5KLVH

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 5klvH00
1KB9F 1BGYH 1PPJH 1BCCH 1SQQH 1EZVH 3L75H 3L74H 3BCCH 3CWBH 3CX5F 3L72H 1L0NH 1NTMH 2A06H 3H1IH 3H1KH 1NTKH 1KYOF 1NTZH 1P84F 1SQVH 3H1JH 2FYUH 2IBZH 3L73H 1SQPH 3L70H 1SQBH 3H1HH 4PD4F 1NU1H 2BCCH 4D6TH 1SQXH 3TGUH 3H1LH 1PP9H 3CXHF 3L71H 5KLVH 4U3FH 1L0LH 1BE3H
chains in the Genus database with same CATH superfamily
3QTCA 3SJBC 1YI2V 2F4VB 4I5SA 3T4DA 4TUYB 1AI5A 1OCZC 3TJTA 4KL1A 4X9QA 5FNVA 4I7ZB 3EXAA 3RVYA 5BMVA 2Q73A 2E5LB 2HEPA 4PJ0Z 2ITCC 3RYFA 3JCZA 2HLDG 3K5NA 4X20B 1KUQA 3LNNA 4PA4A 3JARB 2PYLA 2FB5A 4XDKA 2IJJA 3CCQV 1F7YA 2AW9A 4E2LA 3NXSA 1AR1B 4YHHO 1VQLV 2QWOB 4UB6Z 1TA8A 4LNUB 5A2QN 2GDSA 1COWG 3F7VC 2LQTA 2L6LA 1BCCH 4OPAA 2H94A 4X65B 2DOSA 1GRJA 2X6AA 2XAJA 2BTQA 3RW0A 2VS0A 4FLXA 3DC6A 1PKXA 5J2TA 4EEQA 1M56C 5H9CA 4TV9A 4D7SA 4LF6B 4QGPA 4QPJA 2BCCH 1JCHA 2GHYA 4GYCB 3HKEA 3K5OA 4HBNA 1JFFB 2Y48A 3JASB 4FZ0A 4I9WA 1EZVH 3ABLC 4B7KA 3BCCH 4R50A 2KQXA 5B1BB 3CC2V 4UCTA 1S72V 1VQOV 3CRCA 4HNAA 4U7OA 2O57A 4FMTA 3P32A 1KQSU 2YEVA 5K1PA 1M4UA 4YJ2A 4DUZO 2AGAA 4IIJA 4OXSA 4RQFA 1OCCC 2E76B 2F23A 3QF7A 4J10A 5FNVB 1YXBA 1MABG 2EIMC 4KP4A 5HFMA 5KLVH 5JH7A 5BMVB 1EN4A 1QU7A 4OPHA 3RYFB 4B3TO 5DECA 3WB0A 2PI4A 2OCHA 2A0LA 4XDLA 1FS0G 1W59A 1Y74A 5CB4B 3W7XA 5BZBA 4F4LA 1NR7A 2PUSA 4P30A 1PNKA 5KHIA 3B2EE 4K3AA 1FPOA 2WLNA 4OGQB 1G6UA 3ML0A 2DWEC 3P3PA 4DYLA 3AG7A 4X64O 1JJ2U 4DR3O 4GX0A 4WF9V 1FD9A 2BTQB 4NTWA 5IJ0A 3ZEDA 3KG2A 3LSSA 5J2TB 4HYOA 4GKJO 3W7SA 4TV9B 5B1NA 3EFFK 3HKEB 1X59A 1V54C 3LSUA 1WA8A 2PGGA 3JD2A 5H5NA 3D3IA 1B6QA 2JGDA 3OUFA 1MOFA 5A9GA 1IX9A 1GO3F 5K1XA 4YIPA 4O4LA 1XEQA 1Q86W 4HNAB 4X1YA 4BIOA 3ZMTA 2YEVB 2ZINA 4YJ2B 4J7ZA 3K9AA 1TUBA 4IIJB 1WPXA 2JS3A 4LP8A 2D2CB 1B3QA 5JH7B 2X6BA 2P06A 2RDCA 3CCVV 4GKKO 4JI3B 5L3EA 3MAQA 3CCLV 3CCSV 5LYJB 2P90A 3ZS8C 1R1BA 1CXZB 3ASOC 2UXCB 4UFZA 2LGQA 4UVBA 2QKAA 1N36O 3CHXA 4CH3A 3UQ8A 3W7TA 3RGBA 3ETEA 1Y66A 4FZ1A 3RYHA 1PL4A 3ZN1A 2YDEA 3J7AU 1M57C 1R6TA 2N04A 3OGIB 3IFXA 2Y0PA 5AG2A 3ZMZA 4JYYA 3E8FA 4CZZA 1QR8A 3JAWA 1SA0A 5IJ0B 1N32O 2QA4V 2Y0IA 4EFBA 3BRCA 3BVOA 1B04A 4JAAA 2Q8VA 2EIJB 2UXXA 2GTAA 4I50A 2H8PC 2Q9LA 2LFRA 5LBQA 5J2UA 4X62O 2JGDB 1AR4A 4JI6B 1H2SB 2BOCC 2W6IG 2V7QG 3C3SA 4O4LB 4X1YB 3ZRWB 2KKWA 2YXLA 1IZ3A 2RJZA 1NTZH 3F5WC 5IT9N 1TUBB 2WLKA 4GT1A 4LFBB 4JZGA 1Y67A 3P3NA 1P7BA 2XTAA 4G28B 3SPIA 3SJAC 5LHGA 2N05A 1RM1B 2IJKA 1SQGA 1Q90D 2GV9A 5H6QA 4JYAO 5LP6C 4JI4O 2UUCO 3RYHB 1S5JA 5JVDA 3A0BZ 1FJGB 3ABKC 5B1OA 1QBZA 3WG7C 4NVPA 3SYCA 1B06A 4NR1A 4MW3A 3SPCA 1E1RG 2KSDA 3JAWB 2P5OA 1SA0B 5IY5B 3L70H 3LSQA 4LFCO 3IGAC 5EBWC 2CAZC 4DW0A 3UO2A 2IU3A 1VQNV 3VQVA 3CXHF 3TK1A 5KHGA 1NR1A 4I50B 1KU9A 1HP8A 3CC4V 2DW4A 3H9VA 2E75B 5J2UB 1W2BU 4JI8B 3GVMA 1P7GA 3G67A 1QVFU 1ORQC 1NJIW 1NQTA 3I56V 1EBOA 5IYZA 3ZN0A 3CE2A 4TQFA 2ZKOA 1RP3B 1YSCA 2P7TC 4WFEA 1FXKC 1HNZB 4MVRA 2MK3A 3T2MA 2NLJC 3FX7A 1T5EA 2Y4UA 2Q0OC 5IYDO 2KB1A 2XHBA 4L87A 3UKMA 2PI5A 3LDCA 4JZ2A 1XREA 1P49A 3F7YC 4LWSA 3DC5A 1IBKO 2CGNA 2Q7EA 4RWUA 1H2MA 4D7TA 1AROP 4H13B 4JI0B 1M5IA 5JVDB 3AG2C 2F4VO 1PL0A 5KAIZ 1F23A 5B1AC 2IW5A 2QM8A 4E4EA 5KA5A 1V55B 2XAHA 2EZPA 4DRXA 1OV9A 4JF3A 3JALA 1YVWA 4FLWA 3AG4B 3TXSA 4X66B 2HG5C 4D6TH 1RSOA 1N33B 3BPZA 1GK9A 5EBMC 5DN6G 3OTFA 3ABMC 3T1CA 1Q7YW 1N0NA 2WLLA 1XL4A 2AHZA 1BS3A 3BAAA 3OD4A 3CX5F 1PD3A 3H1IH 1URFA 4MTOA 1WP8A 3OTOB 5FLXN 3M99B 4B08A 2DN9A 4LF9B 3JSLA 1VQ6V 3WFVA 1CEZA 1UJWB 3HPLC 4X1KA 5IYZB 1F4MA 1OZ0A 4KUMA 4X65O 2EZOA 3DGEA 4EFEA 3JAMN 2EIKB 1Y4MA 3RYCA 4CS2A 3ZMVA 4IT5A 2JS5A 2FYUH 3K59A 1XDCA 1IURA 3D36A 1AR5A 4LWSB 5GTIZ 1JA8A 3OEHG 4NKGB 2F95B 1XL6A 2ZD9A 1IBLB 4DR6B 3CMAV 2DYSC 3U10A 4AILC 2V4DA 1H38A 3THOA 2RCVA 1NKDA 5LA6A 2QDOA 4X88A 1LNQA 4MVSA 5LHHA 2XAQA 2QWPB 4QNHB 2YIBD 3VBBA 2EINB 4DRXB 1MA1A 4LH6A 3CRAA 3JALB 5DM6V 4PDMA 1YF2A 5CA0A 1CPYA 2LW1A 4YY3O 2UUBB 3GWOA 1IDSA 2ZIOA 1RSOB 4MW8A 5FPOA 4MVZA 3OMIB 1MZFA 2W0FC 2W6JG 2WLLB 4BIZA 3N2KA 3OFNG 1ZLZA 1DGSA 4LCUC 1QR9A 3K06A 2OTLV 5LGUA 4DV1B 3L72H 4X1KB 1S5LZ 1JVMA 2AHYA 4LF7O 2Y69B 1I5YA 2QGNA 3RYCB 3FB7C 2ZDIC 4JV5B 1N8RW 3UCSC 5CMUA 2IH3C 2VWJA 1OCOC 5E79Z 2Q4PA 1Y6XA 3H1LH 3JAKA 2OIEA 2WPDG 4UB8Z 1FXHA 4BW9A 2GSMB 4CH5A 3T1YO 5EIBC 2UU9B 1AP6A 3K57A 5B3SC 5CA1A 1XNQB 3CJHA 2Q7GA 2DMXA 4H33A 2K9PA 4JASA 5CBFA 2BOBC 3FB8C 5LA6B 2ATKC 3JSNA 1VMGA 1HNXB 5CN0A 3HKDB 5GONA 5LMNO 4TSFG 4JI5O 2QWQB 3CRRA 4DV2O 3OGCC 5CA0B 4MS2A 5L3GA 4JI3O 1L1FA 2EILB 5LGTA 4CS3A 3BFRA 3FYIB 3SJCC 3SPHA 5JCOC 2UXCO 3CS5A 4JYBA 3CP1A 1HWYA 3VQWA 3TGUH 4PDLA 3TETA 2WLJA 3ZMSA 3N2KB 2UXDO 5JJJB 3BA9A 4JAUA 1D5NA 3LDDA 1WLEA 1HNWB 1U96A 3STLC 1EM1A 1VF6A 5IYBO 3HKBA 4O4JA 3MD0A 2QKSA 1SC5B 2OTJV 1JQ0A 1WNSA 2CUGA 5D5PA 1V55C 4W4LA 4B3MO 3VOUA 2FMLA 1YCIA 2OT5A 4AQYB 4PA6A 5LMUO 1GTOA 2X7RB 3CC7V 4DV0B 1SZTA 3B4SA 3JAKB 2YC0A 3N27A 3E8BA 2ZXWB 2CK3G 3P30A 4P2ZA 5H2FZ 1AJPA 1KKDA 5CA1B 3CJHB 3RFRA 4JI6O 2HR3A 4F6RA 1KKCA 1Q8IA 5IE9A 1XBLA 5HFLA 1EN5A 4JYCA 1BHAA 3D3QA 1BL8A 3CRQA 4N21A 5GONB 4DR1B 3Q4HA 3VQXA 1YZBA 1G4YB 3OM3B 1Y76A 3AG1B 4UXNA 4LFBO 5GTHZ 1YITV 1IXMA 1XUQA 2IJHA 3RYIA 3EVKA 3B77A 3SYAA 1Q5OA 3G6EV 2RMKB 4CC6A 1PNLA 4EB6A 4LBEC 4WBNA 3WU2Z 3K58A 1GM7A 3LDEA 3ZHUA 1QLEB 4RQEA 4IYHA 5KHJA 2JJ2G 1O9GA 2VQEB 1EFRG 2L35A 1H8HG 4DUYB 4BR6A 4DW1A 3H1HH 3RBZA 4O4JB 1MMMA 4JTDB 3APQA 3TXQA 3E8HA 1VF5B 4LF8B 1U97A 4MT8A 1OHHG 1AI7A 1L0LH 4FM0A 3E22A 1N34O 5IDJA 4QE9A 5JWPA 4RUEA 1M90W 3FFQA 2EJRA 1MZEA 4Z1VA 2R72A 2F66C 3ETQA 3FYEB 1VIBA 2QE7G 3K08A 1SQBH 3T1HB 4KFMA 4KHPB 1ZX3A 3JD0A 3ZCCA 1OCRB 3GWKC 4PA3A 1WPBA 4PDRA 4JI8O 1KECA 2DQ0A 4QPKA 4F6RB 1Q6UA 4UCOA 2YIAA 3IC7A 3LNMB 4CBCA 3K5MA 5BR8O 1E79G 3E86A 4JI1B 4LF4B 2E74B 4DV6B 4MVQA 5KHKA 5IYCO 4NXNB 3Q4HB 1HNZO 3CEIA 2Q6AA 1XHZA 4BW5A 4NXMB 5KUKA 4Z1MG 1Y74B 3L75H 1GN2A 2ZNIA 5LXTA 1YHQV 4RO2A 4EB6B 1KYOF 1US6A 4WBNB 5CA3A 2Z0AA 4UCRA 3D36C 4YXWG 4JTCB 2EX3A 1KBHA 2ETNA 1NI8A 4JI0O 2R9IA 4WFHA 4FLYA 1F51A 4FFKA 1BHBA 3W7WA 2WSSG 4OX9O 3ETDA 2PF4E 4J9ZB 4J7KA 4JI7O 3E22B 3QO5A 1Q81W 3TCUA 2ZM6B 2RN9A 1K92A 2Z5UA 4ZHQA 4X66O 3BEHA 4ABMA 1N33O 1WA8B 2XAGA 1PP9H 4ZI7A 4PV1B 3AG3B 1SZXA 3FD9A 2LFSA 2CTPA 1AB3A 4GX5A 3OTOO 2IU0A 3AEIA 1ENVA 1ROPA 1P84F 4LF9O 3ZBHA 4LFAB 3L73H 3DTUB 4UCUA 3SR2C 4CH4A 1PV0A 4DR7B 2B9ZA 5L3CA 2YIBA 2HHHB 1AJNA 2E3CA 3ZRVA 4GLXA 4DR2B 1UPGA 5KX5A 3CMEV 1NS1A 1ZL8A 2ZE5A 2IJIA 3SYOA 5IWAO 3A0RA 2QWNB 4FFBA 3B40A 5B1BC 1AVMA 1K5QA 3LUTB 3CCUV 1IBLO 4DR6O 2WLMA 4IHJA 4TQDA 3AK1A 1NVPD 2HJDA 1YTFD 1PPJH 1UFIA 2JRIA 1YIJV 1R6NA 2ZE6A 2A7WA 2CH7A 3CPWU 1V9PA 4DV5O 4K8XA 2CE4A 1NU1H 4H0LB 3UM7A 4KXRA 2YSUB 2UUBO 2B1IA 4ZHQB 3O9OA 4X1IA 2ZCEA 4DV3B 4ZI7B 2EULA 3HKCA 1VQKV 2WLHA 4UCSA 4K0KB 3T4ZA 4UCVA 2UXBB 1BQZA 2RQ6A 1DF4A 4TT3G 3L9DA 4FJCC 1M9NA 2ZT9B 4MTFA 4R8CA 3J80N 2ZR2A 4DV1O 3K03A 1NTKH 2M6YA 2ARHA 3E35A 2ZE8A 2QR4A 1I94B 3N2GA 2G38A 5KX5B 1ZL8B 4JV5O 2VQFB 4JTAB 1D2DA 1XQ8A 2F93B 1SQFA 1GN6A 2DQ3A 2QTOA 4WCEV 2QM7A 4FFBB 1QHTA 4MVOA 2OCCB 2UU9O 1XNQO 2ZIMA 4IHJB 1NTMH 2UXNA 3H1KH 3IJ4A 1N0JA 1R3IC 2XAFA 2E5LO 4TV8A 1HNXO 2R9RB 4O4IA 2CH7B 3K9SA 4YJ3A 3ZRSA 1BE3H 1NZ6A 2LP7A 2QKCA 2GBOA 1NH2B 4DV7B 4MVMA 1N32B 1SETA 1I0HA 1M1KW 3FB6C 5C8YA 4GX1A 4LC1A 4X1IB 1Q6HA 3ABLB 1AI6A 1O9HA 5LOVA 3HKCB 1FFTB 1JJOA 5JQGA 1BGYH 1FAFA 2YUAA 4B3SB 3MDSA 4GX2A 2VWKA 2XNDG 1FYJA 3MHHC 3F5TA 4L8JA 1OCCB 2UUAB 1Q43A 3SJQC 3R65A 1S5HC 2EIMB 3CRMA 5IJ9A 4P9OA 3BA8A 3C3TA 4LF6O 2GUZA 4FLVA 1VQ4V 3FKSG 4AQYO 2CDYA 3N2GB 4LR3A 1JOYA 3X2QB 4DV0O 2EIJC 2OWOA 1DK1A 4H44B 1BSMA 3FAVA 1M93A 1KP2A 1DTOA 2ZNJA 4PI0A 4G2KA 2ZR3A 4JI2B 2UUCB 3QG5A 1XI1A 4XBFA 4CH6A 3H01A 4BAYA 1VEWA 3K79A 4GZRB 1TUEB 4DXWA 1QQCA 1SESA 4TV8B 4O4IB 1GN4A 4DR1O 2B1GA 4YJ3B 1I08A 4B3RB 2JGUA 2WA3A 3K0GA 3HB3B 3WB2A 1RM1C 4LFCB 4TOIA 4DO2A 5EK0A 4J80A 1L8DA 1V54B 5JJEB 5C8YB 5KAFZ 1R73A 5TISZ 3G4SV 4O2AA 4NTXA 1H8EG 3U11A 2P4VA 4FK5C 1IXBA 3A2FA 5JQGB 4U7NA 4DUYO 1AILA 3SGIA 3OMAB 4DV4B 1NH2D 4Z2WA 1Z5VA 3ZX6A 2XOKG 2BSKA 3ZHRA 4IGGA 3L71H 2P6JA 1K4CC 5IY5C 2GUZB 4MVUA 2ODMA 1KP3A 3ASOB 2Q7HA 3KCYA 2HJFC 1JR9A 2JJ1G 1ZAUA 3T1HO 3JASA 4LF5B 3FAVB 1QNMA 5LP6A 1YJNV 4KHPO 1K8AW 1QCEA 1BT8A 2PTMA 2LW7A 4K35A 2PYJA 2P67A 1AJQA 2QTSA 3C90A 3RWRD 1MSDA 3IAYA 3G80A 1XILA 1Q3EA 2DYRB 5LHIA 4FLZA 3RVZA 1QLNA 4DR5B 3CD6V 3ASNB 2V1DA 1XMOB 2QWRB 1W0JG 3AK3A 3CSXA 4JI1O 4LF4O 4DV6O 4WFBV 3NR7A 4NXNO 4FVMA 4W4KA 5DEDA 3HR0A 4ICGA 1KC8W 1XNRB 2N74A 4TWKA 4NXMO 1FXVA 3K3WA 1LUWA 4I9QA 1LR1A 4QJFB 2HVKC 4PDVA 1IBMB 5CB4A 1VARA 4O2AB 5B66Z 2OCCC 3M7MX 1HR0B 2LO1A 2P22C 3CCRV 1YDXA 4QE7A 3JATA 1JPXA 2FL4A 4PD4F 4J9YB 2Q69A 3CXCU 3GB7C 3S3WA 1FXKA 1KD1W 2BSKB 3AG4C 1RPRA 3JD1A 4PELA 2LGWA 4Q20A 2ZM6O 1D5AA 4UUJC 1E1QG 1WN7A 1H2GA 4PA9A 1VQPV 4MTXA 2QM4A 4DR4B 2WAMA 2NR5A 5J9PC 1K5SA 5LP6B 1G1XB 3ABKB 3WG7B 4X89A 5B5EZ 2D3OW 1GH6A 3ICXA 2RNBA 1XMQB 4LFAO 3K5LA 3FB5C 1W0KG 4IL6Z 3ZRXA 4BIUA 1K97A 2FTKA 4H37A 4DR7O 2EIKC 1SF9A 4RAIA 2HHHO 2DJVA 1TVKA 2X0LA 2YICA 4DR2O 2QEXV 2HKOA 4YY3B 5LYJA 1OJHA 4N23A 3UO3A 3X2QC 2Q0AA 1FJGO 1I7FA 2HP8A 2ADQB 3HKBB 5CBGA 1IVSA 1WB8A 2WWWA 4UV9A 5EYPA 3STZC 1R6KA 4J11A 1P4RA 3JATB 3U0ZA 1J5EB 1KB9F 2QSAA 4JGSA 2EINC 1H2KA 4B7EA 4J41A 4AI8A 5BY1A 4BWAA 1FXKB 4LF7B 1GM9A 5L3FA 2ZQMA 4YIOA 4DK1A 2EJ7A 2M7WA 4R6ZA 2CTQA 2PZSA 2GTSA 3I55V 4QIWF 2YS8A 4U3FH 4MTGA 5KMGA 3UT5A 4DV3O 3T1YB 4GCZA 3OR7C 1ZWIC 3J81N 4K0KO 4F6EA 1X4TA 3AG2B 1NVPB 3BY6A 5B1AB 3ZHVA 1GKFA 1YTFB 2UXBO 4Q6GA 2YI9A 3ZRWA 1JX9A 2Y69C 1Y76B 4CC5A 5LMNB 2P4KA 4JI5B 4MSWC 3RYIB 2ZE7A 3ZJZA 1TVKB 4DV2B 1VQ7V 1RPOA 1I94O 1BQ0A 1PM9A 3APOA 3OMNB 3ABMB 2VQFO 2EBOA 1VQ9V 2DE0X 3SPGA 4YHHB 1VQMV 1DF5A 3OT7A 4FLUA 2CGOA 3K0DA 4NYKA 2ILMA 2WA4A 3JYCA 3QNEA 2UXDB 2A3QA 2W0XA 2AZ0A 4O4HA 3PN1A 2JVDA 3OEEG 1PNMA 5EYPB 1CP9A 4O2BA 3ZIAG 1NT2B 3KKYA 1AI4A 3M8AA 3E2EA 2DYRC 2H3OA 2HVJC 1LUVA 2X6CA 5L3BA 4B3MB 3ASNC 3RT3C 2ZDIA 4JPRA 4LH7A 1TAEA 2R70A 2Z3YA 2EILC 2F43G 2HFEC 5LMUB 4DV7O 1GN3A 1EN6A 1SQQH 1R3LC 4CS4A 3QO8A 1L0NH 5H6RA 2ITDC 3PJSK 5KMGB 1TGOA 3UT5B 2DYSB 1VQ5V 1GAXA 2JIZG 2Q5ZA 3IC9A 4IYIA 5BXZA 3KCXA 1K3EA 5ITZA 2B5UA 4DUZB 2OIGA 5KHHA 4WFGA 4UV8A 4B3SO 2CTWA 1Z5WA 4AHCA 2XT9A 5E1AC 1MNGA 2UUAO 4WFAV 2VRZA 2IH1C 4B3TB 4P9PA 2IBZH 1SQPH 1GM8A 5LXTB 4I55A 5LL6Y 5JCOA 2ZXWC 2A79B 1XOUA 3B8NA 5L3DA 3AK2A 2NNUA 3ABUA 3OAAG 2DWDC 3JD3A 1THZA 5GW7A 1AP5A 5CBHA 4X64B 3E89A 3B09A 4JI2O 4O4HB 4DR3B 1QVGU 1H2NA 3ABTA 4PHZA 5EZYA 4O2BB 2JEXA 2PY5A 5F2VO 4ZOLA 4EKWA 1S77D 3AG1C 1WJZA 4GKJB 2KG7A 1ZTEA 5FPRA 3JD4A 1N34B 1R3JC 1OCOB 4B3RO 5D5QA 4FPPA 1QLEC 1Q82W 1OCZB 5B3SB 4ZIBA 1VF7A 1SERA 1J95A 4FIPC 1VF6C 5ITZB 1I5XA 5JJNB 3K04A 4RUFA 2CTRA 1RFYA 4DV4O 1SQVH 3WB1A 3ZMUA 4J42A 5BR8B 4GKKB 4C7UA 1XHXA 5C93A 1SQXH 3ZHQA 3RN4A 3CCJV 1S0VA 5FL7G 1N36B 5EC1C 1K33A 4I55B 3L74H 3E83A 1BZKA 1SRYA 1FFXA 5LGNA 1Q6IA 1OCRC 4LF5O 1VP7A 3DXRA 1VQ8V 4FLTA 2ADPA 4A5UB 3D8CA 2WLIA 3BHPA 4HAMA 1H2LA 3A0HZ 5EZYB 1M56B 4DR5O 1R3KC 1ZSPA 3SPJA 1XMOO 4ZOLB 4OX9B 3VQYA 2Q68A 4R7CA 5EC2C 1YEWA 4JI7B 2KG7B 1HW7A 3ZHTA 4U3JA 3OW2U 3OUSA 1XNRO 4UVCA 4ZBMA 2YIDA 4X62B 2XASA 1WB7A 1HNWO 4FM1A 1YJ9V 3S3XA 1IBMO 3KZIZ 3CWBH 1WP7A 1HR0O 2YI8A 3A8TA 3BABA 3H1JH 3G6BA 5EBLC 4G27B 3CCEV 4UVAA 1SS3A 4I4TA 3SYPA 3R66A 4GUNA 1HDJA 2A9HA 1NBMG 1ZUQA 2OYQA 4PI2A 4XDJA 5EIBD 1SKVA 4NTYA 1MSWD 1K9MW 3CYOA 2A06H 3O65A 3EHBB 3AG3C 5IWAB 1DLBA 4I0XA 4JYAB 4DR4O 4JAVA 2JDIG 1FFXB 4JI4B 2K1EA 1K34A 1K4DC 4TUYA 3DSQA 2FKXA 4J7JA 3DXRB 2LJ2A 2Y4TA 1XMQO 2C2AA 1YJWV 2WLIB 3I5DA 1MG1A 3HKDA 4PA7A 4DV5B 2XUMA 1S76D 4X20A 1G8MA 2YXHA 1EZJA 3JARA 1FKAO 3E8GA 2AZ2A 1A32A 4HZ3A 1Z2GA 4U3JB 1S3JA 4X8AA 5LOVB 2JEUA 2YXYA 3ETGA 1K73W 4NB5A 2VQEO 2BE3A 3SYQA 4LNUA 1BMFG 2QJ1A 3OE7G 2AXTZ 5KA6A 2F1MA 4ZKIA 4LF8O 1J5EO 5KUMA 3MHSC 3CCMV 5IJ9B 3QVNA 2R9AA 4I4TB 2JK5C 1F4NA 1KMIZ 1GMGA 2BTOA 3QO7A 3CB2A 1JMKC 3ZHSA 3JCUZ 2NN4A 1JFFA 4FM2A 4WFFA 3G71V 4ASUG 2MW2B 3OR6C 1IBKB 1WAZA 3W7UA 4K8ZA 3SDLA 4DK0A 1M57B 4I0XB 1K7DA 2Q67A 3B8MA 1N4CA 2IM9A
chains in the Genus database with same CATH topology
1KB9F 1BGYH 1PPJH 1BCCH 1SQQH 1EZVH 3L75H 3L74H 3BCCH 3CWBH 3CX5F 3L72H 1L0NH 1NTMH 2A06H 3H1IH 3H1KH 1NTKH 1KYOF 1NTZH 1P84F 1SQVH 3H1JH 2FYUH 2IBZH 3L73H 1SQPH 3L70H 1SQBH 3H1HH 4PD4F 1NU1H 2BCCH 4D6TH 1SQXH 3TGUH 3H1LH 1PP9H 3CXHF 3L71H 5KLVH 4U3FH 1L0LH 1BE3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 F;  1BGY H;  1PPJ H;  1BCC H;  1SQQ H;  1EZV H;  3L75 H;  3L74 H;  3BCC H;  3CWB H;  3CX5 F;  3L72 H;  1L0N H;  1NTM H;  2A06 H;  3H1I H;  3H1K H;  1NTK H;  1KYO F;  1NTZ H;  1P84 F;  1SQV H;  3H1J H;  2FYU H;  2IBZ H;  3L73 H;  1SQP H;  3L70 H;  1SQB H;  3H1H H;  4PD4 F;  1NU1 H;  2BCC H;  4D6T H;  1SQX H;  3TGU H;  3H1L H;  1PP9 H;  3CXH F;  3L71 H;  5KLV H;  4U3F H;  1L0L H;  1BE3 H; 
#chains in the Genus database with same CATH topology
 3QTC A;  3SJB C;  1YI2 V;  2F4V B;  4I5S A;  3T4D A;  4TUY B;  1AI5 A;  1OCZ C;  3TJT A;  4KL1 A;  4X9Q A;  5FNV A;  4I7Z B;  3EXA A;  3RVY A;  5BMV A;  2Q73 A;  2E5L B;  2HEP A;  4PJ0 Z;  2ITC C;  3RYF A;  3JCZ A;  2HLD G;  3K5N A;  4X20 B;  1KUQ A;  3LNN A;  4PA4 A;  3JAR B;  2PYL A;  2FB5 A;  4XDK A;  2IJJ A;  3CCQ V;  1F7Y A;  2AW9 A;  4E2L A;  3NXS A;  1AR1 B;  4YHH O;  1VQL V;  2QWO B;  4UB6 Z;  1TA8 A;  4LNU B;  5A2Q N;  2GDS A;  1COW G;  3F7V C;  2LQT A;  2L6L A;  1BCC H;  4OPA A;  2H94 A;  4X65 B;  2DOS A;  1GRJ A;  2X6A A;  2XAJ A;  2BTQ A;  3RW0 A;  2VS0 A;  4FLX A;  3DC6 A;  1PKX A;  5J2T A;  4EEQ A;  1M56 C;  5H9C A;  4TV9 A;  4D7S A;  4LF6 B;  4QGP A;  4QPJ A;  2BCC H;  1JCH A;  2GHY A;  4GYC B;  3HKE A;  3K5O A;  4HBN A;  1JFF B;  2Y48 A;  3JAS B;  4FZ0 A;  4I9W A;  1EZV H;  3ABL C;  4B7K A;  3BCC H;  4R50 A;  2KQX A;  5B1B B;  3CC2 V;  4UCT A;  1S72 V;  1VQO V;  3CRC A;  4HNA A;  4U7O A;  2O57 A;  4FMT A;  3P32 A;  1KQS U;  2YEV A;  5K1P A;  1M4U A;  4YJ2 A;  4DUZ O;  2AGA A;  4IIJ A;  4OXS A;  4RQF A;  1OCC C;  2E76 B;  2F23 A;  3QF7 A;  4J10 A;  5FNV B;  1YXB A;  1MAB G;  2EIM C;  4KP4 A;  5HFM A;  5KLV H;  5JH7 A;  5BMV B;  1EN4 A;  1QU7 A;  4OPH A;  3RYF B;  4B3T O;  5DEC A;  3WB0 A;  2PI4 A;  2OCH A;  2A0L A;  4XDL A;  1FS0 G;  1W59 A;  1Y74 A;  5CB4 B;  3W7X A;  5BZB A;  4F4L A;  1NR7 A;  2PUS A;  4P30 A;  1PNK A;  5KHI A;  3B2E E;  4K3A A;  1FPO A;  2WLN A;  4OGQ B;  1G6U A;  3ML0 A;  2DWE C;  3P3P A;  4DYL A;  3AG7 A;  4X64 O;  1JJ2 U;  4DR3 O;  4GX0 A;  4WF9 V;  1FD9 A;  2BTQ B;  4NTW A;  5IJ0 A;  3ZED A;  3KG2 A;  3LSS A;  5J2T B;  4HYO A;  4GKJ O;  3W7S A;  4TV9 B;  5B1N A;  3EFF K;  3HKE B;  1X59 A;  1V54 C;  3LSU A;  1WA8 A;  2PGG A;  3JD2 A;  5H5N A;  3D3I A;  1B6Q A;  2JGD A;  3OUF A;  1MOF A;  5A9G A;  1IX9 A;  1GO3 F;  5K1X A;  4YIP A;  4O4L A;  1XEQ A;  1Q86 W;  4HNA B;  4X1Y A;  4BIO A;  3ZMT A;  2YEV B;  2ZIN A;  4YJ2 B;  4J7Z A;  3K9A A;  1TUB A;  4IIJ B;  1WPX A;  2JS3 A;  4LP8 A;  2D2C B;  1B3Q A;  5JH7 B;  2X6B A;  2P06 A;  2RDC A;  3CCV V;  4GKK O;  4JI3 B;  5L3E A;  3MAQ A;  3CCL V;  3CCS V;  5LYJ B;  2P90 A;  3ZS8 C;  1R1B A;  1CXZ B;  3ASO C;  2UXC B;  4UFZ A;  2LGQ A;  4UVB A;  2QKA A;  1N36 O;  3CHX A;  4CH3 A;  3UQ8 A;  3W7T A;  3RGB A;  3ETE A;  1Y66 A;  4FZ1 A;  3RYH A;  1PL4 A;  3ZN1 A;  2YDE A;  3J7A U;  1M57 C;  1R6T A;  2N04 A;  3OGI B;  3IFX A;  2Y0P A;  5AG2 A;  3ZMZ A;  4JYY A;  3E8F A;  4CZZ A;  1QR8 A;  3JAW A;  1SA0 A;  5IJ0 B;  1N32 O;  2QA4 V;  2Y0I A;  4EFB A;  3BRC A;  3BVO A;  1B04 A;  4JAA A;  2Q8V A;  2EIJ B;  2UXX A;  2GTA A;  4I50 A;  2H8P C;  2Q9L A;  2LFR A;  5LBQ A;  5J2U A;  4X62 O;  2JGD B;  1AR4 A;  4JI6 B;  1H2S B;  2BOC C;  2W6I G;  2V7Q G;  3C3S A;  4O4L B;  4X1Y B;  3ZRW B;  2KKW A;  2YXL A;  1IZ3 A;  2RJZ A;  1NTZ H;  3F5W C;  5IT9 N;  1TUB B;  2WLK A;  4GT1 A;  4LFB B;  4JZG A;  1Y67 A;  3P3N A;  1P7B A;  2XTA A;  4G28 B;  3SPI A;  3SJA C;  5LHG A;  2N05 A;  1RM1 B;  2IJK A;  1SQG A;  1Q90 D;  2GV9 A;  5H6Q A;  4JYA O;  5LP6 C;  4JI4 O;  2UUC O;  3RYH B;  1S5J A;  5JVD A;  3A0B Z;  1FJG B;  3ABK C;  5B1O A;  1QBZ A;  3WG7 C;  4NVP A;  3SYC A;  1B06 A;  4NR1 A;  4MW3 A;  3SPC A;  1E1R G;  2KSD A;  3JAW B;  2P5O A;  1SA0 B;  5IY5 B;  3L70 H;  3LSQ A;  4LFC O;  3IGA C;  5EBW C;  2CAZ C;  4DW0 A;  3UO2 A;  2IU3 A;  1VQN V;  3VQV A;  3CXH F;  3TK1 A;  5KHG A;  1NR1 A;  4I50 B;  1KU9 A;  1HP8 A;  3CC4 V;  2DW4 A;  3H9V A;  2E75 B;  5J2U B;  1W2B U;  4JI8 B;  3GVM A;  1P7G A;  3G67 A;  1QVF U;  1ORQ C;  1NJI W;  1NQT A;  3I56 V;  1EBO A;  5IYZ A;  3ZN0 A;  3CE2 A;  4TQF A;  2ZKO A;  1RP3 B;  1YSC A;  2P7T C;  4WFE A;  1FXK C;  1HNZ B;  4MVR A;  2MK3 A;  3T2M A;  2NLJ C;  3FX7 A;  1T5E A;  2Y4U A;  2Q0O C;  5IYD O;  2KB1 A;  2XHB A;  4L87 A;  3UKM A;  2PI5 A;  3LDC A;  4JZ2 A;  1XRE A;  1P49 A;  3F7Y C;  4LWS A;  3DC5 A;  1IBK O;  2CGN A;  2Q7E A;  4RWU A;  1H2M A;  4D7T A;  1ARO P;  4H13 B;  4JI0 B;  1M5I A;  5JVD B;  3AG2 C;  2F4V O;  1PL0 A;  5KAI Z;  1F23 A;  5B1A C;  2IW5 A;  2QM8 A;  4E4E A;  5KA5 A;  1V55 B;  2XAH A;  2EZP A;  4DRX A;  1OV9 A;  4JF3 A;  3JAL A;  1YVW A;  4FLW A;  3AG4 B;  3TXS A;  4X66 B;  2HG5 C;  4D6T H;  1RSO A;  1N33 B;  3BPZ A;  1GK9 A;  5EBM C;  5DN6 G;  3OTF A;  3ABM C;  3T1C A;  1Q7Y W;  1N0N A;  2WLL A;  1XL4 A;  2AHZ A;  1BS3 A;  3BAA A;  3OD4 A;  3CX5 F;  1PD3 A;  3H1I H;  1URF A;  4MTO A;  1WP8 A;  3OTO B;  5FLX N;  3M99 B;  4B08 A;  2DN9 A;  4LF9 B;  3JSL A;  1VQ6 V;  3WFV A;  1CEZ A;  1UJW B;  3HPL C;  4X1K A;  5IYZ B;  1F4M A;  1OZ0 A;  4KUM A;  4X65 O;  2EZO A;  3DGE A;  4EFE A;  3JAM N;  2EIK B;  1Y4M A;  3RYC A;  4CS2 A;  3ZMV A;  4IT5 A;  2JS5 A;  2FYU H;  3K59 A;  1XDC A;  1IUR A;  3D36 A;  1AR5 A;  4LWS B;  5GTI Z;  1JA8 A;  3OEH G;  4NKG B;  2F95 B;  1XL6 A;  2ZD9 A;  1IBL B;  4DR6 B;  3CMA V;  2DYS C;  3U10 A;  4AIL C;  2V4D A;  1H38 A;  3THO A;  2RCV A;  1NKD A;  5LA6 A;  2QDO A;  4X88 A;  1LNQ A;  4MVS A;  5LHH A;  2XAQ A;  2QWP B;  4QNH B;  2YIB D;  3VBB A;  2EIN B;  4DRX B;  1MA1 A;  4LH6 A;  3CRA A;  3JAL B;  5DM6 V;  4PDM A;  1YF2 A;  5CA0 A;  1CPY A;  2LW1 A;  4YY3 O;  2UUB B;  3GWO A;  1IDS A;  2ZIO A;  1RSO B;  4MW8 A;  5FPO A;  4MVZ A;  3OMI B;  1MZF A;  2W0F C;  2W6J G;  2WLL B;  4BIZ A;  3N2K A;  3OFN G;  1ZLZ A;  1DGS A;  4LCU C;  1QR9 A;  3K06 A;  2OTL V;  5LGU A;  4DV1 B;  3L72 H;  4X1K B;  1S5L Z;  1JVM A;  2AHY A;  4LF7 O;  2Y69 B;  1I5Y A;  2QGN A;  3RYC B;  3FB7 C;  2ZDI C;  4JV5 B;  1N8R W;  3UCS C;  5CMU A;  2IH3 C;  2VWJ A;  1OCO C;  5E79 Z;  2Q4P A;  1Y6X A;  3H1L H;  3JAK A;  2OIE A;  2WPD G;  4UB8 Z;  1FXH A;  4BW9 A;  2GSM B;  4CH5 A;  3T1Y O;  5EIB C;  2UU9 B;  1AP6 A;  3K57 A;  5B3S C;  5CA1 A;  1XNQ B;  3CJH A;  2Q7G A;  2DMX A;  4H33 A;  2K9P A;  4JAS A;  5CBF A;  2BOB C;  3FB8 C;  5LA6 B;  2ATK C;  3JSN A;  1VMG A;  1HNX B;  5CN0 A;  3HKD B;  5GON A;  5LMN O;  4TSF G;  4JI5 O;  2QWQ B;  3CRR A;  4DV2 O;  3OGC C;  5CA0 B;  4MS2 A;  5L3G A;  4JI3 O;  1L1F A;  2EIL B;  5LGT A;  4CS3 A;  3BFR A;  3FYI B;  3SJC C;  3SPH A;  5JCO C;  2UXC O;  3CS5 A;  4JYB A;  3CP1 A;  1HWY A;  3VQW A;  3TGU H;  4PDL A;  3TET A;  2WLJ A;  3ZMS A;  3N2K B;  2UXD O;  5JJJ B;  3BA9 A;  4JAU A;  1D5N A;  3LDD A;  1WLE A;  1HNW B;  1U96 A;  3STL C;  1EM1 A;  1VF6 A;  5IYB O;  3HKB A;  4O4J A;  3MD0 A;  2QKS A;  1SC5 B;  2OTJ V;  1JQ0 A;  1WNS A;  2CUG A;  5D5P A;  1V55 C;  4W4L A;  4B3M O;  3VOU A;  2FML A;  1YCI A;  2OT5 A;  4AQY B;  4PA6 A;  5LMU O;  1GTO A;  2X7R B;  3CC7 V;  4DV0 B;  1SZT A;  3B4S A;  3JAK B;  2YC0 A;  3N27 A;  3E8B A;  2ZXW B;  2CK3 G;  3P30 A;  4P2Z A;  5H2F Z;  1AJP A;  1KKD A;  5CA1 B;  3CJH B;  3RFR A;  4JI6 O;  2HR3 A;  4F6R A;  1KKC A;  1Q8I A;  5IE9 A;  1XBL A;  5HFL A;  1EN5 A;  4JYC A;  1BHA A;  3D3Q A;  1BL8 A;  3CRQ A;  4N21 A;  5GON B;  4DR1 B;  3Q4H A;  3VQX A;  1YZB A;  1G4Y B;  3OM3 B;  1Y76 A;  3AG1 B;  4UXN A;  4LFB O;  5GTH Z;  1YIT V;  1IXM A;  1XUQ A;  2IJH A;  3RYI A;  3EVK A;  3B77 A;  3SYA A;  1Q5O A;  3G6E V;  2RMK B;  4CC6 A;  1PNL A;  4EB6 A;  4LBE C;  4WBN A;  3WU2 Z;  3K58 A;  1GM7 A;  3LDE A;  3ZHU A;  1QLE B;  4RQE A;  4IYH A;  5KHJ A;  2JJ2 G;  1O9G A;  2VQE B;  1EFR G;  2L35 A;  1H8H G;  4DUY B;  4BR6 A;  4DW1 A;  3H1H H;  3RBZ A;  4O4J B;  1MMM A;  4JTD B;  3APQ A;  3TXQ A;  3E8H A;  1VF5 B;  4LF8 B;  1U97 A;  4MT8 A;  1OHH G;  1AI7 A;  1L0L H;  4FM0 A;  3E22 A;  1N34 O;  5IDJ A;  4QE9 A;  5JWP A;  4RUE A;  1M90 W;  3FFQ A;  2EJR A;  1MZE A;  4Z1V A;  2R72 A;  2F66 C;  3ETQ A;  3FYE B;  1VIB A;  2QE7 G;  3K08 A;  1SQB H;  3T1H B;  4KFM A;  4KHP B;  1ZX3 A;  3JD0 A;  3ZCC A;  1OCR B;  3GWK C;  4PA3 A;  1WPB A;  4PDR A;  4JI8 O;  1KEC A;  2DQ0 A;  4QPK A;  4F6R B;  1Q6U A;  4UCO A;  2YIA A;  3IC7 A;  3LNM B;  4CBC A;  3K5M A;  5BR8 O;  1E79 G;  3E86 A;  4JI1 B;  4LF4 B;  2E74 B;  4DV6 B;  4MVQ A;  5KHK A;  5IYC O;  4NXN B;  3Q4H B;  1HNZ O;  3CEI A;  2Q6A A;  1XHZ A;  4BW5 A;  4NXM B;  5KUK A;  4Z1M G;  1Y74 B;  3L75 H;  1GN2 A;  2ZNI A;  5LXT A;  1YHQ V;  4RO2 A;  4EB6 B;  1KYO F;  1US6 A;  4WBN B;  5CA3 A;  2Z0A A;  4UCR A;  3D36 C;  4YXW G;  4JTC B;  2EX3 A;  1KBH A;  2ETN A;  1NI8 A;  4JI0 O;  2R9I A;  4WFH A;  4FLY A;  1F51 A;  4FFK A;  1BHB A;  3W7W A;  2WSS G;  4OX9 O;  3ETD A;  2PF4 E;  4J9Z B;  4J7K A;  4JI7 O;  3E22 B;  3QO5 A;  1Q81 W;  3TCU A;  2ZM6 B;  2RN9 A;  1K92 A;  2Z5U A;  4ZHQ A;  4X66 O;  3BEH A;  4ABM A;  1N33 O;  1WA8 B;  2XAG A;  1PP9 H;  4ZI7 A;  4PV1 B;  3AG3 B;  1SZX A;  3FD9 A;  2LFS A;  2CTP A;  1AB3 A;  4GX5 A;  3OTO O;  2IU0 A;  3AEI A;  1ENV A;  1ROP A;  1P84 F;  4LF9 O;  3ZBH A;  4LFA B;  3L73 H;  3DTU B;  4UCU A;  3SR2 C;  4CH4 A;  1PV0 A;  4DR7 B;  2B9Z A;  5L3C A;  2YIB A;  2HHH B;  1AJN A;  2E3C A;  3ZRV A;  4GLX A;  4DR2 B;  1UPG A;  5KX5 A;  3CME V;  1NS1 A;  1ZL8 A;  2ZE5 A;  2IJI A;  3SYO A;  5IWA O;  3A0R A;  2QWN B;  4FFB A;  3B40 A;  5B1B C;  1AVM A;  1K5Q A;  3LUT B;  3CCU V;  1IBL O;  4DR6 O;  2WLM A;  4IHJ A;  4TQD A;  3AK1 A;  1NVP D;  2HJD A;  1YTF D;  1PPJ H;  1UFI A;  2JRI A;  1YIJ V;  1R6N A;  2ZE6 A;  2A7W A;  2CH7 A;  3CPW U;  1V9P A;  4DV5 O;  4K8X A;  2CE4 A;  1NU1 H;  4H0L B;  3UM7 A;  4KXR A;  2YSU B;  2UUB O;  2B1I A;  4ZHQ B;  3O9O A;  4X1I A;  2ZCE A;  4DV3 B;  4ZI7 B;  2EUL A;  3HKC A;  1VQK V;  2WLH A;  4UCS A;  4K0K B;  3T4Z A;  4UCV A;  2UXB B;  1BQZ A;  2RQ6 A;  1DF4 A;  4TT3 G;  3L9D A;  4FJC C;  1M9N A;  2ZT9 B;  4MTF A;  4R8C A;  3J80 N;  2ZR2 A;  4DV1 O;  3K03 A;  1NTK H;  2M6Y A;  2ARH A;  3E35 A;  2ZE8 A;  2QR4 A;  1I94 B;  3N2G A;  2G38 A;  5KX5 B;  1ZL8 B;  4JV5 O;  2VQF B;  4JTA B;  1D2D A;  1XQ8 A;  2F93 B;  1SQF A;  1GN6 A;  2DQ3 A;  2QTO A;  4WCE V;  2QM7 A;  4FFB B;  1QHT A;  4MVO A;  2OCC B;  2UU9 O;  1XNQ O;  2ZIM A;  4IHJ B;  1NTM H;  2UXN A;  3H1K H;  3IJ4 A;  1N0J A;  1R3I C;  2XAF A;  2E5L O;  4TV8 A;  1HNX O;  2R9R B;  4O4I A;  2CH7 B;  3K9S A;  4YJ3 A;  3ZRS A;  1BE3 H;  1NZ6 A;  2LP7 A;  2QKC A;  2GBO A;  1NH2 B;  4DV7 B;  4MVM A;  1N32 B;  1SET A;  1I0H A;  1M1K W;  3FB6 C;  5C8Y A;  4GX1 A;  4LC1 A;  4X1I B;  1Q6H A;  3ABL B;  1AI6 A;  1O9H A;  5LOV A;  3HKC B;  1FFT B;  1JJO A;  5JQG A;  1BGY H;  1FAF A;  2YUA A;  4B3S B;  3MDS A;  4GX2 A;  2VWK A;  2XND G;  1FYJ A;  3MHH C;  3F5T A;  4L8J A;  1OCC B;  2UUA B;  1Q43 A;  3SJQ C;  3R65 A;  1S5H C;  2EIM B;  3CRM A;  5IJ9 A;  4P9O A;  3BA8 A;  3C3T A;  4LF6 O;  2GUZ A;  4FLV A;  1VQ4 V;  3FKS G;  4AQY O;  2CDY A;  3N2G B;  4LR3 A;  1JOY A;  3X2Q B;  4DV0 O;  2EIJ C;  2OWO A;  1DK1 A;  4H44 B;  1BSM A;  3FAV A;  1M93 A;  1KP2 A;  1DTO A;  2ZNJ A;  4PI0 A;  4G2K A;  2ZR3 A;  4JI2 B;  2UUC B;  3QG5 A;  1XI1 A;  4XBF A;  4CH6 A;  3H01 A;  4BAY A;  1VEW A;  3K79 A;  4GZR B;  1TUE B;  4DXW A;  1QQC A;  1SES A;  4TV8 B;  4O4I B;  1GN4 A;  4DR1 O;  2B1G A;  4YJ3 B;  1I08 A;  4B3R B;  2JGU A;  2WA3 A;  3K0G A;  3HB3 B;  3WB2 A;  1RM1 C;  4LFC B;  4TOI A;  4DO2 A;  5EK0 A;  4J80 A;  1L8D A;  1V54 B;  5JJE B;  5C8Y B;  5KAF Z;  1R73 A;  5TIS Z;  3G4S V;  4O2A A;  4NTX A;  1H8E G;  3U11 A;  2P4V A;  4FK5 C;  1IXB A;  3A2F A;  5JQG B;  4U7N A;  4DUY O;  1AIL A;  3SGI A;  3OMA B;  4DV4 B;  1NH2 D;  4Z2W A;  1Z5V A;  3ZX6 A;  2XOK G;  2BSK A;  3ZHR A;  4IGG A;  3L71 H;  2P6J A;  1K4C C;  5IY5 C;  2GUZ B;  4MVU A;  2ODM A;  1KP3 A;  3ASO B;  2Q7H A;  3KCY A;  2HJF C;  1JR9 A;  2JJ1 G;  1ZAU A;  3T1H O;  3JAS A;  4LF5 B;  3FAV B;  1QNM A;  5LP6 A;  1YJN V;  4KHP O;  1K8A W;  1QCE A;  1BT8 A;  2PTM A;  2LW7 A;  4K35 A;  2PYJ A;  2P67 A;  1AJQ A;  2QTS A;  3C90 A;  3RWR D;  1MSD A;  3IAY A;  3G80 A;  1XIL A;  1Q3E A;  2DYR B;  5LHI A;  4FLZ A;  3RVZ A;  1QLN A;  4DR5 B;  3CD6 V;  3ASN B;  2V1D A;  1XMO B;  2QWR B;  1W0J G;  3AK3 A;  3CSX A;  4JI1 O;  4LF4 O;  4DV6 O;  4WFB V;  3NR7 A;  4NXN O;  4FVM A;  4W4K A;  5DED A;  3HR0 A;  4ICG A;  1KC8 W;  1XNR B;  2N74 A;  4TWK A;  4NXM O;  1FXV A;  3K3W A;  1LUW A;  4I9Q A;  1LR1 A;  4QJF B;  2HVK C;  4PDV A;  1IBM B;  5CB4 A;  1VAR A;  4O2A B;  5B66 Z;  2OCC C;  3M7M X;  1HR0 B;  2LO1 A;  2P22 C;  3CCR V;  1YDX A;  4QE7 A;  3JAT A;  1JPX A;  2FL4 A;  4PD4 F;  4J9Y B;  2Q69 A;  3CXC U;  3GB7 C;  3S3W A;  1FXK A;  1KD1 W;  2BSK B;  3AG4 C;  1RPR A;  3JD1 A;  4PEL A;  2LGW A;  4Q20 A;  2ZM6 O;  1D5A A;  4UUJ C;  1E1Q G;  1WN7 A;  1H2G A;  4PA9 A;  1VQP V;  4MTX A;  2QM4 A;  4DR4 B;  2WAM A;  2NR5 A;  5J9P C;  1K5S A;  5LP6 B;  1G1X B;  3ABK B;  3WG7 B;  4X89 A;  5B5E Z;  2D3O W;  1GH6 A;  3ICX A;  2RNB A;  1XMQ B;  4LFA O;  3K5L A;  3FB5 C;  1W0K G;  4IL6 Z;  3ZRX A;  4BIU A;  1K97 A;  2FTK A;  4H37 A;  4DR7 O;  2EIK C;  1SF9 A;  4RAI A;  2HHH O;  2DJV A;  1TVK A;  2X0L A;  2YIC A;  4DR2 O;  2QEX V;  2HKO A;  4YY3 B;  5LYJ A;  1OJH A;  4N23 A;  3UO3 A;  3X2Q C;  2Q0A A;  1FJG O;  1I7F A;  2HP8 A;  2ADQ B;  3HKB B;  5CBG A;  1IVS A;  1WB8 A;  2WWW A;  4UV9 A;  5EYP A;  3STZ C;  1R6K A;  4J11 A;  1P4R A;  3JAT B;  3U0Z A;  1J5E B;  1KB9 F;  2QSA A;  4JGS A;  2EIN C;  1H2K A;  4B7E A;  4J41 A;  4AI8 A;  5BY1 A;  4BWA A;  1FXK B;  4LF7 B;  1GM9 A;  5L3F A;  2ZQM A;  4YIO A;  4DK1 A;  2EJ7 A;  2M7W A;  4R6Z A;  2CTQ A;  2PZS A;  2GTS A;  3I55 V;  4QIW F;  2YS8 A;  4U3F H;  4MTG A;  5KMG A;  3UT5 A;  4DV3 O;  3T1Y B;  4GCZ A;  3OR7 C;  1ZWI C;  3J81 N;  4K0K O;  4F6E A;  1X4T A;  3AG2 B;  1NVP B;  3BY6 A;  5B1A B;  3ZHV A;  1GKF A;  1YTF B;  2UXB O;  4Q6G A;  2YI9 A;  3ZRW A;  1JX9 A;  2Y69 C;  1Y76 B;  4CC5 A;  5LMN B;  2P4K A;  4JI5 B;  4MSW C;  3RYI B;  2ZE7 A;  3ZJZ A;  1TVK B;  4DV2 B;  1VQ7 V;  1RPO A;  1I94 O;  1BQ0 A;  1PM9 A;  3APO A;  3OMN B;  3ABM B;  2VQF O;  2EBO A;  1VQ9 V;  2DE0 X;  3SPG A;  4YHH B;  1VQM V;  1DF5 A;  3OT7 A;  4FLU A;  2CGO A;  3K0D A;  4NYK A;  2ILM A;  2WA4 A;  3JYC A;  3QNE A;  2UXD B;  2A3Q A;  2W0X A;  2AZ0 A;  4O4H A;  3PN1 A;  2JVD A;  3OEE G;  1PNM A;  5EYP B;  1CP9 A;  4O2B A;  3ZIA G;  1NT2 B;  3KKY A;  1AI4 A;  3M8A A;  3E2E A;  2DYR C;  2H3O A;  2HVJ C;  1LUV A;  2X6C A;  5L3B A;  4B3M B;  3ASN C;  3RT3 C;  2ZDI A;  4JPR A;  4LH7 A;  1TAE A;  2R70 A;  2Z3Y A;  2EIL C;  2F43 G;  2HFE C;  5LMU B;  4DV7 O;  1GN3 A;  1EN6 A;  1SQQ H;  1R3L C;  4CS4 A;  3QO8 A;  1L0N H;  5H6R A;  2ITD C;  3PJS K;  5KMG B;  1TGO A;  3UT5 B;  2DYS B;  1VQ5 V;  1GAX A;  2JIZ G;  2Q5Z A;  3IC9 A;  4IYI A;  5BXZ A;  3KCX A;  1K3E A;  5ITZ A;  2B5U A;  4DUZ B;  2OIG A;  5KHH A;  4WFG A;  4UV8 A;  4B3S O;  2CTW A;  1Z5W A;  4AHC A;  2XT9 A;  5E1A C;  1MNG A;  2UUA O;  4WFA V;  2VRZ A;  2IH1 C;  4B3T B;  4P9P A;  2IBZ H;  1SQP H;  1GM8 A;  5LXT B;  4I55 A;  5LL6 Y;  5JCO A;  2ZXW C;  2A79 B;  1XOU A;  3B8N A;  5L3D A;  3AK2 A;  2NNU A;  3ABU A;  3OAA G;  2DWD C;  3JD3 A;  1THZ A;  5GW7 A;  1AP5 A;  5CBH A;  4X64 B;  3E89 A;  3B09 A;  4JI2 O;  4O4H B;  4DR3 B;  1QVG U;  1H2N A;  3ABT A;  4PHZ A;  5EZY A;  4O2B B;  2JEX A;  2PY5 A;  5F2V O;  4ZOL A;  4EKW A;  1S77 D;  3AG1 C;  1WJZ A;  4GKJ B;  2KG7 A;  1ZTE A;  5FPR A;  3JD4 A;  1N34 B;  1R3J C;  1OCO B;  4B3R O;  5D5Q A;  4FPP A;  1QLE C;  1Q82 W;  1OCZ B;  5B3S B;  4ZIB A;  1VF7 A;  1SER A;  1J95 A;  4FIP C;  1VF6 C;  5ITZ B;  1I5X A;  5JJN B;  3K04 A;  4RUF A;  2CTR A;  1RFY A;  4DV4 O;  1SQV H;  3WB1 A;  3ZMU A;  4J42 A;  5BR8 B;  4GKK B;  4C7U A;  1XHX A;  5C93 A;  1SQX H;  3ZHQ A;  3RN4 A;  3CCJ V;  1S0V A;  5FL7 G;  1N36 B;  5EC1 C;  1K33 A;  4I55 B;  3L74 H;  3E83 A;  1BZK A;  1SRY A;  1FFX A;  5LGN A;  1Q6I A;  1OCR C;  4LF5 O;  1VP7 A;  3DXR A;  1VQ8 V;  4FLT A;  2ADP A;  4A5U B;  3D8C A;  2WLI A;  3BHP A;  4HAM A;  1H2L A;  3A0H Z;  5EZY B;  1M56 B;  4DR5 O;  1R3K C;  1ZSP A;  3SPJ A;  1XMO O;  4ZOL B;  4OX9 B;  3VQY A;  2Q68 A;  4R7C A;  5EC2 C;  1YEW A;  4JI7 B;  2KG7 B;  1HW7 A;  3ZHT A;  4U3J A;  3OW2 U;  3OUS A;  1XNR O;  4UVC A;  4ZBM A;  2YID A;  4X62 B;  2XAS A;  1WB7 A;  1HNW O;  4FM1 A;  1YJ9 V;  3S3X A;  1IBM O;  3KZI Z;  3CWB H;  1WP7 A;  1HR0 O;  2YI8 A;  3A8T A;  3BAB A;  3H1J H;  3G6B A;  5EBL C;  4G27 B;  3CCE V;  4UVA A;  1SS3 A;  4I4T A;  3SYP A;  3R66 A;  4GUN A;  1HDJ A;  2A9H A;  1NBM G;  1ZUQ A;  2OYQ A;  4PI2 A;  4XDJ A;  5EIB D;  1SKV A;  4NTY A;  1MSW D;  1K9M W;  3CYO A;  2A06 H;  3O65 A;  3EHB B;  3AG3 C;  5IWA B;  1DLB A;  4I0X A;  4JYA B;  4DR4 O;  4JAV A;  2JDI G;  1FFX B;  4JI4 B;  2K1E A;  1K34 A;  1K4D C;  4TUY A;  3DSQ A;  2FKX A;  4J7J A;  3DXR B;  2LJ2 A;  2Y4T A;  1XMQ O;  2C2A A;  1YJW V;  2WLI B;  3I5D A;  1MG1 A;  3HKD A;  4PA7 A;  4DV5 B;  2XUM A;  1S76 D;  4X20 A;  1G8M A;  2YXH A;  1EZJ A;  3JAR A;  1FKA O;  3E8G A;  2AZ2 A;  1A32 A;  4HZ3 A;  1Z2G A;  4U3J B;  1S3J A;  4X8A A;  5LOV B;  2JEU A;  2YXY A;  3ETG A;  1K73 W;  4NB5 A;  2VQE O;  2BE3 A;  3SYQ A;  4LNU A;  1BMF G;  2QJ1 A;  3OE7 G;  2AXT Z;  5KA6 A;  2F1M A;  4ZKI A;  4LF8 O;  1J5E O;  5KUM A;  3MHS C;  3CCM V;  5IJ9 B;  3QVN A;  2R9A A;  4I4T B;  2JK5 C;  1F4N A;  1KMI Z;  1GMG A;  2BTO A;  3QO7 A;  3CB2 A;  1JMK C;  3ZHS A;  3JCU Z;  2NN4 A;  1JFF A;  4FM2 A;  4WFF A;  3G71 V;  4ASU G;  2MW2 B;  3OR6 C;  1IBK B;  1WAZ A;  3W7U A;  4K8Z A;  3SDL A;  4DK0 A;  1M57 B;  4I0X B;  1K7D A;  2Q67 A;  3B8M A;  1N4C A;  2IM9 A; 
#chains in the Genus database with same CATH homology
 1KB9 F;  1BGY H;  1PPJ H;  1BCC H;  1SQQ H;  1EZV H;  3L75 H;  3L74 H;  3BCC H;  3CWB H;  3CX5 F;  3L72 H;  1L0N H;  1NTM H;  2A06 H;  3H1I H;  3H1K H;  1NTK H;  1KYO F;  1NTZ H;  1P84 F;  1SQV H;  3H1J H;  2FYU H;  2IBZ H;  3L73 H;  1SQP H;  3L70 H;  1SQB H;  3H1H H;  4PD4 F;  1NU1 H;  2BCC H;  4D6T H;  1SQX H;  3TGU H;  3H1L H;  1PP9 H;  3CXH F;  3L71 H;  5KLV H;  4U3F H;  1L0L H;  1BE3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...