2YXYA

Crystarl structure of hypothetical conserved protein, gk0453
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
EQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYMLNPADFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISLLRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein, GK0453
publication title Structure of the hypothetical DUF1811-family protein GK0453 from Geobacillus kaustophilus HTA426
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08838 DUF1811 Protein of unknown function (DUF1811)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.880 Mainly Alpha Orthogonal Bundle Helix Hairpins Hypothetical protein YfhH domain 2yxyA01
2.30.30.340 Mainly Beta Roll SH3 type barrels. Hypothetical protein YfhH like domains 2yxyA02
2YXYA 1SF9A
chains in the Genus database with same CATH superfamily
2Q0AA 1BMFG 2GTAA 1BCCH 3MHSC 4L5GA 2DTOA 3PT9A 1XQHA 3K5MA 3UT5B 1IX9A 3BABA 3S3XA 4XDLA 2UU9O 3JAMN 4FLTA 1JO8A 4M7DE 5IXBA 5DLQE 3JATB 3AG4B 3M9QA 4ME7A 3EG3A 5BR8O 4AFZC 3I35A 5DLOA 2KG7B 3CEIA 2K1EA 1M57B 3SEMA 3L2QA 2KQXA 1VQ5T 2BZYA 1JXOA 4KT0E 1IO6A 2FO0A 3LH5A 2P4VA 3EG0A 1YJ9Q 4DA4A 5BZBA 2GBOA 1WIEA 3QWXX 5KAFZ 2WSFE 4HBNA 3J7AF 1EZJA 4BI3A 1SZXA 2QKAA 1VQNQ 1H8HG 5JQGB 4DV1B 2ETNA 3CCLV 1WJQA 1X6OA 5H5NA 2XK0A 2A36A 4NS5A 1PSEA 3JCMg 1UHFA 2L89A 4QKUA 5KYNA 1QHTA 4MVRA 1PRMC 5CB4A 2EKHA 1OCCC 2KE9A 2DKGA 2DIGA 5GANf 1THZA 3CCQA 4QVZA 2XAJA 1AHJB 1FYJA 2YLBA 2BTTA 3CCUV 3AHUA 4NB5A 5GAMg 3JB9D 3QSUA 4RTTA 1S5JA 1WXBA 3LX7A 4YHHO 2YC0A 4N4IA 3HP9A 3RIRA 3GIBA 3AK3A 3G4SV 4HVWA 3APQA 3D7SB 3CC4Q 3ETEA 3CYOA 4CC6A 3CCSV 4FM0A 1R0CB 4MZTA 4F7UE 3HKBB 2AK5A 2ESWA 3W7SA 3CD6Q 4ZHQA 2F66C 3QWYA 3D36C 5FWBA 4DBFA 4BIOA 1KD1R 2XI9A 2OAUA 2CGOA 1KFZA 2SRCA 2KRNA 3U10A 2EVRA 2IG0A 1ZHIA 1EM1A 3LNNA 1KQSP 4E7SA 1WPBA 3EG1A 1NZ6A 4M7AF 2Y0IA 3SYAA 5DN6G 1R8OB 4P9OA 5B1NA 2DN9A 4M7AG 2JDIG 4OGCA 4L8JA 4IUTA 4DV7B 2EYXA 5GONA 4RUFA 3ZMZA 2E6NA 2K5FA 3NMZC 2JTEA 3L2RA 1BI3A 3G6EA 1ZAUA 5LP6C 2XIDA 5IY5C 2HAXA 4X62B 2GDSA 4F04B 1BIAA 1JBMA 1TG0A 4M78D 1WN7A 3LDDA 3OYYA 1EZZB 2JS5A 3HKCB 4RTZA 1UGSB 4X89A 3ZMTA 2ZPIB 4YJ3B 2FVUA 1JU5C 1PKXA 4TV9B 3THOA 5DM7R 4BWAA 2QQAA 5LP6A 3RW0A 2JNGA 1NZ9A 2MYSA 2DX1A 2VASA 4W4KA 3I5RA 2ARHA 1AJPA 2DQ0A 4J6WA 4FYXB 2F23A 4OMFB 2OIGA 5C93A 5LHIA 1M90W 2DXTA 2F93B 3X25B 5AG2A 4GKJO 4CS3A 3Q4HA 3M0UA 4DR7O 2QKCA 3H9NA 3META 5KHIA 1F1BB 3UA6A 2CH7B 1NTMH 3MD0A 3U23A 4J80A 1FFXA 3D3QA 1N4CA 2HR3A 2JGDB 3WG7C 2WWWA 1AILA 2LT1A 3OMNB 5DM6V 4UCTA 4JRKA 3FFQA 3ZHQA 3ASNB 2R9AA 4O4JA 3RYCA 4X34A 1LNQA 1EX4A 5BMVB 4RO2A 2J6FA 5AT1B 3JD2A 2ZPHB 1BE3H 1P7GA 3VRYA 5CKDA 1BI1A 1UE9A 4M77B 1KQ1A 1WA8B 3WB0A 2A08A 3JB9G 2EQUA 3OSVA 5LJ5f 2HSEB 2VV5A 5L3EA 1VQMV 4LDVA 2LVMA 5C0MA 2GQVA 1Q81W 1E6HA 3EFOB 2A0FB 2HLDG 4B3RO 2X4XA 4M7DB 2JJ1G 3EHBB 1KBHA 2ATCB 3CCMQ 1JB0E 3CCQQ 3TETA 1KD1C 3AG2B 2D0QB 2LGQA 1G4YB 5CA1B 1IVSA 3SJCC 1YHQV 3ABTA 4JF3A 2YRDA 3GLXA 1RABB 4A4GA 1PSFA 4UVBA 2DM1A 3LGLA 3M0SA 3K79A 1QKWA 1WJZA 4LD9K 3JCMe 2K2MA 3B09A 1YIJV 4X1VA 1FMWA 2EYWA 3NTHA 5LYJA 1G5VA 1RLPC 1UJ0A 1QVGA 2YRVA 2Q5ZA 1YJWV 1FJGB 1QVPA 2DL8A 2EQKA 5FPRA 3GNFB 5DY9A 3OFNG 5FW9A 1J95A 1ARKA 5LJ5g 3J7AU 1D5AA 1VQPV 4JLIA 4M78G 2PQWA 2ZIMA 3CC7V 4OVAA 3IAYA 1IHWA 4LF4B 1H2NA 4WFFA 3W7XA 4FLWA 4JYAO 4JJNK 3TCUA 1QLNA 4M7AC 2YEVA 4PJOF 4TOIA 2AXTZ 3K04A 1SQPH 4AHCA 2ECZA 1KD1U 5GAN2 1KP3A 1TU0B 4UFZA 4XBFA 4FK5C 1QVGU 5LGTA 1B34A 3GNGA 4X9QA 5D5PA 5GAOl 3ZHTA 3KKYA 5KYXA 3BW1A 3OD4A 2DJVA 3CCJT 3OGCC 1S5HC 3NFCA 4QGPA 5GMKm 1PD1A 1WHJA 4Z1MG 2BOBC 1NYGA 1Y66A 4LC1A 3VV0A 2EINB 5FRNA 3G67A 2CT3A 4CS4A 1ZX3A 2M02A 3EG9A 4MW3A 3W7WA 2QI2A 1TUCA 3H01A 1SS3A 1JMKC 1RACB 5FU6C 1OV9A 3OR6C 2C0TA 4AT1B 5IYCO 5HK0A 2XDDA 1Q7YR 4QJFB 2Q7GA 3RYHA 1R1BA 4DO2A 5IJ9B 3G6BA 1HD3A 1LCKA 3MP1A 3G7ZA 2AKKA 1VQOA 5KYYA 5JH7A 3T1HO 3F7YC 3EGDB 1KJWA 1QBZA 4A5UB 3A0HZ 1X6GA 4EKWA 4YY3B 3FB9A 3O65A 4M77D 5GAN5 5IDJA 2RM4A 1XL6A 1UG1A 4RTVA 2HBPA 4K0KO 1AJNA 3JCMX 5GANj 2HQEA 1QCFA 3MO8A 2E74B 5E79Z 1OX8A 1WP8A 2QWNB 1I7FA 1HW7A 2GUZB 5ECAA 3EXAA 4JS4A 1WGSA 4M7DD 4FCYA 1EFNA 2E70A 1N33B 1NEGA 4JGSA 2V1DA 2PUKB 3CPWU 4MDWA 1LVKA 1UPGA 1WA7A 1YJNV 2HG5C 4GYCB 3X20B 5EIBD 1K4US 3JARB 3HPWA 1SA0A 3MJXA 2YSUB 4CC4B 3OSSC 1B04A 1QQCA 4HNAA 1L0LH 2H8PC 3CP1A 1MUZA 3P8DA 2DETA 3KBGA 2P6JA 2AZ2A 1VF5B 5KA5A 1QVGS 1T5EA 2C2AA 2QWRB 1PP9H 3HL8A 2D3OW 3LH0A 4FSSA 4FT2A 1SZTA 2UUCB 4DV5B 1A0NB 4XQ3A 2IBZH 3QZ5B 3UKMA 3ABKB 1QCOA 2M0OA 2DL7A 3M56A 2QR4A 4J9YB 4QQ6A 2OTJT 1PC0A 1Q8IA 4LF8O 5GAN8 4WF2A 3WB2A 4Z2WA 1PM3A 1FS0G 4M78C 2HVKC 1SHFA 1X2QA 4DUZB 1SEMA 1BL8A 2JTFA 1Y6XA 5GW7A 1J3TA 4JZGA 5KA6A 3R66A 1QP3A 3A5ZB 4BE2A 5LOVB 4WCIA 4JPRA 2P06A 2W6JG 4TUYA 3PVQA 3QJ6A 5LHGA 1T0JA 4KRTA 3VS1A 1UB4A 4ELZC 3KZIZ 1Y74B 3L73H 4GX2A 5KYWA 1K33A 1VIBA 4CH3A 4M78A 4KFMA 4PA6A 2E5KA 2FZKB 1LUWA 1YVWA 1K5QA 1PD0A 3IQLA 3ZRSA 4LF9B 3AG4C 1UTIA 1XNIA 4HT8A 1RL2A 3ZS8C 4X20B 3ZMUA 4IUPA 1P92A 2HHHB 1WXUA 3QPHA 2BOCC 3UT5A 1W2BP 1M57C 2RQTA 4JI6B 1VQKT 4N4HA 5GAOr 2CKKA 3WVDB 3V8KA 4CC7A 2HEPA 3OGIB 2VQEO 3JATA 4J83A 2E12A 1BI2A 3URGA 2KG7A 1VQOQ 1N32B 2NUTB 4WFGA 3QZ9B 5LJ5j 2E75B 4PI0A 2RF0A 3S3NA 1VQLT 3OYLA 4DUYB 4M7DG 2EQJA 5CR2A 1AP6A 4RTXA 2YXYA 2ZPEB 4DRXB 1D3BB 2K79A 3BDLA 4O4LB 4LXCA 1K4DC 4ESRA 3RN4A 3SDLA 4OMNA 1KECA 1FD9A 1JCHA 3CBMA 1XILA 4XU2A 4DV1O 1TOVA 1U1SA 3BA9A 4PJNA 1N34O 2QM8A 3T1YO 2GTSA 1KKCA 4B3TB 4GT1A 4DV3B 3VQWA 1ZUKA 4AQYB 4BI4A 5FL7G 5IHIA 3CE2A 1JPXA 4HVUA 2XAQA 3FB8C 2WA3A 2EGAA 4OMPA 2DILA 1NJIC 2IU0A 1VQ7V 4C92E 3B8NA 4LNUB 3BHPA 4A4KA 4LF6B 1RSOB 2HZYA 4X1KB 1VYTA 5LA6B 2KRMA 3M8AA 2IW5A 2YUNA 1BGYH 5IWAO 1T3SA 5GJVB 4CC5A 5LJ3h 3HKBA 4LFCB 3L72H 1NR7A 1HSQA 3M0RA 2VB6A 4KGXB 1VQ8T 3M57A 5GAOn 2A7WA 1TVKB 2CP3A 1E79G 1Q81R 5CA0B 4OB3B 2CP0A 5B1AC 4PA3A 1GAXA 1MMGA 2PYLA 1UUEA 1T3LA 3EAEA 3NTKA 2X4YA 4C0DB 4ZGEB 1FAFA 1AR4A 3DLMA 1KQSA 3KG2A 2JZ2A 5B66Z 1X75C 4YTLA 4LFBB 3H0HA 4DV7O 3BFRA 4X1IB 3CSXA 1SQQH 3CCVT 4I4TB 3JAWB 1TGOA 3OYEA 1KMIZ 3CMAT 5HKCA 3BRCA 1M8MA 4X62O 1MG1A 4LF5B 3HKCA 2JMAA 4Z8AA 2OTLV 4YJ3A 3ZHRA 2HKNA 3F5TA 3H1IH 4TV9A 1BU1A 2Q69A 2DEUA 1JJ2U 4OB0B 1M9NA 4GUNA 4HVVA 3K06A 2DFUA 4F6RB 4R6ZA 1M1KC 1Q86C 1XHZA 2XICA 3DB3A 2IM9A 1OCOC 3C4SA 2Q9LA 3CS5A 4IIJB 4EPCA 4UCOA 3MAQA 4PJJA 3VU3C 4JRQA 3A2FA 3CC2A 1VMGA 2PZ1A 3T4DA 1FYNA 2CREA 3FLGA 4BAYA 4M75F 2JGDA 5EK0A 4F4LA 2C0OA 4AG1C 1KQ2A 3SR2C 2K7AA 2OCCB 4MSWC 1HNZB 3T9NA 2DK3A 5M9OA 3CCJA 1RM1B 3ABMB 4DXWA 2EQMA 1EN4A 4PA9A 4ZNXA 3CMEV 4N23A 2LCSA 1KD1W 5BMVA 1V9PA 4L6V5 4EMKB 4GCZA 3DXRB 4D7SA 4M7DC 4G28B 4MVMA 2VVKA 4M77A 2OTLT 1WLEA 3KFVA 3AG2C 1S72A 4JAAA 2CZ7B 1WA8A 2JUFA 1Q82R 5KE2A 4PDVA 2RN8A 2HFEC 2A3QA 4NKGB 3I56V 5EIBC 1N9SA 3G71Q 1K9MC 3B77A 3EFOA 3INZA 2HP8A 1VARA 2E6ZA 3AT1B 4OPHA 2JGUA 4LDYA 2ZE5A 2ZINA 4C8QF 4M7DA 1K3EA 2D8JA 2DWDC 3BEHA 4B3SB 3OYKA 3ZIAG 2BTOA 3ZEDA 3OMGA 4ELYC 4KUIA 1JFFB 4C5GA 1Q81C 1TUBB 4YJ2B 2EGCA 1QMCA 4LN2A 1K8AC 2D8HA 1YITV 1R77A 2KR3A 2Z0WA 4J6YA 4TV8B 3TK1A 4KHPB 1YCIA 4LD6A 3OW2P 4ORZA 4JI2B 1TAEA 1MNEA 3SYOA 3CMET 1OHHG 4PA7A 5C8YB 2DQ3A 1VF6C 4JDSA 5KCOA 2WA4A 2E64A 2MK5A 3VBBA 1FMKA 5HCKA 2UXBB 3E9GA 1UGVA 3JCMJ 2P4RA 1XMQO 2XAHA 4J8OA 1CSKA 1FJGO 2X4JA 1JJ2S 3GPLA 4G27B 3DC5A 1HP8A 1K9MU 3OAAG 5FU7C 2DA9A 4RG2A 4K8ZA 6AT1B 4Z89A 3CCRV 3FJPA 1F4MA 2QGNA 2DERA 5A2QE 2EQIA 4F14A 1Q81U 1GN4A 2EINC 2DVJA 4N4GA 4C92B 1K8AU 1CKAA 3E22B 4BIUA 1Q90D 3BAAA 1AWJA 5JJJB 3G1JA 3O5ZA 4I9WA 2HKOA 3MP6A 2P7TC 2UXNA 2QEXT 5F2VO 3SD4A 3ZX6A 4WFAV 4CH6A 2X3XD 1W0JG 1RI0A 2F5KA 3OYHA 2HNIA 4K35A 3ASOB 1AP5A 2G38A 4XTYA 4ABMA 3CCEV 4AILC 4JV5B 4ZI7B 2OTJA 1N27A 2IJIA 2DIQA 1WB8A 2MI6A 4D8KA 3SB2A 4H0LB 2QQSA 4GY5A 3CC2Q 1GO3F 4C5EA 3AG1B 4RQFA 2YDEA 3RKWA 1WJRA 1Q82C 5GMKh 3OTFA 4XU0A 2MIOA 3K08A 1D1AA 3EGDA 4FT4A 2RCVA 3CCJQ 2W6IG 1X27A 2LW7A 4XDJA 4EFEA 1FFTB 1TXQA 4AMCA 2L0AA 2RJEA 2UXCB 3SWNB 1BT8A 3ZBHA 2F4VB 2H3JA 4PJLA 3QBYA 2E3IA 4I50B 3RMQA 1V1CA 1SESA 5KUMA 4FIBA 3JCMV 4E6RA 4JZ4A 5CKBA 3MPUB 3RDVA 3PTAA 4OPAA 2GUZA 2W0ZA 4E7JA 1S72Q 3VS6A 4JJBA 1VQKA 1YWPA 4A54A 4EMGA 1V54B 2JMCA 2NUPB 1AWOA 4O2BB 2QTVA 5LJ3d 2RN9A 5GAN7 1U06A 3CCET 3E8FA 5GMKl 1PNMA 4NXMB 1N33O 1W6XA 3CXHF 1AOJA 3CRQA 1DK1A 1P84F 1TA8A 1W4SA 2QA4V 3JARA 4RTWA 3MEVA 1V55C 2RPNA 1Q6UA 4B6MA 2BIVA 1Q82U 2PI4A 1VQLA 1P4RA 4QQDA 4PJ0Z 2B86A 2HL5C 1VQ6T 3ABKC 1YP5A 1PRLC 2RJDA 5LL6S 5LXTB 3MEAA 4MTFA 3QUIA 4Y92A 2PTKA 1QVFP 3JB9F 1BK2A 3EGUA 2RNAA 4FU6A 3RGBA 4IYHA 1M5IA 4P9PA 5GMKj 3J81E 2IH3C 1W0KG 3SPCA 2UXDO 4FZ0A 3CJHB 1KHCA 1WHMA 1B06A 4GKKO 3RUXA 3OY9A 4DV5O 3PVLA 1HXDA 2IJHA 3A1PA 3A8HB 4FSXA 1R6TA 3I55V 1AZGB 1TUGB 3OT7A 4C92D 2VKNA 1NKDA 2O9SA 2ZR3A 3UATA 2FB5A 1E7OA 3VS2A 1X43A 5CO7A 1M9SA 1A32A 1ZSZB 4DUZO 2QA4T 4I55B 5LOVA 3MHXA 1JQQA 2NLUA 3JCMf 2QXFA 3VKIA 1K5SA 3SJQC 1YFNA 3FYEB 4PKCC 1VQ8A 1Y74A 1YBYA 3ETQA 3P32A 1F23A 4BE1A 2XHBA 1US6A 3K3WA 2RHYA 2AGAA 3TGUH 1ZBXA 4XTUA 1M3BA 4ZOLB 2GFAA 2CAZC 4BR6A 1I81A 1PCXA 2CE4A 3E86A 2RHIA 4LF9O 4X20A 5GAMf 1XNQB 1W1FA 1ABOA 4BACA 2OTJQ 1HJDA 2RK2A 4I0XB 5EBWC 1W2BA 2B5UA 4CBCA 1VQ9V 4EFBA 4B7KA 4JI6O 4MVOA 1H8EG 4I5SA 3CCVA 2NR5A 2R58A 4E7ZA 3CMAA 2NUTA 4JRPA 5H6QA 4HCKA 3JAME 3MEWA 4HT9A 4DUYO 4EEQA 1W2BU 4DRXA 1NJIW 1D3BA 2E4HA 2EYZA 3M0PA 3SYPA 3FYIB 4O4LA 5HFLA 2RB6A 2FPEA 4DBHA 3E35A 5H9CA 2YS8A 5EC2C 1PWTA 5K1XA 2P22C 1BS3A 5D7UA 1VQKQ 2ATKC 1XJWB 3H41A 5KMGB 2ZM6B 3QG1A 5FWCA 1AT1B 3VRZA 4BE0A 3M5AA 3PFSA 4CS2A 2WAMA 3LLRA 4RCCA 4B3TO 2YXHA 4DV3O 3QYHB 1NLPC 4AQYO 2EIFA 1I5XA 2HMAA 1N0NA 1BSMA 4L59A 2R9RB 2D2CB 2PVGB 1DF5A 2D9TA 4E47A 4AFQC 1VQLQ 4LNUA 2QJ1A 1S1NA 5GAOm 1RSOA 3OYJA 3S3MA 2X0LA 5LA6A 1N5ZA 2DD5A 4JI7B 5IYDO 2LP7A 5KX5B 5KCHA 4LF6O 1VQ4V 4R56A 2A37A 2OTLA 3CCLT 2PZSA 4C0DC 3H1KH 1K9AA 1K92A 1OZ2A 3JASB 3FKSG 2YUAA 5J2TB 1K76A 3FJ5A 4OP0A 1H2MA 1TVKA 4RMOA 4CRIA 1OEBA 1MSDA 3FAVB 4LFCO 1OULA 1TH7A 1SF9A 1ZLZA 3G80A 1U5SA 2EJGA 2X35A 3E1SA 1PHTA 5CA0A 2BUDA 1UDLA 2EAYA 4DBQA 3LWIA 3LGFA 2Q0OC 3M7MX 1UGQB 4ANJA 3UO3A 4QNHB 1NU1H 4JI3B 2CTRA 4FZ1A 3CCUT 1QU7A 1WI7A 2JN0A 5EZYB 1BCOA 3G4ST 1M1KW 4BUGA 1Q86W 1MNDA 4X1IA 2A0LA 3K59A 3G71V 2DO3A 3CCST 3M4GA 2RDCA 4LFBO 4I4TA 3JAWA 1RADB 1YXBA 1OU8A 1WDXA 5CMUA 2VUBA 3X2QB 2ITCC 2ZKOA 1C0MA 1AVZC 4JASA 2ED1A 3CMEA 3EVKA 1VQ8Q 2XOKG 1JVMA 2H3EB 2FB7A 1Q95G 2RHUA 2DZCA 4TWKA 5IXFA 3JB9H 2FRWA 5BY1A 1YCYA 3OM3B 4Q6GA 4F6RA 2BTQA 3FC3A 1H2GA 2ZXWB 5J39A 1W2BS 2Y0PA 3FDRA 4PLIA 2ZZDA 5GMKi 2OCCC 4UCSA 3CB2A 3VS4A 1RM1C 3ABMC 5BXZA 4IIJA 1OI1A 2LJ2A 1H38A 5KHHA 2J7IA 4EMKC 1R3IC 2VGMA 5DEDA 1K34A 2V8IA 4KGZB 2CZ1B 1F4NA 3FB5C 3CCVQ 3N2GB 1U8RA 4EIKA 3CMAQ 1K9MW 2QGFB 3KUFA 2JM8A 1CPYA 1IXBA 2Z5UA 3RWRD 1GM8A 1PNLA 3K5OA 4MTOA 5DECA 3STZC 1WYXA 2Y4XA 5HFMA 4C0ZA 3X26B 2QEXA 2PUSA 1UGPB 1HNZO 2AHYA 2CZ0B 4EMKA 3DXRA 4R0KA 2YIAA 2Q8VA 4MMLA 1WNLA 4B9XA 1O9SA 5EC7A 1DTOA 1K8AW 3GOXA 3EFRA 1R3KC 1YI2V 3LSUA 5H2FZ 3M4YA 1D1CA 3LUTB 3L71H 4DV0O 3E2UA 2EILC 2EBPA 4K11A 2Q6AA 1Q6IA 3STLC 2HVJC 1P7BA 5GAMh 4JTDB 1GM9A 2M7WA 3QO8A 4BD3A 1NVPB 4Z88A 1G83A 2HDAA 2G3RA 3L70H 4BI8B 1IHVA 2CUGA 3QNEA 3WFVA 3CX5F 4BDYA 3RMSA 1TUBA 4J7IA 4F17A 4YJ2A 1SRYA 3GF5A 3P8HA 2ADPA 2YIBD 2FYUH 2R9IA 4TV8A 4D6TH 2DW4A 2A7YA 3HPLC 1WP7A 2YUOA 4M78F 2DZ9A 3JD0A 5A0GA 2QTXA 2F1MA 5L3CA 1C6VX 5C8YA 4JI2O 3OW2A 4O4IA 1VQMT 1Y4MA 4JAUA 4FM1A 1N9RA 3OS0A 2CS7A 1Q5OA 1DJ7B 1U1TA 3ABLC 4ZTJA 1Y57A 3ZRWB 4X8AA 2LP5A 4BW5A 2CP6A 5CCAA 3WU2Z 5GAN3 2UXBO 2JJ2G 3OMAB 1MHNA 3G6EQ 1VYVA 1H3HA 1Q6HA 5GANh 2IH1C 3L9DA 3SYQA 4DW1A 3O8VA 4Y91A 1YHQT 2WLJA 2E5LB 3P3NA 4AFUC 3QTCA 4JPBW 2FPFA 1KHIA 2YI8A 2DYBA 2EFIA 4F7UB 1VQ6A 2KBTA 3M54A 1M2VB 3ASOC 5IJ0B 5GAMj 4C92A 1YIJT 3LW5E 5CBFA 4JYBA 1MNGA 2A3LA 1QW1A 3CRCA 3VS3A 1YJWT 1QKXA 1Q82W 1PL4A 5KLVH 4B3MB 4WFEA 4B08A 3JALB 1ZL8B 3AG1C 3N2KB 3ETGA 1O9GA 3HFNA 2DYIA 1VQPT 3FX7A 4EB6B 2AHJB 3CC7T 1WX6A 4ZI7A 2M0YA 2JEUA 1HNXB 5FROA 2OCHA 2DYRB 4JV5O 5CA3A 1URFA 1J5EO 3CBPA 1XOUA 3AG3C 4HKEA 2KAFA 4QPKA 2AKLA 5L3GA 4H13B 2P5OA 1KKDA 4ZIBA 4LFAB 4N21A 4U3JB 1SQXH 2VQFB 1ZA1B 1SHGA 5B1BB 1IBKB 4ZGDB 1EBOA 3H8ZA 1D5NA 1G6UA 3HTRA 1XNRB 4MW8A 2QEXQ 2VWKA 1I4K1 3SWNA 2EWNA 4QIWF 2ZPBB 2PTMA 3IJ4A 4I50A 2P0PA 4FM2A 1CKBA 4RTYA 1XI1A 2UXCO 2D0NA 2P4TA 1KU9A 3B8MA 2F4VO 4LDWA 2V8JA 4FYWB 1SG5A 1IGQA 3ME9A 1G8MA 2OT5A 2WSEE 3A8TA 2NUPA 3LWHA 1L8DA 4O2BA 1NVPD 4HA8A 3OYAA 3GVMA 1LR1A 1VQ5A 4UB6Z 2RQWA 5KYUB 1X01A 2JS2A 2WLMA 5CQXA 2UUAB 1W59A 3S6WA 2QDOA 3HB3B 4X9DA 1SERA 1N0JA 4ATOA 4NXMO 1BCMA 2CGHA 1N6AA 1I5YA 4DV6B 1K4CC 1H641 5CBGA 3BCCH 3O9OA 2FRYA 4DEXA 3K5NA 5LXTA 1NJIR 4JTAB 4GLKA 2PI5A 5J2UB 1UHCA 2KQWA 1YJ9V 1QVFA 4DV2B 2NYSA 4O2AB 1QLEC 4FFKA 1I94B 1VF7A 1VQNV 5LJ5h 3CJHA 1LPLA 5LJ3g 4PV1B 1M27C 3B40A 1WHLA 3BPZA 2GV9A 2ROLA 3F70A 4GLMA 3EG2A 3LSQA 1IZ3A 1YJNT 1NPRA 2K3YA 2O01E 2ZQMA 4NTWA 3VOUA 2EX3A 3H9VA 2FG0A 1GRJA 4MVSA 1MMNA 2P0QA 4HCZA 5EG2A 4H33A 5C6SA 2DBKA 5D5QA 2B1GA 1VQ6Q 1U96A 2DWEC 4J6XA 4I55A 2EZOA 4XU3A 1ORQC 2BE3A 5KAIZ 1MGQA 4DR5B 3CC4V 3CCLA 3K9SA 2KVQG 4IIOA 2LFSA 3E89A 2EIJB 1L1FA 1RUWA 3CD6V 4ZOLA 1NPPA 4M77F 3HRTA 5IH2A 3THKA 1GXIE 1XBLA 5EBLC 3PNWC 4M77G 4FW1A 4IUVA 4JI4B 1VYUA 1PL0A 4UUJC 1N36B 1VUBA 3CCUA 4X9CA 2J06A 2R5MA 3V7SA 4I0XA 1K0SA 3AG7A 4JI5B 1JRIA 3G4SA 1M1KR 2O31A 1M1GA 4M7DF 2DAQA 1Q86R 2F69A 1Y71A 2DVEA 2ZE8A 1X69A 3K9AA 3CCSA 2KYMA 4KH1B 1G2BA 2EYQA 1QWEA 1M56B 5JQGA 1Y67A 1ZLMA 5ITZB 5J26A 3OTOB 5GJWB 2PVOB 3HKDB 3FB6C 3IFXA 3CC4T 3TREA 2FEIA 4MVQA 4WBNB 2YI9A 3UPUA 2XTAA 1I0HA 3D3IA 4D8DA 4HZ3A 4MVZA 1VIFA 3LDEA 3SYCA 5JJEB 4WF9V 5KMGA 5CQYA 4FPPA 2BE9B 5CN0A 3ICXA 4OXSA 3JSNA 1EIFA 3UT1A 2CUBA 1VQ5Q 1RI9A 2BZXA 1I8FA 2ZM6O 4ASUG 1LJOA 1K9MR 4MT8A 3X24B 1OJHA 1ZTEA 3LDCA 3NR7A 2F2WA 4V2SA 3K57A 2ZPFB 1NI8A 2ADQB 4TT3G 4JRIA 5GANd 3J80N 5L3FA 2EIKB 1QVFS 5KX5A 1FXHA 2Q68A 4DV4B 4BY6B 2YIBA 3OEHG 1GCPA 3ZL7C 2WLLB 1OCCB 4JI7O 4OMQA 1K8AR 4RUEA 3JASA 4WFBV 2KSDA 2XT9A 5J2TA 3E9FA 3JSCA 4FW2A 1MV3A 4F7UG 1WHHA 4GX1A 4ZHQB 4M7AE 3FAVA 2KI7A 4YIOA 2ZPGB 3MDSA 1NS1A 3P30A 1TUEB 3F5WC 1NJIU 2WPDG 2XAFA 2MPXC 5EZYA 4CC2A 5IYZB 1VQ7T 4JI3O 2ZDIC 3EH1A 3CCMV 3CCQV 3EGXB 3KXTA 4FM4B 3NGPA 1WNSA 1KQSU 2G6FX 2ZXWC 3ML0A 3SGIA 1FXVA 1O75A 4KUMA 3CCLQ 5LJ3e 3QVNA 3UO2A 2WLKA 5GAOq 1QR9A 1M30A 5KHGA 5LMUB 3DB4A 1VQMA 1NTZH 4PHZA 1G3SA 2CUDA 2ZDIA 4OF1A 1K1ZA 2A79B 3ASNC 1S76D 2YDLA 3E19A 4MS2A 1AWXA 4B9WA 2JIZG 4VUBA 4J42A 1H92A 3SPHA 2Y90A 3C3SA 2CH7A 3C90A 1KC8C 3CCUQ 2EIMB 3IC7A 4M77C 4DBRA 3JD3A 1KUQA 4GKJB 2FPDA 2RQVA 3IGAC 3ZMSA 3OB9A 1JQ0A 1YHQA 4E4EA 1K73C 3G4SQ 3CRMA 2ZGWA 3ZRXA 3E2EA 4II1A 2MK3A 3JCZA 3UM7A 3CCSQ 3N2GA 9ATCB 2JJ9A 1YIJA 1ACMB 3PE0A 2L6LA 1BQ0A 1GKFA 3G6EV 2K5LA 4FVMA 3CCMT 1G8XA 3ZHSA 2M16A 3QIIA 3UWNA 4C5HA 2E76B 2L2PA 1YJWA 3K0GA 3CPFA 1GFDA 1U97A 1I07A 1WQWA 2XUMA 3CWBH 5FPOA 1M1KU 1Q86U 3CEYA 1QNMA 2BE7D 3OYFA 3ZFJA 1FMVA 4DYLA 2MAMA 3CC7A 1VQPA 3V8JA 4IGGA 2CZ6B 1XREA 2DRMA 1X59A 3WG7B 1RPOA 3WB1A 1F7YA 2GGRA 2PF4E 5CA1A 2W0XA 3H1LH 3ZMVA 2A28A 5D6XA 4DR3B 2L35A 4ZKIA 4J9DA 1BZKA 4CC3A 5IT9E 1SRMA 2DTIA 1YWOA 1SQBH 1NEBA 2NN4A 2ZE7A 4R55A 2PGGA 4H44B 2PVDB 4MZPA 3CXCP 3QDFA 3A8LB 4L87A 1KSWA 1KK7A 4GZRB 4RKUE 2HJFC 2LMJA 2YICA 1H8KA 4LUEA 4YIPA 4NVPA 2LZ6B 2UUBB 1SSFA 2OI3A 4M78E 1KP2A 1KQSS 1QVGP 3OUFA 3RT3C 2V8KA 3I56T 2OWOA 1FWZA 3OYGA 3ZRWA 1N8RC 3OMIB 2LC4A 4CH4A 1MA1A 3QDRB 4HCBA 4PJOE 4LF4O 2COZA 5CIUA 3H1HH 1UJWB 3UDCA 5CVIA 1Z5VA 1RPRA 2Q67A 1LNXA 4XTWA 2QM4A 4JZ2A 3KCXA 1SQFA 3R6NA 5K1PA 1OOTA 4JZ3A 2X9HA 2LNHB 4QVDA 3H6ZA 2ZNIA 2PU9B 3JB9I 1Y07A 2E5LO 4F7UA 3JCMP 1YITT 1CXZB 4O5VA 2DOSA 2ZE6A 5IJ0A 5I11A 1R6KA 3JCUZ 3X28B 4DR6B 4A4HA 2IVWA 1PNJA 1PM9A 1H3ZA 3TQ7P 4KP4A 2LX7A 2WLIB 2LJ3A 3DLLA 3ZCCA 5LMNB 2OYQA 1VQMQ 3L2VA 4MTXA 1PKTA 1C1AA 1JA8A 1SRLA 4M7AB 3HFOA 1ZL8A 3N2KA 5JVDB 5JCOC 4EB6A 4RG8A 4X88A 4FLYA 3VJPA 1YJNA 2LQNA 1G1XB 1R3JC 5IJ9A 1N8RU 5B1BC 3CCRT 3ETDA 2LX9A 3WVEB 5FLXN 3A8MB 1JXMA 1YHQQ 1D09B 3FIFA 1VEWA 5CAIA 2ZNJA 3M59A 2M6YA 5KHKA 1NQTA 3CQTA 2DRKA 2GBQA 2YHTA 4F6EA 1KB9F 5JCOA 4OGEA 3RYIB 1YIJQ 4MMKA 3T1HB 3RYHB 4YY3O 1AR1B 4U3JA 1XEQA 1FXKB 2HQXA 2KB1A 3FEOA 3JRZA 4J9EA 5GAN4 3CPWP 1AZEA 4LFAO 2LW1A 2R70A 2X6BA 2VQFO 2QQ9A 2GNCA 3OYCA 1IBKO 2DF6A 4NR1A 5FU6B 3IC9A 1XNRO 3JB9J 5CK9A 1R6NA 3VS7A 4J9CA 4XDKA 5B5EZ 1VQPQ 2BSKB 3CC7Q 4QQGA 3SFMA 5L3DA 1D0XA 4RTUA 1S0VA 3V8LA 2L3PA 3QJYA 1OZ3A 2FHDA 2RK1A 1WLPB 1Y76B 2LCLA 5KYUA 1OCRB 2VXFA 2F5TX 1IXMA 1UECA 1GK9A 4UCVA 2CH4A 3RESA 4LF7B 3CBOA 4X1YB 3NHNA 4E2LA 2R72A 4XTXA 2UUAO 2FL7A 1M93A 2CTWA 1FX7A 3QF7A 1S3JA 2WSCE 2AHZA 5GMKe 2CDYA 3EFSA 3ZRVA 1VQOV 4JI8B 5GTHZ 2CDTA 3M0QA 4LCUC 4DV6O 1I0CA 2CYZB 3QYGB 4FLXA 1FPOA 4JI0B 2J6OA 2UUCO 1IDSA 5J2UA 2X6AA 4DR1B 2K6DA 4O2AA 2DYSB 2Q4PA 5FRMA 4P5NA 4J7ZA 2OIEA 4O4HB 1OZ0A 4BW9A 1SQGA 3K03A 1I94O 4OMMA 3W7TA 1UJYA 2VS0A 1MMMA 3JD1A 2JTMA 3SHWA 3PMTA 2NNUA 2KROA 4LE9A 2EIJC 4E7KA 2D1XA 4AG2C 2CP5A 3FD9A 2QQRA 3BY6A 3MKDA 3FRNA 1H2KA 3M0TA 4E7LA 2N04A 3OBWA 1QCNA 2E3HA 2FZCB 1TTHB 3MP8A 3QKJA 3RKXA 4M7AD 2A9HA 4DR5O 2Y69B 4J7FA 3RNJA 2RO0A 2DE0X 1JJOA 2RHXA 4C7UA 3BDUA 3M55A 3REBB 1S5LZ 2HHHO 4DK1A 3OR7C 5AYFA 1YJNQ 3RFRA 4MZMA 3I55T 3NXSA 1M56C 2P4KA 4J9ZB 4PJOB 2QWQB 4A63B 3L1AA 4JI4O 2H3OA 2VQEB 1N36O 2E1HA 2R5AA 1VQ7A 4PI2A 1H2SB 3OQ5A 2X7RB 2DXCA 1N32O 4JI5O 2QASA 4IIMA 4PFOA 3K58A 3GWOA 4XTVA 4TSFG 4J9GA 4HCCA 4A4FA 1I1JA 3VUBA 4PDRA 4D7TA 1IBMB 3AK1A 2LQKA 2IJJA 5ITZA 2XASA 2HQHA 1NBEB 2K9PA 2KT8A 3HKDA 1M4UA 2FTKA 3OTOO 2W10A 5J9PC 4WBNA 1QP2A 1NM7A 3HKEB 3HR0A 5I21A 3MHHC 1NE8A 2QE7G 2VYTA 2CTPA 3M99B 1VQ9T 2K5IA 4J9FA 1N34B 3OE7G 4K3AA 3T1YB 3OYBA 1RAGB 4QE7A 4LDXA 1BYMA 2LDMA 5I2MA 2MWPA 4ZGJB 2EIKC 3OBYA 3EFFK 4BY6C 4X1KA 1M5Q1 2LCCA 4DK0A 1AI6A 2P90A 3QHSA 1X6BA 4OB2B 4ZTFA 3I5SA 3CCMA 2DTHA 3DGEA 4PL6A 1BQZA 4HAMA 1O9HA 1RAAB 1HYOA 4C92F 1ENVA 3JAKB 2XDPA 1AWWA 2COYA 4N0AC 1QCEA 5IWAB 4C92G 3TSWA 1OCZB 3GB7C 4FFBB 1V29B 2WLLA 1BHBA 5LBQA 2QM7A 5LGNA 2AZSA 3H0IA 1JEGA 4DV4O 1GL5A 2SEMA 2KK4A 4J11A 3EHQA 4PK4A 2ABLA 3UF4A 3N27A 3R6OA 3OS2A 1WXTA 2ZAEA 4Z1VA 4N0AA 3RBBB 4MDXA 1JJ2P 5IAYA 1VIEA 2AZ0A 3C94A 2Y4YA 1B6QA 5IYZA 5CKEA 3D36A 1GMGA 5EC1C 1HK9A 3EGXA 1HR0B 4QE9A 1GBQA 1MABG 1KC8W 2MW2B 2DMOA 4RUGA 5GANg 1ZUYA 4LF5O 3SPIA 1VQ4T 1K73W 4DOVA 4KBMB 2LTOA 1AROP 1RP3B 5B1AB 4I7ZB 2V1RA 2EIMC 2CSQA 1PV0A 2BZ8A 3GBQA 3I56A 3PN1A 1ZX6A 4OMLA 2AIRB 2PUOB 5LMUO 1GFCA 1UFIA 4E7IA 4PJOD 2JRIA 1NTKH 2LGWA 1EN5A 2M51A 3GP8A 4IUUA 4GLXA 3QO5A 3RYFB 3RBZA 2L8DA 4M75E 2WACA 4OX9B 1VQ7Q 2QSAA 4DR4B 1VP7A 4UB8Z 3G71T 4X65B 1YITA 2XDBA 2DMXA 4LWSB 3D8CA 2RI3A 3L2ZA 3RKYA 1P49A 1AD5A 1TWBA 4UXNA 3JCMh 4IUQA 2E10A 4JLGA 4ZN3A 1MV0B 1OCOB 4DW0A 1D1BA 1MSWD 2QAZA 4OB1B 1PD3A 4KH0B 5EYPB 1E1RG 4PA4A 4J9BA 2LJ1A 1YCSB 1XOVA 4RCBA 2DL4A 3ZN1A 4C8QE 1F51A 2F2XA 1QR8A 3CCRA 2ED0A 1NT2B 2RJCA 3APOA 3BY7A 2ZCEA 3LYIA 3E8HA 3V7CA 2CK3G 3SPGA 5TISZ 1JFFA 5LL6Y 4B3SO 2JT4A 2JW4A 2M9UA 4GX0A 4E7HA 3OYMA 2MOXA 2QQBA 2EGEA 3M58A 1DF4A 2GTOA 4AI8A 2JVVA 1AEYA 2DNUA 4DR3O 3RERA 2K9GA 1N8RW 4PFPA 3CC2V 3REAB 4OMOA 1TSFA 2HSPA 2OTLQ 3CRRA 2EYYA 4KHPO 4PD4F 1Y96B 4FIPC 2QDYB 3CXCA 4LH6A 4KUDK 4Z02A 3AEIA 3CCJV 5GAN6 2VGNA 4DEYA 4B7EA 3CCEA 1YI2T 1HNWB 4C92C 3HKSA 4NL2A 4IT5A 2UUBO 4NXNB 2DL5A 3JCMb 2FL4A 4IL6Z 2LQ8A 2P84A 1S72V 1XMQB 3JD4A 4TVRA 5EBMC 1QWFA 1ABQA 1M4ZA 1OU9A 2JXBA 4UC4A 2FMLA 2WLNA 1Z9ZA 2E65A 5IE9A 1YTFB 3VQVA 3OW2U 1WQ7A 3CXCU 5GAMe 4FL6A 2O57A 2X4WA 3HSBA 2ITDC 3TXSA 1CEZA 4TQDA 1OV3A 3E22A 5CKFA 4MTGA 3HRUA 5I2SA 2DD4A 2XKOC 3CMEQ 1COWG 4J5YA 1D0YA 4R50A 2KXCA 2ILMA 4PJOG 3CC2T 2JOYA 2KNBB 2EULA 3S3WA 2EJ9A 1B3QA 1U3OA 1K0XA 2ODMA 2WLIA 2EKOA 1GM7A 4DR6O 4WCEV 4DR2B 2Y4TA 1R0BG 2V1QA 2RMOA 1EZVH 3OMCA 5FU7B 4AFSC 3I56Q 2N74A 1ZSPA 2EJFA 2WSSG 3OYIA 4BB7A 1D0ZA 4M7AA 5LMNO 1ZSGA 5HK3A 3SWNC 5JVDA 5JWPA 3V7RA 5KE3A 4NOYA 1FXKC 1Y0MA 5J3BA 2JK5C 5B3SB 2KGTA 3QG5A 2QA4A 1S72T 2O4XB 2VWJA 2CH4W 5GANe 1YNZA 1DGSA 1V54C 2HCKA 4JI1B 2RQRA 1YITQ 3T4ZA 3DKMA 4M4ZA 4PDMA 3TEEA 3RYIA 2JS3A 3P3PA 1PPJH 1R3LC 3TVTA 1FXKA 4X66B 3TSZA 3FB7C 2R57A 5LJ3f 3RR6A 2A06H 4C0GA 2JVDA 1V76A 2L5QA 3A0RA 3CPWA 2JEXA 1OCRC 2NLJC 4JTCB 4OGQB 2ZCFB 3MCAB 1TS9A 4BIZA 4IHJB 4JAVA 1SKUB 1KG1A 2BSKA 2IPOB 1GTOA 1QQJA 2GCXA 3H1JH 1G3YA 2MWOA 3JV3A 3I55A 2V26A 3CCRQ 1IXDA 3NPFA 4LP8A 2X6CA 2ZIOA 5GTIZ 3OEEG 2W0FC 4PELA 5D6WA 1KIKA 4U7NA 5A0DA 1Y76A 4X64B 2OTJV 3VQXA 4JUVA 3JYCA 4M75B 4GX5A 1M1FA 1IRXA 4X1YA 5FNVB 1QLYA 3DC6A 3OS1A 3OW2S 4ZN1A 1PNKA 3CXCS 4LF7O 2DYSC 3B2EE 1GBRA 2YXLA 3E83A 1BBZA 2ROTA 2Z0AA 1H2LA 1YDXA 3GWKC 2OAWA 4WFHA 3QO3A 1XMOB 4LR3A 4JI8O 3M53A 2I0NA 1DLBA 3CCEQ 1ZSZC 4KULA 1IZ6A 2WLHA 2UXDB 4JI0O 1BB9A 1VQ9A 4FLZA 2F43G 2HJDA 4DR1O 4GKKB 4JJDA 1ZA2B 4O4HA 1YTFD 1V55B 4C8QB 1IBLB 2KYBA 1VQKV 1KYOF 1YN8A 2KXDA 1QVFU 5A0LA 4PLLA 4Q20A 3S3OA 1ZSZA 1JX9A 5LHHA 4LDUA 2DJQA 1XDCA 1I08A 3RVZA 2Y69C 1K97A 1NLOC 3TU4K 4PFZA 2K3BA 4CZZA 4HXJA 2YLCA 3ZHVA 1GCQC 1VQLV 3JCMQ 1K7DA 1YJ9T 5IHNA 3ER0A 2XU8A 4PJOC 1VQNT 4QT7A 2UU9B 4ZBMA 1SC5B 1R73A 3ZHUA 4XK8E 2KKWA 1XNQO 3T1CA 4NYKA 1G3TA 1IB8A 2DJZA 2XHCA 5LJ5e 3JCMd 1Q7YC 1XL4A 4TQFA 1JR9A 2P0KA 2QTSA 5BR8B 1GCQA 5KH6A 2O88A 5B1OA 2Q73A 4IURA 1ZUQA 2F95B 4UV9A 2HL3A 2QA4Q 2DXUA 4PJOA 2CP2A 1SETA 2YUPA 3OS5A 4QW2A 3DTUB 1X4TA 1XUQA 3B4SA 2FZGB 8AT1B 2ZD9A 1KC8R 2Z3YA 2FYKA 2L3QA 5GAMd 1Q3EA 2LQWA 1VQ4A 1K73R 4EMHA 5L23A 3TXQA 2IIMA 1MOFA 2HKQB 2L3RA 3CPWS 4C5IA 5IHKA 3NTIA 2ENMA 4A53A 3EHRA 1YSCA 3ZN0A 4HYOA 1JOYA 1IBMO 3CD6T 1UGRB 2Q7EA 1Z5WA 1VQ8V 4UV8A 2K2VA 1B07A 2YUQA 3HKEA 1FKAO 3U11A 5E1AC 3JSLA 2RJZA 1RFYA 1VOMA 3L75H 5CB4B 3I55Q 1Q7YU 2I2LA 1XQ8A 5KHJA 1GN6A 3VS5A 2DXBA 4M75D 2LJ0A 1ZWIC 3WXMB 1M90R 4YHHB 1MZEA 2CP7A 4FLUA 3G71A 1OCZC 3RVYA 2VRZA 1SKVA 1HDJA 1WHGA 2LRQA 5JJNB 1TUDA 2JM9A 4DOWA 3CCVV 2HBWA 2K3XA 4F7UF 3A8GB 1PG5B 2V4DA 4KL1A 3CMAV 1M2OA 3JAKA 1XTDA 1NH2B 2IU3A 3BFMA 2EJRA 4FFBA 4PJMA 4H37A 2LFRA 3A98A 5D6YA 2F1LA 4FYVB 4C8QD 3X2QC 2YIDA 3HHTB 3C0CA 4D6WA 3BVOA 1S77D 4FYYB 1VQ9Q 3EH2A 2D6FA 2K4YA 2XNDG 3KCYA 2O2OA 3CHXA 2N05A 5GONB 5KUKA 3H0FA 3J80E 4E2FB 1IREB 5IN1A 3I5DA 5H6RA 1RAHB 2RNBA 1N8RR 1B7TA 3QO7A 3LNMB 3L2WA 1JJ2A 2GTJA 4FMTA 1T0HA 2RQ6A 2MMPA 1HR0O 7AT1B 1AI7A 1ZQ1A 2UXXA 2F2VA 2RI5A 3SJAC 3CRAA 3N5BB 3ZBDA 2B9ZA 2B1IA 2ZT9B 5LGUA 5CKHA 4MVUA 2RHZA 5LP6B 3L42A 1YI2A 5IY5B 1GRIA 2LT4A 4JYYA 4JJCA 1OPLA 2LNVA 4R7CA 2EJ7A 4FJCC 3Q1JA 2CT4A 1BI0A 3E8BA 2X3WD 4DR7B 2YSQA 4G2KA 3PJSK 3OYNA 3Q4HB 2EBOA 3C95A 3HRSA 2BTQB 5LJ3j 3RYFA 5I22A 1NG2A 1FFXB 3CCQT 4IKFA 1AB3A 3PMIA 4J7JA 1ZBJA 1EFRG 4OX9O 2DL3A 4PNOA 4Y28E 4LWSA 2CGNA 4O4JB 3RYCB 4DR4O 3L74H 1Y7XA 4X65O 2C0IA 2QG9B 1VQ4Q 3BA8A 5CBHA 1WZOA 1M90C 2XMFA 5HY6A 2JS0A 4M75G 4ICGA 4P2ZA 1FXXA 2Y4UA 2VC8A 2AT1B 5EYPA 1SSHA 1G3WA 1KC8U 5IT9N 1D2DA 4BDZA 4B3RB 3SJBC 2RJFA 2VWFA 3TJTA 1WFWA 1K73U 3R65A 1HWYA 2J05A 4DV0B 2HD0A 3E8GA 4U7OA 2PYJA 5LJ5d 4F16A 2P67A 3BE3A 4WTOB 2QGGA 3UA7A 1UEBA 4XTZA 2QYZA 1Z2GA 3ABUA 4FLVA 2EW3A 5L3BA 3G6ET 1BHAA 1UFFA 2LO1A 2J6KA 1LOJA 1BKBA 1L0NH 4C8QG 2KEAA 1NH2D 2V7QG 1WB7A 2LQTA 4YXWG 1X2KA 4GBQA 1WPYA 3ULRB 3QXEB 3JCMW 2KRSA 1Y96A 3VQYA 2EILB 2YRCA 5LYJB 3OUSA 5A2QN 1M90U 4UCRA 4K8XA 4JYCA 2QEXV 4UVAA 1W70A 4XU1A 4J10A 4C0FA 2OJ2A 3UQ8A 1GH6A 1NR1A 4LBEC 4A4EA 4J9HA 1HNWO 2X51A 4JYAB 4O4IB 4RAIA 4NTYA 2PY5A 4NXNO 1WJSA 3PGGA 2YEVB 2O9VA 1GN2A 2QTOA 3K5LA 2XG8D 1IGUA 1M2VA 2HEQA 2QKSA 2Y48A 4NTXA 2QWPB 1AVMA 1B34B 2QK0A 2B8AA 2OX7A 2RA2A 2XD0A 4RWUA 2QWOB 4CH5A 1VF6A 2DYRC 5KYXB 3P8BB 2K57A 1OYXA 1CP9A 3ABLB 2KT1A 4KXRA 2KY9A 1RAIB 3C12A 4Q5WA 1M3CA 2AW9A 3JALA 1VA7A 3VYGA 3PIPA 2BCCH 3PIOA 4QPJA 5B3SC 4B3MO 1YI2Q 1LUVA 1NYFA 4JS5A 1Q43A 3AK2A 1OX9A 2GQIA 3T2MA 1M8VA 2XAGA 3W7UA 4DR2O 2RD1A 3EG9B 4W4LA 2GHYA 4LNPA 1HNXO 2NUZA 2YWWA 2Q7HA 1I5OB 4I9QA 3VYHB 2RH2A 1ZUUA 1AJQA 2O4XA 2CSIA 4LUDA 4IYIA 4U3FH 1AI4A 1E6GA 5GAOp 2BKDN 1J5EB 4XAXB 2GSMB 5KYYB 5JH7B 2RQUA 2RMKB 2NWMA 1YJWQ 2PNIA 1M3AA 3VS0A 4K0KB 4JI1O 3L2UA 1YJ9A 1VQ6V 2KMTA 2DEQA 4R8CA 1YF2A 2EZPA 1VQNA 4X66O 4J7KA 3SPJA 1RAFB 2DPPB 4UVCA 3F7VC 3UCSC 3LSSA 5FLXE 1EN6A 4CI0C 4NL3A 2GFUA 4P30A 2M1HA 4M75C 3AG3B 4IHJA 2VXEA 4J9IA 1WHKA 3TCJA 3U0ZA 3ZEHA 1SQVH 1NBMG 3J81N 2COWA 1WAZA 4O6JA 2MCNA 5IYBO 1XHXA 1MZFA 4M75A 1SA0B 3OA6A 4X64O 3ZJZA 3I9QA 1IURA 3ASKA 3CC4A 5FNVA 1ROPA 4HNAB 1E1QG 2E41A 1WPXA 2H94A 3CD6A 2FKXA 2GF7A 4C8QC 4LH7A 2IJKA 5A9GA 1RLQC 4DV2O 4PDLA 1AI5A 4KGVB 2E5QA 2KDSA 1XMOO 2YT6A 3A0BZ 4LF8B 3K0DA 2RI2A 2E3CA 3JCMc 1SPKA 4EDUA 4J41A 2EPDA 2MF2A 4C8QA 1RAEB 5L8RE 2DLPA 1OQKA 3OYDA 2QDLA 2L3SA 3C3TA 1BIBA 1MMDA 1AR5A 1IBLO 1PKSA 1VQ5V 3MEUA 3SDZA 1Q7YW 1I5LA 1GN3A 2CTQA 2ZR2A 1MMAA 2AZVA 1VQOT 1QLEB 2C06A 4TUYB 5KYWB 2DBMA 1YZBA 4UCUA 2H8HA 3A8OB 4M78B 1YEWA 3VUZA 2KSSA 4M77E 1Z9QA 4QVCA 4DQ2A 1OPKA 8ATCB 4RQEA 3DSQA
chains in the Genus database with same CATH topology
2YXYA 1SF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXY A;  1SF9 A; 
#chains in the Genus database with same CATH topology
 2Q0A A;  1BMF G;  2GTA A;  1BCC H;  3MHS C;  4L5G A;  2DTO A;  3PT9 A;  1XQH A;  3K5M A;  3UT5 B;  1IX9 A;  3BAB A;  3S3X A;  4XDL A;  2UU9 O;  3JAM N;  4FLT A;  1JO8 A;  4M7D E;  5IXB A;  5DLQ E;  3JAT B;  3AG4 B;  3M9Q A;  4ME7 A;  3EG3 A;  5BR8 O;  4AFZ C;  3I35 A;  5DLO A;  2KG7 B;  3CEI A;  2K1E A;  1M57 B;  3SEM A;  3L2Q A;  2KQX A;  1VQ5 T;  2BZY A;  1JXO A;  4KT0 E;  1IO6 A;  2FO0 A;  3LH5 A;  2P4V A;  3EG0 A;  1YJ9 Q;  4DA4 A;  5BZB A;  2GBO A;  1WIE A;  3QWX X;  5KAF Z;  2WSF E;  4HBN A;  3J7A F;  1EZJ A;  4BI3 A;  1SZX A;  2QKA A;  1VQN Q;  1H8H G;  5JQG B;  4DV1 B;  2ETN A;  3CCL V;  1WJQ A;  1X6O A;  5H5N A;  2XK0 A;  2A36 A;  4NS5 A;  1PSE A;  3JCM g;  1UHF A;  2L89 A;  4QKU A;  5KYN A;  1QHT A;  4MVR A;  1PRM C;  5CB4 A;  2EKH A;  1OCC C;  2KE9 A;  2DKG A;  2DIG A;  5GAN f;  1THZ A;  3CCQ A;  4QVZ A;  2XAJ A;  1AHJ B;  1FYJ A;  2YLB A;  2BTT A;  3CCU V;  3AHU A;  4NB5 A;  5GAM g;  3JB9 D;  3QSU A;  4RTT A;  1S5J A;  1WXB A;  3LX7 A;  4YHH O;  2YC0 A;  4N4I A;  3HP9 A;  3RIR A;  3GIB A;  3AK3 A;  3G4S V;  4HVW A;  3APQ A;  3D7S B;  3CC4 Q;  3ETE A;  3CYO A;  4CC6 A;  3CCS V;  4FM0 A;  1R0C B;  4MZT A;  4F7U E;  3HKB B;  2AK5 A;  2ESW A;  3W7S A;  3CD6 Q;  4ZHQ A;  2F66 C;  3QWY A;  3D36 C;  5FWB A;  4DBF A;  4BIO A;  1KD1 R;  2XI9 A;  2OAU A;  2CGO A;  1KFZ A;  2SRC A;  2KRN A;  3U10 A;  2EVR A;  2IG0 A;  1ZHI A;  1EM1 A;  3LNN A;  1KQS P;  4E7S A;  1WPB A;  3EG1 A;  1NZ6 A;  4M7A F;  2Y0I A;  3SYA A;  5DN6 G;  1R8O B;  4P9O A;  5B1N A;  2DN9 A;  4M7A G;  2JDI G;  4OGC A;  4L8J A;  4IUT A;  4DV7 B;  2EYX A;  5GON A;  4RUF A;  3ZMZ A;  2E6N A;  2K5F A;  3NMZ C;  2JTE A;  3L2R A;  1BI3 A;  3G6E A;  1ZAU A;  5LP6 C;  2XID A;  5IY5 C;  2HAX A;  4X62 B;  2GDS A;  4F04 B;  1BIA A;  1JBM A;  1TG0 A;  4M78 D;  1WN7 A;  3LDD A;  3OYY A;  1EZZ B;  2JS5 A;  3HKC B;  4RTZ A;  1UGS B;  4X89 A;  3ZMT A;  2ZPI B;  4YJ3 B;  2FVU A;  1JU5 C;  1PKX A;  4TV9 B;  3THO A;  5DM7 R;  4BWA A;  2QQA A;  5LP6 A;  3RW0 A;  2JNG A;  1NZ9 A;  2MYS A;  2DX1 A;  2VAS A;  4W4K A;  3I5R A;  2ARH A;  1AJP A;  2DQ0 A;  4J6W A;  4FYX B;  2F23 A;  4OMF B;  2OIG A;  5C93 A;  5LHI A;  1M90 W;  2DXT A;  2F93 B;  3X25 B;  5AG2 A;  4GKJ O;  4CS3 A;  3Q4H A;  3M0U A;  4DR7 O;  2QKC A;  3H9N A;  3MET A;  5KHI A;  1F1B B;  3UA6 A;  2CH7 B;  1NTM H;  3MD0 A;  3U23 A;  4J80 A;  1FFX A;  3D3Q A;  1N4C A;  2HR3 A;  2JGD B;  3WG7 C;  2WWW A;  1AIL A;  2LT1 A;  3OMN B;  5DM6 V;  4UCT A;  4JRK A;  3FFQ A;  3ZHQ A;  3ASN B;  2R9A A;  4O4J A;  3RYC A;  4X34 A;  1LNQ A;  1EX4 A;  5BMV B;  4RO2 A;  2J6F A;  5AT1 B;  3JD2 A;  2ZPH B;  1BE3 H;  1P7G A;  3VRY A;  5CKD A;  1BI1 A;  1UE9 A;  4M77 B;  1KQ1 A;  1WA8 B;  3WB0 A;  2A08 A;  3JB9 G;  2EQU A;  3OSV A;  5LJ5 f;  2HSE B;  2VV5 A;  5L3E A;  1VQM V;  4LDV A;  2LVM A;  5C0M A;  2GQV A;  1Q81 W;  1E6H A;  3EFO B;  2A0F B;  2HLD G;  4B3R O;  2X4X A;  4M7D B;  2JJ1 G;  3EHB B;  1KBH A;  2ATC B;  3CCM Q;  1JB0 E;  3CCQ Q;  3TET A;  1KD1 C;  3AG2 B;  2D0Q B;  2LGQ A;  1G4Y B;  5CA1 B;  1IVS A;  3SJC C;  1YHQ V;  3ABT A;  4JF3 A;  2YRD A;  3GLX A;  1RAB B;  4A4G A;  1PSF A;  4UVB A;  2DM1 A;  3LGL A;  3M0S A;  3K79 A;  1QKW A;  1WJZ A;  4LD9 K;  3JCM e;  2K2M A;  3B09 A;  1YIJ V;  4X1V A;  1FMW A;  2EYW A;  3NTH A;  5LYJ A;  1G5V A;  1RLP C;  1UJ0 A;  1QVG A;  2YRV A;  2Q5Z A;  1YJW V;  1FJG B;  1QVP A;  2DL8 A;  2EQK A;  5FPR A;  3GNF B;  5DY9 A;  3OFN G;  5FW9 A;  1J95 A;  1ARK A;  5LJ5 g;  3J7A U;  1D5A A;  1VQP V;  4JLI A;  4M78 G;  2PQW A;  2ZIM A;  3CC7 V;  4OVA A;  3IAY A;  1IHW A;  4LF4 B;  1H2N A;  4WFF A;  3W7X A;  4FLW A;  4JYA O;  4JJN K;  3TCU A;  1QLN A;  4M7A C;  2YEV A;  4PJO F;  4TOI A;  2AXT Z;  3K04 A;  1SQP H;  4AHC A;  2ECZ A;  1KD1 U;  5GAN 2;  1KP3 A;  1TU0 B;  4UFZ A;  4XBF A;  4FK5 C;  1QVG U;  5LGT A;  1B34 A;  3GNG A;  4X9Q A;  5D5P A;  5GAO l;  3ZHT A;  3KKY A;  5KYX A;  3BW1 A;  3OD4 A;  2DJV A;  3CCJ T;  3OGC C;  1S5H C;  3NFC A;  4QGP A;  5GMK m;  1PD1 A;  1WHJ A;  4Z1M G;  2BOB C;  1NYG A;  1Y66 A;  4LC1 A;  3VV0 A;  2EIN B;  5FRN A;  3G67 A;  2CT3 A;  4CS4 A;  1ZX3 A;  2M02 A;  3EG9 A;  4MW3 A;  3W7W A;  2QI2 A;  1TUC A;  3H01 A;  1SS3 A;  1JMK C;  1RAC B;  5FU6 C;  1OV9 A;  3OR6 C;  2C0T A;  4AT1 B;  5IYC O;  5HK0 A;  2XDD A;  1Q7Y R;  4QJF B;  2Q7G A;  3RYH A;  1R1B A;  4DO2 A;  5IJ9 B;  3G6B A;  1HD3 A;  1LCK A;  3MP1 A;  3G7Z A;  2AKK A;  1VQO A;  5KYY A;  5JH7 A;  3T1H O;  3F7Y C;  3EGD B;  1KJW A;  1QBZ A;  4A5U B;  3A0H Z;  1X6G A;  4EKW A;  4YY3 B;  3FB9 A;  3O65 A;  4M77 D;  5GAN 5;  5IDJ A;  2RM4 A;  1XL6 A;  1UG1 A;  4RTV A;  2HBP A;  4K0K O;  1AJN A;  3JCM X;  5GAN j;  2HQE A;  1QCF A;  3MO8 A;  2E74 B;  5E79 Z;  1OX8 A;  1WP8 A;  2QWN B;  1I7F A;  1HW7 A;  2GUZ B;  5ECA A;  3EXA A;  4JS4 A;  1WGS A;  4M7D D;  4FCY A;  1EFN A;  2E70 A;  1N33 B;  1NEG A;  4JGS A;  2V1D A;  2PUK B;  3CPW U;  4MDW A;  1LVK A;  1UPG A;  1WA7 A;  1YJN V;  2HG5 C;  4GYC B;  3X20 B;  5EIB D;  1K4U S;  3JAR B;  3HPW A;  1SA0 A;  3MJX A;  2YSU B;  4CC4 B;  3OSS C;  1B04 A;  1QQC A;  4HNA A;  1L0L H;  2H8P C;  3CP1 A;  1MUZ A;  3P8D A;  2DET A;  3KBG A;  2P6J A;  2AZ2 A;  1VF5 B;  5KA5 A;  1QVG S;  1T5E A;  2C2A A;  2QWR B;  1PP9 H;  3HL8 A;  2D3O W;  3LH0 A;  4FSS A;  4FT2 A;  1SZT A;  2UUC B;  4DV5 B;  1A0N B;  4XQ3 A;  2IBZ H;  3QZ5 B;  3UKM A;  3ABK B;  1QCO A;  2M0O A;  2DL7 A;  3M56 A;  2QR4 A;  4J9Y B;  4QQ6 A;  2OTJ T;  1PC0 A;  1Q8I A;  4LF8 O;  5GAN 8;  4WF2 A;  3WB2 A;  4Z2W A;  1PM3 A;  1FS0 G;  4M78 C;  2HVK C;  1SHF A;  1X2Q A;  4DUZ B;  1SEM A;  1BL8 A;  2JTF A;  1Y6X A;  5GW7 A;  1J3T A;  4JZG A;  5KA6 A;  3R66 A;  1QP3 A;  3A5Z B;  4BE2 A;  5LOV B;  4WCI A;  4JPR A;  2P06 A;  2W6J G;  4TUY A;  3PVQ A;  3QJ6 A;  5LHG A;  1T0J A;  4KRT A;  3VS1 A;  1UB4 A;  4ELZ C;  3KZI Z;  1Y74 B;  3L73 H;  4GX2 A;  5KYW A;  1K33 A;  1VIB A;  4CH3 A;  4M78 A;  4KFM A;  4PA6 A;  2E5K A;  2FZK B;  1LUW A;  1YVW A;  1K5Q A;  1PD0 A;  3IQL A;  3ZRS A;  4LF9 B;  3AG4 C;  1UTI A;  1XNI A;  4HT8 A;  1RL2 A;  3ZS8 C;  4X20 B;  3ZMU A;  4IUP A;  1P92 A;  2HHH B;  1WXU A;  3QPH A;  2BOC C;  3UT5 A;  1W2B P;  1M57 C;  2RQT A;  4JI6 B;  1VQK T;  4N4H A;  5GAO r;  2CKK A;  3WVD B;  3V8K A;  4CC7 A;  2HEP A;  3OGI B;  2VQE O;  3JAT A;  4J83 A;  2E12 A;  1BI2 A;  3URG A;  2KG7 A;  1VQO Q;  1N32 B;  2NUT B;  4WFG A;  3QZ9 B;  5LJ5 j;  2E75 B;  4PI0 A;  2RF0 A;  3S3N A;  1VQL T;  3OYL A;  4DUY B;  4M7D G;  2EQJ A;  5CR2 A;  1AP6 A;  4RTX A;  2YXY A;  2ZPE B;  4DRX B;  1D3B B;  2K79 A;  3BDL A;  4O4L B;  4LXC A;  1K4D C;  4ESR A;  3RN4 A;  3SDL A;  4OMN A;  1KEC A;  1FD9 A;  1JCH A;  3CBM A;  1XIL A;  4XU2 A;  4DV1 O;  1TOV A;  1U1S A;  3BA9 A;  4PJN A;  1N34 O;  2QM8 A;  3T1Y O;  2GTS A;  1KKC A;  4B3T B;  4GT1 A;  4DV3 B;  3VQW A;  1ZUK A;  4AQY B;  4BI4 A;  5FL7 G;  5IHI A;  3CE2 A;  1JPX A;  4HVU A;  2XAQ A;  3FB8 C;  2WA3 A;  2EGA A;  4OMP A;  2DIL A;  1NJI C;  2IU0 A;  1VQ7 V;  4C92 E;  3B8N A;  4LNU B;  3BHP A;  4A4K A;  4LF6 B;  1RSO B;  2HZY A;  4X1K B;  1VYT A;  5LA6 B;  2KRM A;  3M8A A;  2IW5 A;  2YUN A;  1BGY H;  5IWA O;  1T3S A;  5GJV B;  4CC5 A;  5LJ3 h;  3HKB A;  4LFC B;  3L72 H;  1NR7 A;  1HSQ A;  3M0R A;  2VB6 A;  4KGX B;  1VQ8 T;  3M57 A;  5GAO n;  2A7W A;  1TVK B;  2CP3 A;  1E79 G;  1Q81 R;  5CA0 B;  4OB3 B;  2CP0 A;  5B1A C;  4PA3 A;  1GAX A;  1MMG A;  2PYL A;  1UUE A;  1T3L A;  3EAE A;  3NTK A;  2X4Y A;  4C0D B;  4ZGE B;  1FAF A;  1AR4 A;  3DLM A;  1KQS A;  3KG2 A;  2JZ2 A;  5B66 Z;  1X75 C;  4YTL A;  4LFB B;  3H0H A;  4DV7 O;  3BFR A;  4X1I B;  3CSX A;  1SQQ H;  3CCV T;  4I4T B;  3JAW B;  1TGO A;  3OYE A;  1KMI Z;  3CMA T;  5HKC A;  3BRC A;  1M8M A;  4X62 O;  1MG1 A;  4LF5 B;  3HKC A;  2JMA A;  4Z8A A;  2OTL V;  4YJ3 A;  3ZHR A;  2HKN A;  3F5T A;  3H1I H;  4TV9 A;  1BU1 A;  2Q69 A;  2DEU A;  1JJ2 U;  4OB0 B;  1M9N A;  4GUN A;  4HVV A;  3K06 A;  2DFU A;  4F6R B;  4R6Z A;  1M1K C;  1Q86 C;  1XHZ A;  2XIC A;  3DB3 A;  2IM9 A;  1OCO C;  3C4S A;  2Q9L A;  3CS5 A;  4IIJ B;  4EPC A;  4UCO A;  3MAQ A;  4PJJ A;  3VU3 C;  4JRQ A;  3A2F A;  3CC2 A;  1VMG A;  2PZ1 A;  3T4D A;  1FYN A;  2CRE A;  3FLG A;  4BAY A;  4M75 F;  2JGD A;  5EK0 A;  4F4L A;  2C0O A;  4AG1 C;  1KQ2 A;  3SR2 C;  2K7A A;  2OCC B;  4MSW C;  1HNZ B;  3T9N A;  2DK3 A;  5M9O A;  3CCJ A;  1RM1 B;  3ABM B;  4DXW A;  2EQM A;  1EN4 A;  4PA9 A;  4ZNX A;  3CME V;  4N23 A;  2LCS A;  1KD1 W;  5BMV A;  1V9P A;  4L6V 5;  4EMK B;  4GCZ A;  3DXR B;  4D7S A;  4M7D C;  4G28 B;  4MVM A;  2VVK A;  4M77 A;  2OTL T;  1WLE A;  3KFV A;  3AG2 C;  1S72 A;  4JAA A;  2CZ7 B;  1WA8 A;  2JUF A;  1Q82 R;  5KE2 A;  4PDV A;  2RN8 A;  2HFE C;  2A3Q A;  4NKG B;  3I56 V;  5EIB C;  1N9S A;  3G71 Q;  1K9M C;  3B77 A;  3EFO A;  3INZ A;  2HP8 A;  1VAR A;  2E6Z A;  3AT1 B;  4OPH A;  2JGU A;  4LDY A;  2ZE5 A;  2ZIN A;  4C8Q F;  4M7D A;  1K3E A;  2D8J A;  2DWD C;  3BEH A;  4B3S B;  3OYK A;  3ZIA G;  2BTO A;  3ZED A;  3OMG A;  4ELY C;  4KUI A;  1JFF B;  4C5G A;  1Q81 C;  1TUB B;  4YJ2 B;  2EGC A;  1QMC A;  4LN2 A;  1K8A C;  2D8H A;  1YIT V;  1R77 A;  2KR3 A;  2Z0W A;  4J6Y A;  4TV8 B;  3TK1 A;  4KHP B;  1YCI A;  4LD6 A;  3OW2 P;  4ORZ A;  4JI2 B;  1TAE A;  1MNE A;  3SYO A;  3CME T;  1OHH G;  4PA7 A;  5C8Y B;  2DQ3 A;  1VF6 C;  4JDS A;  5KCO A;  2WA4 A;  2E64 A;  2MK5 A;  3VBB A;  1FMK A;  5HCK A;  2UXB B;  3E9G A;  1UGV A;  3JCM J;  2P4R A;  1XMQ O;  2XAH A;  4J8O A;  1CSK A;  1FJG O;  2X4J A;  1JJ2 S;  3GPL A;  4G27 B;  3DC5 A;  1HP8 A;  1K9M U;  3OAA G;  5FU7 C;  2DA9 A;  4RG2 A;  4K8Z A;  6AT1 B;  4Z89 A;  3CCR V;  3FJP A;  1F4M A;  2QGN A;  2DER A;  5A2Q E;  2EQI A;  4F14 A;  1Q81 U;  1GN4 A;  2EIN C;  2DVJ A;  4N4G A;  4C92 B;  1K8A U;  1CKA A;  3E22 B;  4BIU A;  1Q90 D;  3BAA A;  1AWJ A;  5JJJ B;  3G1J A;  3O5Z A;  4I9W A;  2HKO A;  3MP6 A;  2P7T C;  2UXN A;  2QEX T;  5F2V O;  3SD4 A;  3ZX6 A;  4WFA V;  4CH6 A;  2X3X D;  1W0J G;  1RI0 A;  2F5K A;  3OYH A;  2HNI A;  4K35 A;  3ASO B;  1AP5 A;  2G38 A;  4XTY A;  4ABM A;  3CCE V;  4AIL C;  4JV5 B;  4ZI7 B;  2OTJ A;  1N27 A;  2IJI A;  2DIQ A;  1WB8 A;  2MI6 A;  4D8K A;  3SB2 A;  4H0L B;  2QQS A;  4GY5 A;  3CC2 Q;  1GO3 F;  4C5E A;  3AG1 B;  4RQF A;  2YDE A;  3RKW A;  1WJR A;  1Q82 C;  5GMK h;  3OTF A;  4XU0 A;  2MIO A;  3K08 A;  1D1A A;  3EGD A;  4FT4 A;  2RCV A;  3CCJ Q;  2W6I G;  1X27 A;  2LW7 A;  4XDJ A;  4EFE A;  1FFT B;  1TXQ A;  4AMC A;  2L0A A;  2RJE A;  2UXC B;  3SWN B;  1BT8 A;  3ZBH A;  2F4V B;  2H3J A;  4PJL A;  3QBY A;  2E3I A;  4I50 B;  3RMQ A;  1V1C A;  1SES A;  5KUM A;  4FIB A;  3JCM V;  4E6R A;  4JZ4 A;  5CKB A;  3MPU B;  3RDV A;  3PTA A;  4OPA A;  2GUZ A;  2W0Z A;  4E7J A;  1S72 Q;  3VS6 A;  4JJB A;  1VQK A;  1YWP A;  4A54 A;  4EMG A;  1V54 B;  2JMC A;  2NUP B;  1AWO A;  4O2B B;  2QTV A;  5LJ3 d;  2RN9 A;  5GAN 7;  1U06 A;  3CCE T;  3E8F A;  5GMK l;  1PNM A;  4NXM B;  1N33 O;  1W6X A;  3CXH F;  1AOJ A;  3CRQ A;  1DK1 A;  1P84 F;  1TA8 A;  1W4S A;  2QA4 V;  3JAR A;  4RTW A;  3MEV A;  1V55 C;  2RPN A;  1Q6U A;  4B6M A;  2BIV A;  1Q82 U;  2PI4 A;  1VQL A;  1P4R A;  4QQD A;  4PJ0 Z;  2B86 A;  2HL5 C;  1VQ6 T;  3ABK C;  1YP5 A;  1PRL C;  2RJD A;  5LL6 S;  5LXT B;  3MEA A;  4MTF A;  3QUI A;  4Y92 A;  2PTK A;  1QVF P;  3JB9 F;  1BK2 A;  3EGU A;  2RNA A;  4FU6 A;  3RGB A;  4IYH A;  1M5I A;  4P9P A;  5GMK j;  3J81 E;  2IH3 C;  1W0K G;  3SPC A;  2UXD O;  4FZ0 A;  3CJH B;  1KHC A;  1WHM A;  1B06 A;  4GKK O;  3RUX A;  3OY9 A;  4DV5 O;  3PVL A;  1HXD A;  2IJH A;  3A1P A;  3A8H B;  4FSX A;  1R6T A;  3I55 V;  1AZG B;  1TUG B;  3OT7 A;  4C92 D;  2VKN A;  1NKD A;  2O9S A;  2ZR3 A;  3UAT A;  2FB5 A;  1E7O A;  3VS2 A;  1X43 A;  5CO7 A;  1M9S A;  1A32 A;  1ZSZ B;  4DUZ O;  2QA4 T;  4I55 B;  5LOV A;  3MHX A;  1JQQ A;  2NLU A;  3JCM f;  2QXF A;  3VKI A;  1K5S A;  3SJQ C;  1YFN A;  3FYE B;  4PKC C;  1VQ8 A;  1Y74 A;  1YBY A;  3ETQ A;  3P32 A;  1F23 A;  4BE1 A;  2XHB A;  1US6 A;  3K3W A;  2RHY A;  2AGA A;  3TGU H;  1ZBX A;  4XTU A;  1M3B A;  4ZOL B;  2GFA A;  2CAZ C;  4BR6 A;  1I81 A;  1PCX A;  2CE4 A;  3E86 A;  2RHI A;  4LF9 O;  4X20 A;  5GAM f;  1XNQ B;  1W1F A;  1ABO A;  4BAC A;  2OTJ Q;  1HJD A;  2RK2 A;  4I0X B;  5EBW C;  1W2B A;  2B5U A;  4CBC A;  1VQ9 V;  4EFB A;  4B7K A;  4JI6 O;  4MVO A;  1H8E G;  4I5S A;  3CCV A;  2NR5 A;  2R58 A;  4E7Z A;  3CMA A;  2NUT A;  4JRP A;  5H6Q A;  4HCK A;  3JAM E;  3MEW A;  4HT9 A;  4DUY O;  4EEQ A;  1W2B U;  4DRX A;  1NJI W;  1D3B A;  2E4H A;  2EYZ A;  3M0P A;  3SYP A;  3FYI B;  4O4L A;  5HFL A;  2RB6 A;  2FPE A;  4DBH A;  3E35 A;  5H9C A;  2YS8 A;  5EC2 C;  1PWT A;  5K1X A;  2P22 C;  1BS3 A;  5D7U A;  1VQK Q;  2ATK C;  1XJW B;  3H41 A;  5KMG B;  2ZM6 B;  3QG1 A;  5FWC A;  1AT1 B;  3VRZ A;  4BE0 A;  3M5A A;  3PFS A;  4CS2 A;  2WAM A;  3LLR A;  4RCC A;  4B3T O;  2YXH A;  4DV3 O;  3QYH B;  1NLP C;  4AQY O;  2EIF A;  1I5X A;  2HMA A;  1N0N A;  1BSM A;  4L59 A;  2R9R B;  2D2C B;  2PVG B;  1DF5 A;  2D9T A;  4E47 A;  4AFQ C;  1VQL Q;  4LNU A;  2QJ1 A;  1S1N A;  5GAO m;  1RSO A;  3OYJ A;  3S3M A;  2X0L A;  5LA6 A;  1N5Z A;  2DD5 A;  4JI7 B;  5IYD O;  2LP7 A;  5KX5 B;  5KCH A;  4LF6 O;  1VQ4 V;  4R56 A;  2A37 A;  2OTL A;  3CCL T;  2PZS A;  4C0D C;  3H1K H;  1K9A A;  1K92 A;  1OZ2 A;  3JAS B;  3FKS G;  2YUA A;  5J2T B;  1K76 A;  3FJ5 A;  4OP0 A;  1H2M A;  1TVK A;  4RMO A;  4CRI A;  1OEB A;  1MSD A;  3FAV B;  4LFC O;  1OUL A;  1TH7 A;  1SF9 A;  1ZLZ A;  3G80 A;  1U5S A;  2EJG A;  2X35 A;  3E1S A;  1PHT A;  5CA0 A;  2BUD A;  1UDL A;  2EAY A;  4DBQ A;  3LWI A;  3LGF A;  2Q0O C;  3M7M X;  1UGQ B;  4ANJ A;  3UO3 A;  4QNH B;  1NU1 H;  4JI3 B;  2CTR A;  4FZ1 A;  3CCU T;  1QU7 A;  1WI7 A;  2JN0 A;  5EZY B;  1BCO A;  3G4S T;  1M1K W;  4BUG A;  1Q86 W;  1MND A;  4X1I A;  2A0L A;  3K59 A;  3G71 V;  2DO3 A;  3CCS T;  3M4G A;  2RDC A;  4LFB O;  4I4T A;  3JAW A;  1RAD B;  1YXB A;  1OU8 A;  1WDX A;  5CMU A;  2VUB A;  3X2Q B;  2ITC C;  2ZKO A;  1C0M A;  1AVZ C;  4JAS A;  2ED1 A;  3CME A;  3EVK A;  1VQ8 Q;  2XOK G;  1JVM A;  2H3E B;  2FB7 A;  1Q95 G;  2RHU A;  2DZC A;  4TWK A;  5IXF A;  3JB9 H;  2FRW A;  5BY1 A;  1YCY A;  3OM3 B;  4Q6G A;  4F6R A;  2BTQ A;  3FC3 A;  1H2G A;  2ZXW B;  5J39 A;  1W2B S;  2Y0P A;  3FDR A;  4PLI A;  2ZZD A;  5GMK i;  2OCC C;  4UCS A;  3CB2 A;  3VS4 A;  1RM1 C;  3ABM C;  5BXZ A;  4IIJ A;  1OI1 A;  2LJ2 A;  1H38 A;  5KHH A;  2J7I A;  4EMK C;  1R3I C;  2VGM A;  5DED A;  1K34 A;  2V8I A;  4KGZ B;  2CZ1 B;  1F4N A;  3FB5 C;  3CCV Q;  3N2G B;  1U8R A;  4EIK A;  3CMA Q;  1K9M W;  2QGF B;  3KUF A;  2JM8 A;  1CPY A;  1IXB A;  2Z5U A;  3RWR D;  1GM8 A;  1PNL A;  3K5O A;  4MTO A;  5DEC A;  3STZ C;  1WYX A;  2Y4X A;  5HFM A;  4C0Z A;  3X26 B;  2QEX A;  2PUS A;  1UGP B;  1HNZ O;  2AHY A;  2CZ0 B;  4EMK A;  3DXR A;  4R0K A;  2YIA A;  2Q8V A;  4MML A;  1WNL A;  4B9X A;  1O9S A;  5EC7 A;  1DTO A;  1K8A W;  3GOX A;  3EFR A;  1R3K C;  1YI2 V;  3LSU A;  5H2F Z;  3M4Y A;  1D1C A;  3LUT B;  3L71 H;  4DV0 O;  3E2U A;  2EIL C;  2EBP A;  4K11 A;  2Q6A A;  1Q6I A;  3STL C;  2HVJ C;  1P7B A;  5GAM h;  4JTD B;  1GM9 A;  2M7W A;  3QO8 A;  4BD3 A;  1NVP B;  4Z88 A;  1G83 A;  2HDA A;  2G3R A;  3L70 H;  4BI8 B;  1IHV A;  2CUG A;  3QNE A;  3WFV A;  3CX5 F;  4BDY A;  3RMS A;  1TUB A;  4J7I A;  4F17 A;  4YJ2 A;  1SRY A;  3GF5 A;  3P8H A;  2ADP A;  2YIB D;  2FYU H;  2R9I A;  4TV8 A;  4D6T H;  2DW4 A;  2A7Y A;  3HPL C;  1WP7 A;  2YUO A;  4M78 F;  2DZ9 A;  3JD0 A;  5A0G A;  2QTX A;  2F1M A;  5L3C A;  1C6V X;  5C8Y A;  4JI2 O;  3OW2 A;  4O4I A;  1VQM T;  1Y4M A;  4JAU A;  4FM1 A;  1N9R A;  3OS0 A;  2CS7 A;  1Q5O A;  1DJ7 B;  1U1T A;  3ABL C;  4ZTJ A;  1Y57 A;  3ZRW B;  4X8A A;  2LP5 A;  4BW5 A;  2CP6 A;  5CCA A;  3WU2 Z;  5GAN 3;  2UXB O;  2JJ2 G;  3OMA B;  1MHN A;  3G6E Q;  1VYV A;  1H3H A;  1Q6H A;  5GAN h;  2IH1 C;  3L9D A;  3SYQ A;  4DW1 A;  3O8V A;  4Y91 A;  1YHQ T;  2WLJ A;  2E5L B;  3P3N A;  4AFU C;  3QTC A;  4JPB W;  2FPF A;  1KHI A;  2YI8 A;  2DYB A;  2EFI A;  4F7U B;  1VQ6 A;  2KBT A;  3M54 A;  1M2V B;  3ASO C;  5IJ0 B;  5GAM j;  4C92 A;  1YIJ T;  3LW5 E;  5CBF A;  4JYB A;  1MNG A;  2A3L A;  1QW1 A;  3CRC A;  3VS3 A;  1YJW T;  1QKX A;  1Q82 W;  1PL4 A;  5KLV H;  4B3M B;  4WFE A;  4B08 A;  3JAL B;  1ZL8 B;  3AG1 C;  3N2K B;  3ETG A;  1O9G A;  3HFN A;  2DYI A;  1VQP T;  3FX7 A;  4EB6 B;  2AHJ B;  3CC7 T;  1WX6 A;  4ZI7 A;  2M0Y A;  2JEU A;  1HNX B;  5FRO A;  2OCH A;  2DYR B;  4JV5 O;  5CA3 A;  1URF A;  1J5E O;  3CBP A;  1XOU A;  3AG3 C;  4HKE A;  2KAF A;  4QPK A;  2AKL A;  5L3G A;  4H13 B;  2P5O A;  1KKD A;  4ZIB A;  4LFA B;  4N21 A;  4U3J B;  1SQX H;  2VQF B;  1ZA1 B;  1SHG A;  5B1B B;  1IBK B;  4ZGD B;  1EBO A;  3H8Z A;  1D5N A;  1G6U A;  3HTR A;  1XNR B;  4MW8 A;  2QEX Q;  2VWK A;  1I4K 1;  3SWN A;  2EWN A;  4QIW F;  2ZPB B;  2PTM A;  3IJ4 A;  4I50 A;  2P0P A;  4FM2 A;  1CKB A;  4RTY A;  1XI1 A;  2UXC O;  2D0N A;  2P4T A;  1KU9 A;  3B8M A;  2F4V O;  4LDW A;  2V8J A;  4FYW B;  1SG5 A;  1IGQ A;  3ME9 A;  1G8M A;  2OT5 A;  2WSE E;  3A8T A;  2NUP A;  3LWH A;  1L8D A;  4O2B A;  1NVP D;  4HA8 A;  3OYA A;  3GVM A;  1LR1 A;  1VQ5 A;  4UB6 Z;  2RQW A;  5KYU B;  1X01 A;  2JS2 A;  2WLM A;  5CQX A;  2UUA B;  1W59 A;  3S6W A;  2QDO A;  3HB3 B;  4X9D A;  1SER A;  1N0J A;  4ATO A;  4NXM O;  1BCM A;  2CGH A;  1N6A A;  1I5Y A;  4DV6 B;  1K4C C;  1H64 1;  5CBG A;  3BCC H;  3O9O A;  2FRY A;  4DEX A;  3K5N A;  5LXT A;  1NJI R;  4JTA B;  4GLK A;  2PI5 A;  5J2U B;  1UHC A;  2KQW A;  1YJ9 V;  1QVF A;  4DV2 B;  2NYS A;  4O2A B;  1QLE C;  4FFK A;  1I94 B;  1VF7 A;  1VQN V;  5LJ5 h;  3CJH A;  1LPL A;  5LJ3 g;  4PV1 B;  1M27 C;  3B40 A;  1WHL A;  3BPZ A;  2GV9 A;  2ROL A;  3F70 A;  4GLM A;  3EG2 A;  3LSQ A;  1IZ3 A;  1YJN T;  1NPR A;  2K3Y A;  2O01 E;  2ZQM A;  4NTW A;  3VOU A;  2EX3 A;  3H9V A;  2FG0 A;  1GRJ A;  4MVS A;  1MMN A;  2P0Q A;  4HCZ A;  5EG2 A;  4H33 A;  5C6S A;  2DBK A;  5D5Q A;  2B1G A;  1VQ6 Q;  1U96 A;  2DWE C;  4J6X A;  4I55 A;  2EZO A;  4XU3 A;  1ORQ C;  2BE3 A;  5KAI Z;  1MGQ A;  4DR5 B;  3CC4 V;  3CCL A;  3K9S A;  2KVQ G;  4IIO A;  2LFS A;  3E89 A;  2EIJ B;  1L1F A;  1RUW A;  3CD6 V;  4ZOL A;  1NPP A;  4M77 F;  3HRT A;  5IH2 A;  3THK A;  1GXI E;  1XBL A;  5EBL C;  3PNW C;  4M77 G;  4FW1 A;  4IUV A;  4JI4 B;  1VYU A;  1PL0 A;  4UUJ C;  1N36 B;  1VUB A;  3CCU A;  4X9C A;  2J06 A;  2R5M A;  3V7S A;  4I0X A;  1K0S A;  3AG7 A;  4JI5 B;  1JRI A;  3G4S A;  1M1K R;  2O31 A;  1M1G A;  4M7D F;  2DAQ A;  1Q86 R;  2F69 A;  1Y71 A;  2DVE A;  2ZE8 A;  1X69 A;  3K9A A;  3CCS A;  2KYM A;  4KH1 B;  1G2B A;  2EYQ A;  1QWE A;  1M56 B;  5JQG A;  1Y67 A;  1ZLM A;  5ITZ B;  5J26 A;  3OTO B;  5GJW B;  2PVO B;  3HKD B;  3FB6 C;  3IFX A;  3CC4 T;  3TRE A;  2FEI A;  4MVQ A;  4WBN B;  2YI9 A;  3UPU A;  2XTA A;  1I0H A;  3D3I A;  4D8D A;  4HZ3 A;  4MVZ A;  1VIF A;  3LDE A;  3SYC A;  5JJE B;  4WF9 V;  5KMG A;  5CQY A;  4FPP A;  2BE9 B;  5CN0 A;  3ICX A;  4OXS A;  3JSN A;  1EIF A;  3UT1 A;  2CUB A;  1VQ5 Q;  1RI9 A;  2BZX A;  1I8F A;  2ZM6 O;  4ASU G;  1LJO A;  1K9M R;  4MT8 A;  3X24 B;  1OJH A;  1ZTE A;  3LDC A;  3NR7 A;  2F2W A;  4V2S A;  3K57 A;  2ZPF B;  1NI8 A;  2ADQ B;  4TT3 G;  4JRI A;  5GAN d;  3J80 N;  5L3F A;  2EIK B;  1QVF S;  5KX5 A;  1FXH A;  2Q68 A;  4DV4 B;  4BY6 B;  2YIB A;  3OEH G;  1GCP A;  3ZL7 C;  2WLL B;  1OCC B;  4JI7 O;  4OMQ A;  1K8A R;  4RUE A;  3JAS A;  4WFB V;  2KSD A;  2XT9 A;  5J2T A;  3E9F A;  3JSC A;  4FW2 A;  1MV3 A;  4F7U G;  1WHH A;  4GX1 A;  4ZHQ B;  4M7A E;  3FAV A;  2KI7 A;  4YIO A;  2ZPG B;  3MDS A;  1NS1 A;  3P30 A;  1TUE B;  3F5W C;  1NJI U;  2WPD G;  2XAF A;  2MPX C;  5EZY A;  4CC2 A;  5IYZ B;  1VQ7 T;  4JI3 O;  2ZDI C;  3EH1 A;  3CCM V;  3CCQ V;  3EGX B;  3KXT A;  4FM4 B;  3NGP A;  1WNS A;  1KQS U;  2G6F X;  2ZXW C;  3ML0 A;  3SGI A;  1FXV A;  1O75 A;  4KUM A;  3CCL Q;  5LJ3 e;  3QVN A;  3UO2 A;  2WLK A;  5GAO q;  1QR9 A;  1M30 A;  5KHG A;  5LMU B;  3DB4 A;  1VQM A;  1NTZ H;  4PHZ A;  1G3S A;  2CUD A;  2ZDI A;  4OF1 A;  1K1Z A;  2A79 B;  3ASN C;  1S76 D;  2YDL A;  3E19 A;  4MS2 A;  1AWX A;  4B9W A;  2JIZ G;  4VUB A;  4J42 A;  1H92 A;  3SPH A;  2Y90 A;  3C3S A;  2CH7 A;  3C90 A;  1KC8 C;  3CCU Q;  2EIM B;  3IC7 A;  4M77 C;  4DBR A;  3JD3 A;  1KUQ A;  4GKJ B;  2FPD A;  2RQV A;  3IGA C;  3ZMS A;  3OB9 A;  1JQ0 A;  1YHQ A;  4E4E A;  1K73 C;  3G4S Q;  3CRM A;  2ZGW A;  3ZRX A;  3E2E A;  4II1 A;  2MK3 A;  3JCZ A;  3UM7 A;  3CCS Q;  3N2G A;  9ATC B;  2JJ9 A;  1YIJ A;  1ACM B;  3PE0 A;  2L6L A;  1BQ0 A;  1GKF A;  3G6E V;  2K5L A;  4FVM A;  3CCM T;  1G8X A;  3ZHS A;  2M16 A;  3QII A;  3UWN A;  4C5H A;  2E76 B;  2L2P A;  1YJW A;  3K0G A;  3CPF A;  1GFD A;  1U97 A;  1I07 A;  1WQW A;  2XUM A;  3CWB H;  5FPO A;  1M1K U;  1Q86 U;  3CEY A;  1QNM A;  2BE7 D;  3OYF A;  3ZFJ A;  1FMV A;  4DYL A;  2MAM A;  3CC7 A;  1VQP A;  3V8J A;  4IGG A;  2CZ6 B;  1XRE A;  2DRM A;  1X59 A;  3WG7 B;  1RPO A;  3WB1 A;  1F7Y A;  2GGR A;  2PF4 E;  5CA1 A;  2W0X A;  3H1L H;  3ZMV A;  2A28 A;  5D6X A;  4DR3 B;  2L35 A;  4ZKI A;  4J9D A;  1BZK A;  4CC3 A;  5IT9 E;  1SRM A;  2DTI A;  1YWO A;  1SQB H;  1NEB A;  2NN4 A;  2ZE7 A;  4R55 A;  2PGG A;  4H44 B;  2PVD B;  4MZP A;  3CXC P;  3QDF A;  3A8L B;  4L87 A;  1KSW A;  1KK7 A;  4GZR B;  4RKU E;  2HJF C;  2LMJ A;  2YIC A;  1H8K A;  4LUE A;  4YIP A;  4NVP A;  2LZ6 B;  2UUB B;  1SSF A;  2OI3 A;  4M78 E;  1KP2 A;  1KQS S;  1QVG P;  3OUF A;  3RT3 C;  2V8K A;  3I56 T;  2OWO A;  1FWZ A;  3OYG A;  3ZRW A;  1N8R C;  3OMI B;  2LC4 A;  4CH4 A;  1MA1 A;  3QDR B;  4HCB A;  4PJO E;  4LF4 O;  2COZ A;  5CIU A;  3H1H H;  1UJW B;  3UDC A;  5CVI A;  1Z5V A;  1RPR A;  2Q67 A;  1LNX A;  4XTW A;  2QM4 A;  4JZ2 A;  3KCX A;  1SQF A;  3R6N A;  5K1P A;  1OOT A;  4JZ3 A;  2X9H A;  2LNH B;  4QVD A;  3H6Z A;  2ZNI A;  2PU9 B;  3JB9 I;  1Y07 A;  2E5L O;  4F7U A;  3JCM P;  1YIT T;  1CXZ B;  4O5V A;  2DOS A;  2ZE6 A;  5IJ0 A;  5I11 A;  1R6K A;  3JCU Z;  3X28 B;  4DR6 B;  4A4H A;  2IVW A;  1PNJ A;  1PM9 A;  1H3Z A;  3TQ7 P;  4KP4 A;  2LX7 A;  2WLI B;  2LJ3 A;  3DLL A;  3ZCC A;  5LMN B;  2OYQ A;  1VQM Q;  3L2V A;  4MTX A;  1PKT A;  1C1A A;  1JA8 A;  1SRL A;  4M7A B;  3HFO A;  1ZL8 A;  3N2K A;  5JVD B;  5JCO C;  4EB6 A;  4RG8 A;  4X88 A;  4FLY A;  3VJP A;  1YJN A;  2LQN A;  1G1X B;  1R3J C;  5IJ9 A;  1N8R U;  5B1B C;  3CCR T;  3ETD A;  2LX9 A;  3WVE B;  5FLX N;  3A8M B;  1JXM A;  1YHQ Q;  1D09 B;  3FIF A;  1VEW A;  5CAI A;  2ZNJ A;  3M59 A;  2M6Y A;  5KHK A;  1NQT A;  3CQT A;  2DRK A;  2GBQ A;  2YHT A;  4F6E A;  1KB9 F;  5JCO A;  4OGE A;  3RYI B;  1YIJ Q;  4MMK A;  3T1H B;  3RYH B;  4YY3 O;  1AR1 B;  4U3J A;  1XEQ A;  1FXK B;  2HQX A;  2KB1 A;  3FEO A;  3JRZ A;  4J9E A;  5GAN 4;  3CPW P;  1AZE A;  4LFA O;  2LW1 A;  2R70 A;  2X6B A;  2VQF O;  2QQ9 A;  2GNC A;  3OYC A;  1IBK O;  2DF6 A;  4NR1 A;  5FU6 B;  3IC9 A;  1XNR O;  3JB9 J;  5CK9 A;  1R6N A;  3VS7 A;  4J9C A;  4XDK A;  5B5E Z;  1VQP Q;  2BSK B;  3CC7 Q;  4QQG A;  3SFM A;  5L3D A;  1D0X A;  4RTU A;  1S0V A;  3V8L A;  2L3P A;  3QJY A;  1OZ3 A;  2FHD A;  2RK1 A;  1WLP B;  1Y76 B;  2LCL A;  5KYU A;  1OCR B;  2VXF A;  2F5T X;  1IXM A;  1UEC A;  1GK9 A;  4UCV A;  2CH4 A;  3RES A;  4LF7 B;  3CBO A;  4X1Y B;  3NHN A;  4E2L A;  2R72 A;  4XTX A;  2UUA O;  2FL7 A;  1M93 A;  2CTW A;  1FX7 A;  3QF7 A;  1S3J A;  2WSC E;  2AHZ A;  5GMK e;  2CDY A;  3EFS A;  3ZRV A;  1VQO V;  4JI8 B;  5GTH Z;  2CDT A;  3M0Q A;  4LCU C;  4DV6 O;  1I0C A;  2CYZ B;  3QYG B;  4FLX A;  1FPO A;  4JI0 B;  2J6O A;  2UUC O;  1IDS A;  5J2U A;  2X6A A;  4DR1 B;  2K6D A;  4O2A A;  2DYS B;  2Q4P A;  5FRM A;  4P5N A;  4J7Z A;  2OIE A;  4O4H B;  1OZ0 A;  4BW9 A;  1SQG A;  3K03 A;  1I94 O;  4OMM A;  3W7T A;  1UJY A;  2VS0 A;  1MMM A;  3JD1 A;  2JTM A;  3SHW A;  3PMT A;  2NNU A;  2KRO A;  4LE9 A;  2EIJ C;  4E7K A;  2D1X A;  4AG2 C;  2CP5 A;  3FD9 A;  2QQR A;  3BY6 A;  3MKD A;  3FRN A;  1H2K A;  3M0T A;  4E7L A;  2N04 A;  3OBW A;  1QCN A;  2E3H A;  2FZC B;  1TTH B;  3MP8 A;  3QKJ A;  3RKX A;  4M7A D;  2A9H A;  4DR5 O;  2Y69 B;  4J7F A;  3RNJ A;  2RO0 A;  2DE0 X;  1JJO A;  2RHX A;  4C7U A;  3BDU A;  3M55 A;  3REB B;  1S5L Z;  2HHH O;  4DK1 A;  3OR7 C;  5AYF A;  1YJN Q;  3RFR A;  4MZM A;  3I55 T;  3NXS A;  1M56 C;  2P4K A;  4J9Z B;  4PJO B;  2QWQ B;  4A63 B;  3L1A A;  4JI4 O;  2H3O A;  2VQE B;  1N36 O;  2E1H A;  2R5A A;  1VQ7 A;  4PI2 A;  1H2S B;  3OQ5 A;  2X7R B;  2DXC A;  1N32 O;  4JI5 O;  2QAS A;  4IIM A;  4PFO A;  3K58 A;  3GWO A;  4XTV A;  4TSF G;  4J9G A;  4HCC A;  4A4F A;  1I1J A;  3VUB A;  4PDR A;  4D7T A;  1IBM B;  3AK1 A;  2LQK A;  2IJJ A;  5ITZ A;  2XAS A;  2HQH A;  1NBE B;  2K9P A;  2KT8 A;  3HKD A;  1M4U A;  2FTK A;  3OTO O;  2W10 A;  5J9P C;  4WBN A;  1QP2 A;  1NM7 A;  3HKE B;  3HR0 A;  5I21 A;  3MHH C;  1NE8 A;  2QE7 G;  2VYT A;  2CTP A;  3M99 B;  1VQ9 T;  2K5I A;  4J9F A;  1N34 B;  3OE7 G;  4K3A A;  3T1Y B;  3OYB A;  1RAG B;  4QE7 A;  4LDX A;  1BYM A;  2LDM A;  5I2M A;  2MWP A;  4ZGJ B;  2EIK C;  3OBY A;  3EFF K;  4BY6 C;  4X1K A;  1M5Q 1;  2LCC A;  4DK0 A;  1AI6 A;  2P90 A;  3QHS A;  1X6B A;  4OB2 B;  4ZTF A;  3I5S A;  3CCM A;  2DTH A;  3DGE A;  4PL6 A;  1BQZ A;  4HAM A;  1O9H A;  1RAA B;  1HYO A;  4C92 F;  1ENV A;  3JAK B;  2XDP A;  1AWW A;  2COY A;  4N0A C;  1QCE A;  5IWA B;  4C92 G;  3TSW A;  1OCZ B;  3GB7 C;  4FFB B;  1V29 B;  2WLL A;  1BHB A;  5LBQ A;  2QM7 A;  5LGN A;  2AZS A;  3H0I A;  1JEG A;  4DV4 O;  1GL5 A;  2SEM A;  2KK4 A;  4J11 A;  3EHQ A;  4PK4 A;  2ABL A;  3UF4 A;  3N27 A;  3R6O A;  3OS2 A;  1WXT A;  2ZAE A;  4Z1V A;  4N0A A;  3RBB B;  4MDX A;  1JJ2 P;  5IAY A;  1VIE A;  2AZ0 A;  3C94 A;  2Y4Y A;  1B6Q A;  5IYZ A;  5CKE A;  3D36 A;  1GMG A;  5EC1 C;  1HK9 A;  3EGX A;  1HR0 B;  4QE9 A;  1GBQ A;  1MAB G;  1KC8 W;  2MW2 B;  2DMO A;  4RUG A;  5GAN g;  1ZUY A;  4LF5 O;  3SPI A;  1VQ4 T;  1K73 W;  4DOV A;  4KBM B;  2LTO A;  1ARO P;  1RP3 B;  5B1A B;  4I7Z B;  2V1R A;  2EIM C;  2CSQ A;  1PV0 A;  2BZ8 A;  3GBQ A;  3I56 A;  3PN1 A;  1ZX6 A;  4OML A;  2AIR B;  2PUO B;  5LMU O;  1GFC A;  1UFI A;  4E7I A;  4PJO D;  2JRI A;  1NTK H;  2LGW A;  1EN5 A;  2M51 A;  3GP8 A;  4IUU A;  4GLX A;  3QO5 A;  3RYF B;  3RBZ A;  2L8D A;  4M75 E;  2WAC A;  4OX9 B;  1VQ7 Q;  2QSA A;  4DR4 B;  1VP7 A;  4UB8 Z;  3G71 T;  4X65 B;  1YIT A;  2XDB A;  2DMX A;  4LWS B;  3D8C A;  2RI3 A;  3L2Z A;  3RKY A;  1P49 A;  1AD5 A;  1TWB A;  4UXN A;  3JCM h;  4IUQ A;  2E10 A;  4JLG A;  4ZN3 A;  1MV0 B;  1OCO B;  4DW0 A;  1D1B A;  1MSW D;  2QAZ A;  4OB1 B;  1PD3 A;  4KH0 B;  5EYP B;  1E1R G;  4PA4 A;  4J9B A;  2LJ1 A;  1YCS B;  1XOV A;  4RCB A;  2DL4 A;  3ZN1 A;  4C8Q E;  1F51 A;  2F2X A;  1QR8 A;  3CCR A;  2ED0 A;  1NT2 B;  2RJC A;  3APO A;  3BY7 A;  2ZCE A;  3LYI A;  3E8H A;  3V7C A;  2CK3 G;  3SPG A;  5TIS Z;  1JFF A;  5LL6 Y;  4B3S O;  2JT4 A;  2JW4 A;  2M9U A;  4GX0 A;  4E7H A;  3OYM A;  2MOX A;  2QQB A;  2EGE A;  3M58 A;  1DF4 A;  2GTO A;  4AI8 A;  2JVV A;  1AEY A;  2DNU A;  4DR3 O;  3RER A;  2K9G A;  1N8R W;  4PFP A;  3CC2 V;  3REA B;  4OMO A;  1TSF A;  2HSP A;  2OTL Q;  3CRR A;  2EYY A;  4KHP O;  4PD4 F;  1Y96 B;  4FIP C;  2QDY B;  3CXC A;  4LH6 A;  4KUD K;  4Z02 A;  3AEI A;  3CCJ V;  5GAN 6;  2VGN A;  4DEY A;  4B7E A;  3CCE A;  1YI2 T;  1HNW B;  4C92 C;  3HKS A;  4NL2 A;  4IT5 A;  2UUB O;  4NXN B;  2DL5 A;  3JCM b;  2FL4 A;  4IL6 Z;  2LQ8 A;  2P84 A;  1S72 V;  1XMQ B;  3JD4 A;  4TVR A;  5EBM C;  1QWF A;  1ABQ A;  1M4Z A;  1OU9 A;  2JXB A;  4UC4 A;  2FML A;  2WLN A;  1Z9Z A;  2E65 A;  5IE9 A;  1YTF B;  3VQV A;  3OW2 U;  1WQ7 A;  3CXC U;  5GAM e;  4FL6 A;  2O57 A;  2X4W A;  3HSB A;  2ITD C;  3TXS A;  1CEZ A;  4TQD A;  1OV3 A;  3E22 A;  5CKF A;  4MTG A;  3HRU A;  5I2S A;  2DD4 A;  2XKO C;  3CME Q;  1COW G;  4J5Y A;  1D0Y A;  4R50 A;  2KXC A;  2ILM A;  4PJO G;  3CC2 T;  2JOY A;  2KNB B;  2EUL A;  3S3W A;  2EJ9 A;  1B3Q A;  1U3O A;  1K0X A;  2ODM A;  2WLI A;  2EKO A;  1GM7 A;  4DR6 O;  4WCE V;  4DR2 B;  2Y4T A;  1R0B G;  2V1Q A;  2RMO A;  1EZV H;  3OMC A;  5FU7 B;  4AFS C;  3I56 Q;  2N74 A;  1ZSP A;  2EJF A;  2WSS G;  3OYI A;  4BB7 A;  1D0Z A;  4M7A A;  5LMN O;  1ZSG A;  5HK3 A;  3SWN C;  5JVD A;  5JWP A;  3V7R A;  5KE3 A;  4NOY A;  1FXK C;  1Y0M A;  5J3B A;  2JK5 C;  5B3S B;  2KGT A;  3QG5 A;  2QA4 A;  1S72 T;  2O4X B;  2VWJ A;  2CH4 W;  5GAN e;  1YNZ A;  1DGS A;  1V54 C;  2HCK A;  4JI1 B;  2RQR A;  1YIT Q;  3T4Z A;  3DKM A;  4M4Z A;  4PDM A;  3TEE A;  3RYI A;  2JS3 A;  3P3P A;  1PPJ H;  1R3L C;  3TVT A;  1FXK A;  4X66 B;  3TSZ A;  3FB7 C;  2R57 A;  5LJ3 f;  3RR6 A;  2A06 H;  4C0G A;  2JVD A;  1V76 A;  2L5Q A;  3A0R A;  3CPW A;  2JEX A;  1OCR C;  2NLJ C;  4JTC B;  4OGQ B;  2ZCF B;  3MCA B;  1TS9 A;  4BIZ A;  4IHJ B;  4JAV A;  1SKU B;  1KG1 A;  2BSK A;  2IPO B;  1GTO A;  1QQJ A;  2GCX A;  3H1J H;  1G3Y A;  2MWO A;  3JV3 A;  3I55 A;  2V26 A;  3CCR Q;  1IXD A;  3NPF A;  4LP8 A;  2X6C A;  2ZIO A;  5GTI Z;  3OEE G;  2W0F C;  4PEL A;  5D6W A;  1KIK A;  4U7N A;  5A0D A;  1Y76 A;  4X64 B;  2OTJ V;  3VQX A;  4JUV A;  3JYC A;  4M75 B;  4GX5 A;  1M1F A;  1IRX A;  4X1Y A;  5FNV B;  1QLY A;  3DC6 A;  3OS1 A;  3OW2 S;  4ZN1 A;  1PNK A;  3CXC S;  4LF7 O;  2DYS C;  3B2E E;  1GBR A;  2YXL A;  3E83 A;  1BBZ A;  2ROT A;  2Z0A A;  1H2L A;  1YDX A;  3GWK C;  2OAW A;  4WFH A;  3QO3 A;  1XMO B;  4LR3 A;  4JI8 O;  3M53 A;  2I0N A;  1DLB A;  3CCE Q;  1ZSZ C;  4KUL A;  1IZ6 A;  2WLH A;  2UXD B;  4JI0 O;  1BB9 A;  1VQ9 A;  4FLZ A;  2F43 G;  2HJD A;  4DR1 O;  4GKK B;  4JJD A;  1ZA2 B;  4O4H A;  1YTF D;  1V55 B;  4C8Q B;  1IBL B;  2KYB A;  1VQK V;  1KYO F;  1YN8 A;  2KXD A;  1QVF U;  5A0L A;  4PLL A;  4Q20 A;  3S3O A;  1ZSZ A;  1JX9 A;  5LHH A;  4LDU A;  2DJQ A;  1XDC A;  1I08 A;  3RVZ A;  2Y69 C;  1K97 A;  1NLO C;  3TU4 K;  4PFZ A;  2K3B A;  4CZZ A;  4HXJ A;  2YLC A;  3ZHV A;  1GCQ C;  1VQL V;  3JCM Q;  1K7D A;  1YJ9 T;  5IHN A;  3ER0 A;  2XU8 A;  4PJO C;  1VQN T;  4QT7 A;  2UU9 B;  4ZBM A;  1SC5 B;  1R73 A;  3ZHU A;  4XK8 E;  2KKW A;  1XNQ O;  3T1C A;  4NYK A;  1G3T A;  1IB8 A;  2DJZ A;  2XHC A;  5LJ5 e;  3JCM d;  1Q7Y C;  1XL4 A;  4TQF A;  1JR9 A;  2P0K A;  2QTS A;  5BR8 B;  1GCQ A;  5KH6 A;  2O88 A;  5B1O A;  2Q73 A;  4IUR A;  1ZUQ A;  2F95 B;  4UV9 A;  2HL3 A;  2QA4 Q;  2DXU A;  4PJO A;  2CP2 A;  1SET A;  2YUP A;  3OS5 A;  4QW2 A;  3DTU B;  1X4T A;  1XUQ A;  3B4S A;  2FZG B;  8AT1 B;  2ZD9 A;  1KC8 R;  2Z3Y A;  2FYK A;  2L3Q A;  5GAM d;  1Q3E A;  2LQW A;  1VQ4 A;  1K73 R;  4EMH A;  5L23 A;  3TXQ A;  2IIM A;  1MOF A;  2HKQ B;  2L3R A;  3CPW S;  4C5I A;  5IHK A;  3NTI A;  2ENM A;  4A53 A;  3EHR A;  1YSC A;  3ZN0 A;  4HYO A;  1JOY A;  1IBM O;  3CD6 T;  1UGR B;  2Q7E A;  1Z5W A;  1VQ8 V;  4UV8 A;  2K2V A;  1B07 A;  2YUQ A;  3HKE A;  1FKA O;  3U11 A;  5E1A C;  3JSL A;  2RJZ A;  1RFY A;  1VOM A;  3L75 H;  5CB4 B;  3I55 Q;  1Q7Y U;  2I2L A;  1XQ8 A;  5KHJ A;  1GN6 A;  3VS5 A;  2DXB A;  4M75 D;  2LJ0 A;  1ZWI C;  3WXM B;  1M90 R;  4YHH B;  1MZE A;  2CP7 A;  4FLU A;  3G71 A;  1OCZ C;  3RVY A;  2VRZ A;  1SKV A;  1HDJ A;  1WHG A;  2LRQ A;  5JJN B;  1TUD A;  2JM9 A;  4DOW A;  3CCV V;  2HBW A;  2K3X A;  4F7U F;  3A8G B;  1PG5 B;  2V4D A;  4KL1 A;  3CMA V;  1M2O A;  3JAK A;  1XTD A;  1NH2 B;  2IU3 A;  3BFM A;  2EJR A;  4FFB A;  4PJM A;  4H37 A;  2LFR A;  3A98 A;  5D6Y A;  2F1L A;  4FYV B;  4C8Q D;  3X2Q C;  2YID A;  3HHT B;  3C0C A;  4D6W A;  3BVO A;  1S77 D;  4FYY B;  1VQ9 Q;  3EH2 A;  2D6F A;  2K4Y A;  2XND G;  3KCY A;  2O2O A;  3CHX A;  2N05 A;  5GON B;  5KUK A;  3H0F A;  3J80 E;  4E2F B;  1IRE B;  5IN1 A;  3I5D A;  5H6R A;  1RAH B;  2RNB A;  1N8R R;  1B7T A;  3QO7 A;  3LNM B;  3L2W A;  1JJ2 A;  2GTJ A;  4FMT A;  1T0H A;  2RQ6 A;  2MMP A;  1HR0 O;  7AT1 B;  1AI7 A;  1ZQ1 A;  2UXX A;  2F2V A;  2RI5 A;  3SJA C;  3CRA A;  3N5B B;  3ZBD A;  2B9Z A;  2B1I A;  2ZT9 B;  5LGU A;  5CKH A;  4MVU A;  2RHZ A;  5LP6 B;  3L42 A;  1YI2 A;  5IY5 B;  1GRI A;  2LT4 A;  4JYY A;  4JJC A;  1OPL A;  2LNV A;  4R7C A;  2EJ7 A;  4FJC C;  3Q1J A;  2CT4 A;  1BI0 A;  3E8B A;  2X3W D;  4DR7 B;  2YSQ A;  4G2K A;  3PJS K;  3OYN A;  3Q4H B;  2EBO A;  3C95 A;  3HRS A;  2BTQ B;  5LJ3 j;  3RYF A;  5I22 A;  1NG2 A;  1FFX B;  3CCQ T;  4IKF A;  1AB3 A;  3PMI A;  4J7J A;  1ZBJ A;  1EFR G;  4OX9 O;  2DL3 A;  4PNO A;  4Y28 E;  4LWS A;  2CGN A;  4O4J B;  3RYC B;  4DR4 O;  3L74 H;  1Y7X A;  4X65 O;  2C0I A;  2QG9 B;  1VQ4 Q;  3BA8 A;  5CBH A;  1WZO A;  1M90 C;  2XMF A;  5HY6 A;  2JS0 A;  4M75 G;  4ICG A;  4P2Z A;  1FXX A;  2Y4U A;  2VC8 A;  2AT1 B;  5EYP A;  1SSH A;  1G3W A;  1KC8 U;  5IT9 N;  1D2D A;  4BDZ A;  4B3R B;  3SJB C;  2RJF A;  2VWF A;  3TJT A;  1WFW A;  1K73 U;  3R65 A;  1HWY A;  2J05 A;  4DV0 B;  2HD0 A;  3E8G A;  4U7O A;  2PYJ A;  5LJ5 d;  4F16 A;  2P67 A;  3BE3 A;  4WTO B;  2QGG A;  3UA7 A;  1UEB A;  4XTZ A;  2QYZ A;  1Z2G A;  3ABU A;  4FLV A;  2EW3 A;  5L3B A;  3G6E T;  1BHA A;  1UFF A;  2LO1 A;  2J6K A;  1LOJ A;  1BKB A;  1L0N H;  4C8Q G;  2KEA A;  1NH2 D;  2V7Q G;  1WB7 A;  2LQT A;  4YXW G;  1X2K A;  4GBQ A;  1WPY A;  3ULR B;  3QXE B;  3JCM W;  2KRS A;  1Y96 A;  3VQY A;  2EIL B;  2YRC A;  5LYJ B;  3OUS A;  5A2Q N;  1M90 U;  4UCR A;  4K8X A;  4JYC A;  2QEX V;  4UVA A;  1W70 A;  4XU1 A;  4J10 A;  4C0F A;  2OJ2 A;  3UQ8 A;  1GH6 A;  1NR1 A;  4LBE C;  4A4E A;  4J9H A;  1HNW O;  2X51 A;  4JYA B;  4O4I B;  4RAI A;  4NTY A;  2PY5 A;  4NXN O;  1WJS A;  3PGG A;  2YEV B;  2O9V A;  1GN2 A;  2QTO A;  3K5L A;  2XG8 D;  1IGU A;  1M2V A;  2HEQ A;  2QKS A;  2Y48 A;  4NTX A;  2QWP B;  1AVM A;  1B34 B;  2QK0 A;  2B8A A;  2OX7 A;  2RA2 A;  2XD0 A;  4RWU A;  2QWO B;  4CH5 A;  1VF6 A;  2DYR C;  5KYX B;  3P8B B;  2K57 A;  1OYX A;  1CP9 A;  3ABL B;  2KT1 A;  4KXR A;  2KY9 A;  1RAI B;  3C12 A;  4Q5W A;  1M3C A;  2AW9 A;  3JAL A;  1VA7 A;  3VYG A;  3PIP A;  2BCC H;  3PIO A;  4QPJ A;  5B3S C;  4B3M O;  1YI2 Q;  1LUV A;  1NYF A;  4JS5 A;  1Q43 A;  3AK2 A;  1OX9 A;  2GQI A;  3T2M A;  1M8V A;  2XAG A;  3W7U A;  4DR2 O;  2RD1 A;  3EG9 B;  4W4L A;  2GHY A;  4LNP A;  1HNX O;  2NUZ A;  2YWW A;  2Q7H A;  1I5O B;  4I9Q A;  3VYH B;  2RH2 A;  1ZUU A;  1AJQ A;  2O4X A;  2CSI A;  4LUD A;  4IYI A;  4U3F H;  1AI4 A;  1E6G A;  5GAO p;  2BKD N;  1J5E B;  4XAX B;  2GSM B;  5KYY B;  5JH7 B;  2RQU A;  2RMK B;  2NWM A;  1YJW Q;  2PNI A;  1M3A A;  3VS0 A;  4K0K B;  4JI1 O;  3L2U A;  1YJ9 A;  1VQ6 V;  2KMT A;  2DEQ A;  4R8C A;  1YF2 A;  2EZP A;  1VQN A;  4X66 O;  4J7K A;  3SPJ A;  1RAF B;  2DPP B;  4UVC A;  3F7V C;  3UCS C;  3LSS A;  5FLX E;  1EN6 A;  4CI0 C;  4NL3 A;  2GFU A;  4P30 A;  2M1H A;  4M75 C;  3AG3 B;  4IHJ A;  2VXE A;  4J9I A;  1WHK A;  3TCJ A;  3U0Z A;  3ZEH A;  1SQV H;  1NBM G;  3J81 N;  2COW A;  1WAZ A;  4O6J A;  2MCN A;  5IYB O;  1XHX A;  1MZF A;  4M75 A;  1SA0 B;  3OA6 A;  4X64 O;  3ZJZ A;  3I9Q A;  1IUR A;  3ASK A;  3CC4 A;  5FNV A;  1ROP A;  4HNA B;  1E1Q G;  2E41 A;  1WPX A;  2H94 A;  3CD6 A;  2FKX A;  2GF7 A;  4C8Q C;  4LH7 A;  2IJK A;  5A9G A;  1RLQ C;  4DV2 O;  4PDL A;  1AI5 A;  4KGV B;  2E5Q A;  2KDS A;  1XMO O;  2YT6 A;  3A0B Z;  4LF8 B;  3K0D A;  2RI2 A;  2E3C A;  3JCM c;  1SPK A;  4EDU A;  4J41 A;  2EPD A;  2MF2 A;  4C8Q A;  1RAE B;  5L8R E;  2DLP A;  1OQK A;  3OYD A;  2QDL A;  2L3S A;  3C3T A;  1BIB A;  1MMD A;  1AR5 A;  1IBL O;  1PKS A;  1VQ5 V;  3MEU A;  3SDZ A;  1Q7Y W;  1I5L A;  1GN3 A;  2CTQ A;  2ZR2 A;  1MMA A;  2AZV A;  1VQO T;  1QLE B;  2C06 A;  4TUY B;  5KYW B;  2DBM A;  1YZB A;  4UCU A;  2H8H A;  3A8O B;  4M78 B;  1YEW A;  3VUZ A;  2KSS A;  4M77 E;  1Z9Q A;  4QVC A;  4DQ2 A;  1OPK A;  8ATC B;  4RQE A;  3DSQ A; 
#chains in the Genus database with same CATH homology
 2YXY A;  1SF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...