1VQLV

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqlV00
1VQNV 4WFBV 3OW2U 3G6EV 3CC2V 1VQ4V 3G71V 1K73W 1YIJV 1QVFU 2OTLV 1VQKV 1YI2V 2D3OW 1KC8W 1VQLV 1KD1W 3CCLV 3CCVV 1VQ9V 1Q82W 1M90W 3CCQV 2OTJV 3CCMV 1YJNV 1YJ9V 3CCSV 1YITV 3G4SV 1YHQV 1YJWV 1KQSU 1R73A 1VQ6V 4WFAV 2QA4V 1NJIW 3CMAV 4WF9V 1JJ2U 1VQOV 1K8AW 3CC4V 5DM6V 1N8RW 3CCJV 1QVGU 1M1KW 1VQMV 1Q7YW 1VQ8V 3CPWU 4WCEV 1K9MW 1Q86W 3I56V 3CMEV 3CCEV 1S72V 1W2BU 1Q81W 1VQ5V 3CD6V 3CCRV 3I55V 3CXCU 1VQ7V 3CCUV 1VQPV 2QEXV 3CC7V
chains in the Genus database with same CATH superfamily
5FL7G 1G1XB 4UVAA 1XMQO 4MW8A 4CBCA 1BQ0A 1N32B 4LCUC 3T2MA 3H1IH 4PA6A 1LR1A 3SPIA 2IH1C 2YI8A 3F5WC 3FYEB 2BOBC 3CP1A 1AILA 3BRCA 1VQ7V 4DW1A 5LBQA 1VQ4V 4JI0O 4DV1B 4IT5A 1XMOB 2WLJA 2E5LO 1XHZA 2UU9B 4ABMA 2HJDA 3ZMUA 2CTWA 3CRQA 4JYBA 3W7WA 4EB6A 2ZIOA 3H1JH 2A79B 3ETEA 4YJ2A 1HNZO 1Z2GA 4PA4A 2YICA 2A9HA 5IY5B 2GV9A 1AR5A 2L6LA 3G67A 4NB5A 2ZT9B 4EB6B 4R50A 4DR4O 4KP4A 1N34B 3EHBB 3I56V 3GB7C 4XDJA 4JI0B 2F43G 3ZMVA 1I94O 3MD0A 4Z2WA 1JA8A 2W0XA 4QPKA 3ZMTA 2FMLA 3K9AA 5KA6A 1O9HA 1JFFB 4FVMA 1X4TA 5CMUA 2CDYA 4RUEA 3WG7B 4LR3A 1KKCA 3TXQA 4DK0A 3K79A 1HNZB 5EIBC 5JCOA 4ICGA 1SQQH 2PY5A 1PL0A 1MMMA 5H6QA 1I08A 2M7WA 4I4TA 3K08A 3RBZA 3CCQV 3CCMV 1VF6C 1KQSU 4O4JB 1Y74A 1G8MA 1ZSPA 5LHHA 2F4VO 3U0ZA 4IHJA 1M1KW 1W0JG 4I5SA 1ZUQA 3UO2A 5D5QA 1BCCH 3OR6C 5EBMC 4I4TB 1H38A 1I94B 4JI5O 4A5UB 1UJWB 1AB3A 2R72A 1BMFG 4RQEA 4K0KB 4WFFA 4EFBA 2ZR2A 3JYCA 5E1AC 3TXSA 3N2GA 4R6ZA 4BIUA 1Y74B 4K3AA 1YTFB 2ZE7A 4PDMA 3B40A 1SA0B 4IHJB 3RGBA 1BSMA 1DF4A 3JASA 1HW7A 5D5PA 1R3LC 3K0GA 3CXCU 3B8MA 3N2GB 4FM2A 3QO7A 1H8HG 4ZI7B 4O4HB 3BVOA 3SYQA 3GVMA 3K3WA 4D7TA 4GX0A 4N21A 1M90W 3JASB 2F66C 4DR2O 4WFAV 2QWNB 2F4VB 1AI4A 2AZ0A 1GN2A 1FD9A 5DEDA 4YIOA 4J9ZB 3RVZA 1M56B 2F1MA 2CTRA 1WLEA 1AP6A 4J7JA 4CH6A 3A8TA 2E3CA 2Q6AA 1EN4A 1QR9A 3CC4V 2BTQA 2QTOA 4EEQA 1AJPA 3SYPA 3CPWU 4TV9A 3I55V 3E83A 1RP3B 4O2AA 4FZ1A 1FS0G 1B04A 4KL1A 2WA4A 3RYFA 2AHZA 3G6BA 3ZRWA 4DR2B 4JI7B 2RCVA 1RM1B 1AVMA 1MA1A 5FPRA 4TV9B 4KHPO 2DWEC 3ZRSA 5EK0A 5JQGB 2N04A 1KD1W 1VQNV 3RYFB 3ZRWB 3AEIA 1VQKV 2FKXA 1KC8W 5C93A 1L8DA 1DLBA 5LP6B 1YDXA 1AP5A 2G38A 2H3OA 5KHIA 3DC6A 4CS2A 4X62B 5LOVA 2PTMA 3JARB 1VQ8V 4DR3B 1VQ5V 1Q5OA 3CCUV 3K57A 2EIJB 2V7QG 4GX5A 5CBFA 2DYRB 3BA8A 2JIZG 3ABUA 4DV0O 5KX5B 1IBKO 1XI1A 1NTZH 2XAFA 3VQWA 4MSWC 5LOVB 3M99B 4PDLA 5BXZA 2HVKC 4DV6O 4X20A 5B66Z 1MSDA 3OTOO 3LSUA 2K1EA 1PNLA 5LXTA 2UUBB 1PV0A 3WU2Z 3CC2V 5DN6G 2OWOA 3K5OA 5LYJA 1PP9H 4QE7A 4X65O 3HKEB 2OCHA 1M93A 1N33B 5LMUB 2FL4A 1K8AW 4X20B 3VQYA 1WJZA 3E8GA 3K03A 2F23A 1ZL8B 2IW5A 4DRXA 2AZ2A 1AI6A 2WLHA 3CJHA 1HWYA 4DYLA 4DV0B 4TT3G 3OW2U 1LNQA 4KXRA 1COWG 1KUQA 2F95B 2VRZA 1NT2B 1SZTA 1MNGA 2P67A 4JI4O 3OD4A 4DV6B 1A32A 1PL4A 4DRXB 1HP8A 2ZIMA 1KP3A 3OTOB 2WLNA 1SQFA 3M8AA 4JI3O 4X65B 4TSFG 1IX9A 3ZHRA 2GBOA 2ZE6A 4JI6O 2ZD9A 2P4KA 1M56C 3ZMZA 1Z5VA 5BMVA 5H6RA 4MVRA 2UUAO 1VQMV 1QBZA 3JAKA 1W2BU 1IBLO 2EJ7A 1V9PA 3O65A 2ZXWB 5ITZA 1WPBA 2YSUB 5BMVB 2ZDIC 4JI4B 2CUGA 5IWAO 3ABMB 2E76B 1GM8A 4FK5C 3JAKB 3CRAA 5ITZB 2NLJC 4UVCA 3CD6V 1NR7A 1JPXA 1BZKA 2KG7A 2B1IA 4JI3B 2DQ0A 1WB8A 3JALA 3D8CA 2HR3A 5A9GA 4JI6B 4GKKO 1VMGA 1XOUA 2N74A 2CGOA 1AJQA 4ZIBA 1Q6IA 1HDJA 3SPHA 5L3EA 3ABKB 3DXRA 5LP6C 4G2KA 2HLDG 2JRIA 2KG7B 4JTDB 4EKWA 4YJ3A 2RJZA 3JALB 1MZEA 4ZKIA 3PJSK 1TA8A 3OR7C 4F6RA 2Y48A 2YXLA 1ZLZA 5IWAB 2DYRC 5EBWC 1G6UA 3AK1A 5CA1A 1UPGA 5IYCO 3DXRB 4JAUA 1YF2A 4PA7A 4RUFA 3ZMSA 2DYSB 4LFBO 1D2DA 1JOYA 3LDEA 4F6RB 3OUFA 2B9ZA 3OAAG 4GKKB 4DR1O 4FLXA 4FLUA 1BQZA 4R8CA 2YUAA 4NXNB 3FD9A 4C7UA 5EYPA 2VWKA 4HNAA 4KUMA 3ASOB 1K4DC 5L3FA 1ROPA 2MW2B 4JTAB 5DECA 1FFTB 4J7KA 3E22A 4RO2A 3RW0A 1VF7A 4ZHQA 1ZX3A 3JSNA 5EYPB 4MTGA 2NN4A 3G4SV 1VF6A 4HNAB 2XT9A 3DC5A 4H33A 2HG5C 2GHYA 4Z1MG 4B3TB 1RPOA 3AG4B 3E22B 1ORQC 4DV4O 4B3MO 2UXCO 4GKJB 2YDEA 1QVFU 4ZHQB 2OTLV 1SETA 1V54B 2JEUA 1QCEA 1R73A 2M6YA 1AI7A 1K33A 2HFEC 4JI1O 3CCJV 1QVGU 3JCUZ 1TGOA 4BIOA 4E4EA 2Z3YA 4O4IB 3R66A 3AG1B 3U10A 5KAIZ 3CX5F 3J81N 2ZXWC 1FJGB 1AR4A 2XOKG 4JASA 2ITCC 4QJFB 2RQ6A 1JQ0A 4ZBMA 3CS5A 2FYUH 3ZRXA 2PF4E 1Q7YW 4DV4B 4B3MB 4UCVA 2EJRA 3KCXA 1TAEA 4TWKA 4FLWA 4MVUA 4UCTA 3H9VA 1Y66A 2CK3G 2OTJV 4MVQA 3B77A 2P5OA 5KA5A 5FLXN 4JI1B 2Q5ZA 2QKAA 4FZ0A 5L3DA 5BZBA 2QGNA 2R70A 3ABKC 2EIKC 4GZRB 4RAIA 4YXWG 3BFRA 3E86A 1QR8A 5IJ9A 4JV5O 2WLMA 2PI5A 1YJWV 4UB8Z 1XUQA 4CS3A 3OUSA 3OMNB 1MG1A 4PA3A 1FFXA 1Q6HA 2FB5A 1WA8B 4DK1A 3AG3B 2DYSC 4CC6A 2YS8A 3EXAA 5EZYA 5IJ9B 3T1HO 1FXKC 1XMQB 2EZOA 3IAYA 4O2BA 4GX1A 1EZVH 4UFZA 4JYAO 2XAGA 1GH6A 3LDDA 4MTXA 1FFXB 2Y0PA 1E1QG 4P30A 4WBNA 2ZNJA 1JFFA 4JZGA 3VQVA 1RPRA 3D3IA 1N0JA 4QIWF 5EZYB 3CMEV 2PYLA 4AI8A 4U3FH 4O4LA 3P3PA 3LNNA 4O2BB 3ASOC 1WAZA 4JV5B 4UB6Z 2E5LB 1PD3A 1Q8IA 1FAFA 1E79G 4IYHA 4WBNB 2YI9A 1YXBA 3ABLC 1J95A 2RMKB 3TGUH 5KMGA 1SS3A 2YIDA 3D3QA 4UCSA 4O4JA 4LP8A 1OCOB 2NNUA 4FJCC 4O4LB 1K5SA 2DW4A 3L73H 1N36O 3ML0A 3OE7G 1XNRO 3E8BA 3AG4C 1IBMO 1QLEB 2ZE8A 3KG2A 1J5EO 5HFMA 1GTOA 5KMGB 3TETA 1I7FA 2JEXA 4DR4B 5L3CA 1ZWIC 1B6QA 1V54C 2ZQMA 5LGNA 1SA0A 3RYHB 2IU3A 3ZX6A 4WCEV 2OIEA 2VS0A 3FB7C 2KSDA 1NU1H 2JGUA 3BABA 3C90A 2Q7GA 1RSOA 4NR1A 2LW1A 3E2EA 3ZN0A 2AXTZ 1DGSA 2CH7B 4UCOA 4ZI7A 4O4HA 1NQTA 4P2ZA 3AG1C 3J7AU 1L0NH 1VQ6V 1TUBA 1SRYA 2WA3A 3P32A 2BE3A 1RSOB 4ZOLB 3CYOA 1Y4MA 4G28B 3X2QC 4FLTA 1UFIA 3L71H 3IGAC 2HJFC 4MVSA 1J5EB 1IURA 3ICXA 1TUBB 3FAVB 1BHBA 2X0LA 3SJQC 4HAMA 2LFRA 4XDKA 4FM1A 1F51A 1NR1A 3LDCA 1S77D 3QTCA 4LWSB 1JJOA 4W4LA 4DR6O 4B7EA 4JI5B 1Q3EA 3E35A 4X1YB 1GM9A 5IYBO 1K92A 3E89A 5J2UA 2EULA 3RT3C 1NTMH 3IC7A 4YY3O 2YIBA 1OCCC 5IJ0A 2ZDIA 4CH4A 4WFGA 1U96A 3F5TA 1KKDA 4HBNA 3JCZA 3H1LH 1IVSA 4J42A 1EBOA 4QE9A 3VBBA 4DV2O 5LL6Y 2UXXA 3P3NA 2BCCH 5J2UB 1NZ6A 4QPJA 1EM1A 5IJ0B 3K5LA 3AG3C 5JQGA 2R9IA 1NVPD 4DR5O 4LC1A 1T5EA 5A2QN 2X6CA 1YJ9V 4YHHO 1OZ0A 1WB7A 1LUWA 4YIPA 4LBEC 3UT5A 2LO1A 1M4UA 4DR6B 5AG2A 3SJCC 3L9DA 4NVPA 3HKBA 1L1FA 5KLVH 5LP6A 1FXHA 2UXBO 3SR2C 3MHSC 1PNMA 3MHHC 5FNVA 3APOA 3JARA 3H01A 3JD2A 3L74H 4YY3B 4NTXA 4J10A 1SKVA 2DE0X 4BWAA 1YCIA 3UCSC 3UT5B 4GX2A 5KX5A 1S76D 1TVKB 3HKBB 4JGSA 1Q6UA 5B1BB 2LGWA 5IYDO 3CEIA 3AK3A 5CB4B 5FNVB 1I5XA 1NS1A 1WNSA 3B09A 4U7NA 4PHZA 3SYAA 3HKDA 1OCOC 3LSQA 4XBFA 4DR5B 3ZIAG 4X66O 1BT8A 4YHHB 4W4KA 5GONB 1QLEC 2QKCA 2X7RB 3HKEA 4KHPB 3CWBH 4DXWA 3HKDB 4FPPA 4I0XA 4AQYO 5B5EZ 3G80A 4DV3O 1ZL8A 4FM0A 4BW9A 5KHJA 4X1IA 2ZM6O 3IFXA 2ETNA 3N2KA 3ETDA 3HKCA 2Z0AA 4QGPA 1F4NA 2P4VA 1I5YA 1HNWO 1S3JA 5KAFZ 1BS3A 1MOFA 4I0XB 3ETGA 4JPRA 1P7BA 5CA0A 3IC9A 1K9MW 4X1IB 1H2NA 3N2KB 2Q9LA 4K8XA 3HKCB 3LSSA 4DV5O 2FTKA 5B1NA 1QLNA 1H8EG 2BSKA 3JD3A 4UV8A 1IBKB 1GN3A 5LGUA 2DOSA 2GUZA 2QA4V 1M9NA 2OYQA 5CA0B 2HHHO 5LMNO 1R3JC 5CBHA 4X8AA 1NKDA 3HB3B 4AQYB 2JJ2G 4ASUG 1QHTA 2BSKB 1V55B 2HEPA 2EZPA 2AGAA 4I9WA 4JZ2A 2GUZB 4I55A 3F7YC 2YEVB 3WB1A 4LNUA 5B3SC 1M57C 4AHCA 4DR7O 2Y0IA 3UO3A 4LF4O 1WP7A 5L3BA 2H8PC 4X64O 2XAQA 2QWOB 2YIAA 2ODMA 1WN7A 2Q68A 3FX7A 3SGIA 3ZHVA 3C3TA 4LF7O 3OEHG 3S3XA 4UUJC 2Q8VA 4Z1VA 4WFBV 4I55B 2AW9A 5KUKA 2UUCO 4LNUB 1SESA 2ARHA 1P7GA 2Q0OC 4DO2A 4KFMA 2QM4A 2HHHB 5LMNB 4LF6O 1JCHA 1PPJH 3L75H 5BR8O 3VOUA 4PI0A 2RDCA 2V1DA 1N0NA 4MS2A 2IJKA 3BEHA 4TV8B 4DV7O 4PV1B 2IJJA 4DR7B 3L72H 1ENVA 3MDSA 2B1GA 4X64B 2UUAB 1SC5B 2W6JG 1WP8A 2EIKB 4TQFA 3ZJZA 1IBLB 5B1BC 3VQXA 1Q43A 2JVDA 1US6A 3TCUA 4FLZA 4MTOA 3H1KH 4FLVA 3QF7A 1FXKA 2D3OW 4UVBA 4TUYA 1R6TA 3QNEA 2JS3A 2P7TC 2GTSA 3SPJA 1NH2D 5H5NA 3U11A 1Y76B 3BY6A 3ZHTA 3QO5A 2GSMB 1K4CC 3UM7A 2JJ1G 3AG2C 1FXKB 1RFYA 4TUYB 4GCZA 4DV7B 3T1YO 4PI2A 3WB0A 3CE2A 2Q0AA 5JJJB 4LFCO 1VQLV 2XAJA 2Z5UA 2R9AA 1S0VA 4WF9V 1MZFA 3OM3B 1NBMG 1F23A 1VIBA 3T4ZA 2VWJA 2KKWA 1P49A 5IT9N 3NR7A 1CEZA 4LF8O 1VP7A 3OMAB 3ABLB 5B1AB 2CGNA 5GTHZ 1S5HC 1O9GA 2VQFO 1MABG 4MVMA 4LFBB 3BCCH 2QSAA 1YTFD 3B8NA 2A0LA 4JYCA 4B3SO 3SJAC 2OT5A 3K9SA 3T1YB 3KCYA 1V55C 1Q90D 4DR1B 2Q7HA 4JYYA 3CXHF 4O4IA 1SQVH 2UXDO 3K0DA 1W0KG 5LA6B 1D5NA 3JD0A 2QWRB 5DM6V 1GN4A 2H94A 3SDLA 3RYCB 3ZHUA 4QNHB 1HR0O 1R6NA 4MVZA 2JK5C 1PNKA 4LF8B 2WWWA 4K35A 3K59A 4OPHA 4NKGB 3NXSA 1EFRG 2QE7G 3STLC 3OTFA 2XHBA 5GTIZ 5LHIA 3JD1A 3LNMB 4PJ0Z 1N32O 1JX9A 4BR6A 1PM9A 2A3QA 2VQFB 1H2LA 3ZBHA 3ZCCA 5K1XA 2EIMC 1VEWA 1KYOF 2QM7A 3X2QB 4FIPC 4B3SB 3SJBC 4FFKA 2UXCB 4F4LA 4GLXA 5LGTA 1YI2V 1AROP 2X6BA 3W7SA 1XMOO 1SQPH 5EBLC 1P84F 5EC2C 4CC5A 1XL4A 4H0LB 1FKAO 3BHPA 4GYCB 1HR0B 2EILB 1OCCB 3EFFK 1WA8A 4WFEA 1G4YB 5FPOA 5IYZA 3M7MX 2ATKC 3OGCC 3RWRD 1P4RA 2AHYA 2QWPB 2RNBA 2Y69B 3JAWA 3E8HA 3HR0A 3OT7A 2Q67A 1N34O 1YSCA 4NXMO 3Q4HA 4JAAA 4FFBA 5KHKA 5IYZB 3ASNC 1K5QA 1XNQO 3BA9A 2LFSA 3FB8C 3FB6C 4LFAO 3JAWB 4X9QA 3SPCA 3DSQA 2NR5A 2DMXA 3Q4HB 4FFBB 1Q86W 1R3IC 3ZN1A 1F4MA 3K06A 2QTSA 1H2KA 1CXZB 2IU0A 2QDOA 2WLIA 3DTUB 3CSXA 4FLYA 1KP2A 1YITV 1K7DA 5B1AC 3W7TA 2KQXA 4YJ2B 4LF5O 5H2FZ 1QNMA 5E79Z 4NXMB 2RN9A 4J11A 4AILC 5IDJA 5JVDA 4LH6A 1EN6A 2CE4A 1NH2B 3RYHA 2YXYA 1WPXA 2CTPA 3T1HB 2WLIB 2OIGA 1XNQB 1NTKH 4LFAB 4K0KO 3D36C 4H13B 4JYAB 1TUEB 4B7KA 4X1KA 3CCSV 3A0RA 2CH7A 1VQOV 2Y4UA 4Q6GA 2WSSG 1Y6XA 1GKFA 5JVDB 2IJIA 1GMGA 4FMTA 3K58A 4PDRA 1CPYA 1ZTEA 3K5NA 2XTAA 4D7SA 2DWDC 3CCEV 2A7WA 4HYOA 1VQPV 5BY1A 5GW7A 3CC7V 4B08A 3W7UA 4ZOLA 2LGQA 4X1KB 1GN6A 1THZA 2WAMA 1Q82W 2PI4A 1YJNV 3FFQA 3OEEG 1FPOA 2ADQB 2IBZH 1XILA 5F2VO 4LF5B 3FAVA 1GK9A 2ZCEA 1DF5A 1R6KA 4D6TH 2F93B 2W6IG 2HVJC 3QVNA 4LWSA 1N36B 3I5DA 4UCUA 4R7CA 1XNRB 5CA3A 3DGEA 1IBMB 3UQ8A 2Q69A 4X1YA 1KBHA 1B06A 3CMAV 2E75B 3P30A 1AI5A 1KB9F 2LQTA 1SQBH 1Q81W 4I50A 2CAZC 4P9OA 1XEQA 1U97A 1VARA 3H1HH 2EILC 5B3SB 1E1RG 1M57B 1OCZB 2VQEO 3F7VC 3ZHQA 1VQ9V 1DK1A 2W0FC 3ZHSA 4JI7O 1XL6A 1GO3F 3K04A 2DN9A 1VF5B 1PKXA 2C2AA 4I50B 2L35A 4NTYA 5C8YA 2Y69C 1JMKC 2V4DA 3W7XA 3ZRVA 4P9PA 5HFLA 2JS5A 2MK3A 1YVWA 2XNDG 1M5IA 2XUMA 2IH3C 2YXHA 4TQDA 5KHGA 5C8YB 4BAYA 1B3QA 4JTCB 4PA9A 2EX3A 3HPLC 1TVKA 1I0HA 4X62O 4OPAA 1H2GA 1BL8A 3BPZA 4Q20A 1JR9A 4DR3O 3CCRV 5K1PA 5CB4A 2VQEB 1N4CA 3PN1A 3QO8A 2EBOA 5IY5C 2BTQB 1GAXA 1KMIZ 1SF9A 5GONA 4O2AB 4DV2B 1S72V 3S3WA 1YZBA 4PELA 3A0BZ 2UUBO 3GWKC 1XREA 1OHHG 4L87A 2QWQB 3EVKA 3JD4A 2QR4A 4J80A 1QQCA 2LJ2A 1N33O 2CTQA 5LMUO 1JJ2U 5IE9A 4UXNA 3AG2B 2LW7A 2UXBB 4CH3A 2D2CB 3E8FA 3WG7C 2OCCB 3TJTA 2IJHA 4JF3A 3G71V 2GDSA 4DUYO 1SQXH 5EIBD 4GT1A 3J80N 1L0LH 1FYJA 1EZJA 1DTOA 1OCRB 3ZS8C 2ZR3A 4WFHA 2ITDC 3A0HZ 4RWUA 2P22C 4RQFA 5JCOC 2HP8A 4GUNA 3CRRA 4X66B 3T4DA 4JAVA 2O57A 2QKSA 2YEVA 1K3EA 3CHXA 2ZE5A 1ZAUA 3WB2A 2Q73A 3RYIA 2A06H 5LXTB 5EC1C 2KB1A 3CB2A 1XBLA 2WPDG 4H37A 4DV3B 1YEWA 4OXSA 1IZ3A 5LYJB 2ZM6B 3GWOA 1SZXA 3T1CA 4DUYB 1X59A 4UCRA 3SPGA 4X89A 5CBGA 4DW0A 3BAAA 4L8JA 3FB5C 1HNWB 1Z5WA 1OCZC 2PZSA 3RYIB 1GM7A 3RN4A 3CJHB 1Y67A 3UKMA 1BGYH 4LH7A 4MT8A 2P6JA 4DV5B 3B2EE 1K73W 1JVMA 1BHAA 3OFNG 2EIMB 2JGDA 4PD4F 1NJIW 4TV8A 5CN0A 5JJNB 3O9OA 1KECA 3CRMA 2IM9A 1AR1B 4I7ZB 1OV9A 4NTWA 1CP9A 1W59A 5H9CA 1R3KC 2ADPA 2PUSA 4EFEA 3OMIB 2JGDB 4BIZA 4B3RO 1URFA 2WLLA 4XDLA 3QG5A 3SYOA 4LF4B 2E74B 4IIJA 3R65A 2EINB 3IJ4A 1S5LZ 3ETQA 1RM1C 1SQGA 4LF9O 4E2LA 4HZ3A 2BTOA 1Y76A 2DQ3A 2BOCC 3L70H 4LF7B 2QEXV 4J41A 2WLKA 2N05A 2UUCB 5KHHA 1IDSA 2WLLB 4MW3A 3FYIB 4OX9O 4IIJB 1LUVA 1NI8A 4LF6B 4NXNO 5J2TA 2QJ1A 5BR8B 1NVPB 4K8ZA 3JAMN 1HNXO 3ZEDA 1K34A 3ASNB 1K97A 1S5JA 3STZC 3G6EV 4J9YB 4F6EA 4JI8O 3SYCA 2OCCC 3B4SA 4UV9A 2EIJC 4B3RB 5J2TB 2DJVA 1H2SB 1D5AA 3WFVA 4J7ZA 4DUZO 1F7YA 4LF9B 4YJ3B 1FXVA 2K9PA 3K5MA 4B3TO 2XAHA 1IXMA 4H44B 3JATA 2X6AA 1OCRC 4OGQB 3CRCA 2R9RB 4IYIA 5B1OA 2LP7A 4OX9B 1XHXA 4NYKA 5CA1B 4GKJO 3D36A 4MTFA 5JH7A 2UXNA 2JDIG 1XDCA 5LHGA 1YHQV 3ABTA 1QU7A 3RFRA 1EN5A 3TK1A 2P90A 5LA6A 1HNXB 3JATB 1AJNA 2QM8A 2ILMA 3JSLA 2P06A 4JI8B 5JH7B 3RYCA 1IXBA 4JI2O 2XASA 4LFCB 4I9QA 3CCLV 3CCVV 2B5UA 4MVOA 5L3GA 1FJGO 4DUZB 1GRJA 2HKOA 2GTAA 5JWPA 3LUTB 2ZNIA 1R1BA 4TOIA 1KU9A 3N27A 3KKYA 3KZIZ 2PYJA 3APQA 5TISZ 4G27B 4CS4A 5J9PC 4CZZA 4IL6Z 4PDVA 4U7OA 1XQ8A 3AG7A 4IGGA 3RVYA 2Q4PA 3MAQA 2YC0A 3AK2A 5KUMA 4CH5A 1OJHA 3OGIB 4U3JA 4JI2B 1SERA 3FKSG 1YIJV 1BE3H 4DV1O 2UXDB 4BW5A 2ZKOA 1MSWD 4N23A 4X88A 2UU9O 2PGGA 3A2FA 2YIBD 1H2MA 3ABMC 3C3SA 3THOA 2Y4TA 4U3JB 2ZINA 5JJEB 2EINC 1N8RW 2Q7EA
chains in the Genus database with same CATH topology
5FL7G 4R7CA 3PJSK 3IFXA 5CA3A 3DGEA 3OR7C 2Y48A 3ETDA 4UVAA 4MW8A 4CBCA 2Q69A 1F4NA 4LCUC 2DYRC 3T2MA 5EBWC 1I5YA 5IYCO 1S3JA 4PA6A 3SPIA 3CMAV 4JAUA 2IH1C 3P30A 1MOFA 3F5WC 1AI5A 3FYEB 4PA7A 2BOBC 3ETGA 3CP1A 4JPRA 4RUFA 1P7BA 3ZMSA 2DYSB 1K9MW 1Q81W 1JOYA 3LDEA 1VQ7V 4P9OA 5LBQA 3LSSA 3OUFA 2FTKA 5B1NA 1QLNA 1H8EG 3OAAG 1VQ4V 3JD3A 4UV8A 5B3SB 2EILC 1E1RG 1M57B 1OCZB 5LGUA 2WLJA 3F7VC 1VQ9V 4R8CA 2W0FC 1XL6A 2QA4V 1GO3F 1M9NA 3K04A 3ZMUA 1PKXA 4JYBA 2C2AA 1R3JC 3W7WA 5CBHA 4X8AA 1NKDA 2Y69C 3HB3B 4KUMA 2JJ2G 4ASUG 3W7XA 3ASOB 1K4DC 2A79B 1V55B 3ETEA 3ZRVA 5L3FA 1ROPA 2EZPA 4P9PA 4JTAB 4I9WA 5HFLA 4PA4A 2A9HA 1FFTB 5IY5B 2MK3A 4RO2A 3RW0A 2XNDG 3F7YC 2YEVB 5B3SC 1M57C 2IH3C 4MTGA 3G4SV 4R50A 4BAYA 5L3BA 4H33A 2H8PC 2HG5C 4JTCB 2GHYA 4PA9A 4KP4A 4Z1MG 2XAQA 3HPLC 1H2GA 1RPOA 3EHBB 1BL8A 3I56V 4Q20A 2Q68A 3GB7C 3CCRV 3AG4B 4XDJA 1ORQC 3OEHG 4UUJC 4WFBV 2F43G 3ZMVA 3MD0A 5KUKA 1QVFU 2OTLV 1SESA 3QO8A 4QPKA 3ZMTA 2EBOA 4DO2A 3K9AA 4KFMA 5KA6A 1SETA 5IY5C 1V54B 2JEUA 1QCEA 1R73A 1AI7A 5CMUA 1JCHA 1K33A 2HFEC 4RUEA 3CCJV 3WG7B 1QVGU 3VOUA 3K79A 1S72V 2Z3YA 4PELA 2V1DA 1PL0A 5H6QA 3AG1B 4MS2A 2M7WA 1OHHG 4L87A 2IJKA 3K08A 3BEHA 2ZXWC 2IJJA 3RBZA 3JD4A 3CCQV 2XOKG 3CCMV 4JASA 1KQSU 2ITCC 4QJFB 1JJ2U 1ENVA 2B1GA 1G8MA 1JQ0A 2W6JG 4ZBMA 5LHHA 4UXNA 3AG2B 3ZRXA 2EIKB 1M1KW 1W0JG 4I5SA 3ZJZA 1Q7YW 3E8FA 5B1BC 3OR6C 5EBMC 3WG7C 2OCCB 1H38A 2EJRA 3TCUA 1UJWB 2IJHA 1BMFG 4JF3A 4MTOA 4RQEA 4TWKA 4WFFA 3G71V 2ZR2A 3JYCA 4MVUA 5E1AC 1FXKA 2D3OW 1Y66A 4UVBA 4R6ZA 2CK3G 4GT1A 4BIUA 1YTFB 2OTJV 3QNEA 4PDMA 4MVQA 3B77A 2P7TC 5KA5A 3SPJA 1NH2D 1DF4A 1EZJA 1DTOA 3BY6A 1OCRB 3QO5A 2GSMB 2ZR3A 4WFHA 1K4CC 2ITDC 3UM7A 1R3LC 5L3DA 5BZBA 2JJ1G 4RQFA 3AG2C 3ABKC 2EIKC 3K0GA 4RAIA 3CXCU 3B8MA 1FXKB 4YXWG 3QO7A 1H8HG 3SYQA 4GCZA 3E86A 1QR8A 3K3WA 3T4DA 1VQLV 2XAJA 4GX0A 4N21A 4JAVA 1M90W 2Z5UA 2WLMA 2PI5A 1YJWV 1S0VA 4WFAV 4WF9V 3OUSA 1AI4A 2QKSA 3OMNB 2YEVA 1MG1A 3OM3B 1K3EA 4PA3A 1NBMG 5EC1C 2KB1A 1F23A 2WPDG 4H37A 3T4ZA 4OXSA 3AG3B 4J9ZB 2DYSC 3GWOA 3T1CA 3RVZA 3SPGA 1CEZA 1M56B 1FXKC 4X89A 2EZOA 5CBGA 1WLEA 3OMAB 3ABLB 5B1AB 2Q6AA 4GX1A 3FB5C 2XAGA 1S5HC 3LDDA 4MTXA 1OCZC 1QR9A 3CC4V 1E1QG 1GM7A 4P30A 1MABG 2QTOA 1AJPA 1RPRA 4MVMA 3SYPA 3D3IA 3CPWU 3UKMA 4QIWF 3CMEV 1YTFD 3B8NA 2A0LA 4JYCA 4MT8A 3I55V 3E83A 2P6JA 2OT5A 1FS0G 1K73W 3ASOC 1V55C 1JVMA 1PD3A 2AHZA 3ZRWA 3K0DA 1E79G 1W0KG 1BHAA 3OFNG 2EIMB 3ABLC 1NJIW 3JD0A 1J95A 5CN0A 1RM1B 5DM6V 2H94A 1KECA 4LP8A 1OCOB 2NNUA 4FJCC 1K5SA 1AR1B 2DWEC 3ZRSA 2DW4A 5EK0A 4QNHB 1R6NA 3ML0A 4MVZA 2JK5C 1KD1W 1VQNV 1PNKA 3OE7G 2WWWA 1CP9A 5H9CA 3ZRWB 1R3KC 3NXSA 3E8BA 1EFRG 3AG4C 2QE7G 3AEIA 3STLC 1VQKV 1KC8W 5C93A 3OMIB 1QLEB 4BIZA 3JD1A 3KG2A 5LHIA 3LNMB 2WLLA 4XDLA 1JX9A 5HFMA 1GTOA 3TETA 1DLBA 3SYOA 2JEXA 3ZCCA 5L3CA 1ZWIC 1B6QA 1V54C 2EIMC 2ZQMA 3R65A 5LGNA 2EINB 2QM7A 1RM1C 3X2QB 2IU3A 1VQ8V 4WCEV 4FIPC 4E2LA 4HZ3A 3FB7C 2DQ3A 2BOCC 1VQ5V 2QEXV 3CCUV 2WLKA 4F4LA 2EIJB 2V7QG 4GX5A 5LGTA 5CBFA 2DYRB 3E2EA 2JIZG 3ABUA 3ZN0A 2WLLB 1YI2V 1AROP 4MW3A 3FYIB 2X6BA 3W7SA 2XAFA 4MSWC 1NQTA 4P2ZA 3AG1C 5EBLC 5EC2C 1VQ6V 1XL4A 3M99B 4PDLA 1SRYA 3P32A 2HVKC 1NVPB 3CYOA 1K34A 3ASNB 1K97A 1Y4MA 2EILB 4G28B 3X2QC 2K1EA 1PNLA 3STZC 3G6EV 1OCCB 3EFFK 3CC2V 4J9YB 5DN6G 3IGAC 3SYCA 2HJFC 2OCCC 4WFEA 4UV9A 1G4YB 2EIJC 4MVSA 4QE7A 2ATKC 3OGCC 1BHBA 1P4RA 2X0LA 3SJQC 4HAMA 2AHYA 2LFRA 4XDKA 3WFVA 2Y69B 3E8HA 1F51A 1NR1A 3LDCA 1K8AW 1S77D 3E8GA 3K03A 1FXVA 2IW5A 2Q67A 1AI6A 2WLHA 1IXMA 2XAHA 1YSCA 1HWYA 2X6AA 1OCRC 2R9RB 3E35A 4TT3G 3OW2U 5B1OA 1LNQA 1GM9A 3ASNC 2LP7A 1K92A 5IYBO 1K5QA 1COWG 3E89A 3IC7A 3D36A 2LFSA 3FB8C 1OCCC 3FB6C 4MTFA 2UXNA 2JDIG 2ZDIA 1SZTA 4WFGA 3SPCA 5LHGA 1YHQV 2P67A 3ABTA 1KKDA 3JCZA 3TK1A 1KP3A 2P90A 1AJNA 1EBOA 2QM8A 4QE9A 3VBBA 2WLNA 1Q86W 1R3IC 2UXXA 3ZN1A 1F4MA 3K06A 4QPJA 2XASA 2IU0A 3AG3C 4TSFG 1NVPD 2R9IA 2WLIA 3DTUB 3CCLV 4LC1A 3CCVV 2B5UA 2X6CA 2ZD9A 4MVOA 5L3GA 1YJ9V 1M56C 1OZ0A 1KP2A 3ZMZA 1YITV 1K7DA 2HKOA 5B1AC 4LBEC 5H6RA 3W7TA 4MVRA 1L1FA 1VQMV 1FXHA 3LUTB 1QBZA 5IDJA 3MHSC 1W2BU 1PNMA 1NH2B 3MHHC 1WPXA 2ZXWB 3H01A 2WLIB 3JD2A 2YSUB 4G27B 5J9PC 2ZDIC 1TUEB 4GX2A 4CZZA 3CCSV 3ABMB 4PDVA 1S76D 3A0RA 4U7OA 1VQOV 2WSSG 4JGSA 2IJIA 1GKFA 5B1BB 1GM8A 1GMGA 4FK5C 4FMTA 5IYDO 3RVYA 4PDRA 1CPYA 1I5XA 2DWDC 4U7NA 3CCEV 5KUMA 2NLJC 4UVCA 3CD6V 1NR7A 4HYOA 3SYAA 1VQPV 5GW7A 1JPXA 1SERA 3CC7V 2B1IA 1OCOC 3FKSG 3LSQA 2DQ0A 3W7UA 4XBFA 1YIJV 3ZIAG 2HR3A 1THZA 2WAMA 4BW5A 1Q82W 1MSWD 2PI4A 1YJNV 3OEEG 4N23A 4X88A 1AJQA 1QLEC 2X7RB 1GK9A 3ABMC 3SPHA 5L3EA 1DF5A 1R6KA 3ABKB 4DXWA 4G2KA 2HLDG 2W6IG 2HVJC 4FPPA 4JTDB 4EKWA 2EINC 1N8RW 4ZKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN V;  4WFB V;  3OW2 U;  3G6E V;  3CC2 V;  1VQ4 V;  3G71 V;  1K73 W;  1YIJ V;  1QVF U;  2OTL V;  1VQK V;  1YI2 V;  2D3O W;  1KC8 W;  1VQL V;  1KD1 W;  3CCL V;  3CCV V;  1VQ9 V;  1Q82 W;  1M90 W;  3CCQ V;  2OTJ V;  3CCM V;  1YJN V;  1YJ9 V;  3CCS V;  1YIT V;  3G4S V;  1YHQ V;  1YJW V;  1KQS U;  1R73 A;  1VQ6 V;  4WFA V;  2QA4 V;  1NJI W;  3CMA V;  4WF9 V;  1JJ2 U;  1VQO V;  1K8A W;  3CC4 V;  5DM6 V;  1N8R W;  3CCJ V;  1QVG U;  1M1K W;  1VQM V;  1Q7Y W;  1VQ8 V;  3CPW U;  4WCE V;  1K9M W;  1Q86 W;  3I56 V;  3CME V;  3CCE V;  1S72 V;  1W2B U;  1Q81 W;  1VQ5 V;  3CD6 V;  3CCR V;  3I55 V;  3CXC U;  1VQ7 V;  3CCU V;  1VQP V;  2QEX V;  3CC7 V; 
#chains in the Genus database with same CATH topology
 5FL7 G;  1G1X B;  4UVA A;  1XMQ O;  4MW8 A;  4CBC A;  1BQ0 A;  1N32 B;  4LCU C;  3T2M A;  3H1I H;  4PA6 A;  1LR1 A;  3SPI A;  2IH1 C;  2YI8 A;  3F5W C;  3FYE B;  2BOB C;  3CP1 A;  1AIL A;  3BRC A;  1VQ7 V;  4DW1 A;  5LBQ A;  1VQ4 V;  4JI0 O;  4DV1 B;  4IT5 A;  1XMO B;  2WLJ A;  2E5L O;  1XHZ A;  2UU9 B;  4ABM A;  2HJD A;  3ZMU A;  2CTW A;  3CRQ A;  4JYB A;  3W7W A;  4EB6 A;  2ZIO A;  3H1J H;  2A79 B;  3ETE A;  4YJ2 A;  1HNZ O;  1Z2G A;  4PA4 A;  2YIC A;  2A9H A;  5IY5 B;  2GV9 A;  1AR5 A;  2L6L A;  3G67 A;  4NB5 A;  2ZT9 B;  4EB6 B;  4R50 A;  4DR4 O;  4KP4 A;  1N34 B;  3EHB B;  3I56 V;  3GB7 C;  4XDJ A;  4JI0 B;  2F43 G;  3ZMV A;  1I94 O;  3MD0 A;  4Z2W A;  1JA8 A;  2W0X A;  4QPK A;  3ZMT A;  2FML A;  3K9A A;  5KA6 A;  1O9H A;  1JFF B;  4FVM A;  1X4T A;  5CMU A;  2CDY A;  4RUE A;  3WG7 B;  4LR3 A;  1KKC A;  3TXQ A;  4DK0 A;  3K79 A;  1HNZ B;  5EIB C;  5JCO A;  4ICG A;  1SQQ H;  2PY5 A;  1PL0 A;  1MMM A;  5H6Q A;  1I08 A;  2M7W A;  4I4T A;  3K08 A;  3RBZ A;  3CCQ V;  3CCM V;  1VF6 C;  1KQS U;  4O4J B;  1Y74 A;  1G8M A;  1ZSP A;  5LHH A;  2F4V O;  3U0Z A;  4IHJ A;  1M1K W;  1W0J G;  4I5S A;  1ZUQ A;  3UO2 A;  5D5Q A;  1BCC H;  3OR6 C;  5EBM C;  4I4T B;  1H38 A;  1I94 B;  4JI5 O;  4A5U B;  1UJW B;  1AB3 A;  2R72 A;  1BMF G;  4RQE A;  4K0K B;  4WFF A;  4EFB A;  2ZR2 A;  3JYC A;  5E1A C;  3TXS A;  3N2G A;  4R6Z A;  4BIU A;  1Y74 B;  4K3A A;  1YTF B;  2ZE7 A;  4PDM A;  3B40 A;  1SA0 B;  4IHJ B;  3RGB A;  1BSM A;  1DF4 A;  3JAS A;  1HW7 A;  5D5P A;  1R3L C;  3K0G A;  3CXC U;  3B8M A;  3N2G B;  4FM2 A;  3QO7 A;  1H8H G;  4ZI7 B;  4O4H B;  3BVO A;  3SYQ A;  3GVM A;  3K3W A;  4D7T A;  4GX0 A;  4N21 A;  1M90 W;  3JAS B;  2F66 C;  4DR2 O;  4WFA V;  2QWN B;  2F4V B;  1AI4 A;  2AZ0 A;  1GN2 A;  1FD9 A;  5DED A;  4YIO A;  4J9Z B;  3RVZ A;  1M56 B;  2F1M A;  2CTR A;  1WLE A;  1AP6 A;  4J7J A;  4CH6 A;  3A8T A;  2E3C A;  2Q6A A;  1EN4 A;  1QR9 A;  3CC4 V;  2BTQ A;  2QTO A;  4EEQ A;  1AJP A;  3SYP A;  3CPW U;  4TV9 A;  3I55 V;  3E83 A;  1RP3 B;  4O2A A;  4FZ1 A;  1FS0 G;  1B04 A;  4KL1 A;  2WA4 A;  3RYF A;  2AHZ A;  3G6B A;  3ZRW A;  4DR2 B;  4JI7 B;  2RCV A;  1RM1 B;  1AVM A;  1MA1 A;  5FPR A;  4TV9 B;  4KHP O;  2DWE C;  3ZRS A;  5EK0 A;  5JQG B;  2N04 A;  1KD1 W;  1VQN V;  3RYF B;  3ZRW B;  3AEI A;  1VQK V;  2FKX A;  1KC8 W;  5C93 A;  1L8D A;  1DLB A;  5LP6 B;  1YDX A;  1AP5 A;  2G38 A;  2H3O A;  5KHI A;  3DC6 A;  4CS2 A;  4X62 B;  5LOV A;  2PTM A;  3JAR B;  1VQ8 V;  4DR3 B;  1VQ5 V;  1Q5O A;  3CCU V;  3K57 A;  2EIJ B;  2V7Q G;  4GX5 A;  5CBF A;  2DYR B;  3BA8 A;  2JIZ G;  3ABU A;  4DV0 O;  5KX5 B;  1IBK O;  1XI1 A;  1NTZ H;  2XAF A;  3VQW A;  4MSW C;  5LOV B;  3M99 B;  4PDL A;  5BXZ A;  2HVK C;  4DV6 O;  4X20 A;  5B66 Z;  1MSD A;  3OTO O;  3LSU A;  2K1E A;  1PNL A;  5LXT A;  2UUB B;  1PV0 A;  3WU2 Z;  3CC2 V;  5DN6 G;  2OWO A;  3K5O A;  5LYJ A;  1PP9 H;  4QE7 A;  4X65 O;  3HKE B;  2OCH A;  1M93 A;  1N33 B;  5LMU B;  2FL4 A;  1K8A W;  4X20 B;  3VQY A;  1WJZ A;  3E8G A;  3K03 A;  2F23 A;  1ZL8 B;  2IW5 A;  4DRX A;  2AZ2 A;  1AI6 A;  2WLH A;  3CJH A;  1HWY A;  4DYL A;  4DV0 B;  4TT3 G;  3OW2 U;  1LNQ A;  4KXR A;  1COW G;  1KUQ A;  2F95 B;  2VRZ A;  1NT2 B;  1SZT A;  1MNG A;  2P67 A;  4JI4 O;  3OD4 A;  4DV6 B;  1A32 A;  1PL4 A;  4DRX B;  1HP8 A;  2ZIM A;  1KP3 A;  3OTO B;  2WLN A;  1SQF A;  3M8A A;  4JI3 O;  4X65 B;  4TSF G;  1IX9 A;  3ZHR A;  2GBO A;  2ZE6 A;  4JI6 O;  2ZD9 A;  2P4K A;  1M56 C;  3ZMZ A;  1Z5V A;  5BMV A;  5H6R A;  4MVR A;  2UUA O;  1VQM V;  1QBZ A;  3JAK A;  1W2B U;  1IBL O;  2EJ7 A;  1V9P A;  3O65 A;  2ZXW B;  5ITZ A;  1WPB A;  2YSU B;  5BMV B;  2ZDI C;  4JI4 B;  2CUG A;  5IWA O;  3ABM B;  2E76 B;  1GM8 A;  4FK5 C;  3JAK B;  3CRA A;  5ITZ B;  2NLJ C;  4UVC A;  3CD6 V;  1NR7 A;  1JPX A;  1BZK A;  2KG7 A;  2B1I A;  4JI3 B;  2DQ0 A;  1WB8 A;  3JAL A;  3D8C A;  2HR3 A;  5A9G A;  4JI6 B;  4GKK O;  1VMG A;  1XOU A;  2N74 A;  2CGO A;  1AJQ A;  4ZIB A;  1Q6I A;  1HDJ A;  3SPH A;  5L3E A;  3ABK B;  3DXR A;  5LP6 C;  4G2K A;  2HLD G;  2JRI A;  2KG7 B;  4JTD B;  4EKW A;  4YJ3 A;  2RJZ A;  3JAL B;  1MZE A;  4ZKI A;  3PJS K;  1TA8 A;  3OR7 C;  4F6R A;  2Y48 A;  2YXL A;  1ZLZ A;  5IWA B;  2DYR C;  5EBW C;  1G6U A;  3AK1 A;  5CA1 A;  1UPG A;  5IYC O;  3DXR B;  4JAU A;  1YF2 A;  4PA7 A;  4RUF A;  3ZMS A;  2DYS B;  4LFB O;  1D2D A;  1JOY A;  3LDE A;  4F6R B;  3OUF A;  2B9Z A;  3OAA G;  4GKK B;  4DR1 O;  4FLX A;  4FLU A;  1BQZ A;  4R8C A;  2YUA A;  4NXN B;  3FD9 A;  4C7U A;  5EYP A;  2VWK A;  4HNA A;  4KUM A;  3ASO B;  1K4D C;  5L3F A;  1ROP A;  2MW2 B;  4JTA B;  5DEC A;  1FFT B;  4J7K A;  3E22 A;  4RO2 A;  3RW0 A;  1VF7 A;  4ZHQ A;  1ZX3 A;  3JSN A;  5EYP B;  4MTG A;  2NN4 A;  3G4S V;  1VF6 A;  4HNA B;  2XT9 A;  3DC5 A;  4H33 A;  2HG5 C;  2GHY A;  4Z1M G;  4B3T B;  1RPO A;  3AG4 B;  3E22 B;  1ORQ C;  4DV4 O;  4B3M O;  2UXC O;  4GKJ B;  2YDE A;  1QVF U;  4ZHQ B;  2OTL V;  1SET A;  1V54 B;  2JEU A;  1QCE A;  1R73 A;  2M6Y A;  1AI7 A;  1K33 A;  2HFE C;  4JI1 O;  3CCJ V;  1QVG U;  3JCU Z;  1TGO A;  4BIO A;  4E4E A;  2Z3Y A;  4O4I B;  3R66 A;  3AG1 B;  3U10 A;  5KAI Z;  3CX5 F;  3J81 N;  2ZXW C;  1FJG B;  1AR4 A;  2XOK G;  4JAS A;  2ITC C;  4QJF B;  2RQ6 A;  1JQ0 A;  4ZBM A;  3CS5 A;  2FYU H;  3ZRX A;  2PF4 E;  1Q7Y W;  4DV4 B;  4B3M B;  4UCV A;  2EJR A;  3KCX A;  1TAE A;  4TWK A;  4FLW A;  4MVU A;  4UCT A;  3H9V A;  1Y66 A;  2CK3 G;  2OTJ V;  4MVQ A;  3B77 A;  2P5O A;  5KA5 A;  5FLX N;  4JI1 B;  2Q5Z A;  2QKA A;  4FZ0 A;  5L3D A;  5BZB A;  2QGN A;  2R70 A;  3ABK C;  2EIK C;  4GZR B;  4RAI A;  4YXW G;  3BFR A;  3E86 A;  1QR8 A;  5IJ9 A;  4JV5 O;  2WLM A;  2PI5 A;  1YJW V;  4UB8 Z;  1XUQ A;  4CS3 A;  3OUS A;  3OMN B;  1MG1 A;  4PA3 A;  1FFX A;  1Q6H A;  2FB5 A;  1WA8 B;  4DK1 A;  3AG3 B;  2DYS C;  4CC6 A;  2YS8 A;  3EXA A;  5EZY A;  5IJ9 B;  3T1H O;  1FXK C;  1XMQ B;  2EZO A;  3IAY A;  4O2B A;  4GX1 A;  1EZV H;  4UFZ A;  4JYA O;  2XAG A;  1GH6 A;  3LDD A;  4MTX A;  1FFX B;  2Y0P A;  1E1Q G;  4P30 A;  4WBN A;  2ZNJ A;  1JFF A;  4JZG A;  3VQV A;  1RPR A;  3D3I A;  1N0J A;  4QIW F;  5EZY B;  3CME V;  2PYL A;  4AI8 A;  4U3F H;  4O4L A;  3P3P A;  3LNN A;  4O2B B;  3ASO C;  1WAZ A;  4JV5 B;  4UB6 Z;  2E5L B;  1PD3 A;  1Q8I A;  1FAF A;  1E79 G;  4IYH A;  4WBN B;  2YI9 A;  1YXB A;  3ABL C;  1J95 A;  2RMK B;  3TGU H;  5KMG A;  1SS3 A;  2YID A;  3D3Q A;  4UCS A;  4O4J A;  4LP8 A;  1OCO B;  2NNU A;  4FJC C;  4O4L B;  1K5S A;  2DW4 A;  3L73 H;  1N36 O;  3ML0 A;  3OE7 G;  1XNR O;  3E8B A;  3AG4 C;  1IBM O;  1QLE B;  2ZE8 A;  3KG2 A;  1J5E O;  5HFM A;  1GTO A;  5KMG B;  3TET A;  1I7F A;  2JEX A;  4DR4 B;  5L3C A;  1ZWI C;  1B6Q A;  1V54 C;  2ZQM A;  5LGN A;  1SA0 A;  3RYH B;  2IU3 A;  3ZX6 A;  4WCE V;  2OIE A;  2VS0 A;  3FB7 C;  2KSD A;  1NU1 H;  2JGU A;  3BAB A;  3C90 A;  2Q7G A;  1RSO A;  4NR1 A;  2LW1 A;  3E2E A;  3ZN0 A;  2AXT Z;  1DGS A;  2CH7 B;  4UCO A;  4ZI7 A;  4O4H A;  1NQT A;  4P2Z A;  3AG1 C;  3J7A U;  1L0N H;  1VQ6 V;  1TUB A;  1SRY A;  2WA3 A;  3P32 A;  2BE3 A;  1RSO B;  4ZOL B;  3CYO A;  1Y4M A;  4G28 B;  3X2Q C;  4FLT A;  1UFI A;  3L71 H;  3IGA C;  2HJF C;  4MVS A;  1J5E B;  1IUR A;  3ICX A;  1TUB B;  3FAV B;  1BHB A;  2X0L A;  3SJQ C;  4HAM A;  2LFR A;  4XDK A;  4FM1 A;  1F51 A;  1NR1 A;  3LDC A;  1S77 D;  3QTC A;  4LWS B;  1JJO A;  4W4L A;  4DR6 O;  4B7E A;  4JI5 B;  1Q3E A;  3E35 A;  4X1Y B;  1GM9 A;  5IYB O;  1K92 A;  3E89 A;  5J2U A;  2EUL A;  3RT3 C;  1NTM H;  3IC7 A;  4YY3 O;  2YIB A;  1OCC C;  5IJ0 A;  2ZDI A;  4CH4 A;  4WFG A;  1U96 A;  3F5T A;  1KKD A;  4HBN A;  3JCZ A;  3H1L H;  1IVS A;  4J42 A;  1EBO A;  4QE9 A;  3VBB A;  4DV2 O;  5LL6 Y;  2UXX A;  3P3N A;  2BCC H;  5J2U B;  1NZ6 A;  4QPJ A;  1EM1 A;  5IJ0 B;  3K5L A;  3AG3 C;  5JQG A;  2R9I A;  1NVP D;  4DR5 O;  4LC1 A;  1T5E A;  5A2Q N;  2X6C A;  1YJ9 V;  4YHH O;  1OZ0 A;  1WB7 A;  1LUW A;  4YIP A;  4LBE C;  3UT5 A;  2LO1 A;  1M4U A;  4DR6 B;  5AG2 A;  3SJC C;  3L9D A;  4NVP A;  3HKB A;  1L1F A;  5KLV H;  5LP6 A;  1FXH A;  2UXB O;  3SR2 C;  3MHS C;  1PNM A;  3MHH C;  5FNV A;  3APO A;  3JAR A;  3H01 A;  3JD2 A;  3L74 H;  4YY3 B;  4NTX A;  4J10 A;  1SKV A;  2DE0 X;  4BWA A;  1YCI A;  3UCS C;  3UT5 B;  4GX2 A;  5KX5 A;  1S76 D;  1TVK B;  3HKB B;  4JGS A;  1Q6U A;  5B1B B;  2LGW A;  5IYD O;  3CEI A;  3AK3 A;  5CB4 B;  5FNV B;  1I5X A;  1NS1 A;  1WNS A;  3B09 A;  4U7N A;  4PHZ A;  3SYA A;  3HKD A;  1OCO C;  3LSQ A;  4XBF A;  4DR5 B;  3ZIA G;  4X66 O;  1BT8 A;  4YHH B;  4W4K A;  5GON B;  1QLE C;  2QKC A;  2X7R B;  3HKE A;  4KHP B;  3CWB H;  4DXW A;  3HKD B;  4FPP A;  4I0X A;  4AQY O;  5B5E Z;  3G80 A;  4DV3 O;  1ZL8 A;  4FM0 A;  4BW9 A;  5KHJ A;  4X1I A;  2ZM6 O;  3IFX A;  2ETN A;  3N2K A;  3ETD A;  3HKC A;  2Z0A A;  4QGP A;  1F4N A;  2P4V A;  1I5Y A;  1HNW O;  1S3J A;  5KAF Z;  1BS3 A;  1MOF A;  4I0X B;  3ETG A;  4JPR A;  1P7B A;  5CA0 A;  3IC9 A;  1K9M W;  4X1I B;  1H2N A;  3N2K B;  2Q9L A;  4K8X A;  3HKC B;  3LSS A;  4DV5 O;  2FTK A;  5B1N A;  1QLN A;  1H8E G;  2BSK A;  3JD3 A;  4UV8 A;  1IBK B;  1GN3 A;  5LGU A;  2DOS A;  2GUZ A;  2QA4 V;  1M9N A;  2OYQ A;  5CA0 B;  2HHH O;  5LMN O;  1R3J C;  5CBH A;  4X8A A;  1NKD A;  3HB3 B;  4AQY B;  2JJ2 G;  4ASU G;  1QHT A;  2BSK B;  1V55 B;  2HEP A;  2EZP A;  2AGA A;  4I9W A;  4JZ2 A;  2GUZ B;  4I55 A;  3F7Y C;  2YEV B;  3WB1 A;  4LNU A;  5B3S C;  1M57 C;  4AHC A;  4DR7 O;  2Y0I A;  3UO3 A;  4LF4 O;  1WP7 A;  5L3B A;  2H8P C;  4X64 O;  2XAQ A;  2QWO B;  2YIA A;  2ODM A;  1WN7 A;  2Q68 A;  3FX7 A;  3SGI A;  3ZHV A;  3C3T A;  4LF7 O;  3OEH G;  3S3X A;  4UUJ C;  2Q8V A;  4Z1V A;  4WFB V;  4I55 B;  2AW9 A;  5KUK A;  2UUC O;  4LNU B;  1SES A;  2ARH A;  1P7G A;  2Q0O C;  4DO2 A;  4KFM A;  2QM4 A;  2HHH B;  5LMN B;  4LF6 O;  1JCH A;  1PPJ H;  3L75 H;  5BR8 O;  3VOU A;  4PI0 A;  2RDC A;  2V1D A;  1N0N A;  4MS2 A;  2IJK A;  3BEH A;  4TV8 B;  4DV7 O;  4PV1 B;  2IJJ A;  4DR7 B;  3L72 H;  1ENV A;  3MDS A;  2B1G A;  4X64 B;  2UUA B;  1SC5 B;  2W6J G;  1WP8 A;  2EIK B;  4TQF A;  3ZJZ A;  1IBL B;  5B1B C;  3VQX A;  1Q43 A;  2JVD A;  1US6 A;  3TCU A;  4FLZ A;  4MTO A;  3H1K H;  4FLV A;  3QF7 A;  1FXK A;  2D3O W;  4UVB A;  4TUY A;  1R6T A;  3QNE A;  2JS3 A;  2P7T C;  2GTS A;  3SPJ A;  1NH2 D;  5H5N A;  3U11 A;  1Y76 B;  3BY6 A;  3ZHT A;  3QO5 A;  2GSM B;  1K4C C;  3UM7 A;  2JJ1 G;  3AG2 C;  1FXK B;  1RFY A;  4TUY B;  4GCZ A;  4DV7 B;  3T1Y O;  4PI2 A;  3WB0 A;  3CE2 A;  2Q0A A;  5JJJ B;  4LFC O;  1VQL V;  2XAJ A;  2Z5U A;  2R9A A;  1S0V A;  4WF9 V;  1MZF A;  3OM3 B;  1NBM G;  1F23 A;  1VIB A;  3T4Z A;  2VWJ A;  2KKW A;  1P49 A;  5IT9 N;  3NR7 A;  1CEZ A;  4LF8 O;  1VP7 A;  3OMA B;  3ABL B;  5B1A B;  2CGN A;  5GTH Z;  1S5H C;  1O9G A;  2VQF O;  1MAB G;  4MVM A;  4LFB B;  3BCC H;  2QSA A;  1YTF D;  3B8N A;  2A0L A;  4JYC A;  4B3S O;  3SJA C;  2OT5 A;  3K9S A;  3T1Y B;  3KCY A;  1V55 C;  1Q90 D;  4DR1 B;  2Q7H A;  4JYY A;  3CXH F;  4O4I A;  1SQV H;  2UXD O;  3K0D A;  1W0K G;  5LA6 B;  1D5N A;  3JD0 A;  2QWR B;  5DM6 V;  1GN4 A;  2H94 A;  3SDL A;  3RYC B;  3ZHU A;  4QNH B;  1HR0 O;  1R6N A;  4MVZ A;  2JK5 C;  1PNK A;  4LF8 B;  2WWW A;  4K35 A;  3K59 A;  4OPH A;  4NKG B;  3NXS A;  1EFR G;  2QE7 G;  3STL C;  3OTF A;  2XHB A;  5GTI Z;  5LHI A;  3JD1 A;  3LNM B;  4PJ0 Z;  1N32 O;  1JX9 A;  4BR6 A;  1PM9 A;  2A3Q A;  2VQF B;  1H2L A;  3ZBH A;  3ZCC A;  5K1X A;  2EIM C;  1VEW A;  1KYO F;  2QM7 A;  3X2Q B;  4FIP C;  4B3S B;  3SJB C;  4FFK A;  2UXC B;  4F4L A;  4GLX A;  5LGT A;  1YI2 V;  1ARO P;  2X6B A;  3W7S A;  1XMO O;  1SQP H;  5EBL C;  1P84 F;  5EC2 C;  4CC5 A;  1XL4 A;  4H0L B;  1FKA O;  3BHP A;  4GYC B;  1HR0 B;  2EIL B;  1OCC B;  3EFF K;  1WA8 A;  4WFE A;  1G4Y B;  5FPO A;  5IYZ A;  3M7M X;  2ATK C;  3OGC C;  3RWR D;  1P4R A;  2AHY A;  2QWP B;  2RNB A;  2Y69 B;  3JAW A;  3E8H A;  3HR0 A;  3OT7 A;  2Q67 A;  1N34 O;  1YSC A;  4NXM O;  3Q4H A;  4JAA A;  4FFB A;  5KHK A;  5IYZ B;  3ASN C;  1K5Q A;  1XNQ O;  3BA9 A;  2LFS A;  3FB8 C;  3FB6 C;  4LFA O;  3JAW B;  4X9Q A;  3SPC A;  3DSQ A;  2NR5 A;  2DMX A;  3Q4H B;  4FFB B;  1Q86 W;  1R3I C;  3ZN1 A;  1F4M A;  3K06 A;  2QTS A;  1H2K A;  1CXZ B;  2IU0 A;  2QDO A;  2WLI A;  3DTU B;  3CSX A;  4FLY A;  1KP2 A;  1YIT V;  1K7D A;  5B1A C;  3W7T A;  2KQX A;  4YJ2 B;  4LF5 O;  5H2F Z;  1QNM A;  5E79 Z;  4NXM B;  2RN9 A;  4J11 A;  4AIL C;  5IDJ A;  5JVD A;  4LH6 A;  1EN6 A;  2CE4 A;  1NH2 B;  3RYH A;  2YXY A;  1WPX A;  2CTP A;  3T1H B;  2WLI B;  2OIG A;  1XNQ B;  1NTK H;  4LFA B;  4K0K O;  3D36 C;  4H13 B;  4JYA B;  1TUE B;  4B7K A;  4X1K A;  3CCS V;  3A0R A;  2CH7 A;  1VQO V;  2Y4U A;  4Q6G A;  2WSS G;  1Y6X A;  1GKF A;  5JVD B;  2IJI A;  1GMG A;  4FMT A;  3K58 A;  4PDR A;  1CPY A;  1ZTE A;  3K5N A;  2XTA A;  4D7S A;  2DWD C;  3CCE V;  2A7W A;  4HYO A;  1VQP V;  5BY1 A;  5GW7 A;  3CC7 V;  4B08 A;  3W7U A;  4ZOL A;  2LGQ A;  4X1K B;  1GN6 A;  1THZ A;  2WAM A;  1Q82 W;  2PI4 A;  1YJN V;  3FFQ A;  3OEE G;  1FPO A;  2ADQ B;  2IBZ H;  1XIL A;  5F2V O;  4LF5 B;  3FAV A;  1GK9 A;  2ZCE A;  1DF5 A;  1R6K A;  4D6T H;  2F93 B;  2W6I G;  2HVJ C;  3QVN A;  4LWS A;  1N36 B;  3I5D A;  4UCU A;  4R7C A;  1XNR B;  5CA3 A;  3DGE A;  1IBM B;  3UQ8 A;  2Q69 A;  4X1Y A;  1KBH A;  1B06 A;  3CMA V;  2E75 B;  3P30 A;  1AI5 A;  1KB9 F;  2LQT A;  1SQB H;  1Q81 W;  4I50 A;  2CAZ C;  4P9O A;  1XEQ A;  1U97 A;  1VAR A;  3H1H H;  2EIL C;  5B3S B;  1E1R G;  1M57 B;  1OCZ B;  2VQE O;  3F7V C;  3ZHQ A;  1VQ9 V;  1DK1 A;  2W0F C;  3ZHS A;  4JI7 O;  1XL6 A;  1GO3 F;  3K04 A;  2DN9 A;  1VF5 B;  1PKX A;  2C2A A;  4I50 B;  2L35 A;  4NTY A;  5C8Y A;  2Y69 C;  1JMK C;  2V4D A;  3W7X A;  3ZRV A;  4P9P A;  5HFL A;  2JS5 A;  2MK3 A;  1YVW A;  2XND G;  1M5I A;  2XUM A;  2IH3 C;  2YXH A;  4TQD A;  5KHG A;  5C8Y B;  4BAY A;  1B3Q A;  4JTC B;  4PA9 A;  2EX3 A;  3HPL C;  1TVK A;  1I0H A;  4X62 O;  4OPA A;  1H2G A;  1BL8 A;  3BPZ A;  4Q20 A;  1JR9 A;  4DR3 O;  3CCR V;  5K1P A;  5CB4 A;  2VQE B;  1N4C A;  3PN1 A;  3QO8 A;  2EBO A;  5IY5 C;  2BTQ B;  1GAX A;  1KMI Z;  1SF9 A;  5GON A;  4O2A B;  4DV2 B;  1S72 V;  3S3W A;  1YZB A;  4PEL A;  3A0B Z;  2UUB O;  3GWK C;  1XRE A;  1OHH G;  4L87 A;  2QWQ B;  3EVK A;  3JD4 A;  2QR4 A;  4J80 A;  1QQC A;  2LJ2 A;  1N33 O;  2CTQ A;  5LMU O;  1JJ2 U;  5IE9 A;  4UXN A;  3AG2 B;  2LW7 A;  2UXB B;  4CH3 A;  2D2C B;  3E8F A;  3WG7 C;  2OCC B;  3TJT A;  2IJH A;  4JF3 A;  3G71 V;  2GDS A;  4DUY O;  1SQX H;  5EIB D;  4GT1 A;  3J80 N;  1L0L H;  1FYJ A;  1EZJ A;  1DTO A;  1OCR B;  3ZS8 C;  2ZR3 A;  4WFH A;  2ITD C;  3A0H Z;  4RWU A;  2P22 C;  4RQF A;  5JCO C;  2HP8 A;  4GUN A;  3CRR A;  4X66 B;  3T4D A;  4JAV A;  2O57 A;  2QKS A;  2YEV A;  1K3E A;  3CHX A;  2ZE5 A;  1ZAU A;  3WB2 A;  2Q73 A;  3RYI A;  2A06 H;  5LXT B;  5EC1 C;  2KB1 A;  3CB2 A;  1XBL A;  2WPD G;  4H37 A;  4DV3 B;  1YEW A;  4OXS A;  1IZ3 A;  5LYJ B;  2ZM6 B;  3GWO A;  1SZX A;  3T1C A;  4DUY B;  1X59 A;  4UCR A;  3SPG A;  4X89 A;  5CBG A;  4DW0 A;  3BAA A;  4L8J A;  3FB5 C;  1HNW B;  1Z5W A;  1OCZ C;  2PZS A;  3RYI B;  1GM7 A;  3RN4 A;  3CJH B;  1Y67 A;  3UKM A;  1BGY H;  4LH7 A;  4MT8 A;  2P6J A;  4DV5 B;  3B2E E;  1K73 W;  1JVM A;  1BHA A;  3OFN G;  2EIM B;  2JGD A;  4PD4 F;  1NJI W;  4TV8 A;  5CN0 A;  5JJN B;  3O9O A;  1KEC A;  3CRM A;  2IM9 A;  1AR1 B;  4I7Z B;  1OV9 A;  4NTW A;  1CP9 A;  1W59 A;  5H9C A;  1R3K C;  2ADP A;  2PUS A;  4EFE A;  3OMI B;  2JGD B;  4BIZ A;  4B3R O;  1URF A;  2WLL A;  4XDL A;  3QG5 A;  3SYO A;  4LF4 B;  2E74 B;  4IIJ A;  3R65 A;  2EIN B;  3IJ4 A;  1S5L Z;  3ETQ A;  1RM1 C;  1SQG A;  4LF9 O;  4E2L A;  4HZ3 A;  2BTO A;  1Y76 A;  2DQ3 A;  2BOC C;  3L70 H;  4LF7 B;  2QEX V;  4J41 A;  2WLK A;  2N05 A;  2UUC B;  5KHH A;  1IDS A;  2WLL B;  4MW3 A;  3FYI B;  4OX9 O;  4IIJ B;  1LUV A;  1NI8 A;  4LF6 B;  4NXN O;  5J2T A;  2QJ1 A;  5BR8 B;  1NVP B;  4K8Z A;  3JAM N;  1HNX O;  3ZED A;  1K34 A;  3ASN B;  1K97 A;  1S5J A;  3STZ C;  3G6E V;  4J9Y B;  4F6E A;  4JI8 O;  3SYC A;  2OCC C;  3B4S A;  4UV9 A;  2EIJ C;  4B3R B;  5J2T B;  2DJV A;  1H2S B;  1D5A A;  3WFV A;  4J7Z A;  4DUZ O;  1F7Y A;  4LF9 B;  4YJ3 B;  1FXV A;  2K9P A;  3K5M A;  4B3T O;  2XAH A;  1IXM A;  4H44 B;  3JAT A;  2X6A A;  1OCR C;  4OGQ B;  3CRC A;  2R9R B;  4IYI A;  5B1O A;  2LP7 A;  4OX9 B;  1XHX A;  4NYK A;  5CA1 B;  4GKJ O;  3D36 A;  4MTF A;  5JH7 A;  2UXN A;  2JDI G;  1XDC A;  5LHG A;  1YHQ V;  3ABT A;  1QU7 A;  3RFR A;  1EN5 A;  3TK1 A;  2P90 A;  5LA6 A;  1HNX B;  3JAT B;  1AJN A;  2QM8 A;  2ILM A;  3JSL A;  2P06 A;  4JI8 B;  5JH7 B;  3RYC A;  1IXB A;  4JI2 O;  2XAS A;  4LFC B;  4I9Q A;  3CCL V;  3CCV V;  2B5U A;  4MVO A;  5L3G A;  1FJG O;  4DUZ B;  1GRJ A;  2HKO A;  2GTA A;  5JWP A;  3LUT B;  2ZNI A;  1R1B A;  4TOI A;  1KU9 A;  3N27 A;  3KKY A;  3KZI Z;  2PYJ A;  3APQ A;  5TIS Z;  4G27 B;  4CS4 A;  5J9P C;  4CZZ A;  4IL6 Z;  4PDV A;  4U7O A;  1XQ8 A;  3AG7 A;  4IGG A;  3RVY A;  2Q4P A;  3MAQ A;  2YC0 A;  3AK2 A;  5KUM A;  4CH5 A;  1OJH A;  3OGI B;  4U3J A;  4JI2 B;  1SER A;  3FKS G;  1YIJ V;  1BE3 H;  4DV1 O;  2UXD B;  4BW5 A;  2ZKO A;  1MSW D;  4N23 A;  4X88 A;  2UU9 O;  2PGG A;  3A2F A;  2YIB D;  1H2M A;  3ABM C;  3C3S A;  3THO A;  2Y4T A;  4U3J B;  2ZIN A;  5JJE B;  2EIN C;  1N8R W;  2Q7E A; 
#chains in the Genus database with same CATH homology
 5FL7 G;  4R7C A;  3PJS K;  3IFX A;  5CA3 A;  3DGE A;  3OR7 C;  2Y48 A;  3ETD A;  4UVA A;  4MW8 A;  4CBC A;  2Q69 A;  1F4N A;  4LCU C;  2DYR C;  3T2M A;  5EBW C;  1I5Y A;  5IYC O;  1S3J A;  4PA6 A;  3SPI A;  3CMA V;  4JAU A;  2IH1 C;  3P30 A;  1MOF A;  3F5W C;  1AI5 A;  3FYE B;  4PA7 A;  2BOB C;  3ETG A;  3CP1 A;  4JPR A;  4RUF A;  1P7B A;  3ZMS A;  2DYS B;  1K9M W;  1Q81 W;  1JOY A;  3LDE A;  1VQ7 V;  4P9O A;  5LBQ A;  3LSS A;  3OUF A;  2FTK A;  5B1N A;  1QLN A;  1H8E G;  3OAA G;  1VQ4 V;  3JD3 A;  4UV8 A;  5B3S B;  2EIL C;  1E1R G;  1M57 B;  1OCZ B;  5LGU A;  2WLJ A;  3F7V C;  1VQ9 V;  4R8C A;  2W0F C;  1XL6 A;  2QA4 V;  1GO3 F;  1M9N A;  3K04 A;  3ZMU A;  1PKX A;  4JYB A;  2C2A A;  1R3J C;  3W7W A;  5CBH A;  4X8A A;  1NKD A;  2Y69 C;  3HB3 B;  4KUM A;  2JJ2 G;  4ASU G;  3W7X A;  3ASO B;  1K4D C;  2A79 B;  1V55 B;  3ETE A;  3ZRV A;  5L3F A;  1ROP A;  2EZP A;  4P9P A;  4JTA B;  4I9W A;  5HFL A;  4PA4 A;  2A9H A;  1FFT B;  5IY5 B;  2MK3 A;  4RO2 A;  3RW0 A;  2XND G;  3F7Y C;  2YEV B;  5B3S C;  1M57 C;  2IH3 C;  4MTG A;  3G4S V;  4R50 A;  4BAY A;  5L3B A;  4H33 A;  2H8P C;  2HG5 C;  4JTC B;  2GHY A;  4PA9 A;  4KP4 A;  4Z1M G;  2XAQ A;  3HPL C;  1H2G A;  1RPO A;  3EHB B;  1BL8 A;  3I56 V;  4Q20 A;  2Q68 A;  3GB7 C;  3CCR V;  3AG4 B;  4XDJ A;  1ORQ C;  3OEH G;  4UUJ C;  4WFB V;  2F43 G;  3ZMV A;  3MD0 A;  5KUK A;  1QVF U;  2OTL V;  1SES A;  3QO8 A;  4QPK A;  3ZMT A;  2EBO A;  4DO2 A;  3K9A A;  4KFM A;  5KA6 A;  1SET A;  5IY5 C;  1V54 B;  2JEU A;  1QCE A;  1R73 A;  1AI7 A;  5CMU A;  1JCH A;  1K33 A;  2HFE C;  4RUE A;  3CCJ V;  3WG7 B;  1QVG U;  3VOU A;  3K79 A;  1S72 V;  2Z3Y A;  4PEL A;  2V1D A;  1PL0 A;  5H6Q A;  3AG1 B;  4MS2 A;  2M7W A;  1OHH G;  4L87 A;  2IJK A;  3K08 A;  3BEH A;  2ZXW C;  2IJJ A;  3RBZ A;  3JD4 A;  3CCQ V;  2XOK G;  3CCM V;  4JAS A;  1KQS U;  2ITC C;  4QJF B;  1JJ2 U;  1ENV A;  2B1G A;  1G8M A;  1JQ0 A;  2W6J G;  4ZBM A;  5LHH A;  4UXN A;  3AG2 B;  3ZRX A;  2EIK B;  1M1K W;  1W0J G;  4I5S A;  3ZJZ A;  1Q7Y W;  3E8F A;  5B1B C;  3OR6 C;  5EBM C;  3WG7 C;  2OCC B;  1H38 A;  2EJR A;  3TCU A;  1UJW B;  2IJH A;  1BMF G;  4JF3 A;  4MTO A;  4RQE A;  4TWK A;  4WFF A;  3G71 V;  2ZR2 A;  3JYC A;  4MVU A;  5E1A C;  1FXK A;  2D3O W;  1Y66 A;  4UVB A;  4R6Z A;  2CK3 G;  4GT1 A;  4BIU A;  1YTF B;  2OTJ V;  3QNE A;  4PDM A;  4MVQ A;  3B77 A;  2P7T C;  5KA5 A;  3SPJ A;  1NH2 D;  1DF4 A;  1EZJ A;  1DTO A;  3BY6 A;  1OCR B;  3QO5 A;  2GSM B;  2ZR3 A;  4WFH A;  1K4C C;  2ITD C;  3UM7 A;  1R3L C;  5L3D A;  5BZB A;  2JJ1 G;  4RQF A;  3AG2 C;  3ABK C;  2EIK C;  3K0G A;  4RAI A;  3CXC U;  3B8M A;  1FXK B;  4YXW G;  3QO7 A;  1H8H G;  3SYQ A;  4GCZ A;  3E86 A;  1QR8 A;  3K3W A;  3T4D A;  1VQL V;  2XAJ A;  4GX0 A;  4N21 A;  4JAV A;  1M90 W;  2Z5U A;  2WLM A;  2PI5 A;  1YJW V;  1S0V A;  4WFA V;  4WF9 V;  3OUS A;  1AI4 A;  2QKS A;  3OMN B;  2YEV A;  1MG1 A;  3OM3 B;  1K3E A;  4PA3 A;  1NBM G;  5EC1 C;  2KB1 A;  1F23 A;  2WPD G;  4H37 A;  3T4Z A;  4OXS A;  3AG3 B;  4J9Z B;  2DYS C;  3GWO A;  3T1C A;  3RVZ A;  3SPG A;  1CEZ A;  1M56 B;  1FXK C;  4X89 A;  2EZO A;  5CBG A;  1WLE A;  3OMA B;  3ABL B;  5B1A B;  2Q6A A;  4GX1 A;  3FB5 C;  2XAG A;  1S5H C;  3LDD A;  4MTX A;  1OCZ C;  1QR9 A;  3CC4 V;  1E1Q G;  1GM7 A;  4P30 A;  1MAB G;  2QTO A;  1AJP A;  1RPR A;  4MVM A;  3SYP A;  3D3I A;  3CPW U;  3UKM A;  4QIW F;  3CME V;  1YTF D;  3B8N A;  2A0L A;  4JYC A;  4MT8 A;  3I55 V;  3E83 A;  2P6J A;  2OT5 A;  1FS0 G;  1K73 W;  3ASO C;  1V55 C;  1JVM A;  1PD3 A;  2AHZ A;  3ZRW A;  3K0D A;  1E79 G;  1W0K G;  1BHA A;  3OFN G;  2EIM B;  3ABL C;  1NJI W;  3JD0 A;  1J95 A;  5CN0 A;  1RM1 B;  5DM6 V;  2H94 A;  1KEC A;  4LP8 A;  1OCO B;  2NNU A;  4FJC C;  1K5S A;  1AR1 B;  2DWE C;  3ZRS A;  2DW4 A;  5EK0 A;  4QNH B;  1R6N A;  3ML0 A;  4MVZ A;  2JK5 C;  1KD1 W;  1VQN V;  1PNK A;  3OE7 G;  2WWW A;  1CP9 A;  5H9C A;  3ZRW B;  1R3K C;  3NXS A;  3E8B A;  1EFR G;  3AG4 C;  2QE7 G;  3AEI A;  3STL C;  1VQK V;  1KC8 W;  5C93 A;  3OMI B;  1QLE B;  4BIZ A;  3JD1 A;  3KG2 A;  5LHI A;  3LNM B;  2WLL A;  4XDL A;  1JX9 A;  5HFM A;  1GTO A;  3TET A;  1DLB A;  3SYO A;  2JEX A;  3ZCC A;  5L3C A;  1ZWI C;  1B6Q A;  1V54 C;  2EIM C;  2ZQM A;  3R65 A;  5LGN A;  2EIN B;  2QM7 A;  1RM1 C;  3X2Q B;  2IU3 A;  1VQ8 V;  4WCE V;  4FIP C;  4E2L A;  4HZ3 A;  3FB7 C;  2DQ3 A;  2BOC C;  1VQ5 V;  2QEX V;  3CCU V;  2WLK A;  4F4L A;  2EIJ B;  2V7Q G;  4GX5 A;  5LGT A;  5CBF A;  2DYR B;  3E2E A;  2JIZ G;  3ABU A;  3ZN0 A;  2WLL B;  1YI2 V;  1ARO P;  4MW3 A;  3FYI B;  2X6B A;  3W7S A;  2XAF A;  4MSW C;  1NQT A;  4P2Z A;  3AG1 C;  5EBL C;  5EC2 C;  1VQ6 V;  1XL4 A;  3M99 B;  4PDL A;  1SRY A;  3P32 A;  2HVK C;  1NVP B;  3CYO A;  1K34 A;  3ASN B;  1K97 A;  1Y4M A;  2EIL B;  4G28 B;  3X2Q C;  2K1E A;  1PNL A;  3STZ C;  3G6E V;  1OCC B;  3EFF K;  3CC2 V;  4J9Y B;  5DN6 G;  3IGA C;  3SYC A;  2HJF C;  2OCC C;  4WFE A;  4UV9 A;  1G4Y B;  2EIJ C;  4MVS A;  4QE7 A;  2ATK C;  3OGC C;  1BHB A;  1P4R A;  2X0L A;  3SJQ C;  4HAM A;  2AHY A;  2LFR A;  4XDK A;  3WFV A;  2Y69 B;  3E8H A;  1F51 A;  1NR1 A;  3LDC A;  1K8A W;  1S77 D;  3E8G A;  3K03 A;  1FXV A;  2IW5 A;  2Q67 A;  1AI6 A;  2WLH A;  1IXM A;  2XAH A;  1YSC A;  1HWY A;  2X6A A;  1OCR C;  2R9R B;  3E35 A;  4TT3 G;  3OW2 U;  5B1O A;  1LNQ A;  1GM9 A;  3ASN C;  2LP7 A;  1K92 A;  5IYB O;  1K5Q A;  1COW G;  3E89 A;  3IC7 A;  3D36 A;  2LFS A;  3FB8 C;  1OCC C;  3FB6 C;  4MTF A;  2UXN A;  2JDI G;  2ZDI A;  1SZT A;  4WFG A;  3SPC A;  5LHG A;  1YHQ V;  2P67 A;  3ABT A;  1KKD A;  3JCZ A;  3TK1 A;  1KP3 A;  2P90 A;  1AJN A;  1EBO A;  2QM8 A;  4QE9 A;  3VBB A;  2WLN A;  1Q86 W;  1R3I C;  2UXX A;  3ZN1 A;  1F4M A;  3K06 A;  4QPJ A;  2XAS A;  2IU0 A;  3AG3 C;  4TSF G;  1NVP D;  2R9I A;  2WLI A;  3DTU B;  3CCL V;  4LC1 A;  3CCV V;  2B5U A;  2X6C A;  2ZD9 A;  4MVO A;  5L3G A;  1YJ9 V;  1M56 C;  1OZ0 A;  1KP2 A;  3ZMZ A;  1YIT V;  1K7D A;  2HKO A;  5B1A C;  4LBE C;  5H6R A;  3W7T A;  4MVR A;  1L1F A;  1VQM V;  1FXH A;  3LUT B;  1QBZ A;  5IDJ A;  3MHS C;  1W2B U;  1PNM A;  1NH2 B;  3MHH C;  1WPX A;  2ZXW B;  3H01 A;  2WLI B;  3JD2 A;  2YSU B;  4G27 B;  5J9P C;  2ZDI C;  1TUE B;  4GX2 A;  4CZZ A;  3CCS V;  3ABM B;  4PDV A;  1S76 D;  3A0R A;  4U7O A;  1VQO V;  2WSS G;  4JGS A;  2IJI A;  1GKF A;  5B1B B;  1GM8 A;  1GMG A;  4FK5 C;  4FMT A;  5IYD O;  3RVY A;  4PDR A;  1CPY A;  1I5X A;  2DWD C;  4U7N A;  3CCE V;  5KUM A;  2NLJ C;  4UVC A;  3CD6 V;  1NR7 A;  4HYO A;  3SYA A;  1VQP V;  5GW7 A;  1JPX A;  1SER A;  3CC7 V;  2B1I A;  1OCO C;  3FKS G;  3LSQ A;  2DQ0 A;  3W7U A;  4XBF A;  1YIJ V;  3ZIA G;  2HR3 A;  1THZ A;  2WAM A;  4BW5 A;  1Q82 W;  1MSW D;  2PI4 A;  1YJN V;  3OEE G;  4N23 A;  4X88 A;  1AJQ A;  1QLE C;  2X7R B;  1GK9 A;  3ABM C;  3SPH A;  5L3E A;  1DF5 A;  1R6K A;  3ABK B;  4DXW A;  4G2K A;  2HLD G;  2W6I G;  2HVJ C;  4FPP A;  4JTD B;  4EKW A;  2EIN C;  1N8R W;  4ZKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...