2YSUB

Structure of the complex between btub and colicin e2 receptor binding domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
RNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein/hydrolase
molecule keywords Vitamin B12 transporter btuB
publication title Structure of the complex of the colicin E2 R-domain and its BtuB receptor. The outer membrane colicin translocon
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 123
sequence length 123
ec nomenclature ec 3.1.-.-:
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ysuB00
1UJWB 1JCHA 2B5UA 2YSUB
chains in the Genus database with same CATH superfamily
3OTFA 4UXNA 5LL6Y 1UFIA 4DR3B 4B3SO 4ABMA 2NLJC 4DR6O 1Y6XA 2K1EA 4QIWF 4FFBB 3CJHB 3ZMTA 1ZUQA 3CB2A 2BTOA 4LFCB 1O9GA 1QU7A 1PD3A 1MSDA 4MTGA 2CAZC 4YHHO 3L74H 1G8MA 3ZIAG 1P7BA 2OCCB 4ICGA 1YI2V 1JVMA 3JSNA 2XAGA 5KHHA 1NZ6A 4LC1A 2ZR3A 1DTOA 1K34A 4UFZA 3B2EE 4WFEA 3QG5A 2EIMC 2B9ZA 1AJPA 2FTKA 3FAVA 2XAHA 2E75B 3GB7C 1BQZA 4JTAB 4KXRA 1K97A 2X7RB 4JI5O 4JYAB 4JI2O 2X6AA 2EINC 1YF2A 4JI4B 4FM0A 4BW9A 1XILA 1M4UA 2MK3A 4JYYA 4X20A 4A5UB 3ZJZA 4FPPA 2KB1A 2LW7A 4H13B 3MHSC 3ZRXA 2EILB 2PTMA 4DRXA 1U96A 1IBMO 2ADQB 4HNAA 3LNMB 1Q6IA 4YY3B 2WLLB 3ETEA 1V54B 1ZL8A 4PDLA 3JCZA 5GONB 2WLIB 1FYJA 1P7GA 1M5IA 4UVAA 4JI8O 1HDJA 4LWSB 5LMNO 5CB4A 5DECA 2JJ1G 2JS5A 3K5LA 2WA3A 4UV9A 1AP5A 4DV6B 3K5MA 3BCCH 3ZHVA 5F2VO 4Z1VA 2V1DA 1D2DA 3A0HZ 1YVWA 3FB6C 3CRCA 1SQPH 3GWKC 4PA4A 4TV9B 1FXKA 1OHHG 5LA6B 2QWQB 1W0JG 1ZLZA 4ZOLB 2C2AA 4MW8A 2Q7GA 3MDSA 3SPHA 5KLVH 4FLYA 3EHBB 5J2UB 1VF6C 4I0XA 1LUWA 3A8TA 4NTXA 2Q67A 4GKKO 3ZBHA 1XMOB 1QQCA 2P7TC 4PA7A 5A9GA 4LFAO 4IIJB 4J11A 5KHGA 4DO2A 1WP8A 3K06A 3HKDB 1XI1A 4I50B 2W0FC 4I4TB 1BHAA 1EBOA 3K9AA 2F43G 1UJWB 4JAAA 3SR2C 2HEPA 3LDEA 1JJOA 3ETQA 3JD4A 3FB7C 4WFFA 2EIMB 3M8AA 2PF4E 2BSKB 3UCSC 3P3NA 2LFRA 2OIGA 1VQNV 3TXQA 4DR2B 4RUFA 2EINB 4KHPO 1YXBA 3UT5B 1CPYA 1QR9A 5B1OA 4JZGA 3OMAB 4LFCO 1V9PA 1H2MA 5C93A 1AILA 1Z5WA 1N36B 3JARA 1S72V 3EXAA 1K5QA 1HP8A 3K04A 1HNWB 1SZXA 1JFFA 2DOSA 5EYPA 4DV2B 3QO7A 3RYIA 3HKCB 2ETNA 1WNSA 2ZIMA 1R6KA 1QCEA 4DK1A 1JOYA 4LNUA 3RYHB 5ITZB 5IJ9B 1Q8IA 3QO5A 1S77D 1JX9A 1Y66A 1WJZA 4FFKA 3OMNB 2ARHA 5JQGA 2IW5A 4AQYB 1TVKB 1A32A 2IJKA 1YHQV 5KUKA 2QKSA 1FAFA 4K8ZA 4JYAO 5EBWC 1VMGA 2QTOA 4JI4O 3JATA 4B7KA 4EB6A 2RN9A 4X1YB 2QTSA 4DW0A 2VWJA 4H37A 4IT5A 1P49A 4JV5B 1Z5VA 1VARA 4ZKIA 4YJ3A 4X1KA 1I7FA 4RQEA 3ZMSA 1VQ4V 1OV9A 4EKWA 1SQXH 1VQLV 3AG3C 3K08A 1NR1A 4O4IB 2VQFB 4YY3O 1Q3EA 2QWNB 1E1RG 1K4DC 3VQXA 2YXYA 4LF5B 2BTQB 4FIPC 3T1YB 1P84F 2KG7B 1EN5A 1BSMA 4JI0O 4ZHQA 3AG7A 1OCCC 4PA3A 1MABG 2ZM6O 4DV6O 4JYBA 4QE7A 1YZBA 1WA8B 4QNHB 2HKOA 1BCCH 3E8HA 2CE4A 1Q6UA 5C8YA 3GWOA 3E86A 3L72H 4PA6A 4OX9B 4MSWC 4IYHA 1P4RA 1JQ0A 3BAAA 1MMMA 1D5AA 3CHXA 2ZDIC 2P90A 4J42A 1OCZC 2NR5A 1N0JA 1XUQA 1XMOO 4YJ2A 4MT8A 3EFFK 1KD1W 2UUCB 1GRJA 1Z2GA 5LP6A 1SF9A 2A79B 3AK3A 4J9YB 1DF5A 5LXTA 4NR1A 3SPJA 1NTKH 3BVOA 4NKGB 2FMLA 1KU9A 1M90W 3ABMC 1DGSA 3I5DA 1KB9F 3CRQA 2QEXV 2ZD9A 2E5LO 2X0LA 3B40A 4R8CA 1PL4A 3DXRB 2XNDG 4HBNA 4DV1B 4DR2O 4JAVA 3E8GA 1EM1A 3SJAC 2ZE6A 3WG7C 3CX5F 2ZIOA 2OIEA 1KKCA 1N36O 1K4CC 3OD4A 5B3SC 1BHBA 4DV3O 2JEUA 2BOBC 4X66O 1HNWO 3AG3B 3L9DA 4FLTA 4P30A 1XNQB 4LFBB 3K79A 3H9VA 3DGEA 4CZZA 1M9NA 4X64B 3HKBB 4JI7B 2QR4A 2P4KA 1FFXB 1GTOA 4I9QA 4O2BB 4G27B 4X9QA 1VQKV 1AR4A 1T5EA 4FVMA 4G28B 1OCCB 2LGWA 1Y76A 1PM9A 3CCJV 4LP8A 3BA8A 5IYZA 3CCSV 1K9MW 3F5WC 3RGBA 1CXZB 4JV5O 2KQXA 4LCUC 2QM4A 1R3KC 5AG2A 5H5NA 5BZBA 3C3TA 4JGSA 1BZKA 5GTIZ 5KA5A 3RYFB 1EN4A 3VBBA 2XAQA 2RCVA 2RMKB 3PJSK 5KHKA 2HVJC 3B8MA 5D5QA 4CS4A 4LF5O 4O4HB 1GM9A 1OCZB 3ZRSA 2CTWA 3Q4HB 5CMUA 2AHYA 4RO2A 3CMEV 3T1YO 4ZBMA 3KCXA 5JWPA 4UVBA 1SQGA 4Z2WA 2RDCA 1I0HA 1HR0O 1JJ2U 1YJ9V 4X88A 1XEQA 4AHCA 5BMVB 2W0XA 1SA0B 4X1IA 3CRAA 1Y4MA 1BE3H 4K0KB 4H33A 3ABMB 5IT9N 2Y0IA 1RPOA 2CK3G 4PDVA 2IBZH 2Q0AA 1JCHA 2XASA 2ZCEA 3E22A 4O4JB 5JH7A 1JPXA 2F4VB 2YEVA 3N2KB 3WG7B 1MNGA 3PN1A 1SKVA 3G6BA 2YXLA 1GN4A 3DC6A 1K3EA 3G80A 1YTFD 1S0VA 2Y69C 5B3SB 4O2AB 2UUCO 2HJDA 2B5UA 1KUQA 1XL6A 5BR8B 4WFAV 4WBNB 3H1KH 4FFBA 2WPDG 1IBLB 3RVZA 5CA1B 3SPCA 4GX2A 1G1XB 5IYBO 2R9IA 5L3GA 2ZE8A 3HB3B 1BGYH 4LF7B 4ZI7B 2Q9LA 4DR7B 1GM8A 1N8RW 1FJGB 3E8FA 2Q8VA 1NKDA 3ZX6A 1V55C 3CC4V 2QE7G 2JGDB 2V4DA 2IH1C 2Q0OC 3BPZA 4LFBO 1F7YA 1AR5A 3KCYA 3I56V 4LF4O 1SERA 2CUGA 4X64O 4JI7O 1FS0G 1G4YB 3CXHF 1L0NH 3E2EA 3K9SA 3OUSA 2Y4UA 2UU9O 2YI9A 3HPLC 3ZHRA 4FLXA 1ORQC 1R3IC 5JVDB 3OGCC 3DC5A 1TUBB 4XDJA 2WLLA 2GBOA 3ABKC 3W7UA 1KMIZ 5GONA 1TAEA 2WLIA 1QVGU 3FB5C 4LWSA 4MTFA 2IJHA 5HFMA 3H1JH 5D5PA 4CS2A 3EVKA 4RUEA 5JJJB 4WFGA 4JTDB 3ASNB 5EC1C 1PNLA 3SJQC 3FYEB 1NTMH 2Y69B 4TV9A 4TV8B 3D36C 2CGNA 4P9PA 1F4NA 3T4DA 3ZHUA 2HLDG 4DK0A 2WLJA 5J2UA 2YSUB 1N34B 1WPBA 1AJNA 4J10A 2P67A 1ZWIC 2ODMA 3OEEG 4KP4A 2EZOA 1H8EG 4XDLA 3CYOA 4IIJA 4N21A 3JASB 1MZEA 3K57A 1Y67A 1YTFB 1HW7A 3HKDA 4I50A 2WLHA 4I4TA 2F4VO 5JCOC 1NH2D 1OZ0A 2JRIA 4XDKA 4NTWA 4U3JA 3CCEV 1V55B 1XDCA 2V7QG 2UXCO 3ZRVA 2PGGA 2F95B 2QGNA 2AGAA 2BSKA 2R9RB 5CBHA 4DUYB 1YJWV 5BR8O 3CCQV 3F7VC 5L3CA 1WB7A 1AI5A 1NQTA 3H1HH 2DW4A 3MHHC 1L8DA 1R3LC 2XHBA 1SQQH 3UO3A 1FFTB 2IM9A 2YIDA 1KKDA 3UT5A 3WU2Z 3H1LH 3HKEB 2F23A 4B3MO 4UUJC 3P30A 4B3TB 2B1IA 4PI0A 4DV5B 1S76D 1GMGA 2QM7A 4FLUA 1XNRB 1AP6A 4LF7O 3LSUA 3D3QA 4GCZA 1ZX3A 4TUYB 3RT3C 1NBMG 1H2GA 3ASOC 3HKCA 3ZMZA 3ZN1A 1W2BU 3ZS8C 4JI1O 3ABKB 2QDOA 4MS2A 3RYHA 5ITZA 5IJ9A 3STZC 5H6QA 2HP8A 1QBZA 3K0GA 4GX0A 4L8JA 1TVKA 1N33B 3BFRA 2VRZA 3ABLC 5LBQA 4DR5O 2JJ2G 1LUVA 4CC6A 2UXBO 1KQSU 4X1YA 2F93B 1NVPD 4DR3O 1IBKB 4FZ1A 4MVOA 4J7JA 1U97A 2QSAA 4O4LB 3P3PA 4G2KA 3SYQA 1Y74B 1FXVA 2GUZB 4MW3A 4NVPA 3ZHSA 4O4IA 5HFLA 4EEQA 1VF6A 1YJNV 2PYJA 2Q73A 2AZ0A 3FD9A 4OPAA 3ZMVA 4XBFA 3U0ZA 1DK1A 2FKXA 4JF3A 2BTQA 3OM3B 1GN6A 5B1NA 2KG7A 2A3QA 2LO1A 4F6RB 4LF6B 3G6EV 5LMUB 3T2MA 4B3RB 4LR3A 5DN6G 4F6EA 3CWBH 2P6JA 2WLKA 1WA8A 3ZRWB 1YITV 2MW2B 3CC2V 3L73H 2HR3A 3SPIA 1SC5B 4PHZA 2QKAA 1WP7A 2P22C 3J80N 2QWRB 1PL0A 2DQ0A 3ZHQA 3CCVV 2JK5C 3QTCA 4DR4B 5E1AC 1N34O 3CXCU 1OCOC 4QE9A 4KUMA 3F5TA 1YCIA 4EFBA 5KX5B 1XHZA 1MZFA 4DR1B 3N2GB 3O65A 4H44B 2PUSA 5EK0A 5TISZ 3IFXA 1E79G 1LNQA 1J5EB 1JA8A 3ASOB 3IAYA 1SESA 3W7TA 3ZHTA 4DV4B 3JAWB 3P32A 4BIUA 1ROPA 4LH7A 1XOUA 1IXBA 1THZA 4P9OA 4RAIA 1RSOB 4CH5A 4BW5A 2M7WA 3DXRA 4MVQA 5L3DA 3WFVA 5IDJA 2Y0PA 3ABLB 1NT2B 3SDLA 5LP6C 3AG2C 3JAMN 3RBZA 3LDCA 4PDRA 1VP7A 4UB8Z 4B3TO 1J95A 4DV5O 1LR1A 3CMAV 4D7TA 5BY1A 2EBOA 2XOKG 5IJ0B 4IYIA 2N04A 3B09A 1I5YA 3ZCCA 1EZJA 4NXMB 2GTSA 4DUZB 2YIBD 3HKBA 3AEIA 1FFXA 4O2BA 4LF8B 3CD6V 2AXTZ 3OR6C 3OE7G 1XQ8A 1IX9A 3JATB 5J2TB 5CA0B 4I55B 1NVPB 1IXMA 4JPRA 1N33O 1VQ9V 3B77A 3RYCB 3R66A 2UXDB 5FNVB 4UCOA 3U11A 2CGOA 2ITDC 2OCHA 5LGTA 1IBKO 5L3FA 2RNBA 1O9HA 4N23A 3RYFA 1F23A 2XUMA 4BIZA 1K92A 1GM7A 1F4MA 2ZDIA 2IU3A 4JI3B 3LDDA 1OCOB 4O4HA 3QO8A 4IHJB 3HR0A 3Q4HA 4HZ3A 1ZSPA 3BA9A 4JAUA 4KFMA 1M56C 5KMGB 1I94B 1QHTA 4DV2O 4B3RO 1BT8A 2E74B 2HG5C 1MOFA 2YICA 1AR1B 2Z0AA 4J9ZB 4GKJB 2Z3YA 1SA0A 1K8AW 2M6YA 5H2FZ 1BL8A 1HNXB 3J7AU 1KP3A 2ZE7A 1FXHA 3W7WA 2CTQA 1D5NA 4AQYO 1FPOA 2H8PC 4BAYA 2X6CA 5LHHA 2AW9A 3D8CA 3J81N 2KSDA 2YDEA 4O4JA 5KHIA 3R65A 2VQEB 1YDXA 3N2KA 4LF9B 2EULA 2WSSG 5LP6B 3AG2B 2UUAB 4B3SB 3SYOA 4DR1O 2LW1A 4OGQB 4DR6B 3W7SA 2JS3A 3FYIB 2CH7B 1XHXA 4O2AA 2VQFO 2QWOB 3OW2U 3K03A 4WBNA 1J5EO 1GN3A 4DV4O 3APOA 2N74A 5CA1A 4W4KA 4YHHB 1EZVH 3KG2A 4JI6B 2JIZG 4YIOA 2NNUA 3S3XA 4OPHA 3IJ4A 1VEWA 1M57C 1BQ0A 4ZI7A 3BY6A 2YIAA 4I7ZB 2QJ1A 3A0RA 3X2QC 3OEHG 3NXSA 5CBFA 1YIJV 2E3CA 5LOVB 4MTXA 4OX9O 3UM7A 2LGQA 4HAMA 3UKMA 1SQVH 4GX5A 2JGDA 4FJCC 1TUEB 4JI2B 4TSFG 2IU0A 1TA8A 3ASNC 2R70A 2FYUH 2E76B 3ZEDA 2XT9A 1PNMA 1AI7A 4I9WA 5LYJB 1PV0A 3B8NA 3T1HB 2R9AA 5FPRA 3BABA 1IBMB 2DJVA 3FX7A 1FKAO 5J9PC 1M56B 1NI8A 5EZYB 1RM1C 3CE2A 4LH6A 5BXZA 2EX3A 2O57A 4KL1A 5L3EA 3CJHA 1BS3A 4L87A 3OAAG 2UXDO 1MG1A 5JVDA 4JI8B 2EZPA 2XTAA 5IYCO 3GVMA 1TUBA 1MSWD 3IGAC 2P06A 5LGNA 1N32B 3TCUA 1QR8A 3K3WA 1XMQB 1FD9A 3ABTA 1OCRB 2IH3C 3UQ8A 4X65B 4DV1O 2H3OA 1JMKC 1QLNA 1KC8W 3DTUB 3JALB 3RFRA 1DLBA 3T4ZA 5IY5C 1GK9A 1OJHA 1RPRA 4TQDA 3M99B 3MAQA 4TV8A 1EN6A 3F7YC 4U7NA 4K8XA 1XNQO 4GT1A 2IJIA 4K3AA 1S5LZ 3ABUA 4GKKB 3U10A 4GKJO 1HNZB 3STLC 2AHZA 1GKFA 1L1FA 2Q6AA 4GYCB 2EIKB 4I5SA 3JD1A 4JASA 5JH7B 1ZAUA 3IC7A 1VQ8V 1UPGA 1H8HG 3RWRD 5IE9A 4DYLA 3VQYA 2K9PA 1M57B 4WF9V 4UV8A 4J41A 2VQEO 1KP2A 4FLZA 3X2QB 3TETA 5FLXN 2YXHA 3TJTA 3AK1A 3G71V 4LF9O 4UCVA 4R6ZA 2UUAO 3ML0A 1GN2A 3SJCC 2CTPA 2Q5ZA 1I5XA 5IYDO 5GTHZ 5JJEB 3OGIB 1Q82W 4KHPB 1S5HC 5L3BA 4JZ2A 5EIBD 2BOCC 5FPOA 4CBCA 3MD0A 3OT7A 1PNKA 3RN4A 2WLNA 3D3IA 2HHHB 3E35A 3CCLV 3AG4C 2AZ2A 3M7MX 3HKEA 2Q68A 1AI4A 4JI6O 4ZIBA 1K33A 3B4SA 5LA6A 3QNEA 4W4LA 3LNNA 4ZOLA 2ATKC 1RM1B 1URFA 3JSLA 2YUAA 1KECA 3CP1A 4TUYA 4K0KO 5EIBC 3KKYA 1R73A 2A9HA 4BWAA 4FK5C 2PI5A 2OTLV 4MVRA 1JR9A 3JAKB 1FXKC 3CSXA 4DV7B 3G4SV 2D2CB 5IY5B 3CCMV 3T1HO 3E89A 1RFYA 2Q4PA 1H2KA 4U3FH 2JGUA 1K5SA 3D36A 4O4LA 1Y74A 3SYAA 2DMXA 3L71H 2GUZA 1R6NA 2WAMA 3A0BZ 4NB5A 1IBLO 2ZNIA 3BHPA 4E2LA 4WCEV 1N32O 2PI4A 4JI0B 2LP7A 3QF7A 1XMQO 2N05A 3JD2A 5E79Z 2ZM6B 4NTYA 1VF5B 2DN9A 4X65O 1SZTA 4DR7O 4F6RA 3VOUA 3AG1C 1XBLA 1FJGO 2L6LA 5JCOA 3FAVB 5B1AC 1SRYA 1Q86W 1X59A 3LUTB 2IJJA 4Q6GA 3ZRWA 4C7UA 2VS0A 2ZNJA 3BRCA 3THOA 4X20B 3WB1A 1AVMA 1CEZA 4Z1MG 2B1GA 2FL4A 1KYOF 3TXSA 1R6TA 3K0DA 1S3JA 1HNZO 3TK1A 4DRXB 4CS3A 4J7KA 3AG4B 2F1MA 4X89A 5KAFZ 4HNAB 1G6UA 5KX5A 3C3SA 1GH6A 4CH6A 3OUFA 3VQWA 3LSQA 1M93A 5LHIA 3N2GA 1ZL8B 4U3JB 2GDSA 2ZQMA 5LHGA 2ITCC 4DW1A 1B06A 5CB4B 1B3QA 1VQMV 5DEDA 2E5LB 3JAWA 2VWKA 3C90A 1AI6A 4AI8A 2OWOA 2HJFC 2LJ2A 3E8BA 4TWKA 2ADPA 2QA4V 1KBHA 1VQ5V 4PA9A 4YIPA 1RSOA 1COWG 1FXKB 2YS8A 1B04A 4K35A 4MVMA 2JEXA 2HHHO 1AB3A 4WFBV 2DE0X 3CEIA 4DV3B 4UVCA 4X66B 4JYCA 3JCUZ 1S5JA 1Q6HA 1R1BA 2A0LA 4I0XB 5LGUA 2ZINA 3ETDA 5KUMA 5IWAB 4UB6Z 5IJ0A 1K7DA 1VQ7V 4NXNB 1NH2B 1RP3B 1PP9H 3JD0A 2DYSC 4R7CA 1R3JC 5EC2C 3IC9A 1VF7A 2WA4A 3S3WA 3FB8C 4MVSA 2F66C 5J2TA 2RQ6A 5CA0A 1IZ3A 3I55V 3FKSG 4I55A 1SQBH 3G67A 2A7WA 3AG1B 4DV7O 2Y48A 1EFRG 4DXWA 3RYCA 5B1AB 5CBGA 4NYKA 3CRRA 5FNVA 5B1BC 3JD3A 1YEWA 4CH3A 4D6TH 3DSQA 2ZE5A 1TGOA 4DUYO 2CDYA 2PYLA 1I08A 2EJ7A 3UO2A 3JARB 4FM1A 1X4TA 3KZIZ 4PJ0Z 1JFFB 2Q7EA 5EYPB 4IHJA 3RYIB 1HR0B 1VQPV 5K1XA 1XNRO 1Q7YW 5KMGA 1H2SB 1WN7A 1WLEA 4LNUB 3NR7A 1XL4A 1XREA 5H9CA 2BCCH 1H38A 2Y4TA 3T1CA 4TOIA 5JQGB 1Q90D 1WB8A 3SPGA 3W7XA 1GAXA 5A2QN 2OTJV 1NJIW 4H0LB 3TGUH 2OT5A 2DQ3A 4GLXA 2DWEC 4IL6Z 2A06H 2FB5A 4EB6B 4X62B 4EFEA 2BE3A 3WB2A 1QLEC 3APQA 1DF4A 4YJ3B 3O9OA 4X1KB 3K59A 4FZ0A 3OFNG 4LBEC 1N4CA 3WB0A 4WFHA 4QGPA 2ZKOA 2WLMA 3OTOB 4HYOA 4UCSA 4X8AA 3SYCA 2CH7A 2XAJA 3OMIB 3A2FA 2QWPB 1QVFU 3CPWU 5KAIZ 4PV1B 2X6BA 4CC5A 1WAZA 4UCUA 4DV0B 2EIJC 3E83A 1PKXA 4ZHQB 1GO3F 2DYSB 1PPJH 2CTRA 3CCUV 1B6QA 4LF6O 1AJQA 5LMUO 2NN4A 2XAFA 1VQ6V 3BEHA 5C8YB 3ETGA 2UUBB 5BMVA 4AILC 3ZN0A 2G38A 5B1BB 2ILMA 3LSSA 5LOVA 5JJNB 1OCRC 2YC0A 4GUNA 4B7EA 1ENVA 2YIBA 1HWYA 1NR7A 1US6A 4GX1A 2GSMB 4LF4B 4E4EA 5IWAO 1IDSA 5EBMC 4DR4O 1IURA 4TQFA 4YJ2B 2UXXA 2KKWA 4NXNO 4OXSA 3CS5A 1SQFA 2UU9B 1K73W 4UCRA 5LXTB 5FL7G 5LYJA 3L70H 4GZRB 3ZMUA 2P4VA 2GV9A 5EZYA 2ZXWC 1F51A 2LQTA 1N0NA 3H01A 3JYCA 4J80A 2DYRC 2EIKC 3SGIA 5GW7A 4MTOA 2YI8A 1VQOV 4FM2A 1YSCA 4F4LA 2LFSA 1SS3A 1E1QG 2QM8A 1M1KW 4MVUA 1QLEB 3N27A 4PDMA 1H2LA 3JALA 4TT3G 1SETA 4PELA 4JI5B 3SJBC 2RJZA 2H94A 5K1PA 5CN0A 5EBLC 2L35A 2OYQA 3FFQA 4NXMO 2PZSA 4D7SA 1IVSA 4DUZO 2W6IG 3OR7C 2EIJB 3K5OA 3K58A 4J7ZA 2P5OA 4LF8O 1Y76B 1CP9A 2Q69A 2OCCC 1AROP 2ZT9B 2HVKC 4BR6A 5IYZB 3QVNA 4RWUA 5CA3A 3SYPA 4X62O 3CC7V 4FMTA 4P2ZA 2ZR2A 4QJFB 5LMNB 1NTZH 2UXCB 1WPXA 3RVYA 1QNMA 4JTCB 4PI2A 2GTAA 3OTOO 2QKCA 2JDIG 4YXWG 5B5EZ 2JVDA 4CH4A 2Q7HA 1BMFG 1ZTEA 4JI3O 1VIBA 4B3MB 2HFEC 2EJRA 2UXNA 4DV0O 4PD4F 2EILC 2PY5A 3CRMA 4FLVA 2WWWA 2W6JG 3CCRV 1NU1H 3K5NA 5H6RA 1Q81W 1I94O 2Z5UA 4X1IB 2D3OW 3L75H 3ICXA 1L0LH 1H2NA 2ZXWB 1V54C 5DM6V 3VQVA 2UUBO 4JI1B 4B08A 1W0KG 2DYRB 1MA1A 4LFAB 5KA6A 3E22B 5B66Z 4Q20A 5KHJA 1HNXO 3RW0A 4MVZA 4R50A 1Q43A 4QPJA 2DWDC 2YEVB 3AK2A 4QPKA 4RQFA 4IGGA 3JASA 1NS1A 4DR5B 4UCTA 4FLWA 2R72A 4U7OA 2GHYA 3H1IH 4ASUG 4BIOA 2UXBB 1Q5OA 3JAKA 1W59A
chains in the Genus database with same CATH topology
1CEZA 4Z1MG 3RBZA 3LDCA 4UXNA 2HVJC 2B1GA 4PDRA 3B8MA 1J95A 2NLJC 3CMAV 1GM9A 1OCZB 3ZRSA 2EBOA 3K0DA 1S3JA 2K1EA 4QIWF 3TK1A 2XOKG 3ZMTA 5CMUA 1I5YA 2AHYA 4RO2A 3CMEV 3AG4B 4ZBMA 4X89A 3ZCCA 1EZJA 4UVBA 3OUFA 1JJ2U 1YJ9V 3LSQA 4X88A 1PD3A 5LHIA 3AEIA 4MTGA 3CD6V 3OR6C 3OE7G 5LHGA 1G8MA 2ZQMA 3ZIAG 1Y4MA 2ITCC 1P7BA 2OCCB 1YI2V 1VQMV 1JVMA 4H33A 3ABMB 2XAGA 1NVPB 1RPOA 1IXMA 4JPRA 2CK3G 4LC1A 2ZR3A 1VQ9V 1DTOA 3B77A 4PDVA 1K34A 1JCHA 1AI6A 2XASA 4WFEA 2HJFC 3E8BA 4TWKA 2EIMC 1JPXA 2ITDC 2QA4V 1AJPA 2FTKA 2YEVA 1VQ5V 2XAHA 4PA9A 3GB7C 1COWG 5LGTA 3WG7B 4JTAB 1FXKB 1K97A 2X7RB 5L3FA 4MVMA 4N23A 2JEXA 2X6AA 1K3EA 2EINC 4WFBV 1YTFD 1S0VA 2Y69C 2MK3A 4UVCA 1F23A 5B3SB 4JYCA 3ZJZA 4BIZA 4FPPA 1K92A 1GM7A 1F4MA 2B5UA 2A0LA 2IU3A 2KB1A 2ZDIA 1XL6A 3LDDA 5LGUA 1OCOB 3MHSC 4WFAV 3QO8A 3ETDA 4HZ3A 5KUMA 2WPDG 3ZRXA 2EILB 4JAUA 4KFMA 1K7DA 3RVZA 1M56C 3SPCA 4GX2A 1VQ7V 3LNMB 5IYBO 2R9IA 5L3GA 1NH2B 3HB3B 3JD0A 2DYSC 4R7CA 2HG5C 1R3JC 1MOFA 5EC2C 2WLLB 3ETEA 1AR1B 1V54B 4J9ZB 2Z3YA 3JCZA 4PDLA 2WLIB 4UVAA 3FB8C 1K8AW 4MVSA 1BL8A 3I55V 1GM8A 3FKSG 1N8RW 1KP3A 2JJ1G 1FXHA 3W7WA 3E8FA 3AG1B 2H8PC 2Y48A 1NKDA 1EFRG 4UV9A 4DXWA 5B1AB 5CBGA 1V55C 4BAYA 2X6CA 5LHHA 3CC4V 5B1BC 2QE7G 3JD3A 3R65A 2V1DA 3FB6C 2IH1C 4PA4A 1FXKA 1OHHG 2WSSG 3AG2B 3I56V 1W0JG 3SYOA 1SERA 2C2AA 4MW8A 3SPHA 1FS0G 3W7SA 1G4YB 3FYIB 3E2EA 3EHBB 3OW2U 3OUSA 3K03A 2Q67A 3HPLC 1VQPV 2P7TC 4PA7A 1Q7YW 1ORQC 1R3IC 1WLEA 3KG2A 4DO2A 3OGCC 2JIZG 2NNUA 1XL4A 3K06A 4XDJA 5H9CA 1H38A 2W0FC 1BHAA 1EBOA 2WLLA 3T1CA 3ABKC 3SPGA 3W7UA 3W7XA 1M57C 3K9AA 2F43G 2WLIA 1QVGU 1UJWB 1NJIW 2OTJV 3BY6A 3FB5C 3A0RA 3LDEA 3X2QC 3OEHG 3JD4A 3NXSA 4MTFA 2OT5A 3FB7C 2IJHA 4WFFA 5CBFA 1YIJV 5HFMA 2DQ3A 2DWEC 4RUEA 2EIMB 4MTXA 4WFGA 4JTDB 3UM7A 3ASNB 4HAMA 5EC1C 3UKMA 2LFRA 1VQNV 1PNLA 4GX5A 1QLEC 4FJCC 1DF4A 1TUEB 3SJQC 3OFNG 4TSFG 2IU0A 4RUFA 2EINB 4LBEC 3FYEB 2Y69B 4WFHA 3ASNC 1CPYA 1QR9A 5B1OA 2WLMA 3OMAB 4P9PA 4HYOA 1PNMA 5C93A 1AI7A 1F4NA 4X8AA 3T4DA 3SYCA 4I9WA 1S72V 1K5QA 2HLDG 3B8NA 2WLJA 3K04A 2XAJA 3OMIB 2YSUB 5J9PC 1M56B 1QVFU 3CPWU 1AJNA 2X6BA 2P67A 1RM1C 1ZWIC 3QO7A 2EIJC 3E83A 1PKXA 1GO3F 3OEEG 5L3EA 4KP4A 2DYSB 2EZOA 3OAAG 4L87A 1H8EG 1R6KA 3CYOA 1QCEA 4XDLA 1MG1A 4N21A 1JOYA 3CCUV 1B6QA 2EZPA 1YTFB 5IYCO 3QO5A 1S77D 1MSWD 1JX9A 3IGAC 1AJQA 1Y66A 2WLHA 5LGNA 3OMNB 3TCUA 2XAFA 1NH2D 1VQ6V 3BEHA 1QR8A 1OZ0A 3K3WA 2IW5A 3ETGA 2IJKA 4XDKA 1YHQV 3ABTA 5KUKA 1OCRB 2QKSA 3ZN0A 5EBWC 1V55B 3CCEV 2IH3C 2QTOA 5B1BB 2V7QG 3LSSA 3ZRVA 1QLNA 4H37A 1KC8W 2R9RB 5CBHA 1OCRC 1YJWV 3DTUB 3CCQV 3F7VC 1ENVA 5L3CA 1HWYA 1NR7A 1DLBA 3T4ZA 5IY5C 1GK9A 4GX1A 2GSMB 4ZKIA 1AI5A 1NQTA 3MHHC 2DW4A 5EBMC 4RQEA 1R3LC 3ZMSA 1VQ4V 4EKWA 1VQLV 1FFTB 3AG3C 1RPRA 3K08A 1NR1A 3M99B 2UXXA 1KKDA 3F7YC 4OXSA 4U7NA 4UUJC 1E1RG 1K4DC 3P30A 4GT1A 2B1IA 2IJIA 1S76D 1K73W 3ABUA 1GMGA 2QM7A 5FL7G 3STLC 2AHZA 4FIPC 3ZMUA 1GKFA 1L1FA 2Q6AA 2EIKB 4GCZA 2ZXWC 1F51A 3JD1A 4I5SA 4JASA 1NBMG 1H2GA 3ASOC 3H01A 3IC7A 3ZMZA 3ZN1A 3JYCA 1OCCC 2DYRC 1W2BU 1VQ8V 1H8HG 4PA3A 1MABG 4JYBA 3ABKB 2EIKC 4QE7A 1M57B 4MS2A 5GW7A 4QNHB 4MTOA 2HKOA 4UV8A 4WF9V 3STZC 5H6QA 1VQOV 1KP2A 1QBZA 3E8HA 3X2QB 3TETA 3K0GA 1YSCA 4GX0A 3GWOA 3G71V 3E86A 4PA6A 4R6ZA 4F4LA 2LFSA 4MSWC 3ABLC 3ML0A 5LBQA 2JJ2G 1E1QG 2QM8A 1P4RA 1JQ0A 1M1KW 4MVUA 5IYDO 1I5XA 1QLEB 4PDMA 1KQSU 1Q82W 1S5HC 2ZDIC 5L3BA 2P90A 1NVPD 2BOCC 4TT3G 1SETA 1OCZC 4MVOA 3MD0A 4CBCA 4PELA 1PNKA 2WLNA 3D3IA 4G2KA 3SYQA 3E35A 1FXVA 3CCLV 4MT8A 3AG4C 2H94A 4MW3A 5CN0A 5EBLC 2Q68A 1AI4A 5HFLA 3EFFK 1KD1W 1K33A 1YJNV 2A79B 3QNEA 4J9YB 1DF5A 2ATKC 3ZMVA 1RM1B 4XBFA 3SPJA 2W6IG 4JF3A 3OR7C 2EIJB 3OM3B 1CP9A 2Q69A 2OCCC 1AROP 5B1NA 1KECA 3CP1A 2HVKC 1M90W 3ABMC 3G6EV 3T2MA 1R73A 2A9HA 5DN6G 5CA3A 3SYPA 3CC7V 2QEXV 2ZD9A 4FK5C 2X0LA 2P6JA 2WLKA 4FMTA 4P2ZA 4R8CA 2PI5A 2XNDG 3ZRWB 2ZR2A 2OTLV 4QJFB 1YITV 4MVRA 1WPXA 3E8GA 4JAVA 3CC2V 3RVYA 2HR3A 3WG7C 3SPIA 4JTCB 1FXKC 3G4SV 1PL0A 2DQ0A 1K4CC 3CCVV 2JDIG 5IY5B 2JK5C 4YXWG 3CCMV 5B3SC 1BHBA 2JEUA 3E89A 2BOBC 5E1AC 3CXCU 3AG3B 1BMFG 1OCOC 4QE9A 4KUMA 4P30A 1K5SA 2HFEC 3D36A 3K79A 2EJRA 2UXNA 2EILC 3DGEA 4CZZA 1M9NA 3SYAA 2WWWA 2WAMA 1R6NA 2W6JG 1GTOA 3CCRV 4E2LA 4WCEV 5H6RA 1Q81W 2Z5UA 5EK0A 4G27B 2D3OW 1VQKV 2PI4A 3IFXA 2ZXWB 1V54C 2LP7A 5DM6V 1E79G 1LNQA 4G28B 3ASOB 3JD2A 1SESA 1OCCB 1W0KG 2DYRB 3W7TA 4BIUA 3P32A 1ROPA 5KA6A 3CCJV 4Q20A 1SZTA 4LP8A 3VOUA 3RW0A 4MVZA 3CCSV 4R50A 1THZA 1K9MW 4P9OA 3AG1C 2DWDC 3F5WC 4QPJA 4RAIA 2YEVB 5B1AC 1SRYA 1Q86W 4QPKA 4RQFA 4LCUC 4BW5A 3LUTB 2IJJA 2M7WA 1R3KC 4MVQA 3ZRWA 5L3DA 3WFVA 5BZBA 5IDJA 3ABLB 4U7OA 2GHYA 4JGSA 4ASUG 5KA5A 3VBBA 2XAQA 3PJSK 3AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJW B;  1JCH A;  2B5U A;  2YSU B; 
#chains in the Genus database with same CATH topology
 3OTF A;  4UXN A;  5LL6 Y;  1UFI A;  4DR3 B;  4B3S O;  4ABM A;  2NLJ C;  4DR6 O;  1Y6X A;  2K1E A;  4QIW F;  4FFB B;  3CJH B;  3ZMT A;  1ZUQ A;  3CB2 A;  2BTO A;  4LFC B;  1O9G A;  1QU7 A;  1PD3 A;  1MSD A;  4MTG A;  2CAZ C;  4YHH O;  3L74 H;  1G8M A;  3ZIA G;  1P7B A;  2OCC B;  4ICG A;  1YI2 V;  1JVM A;  3JSN A;  2XAG A;  5KHH A;  1NZ6 A;  4LC1 A;  2ZR3 A;  1DTO A;  1K34 A;  4UFZ A;  3B2E E;  4WFE A;  3QG5 A;  2EIM C;  2B9Z A;  1AJP A;  2FTK A;  3FAV A;  2XAH A;  2E75 B;  3GB7 C;  1BQZ A;  4JTA B;  4KXR A;  1K97 A;  2X7R B;  4JI5 O;  4JYA B;  4JI2 O;  2X6A A;  2EIN C;  1YF2 A;  4JI4 B;  4FM0 A;  4BW9 A;  1XIL A;  1M4U A;  2MK3 A;  4JYY A;  4X20 A;  4A5U B;  3ZJZ A;  4FPP A;  2KB1 A;  2LW7 A;  4H13 B;  3MHS C;  3ZRX A;  2EIL B;  2PTM A;  4DRX A;  1U96 A;  1IBM O;  2ADQ B;  4HNA A;  3LNM B;  1Q6I A;  4YY3 B;  2WLL B;  3ETE A;  1V54 B;  1ZL8 A;  4PDL A;  3JCZ A;  5GON B;  2WLI B;  1FYJ A;  1P7G A;  1M5I A;  4UVA A;  4JI8 O;  1HDJ A;  4LWS B;  5LMN O;  5CB4 A;  5DEC A;  2JJ1 G;  2JS5 A;  3K5L A;  2WA3 A;  4UV9 A;  1AP5 A;  4DV6 B;  3K5M A;  3BCC H;  3ZHV A;  5F2V O;  4Z1V A;  2V1D A;  1D2D A;  3A0H Z;  1YVW A;  3FB6 C;  3CRC A;  1SQP H;  3GWK C;  4PA4 A;  4TV9 B;  1FXK A;  1OHH G;  5LA6 B;  2QWQ B;  1W0J G;  1ZLZ A;  4ZOL B;  2C2A A;  4MW8 A;  2Q7G A;  3MDS A;  3SPH A;  5KLV H;  4FLY A;  3EHB B;  5J2U B;  1VF6 C;  4I0X A;  1LUW A;  3A8T A;  4NTX A;  2Q67 A;  4GKK O;  3ZBH A;  1XMO B;  1QQC A;  2P7T C;  4PA7 A;  5A9G A;  4LFA O;  4IIJ B;  4J11 A;  5KHG A;  4DO2 A;  1WP8 A;  3K06 A;  3HKD B;  1XI1 A;  4I50 B;  2W0F C;  4I4T B;  1BHA A;  1EBO A;  3K9A A;  2F43 G;  1UJW B;  4JAA A;  3SR2 C;  2HEP A;  3LDE A;  1JJO A;  3ETQ A;  3JD4 A;  3FB7 C;  4WFF A;  2EIM B;  3M8A A;  2PF4 E;  2BSK B;  3UCS C;  3P3N A;  2LFR A;  2OIG A;  1VQN V;  3TXQ A;  4DR2 B;  4RUF A;  2EIN B;  4KHP O;  1YXB A;  3UT5 B;  1CPY A;  1QR9 A;  5B1O A;  4JZG A;  3OMA B;  4LFC O;  1V9P A;  1H2M A;  5C93 A;  1AIL A;  1Z5W A;  1N36 B;  3JAR A;  1S72 V;  3EXA A;  1K5Q A;  1HP8 A;  3K04 A;  1HNW B;  1SZX A;  1JFF A;  2DOS A;  5EYP A;  4DV2 B;  3QO7 A;  3RYI A;  3HKC B;  2ETN A;  1WNS A;  2ZIM A;  1R6K A;  1QCE A;  4DK1 A;  1JOY A;  4LNU A;  3RYH B;  5ITZ B;  5IJ9 B;  1Q8I A;  3QO5 A;  1S77 D;  1JX9 A;  1Y66 A;  1WJZ A;  4FFK A;  3OMN B;  2ARH A;  5JQG A;  2IW5 A;  4AQY B;  1TVK B;  1A32 A;  2IJK A;  1YHQ V;  5KUK A;  2QKS A;  1FAF A;  4K8Z A;  4JYA O;  5EBW C;  1VMG A;  2QTO A;  4JI4 O;  3JAT A;  4B7K A;  4EB6 A;  2RN9 A;  4X1Y B;  2QTS A;  4DW0 A;  2VWJ A;  4H37 A;  4IT5 A;  1P49 A;  4JV5 B;  1Z5V A;  1VAR A;  4ZKI A;  4YJ3 A;  4X1K A;  1I7F A;  4RQE A;  3ZMS A;  1VQ4 V;  1OV9 A;  4EKW A;  1SQX H;  1VQL V;  3AG3 C;  3K08 A;  1NR1 A;  4O4I B;  2VQF B;  4YY3 O;  1Q3E A;  2QWN B;  1E1R G;  1K4D C;  3VQX A;  2YXY A;  4LF5 B;  2BTQ B;  4FIP C;  3T1Y B;  1P84 F;  2KG7 B;  1EN5 A;  1BSM A;  4JI0 O;  4ZHQ A;  3AG7 A;  1OCC C;  4PA3 A;  1MAB G;  2ZM6 O;  4DV6 O;  4JYB A;  4QE7 A;  1YZB A;  1WA8 B;  4QNH B;  2HKO A;  1BCC H;  3E8H A;  2CE4 A;  1Q6U A;  5C8Y A;  3GWO A;  3E86 A;  3L72 H;  4PA6 A;  4OX9 B;  4MSW C;  4IYH A;  1P4R A;  1JQ0 A;  3BAA A;  1MMM A;  1D5A A;  3CHX A;  2ZDI C;  2P90 A;  4J42 A;  1OCZ C;  2NR5 A;  1N0J A;  1XUQ A;  1XMO O;  4YJ2 A;  4MT8 A;  3EFF K;  1KD1 W;  2UUC B;  1GRJ A;  1Z2G A;  5LP6 A;  1SF9 A;  2A79 B;  3AK3 A;  4J9Y B;  1DF5 A;  5LXT A;  4NR1 A;  3SPJ A;  1NTK H;  3BVO A;  4NKG B;  2FML A;  1KU9 A;  1M90 W;  3ABM C;  1DGS A;  3I5D A;  1KB9 F;  3CRQ A;  2QEX V;  2ZD9 A;  2E5L O;  2X0L A;  3B40 A;  4R8C A;  1PL4 A;  3DXR B;  2XND G;  4HBN A;  4DV1 B;  4DR2 O;  4JAV A;  3E8G A;  1EM1 A;  3SJA C;  2ZE6 A;  3WG7 C;  3CX5 F;  2ZIO A;  2OIE A;  1KKC A;  1N36 O;  1K4C C;  3OD4 A;  5B3S C;  1BHB A;  4DV3 O;  2JEU A;  2BOB C;  4X66 O;  1HNW O;  3AG3 B;  3L9D A;  4FLT A;  4P30 A;  1XNQ B;  4LFB B;  3K79 A;  3H9V A;  3DGE A;  4CZZ A;  1M9N A;  4X64 B;  3HKB B;  4JI7 B;  2QR4 A;  2P4K A;  1FFX B;  1GTO A;  4I9Q A;  4O2B B;  4G27 B;  4X9Q A;  1VQK V;  1AR4 A;  1T5E A;  4FVM A;  4G28 B;  1OCC B;  2LGW A;  1Y76 A;  1PM9 A;  3CCJ V;  4LP8 A;  3BA8 A;  5IYZ A;  3CCS V;  1K9M W;  3F5W C;  3RGB A;  1CXZ B;  4JV5 O;  2KQX A;  4LCU C;  2QM4 A;  1R3K C;  5AG2 A;  5H5N A;  5BZB A;  3C3T A;  4JGS A;  1BZK A;  5GTI Z;  5KA5 A;  3RYF B;  1EN4 A;  3VBB A;  2XAQ A;  2RCV A;  2RMK B;  3PJS K;  5KHK A;  2HVJ C;  3B8M A;  5D5Q A;  4CS4 A;  4LF5 O;  4O4H B;  1GM9 A;  1OCZ B;  3ZRS A;  2CTW A;  3Q4H B;  5CMU A;  2AHY A;  4RO2 A;  3CME V;  3T1Y O;  4ZBM A;  3KCX A;  5JWP A;  4UVB A;  1SQG A;  4Z2W A;  2RDC A;  1I0H A;  1HR0 O;  1JJ2 U;  1YJ9 V;  4X88 A;  1XEQ A;  4AHC A;  5BMV B;  2W0X A;  1SA0 B;  4X1I A;  3CRA A;  1Y4M A;  1BE3 H;  4K0K B;  4H33 A;  3ABM B;  5IT9 N;  2Y0I A;  1RPO A;  2CK3 G;  4PDV A;  2IBZ H;  2Q0A A;  1JCH A;  2XAS A;  2ZCE A;  3E22 A;  4O4J B;  5JH7 A;  1JPX A;  2F4V B;  2YEV A;  3N2K B;  3WG7 B;  1MNG A;  3PN1 A;  1SKV A;  3G6B A;  2YXL A;  1GN4 A;  3DC6 A;  1K3E A;  3G80 A;  1YTF D;  1S0V A;  2Y69 C;  5B3S B;  4O2A B;  2UUC O;  2HJD A;  2B5U A;  1KUQ A;  1XL6 A;  5BR8 B;  4WFA V;  4WBN B;  3H1K H;  4FFB A;  2WPD G;  1IBL B;  3RVZ A;  5CA1 B;  3SPC A;  4GX2 A;  1G1X B;  5IYB O;  2R9I A;  5L3G A;  2ZE8 A;  3HB3 B;  1BGY H;  4LF7 B;  4ZI7 B;  2Q9L A;  4DR7 B;  1GM8 A;  1N8R W;  1FJG B;  3E8F A;  2Q8V A;  1NKD A;  3ZX6 A;  1V55 C;  3CC4 V;  2QE7 G;  2JGD B;  2V4D A;  2IH1 C;  2Q0O C;  3BPZ A;  4LFB O;  1F7Y A;  1AR5 A;  3KCY A;  3I56 V;  4LF4 O;  1SER A;  2CUG A;  4X64 O;  4JI7 O;  1FS0 G;  1G4Y B;  3CXH F;  1L0N H;  3E2E A;  3K9S A;  3OUS A;  2Y4U A;  2UU9 O;  2YI9 A;  3HPL C;  3ZHR A;  4FLX A;  1ORQ C;  1R3I C;  5JVD B;  3OGC C;  3DC5 A;  1TUB B;  4XDJ A;  2WLL A;  2GBO A;  3ABK C;  3W7U A;  1KMI Z;  5GON A;  1TAE A;  2WLI A;  1QVG U;  3FB5 C;  4LWS A;  4MTF A;  2IJH A;  5HFM A;  3H1J H;  5D5P A;  4CS2 A;  3EVK A;  4RUE A;  5JJJ B;  4WFG A;  4JTD B;  3ASN B;  5EC1 C;  1PNL A;  3SJQ C;  3FYE B;  1NTM H;  2Y69 B;  4TV9 A;  4TV8 B;  3D36 C;  2CGN A;  4P9P A;  1F4N A;  3T4D A;  3ZHU A;  2HLD G;  4DK0 A;  2WLJ A;  5J2U A;  2YSU B;  1N34 B;  1WPB A;  1AJN A;  4J10 A;  2P67 A;  1ZWI C;  2ODM A;  3OEE G;  4KP4 A;  2EZO A;  1H8E G;  4XDL A;  3CYO A;  4IIJ A;  4N21 A;  3JAS B;  1MZE A;  3K57 A;  1Y67 A;  1YTF B;  1HW7 A;  3HKD A;  4I50 A;  2WLH A;  4I4T A;  2F4V O;  5JCO C;  1NH2 D;  1OZ0 A;  2JRI A;  4XDK A;  4NTW A;  4U3J A;  3CCE V;  1V55 B;  1XDC A;  2V7Q G;  2UXC O;  3ZRV A;  2PGG A;  2F95 B;  2QGN A;  2AGA A;  2BSK A;  2R9R B;  5CBH A;  4DUY B;  1YJW V;  5BR8 O;  3CCQ V;  3F7V C;  5L3C A;  1WB7 A;  1AI5 A;  1NQT A;  3H1H H;  2DW4 A;  3MHH C;  1L8D A;  1R3L C;  2XHB A;  1SQQ H;  3UO3 A;  1FFT B;  2IM9 A;  2YID A;  1KKD A;  3UT5 A;  3WU2 Z;  3H1L H;  3HKE B;  2F23 A;  4B3M O;  4UUJ C;  3P30 A;  4B3T B;  2B1I A;  4PI0 A;  4DV5 B;  1S76 D;  1GMG A;  2QM7 A;  4FLU A;  1XNR B;  1AP6 A;  4LF7 O;  3LSU A;  3D3Q A;  4GCZ A;  1ZX3 A;  4TUY B;  3RT3 C;  1NBM G;  1H2G A;  3ASO C;  3HKC A;  3ZMZ A;  3ZN1 A;  1W2B U;  3ZS8 C;  4JI1 O;  3ABK B;  2QDO A;  4MS2 A;  3RYH A;  5ITZ A;  5IJ9 A;  3STZ C;  5H6Q A;  2HP8 A;  1QBZ A;  3K0G A;  4GX0 A;  4L8J A;  1TVK A;  1N33 B;  3BFR A;  2VRZ A;  3ABL C;  5LBQ A;  4DR5 O;  2JJ2 G;  1LUV A;  4CC6 A;  2UXB O;  1KQS U;  4X1Y A;  2F93 B;  1NVP D;  4DR3 O;  1IBK B;  4FZ1 A;  4MVO A;  4J7J A;  1U97 A;  2QSA A;  4O4L B;  3P3P A;  4G2K A;  3SYQ A;  1Y74 B;  1FXV A;  2GUZ B;  4MW3 A;  4NVP A;  3ZHS A;  4O4I A;  5HFL A;  4EEQ A;  1VF6 A;  1YJN V;  2PYJ A;  2Q73 A;  2AZ0 A;  3FD9 A;  4OPA A;  3ZMV A;  4XBF A;  3U0Z A;  1DK1 A;  2FKX A;  4JF3 A;  2BTQ A;  3OM3 B;  1GN6 A;  5B1N A;  2KG7 A;  2A3Q A;  2LO1 A;  4F6R B;  4LF6 B;  3G6E V;  5LMU B;  3T2M A;  4B3R B;  4LR3 A;  5DN6 G;  4F6E A;  3CWB H;  2P6J A;  2WLK A;  1WA8 A;  3ZRW B;  1YIT V;  2MW2 B;  3CC2 V;  3L73 H;  2HR3 A;  3SPI A;  1SC5 B;  4PHZ A;  2QKA A;  1WP7 A;  2P22 C;  3J80 N;  2QWR B;  1PL0 A;  2DQ0 A;  3ZHQ A;  3CCV V;  2JK5 C;  3QTC A;  4DR4 B;  5E1A C;  1N34 O;  3CXC U;  1OCO C;  4QE9 A;  4KUM A;  3F5T A;  1YCI A;  4EFB A;  5KX5 B;  1XHZ A;  1MZF A;  4DR1 B;  3N2G B;  3O65 A;  4H44 B;  2PUS A;  5EK0 A;  5TIS Z;  3IFX A;  1E79 G;  1LNQ A;  1J5E B;  1JA8 A;  3ASO B;  3IAY A;  1SES A;  3W7T A;  3ZHT A;  4DV4 B;  3JAW B;  3P32 A;  4BIU A;  1ROP A;  4LH7 A;  1XOU A;  1IXB A;  1THZ A;  4P9O A;  4RAI A;  1RSO B;  4CH5 A;  4BW5 A;  2M7W A;  3DXR A;  4MVQ A;  5L3D A;  3WFV A;  5IDJ A;  2Y0P A;  3ABL B;  1NT2 B;  3SDL A;  5LP6 C;  3AG2 C;  3JAM N;  3RBZ A;  3LDC A;  4PDR A;  1VP7 A;  4UB8 Z;  4B3T O;  1J95 A;  4DV5 O;  1LR1 A;  3CMA V;  4D7T A;  5BY1 A;  2EBO A;  2XOK G;  5IJ0 B;  4IYI A;  2N04 A;  3B09 A;  1I5Y A;  3ZCC A;  1EZJ A;  4NXM B;  2GTS A;  4DUZ B;  2YIB D;  3HKB A;  3AEI A;  1FFX A;  4O2B A;  4LF8 B;  3CD6 V;  2AXT Z;  3OR6 C;  3OE7 G;  1XQ8 A;  1IX9 A;  3JAT B;  5J2T B;  5CA0 B;  4I55 B;  1NVP B;  1IXM A;  4JPR A;  1N33 O;  1VQ9 V;  3B77 A;  3RYC B;  3R66 A;  2UXD B;  5FNV B;  4UCO A;  3U11 A;  2CGO A;  2ITD C;  2OCH A;  5LGT A;  1IBK O;  5L3F A;  2RNB A;  1O9H A;  4N23 A;  3RYF A;  1F23 A;  2XUM A;  4BIZ A;  1K92 A;  1GM7 A;  1F4M A;  2ZDI A;  2IU3 A;  4JI3 B;  3LDD A;  1OCO B;  4O4H A;  3QO8 A;  4IHJ B;  3HR0 A;  3Q4H A;  4HZ3 A;  1ZSP A;  3BA9 A;  4JAU A;  4KFM A;  1M56 C;  5KMG B;  1I94 B;  1QHT A;  4DV2 O;  4B3R O;  1BT8 A;  2E74 B;  2HG5 C;  1MOF A;  2YIC A;  1AR1 B;  2Z0A A;  4J9Z B;  4GKJ B;  2Z3Y A;  1SA0 A;  1K8A W;  2M6Y A;  5H2F Z;  1BL8 A;  1HNX B;  3J7A U;  1KP3 A;  2ZE7 A;  1FXH A;  3W7W A;  2CTQ A;  1D5N A;  4AQY O;  1FPO A;  2H8P C;  4BAY A;  2X6C A;  5LHH A;  2AW9 A;  3D8C A;  3J81 N;  2KSD A;  2YDE A;  4O4J A;  5KHI A;  3R65 A;  2VQE B;  1YDX A;  3N2K A;  4LF9 B;  2EUL A;  2WSS G;  5LP6 B;  3AG2 B;  2UUA B;  4B3S B;  3SYO A;  4DR1 O;  2LW1 A;  4OGQ B;  4DR6 B;  3W7S A;  2JS3 A;  3FYI B;  2CH7 B;  1XHX A;  4O2A A;  2VQF O;  2QWO B;  3OW2 U;  3K03 A;  4WBN A;  1J5E O;  1GN3 A;  4DV4 O;  3APO A;  2N74 A;  5CA1 A;  4W4K A;  4YHH B;  1EZV H;  3KG2 A;  4JI6 B;  2JIZ G;  4YIO A;  2NNU A;  3S3X A;  4OPH A;  3IJ4 A;  1VEW A;  1M57 C;  1BQ0 A;  4ZI7 A;  3BY6 A;  2YIA A;  4I7Z B;  2QJ1 A;  3A0R A;  3X2Q C;  3OEH G;  3NXS A;  5CBF A;  1YIJ V;  2E3C A;  5LOV B;  4MTX A;  4OX9 O;  3UM7 A;  2LGQ A;  4HAM A;  3UKM A;  1SQV H;  4GX5 A;  2JGD A;  4FJC C;  1TUE B;  4JI2 B;  4TSF G;  2IU0 A;  1TA8 A;  3ASN C;  2R70 A;  2FYU H;  2E76 B;  3ZED A;  2XT9 A;  1PNM A;  1AI7 A;  4I9W A;  5LYJ B;  1PV0 A;  3B8N A;  3T1H B;  2R9A A;  5FPR A;  3BAB A;  1IBM B;  2DJV A;  3FX7 A;  1FKA O;  5J9P C;  1M56 B;  1NI8 A;  5EZY B;  1RM1 C;  3CE2 A;  4LH6 A;  5BXZ A;  2EX3 A;  2O57 A;  4KL1 A;  5L3E A;  3CJH A;  1BS3 A;  4L87 A;  3OAA G;  2UXD O;  1MG1 A;  5JVD A;  4JI8 B;  2EZP A;  2XTA A;  5IYC O;  3GVM A;  1TUB A;  1MSW D;  3IGA C;  2P06 A;  5LGN A;  1N32 B;  3TCU A;  1QR8 A;  3K3W A;  1XMQ B;  1FD9 A;  3ABT A;  1OCR B;  2IH3 C;  3UQ8 A;  4X65 B;  4DV1 O;  2H3O A;  1JMK C;  1QLN A;  1KC8 W;  3DTU B;  3JAL B;  3RFR A;  1DLB A;  3T4Z A;  5IY5 C;  1GK9 A;  1OJH A;  1RPR A;  4TQD A;  3M99 B;  3MAQ A;  4TV8 A;  1EN6 A;  3F7Y C;  4U7N A;  4K8X A;  1XNQ O;  4GT1 A;  2IJI A;  4K3A A;  1S5L Z;  3ABU A;  4GKK B;  3U10 A;  4GKJ O;  1HNZ B;  3STL C;  2AHZ A;  1GKF A;  1L1F A;  2Q6A A;  4GYC B;  2EIK B;  4I5S A;  3JD1 A;  4JAS A;  5JH7 B;  1ZAU A;  3IC7 A;  1VQ8 V;  1UPG A;  1H8H G;  3RWR D;  5IE9 A;  4DYL A;  3VQY A;  2K9P A;  1M57 B;  4WF9 V;  4UV8 A;  4J41 A;  2VQE O;  1KP2 A;  4FLZ A;  3X2Q B;  3TET A;  5FLX N;  2YXH A;  3TJT A;  3AK1 A;  3G71 V;  4LF9 O;  4UCV A;  4R6Z A;  2UUA O;  3ML0 A;  1GN2 A;  3SJC C;  2CTP A;  2Q5Z A;  1I5X A;  5IYD O;  5GTH Z;  5JJE B;  3OGI B;  1Q82 W;  4KHP B;  1S5H C;  5L3B A;  4JZ2 A;  5EIB D;  2BOC C;  5FPO A;  4CBC A;  3MD0 A;  3OT7 A;  1PNK A;  3RN4 A;  2WLN A;  3D3I A;  2HHH B;  3E35 A;  3CCL V;  3AG4 C;  2AZ2 A;  3M7M X;  3HKE A;  2Q68 A;  1AI4 A;  4JI6 O;  4ZIB A;  1K33 A;  3B4S A;  5LA6 A;  3QNE A;  4W4L A;  3LNN A;  4ZOL A;  2ATK C;  1RM1 B;  1URF A;  3JSL A;  2YUA A;  1KEC A;  3CP1 A;  4TUY A;  4K0K O;  5EIB C;  3KKY A;  1R73 A;  2A9H A;  4BWA A;  4FK5 C;  2PI5 A;  2OTL V;  4MVR A;  1JR9 A;  3JAK B;  1FXK C;  3CSX A;  4DV7 B;  3G4S V;  2D2C B;  5IY5 B;  3CCM V;  3T1H O;  3E89 A;  1RFY A;  2Q4P A;  1H2K A;  4U3F H;  2JGU A;  1K5S A;  3D36 A;  4O4L A;  1Y74 A;  3SYA A;  2DMX A;  3L71 H;  2GUZ A;  1R6N A;  2WAM A;  3A0B Z;  4NB5 A;  1IBL O;  2ZNI A;  3BHP A;  4E2L A;  4WCE V;  1N32 O;  2PI4 A;  4JI0 B;  2LP7 A;  3QF7 A;  1XMQ O;  2N05 A;  3JD2 A;  5E79 Z;  2ZM6 B;  4NTY A;  1VF5 B;  2DN9 A;  4X65 O;  1SZT A;  4DR7 O;  4F6R A;  3VOU A;  3AG1 C;  1XBL A;  1FJG O;  2L6L A;  5JCO A;  3FAV B;  5B1A C;  1SRY A;  1Q86 W;  1X59 A;  3LUT B;  2IJJ A;  4Q6G A;  3ZRW A;  4C7U A;  2VS0 A;  2ZNJ A;  3BRC A;  3THO A;  4X20 B;  3WB1 A;  1AVM A;  1CEZ A;  4Z1M G;  2B1G A;  2FL4 A;  1KYO F;  3TXS A;  1R6T A;  3K0D A;  1S3J A;  1HNZ O;  3TK1 A;  4DRX B;  4CS3 A;  4J7K A;  3AG4 B;  2F1M A;  4X89 A;  5KAF Z;  4HNA B;  1G6U A;  5KX5 A;  3C3S A;  1GH6 A;  4CH6 A;  3OUF A;  3VQW A;  3LSQ A;  1M93 A;  5LHI A;  3N2G A;  1ZL8 B;  4U3J B;  2GDS A;  2ZQM A;  5LHG A;  2ITC C;  4DW1 A;  1B06 A;  5CB4 B;  1B3Q A;  1VQM V;  5DED A;  2E5L B;  3JAW A;  2VWK A;  3C90 A;  1AI6 A;  4AI8 A;  2OWO A;  2HJF C;  2LJ2 A;  3E8B A;  4TWK A;  2ADP A;  2QA4 V;  1KBH A;  1VQ5 V;  4PA9 A;  4YIP A;  1RSO A;  1COW G;  1FXK B;  2YS8 A;  1B04 A;  4K35 A;  4MVM A;  2JEX A;  2HHH O;  1AB3 A;  4WFB V;  2DE0 X;  3CEI A;  4DV3 B;  4UVC A;  4X66 B;  4JYC A;  3JCU Z;  1S5J A;  1Q6H A;  1R1B A;  2A0L A;  4I0X B;  5LGU A;  2ZIN A;  3ETD A;  5KUM A;  5IWA B;  4UB6 Z;  5IJ0 A;  1K7D A;  1VQ7 V;  4NXN B;  1NH2 B;  1RP3 B;  1PP9 H;  3JD0 A;  2DYS C;  4R7C A;  1R3J C;  5EC2 C;  3IC9 A;  1VF7 A;  2WA4 A;  3S3W A;  3FB8 C;  4MVS A;  2F66 C;  5J2T A;  2RQ6 A;  5CA0 A;  1IZ3 A;  3I55 V;  3FKS G;  4I55 A;  1SQB H;  3G67 A;  2A7W A;  3AG1 B;  4DV7 O;  2Y48 A;  1EFR G;  4DXW A;  3RYC A;  5B1A B;  5CBG A;  4NYK A;  3CRR A;  5FNV A;  5B1B C;  3JD3 A;  1YEW A;  4CH3 A;  4D6T H;  3DSQ A;  2ZE5 A;  1TGO A;  4DUY O;  2CDY A;  2PYL A;  1I08 A;  2EJ7 A;  3UO2 A;  3JAR B;  4FM1 A;  1X4T A;  3KZI Z;  4PJ0 Z;  1JFF B;  2Q7E A;  5EYP B;  4IHJ A;  3RYI B;  1HR0 B;  1VQP V;  5K1X A;  1XNR O;  1Q7Y W;  5KMG A;  1H2S B;  1WN7 A;  1WLE A;  4LNU B;  3NR7 A;  1XL4 A;  1XRE A;  5H9C A;  2BCC H;  1H38 A;  2Y4T A;  3T1C A;  4TOI A;  5JQG B;  1Q90 D;  1WB8 A;  3SPG A;  3W7X A;  1GAX A;  5A2Q N;  2OTJ V;  1NJI W;  4H0L B;  3TGU H;  2OT5 A;  2DQ3 A;  4GLX A;  2DWE C;  4IL6 Z;  2A06 H;  2FB5 A;  4EB6 B;  4X62 B;  4EFE A;  2BE3 A;  3WB2 A;  1QLE C;  3APQ A;  1DF4 A;  4YJ3 B;  3O9O A;  4X1K B;  3K59 A;  4FZ0 A;  3OFN G;  4LBE C;  1N4C A;  3WB0 A;  4WFH A;  4QGP A;  2ZKO A;  2WLM A;  3OTO B;  4HYO A;  4UCS A;  4X8A A;  3SYC A;  2CH7 A;  2XAJ A;  3OMI B;  3A2F A;  2QWP B;  1QVF U;  3CPW U;  5KAI Z;  4PV1 B;  2X6B A;  4CC5 A;  1WAZ A;  4UCU A;  4DV0 B;  2EIJ C;  3E83 A;  1PKX A;  4ZHQ B;  1GO3 F;  2DYS B;  1PPJ H;  2CTR A;  3CCU V;  1B6Q A;  4LF6 O;  1AJQ A;  5LMU O;  2NN4 A;  2XAF A;  1VQ6 V;  3BEH A;  5C8Y B;  3ETG A;  2UUB B;  5BMV A;  4AIL C;  3ZN0 A;  2G38 A;  5B1B B;  2ILM A;  3LSS A;  5LOV A;  5JJN B;  1OCR C;  2YC0 A;  4GUN A;  4B7E A;  1ENV A;  2YIB A;  1HWY A;  1NR7 A;  1US6 A;  4GX1 A;  2GSM B;  4LF4 B;  4E4E A;  5IWA O;  1IDS A;  5EBM C;  4DR4 O;  1IUR A;  4TQF A;  4YJ2 B;  2UXX A;  2KKW A;  4NXN O;  4OXS A;  3CS5 A;  1SQF A;  2UU9 B;  1K73 W;  4UCR A;  5LXT B;  5FL7 G;  5LYJ A;  3L70 H;  4GZR B;  3ZMU A;  2P4V A;  2GV9 A;  5EZY A;  2ZXW C;  1F51 A;  2LQT A;  1N0N A;  3H01 A;  3JYC A;  4J80 A;  2DYR C;  2EIK C;  3SGI A;  5GW7 A;  4MTO A;  2YI8 A;  1VQO V;  4FM2 A;  1YSC A;  4F4L A;  2LFS A;  1SS3 A;  1E1Q G;  2QM8 A;  1M1K W;  4MVU A;  1QLE B;  3N27 A;  4PDM A;  1H2L A;  3JAL A;  4TT3 G;  1SET A;  4PEL A;  4JI5 B;  3SJB C;  2RJZ A;  2H94 A;  5K1P A;  5CN0 A;  5EBL C;  2L35 A;  2OYQ A;  3FFQ A;  4NXM O;  2PZS A;  4D7S A;  1IVS A;  4DUZ O;  2W6I G;  3OR7 C;  2EIJ B;  3K5O A;  3K58 A;  4J7Z A;  2P5O A;  4LF8 O;  1Y76 B;  1CP9 A;  2Q69 A;  2OCC C;  1ARO P;  2ZT9 B;  2HVK C;  4BR6 A;  5IYZ B;  3QVN A;  4RWU A;  5CA3 A;  3SYP A;  4X62 O;  3CC7 V;  4FMT A;  4P2Z A;  2ZR2 A;  4QJF B;  5LMN B;  1NTZ H;  2UXC B;  1WPX A;  3RVY A;  1QNM A;  4JTC B;  4PI2 A;  2GTA A;  3OTO O;  2QKC A;  2JDI G;  4YXW G;  5B5E Z;  2JVD A;  4CH4 A;  2Q7H A;  1BMF G;  1ZTE A;  4JI3 O;  1VIB A;  4B3M B;  2HFE C;  2EJR A;  2UXN A;  4DV0 O;  4PD4 F;  2EIL C;  2PY5 A;  3CRM A;  4FLV A;  2WWW A;  2W6J G;  3CCR V;  1NU1 H;  3K5N A;  5H6R A;  1Q81 W;  1I94 O;  2Z5U A;  4X1I B;  2D3O W;  3L75 H;  3ICX A;  1L0L H;  1H2N A;  2ZXW B;  1V54 C;  5DM6 V;  3VQV A;  2UUB O;  4JI1 B;  4B08 A;  1W0K G;  2DYR B;  1MA1 A;  4LFA B;  5KA6 A;  3E22 B;  5B66 Z;  4Q20 A;  5KHJ A;  1HNX O;  3RW0 A;  4MVZ A;  4R50 A;  1Q43 A;  4QPJ A;  2DWD C;  2YEV B;  3AK2 A;  4QPK A;  4RQF A;  4IGG A;  3JAS A;  1NS1 A;  4DR5 B;  4UCT A;  4FLW A;  2R72 A;  4U7O A;  2GHY A;  3H1I H;  4ASU G;  4BIO A;  2UXB B;  1Q5O A;  3JAK A;  1W59 A; 
#chains in the Genus database with same CATH homology
 1CEZ A;  4Z1M G;  3RBZ A;  3LDC A;  4UXN A;  2HVJ C;  2B1G A;  4PDR A;  3B8M A;  1J95 A;  2NLJ C;  3CMA V;  1GM9 A;  1OCZ B;  3ZRS A;  2EBO A;  3K0D A;  1S3J A;  2K1E A;  4QIW F;  3TK1 A;  2XOK G;  3ZMT A;  5CMU A;  1I5Y A;  2AHY A;  4RO2 A;  3CME V;  3AG4 B;  4ZBM A;  4X89 A;  3ZCC A;  1EZJ A;  4UVB A;  3OUF A;  1JJ2 U;  1YJ9 V;  3LSQ A;  4X88 A;  1PD3 A;  5LHI A;  3AEI A;  4MTG A;  3CD6 V;  3OR6 C;  3OE7 G;  5LHG A;  1G8M A;  2ZQM A;  3ZIA G;  1Y4M A;  2ITC C;  1P7B A;  2OCC B;  1YI2 V;  1VQM V;  1JVM A;  4H33 A;  3ABM B;  2XAG A;  1NVP B;  1RPO A;  1IXM A;  4JPR A;  2CK3 G;  4LC1 A;  2ZR3 A;  1VQ9 V;  1DTO A;  3B77 A;  4PDV A;  1K34 A;  1JCH A;  1AI6 A;  2XAS A;  4WFE A;  2HJF C;  3E8B A;  4TWK A;  2EIM C;  1JPX A;  2ITD C;  2QA4 V;  1AJP A;  2FTK A;  2YEV A;  1VQ5 V;  2XAH A;  4PA9 A;  3GB7 C;  1COW G;  5LGT A;  3WG7 B;  4JTA B;  1FXK B;  1K97 A;  2X7R B;  5L3F A;  4MVM A;  4N23 A;  2JEX A;  2X6A A;  1K3E A;  2EIN C;  4WFB V;  1YTF D;  1S0V A;  2Y69 C;  2MK3 A;  4UVC A;  1F23 A;  5B3S B;  4JYC A;  3ZJZ A;  4BIZ A;  4FPP A;  1K92 A;  1GM7 A;  1F4M A;  2B5U A;  2A0L A;  2IU3 A;  2KB1 A;  2ZDI A;  1XL6 A;  3LDD A;  5LGU A;  1OCO B;  3MHS C;  4WFA V;  3QO8 A;  3ETD A;  4HZ3 A;  5KUM A;  2WPD G;  3ZRX A;  2EIL B;  4JAU A;  4KFM A;  1K7D A;  3RVZ A;  1M56 C;  3SPC A;  4GX2 A;  1VQ7 V;  3LNM B;  5IYB O;  2R9I A;  5L3G A;  1NH2 B;  3HB3 B;  3JD0 A;  2DYS C;  4R7C A;  2HG5 C;  1R3J C;  1MOF A;  5EC2 C;  2WLL B;  3ETE A;  1AR1 B;  1V54 B;  4J9Z B;  2Z3Y A;  3JCZ A;  4PDL A;  2WLI B;  4UVA A;  3FB8 C;  1K8A W;  4MVS A;  1BL8 A;  3I55 V;  1GM8 A;  3FKS G;  1N8R W;  1KP3 A;  2JJ1 G;  1FXH A;  3W7W A;  3E8F A;  3AG1 B;  2H8P C;  2Y48 A;  1NKD A;  1EFR G;  4UV9 A;  4DXW A;  5B1A B;  5CBG A;  1V55 C;  4BAY A;  2X6C A;  5LHH A;  3CC4 V;  5B1B C;  2QE7 G;  3JD3 A;  3R65 A;  2V1D A;  3FB6 C;  2IH1 C;  4PA4 A;  1FXK A;  1OHH G;  2WSS G;  3AG2 B;  3I56 V;  1W0J G;  3SYO A;  1SER A;  2C2A A;  4MW8 A;  3SPH A;  1FS0 G;  3W7S A;  1G4Y B;  3FYI B;  3E2E A;  3EHB B;  3OW2 U;  3OUS A;  3K03 A;  2Q67 A;  3HPL C;  1VQP V;  2P7T C;  4PA7 A;  1Q7Y W;  1ORQ C;  1R3I C;  1WLE A;  3KG2 A;  4DO2 A;  3OGC C;  2JIZ G;  2NNU A;  1XL4 A;  3K06 A;  4XDJ A;  5H9C A;  1H38 A;  2W0F C;  1BHA A;  1EBO A;  2WLL A;  3T1C A;  3ABK C;  3SPG A;  3W7U A;  3W7X A;  1M57 C;  3K9A A;  2F43 G;  2WLI A;  1QVG U;  1UJW B;  1NJI W;  2OTJ V;  3BY6 A;  3FB5 C;  3A0R A;  3LDE A;  3X2Q C;  3OEH G;  3JD4 A;  3NXS A;  4MTF A;  2OT5 A;  3FB7 C;  2IJH A;  4WFF A;  5CBF A;  1YIJ V;  5HFM A;  2DQ3 A;  2DWE C;  4RUE A;  2EIM B;  4MTX A;  4WFG A;  4JTD B;  3UM7 A;  3ASN B;  4HAM A;  5EC1 C;  3UKM A;  2LFR A;  1VQN V;  1PNL A;  4GX5 A;  1QLE C;  4FJC C;  1DF4 A;  1TUE B;  3SJQ C;  3OFN G;  4TSF G;  2IU0 A;  4RUF A;  2EIN B;  4LBE C;  3FYE B;  2Y69 B;  4WFH A;  3ASN C;  1CPY A;  1QR9 A;  5B1O A;  2WLM A;  3OMA B;  4P9P A;  4HYO A;  1PNM A;  5C93 A;  1AI7 A;  1F4N A;  4X8A A;  3T4D A;  3SYC A;  4I9W A;  1S72 V;  1K5Q A;  2HLD G;  3B8N A;  2WLJ A;  3K04 A;  2XAJ A;  3OMI B;  2YSU B;  5J9P C;  1M56 B;  1QVF U;  3CPW U;  1AJN A;  2X6B A;  2P67 A;  1RM1 C;  1ZWI C;  3QO7 A;  2EIJ C;  3E83 A;  1PKX A;  1GO3 F;  3OEE G;  5L3E A;  4KP4 A;  2DYS B;  2EZO A;  3OAA G;  4L87 A;  1H8E G;  1R6K A;  3CYO A;  1QCE A;  4XDL A;  1MG1 A;  4N21 A;  1JOY A;  3CCU V;  1B6Q A;  2EZP A;  1YTF B;  5IYC O;  3QO5 A;  1S77 D;  1MSW D;  1JX9 A;  3IGA C;  1AJQ A;  1Y66 A;  2WLH A;  5LGN A;  3OMN B;  3TCU A;  2XAF A;  1NH2 D;  1VQ6 V;  3BEH A;  1QR8 A;  1OZ0 A;  3K3W A;  2IW5 A;  3ETG A;  2IJK A;  4XDK A;  1YHQ V;  3ABT A;  5KUK A;  1OCR B;  2QKS A;  3ZN0 A;  5EBW C;  1V55 B;  3CCE V;  2IH3 C;  2QTO A;  5B1B B;  2V7Q G;  3LSS A;  3ZRV A;  1QLN A;  4H37 A;  1KC8 W;  2R9R B;  5CBH A;  1OCR C;  1YJW V;  3DTU B;  3CCQ V;  3F7V C;  1ENV A;  5L3C A;  1HWY A;  1NR7 A;  1DLB A;  3T4Z A;  5IY5 C;  1GK9 A;  4GX1 A;  2GSM B;  4ZKI A;  1AI5 A;  1NQT A;  3MHH C;  2DW4 A;  5EBM C;  4RQE A;  1R3L C;  3ZMS A;  1VQ4 V;  4EKW A;  1VQL V;  1FFT B;  3AG3 C;  1RPR A;  3K08 A;  1NR1 A;  3M99 B;  2UXX A;  1KKD A;  3F7Y C;  4OXS A;  4U7N A;  4UUJ C;  1E1R G;  1K4D C;  3P30 A;  4GT1 A;  2B1I A;  2IJI A;  1S76 D;  1K73 W;  3ABU A;  1GMG A;  2QM7 A;  5FL7 G;  3STL C;  2AHZ A;  4FIP C;  3ZMU A;  1GKF A;  1L1F A;  2Q6A A;  2EIK B;  4GCZ A;  2ZXW C;  1F51 A;  3JD1 A;  4I5S A;  4JAS A;  1NBM G;  1H2G A;  3ASO C;  3H01 A;  3IC7 A;  3ZMZ A;  3ZN1 A;  3JYC A;  1OCC C;  2DYR C;  1W2B U;  1VQ8 V;  1H8H G;  4PA3 A;  1MAB G;  4JYB A;  3ABK B;  2EIK C;  4QE7 A;  1M57 B;  4MS2 A;  5GW7 A;  4QNH B;  4MTO A;  2HKO A;  4UV8 A;  4WF9 V;  3STZ C;  5H6Q A;  1VQO V;  1KP2 A;  1QBZ A;  3E8H A;  3X2Q B;  3TET A;  3K0G A;  1YSC A;  4GX0 A;  3GWO A;  3G71 V;  3E86 A;  4PA6 A;  4R6Z A;  4F4L A;  2LFS A;  4MSW C;  3ABL C;  3ML0 A;  5LBQ A;  2JJ2 G;  1E1Q G;  2QM8 A;  1P4R A;  1JQ0 A;  1M1K W;  4MVU A;  5IYD O;  1I5X A;  1QLE B;  4PDM A;  1KQS U;  1Q82 W;  1S5H C;  2ZDI C;  5L3B A;  2P90 A;  1NVP D;  2BOC C;  4TT3 G;  1SET A;  1OCZ C;  4MVO A;  3MD0 A;  4CBC A;  4PEL A;  1PNK A;  2WLN A;  3D3I A;  4G2K A;  3SYQ A;  3E35 A;  1FXV A;  3CCL V;  4MT8 A;  3AG4 C;  2H94 A;  4MW3 A;  5CN0 A;  5EBL C;  2Q68 A;  1AI4 A;  5HFL A;  3EFF K;  1KD1 W;  1K33 A;  1YJN V;  2A79 B;  3QNE A;  4J9Y B;  1DF5 A;  2ATK C;  3ZMV A;  1RM1 B;  4XBF A;  3SPJ A;  2W6I G;  4JF3 A;  3OR7 C;  2EIJ B;  3OM3 B;  1CP9 A;  2Q69 A;  2OCC C;  1ARO P;  5B1N A;  1KEC A;  3CP1 A;  2HVK C;  1M90 W;  3ABM C;  3G6E V;  3T2M A;  1R73 A;  2A9H A;  5DN6 G;  5CA3 A;  3SYP A;  3CC7 V;  2QEX V;  2ZD9 A;  4FK5 C;  2X0L A;  2P6J A;  2WLK A;  4FMT A;  4P2Z A;  4R8C A;  2PI5 A;  2XND G;  3ZRW B;  2ZR2 A;  2OTL V;  4QJF B;  1YIT V;  4MVR A;  1WPX A;  3E8G A;  4JAV A;  3CC2 V;  3RVY A;  2HR3 A;  3WG7 C;  3SPI A;  4JTC B;  1FXK C;  3G4S V;  1PL0 A;  2DQ0 A;  1K4C C;  3CCV V;  2JDI G;  5IY5 B;  2JK5 C;  4YXW G;  3CCM V;  5B3S C;  1BHB A;  2JEU A;  3E89 A;  2BOB C;  5E1A C;  3CXC U;  3AG3 B;  1BMF G;  1OCO C;  4QE9 A;  4KUM A;  4P30 A;  1K5S A;  2HFE C;  3D36 A;  3K79 A;  2EJR A;  2UXN A;  2EIL C;  3DGE A;  4CZZ A;  1M9N A;  3SYA A;  2WWW A;  2WAM A;  1R6N A;  2W6J G;  1GTO A;  3CCR V;  4E2L A;  4WCE V;  5H6R A;  1Q81 W;  2Z5U A;  5EK0 A;  4G27 B;  2D3O W;  1VQK V;  2PI4 A;  3IFX A;  2ZXW B;  1V54 C;  2LP7 A;  5DM6 V;  1E79 G;  1LNQ A;  4G28 B;  3ASO B;  3JD2 A;  1SES A;  1OCC B;  1W0K G;  2DYR B;  3W7T A;  4BIU A;  3P32 A;  1ROP A;  5KA6 A;  3CCJ V;  4Q20 A;  1SZT A;  4LP8 A;  3VOU A;  3RW0 A;  4MVZ A;  3CCS V;  4R50 A;  1THZ A;  1K9M W;  4P9O A;  3AG1 C;  2DWD C;  3F5W C;  4QPJ A;  4RAI A;  2YEV B;  5B1A C;  1SRY A;  1Q86 W;  4QPK A;  4RQF A;  4LCU C;  4BW5 A;  3LUT B;  2IJJ A;  2M7W A;  1R3K C;  4MVQ A;  3ZRW A;  5L3D A;  3WFV A;  5BZB A;  5IDJ A;  3ABL B;  4U7O A;  2GHY A;  4JGS A;  4ASU G;  5KA5 A;  3VBB A;  2XAQ A;  3PJS K;  3AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...