5KLVH

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 5klvH00
3L70H 3L72H 2A06H 1L0LH 3TGUH 2BCCH 3CXHF 1SQXH 1BE3H 3L75H 5KLVH 1L0NH 3CWBH 1KB9F 1PPJH 3L71H 4U3FH 1NTKH 3H1HH 1SQVH 1SQPH 1EZVH 1P84F 3H1KH 1SQQH 3L74H 3CX5F 1BGYH 2IBZH 1BCCH 3BCCH 3L73H 1PP9H 1SQBH 4D6TH 1KYOF 1NU1H 3H1IH 1NTMH 1NTZH 3H1JH 4PD4F 3H1LH 2FYUH
chains in the Genus database with same CATH superfamily
1GM7A 5LMNO 3K59A 1YZBA 4B3MO 1L0NH 3CWBH 2ILMA 3GVMA 1WAZA 3LSUA 1H2MA 3ZRWB 1B6QA 4LF6O 1NQTA 1NTMH 1IDSA 1DF5A 1NT2B 5FNVB 3ZHQA 1QLNA 4B3SO 1YITV 2AHZA 5F2VO 5LP6C 4LFAO 4TV9A 2LW7A 2CK3G 4IGGA 4JGSA 1OCCC 3E89A 2EZPA 5AG2A 1TAEA 1PNLA 1F4MA 3RYHA 1RSOA 1GK9A 2AGAA 1VQ8V 1S76D 5B1NA 4YHHB 1VQNV 1EN6A 4I4TA 2UUAB 4GX0A 1BZKA 1CP9A 4O2BA 3E2EA 2GDSA 2CAZC 4LCUC 2ZR3A 3CCQV 1WPBA 3K3WA 5KHKA 5EBMC 1EN5A 4DR7O 2R9IA 1DGSA 3I56V 4UVBA 1WN7A 1MNGA 3K5OA 4ZHQB 1VF6A 1NI8A 2RDCA 4DUZO 1Q7YW 1I5XA 1ZL8A 1AR1B 2Z0AA 4LFCB 3AK1A 4JYAB 2W0FC 4PA3A 4I9WA 4IT5A 2Q6AA 1FKAO 1F51A 2XAQA 1TUBA 4LNUB 4XDLA 4J7KA 5KMGB 2HEPA 3JCZA 5EYPB 1N36B 4UFZA 4WBNA 3OTOO 2GHYA 4LWSB 3N2KA 4NXMO 4G2KA 5H6QA 1HNXO 2Y69B 3PJSK 2ZE5A 2EINB 4X65B 2VQFO 1KB9F 2DQ3A 1OHHG 2LJ2A 5GW7A 4AI8A 4HBNA 3K03A 5IE9A 3BABA 5CN0A 1EBOA 4UCOA 1Q6UA 3BCCH 1KBHA 1W0JG 2XASA 4WFHA 3TXQA 1I94O 1KQSU 3IGAC 4LP8A 4ZOLA 3B4SA 2GSMB 2ZDIC 2EIKC 4DUYO 4PJ0Z 1VQOV 2Y4TA 2JJ1G 3HKEA 4GKKO 3AG3B 1YF2A 2DJVA 3VQWA 1XNRO 3N2GB 3AG7A 3ZJZA 3A0RA 1TVKB 5FLXN 2QDOA 2V4DA 1XMQB 2E3CA 3RT3C 3SYPA 4PV1B 2E74B 2UXDO 4Q6GA 4DYLA 1SA0B 4I55B 3APOA 5KLVH 1QQCA 4G28B 1K33A 2E75B 3VQYA 4F6RB 2EIMB 3AG2C 1BQ0A 3CE2A 4O4IB 4RUFA 2ZQMA 5KAIZ 3CRAA 3ZHSA 3T1HO 3H01A 1L8DA 3F5WC 4TQFA 1PD3A 2IJIA 2F4VB 4O4JB 5LXTA 4HYOA 2GBOA 3HPLC 5CBHA 1QBZA 4DV6B 1M56C 3CCLV 2HR3A 2FTKA 2RMKB 2EILB 4JI1O 3CHXA 3KCYA 1Y74B 3CS5A 3QO5A 1JJ2U 2BSKB 2CH7A 5KUMA 3UM7A 2OTLV 3S3WA 4HZ3A 5EC1C 4FLVA 1VQ5V 1R3IC 3CYOA 2IU3A 3GWKC 2AZ0A 1K73W 3SJAC 1Y76B 1E79G 2QWRB 3ETQA 3FYEB 1FS0G 2QM7A 5BMVB 3T1YO 4X1YA 1FPOA 1JCHA 1RFYA 4R7CA 4DR1O 5KHGA 5EBLC 3K0DA 4DV3O 3UT5B 1IBKB 4J7ZA 3OEEG 1F7YA 4GZRB 4DV4B 2BTQB 3K04A 4NTXA 2P7TC 4LF4O 1GH6A 4RO2A 3ZN0A 3E22A 4UUJC 4FM1A 4TWKA 2WLNA 3G6EV 5IWAB 1SS3A 1ZAUA 3O65A 1YTFB 4LFBB 1NTKH 3HR0A 3CC7V 2JGUA 3UKMA 4DV7B 2P67A 2EILC 1V55C 2HFEC 5KHIA 1H2GA 1JFFB 1JMKC 2VQEO 2CGNA 4MTGA 1K34A 2A9HA 4OX9B 4ZBMA 2H8PC 4GX1A 3WU2Z 4LF5O 3N27A 3ZRXA 4KHPB 2IH3C 4B3TO 3CJHA 3A8TA 4BIOA 1VQLV 2MK3A 1COWG 4DXWA 1XREA 2X6BA 1F4NA 3SJQC 5K1PA 4JYYA 3CD6V 2EULA 3RYIA 1W59A 1DF4A 1EN4A 5FPRA 4JI3B 3RYHB 1RSOB 1WLEA 1SRYA 3JD4A 3NXSA 1FXHA 3JD1A 2ZINA 5KA5A 5D5PA 4I4TB 4LH7A 2N05A 4ZHQA 1QR8A 1S77D 4O2BB 4N21A 2QJ1A 2DYRC 4K0KO 2ZE8A 1N0NA 1ZUQA 2PI4A 1H38A 3JCUZ 5C93A 5BR8B 4JI0O 4JTDB 2HP8A 4UCVA 3THOA 2JJ2G 1GKFA 3SDLA 3K58A 3FX7A 4QIWF 5EYPA 1Q6IA 2R9RB 5KX5B 1OCOC 1ZL8B 2PTMA 4JI4O 2PYJA 4LWSA 3SPHA 1TUBB 1WB7A 2LO1A 4JV5O 3MHSC 3OMAB 1G6UA 1HP8A 2YS8A 1HR0O 3G6BA 2BTOA 4D6TH 3Q4HB 3ZEDA 2PUSA 1B3QA 1K92A 3OAAG 3ZMTA 1YI2V 1M1KW 1NTZH 2E5LO 3E8GA 3ZHVA 4MW3A 1HNZB 2KG7A 4FJCC 4WFAV 2EJ7A 1XL4A 2ZXWB 5E79Z 5CB4A 1XHXA 1VQ6V 4B3RO 2Q0OC 4JI6O 3ASNC 3W7XA 2DMXA 5KA6A 1FJGB 4IYHA 4H0LB 1NR1A 3K5MA 1N32B 2LP7A 4GX2A 1AR5A 3LSQA 2FKXA 3BA9A 1O9GA 1FXKC 2DWDC 3S3XA 2HHHB 2CTRA 2Q7GA 4LF8O 4JPRA 1VEWA 3M99B 1VF6C 3B40A 2DQ0A 1PNKA 4F6RA 4CH6A 4JAUA 4KP4A 2CTQA 3K9AA 3WB1A 4IYIA 2ARHA 5ITZA 3ETDA 3RVZA 1WNSA 1Q90D 1ORQC 3AEIA 1XNQO 3QVNA 5BZBA 1XMOB 1PV0A 2OWOA 3STZC 1CEZA 3AG4B 1N33O 4DV5B 2NR5A 3LDDA 5EZYB 2IJJA 5H5NA 4P30A 1SC5B 5IT9N 3ZX6A 1K7DA 3K5LA 4YY3B 1YTFD 1NBMG 3VOUA 1AVMA 5LXTB 1IXBA 3SYOA 5B3SB 1I08A 2OT5A 3IC7A 4J7JA 2ZT9B 1M4UA 1Y76A 3CPWU 1K97A 2DYSC 2F23A 4JASA 3IC9A 2P4KA 3T4DA 4JZGA 2AZ2A 1FD9A 4ABMA 2XUMA 2W6JG 4TT3G 3UT5A 2F1MA 1OCRB 4I9QA 4X1YB 4FLZA 2JVDA 3E8BA 5E1AC 4X66B 3ZCCA 3P3NA 1EZJA 3LUTB 1J95A 1WB8A 1ZSPA 4B7KA 1VQ9V 2PYLA 2FB5A 2EIJB 3RYCA 3W7UA 2VS0A 5KAFZ 5DEDA 1PNMA 4JI5B 4CS2A 1QR9A 2QKAA 1MA1A 2AW9A 1GTOA 3E22B 2IU0A 3FB8C 1G1XB 4EFEA 1UJWB 4X20A 1XUQA 3OGCC 1HNWO 1F23A 1L1FA 1MMMA 3D3IA 1HW7A 1ZWIC 3CMAV 2YDEA 4GKJO 4U7OA 2DWEC 3EFFK 5LMNB 3ETGA 4XDKA 3I55V 1VQ7V 2XAFA 2BOBC 5B1BB 2D3OW 1IBLO 4DV0O 2FYUH 3CMEV 4GUNA 5A9GA 2JGDA 3UO2A 5EIBD 3ABLB 3ZRSA 4UV8A 3APQA 4UCTA 3OUFA 3CJHB 1VF7A 3K79A 1P84F 5IY5C 2L6LA 1ROPA 4P9PA 4NB5A 4D7SA 2HVJC 4FZ0A 3CCSV 4B3SB 2EZOA 2W6IG 4TUYA 1N8RW 2L35A 4ZI7B 4LFAB 2WLLA 3RYIB 4MVZA 3PN1A 3C3SA 1JVMA 4YHHO 3CP1A 4CBCA 1O9HA 4PI0A 3BA8A 3DTUB 2Q68A 2VWKA 2P90A 5K1XA 2Q9LA 4PA7A 3ASOB 1TGOA 5IJ0A 1THZA 2QA4V 1EM1A 2NNUA 5KX5A 2LQTA 1WPXA 1XQ8A 2R72A 4J80A 4DR7B 2KKWA 2WAMA 5BY1A 2F93B 3CRQA 4JYAO 1EZVH 3DC6A 4MW8A 1TUEB 4DUZB 5L3EA 4WFEA 3QTCA 2K1EA 3QO7A 2W0XA 4UB6Z 5GTIZ 1K3EA 4MVOA 5KUKA 3H1IH 3B09A 1K4DC 1N36O 1IVSA 1R1BA 4U7NA 3B77A 3Q4HA 3ZN1A 1VQPV 1XL6A 3DXRA 5JVDB 4DR3B 3OTOB 4WFFA 4IIJA 5IJ9A 3J7AU 4FK5C 2DW4A 3TCUA 2HVKC 1QVGU 3JAMN 3ABKB 2UUBO 1QCEA 4NYKA 4AILC 2KG7B 4QPKA 5LL6Y 4O2AA 1K8AW 5LYJA 2QM4A 1JPXA 3ABTA 2A7WA 4BIZA 2HLDG 3OR7C 4QNHB 2QWNB 5CB4B 2QTOA 4UCUA 4J11A 3B2EE 3RYFA 3ML0A 2NLJC 4Z2WA 1Z2GA 1SQBH 3SYQA 4TSFG 1WP7A 3J81N 4PDMA 4DK0A 3ICXA 1JX9A 4QJFB 3CRRA 3LNMB 4GKKB 2VWJA 3DC5A 3KG2A 1XNRB 1GMGA 3W7SA 4JI8O 3K9SA 1R3KC 1PKXA 5L3GA 4FVMA 4PA4A 1XOUA 4MVQA 2UXDB 4WF9V 5LHGA 2CTWA 1KYOF 5ITZB 5EZYA 2Y69C 2YC0A 2EINC 3CEIA 1SQXH 5JCOC 1FYJA 3RFRA 4X62B 3WG7B 2UXBO 1JA8A 5CMUA 3ZRVA 3T1HB 2UXNA 1MZFA 2QE7G 1OV9A 3ABKC 5DM6V 2ZD9A 4DR5O 2LFSA 3SPGA 1V9PA 3F5TA 4DR6B 4DV6O 4DV2B 2WLKA 2HJFC 2Q5ZA 4FPPA 4CC6A 3HKBA 1FFTB 2WLJA 5CBGA 3IFXA 3AG3C 2QSAA 3I5DA 3ZHRA 3OUSA 4PELA 1JJOA 4JI1B 2RN9A 3LSSA 1AB3A 3H1KH 2IM9A 4R8CA 1PM9A 2RNBA 1I0HA 3B8NA 3OTFA 2OCCB 4MSWC 2IW5A 3E8FA 2R9AA 2WA3A 3D36A 3CXCU 3WFVA 2AXTZ 1P7GA 2Q0AA 2E76B 5L3BA 1E1QG 3T1YB 2EIMC 4CH3A 1EFRG 1N0JA 5J2UA 3D3QA 3SPJA 2XOKG 5LA6A 1QVFU 5FPOA 5LP6A 1YVWA 4WCEV 4UB8Z 4DV3B 4PD4F 3QF7A 3X2QB 4MTFA 3IAYA 4JI2O 3RYCB 4O4HA 1BSMA 4LF4B 1MZEA 2YIBA 1XEQA 2Q4PA 3F7YC 2Q69A 1S5HC 3H9VA 4LFBO 4LF9O 2VRZA 3JATA 2YI8A 4F4LA 5GTHZ 1LR1A 4X20B 1YJWV 4DW1A 3JASB 5LGTA 1KKDA 4X1IA 4GT1A 4I7ZB 2GTSA 2P4VA 3U10A 1R73A 3FB6C 4EB6A 2VQEB 4DV1O 1VF5B 4KHPO 1NU1H 1OJHA 4RQFA 2KB1A 5B1AB 2JGDB 3M7MX 2FL4A 2BCCH 2B5UA 1YEWA 4ZI7A 4BW5A 4JI7B 2ITDC 1MOFA 4W4KA 1A32A 3B8MA 1AP5A 2P22C 1ZTEA 4TUYB 4XDJA 1SERA 5EC2C 2WLLB 3OR6C 1TA8A 5CBFA 4UVAA 4H33A 2DE0X 1FAFA 2LGWA 2ODMA 2UXCB 3L71H 3MHHC 2ZDIA 4K8XA 3ZIAG 3CCEV 2UU9B 5EK0A 1VQMV 1XBLA 5IJ0B 2NN4A 1US6A 3FYIB 1GO3F 3P32A 4RQEA 1GAXA 2Z5UA 4LR3A 1H8HG 2HKOA 3KKYA 2Y4UA 4JI0B 5LOVB 5JVDA 1VP7A 4JI4B 3OMNB 4QPJA 4QE9A 5B1AC 3QG5A 2V7QG 3W7TA 4K3AA 3ABMB 3DXRB 4JV5B 3L70H 4EKWA 1M9NA 2YIDA 1KP2A 2YXHA 2ZE6A 4GYCB 3EVKA 1KMIZ 4IIJB 5IJ9B 5LMUO 1HR0B 4NTWA 1HNZO 4X64O 3A0BZ 1YSCA 1AJPA 4LF7O 3AK2A 1FFXB 1YJ9V 2UUCO 3F7VC 2XNDG 4O2AB 1CXZB 2XHBA 5LYJB 4DR2O 4MVRA 4AQYO 1SZTA 3CCRV 1FJGO 3RBZA 5KHJA 1N32O 2GV9A 1S5LZ 4JI6B 3RYFB 1DK1A 1VQKV 1ZX3A 4DRXB 2UXXA 1PP9H 5JH7A 2R70A 5J2TA 4JYBA 1G8MA 4FMTA 4LF8B 3TGUH 3MD0A 3JD0A 2QTSA 3BFRA 5EIBC 3K06A 4U3JA 3GWOA 3WB0A 5H2FZ 1N34B 1W0KG 1XMOO 1M57B 4ZKIA 1XNQB 2ZIOA 5JJEB 5CA0A 1WP8A 1WA8A 3OW2U 1K4CC 1N33B 3K0GA 2ZXWC 1H8EG 3JSNA 4RAIA 3RWRD 3K08A 3TJTA 1P4RA 1SQPH 3VQVA 1GN6A 2JS5A 4JF3A 4MVSA 1BGYH 1DTOA 2P5OA 3HKCA 3RGBA 1UFIA 2ZM6O 3R66A 4TOIA 3G71V 5JJJB 3HKBB 4PI2A 2F66C 3HKDA 2DOSA 1R6KA 2B1IA 1D5AA 4DR4O 5DECA 4O4LA 2A0LA 4B7EA 1Z5VA 1Q86W 3UQ8A 1NR7A 3JALA 1V54B 1BT8A 3W7WA 1W2BU 2KSDA 1YIJV 1XHZA 2Y0IA 2BE3A 4NVPA 3SJCC 1BHBA 4NXNO 2B9ZA 3AG4C 1K9MW 4OXSA 5J2UB 4FZ1A 1M57C 4IL6Z 3JYCA 3CC4V 4NTYA 1K5QA 5LA6B 3ZHUA 3CX5F 5LP6B 5IDJA 3UCSC 3EHBB 4JI5O 1IBMB 1J5EO 3OD4A 3H1JH 4BR6A 4O4HB 3A0HZ 1Q6HA 1ZLZA 1VIBA 2IH1C 4J9ZB 4MT8A 3WB2A 1Y67A 5B3SC 2YXLA 1PL4A 3JASA 2P06A 4BWAA 2Y48A 3JATB 2QR4A 2MW2B 1SQGA 5LGUA 2ATKC 1B04A 4B3MB 1HNWB 4X1IB 1IZ3A 3CXHF 2Q7EA 2H3OA 1NH2B 2PY5A 1SZXA 4GKJB 1OCRC 4FLWA 1V54C 3J80N 3DSQA 4LF6B 4EB6B 3OFNG 1G4YB 1R3LC 1NZ6A 3D36C 5H6RA 1IBLB 4DV0B 4DO2A 4GCZA 1LUVA 4ZIBA 1MSWD 3UO3A 1IURA 1RM1B 3H1LH 3FAVA 3RW0A 2EIJC 1AR4A 2GTAA 1M93A 5LHHA 1BQZA 3ETEA 3H1HH 1HWYA 4R6ZA 4FLYA 2UUAO 2RJZA 3L73H 4PA6A 1I7FA 2X0LA 3E83A 4P9OA 4TQDA 1D2DA 2XAHA 4X1KA 2YEVA 4TV8A 4KUMA 4CC5A 1GN3A 4G27B 5GONA 5J9PC 1S72V 2EIKB 4IHJA 3CRMA 1YJNV 4LFCO 3JAWA 1FXKA 5LOVA 1DLBA 4J42A 1NVPB 1VQ4V 3MDSA 2Y0PA 3RVYA 3ZMZA 2XAGA 4PDRA 5B1BC 3U0ZA 4FLXA 1D5NA 1KU9A 1FXVA 1Q8IA 5C8YA 1IX9A 1XDCA 3A2FA 3TETA 3ABLC 5JWPA 3ZMVA 2WA4A 1AI6A 4MS2A 2LW1A 1SQVH 1OZ0A 1URFA 1SETA 4DR3O 4NXMB 4X65O 4W4LA 1SESA 1HNXB 3AG2B 1RM1C 1XI1A 1FFXA 4MVUA 2M7WA 1R6TA 2VQFB 5JJNB 4YJ3A 1L0LH 3OMIB 4NKGB 1BE3H 4FFBA 4CZZA 3JSLA 3BVOA 3JARA 1KC8W 1JOYA 1I94B 2UUBB 3C90A 4YIOA 3SGIA 3ASOC 1P7BA 4C7UA 5KHHA 1M56B 4DUYB 5HFMA 4DRXA 4JTAB 4BAYA 1Q43A 4RWUA 5IYCO 1SQFA 2ZNJA 1N4CA 2F95B 3CC2V 1XMQO 2YUAA 3OEHG 4MTOA 4E2LA 4I0XA 1KUQA 2JEXA 1AJQA 3K57A 5JH7B 5J2TB 1BL8A 3OE7G 1QHTA 1YXBA 2QEXV 1MG1A 4JAVA 4PDLA 4JI8B 4I50A 1AJNA 3TK1A 4YJ2A 2YXYA 2WLMA 4CH5A 2A06H 4R50A 4U3JB 1YCIA 2YSUB 2HJDA 1GM8A 2ZKOA 2ZR2A 3KZIZ 3FB7C 1SQQH 2H94A 4JZ2A 2LFRA 1R6NA 1UPGA 2F4VO 4X62O 3TXSA 1X4TA 5CA0B 1WA8B 2HG5C 4LC1A 4BW9A 3OGIB 3G80A 4MVMA 2YIBD 2Q73A 3CCVV 2UXBB 2RCVA 4DR6O 4P2ZA 4DV2O 3QO8A 4X89A 4DR5B 4GX5A 2EJRA 2WSSG 2RQ6A 4X88A 3HKCB 3FFQA 2P6JA 2C2AA 4XBFA 1S5JA 1RP3B 3ZBHA 3D8CA 1V55B 4JYCA 4GLXA 5CA1A 2F43G 2QM8A 3CCJV 3HKDB 1T5EA 1NH2D 3DGEA 4KL1A 4UVCA 4O4LB 3EXAA 4WFBV 5HFLA 3L75H 1S3JA 2QKSA 1PPJH 2ETNA 2ITCC 3JALB 3JD3A 4X9QA 1GN2A 3BAAA 4HNAA 2FMLA 2O57A 2ZE7A 3LDEA 3VBBA 2PI5A 4JTCB 1IBKO 4CS3A 4DR1B 4JAAA 4H44B 4Q20A 4FM0A 2WPDG 4DV4O 4UXNA 2JEUA 5IYZA 3CB2A 4CH4A 2WLIA 3WG7C 4QE7A 4L87A 4ASUG 1MABG 5CA3A 3ZMSA 3O9OA 5IWAO 2ZNIA 3JAKA 4UCRA 4FFKA 2BOCC 1BCCH 3NR7A 3KCXA 1K5SA 4JI2B 4NR1A 4DV7O 1H2NA 4J10A 2GUZB 3HB3B 4J9YB 1Y66A 1QNMA 5JQGB 1WJZA 2QWPB 4LF9B 1NVPD 3U11A 2DYRB 2ZCEA 4OX9O 5LHIA 2IBZH 2M6YA 4WFGA 3SR2C 2OCCC 2X6CA 1AROP 3ZMUA 3ZRWA 3SYCA 3BRCA 1ENVA 1XILA 1OCOB 4LF5B 3T1CA 4EEQA 2Q8VA 5FNVA 4B3TB 1KD1W 2PZSA 4L8JA 4DV1B 4EFBA 4X8AA 3ZHTA 1H2LA 4I5SA 1VMGA 3MAQA 5EBWC 2G38A 1P49A 3P3PA 4JI7O 1PL0A 5L3CA 1Q81W 2WLHA 1Z5WA 3X2QC 3FAVB 4F6EA 3RN4A 2ADQB 4JI3O 3GB7C 3BHPA 1H2KA 4MTXA 2OCHA 2XTAA 2CDYA 2JS3A 4KFMA 4TV9B 1NKDA 1M90W 2QKCA 2D2CB 1AI4A 2YICA 2UXCO 4HAMA 2N74A 4X1KB 2CE4A 2B1GA 2OIGA 1KKCA 3ASNB 2YEVB 5BR8O 1B06A 4ICGA 2K9PA 4TV8B 2UU9O 1M5IA 4FM2A 4CS4A 4K8ZA 5GONB 4K0KB 4IHJB 2KQXA 4OPHA 1HDJA 3CCUV 3CRCA 3K5NA 3JAWB 1FXKB 1U97A 1VARA 3T4ZA 4LNUA 1IXMA 3E35A 2JRIA 4Z1VA 3BEHA 5KMGA 4UCSA 2OYQA 4YXWG 3FB5C 5C8YB 1KECA 4OPAA 1RPOA 4AHCA 4UV9A 1I5YA 2YIAA 2IJKA 4PDVA 4BIUA 3T2MA 1BS3A 1OCZB 2DN9A 2Q67A 4J41A 3CSXA 4LBEC 3G67A 4WBNB 1AI7A 1KP3A 5JCOA 2E5LB 3N2KB 4B08A 1MSDA 5D5QA 2ADPA 5LMUB 4YJ3B 3OT7A 2LGQA 4X64B 4FFBB 3SPIA 3JARB 2QWQB 4LF7B 2UUCB 4B3RB 2CTPA 3QNEA 1RPRA 2Q7HA 4DR2B 4N23A 1H2SB 2HHHO 1BMFG 4AQYB 1LUWA 3N2GA 4ZOLB 1AP6A 4OGQB 3C3TA 1TVKA 3R65A 2DYSB 2OTJV 1GN4A 3HKEB 5B1OA 2XT9A 1YHQV 5LBQA 1BHAA 2EX3A 4I0XB 1SA0A 4I55A 5IYDO 3AK3A 2WWWA 1Q82W 3CCMV 1QLEB 1LNQA 1E1RG 1S0VA 4O4IA 2JIZG 3ABMC 1N34O 4I50B 4YJ2B 4DV5O 4E4EA 3E8HA 2IJHA 1SF9A 3FKSG 1OCZC 3FD9A 5FL7G 4DW0A 2JDIG 4YY3O 5A2QN 3STLC 2YI9A 3L74H 5DN6G 4O4JA 3SPCA 2N04A 3SYAA 5H9CA 2CUGA 2AHYA 4PHZA 5B5EZ 1U96A 3AG1B 1GRJA 4FIPC 1Y74A 1AILA 5B66Z 2BSKA 2OIEA 4FLUA 2ZM6B 2CGOA 3SJBC 1JQ0A 4K35A 5CA1B 4DK1A 2JK5C 2A79B 5BMVA 1QU7A 2CH7B 4DR4B 2A3QA 3LNNA 3L72H 3G4SV 4Z1MG 4X66O 4D7TA 5L3FA 3E86A 5BXZA 5L3DA 1JR9A 1AI5A 4KXRA 4U3FH 1QLEC 2V1DA 4HNAB 3BPZA 3IJ4A 5LGNA 1NJIW 2PGGA 1Q5OA 1Q3EA 1YDXA 2EBOA 1OCCB 4NXNB 2BTQA 5IY5B 2QWOB 3VQXA 2Z3YA 3JD2A 2PF4E 4H37A 5IYZB 1GM9A 1R3JC 4YIPA 2WLIB 3L9DA 1Y6XA 4LH6A 2GUZA 1Y4MA 5IYBO 1IBMO 3LDCA 1SKVA 3JAKB 2X6AA 2ZIMA 3ZS8C 5TISZ 5JQGA 3M8AA 1J5EB 2QGNA 1X59A 1CPYA 2XAJA 4H13B 4A5UB 4QGPA 4RUEA 4FLTA 1NS1A 2X7RB 3AG1C 3BY6A 4PA9A 1JFFA 3OM3B 3ABUA 3P30A
chains in the Genus database with same CATH topology
3L70H 3L72H 2A06H 1L0LH 3TGUH 2BCCH 3CXHF 1SQXH 1BE3H 3L75H 5KLVH 1L0NH 3CWBH 1KB9F 1PPJH 3L71H 4U3FH 1NTKH 3H1HH 1SQVH 1SQPH 1EZVH 1P84F 3H1KH 1SQQH 3L74H 3CX5F 1BGYH 2IBZH 1BCCH 3BCCH 3L73H 1PP9H 1SQBH 4D6TH 1KYOF 1NU1H 3H1IH 1NTMH 1NTZH 3H1JH 4PD4F 3H1LH 2FYUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 H;  3L72 H;  2A06 H;  1L0L H;  3TGU H;  2BCC H;  3CXH F;  1SQX H;  1BE3 H;  3L75 H;  5KLV H;  1L0N H;  3CWB H;  1KB9 F;  1PPJ H;  3L71 H;  4U3F H;  1NTK H;  3H1H H;  1SQV H;  1SQP H;  1EZV H;  1P84 F;  3H1K H;  1SQQ H;  3L74 H;  3CX5 F;  1BGY H;  2IBZ H;  1BCC H;  3BCC H;  3L73 H;  1PP9 H;  1SQB H;  4D6T H;  1KYO F;  1NU1 H;  3H1I H;  1NTM H;  1NTZ H;  3H1J H;  4PD4 F;  3H1L H;  2FYU H; 
#chains in the Genus database with same CATH topology
 1GM7 A;  5LMN O;  3K59 A;  1YZB A;  4B3M O;  1L0N H;  3CWB H;  2ILM A;  3GVM A;  1WAZ A;  3LSU A;  1H2M A;  3ZRW B;  1B6Q A;  4LF6 O;  1NQT A;  1NTM H;  1IDS A;  1DF5 A;  1NT2 B;  5FNV B;  3ZHQ A;  1QLN A;  4B3S O;  1YIT V;  2AHZ A;  5F2V O;  5LP6 C;  4LFA O;  4TV9 A;  2LW7 A;  2CK3 G;  4IGG A;  4JGS A;  1OCC C;  3E89 A;  2EZP A;  5AG2 A;  1TAE A;  1PNL A;  1F4M A;  3RYH A;  1RSO A;  1GK9 A;  2AGA A;  1VQ8 V;  1S76 D;  5B1N A;  4YHH B;  1VQN V;  1EN6 A;  4I4T A;  2UUA B;  4GX0 A;  1BZK A;  1CP9 A;  4O2B A;  3E2E A;  2GDS A;  2CAZ C;  4LCU C;  2ZR3 A;  3CCQ V;  1WPB A;  3K3W A;  5KHK A;  5EBM C;  1EN5 A;  4DR7 O;  2R9I A;  1DGS A;  3I56 V;  4UVB A;  1WN7 A;  1MNG A;  3K5O A;  4ZHQ B;  1VF6 A;  1NI8 A;  2RDC A;  4DUZ O;  1Q7Y W;  1I5X A;  1ZL8 A;  1AR1 B;  2Z0A A;  4LFC B;  3AK1 A;  4JYA B;  2W0F C;  4PA3 A;  4I9W A;  4IT5 A;  2Q6A A;  1FKA O;  1F51 A;  2XAQ A;  1TUB A;  4LNU B;  4XDL A;  4J7K A;  5KMG B;  2HEP A;  3JCZ A;  5EYP B;  1N36 B;  4UFZ A;  4WBN A;  3OTO O;  2GHY A;  4LWS B;  3N2K A;  4NXM O;  4G2K A;  5H6Q A;  1HNX O;  2Y69 B;  3PJS K;  2ZE5 A;  2EIN B;  4X65 B;  2VQF O;  1KB9 F;  2DQ3 A;  1OHH G;  2LJ2 A;  5GW7 A;  4AI8 A;  4HBN A;  3K03 A;  5IE9 A;  3BAB A;  5CN0 A;  1EBO A;  4UCO A;  1Q6U A;  3BCC H;  1KBH A;  1W0J G;  2XAS A;  4WFH A;  3TXQ A;  1I94 O;  1KQS U;  3IGA C;  4LP8 A;  4ZOL A;  3B4S A;  2GSM B;  2ZDI C;  2EIK C;  4DUY O;  4PJ0 Z;  1VQO V;  2Y4T A;  2JJ1 G;  3HKE A;  4GKK O;  3AG3 B;  1YF2 A;  2DJV A;  3VQW A;  1XNR O;  3N2G B;  3AG7 A;  3ZJZ A;  3A0R A;  1TVK B;  5FLX N;  2QDO A;  2V4D A;  1XMQ B;  2E3C A;  3RT3 C;  3SYP A;  4PV1 B;  2E74 B;  2UXD O;  4Q6G A;  4DYL A;  1SA0 B;  4I55 B;  3APO A;  5KLV H;  1QQC A;  4G28 B;  1K33 A;  2E75 B;  3VQY A;  4F6R B;  2EIM B;  3AG2 C;  1BQ0 A;  3CE2 A;  4O4I B;  4RUF A;  2ZQM A;  5KAI Z;  3CRA A;  3ZHS A;  3T1H O;  3H01 A;  1L8D A;  3F5W C;  4TQF A;  1PD3 A;  2IJI A;  2F4V B;  4O4J B;  5LXT A;  4HYO A;  2GBO A;  3HPL C;  5CBH A;  1QBZ A;  4DV6 B;  1M56 C;  3CCL V;  2HR3 A;  2FTK A;  2RMK B;  2EIL B;  4JI1 O;  3CHX A;  3KCY A;  1Y74 B;  3CS5 A;  3QO5 A;  1JJ2 U;  2BSK B;  2CH7 A;  5KUM A;  3UM7 A;  2OTL V;  3S3W A;  4HZ3 A;  5EC1 C;  4FLV A;  1VQ5 V;  1R3I C;  3CYO A;  2IU3 A;  3GWK C;  2AZ0 A;  1K73 W;  3SJA C;  1Y76 B;  1E79 G;  2QWR B;  3ETQ A;  3FYE B;  1FS0 G;  2QM7 A;  5BMV B;  3T1Y O;  4X1Y A;  1FPO A;  1JCH A;  1RFY A;  4R7C A;  4DR1 O;  5KHG A;  5EBL C;  3K0D A;  4DV3 O;  3UT5 B;  1IBK B;  4J7Z A;  3OEE G;  1F7Y A;  4GZR B;  4DV4 B;  2BTQ B;  3K04 A;  4NTX A;  2P7T C;  4LF4 O;  1GH6 A;  4RO2 A;  3ZN0 A;  3E22 A;  4UUJ C;  4FM1 A;  4TWK A;  2WLN A;  3G6E V;  5IWA B;  1SS3 A;  1ZAU A;  3O65 A;  1YTF B;  4LFB B;  1NTK H;  3HR0 A;  3CC7 V;  2JGU A;  3UKM A;  4DV7 B;  2P67 A;  2EIL C;  1V55 C;  2HFE C;  5KHI A;  1H2G A;  1JFF B;  1JMK C;  2VQE O;  2CGN A;  4MTG A;  1K34 A;  2A9H A;  4OX9 B;  4ZBM A;  2H8P C;  4GX1 A;  3WU2 Z;  4LF5 O;  3N27 A;  3ZRX A;  4KHP B;  2IH3 C;  4B3T O;  3CJH A;  3A8T A;  4BIO A;  1VQL V;  2MK3 A;  1COW G;  4DXW A;  1XRE A;  2X6B A;  1F4N A;  3SJQ C;  5K1P A;  4JYY A;  3CD6 V;  2EUL A;  3RYI A;  1W59 A;  1DF4 A;  1EN4 A;  5FPR A;  4JI3 B;  3RYH B;  1RSO B;  1WLE A;  1SRY A;  3JD4 A;  3NXS A;  1FXH A;  3JD1 A;  2ZIN A;  5KA5 A;  5D5P A;  4I4T B;  4LH7 A;  2N05 A;  4ZHQ A;  1QR8 A;  1S77 D;  4O2B B;  4N21 A;  2QJ1 A;  2DYR C;  4K0K O;  2ZE8 A;  1N0N A;  1ZUQ A;  2PI4 A;  1H38 A;  3JCU Z;  5C93 A;  5BR8 B;  4JI0 O;  4JTD B;  2HP8 A;  4UCV A;  3THO A;  2JJ2 G;  1GKF A;  3SDL A;  3K58 A;  3FX7 A;  4QIW F;  5EYP A;  1Q6I A;  2R9R B;  5KX5 B;  1OCO C;  1ZL8 B;  2PTM A;  4JI4 O;  2PYJ A;  4LWS A;  3SPH A;  1TUB B;  1WB7 A;  2LO1 A;  4JV5 O;  3MHS C;  3OMA B;  1G6U A;  1HP8 A;  2YS8 A;  1HR0 O;  3G6B A;  2BTO A;  4D6T H;  3Q4H B;  3ZED A;  2PUS A;  1B3Q A;  1K92 A;  3OAA G;  3ZMT A;  1YI2 V;  1M1K W;  1NTZ H;  2E5L O;  3E8G A;  3ZHV A;  4MW3 A;  1HNZ B;  2KG7 A;  4FJC C;  4WFA V;  2EJ7 A;  1XL4 A;  2ZXW B;  5E79 Z;  5CB4 A;  1XHX A;  1VQ6 V;  4B3R O;  2Q0O C;  4JI6 O;  3ASN C;  3W7X A;  2DMX A;  5KA6 A;  1FJG B;  4IYH A;  4H0L B;  1NR1 A;  3K5M A;  1N32 B;  2LP7 A;  4GX2 A;  1AR5 A;  3LSQ A;  2FKX A;  3BA9 A;  1O9G A;  1FXK C;  2DWD C;  3S3X A;  2HHH B;  2CTR A;  2Q7G A;  4LF8 O;  4JPR A;  1VEW A;  3M99 B;  1VF6 C;  3B40 A;  2DQ0 A;  1PNK A;  4F6R A;  4CH6 A;  4JAU A;  4KP4 A;  2CTQ A;  3K9A A;  3WB1 A;  4IYI A;  2ARH A;  5ITZ A;  3ETD A;  3RVZ A;  1WNS A;  1Q90 D;  1ORQ C;  3AEI A;  1XNQ O;  3QVN A;  5BZB A;  1XMO B;  1PV0 A;  2OWO A;  3STZ C;  1CEZ A;  3AG4 B;  1N33 O;  4DV5 B;  2NR5 A;  3LDD A;  5EZY B;  2IJJ A;  5H5N A;  4P30 A;  1SC5 B;  5IT9 N;  3ZX6 A;  1K7D A;  3K5L A;  4YY3 B;  1YTF D;  1NBM G;  3VOU A;  1AVM A;  5LXT B;  1IXB A;  3SYO A;  5B3S B;  1I08 A;  2OT5 A;  3IC7 A;  4J7J A;  2ZT9 B;  1M4U A;  1Y76 A;  3CPW U;  1K97 A;  2DYS C;  2F23 A;  4JAS A;  3IC9 A;  2P4K A;  3T4D A;  4JZG A;  2AZ2 A;  1FD9 A;  4ABM A;  2XUM A;  2W6J G;  4TT3 G;  3UT5 A;  2F1M A;  1OCR B;  4I9Q A;  4X1Y B;  4FLZ A;  2JVD A;  3E8B A;  5E1A C;  4X66 B;  3ZCC A;  3P3N A;  1EZJ A;  3LUT B;  1J95 A;  1WB8 A;  1ZSP A;  4B7K A;  1VQ9 V;  2PYL A;  2FB5 A;  2EIJ B;  3RYC A;  3W7U A;  2VS0 A;  5KAF Z;  5DED A;  1PNM A;  4JI5 B;  4CS2 A;  1QR9 A;  2QKA A;  1MA1 A;  2AW9 A;  1GTO A;  3E22 B;  2IU0 A;  3FB8 C;  1G1X B;  4EFE A;  1UJW B;  4X20 A;  1XUQ A;  3OGC C;  1HNW O;  1F23 A;  1L1F A;  1MMM A;  3D3I A;  1HW7 A;  1ZWI C;  3CMA V;  2YDE A;  4GKJ O;  4U7O A;  2DWE C;  3EFF K;  5LMN B;  3ETG A;  4XDK A;  3I55 V;  1VQ7 V;  2XAF A;  2BOB C;  5B1B B;  2D3O W;  1IBL O;  4DV0 O;  2FYU H;  3CME V;  4GUN A;  5A9G A;  2JGD A;  3UO2 A;  5EIB D;  3ABL B;  3ZRS A;  4UV8 A;  3APQ A;  4UCT A;  3OUF A;  3CJH B;  1VF7 A;  3K79 A;  1P84 F;  5IY5 C;  2L6L A;  1ROP A;  4P9P A;  4NB5 A;  4D7S A;  2HVJ C;  4FZ0 A;  3CCS V;  4B3S B;  2EZO A;  2W6I G;  4TUY A;  1N8R W;  2L35 A;  4ZI7 B;  4LFA B;  2WLL A;  3RYI B;  4MVZ A;  3PN1 A;  3C3S A;  1JVM A;  4YHH O;  3CP1 A;  4CBC A;  1O9H A;  4PI0 A;  3BA8 A;  3DTU B;  2Q68 A;  2VWK A;  2P90 A;  5K1X A;  2Q9L A;  4PA7 A;  3ASO B;  1TGO A;  5IJ0 A;  1THZ A;  2QA4 V;  1EM1 A;  2NNU A;  5KX5 A;  2LQT A;  1WPX A;  1XQ8 A;  2R72 A;  4J80 A;  4DR7 B;  2KKW A;  2WAM A;  5BY1 A;  2F93 B;  3CRQ A;  4JYA O;  1EZV H;  3DC6 A;  4MW8 A;  1TUE B;  4DUZ B;  5L3E A;  4WFE A;  3QTC A;  2K1E A;  3QO7 A;  2W0X A;  4UB6 Z;  5GTI Z;  1K3E A;  4MVO A;  5KUK A;  3H1I H;  3B09 A;  1K4D C;  1N36 O;  1IVS A;  1R1B A;  4U7N A;  3B77 A;  3Q4H A;  3ZN1 A;  1VQP V;  1XL6 A;  3DXR A;  5JVD B;  4DR3 B;  3OTO B;  4WFF A;  4IIJ A;  5IJ9 A;  3J7A U;  4FK5 C;  2DW4 A;  3TCU A;  2HVK C;  1QVG U;  3JAM N;  3ABK B;  2UUB O;  1QCE A;  4NYK A;  4AIL C;  2KG7 B;  4QPK A;  5LL6 Y;  4O2A A;  1K8A W;  5LYJ A;  2QM4 A;  1JPX A;  3ABT A;  2A7W A;  4BIZ A;  2HLD G;  3OR7 C;  4QNH B;  2QWN B;  5CB4 B;  2QTO A;  4UCU A;  4J11 A;  3B2E E;  3RYF A;  3ML0 A;  2NLJ C;  4Z2W A;  1Z2G A;  1SQB H;  3SYQ A;  4TSF G;  1WP7 A;  3J81 N;  4PDM A;  4DK0 A;  3ICX A;  1JX9 A;  4QJF B;  3CRR A;  3LNM B;  4GKK B;  2VWJ A;  3DC5 A;  3KG2 A;  1XNR B;  1GMG A;  3W7S A;  4JI8 O;  3K9S A;  1R3K C;  1PKX A;  5L3G A;  4FVM A;  4PA4 A;  1XOU A;  4MVQ A;  2UXD B;  4WF9 V;  5LHG A;  2CTW A;  1KYO F;  5ITZ B;  5EZY A;  2Y69 C;  2YC0 A;  2EIN C;  3CEI A;  1SQX H;  5JCO C;  1FYJ A;  3RFR A;  4X62 B;  3WG7 B;  2UXB O;  1JA8 A;  5CMU A;  3ZRV A;  3T1H B;  2UXN A;  1MZF A;  2QE7 G;  1OV9 A;  3ABK C;  5DM6 V;  2ZD9 A;  4DR5 O;  2LFS A;  3SPG A;  1V9P A;  3F5T A;  4DR6 B;  4DV6 O;  4DV2 B;  2WLK A;  2HJF C;  2Q5Z A;  4FPP A;  4CC6 A;  3HKB A;  1FFT B;  2WLJ A;  5CBG A;  3IFX A;  3AG3 C;  2QSA A;  3I5D A;  3ZHR A;  3OUS A;  4PEL A;  1JJO A;  4JI1 B;  2RN9 A;  3LSS A;  1AB3 A;  3H1K H;  2IM9 A;  4R8C A;  1PM9 A;  2RNB A;  1I0H A;  3B8N A;  3OTF A;  2OCC B;  4MSW C;  2IW5 A;  3E8F A;  2R9A A;  2WA3 A;  3D36 A;  3CXC U;  3WFV A;  2AXT Z;  1P7G A;  2Q0A A;  2E76 B;  5L3B A;  1E1Q G;  3T1Y B;  2EIM C;  4CH3 A;  1EFR G;  1N0J A;  5J2U A;  3D3Q A;  3SPJ A;  2XOK G;  5LA6 A;  1QVF U;  5FPO A;  5LP6 A;  1YVW A;  4WCE V;  4UB8 Z;  4DV3 B;  4PD4 F;  3QF7 A;  3X2Q B;  4MTF A;  3IAY A;  4JI2 O;  3RYC B;  4O4H A;  1BSM A;  4LF4 B;  1MZE A;  2YIB A;  1XEQ A;  2Q4P A;  3F7Y C;  2Q69 A;  1S5H C;  3H9V A;  4LFB O;  4LF9 O;  2VRZ A;  3JAT A;  2YI8 A;  4F4L A;  5GTH Z;  1LR1 A;  4X20 B;  1YJW V;  4DW1 A;  3JAS B;  5LGT A;  1KKD A;  4X1I A;  4GT1 A;  4I7Z B;  2GTS A;  2P4V A;  3U10 A;  1R73 A;  3FB6 C;  4EB6 A;  2VQE B;  4DV1 O;  1VF5 B;  4KHP O;  1NU1 H;  1OJH A;  4RQF A;  2KB1 A;  5B1A B;  2JGD B;  3M7M X;  2FL4 A;  2BCC H;  2B5U A;  1YEW A;  4ZI7 A;  4BW5 A;  4JI7 B;  2ITD C;  1MOF A;  4W4K A;  1A32 A;  3B8M A;  1AP5 A;  2P22 C;  1ZTE A;  4TUY B;  4XDJ A;  1SER A;  5EC2 C;  2WLL B;  3OR6 C;  1TA8 A;  5CBF A;  4UVA A;  4H33 A;  2DE0 X;  1FAF A;  2LGW A;  2ODM A;  2UXC B;  3L71 H;  3MHH C;  2ZDI A;  4K8X A;  3ZIA G;  3CCE V;  2UU9 B;  5EK0 A;  1VQM V;  1XBL A;  5IJ0 B;  2NN4 A;  1US6 A;  3FYI B;  1GO3 F;  3P32 A;  4RQE A;  1GAX A;  2Z5U A;  4LR3 A;  1H8H G;  2HKO A;  3KKY A;  2Y4U A;  4JI0 B;  5LOV B;  5JVD A;  1VP7 A;  4JI4 B;  3OMN B;  4QPJ A;  4QE9 A;  5B1A C;  3QG5 A;  2V7Q G;  3W7T A;  4K3A A;  3ABM B;  3DXR B;  4JV5 B;  3L70 H;  4EKW A;  1M9N A;  2YID A;  1KP2 A;  2YXH A;  2ZE6 A;  4GYC B;  3EVK A;  1KMI Z;  4IIJ B;  5IJ9 B;  5LMU O;  1HR0 B;  4NTW A;  1HNZ O;  4X64 O;  3A0B Z;  1YSC A;  1AJP A;  4LF7 O;  3AK2 A;  1FFX B;  1YJ9 V;  2UUC O;  3F7V C;  2XND G;  4O2A B;  1CXZ B;  2XHB A;  5LYJ B;  4DR2 O;  4MVR A;  4AQY O;  1SZT A;  3CCR V;  1FJG O;  3RBZ A;  5KHJ A;  1N32 O;  2GV9 A;  1S5L Z;  4JI6 B;  3RYF B;  1DK1 A;  1VQK V;  1ZX3 A;  4DRX B;  2UXX A;  1PP9 H;  5JH7 A;  2R70 A;  5J2T A;  4JYB A;  1G8M A;  4FMT A;  4LF8 B;  3TGU H;  3MD0 A;  3JD0 A;  2QTS A;  3BFR A;  5EIB C;  3K06 A;  4U3J A;  3GWO A;  3WB0 A;  5H2F Z;  1N34 B;  1W0K G;  1XMO O;  1M57 B;  4ZKI A;  1XNQ B;  2ZIO A;  5JJE B;  5CA0 A;  1WP8 A;  1WA8 A;  3OW2 U;  1K4C C;  1N33 B;  3K0G A;  2ZXW C;  1H8E G;  3JSN A;  4RAI A;  3RWR D;  3K08 A;  3TJT A;  1P4R A;  1SQP H;  3VQV A;  1GN6 A;  2JS5 A;  4JF3 A;  4MVS A;  1BGY H;  1DTO A;  2P5O A;  3HKC A;  3RGB A;  1UFI A;  2ZM6 O;  3R66 A;  4TOI A;  3G71 V;  5JJJ B;  3HKB B;  4PI2 A;  2F66 C;  3HKD A;  2DOS A;  1R6K A;  2B1I A;  1D5A A;  4DR4 O;  5DEC A;  4O4L A;  2A0L A;  4B7E A;  1Z5V A;  1Q86 W;  3UQ8 A;  1NR7 A;  3JAL A;  1V54 B;  1BT8 A;  3W7W A;  1W2B U;  2KSD A;  1YIJ V;  1XHZ A;  2Y0I A;  2BE3 A;  4NVP A;  3SJC C;  1BHB A;  4NXN O;  2B9Z A;  3AG4 C;  1K9M W;  4OXS A;  5J2U B;  4FZ1 A;  1M57 C;  4IL6 Z;  3JYC A;  3CC4 V;  4NTY A;  1K5Q A;  5LA6 B;  3ZHU A;  3CX5 F;  5LP6 B;  5IDJ A;  3UCS C;  3EHB B;  4JI5 O;  1IBM B;  1J5E O;  3OD4 A;  3H1J H;  4BR6 A;  4O4H B;  3A0H Z;  1Q6H A;  1ZLZ A;  1VIB A;  2IH1 C;  4J9Z B;  4MT8 A;  3WB2 A;  1Y67 A;  5B3S C;  2YXL A;  1PL4 A;  3JAS A;  2P06 A;  4BWA A;  2Y48 A;  3JAT B;  2QR4 A;  2MW2 B;  1SQG A;  5LGU A;  2ATK C;  1B04 A;  4B3M B;  1HNW B;  4X1I B;  1IZ3 A;  3CXH F;  2Q7E A;  2H3O A;  1NH2 B;  2PY5 A;  1SZX A;  4GKJ B;  1OCR C;  4FLW A;  1V54 C;  3J80 N;  3DSQ A;  4LF6 B;  4EB6 B;  3OFN G;  1G4Y B;  1R3L C;  1NZ6 A;  3D36 C;  5H6R A;  1IBL B;  4DV0 B;  4DO2 A;  4GCZ A;  1LUV A;  4ZIB A;  1MSW D;  3UO3 A;  1IUR A;  1RM1 B;  3H1L H;  3FAV A;  3RW0 A;  2EIJ C;  1AR4 A;  2GTA A;  1M93 A;  5LHH A;  1BQZ A;  3ETE A;  3H1H H;  1HWY A;  4R6Z A;  4FLY A;  2UUA O;  2RJZ A;  3L73 H;  4PA6 A;  1I7F A;  2X0L A;  3E83 A;  4P9O A;  4TQD A;  1D2D A;  2XAH A;  4X1K A;  2YEV A;  4TV8 A;  4KUM A;  4CC5 A;  1GN3 A;  4G27 B;  5GON A;  5J9P C;  1S72 V;  2EIK B;  4IHJ A;  3CRM A;  1YJN V;  4LFC O;  3JAW A;  1FXK A;  5LOV A;  1DLB A;  4J42 A;  1NVP B;  1VQ4 V;  3MDS A;  2Y0P A;  3RVY A;  3ZMZ A;  2XAG A;  4PDR A;  5B1B C;  3U0Z A;  4FLX A;  1D5N A;  1KU9 A;  1FXV A;  1Q8I A;  5C8Y A;  1IX9 A;  1XDC A;  3A2F A;  3TET A;  3ABL C;  5JWP A;  3ZMV A;  2WA4 A;  1AI6 A;  4MS2 A;  2LW1 A;  1SQV H;  1OZ0 A;  1URF A;  1SET A;  4DR3 O;  4NXM B;  4X65 O;  4W4L A;  1SES A;  1HNX B;  3AG2 B;  1RM1 C;  1XI1 A;  1FFX A;  4MVU A;  2M7W A;  1R6T A;  2VQF B;  5JJN B;  4YJ3 A;  1L0L H;  3OMI B;  4NKG B;  1BE3 H;  4FFB A;  4CZZ A;  3JSL A;  3BVO A;  3JAR A;  1KC8 W;  1JOY A;  1I94 B;  2UUB B;  3C90 A;  4YIO A;  3SGI A;  3ASO C;  1P7B A;  4C7U A;  5KHH A;  1M56 B;  4DUY B;  5HFM A;  4DRX A;  4JTA B;  4BAY A;  1Q43 A;  4RWU A;  5IYC O;  1SQF A;  2ZNJ A;  1N4C A;  2F95 B;  3CC2 V;  1XMQ O;  2YUA A;  3OEH G;  4MTO A;  4E2L A;  4I0X A;  1KUQ A;  2JEX A;  1AJQ A;  3K57 A;  5JH7 B;  5J2T B;  1BL8 A;  3OE7 G;  1QHT A;  1YXB A;  2QEX V;  1MG1 A;  4JAV A;  4PDL A;  4JI8 B;  4I50 A;  1AJN A;  3TK1 A;  4YJ2 A;  2YXY A;  2WLM A;  4CH5 A;  2A06 H;  4R50 A;  4U3J B;  1YCI A;  2YSU B;  2HJD A;  1GM8 A;  2ZKO A;  2ZR2 A;  3KZI Z;  3FB7 C;  1SQQ H;  2H94 A;  4JZ2 A;  2LFR A;  1R6N A;  1UPG A;  2F4V O;  4X62 O;  3TXS A;  1X4T A;  5CA0 B;  1WA8 B;  2HG5 C;  4LC1 A;  4BW9 A;  3OGI B;  3G80 A;  4MVM A;  2YIB D;  2Q73 A;  3CCV V;  2UXB B;  2RCV A;  4DR6 O;  4P2Z A;  4DV2 O;  3QO8 A;  4X89 A;  4DR5 B;  4GX5 A;  2EJR A;  2WSS G;  2RQ6 A;  4X88 A;  3HKC B;  3FFQ A;  2P6J A;  2C2A A;  4XBF A;  1S5J A;  1RP3 B;  3ZBH A;  3D8C A;  1V55 B;  4JYC A;  4GLX A;  5CA1 A;  2F43 G;  2QM8 A;  3CCJ V;  3HKD B;  1T5E A;  1NH2 D;  3DGE A;  4KL1 A;  4UVC A;  4O4L B;  3EXA A;  4WFB V;  5HFL A;  3L75 H;  1S3J A;  2QKS A;  1PPJ H;  2ETN A;  2ITC C;  3JAL B;  3JD3 A;  4X9Q A;  1GN2 A;  3BAA A;  4HNA A;  2FML A;  2O57 A;  2ZE7 A;  3LDE A;  3VBB A;  2PI5 A;  4JTC B;  1IBK O;  4CS3 A;  4DR1 B;  4JAA A;  4H44 B;  4Q20 A;  4FM0 A;  2WPD G;  4DV4 O;  4UXN A;  2JEU A;  5IYZ A;  3CB2 A;  4CH4 A;  2WLI A;  3WG7 C;  4QE7 A;  4L87 A;  4ASU G;  1MAB G;  5CA3 A;  3ZMS A;  3O9O A;  5IWA O;  2ZNI A;  3JAK A;  4UCR A;  4FFK A;  2BOC C;  1BCC H;  3NR7 A;  3KCX A;  1K5S A;  4JI2 B;  4NR1 A;  4DV7 O;  1H2N A;  4J10 A;  2GUZ B;  3HB3 B;  4J9Y B;  1Y66 A;  1QNM A;  5JQG B;  1WJZ A;  2QWP B;  4LF9 B;  1NVP D;  3U11 A;  2DYR B;  2ZCE A;  4OX9 O;  5LHI A;  2IBZ H;  2M6Y A;  4WFG A;  3SR2 C;  2OCC C;  2X6C A;  1ARO P;  3ZMU A;  3ZRW A;  3SYC A;  3BRC A;  1ENV A;  1XIL A;  1OCO B;  4LF5 B;  3T1C A;  4EEQ A;  2Q8V A;  5FNV A;  4B3T B;  1KD1 W;  2PZS A;  4L8J A;  4DV1 B;  4EFB A;  4X8A A;  3ZHT A;  1H2L A;  4I5S A;  1VMG A;  3MAQ A;  5EBW C;  2G38 A;  1P49 A;  3P3P A;  4JI7 O;  1PL0 A;  5L3C A;  1Q81 W;  2WLH A;  1Z5W A;  3X2Q C;  3FAV B;  4F6E A;  3RN4 A;  2ADQ B;  4JI3 O;  3GB7 C;  3BHP A;  1H2K A;  4MTX A;  2OCH A;  2XTA A;  2CDY A;  2JS3 A;  4KFM A;  4TV9 B;  1NKD A;  1M90 W;  2QKC A;  2D2C B;  1AI4 A;  2YIC A;  2UXC O;  4HAM A;  2N74 A;  4X1K B;  2CE4 A;  2B1G A;  2OIG A;  1KKC A;  3ASN B;  2YEV B;  5BR8 O;  1B06 A;  4ICG A;  2K9P A;  4TV8 B;  2UU9 O;  1M5I A;  4FM2 A;  4CS4 A;  4K8Z A;  5GON B;  4K0K B;  4IHJ B;  2KQX A;  4OPH A;  1HDJ A;  3CCU V;  3CRC A;  3K5N A;  3JAW B;  1FXK B;  1U97 A;  1VAR A;  3T4Z A;  4LNU A;  1IXM A;  3E35 A;  2JRI A;  4Z1V A;  3BEH A;  5KMG A;  4UCS A;  2OYQ A;  4YXW G;  3FB5 C;  5C8Y B;  1KEC A;  4OPA A;  1RPO A;  4AHC A;  4UV9 A;  1I5Y A;  2YIA A;  2IJK A;  4PDV A;  4BIU A;  3T2M A;  1BS3 A;  1OCZ B;  2DN9 A;  2Q67 A;  4J41 A;  3CSX A;  4LBE C;  3G67 A;  4WBN B;  1AI7 A;  1KP3 A;  5JCO A;  2E5L B;  3N2K B;  4B08 A;  1MSD A;  5D5Q A;  2ADP A;  5LMU B;  4YJ3 B;  3OT7 A;  2LGQ A;  4X64 B;  4FFB B;  3SPI A;  3JAR B;  2QWQ B;  4LF7 B;  2UUC B;  4B3R B;  2CTP A;  3QNE A;  1RPR A;  2Q7H A;  4DR2 B;  4N23 A;  1H2S B;  2HHH O;  1BMF G;  4AQY B;  1LUW A;  3N2G A;  4ZOL B;  1AP6 A;  4OGQ B;  3C3T A;  1TVK A;  3R65 A;  2DYS B;  2OTJ V;  1GN4 A;  3HKE B;  5B1O A;  2XT9 A;  1YHQ V;  5LBQ A;  1BHA A;  2EX3 A;  4I0X B;  1SA0 A;  4I55 A;  5IYD O;  3AK3 A;  2WWW A;  1Q82 W;  3CCM V;  1QLE B;  1LNQ A;  1E1R G;  1S0V A;  4O4I A;  2JIZ G;  3ABM C;  1N34 O;  4I50 B;  4YJ2 B;  4DV5 O;  4E4E A;  3E8H A;  2IJH A;  1SF9 A;  3FKS G;  1OCZ C;  3FD9 A;  5FL7 G;  4DW0 A;  2JDI G;  4YY3 O;  5A2Q N;  3STL C;  2YI9 A;  3L74 H;  5DN6 G;  4O4J A;  3SPC A;  2N04 A;  3SYA A;  5H9C A;  2CUG A;  2AHY A;  4PHZ A;  5B5E Z;  1U96 A;  3AG1 B;  1GRJ A;  4FIP C;  1Y74 A;  1AIL A;  5B66 Z;  2BSK A;  2OIE A;  4FLU A;  2ZM6 B;  2CGO A;  3SJB C;  1JQ0 A;  4K35 A;  5CA1 B;  4DK1 A;  2JK5 C;  2A79 B;  5BMV A;  1QU7 A;  2CH7 B;  4DR4 B;  2A3Q A;  3LNN A;  3L72 H;  3G4S V;  4Z1M G;  4X66 O;  4D7T A;  5L3F A;  3E86 A;  5BXZ A;  5L3D A;  1JR9 A;  1AI5 A;  4KXR A;  4U3F H;  1QLE C;  2V1D A;  4HNA B;  3BPZ A;  3IJ4 A;  5LGN A;  1NJI W;  2PGG A;  1Q5O A;  1Q3E A;  1YDX A;  2EBO A;  1OCC B;  4NXN B;  2BTQ A;  5IY5 B;  2QWO B;  3VQX A;  2Z3Y A;  3JD2 A;  2PF4 E;  4H37 A;  5IYZ B;  1GM9 A;  1R3J C;  4YIP A;  2WLI B;  3L9D A;  1Y6X A;  4LH6 A;  2GUZ A;  1Y4M A;  5IYB O;  1IBM O;  3LDC A;  1SKV A;  3JAK B;  2X6A A;  2ZIM A;  3ZS8 C;  5TIS Z;  5JQG A;  3M8A A;  1J5E B;  2QGN A;  1X59 A;  1CPY A;  2XAJ A;  4H13 B;  4A5U B;  4QGP A;  4RUE A;  4FLT A;  1NS1 A;  2X7R B;  3AG1 C;  3BY6 A;  4PA9 A;  1JFF A;  3OM3 B;  3ABU A;  3P30 A; 
#chains in the Genus database with same CATH homology
 3L70 H;  3L72 H;  2A06 H;  1L0L H;  3TGU H;  2BCC H;  3CXH F;  1SQX H;  1BE3 H;  3L75 H;  5KLV H;  1L0N H;  3CWB H;  1KB9 F;  1PPJ H;  3L71 H;  4U3F H;  1NTK H;  3H1H H;  1SQV H;  1SQP H;  1EZV H;  1P84 F;  3H1K H;  1SQQ H;  3L74 H;  3CX5 F;  1BGY H;  2IBZ H;  1BCC H;  3BCC H;  3L73 H;  1PP9 H;  1SQB H;  4D6T H;  1KYO F;  1NU1 H;  3H1I H;  1NTM H;  1NTZ H;  3H1J H;  4PD4 F;  3H1L H;  2FYU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...