;  4LF6 O;  2X6C A;  3DTU B;  1T5E A;  3W7U A;  1Q86 W;  1FPO A;  1Z5W A;  5IYZ B;  1TUE B;  3LNM B;  4LFC B;  4B7E A;  2JEX A;  1WPX A;  3W7S A;  1K33 A;  2KKW A;  2VRZ A;  1P7B A;  5CBH A;  1QCE A;  1JFF B;  4FLU A;  1AJN A;  1IBM B;  2WSS G;  4DR4 B;  2CAZ C;  4OGQ B;  5K1X A;  4LF6 B;  5JCO C;  4QJF B;  2IM9 A;  1YI2 V;  1VEW A;  3FAV B;  5J2T B;  4DW1 A;  3OUF A;  1NTZ H;  2QKC A;  5JH7 B;  2YXY A;  4CC6 A;  3AG3 B;  2ZIN A;  4LCU C;  1MZF A;  3IGA C;  2RQ6 A;  3OUS A;  4ZI7 B;  1VQM V;  3JSN A;  4TUY B;  3RWR D;  2Q67 A;  5LL6 Y;  1P49 A;  3QNE A;  5CA0 B;  4NTY A;  1Y67 A;  3CRC A;  4K3A A;  3VQW A;  3AG3 C;  2EIJ C;  3JAK A;  4DR1 O;  1K4D C;  2B1I A;  5EC1 C;  1LNQ A;  2ADP A;  5KX5 B;  4B7K A;  5C8Y B;  2CTR A;  2UU9 B;  4DR5 B;  4LF7 O;  1D2D A;  2RNB A;  4PI0 A;  1FJG O;  3GWO A;  1E79 G;  3OEE G;  2P06 A;  2OCH A;  5JJE B;  5GTH Z;  1K9M W;  2JIZ G;  2ZR3 A;  3RYI A;  4WFG A;  5LXT B;  5HFM A;  3JAW A;  5LA6 B;  5LMN B;  5KUM A;  2WLN A;  2XUM A;  4YJ3 A;  1WN7 A;  4BIZ A;  1XMQ B;  2DE0 X;  1GKF A;  5EK0 A;  5EBL C;  4LF7 B;  1YJN V;  1FJG B;  3ZRS A;  2F1M A;  5CBG A;  5LHG A;  1XQ8 A;  2WLI A;  4FFB A;  4NXM B;  4J9Y B;  2LGW A;  5CB4 A;  1XI1 A;  1YXB A;  4IIJ A;  5FPO A;  1URF A;  3CEI A;  4UCT A;  2YI8 A;  2XAF A;  1BHB A;  4DUZ O;  4PDR A;  4EFE A;  4UB8 Z;  3SJB C;  3OM3 B;  2NR5 A;  5EBW C;  1B6Q A;  2B9Z A;  2M6Y A;  3ABT A;  2DYS B;  3AK3 A;  3CC2 V;  1IBK O;  4AHC A;  4KL1 A;  2D3O W;  2ILM A;  2Y4T A;  3HKC B;  3K58 A;  1Q7Y W;  1QVG U;  4ICG A;  1TVK A;  1WA8 B;  2RJZ A;  2CH7 B;  2CK3 G;  2CGN A;  1AR5 A;  4I5S A;  4N23 A;  3IC9 A;  1VMG A;  1P84 F;  3E22 B;  4QGP A;  2R9A A;  5L3B A;  1BT8 A;  3LDD A;  1IBK B;  3BVO A;  2VQE O;  2V4D A;  5KHH A;  3A2F A;  5H2F Z;  3ZMU A;  1QBZ A;  3ETD A;  2OTJ V;  1NH2 B;  1VQO V;  1Q3E A;  1V54 C;  3W7X A;  4TV9 B;  4JI1 B;  4BR6 A;  1W0K G;  4C7U A;  4DV3 O;  4IYI A;  1XMO O;  1YVW A;  5B3S B;  4GKJ O;  3N2K A;  3SGI A;  4MS2 A;  1M57 B;  3BY6 A;  3B8M A;  4X88 A;  3X2Q B;  3AEI A;  3BA9 A;  2QTS A;  2LO1 A;  4IHJ B;  2ZKO A;  1BHA A;  3SPI A;  3R66 A;  4PEL A;  2C2A A;  4RQF A;  4CC5 A;  5B5E Z;  3JAR B;  4P30 A;  5H6Q A;  3E8G A;  2EZO A;  3CCQ V;  1E1Q G;  1SQB H;  4YXW G;  2WPD G;  5J2U B;  5GW7 A;  3X2Q C;  3MHH C;  5L3E A;  4ZHQ A;  2Q68 A;  2PI4 A;  3UT5 B;  3U11 A;  1FXV A;  5KA6 A;  1IXB A;  2PYL A;  1EZV H;  4JYB A;  4UVA A;  2OTL V;  2XAQ A;  3VQX A;  3GWK C;  2QWQ B;  5JQG B;  2CTQ A;  1N36 B;  2P67 A;  3HKE B;  3UKM A;  1H2G A;  3WB1 A;  3JD3 A;  2F95 B;  1SER A;  1I08 A;  1OCC B;  2XHB A;  2Z3Y A;  3FYI B;  2V7Q G;  1L1F A;  4TV8 A;  4PDL A;  4LF5 O;  4CH3 A;  4MVQ A;  2ITC C;  1S5L Z;  1NTM H;  1PNL A;  2PGG A;  1GRJ A;  5EYP A;  3ZN1 A;  1XNR O;  1AB3 A;  4DV1 B;  4GUN A;  1YTF B;  3F7Y C;  2F23 A;  1R6K A;  2GV9 A;  3W7W A;  3JD2 A;  1XL4 A;  2AZ0 A;  3VOU A;  5IJ9 B;  2K1E A;  1SC5 B;  1O9H A;  3ETQ A;  5KHK A;  4PHZ A;  2CDY A;  4JF3 A;  1S3J A;  4RO2 A;  2EIM B;  3OR7 C;  1Q82 W;  5B1A C;  1FD9 A;  5B1B C;  3CHX A;  1JMK C;  1XRE A;  3G6B A;  5CA1 B;  1M90 W;  4DUY B;  4JV5 B;  3K59 A;  4GX5 A;  4DR2 O;  4ZOL B;  2Q73 A;  4X89 A;  2YEV B;  2VWJ A;  4WFE A;  3AG1 C;  2HEP A;  4LFB O;  3E86 A;  4J41 A;  3EHB B;  3ZMS A;  1OZ0 A;  1GN6 A;  2GTA A;  2KSD A;  3ZHQ A;  3DC5 A;  1SET A;  1K5Q A;  3L72 H;  2QR4 A;  1J5E B;  3E8H A;  3P30 A;  1XHZ A;  3RGB A;  3CCL V;  3N2G A;  4DR2 B;  5LYJ B;  3FFQ A;  2EUL A;  3FX7 A;  2ZM6 O;  3LUT B;  3FYE B;  4FLX A;  3OE7 G;  4X1K A;  3SPC A;  2WLK A;  3ZED A;  3T4Z A;  3ZS8 C;  3Q4H B;  1HNX O;  1GMG A;  3UCS C;  1SQV H;  2ADQ B;  2ZE8 A;  2EBO A;  4WFA V;  2A79 B;  1XNQ O;  4HNA A;  4O2B A;  3ZHU A;  4I4T B;  1JVM A;  3L75 H;  3STZ C;  1KKD A;  1OCZ B;  5JVD A;  1NKD A;  1HW7 A;  3K0D A;  4UCU A;  1KBH A;  4B3S O;  3JYC A;  1ZSP A;  2IH3 C;  3K06 A;  1MSW D;  2IH1 C;  1RSO A;  5B1N A;  1SQP H;  3E2E A;  1EFR G;  4YJ2 A;  1HNX B;  1YJW V;  3HKB A;  3O9O A;  2UUA O;  1HNZ O;  3H1L H;  4D7S A;  4JAA A;  2LJ2 A;  1L0L H;  3RYC B;  1GM7 A;  1OCZ C;  4JI2 O;  4G27 B;  2A0L A;  1S77 D;  1NTK H;  3I55 V;  5LGU A;  4W4K A;  4PD4 F;  4DV2 O;  3CYO A;  1VQ4 V;  4B3S B;  1RFY A;  4B3M O;  1KQS U;  1RM1 C;  4R7C A;  3AG7 A;  2UUA B;  1HNZ B;  2OWO A;  5C93 A;  4K35 A;  3EXA A;  2QWR B;  4JI2 B;  3GB7 C;  2F4V O;  2GHY A;  5KA5 A;  1K73 W;  3AG2 C;  3T1Y O;  3ZHT A;  1HNW B;  3RFR A;  1YEW A;  1DK1 A;  3TCU A;  1QLE C;  4UV9 A;  1EM1 A;  1MNG A;  4X65 B;  2GSM B;  4UB6 Z;  1BQ0 A;  1F51 A;  3QF7 A;  5IYC O;  2KG7 A;  4UVC A;  3L9D A;  2UXX A;  3CS5 A;  2UUB O;  5FPR A;  1XOU A;  2FKX A;  5K1P A;  2F4V B;  5LP6 A;  4UCV A;  4X62 B;  2ZE5 A;  1SS3 A;  2W6I G;  4KHP B;  4E2L A;  1Q8I A;  4JZG A;  2RCV A;  3CD6 V;  2QDO A;  4JI4 O;  3IAY A;  5HFL A;  4U3J A;  2A9H A;  2EIK C;  4TT3 G;  3DXR A;  4MT8 A;  1VQ5 V;  1IBL B;  3D36 C;  1H8E G;  3LDE A;  5IYZ A;  3CCJ V;  3T1H O;  1DF5 A;  5JCO A;  4DR6 B;  1XL6 A;  1M56 B;  2NNU A;  3J81 N;  1ZL8 B;  4JI4 B;  2JJ2 G;  3K5M A;  2YXL A;  1MZE A;  3UO3 A;  1MOF A;  3E89 A;  1IUR A;  3C3S A;  3GVM A;  2HG5 C;  4GYC B;  3QO8 A;  4DR3 O;  1V55 B;  2WLL A;  1NQT A;  2E76 B;  1M56 C;  1WNS A;  3C3T A;  3FAV A;  3ABM C;  3MAQ A;  5GON B;  5A2Q N;  5FLX N;  3CRR A;  5BY1 A;  4UFZ A;  1H2L A;  1COW G;  2R70 A;  1V55 C;  4ZI7 A;  3K57 A;  4AI8 A;  1R6N A;  4TUY A;  3H9V A;  5CA0 A;  5J9P C;  2Q7G A;  1I94 O;  3BCC H;  3SJQ C;  2ZE6 A;  4JI6 O;  1NVP D;  4BAY A;  1AP6 A;  2Y0P A;  4MW3 A;  3D3Q A;  1YZB A;  2MW2 B;  1TA8 A;  2BOC C;  2A3Q A;  1FFX A;  2YXH A;  4GT1 A;  2GDS A;  4ABM A;  3ZIA G;  1JR9 A;  3K9A A;  5LA6 A;  3H1K H;  5DM6 V;  3WG7 B;  4MVR A;  5E1A C;  4QE9 A;  4O4J B;  2BSK B;  3SR2 C;  3BAA A;  1K4C C;  4J80 A;  1Q6U A;  1KUQ A;  5LGT A;  4O4I A;  3RT3 C;  3L71 H;  2FYU H;  1OV9 A;  4R50 A;  1PV0 A;  5LBQ A;  1DF4 A;  2WLH A;  3LSU A;  1LUW A;  4I55 B;  4X66 O;  4K0K B;  3RYF B;  1JJ2 U;  5KHI A;  1IXM A;  3AK2 A;  2X7R B;  3QO5 A;  1R73 A;  2ZXW B;  2HJD A;  3ICX A;  4DV0 O;  2EZP A;  4FLY A;  1PD3 A;  1Q90 D;  2AXT Z;  3CRM A;  2ITD C;  4X66 B;  2YSU B;  1NT2 B;  3U10 A;  4KFM A;  2ZXW C;  3HKC A;  1MSD A;  1NR1 A;  2EJR A;  1R3L C;  4LC1 A;  3B8N A;  3BPZ A;  2CUG A;  3TXS A;  5ITZ A;  1H2M A;  5LHH A;  3L74 H;  4UV8 A;  2GUZ B;  3HKD A;  1QHT A;  3CSX A;  1F4N A;  1OHH G;  4N21 A;  4O4H B;  2EJ7 A;  1LUV A;  1VF6 C;  1BZK A;  3KKY A;  2JEU A;  4O4L A;  2PYJ A;  2P90 A;  1SQF A;  5KAF Z;  4O2A B;  3VQV A;  1RP3 B;  2HP8 A;  1CPY A;  1Q5O A;  4X1Y B;  3NXS A;  2JS3 A;  2QA4 V;  1SZX A;  2YIB D;  2QJ1 A;  5L3D A;  1UFI A;  3FB6 C;  4DR1 B;  3TGU H;  2BTO A;  4IHJ A;  3N27 A;  3ML0 A;  4YY3 O;  4IT5 A;  1Y6X A;  3T1C A;  2AW9 A;  4KXR A;  1R1B A;  1Q43 A;  4JPR A;  1Z5V A;  1Y4M A;  2RMK B;  5DED A;  3JAL A;  1BMF G;  4R6Z A;  4WBN A;  3RYH A;  3SYC A;  1JJO A;  3H1J H;  1VIB A;  3L70 H;  3VQY A;  2R9R B;  1VF7 A;  4MVU A;  5JQG A;  4EEQ A;  4JYC A;  3HKE A;  4YY3 B;  4H33 A;  4JI0 O;  2IJK A;  4QPK A;  1Y76 B;  5L3F A;  1E1R G;  3WB2 A;  3BEH A;  5L3C A;  1AIL A;  4J7J A;  1ZTE A;  1QR8 A;  2GBO A;  1XHX A;  2JGD A;  4DUZ B;  2DYS C;  1FAF A;  1AVM A;  2G38 A;  4JI0 B;  5IJ9 A;  1G4Y B;  1K3E A;  3S3W A;  1NI8 A;  3CRQ A;  4GLX A;  2IBZ H;  4LNU A;  2BCC H;  5FNV B;  1ZWI C;  4MW8 A;  2B5U A;  4LFA O;  4H0L B;  3BRC A;  4CS3 A;  2WA3 A;  4FM1 A;  1JA8 A;  3A0H Z;  5CA1 A;  1FXK B;  3TET A;  1AR4 A;  3RVZ A;  2ETN A;  4MVS A;  2UUC O;  3P3N A;  3SYP A;  2YEV A;  4EB6 A;  2AHY A;  1WPB A;  1N8R W;  5IYD O;  2YIC A;  1R3K C;  3JAK B;  1WAZ A;  4NTX A;  1K7D A;  2VQE B;  1EN4 A;  4FK5 C;  2OIE A;  4PJ0 Z;  4LFA B;  5H9C A;  3CE2 A;  1FXK C;  4JAU A;  4WFF A;  3RYI B;  5B3S C;  1THZ A;  2YS8 A;  3ETE A;  2Q4P A;  4DV3 B;  2IW5 A;  2RDC A;  1M57 C;  1XMO B;  2BTQ B;  4GKJ B;  1DLB A;  4YJ3 B;  4JI7 O;  3K9S A;  3Q4H A;  2FB5 A;  3SPH A;  3R65 A;  4DV6 O;  4DV4 O;  4JI3 O;  4ZBM A;  2OIG A;  3W7T A;  4D7T A;  1YF2 A;  2Z5U A;  2WLI B;  3BFR A;  2JS5 A;  3SYQ A;  2HR3 A;  4IIJ B;  1MG1 A;  2P22 C;  1I0H A;  4ZIB A;  4DV7 O;  3VBB A;  3IFX A;  3F5T A;  4I9W A;  4GKK O;  3CX5 F;  1YDX A;  3RYC A;  4MSW C;  3MD0 A;  1OCC C;  2WAM A;  1HR0 O;  4RAI A;  3ZRW A;  3QTC A;  2H3O A;  3D8C A;  3JAT B;  4DXW A;  4LF5 B;  3CXC U;  2JJ1 G;  1PNK A;  4ZKI A;  2Q69 A;  4I0X B;  4DV7 B;  4R8C A;  1MAB G;  1DTO A;  2R9I A;  1XNR B;  2KQX A;  1VF5 B;  3K5O A;  1HR0 B;  5KHJ A;  2ZIO A;  2E3C A;  4RUF A;  4NVP A;  1JOY A;  2E74 B;  3ASN B;  2N04 A;  3CCU V;  4PA7 A;  2EIM C;  3S3X A;  2R72 A;  4U7O A;  4PV1 B;  1H2N A;  2WA4 A;  2NN4 A;  5AG2 A;  4DYL A;  5DN6 G;  3D36 A;  4LF4 O;  4DV5 O;  1DGS A;  3CPW U;  4DK1 A;  3ZMV A;  3N2K B;  2Q0O C;  4LFB B;  2Q0A A;  4UVB A;  1QNM A;  3F5W C;  5IDJ A;  4XDK A;  2LW7 A;  3J7A U;  4JYY A;  4DR7 O;  3I5D A;  1U96 A;  3SYO A;  1TUB B;  5LOV A;  1KP3 A;  4L8J A;  1NH2 D;  1UPG A;  1TGO A;  5BR8 O;  2ZM6 B;  4TQD A;  1VQ6 V;  4ZHQ B;  3A8T A;  2P7T C;  3JAS A;  4NXN O;  2QE7 G;  4B08 A;  1NZ6 A;  4D6T H;  1B3Q A;  2CTW A;  1VQL V;  1XNQ B;  1M4U A;  3QG5 A;  4NYK A;  1M93 A;  4P9P A;  2YIB A;  3M7M X;  2BE3 A;  1KP2 A;  1I7F A;  4P9O A;  4XBF A;  4DRX A;  3K04 A;  1PNM A;  2BOB C;  4TV8 B;  1AJQ A;  1SQX H;  2MK3 A;  4K8X A;  1SQG A;  1GN4 A;  4YIP A;  4FM2 A;  1N33 O;  3A0R A;  4OX9 O;  3CC4 V;  1SA0 A;  3ABL B;  4JAV A;  1VQ8 V;  1HP8 A;  2DWE C;  4PDM A;  1S76 D;  4NR1 A;  1Y74 A;  4UXN A;  4DV2 B;  1GN3 A;  3IC7 A;  4QE7 A;  3K08 A;  4LWS B;  4ASU G;  4MTF A;  3B40 A;  3ZN0 A;  4BW5 A;  4B3R O;  3ABL C;  1GAX A;  5CA3 A;  4B3M B;  4X20 B;  5CBF A;  4OX9 B;  3KCY A;  1L8D A;  3CJH A;  1JCH A;  3SPG A;  2X6A A;  2XAJ A;  4Q6G A;  2DYR B;  3T1Y B;  3E8B A;  4PA3 A;  1YTF D;  4QPJ A;  1Q81 W;  4O4J A;  2GTS A;  3OAA G;  1NU1 H;  3OTO O;  3ZBH A;  4HZ3 A;  4H13 B;  2B1G A;  1L0N H;  3SJC C;  4G28 B;  2UUB B;  3DSQ A;  4FLW A;  3N2G B;  2Q8V A;  1SF9 A;  1K8A W;  2XOK G;  1SES A;  4XDL A;  4X1K B;  4LP8 A;  1Q6I A;  1JFF A;  4GX1 A;  2HFE C;  5IE9 A;  2WWW A;  4I50 B;  3OTO B;  4U3F H;  1QU7 A;  4HNA B;  3B77 A;  4O2B B;  2PZS A;  3OMN B;  4YHH O;  1LR1 A;  5EZY B;  4BIU A;  3AG4 B;  1QVF U;  4AQY O;  4MTX A;  5LMU O;  1W2B U;  3T1H B;  3QVN A;  4U7N A;  3L73 H;  5J2T A;  3CCS V;  5JH7 A;  2LFS A;  1XDC A;  3MHS C;  1RSO B;  2DQ3 A;  4YJ2 B;  3ZRV A;  1K92 A;  3HKB B;  1XEQ A;  3M99 B;  5E79 Z;  2W6J G;  2ZDI C;  4FZ0 A;  4LF8 O;  1VF6 A;  3BHP A;  2YUA A;  4JTC B;  5CN0 A;  4DR3 B;  1CEZ A;  4AQY B;  4FVM A;  3UO2 A;  4FLV A;  4J10 A;  2CTP A;  2Q9L A;  4GZR B;  3C90 A;  4RUE A;  4UCR A;  2LQT A;  3DC6 A;  2EIL B;  2QSA A;  3B4S A;  4JI5 O;  3CCR V;  1M5I A;  1GM9 A;  3JAM N;  3WU2 Z;  2P6J A;  1KEC A;  5KX5 A;  2QM8 A;  5IY5 B;  5C8Y A;  4TOI A;  3P3P A;  4TQF A;  1K5S A;  2QWP B;  1AP5 A;  4PA6 A;  2RN9 A;  1KYO F;  2FTK A;  2FML A;  4OXS A;  3E83 A;  4O2A A;  3IJ4 A;  3OW2 U;  4JI8 O;  1I94 B;  1A32 A;  4L87 A;  5LXT A;  1AI6 A;  2O57 A;  4CZZ A;  4JI6 B;  2Q5Z A;  2UXC O;  3QO7 A;  1WB8 A;  2OYQ A;  4JYA O;  1QLN A;  4H44 B;  2W0X A;  2ZD9 A;  3K79 A;  4LH7 A;  5LP6 B;  3ETG A;  2DN9 A;  2YC0 A;  5H5N A;  2EX3 A;  3T2M A;  4B3T O;  3WG7 C;  5KHG A;  3M8A A;  3JCZ A;  2F66 C;  3ZMT A;  2DMX A;  1IBM O;  1NR7 A;  1OCR B;  2JVD A;  5JJN B;  3KZI Z;  4YIO A;  5LP6 C;  1ZAU A;  2WLJ A;  4MTO A;  4FMT A;  5B1O A;  1BSM A;  4MVM A;  2AGA A;  5IJ0 B;  3OGI B;  4B3T B;  4FM0 A;  2LFR A;  2ZCE A;  1OCR C;  5LHI A;  1Y76 A;  3H1H H;  2FL4 A;  2ZIM A;  4Z1V A;  3U0Z A;  4IGG A;  5FL7 G;  3NR7 A;  1WA8 A;  3CCV V;  1R6T A;  1WLE A;  4GX0 A;  2CH7 A;  2WLL B;  5JJJ B;  4DV0 B;  5KAI Z;  2E5L O;  1ROP A;  3E22 A;  1OCO B;  4NKG B;  4F6R B;  2AZ2 A;  3MDS A;  2ATK C;  5FNV A;  2EIN B;  2EIJ B;  4X1I B;  3H1I H;  5BMV B;  1K34 A;  5KMG B;  1YIJ V;  2UU9 O;  3RVY A;  3FB8 C;  4LH6 A;  4DR5 O;  4I9Q A;  1SKV A;  4LR3 A;  4FPP A;  3BAB A;  4TWK A;  4TV9 A;  1FXK A;  1FXH A;  1OCO C;  3K5N A;  1HWY A;  3WB0 A;  2E5L B;  2Q7H A;  5LMN O;  2EIN C;  2HLD G;  1KU9 A;  1XMQ O;  5LGN A;  2YID A;  1M9N A;  5CMU A;  2XAS A;  2PF4 E;  3UQ8 A;  1BE3 H;  1VQ7 V;  1FFX B;  2PI5 A;  1GK9 A;  5TIS Z;  4JZ2 A;  2YI9 A;  1AJP A;  3H01 A;  2JRI A;  3BA8 A;  1YIT V;  1WP8 A;  1ZX3 A;  3JAR A;  4NXM O;  2HJF C;  2QWO B;  4FLT A;  3WFV A;  1IZ3 A;  2BTQ A;  2YDE A;  3JD0 A;  5BZB A;  5J2U A;  4LBE C;  4CS4 A;  3E35 A;  2Q7E A;  1PP9 H;  3RBZ A;  3UT5 A;  4K8Z A;  4MVO A;  3LSS A;  2F43 G;  3RW0 A;  1GH6 A;  3A0B Z;  3CMA V;  5B66 Z;  4O4I B;  2OCC B;  5EBM C;  1J95 A;  2Z0A A;  5KUK A;  2QKS A;  3ZHR A;  2IJJ A;  1M1K W;  1US6 A;  1I5Y A;  5EC2 C;  3ZHS A;  3OGC C;  2P4V A;  1EBO A;  2OCC C;  1BL8 A;  2UXB O;  2PUS A;  1I5X A;  1PKX A;  2Y69 B;  2Y48 A;  1QQC A;  1AI4 A;  1KC8 W;  3OR6 C;  4WF9 V;  3FB7 C;  1D5N A;  3JAT A;  1N34 O;  1SZT A;  3THO A;  4I0X A;  2M7W A;  1SRY A;  2Y69 C;  4JI1 O;  2UXB B;  2CE4 A;  1D5A A;  3JSL A;  1V54 B;  2QM4 A;  4OPA A;  2LGQ A;  1UJW B;  1X59 A;  5ITZ B;  4ZOL A;  5D5Q A;  4BWA A;  3HKD B;  3CRA A;  2CGO A;  2L35 A;  1AI7 A;  2D2C B;  3CB2 A;  3EVK A;  3J80 N;  2AHZ A;  1N34 B;  2PTM A;  3OT7 A;  3JD4 A;  3ZX6 A;  1X4T A;  2VWK A;  1N0N A;  3OTF A;  1NS1 A;  4O4L B;  4Q20 A;  1WJZ A;  1Q6H A;  2YIA A;  2ZE7 A;  1F7Y A;  2UUC B;  1JPX A;  1N0J A;  1N4C A;  2P4K A;  4FFK A;  5LYJ A;  2XAH A;  3OFN G;  4X8A A;  1BS3 A;  3JAW B;  1IDS A;  3ZMZ A;  2N05 A;  5IT9 N;  3STL C;  1RPR A;  3ZCC A;  1VAR A;  3OD4 A;  1GTO A;  1GO3 F;  1AI5 A;  4BIO A;  4J11 A;  1TUB A;  3B2E E;  3G67 A;  3CCE V;  1N36 O;  4I4T A;  1HDJ A;  1S5J A;  4GCZ A;  3LNN A;  4FFB B;  3CCM V;  1CXZ B;  3JAL B;  5CB4 B;  4WBN B;  4UCO A;  3F7V C;  4PA4 A;  3ZHV A;  1XBL A;  1OJH A;  3CP1 A;  3RYH B;  4JI7 B;  2A7W A;  5D5P A;  1MMM A;  3TJT A;  4DV1 O;  4DV6 B;  4KUM A;  1RPO A;  4DV4 B;  2ZNJ A;  4JI3 B;  1IVS A;  1PPJ H;  3KCX A;  4FLZ A;  3SDL A;  4GX2 A;  2ARH A;  4BW9 A;  2QKA A;  3ABK B;  3APO A;  1SQQ H;  4KP4 A;  4RQE A;  1H8H G;  4HAM A;  3LSQ A;  2LW1 A;  2IU0 A;  2JGU A;  4HYO A;  3UM7 A;  2IJI A;  1TVK B;  4J42 A;  2JGD B;  2WLM A;  2W0F C;  1N32 O;  4CH6 A;  4GKK B;  4DUY O;  4JV5 O;  4QNH B;  2OT5 A;  5B1A B;  2KB1 A;  5B1B B;  3K0G A;  5EIB C;  4NB5 A;  2HHH O;  4NTW A;  3ABK C;  4J9Z B;  4LWS A;  4LNU B;  2N74 A;  3AG1 B;  2P5O A;  1Y66 A;  4JGS A;  1YHQ V;  5KLV H;  4X20 A;  2XT9 A;  4EKW A;  4Z2W A;  2QTO A;  2Q6A A;  1VQN V;  1J5E O;  1N32 B;  3TK1 A;  1NBM G;  2VQF O;  3ASO B;  1KMI Z;  4EB6 B;  1V9P A;  2HHH B;  1CP9 A;  3CXH F;  3ASN C;  2X0L A;  1WB7 A;  4E4E A;  3OMA B;  3SYA A;  4UCS A;  4G2K A;  1GM8 A;  4PDV A;  4JTA B;  1MA1 A;  2NLJ C;  3ASO C;  1FKA O;  1GN2 A;  4DW0 A;  1Z2G A;  2VQF B;  5GTI Z;  1P4R A;  4FIP C;  3G6E V;  4F6E A;  2IU3 A;  2VS0 A;  3E8F A;  1H2S B;  4LF4 B;  4DV5 B;  4HBN A;  4PI2 A;  4IL6 Z;  1ZL8 A;  1TAE A;  1VP7 A;  4I50 A;  3OMI B;  1B06 A;  4TSF G;  1B04 A;  3K3W A;  4DR7 B;  3DGE A;  1NVP B;  2ZDI A;  5EZY A;  4PA9 A;  4F4L A;  1F23 A;  4X9Q A;  5IYB O;  2DOS A;  4A5U B;  4W4L A;  5F2V O;  1AR1 B;  1R3I C;  5GON A;  4OPH A;  4JTD B;  5BR8 B;  1EN5 A;  2QM7 A;  1ZLZ A;  3I56 V;  3HR0 A;  4NXN B;  1BQZ A;  1FS0 G;  5EYP B;  1RM1 B;  3K03 A;  3JCU Z;  3G71 V;  1F4M A;  3G4S V;  1H38 A;  2QGN A;  5BXZ A;  1HNW O;  3ZRW B;  3O65 A;  5A9G A;  3AG2 B;  2L6L A;  4CH4 A;  4DO2 A;  4FZ1 A;  5L3G A;  4FJC C;  1QLE B;  4X65 O;  4XDJ A;  2ZT9 B;  3HPL C;  2A06 H;  1N33 B;  4RWU A;  4P2Z A;  3G80 A;  3RN4 A;  2ZNI A;  1R3J C;  4X62 O;  2Y0I A;  2XND G;  4KHP O;  1FYJ A;  2DW4 A;  4I7Z B;  1U97 A;  2HKO A;  1PL0 A;  3ABU A;  2DWD C;  2IJH A;  2H8P C;  2QEX V;  5EIB D;  1KB9 F;  2BSK A;  4B3R B;  2PY5 A;  4CS2 A;  1S72 V;  2UXD O;  3AK1 A;  3OEH G;  1PL4 A;  4X64 O;  1IBL O;  2EIK B;  1KD1 W;  2JDI G;  2ZR2 A;  3B09 A;  4EFB A;  2DYR C;  3PJS K;  4DR6 O;  4AIL C;  1O9G A;  4I55 A;  4JAS A;  3KG2 A;  1YSC A;  2X6B A;  2UXN A;  3RYF A;  1W0J G;  2XAG A;  3K5L A;  2UXD B;  2DJV A;  4X64 B;  3CME V;  2ODM A;  5LOV B;  5IWA O;  5H6R A;  2HVJ C;  5IJ0 A;  3LDC A;  5JVD B;  1S0V A;  1JQ0 A;  1PM9 A;  3ABM B;  5DEC A;  1G8M A;  1XIL A;  1ZUQ A;  3JAS B;  1FFT B;  3FKS G;  1ARO P;  2H94 A;  3AG4 C;  4WFH A;  2ZQM A;  4LF9 O;  3P32 A;  5IWA B;  4YHH B;  3EFF K;  3PN1 A;  1QR9 A;  3CWB H;  4DRX B;  3T4D A;  5LMU B;  1XUQ A;  1ENV A;  2GUZ A;  4J7Z A;  1P7G A;  2F93 B;  4F6R A;  3FB5 C;  4J7K A;  1VQ9 V;  4X1I A;  4O4H A;  5BMV A;  3APQ A;  1VQP V;  5KMG A;  1YJ9 V;  1IX9 A;  3SJA C;  1SA0 B;  4LF9 B;  1BCC H;  4QIW F;  4LF8 B;  1JX9 A;  3SPJ A;  1G1X B;  1EZJ A;  1Y74 B;  4MTG A;  2EIL C;  2XTA A;  4X1Y A;  1BGY H;  1WP7 A;  3TXQ A;  1W59 A;  3FD9 A;  2DQ0 A;  3ZRX A;  4JI5 B;  4WCE V;  5IY5 C;  1KKC A;  4H37 A;  3HB3 B;  1G6U A;  5JWP A;  3D3I A;  2JK5 C;  4CH5 A;  2KG7 B;  4WFB V;  4UUJ C;  1H2K A;  2E75 B;  1EN6 A;  2Y4U A;  4IYH A;  1ORQ C;  3CJH B;  4LFC O;  1NJI W;  4JI8 B;  1S5H C;  4MVZ A;  4K0K O;  4DK0 A;  4Z1M G;  3ZJZ A;  3CC7 V;  1VQK V;  2HVK C;  2UXC B;  2QWN B;  2V1D A;  2LP7 A;  3JD1 A; 
#chains in the Genus database with same CATH homology
 2GSM B;  1F51 A;  1PNK A;  4CBC A;  4ZKI A;  2Q69 A;  1EBO A;  4R8C A;  5IYC O;  2OCC C;  4UVC A;  1K97 A;  1MAB G;  1DTO A;  1BL8 A;  2UXX A;  2R9I A;  2X6C A;  3DTU B;  1I5X A;  3W7U A;  1Q86 W;  1PKX A;  2Y69 B;  2Y48 A;  1TUE B;  2W6I G;  1AI4 A;  1KC8 W;  3LNM B;  3OR6 C;  4WF9 V;  4E2L A;  2JEX A;  1WPX A;  4RUF A;  3W7S A;  1JOY A;  1K33 A;  3FB7 C;  3ASN B;  3CD6 V;  1P7B A;  5CBH A;  5HFL A;  1QCE A;  1SZT A;  3CCU V;  4PA7 A;  2EIM C;  1AJN A;  2A9H A;  2M7W A;  2EIK C;  2WSS G;  4TT3 G;  1SRY A;  4MT8 A;  4U7O A;  2Y69 C;  1VQ5 V;  5DN6 G;  1H8E G;  3LDE A;  1V54 B;  4QJF B;  1UJW B;  3CCJ V;  1YI2 V;  1DF5 A;  3D36 A;  1XL6 A;  3CPW U;  1M56 B;  3ZMV A;  1AI7 A;  3OUF A;  2NNU A;  4UVB A;  3F5W C;  5IDJ A;  2AHZ A;  3AG3 B;  4XDK A;  2JJ2 G;  4LCU C;  3IGA C;  3JD4 A;  1MOF A;  3E89 A;  3OUS A;  1VQM V;  2HG5 C;  2Q67 A;  3SYO A;  3QNE A;  3QO8 A;  4Q20 A;  1V55 B;  2WLL A;  1NQT A;  1M56 C;  1KP3 A;  1NH2 D;  1JPX A;  2XAH A;  3OFN G;  4X8A A;  3ABM C;  3AG3 C;  3ZMZ A;  2EIJ C;  3STL C;  1RPR A;  1VQ6 V;  2P7T C;  1K4D C;  3ZCC A;  2B1I A;  5EC1 C;  1LNQ A;  2QE7 G;  1GTO A;  1GO3 F;  1AI5 A;  1COW G;  1V55 C;  1R6N A;  1VQL V;  3GWO A;  3CCE V;  1E79 G;  3OEE G;  5J9P C;  1K9M W;  3OGC C;  4P9P A;  2JIZ G;  2ZR3 A;  4GCZ A;  1KP2 A;  4P9O A;  4XBF A;  4WFG A;  3CCM V;  3K04 A;  3SJQ C;  5HFM A;  1PNM A;  2BOB C;  1NVP D;  1AJQ A;  3F7V C;  4PA4 A;  5KUM A;  4BAY A;  2WLN A;  3CP1 A;  4MW3 A;  2MK3 A;  4BIZ A;  1GKF A;  5EK0 A;  5EBL C;  2BOC C;  3A0R A;  3CC4 V;  3ABL B;  4KUM A;  4JAV A;  1RPO A;  1YJN V;  1VQ8 V;  3ZRS A;  5CBG A;  5LHG A;  4GT1 A;  2DWE C;  3ZIA G;  4PDM A;  2WLI A;  1S76 D;  4UXN A;  4J9Y B;  3K9A A;  3IC7 A;  4GX2 A;  4QE7 A;  3K08 A;  4ASU G;  4MTF A;  5DM6 V;  3ABK B;  4KP4 A;  4MVR A;  3WG7 B;  4RQE A;  3ZN0 A;  1H8H G;  5E1A C;  4BW5 A;  4QE9 A;  2XAF A;  3ABL C;  4HAM A;  3LSQ A;  5CA3 A;  2IU0 A;  4HYO A;  3UM7 A;  1K4C C;  2IJI A;  1BHB A;  5CBF A;  2WLM A;  2W0F C;  4PDR A;  5LGT A;  4QNH B;  2OT5 A;  5B1A B;  2KB1 A;  5B1B B;  3K0G A;  3OM3 B;  1JCH A;  3SPG A;  5EBW C;  2X6A A;  2XAJ A;  4R50 A;  1B6Q A;  5LBQ A;  2DYR B;  1DF4 A;  3ABK C;  2WLH A;  3ABT A;  2DYS B;  3E8B A;  4J9Z B;  4PA3 A;  1YTF D;  3CC2 V;  4QPJ A;  1JJ2 U;  3AG1 B;  1IXM A;  1Q81 W;  1Y66 A;  2X7R B;  2D3O W;  4JGS A;  1YHQ V;  3OAA G;  1Q7Y W;  1QVG U;  3QO5 A;  4HZ3 A;  1R73 A;  2ZXW B;  4EKW A;  2QTO A;  2Q6A A;  1VQN V;  2B1G A;  3TK1 A;  4G28 B;  1NBM G;  2CK3 G;  3ASO B;  4I5S A;  2EZP A;  4N23 A;  1PD3 A;  1K8A W;  1CP9 A;  2XOK G;  1SES A;  5L3B A;  3ASN C;  2X0L A;  4XDL A;  2ITD C;  3LDD A;  2YSU B;  4LP8 A;  3OMA B;  3SYA A;  4KFM A;  2ZXW C;  4G2K A;  1NR1 A;  1GM8 A;  2EJR A;  3ZMU A;  4PDV A;  4GX1 A;  1R3L C;  2HFE C;  4JTA B;  2WWW A;  1QBZ A;  3ETD A;  2OTJ V;  2NLJ C;  4LC1 A;  1NH2 B;  1VQO V;  3ASO C;  3B77 A;  3B8N A;  1V54 C;  3W7X A;  3OMN B;  4BIU A;  3AG4 B;  1QVF U;  4MTX A;  1P4R A;  4FIP C;  3G6E V;  1W0K G;  1W2B U;  5LHH A;  2IU3 A;  4UV8 A;  3E8F A;  4U7N A;  5B3S B;  1F4N A;  1OHH G;  4N21 A;  3CCS V;  2LFS A;  3MHS C;  4MS2 A;  1M57 B;  3BY6 A;  3B8M A;  2DQ3 A;  4X88 A;  3ZRV A;  1K92 A;  3X2Q B;  3OMI B;  3M99 B;  4TSF G;  2W6J G;  2ZDI C;  3AEI A;  3K3W A;  2JEU A;  1BHA A;  3DGE A;  4PEL A;  3SPI A;  1NVP B;  2ZDI A;  4JTC B;  5CN0 A;  4PA9 A;  4F4L A;  2P90 A;  2C2A A;  1CEZ A;  1F23 A;  4RQF A;  4P30 A;  5IYB O;  1CPY A;  5H6Q A;  3E8G A;  2EZO A;  3NXS A;  3CCQ V;  2QA4 V;  1E1Q G;  4YXW G;  1AR1 B;  1R3I C;  4RUE A;  2WPD G;  4JTD B;  2EIL B;  5GW7 A;  3CCR V;  3X2Q C;  2QM7 A;  1GM9 A;  3MHH C;  5L3E A;  5L3D A;  3I56 V;  2Q68 A;  3FB6 C;  2PI4 A;  2P6J A;  1KEC A;  1FXV A;  2QM8 A;  5IY5 B;  5KA6 A;  1FS0 G;  1RM1 B;  3K03 A;  1K5S A;  4JYB A;  4UVA A;  2OTL V;  4PA6 A;  3ML0 A;  2FTK A;  1F4M A;  2XAQ A;  3G71 V;  4OXS A;  3G4S V;  1H38 A;  3E83 A;  2P67 A;  3T1C A;  3UKM A;  1H2G A;  3OW2 U;  3JD3 A;  3ZRW B;  4L87 A;  1SER A;  1OCC B;  4JPR A;  1Y4M A;  2Z3Y A;  3FYI B;  3AG2 B;  1AI6 A;  2V7Q G;  1L1F A;  4CZZ A;  4PDL A;  1BMF G;  4R6Z A;  4DO2 A;  3QO7 A;  5L3G A;  4FJC C;  1QLE B;  4MVQ A;  4XDJ A;  2ITC C;  3SYC A;  3HPL C;  1QLN A;  1PNL A;  3ZN1 A;  4P2Z A;  2ZD9 A;  2R9R B;  3K79 A;  1YTF B;  3F7Y C;  1R3J C;  1R6K A;  4MVU A;  3W7W A;  4JYC A;  2XND G;  3ETG A;  3JD2 A;  1XL4 A;  2DW4 A;  4H33 A;  3T2M A;  3VOU A;  3WG7 C;  2HKO A;  1PL0 A;  2K1E A;  2IJK A;  3ABU A;  3JCZ A;  2DWD C;  2IJH A;  3ZMT A;  4QPK A;  2H8P C;  5L3F A;  1E1R G;  3BEH A;  2QEX V;  1NR7 A;  1OCR B;  5L3C A;  1QR8 A;  4JF3 A;  1S3J A;  4RO2 A;  1S72 V;  2EIM B;  3OEH G;  3OR7 C;  1Q82 W;  5B1A C;  2EIK B;  5B1B C;  2WLJ A;  4MTO A;  1M90 W;  1KD1 W;  2JDI G;  2ZR2 A;  2DYR C;  3PJS K;  4FMT A;  4GX5 A;  2DYS C;  5B1O A;  4MVM A;  4X89 A;  2YEV B;  4WFE A;  3AG1 C;  1G4Y B;  1K3E A;  3E86 A;  2LFR A;  4JAS A;  1OCR C;  1YSC A;  3KG2 A;  2X6B A;  2UXN A;  5LHI A;  3EHB B;  3ZMS A;  2XAG A;  1W0J G;  1ZWI C;  4MW8 A;  2B5U A;  1OZ0 A;  5FL7 G;  1SET A;  3CCV V;  4GX0 A;  1WLE A;  3CME V;  1K5Q A;  2WLL B;  3E8H A;  1FXK B;  3P30 A;  3RVZ A;  3TET A;  4MVS A;  3CCL V;  3SYP A;  5H6R A;  2HVJ C;  1ROP A;  2YEV A;  2AHY A;  3LDC A;  1OCO B;  1N8R W;  5IYD O;  3LUT B;  3FYE B;  1S0V A;  1JQ0 A;  3OE7 G;  3ABM B;  1R3K C;  1G8M A;  1K7D A;  2ATK C;  2WLK A;  3SPC A;  1FFT B;  2EIN B;  2EIJ B;  3T4Z A;  4FK5 C;  3FKS G;  1K34 A;  1GMG A;  1ARO P;  5H9C A;  1YIJ V;  3RVY A;  2EBO A;  3FB8 C;  4WFA V;  2A79 B;  1FXK C;  2H94 A;  4JAU A;  3AG4 C;  4WFH A;  2ZQM A;  4FPP A;  3P32 A;  4TWK A;  1FXK A;  1FXH A;  1JVM A;  1OCO C;  3EFF K;  4WFF A;  1QR9 A;  1HWY A;  3STZ C;  1KKD A;  5B3S C;  1OCZ B;  3T4D A;  1NKD A;  1THZ A;  1ENV A;  3ETE A;  3K0D A;  2EIN C;  2HLD G;  2IW5 A;  1M57 C;  3JYC A;  3FB5 C;  3K06 A;  2IH3 C;  1DLB A;  1MSW D;  2IH1 C;  5B1N A;  1VQ9 V;  5LGN A;  3SPH A;  3E2E A;  1EFR G;  1VQP V;  1M9N A;  3R65 A;  1YJ9 V;  5CMU A;  1YJW V;  2XAS A;  1VQ7 V;  4ZBM A;  2PI5 A;  1GK9 A;  1GM7 A;  1OCZ C;  4QIW F;  4G27 B;  1AJP A;  1JX9 A;  2A0L A;  3W7T A;  1S77 D;  3H01 A;  3SPJ A;  3I55 V;  1YIT V;  2Z5U A;  5LGU A;  2WLI B;  1EZJ A;  2HJF C;  4MTG A;  3SYQ A;  2EIL C;  2HR3 A;  3CYO A;  1VQ4 V;  3WFV A;  1MG1 A;  5BZB A;  3JD0 A;  2DQ0 A;  3ZRX A;  4WCE V;  5IY5 C;  1KQS U;  4LBE C;  4H37 A;  3HB3 B;  3E35 A;  1RM1 C;  4R7C A;  3RBZ A;  3D3I A;  2JK5 C;  3VBB A;  3IFX A;  4MVO A;  3LSS A;  2F43 G;  3RW0 A;  4WFB V;  4UUJ C;  4I9W A;  5C93 A;  3CMA V;  2OCC B;  5EBM C;  4MSW C;  1ORQ C;  3MD0 A;  1J95 A;  3GB7 C;  1OCC C;  2WAM A;  2GHY A;  5KUK A;  5KA5 A;  1K73 W;  3AG2 C;  2QKS A;  4RAI A;  3ZRW A;  1NJI W;  1S5H C;  4MVZ A;  4Z1M G;  2IJJ A;  1M1K W;  3TCU A;  3ZJZ A;  1QLE C;  4UV9 A;  3CC7 V;  1VQK V;  1I5Y A;  2HVK C;  5EC2 C;  4DXW A;  2V1D A;  2LP7 A;  3CXC U;  3JD1 A;  2JJ1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...