2YSUB

Structure of the complex between btub and colicin e2 receptor binding domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
RNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vitamin B12 transporter btuB
publication title Structure of the complex of the colicin E2 R-domain and its BtuB receptor. The outer membrane colicin translocon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/hydrolase
total genus 47
structure length 123
sequence length 123
ec nomenclature ec 3.1.-.-:
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ysuB00
2YSUB 1JCHA 2B5UA 1UJWB
chains in the Genus database with same CATH superfamily
3DC6A 2JS3A 1AP6A 4GX2A 3ZMVA 1Q6IA 2P67A 5JVDA 4TV9B 2F95B 2WWWA 2R9AA 4I55A 4LFBB 1KKDA 2ZIMA 2A06H 2QR4A 4EFBA 2E74B 2W0FC 3CCMV 4IHJB 4WF9V 5IJ0A 4DR2B 4DO2A 4UCSA 2WA3A 3K5LA 1BGYH 4X64B 2OTJV 2HR3A 1XOUA 1AB3A 2CE4A 4TOIA 5HFLA 1BL8A 4LF5B 4DR3O 5IY5B 5BZBA 4X9QA 1K7DA 4MS2A 1MABG 3EVKA 4O2AB 3EHBB 3TK1A 4X20A 4JI5O 2UXXA 2HG5C 1IBMB 2X7RB 1AJPA 2DW4A 1AILA 1KQSU 2R70A 4O4LB 1D2DA 2ZR3A 1K34A 5JH7A 2Y48A 5KHIA 4RAIA 1H2MA 2QSAA 2Y4TA 3LDEA 1JFFA 1X4TA 1TAEA 2ZE8A 2P5OA 1QLNA 3JARA 5BMVB 3CYOA 3CC4V 3ASOB 1OCCB 1NH2B 3H1JH 2JGDA 2YS8A 2NR5A 2Y69B 3MAQA 4FM0A 1H2GA 4Z1MG 2QM4A 2Q4PA 1R3KC 2WLJA 2Q6AA 2DQ0A 1HWYA 3VBBA 1WB7A 2HVKC 2X0LA 4ZBMA 1OZ0A 3UO2A 1NTZH 1VQ9V 4DV5B 2PUSA 3W7XA 4HNAB 5EYPA 1VQ5V 1LUWA 2YXYA 4FLYA 3A2FA 2ZNIA 4JI4O 2F1MA 1I5XA 2N05A 2YIBD 2GSMB 2QDOA 1HNXO 2CTWA 4OXSA 1LNQA 1MMMA 2ZCEA 4DR7B 1O9HA 3ZRVA 2XASA 3W7SA 1NI8A 3IFXA 4AQYO 2EIKC 3P3NA 2F4VO 2EZPA 4GX1A 4OX9B 1FXKA 4X1YA 5KHKA 3T1HB 3SYAA 3ZMUA 3ABKB 1YTFB 4JI6O 3HPLC 2EJRA 1GRJA 3E83A 3AG3C 2IM9A 4LF7O 5B1OA 1BMFG 5J2TA 1XREA 3ZN1A 1TUEB 3PN1A 3JD4A 4GKJO 1JJOA 3E2EA 5LHGA 1VQOV 1IBKB 3FFQA 1WB8A 3JSNA 4DK0A 1RFYA 3OGIB 1SZTA 5IYCO 3RBZA 1SF9A 4X62O 1SERA 5GTHZ 4UCOA 1ZUQA 4BWAA 4RWUA 1BHAA 2DE0X 5B1BB 1YZBA 3M8AA 1GM9A 2VWJA 3VQWA 4WFBV 1FFTB 2BTQA 1N36B 3EXAA 5LA6A 1I0HA 4MSWC 4CC6A 2AHZA 4LF4B 1SQPH 3ZEDA 4MT8A 1GN3A 1BT8A 2FTKA 3BFRA 4TV8B 1S77D 1L1FA 4JTAB 5IYDO 1G8MA 5BR8B 1BHBA 1L0NH 2ZDIC 4I7ZB 4ZOLB 5FNVA 3B77A 2B5UA 1V54C 5DN6G 1NS1A 3L70H 1UFIA 1IX9A 3N27A 1A32A 2E75B 4FLTA 4RQFA 2GUZA 3CRAA 4B3MB 4FFBB 1DK1A 3IC9A 2XAFA 2ETNA 3CD6V 4LFBO 1J5EB 2HKOA 2H94A 4DV6B 1PPJH 4JAUA 3B4SA 1M4UA 2WLNA 3FKSG 1SS3A 4DR2O 3CC2V 5D5PA 1V55B 4O4IB 4X64O 2OCCC 2JDIG 4LF5O 5GONA 3KCYA 5JJEB 5HFMA 3SJAC 2RDCA 1YHQV 1AI7A 4DUYB 4UFZA 5J2UB 4NXNO 3RGBA 1K97A 1YJNV 3G6EV 4CC5A 2O57A 1JX9A 1K9MW 4KP4A 4U3JA 1SA0B 3K9SA 1GN6A 2UUBB 1FS0G 4BAYA 5L3CA 4QJFB 2ILMA 4MVUA 4WBNA 2XAJA 1QR9A 3ETEA 1GM8A 2A0LA 2KG7B 1N33O 1LUVA 4BW9A 4J42A 2WLHA 2OWOA 2QE7G 4PJ0Z 2UXDB 1VIBA 3IAYA 4JI0B 3CEIA 3JCZA 2ADPA 3BABA 4O4HB 4E4EA 1FKAO 2IJKA 5F2VO 5EK0A 4J9ZB 4DV5O 5LOVA 3KCXA 4MTOA 4UXNA 5LYJB 2Q7EA 3OUFA 5FL7G 2QGNA 4A5UB 4JYAB 1L8DA 3RYCB 3HKEB 3KG2A 3R66A 2WLIA 2BCCH 4DR7O 2QWNB 3T1CA 4JI2B 3HKCB 3B40A 3ZHUA 4DV3B 4GZRB 5IDJA 2YICA 1JMKC 5EC2C 4OX9O 3ABTA 4FZ1A 1KMIZ 2XAGA 3T1HO 1QR8A 2PI4A 4EEQA 2GHYA 3JYCA 1XQ8A 3CB2A 4QPJA 3CXCU 2LQTA 3P30A 2JGUA 3CRRA 1PD3A 5E1AC 3QVNA 1NVPD 1IBKO 1NT2B 3D3QA 2UXCO 3FAVB 5LP6A 4I0XA 3Q4HA 2F23A 3ICXA 1EFRG 2QKCA 4L87A 4CH5A 3FB5C 2EBOA 1D5AA 4JYCA 4TQDA 1JOYA 1Q6UA 3CCJV 1N36O 4BIZA 2LJ2A 1QBZA 4LF4O 3ZJZA 1Y76B 2P7TC 4IT5A 5KHHA 4K8ZA 1LR1A 3E22A 4FLXA 4JI8B 1RSOA 2WLKA 5BR8O 1OV9A 3LSUA 3QG5A 1ZTEA 2Y4UA 4DRXA 3J81N 4UUJC 1Z5VA 4LH7A 4PA7A 1GN2A 3QNEA 4TSFG 3SPHA 4FLZA 1N34B 2DOSA 5KAFZ 5KA6A 5KUMA 2RNBA 2DYSC 4B3MO 3HB3B 1M57B 4IIJB 1R3LC 1ZLZA 4RUEA 4EB6B 2YUAA 1Q3EA 3M7MX 3TGUH 3AG4B 1RM1B 3JAWA 3UT5B 1J5EO 5CMUA 4DV6O 2YSUB 1S3JA 4FK5C 5CB4A 2PTMA 3CCEV 4DR1B 1K3EA 1ZSPA 1I94B 1ZL8A 4MTXA 3WB2A 1YVWA 2FL4A 1XEQA 2QEXV 4FVMA 1CXZB 3K04A 4NB5A 4KFMA 3STZC 3SPIA 5C8YA 1WPBA 2QJ1A 2ZQMA 2QWOB 4DUYO 1K4DC 1B3QA 1HNXB 5IY5C 3D3IA 4QE9A 1H38A 5H6QA 5J9PC 2Y0IA 3LDCA 2UUAB 4F6EA 4CH4A 3K03A 2P22C 2XHBA 5JQGB 1ZX3A 2RN9A 3UKMA 2F93B 3S3WA 5B1AB 2JEXA 1L0LH 3JSLA 4NTWA 3HKDA 4TUYB 2UUBO 4P30A 4X1KA 2QM8A 2PI5A 1KKCA 3WB0A 4ZHQA 4D7TA 3OFNG 3NXSA 1RPOA 3ASOC 1OCCC 3JD2A 5LGTA 4B3RB 2AZ0A 2Y69C 2YXHA 3MHHC 2ZINA 4H44B 2UXDO 4X8AA 5H2FZ 3D8CA 4DK1A 4P2ZA 3FB7C 1N32O 3ETQA 1XL4A 3STLC 4X62B 3K57A 3K08A 1WNSA 3BRCA 5KMGA 5KX5A 1NJIW 1NVPB 1KP2A 4K0KB 2DMXA 2X6BA 4JYAO 3PJSK 3OEHG 2EIMB 2WLLB 2EX3A 5EZYB 1YTFD 3CJHA 4P9OA 1P49A 4JZ2A 2D3OW 4UV9A 1TUBA 2JEUA 4U3FH 1DLBA 3LDDA 5K1PA 2HEPA 4ZKIA 5IJ0B 3N2KA 4FLUA 4PDRA 3G71V 3AG2B 3ABKC 4DXWA 2EJ7A 2LW7A 2ITDC 3ABMB 2IH3C 3H1HH 4X20B 4J7ZA 3W7TA 3SGIA 1NZ6A 2OIGA 1HNZB 5GW7A 4YXWG 5JH7B 3R65A 3DTUB 4MVZA 1E79G 2JK5C 1F7YA 4MVMA 3A0BZ 2Q0AA 1Z2GA 2HLDG 5AG2A 1THZA 3GWKC 2DN9A 3H9VA 1FXVA 3X2QB 1JFFB 1X59A 1F51A 1M90W 3OW2U 1R1BA 5CA1A 1YF2A 4UCTA 5B1BC 4CZZA 3JARB 3B2EE 4NXNB 4JTCB 5C93A 1IVSA 3I55V 1F23A 2JS5A 2FB5A 2BOBC 3ETGA 4JI8O 4NR1A 2ODMA 5LBQA 3ZRSA 1Q81W 4LNUA 2OT5A 3CS5A 4CH3A 2HFEC 3F5WC 1ENVA 3H01A 1I7FA 3BA9A 3FB6C 1N34O 1OCRB 4Q6GA 4I4TA 1Y6XA 4UVAA 4MW3A 1N33B 2H3OA 5EYPB 3ZN0A 3VQXA 1K4CC 2KSDA 4OGQB 3CRQA 2XAHA 1VEWA 4N21A 1QNMA 2C2AA 4O4LA 1FJGO 4XDKA 1G1XB 1D5NA 1KECA 1PNKA 4DR1O 4GCZA 1M9NA 4DV2B 2BSKB 1I94O 1P7BA 5E79Z 1OCZB 4FLWA 1EN6A 4JTDB 2YIDA 3CRCA 2B1GA 4B7EA 1V55C 1AR4A 2XAQA 2JJ1G 1XNQO 2RQ6A 1AR1B 1VQ4V 3J7AU 5BMVA 3WG7B 2UXBB 4CBCA 2FMLA 5J2TB 4MVQA 2UUAO 3E86A 2RCVA 3G4SV 4PA9A 1KP3A 4MVSA 1VF6A 3G67A 3S3XA 1HDJA 3ZMTA 2QWQB 3IC7A 1K5QA 4FJCC 4YJ2B 2EINB 1JQ0A 4HNAA 1OHHG 2L6LA 4I5SA 5LMUO 1YI2V 4B3RO 2IJHA 2BTQB 5LA6B 2UXCB 1US6A 3D36C 1HR0B 3OGCC 1AROP 2JRIA 3DGEA 2VS0A 5EC1C 1HNWB 4J80A 3F7YC 3L73H 1PNLA 2R72A 3I56V 2NLJC 3RYFB 5FNVB 4K0KO 4OPHA 1P84F 4YJ3A 4RUFA 1I08A 3CE2A 2P90A 1SQXH 1M1KW 1BS3A 2K1EA 5D5QA 5KHGA 2NNUA 2DJVA 1S5HC 3IJ4A 4X88A 2YDEA 3L71H 4B7KA 5IYBO 1HW7A 3AEIA 3ZHTA 3E8HA 1Y74B 4JGSA 1W0KG 4QGPA 3LSQA 1PM9A 4ZIBA 5KLVH 4TT3G 2GBOA 1H2SB 2B9ZA 3UCSC 2CH7A 2AZ2A 1YITV 4QNHB 2UUCO 1VQ8V 1KBHA 1K33A 4GUNA 1E1QG 2WSSG 1AI6A 3OTOB 3ZHSA 1HNZO 2AHYA 1TVKA 5JJNB 1VF5B 3DC5A 4R50A 5A9GA 3OAAG 2XOKG 1BZKA 1Q43A 1H8HG 5CN0A 4ZOLA 2F66C 2WAMA 2DQ3A 1MSDA 3SYCA 4WBNB 1Q6HA 4LF8B 4D7SA 4PA4A 4FFBA 2E76B 1MZEA 4G27B 5L3DA 3SPJA 3QO5A 5A2QN 4JZGA 4IYIA 1QHTA 1K8AW 4WCEV 1SQQH 2EIJB 1H2KA 4BIOA 4X1IB 5EBLC 1BSMA 5BXZA 2LO1A 3CCUV 2NN4A 5LOVB 3BA8A 4PHZA 3JASA 3C3TA 4MTFA 1EN5A 1M57C 4WFFA 3VOUA 2QTOA 4FIPC 4MW8A 5CBFA 1UPGA 1PP9H 1N32B 5J2UA 3K5MA 3AG4C 3HKBA 1RM1C 3DXRA 1GH6A 4DV1O 2XNDG 3TXQA 4DV2O 4ZI7A 2P4KA 3BHPA 1FPOA 1FFXB 4KUMA 2QWRB 3UQ8A 1AI5A 4FLVA 1EZJA 3OD4A 4ASUG 2GTSA 4BIUA 4MVRA 2YIBA 4UCVA 4LBEC 1N0JA 1M56B 2UXBO 1G4YB 3ZMZA 4LF9B 2UU9B 2N04A 3JAKA 4O2BB 2XT9A 4K35A 3JALB 2Q7HA 4R6ZA 4U7NA 1F4NA 3W7UA 4I50B 4KHPO 3K3WA 5KA5A 1NKDA 2WPDG 2Y0PA 5B1AC 4RO2A 2Q73A 2WA4A 5LP6B 2KB1A 4I0XB 3Q4HB 4NXMB 3T2MA 1AVMA 2Q5ZA 4X66B 1JR9A 3JD0A 1WA8A 1WN7A 1YJWV 4KL1A 5LYJA 3K5NA 4LFAB 1XHXA 2YEVB 1ZAUA 3RYCA 4YY3B 1HR0O 5CBGA 4MVOA 1S5LZ 2ZXWB 2ZDIA 3SPGA 3HKCA 5H9CA 4K3AA 3OMNB 1HNWO 1RSOB 3U0ZA 4DW1A 1CPYA 2OYQA 4DRXB 3QTCA 4IGGA 3OTFA 4PA6A 3BEHA 4HYOA 5IJ9A 4W4LA 3RYIB 2OTLV 1H8EG 4FMTA 2EIMC 3CCVV 1RP3B 4JI3B 5LXTB 4AI8A 3JAWB 1VARA 1M5IA 3CHXA 3CC7V 1K5SA 4BR6A 5CB4B 3BPZA 3TXSA 3SYPA 3OM3B 1VMGA 4H37A 2HJFC 3OR6C 2ADQB 3JD3A 3AG2C 4PV1B 2K9PA 2G38A 3UM7A 4O4JA 3SR2C 4CS4A 2QTSA 3ML0A 4YIOA 3A8TA 3OE7G 3OTOO 3ABMC 3K0GA 2W6JG 3T1YB 1FJGB 1R6KA 1S5JA 5IYZB 1GO3F 1GK9A 5LMNB 3ZRWA 1OCOB 1N4CA 3IGAC 1U97A 4LCUC 2ZE7A 2DYRB 4DV7O 1XNQB 4H0LB 2PF4E 3L9DA 3HKDB 5LGUA 4LWSB 3H1KH 4X1KB 3X2QC 1H2NA 4R7CA 3BY6A 4ZHQB 4LF8O 3SJCC 2HVJC 4IIJA 3RYHB 4DR5B 4JASA 1NTKH 5LL6Y 1Z5WA 1GAXA 5LHHA 1DF4A 2Z0AA 3UT5A 3TCUA 3CCLV 5L3GA 5CA0B 2A7WA 1W59A 4DUZB 4CS2A 1G6UA 5LMUB 3N2GA 1OCRC 5B1NA 4GX5A 1P4RA 3K59A 2ZNJA 2VQFB 1YJ9V 2LGQA 1ROPA 3A0HZ 2ZD9A 4HAMA 4YIPA 2BTOA 5KUKA 3CJHB 3ABLB 4JF3A 3T4DA 3E89A 2DWEC 3THOA 1TUBB 5JQGA 4F6RB 3KKYA 4LP8A 4JI1B 2LP7A 3G80A 1OCZC 5IE9A 4NTYA 3ZBHA 3AK3A 4J41A 5ITZA 4TUYA 2WLMA 2AGAA 4LF9O 2ZM6B 3FD9A 5TISZ 3L74H 1J95A 1MZFA 2UU9O 3WG7C 5JVDB 5H6RA 4EFEA 3OMIB 2B1IA 4I55B 4L8JA 4J7JA 1ZWIC 5LHIA 1NTMH 4DV0B 2M7WA 1AJNA 2RMKB 3F5TA 5K1XA 4PI0A 4B08A 2UXNA 3O65A 1IURA 2P06A 1KUQA 1S0VA 1XILA 5CA3A 1SRYA 3OT7A 4NXMO 1WPXA 1Y66A 2EINC 4X66O 2UUCB 3A0RA 2EILB 4X89A 4H33A 4LFAO 5CA1B 4U7OA 1MOFA 1R6NA 2RJZA 4YY3O 1I5YA 2GDSA 4WFAV 3JATA 5EBMC 1QVFU 4BW5A 2IBZH 2V7QG 3U10A 3QO7A 1U96A 4X65B 2BOCC 4UCUA 2IW5A 2ZE6A 2VRZA 1WP7A 4LNUB 5DEDA 2ZIOA 5FPOA 1O9GA 4H13B 5BY1A 1RPRA 3ASNB 4LC1A 1QLEB 4F4LA 3CPWU 3FYIB 3OUSA 1S76D 4I4TB 2JGDB 3FYEB 2ZT9B 3APQA 2AW9A 3C90A 2CTPA 3UO3A 3MHSC 1KYOF 2BE3A 3H1LH 1YSCA 4TV9A 4JI3O 2DWDC 1MSWD 5FPRA 3QF7A 2HJDA 4GKKB 4IHJA 3APOA 4MTGA 4RQEA 2ZE5A 1SZXA 4JYYA 3AG1B 3LUTB 2ARHA 4B3SB 3J80N 2Q68A 4O2AA 3RVYA 2VQEB 3K9AA 2PZSA 3MDSA 2QKAA 3CMAV 3E35A 3E8GA 3SPCA 3BVOA 4PDLA 2IJIA 1EBOA 1VQLV 3T1YO 4DV1B 2MW2B 5LMNO 1DTOA 3LSSA 1WJZA 1FXKB 5B5EZ 4X1YB 2ZKOA 1XNRB 1NBMG 1VF7A 1WAZA 2E5LB 4JYBA 3SJQC 2IJJA 1M93A 1KD1W 1GMGA 2X6CA 1R3IC 4ICGA 5IWAB 1TA8A 4N23A 4PDVA 1EM1A 1Q5OA 1JA8A 4YHHO 4DR5O 1QQCA 4DR4B 2CUGA 3M99B 5B3SB 4KHPB 1UJWB 1OJHA 2CK3G 2Q69A 3ZHRA 2EIJC 4UVBA 2BSKA 4QIWF 4GYCB 4QPKA 4PI2A 1KB9F 2HHHB 4FFKA 4DUZO 2ZR2A 4EKWA 1VQNV 4R8CA 2JJ2G 4YJ3B 2VQFO 1XL6A 1BQ0A 1B04A 4WFEA 4UB8Z 5B66Z 4LF6B 1PNMA 2IH1C 2Q67A 1MG1A 4JI1O 1TGOA 3O9OA 3W7WA 2GV9A 1XMOO 4OPAA 3ZCCA 3GB7C 1MA1A 4YJ2A 2EULA 2CGNA 1AI4A 3C3SA 2GUZB 2YC0A 2ZM6O 3EFFK 3CCQV 2CH7B 1NQTA 1M56C 1YIJV 3CP1A 1BE3H 2Z3YA 3RT3C 3AK1A 4DV0O 1AR5A 2L35A 4E2LA 2Q9LA 1JVMA 1TVKB 1FAFA 1VQKV 4DV4B 4C7UA 4AILC 3B09A 5LP6C 3CRMA 5GONB 3T4ZA 1YCIA 3RYFA 3OMAB 1F4MA 2CGOA 1YEWA 1SETA 4LFCB 3ETDA 1VP7A 3E8BA 3ZS8C 2A3QA 4P9PA 1IXMA 2AXTZ 4TV8A 2A79B 3GWOA 2VWKA 5H5NA 1SKVA 4X65O 1KC8W 1DGSA 2ZXWC 4U3JB 4DV7B 1JPXA 4J10A 1K92A 3B8NA 1Y74A 2IU3A 4J7KA 3RVZA 3JCUZ 1B06A 3GVMA 1GTOA 2E3CA 5JWPA 1Y4MA 2F43G 3E8FA 4Z2WA 3JASB 1AP5A 1SQVH 2LFRA 2QWPB 3JAMN 1PKXA 1S72V 2P4VA 1IBMO 2Z5UA 4GKKO 3CX5F 2QA4V 3NR7A 3HKBB 2EIKB 3MD0A 4PELA 3DXRB 1ORQC 5JCOC 4ZI7B 4O4IA 1Q7YW 1XBLA 3ZIAG 4IL6Z 3OR7C 1IDSA 3P32A 4KXRA 4B3SO 2D2CB 2VQEO 4JV5B 3AG3B 4AHCA 3TETA 1EN4A 2CDYA 1PL0A 4GT1A 4XDJA 3LNNA 2WLIB 1EZVH 1N0NA 3K79A 3AG7A 1VQ7V 4CH6A 5KAIZ 3JAKB 1XI1A 4XDLA 1IBLB 3WU2Z 2YXLA 4FM1A 3CWBH 4B3TB 1SC5B 3G6BA 3KZIZ 2Q8VA 1SA0A 1OCOC 1R3JC 3ZRXA 3B8MA 1XNRO 4ABMA 4UVCA 4X1IA 3RWRD 2E5LO 2X6AA 1PL4A 2DYRC 3K06A 1AJQA 3RN4A 3K0DA 2LFSA 4FZ0A 2KG7A 1JJ2U 4LR3A 1WA8B 5IWAO 1HP8A 3D36A 1XMQB 4DR4O 4UCRA 2Q0OC 4CS3A 4J11A 1YXBA 1B6QA 4O4HA 1QVGU 5LGNA 3L75H 5DM6V 1R73A 4I9WA 4FPPA 2YI9A 1FFXA 2KKWA 2XUMA 2HHHO 5L3FA 4DR6B 5KHJA 1VQPV 2ATKC 2W0XA 1V54B 3SJBC 1VQMV 3JD1A 3SYQA 2P6JA 1XDCA 1YDXA 3VQVA 1CP9A 4JI7B 4K8XA 4NYKA 2W6IG 3HKEA 5IJ9B 1BQZA 4HBNA 3P3PA 2JVDA 4LF6O 2FKXA 1BCCH 5FLXN 1P7GA 3E22B 4O2BA 4FM2A 3ABLC 3ABUA 4Q20A 3JALA 3CCSV 5CBHA 4QE7A 3H1IH 4I50A 1CEZA 5JJJB 2OCCB 1NR1A 3L72H 2PGGA 3QO8A 1COWG 1FD9A 2H8PC 4DR3B 3OEEG 3K58A 1PV0A 2M6YA 4O4JB 4JI5B 2QKSA 4G2KA 1XHZA 4IYHA 2PYLA 2FYUH 4DYLA 2YEVA 3TJTA 3FAVA 2OIEA 3HR0A 1ZL8B 2V1DA 5DECA 3ZRWB 4DV4O 4W4KA 1VQ6V 1Q86W 4Z1VA 2Q7GA 3CSXA 5C8YB 2PY5A 3SYOA 3DSQA 4LFCO 2EILC 4NVPA 1Y76A 2IU0A 5L3EA 1V9PA 3RYIA 1E1RG 4JPRA 4NKGB 1FYJA 5GTIZ 1FXHA 4D6TH 2V4DA 5LXTA 3AK2A 1WLEA 1JCHA 5JCOA 2R9IA 1IZ3A 3CXHF 2ITCC 4TQFA 3I5DA 1SQGA 1Q90D 2YIAA 2R9RB 1Q8IA 1URFA 1GN4A 2OCHA 1H2LA 3ASNC 2PYJA 1QLEC 4J9YB 3N2GB 4YHHB 4JI4B 2N74A 4JAVA 2LW1A 4EB6A 1KU9A 1SQFA 3FB8C 4GLXA 3VQYA 5IT9N 4I9QA 1NU1H 4LH6A 3ZHVA 4WFHA 5IYZA 2YI8A 2CTRA 4AQYB 3ZX6A 1NH2D 3F7VC 4G28B 5KMGB 2A9HA 5KX5B 2F4VB 4HZ3A 4TWKA 4UV8A 1IXBA 2QM7A 4DW0A 1DF5A 3AG1C 3BAAA 4JV5O 5EBWC 5ITZB 4PD4F 1QCEA 4LWSA 4JI6B 1QU7A 3WB1A 1K73W 1Y67A 2JIZG 4LF7B 3CCRV 2EZOA 5EIBD 4PDMA 1SQBH 3FX7A 4XBFA 1IBLO 3RYHA 3ZMSA 4GKJB 1N8RW 4B3TO 2GTAA 2MK3A 1R6TA 1XMOB 1VF6C 4JI0O 1T5EA 1FXKC 1XUQA 3N2KB 3U11A 5CA0A 4JAAA 1GKFA 1SESA 1WP8A 1W0JG 5EIBC 4UB6Z 1XMQO 1MNGA 1Q82W 2XTAA 3RW0A 4PA3A 2CAZC 2HP8A 2CTQA 3JATB 5B3SC 4JI2O 3LNMB 3CMEV 4F6RA 4DV3O 2LGWA 4DR6O 2KQXA 4NTXA 3SDLA 4WFGA 3ZHQA 1W2BU 3BCCH 1GM7A 4JI7O 4GX0A 2DYSB 3K5OA 1NR7A 5L3BA 2WLLA 3RFRA 5EZYA 3WFVA
chains in the Genus database with same CATH topology
3HB3B 1M57B 1XL6A 4MTFA 4GX2A 1M57C 4WFFA 1R3LC 3VOUA 3ZMVA 2QTOA 4WFEA 4RUEA 4FIPC 4MW8A 5CBFA 2P67A 3AG4B 1RM1B 1PNMA 2IH1C 2Q67A 2WWWA 3AG4C 1RM1C 5CMUA 1MG1A 2XNDG 2YSUB 1KKDA 1S3JA 4FK5C 3CCEV 4KUMA 1K3EA 2W0FC 3CCMV 1AI5A 1EZJA 4MTXA 4WF9V 4ASUG 4BIUA 3W7WA 4DO2A 4MVRA 3ZCCA 2HR3A 3GB7C 2QEXV 2OTJV 4LBEC 3K04A 5HFLA 1AI4A 1BL8A 4KFMA 3STZC 3SPIA 5IY5B 2ZQMA 5BZBA 1M56B 1K4DC 1K7DA 1MABG 3EFFK 4MS2A 3EHBB 3D3IA 1G4YB 1NQTA 1M56C 4QE9A 3ZMZA 5IY5C 2UXXA 2HG5C 1H38A 5H6QA 2X7RB 1AJPA 5J9PC 1YIJV 3CP1A 2DW4A 1KQSU 3LDCA 2Z3YA 2ZR3A 1K34A 3K03A 4R6ZA 4U7NA 3UKMA 4E2LA 1F4NA 3W7UA 2Y48A 1JVMA 3K3WA 5B1AB 2JEXA 4RAIA 5KA5A 3CCQV 1NKDA 1VQKV 2WPDG 5B1AC 4RO2A 2KB1A 3LDEA 4P30A 3T4ZA 2QM8A 2PI5A 3T2MA 3OMAB 1F4MA 1QLNA 3JD0A 1YJWV 3OFNG 3CYOA 3CC4V 1SETA 3ASOB 1OCCB 3NXSA 1NH2B 3ETDA 1RPOA 3ASOC 1OCCC 3E8BA 3JD2A 5LGTA 2Y69B 2YEVB 4P9PA 1H2GA 1IXMA 2Y69C 3MHHC 2A79B 4Z1MG 4X8AA 5CBGA 3GWOA 4MVOA 1R3KC 2WLJA 4P2ZA 2Q6AA 2DQ0A 1HWYA 3VBBA 3FB7C 2ZXWB 2ZDIA 1KC8W 3SPGA 2HVKC 1XL4A 2ZXWC 5H9CA 3STLC 2X0LA 3OMNB 3K08A 4ZBMA 1OZ0A 1JPXA 1CPYA 1K92A 3B8NA 1NJIW 2IU3A 1VQ9V 1NVPB 3W7XA 4PA6A 3RVZA 1KP2A 3BEHA 4HYOA 1VQ5V 1GTOA 2X6BA 2OTLV 1Y4MA 3OEHG 2F43G 3PJSK 2EIMB 1I5XA 1H8EG 2GSMB 4FMTA 2WLLB 3E8FA 2EIMC 3CCVV 1YTFD 4P9OA 2LFRA 4OXSA 1PKXA 1S72V 1LNQA 2D3OW 2Z5UA 4UV9A 3ZRVA 2JEUA 2XASA 3W7SA 2QA4V 1DLBA 3IFXA 2EIKB 3MD0A 4PELA 3LDDA 1ORQC 2EIKC 3CC7V 1K5SA 2EZPA 4GX1A 1Q7YW 1FXKA 3SYPA 3SYAA 3OM3B 3ZIAG 4ZKIA 4H37A 2HJFC 3OR6C 3OR7C 3P32A 4PDRA 3ZMUA 3G71V 3ABKB 1YTFB 3AG2B 3HPLC 2EJRA 3ABKC 3JD3A 3AG3B 3E83A 3AG2C 3TETA 4DXWA 3AG3C 3UM7A 1PL0A 4GT1A 5B1OA 1BMFG 2ITDC 3ML0A 4XDJA 2WLIB 3ABMB 2IH3C 3OE7G 3ZN1A 3K79A 3ABMC 3K0GA 1TUEB 1VQ7V 3W7TA 2W6JG 1R6KA 3JD4A 4XDLA 1GO3F 1GK9A 3E2EA 5LHGA 1VQOV 5GW7A 4YXWG 3ZRWA 3R65A 3DTUB 1OCOB 4MVZA 1E79G 1OCOC 1R3JC 2JK5C 3IGAC 4LCUC 3B8MA 1SZTA 3ZRXA 4MVMA 5IYCO 3RBZA 2DYRB 4UVCA 1SERA 2X6AA 2DYRC 2HLDG 3K06A 1THZA 5LGUA 1FXVA 1AJQA 3X2QB 1F51A 3K0DA 1M90W 3X2QC 3OW2U 1BHAA 2LFSA 4R7CA 5B1BB 3BY6A 4CZZA 5B1BC 1GM9A 1JJ2U 4WFBV 1FFTB 4JTCB 5C93A 3D36A 4MSWC 2AHZA 3I55V 2HVJC 1F23A 4JASA 4MT8A 2FTKA 1S77D 5LHHA 1DF4A 2BOBC 3ETGA 1L1FA 1B6QA 1QVGU 5LBQA 5LGNA 3ZRSA 1Q81W 4JTAB 3TCUA 5IYDO 3CCLV 1G8MA 1R73A 5DM6V 1BHBA 4I9WA 4FPPA 2OT5A 2ZDIC 2HFEC 3F5WC 5L3GA 1ENVA 5L3FA 1VQPV 3H01A 2ATKC 3B77A 1V54B 2B5UA 1V54C 3FB6C 5DN6G 1OCRB 1VQMV 3JD1A 4UVAA 3SYQA 1OCRC 2P6JA 4MW3A 5B1NA 1CP9A 4GX5A 1P4RA 2W6IG 3ZN0A 4RQFA 1YJ9V 2XAFA 1ROPA 2ZD9A 4HAMA 5KUKA 1K4CC 3ABLB 2XAHA 4JF3A 3ABLC 3ABUA 4N21A 4Q20A 3CD6V 2C2AA 3T4DA 3CCSV 3E89A 4XDKA 2DWEC 2HKOA 1KECA 1PNKA 2H94A 4GCZA 1M9NA 4JAUA 5CBHA 4QE7A 1P7BA 4LP8A 1OCZB 2LP7A 2WLNA 3FKSG 4JTDB 3CC2V 1CEZA 1OCZC 2B1GA 1V55B 2OCCB 1NR1A 1V55C 2OCCC 2JDIG 3QO8A 2XAQA 2JJ1G 1COWG 1VQ4V 1AR1B 2WLMA 5HFMA 2H8PC 3OEEG 1YHQV 1AI7A 3WG7B 1J95A 4CBCA 2QKSA 4G2KA 3WG7C 4MVQA 3E86A 5H6RA 3OMIB 2B1IA 2YEVA 3G4SV 1K97A 1YJNV 1ZWIC 4PA9A 5LHIA 1KP3A 4MVSA 2M7WA 3G6EV 1AJNA 1JX9A 2V1DA 3ZRWB 2UXNA 3ZMTA 1K9MW 1VQ6V 4KP4A 1S0VA 1Q86W 5CA3A 3IC7A 1SRYA 1K5QA 4FJCC 1FS0G 2EINB 1WPXA 4BAYA 1Y66A 4QJFB 5L3CA 2EINC 4MVUA 1JQ0A 2EILB 3A0RA 4X89A 3SYOA 2XAJA 1OHHG 1QR9A 2EILC 3ETEA 4H33A 1GM8A 4I5SA 4U7OA 2A0LA 2IU0A 1YI2V 2IJHA 5L3EA 1MOFA 1E1RG 1R6NA 4JPRA 1I5YA 2WLHA 2QE7G 4WFAV 5EBMC 1QVFU 3OGCC 4BW5A 2V7QG 1FXHA 1AROP 3QO7A 3JCZA 3DGEA 2BOCC 1WLEA 1JCHA 2IJKA 2IW5A 5EC1C 2R9IA 3F7YC 1PNLA 2ITCC 5EK0A 3I56V 4J9ZB 2NLJC 4MTOA 1RPRA 2R9RB 4UXNA 3ASNB 4LC1A 1QLEB 4RUFA 4F4LA 3FYIB 3CPWU 2P90A 3ASNC 3OUSA 1M1KW 1QLEC 3OUFA 1S76D 5FL7G 3FYEB 4J9YB 2K1EA 4JAVA 2NNUA 3FB8C 3MHSC 1S5HC 1YSCA 3KG2A 2WLIA 2DWDC 4X88A 1MSWD 3T1CA 4WFHA 5IYBO 3AEIA 3E8HA 5IDJA 1NH2D 3F7VC 4G28B 5EC2C 2A9HA 4MTGA 3ABTA 4JGSA 4RQEA 4HZ3A 2XAGA 1QR8A 2PI4A 1W0KG 4TWKA 4UV8A 2QM7A 3LSQA 3AG1B 3LUTB 2GHYA 1DF5A 3AG1C 3JYCA 4TT3G 5EBWC 4QPJA 1QCEA 2Q68A 3RVYA 3CXCU 3K9AA 1YITV 3P30A 1K73W 3CMAV 4QNHB 2JIZG 3E35A 3E8GA 3SPCA 1VQ8V 1K33A 4PDLA 1E1QG 2IJIA 1EBOA 1PD3A 2EZOA 2WSSG 3CCRV 1VQLV 1AI6A 4PDMA 5E1AC 4XBFA 1NVPD 3ZMSA 2AHYA 1N8RW 1DTOA 3LSSA 2MK3A 4R50A 1FXKB 3OAAG 2XOKG 1FXKC 1H8HG 1EFRG 1NBMG 5CN0A 4L87A 3FB5C 1GKFA 2EBOA 4JYBA 4JYCA 3TK1A 3SJQC 2WAMA 1SESA 2DQ3A 2IJJA 1JOYA 1W0JG 1KD1W 3SYCA 1GMGA 2X6CA 3CCJV 4BIZA 1R3IC 1QBZA 4PA4A 3ZJZA 4PDVA 4N23A 1Q82W 2P7TC 3RW0A 3M99B 4G27B 5L3DA 4PA3A 3SPJA 3QO5A 5B3SB 1UJWB 5B3SC 1K8AW 2CK3G 2WLKA 2Q69A 4WCEV 3LNMB 2EIJB 3CMEV 2EIJC 4UVBA 5EBLC 4QIWF 4QPKA 4UUJC 4WFGA 4PA7A 2ZR2A 4EKWA 1W2BU 3CCUV 3QNEA 4TSFG 3SPHA 1VQNV 4R8CA 1GM7A 4GX0A 2DYSB 5KA6A 1NR7A 5KUMA 2JJ2G 5L3BA 2WLLA 2DYSC 3WFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSU B;  1JCH A;  2B5U A;  1UJW B; 
#chains in the Genus database with same CATH topology
 3DC6 A;  2JS3 A;  1AP6 A;  4GX2 A;  3ZMV A;  1Q6I A;  2P67 A;  5JVD A;  4TV9 B;  2F95 B;  2WWW A;  2R9A A;  4I55 A;  4LFB B;  1KKD A;  2ZIM A;  2A06 H;  2QR4 A;  4EFB A;  2E74 B;  2W0F C;  3CCM V;  4IHJ B;  4WF9 V;  5IJ0 A;  4DR2 B;  4DO2 A;  4UCS A;  2WA3 A;  3K5L A;  1BGY H;  4X64 B;  2OTJ V;  2HR3 A;  1XOU A;  1AB3 A;  2CE4 A;  4TOI A;  5HFL A;  1BL8 A;  4LF5 B;  4DR3 O;  5IY5 B;  5BZB A;  4X9Q A;  1K7D A;  4MS2 A;  1MAB G;  3EVK A;  4O2A B;  3EHB B;  3TK1 A;  4X20 A;  4JI5 O;  2UXX A;  2HG5 C;  1IBM B;  2X7R B;  1AJP A;  2DW4 A;  1AIL A;  1KQS U;  2R70 A;  4O4L B;  1D2D A;  2ZR3 A;  1K34 A;  5JH7 A;  2Y48 A;  5KHI A;  4RAI A;  1H2M A;  2QSA A;  2Y4T A;  3LDE A;  1JFF A;  1X4T A;  1TAE A;  2ZE8 A;  2P5O A;  1QLN A;  3JAR A;  5BMV B;  3CYO A;  3CC4 V;  3ASO B;  1OCC B;  1NH2 B;  3H1J H;  2JGD A;  2YS8 A;  2NR5 A;  2Y69 B;  3MAQ A;  4FM0 A;  1H2G A;  4Z1M G;  2QM4 A;  2Q4P A;  1R3K C;  2WLJ A;  2Q6A A;  2DQ0 A;  1HWY A;  3VBB A;  1WB7 A;  2HVK C;  2X0L A;  4ZBM A;  1OZ0 A;  3UO2 A;  1NTZ H;  1VQ9 V;  4DV5 B;  2PUS A;  3W7X A;  4HNA B;  5EYP A;  1VQ5 V;  1LUW A;  2YXY A;  4FLY A;  3A2F A;  2ZNI A;  4JI4 O;  2F1M A;  1I5X A;  2N05 A;  2YIB D;  2GSM B;  2QDO A;  1HNX O;  2CTW A;  4OXS A;  1LNQ A;  1MMM A;  2ZCE A;  4DR7 B;  1O9H A;  3ZRV A;  2XAS A;  3W7S A;  1NI8 A;  3IFX A;  4AQY O;  2EIK C;  3P3N A;  2F4V O;  2EZP A;  4GX1 A;  4OX9 B;  1FXK A;  4X1Y A;  5KHK A;  3T1H B;  3SYA A;  3ZMU A;  3ABK B;  1YTF B;  4JI6 O;  3HPL C;  2EJR A;  1GRJ A;  3E83 A;  3AG3 C;  2IM9 A;  4LF7 O;  5B1O A;  1BMF G;  5J2T A;  1XRE A;  3ZN1 A;  1TUE B;  3PN1 A;  3JD4 A;  4GKJ O;  1JJO A;  3E2E A;  5LHG A;  1VQO V;  1IBK B;  3FFQ A;  1WB8 A;  3JSN A;  4DK0 A;  1RFY A;  3OGI B;  1SZT A;  5IYC O;  3RBZ A;  1SF9 A;  4X62 O;  1SER A;  5GTH Z;  4UCO A;  1ZUQ A;  4BWA A;  4RWU A;  1BHA A;  2DE0 X;  5B1B B;  1YZB A;  3M8A A;  1GM9 A;  2VWJ A;  3VQW A;  4WFB V;  1FFT B;  2BTQ A;  1N36 B;  3EXA A;  5LA6 A;  1I0H A;  4MSW C;  4CC6 A;  2AHZ A;  4LF4 B;  1SQP H;  3ZED A;  4MT8 A;  1GN3 A;  1BT8 A;  2FTK A;  3BFR A;  4TV8 B;  1S77 D;  1L1F A;  4JTA B;  5IYD O;  1G8M A;  5BR8 B;  1BHB A;  1L0N H;  2ZDI C;  4I7Z B;  4ZOL B;  5FNV A;  3B77 A;  2B5U A;  1V54 C;  5DN6 G;  1NS1 A;  3L70 H;  1UFI A;  1IX9 A;  3N27 A;  1A32 A;  2E75 B;  4FLT A;  4RQF A;  2GUZ A;  3CRA A;  4B3M B;  4FFB B;  1DK1 A;  3IC9 A;  2XAF A;  2ETN A;  3CD6 V;  4LFB O;  1J5E B;  2HKO A;  2H94 A;  4DV6 B;  1PPJ H;  4JAU A;  3B4S A;  1M4U A;  2WLN A;  3FKS G;  1SS3 A;  4DR2 O;  3CC2 V;  5D5P A;  1V55 B;  4O4I B;  4X64 O;  2OCC C;  2JDI G;  4LF5 O;  5GON A;  3KCY A;  5JJE B;  5HFM A;  3SJA C;  2RDC A;  1YHQ V;  1AI7 A;  4DUY B;  4UFZ A;  5J2U B;  4NXN O;  3RGB A;  1K97 A;  1YJN V;  3G6E V;  4CC5 A;  2O57 A;  1JX9 A;  1K9M W;  4KP4 A;  4U3J A;  1SA0 B;  3K9S A;  1GN6 A;  2UUB B;  1FS0 G;  4BAY A;  5L3C A;  4QJF B;  2ILM A;  4MVU A;  4WBN A;  2XAJ A;  1QR9 A;  3ETE A;  1GM8 A;  2A0L A;  2KG7 B;  1N33 O;  1LUV A;  4BW9 A;  4J42 A;  2WLH A;  2OWO A;  2QE7 G;  4PJ0 Z;  2UXD B;  1VIB A;  3IAY A;  4JI0 B;  3CEI A;  3JCZ A;  2ADP A;  3BAB A;  4O4H B;  4E4E A;  1FKA O;  2IJK A;  5F2V O;  5EK0 A;  4J9Z B;  4DV5 O;  5LOV A;  3KCX A;  4MTO A;  4UXN A;  5LYJ B;  2Q7E A;  3OUF A;  5FL7 G;  2QGN A;  4A5U B;  4JYA B;  1L8D A;  3RYC B;  3HKE B;  3KG2 A;  3R66 A;  2WLI A;  2BCC H;  4DR7 O;  2QWN B;  3T1C A;  4JI2 B;  3HKC B;  3B40 A;  3ZHU A;  4DV3 B;  4GZR B;  5IDJ A;  2YIC A;  1JMK C;  5EC2 C;  4OX9 O;  3ABT A;  4FZ1 A;  1KMI Z;  2XAG A;  3T1H O;  1QR8 A;  2PI4 A;  4EEQ A;  2GHY A;  3JYC A;  1XQ8 A;  3CB2 A;  4QPJ A;  3CXC U;  2LQT A;  3P30 A;  2JGU A;  3CRR A;  1PD3 A;  5E1A C;  3QVN A;  1NVP D;  1IBK O;  1NT2 B;  3D3Q A;  2UXC O;  3FAV B;  5LP6 A;  4I0X A;  3Q4H A;  2F23 A;  3ICX A;  1EFR G;  2QKC A;  4L87 A;  4CH5 A;  3FB5 C;  2EBO A;  1D5A A;  4JYC A;  4TQD A;  1JOY A;  1Q6U A;  3CCJ V;  1N36 O;  4BIZ A;  2LJ2 A;  1QBZ A;  4LF4 O;  3ZJZ A;  1Y76 B;  2P7T C;  4IT5 A;  5KHH A;  4K8Z A;  1LR1 A;  3E22 A;  4FLX A;  4JI8 B;  1RSO A;  2WLK A;  5BR8 O;  1OV9 A;  3LSU A;  3QG5 A;  1ZTE A;  2Y4U A;  4DRX A;  3J81 N;  4UUJ C;  1Z5V A;  4LH7 A;  4PA7 A;  1GN2 A;  3QNE A;  4TSF G;  3SPH A;  4FLZ A;  1N34 B;  2DOS A;  5KAF Z;  5KA6 A;  5KUM A;  2RNB A;  2DYS C;  4B3M O;  3HB3 B;  1M57 B;  4IIJ B;  1R3L C;  1ZLZ A;  4RUE A;  4EB6 B;  2YUA A;  1Q3E A;  3M7M X;  3TGU H;  3AG4 B;  1RM1 B;  3JAW A;  3UT5 B;  1J5E O;  5CMU A;  4DV6 O;  2YSU B;  1S3J A;  4FK5 C;  5CB4 A;  2PTM A;  3CCE V;  4DR1 B;  1K3E A;  1ZSP A;  1I94 B;  1ZL8 A;  4MTX A;  3WB2 A;  1YVW A;  2FL4 A;  1XEQ A;  2QEX V;  4FVM A;  1CXZ B;  3K04 A;  4NB5 A;  4KFM A;  3STZ C;  3SPI A;  5C8Y A;  1WPB A;  2QJ1 A;  2ZQM A;  2QWO B;  4DUY O;  1K4D C;  1B3Q A;  1HNX B;  5IY5 C;  3D3I A;  4QE9 A;  1H38 A;  5H6Q A;  5J9P C;  2Y0I A;  3LDC A;  2UUA B;  4F6E A;  4CH4 A;  3K03 A;  2P22 C;  2XHB A;  5JQG B;  1ZX3 A;  2RN9 A;  3UKM A;  2F93 B;  3S3W A;  5B1A B;  2JEX A;  1L0L H;  3JSL A;  4NTW A;  3HKD A;  4TUY B;  2UUB O;  4P30 A;  4X1K A;  2QM8 A;  2PI5 A;  1KKC A;  3WB0 A;  4ZHQ A;  4D7T A;  3OFN G;  3NXS A;  1RPO A;  3ASO C;  1OCC C;  3JD2 A;  5LGT A;  4B3R B;  2AZ0 A;  2Y69 C;  2YXH A;  3MHH C;  2ZIN A;  4H44 B;  2UXD O;  4X8A A;  5H2F Z;  3D8C A;  4DK1 A;  4P2Z A;  3FB7 C;  1N32 O;  3ETQ A;  1XL4 A;  3STL C;  4X62 B;  3K57 A;  3K08 A;  1WNS A;  3BRC A;  5KMG A;  5KX5 A;  1NJI W;  1NVP B;  1KP2 A;  4K0K B;  2DMX A;  2X6B A;  4JYA O;  3PJS K;  3OEH G;  2EIM B;  2WLL B;  2EX3 A;  5EZY B;  1YTF D;  3CJH A;  4P9O A;  1P49 A;  4JZ2 A;  2D3O W;  4UV9 A;  1TUB A;  2JEU A;  4U3F H;  1DLB A;  3LDD A;  5K1P A;  2HEP A;  4ZKI A;  5IJ0 B;  3N2K A;  4FLU A;  4PDR A;  3G71 V;  3AG2 B;  3ABK C;  4DXW A;  2EJ7 A;  2LW7 A;  2ITD C;  3ABM B;  2IH3 C;  3H1H H;  4X20 B;  4J7Z A;  3W7T A;  3SGI A;  1NZ6 A;  2OIG A;  1HNZ B;  5GW7 A;  4YXW G;  5JH7 B;  3R65 A;  3DTU B;  4MVZ A;  1E79 G;  2JK5 C;  1F7Y A;  4MVM A;  3A0B Z;  2Q0A A;  1Z2G A;  2HLD G;  5AG2 A;  1THZ A;  3GWK C;  2DN9 A;  3H9V A;  1FXV A;  3X2Q B;  1JFF B;  1X59 A;  1F51 A;  1M90 W;  3OW2 U;  1R1B A;  5CA1 A;  1YF2 A;  4UCT A;  5B1B C;  4CZZ A;  3JAR B;  3B2E E;  4NXN B;  4JTC B;  5C93 A;  1IVS A;  3I55 V;  1F23 A;  2JS5 A;  2FB5 A;  2BOB C;  3ETG A;  4JI8 O;  4NR1 A;  2ODM A;  5LBQ A;  3ZRS A;  1Q81 W;  4LNU A;  2OT5 A;  3CS5 A;  4CH3 A;  2HFE C;  3F5W C;  1ENV A;  3H01 A;  1I7F A;  3BA9 A;  3FB6 C;  1N34 O;  1OCR B;  4Q6G A;  4I4T A;  1Y6X A;  4UVA A;  4MW3 A;  1N33 B;  2H3O A;  5EYP B;  3ZN0 A;  3VQX A;  1K4C C;  2KSD A;  4OGQ B;  3CRQ A;  2XAH A;  1VEW A;  4N21 A;  1QNM A;  2C2A A;  4O4L A;  1FJG O;  4XDK A;  1G1X B;  1D5N A;  1KEC A;  1PNK A;  4DR1 O;  4GCZ A;  1M9N A;  4DV2 B;  2BSK B;  1I94 O;  1P7B A;  5E79 Z;  1OCZ B;  4FLW A;  1EN6 A;  4JTD B;  2YID A;  3CRC A;  2B1G A;  4B7E A;  1V55 C;  1AR4 A;  2XAQ A;  2JJ1 G;  1XNQ O;  2RQ6 A;  1AR1 B;  1VQ4 V;  3J7A U;  5BMV A;  3WG7 B;  2UXB B;  4CBC A;  2FML A;  5J2T B;  4MVQ A;  2UUA O;  3E86 A;  2RCV A;  3G4S V;  4PA9 A;  1KP3 A;  4MVS A;  1VF6 A;  3G67 A;  3S3X A;  1HDJ A;  3ZMT A;  2QWQ B;  3IC7 A;  1K5Q A;  4FJC C;  4YJ2 B;  2EIN B;  1JQ0 A;  4HNA A;  1OHH G;  2L6L A;  4I5S A;  5LMU O;  1YI2 V;  4B3R O;  2IJH A;  2BTQ B;  5LA6 B;  2UXC B;  1US6 A;  3D36 C;  1HR0 B;  3OGC C;  1ARO P;  2JRI A;  3DGE A;  2VS0 A;  5EC1 C;  1HNW B;  4J80 A;  3F7Y C;  3L73 H;  1PNL A;  2R72 A;  3I56 V;  2NLJ C;  3RYF B;  5FNV B;  4K0K O;  4OPH A;  1P84 F;  4YJ3 A;  4RUF A;  1I08 A;  3CE2 A;  2P90 A;  1SQX H;  1M1K W;  1BS3 A;  2K1E A;  5D5Q A;  5KHG A;  2NNU A;  2DJV A;  1S5H C;  3IJ4 A;  4X88 A;  2YDE A;  3L71 H;  4B7K A;  5IYB O;  1HW7 A;  3AEI A;  3ZHT A;  3E8H A;  1Y74 B;  4JGS A;  1W0K G;  4QGP A;  3LSQ A;  1PM9 A;  4ZIB A;  5KLV H;  4TT3 G;  2GBO A;  1H2S B;  2B9Z A;  3UCS C;  2CH7 A;  2AZ2 A;  1YIT V;  4QNH B;  2UUC O;  1VQ8 V;  1KBH A;  1K33 A;  4GUN A;  1E1Q G;  2WSS G;  1AI6 A;  3OTO B;  3ZHS A;  1HNZ O;  2AHY A;  1TVK A;  5JJN B;  1VF5 B;  3DC5 A;  4R50 A;  5A9G A;  3OAA G;  2XOK G;  1BZK A;  1Q43 A;  1H8H G;  5CN0 A;  4ZOL A;  2F66 C;  2WAM A;  2DQ3 A;  1MSD A;  3SYC A;  4WBN B;  1Q6H A;  4LF8 B;  4D7S A;  4PA4 A;  4FFB A;  2E76 B;  1MZE A;  4G27 B;  5L3D A;  3SPJ A;  3QO5 A;  5A2Q N;  4JZG A;  4IYI A;  1QHT A;  1K8A W;  4WCE V;  1SQQ H;  2EIJ B;  1H2K A;  4BIO A;  4X1I B;  5EBL C;  1BSM A;  5BXZ A;  2LO1 A;  3CCU V;  2NN4 A;  5LOV B;  3BA8 A;  4PHZ A;  3JAS A;  3C3T A;  4MTF A;  1EN5 A;  1M57 C;  4WFF A;  3VOU A;  2QTO A;  4FIP C;  4MW8 A;  5CBF A;  1UPG A;  1PP9 H;  1N32 B;  5J2U A;  3K5M A;  3AG4 C;  3HKB A;  1RM1 C;  3DXR A;  1GH6 A;  4DV1 O;  2XND G;  3TXQ A;  4DV2 O;  4ZI7 A;  2P4K A;  3BHP A;  1FPO A;  1FFX B;  4KUM A;  2QWR B;  3UQ8 A;  1AI5 A;  4FLV A;  1EZJ A;  3OD4 A;  4ASU G;  2GTS A;  4BIU A;  4MVR A;  2YIB A;  4UCV A;  4LBE C;  1N0J A;  1M56 B;  2UXB O;  1G4Y B;  3ZMZ A;  4LF9 B;  2UU9 B;  2N04 A;  3JAK A;  4O2B B;  2XT9 A;  4K35 A;  3JAL B;  2Q7H A;  4R6Z A;  4U7N A;  1F4N A;  3W7U A;  4I50 B;  4KHP O;  3K3W A;  5KA5 A;  1NKD A;  2WPD G;  2Y0P A;  5B1A C;  4RO2 A;  2Q73 A;  2WA4 A;  5LP6 B;  2KB1 A;  4I0X B;  3Q4H B;  4NXM B;  3T2M A;  1AVM A;  2Q5Z A;  4X66 B;  1JR9 A;  3JD0 A;  1WA8 A;  1WN7 A;  1YJW V;  4KL1 A;  5LYJ A;  3K5N A;  4LFA B;  1XHX A;  2YEV B;  1ZAU A;  3RYC A;  4YY3 B;  1HR0 O;  5CBG A;  4MVO A;  1S5L Z;  2ZXW B;  2ZDI A;  3SPG A;  3HKC A;  5H9C A;  4K3A A;  3OMN B;  1HNW O;  1RSO B;  3U0Z A;  4DW1 A;  1CPY A;  2OYQ A;  4DRX B;  3QTC A;  4IGG A;  3OTF A;  4PA6 A;  3BEH A;  4HYO A;  5IJ9 A;  4W4L A;  3RYI B;  2OTL V;  1H8E G;  4FMT A;  2EIM C;  3CCV V;  1RP3 B;  4JI3 B;  5LXT B;  4AI8 A;  3JAW B;  1VAR A;  1M5I A;  3CHX A;  3CC7 V;  1K5S A;  4BR6 A;  5CB4 B;  3BPZ A;  3TXS A;  3SYP A;  3OM3 B;  1VMG A;  4H37 A;  2HJF C;  3OR6 C;  2ADQ B;  3JD3 A;  3AG2 C;  4PV1 B;  2K9P A;  2G38 A;  3UM7 A;  4O4J A;  3SR2 C;  4CS4 A;  2QTS A;  3ML0 A;  4YIO A;  3A8T A;  3OE7 G;  3OTO O;  3ABM C;  3K0G A;  2W6J G;  3T1Y B;  1FJG B;  1R6K A;  1S5J A;  5IYZ B;  1GO3 F;  1GK9 A;  5LMN B;  3ZRW A;  1OCO B;  1N4C A;  3IGA C;  1U97 A;  4LCU C;  2ZE7 A;  2DYR B;  4DV7 O;  1XNQ B;  4H0L B;  2PF4 E;  3L9D A;  3HKD B;  5LGU A;  4LWS B;  3H1K H;  4X1K B;  3X2Q C;  1H2N A;  4R7C A;  3BY6 A;  4ZHQ B;  4LF8 O;  3SJC C;  2HVJ C;  4IIJ A;  3RYH B;  4DR5 B;  4JAS A;  1NTK H;  5LL6 Y;  1Z5W A;  1GAX A;  5LHH A;  1DF4 A;  2Z0A A;  3UT5 A;  3TCU A;  3CCL V;  5L3G A;  5CA0 B;  2A7W A;  1W59 A;  4DUZ B;  4CS2 A;  1G6U A;  5LMU B;  3N2G A;  1OCR C;  5B1N A;  4GX5 A;  1P4R A;  3K59 A;  2ZNJ A;  2VQF B;  1YJ9 V;  2LGQ A;  1ROP A;  3A0H Z;  2ZD9 A;  4HAM A;  4YIP A;  2BTO A;  5KUK A;  3CJH B;  3ABL B;  4JF3 A;  3T4D A;  3E89 A;  2DWE C;  3THO A;  1TUB B;  5JQG A;  4F6R B;  3KKY A;  4LP8 A;  4JI1 B;  2LP7 A;  3G80 A;  1OCZ C;  5IE9 A;  4NTY A;  3ZBH A;  3AK3 A;  4J41 A;  5ITZ A;  4TUY A;  2WLM A;  2AGA A;  4LF9 O;  2ZM6 B;  3FD9 A;  5TIS Z;  3L74 H;  1J95 A;  1MZF A;  2UU9 O;  3WG7 C;  5JVD B;  5H6R A;  4EFE A;  3OMI B;  2B1I A;  4I55 B;  4L8J A;  4J7J A;  1ZWI C;  5LHI A;  1NTM H;  4DV0 B;  2M7W A;  1AJN A;  2RMK B;  3F5T A;  5K1X A;  4PI0 A;  4B08 A;  2UXN A;  3O65 A;  1IUR A;  2P06 A;  1KUQ A;  1S0V A;  1XIL A;  5CA3 A;  1SRY A;  3OT7 A;  4NXM O;  1WPX A;  1Y66 A;  2EIN C;  4X66 O;  2UUC B;  3A0R A;  2EIL B;  4X89 A;  4H33 A;  4LFA O;  5CA1 B;  4U7O A;  1MOF A;  1R6N A;  2RJZ A;  4YY3 O;  1I5Y A;  2GDS A;  4WFA V;  3JAT A;  5EBM C;  1QVF U;  4BW5 A;  2IBZ H;  2V7Q G;  3U10 A;  3QO7 A;  1U96 A;  4X65 B;  2BOC C;  4UCU A;  2IW5 A;  2ZE6 A;  2VRZ A;  1WP7 A;  4LNU B;  5DED A;  2ZIO A;  5FPO A;  1O9G A;  4H13 B;  5BY1 A;  1RPR A;  3ASN B;  4LC1 A;  1QLE B;  4F4L A;  3CPW U;  3FYI B;  3OUS A;  1S76 D;  4I4T B;  2JGD B;  3FYE B;  2ZT9 B;  3APQ A;  2AW9 A;  3C90 A;  2CTP A;  3UO3 A;  3MHS C;  1KYO F;  2BE3 A;  3H1L H;  1YSC A;  4TV9 A;  4JI3 O;  2DWD C;  1MSW D;  5FPR A;  3QF7 A;  2HJD A;  4GKK B;  4IHJ A;  3APO A;  4MTG A;  4RQE A;  2ZE5 A;  1SZX A;  4JYY A;  3AG1 B;  3LUT B;  2ARH A;  4B3S B;  3J80 N;  2Q68 A;  4O2A A;  3RVY A;  2VQE B;  3K9A A;  2PZS A;  3MDS A;  2QKA A;  3CMA V;  3E35 A;  3E8G A;  3SPC A;  3BVO A;  4PDL A;  2IJI A;  1EBO A;  1VQL V;  3T1Y O;  4DV1 B;  2MW2 B;  5LMN O;  1DTO A;  3LSS A;  1WJZ A;  1FXK B;  5B5E Z;  4X1Y B;  2ZKO A;  1XNR B;  1NBM G;  1VF7 A;  1WAZ A;  2E5L B;  4JYB A;  3SJQ C;  2IJJ A;  1M93 A;  1KD1 W;  1GMG A;  2X6C A;  1R3I C;  4ICG A;  5IWA B;  1TA8 A;  4N23 A;  4PDV A;  1EM1 A;  1Q5O A;  1JA8 A;  4YHH O;  4DR5 O;  1QQC A;  4DR4 B;  2CUG A;  3M99 B;  5B3S B;  4KHP B;  1UJW B;  1OJH A;  2CK3 G;  2Q69 A;  3ZHR A;  2EIJ C;  4UVB A;  2BSK A;  4QIW F;  4GYC B;  4QPK A;  4PI2 A;  1KB9 F;  2HHH B;  4FFK A;  4DUZ O;  2ZR2 A;  4EKW A;  1VQN V;  4R8C A;  2JJ2 G;  4YJ3 B;  2VQF O;  1XL6 A;  1BQ0 A;  1B04 A;  4WFE A;  4UB8 Z;  5B66 Z;  4LF6 B;  1PNM A;  2IH1 C;  2Q67 A;  1MG1 A;  4JI1 O;  1TGO A;  3O9O A;  3W7W A;  2GV9 A;  1XMO O;  4OPA A;  3ZCC A;  3GB7 C;  1MA1 A;  4YJ2 A;  2EUL A;  2CGN A;  1AI4 A;  3C3S A;  2GUZ B;  2YC0 A;  2ZM6 O;  3EFF K;  3CCQ V;  2CH7 B;  1NQT A;  1M56 C;  1YIJ V;  3CP1 A;  1BE3 H;  2Z3Y A;  3RT3 C;  3AK1 A;  4DV0 O;  1AR5 A;  2L35 A;  4E2L A;  2Q9L A;  1JVM A;  1TVK B;  1FAF A;  1VQK V;  4DV4 B;  4C7U A;  4AIL C;  3B09 A;  5LP6 C;  3CRM A;  5GON B;  3T4Z A;  1YCI A;  3RYF A;  3OMA B;  1F4M A;  2CGO A;  1YEW A;  1SET A;  4LFC B;  3ETD A;  1VP7 A;  3E8B A;  3ZS8 C;  2A3Q A;  4P9P A;  1IXM A;  2AXT Z;  4TV8 A;  2A79 B;  3GWO A;  2VWK A;  5H5N A;  1SKV A;  4X65 O;  1KC8 W;  1DGS A;  2ZXW C;  4U3J B;  4DV7 B;  1JPX A;  4J10 A;  1K92 A;  3B8N A;  1Y74 A;  2IU3 A;  4J7K A;  3RVZ A;  3JCU Z;  1B06 A;  3GVM A;  1GTO A;  2E3C A;  5JWP A;  1Y4M A;  2F43 G;  3E8F A;  4Z2W A;  3JAS B;  1AP5 A;  1SQV H;  2LFR A;  2QWP B;  3JAM N;  1PKX A;  1S72 V;  2P4V A;  1IBM O;  2Z5U A;  4GKK O;  3CX5 F;  2QA4 V;  3NR7 A;  3HKB B;  2EIK B;  3MD0 A;  4PEL A;  3DXR B;  1ORQ C;  5JCO C;  4ZI7 B;  4O4I A;  1Q7Y W;  1XBL A;  3ZIA G;  4IL6 Z;  3OR7 C;  1IDS A;  3P32 A;  4KXR A;  4B3S O;  2D2C B;  2VQE O;  4JV5 B;  3AG3 B;  4AHC A;  3TET A;  1EN4 A;  2CDY A;  1PL0 A;  4GT1 A;  4XDJ A;  3LNN A;  2WLI B;  1EZV H;  1N0N A;  3K79 A;  3AG7 A;  1VQ7 V;  4CH6 A;  5KAI Z;  3JAK B;  1XI1 A;  4XDL A;  1IBL B;  3WU2 Z;  2YXL A;  4FM1 A;  3CWB H;  4B3T B;  1SC5 B;  3G6B A;  3KZI Z;  2Q8V A;  1SA0 A;  1OCO C;  1R3J C;  3ZRX A;  3B8M A;  1XNR O;  4ABM A;  4UVC A;  4X1I A;  3RWR D;  2E5L O;  2X6A A;  1PL4 A;  2DYR C;  3K06 A;  1AJQ A;  3RN4 A;  3K0D A;  2LFS A;  4FZ0 A;  2KG7 A;  1JJ2 U;  4LR3 A;  1WA8 B;  5IWA O;  1HP8 A;  3D36 A;  1XMQ B;  4DR4 O;  4UCR A;  2Q0O C;  4CS3 A;  4J11 A;  1YXB A;  1B6Q A;  4O4H A;  1QVG U;  5LGN A;  3L75 H;  5DM6 V;  1R73 A;  4I9W A;  4FPP A;  2YI9 A;  1FFX A;  2KKW A;  2XUM A;  2HHH O;  5L3F A;  4DR6 B;  5KHJ A;  1VQP V;  2ATK C;  2W0X A;  1V54 B;  3SJB C;  1VQM V;  3JD1 A;  3SYQ A;  2P6J A;  1XDC A;  1YDX A;  3VQV A;  1CP9 A;  4JI7 B;  4K8X A;  4NYK A;  2W6I G;  3HKE A;  5IJ9 B;  1BQZ A;  4HBN A;  3P3P A;  2JVD A;  4LF6 O;  2FKX A;  1BCC H;  5FLX N;  1P7G A;  3E22 B;  4O2B A;  4FM2 A;  3ABL C;  3ABU A;  4Q20 A;  3JAL A;  3CCS V;  5CBH A;  4QE7 A;  3H1I H;  4I50 A;  1CEZ A;  5JJJ B;  2OCC B;  1NR1 A;  3L72 H;  2PGG A;  3QO8 A;  1COW G;  1FD9 A;  2H8P C;  4DR3 B;  3OEE G;  3K58 A;  1PV0 A;  2M6Y A;  4O4J B;  4JI5 B;  2QKS A;  4G2K A;  1XHZ A;  4IYH A;  2PYL A;  2FYU H;  4DYL A;  2YEV A;  3TJT A;  3FAV A;  2OIE A;  3HR0 A;  1ZL8 B;  2V1D A;  5DEC A;  3ZRW B;  4DV4 O;  4W4K A;  1VQ6 V;  1Q86 W;  4Z1V A;  2Q7G A;  3CSX A;  5C8Y B;  2PY5 A;  3SYO A;  3DSQ A;  4LFC O;  2EIL C;  4NVP A;  1Y76 A;  2IU0 A;  5L3E A;  1V9P A;  3RYI A;  1E1R G;  4JPR A;  4NKG B;  1FYJ A;  5GTI Z;  1FXH A;  4D6T H;  2V4D A;  5LXT A;  3AK2 A;  1WLE A;  1JCH A;  5JCO A;  2R9I A;  1IZ3 A;  3CXH F;  2ITC C;  4TQF A;  3I5D A;  1SQG A;  1Q90 D;  2YIA A;  2R9R B;  1Q8I A;  1URF A;  1GN4 A;  2OCH A;  1H2L A;  3ASN C;  2PYJ A;  1QLE C;  4J9Y B;  3N2G B;  4YHH B;  4JI4 B;  2N74 A;  4JAV A;  2LW1 A;  4EB6 A;  1KU9 A;  1SQF A;  3FB8 C;  4GLX A;  3VQY A;  5IT9 N;  4I9Q A;  1NU1 H;  4LH6 A;  3ZHV A;  4WFH A;  5IYZ A;  2YI8 A;  2CTR A;  4AQY B;  3ZX6 A;  1NH2 D;  3F7V C;  4G28 B;  5KMG B;  2A9H A;  5KX5 B;  2F4V B;  4HZ3 A;  4TWK A;  4UV8 A;  1IXB A;  2QM7 A;  4DW0 A;  1DF5 A;  3AG1 C;  3BAA A;  4JV5 O;  5EBW C;  5ITZ B;  4PD4 F;  1QCE A;  4LWS A;  4JI6 B;  1QU7 A;  3WB1 A;  1K73 W;  1Y67 A;  2JIZ G;  4LF7 B;  3CCR V;  2EZO A;  5EIB D;  4PDM A;  1SQB H;  3FX7 A;  4XBF A;  1IBL O;  3RYH A;  3ZMS A;  4GKJ B;  1N8R W;  4B3T O;  2GTA A;  2MK3 A;  1R6T A;  1XMO B;  1VF6 C;  4JI0 O;  1T5E A;  1FXK C;  1XUQ A;  3N2K B;  3U11 A;  5CA0 A;  4JAA A;  1GKF A;  1SES A;  1WP8 A;  1W0J G;  5EIB C;  4UB6 Z;  1XMQ O;  1MNG A;  1Q82 W;  2XTA A;  3RW0 A;  4PA3 A;  2CAZ C;  2HP8 A;  2CTQ A;  3JAT B;  5B3S C;  4JI2 O;  3LNM B;  3CME V;  4F6R A;  4DV3 O;  2LGW A;  4DR6 O;  2KQX A;  4NTX A;  3SDL A;  4WFG A;  3ZHQ A;  1W2B U;  3BCC H;  1GM7 A;  4JI7 O;  4GX0 A;  2DYS B;  3K5O A;  1NR7 A;  5L3B A;  2WLL A;  3RFR A;  5EZY A;  3WFV A; 
#chains in the Genus database with same CATH homology
 3HB3 B;  1M57 B;  1XL6 A;  4MTF A;  4GX2 A;  1M57 C;  4WFF A;  1R3L C;  3VOU A;  3ZMV A;  2QTO A;  4WFE A;  4RUE A;  4FIP C;  4MW8 A;  5CBF A;  2P67 A;  3AG4 B;  1RM1 B;  1PNM A;  2IH1 C;  2Q67 A;  2WWW A;  3AG4 C;  1RM1 C;  5CMU A;  1MG1 A;  2XND G;  2YSU B;  1KKD A;  1S3J A;  4FK5 C;  3CCE V;  4KUM A;  1K3E A;  2W0F C;  3CCM V;  1AI5 A;  1EZJ A;  4MTX A;  4WF9 V;  4ASU G;  4BIU A;  3W7W A;  4DO2 A;  4MVR A;  3ZCC A;  2HR3 A;  3GB7 C;  2QEX V;  2OTJ V;  4LBE C;  3K04 A;  5HFL A;  1AI4 A;  1BL8 A;  4KFM A;  3STZ C;  3SPI A;  5IY5 B;  2ZQM A;  5BZB A;  1M56 B;  1K4D C;  1K7D A;  1MAB G;  3EFF K;  4MS2 A;  3EHB B;  3D3I A;  1G4Y B;  1NQT A;  1M56 C;  4QE9 A;  3ZMZ A;  5IY5 C;  2UXX A;  2HG5 C;  1H38 A;  5H6Q A;  2X7R B;  1AJP A;  5J9P C;  1YIJ V;  3CP1 A;  2DW4 A;  1KQS U;  3LDC A;  2Z3Y A;  2ZR3 A;  1K34 A;  3K03 A;  4R6Z A;  4U7N A;  3UKM A;  4E2L A;  1F4N A;  3W7U A;  2Y48 A;  1JVM A;  3K3W A;  5B1A B;  2JEX A;  4RAI A;  5KA5 A;  3CCQ V;  1NKD A;  1VQK V;  2WPD G;  5B1A C;  4RO2 A;  2KB1 A;  3LDE A;  4P30 A;  3T4Z A;  2QM8 A;  2PI5 A;  3T2M A;  3OMA B;  1F4M A;  1QLN A;  3JD0 A;  1YJW V;  3OFN G;  3CYO A;  3CC4 V;  1SET A;  3ASO B;  1OCC B;  3NXS A;  1NH2 B;  3ETD A;  1RPO A;  3ASO C;  1OCC C;  3E8B A;  3JD2 A;  5LGT A;  2Y69 B;  2YEV B;  4P9P A;  1H2G A;  1IXM A;  2Y69 C;  3MHH C;  2A79 B;  4Z1M G;  4X8A A;  5CBG A;  3GWO A;  4MVO A;  1R3K C;  2WLJ A;  4P2Z A;  2Q6A A;  2DQ0 A;  1HWY A;  3VBB A;  3FB7 C;  2ZXW B;  2ZDI A;  1KC8 W;  3SPG A;  2HVK C;  1XL4 A;  2ZXW C;  5H9C A;  3STL C;  2X0L A;  3OMN B;  3K08 A;  4ZBM A;  1OZ0 A;  1JPX A;  1CPY A;  1K92 A;  3B8N A;  1NJI W;  2IU3 A;  1VQ9 V;  1NVP B;  3W7X A;  4PA6 A;  3RVZ A;  1KP2 A;  3BEH A;  4HYO A;  1VQ5 V;  1GTO A;  2X6B A;  2OTL V;  1Y4M A;  3OEH G;  2F43 G;  3PJS K;  2EIM B;  1I5X A;  1H8E G;  2GSM B;  4FMT A;  2WLL B;  3E8F A;  2EIM C;  3CCV V;  1YTF D;  4P9O A;  2LFR A;  4OXS A;  1PKX A;  1S72 V;  1LNQ A;  2D3O W;  2Z5U A;  4UV9 A;  3ZRV A;  2JEU A;  2XAS A;  3W7S A;  2QA4 V;  1DLB A;  3IFX A;  2EIK B;  3MD0 A;  4PEL A;  3LDD A;  1ORQ C;  2EIK C;  3CC7 V;  1K5S A;  2EZP A;  4GX1 A;  1Q7Y W;  1FXK A;  3SYP A;  3SYA A;  3OM3 B;  3ZIA G;  4ZKI A;  4H37 A;  2HJF C;  3OR6 C;  3OR7 C;  3P32 A;  4PDR A;  3ZMU A;  3G71 V;  3ABK B;  1YTF B;  3AG2 B;  3HPL C;  2EJR A;  3ABK C;  3JD3 A;  3AG3 B;  3E83 A;  3AG2 C;  3TET A;  4DXW A;  3AG3 C;  3UM7 A;  1PL0 A;  4GT1 A;  5B1O A;  1BMF G;  2ITD C;  3ML0 A;  4XDJ A;  2WLI B;  3ABM B;  2IH3 C;  3OE7 G;  3ZN1 A;  3K79 A;  3ABM C;  3K0G A;  1TUE B;  1VQ7 V;  3W7T A;  2W6J G;  1R6K A;  3JD4 A;  4XDL A;  1GO3 F;  1GK9 A;  3E2E A;  5LHG A;  1VQO V;  5GW7 A;  4YXW G;  3ZRW A;  3R65 A;  3DTU B;  1OCO B;  4MVZ A;  1E79 G;  1OCO C;  1R3J C;  2JK5 C;  3IGA C;  4LCU C;  3B8M A;  1SZT A;  3ZRX A;  4MVM A;  5IYC O;  3RBZ A;  2DYR B;  4UVC A;  1SER A;  2X6A A;  2DYR C;  2HLD G;  3K06 A;  1THZ A;  5LGU A;  1FXV A;  1AJQ A;  3X2Q B;  1F51 A;  3K0D A;  1M90 W;  3X2Q C;  3OW2 U;  1BHA A;  2LFS A;  4R7C A;  5B1B B;  3BY6 A;  4CZZ A;  5B1B C;  1GM9 A;  1JJ2 U;  4WFB V;  1FFT B;  4JTC B;  5C93 A;  3D36 A;  4MSW C;  2AHZ A;  3I55 V;  2HVJ C;  1F23 A;  4JAS A;  4MT8 A;  2FTK A;  1S77 D;  5LHH A;  1DF4 A;  2BOB C;  3ETG A;  1L1F A;  1B6Q A;  1QVG U;  5LBQ A;  5LGN A;  3ZRS A;  1Q81 W;  4JTA B;  3TCU A;  5IYD O;  3CCL V;  1G8M A;  1R73 A;  5DM6 V;  1BHB A;  4I9W A;  4FPP A;  2OT5 A;  2ZDI C;  2HFE C;  3F5W C;  5L3G A;  1ENV A;  5L3F A;  1VQP V;  3H01 A;  2ATK C;  3B77 A;  1V54 B;  2B5U A;  1V54 C;  3FB6 C;  5DN6 G;  1OCR B;  1VQM V;  3JD1 A;  4UVA A;  3SYQ A;  1OCR C;  2P6J A;  4MW3 A;  5B1N A;  1CP9 A;  4GX5 A;  1P4R A;  2W6I G;  3ZN0 A;  4RQF A;  1YJ9 V;  2XAF A;  1ROP A;  2ZD9 A;  4HAM A;  5KUK A;  1K4C C;  3ABL B;  2XAH A;  4JF3 A;  3ABL C;  3ABU A;  4N21 A;  4Q20 A;  3CD6 V;  2C2A A;  3T4D A;  3CCS V;  3E89 A;  4XDK A;  2DWE C;  2HKO A;  1KEC A;  1PNK A;  2H94 A;  4GCZ A;  1M9N A;  4JAU A;  5CBH A;  4QE7 A;  1P7B A;  4LP8 A;  1OCZ B;  2LP7 A;  2WLN A;  3FKS G;  4JTD B;  3CC2 V;  1CEZ A;  1OCZ C;  2B1G A;  1V55 B;  2OCC B;  1NR1 A;  1V55 C;  2OCC C;  2JDI G;  3QO8 A;  2XAQ A;  2JJ1 G;  1COW G;  1VQ4 V;  1AR1 B;  2WLM A;  5HFM A;  2H8P C;  3OEE G;  1YHQ V;  1AI7 A;  3WG7 B;  1J95 A;  4CBC A;  2QKS A;  4G2K A;  3WG7 C;  4MVQ A;  3E86 A;  5H6R A;  3OMI B;  2B1I A;  2YEV A;  3G4S V;  1K97 A;  1YJN V;  1ZWI C;  4PA9 A;  5LHI A;  1KP3 A;  4MVS A;  2M7W A;  3G6E V;  1AJN A;  1JX9 A;  2V1D A;  3ZRW B;  2UXN A;  3ZMT A;  1K9M W;  1VQ6 V;  4KP4 A;  1S0V A;  1Q86 W;  5CA3 A;  3IC7 A;  1SRY A;  1K5Q A;  4FJC C;  1FS0 G;  2EIN B;  1WPX A;  4BAY A;  1Y66 A;  4QJF B;  5L3C A;  2EIN C;  4MVU A;  1JQ0 A;  2EIL B;  3A0R A;  4X89 A;  3SYO A;  2XAJ A;  1OHH G;  1QR9 A;  2EIL C;  3ETE A;  4H33 A;  1GM8 A;  4I5S A;  4U7O A;  2A0L A;  2IU0 A;  1YI2 V;  2IJH A;  5L3E A;  1MOF A;  1E1R G;  1R6N A;  4JPR A;  1I5Y A;  2WLH A;  2QE7 G;  4WFA V;  5EBM C;  1QVF U;  3OGC C;  4BW5 A;  2V7Q G;  1FXH A;  1ARO P;  3QO7 A;  3JCZ A;  3DGE A;  2BOC C;  1WLE A;  1JCH A;  2IJK A;  2IW5 A;  5EC1 C;  2R9I A;  3F7Y C;  1PNL A;  2ITC C;  5EK0 A;  3I56 V;  4J9Z B;  2NLJ C;  4MTO A;  1RPR A;  2R9R B;  4UXN A;  3ASN B;  4LC1 A;  1QLE B;  4RUF A;  4F4L A;  3FYI B;  3CPW U;  2P90 A;  3ASN C;  3OUS A;  1M1K W;  1QLE C;  3OUF A;  1S76 D;  5FL7 G;  3FYE B;  4J9Y B;  2K1E A;  4JAV A;  2NNU A;  3FB8 C;  3MHS C;  1S5H C;  1YSC A;  3KG2 A;  2WLI A;  2DWD C;  4X88 A;  1MSW D;  3T1C A;  4WFH A;  5IYB O;  3AEI A;  3E8H A;  5IDJ A;  1NH2 D;  3F7V C;  4G28 B;  5EC2 C;  2A9H A;  4MTG A;  3ABT A;  4JGS A;  4RQE A;  4HZ3 A;  2XAG A;  1QR8 A;  2PI4 A;  1W0K G;  4TWK A;  4UV8 A;  2QM7 A;  3LSQ A;  3AG1 B;  3LUT B;  2GHY A;  1DF5 A;  3AG1 C;  3JYC A;  4TT3 G;  5EBW C;  4QPJ A;  1QCE A;  2Q68 A;  3RVY A;  3CXC U;  3K9A A;  1YIT V;  3P30 A;  1K73 W;  3CMA V;  4QNH B;  2JIZ G;  3E35 A;  3E8G A;  3SPC A;  1VQ8 V;  1K33 A;  4PDL A;  1E1Q G;  2IJI A;  1EBO A;  1PD3 A;  2EZO A;  2WSS G;  3CCR V;  1VQL V;  1AI6 A;  4PDM A;  5E1A C;  4XBF A;  1NVP D;  3ZMS A;  2AHY A;  1N8R W;  1DTO A;  3LSS A;  2MK3 A;  4R50 A;  1FXK B;  3OAA G;  2XOK G;  1FXK C;  1H8H G;  1EFR G;  1NBM G;  5CN0 A;  4L87 A;  3FB5 C;  1GKF A;  2EBO A;  4JYB A;  4JYC A;  3TK1 A;  3SJQ C;  2WAM A;  1SES A;  2DQ3 A;  2IJJ A;  1JOY A;  1W0J G;  1KD1 W;  3SYC A;  1GMG A;  2X6C A;  3CCJ V;  4BIZ A;  1R3I C;  1QBZ A;  4PA4 A;  3ZJZ A;  4PDV A;  4N23 A;  1Q82 W;  2P7T C;  3RW0 A;  3M99 B;  4G27 B;  5L3D A;  4PA3 A;  3SPJ A;  3QO5 A;  5B3S B;  1UJW B;  5B3S C;  1K8A W;  2CK3 G;  2WLK A;  2Q69 A;  4WCE V;  3LNM B;  2EIJ B;  3CME V;  2EIJ C;  4UVB A;  5EBL C;  4QIW F;  4QPK A;  4UUJ C;  4WFG A;  4PA7 A;  2ZR2 A;  4EKW A;  1W2B U;  3CCU V;  3QNE A;  4TSF G;  3SPH A;  1VQN V;  4R8C A;  1GM7 A;  4GX0 A;  2DYS B;  5KA6 A;  1NR7 A;  5KUM A;  2JJ2 G;  5L3B A;  2WLL A;  2DYS C;  3WFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...