5KLVH

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
b'ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 5klvH00
1BE3H 3L72H 1SQBH 1KB9F 1L0NH 1SQQH 2BCCH 3CWBH 1NTMH 5KLVH 1SQPH 1SQXH 2IBZH 3L75H 3H1HH 1KYOF 3H1JH 3H1KH 1NTKH 2FYUH 3CXHF 3H1LH 1BGYH 2A06H 3L70H 4U3FH 1P84F 1NTZH 3TGUH 1SQVH 3CX5F 1PPJH 3L74H 1PP9H 3L73H 3L71H 3H1IH 4D6TH 3BCCH 1EZVH 4PD4F 1L0LH 1NU1H 1BCCH
chains in the Genus database with same CATH superfamily
1SC5B 4AI8A 3ABKC 3DXRB 2DYRB 4JI4O 2ZIMA 4NXMB 1Q43A 1M9NA 3K79A 1SQVH 4OGQB 4Z1MG 3K08A 1B04A 2QWOB 4DR4B 1OCRB 4MVQA 1SESA 3RYIA 4BR6A 3NXSA 2QM7A 3CRRA 3T1HO 4J9YB 4C7UA 5FPRA 4K8XA 1NKDA 2UUBO 4TSFG 3OGIB 2Q4PA 3ZHUA 4JI2O 4OX9B 5CA1A 1HNWB 2Q9LA 4AILC 2HJDA 4PDMA 3ZBHA 4FLYA 3OTOO 1H2GA 3X2QB 1NU1H 4LF4O 2QM8A 4TUYA 5KAFZ 2UUAB 1AP5A 4Q6GA 2EIJB 5KX5B 4N21A 4IT5A 3ZN0A 2JS5A 3CRMA 5JJEB 1VQMV 3G6BA 5LL6Y 2A06H 4DV5O 4ZHQA 5L3GA 4F6EA 5EBWC 3CP1A 1WN7A 4AHCA 2P90A 3K04A 2GV9A 2P67A 3ZIAG 2QWNB 3MHHC 2WLHA 1BSMA 1VQ8V 3B77A 3L75H 4TWKA 2BTQB 2EINC 4WBNA 1N33B 4PA3A 1Y76B 1JA8A 1FD9A 4BIUA 3I55V 1TVKB 4DK1A 4X62B 3AK2A 2HR3A 3X2QC 5KUKA 3TETA 3BCCH 3OTFA 3K0GA 1OCOC 3QF7A 1WPXA 2Q7EA 1Z5VA 5KA6A 3BA9A 3LSSA 1IBKO 4K8ZA 1E1RG 1HDJA 2P06A 4DV3O 3VQYA 4FFBB 4LH7A 1OHHG 3BABA 5DECA 4WFEA 1F4NA 1BT8A 4JGSA 1AILA 2WLLB 3AG7A 4B7EA 4PA7A 4UCUA 1Z5WA 3HB3B 4MVZA 2HJFC 4JF3A 1OZ0A 3A0RA 5K1PA 2BOCC 5C8YA 3OEEG 2A3QA 2W6JG 1OCCC 2P7TC 1FS0G 2IJIA 4FM1A 1XL4A 3JATB 4EKWA 5IJ0A 1P49A 2PI4A 3J7AU 1GN6A 4DV2O 2AZ0A 4YIPA 2QTSA 1EN5A 3LSUA 1GM7A 2OIGA 4X1YA 4X8AA 3SJCC 4DV7O 4FPPA 1MOFA 3D3QA 3DC5A 3VBBA 4QE9A 5JCOC 5H6RA 2V4DA 4X1KA 3BVOA 2E3CA 1WA8A 2VQFO 4ZI7A 3JD1A 4XDLA 3JD2A 1J5EB 2UUCB 1BZKA 1XNQO 2CK3G 4TV9A 4IIJB 4KUMA 2LGQA 4EB6B 1SZTA 2R9IA 2EZPA 3E83A 3CC4V 5F2VO 1K5QA 4XDJA 2M7WA 5J9PC 2GSMB 2CGNA 2E5LO 1JVMA 4LF9B 5L3FA 3JAWB 4LC1A 5CB4B 4FVMA 4UCRA 1V55B 5KMGB 4JTCB 2EIMB 5L3DA 3M7MX 5BR8B 2EX3A 2GBOA 4LNUB 1Q3EA 2WAMA 4TV8B 3OUFA 4LFCO 1Y6XA 1T5EA 4FLUA 1S5HC 1R3JC 1LUVA 4XDKA 1D2DA 3E2EA 5JVDA 3A0BZ 4Q20A 1MG1A 1X4TA 4NXMO 3MD0A 3ZMTA 1WB8A 4DR4O 1J95A 2LFSA 5C93A 4B08A 5HFMA 1DTOA 1V54B 4DYLA 2D3OW 1XMOB 2LGWA 2JK5C 4RQFA 1K4DC 2CTWA 1WNSA 4O2AB 3OMNB 1KC8W 3AG3B 4O4HA 4RQEA 1ZWIC 1FXKC 2YI8A 1K92A 5FNVA 2EZOA 4DR5B 4X9QA 5LHIA 4OX9O 1M56C 1HNWO 4J9ZB 1MSDA 4HYOA 4DV6B 1URFA 2JGUA 5KHGA 4GX1A 5BZBA 5J2UA 2XAQA 5JCOA 2UUAO 4FMTA 4JYYA 4Z1VA 1B06A 3CRAA 3A0HZ 5JJNB 4MVRA 2YUAA 4B3SB 4H37A 1SRYA 1CEZA 4MTGA 4KP4A 4CC6A 1O9GA 4I55B 4UV9A 1R6KA 3N2KA 2F66C 2EILC 1RM1C 1R6TA 3OT7A 2E75B 1X59A 1AI5A 5LMNO 3DGEA 2ZR3A 3AG3C 3GWKC 1BGYH 3ML0A 5CMUA 1N33O 1RSOA 1YZBA 3JD3A 1P84F 1AR1B 1YJNV 3JASA 2QWPB 1ZL8A 1XNRB 1FXVA 3SDLA 2EBOA 3KCYA 3BPZA 3T1YB 3WB1A 2O57A 1QLEC 1XEQA 1UFIA 3UT5A 3ZMVA 3D36A 1QVGU 1K5SA 2ZM6B 4LFAB 4JZ2A 1COWG 1EM1A 2Q7GA 3ICXA 1FXKA 5HFLA 4DUZB 1FAFA 3I5DA 5LYJA 2H3OA 4DW0A 5JH7A 1QBZA 2ZT9B 2LFRA 3EXAA 4J7JA 3D8CA 4DR2B 1IBLB 5KAIZ 4LF6O 2ZIOA 2DJVA 1PNLA 2F95B 1OJHA 1JFFB 1MZFA 2Y69C 2AGAA 3LDDA 2QJ1A 2CTQA 5IY5B 3O9OA 1TA8A 4MTOA 4CH4A 4FM2A 3ASOB 4P2ZA 3E8HA 2KB1A 1IXMA 3VQXA 4UV8A 4PDVA 4FJCC 5B1NA 3HKCA 1L1FA 1BQ0A 1NR7A 3AEIA 1J5EO 2UUCO 1CXZB 2N04A 3ZHQA 5B1AB 3PJSK 4FLWA 1K7DA 2JDIG 3M8AA 2WSSG 2OTLV 4K0KO 5H6QA 3RYCB 3T2MA 1YCIA 3BRCA 3FYIB 3ZMZA 3P30A 4LF9O 2P22C 3RYHB 2Y4UA 5BR8O 3ABLC 4NKGB 4QPJA 1GMGA 1Q82W 4I50A 1XBLA 2X6BA 3HKBA 5CA0B 2W6IG 2FYUH 3ZRWB 2ZDIA 4UCSA 1AJPA 2P4VA 2FMLA 3K5LA 1OCZB 2Q67A 5GTHZ 2B1GA 1M57C 2F4VB 2B1IA 4JI7B 2OCHA 5LHGA 3CCQV 1Y4MA 1PD3A 4GLXA 2NN4A 4WFAV 4NTYA 5IJ9B 3RYIB 1IX9A 5FLXN 3L70H 4JI0B 1SA0A 1KMIZ 3OMAB 3ABMB 5FPOA 3OMIB 1GM9A 1KU9A 5AG2A 3H1IH 1S0VA 4DV6O 2QWQB 3A8TA 1DK1A 4JTDB 1YI2V 2AXTZ 4PDLA 1AJNA 5CA1B 4B3MO 3HKDA 1ZTEA 1JR9A 4DV1B 3H1JH 3ZHTA 3QO7A 4NR1A 1YJ9V 3CE2A 3U10A 4TUYB 2WLIA 4L8JA 3ETQA 3FB7C 3N2GA 1SERA 1XMQB 2OCCB 3HKEB 4HBNA 2B5UA 2QKSA 2YIBA 3QTCA 4U7OA 2IJJA 2F93B 4ZHQB 5J2TA 3CPWU 1YITV 4G27B 1TUBA 2CE4A 1XHZA 1WP8A 3JAMN 2EULA 4GX5A 4NXNB 2K1EA 4NYKA 3L74H 5FL7G 1VEWA 3GB7C 1XNRO 1M1KW 2WLJA 4ABMA 1XI1A 1F51A 1YTFB 3FX7A 3STZC 4UFZA 2QTOA 5E1AC 4LF8B 3AK1A 3ZX6A 3Q4HA 1GN4A 3RT3C 3OEHG 2ZM6O 1NQTA 5KHIA 4LFAO 1HWYA 1XDCA 1BS3A 4GT1A 2YXYA 1QR9A 3FAVA 3ASNC 5JWPA 5LXTA 4PELA 2QWRB 2W0XA 1P7GA 1XREA 2UU9B 4CS4A 4U3JA 5EIBC 5LMUB 4DUZO 2RJZA 3AG4B 5LA6A 4DV4B 5EC2C 1F23A 1RPOA 4FLTA 3JCZA 3L9DA 4D7TA 4GUNA 2OYQA 4FLZA 3RBZA 4F4LA 5EIBD 1N0JA 4JV5B 1BL8A 2HVKC 1TAEA 2Q69A 3CX5F 4DR2O 1IBLO 1CPYA 4FK5C 2B9ZA 2YXHA 4QJFB 3LDEA 4R7CA 1VF6A 1W0JG 5C8YB 3F5WC 5EYPA 1F4MA 1DF4A 3OD4A 4X1IB 3W7XA 5IJ0B 2Q6AA 3VQWA 1PNKA 2YEVA 4X1YB 2R70A 2YC0A 2V7QG 1NJIW 4GX2A 2YIAA 2ZE7A 2YS8A 1H2LA 1KKCA 2DYRC 1WB7A 3RW0A 4MW8A 5D5QA 4TV9B 3RWRD 1K9MW 3P32A 1OCRC 4PV1B 2PZSA 2HKOA 3S3XA 4I9WA 1EZVH 4FZ1A 1Q7YW 4W4KA 2DYSB 1IBMB 3AG1B 3CCEV 4UCVA 1G8MA 4ZBMA 3IC7A 4BIZA 1R73A 2ZKOA 2FKXA 2F1MA 3CYOA 5L3BA 1KKDA 4DRXA 5EZYB 2ZE6A 1JOYA 4LR3A 3E35A 2F4VO 2YIDA 4JI7O 3ZHVA 1NS1A 2EIJC 3JD4A 1PKXA 5EK0A 3CRCA 4HNAB 1R1BA 5BY1A 4LWSA 5IYCO 3RYFA 3TCUA 1IXBA 2JIZG 4JI0O 3K0DA 3IJ4A 1VMGA 3K3WA 1US6A 4YHHB 3TXQA 3AG1C 4O2BA 3OE7G 4O4HB 1H8EG 3MDSA 2DWDC 1HNXO 5FNVB 1VQ4V 2H94A 1HW7A 3DTUB 3DC6A 2DW4A 1KD1W 3E22A 3NR7A 1AI6A 1R3KC 4DV1O 5IWAB 5J2UB 2A7WA 3JALB 1WP7A 3DXRA 4X64B 5B1OA 1WAZA 4DR7B 1GN2A 4UVBA 2BE3A 1O9HA 1XMQO 2P6JA 5IYBO 3IFXA 4X20A 4CZZA 4IYIA 4YJ2A 3OGCC 5IDJA 1MMMA 5LOVB 3UCSC 4P9PA 4JZGA 3N2KB 4KFMA 1IVSA 1KBHA 1FKAO 3B8MA 1H8HG 2R9AA 1JJOA 4DO2A 4NXNO 1N34B 5B3SB 4U7NA 1E1QG 1EFRG 5EC1C 2UXXA 4MT8A 4X88A 4B3TO 2X7RB 3C3SA 1BCCH 2Z0AA 1RSOB 1PL4A 3BFRA 4F6RB 4MSWC 1ZL8B 4J10A 4J80A 1NH2B 4LF8O 1HNZB 4FZ0A 2AHZA 3FFQA 2Q68A 2CH7A 2XT9A 3GVMA 1DF5A 2P4KA 2WA4A 2ZR2A 1JJ2U 3LDCA 4X89A 2XOKG 2NNUA 4RUEA 4I0XA 1H2NA 3JAKB 4UVCA 5KLVH 1N4CA 5GONA 4PDRA 3APOA 2IH3C 2V1DA 4X65B 4DV4O 3BEHA 4YJ3B 1VIBA 3CXHF 2ITDC 3RFRA 1SKVA 3I56V 4UB8Z 1I5XA 2UXNA 1I94B 1VQLV 4JV5O 2BTQA 4ZOLA 3SJQC 2A9HA 3H9VA 4FLVA 1TVKA 3C90A 3B4SA 3BY6A 2ZE8A 2G38A 4DUYB 5KHKA 5JJJB 3P3PA 4LH6A 4GCZA 2FL4A 3P3NA 2E76B 5L3CA 1EN6A 1V55C 2EIMC 5CBGA 4KHPB 4MS2A 4DV0B 4J11A 1GM8A 3MHSC 4CBCA 3F7YC 4MTFA 4OXSA 2JJ1G 2Y4TA 4JAAA 4R50A 2OTJV 4FFBA 4MVSA 3H1LH 2Z5UA 4QGPA 3UO2A 4J41A 2PY5A 2CGOA 3TGUH 1K97A 3WG7B 3B09A 4GKKB 5LP6B 2RQ6A 1GH6A 4LP8A 4GZRB 5DM6V 1S76D 1MZEA 1V54C 1SZXA 3ZS8C 1IBMO 1K4CC 4DXWA 4A5UB 4FLXA 3CHXA 1QHTA 3JATA 1VARA 4MW3A 1Q90D 1VQ7V 3N27A 5KUMA 2A79B 2ETNA 5BXZA 2Y48A 4H44B 5TISZ 1TGOA 4UUJC 3HKBB 2ARHA 2QEXV 1AI7A 3CJHB 1N36B 3ZMUA 4X62O 2OWOA 2ZE5A 4ZKIA 3THOA 1HR0B 1G4YB 4DR1B 1VQNV 2K9PA 2FB5A 3H01A 1GTOA 1N8RW 2LJ2A 1NI8A 3G71V 3KCXA 2XNDG 3FYEB 5IT9N 4X66B 4G2KA 4QNHB 4YHHO 2GTSA 4GKJB 1I5YA 1SA0B 4K35A 4O4LB 4GYCB 2L35A 1MA1A 4LNUA 4XBFA 1CP9A 4JI3B 3UO3A 1ZX3A 3CC2V 2JGDA 2JVDA 4X64O 2Q7HA 3HKDB 4CH3A 4D6TH 1MABG 4DR7O 1AI4A 5BMVB 1QU7A 3CCUV 3PN1A 1IDSA 2QDOA 4I5SA 5B5EZ 3G4SV 1Z2GA 2HG5C 2WLIB 4BW9A 1NTMH 2EIKB 4JI4B 3H1HH 3BHPA 2UXBB 2IU0A 2EJRA 2ZINA 2N05A 4YY3B 5JQGB 4HAMA 4UCTA 3G6EV 3AG2B 1DLBA 1N34O 2CUGA 1I0HA 5EBLC 3ZHSA 1GKFA 3R66A 3FB8C 1FFXA 2PYLA 2HFEC 4JAVA 1GK9A 2KG7A 1HNZO 3QO5A 1AR5A 4I9QA 4UVAA 2QR4A 3LSQA 4JYCA 1PNMA 4PA9A 2ITCC 4I4TB 1E79G 4LF4B 3Q4HB 1QCEA 2QKAA 4IYHA 5IY5C 4LFBB 2DN9A 3CC7V 1WPBA 3ASOC 4ZIBA 1VP7A 4I55A 1NVPB 2Q73A 1BHAA 4X65O 1VQ9V 2OT5A 4JI6B 2WWWA 4O4JA 1I94O 3CCVV 2YICA 5LA6B 2HVJC 4O4IA 2A0LA 1GRJA 3ETGA 5B1AC 1LR1A 1KB9F 3K59A 2BCCH 4CS2A 1XMOO 2GHYA 4DUYO 2ZNIA 2Q5ZA 2L6LA 2QSAA 2P5OA 4KXRA 1W59A 4DR5O 4KHPO 2MW2B 5EYPB 2LP7A 4DV0O 2KKWA 1YJWV 2AW9A 2LW7A 2ZXWB 4BWAA 3FD9A 2YEVB 2GUZA 1UJWB 3CCJV 2WPDG 2RMKB 1IBKB 1OCZC 2XAJA 4DK0A 1VQ6V 3KG2A 2XAHA 4B3SO 1IZ3A 1JPXA 3ZHRA 4GKKO 3J81N 1S5JA 1SS3A 4BW5A 1B6QA 3SYCA 1GO3F 2QGNA 4P30A 3K57A 1ZUQA 2JRIA 2YDEA 1KYOF 4ICGA 2DE0X 2PUSA 4PI2A 2CTRA 4U3FH 3ABMC 4FFKA 5L3EA 4DR3B 2AZ2A 4KL1A 1N36O 4H13B 4J7KA 2ZXWC 4DV2B 2XASA 4L87A 4WBNB 4B3RB 1HR0O 1Q5OA 4DRXB 4DV7B 3T1YO 4PJ0Z 1JMKC 2Q0AA 3CCLV 3R65A 3U11A 1WLEA 4J7ZA 3SPGA 2RN9A 2OCCC 2BSKA 1PP9H 1XNQB 3RYCA 4X66O 3E8GA 1VQPV 4LWSB 3RYFB 1PV0A 3T1CA 3RYHA 3IC9A 2H8PC 3RVZA 4LF7B 2N74A 3OR6C 2E5LB 2IU3A 4O2BB 1JQ0A 5CA0A 1M4UA 2DWEC 4IGGA 5A2QN 4JI8B 1M93A 4JTAB 3VOUA 3UKMA 5IE9A 4PA6A 3F5TA 5IYZA 3ZEDA 2Z3YA 1QLNA 1KP2A 3SPCA 1YTFD 2UXBO 4X20B 4G28B 4YJ2B 4P9OA 1PL0A 1Q81W 1PPJH 1YEWA 3SJBC 4YY3O 5IJ9A 1DGSA 1KUQA 3IAYA 3FKSG 3DSQA 2JS3A 2MK3A 4GX0A 2LW1A 3AG4C 3C3TA 4J42A 3WB2A 2X6CA 2IM9A 5EBMC 4X1KB 1WA8B 1EBOA 4ZI7B 3E86A 1N0NA 3SR2C 3ZN1A 2EINB 3K9AA 5ITZA 5CBFA 3SPJA 2NR5A 4CH6A 3W7TA 3K5NA 3ZRXA 3KZIZ 4JAUA 1R3IC 4E4EA 4LFBO 1OCOB 1H38A 3HKEA 4IHJA 2CH7B 2VS0A 1QQCA 1H2KA 1RFYA 2FTKA 4JI6O 4I0XB 3EFFK 1QR8A 5GONB 2WA3A 1VQ5V 4LBEC 3SYAA 5JVDB 3JARA 2YSUB 5LMNB 3T4DA 1Y74A 4CS3A 1I7FA 3HR0A 4YIOA 1BHBA 2IBZH 4ZOLB 3TXSA 3ZRVA 1ZSPA 1K33A 4LF5B 1S77D 1FJGB 4JPRA 1JX9A 3CMEV 2ADQB 2DQ0A 4OPHA 3W7UA 4MVMA 1IURA 1OCCB 2DYSC 5H9CA 1YIJV 2QE7G 1KP3A 1XHXA 3EVKA 1P7BA 2RDCA 4WF9V 1NR1A 1QNMA 3IGAC 3D3IA 3OUSA 4NTXA 5CN0A 1HP8A 1EZJA 3ZMSA 4JI5B 4RAIA 3JSLA 1S3JA 2Q8VA 3S3WA 1YVWA 4I7ZB 1SQPH 1PM9A 2PF4E 3J80N 1NBMG 2ATKC 4LF6B 1QVFU 4WCEV 4H0LB 4JASA 1L8DA 1D5AA 2WLNA 4UCOA 4DR3O 4X1IA 1U96A 2IH1C 1ORQC 4PD4F 1L0LH 2ILMA 3K06A 1XOUA 3TJTA 3WB0A 4RO2A 1VF5B 1ZAUA 2R9RB 1K34A 1L0NH 2PI5A 4B3RO 3HPLC 2EJ7A 3JASB 1WJZA 2HHHB 2YI9A 2JJ2G 1SQFA 5K1XA 1K73W 3CD6V 5LBQA 5KX5A 4ASUG 4MVUA 3M99B 3STLC 3SYQA 2CDYA 3UT5B 1BQZA 3ABUA 2UU9O 2XHBA 3CMAV 4K0KB 5LMUO 1XUQA 1JCHA 1ZLZA 4LF7O 3QO8A 3MAQA 2XUMA 1FXKB 3QVNA 2AHYA 5B3SC 1Q86W 1M56B 4DR6B 2F43G 5LYJB 4LCUC 1XQ8A 5JH7B 4JI8O 1LUWA 1W0KG 1Y76A 2VRZA 5EZYA 5CA3A 2PGGA 2JGDB 3WU2Z 1FFTB 1YHQV 4QIWF 1UPGA 1NH2D 4HNAA 4RUFA 3D36C 5KHJA 4TOIA 3JCUZ 4JI1B 3G80A 1BE3H 2JEUA 5KHHA 2EILB 2ODMA 3LNMB 1Q6HA 1TUEB 2YXLA 4NTWA 1RM1B 4N23A 2VQEB 2Y0IA 3BAAA 1VQOV 3HKCB 4R8CA 3CSXA 1M5IA 1AP6A 1NT2B 2WLLA 2E74B 1FFXB 1Q6IA 2WLKA 1AJQA 2IW5A 3SJAC 2KG7B 3JALA 4B3MB 4TT3G 1KQSU 1Q8IA 4TQDA 2ADPA 3CS5A 1QLEB 4PI0A 3RGBA 3QG5A 4UB6Z 1U97A 5LOVA 2Q0OC 4Z2WA 3ETEA 4I50B 4JYAB 4K3AA 3OM3B 4O4JB 1G1XB 4NVPA 1YF2A 2R72A 1B3QA 4EFBA 1W2BU 3H1KH 2HEPA 4O4IB 3WG7C 4IIJA 2GDSA 4F6RA 5LP6C 4LF5O 4EB6A 1FJGO 1MSWD 2UXCB 1D5NA 5GTIZ 3U0ZA 2GTAA 2LQTA 1XL6A 3KKYA 3SPHA 1VQKV 4E2LA 2Y69B 3JAWA 5CB4A 3FB5C 5KMGA 1SQXH 1AROP 2UXDB 4TV8A 3LNNA 3JD0A 3E8BA 2QA4V 4QPKA 2DOSA 3W7WA 3JAKA 3TK1A 5IWAO 1N32B 3E8FA 3FB6C 2X6AA 2XAGA 1SETA 4YJ3A 3SYOA 3SYPA 1V9PA 3L73H 4AQYB 4JI5O 1R3LC 1K3EA 3B2EE 3UM7A 2GUZB 2ZDIC 4UXNA 2ZCEA 3VQVA 2M6YA 1BMFG 1I08A 5IYDO 3SGIA 2JEXA 2Y0PA 3ZRSA 3N2GB 3JYCA 1YSCA 2RCVA 3T4ZA 3K9SA 4BIOA 1YXBA 3K5MA 3W7SA 1EN4A 5J2TB 1RPRA 4O2AA 3QNEA 1F7YA 3RN4A 4JYBA 2BOBC 2KSDA 1TUBB 2W0FC 3ABLB 4QE7A 3T1HB 3CWBH 5LGUA 2UUBB 5CBHA 3CCSV 3K03A 1S72V 1LNQA 2HHHO 4CH5A 1Q6UA 4JI2B 1R6NA 1H2SB 2X0LA 3B40A 1K8AW 2F23A 4RWUA 1FPOA 3OTOB 1M57B 2D2CB 3K5OA 3SPIA 1Y67A 4D7SA 5LP6A 2EIKC 1THZA 2ZNJA 2XAFA 5B1BB 3CCRV 2BSKB 4B7KA 3EHBB 3FAVB 5LXTB 4DV5B 4FIPC 4WFGA 1FYJA 1NZ6A 1SQGA 4OPAA 2DMXA 4U3JB 5KA5A 3AG2C 2LO1A 1A32A 4DR6O 1G6UA 3JSNA 4WFBV 2YIBD 3BA8A 3RVYA 3CJHA 2OIEA 1NTKH 3CCMV 2HP8A 1OV9A 3OAAG 5LGNA 1XILA 4MTXA 2HLDG 5IYZB 5A9GA 4PHZA 5LGTA 3ABTA 3OFNG 4JI1O 1SQBH 2CAZC 5B1BC 1SQQH 3ZCCA 4WFHA 3OR7C 4EEQA 1YDXA 2VQEO 3AK3A 3A2FA 3ETDA 2C2AA 4O4LA 3CEIA 2CTPA 1NVPD 4DV3B 4YXWG 3B8NA 1P4RA 4PA4A 1HNXB 3UQ8A 1VF7A 4HZ3A 2PYJA 1RP3B 3L72H 5ITZB 1ROPA 5GW7A 1M90W 2ZD9A 1KECA 3CRQA 5DEDA 1JFFA 5BMVA 2IJHA 5DN6G 3O65A 2XTAA 1NTZH 3G67A 1VF6C 4FM0A 3APQA 4CC5A 4IHJB 3ASNB 2DQ3A 5H2FZ 2WLMA 4JYAO 1GN3A 2BTOA 4W4LA 3LUTB 5LHHA 1Y66A 1H2MA 4TQFA 4BAYA 1AVMA 4EFEA 5JQGA 3ZJZA 2IJKA 3E89A 4DR1O 3CXCU 3K58A 2KQXA 1SF9A 1MNGA 2PTMA 3ABKB 1FXHA 4DW1A 2QM4A 4H33A 3JARB 2NLJC 2VWKA 2VQFB 1AB3A 1Y74B 1ENVA 4B3TB 3L71H 2UXCO 3F7VC 5B66Z 4MVOA 1AR4A 3GWOA 4GKJO 4I4TA 2ZQMA 3CB2A 5H5NA 2UXDO 3WFVA 2VWJA 4JI3O 1GAXA 1S5LZ 5E79Z 5D5PA 4NB5A 1N32O 4IL6Z 3OW2U 2RNBA 3ZRWA 2QKCA 4WFFA 4AQYO 4LFCB 3E22B 4R6ZA
chains in the Genus database with same CATH topology
1BE3H 3L72H 1SQBH 1KB9F 1L0NH 1SQQH 2BCCH 3CWBH 1NTMH 5KLVH 1SQPH 1SQXH 2IBZH 3L75H 3H1HH 1KYOF 3H1JH 3H1KH 1NTKH 2FYUH 3CXHF 3H1LH 1BGYH 2A06H 3L70H 4U3FH 1P84F 1NTZH 3TGUH 1SQVH 3CX5F 1PPJH 3L74H 1PP9H 3L73H 3L71H 3H1IH 4D6TH 3BCCH 1EZVH 4PD4F 1L0LH 1NU1H 1BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 H;  3L72 H;  1SQB H;  1KB9 F;  1L0N H;  1SQQ H;  2BCC H;  3CWB H;  1NTM H;  5KLV H;  1SQP H;  1SQX H;  2IBZ H;  3L75 H;  3H1H H;  1KYO F;  3H1J H;  3H1K H;  1NTK H;  2FYU H;  3CXH F;  3H1L H;  1BGY H;  2A06 H;  3L70 H;  4U3F H;  1P84 F;  1NTZ H;  3TGU H;  1SQV H;  3CX5 F;  1PPJ H;  3L74 H;  1PP9 H;  3L73 H;  3L71 H;  3H1I H;  4D6T H;  3BCC H;  1EZV H;  4PD4 F;  1L0L H;  1NU1 H;  1BCC H; 
#chains in the Genus database with same CATH topology
 1SC5 B;  4AI8 A;  3ABK C;  3DXR B;  2DYR B;  4JI4 O;  2ZIM A;  4NXM B;  1Q43 A;  1M9N A;  3K79 A;  1SQV H;  4OGQ B;  4Z1M G;  3K08 A;  1B04 A;  2QWO B;  4DR4 B;  1OCR B;  4MVQ A;  1SES A;  3RYI A;  4BR6 A;  3NXS A;  2QM7 A;  3CRR A;  3T1H O;  4J9Y B;  4C7U A;  5FPR A;  4K8X A;  1NKD A;  2UUB O;  4TSF G;  3OGI B;  2Q4P A;  3ZHU A;  4JI2 O;  4OX9 B;  5CA1 A;  1HNW B;  2Q9L A;  4AIL C;  2HJD A;  4PDM A;  3ZBH A;  4FLY A;  3OTO O;  1H2G A;  3X2Q B;  1NU1 H;  4LF4 O;  2QM8 A;  4TUY A;  5KAF Z;  2UUA B;  1AP5 A;  4Q6G A;  2EIJ B;  5KX5 B;  4N21 A;  4IT5 A;  3ZN0 A;  2JS5 A;  3CRM A;  5JJE B;  1VQM V;  3G6B A;  5LL6 Y;  2A06 H;  4DV5 O;  4ZHQ A;  5L3G A;  4F6E A;  5EBW C;  3CP1 A;  1WN7 A;  4AHC A;  2P90 A;  3K04 A;  2GV9 A;  2P67 A;  3ZIA G;  2QWN B;  3MHH C;  2WLH A;  1BSM A;  1VQ8 V;  3B77 A;  3L75 H;  4TWK A;  2BTQ B;  2EIN C;  4WBN A;  1N33 B;  4PA3 A;  1Y76 B;  1JA8 A;  1FD9 A;  4BIU A;  3I55 V;  1TVK B;  4DK1 A;  4X62 B;  3AK2 A;  2HR3 A;  3X2Q C;  5KUK A;  3TET A;  3BCC H;  3OTF A;  3K0G A;  1OCO C;  3QF7 A;  1WPX A;  2Q7E A;  1Z5V A;  5KA6 A;  3BA9 A;  3LSS A;  1IBK O;  4K8Z A;  1E1R G;  1HDJ A;  2P06 A;  4DV3 O;  3VQY A;  4FFB B;  4LH7 A;  1OHH G;  3BAB A;  5DEC A;  4WFE A;  1F4N A;  1BT8 A;  4JGS A;  1AIL A;  2WLL B;  3AG7 A;  4B7E A;  4PA7 A;  4UCU A;  1Z5W A;  3HB3 B;  4MVZ A;  2HJF C;  4JF3 A;  1OZ0 A;  3A0R A;  5K1P A;  2BOC C;  5C8Y A;  3OEE G;  2A3Q A;  2W6J G;  1OCC C;  2P7T C;  1FS0 G;  2IJI A;  4FM1 A;  1XL4 A;  3JAT B;  4EKW A;  5IJ0 A;  1P49 A;  2PI4 A;  3J7A U;  1GN6 A;  4DV2 O;  2AZ0 A;  4YIP A;  2QTS A;  1EN5 A;  3LSU A;  1GM7 A;  2OIG A;  4X1Y A;  4X8A A;  3SJC C;  4DV7 O;  4FPP A;  1MOF A;  3D3Q A;  3DC5 A;  3VBB A;  4QE9 A;  5JCO C;  5H6R A;  2V4D A;  4X1K A;  3BVO A;  2E3C A;  1WA8 A;  2VQF O;  4ZI7 A;  3JD1 A;  4XDL A;  3JD2 A;  1J5E B;  2UUC B;  1BZK A;  1XNQ O;  2CK3 G;  4TV9 A;  4IIJ B;  4KUM A;  2LGQ A;  4EB6 B;  1SZT A;  2R9I A;  2EZP A;  3E83 A;  3CC4 V;  5F2V O;  1K5Q A;  4XDJ A;  2M7W A;  5J9P C;  2GSM B;  2CGN A;  2E5L O;  1JVM A;  4LF9 B;  5L3F A;  3JAW B;  4LC1 A;  5CB4 B;  4FVM A;  4UCR A;  1V55 B;  5KMG B;  4JTC B;  2EIM B;  5L3D A;  3M7M X;  5BR8 B;  2EX3 A;  2GBO A;  4LNU B;  1Q3E A;  2WAM A;  4TV8 B;  3OUF A;  4LFC O;  1Y6X A;  1T5E A;  4FLU A;  1S5H C;  1R3J C;  1LUV A;  4XDK A;  1D2D A;  3E2E A;  5JVD A;  3A0B Z;  4Q20 A;  1MG1 A;  1X4T A;  4NXM O;  3MD0 A;  3ZMT A;  1WB8 A;  4DR4 O;  1J95 A;  2LFS A;  5C93 A;  4B08 A;  5HFM A;  1DTO A;  1V54 B;  4DYL A;  2D3O W;  1XMO B;  2LGW A;  2JK5 C;  4RQF A;  1K4D C;  2CTW A;  1WNS A;  4O2A B;  3OMN B;  1KC8 W;  3AG3 B;  4O4H A;  4RQE A;  1ZWI C;  1FXK C;  2YI8 A;  1K92 A;  5FNV A;  2EZO A;  4DR5 B;  4X9Q A;  5LHI A;  4OX9 O;  1M56 C;  1HNW O;  4J9Z B;  1MSD A;  4HYO A;  4DV6 B;  1URF A;  2JGU A;  5KHG A;  4GX1 A;  5BZB A;  5J2U A;  2XAQ A;  5JCO A;  2UUA O;  4FMT A;  4JYY A;  4Z1V A;  1B06 A;  3CRA A;  3A0H Z;  5JJN B;  4MVR A;  2YUA A;  4B3S B;  4H37 A;  1SRY A;  1CEZ A;  4MTG A;  4KP4 A;  4CC6 A;  1O9G A;  4I55 B;  4UV9 A;  1R6K A;  3N2K A;  2F66 C;  2EIL C;  1RM1 C;  1R6T A;  3OT7 A;  2E75 B;  1X59 A;  1AI5 A;  5LMN O;  3DGE A;  2ZR3 A;  3AG3 C;  3GWK C;  1BGY H;  3ML0 A;  5CMU A;  1N33 O;  1RSO A;  1YZB A;  3JD3 A;  1P84 F;  1AR1 B;  1YJN V;  3JAS A;  2QWP B;  1ZL8 A;  1XNR B;  1FXV A;  3SDL A;  2EBO A;  3KCY A;  3BPZ A;  3T1Y B;  3WB1 A;  2O57 A;  1QLE C;  1XEQ A;  1UFI A;  3UT5 A;  3ZMV A;  3D36 A;  1QVG U;  1K5S A;  2ZM6 B;  4LFA B;  4JZ2 A;  1COW G;  1EM1 A;  2Q7G A;  3ICX A;  1FXK A;  5HFL A;  4DUZ B;  1FAF A;  3I5D A;  5LYJ A;  2H3O A;  4DW0 A;  5JH7 A;  1QBZ A;  2ZT9 B;  2LFR A;  3EXA A;  4J7J A;  3D8C A;  4DR2 B;  1IBL B;  5KAI Z;  4LF6 O;  2ZIO A;  2DJV A;  1PNL A;  2F95 B;  1OJH A;  1JFF B;  1MZF A;  2Y69 C;  2AGA A;  3LDD A;  2QJ1 A;  2CTQ A;  5IY5 B;  3O9O A;  1TA8 A;  4MTO A;  4CH4 A;  4FM2 A;  3ASO B;  4P2Z A;  3E8H A;  2KB1 A;  1IXM A;  3VQX A;  4UV8 A;  4PDV A;  4FJC C;  5B1N A;  3HKC A;  1L1F A;  1BQ0 A;  1NR7 A;  3AEI A;  1J5E O;  2UUC O;  1CXZ B;  2N04 A;  3ZHQ A;  5B1A B;  3PJS K;  4FLW A;  1K7D A;  2JDI G;  3M8A A;  2WSS G;  2OTL V;  4K0K O;  5H6Q A;  3RYC B;  3T2M A;  1YCI A;  3BRC A;  3FYI B;  3ZMZ A;  3P30 A;  4LF9 O;  2P22 C;  3RYH B;  2Y4U A;  5BR8 O;  3ABL C;  4NKG B;  4QPJ A;  1GMG A;  1Q82 W;  4I50 A;  1XBL A;  2X6B A;  3HKB A;  5CA0 B;  2W6I G;  2FYU H;  3ZRW B;  2ZDI A;  4UCS A;  1AJP A;  2P4V A;  2FML A;  3K5L A;  1OCZ B;  2Q67 A;  5GTH Z;  2B1G A;  1M57 C;  2F4V B;  2B1I A;  4JI7 B;  2OCH A;  5LHG A;  3CCQ V;  1Y4M A;  1PD3 A;  4GLX A;  2NN4 A;  4WFA V;  4NTY A;  5IJ9 B;  3RYI B;  1IX9 A;  5FLX N;  3L70 H;  4JI0 B;  1SA0 A;  1KMI Z;  3OMA B;  3ABM B;  5FPO A;  3OMI B;  1GM9 A;  1KU9 A;  5AG2 A;  3H1I H;  1S0V A;  4DV6 O;  2QWQ B;  3A8T A;  1DK1 A;  4JTD B;  1YI2 V;  2AXT Z;  4PDL A;  1AJN A;  5CA1 B;  4B3M O;  3HKD A;  1ZTE A;  1JR9 A;  4DV1 B;  3H1J H;  3ZHT A;  3QO7 A;  4NR1 A;  1YJ9 V;  3CE2 A;  3U10 A;  4TUY B;  2WLI A;  4L8J A;  3ETQ A;  3FB7 C;  3N2G A;  1SER A;  1XMQ B;  2OCC B;  3HKE B;  4HBN A;  2B5U A;  2QKS A;  2YIB A;  3QTC A;  4U7O A;  2IJJ A;  2F93 B;  4ZHQ B;  5J2T A;  3CPW U;  1YIT V;  4G27 B;  1TUB A;  2CE4 A;  1XHZ A;  1WP8 A;  3JAM N;  2EUL A;  4GX5 A;  4NXN B;  2K1E A;  4NYK A;  3L74 H;  5FL7 G;  1VEW A;  3GB7 C;  1XNR O;  1M1K W;  2WLJ A;  4ABM A;  1XI1 A;  1F51 A;  1YTF B;  3FX7 A;  3STZ C;  4UFZ A;  2QTO A;  5E1A C;  4LF8 B;  3AK1 A;  3ZX6 A;  3Q4H A;  1GN4 A;  3RT3 C;  3OEH G;  2ZM6 O;  1NQT A;  5KHI A;  4LFA O;  1HWY A;  1XDC A;  1BS3 A;  4GT1 A;  2YXY A;  1QR9 A;  3FAV A;  3ASN C;  5JWP A;  5LXT A;  4PEL A;  2QWR B;  2W0X A;  1P7G A;  1XRE A;  2UU9 B;  4CS4 A;  4U3J A;  5EIB C;  5LMU B;  4DUZ O;  2RJZ A;  3AG4 B;  5LA6 A;  4DV4 B;  5EC2 C;  1F23 A;  1RPO A;  4FLT A;  3JCZ A;  3L9D A;  4D7T A;  4GUN A;  2OYQ A;  4FLZ A;  3RBZ A;  4F4L A;  5EIB D;  1N0J A;  4JV5 B;  1BL8 A;  2HVK C;  1TAE A;  2Q69 A;  3CX5 F;  4DR2 O;  1IBL O;  1CPY A;  4FK5 C;  2B9Z A;  2YXH A;  4QJF B;  3LDE A;  4R7C A;  1VF6 A;  1W0J G;  5C8Y B;  3F5W C;  5EYP A;  1F4M A;  1DF4 A;  3OD4 A;  4X1I B;  3W7X A;  5IJ0 B;  2Q6A A;  3VQW A;  1PNK A;  2YEV A;  4X1Y B;  2R70 A;  2YC0 A;  2V7Q G;  1NJI W;  4GX2 A;  2YIA A;  2ZE7 A;  2YS8 A;  1H2L A;  1KKC A;  2DYR C;  1WB7 A;  3RW0 A;  4MW8 A;  5D5Q A;  4TV9 B;  3RWR D;  1K9M W;  3P32 A;  1OCR C;  4PV1 B;  2PZS A;  2HKO A;  3S3X A;  4I9W A;  1EZV H;  4FZ1 A;  1Q7Y W;  4W4K A;  2DYS B;  1IBM B;  3AG1 B;  3CCE V;  4UCV A;  1G8M A;  4ZBM A;  3IC7 A;  4BIZ A;  1R73 A;  2ZKO A;  2FKX A;  2F1M A;  3CYO A;  5L3B A;  1KKD A;  4DRX A;  5EZY B;  2ZE6 A;  1JOY A;  4LR3 A;  3E35 A;  2F4V O;  2YID A;  4JI7 O;  3ZHV A;  1NS1 A;  2EIJ C;  3JD4 A;  1PKX A;  5EK0 A;  3CRC A;  4HNA B;  1R1B A;  5BY1 A;  4LWS A;  5IYC O;  3RYF A;  3TCU A;  1IXB A;  2JIZ G;  4JI0 O;  3K0D A;  3IJ4 A;  1VMG A;  3K3W A;  1US6 A;  4YHH B;  3TXQ A;  3AG1 C;  4O2B A;  3OE7 G;  4O4H B;  1H8E G;  3MDS A;  2DWD C;  1HNX O;  5FNV B;  1VQ4 V;  2H94 A;  1HW7 A;  3DTU B;  3DC6 A;  2DW4 A;  1KD1 W;  3E22 A;  3NR7 A;  1AI6 A;  1R3K C;  4DV1 O;  5IWA B;  5J2U B;  2A7W A;  3JAL B;  1WP7 A;  3DXR A;  4X64 B;  5B1O A;  1WAZ A;  4DR7 B;  1GN2 A;  4UVB A;  2BE3 A;  1O9H A;  1XMQ O;  2P6J A;  5IYB O;  3IFX A;  4X20 A;  4CZZ A;  4IYI A;  4YJ2 A;  3OGC C;  5IDJ A;  1MMM A;  5LOV B;  3UCS C;  4P9P A;  4JZG A;  3N2K B;  4KFM A;  1IVS A;  1KBH A;  1FKA O;  3B8M A;  1H8H G;  2R9A A;  1JJO A;  4DO2 A;  4NXN O;  1N34 B;  5B3S B;  4U7N A;  1E1Q G;  1EFR G;  5EC1 C;  2UXX A;  4MT8 A;  4X88 A;  4B3T O;  2X7R B;  3C3S A;  1BCC H;  2Z0A A;  1RSO B;  1PL4 A;  3BFR A;  4F6R B;  4MSW C;  1ZL8 B;  4J10 A;  4J80 A;  1NH2 B;  4LF8 O;  1HNZ B;  4FZ0 A;  2AHZ A;  3FFQ A;  2Q68 A;  2CH7 A;  2XT9 A;  3GVM A;  1DF5 A;  2P4K A;  2WA4 A;  2ZR2 A;  1JJ2 U;  3LDC A;  4X89 A;  2XOK G;  2NNU A;  4RUE A;  4I0X A;  1H2N A;  3JAK B;  4UVC A;  5KLV H;  1N4C A;  5GON A;  4PDR A;  3APO A;  2IH3 C;  2V1D A;  4X65 B;  4DV4 O;  3BEH A;  4YJ3 B;  1VIB A;  3CXH F;  2ITD C;  3RFR A;  1SKV A;  3I56 V;  4UB8 Z;  1I5X A;  2UXN A;  1I94 B;  1VQL V;  4JV5 O;  2BTQ A;  4ZOL A;  3SJQ C;  2A9H A;  3H9V A;  4FLV A;  1TVK A;  3C90 A;  3B4S A;  3BY6 A;  2ZE8 A;  2G38 A;  4DUY B;  5KHK A;  5JJJ B;  3P3P A;  4LH6 A;  4GCZ A;  2FL4 A;  3P3N A;  2E76 B;  5L3C A;  1EN6 A;  1V55 C;  2EIM C;  5CBG A;  4KHP B;  4MS2 A;  4DV0 B;  4J11 A;  1GM8 A;  3MHS C;  4CBC A;  3F7Y C;  4MTF A;  4OXS A;  2JJ1 G;  2Y4T A;  4JAA A;  4R50 A;  2OTJ V;  4FFB A;  4MVS A;  3H1L H;  2Z5U A;  4QGP A;  3UO2 A;  4J41 A;  2PY5 A;  2CGO A;  3TGU H;  1K97 A;  3WG7 B;  3B09 A;  4GKK B;  5LP6 B;  2RQ6 A;  1GH6 A;  4LP8 A;  4GZR B;  5DM6 V;  1S76 D;  1MZE A;  1V54 C;  1SZX A;  3ZS8 C;  1IBM O;  1K4C C;  4DXW A;  4A5U B;  4FLX A;  3CHX A;  1QHT A;  3JAT A;  1VAR A;  4MW3 A;  1Q90 D;  1VQ7 V;  3N27 A;  5KUM A;  2A79 B;  2ETN A;  5BXZ A;  2Y48 A;  4H44 B;  5TIS Z;  1TGO A;  4UUJ C;  3HKB B;  2ARH A;  2QEX V;  1AI7 A;  3CJH B;  1N36 B;  3ZMU A;  4X62 O;  2OWO A;  2ZE5 A;  4ZKI A;  3THO A;  1HR0 B;  1G4Y B;  4DR1 B;  1VQN V;  2K9P A;  2FB5 A;  3H01 A;  1GTO A;  1N8R W;  2LJ2 A;  1NI8 A;  3G71 V;  3KCX A;  2XND G;  3FYE B;  5IT9 N;  4X66 B;  4G2K A;  4QNH B;  4YHH O;  2GTS A;  4GKJ B;  1I5Y A;  1SA0 B;  4K35 A;  4O4L B;  4GYC B;  2L35 A;  1MA1 A;  4LNU A;  4XBF A;  1CP9 A;  4JI3 B;  3UO3 A;  1ZX3 A;  3CC2 V;  2JGD A;  2JVD A;  4X64 O;  2Q7H A;  3HKD B;  4CH3 A;  4D6T H;  1MAB G;  4DR7 O;  1AI4 A;  5BMV B;  1QU7 A;  3CCU V;  3PN1 A;  1IDS A;  2QDO A;  4I5S A;  5B5E Z;  3G4S V;  1Z2G A;  2HG5 C;  2WLI B;  4BW9 A;  1NTM H;  2EIK B;  4JI4 B;  3H1H H;  3BHP A;  2UXB B;  2IU0 A;  2EJR A;  2ZIN A;  2N05 A;  4YY3 B;  5JQG B;  4HAM A;  4UCT A;  3G6E V;  3AG2 B;  1DLB A;  1N34 O;  2CUG A;  1I0H A;  5EBL C;  3ZHS A;  1GKF A;  3R66 A;  3FB8 C;  1FFX A;  2PYL A;  2HFE C;  4JAV A;  1GK9 A;  2KG7 A;  1HNZ O;  3QO5 A;  1AR5 A;  4I9Q A;  4UVA A;  2QR4 A;  3LSQ A;  4JYC A;  1PNM A;  4PA9 A;  2ITC C;  4I4T B;  1E79 G;  4LF4 B;  3Q4H B;  1QCE A;  2QKA A;  4IYH A;  5IY5 C;  4LFB B;  2DN9 A;  3CC7 V;  1WPB A;  3ASO C;  4ZIB A;  1VP7 A;  4I55 A;  1NVP B;  2Q73 A;  1BHA A;  4X65 O;  1VQ9 V;  2OT5 A;  4JI6 B;  2WWW A;  4O4J A;  1I94 O;  3CCV V;  2YIC A;  5LA6 B;  2HVJ C;  4O4I A;  2A0L A;  1GRJ A;  3ETG A;  5B1A C;  1LR1 A;  1KB9 F;  3K59 A;  2BCC H;  4CS2 A;  1XMO O;  2GHY A;  4DUY O;  2ZNI A;  2Q5Z A;  2L6L A;  2QSA A;  2P5O A;  4KXR A;  1W59 A;  4DR5 O;  4KHP O;  2MW2 B;  5EYP B;  2LP7 A;  4DV0 O;  2KKW A;  1YJW V;  2AW9 A;  2LW7 A;  2ZXW B;  4BWA A;  3FD9 A;  2YEV B;  2GUZ A;  1UJW B;  3CCJ V;  2WPD G;  2RMK B;  1IBK B;  1OCZ C;  2XAJ A;  4DK0 A;  1VQ6 V;  3KG2 A;  2XAH A;  4B3S O;  1IZ3 A;  1JPX A;  3ZHR A;  4GKK O;  3J81 N;  1S5J A;  1SS3 A;  4BW5 A;  1B6Q A;  3SYC A;  1GO3 F;  2QGN A;  4P30 A;  3K57 A;  1ZUQ A;  2JRI A;  2YDE A;  1KYO F;  4ICG A;  2DE0 X;  2PUS A;  4PI2 A;  2CTR A;  4U3F H;  3ABM C;  4FFK A;  5L3E A;  4DR3 B;  2AZ2 A;  4KL1 A;  1N36 O;  4H13 B;  4J7K A;  2ZXW C;  4DV2 B;  2XAS A;  4L87 A;  4WBN B;  4B3R B;  1HR0 O;  1Q5O A;  4DRX B;  4DV7 B;  3T1Y O;  4PJ0 Z;  1JMK C;  2Q0A A;  3CCL V;  3R65 A;  3U11 A;  1WLE A;  4J7Z A;  3SPG A;  2RN9 A;  2OCC C;  2BSK A;  1PP9 H;  1XNQ B;  3RYC A;  4X66 O;  3E8G A;  1VQP V;  4LWS B;  3RYF B;  1PV0 A;  3T1C A;  3RYH A;  3IC9 A;  2H8P C;  3RVZ A;  4LF7 B;  2N74 A;  3OR6 C;  2E5L B;  2IU3 A;  4O2B B;  1JQ0 A;  5CA0 A;  1M4U A;  2DWE C;  4IGG A;  5A2Q N;  4JI8 B;  1M93 A;  4JTA B;  3VOU A;  3UKM A;  5IE9 A;  4PA6 A;  3F5T A;  5IYZ A;  3ZED A;  2Z3Y A;  1QLN A;  1KP2 A;  3SPC A;  1YTF D;  2UXB O;  4X20 B;  4G28 B;  4YJ2 B;  4P9O A;  1PL0 A;  1Q81 W;  1PPJ H;  1YEW A;  3SJB C;  4YY3 O;  5IJ9 A;  1DGS A;  1KUQ A;  3IAY A;  3FKS G;  3DSQ A;  2JS3 A;  2MK3 A;  4GX0 A;  2LW1 A;  3AG4 C;  3C3T A;  4J42 A;  3WB2 A;  2X6C A;  2IM9 A;  5EBM C;  4X1K B;  1WA8 B;  1EBO A;  4ZI7 B;  3E86 A;  1N0N A;  3SR2 C;  3ZN1 A;  2EIN B;  3K9A A;  5ITZ A;  5CBF A;  3SPJ A;  2NR5 A;  4CH6 A;  3W7T A;  3K5N A;  3ZRX A;  3KZI Z;  4JAU A;  1R3I C;  4E4E A;  4LFB O;  1OCO B;  1H38 A;  3HKE A;  4IHJ A;  2CH7 B;  2VS0 A;  1QQC A;  1H2K A;  1RFY A;  2FTK A;  4JI6 O;  4I0X B;  3EFF K;  1QR8 A;  5GON B;  2WA3 A;  1VQ5 V;  4LBE C;  3SYA A;  5JVD B;  3JAR A;  2YSU B;  5LMN B;  3T4D A;  1Y74 A;  4CS3 A;  1I7F A;  3HR0 A;  4YIO A;  1BHB A;  2IBZ H;  4ZOL B;  3TXS A;  3ZRV A;  1ZSP A;  1K33 A;  4LF5 B;  1S77 D;  1FJG B;  4JPR A;  1JX9 A;  3CME V;  2ADQ B;  2DQ0 A;  4OPH A;  3W7U A;  4MVM A;  1IUR A;  1OCC B;  2DYS C;  5H9C A;  1YIJ V;  2QE7 G;  1KP3 A;  1XHX A;  3EVK A;  1P7B A;  2RDC A;  4WF9 V;  1NR1 A;  1QNM A;  3IGA C;  3D3I A;  3OUS A;  4NTX A;  5CN0 A;  1HP8 A;  1EZJ A;  3ZMS A;  4JI5 B;  4RAI A;  3JSL A;  1S3J A;  2Q8V A;  3S3W A;  1YVW A;  4I7Z B;  1SQP H;  1PM9 A;  2PF4 E;  3J80 N;  1NBM G;  2ATK C;  4LF6 B;  1QVF U;  4WCE V;  4H0L B;  4JAS A;  1L8D A;  1D5A A;  2WLN A;  4UCO A;  4DR3 O;  4X1I A;  1U96 A;  2IH1 C;  1ORQ C;  4PD4 F;  1L0L H;  2ILM A;  3K06 A;  1XOU A;  3TJT A;  3WB0 A;  4RO2 A;  1VF5 B;  1ZAU A;  2R9R B;  1K34 A;  1L0N H;  2PI5 A;  4B3R O;  3HPL C;  2EJ7 A;  3JAS B;  1WJZ A;  2HHH B;  2YI9 A;  2JJ2 G;  1SQF A;  5K1X A;  1K73 W;  3CD6 V;  5LBQ A;  5KX5 A;  4ASU G;  4MVU A;  3M99 B;  3STL C;  3SYQ A;  2CDY A;  3UT5 B;  1BQZ A;  3ABU A;  2UU9 O;  2XHB A;  3CMA V;  4K0K B;  5LMU O;  1XUQ A;  1JCH A;  1ZLZ A;  4LF7 O;  3QO8 A;  3MAQ A;  2XUM A;  1FXK B;  3QVN A;  2AHY A;  5B3S C;  1Q86 W;  1M56 B;  4DR6 B;  2F43 G;  5LYJ B;  4LCU C;  1XQ8 A;  5JH7 B;  4JI8 O;  1LUW A;  1W0K G;  1Y76 A;  2VRZ A;  5EZY A;  5CA3 A;  2PGG A;  2JGD B;  3WU2 Z;  1FFT B;  1YHQ V;  4QIW F;  1UPG A;  1NH2 D;  4HNA A;  4RUF A;  3D36 C;  5KHJ A;  4TOI A;  3JCU Z;  4JI1 B;  3G80 A;  1BE3 H;  2JEU A;  5KHH A;  2EIL B;  2ODM A;  3LNM B;  1Q6H A;  1TUE B;  2YXL A;  4NTW A;  1RM1 B;  4N23 A;  2VQE B;  2Y0I A;  3BAA A;  1VQO V;  3HKC B;  4R8C A;  3CSX A;  1M5I A;  1AP6 A;  1NT2 B;  2WLL A;  2E74 B;  1FFX B;  1Q6I A;  2WLK A;  1AJQ A;  2IW5 A;  3SJA C;  2KG7 B;  3JAL A;  4B3M B;  4TT3 G;  1KQS U;  1Q8I A;  4TQD A;  2ADP A;  3CS5 A;  1QLE B;  4PI0 A;  3RGB A;  3QG5 A;  4UB6 Z;  1U97 A;  5LOV A;  2Q0O C;  4Z2W A;  3ETE A;  4I50 B;  4JYA B;  4K3A A;  3OM3 B;  4O4J B;  1G1X B;  4NVP A;  1YF2 A;  2R72 A;  1B3Q A;  4EFB A;  1W2B U;  3H1K H;  2HEP A;  4O4I B;  3WG7 C;  4IIJ A;  2GDS A;  4F6R A;  5LP6 C;  4LF5 O;  4EB6 A;  1FJG O;  1MSW D;  2UXC B;  1D5N A;  5GTI Z;  3U0Z A;  2GTA A;  2LQT A;  1XL6 A;  3KKY A;  3SPH A;  1VQK V;  4E2L A;  2Y69 B;  3JAW A;  5CB4 A;  3FB5 C;  5KMG A;  1SQX H;  1ARO P;  2UXD B;  4TV8 A;  3LNN A;  3JD0 A;  3E8B A;  2QA4 V;  4QPK A;  2DOS A;  3W7W A;  3JAK A;  3TK1 A;  5IWA O;  1N32 B;  3E8F A;  3FB6 C;  2X6A A;  2XAG A;  1SET A;  4YJ3 A;  3SYO A;  3SYP A;  1V9P A;  3L73 H;  4AQY B;  4JI5 O;  1R3L C;  1K3E A;  3B2E E;  3UM7 A;  2GUZ B;  2ZDI C;  4UXN A;  2ZCE A;  3VQV A;  2M6Y A;  1BMF G;  1I08 A;  5IYD O;  3SGI A;  2JEX A;  2Y0P A;  3ZRS A;  3N2G B;  3JYC A;  1YSC A;  2RCV A;  3T4Z A;  3K9S A;  4BIO A;  1YXB A;  3K5M A;  3W7S A;  1EN4 A;  5J2T B;  1RPR A;  4O2A A;  3QNE A;  1F7Y A;  3RN4 A;  4JYB A;  2BOB C;  2KSD A;  1TUB B;  2W0F C;  3ABL B;  4QE7 A;  3T1H B;  3CWB H;  5LGU A;  2UUB B;  5CBH A;  3CCS V;  3K03 A;  1S72 V;  1LNQ A;  2HHH O;  4CH5 A;  1Q6U A;  4JI2 B;  1R6N A;  1H2S B;  2X0L A;  3B40 A;  1K8A W;  2F23 A;  4RWU A;  1FPO A;  3OTO B;  1M57 B;  2D2C B;  3K5O A;  3SPI A;  1Y67 A;  4D7S A;  5LP6 A;  2EIK C;  1THZ A;  2ZNJ A;  2XAF A;  5B1B B;  3CCR V;  2BSK B;  4B7K A;  3EHB B;  3FAV B;  5LXT B;  4DV5 B;  4FIP C;  4WFG A;  1FYJ A;  1NZ6 A;  1SQG A;  4OPA A;  2DMX A;  4U3J B;  5KA5 A;  3AG2 C;  2LO1 A;  1A32 A;  4DR6 O;  1G6U A;  3JSN A;  4WFB V;  2YIB D;  3BA8 A;  3RVY A;  3CJH A;  2OIE A;  1NTK H;  3CCM V;  2HP8 A;  1OV9 A;  3OAA G;  5LGN A;  1XIL A;  4MTX A;  2HLD G;  5IYZ B;  5A9G A;  4PHZ A;  5LGT A;  3ABT A;  3OFN G;  4JI1 O;  1SQB H;  2CAZ C;  5B1B C;  1SQQ H;  3ZCC A;  4WFH A;  3OR7 C;  4EEQ A;  1YDX A;  2VQE O;  3AK3 A;  3A2F A;  3ETD A;  2C2A A;  4O4L A;  3CEI A;  2CTP A;  1NVP D;  4DV3 B;  4YXW G;  3B8N A;  1P4R A;  4PA4 A;  1HNX B;  3UQ8 A;  1VF7 A;  4HZ3 A;  2PYJ A;  1RP3 B;  3L72 H;  5ITZ B;  1ROP A;  5GW7 A;  1M90 W;  2ZD9 A;  1KEC A;  3CRQ A;  5DED A;  1JFF A;  5BMV A;  2IJH A;  5DN6 G;  3O65 A;  2XTA A;  1NTZ H;  3G67 A;  1VF6 C;  4FM0 A;  3APQ A;  4CC5 A;  4IHJ B;  3ASN B;  2DQ3 A;  5H2F Z;  2WLM A;  4JYA O;  1GN3 A;  2BTO A;  4W4L A;  3LUT B;  5LHH A;  1Y66 A;  1H2M A;  4TQF A;  4BAY A;  1AVM A;  4EFE A;  5JQG A;  3ZJZ A;  2IJK A;  3E89 A;  4DR1 O;  3CXC U;  3K58 A;  2KQX A;  1SF9 A;  1MNG A;  2PTM A;  3ABK B;  1FXH A;  4DW1 A;  2QM4 A;  4H33 A;  3JAR B;  2NLJ C;  2VWK A;  2VQF B;  1AB3 A;  1Y74 B;  1ENV A;  4B3T B;  3L71 H;  2UXC O;  3F7V C;  5B66 Z;  4MVO A;  1AR4 A;  3GWO A;  4GKJ O;  4I4T A;  2ZQM A;  3CB2 A;  5H5N A;  2UXD O;  3WFV A;  2VWJ A;  4JI3 O;  1GAX A;  1S5L Z;  5E79 Z;  5D5P A;  4NB5 A;  1N32 O;  4IL6 Z;  3OW2 U;  2RNB A;  3ZRW A;  2QKC A;  4WFF A;  4AQY O;  4LFC B;  3E22 B;  4R6Z A; 
#chains in the Genus database with same CATH homology
 1BE3 H;  3L72 H;  1SQB H;  1KB9 F;  1L0N H;  1SQQ H;  2BCC H;  3CWB H;  1NTM H;  5KLV H;  1SQP H;  1SQX H;  2IBZ H;  3L75 H;  3H1H H;  1KYO F;  3H1J H;  3H1K H;  1NTK H;  2FYU H;  3CXH F;  3H1L H;  1BGY H;  2A06 H;  3L70 H;  4U3F H;  1P84 F;  1NTZ H;  3TGU H;  1SQV H;  3CX5 F;  1PPJ H;  3L74 H;  1PP9 H;  3L73 H;  3L71 H;  3H1I H;  4D6T H;  3BCC H;  1EZV H;  4PD4 F;  1L0L H;  1NU1 H;  1BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...