2YSUB

Structure of the complex between btub and colicin e2 receptor binding domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
b'RNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vitamin B12 transporter btuB
publication title Structure of the complex of the colicin E2 R-domain and its BtuB receptor. The outer membrane colicin translocon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/hydrolase
total genus 47
structure length 123
sequence length 123
ec nomenclature ec 3.1.-.-:
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ysuB00
1UJWB 2YSUB 1JCHA 2B5UA
chains in the Genus database with same CATH superfamily
2VWJA 1HNXO 5KUMA 4DXWA 2YS8A 4J7KA 2YI8A 1R3LC 4MS2A 3UCSC 3IFXA 5KHIA 4B7KA 3IAYA 2KG7B 2Q7HA 4MTOA 2ZXWB 2BSKB 3LDDA 3QO7A 3B40A 3BA8A 5B1AB 1IBLO 3K0DA 1TA8A 4XBFA 1QR9A 2M7WA 2F93B 1QNMA 1Y76A 1Y66A 4DV2O 3N2GB 1VIBA 4KHPO 3A0HZ 2WA4A 4BIUA 3ETQA 2ZM6B 3CS5A 1VQ4V 3AG4B 3OEHG 2F4VO 3ABKC 2EBOA 4ZHQA 5KUKA 2DJVA 1M57B 1MZEA 5CA1A 3ZMZA 5K1XA 3UT5B 1EN6A 1ENVA 3D8CA 3DC5A 3BPZA 4LF5O 2ZKOA 1SQXH 4XDJA 1JJOA 1ZX3A 3JYCA 5IY5C 4X66B 4X1KA 1SESA 2QE7G 1KC8W 2OWOA 1XMQO 4AQYB 3SYOA 2W6JG 2EILC 4DR2B 4AHCA 4YHHB 2YICA 3AG1B 1SQPH 4J10A 2A06H 5JCOA 1QVGU 1K4CC 4YY3B 3DC6A 2ZD9A 2HR3A 1R73A 5LP6B 3SPIA 3JCUZ 1HNWB 4IYHA 3E89A 4J42A 4DW1A 1GH6A 4UVCA 3I5DA 1OZ0A 5IWAB 2PZSA 3D36A 4O4LA 3OGIB 1FXHA 1QLEB 4DW0A 5KHKA 2IJIA 4U3FH 5HFLA 3E86A 4B3TB 1X59A 1V54B 1BSMA 2Y4TA 3ZEDA 1BQ0A 3LUTB 3H1KH 1X4TA 3K5NA 4LF9B 5JH7A 4DO2A 3H01A 5LXTB 2JK5C 1IZ3A 4FK5C 5H6RA 1PD3A 2VQFO 1MSDA 1L0NH 4G2KA 4IHJB 3STLC 4DV0O 2IW5A 4GUNA 5LMUB 2FMLA 2HG5C 2XAQA 3KCYA 3RT3C 4OX9O 5B3SC 1S76D 2LQTA 2QJ1A 3U0ZA 3CCEV 5EIBC 4NXNO 2WLHA 4YJ3B 1VQ7V 1NI8A 2PYJA 5EIBD 2Q0OC 3B8NA 3ZMSA 4X20A 4X64O 1WA8A 5KA5A 4PI2A 3L75H 1TVKB 4I55B 4Z2WA 3CX5F 4DR7B 4IL6Z 4HYOA 2GTAA 5IYCO 4PI0A 1W2BU 4LF6O 3G4SV 3ZCCA 1YJWV 1LUWA 4I5SA 5ITZB 3M7MX 4BR6A 5LMNB 1N32B 1NBMG 3ZMTA 4J9ZB 5L3BA 4F6RA 1N34B 1VF5B 5CBHA 5IDJA 5IJ0A 3JATA 1ORQC 3CCUV 4ZI7B 2DWDC 3P32A 2W0FC 3UQ8A 1EFRG 1K5QA 1UJWB 3BAAA 4DR3O 1I7FA 2AHYA 4FLVA 1NTZH 4ABMA 2QR4A 2Q68A 1OCRC 1K73W 2ARHA 5B1OA 5JVDB 1JVMA 4FM1A 4X9QA 3ZHRA 4LWSA 3VQWA 1WLEA 1AILA 2ADQB 2GTSA 3JASA 5JWPA 4NVPA 3X2QB 4FLYA 3P3PA 1B6QA 1FXKC 2PI5A 2XAGA 1K9MW 2EINC 4PA9A 3HKCA 1P4RA 3SYPA 1JFFB 5IJ9A 3ZMUA 2DE0X 4EB6B 5KMGB 2PUSA 1IBMO 3QNEA 3SJBC 4B3MB 4CZZA 2RQ6A 3AK3A 4GKKO 5J2UA 1Y74B 3SJAC 4GKJB 5IYZB 3FB8C 3G67A 1YTFB 5KX5B 5GTHZ 1T5EA 2E74B 2AZ2A 2AW9A 1D5AA 2BOCC 4RWUA 4DV6B 4MVUA 2EJRA 1FJGB 4K0KB 1I94O 1G8MA 1YI2V 3HKDB 4PJ0Z 1VQMV 4BAYA 4DV1O 3ICXA 3F5TA 1K7DA 1Q6IA 1RSOA 4UCTA 3R66A 5LGTA 2N04A 3NXSA 2RNBA 4GX1A 4D6TH 3T1YB 4ZIBA 1Z5VA 1A32A 1OCOC 1YEWA 2QEXV 2YEVA 5EYPA 1M1KW 4YXWG 2HJDA 1H2GA 3T4ZA 1L0LH 2LW7A 4TQDA 4DRXB 4HZ3A 4LFAB 1YITV 4DV7B 4NTXA 2ATKC 3SR2C 4LF4B 1XMOO 2JS5A 4DR1O 4JAVA 4QNHB 5LHIA 2RDCA 4TV9B 2UUAO 3K79A 1QR8A 4ZBMA 4AI8A 4N23A 1F4NA 1M57C 2LP7A 4JTCB 1PKXA 2RJZA 4LF7O 4I7ZB 3BFRA 4ZKIA 1VARA 1Z5WA 1AI6A 2P6JA 4EKWA 1HP8A 3IGAC 2ZE7A 4JI3O 3K06A 4FPPA 4JI6O 2Q73A 4C7UA 2ZIOA 3OTOB 4NXMB 3AG1C 3BY6A 1ZSPA 2QGNA 2E3CA 4P30A 4PHZA 4MTFA 4JI8B 2LGWA 4O4HB 2F23A 2O57A 3FAVA 4GT1A 5EBLC 5KAIZ 4U3JB 3AG3C 5LP6C 3K08A 4NR1A 4P9OA 4TOIA 2NLJC 2EIJB 3CC7V 2WLKA 2UU9B 3ZMVA 3O9OA 3E22B 1YIJV 4MW8A 2YC0A 3ETDA 1H2MA 3KKYA 1O9HA 4YIPA 2YXHA 4X8AA 3E8GA 4B08A 1SQBH 3N2KA 1W0JG 4JYBA 3ABLC 1TAEA 2CH7A 2CTQA 2ZR3A 4MVRA 4G28B 4JI7O 1E79G 4BIZA 3CC2V 5L3CA 1M93A 5GONA 2E5LB 3G71V 1K3EA 5CA0B 2BTQB 2DYSB 4B3RB 4PDMA 5DECA 4X1YA 1XL6A 3JAWB 4DK1A 4K8XA 2C2AA 4J11A 4PA4A 2EX3A 4I0XA 4O2AA 3C3TA 1IBKB 1M56B 1RPRA 1YJ9V 4NYKA 1PNKA 1ZTEA 4DR5B 4PA3A 5LBQA 1DK1A 5FPRA 1VQOV 3QTCA 1N0NA 3CRQA 1BZKA 1QVFU 2WSSG 4LP8A 1OJHA 4IIJB 5BMVA 1KB9F 2R70A 3OR7C 2ZQMA 3CD6V 5C93A 3OM3B 3K03A 4JI0B 4DV4B 2WAMA 5F2VO 2A7WA 4DV3B 2P22C 4QE9A 4CH6A 2Q5ZA 4LNUB 3N2GA 1AR4A 3RVYA 5GW7A 1R6KA 1SC5B 1B06A 5D5QA 2QKCA 3CE2A 1L1FA 4BWAA 1DF5A 1K33A 2YXYA 2CE4A 2OT5A 5LA6B 1YCIA 3AK2A 1XHZA 4B7EA 3T1HO 4CH3A 1OCCC 4KL1A 2LGQA 4DUYB 2PY5A 4J9YB 2K1EA 1YZBA 1F23A 3K3WA 2JDIG 2H8PC 1OCZB 1ROPA 3OT7A 4LFBB 3CRRA 3T2MA 2YUAA 1WP7A 4AQYO 5CMUA 3MHSC 2CTRA 2FKXA 4NTYA 2OIGA 1K8AW 3GWKC 1J5EB 2WLMA 1HNZB 4D7SA 4YY3O 4DR6B 2UUCB 1FXVA 3CCSV 1HNWO 1AP5A 3CCJV 1BHAA 4JASA 1XEQA 1W0KG 2Q67A 2Y48A 5LP6A 1NH2D 3LDEA 2B1IA 4WFGA 1F4MA 3CRCA 1JOYA 1AVMA 3UO3A 4QIWF 4CS3A 2P5OA 3HKBB 1R3IC 2ZINA 1VP7A 4B3TO 4UV8A 3ZN0A 2N05A 3J80N 2MK3A 5DM6V 3I56V 2W6IG 4MVOA 1I5YA 1I08A 3S3WA 2UXNA 1XDCA 4PD4F 3AEIA 3PJSK 5L3FA 4UUJC 1SETA 5LXTA 2UXBB 2WLIA 3LNNA 2BE3A 3SGIA 1AJNA 5CB4B 2IBZH 2RMKB 2EULA 1GMGA 4X1IB 3LSQA 4LFCO 2UXDO 3FB7C 3K57A 3G6EV 4JV5B 1L8DA 3J7AU 2YIBD 2WWWA 3RYCA 4AILC 1HR0B 4YJ3A 1FFXB 4MTGA 4MTXA 1BQZA 1LR1A 4LH7A 3SPJA 4DR4B 3LSUA 4DR7O 3FYEB 1NS1A 4CC5A 1TVKA 2R9RB 3ZRSA 3RW0A 3HKEB 3WG7C 1HWYA 2MW2B 4O4IB 1GM9A 3ABMC 4JTDB 5LMNO 2QM8A 1AB3A 3JALB 3EVKA 1N34O 4MW3A 1SS3A 4JI2B 3ASOB 4E2LA 4R50A 5BZBA 2W0XA 3JSLA 5H2FZ 4U7NA 5L3DA 1TGOA 5B5EZ 2ZT9B 1QBZA 4A5UB 2QDOA 5FNVB 5J2TB 5IYBO 1P84F 4FFBB 1COWG 5JVDA 3RYFB 3CMEV 1DF4A 1NJIW 3ZN1A 1DTOA 2QA4V 2DMXA 1KP2A 2YXLA 5B1BC 1Y6XA 3CCVV 1CP9A 2XTAA 2VS0A 1P7GA 4X89A 3CP1A 4BW9A 2OYQA 2ODMA 1WPXA 3QG5A 4JYAB 5C8YB 2V1DA 4FZ0A 2OCCC 3ABTA 4J80A 4WFAV 1N33B 4GX2A 4EB6A 5BR8O 5BXZA 3JD0A 1Y74A 4P2ZA 3I55V 5E1AC 5GTIZ 2XT9A 5IYZA 4DV6O 4LBEC 5KX5A 2EIKC 4CC6A 4K0KO 2H94A 4FLXA 3JCZA 1XILA 2A3QA 2GSMB 2DYSC 3VQXA 2JVDA 3CYOA 4JAAA 3B4SA 1HNXB 3HKDA 1VF7A 2YIAA 1WPBA 3CC4V 3TXQA 2XAFA 3T1YO 2YIBA 1KECA 1GN4A 1PM9A 2PYLA 2HP8A 4JI1B 2HVKC 4U7OA 3RBZA 3JD2A 4L8JA 3WB2A 3OUSA 1NTMH 1GN2A 4UCUA 3BEHA 1Y76B 1XUQA 3E8FA 4OXSA 1SA0A 2FYUH 4MSWC 5H5NA 4LFAO 1D5NA 2P90A 2Q9LA 4HBNA 1Y67A 1FKAO 3CEIA 4GZRB 3OMNB 3DXRA 2DYRB 1WN7A 3B8MA 2Y0PA 3IC7A 5KHJA 2Y4UA 2HFEC 3CXCU 2FTKA 3OUFA 4JTAB 3RGBA 2IH3C 4MVQA 3JD4A 2E76B 2NN4A 4X1KB 5DEDA 1SF9A 3A8TA 4F4LA 2ETNA 3JAKA 4JYYA 3KZIZ 1E1RG 3ML0A 3OMIB 3TK1A 1ZL8B 4B3SO 3P3NA 3OTOO 2IJJA 1BGYH 5BY1A 1IXMA 2EIMC 3W7SA 1D2DA 3EHBB 2UUBB 3K0GA 4JI8O 4UVBA 1NR1A 3FX7A 3TCUA 2Q6AA 5EZYA 3BRCA 5HFMA 2VQEO 1UPGA 1DLBA 4U3JA 3ZHQA 2UU9O 3E83A 4WFFA 3K5OA 3QVNA 4PDLA 1ZUQA 3E22A 5LYJB 4QJFB 3CWBH 2HVJC 1VQKV 1IX9A 1JQ0A 4WCEV 4PA7A 3EFFK 1JCHA 2E5LO 1RM1B 3AG2B 2QSAA 1Q90D 1TUBA 1VQ6V 1HDJA 3CPWU 4B3RO 4ASUG 1NQTA 5CA0A 2BTQA 1Z2GA 3M99B 1BE3H 1JJ2U 1IBKO 1PP9H 1XNQB 3D3QA 3JAWA 1FPOA 4Z1MG 5KA6A 4DR5O 5FPOA 4L87A 3ASNB 2ZXWC 4NXNB 1Q6UA 4EFEA 4RO2A 1WA8B 1GAXA 5B1AC 1FFTB 4WBNB 3ZRXA 1S5HC 4PDVA 4RQEA 2GHYA 1H8EG 5D5PA 3M8AA 3G6BA 3IC9A 3APQA 3MDSA 3E8BA 3K9AA 4ZOLA 4IIJA 2CUGA 1Q7YW 3AG4C 4JI0O 3E8HA 1S3JA 3H1JH 1LUVA 3RYIA 3UKMA 1JA8A 4FJCC 3QF7A 2XAHA 4F6RB 3OE7G 3ABKB 2CGOA 1Q86W 3SJQC 3RVZA 1AJQA 3JATB 2HKOA 4LNUA 4XDKA 3SJCC 2L35A 1KMIZ 3TXSA 2BOBC 1WB7A 5IY5B 3F5WC 4D7TA 1XNRB 5LGUA 1SZTA 4FMTA 1BT8A 3MD0A 4JI5B 3L70H 5LHGA 4LFBO 5IT9N 2ZIMA 4TSFG 4J41A 3SYAA 4LWSB 2EILB 2ZE8A 3JSNA 4LH6A 4PDRA 1GN3A 1BHBA 5JQGB 1HNZO 3CXHF 1KU9A 1LNQA 2UUCO 3SPHA 4FLWA 3MAQA 5LL6Y 4OPAA 1QLEC 3HKCB 3O65A 4XDLA 3MHHC 2Y69B 3KCXA 5IJ9B 4X88A 2X0LA 1VQ5V 2UXCO 2P4KA 4FVMA 3HPLC 3OFNG 4IT5A 2QWRB 1VQPV 1V54C 3JAMN 3RYHA 2YSUB 1XBLA 3EXAA 4YJ2B 1TUEB 1US6A 1PPJH 2Z0AA 4UCVA 1NU1H 1PV0A 1GTOA 1K5SA 3FKSG 1JR9A 1H2LA 4FFKA 1I0HA 4QGPA 3CMAV 1YJNV 1MNGA 3J81N 1RP3B 2YIDA 4FM2A 1GRJA 1NKDA 3ZIAG 2XOKG 1H2NA 1GKFA 1HW7A 4RUEA 1YHQV 5B3SB 1Q43A 1QQCA 2DW4A 3ZS8C 2X6CA 3ETEA 2A0LA 3OR6C 2GV9A 4X1IA 3VQVA 2YDEA 3D3IA 4JV5O 4EFBA 2KG7A 2R9IA 3OD4A 4Q20A 2BSKA 2Q7GA 1SRYA 4DR4O 2ZM6O 4X62B 2Q69A 1FFXA 1FD9A 1FS0G 1JPXA 4UXNA 1I5XA 3JARB 3LSSA 2G38A 1WAZA 1VF6C 3FFQA 4H33A 1R3JC 4DUZB 5EC2C 4QPKA 4HAMA 4BIOA 2CK3G 1AI4A 3HKEA 1B3QA 3DGEA 4TV8B 2Q7EA 4JF3A 1XMOB 4O4IA 1S77D 2DYRC 3VQYA 3UT5A 1XL4A 2CDYA 4QPJA 4X66O 1M4UA 3JALA 2DN9A 3ZBHA 4LF7B 3OW2U 4UFZA 5LOVB 4KXRA 4H37A 1VQLV 3QO8A 1W59A 2N74A 4DR2O 1OCRB 4YHHO 2L6LA 4J7JA 4O4JB 2QKAA 4JI3B 4JZGA 3L73H 2JGUA 5IYDO 4UCRA 2AHZA 1H2KA 2ZDIA 5FNVA 5EBMC 4H13B 4PA6A 4FFBA 3QO5A 3X2QC 1AI7A 3RYFA 4I50B 5IWAO 4JI4B 4TUYB 4KP4A 1FXKB 3CSXA 3AG7A 1YVWA 1G1XB 2WLLB 5LHHA 1UFIA 5EBWC 4X65B 5A9GA 4JPRA 1IDSA 2ZCEA 1N33O 3ZHUA 1XREA 5CBGA 5C8YA 1ZWIC 4LF9O 3A0RA 2PF4E 3JD3A 1WB8A 2QWQB 2CH7B 2AXTZ 2AGAA 1YTFD 3C3SA 4CS4A 2QWOB 1SKVA 1U97A 5FL7G 2V7QG 4NTWA 1GM7A 3ZHTA 3B2EE 1CPYA 5CBFA 4DV5B 1P7BA 5LMUO 1AJPA 1WP8A 4IHJA 4X1YB 4LC1A 3CHXA 1KBHA 1FYJA 3ZHVA 5KLVH 3U11A 4R8CA 3STZC 2K9PA 2JGDB 1IVSA 1S5LZ 5EK0A 2Q8VA 4GX5A 1EN4A 4JI1O 5B66Z 1OCOB 3ASNC 4W4LA 5BMVB 2NNUA 5JJEB 2HHHB 3GVMA 3B09A 4TWKA 4I55A 2E75B 4Q6GA 3ETGA 2P06A 1N32O 5TISZ 2B9ZA 3AK1A 4ICGA 2Z3YA 1VF6A 5ITZA 4RUFA 3CJHB 3HB3B 3CB2A 3E2EA 4ZI7A 2HJFC 3FB6C 1WJZA 3G80A 3K04A 3T1HB 1R3KC 4IYIA 1FAFA 2QKSA 1YXBA 3CCMV 1MOFA 1GN6A 2P67A 3KG2A 4LF8B 2ADPA 3F7VC 1N8RW 1B04A 2F1MA 4E4EA 3ZRVA 2F66C 2Z5UA 4O2BB 1SERA 1ZL8A 2VWKA 4H0LB 4FLZA 4EEQA 3H1LH 2UUBO 2X7RB 3AG3B 3ABUA 2EIJC 4MVZA 1Y4MA 3ZRWB 4MT8A 3Q4HB 5IE9A 4RQFA 1JMKC 2Y0IA 3K5LA 2CTWA 2WLNA 5H9CA 1JFFA 2Y69C 4B3MO 2DWEC 2P7TC 5KMGA 1KQSU 4GKJO 4YIOA 1M9NA 4I4TB 4MVSA 1V9PA 2JJ2G 2M6YA 1N36B 2P4VA 3ZX6A 5L3EA 4OPHA 5DN6G 4N21A 1URFA 1XQ8A 2LFRA 4HNAB 4TT3G 2IJHA 3ABLB 4P9PA 1KKDA 2H3OA 2CGNA 3JD1A 1Q81W 1FJGO 1V55B 2XAJA 2A79B 5LYJA 5KAFZ 2GUZB 1RFYA 2QWPB 2WLIB 2IU0A 1K92A 1NVPD 1IURA 4FLTA 3BHPA 1MA1A 2D2CB 3FB5C 2F95B 1M56C 4TQFA 3PN1A 4BW5A 4CS2A 1SQVH 4LFCB 4FLUA 1XNQO 2UXDB 1R6TA 3GB7C 3H1HH 5LGNA 3RYCB 2QM4A 3K58A 4DK0A 4F6EA 1IBLB 2Q4PA 5K1PA 3OGCC 3TETA 1PNMA 1AI5A 2HLDG 4UCOA 1K34A 4DV2B 4WBNA 1MMMA 4DYLA 4DV7O 1G6UA 4KHPB 1EZVH 3WFVA 1AROP 4DRXA 4ZHQB 3FYIB 2R9AA 3T1CA 4LF4O 5JJJB 2F4VB 1H38A 2B5UA 1KD1W 2OTLV 5CA1B 3BVOA 2EJ7A 5H6QA 2A9HA 3W7XA 1BCCH 1QLNA 1KUQA 4LF5B 4TV9A 4CH5A 2UXXA 2ZNJA 3SYCA 3GWOA 2WLJA 2DQ0A 3L9DA 3U10A 1OCCB 1SQGA 5CA3A 1XMQB 1OCZC 1XNRO 2IH1C 1Q5OA 4JI5O 1BMFG 1F51A 4NXMO 4I9QA 1H2SB 1WNSA 3K59A 3HR0A 2LJ2A 3RWRD 1GM8A 2JEXA 3W7TA 4O4HA 5JQGA 4O4LB 3E35A 1NH2B 4K3AA 2IU3A 1XI1A 1SZXA 2KQXA 3ZHSA 1MZFA 2QM7A 3FD9A 2LO1A 3CCRV 1S72V 2RCVA 1M5IA 3BABA 4KFMA 2YI9A 1U96A 4JZ2A 2XUMA 3LDCA 3OMAB 1AR5A 2XNDG 4IGGA 1R1BA 5JH7B 1CXZB 5KHHA 2BTOA 3F7YC 5BR8B 3CCLV 2CAZC 2F43G 4UV9A 2VQFB 1N4CA 4YJ2A 1Q8IA 3IJ4A 4DV0B 1PNLA 1H8HG 2ZE5A 1MSWD 3A2FA 4CH4A 2DOSA 4WFEA 4OX9B 3W7WA 3OTFA 5JJNB 4GX0A 2LFSA 4W4KA 1THZA 4GYCB 4X20B 3L74H 2XHBA 2D3OW 3NR7A 3P30A 5EC1C 4GCZA 1SQFA 4X64B 1Q3EA 4MVMA 1F7YA 1AR1B 2KB1A 3CRAA 3SYQA 3VOUA 2HEPA 1SA0B 2AZ0A 1DGSA 5B1NA 4DV4O 3LNMB 2R72A 3CCQV 4DV3O 2PI4A 1NR7A 4UB8Z 4X62O 1YDXA 1GK9A 4LF6B 3WG7B 2KSDA 5IJ0B 4DUZO 1EBOA 3DXRB 2VRZA 3ABMB 2NR5A 3JARA 1KKCA 4R7CA 1YSCA 1SQQH 1NZ6A 3TGUH 3N27A 3SDLA 2IM9A 4DR3B 4GLXA 5LA6A 4DUYO 2PTMA 4TV8A 5CN0A 3ASOC 1VQ8V 1KP3A 3ZJZA 2QWNB 2RN9A 5KHGA 3L72H 1XHXA 3JAKB 1VMGA 2OIEA 4FIPC 1O9GA 2JJ1G 1J5EO 5LOVA 2ZDIC 1K97A 1ZAUA 3JASB 4OGQB 1J95A 2GDSA 2WPDG 4DR6O 2XASA 4UVAA 4O4JA 4PELA 3W7UA 4B3SB 2JRIA 4KUMA 2CTPA 3RN4A 4PV1B 1QHTA 5B1BB 2JIZG 4JYCA 2QTSA 1S5JA 5EZYB 4JI4O 1AP6A 4RAIA 4LR3A 4I50A 2VQEB 4WF9V 3A0BZ 4TUYA 5J2UB 1IXBA 1IBMB 1FXKA 4GKKB 2OCCB 4X65O 3B77A 2WLLA 3SPCA 3WU2Z 1P49A 3HKBA 3APOA 3BCCH 4FZ1A 1KYOF 1I94B 3UO2A 2UXBO 3THOA 1V55C 2EIKB 1N0JA 3UM7A 3DTUB 2OCHA 1TUBB 4DV5O 1E1QG 1RSOB 5E79Z 1R6NA 4DV1B 1NVPB 1GO3F 5CB4A 5J9PC 1PL0A 4NKGB 1Q82W 4JAUA 4R6ZA 4K8ZA 3OAAG 2ZE6A 2X6AA 3DSQA 1BS3A 1EN5A 1NT2B 2YEVB 1K4DC 5EYPB 2IJKA 2ILMA 3L71H 2EZOA 4Z1VA 5AG2A 1HR0O 2WA3A 2V4DA 3BA9A 1Q6HA 1QCEA 4CBCA 2JGDA 2ZR2A 3WB1A 3R65A 1CEZA 2HHHO 4ZOLB 1PL4A 3OEEG 3RYIB 1G4YB 3VBBA 4J7ZA 1EM1A 2X6BA 4DR1B 2ITCC 4UCSA 2UUAB 2Q0AA 4UB6Z 1OHHG 1NTKH 2PGGA 4NB5A 3C90A 1MG1A 4JI2O 1YF2A 3CJHA 4LCUC 1BL8A 1JX9A 3TJTA 2QTOA 3H9VA 3CRMA 4I9WA 4JI6B 4WFBV 4H44B 2EZPA 5FLXN 4LF8O 5JCOC 3SPGA 2FB5A 5J2TA 2ZNIA 3FAVB 4G27B 1OV9A 2FL4A 2EIMB 4WFHA 1XOUA 4O2BA 3RFRA 4FM0A 1ZLZA 2OTJV 3S3XA 3D36C 2EINB 1MABG 4QE7A 2GBOA 3WB0A 1EZJA 3T4DA 4JYAO 2KKWA 2JEUA 5L3GA 3ZRWA 3Q4HA 4K35A 2B1GA 2JS3A 2DQ3A 3N2KB 2UXCB 1QU7A 1VEWA 3RYHB 3K5MA 1N36O 5GONB 1M90W 1VQ9V 3H1IH 4I4TA 4JI7B 1RPOA 4HNAA 2LW1A 1RM1C 3AG2C 2ITDC 2BCCH 4I0XB 4O2AB 5A2QN 4JGSA 1VQNV 3K9SA 1S0VA 2GUZA
chains in the Genus database with same CATH topology
3FB5C 2C2AA 5KUMA 4ASUG 1NQTA 4DXWA 1M56C 4PA4A 1M56B 1RPRA 3M99B 1YJ9V 1PNKA 1R3LC 4MS2A 1JJ2U 4PA3A 3IFXA 4BW5A 4Z1MG 5KA6A 5LBQA 3GB7C 4L87A 3ASNB 5LGNA 2ZXWC 4MTOA 2ZXWB 4RO2A 1VQOV 3LDDA 5B1AC 1FFTB 3QO7A 1QVFU 5B1AB 3OGCC 3K0DA 3TETA 4XBFA 2WSSG 4LP8A 3ZRXA 1PNMA 1QR9A 1S5HC 1AI5A 1H8EG 2GHYA 2HLDG 2M7WA 4PDVA 4RQEA 3OR7C 1K34A 2ZQMA 3CD6V 5C93A 1Y66A 3OM3B 3K03A 3WFVA 1AROP 3E8BA 3K9AA 3FYIB 4BIUA 2WAMA 3AG4C 3T1CA 1Q7YW 1VQ4V 3AG4B 3E8HA 1S3JA 1H38A 2B5UA 3OEHG 4QE9A 1KD1W 2OTLV 3UKMA 3ABKC 3RVYA 4FJCC 2EBOA 2XAHA 5GW7A 3OE7G 3ABKB 1R6KA 1Q86W 5H6QA 3SJQC 5KUKA 2A9HA 1M57B 3RVZA 1AJQA 3W7XA 2HKOA 1QLNA 1L1FA 3ZMZA 1DF5A 1K33A 4XDKA 2OT5A 2UXXA 3SYCA 1ENVA 3GWOA 2WLJA 4XDJA 2DQ0A 2BOBC 1OCCC 3JYCA 5IY5C 1OCCB 5IY5B 4J9YB 2K1EA 5CA3A 1SESA 3F5WC 1F23A 2QE7G 5LGUA 1KC8W 3K3WA 1OCZC 2JDIG 1SZTA 4FMTA 2H8PC 1OCZB 1ROPA 3MD0A 2IH1C 3T2MA 3SYOA 5LHGA 2W6JG 1BMFG 1F51A 4TSFG 3MHSC 5CMUA 2EILC 3AG1B 3SYAA 1K8AW 2EILB 4PDRA 2WLMA 1BHBA 1QVGU 1K4CC 2ZD9A 2HR3A 1R73A 1FXVA 3CCSV 3SPIA 1GM8A 1LNQA 3E89A 2JEXA 3W7TA 3SPHA 3CCJV 1BHAA 3E35A 4JASA 4UVCA 1NH2B 2IU3A 1OZ0A 1W0KG 2Q67A 2Y48A 1NH2D 3LDEA 2QM7A 2B1IA 4WFGA 3D36A 1QLEC 4XDLA 1F4MA 3MHHC 1FXHA 1QLEB 2Y69B 1JOYA 4X88A 2X0LA 3CCRV 1S72V 1VQ5V 4KFMA 2IJIA 3HPLC 3OFNG 3LDCA 4QIWF 5HFLA 1R3IC 3OMAB 3E86A 1VQPV 1V54C 2XNDG 2YSUB 1V54B 4UV8A 3LUTB 3ZN0A 1TUEB 3F7YC 2MK3A 5DM6V 3I56V 2W6IG 3CCLV 4MVOA 1I5YA 2F43G 4UV9A 4DO2A 3H01A 1GTOA 1K5SA 2JK5C 3FKSG 4FK5C 5H6RA 2UXNA 1PD3A 3CMAV 1YJNV 4G2KA 3AEIA 3PJSK 5L3FA 4UUJC 1SETA 1NKDA 1PNLA 2WLIA 3STLC 3ZIAG 2XOKG 1H8HG 2IW5A 1GKFA 1AJNA 1MSWD 4RUEA 4WFEA 1GMGA 3W7WA 1YHQV 2HG5C 2XAQA 5B3SC 4GX0A 2LFSA 1S76D 5B3SB 1THZA 2DW4A 3LSQA 3CCEV 3FB7C 3G6EV 2WLHA 2X6CA 3ETEA 2D3OW 3P30A 2A0LA 5EC1C 3OR6C 1VQ7V 4GCZA 3D3IA 3B8NA 2WWWA 3ZMSA 2R9IA 4Q20A 4MVMA 5KA5A 1AR1B 2KB1A 4MTGA 4MTXA 3SYQA 3SPJA 3VOUA 1SRYA 5B1NA 3LNMB 3FYEB 2Q69A 3CCQV 2PI4A 1NR7A 4UXNA 1FS0G 1JPXA 2R9RB 4HYOA 3RW0A 3WG7C 1GK9A 1I5XA 3ZRSA 5IYCO 3LSSA 1HWYA 3WG7B 1W2BU 4H33A 1R3JC 3G4SV 3ZCCA 1YJWV 1GM9A 5EC2C 4QPKA 3ABMC 4I5SA 4HAMA 4JTDB 1EBOA 3ABMB 1NBMG 2CK3G 3ZMTA 1AI4A 4J9ZB 5L3BA 3DGEA 2QM8A 4R7CA 4JF3A 5CBHA 1YSCA 5IDJA 4MW3A 1ORQC 3CCUV 2DWDC 3P32A 2W0FC 1S77D 2DYRC 1EFRG 1K5QA 1UJWB 1XL4A 4QPJA 5CN0A 3ASOC 1VQ8V 1KP3A 2AHYA 3ZJZA 3ASOB 4E2LA 4R50A 3OW2U 5BZBA 4H37A 4U7NA 1VQLV 3QO8A 5L3DA 2Q68A 1OCRC 1K73W 5B1OA 4FIPC 1OCRB 1JVMA 2JJ1G 2ZDIC 1QBZA 1K97A 5IYBO 1J95A 2WPDG 1COWG 2XASA 4UVAA 5IYDO 3CMEV 4PELA 1WLEA 2AHZA 1DF4A 3E2EA 1NJIW 3ZN1A 3W7UA 1DTOA 2QA4V 2ZDIA 4KUMA 1KP2A 5EBMC 5B1BC 4PA6A 3QO5A 3X2QC 3CCVV 5B1BB 2JIZG 1AI7A 4JYCA 3X2QB 1CP9A 4KP4A 1B6QA 1FXKC 4X89A 4RAIA 2PI5A 3CP1A 1FXKB 2XAGA 1K9MW 2EINC 4PA9A 4WF9V 1P4RA 2WLLB 3SYPA 1WPXA 5LHHA 3ZMUA 5EBWC 2V1DA 1FXKA 2OCCC 3ABTA 4WFAV 3QNEA 4JPRA 2OCCB 4CZZA 3B77A 2WLLA 3SPCA 5CBGA 4GX2A 3FB8C 3JD0A 1ZWIC 3A0RA 3JD3A 1YTFB 1YTFD 4P2ZA 3I55V 5E1AC 2BOCC 4LBEC 4MVUA 5FL7G 2V7QG 2EJRA 1GM7A 2EIKC 1V55C 2EIKB 1CPYA 3UM7A 5CBFA 3DTUB 1G8MA 1P7BA 2H94A 1AJPA 1YI2V 1E1QG 3JCZA 1VQMV 1R6NA 2GSMB 1NVPB 4BAYA 1GO3F 5J9PC 2DYSC 1PL0A 4LC1A 1Q82W 1K7DA 4JAUA 4R6ZA 3CYOA 3OAAG 2X6AA 5LGTA 3NXSA 4R8CA 3STZC 2YEVB 1K4DC 4GX1A 2IJKA 3CC4V 2XAFA 2EZOA 1KECA 5EK0A 4GX5A 2HVKC 1OCOC 4U7OA 2QEXV 2YEVA 1QCEA 1OCOB 3ASNC 3JD2A 3RBZA 1M1KW 4YXWG 4CBCA 2ZR2A 2NNUA 3OUSA 1H2GA 3T4ZA 3BEHA 4TWKA 3R65A 1CEZA 3E8FA 4OXSA 4HZ3A 1YITV 4MSWC 3OEEG 2P90A 1G4YB 3ETGA 3VBBA 2ATKC 2X6BA 2Z3YA 2ITCC 3OMNB 4JAVA 4RUFA 2DYRB 3B8MA 3HB3B 4QNHB 5LHIA 3IC7A 1OHHG 3K79A 1QR8A 2HFEC 4ZBMA 4N23A 1F4NA 1M57C 2LP7A 3CXCU 2FTKA 3OUFA 1MG1A 4JTCB 1PKXA 4JTAB 2IH3C 4MVQA 2HJFC 4LCUC 3JD4A 4ZKIA 3FB6C 1BL8A 1JX9A 1AI6A 3K04A 1R3KC 2P6JA 4EKWA 2QTOA 2QKSA 4F4LA 3IGAC 3CCMV 1MOFA 4I9WA 3K06A 2P67A 3KG2A 4WFBV 4FPPA 2EZPA 1E1RG 3F7VC 3ML0A 3OMIB 3TK1A 1N8RW 3SPGA 4G27B 3ZRVA 2Z5UA 2IJJA 3AG1C 1SERA 3BY6A 1IXMA 2EIMC 4P30A 3W7SA 4MTFA 2EIMB 3EHBB 4WFHA 3K0GA 4GT1A 5EBLC 4UVBA 2X7RB 3AG3C 3K08A 1NR1A 3AG3B 3ABUA 3TCUA 2OTJV 4P9OA 2EIJC 2EINB 2Q6AA 4MVZA 2NLJC 5HFMA 1Y4MA 2EIJB 3CC7V 3ZRWB 4MT8A 1MABG 1DLBA 2WLKA 4QE7A 4RQFA 1EZJA 3T4DA 2JEUA 3ZMVA 5L3GA 2WLNA 5H9CA 3ZRWA 2Y69C 2DWEC 3E83A 2B1GA 2P7TC 4MW8A 1YIJV 3ETDA 2DQ3A 4WFFA 1KQSU 1M9NA 4MVSA 2JJ2G 4PDLA 4X8AA 5L3EA 3E8GA 5DN6G 4N21A 4QJFB 1W0JG 4JYBA 2LFRA 3ABLC 4TT3G 2IJHA 2HVJC 3ABLB 1M90W 4P9PA 1VQ9V 1KKDA 1VQKV 2ZR3A 4MVRA 4G28B 3JD1A 1Q81W 1V55B 1JQ0A 2XAJA 2A79B 1E79G 1RPOA 4BIZA 3CC2V 5L3CA 4WCEV 4PA7A 1RM1C 3AG2C 3G71V 3EFFK 1JCHA 1K3EA 2ITDC 2WLIB 1RM1B 3AG2B 2IU0A 1K92A 2DYSB 1NVPD 4JGSA 1VQ6V 1VQNV 4PDMA 1XL6A 1S0VA 3CPWU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJW B;  2YSU B;  1JCH A;  2B5U A; 
#chains in the Genus database with same CATH topology
 2VWJ A;  1HNX O;  5KUM A;  4DXW A;  2YS8 A;  4J7K A;  2YI8 A;  1R3L C;  4MS2 A;  3UCS C;  3IFX A;  5KHI A;  4B7K A;  3IAY A;  2KG7 B;  2Q7H A;  4MTO A;  2ZXW B;  2BSK B;  3LDD A;  3QO7 A;  3B40 A;  3BA8 A;  5B1A B;  1IBL O;  3K0D A;  1TA8 A;  4XBF A;  1QR9 A;  2M7W A;  2F93 B;  1QNM A;  1Y76 A;  1Y66 A;  4DV2 O;  3N2G B;  1VIB A;  4KHP O;  3A0H Z;  2WA4 A;  4BIU A;  3ETQ A;  2ZM6 B;  3CS5 A;  1VQ4 V;  3AG4 B;  3OEH G;  2F4V O;  3ABK C;  2EBO A;  4ZHQ A;  5KUK A;  2DJV A;  1M57 B;  1MZE A;  5CA1 A;  3ZMZ A;  5K1X A;  3UT5 B;  1EN6 A;  1ENV A;  3D8C A;  3DC5 A;  3BPZ A;  4LF5 O;  2ZKO A;  1SQX H;  4XDJ A;  1JJO A;  1ZX3 A;  3JYC A;  5IY5 C;  4X66 B;  4X1K A;  1SES A;  2QE7 G;  1KC8 W;  2OWO A;  1XMQ O;  4AQY B;  3SYO A;  2W6J G;  2EIL C;  4DR2 B;  4AHC A;  4YHH B;  2YIC A;  3AG1 B;  1SQP H;  4J10 A;  2A06 H;  5JCO A;  1QVG U;  1K4C C;  4YY3 B;  3DC6 A;  2ZD9 A;  2HR3 A;  1R73 A;  5LP6 B;  3SPI A;  3JCU Z;  1HNW B;  4IYH A;  3E89 A;  4J42 A;  4DW1 A;  1GH6 A;  4UVC A;  3I5D A;  1OZ0 A;  5IWA B;  2PZS A;  3D36 A;  4O4L A;  3OGI B;  1FXH A;  1QLE B;  4DW0 A;  5KHK A;  2IJI A;  4U3F H;  5HFL A;  3E86 A;  4B3T B;  1X59 A;  1V54 B;  1BSM A;  2Y4T A;  3ZED A;  1BQ0 A;  3LUT B;  3H1K H;  1X4T A;  3K5N A;  4LF9 B;  5JH7 A;  4DO2 A;  3H01 A;  5LXT B;  2JK5 C;  1IZ3 A;  4FK5 C;  5H6R A;  1PD3 A;  2VQF O;  1MSD A;  1L0N H;  4G2K A;  4IHJ B;  3STL C;  4DV0 O;  2IW5 A;  4GUN A;  5LMU B;  2FML A;  2HG5 C;  2XAQ A;  3KCY A;  3RT3 C;  4OX9 O;  5B3S C;  1S76 D;  2LQT A;  2QJ1 A;  3U0Z A;  3CCE V;  5EIB C;  4NXN O;  2WLH A;  4YJ3 B;  1VQ7 V;  1NI8 A;  2PYJ A;  5EIB D;  2Q0O C;  3B8N A;  3ZMS A;  4X20 A;  4X64 O;  1WA8 A;  5KA5 A;  4PI2 A;  3L75 H;  1TVK B;  4I55 B;  4Z2W A;  3CX5 F;  4DR7 B;  4IL6 Z;  4HYO A;  2GTA A;  5IYC O;  4PI0 A;  1W2B U;  4LF6 O;  3G4S V;  3ZCC A;  1YJW V;  1LUW A;  4I5S A;  5ITZ B;  3M7M X;  4BR6 A;  5LMN B;  1N32 B;  1NBM G;  3ZMT A;  4J9Z B;  5L3B A;  4F6R A;  1N34 B;  1VF5 B;  5CBH A;  5IDJ A;  5IJ0 A;  3JAT A;  1ORQ C;  3CCU V;  4ZI7 B;  2DWD C;  3P32 A;  2W0F C;  3UQ8 A;  1EFR G;  1K5Q A;  1UJW B;  3BAA A;  4DR3 O;  1I7F A;  2AHY A;  4FLV A;  1NTZ H;  4ABM A;  2QR4 A;  2Q68 A;  1OCR C;  1K73 W;  2ARH A;  5B1O A;  5JVD B;  1JVM A;  4FM1 A;  4X9Q A;  3ZHR A;  4LWS A;  3VQW A;  1WLE A;  1AIL A;  2ADQ B;  2GTS A;  3JAS A;  5JWP A;  4NVP A;  3X2Q B;  4FLY A;  3P3P A;  1B6Q A;  1FXK C;  2PI5 A;  2XAG A;  1K9M W;  2EIN C;  4PA9 A;  3HKC A;  1P4R A;  3SYP A;  1JFF B;  5IJ9 A;  3ZMU A;  2DE0 X;  4EB6 B;  5KMG B;  2PUS A;  1IBM O;  3QNE A;  3SJB C;  4B3M B;  4CZZ A;  2RQ6 A;  3AK3 A;  4GKK O;  5J2U A;  1Y74 B;  3SJA C;  4GKJ B;  5IYZ B;  3FB8 C;  3G67 A;  1YTF B;  5KX5 B;  5GTH Z;  1T5E A;  2E74 B;  2AZ2 A;  2AW9 A;  1D5A A;  2BOC C;  4RWU A;  4DV6 B;  4MVU A;  2EJR A;  1FJG B;  4K0K B;  1I94 O;  1G8M A;  1YI2 V;  3HKD B;  4PJ0 Z;  1VQM V;  4BAY A;  4DV1 O;  3ICX A;  3F5T A;  1K7D A;  1Q6I A;  1RSO A;  4UCT A;  3R66 A;  5LGT A;  2N04 A;  3NXS A;  2RNB A;  4GX1 A;  4D6T H;  3T1Y B;  4ZIB A;  1Z5V A;  1A32 A;  1OCO C;  1YEW A;  2QEX V;  2YEV A;  5EYP A;  1M1K W;  4YXW G;  2HJD A;  1H2G A;  3T4Z A;  1L0L H;  2LW7 A;  4TQD A;  4DRX B;  4HZ3 A;  4LFA B;  1YIT V;  4DV7 B;  4NTX A;  2ATK C;  3SR2 C;  4LF4 B;  1XMO O;  2JS5 A;  4DR1 O;  4JAV A;  4QNH B;  5LHI A;  2RDC A;  4TV9 B;  2UUA O;  3K79 A;  1QR8 A;  4ZBM A;  4AI8 A;  4N23 A;  1F4N A;  1M57 C;  2LP7 A;  4JTC B;  1PKX A;  2RJZ A;  4LF7 O;  4I7Z B;  3BFR A;  4ZKI A;  1VAR A;  1Z5W A;  1AI6 A;  2P6J A;  4EKW A;  1HP8 A;  3IGA C;  2ZE7 A;  4JI3 O;  3K06 A;  4FPP A;  4JI6 O;  2Q73 A;  4C7U A;  2ZIO A;  3OTO B;  4NXM B;  3AG1 C;  3BY6 A;  1ZSP A;  2QGN A;  2E3C A;  4P30 A;  4PHZ A;  4MTF A;  4JI8 B;  2LGW A;  4O4H B;  2F23 A;  2O57 A;  3FAV A;  4GT1 A;  5EBL C;  5KAI Z;  4U3J B;  3AG3 C;  5LP6 C;  3K08 A;  4NR1 A;  4P9O A;  4TOI A;  2NLJ C;  2EIJ B;  3CC7 V;  2WLK A;  2UU9 B;  3ZMV A;  3O9O A;  3E22 B;  1YIJ V;  4MW8 A;  2YC0 A;  3ETD A;  1H2M A;  3KKY A;  1O9H A;  4YIP A;  2YXH A;  4X8A A;  3E8G A;  4B08 A;  1SQB H;  3N2K A;  1W0J G;  4JYB A;  3ABL C;  1TAE A;  2CH7 A;  2CTQ A;  2ZR3 A;  4MVR A;  4G28 B;  4JI7 O;  1E79 G;  4BIZ A;  3CC2 V;  5L3C A;  1M93 A;  5GON A;  2E5L B;  3G71 V;  1K3E A;  5CA0 B;  2BTQ B;  2DYS B;  4B3R B;  4PDM A;  5DEC A;  4X1Y A;  1XL6 A;  3JAW B;  4DK1 A;  4K8X A;  2C2A A;  4J11 A;  4PA4 A;  2EX3 A;  4I0X A;  4O2A A;  3C3T A;  1IBK B;  1M56 B;  1RPR A;  1YJ9 V;  4NYK A;  1PNK A;  1ZTE A;  4DR5 B;  4PA3 A;  5LBQ A;  1DK1 A;  5FPR A;  1VQO V;  3QTC A;  1N0N A;  3CRQ A;  1BZK A;  1QVF U;  2WSS G;  4LP8 A;  1OJH A;  4IIJ B;  5BMV A;  1KB9 F;  2R70 A;  3OR7 C;  2ZQM A;  3CD6 V;  5C93 A;  3OM3 B;  3K03 A;  4JI0 B;  4DV4 B;  2WAM A;  5F2V O;  2A7W A;  4DV3 B;  2P22 C;  4QE9 A;  4CH6 A;  2Q5Z A;  4LNU B;  3N2G A;  1AR4 A;  3RVY A;  5GW7 A;  1R6K A;  1SC5 B;  1B06 A;  5D5Q A;  2QKC A;  3CE2 A;  1L1F A;  4BWA A;  1DF5 A;  1K33 A;  2YXY A;  2CE4 A;  2OT5 A;  5LA6 B;  1YCI A;  3AK2 A;  1XHZ A;  4B7E A;  3T1H O;  4CH3 A;  1OCC C;  4KL1 A;  2LGQ A;  4DUY B;  2PY5 A;  4J9Y B;  2K1E A;  1YZB A;  1F23 A;  3K3W A;  2JDI G;  2H8P C;  1OCZ B;  1ROP A;  3OT7 A;  4LFB B;  3CRR A;  3T2M A;  2YUA A;  1WP7 A;  4AQY O;  5CMU A;  3MHS C;  2CTR A;  2FKX A;  4NTY A;  2OIG A;  1K8A W;  3GWK C;  1J5E B;  2WLM A;  1HNZ B;  4D7S A;  4YY3 O;  4DR6 B;  2UUC B;  1FXV A;  3CCS V;  1HNW O;  1AP5 A;  3CCJ V;  1BHA A;  4JAS A;  1XEQ A;  1W0K G;  2Q67 A;  2Y48 A;  5LP6 A;  1NH2 D;  3LDE A;  2B1I A;  4WFG A;  1F4M A;  3CRC A;  1JOY A;  1AVM A;  3UO3 A;  4QIW F;  4CS3 A;  2P5O A;  3HKB B;  1R3I C;  2ZIN A;  1VP7 A;  4B3T O;  4UV8 A;  3ZN0 A;  2N05 A;  3J80 N;  2MK3 A;  5DM6 V;  3I56 V;  2W6I G;  4MVO A;  1I5Y A;  1I08 A;  3S3W A;  2UXN A;  1XDC A;  4PD4 F;  3AEI A;  3PJS K;  5L3F A;  4UUJ C;  1SET A;  5LXT A;  2UXB B;  2WLI A;  3LNN A;  2BE3 A;  3SGI A;  1AJN A;  5CB4 B;  2IBZ H;  2RMK B;  2EUL A;  1GMG A;  4X1I B;  3LSQ A;  4LFC O;  2UXD O;  3FB7 C;  3K57 A;  3G6E V;  4JV5 B;  1L8D A;  3J7A U;  2YIB D;  2WWW A;  3RYC A;  4AIL C;  1HR0 B;  4YJ3 A;  1FFX B;  4MTG A;  4MTX A;  1BQZ A;  1LR1 A;  4LH7 A;  3SPJ A;  4DR4 B;  3LSU A;  4DR7 O;  3FYE B;  1NS1 A;  4CC5 A;  1TVK A;  2R9R B;  3ZRS A;  3RW0 A;  3HKE B;  3WG7 C;  1HWY A;  2MW2 B;  4O4I B;  1GM9 A;  3ABM C;  4JTD B;  5LMN O;  2QM8 A;  1AB3 A;  3JAL B;  3EVK A;  1N34 O;  4MW3 A;  1SS3 A;  4JI2 B;  3ASO B;  4E2L A;  4R50 A;  5BZB A;  2W0X A;  3JSL A;  5H2F Z;  4U7N A;  5L3D A;  1TGO A;  5B5E Z;  2ZT9 B;  1QBZ A;  4A5U B;  2QDO A;  5FNV B;  5J2T B;  5IYB O;  1P84 F;  4FFB B;  1COW G;  5JVD A;  3RYF B;  3CME V;  1DF4 A;  1NJI W;  3ZN1 A;  1DTO A;  2QA4 V;  2DMX A;  1KP2 A;  2YXL A;  5B1B C;  1Y6X A;  3CCV V;  1CP9 A;  2XTA A;  2VS0 A;  1P7G A;  4X89 A;  3CP1 A;  4BW9 A;  2OYQ A;  2ODM A;  1WPX A;  3QG5 A;  4JYA B;  5C8Y B;  2V1D A;  4FZ0 A;  2OCC C;  3ABT A;  4J80 A;  4WFA V;  1N33 B;  4GX2 A;  4EB6 A;  5BR8 O;  5BXZ A;  3JD0 A;  1Y74 A;  4P2Z A;  3I55 V;  5E1A C;  5GTI Z;  2XT9 A;  5IYZ A;  4DV6 O;  4LBE C;  5KX5 A;  2EIK C;  4CC6 A;  4K0K O;  2H94 A;  4FLX A;  3JCZ A;  1XIL A;  2A3Q A;  2GSM B;  2DYS C;  3VQX A;  2JVD A;  3CYO A;  4JAA A;  3B4S A;  1HNX B;  3HKD A;  1VF7 A;  2YIA A;  1WPB A;  3CC4 V;  3TXQ A;  2XAF A;  3T1Y O;  2YIB A;  1KEC A;  1GN4 A;  1PM9 A;  2PYL A;  2HP8 A;  4JI1 B;  2HVK C;  4U7O A;  3RBZ A;  3JD2 A;  4L8J A;  3WB2 A;  3OUS A;  1NTM H;  1GN2 A;  4UCU A;  3BEH A;  1Y76 B;  1XUQ A;  3E8F A;  4OXS A;  1SA0 A;  2FYU H;  4MSW C;  5H5N A;  4LFA O;  1D5N A;  2P90 A;  2Q9L A;  4HBN A;  1Y67 A;  1FKA O;  3CEI A;  4GZR B;  3OMN B;  3DXR A;  2DYR B;  1WN7 A;  3B8M A;  2Y0P A;  3IC7 A;  5KHJ A;  2Y4U A;  2HFE C;  3CXC U;  2FTK A;  3OUF A;  4JTA B;  3RGB A;  2IH3 C;  4MVQ A;  3JD4 A;  2E76 B;  2NN4 A;  4X1K B;  5DED A;  1SF9 A;  3A8T A;  4F4L A;  2ETN A;  3JAK A;  4JYY A;  3KZI Z;  1E1R G;  3ML0 A;  3OMI B;  3TK1 A;  1ZL8 B;  4B3S O;  3P3N A;  3OTO O;  2IJJ A;  1BGY H;  5BY1 A;  1IXM A;  2EIM C;  3W7S A;  1D2D A;  3EHB B;  2UUB B;  3K0G A;  4JI8 O;  4UVB A;  1NR1 A;  3FX7 A;  3TCU A;  2Q6A A;  5EZY A;  3BRC A;  5HFM A;  2VQE O;  1UPG A;  1DLB A;  4U3J A;  3ZHQ A;  2UU9 O;  3E83 A;  4WFF A;  3K5O A;  3QVN A;  4PDL A;  1ZUQ A;  3E22 A;  5LYJ B;  4QJF B;  3CWB H;  2HVJ C;  1VQK V;  1IX9 A;  1JQ0 A;  4WCE V;  4PA7 A;  3EFF K;  1JCH A;  2E5L O;  1RM1 B;  3AG2 B;  2QSA A;  1Q90 D;  1TUB A;  1VQ6 V;  1HDJ A;  3CPW U;  4B3R O;  4ASU G;  1NQT A;  5CA0 A;  2BTQ A;  1Z2G A;  3M99 B;  1BE3 H;  1JJ2 U;  1IBK O;  1PP9 H;  1XNQ B;  3D3Q A;  3JAW A;  1FPO A;  4Z1M G;  5KA6 A;  4DR5 O;  5FPO A;  4L87 A;  3ASN B;  2ZXW C;  4NXN B;  1Q6U A;  4EFE A;  4RO2 A;  1WA8 B;  1GAX A;  5B1A C;  1FFT B;  4WBN B;  3ZRX A;  1S5H C;  4PDV A;  4RQE A;  2GHY A;  1H8E G;  5D5P A;  3M8A A;  3G6B A;  3IC9 A;  3APQ A;  3MDS A;  3E8B A;  3K9A A;  4ZOL A;  4IIJ A;  2CUG A;  1Q7Y W;  3AG4 C;  4JI0 O;  3E8H A;  1S3J A;  3H1J H;  1LUV A;  3RYI A;  3UKM A;  1JA8 A;  4FJC C;  3QF7 A;  2XAH A;  4F6R B;  3OE7 G;  3ABK B;  2CGO A;  1Q86 W;  3SJQ C;  3RVZ A;  1AJQ A;  3JAT B;  2HKO A;  4LNU A;  4XDK A;  3SJC C;  2L35 A;  1KMI Z;  3TXS A;  2BOB C;  1WB7 A;  5IY5 B;  3F5W C;  4D7T A;  1XNR B;  5LGU A;  1SZT A;  4FMT A;  1BT8 A;  3MD0 A;  4JI5 B;  3L70 H;  5LHG A;  4LFB O;  5IT9 N;  2ZIM A;  4TSF G;  4J41 A;  3SYA A;  4LWS B;  2EIL B;  2ZE8 A;  3JSN A;  4LH6 A;  4PDR A;  1GN3 A;  1BHB A;  5JQG B;  1HNZ O;  3CXH F;  1KU9 A;  1LNQ A;  2UUC O;  3SPH A;  4FLW A;  3MAQ A;  5LL6 Y;  4OPA A;  1QLE C;  3HKC B;  3O65 A;  4XDL A;  3MHH C;  2Y69 B;  3KCX A;  5IJ9 B;  4X88 A;  2X0L A;  1VQ5 V;  2UXC O;  2P4K A;  4FVM A;  3HPL C;  3OFN G;  4IT5 A;  2QWR B;  1VQP V;  1V54 C;  3JAM N;  3RYH A;  2YSU B;  1XBL A;  3EXA A;  4YJ2 B;  1TUE B;  1US6 A;  1PPJ H;  2Z0A A;  4UCV A;  1NU1 H;  1PV0 A;  1GTO A;  1K5S A;  3FKS G;  1JR9 A;  1H2L A;  4FFK A;  1I0H A;  4QGP A;  3CMA V;  1YJN V;  1MNG A;  3J81 N;  1RP3 B;  2YID A;  4FM2 A;  1GRJ A;  1NKD A;  3ZIA G;  2XOK G;  1H2N A;  1GKF A;  1HW7 A;  4RUE A;  1YHQ V;  5B3S B;  1Q43 A;  1QQC A;  2DW4 A;  3ZS8 C;  2X6C A;  3ETE A;  2A0L A;  3OR6 C;  2GV9 A;  4X1I A;  3VQV A;  2YDE A;  3D3I A;  4JV5 O;  4EFB A;  2KG7 A;  2R9I A;  3OD4 A;  4Q20 A;  2BSK A;  2Q7G A;  1SRY A;  4DR4 O;  2ZM6 O;  4X62 B;  2Q69 A;  1FFX A;  1FD9 A;  1FS0 G;  1JPX A;  4UXN A;  1I5X A;  3JAR B;  3LSS A;  2G38 A;  1WAZ A;  1VF6 C;  3FFQ A;  4H33 A;  1R3J C;  4DUZ B;  5EC2 C;  4QPK A;  4HAM A;  4BIO A;  2CK3 G;  1AI4 A;  3HKE A;  1B3Q A;  3DGE A;  4TV8 B;  2Q7E A;  4JF3 A;  1XMO B;  4O4I A;  1S77 D;  2DYR C;  3VQY A;  3UT5 A;  1XL4 A;  2CDY A;  4QPJ A;  4X66 O;  1M4U A;  3JAL A;  2DN9 A;  3ZBH A;  4LF7 B;  3OW2 U;  4UFZ A;  5LOV B;  4KXR A;  4H37 A;  1VQL V;  3QO8 A;  1W59 A;  2N74 A;  4DR2 O;  1OCR B;  4YHH O;  2L6L A;  4J7J A;  4O4J B;  2QKA A;  4JI3 B;  4JZG A;  3L73 H;  2JGU A;  5IYD O;  4UCR A;  2AHZ A;  1H2K A;  2ZDI A;  5FNV A;  5EBM C;  4H13 B;  4PA6 A;  4FFB A;  3QO5 A;  3X2Q C;  1AI7 A;  3RYF A;  4I50 B;  5IWA O;  4JI4 B;  4TUY B;  4KP4 A;  1FXK B;  3CSX A;  3AG7 A;  1YVW A;  1G1X B;  2WLL B;  5LHH A;  1UFI A;  5EBW C;  4X65 B;  5A9G A;  4JPR A;  1IDS A;  2ZCE A;  1N33 O;  3ZHU A;  1XRE A;  5CBG A;  5C8Y A;  1ZWI C;  4LF9 O;  3A0R A;  2PF4 E;  3JD3 A;  1WB8 A;  2QWQ B;  2CH7 B;  2AXT Z;  2AGA A;  1YTF D;  3C3S A;  4CS4 A;  2QWO B;  1SKV A;  1U97 A;  5FL7 G;  2V7Q G;  4NTW A;  1GM7 A;  3ZHT A;  3B2E E;  1CPY A;  5CBF A;  4DV5 B;  1P7B A;  5LMU O;  1AJP A;  1WP8 A;  4IHJ A;  4X1Y B;  4LC1 A;  3CHX A;  1KBH A;  1FYJ A;  3ZHV A;  5KLV H;  3U11 A;  4R8C A;  3STZ C;  2K9P A;  2JGD B;  1IVS A;  1S5L Z;  5EK0 A;  2Q8V A;  4GX5 A;  1EN4 A;  4JI1 O;  5B66 Z;  1OCO B;  3ASN C;  4W4L A;  5BMV B;  2NNU A;  5JJE B;  2HHH B;  3GVM A;  3B09 A;  4TWK A;  4I55 A;  2E75 B;  4Q6G A;  3ETG A;  2P06 A;  1N32 O;  5TIS Z;  2B9Z A;  3AK1 A;  4ICG A;  2Z3Y A;  1VF6 A;  5ITZ A;  4RUF A;  3CJH B;  3HB3 B;  3CB2 A;  3E2E A;  4ZI7 A;  2HJF C;  3FB6 C;  1WJZ A;  3G80 A;  3K04 A;  3T1H B;  1R3K C;  4IYI A;  1FAF A;  2QKS A;  1YXB A;  3CCM V;  1MOF A;  1GN6 A;  2P67 A;  3KG2 A;  4LF8 B;  2ADP A;  3F7V C;  1N8R W;  1B04 A;  2F1M A;  4E4E A;  3ZRV A;  2F66 C;  2Z5U A;  4O2B B;  1SER A;  1ZL8 A;  2VWK A;  4H0L B;  4FLZ A;  4EEQ A;  3H1L H;  2UUB O;  2X7R B;  3AG3 B;  3ABU A;  2EIJ C;  4MVZ A;  1Y4M A;  3ZRW B;  4MT8 A;  3Q4H B;  5IE9 A;  4RQF A;  1JMK C;  2Y0I A;  3K5L A;  2CTW A;  2WLN A;  5H9C A;  1JFF A;  2Y69 C;  4B3M O;  2DWE C;  2P7T C;  5KMG A;  1KQS U;  4GKJ O;  4YIO A;  1M9N A;  4I4T B;  4MVS A;  1V9P A;  2JJ2 G;  2M6Y A;  1N36 B;  2P4V A;  3ZX6 A;  5L3E A;  4OPH A;  5DN6 G;  4N21 A;  1URF A;  1XQ8 A;  2LFR A;  4HNA B;  4TT3 G;  2IJH A;  3ABL B;  4P9P A;  1KKD A;  2H3O A;  2CGN A;  3JD1 A;  1Q81 W;  1FJG O;  1V55 B;  2XAJ A;  2A79 B;  5LYJ A;  5KAF Z;  2GUZ B;  1RFY A;  2QWP B;  2WLI B;  2IU0 A;  1K92 A;  1NVP D;  1IUR A;  4FLT A;  3BHP A;  1MA1 A;  2D2C B;  3FB5 C;  2F95 B;  1M56 C;  4TQF A;  3PN1 A;  4BW5 A;  4CS2 A;  1SQV H;  4LFC B;  4FLU A;  1XNQ O;  2UXD B;  1R6T A;  3GB7 C;  3H1H H;  5LGN A;  3RYC B;  2QM4 A;  3K58 A;  4DK0 A;  4F6E A;  1IBL B;  2Q4P A;  5K1P A;  3OGC C;  3TET A;  1PNM A;  1AI5 A;  2HLD G;  4UCO A;  1K34 A;  4DV2 B;  4WBN A;  1MMM A;  4DYL A;  4DV7 O;  1G6U A;  4KHP B;  1EZV H;  3WFV A;  1ARO P;  4DRX A;  4ZHQ B;  3FYI B;  2R9A A;  3T1C A;  4LF4 O;  5JJJ B;  2F4V B;  1H38 A;  2B5U A;  1KD1 W;  2OTL V;  5CA1 B;  3BVO A;  2EJ7 A;  5H6Q A;  2A9H A;  3W7X A;  1BCC H;  1QLN A;  1KUQ A;  4LF5 B;  4TV9 A;  4CH5 A;  2UXX A;  2ZNJ A;  3SYC A;  3GWO A;  2WLJ A;  2DQ0 A;  3L9D A;  3U10 A;  1OCC B;  1SQG A;  5CA3 A;  1XMQ B;  1OCZ C;  1XNR O;  2IH1 C;  1Q5O A;  4JI5 O;  1BMF G;  1F51 A;  4NXM O;  4I9Q A;  1H2S B;  1WNS A;  3K59 A;  3HR0 A;  2LJ2 A;  3RWR D;  1GM8 A;  2JEX A;  3W7T A;  4O4H A;  5JQG A;  4O4L B;  3E35 A;  1NH2 B;  4K3A A;  2IU3 A;  1XI1 A;  1SZX A;  2KQX A;  3ZHS A;  1MZF A;  2QM7 A;  3FD9 A;  2LO1 A;  3CCR V;  1S72 V;  2RCV A;  1M5I A;  3BAB A;  4KFM A;  2YI9 A;  1U96 A;  4JZ2 A;  2XUM A;  3LDC A;  3OMA B;  1AR5 A;  2XND G;  4IGG A;  1R1B A;  5JH7 B;  1CXZ B;  5KHH A;  2BTO A;  3F7Y C;  5BR8 B;  3CCL V;  2CAZ C;  2F43 G;  4UV9 A;  2VQF B;  1N4C A;  4YJ2 A;  1Q8I A;  3IJ4 A;  4DV0 B;  1PNL A;  1H8H G;  2ZE5 A;  1MSW D;  3A2F A;  4CH4 A;  2DOS A;  4WFE A;  4OX9 B;  3W7W A;  3OTF A;  5JJN B;  4GX0 A;  2LFS A;  4W4K A;  1THZ A;  4GYC B;  4X20 B;  3L74 H;  2XHB A;  2D3O W;  3NR7 A;  3P30 A;  5EC1 C;  4GCZ A;  1SQF A;  4X64 B;  1Q3E A;  4MVM A;  1F7Y A;  1AR1 B;  2KB1 A;  3CRA A;  3SYQ A;  3VOU A;  2HEP A;  1SA0 B;  2AZ0 A;  1DGS A;  5B1N A;  4DV4 O;  3LNM B;  2R72 A;  3CCQ V;  4DV3 O;  2PI4 A;  1NR7 A;  4UB8 Z;  4X62 O;  1YDX A;  1GK9 A;  4LF6 B;  3WG7 B;  2KSD A;  5IJ0 B;  4DUZ O;  1EBO A;  3DXR B;  2VRZ A;  3ABM B;  2NR5 A;  3JAR A;  1KKC A;  4R7C A;  1YSC A;  1SQQ H;  1NZ6 A;  3TGU H;  3N27 A;  3SDL A;  2IM9 A;  4DR3 B;  4GLX A;  5LA6 A;  4DUY O;  2PTM A;  4TV8 A;  5CN0 A;  3ASO C;  1VQ8 V;  1KP3 A;  3ZJZ A;  2QWN B;  2RN9 A;  5KHG A;  3L72 H;  1XHX A;  3JAK B;  1VMG A;  2OIE A;  4FIP C;  1O9G A;  2JJ1 G;  1J5E O;  5LOV A;  2ZDI C;  1K97 A;  1ZAU A;  3JAS B;  4OGQ B;  1J95 A;  2GDS A;  2WPD G;  4DR6 O;  2XAS A;  4UVA A;  4O4J A;  4PEL A;  3W7U A;  4B3S B;  2JRI A;  4KUM A;  2CTP A;  3RN4 A;  4PV1 B;  1QHT A;  5B1B B;  2JIZ G;  4JYC A;  2QTS A;  1S5J A;  5EZY B;  4JI4 O;  1AP6 A;  4RAI A;  4LR3 A;  4I50 A;  2VQE B;  4WF9 V;  3A0B Z;  4TUY A;  5J2U B;  1IXB A;  1IBM B;  1FXK A;  4GKK B;  2OCC B;  4X65 O;  3B77 A;  2WLL A;  3SPC A;  3WU2 Z;  1P49 A;  3HKB A;  3APO A;  3BCC H;  4FZ1 A;  1KYO F;  1I94 B;  3UO2 A;  2UXB O;  3THO A;  1V55 C;  2EIK B;  1N0J A;  3UM7 A;  3DTU B;  2OCH A;  1TUB B;  4DV5 O;  1E1Q G;  1RSO B;  5E79 Z;  1R6N A;  4DV1 B;  1NVP B;  1GO3 F;  5CB4 A;  5J9P C;  1PL0 A;  4NKG B;  1Q82 W;  4JAU A;  4R6Z A;  4K8Z A;  3OAA G;  2ZE6 A;  2X6A A;  3DSQ A;  1BS3 A;  1EN5 A;  1NT2 B;  2YEV B;  1K4D C;  5EYP B;  2IJK A;  2ILM A;  3L71 H;  2EZO A;  4Z1V A;  5AG2 A;  1HR0 O;  2WA3 A;  2V4D A;  3BA9 A;  1Q6H A;  1QCE A;  4CBC A;  2JGD A;  2ZR2 A;  3WB1 A;  3R65 A;  1CEZ A;  2HHH O;  4ZOL B;  1PL4 A;  3OEE G;  3RYI B;  1G4Y B;  3VBB A;  4J7Z A;  1EM1 A;  2X6B A;  4DR1 B;  2ITC C;  4UCS A;  2UUA B;  2Q0A A;  4UB6 Z;  1OHH G;  1NTK H;  2PGG A;  4NB5 A;  3C90 A;  1MG1 A;  4JI2 O;  1YF2 A;  3CJH A;  4LCU C;  1BL8 A;  1JX9 A;  3TJT A;  2QTO A;  3H9V A;  3CRM A;  4I9W A;  4JI6 B;  4WFB V;  4H44 B;  2EZP A;  5FLX N;  4LF8 O;  5JCO C;  3SPG A;  2FB5 A;  5J2T A;  2ZNI A;  3FAV B;  4G27 B;  1OV9 A;  2FL4 A;  2EIM B;  4WFH A;  1XOU A;  4O2B A;  3RFR A;  4FM0 A;  1ZLZ A;  2OTJ V;  3S3X A;  3D36 C;  2EIN B;  1MAB G;  4QE7 A;  2GBO A;  3WB0 A;  1EZJ A;  3T4D A;  4JYA O;  2KKW A;  2JEU A;  5L3G A;  3ZRW A;  3Q4H A;  4K35 A;  2B1G A;  2JS3 A;  2DQ3 A;  3N2K B;  2UXC B;  1QU7 A;  1VEW A;  3RYH B;  3K5M A;  1N36 O;  5GON B;  1M90 W;  1VQ9 V;  3H1I H;  4I4T A;  4JI7 B;  1RPO A;  4HNA A;  2LW1 A;  1RM1 C;  3AG2 C;  2ITD C;  2BCC H;  4I0X B;  4O2A B;  5A2Q N;  4JGS A;  1VQN V;  3K9S A;  1S0V A;  2GUZ A; 
#chains in the Genus database with same CATH homology
 3FB5 C;  2C2A A;  5KUM A;  4ASU G;  1NQT A;  4DXW A;  1M56 C;  4PA4 A;  1M56 B;  1RPR A;  3M99 B;  1YJ9 V;  1PNK A;  1R3L C;  4MS2 A;  1JJ2 U;  4PA3 A;  3IFX A;  4BW5 A;  4Z1M G;  5KA6 A;  5LBQ A;  3GB7 C;  4L87 A;  3ASN B;  5LGN A;  2ZXW C;  4MTO A;  2ZXW B;  4RO2 A;  1VQO V;  3LDD A;  5B1A C;  1FFT B;  3QO7 A;  1QVF U;  5B1A B;  3OGC C;  3K0D A;  3TET A;  4XBF A;  2WSS G;  4LP8 A;  3ZRX A;  1PNM A;  1QR9 A;  1S5H C;  1AI5 A;  1H8E G;  2GHY A;  2HLD G;  2M7W A;  4PDV A;  4RQE A;  3OR7 C;  1K34 A;  2ZQM A;  3CD6 V;  5C93 A;  1Y66 A;  3OM3 B;  3K03 A;  3WFV A;  1ARO P;  3E8B A;  3K9A A;  3FYI B;  4BIU A;  2WAM A;  3AG4 C;  3T1C A;  1Q7Y W;  1VQ4 V;  3AG4 B;  3E8H A;  1S3J A;  1H38 A;  2B5U A;  3OEH G;  4QE9 A;  1KD1 W;  2OTL V;  3UKM A;  3ABK C;  3RVY A;  4FJC C;  2EBO A;  2XAH A;  5GW7 A;  3OE7 G;  3ABK B;  1R6K A;  1Q86 W;  5H6Q A;  3SJQ C;  5KUK A;  2A9H A;  1M57 B;  3RVZ A;  1AJQ A;  3W7X A;  2HKO A;  1QLN A;  1L1F A;  3ZMZ A;  1DF5 A;  1K33 A;  4XDK A;  2OT5 A;  2UXX A;  3SYC A;  1ENV A;  3GWO A;  2WLJ A;  4XDJ A;  2DQ0 A;  2BOB C;  1OCC C;  3JYC A;  5IY5 C;  1OCC B;  5IY5 B;  4J9Y B;  2K1E A;  5CA3 A;  1SES A;  3F5W C;  1F23 A;  2QE7 G;  5LGU A;  1KC8 W;  3K3W A;  1OCZ C;  2JDI G;  1SZT A;  4FMT A;  2H8P C;  1OCZ B;  1ROP A;  3MD0 A;  2IH1 C;  3T2M A;  3SYO A;  5LHG A;  2W6J G;  1BMF G;  1F51 A;  4TSF G;  3MHS C;  5CMU A;  2EIL C;  3AG1 B;  3SYA A;  1K8A W;  2EIL B;  4PDR A;  2WLM A;  1BHB A;  1QVG U;  1K4C C;  2ZD9 A;  2HR3 A;  1R73 A;  1FXV A;  3CCS V;  3SPI A;  1GM8 A;  1LNQ A;  3E89 A;  2JEX A;  3W7T A;  3SPH A;  3CCJ V;  1BHA A;  3E35 A;  4JAS A;  4UVC A;  1NH2 B;  2IU3 A;  1OZ0 A;  1W0K G;  2Q67 A;  2Y48 A;  1NH2 D;  3LDE A;  2QM7 A;  2B1I A;  4WFG A;  3D36 A;  1QLE C;  4XDL A;  1F4M A;  3MHH C;  1FXH A;  1QLE B;  2Y69 B;  1JOY A;  4X88 A;  2X0L A;  3CCR V;  1S72 V;  1VQ5 V;  4KFM A;  2IJI A;  3HPL C;  3OFN G;  3LDC A;  4QIW F;  5HFL A;  1R3I C;  3OMA B;  3E86 A;  1VQP V;  1V54 C;  2XND G;  2YSU B;  1V54 B;  4UV8 A;  3LUT B;  3ZN0 A;  1TUE B;  3F7Y C;  2MK3 A;  5DM6 V;  3I56 V;  2W6I G;  3CCL V;  4MVO A;  1I5Y A;  2F43 G;  4UV9 A;  4DO2 A;  3H01 A;  1GTO A;  1K5S A;  2JK5 C;  3FKS G;  4FK5 C;  5H6R A;  2UXN A;  1PD3 A;  3CMA V;  1YJN V;  4G2K A;  3AEI A;  3PJS K;  5L3F A;  4UUJ C;  1SET A;  1NKD A;  1PNL A;  2WLI A;  3STL C;  3ZIA G;  2XOK G;  1H8H G;  2IW5 A;  1GKF A;  1AJN A;  1MSW D;  4RUE A;  4WFE A;  1GMG A;  3W7W A;  1YHQ V;  2HG5 C;  2XAQ A;  5B3S C;  4GX0 A;  2LFS A;  1S76 D;  5B3S B;  1THZ A;  2DW4 A;  3LSQ A;  3CCE V;  3FB7 C;  3G6E V;  2WLH A;  2X6C A;  3ETE A;  2D3O W;  3P30 A;  2A0L A;  5EC1 C;  3OR6 C;  1VQ7 V;  4GCZ A;  3D3I A;  3B8N A;  2WWW A;  3ZMS A;  2R9I A;  4Q20 A;  4MVM A;  5KA5 A;  1AR1 B;  2KB1 A;  4MTG A;  4MTX A;  3SYQ A;  3SPJ A;  3VOU A;  1SRY A;  5B1N A;  3LNM B;  3FYE B;  2Q69 A;  3CCQ V;  2PI4 A;  1NR7 A;  4UXN A;  1FS0 G;  1JPX A;  2R9R B;  4HYO A;  3RW0 A;  3WG7 C;  1GK9 A;  1I5X A;  3ZRS A;  5IYC O;  3LSS A;  1HWY A;  3WG7 B;  1W2B U;  4H33 A;  1R3J C;  3G4S V;  3ZCC A;  1YJW V;  1GM9 A;  5EC2 C;  4QPK A;  3ABM C;  4I5S A;  4HAM A;  4JTD B;  1EBO A;  3ABM B;  1NBM G;  2CK3 G;  3ZMT A;  1AI4 A;  4J9Z B;  5L3B A;  3DGE A;  2QM8 A;  4R7C A;  4JF3 A;  5CBH A;  1YSC A;  5IDJ A;  4MW3 A;  1ORQ C;  3CCU V;  2DWD C;  3P32 A;  2W0F C;  1S77 D;  2DYR C;  1EFR G;  1K5Q A;  1UJW B;  1XL4 A;  4QPJ A;  5CN0 A;  3ASO C;  1VQ8 V;  1KP3 A;  2AHY A;  3ZJZ A;  3ASO B;  4E2L A;  4R50 A;  3OW2 U;  5BZB A;  4H37 A;  4U7N A;  1VQL V;  3QO8 A;  5L3D A;  2Q68 A;  1OCR C;  1K73 W;  5B1O A;  4FIP C;  1OCR B;  1JVM A;  2JJ1 G;  2ZDI C;  1QBZ A;  1K97 A;  5IYB O;  1J95 A;  2WPD G;  1COW G;  2XAS A;  4UVA A;  5IYD O;  3CME V;  4PEL A;  1WLE A;  2AHZ A;  1DF4 A;  3E2E A;  1NJI W;  3ZN1 A;  3W7U A;  1DTO A;  2QA4 V;  2ZDI A;  4KUM A;  1KP2 A;  5EBM C;  5B1B C;  4PA6 A;  3QO5 A;  3X2Q C;  3CCV V;  5B1B B;  2JIZ G;  1AI7 A;  4JYC A;  3X2Q B;  1CP9 A;  4KP4 A;  1B6Q A;  1FXK C;  4X89 A;  4RAI A;  2PI5 A;  3CP1 A;  1FXK B;  2XAG A;  1K9M W;  2EIN C;  4PA9 A;  4WF9 V;  1P4R A;  2WLL B;  3SYP A;  1WPX A;  5LHH A;  3ZMU A;  5EBW C;  2V1D A;  1FXK A;  2OCC C;  3ABT A;  4WFA V;  3QNE A;  4JPR A;  2OCC B;  4CZZ A;  3B77 A;  2WLL A;  3SPC A;  5CBG A;  4GX2 A;  3FB8 C;  3JD0 A;  1ZWI C;  3A0R A;  3JD3 A;  1YTF B;  1YTF D;  4P2Z A;  3I55 V;  5E1A C;  2BOC C;  4LBE C;  4MVU A;  5FL7 G;  2V7Q G;  2EJR A;  1GM7 A;  2EIK C;  1V55 C;  2EIK B;  1CPY A;  3UM7 A;  5CBF A;  3DTU B;  1G8M A;  1P7B A;  2H94 A;  1AJP A;  1YI2 V;  1E1Q G;  3JCZ A;  1VQM V;  1R6N A;  2GSM B;  1NVP B;  4BAY A;  1GO3 F;  5J9P C;  2DYS C;  1PL0 A;  4LC1 A;  1Q82 W;  1K7D A;  4JAU A;  4R6Z A;  3CYO A;  3OAA G;  2X6A A;  5LGT A;  3NXS A;  4R8C A;  3STZ C;  2YEV B;  1K4D C;  4GX1 A;  2IJK A;  3CC4 V;  2XAF A;  2EZO A;  1KEC A;  5EK0 A;  4GX5 A;  2HVK C;  1OCO C;  4U7O A;  2QEX V;  2YEV A;  1QCE A;  1OCO B;  3ASN C;  3JD2 A;  3RBZ A;  1M1K W;  4YXW G;  4CBC A;  2ZR2 A;  2NNU A;  3OUS A;  1H2G A;  3T4Z A;  3BEH A;  4TWK A;  3R65 A;  1CEZ A;  3E8F A;  4OXS A;  4HZ3 A;  1YIT V;  4MSW C;  3OEE G;  2P90 A;  1G4Y B;  3ETG A;  3VBB A;  2ATK C;  2X6B A;  2Z3Y A;  2ITC C;  3OMN B;  4JAV A;  4RUF A;  2DYR B;  3B8M A;  3HB3 B;  4QNH B;  5LHI A;  3IC7 A;  1OHH G;  3K79 A;  1QR8 A;  2HFE C;  4ZBM A;  4N23 A;  1F4N A;  1M57 C;  2LP7 A;  3CXC U;  2FTK A;  3OUF A;  1MG1 A;  4JTC B;  1PKX A;  4JTA B;  2IH3 C;  4MVQ A;  2HJF C;  4LCU C;  3JD4 A;  4ZKI A;  3FB6 C;  1BL8 A;  1JX9 A;  1AI6 A;  3K04 A;  1R3K C;  2P6J A;  4EKW A;  2QTO A;  2QKS A;  4F4L A;  3IGA C;  3CCM V;  1MOF A;  4I9W A;  3K06 A;  2P67 A;  3KG2 A;  4WFB V;  4FPP A;  2EZP A;  1E1R G;  3F7V C;  3ML0 A;  3OMI B;  3TK1 A;  1N8R W;  3SPG A;  4G27 B;  3ZRV A;  2Z5U A;  2IJJ A;  3AG1 C;  1SER A;  3BY6 A;  1IXM A;  2EIM C;  4P30 A;  3W7S A;  4MTF A;  2EIM B;  3EHB B;  4WFH A;  3K0G A;  4GT1 A;  5EBL C;  4UVB A;  2X7R B;  3AG3 C;  3K08 A;  1NR1 A;  3AG3 B;  3ABU A;  3TCU A;  2OTJ V;  4P9O A;  2EIJ C;  2EIN B;  2Q6A A;  4MVZ A;  2NLJ C;  5HFM A;  1Y4M A;  2EIJ B;  3CC7 V;  3ZRW B;  4MT8 A;  1MAB G;  1DLB A;  2WLK A;  4QE7 A;  4RQF A;  1EZJ A;  3T4D A;  2JEU A;  3ZMV A;  5L3G A;  2WLN A;  5H9C A;  3ZRW A;  2Y69 C;  2DWE C;  3E83 A;  2B1G A;  2P7T C;  4MW8 A;  1YIJ V;  3ETD A;  2DQ3 A;  4WFF A;  1KQS U;  1M9N A;  4MVS A;  2JJ2 G;  4PDL A;  4X8A A;  5L3E A;  3E8G A;  5DN6 G;  4N21 A;  4QJF B;  1W0J G;  4JYB A;  2LFR A;  3ABL C;  4TT3 G;  2IJH A;  2HVJ C;  3ABL B;  1M90 W;  4P9P A;  1VQ9 V;  1KKD A;  1VQK V;  2ZR3 A;  4MVR A;  4G28 B;  3JD1 A;  1Q81 W;  1V55 B;  1JQ0 A;  2XAJ A;  2A79 B;  1E79 G;  1RPO A;  4BIZ A;  3CC2 V;  5L3C A;  4WCE V;  4PA7 A;  1RM1 C;  3AG2 C;  3G71 V;  3EFF K;  1JCH A;  1K3E A;  2ITD C;  2WLI B;  1RM1 B;  3AG2 B;  2IU0 A;  1K92 A;  2DYS B;  1NVP D;  4JGS A;  1VQ6 V;  1VQN V;  4PDM A;  1XL6 A;  1S0V A;  3CPW U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...