2YSUB

Structure of the complex between btub and colicin e2 receptor binding domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
RNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vitamin B12 transporter btuB
publication title Structure of the complex of the colicin E2 R-domain and its BtuB receptor. The outer membrane colicin translocon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/hydrolase
total genus 47
structure length 123
sequence length 123
ec nomenclature ec 3.1.-.-:
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ysuB00
1UJWB 2YSUB 2B5UA 1JCHA
chains in the Genus database with same CATH superfamily
1WA8A 2KB1A 1QCEA 1IBKB 5IE9A 4DR2B 4DR6B 2V7QG 4KP4A 1KMIZ 4OX9O 2ZXWB 3TJTA 2F93B 1ZUQA 3G71V 1FKAO 3K57A 4WBNB 2UXCB 2YICA 2H8PC 4BIUA 1BS3A 3WFVA 1AJQA 2QEXV 1QVGU 3JATA 2H3OA 2PYJA 1H38A 4DV2B 2BTQA 5FPOA 2RNBA 2VQEO 4J9ZB 1SQBH 4GX0A 1VF7A 1K5QA 3G6EV 2KQXA 1WP7A 2DOSA 3B09A 2IH3C 4OPAA 4DV5O 3OR7C 4O4LA 5BR8B 2JVDA 4CC5A 1VQMV 2MW2B 1FXKC 2WLNA 1R3KC 3M8AA 1ZAUA 3P30A 1I08A 1D5AA 4DV1B 1VQLV 5LXTA 4DV2O 2UUAB 4NR1A 3FFQA 3F7YC 4DRXB 1AP5A 3B2EE 3JASB 2Y4TA 2W6IG 3R65A 1P49A 1ZL8B 2AHZA 4LF7B 5CA1B 3AK3A 3K0DA 2Q68A 3D8CA 1PNKA 3E8FA 4FVMA 3JD3A 3K06A 2EINC 2F43G 1PD3A 2M6YA 4WF9V 3ICXA 3LDDA 4H44B 3ML0A 3ZHTA 3T2MA 3SYOA 5CA0B 1Q43A 3JSLA 3UO3A 4EEQA 4DV1O 4FLXA 4KL1A 4MS2A 2QGNA 4H0LB 4JI5O 2XAGA 1Z5VA 5J2TB 1EN5A 1SQPH 3UT5B 1AI4A 4O4IA 4PI0A 1K33A 1Q90D 2ITDC 5C93A 5JQGB 1I94B 3RYCA 4JI1O 3ZHVA 2UXBO 1K9MW 2GTAA 4A5UB 2Y69C 5JCOA 3OW2U 5GTIZ 3ASOC 3HPLC 1JQ0A 4RQEA 1LUWA 4DK1A 4PD4F 4DR1O 2QWRB 2X0LA 4CZZA 2FYUH 4QGPA 1M1KW 4UXNA 1S5LZ 4LNUB 5CB4A 2X6BA 3SGIA 4XBFA 4WFFA 3ZEDA 1RM1C 1SETA 4TV9B 5H6RA 1R3IC 1L0LH 4LP8A 1M4UA 3OTOB 3CD6V 1YEWA 3K5OA 4DV0O 2YXYA 2P06A 1NVPB 5DN6G 3AG3C 1IXBA 5H5NA 3ZHRA 1THZA 5LOVA 1S72V 4R7CA 4GKJB 2BSKA 2HLDG 2OIEA 4FFBA 1YZBA 3STLC 1MZFA 3H1LH 4DV6B 2Y4UA 2ATKC 4K8XA 2RMKB 5IJ0B 1PNMA 2CAZC 1AJPA 4WFHA 4TT3G 4JASA 2RQ6A 4CBCA 3ZRWA 4I9QA 2WAMA 4J7KA 3TXQA 1F4MA 4GX1A 1QHTA 1IBLB 1TVKA 2WLIB 4K0KB 4LBEC 4DV4B 3ZMZA 2G38A 5LP6C 3W7WA 1J95A 1US6A 1XHXA 1CP9A 5LL6Y 2Q4PA 1Q7YW 4O2AB 3ETGA 3L74H 2JJ1G 4FLVA 2EX3A 2DYRB 3JD2A 1RPOA 1ZTEA 1QBZA 1FFXB 1M56B 1FJGB 2Q8VA 2Q9LA 4LCUC 1R6KA 4JYAB 2P22C 4QPJA 2CTRA 3ZHUA 2LGWA 4U3JA 2NN4A 1GN4A 1NR1A 4LF8O 5B1BC 4D7SA 3HKEA 1IBLO 1H8EG 2B9ZA 4K0KO 4TV8A 4JAVA 2OCCC 5EYPA 2OYQA 3FB7C 4LF4B 4JI0B 1OCZC 5L3BA 4JI3O 1G6UA 2JGDA 1NQTA 2YXLA 2BE3A 1KP3A 1ORQC 3CRAA 1WN7A 5KHJA 5CA3A 2E76B 4FLTA 1FJGO 3G4SV 3L73H 2L35A 4BIZA 1XNRB 3DXRA 1M57C 5IWAO 5LYJA 1S3JA 4KFMA 1IZ3A 3GVMA 1LUVA 2R70A 3RYHA 3IAYA 5E1AC 1GN2A 2CGOA 1MSDA 2YUAA 2LO1A 2ZKOA 4MTFA 2N74A 2GTSA 4X65B 3CCLV 2Y69B 5JJEB 3VQYA 3CPWU 1U97A 3JATB 3EHBB 4LFAO 2BTQB 1JA8A 4BR6A 3CMAV 1W0KG 1NKDA 5F2VO 1ZX3A 1XMOB 3N2GA 3F7VC 2OIGA 5KA6A 4U7OA 2ITCC 3Q4HB 1XNRO 4UCRA 5IY5C 2PF4E 2CH7A 2XNDG 1YITV 1Z5WA 1H2GA 2IBZH 2V4DA 2ZQMA 3KKYA 4I7ZB 2Q0OC 2AGAA 4DR4B 1VF6C 2PZSA 1M90W 3K3WA 3CCSV 3A0RA 4I4TA 1MA1A 2WSSG 2VS0A 2EIMC 1KB9F 3G67A 3NXSA 5LXTB 4IL6Z 1GMGA 2ZINA 3J81N 3UCSC 3J80N 1S5JA 1WB8A 1HR0O 1AI5A 4FLWA 2PTMA 5CA0A 1Q5OA 1KKDA 3CX5F 4X62B 3IC9A 1JFFA 1GK9A 4KUMA 4FLZA 1MSWD 3ZRXA 1SZTA 1MABG 3UT5A 4DR4O 3OUSA 3FD9A 2F95B 2Q73A 1T5EA 1Q81W 1N0JA 3E8GA 1SERA 5JQGA 2YSUB 4MT8A 1KUQA 3RYFA 1AR5A 2K9PA 2LGQA 1O9HA 4FMTA 4BIOA 1NR7A 4OGQB 4PA7A 5D5PA 2DYSB 1GM9A 1XMQB 1AB3A 5LMNO 2QM4A 3SYCA 4K8ZA 4TSFG 3RYCB 1OHHG 1K97A 3B77A 1SQFA 1JPXA 2YEVB 4ZHQA 3G80A 2FKXA 1XHZA 4UVCA 4I55B 5J9PC 2ZM6B 3LSQA 4LFCB 2YIAA 1N32O 2R9AA 3F5TA 3D3IA 5CB4B 5FLXN 1HNXB 3FB6C 2ADPA 3CEIA 4JF3A 1XMQO 3ZMTA 2A3QA 5KHGA 5ITZB 2A7WA 1A32A 3APQA 4KHPB 4J41A 3AG4B 1QR9A 5A2QN 2K1EA 5GW7A 2VWKA 2JEUA 2UU9B 1AI6A 1PKXA 3CCVV 3ASNB 3I5DA 5LOVB 2N05A 3O65A 1OCCC 2BSKB 3JAKA 1I0HA 1K73W 4JYBA 4AHCA 2WLIA 3E89A 5L3FA 2ZM6O 3O9OA 2ZCEA 2QTSA 4YJ3A 4NXMB 4NTYA 3CYOA 1YCIA 3ABKB 4EFEA 5FPRA 4I5SA 3BAAA 4DV7O 5KA5A 1WPBA 4JI4O 2HVKC 1FXKA 1TVKB 4RWUA 3HB3B 4B3SB 5L3CA 1FFXA 3P32A 1B04A 2DWEC 1YIJV 3E83A 3FAVA 1ZSPA 1NZ6A 2RJZA 3L75H 3OEEG 5LHIA 4JTAB 2Z3YA 2N04A 2QM7A 1HDJA 3TCUA 2CE4A 1VMGA 4LC1A 2EJ7A 3PN1A 1E1QG 1QNMA 2GUZA 2ZNJA 4JAUA 1B3QA 2HKOA 1JCHA 4W4LA 4J10A 3ZMUA 3OMIB 3QVNA 4XDLA 1K8AW 3H9VA 2ZT9B 4H33A 3HKEB 4QIWF 2XUMA 4IHJA 4I50B 1SESA 3KCYA 3BABA 4TV8B 5EYPB 2E74B 1KECA 4PDVA 3ZHQA 2EILC 3RN4A 1QR8A 1F4NA 2F4VB 3E8BA 1G8MA 4CH5A 1YTFB 2JGDB 4YY3B 1ENVA 1HNWB 3AG2B 2Y48A 2WPDG 3UQ8A 2EJRA 2CTWA 4UCUA 2GDSA 5DM6V 3A0HZ 1J5EB 1JOYA 4GZRB 2LP7A 3HR0A 3TXSA 1IURA 5LBQA 1BE3H 2HHHO 2HJDA 1FAFA 2YS8A 3AG1B 2M7WA 1EZJA 2WLHA 4KXRA 3ZBHA 3DXRB 2E5LB 5LYJB 5LHGA 5IYZA 3RYHB 4WFGA 4PDMA 1IBKO 4DR2O 4DR6O 4UCVA 4X20A 3H01A 4WCEV 4FZ1A 3LSSA 3Q4HA 4JI4B 3T1HB 1P7GA 4LF9B 2ZE5A 1MG1A 3WB2A 4YY3O 4JI6B 2V1DA 3QO5A 1P7BA 1OV9A 5EBMC 4O2BB 2QA4V 4X88A 4Z1MG 2CTQA 2AW9A 4B3RB 5GONA 2UXCO 3BPZA 3N2GB 3M7MX 3D3QA 2GV9A 2OTLV 4BAYA 3AG7A 2CH7B 2UUBB 2CUGA 2QWQB 4FM1A 1KU9A 3ZN0A 3H1KH 3R66A 4DXWA 3T1YB 1VF5B 2YI8A 3MDSA 2KG7A 4RO2A 4P9PA 4G2KA 3CC2V 2VQFB 4O4HA 3PJSK 4I4TB 1U96A 5EIBD 1YF2A 4UV9A 2DWDC 5LA6B 1N4CA 2H94A 1BHBA 4B3TB 5BR8O 1Y4MA 1HW7A 3LDCA 4B3RO 1VIBA 3L72H 3H1IH 2CK3G 4F4LA 1GM8A 3CCUV 4HNAB 1QQCA 4FM2A 5EBWC 1JFFB 4YHHB 3E2EA 3X2QB 2IM9A 2LFRA 5IDJA 5FL7G 2UUAO 1XDCA 5IJ9A 3T1YO 2ZR3A 4E4EA 2X7RB 4C7UA 1N33B 4LF7O 5B3SC 1H2LA 4L8JA 1Y76A 4PJ0Z 5C8YB 3RYFB 5HFLA 1LNQA 4DV3B 5EK0A 2YEVA 2ZDIC 5E79Z 2QM8A 5KAFZ 4IGGA 4I55A 1HWYA 1V54C 3SYAA 4FLYA 3AK1A 1QLEB 5A9GA 4CS2A 4PA3A 1XUQA 2W0XA 4QE7A 1VQ6V 1JJ2U 2P5OA 3ABLB 2JJ2G 3JD0A 5LHHA 3CRRA 5KLVH 1NI8A 1XILA 4ZHQB 2GBOA 4X1KA 3SJCC 1YDXA 3JALA 3HKDB 5ITZA 1XREA 1NS1A 1BGYH 3N27A 1VQPV 1YI2V 4GX5A 2IJHA 1I94O 2VRZA 4G27B 2OTJV 4I0XA 4IYIA 4JI2B 3JYCA 2WLKA 1XQ8A 4PHZA 2QKAA 5EBLC 3MD0A 1QLNA 4CS3A 4FFKA 1VQ8V 5JJJB 1EN4A 2R72A 3ZN1A 2B1IA 3E22A 1R6TA 2VWJA 4JYYA 4L87A 2F66C 2ZE6A 4UVAA 3OTOO 3JAKB 1AVMA 4TQDA 1SQGA 3APOA 5LMUB 3VOUA 3BFRA 4EFBA 4ABMA 4X1YA 1EZVH 4YJ3B 5CMUA 1MNGA 3M99B 2Q69A 3JAWA 3ZJZA 4GKJO 1CPYA 2DW4A 2FB5A 3L70H 5FNVA 1VF6A 2Q67A 1FXKB 4DV6O 4JAAA 4QNHB 4AQYB 3NR7A 5KHIA 2HEPA 1PP9H 4XDJA 3FAVB 1HP8A 2XOKG 4MVZA 5B1NA 4I50A 4DV4O 1P4RA 3E8HA 4G28B 5H6QA 1P84F 1AJNA 3DC5A 3EFFK 4ICGA 5D5QA 4WFBV 3CCRV 5DEDA 3LDEA 1BZKA 2EINB 2YIBA 4J80A 2AXTZ 3BCCH 5LGUA 1PL0A 3B8NA 2GUZB 1GO3F 3K5LA 4ZOLA 1SQXH 2X6AA 5BZBA 2ILMA 2WWWA 4IHJB 3RW0A 1IXMA 4JGSA 3RWRD 1SQQH 2MK3A 3S3XA 5EC1C 4JYAO 4JI8B 2HP8A 3JARA 3MAQA 4PI2A 3LNNA 1G1XB 1IDSA 5KHKA 1Y6XA 3OGCC 1OCOC 2CGNA 4LF4O 4JI0O 2IW5A 1NTKH 3AEIA 3I56V 3RYIA 3SPHA 3ASOB 4E2LA 3TETA 5JJNB 5KAIZ 1W2BU 4X89A 2EZOA 3DGEA 5IYZB 4O2BA 4YJ2B 1FFTB 2A06H 3BY6A 4LWSA 1YSCA 3VQXA 4X20B 2EIJC 1TGOA 3SPIA 3OEHG 2PGGA 1RM1B 1WLEA 5KUMA 2Q7EA 3SYPA 2D3OW 1BHAA 4UCOA 1SC5B 4DUYB 1M5IA 3SR2C 1DF4A 3AG3B 3T4DA 2EIKC 5CBHA 5GONB 3SPCA 2P4KA 4X65O 4BW9A 4GLXA 3VQWA 2OWOA 5LA6A 4QE9A 4B3MB 4MVOA 4JV5B 3CHXA 3WG7C 4F6RA 1OCRC 3CE2A 4PELA 1IBMB 4DR7B 1F51A 5KMGA 5GTHZ 2KG7B 3OMAB 1E1RG 2IH1C 1NH2D 1XMOO 1V55C 3S3WA 3N2KB 4OPHA 1EBOA 4O4HB 4HNAA 4Q20A 1OJHA 2W0FC 4LF5B 1R6NA 2FMLA 1B6QA 3CS5A 1XI1A 4YIOA 1H2SB 4EKWA 5LP6B 3OGIB 5CBGA 2WLLA 4X64B 4UB6Z 1QVFU 2YIDA 1XBLA 4PDLA 4TUYA 1TUEB 3IC7A 5C8YA 2L6LA 2LFSA 3ETEA 3OR6C 2W6JG 2ZXWC 3BRCA 5DECA 4XDKA 1DK1A 2CDYA 4GCZA 4PDRA 1IBMO 2QTOA 5IJ9B 3K5NA 1PL4A 1Q8IA 4B7KA 2XTAA 4MVUA 1Y76B 4MTXA 4X62O 4J11A 2UXDB 4DK0A 5B1BB 1JX9A 1SQVH 4Z1VA 3CC4V 3RVYA 3HKDA 3CSXA 2OCCB 3MHSC 4X64O 1OCZB 1YVWA 1VQOV 2DQ3A 3A8TA 4MVSA 1NBMG 4X1KB 2EZPA 3JALB 2Y0IA 3QTCA 2QWPB 2QR4A 3CMEV 1N34B 2UUCB 4GYCB 1M57B 3CRMA 5KX5B 2DMXA 3OAAG 1PV0A 2A79B 2F1MA 1JR9A 2RCVA 4I0XB 5EZYA 5HFMA 2HFEC 1BCCH 4GKKB 4DR5B 4NKGB 3U10A 4D6TH 1E79G 1ROPA 1RSOA 4UCSA 4LFCO 1BMFG 1HNZB 1IVSA 3H1JH 1H2MA 5L3DA 1FS0G 3E22B 1HNXO 2XAJA 4DUZB 2OCHA 4IYHA 2XAHA 2O57A 1WJZA 1MOFA 2QWOB 4KHPO 3SPJA 1DLBA 1S77D 4X1YB 2XHBA 2UU9O 5IY5B 4DR3B 4EB6B 1RFYA 4FJCC 2P67A 5IT9N 3CCJV 1H2NA 4NXNB 3JAWB 1VQ7V 2IU3A 3OTFA 5FNVB 4MW3A 2FL4A 4TQFA 5EIBC 4DR5O 2EIKB 4FPPA 4K35A 1K5SA 1SA0B 3EXAA 4DYLA 4W4KA 2HG5C 2QKCA 2HJFC 3JCUZ 2EIMB 1GKFA 5JVDA 3THOA 3CJHA 1S76D 4NXMO 3ABMC 2QWNB 2JS5A 4OX9B 4AILC 4DUZO 3FKSG 2Z0AA 3FB5C 4LF6B 1TUBA 3P3PA 4LR3A 3U11A 4B3SO 2ZD9A 2PYLA 2ZE8A 3CP1A 3W7TA 3JD1A 1Q82W 1VQ9V 4O4JA 5BMVA 2IJIA 1YXBA 4ZOLB 1XOUA 5K1PA 2VQEB 1K7DA 3HKCB 3ABTA 3WU2Z 1SKVA 2YDEA 2P6JA 1K92A 3HKBB 1EM1A 4X9QA 2ZDIA 1B06A 2QJ1A 4PV1B 3BVOA 3JARB 2R9IA 1R3LC 1BT8A 3ETQA 1N0NA 4DV5B 2JIZG 1UFIA 4YJ2A 4LF6O 4HZ3A 2F23A 2KSDA 2UXXA 3K79A 3OMNB 4J42A 3OD4A 5BY1A 2F4VO 3RYIB 3K9AA 2Q7GA 3BHPA 4PA6A 1HNWO 5EC2C 1D2DA 4TWKA 2Y0PA 3LNMB 3D36C 1AI7A 1L8DA 5J2UA 5JH7A 4LWSB 1J5EO 2B5UA 4UCTA 1FXHA 2E5LO 4UUJC 3CB2A 4TOIA 5B1OA 2DQ0A 3F5WC 4NYKA 1GH6A 1L1FA 2Q6AA 4JTDB 3CC7V 2HR3A 1S5HC 2DYRC 2YXHA 4BW5A 3N2KA 3B40A 2FTKA 2PI5A 3T1CA 3EVKA 1M56C 3T1HO 1EFRG 1Y74B 3K9SA 4P30A 5TISZ 3ZX6A 1YHQV 1N8RW 4JI7B 4LF9O 1OCCB 4WFAV 1KD1W 1R3JC 4BWAA 4F6EA 4JI6O 3J7AU 4JI5B 2Q5ZA 2BTOA 4F6RB 1AR1B 5L3EA 5LP6A 2BOBC 4NTWA 5KMGB 4NTXA 4CS4A 3IFXA 3W7XA 1UPGA 3B8MA 3E86A 4JI1B 4OXSA 1SS3A 2UXBB 1RPRA 4FLUA 4I9WA 2UUBO 2P4VA 5AG2A 4LH7A 4QJFB 3K08A 1I7FA 2WLLB 1XEQA 4DR1B 1CEZA 2D2CB 1WB7A 2IJKA 4Q6GA 4HAMA 4TUYB 2AHYA 2VQFO 3DC6A 4QPKA 1GRJA 1YJ9V 4JI7O 1AP6A 3BA9A 1GAXA 1NVPD 3FB8C 1NTMH 4B3TO 1YJWV 4DV0B 3A2FA 1GN3A 2EULA 3TK1A 4IIJA 2LJ2A 4MTOA 3ZMVA 2WA3A 3ABMB 2ADQB 2JS3A 4H37A 3WB1A 3P3NA 4NVPA 4ZI7A 4P9OA 4YHHO 1L0NH 2DN9A 1KP2A 2RDCA 3OE7G 5KUKA 2PUSA 4B08A 1BSMA 1QU7A 3H1HH 4U7NA 2PI4A 3K5MA 1S0VA 2EILB 2KKWA 3FYIB 3KZIZ 4X1IA 3VQVA 1N33O 5KX5A 2RN9A 1YJNV 2ETNA 4DV3O 2JDIG 2PY5A 3CXCU 4PA9A 3FX7A 1UJWB 3UO2A 4R50A 3KCXA 3JAMN 1K34A 2UXNA 4MVQA 4RAIA 2IU0A 1SZXA 2XAQA 1X59A 2XT9A 1URFA 3C3TA 3T4ZA 2JK5C 2YI9A 1AR4A 2ZIMA 4DO2A 1PPJH 1BL8A 5EZYB 3STZC 3QF7A 2XASA 3GWKC 2QE7G 4FIPC 4PA4A 4ZIBA 1MMMA 1KC8W 2ZIOA 1RSOB 4FM0A 2WLMA 2E75B 1PM9A 4EB6A 2AZ2A 3ZRSA 5CN0A 3VBBA 3ZIAG 3SJBC 4JYCA 3GWOA 2P7TC 3L71H 5L3GA 4LF8B 4JI2O 3CRCA 1XNQB 3A0BZ 2YC0A 1SA0A 3CCMV 3QO8A 4CC6A 4X8AA 2ZR2A 4JI3B 3ABUA 3C90A 3W7SA 5B1AC 3K03A 3SPGA 2C2AA 1D5NA 3FYEB 4FK5C 2JRIA 2DYSC 5LMUO 1NTZH 1COWG 4UB8Z 1M9NA 1WNSA 1Z2GA 3AK2A 2BOCC 3SDLA 3ZHSA 5JVDB 3CJHB 4CH6A 5IWAB 2DJVA 4MSWC 1MZEA 4MVMA 4X66B 1VQKV 5JCOC 1XNQO 1NU1H 3DTUB 1VQ4V 4HYOA 3HKCA 1TUBB 1ZWIC 1VARA 3CXHF 1W0JG 4UV8A 4AQYO 2DE0X 3HKBA 3OT7A 1KKCA 1V9PA 4O4JB 4RUFA 5BMVB 1WA8B 4LFAB 4CH4A 1GTOA 4RUEA 1Q6UA 4CH3A 4WBNA 5B3SB 3AG4C 4J9YB 3I55V 1Q6IA 3B4SA 4U3FH 4Z2WA 1DF5A 4GUNA 3OM3B 1VQNV 3ASNC 1H8HG 5IYCO 1N36B 3QG5A 4X66O 1FD9A 1KBHA 1V54B 3E35A 1VQ5V 1I5YA 1AILA 1W59A 4LFBB 4D7TA 4YXWG 1RP3B 2A9HA 1K3EA 2LW1A 1XL6A 2BCCH 5KHHA 4DW1A 1FYJA 1DGSA 2XAFA 3SJQC 4JI8O 1IX9A 3ABKC 1NT2B 3DSQA 2A0LA 1XL4A 1VEWA 1JJOA 1SRYA 4LH6A 5J2UB 2ZNIA 5JH7B 4H13B 1HR0B 1WPXA 1AROP 1Y74A 3ZMSA 1K4CC 2P90A 3K59A 4DW0A 3RFRA 2R9RB 1N36O 5JWPA 4O4LB 1K4DC 4DRXA 2OT5A 3JASA 1DTOA 4LFBO 1VP7A 1ZL8A 5CA1A 4JPRA 5B66Z 1G4YB 4MVRA 3RBZA 4YIPA 2LQTA 3IJ4A 3JSNA 2AZ0A 1Q86W 5LMNB 4DUYO 3RT3C 3UKMA 2QSAA 4MTGA 4GT1A 2NLJC 4K3AA 5H9CA 4B3MO 4JV5O 4ZKIA 3ZCCA 4RQFA 1FXVA 5J2TA 1H2KA 4DR7O 2HVJC 3IGAC 4N21A 3AG2C 2LW7A 5H2FZ 3KG2A 3QNEA 1R1BA 1I5XA 1WP8A 2ARHA 1N32B 5B1AB 4LF5O 1F23A 3BA8A 3WB0A 1X4TA 3AG1C 1NH2B 1EN6A 3G6BA 5LGNA 5IYBO 4IT5A 2WLJA 1CXZB 5K1XA 4O4IB 2Q7HA 2E3CA 1Y67A 2ZE7A 4IIJB 1SF9A 1WAZA 4LNUA 4ZI7B 1TAEA 1OZ0A 3LSUA 4TV9A 4B7EA 1BQZA 2Q0AA 4ZBMA 2IJJA 5IYDO 4NB5A 4JZ2A 4AI8A 4X1IB 3L9DA 3ETDA 5LGTA 3UM7A 1TA8A 1NJIW 1FPOA 2UXDO 3GB7C 4ASUG 4GX2A 3CCQV 3SJAC 4DV7B 1JVMA 4N23A 3JD4A 2QDOA 3SYQA 1OCOB 4J7JA 5IJ0A 4UVBA 1KQSU 2GSMB 1GN6A 2Z5UA 4R8CA 1ZLZA 4MW8A 1Y66A 1PNLA 3D36A 4HBNA 4FFBB 3K04A 4J7ZA 3LUTB 1BQ0A 2B1GA 2NR5A 2CTPA 1N34O 2EIJB 1Q3EA 2UUCO 2JEXA 5CBFA 4P2ZA 1GM7A 3CCEV 1Q6HA 3K0GA 2JGUA 2ODMA 4O2AA 4R6ZA 3ZRWB 2X6CA 3OUFA 4JTCB 1JMKC 1O9GA 4WFEA 4FZ0A 3X2QC 3RVZA 1M93A 4GKKO 3OFNG 2YIBD 1R73A 3CWBH 3JCZA 1YTFD 2GHYA 2WA4A 5BXZA 3QO7A 1HNZO 3ZS8C 3WG7B 1OCRB 5B5EZ 1F7YA 4JZGA 3RGBA 3C3SA 3MHHC 1V55B 2EBOA 3BEHA 1QLEC 4UFZA 4DR3O 2HHHB 1LR1A 3W7UA 3ZRVA 3U0ZA 1KYOF 3ABLC 2NNUA 4NXNO 2QKSA 4U3JB 3TGUH 3K58A 3CRQA
chains in the Genus database with same CATH topology
2KB1A 1GM9A 1QCEA 3FB8C 2X6AA 1YJWV 5BZBA 2WWWA 3SYCA 3TK1A 3RW0A 1IXMA 2V7QG 4JGSA 4KP4A 4MTOA 3ZMVA 3ABMB 4TSFG 4H37A 2MK3A 5EC1C 1OHHG 4P9OA 1K97A 3B77A 2ZXWB 1JPXA 1KP2A 2YEVB 3OE7G 5KUKA 4UVCA 4U7NA 3G71V 2PI4A 5J9PC 1S0VA 2EILB 3OGCC 3FYIB 3LSQA 1OCOC 2H8PC 4BIUA 2IW5A 3AEIA 3I56V 3SPHA 3D3IA 3WFVA 3ASOB 1YJNV 4E2LA 3TETA 2JDIG 1AJQA 1W2BU 2QEXV 4X89A 2EZOA 3CXCU 1QVGU 3FB6C 4PA9A 3DGEA 1UJWB 4JF3A 4R50A 1H38A 3ZMTA 1K34A 2UXNA 1FFTB 4MVQA 4RAIA 2IU0A 2XAQA 4J9ZB 3AG4B 4GX0A 1QR9A 3BY6A 1YSCA 2K1EA 5GW7A 3T4ZA 2EIJC 2JEUA 3SPIA 1AI6A 1PKXA 3CCVV 3ASNB 3OEHG 2JK5C 1K5QA 3G6EV 1RM1B 1WLEA 5KUMA 4DO2A 3SYPA 1BL8A 1OCCC 2IH3C 3OR7C 3STZC 1K73W 2XASA 4JYBA 2D3OW 2WLIA 1BHAA 2QE7G 3E89A 4FIPC 1VQMV 4PA4A 5L3FA 1FXKC 1DF4A 3AG3B 3T4DA 1KC8W 2WLNA 2EIKC 5CBHA 2WLMA 3SPCA 1R3KC 3ZRSA 5CN0A 3VBBA 3P30A 3ZIAG 3CYOA 4QE9A 3ABKB 4JYCA 3GWOA 2P7TC 4MVOA 1VQLV 4I5SA 5L3GA 3WG7C 1OCRC 4PELA 5KA5A 2HVKC 1FXKA 1F51A 3HB3B 3F7YC 3R65A 3OMAB 2W6IG 5L3CA 1E1RG 2IH1C 3CCMV 1NH2D 3P32A 2AHZA 1V55C 2DWEC 3QO8A 3K0DA 1YIJV 3E83A 4X8AA 1EBOA 2ZR2A 2Q68A 3ABUA 4Q20A 3W7SA 2W0FC 1PNKA 3E8FA 1R6NA 3JD3A 5B1AC 3K06A 2EINC 3K03A 1B6QA 3SPGA 2F43G 2C2AA 1PD3A 4EKWA 4WF9V 3OEEG 3FYEB 5LHIA 4FK5C 2DYSC 4JTAB 2Z3YA 5CBGA 2WLLA 3LDDA 1QVFU 2QM7A 1COWG 3ML0A 3TCUA 4LC1A 4PDLA 3T2MA 1M9NA 1TUEB 3IC7A 2BOCC 3SYOA 2LFSA 1E1QG 3ETEA 3OR6C 2W6JG 4MSWC 4JAUA 4MVMA 2HKOA 1JCHA 4MS2A 3ZMUA 2ZXWC 3OMIB 1VQKV 2XAGA 4XDKA 4XDLA 1K8AW 4H33A 4GCZA 4PDRA 2QTOA 3DTUB 4QIWF 1VQ4V 4HYOA 1SESA 1AI4A 1K33A 1KECA 1ZWIC 2ITDC 4PDVA 1W0JG 2EILC 4UV8A 5C93A 1QR8A 4MVUA 1F4NA 3E8BA 4MTXA 1G8MA 1K9MW 1YTFB 2Y69C 4RUFA 1ENVA 3OW2U 5B1BB 1JX9A 3ASOC 3HPLC 3CC4V 1JQ0A 3AG2B 2Y48A 3RVYA 4RQEA 2WPDG 2EJRA 1GTOA 2OCCB 4RUEA 3MHSC 2X0LA 5B3SB 1OCZB 5DM6V 4CZZA 1M1KW 1JOYA 3AG4C 2LP7A 4J9YB 1VQOV 2DQ3A 5LBQA 3I55V 4MVSA 3AG1B 1DF5A 2M7WA 1EZJA 2WLHA 4UXNA 3OM3B 1NBMG 1VQNV 3ASNC 5LHGA 2X6BA 1RM1C 4XBFA 4WFFA 1H8HG 5IYCO 1SETA 5H6RA 1R3IC 4LP8A 3CD6V 1V54B 2EZPA 3E35A 1VQ5V 4WFGA 4PDMA 1I5YA 3CMEV 1NVPB 4YXWG 2A9HA 3H01A 1K3EA 4WCEV 1XL6A 5DN6G 3AG3C 3LSSA 1M57B 3OAAG 1THZA 2A79B 1NVPD 2XAFA 1S72V 1MG1A 3SJQC 4R7CA 2V1DA 3QO5A 5HFMA 3ABKC 2HLDG 3STLC 2A0LA 2HFEC 1XL4A 1P7BA 5EBMC 2QA4V 4X88A 1SRYA 4Z1MG 2ATKC 1E79G 1ROPA 1PNMA 1BMFG 1AJPA 4WFHA 4TT3G 1WPXA 1AROP 3ZMSA 4JASA 1K4CC 2OTLV 2P90A 4CBCA 4BAYA 3ZRWA 2WAMA 5L3DA 1F4MA 1FS0G 2R9RB 4GX1A 2XAJA 3ZN0A 2XAHA 1K4DC 2WLIB 1MOFA 4DXWA 4LBEC 3ZMZA 2OT5A 1DTOA 4RO2A 3SPJA 1DLBA 4P9PA 1S77D 4JPRA 4G2KA 3CC2V 3W7WA 1J95A 5IY5B 3PJSK 1CP9A 4UV9A 2DWDC 1G4YB 4FJCC 2P67A 4MVRA 3RBZA 3CCJV 1Q7YW 3ETGA 1VQ7V 2H94A 2IU3A 1BHBA 2JJ1G 4MW3A 1Q86W 2DYRB 3JD2A 2EIKB 4FPPA 1RPOA 1Y4MA 1K5SA 3LDCA 1QBZA 1M56B 2HG5C 3UKMA 2HJFC 2CK3G 4F4LA 1GM8A 3CCUV 2EIMB 1GKFA 4MTGA 4LCUC 1R6KA 3ABMC 1S76D 5EBWC 4GT1A 2NLJC 4QPJA 3E2EA 5H9CA 3X2QB 4ZKIA 1NR1A 2LFRA 3ZCCA 4RQFA 3FKSG 1FXVA 5FL7G 5IDJA 5B1BC 2HVJC 1H8EG 3IGAC 3FB5C 4N21A 3AG2C 2ZR3A 3KG2A 3QNEA 4JAVA 2OCCC 1I5XA 2ZD9A 2X7RB 3FB7C 5B3SC 1OCZC 5L3BA 5B1AB 1F23A 3CP1A 5HFLA 3W7TA 3JD1A 1Q82W 1LNQA 3AG1C 1NH2B 1VQ9V 5EK0A 5LGNA 2YEVA 1NQTA 2IJIA 2ZDIC 1KP3A 5IYBO 2QM8A 1ORQC 2WLJA 3SYAA 1HWYA 1V54C 1K7DA 3ABTA 1QLEB 4PA3A 5CA3A 4QE7A 2P6JA 1VQ6V 3G4SV 1K92A 1JJ2U 3ABLB 4BIZA 2JJ2G 3JD0A 5LHHA 1M57C 2ZDIA 1S3JA 1OZ0A 4KFMA 2R9IA 1R3LC 4ZBMA 2JIZG 2IJJA 5E1AC 5IYDO 4HZ3A 1VQPV 1YI2V 4GX5A 2UXXA 3K79A 3OMNB 3ETDA 4MTFA 2IJHA 5LGTA 4G27B 3UM7A 2OTJV 3CCLV 2Y69B 1NJIW 3K9AA 3CPWU 3GB7C 4PA6A 5EC2C 4TWKA 4ASUG 4GX2A 3CCQV 3EHBB 3JYCA 3LNMB 1JVMA 4N23A 3JD4A 1AI7A 2WLKA 3SYQA 3CMAV 1OCOB 1W0KG 1NKDA 5EBLC 3MD0A 3F7VC 1QLNA 5KA6A 4U7OA 2B5UA 2ITCC 1VQ8V 1FXHA 4UVBA 3ZN1A 1KQSU 2B1IA 5IY5C 2GSMB 2PI5A 2Z5UA 2XNDG 4UUJC 4R8CA 2DQ0A 5B1OA 4MW8A 3F5WC 1Y66A 1PNLA 4L87A 1YITV 1H2GA 2ZQMA 3D36A 4UVAA 1L1FA 3K04A 3LUTB 2Q6AA 4JTDB 3CC7V 2B1GA 3VOUA 2HR3A 1S5HC 2DYRC 2EIJB 1M90W 3K3WA 2JEXA 4BW5A 3CCSV 5CBFA 3A0RA 2FTKA 2WSSG 4P2ZA 5CMUA 1GM7A 3M99B 1M56C 3T1CA 1EFRG 4P30A 1N8RW 3CCEV 1YHQV 2EIMC 3K0GA 1OCCB 2Q69A 4WFAV 4R6ZA 3ZRWB 1KD1W 1R3JC 3NXSA 3ZJZA 2X6CA 3OUFA 1CPYA 4JTCB 2DW4A 4WFEA 3X2QC 1AR1B 5L3EA 3RVZA 2BOBC 1GMGA 2Q67A 1FXKB 3OFNG 1R73A 3IFXA 3JCZA 3W7XA 1YTFD 4QNHB 3B8MA 3E86A 1AI5A 2GHYA 4OXSA 1KKDA 3QO7A 1RPRA 4XDJA 3WG7B 1OCRB 4I9WA 1GK9A 4KUMA 1MSWD 3ZRXA 2XOKG 4MVZA 4QJFB 1SZTA 1MABG 5B1NA 3K08A 3OUSA 3MHHC 2WLLB 1P4RA 1V55B 3E8HA 2EBOA 1Q81W 1CEZA 2IJKA 3E8GA 3BEHA 4G28B 1QLEC 1AJNA 3EFFK 4HAMA 5H6QA 2AHYA 4WFBV 3CCRV 1SERA 2YSUB 3LDEA 4MT8A 4QPKA 2EINB 3W7UA 3ZRVA 1YJ9V 5LGUA 1PL0A 3ABLC 2NNUA 4FMTA 3B8NA 2QKSA 1NR7A 4PA7A 1GO3F 2DYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJW B;  2YSU B;  2B5U A;  1JCH A; 
#chains in the Genus database with same CATH topology
 1WA8 A;  2KB1 A;  1QCE A;  1IBK B;  5IE9 A;  4DR2 B;  4DR6 B;  2V7Q G;  4KP4 A;  1KMI Z;  4OX9 O;  2ZXW B;  3TJT A;  2F93 B;  1ZUQ A;  3G71 V;  1FKA O;  3K57 A;  4WBN B;  2UXC B;  2YIC A;  2H8P C;  4BIU A;  1BS3 A;  3WFV A;  1AJQ A;  2QEX V;  1QVG U;  3JAT A;  2H3O A;  2PYJ A;  1H38 A;  4DV2 B;  2BTQ A;  5FPO A;  2RNB A;  2VQE O;  4J9Z B;  1SQB H;  4GX0 A;  1VF7 A;  1K5Q A;  3G6E V;  2KQX A;  1WP7 A;  2DOS A;  3B09 A;  2IH3 C;  4OPA A;  4DV5 O;  3OR7 C;  4O4L A;  5BR8 B;  2JVD A;  4CC5 A;  1VQM V;  2MW2 B;  1FXK C;  2WLN A;  1R3K C;  3M8A A;  1ZAU A;  3P30 A;  1I08 A;  1D5A A;  4DV1 B;  1VQL V;  5LXT A;  4DV2 O;  2UUA B;  4NR1 A;  3FFQ A;  3F7Y C;  4DRX B;  1AP5 A;  3B2E E;  3JAS B;  2Y4T A;  2W6I G;  3R65 A;  1P49 A;  1ZL8 B;  2AHZ A;  4LF7 B;  5CA1 B;  3AK3 A;  3K0D A;  2Q68 A;  3D8C A;  1PNK A;  3E8F A;  4FVM A;  3JD3 A;  3K06 A;  2EIN C;  2F43 G;  1PD3 A;  2M6Y A;  4WF9 V;  3ICX A;  3LDD A;  4H44 B;  3ML0 A;  3ZHT A;  3T2M A;  3SYO A;  5CA0 B;  1Q43 A;  3JSL A;  3UO3 A;  4EEQ A;  4DV1 O;  4FLX A;  4KL1 A;  4MS2 A;  2QGN A;  4H0L B;  4JI5 O;  2XAG A;  1Z5V A;  5J2T B;  1EN5 A;  1SQP H;  3UT5 B;  1AI4 A;  4O4I A;  4PI0 A;  1K33 A;  1Q90 D;  2ITD C;  5C93 A;  5JQG B;  1I94 B;  3RYC A;  4JI1 O;  3ZHV A;  2UXB O;  1K9M W;  2GTA A;  4A5U B;  2Y69 C;  5JCO A;  3OW2 U;  5GTI Z;  3ASO C;  3HPL C;  1JQ0 A;  4RQE A;  1LUW A;  4DK1 A;  4PD4 F;  4DR1 O;  2QWR B;  2X0L A;  4CZZ A;  2FYU H;  4QGP A;  1M1K W;  4UXN A;  1S5L Z;  4LNU B;  5CB4 A;  2X6B A;  3SGI A;  4XBF A;  4WFF A;  3ZED A;  1RM1 C;  1SET A;  4TV9 B;  5H6R A;  1R3I C;  1L0L H;  4LP8 A;  1M4U A;  3OTO B;  3CD6 V;  1YEW A;  3K5O A;  4DV0 O;  2YXY A;  2P06 A;  1NVP B;  5DN6 G;  3AG3 C;  1IXB A;  5H5N A;  3ZHR A;  1THZ A;  5LOV A;  1S72 V;  4R7C A;  4GKJ B;  2BSK A;  2HLD G;  2OIE A;  4FFB A;  1YZB A;  3STL C;  1MZF A;  3H1L H;  4DV6 B;  2Y4U A;  2ATK C;  4K8X A;  2RMK B;  5IJ0 B;  1PNM A;  2CAZ C;  1AJP A;  4WFH A;  4TT3 G;  4JAS A;  2RQ6 A;  4CBC A;  3ZRW A;  4I9Q A;  2WAM A;  4J7K A;  3TXQ A;  1F4M A;  4GX1 A;  1QHT A;  1IBL B;  1TVK A;  2WLI B;  4K0K B;  4LBE C;  4DV4 B;  3ZMZ A;  2G38 A;  5LP6 C;  3W7W A;  1J95 A;  1US6 A;  1XHX A;  1CP9 A;  5LL6 Y;  2Q4P A;  1Q7Y W;  4O2A B;  3ETG A;  3L74 H;  2JJ1 G;  4FLV A;  2EX3 A;  2DYR B;  3JD2 A;  1RPO A;  1ZTE A;  1QBZ A;  1FFX B;  1M56 B;  1FJG B;  2Q8V A;  2Q9L A;  4LCU C;  1R6K A;  4JYA B;  2P22 C;  4QPJ A;  2CTR A;  3ZHU A;  2LGW A;  4U3J A;  2NN4 A;  1GN4 A;  1NR1 A;  4LF8 O;  5B1B C;  4D7S A;  3HKE A;  1IBL O;  1H8E G;  2B9Z A;  4K0K O;  4TV8 A;  4JAV A;  2OCC C;  5EYP A;  2OYQ A;  3FB7 C;  4LF4 B;  4JI0 B;  1OCZ C;  5L3B A;  4JI3 O;  1G6U A;  2JGD A;  1NQT A;  2YXL A;  2BE3 A;  1KP3 A;  1ORQ C;  3CRA A;  1WN7 A;  5KHJ A;  5CA3 A;  2E76 B;  4FLT A;  1FJG O;  3G4S V;  3L73 H;  2L35 A;  4BIZ A;  1XNR B;  3DXR A;  1M57 C;  5IWA O;  5LYJ A;  1S3J A;  4KFM A;  1IZ3 A;  3GVM A;  1LUV A;  2R70 A;  3RYH A;  3IAY A;  5E1A C;  1GN2 A;  2CGO A;  1MSD A;  2YUA A;  2LO1 A;  2ZKO A;  4MTF A;  2N74 A;  2GTS A;  4X65 B;  3CCL V;  2Y69 B;  5JJE B;  3VQY A;  3CPW U;  1U97 A;  3JAT B;  3EHB B;  4LFA O;  2BTQ B;  1JA8 A;  4BR6 A;  3CMA V;  1W0K G;  1NKD A;  5F2V O;  1ZX3 A;  1XMO B;  3N2G A;  3F7V C;  2OIG A;  5KA6 A;  4U7O A;  2ITC C;  3Q4H B;  1XNR O;  4UCR A;  5IY5 C;  2PF4 E;  2CH7 A;  2XND G;  1YIT V;  1Z5W A;  1H2G A;  2IBZ H;  2V4D A;  2ZQM A;  3KKY A;  4I7Z B;  2Q0O C;  2AGA A;  4DR4 B;  1VF6 C;  2PZS A;  1M90 W;  3K3W A;  3CCS V;  3A0R A;  4I4T A;  1MA1 A;  2WSS G;  2VS0 A;  2EIM C;  1KB9 F;  3G67 A;  3NXS A;  5LXT B;  4IL6 Z;  1GMG A;  2ZIN A;  3J81 N;  3UCS C;  3J80 N;  1S5J A;  1WB8 A;  1HR0 O;  1AI5 A;  4FLW A;  2PTM A;  5CA0 A;  1Q5O A;  1KKD A;  3CX5 F;  4X62 B;  3IC9 A;  1JFF A;  1GK9 A;  4KUM A;  4FLZ A;  1MSW D;  3ZRX A;  1SZT A;  1MAB G;  3UT5 A;  4DR4 O;  3OUS A;  3FD9 A;  2F95 B;  2Q73 A;  1T5E A;  1Q81 W;  1N0J A;  3E8G A;  1SER A;  5JQG A;  2YSU B;  4MT8 A;  1KUQ A;  3RYF A;  1AR5 A;  2K9P A;  2LGQ A;  1O9H A;  4FMT A;  4BIO A;  1NR7 A;  4OGQ B;  4PA7 A;  5D5P A;  2DYS B;  1GM9 A;  1XMQ B;  1AB3 A;  5LMN O;  2QM4 A;  3SYC A;  4K8Z A;  4TSF G;  3RYC B;  1OHH G;  1K97 A;  3B77 A;  1SQF A;  1JPX A;  2YEV B;  4ZHQ A;  3G80 A;  2FKX A;  1XHZ A;  4UVC A;  4I55 B;  5J9P C;  2ZM6 B;  3LSQ A;  4LFC B;  2YIA A;  1N32 O;  2R9A A;  3F5T A;  3D3I A;  5CB4 B;  5FLX N;  1HNX B;  3FB6 C;  2ADP A;  3CEI A;  4JF3 A;  1XMQ O;  3ZMT A;  2A3Q A;  5KHG A;  5ITZ B;  2A7W A;  1A32 A;  3APQ A;  4KHP B;  4J41 A;  3AG4 B;  1QR9 A;  5A2Q N;  2K1E A;  5GW7 A;  2VWK A;  2JEU A;  2UU9 B;  1AI6 A;  1PKX A;  3CCV V;  3ASN B;  3I5D A;  5LOV B;  2N05 A;  3O65 A;  1OCC C;  2BSK B;  3JAK A;  1I0H A;  1K73 W;  4JYB A;  4AHC A;  2WLI A;  3E89 A;  5L3F A;  2ZM6 O;  3O9O A;  2ZCE A;  2QTS A;  4YJ3 A;  4NXM B;  4NTY A;  3CYO A;  1YCI A;  3ABK B;  4EFE A;  5FPR A;  4I5S A;  3BAA A;  4DV7 O;  5KA5 A;  1WPB A;  4JI4 O;  2HVK C;  1FXK A;  1TVK B;  4RWU A;  3HB3 B;  4B3S B;  5L3C A;  1FFX A;  3P32 A;  1B04 A;  2DWE C;  1YIJ V;  3E83 A;  3FAV A;  1ZSP A;  1NZ6 A;  2RJZ A;  3L75 H;  3OEE G;  5LHI A;  4JTA B;  2Z3Y A;  2N04 A;  2QM7 A;  1HDJ A;  3TCU A;  2CE4 A;  1VMG A;  4LC1 A;  2EJ7 A;  3PN1 A;  1E1Q G;  1QNM A;  2GUZ A;  2ZNJ A;  4JAU A;  1B3Q A;  2HKO A;  1JCH A;  4W4L A;  4J10 A;  3ZMU A;  3OMI B;  3QVN A;  4XDL A;  1K8A W;  3H9V A;  2ZT9 B;  4H33 A;  3HKE B;  4QIW F;  2XUM A;  4IHJ A;  4I50 B;  1SES A;  3KCY A;  3BAB A;  4TV8 B;  5EYP B;  2E74 B;  1KEC A;  4PDV A;  3ZHQ A;  2EIL C;  3RN4 A;  1QR8 A;  1F4N A;  2F4V B;  3E8B A;  1G8M A;  4CH5 A;  1YTF B;  2JGD B;  4YY3 B;  1ENV A;  1HNW B;  3AG2 B;  2Y48 A;  2WPD G;  3UQ8 A;  2EJR A;  2CTW A;  4UCU A;  2GDS A;  5DM6 V;  3A0H Z;  1J5E B;  1JOY A;  4GZR B;  2LP7 A;  3HR0 A;  3TXS A;  1IUR A;  5LBQ A;  1BE3 H;  2HHH O;  2HJD A;  1FAF A;  2YS8 A;  3AG1 B;  2M7W A;  1EZJ A;  2WLH A;  4KXR A;  3ZBH A;  3DXR B;  2E5L B;  5LYJ B;  5LHG A;  5IYZ A;  3RYH B;  4WFG A;  4PDM A;  1IBK O;  4DR2 O;  4DR6 O;  4UCV A;  4X20 A;  3H01 A;  4WCE V;  4FZ1 A;  3LSS A;  3Q4H A;  4JI4 B;  3T1H B;  1P7G A;  4LF9 B;  2ZE5 A;  1MG1 A;  3WB2 A;  4YY3 O;  4JI6 B;  2V1D A;  3QO5 A;  1P7B A;  1OV9 A;  5EBM C;  4O2B B;  2QA4 V;  4X88 A;  4Z1M G;  2CTQ A;  2AW9 A;  4B3R B;  5GON A;  2UXC O;  3BPZ A;  3N2G B;  3M7M X;  3D3Q A;  2GV9 A;  2OTL V;  4BAY A;  3AG7 A;  2CH7 B;  2UUB B;  2CUG A;  2QWQ B;  4FM1 A;  1KU9 A;  3ZN0 A;  3H1K H;  3R66 A;  4DXW A;  3T1Y B;  1VF5 B;  2YI8 A;  3MDS A;  2KG7 A;  4RO2 A;  4P9P A;  4G2K A;  3CC2 V;  2VQF B;  4O4H A;  3PJS K;  4I4T B;  1U96 A;  5EIB D;  1YF2 A;  4UV9 A;  2DWD C;  5LA6 B;  1N4C A;  2H94 A;  1BHB A;  4B3T B;  5BR8 O;  1Y4M A;  1HW7 A;  3LDC A;  4B3R O;  1VIB A;  3L72 H;  3H1I H;  2CK3 G;  4F4L A;  1GM8 A;  3CCU V;  4HNA B;  1QQC A;  4FM2 A;  5EBW C;  1JFF B;  4YHH B;  3E2E A;  3X2Q B;  2IM9 A;  2LFR A;  5IDJ A;  5FL7 G;  2UUA O;  1XDC A;  5IJ9 A;  3T1Y O;  2ZR3 A;  4E4E A;  2X7R B;  4C7U A;  1N33 B;  4LF7 O;  5B3S C;  1H2L A;  4L8J A;  1Y76 A;  4PJ0 Z;  5C8Y B;  3RYF B;  5HFL A;  1LNQ A;  4DV3 B;  5EK0 A;  2YEV A;  2ZDI C;  5E79 Z;  2QM8 A;  5KAF Z;  4IGG A;  4I55 A;  1HWY A;  1V54 C;  3SYA A;  4FLY A;  3AK1 A;  1QLE B;  5A9G A;  4CS2 A;  4PA3 A;  1XUQ A;  2W0X A;  4QE7 A;  1VQ6 V;  1JJ2 U;  2P5O A;  3ABL B;  2JJ2 G;  3JD0 A;  5LHH A;  3CRR A;  5KLV H;  1NI8 A;  1XIL A;  4ZHQ B;  2GBO A;  4X1K A;  3SJC C;  1YDX A;  3JAL A;  3HKD B;  5ITZ A;  1XRE A;  1NS1 A;  1BGY H;  3N27 A;  1VQP V;  1YI2 V;  4GX5 A;  2IJH A;  1I94 O;  2VRZ A;  4G27 B;  2OTJ V;  4I0X A;  4IYI A;  4JI2 B;  3JYC A;  2WLK A;  1XQ8 A;  4PHZ A;  2QKA A;  5EBL C;  3MD0 A;  1QLN A;  4CS3 A;  4FFK A;  1VQ8 V;  5JJJ B;  1EN4 A;  2R72 A;  3ZN1 A;  2B1I A;  3E22 A;  1R6T A;  2VWJ A;  4JYY A;  4L87 A;  2F66 C;  2ZE6 A;  4UVA A;  3OTO O;  3JAK B;  1AVM A;  4TQD A;  1SQG A;  3APO A;  5LMU B;  3VOU A;  3BFR A;  4EFB A;  4ABM A;  4X1Y A;  1EZV H;  4YJ3 B;  5CMU A;  1MNG A;  3M99 B;  2Q69 A;  3JAW A;  3ZJZ A;  4GKJ O;  1CPY A;  2DW4 A;  2FB5 A;  3L70 H;  5FNV A;  1VF6 A;  2Q67 A;  1FXK B;  4DV6 O;  4JAA A;  4QNH B;  4AQY B;  3NR7 A;  5KHI A;  2HEP A;  1PP9 H;  4XDJ A;  3FAV B;  1HP8 A;  2XOK G;  4MVZ A;  5B1N A;  4I50 A;  4DV4 O;  1P4R A;  3E8H A;  4G28 B;  5H6Q A;  1P84 F;  1AJN A;  3DC5 A;  3EFF K;  4ICG A;  5D5Q A;  4WFB V;  3CCR V;  5DED A;  3LDE A;  1BZK A;  2EIN B;  2YIB A;  4J80 A;  2AXT Z;  3BCC H;  5LGU A;  1PL0 A;  3B8N A;  2GUZ B;  1GO3 F;  3K5L A;  4ZOL A;  1SQX H;  2X6A A;  5BZB A;  2ILM A;  2WWW A;  4IHJ B;  3RW0 A;  1IXM A;  4JGS A;  3RWR D;  1SQQ H;  2MK3 A;  3S3X A;  5EC1 C;  4JYA O;  4JI8 B;  2HP8 A;  3JAR A;  3MAQ A;  4PI2 A;  3LNN A;  1G1X B;  1IDS A;  5KHK A;  1Y6X A;  3OGC C;  1OCO C;  2CGN A;  4LF4 O;  4JI0 O;  2IW5 A;  1NTK H;  3AEI A;  3I56 V;  3RYI A;  3SPH A;  3ASO B;  4E2L A;  3TET A;  5JJN B;  5KAI Z;  1W2B U;  4X89 A;  2EZO A;  3DGE A;  5IYZ B;  4O2B A;  4YJ2 B;  1FFT B;  2A06 H;  3BY6 A;  4LWS A;  1YSC A;  3VQX A;  4X20 B;  2EIJ C;  1TGO A;  3SPI A;  3OEH G;  2PGG A;  1RM1 B;  1WLE A;  5KUM A;  2Q7E A;  3SYP A;  2D3O W;  1BHA A;  4UCO A;  1SC5 B;  4DUY B;  1M5I A;  3SR2 C;  1DF4 A;  3AG3 B;  3T4D A;  2EIK C;  5CBH A;  5GON B;  3SPC A;  2P4K A;  4X65 O;  4BW9 A;  4GLX A;  3VQW A;  2OWO A;  5LA6 A;  4QE9 A;  4B3M B;  4MVO A;  4JV5 B;  3CHX A;  3WG7 C;  4F6R A;  1OCR C;  3CE2 A;  4PEL A;  1IBM B;  4DR7 B;  1F51 A;  5KMG A;  5GTH Z;  2KG7 B;  3OMA B;  1E1R G;  2IH1 C;  1NH2 D;  1XMO O;  1V55 C;  3S3W A;  3N2K B;  4OPH A;  1EBO A;  4O4H B;  4HNA A;  4Q20 A;  1OJH A;  2W0F C;  4LF5 B;  1R6N A;  2FML A;  1B6Q A;  3CS5 A;  1XI1 A;  4YIO A;  1H2S B;  4EKW A;  5LP6 B;  3OGI B;  5CBG A;  2WLL A;  4X64 B;  4UB6 Z;  1QVF U;  2YID A;  1XBL A;  4PDL A;  4TUY A;  1TUE B;  3IC7 A;  5C8Y A;  2L6L A;  2LFS A;  3ETE A;  3OR6 C;  2W6J G;  2ZXW C;  3BRC A;  5DEC A;  4XDK A;  1DK1 A;  2CDY A;  4GCZ A;  4PDR A;  1IBM O;  2QTO A;  5IJ9 B;  3K5N A;  1PL4 A;  1Q8I A;  4B7K A;  2XTA A;  4MVU A;  1Y76 B;  4MTX A;  4X62 O;  4J11 A;  2UXD B;  4DK0 A;  5B1B B;  1JX9 A;  1SQV H;  4Z1V A;  3CC4 V;  3RVY A;  3HKD A;  3CSX A;  2OCC B;  3MHS C;  4X64 O;  1OCZ B;  1YVW A;  1VQO V;  2DQ3 A;  3A8T A;  4MVS A;  1NBM G;  4X1K B;  2EZP A;  3JAL B;  2Y0I A;  3QTC A;  2QWP B;  2QR4 A;  3CME V;  1N34 B;  2UUC B;  4GYC B;  1M57 B;  3CRM A;  5KX5 B;  2DMX A;  3OAA G;  1PV0 A;  2A79 B;  2F1M A;  1JR9 A;  2RCV A;  4I0X B;  5EZY A;  5HFM A;  2HFE C;  1BCC H;  4GKK B;  4DR5 B;  4NKG B;  3U10 A;  4D6T H;  1E79 G;  1ROP A;  1RSO A;  4UCS A;  4LFC O;  1BMF G;  1HNZ B;  1IVS A;  3H1J H;  1H2M A;  5L3D A;  1FS0 G;  3E22 B;  1HNX O;  2XAJ A;  4DUZ B;  2OCH A;  4IYH A;  2XAH A;  2O57 A;  1WJZ A;  1MOF A;  2QWO B;  4KHP O;  3SPJ A;  1DLB A;  1S77 D;  4X1Y B;  2XHB A;  2UU9 O;  5IY5 B;  4DR3 B;  4EB6 B;  1RFY A;  4FJC C;  2P67 A;  5IT9 N;  3CCJ V;  1H2N A;  4NXN B;  3JAW B;  1VQ7 V;  2IU3 A;  3OTF A;  5FNV B;  4MW3 A;  2FL4 A;  4TQF A;  5EIB C;  4DR5 O;  2EIK B;  4FPP A;  4K35 A;  1K5S A;  1SA0 B;  3EXA A;  4DYL A;  4W4K A;  2HG5 C;  2QKC A;  2HJF C;  3JCU Z;  2EIM B;  1GKF A;  5JVD A;  3THO A;  3CJH A;  1S76 D;  4NXM O;  3ABM C;  2QWN B;  2JS5 A;  4OX9 B;  4AIL C;  4DUZ O;  3FKS G;  2Z0A A;  3FB5 C;  4LF6 B;  1TUB A;  3P3P A;  4LR3 A;  3U11 A;  4B3S O;  2ZD9 A;  2PYL A;  2ZE8 A;  3CP1 A;  3W7T A;  3JD1 A;  1Q82 W;  1VQ9 V;  4O4J A;  5BMV A;  2IJI A;  1YXB A;  4ZOL B;  1XOU A;  5K1P A;  2VQE B;  1K7D A;  3HKC B;  3ABT A;  3WU2 Z;  1SKV A;  2YDE A;  2P6J A;  1K92 A;  3HKB B;  1EM1 A;  4X9Q A;  2ZDI A;  1B06 A;  2QJ1 A;  4PV1 B;  3BVO A;  3JAR B;  2R9I A;  1R3L C;  1BT8 A;  3ETQ A;  1N0N A;  4DV5 B;  2JIZ G;  1UFI A;  4YJ2 A;  4LF6 O;  4HZ3 A;  2F23 A;  2KSD A;  2UXX A;  3K79 A;  3OMN B;  4J42 A;  3OD4 A;  5BY1 A;  2F4V O;  3RYI B;  3K9A A;  2Q7G A;  3BHP A;  4PA6 A;  1HNW O;  5EC2 C;  1D2D A;  4TWK A;  2Y0P A;  3LNM B;  3D36 C;  1AI7 A;  1L8D A;  5J2U A;  5JH7 A;  4LWS B;  1J5E O;  2B5U A;  4UCT A;  1FXH A;  2E5L O;  4UUJ C;  3CB2 A;  4TOI A;  5B1O A;  2DQ0 A;  3F5W C;  4NYK A;  1GH6 A;  1L1F A;  2Q6A A;  4JTD B;  3CC7 V;  2HR3 A;  1S5H C;  2DYR C;  2YXH A;  4BW5 A;  3N2K A;  3B40 A;  2FTK A;  2PI5 A;  3T1C A;  3EVK A;  1M56 C;  3T1H O;  1EFR G;  1Y74 B;  3K9S A;  4P30 A;  5TIS Z;  3ZX6 A;  1YHQ V;  1N8R W;  4JI7 B;  4LF9 O;  1OCC B;  4WFA V;  1KD1 W;  1R3J C;  4BWA A;  4F6E A;  4JI6 O;  3J7A U;  4JI5 B;  2Q5Z A;  2BTO A;  4F6R B;  1AR1 B;  5L3E A;  5LP6 A;  2BOB C;  4NTW A;  5KMG B;  4NTX A;  4CS4 A;  3IFX A;  3W7X A;  1UPG A;  3B8M A;  3E86 A;  4JI1 B;  4OXS A;  1SS3 A;  2UXB B;  1RPR A;  4FLU A;  4I9W A;  2UUB O;  2P4V A;  5AG2 A;  4LH7 A;  4QJF B;  3K08 A;  1I7F A;  2WLL B;  1XEQ A;  4DR1 B;  1CEZ A;  2D2C B;  1WB7 A;  2IJK A;  4Q6G A;  4HAM A;  4TUY B;  2AHY A;  2VQF O;  3DC6 A;  4QPK A;  1GRJ A;  1YJ9 V;  4JI7 O;  1AP6 A;  3BA9 A;  1GAX A;  1NVP D;  3FB8 C;  1NTM H;  4B3T O;  1YJW V;  4DV0 B;  3A2F A;  1GN3 A;  2EUL A;  3TK1 A;  4IIJ A;  2LJ2 A;  4MTO A;  3ZMV A;  2WA3 A;  3ABM B;  2ADQ B;  2JS3 A;  4H37 A;  3WB1 A;  3P3N A;  4NVP A;  4ZI7 A;  4P9O A;  4YHH O;  1L0N H;  2DN9 A;  1KP2 A;  2RDC A;  3OE7 G;  5KUK A;  2PUS A;  4B08 A;  1BSM A;  1QU7 A;  3H1H H;  4U7N A;  2PI4 A;  3K5M A;  1S0V A;  2EIL B;  2KKW A;  3FYI B;  3KZI Z;  4X1I A;  3VQV A;  1N33 O;  5KX5 A;  2RN9 A;  1YJN V;  2ETN A;  4DV3 O;  2JDI G;  2PY5 A;  3CXC U;  4PA9 A;  3FX7 A;  1UJW B;  3UO2 A;  4R50 A;  3KCX A;  3JAM N;  1K34 A;  2UXN A;  4MVQ A;  4RAI A;  2IU0 A;  1SZX A;  2XAQ A;  1X59 A;  2XT9 A;  1URF A;  3C3T A;  3T4Z A;  2JK5 C;  2YI9 A;  1AR4 A;  2ZIM A;  4DO2 A;  1PPJ H;  1BL8 A;  5EZY B;  3STZ C;  3QF7 A;  2XAS A;  3GWK C;  2QE7 G;  4FIP C;  4PA4 A;  4ZIB A;  1MMM A;  1KC8 W;  2ZIO A;  1RSO B;  4FM0 A;  2WLM A;  2E75 B;  1PM9 A;  4EB6 A;  2AZ2 A;  3ZRS A;  5CN0 A;  3VBB A;  3ZIA G;  3SJB C;  4JYC A;  3GWO A;  2P7T C;  3L71 H;  5L3G A;  4LF8 B;  4JI2 O;  3CRC A;  1XNQ B;  3A0B Z;  2YC0 A;  1SA0 A;  3CCM V;  3QO8 A;  4CC6 A;  4X8A A;  2ZR2 A;  4JI3 B;  3ABU A;  3C90 A;  3W7S A;  5B1A C;  3K03 A;  3SPG A;  2C2A A;  1D5N A;  3FYE B;  4FK5 C;  2JRI A;  2DYS C;  5LMU O;  1NTZ H;  1COW G;  4UB8 Z;  1M9N A;  1WNS A;  1Z2G A;  3AK2 A;  2BOC C;  3SDL A;  3ZHS A;  5JVD B;  3CJH B;  4CH6 A;  5IWA B;  2DJV A;  4MSW C;  1MZE A;  4MVM A;  4X66 B;  1VQK V;  5JCO C;  1XNQ O;  1NU1 H;  3DTU B;  1VQ4 V;  4HYO A;  3HKC A;  1TUB B;  1ZWI C;  1VAR A;  3CXH F;  1W0J G;  4UV8 A;  4AQY O;  2DE0 X;  3HKB A;  3OT7 A;  1KKC A;  1V9P A;  4O4J B;  4RUF A;  5BMV B;  1WA8 B;  4LFA B;  4CH4 A;  1GTO A;  4RUE A;  1Q6U A;  4CH3 A;  4WBN A;  5B3S B;  3AG4 C;  4J9Y B;  3I55 V;  1Q6I A;  3B4S A;  4U3F H;  4Z2W A;  1DF5 A;  4GUN A;  3OM3 B;  1VQN V;  3ASN C;  1H8H G;  5IYC O;  1N36 B;  3QG5 A;  4X66 O;  1FD9 A;  1KBH A;  1V54 B;  3E35 A;  1VQ5 V;  1I5Y A;  1AIL A;  1W59 A;  4LFB B;  4D7T A;  4YXW G;  1RP3 B;  2A9H A;  1K3E A;  2LW1 A;  1XL6 A;  2BCC H;  5KHH A;  4DW1 A;  1FYJ A;  1DGS A;  2XAF A;  3SJQ C;  4JI8 O;  1IX9 A;  3ABK C;  1NT2 B;  3DSQ A;  2A0L A;  1XL4 A;  1VEW A;  1JJO A;  1SRY A;  4LH6 A;  5J2U B;  2ZNI A;  5JH7 B;  4H13 B;  1HR0 B;  1WPX A;  1ARO P;  1Y74 A;  3ZMS A;  1K4C C;  2P90 A;  3K59 A;  4DW0 A;  3RFR A;  2R9R B;  1N36 O;  5JWP A;  4O4L B;  1K4D C;  4DRX A;  2OT5 A;  3JAS A;  1DTO A;  4LFB O;  1VP7 A;  1ZL8 A;  5CA1 A;  4JPR A;  5B66 Z;  1G4Y B;  4MVR A;  3RBZ A;  4YIP A;  2LQT A;  3IJ4 A;  3JSN A;  2AZ0 A;  1Q86 W;  5LMN B;  4DUY O;  3RT3 C;  3UKM A;  2QSA A;  4MTG A;  4GT1 A;  2NLJ C;  4K3A A;  5H9C A;  4B3M O;  4JV5 O;  4ZKI A;  3ZCC A;  4RQF A;  1FXV A;  5J2T A;  1H2K A;  4DR7 O;  2HVJ C;  3IGA C;  4N21 A;  3AG2 C;  2LW7 A;  5H2F Z;  3KG2 A;  3QNE A;  1R1B A;  1I5X A;  1WP8 A;  2ARH A;  1N32 B;  5B1A B;  4LF5 O;  1F23 A;  3BA8 A;  3WB0 A;  1X4T A;  3AG1 C;  1NH2 B;  1EN6 A;  3G6B A;  5LGN A;  5IYB O;  4IT5 A;  2WLJ A;  1CXZ B;  5K1X A;  4O4I B;  2Q7H A;  2E3C A;  1Y67 A;  2ZE7 A;  4IIJ B;  1SF9 A;  1WAZ A;  4LNU A;  4ZI7 B;  1TAE A;  1OZ0 A;  3LSU A;  4TV9 A;  4B7E A;  1BQZ A;  2Q0A A;  4ZBM A;  2IJJ A;  5IYD O;  4NB5 A;  4JZ2 A;  4AI8 A;  4X1I B;  3L9D A;  3ETD A;  5LGT A;  3UM7 A;  1TA8 A;  1NJI W;  1FPO A;  2UXD O;  3GB7 C;  4ASU G;  4GX2 A;  3CCQ V;  3SJA C;  4DV7 B;  1JVM A;  4N23 A;  3JD4 A;  2QDO A;  3SYQ A;  1OCO B;  4J7J A;  5IJ0 A;  4UVB A;  1KQS U;  2GSM B;  1GN6 A;  2Z5U A;  4R8C A;  1ZLZ A;  4MW8 A;  1Y66 A;  1PNL A;  3D36 A;  4HBN A;  4FFB B;  3K04 A;  4J7Z A;  3LUT B;  1BQ0 A;  2B1G A;  2NR5 A;  2CTP A;  1N34 O;  2EIJ B;  1Q3E A;  2UUC O;  2JEX A;  5CBF A;  4P2Z A;  1GM7 A;  3CCE V;  1Q6H A;  3K0G A;  2JGU A;  2ODM A;  4O2A A;  4R6Z A;  3ZRW B;  2X6C A;  3OUF A;  4JTC B;  1JMK C;  1O9G A;  4WFE A;  4FZ0 A;  3X2Q C;  3RVZ A;  1M93 A;  4GKK O;  3OFN G;  2YIB D;  1R73 A;  3CWB H;  3JCZ A;  1YTF D;  2GHY A;  2WA4 A;  5BXZ A;  3QO7 A;  1HNZ O;  3ZS8 C;  3WG7 B;  1OCR B;  5B5E Z;  1F7Y A;  4JZG A;  3RGB A;  3C3S A;  3MHH C;  1V55 B;  2EBO A;  3BEH A;  1QLE C;  4UFZ A;  4DR3 O;  2HHH B;  1LR1 A;  3W7U A;  3ZRV A;  3U0Z A;  1KYO F;  3ABL C;  2NNU A;  4NXN O;  2QKS A;  4U3J B;  3TGU H;  3K58 A;  3CRQ A; 
#chains in the Genus database with same CATH homology
 2KB1 A;  1GM9 A;  1QCE A;  3FB8 C;  2X6A A;  1YJW V;  5BZB A;  2WWW A;  3SYC A;  3TK1 A;  3RW0 A;  1IXM A;  2V7Q G;  4JGS A;  4KP4 A;  4MTO A;  3ZMV A;  3ABM B;  4TSF G;  4H37 A;  2MK3 A;  5EC1 C;  1OHH G;  4P9O A;  1K97 A;  3B77 A;  2ZXW B;  1JPX A;  1KP2 A;  2YEV B;  3OE7 G;  5KUK A;  4UVC A;  4U7N A;  3G71 V;  2PI4 A;  5J9P C;  1S0V A;  2EIL B;  3OGC C;  3FYI B;  3LSQ A;  1OCO C;  2H8P C;  4BIU A;  2IW5 A;  3AEI A;  3I56 V;  3SPH A;  3D3I A;  3WFV A;  3ASO B;  1YJN V;  4E2L A;  3TET A;  2JDI G;  1AJQ A;  1W2B U;  2QEX V;  4X89 A;  2EZO A;  3CXC U;  1QVG U;  3FB6 C;  4PA9 A;  3DGE A;  1UJW B;  4JF3 A;  4R50 A;  1H38 A;  3ZMT A;  1K34 A;  2UXN A;  1FFT B;  4MVQ A;  4RAI A;  2IU0 A;  2XAQ A;  4J9Z B;  3AG4 B;  4GX0 A;  1QR9 A;  3BY6 A;  1YSC A;  2K1E A;  5GW7 A;  3T4Z A;  2EIJ C;  2JEU A;  3SPI A;  1AI6 A;  1PKX A;  3CCV V;  3ASN B;  3OEH G;  2JK5 C;  1K5Q A;  3G6E V;  1RM1 B;  1WLE A;  5KUM A;  4DO2 A;  3SYP A;  1BL8 A;  1OCC C;  2IH3 C;  3OR7 C;  3STZ C;  1K73 W;  2XAS A;  4JYB A;  2D3O W;  2WLI A;  1BHA A;  2QE7 G;  3E89 A;  4FIP C;  1VQM V;  4PA4 A;  5L3F A;  1FXK C;  1DF4 A;  3AG3 B;  3T4D A;  1KC8 W;  2WLN A;  2EIK C;  5CBH A;  2WLM A;  3SPC A;  1R3K C;  3ZRS A;  5CN0 A;  3VBB A;  3P30 A;  3ZIA G;  3CYO A;  4QE9 A;  3ABK B;  4JYC A;  3GWO A;  2P7T C;  4MVO A;  1VQL V;  4I5S A;  5L3G A;  3WG7 C;  1OCR C;  4PEL A;  5KA5 A;  2HVK C;  1FXK A;  1F51 A;  3HB3 B;  3F7Y C;  3R65 A;  3OMA B;  2W6I G;  5L3C A;  1E1R G;  2IH1 C;  3CCM V;  1NH2 D;  3P32 A;  2AHZ A;  1V55 C;  2DWE C;  3QO8 A;  3K0D A;  1YIJ V;  3E83 A;  4X8A A;  1EBO A;  2ZR2 A;  2Q68 A;  3ABU A;  4Q20 A;  3W7S A;  2W0F C;  1PNK A;  3E8F A;  1R6N A;  3JD3 A;  5B1A C;  3K06 A;  2EIN C;  3K03 A;  1B6Q A;  3SPG A;  2F43 G;  2C2A A;  1PD3 A;  4EKW A;  4WF9 V;  3OEE G;  3FYE B;  5LHI A;  4FK5 C;  2DYS C;  4JTA B;  2Z3Y A;  5CBG A;  2WLL A;  3LDD A;  1QVF U;  2QM7 A;  1COW G;  3ML0 A;  3TCU A;  4LC1 A;  4PDL A;  3T2M A;  1M9N A;  1TUE B;  3IC7 A;  2BOC C;  3SYO A;  2LFS A;  1E1Q G;  3ETE A;  3OR6 C;  2W6J G;  4MSW C;  4JAU A;  4MVM A;  2HKO A;  1JCH A;  4MS2 A;  3ZMU A;  2ZXW C;  3OMI B;  1VQK V;  2XAG A;  4XDK A;  4XDL A;  1K8A W;  4H33 A;  4GCZ A;  4PDR A;  2QTO A;  3DTU B;  4QIW F;  1VQ4 V;  4HYO A;  1SES A;  1AI4 A;  1K33 A;  1KEC A;  1ZWI C;  2ITD C;  4PDV A;  1W0J G;  2EIL C;  4UV8 A;  5C93 A;  1QR8 A;  4MVU A;  1F4N A;  3E8B A;  4MTX A;  1G8M A;  1K9M W;  1YTF B;  2Y69 C;  4RUF A;  1ENV A;  3OW2 U;  5B1B B;  1JX9 A;  3ASO C;  3HPL C;  3CC4 V;  1JQ0 A;  3AG2 B;  2Y48 A;  3RVY A;  4RQE A;  2WPD G;  2EJR A;  1GTO A;  2OCC B;  4RUE A;  3MHS C;  2X0L A;  5B3S B;  1OCZ B;  5DM6 V;  4CZZ A;  1M1K W;  1JOY A;  3AG4 C;  2LP7 A;  4J9Y B;  1VQO V;  2DQ3 A;  5LBQ A;  3I55 V;  4MVS A;  3AG1 B;  1DF5 A;  2M7W A;  1EZJ A;  2WLH A;  4UXN A;  3OM3 B;  1NBM G;  1VQN V;  3ASN C;  5LHG A;  2X6B A;  1RM1 C;  4XBF A;  4WFF A;  1H8H G;  5IYC O;  1SET A;  5H6R A;  1R3I C;  4LP8 A;  3CD6 V;  1V54 B;  2EZP A;  3E35 A;  1VQ5 V;  4WFG A;  4PDM A;  1I5Y A;  3CME V;  1NVP B;  4YXW G;  2A9H A;  3H01 A;  1K3E A;  4WCE V;  1XL6 A;  5DN6 G;  3AG3 C;  3LSS A;  1M57 B;  3OAA G;  1THZ A;  2A79 B;  1NVP D;  2XAF A;  1S72 V;  1MG1 A;  3SJQ C;  4R7C A;  2V1D A;  3QO5 A;  5HFM A;  3ABK C;  2HLD G;  3STL C;  2A0L A;  2HFE C;  1XL4 A;  1P7B A;  5EBM C;  2QA4 V;  4X88 A;  1SRY A;  4Z1M G;  2ATK C;  1E79 G;  1ROP A;  1PNM A;  1BMF G;  1AJP A;  4WFH A;  4TT3 G;  1WPX A;  1ARO P;  3ZMS A;  4JAS A;  1K4C C;  2OTL V;  2P90 A;  4CBC A;  4BAY A;  3ZRW A;  2WAM A;  5L3D A;  1F4M A;  1FS0 G;  2R9R B;  4GX1 A;  2XAJ A;  3ZN0 A;  2XAH A;  1K4D C;  2WLI B;  1MOF A;  4DXW A;  4LBE C;  3ZMZ A;  2OT5 A;  1DTO A;  4RO2 A;  3SPJ A;  1DLB A;  4P9P A;  1S77 D;  4JPR A;  4G2K A;  3CC2 V;  3W7W A;  1J95 A;  5IY5 B;  3PJS K;  1CP9 A;  4UV9 A;  2DWD C;  1G4Y B;  4FJC C;  2P67 A;  4MVR A;  3RBZ A;  3CCJ V;  1Q7Y W;  3ETG A;  1VQ7 V;  2H94 A;  2IU3 A;  1BHB A;  2JJ1 G;  4MW3 A;  1Q86 W;  2DYR B;  3JD2 A;  2EIK B;  4FPP A;  1RPO A;  1Y4M A;  1K5S A;  3LDC A;  1QBZ A;  1M56 B;  2HG5 C;  3UKM A;  2HJF C;  2CK3 G;  4F4L A;  1GM8 A;  3CCU V;  2EIM B;  1GKF A;  4MTG A;  4LCU C;  1R6K A;  3ABM C;  1S76 D;  5EBW C;  4GT1 A;  2NLJ C;  4QPJ A;  3E2E A;  5H9C A;  3X2Q B;  4ZKI A;  1NR1 A;  2LFR A;  3ZCC A;  4RQF A;  3FKS G;  1FXV A;  5FL7 G;  5IDJ A;  5B1B C;  2HVJ C;  1H8E G;  3IGA C;  3FB5 C;  4N21 A;  3AG2 C;  2ZR3 A;  3KG2 A;  3QNE A;  4JAV A;  2OCC C;  1I5X A;  2ZD9 A;  2X7R B;  3FB7 C;  5B3S C;  1OCZ C;  5L3B A;  5B1A B;  1F23 A;  3CP1 A;  5HFL A;  3W7T A;  3JD1 A;  1Q82 W;  1LNQ A;  3AG1 C;  1NH2 B;  1VQ9 V;  5EK0 A;  5LGN A;  2YEV A;  1NQT A;  2IJI A;  2ZDI C;  1KP3 A;  5IYB O;  2QM8 A;  1ORQ C;  2WLJ A;  3SYA A;  1HWY A;  1V54 C;  1K7D A;  3ABT A;  1QLE B;  4PA3 A;  5CA3 A;  4QE7 A;  2P6J A;  1VQ6 V;  3G4S V;  1K92 A;  1JJ2 U;  3ABL B;  4BIZ A;  2JJ2 G;  3JD0 A;  5LHH A;  1M57 C;  2ZDI A;  1S3J A;  1OZ0 A;  4KFM A;  2R9I A;  1R3L C;  4ZBM A;  2JIZ G;  2IJJ A;  5E1A C;  5IYD O;  4HZ3 A;  1VQP V;  1YI2 V;  4GX5 A;  2UXX A;  3K79 A;  3OMN B;  3ETD A;  4MTF A;  2IJH A;  5LGT A;  4G27 B;  3UM7 A;  2OTJ V;  3CCL V;  2Y69 B;  1NJI W;  3K9A A;  3CPW U;  3GB7 C;  4PA6 A;  5EC2 C;  4TWK A;  4ASU G;  4GX2 A;  3CCQ V;  3EHB B;  3JYC A;  3LNM B;  1JVM A;  4N23 A;  3JD4 A;  1AI7 A;  2WLK A;  3SYQ A;  3CMA V;  1OCO B;  1W0K G;  1NKD A;  5EBL C;  3MD0 A;  3F7V C;  1QLN A;  5KA6 A;  4U7O A;  2B5U A;  2ITC C;  1VQ8 V;  1FXH A;  4UVB A;  3ZN1 A;  1KQS U;  2B1I A;  5IY5 C;  2GSM B;  2PI5 A;  2Z5U A;  2XND G;  4UUJ C;  4R8C A;  2DQ0 A;  5B1O A;  4MW8 A;  3F5W C;  1Y66 A;  1PNL A;  4L87 A;  1YIT V;  1H2G A;  2ZQM A;  3D36 A;  4UVA A;  1L1F A;  3K04 A;  3LUT B;  2Q6A A;  4JTD B;  3CC7 V;  2B1G A;  3VOU A;  2HR3 A;  1S5H C;  2DYR C;  2EIJ B;  1M90 W;  3K3W A;  2JEX A;  4BW5 A;  3CCS V;  5CBF A;  3A0R A;  2FTK A;  2WSS G;  4P2Z A;  5CMU A;  1GM7 A;  3M99 B;  1M56 C;  3T1C A;  1EFR G;  4P30 A;  1N8R W;  3CCE V;  1YHQ V;  2EIM C;  3K0G A;  1OCC B;  2Q69 A;  4WFA V;  4R6Z A;  3ZRW B;  1KD1 W;  1R3J C;  3NXS A;  3ZJZ A;  2X6C A;  3OUF A;  1CPY A;  4JTC B;  2DW4 A;  4WFE A;  3X2Q C;  1AR1 B;  5L3E A;  3RVZ A;  2BOB C;  1GMG A;  2Q67 A;  1FXK B;  3OFN G;  1R73 A;  3IFX A;  3JCZ A;  3W7X A;  1YTF D;  4QNH B;  3B8M A;  3E86 A;  1AI5 A;  2GHY A;  4OXS A;  1KKD A;  3QO7 A;  1RPR A;  4XDJ A;  3WG7 B;  1OCR B;  4I9W A;  1GK9 A;  4KUM A;  1MSW D;  3ZRX A;  2XOK G;  4MVZ A;  4QJF B;  1SZT A;  1MAB G;  5B1N A;  3K08 A;  3OUS A;  3MHH C;  2WLL B;  1P4R A;  1V55 B;  3E8H A;  2EBO A;  1Q81 W;  1CEZ A;  2IJK A;  3E8G A;  3BEH A;  4G28 B;  1QLE C;  1AJN A;  3EFF K;  4HAM A;  5H6Q A;  2AHY A;  4WFB V;  3CCR V;  1SER A;  2YSU B;  3LDE A;  4MT8 A;  4QPK A;  2EIN B;  3W7U A;  3ZRV A;  1YJ9 V;  5LGU A;  1PL0 A;  3ABL C;  2NNU A;  4FMT A;  3B8N A;  2QKS A;  1NR7 A;  4PA7 A;  1GO3 F;  2DYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...