2YXYA

Crystarl structure of hypothetical conserved protein, gk0453
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
EQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYMLNPADFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISLLRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the hypothetical DUF1811-family protein GK0453 from Geobacillus kaustophilus HTA426
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical conserved protein, GK0453
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08838 DUF1811 Protein of unknown function (DUF1811)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.880 Mainly Alpha Orthogonal Bundle Helix Hairpins Hypothetical protein YfhH domain 2yxyA01
2.30.30.340 Mainly Beta Roll SH3 type barrels. Hypothetical protein YfhH like domains 2yxyA02
2YXYA 1SF9A
chains in the Genus database with same CATH superfamily
3MP6A 3GPLA 1YITA 1S72A 1K3EA 3SEMA 1QCEA 1N4CA 2A7YA 1HR0O 2H94A 4BW5A 4C8QC 2XAFA 2RJFA 1PPJH 3CJHA 2K3BA 4XU1A 1NR1A 4CI0C 3L73H 1Y76B 1ZUKA 3CBOA 4MZTA 3JCMd 1K73C 1M90U 1VQPQ 3X2QC 2EBPA 2VWKA 5B66Z 4LF7B 1H3HA 4JI4O 1NVPD 3FYEB 3LDDA 3QYHB 4CRIA 2ZM6O 4BIZA 2EBOA 2R9RB 1RAIB 5IT9E 1VQOA 1NJIR 3GWKC 5LMUB 3K79A 1FXKA 2V7QG 5GJVB 1VQPV 4Y92A 5IY5B 4EDUA 1MMDA 3ZN1A 3VS2A 2ZT9B 3RFRA 2LQ8A 4K0KB 2RMKB 4FW1A 4AQYB 2PU9B 4LDVA 3UQ8A 1KSWA 4N4HA 4BR6A 4DW0A 1TUEB 1RPRA 2NUTA 2FZCB 1JCHA 3G6ET 3JCMf 4IUTA 5M9OA 4KHPB 3BDLA 3QJ6A 3V8KA 4CC2A 3HP9A 1A32A 1PD3A 1RFYA 1MV3A 1VQ5Q 2E3CA 4FLZA 1E79G 3UCSC 4M7AB 1BI3A 5KYYA 2UXXA 1KQSS 3ASNC 2DNUA 1H641 5EIBD 3SR2C 1Y96B 2L8DA 2DXBA 5KUMA 4LUEA 2UXCO 1KU9A 2E12A 2EKOA 3I35A 3RERA 4J41A 4TUYA 1US6A 1XILA 3QYGB 4K0KO 1AVMA 1O9SA 3E8BA 3ABUA 5LA6B 1W70A 5KE2A 3CMAT 4PD4F 3RDVA 3FB5C 5KA6A 5H6QA 2OTJA 2IM9A 3SDZA 4CH4A 3SWNB 1Q5OA 5BZBA 2BCCH 1B04A 2F66C 3H0IA 3H9NA 3H0FA 4YY3B 1I08A 2VXFA 4TQDA 4IL6Z 1XNQB 2XT9A 3UT1A 1OQKA 5GJWB 5GMKl 1YIJQ 4LP8A 2UUBO 4J9EA 2HR3A 2ED1A 3JCMW 2EQKA 2UXBB 2EQUA 2KGTA 4JI1B 3CCSA 2B9ZA 3SJBC 1G1XB 1HDJA 3E22A 2XDDA 3L72H 1N9SA 3R6NA 3TREA 1ACMB 4I7ZB 1V1CA 4C92B 2ZPHB 4AG1C 4P9OA 4BAYA 2HFEC 1OZ2A 3C4SA 2RDCA 2UUCB 1WLPB 1ZSGA 1NZ6A 3STZC 1VQ4A 4D8KA 5GAN7 3PE0A 4C92D 1R6KA 4FYVB 4ZGDB 5A0GA 2JTEA 4PA6A 3ZRVA 5IN1A 2JEXA 3ETQA 1AJPA 3AG1B 2A28A 1QLYA 5I22A 1E1RG 2F4VB 2V8JA 3K59A 4WCEV 3DXRA 2DO3A 2HAXA 3HKCB 4A4EA 4W4LA 4X1YB 5CKHA 3CC4T 3FX7A 3WVEB 1EIFA 5BMVA 2CP2A 4ZOLB 3JAME 1Q6IA 3B8MA 4UCUA 5LJ5g 1D1AA 1Z5VA 4MVSA 1ZSZA 4RTZA 5JVDA 3ZJZA 1RI0A 1TWBA 4PV1B 4ZI7A 1U1TA 1PNKA 2DD4A 2FB7A 1BI2A 2VXEA 1AB3A 3CQTA 1LUVA 4K8ZA 1PL0A 2BZXA 3RWRD 3CRCA 1SEMA 4CBCA 4C8QB 2QTVA 2YUOA 3EFOA 5LJ3h 5GANj 3CCET 5HY6A 2OWOA 4YHHO 5GAMg 4X20A 1SQFA 4F17A 4HT9A 1KBHA 2FRWA 1AD5A 1K9AA 2HDAA 3JB9D 1QVFP 1DF5A 4GX1A 2JS5A 3DB3A 2EWNA 1M1KW 4AFZC 1K5SA 4Z8AA 1WGSA 2EGCA 2DM1A 3OYCA 4M77F 3ABKB 4LD9K 3B09A 2J6KA 3EH1A 1BL8A 4H33A 1XQ8A 4O4HA 2LCLA 2LZ6B 2A3LA 2HKOA 3O8VA 4PJOA 3FAVB 3TXSA 3CC4Q 2L35A 1VQNQ 1QU7A 1D5NA 4KUDK 3K5OA 1NJIW 3H0HA 5FU7C 5B1NA 4C0DB 3Q1JA 2RJDA 4ZGJB 2LCCA 1SA0B 1HSQA 1VQLV 4CH6A 4FLXA 5LL6Y 2BSKB 3JCMQ 4OMFB 3CCVT 1SQXH 2CGNA 4FZ0A 2PVGB 1VQ4T 4PDRA 2L3QA 4TVRA 1RLQC 4X1IA 3S3WA 1UHFA 4DR4B 2X4JA 3U11A 3A98A 3N2KB 4TV8A 1TAEA 3OUFA 1N27A 2E75B 1V54B 4MVZA 1IHWA 4NXMO 2V1DA 4JS5A 4R0KA 2LFSA 1P4RA 1H2KA 2DYBA 3QZ5B 2ILMA 2QA4A 1EZJA 4EKWA 1KHIA 2QDLA 2RK2A 5BR8O 2CUDA 5GAOn 1VF6A 3OM3B 4LF4B 4Q5WA 4F7UB 2C0IA 1QP3A 2MAMA 2IH3C 3BW1A 3M4GA 4B9WA 1RSOA 2X6BA 2EIJC 2X6AA 2HCKA 1TA8A 2CT3A 3JALA 3CPWP 2WA3A 1WA8A 1THZA 4ORZA 3AK1A 1TGOA 1YJWT 3X25B 3EGDA 3CSXA 1OCCB 1HNXB 1GN4A 2ZE7A 4L87A 5CKEA 3CMAA 4JLIA 2PZSA 3QWXX 4WFHA 3ZHVA 2E3HA 2LC4A 2RD1A 3I55Q 1FFXB 1KYOF 2FB5A 4DR5B 1MGQA 5D6XA 3T2MA 1OEBA 1OPLA 1B06A 1TUBB 3SYQA 3CCUV 1C6VX 1WJRA 3CCQV 2JMAA 3CCJA 5LOVB 1T0HA 2K57A 2H3JA 3D3IA 1B07A 3LNNA 4MW3A 4FLVA 5L3CA 4KT0E 2A0LA 4F4LA 2NLJC 1WPYA 3B77A 5B1AB 4H0LB 3CMEQ 1QVFA 1ZLZA 4X62B 5JCOA 2LT1A 1SESA 4TWKA 1NH2D 5GAN6 5FRNA 4RAIA 4X1KA 1VQOT 1RLPC 4JAUA 2B86A 5LJ5d 1SHGA 2FKXA 1AR4A 1OYXA 4HKEA 3ZL7C 1LNQA 1IZ3A 4LWSA 4JGSA 2EVRA 2JTMA 2FVUA 5GANd 1WXUA 3K5MA 1M4UA 3T1CA 1OCZB 5J2TB 2E41A 1GTOA 1RM1C 4MDXA 1VQ8V 3JCMe 2YIBD 4C8QF 5I21A 3BY6A 1FX7A 5GAMd 2L6LA 2P7TC 4PDMA 3J81N 2MIOA 4M75C 2ZR2A 3I55T 3D36C 1PG5B 2XAJA 3HKBA 4MS2A 3CPWS 2DERA 1CXZB 2LFRA 2OCHA 3PVLA 1OHHG 3PIPA 1VQ7Q 4GLXA 1BI1A 4GY5A 4RTYA 4XQ3A 1YJ9V 2V1QA 3P8DA 2OJ2A 4JPBW 2CTRA 4RCBA 3MEVA 2F5KA 3RUXA 4DR1B 1PNMA 5IHKA 4EMHA 1NTMH 1PL4A 1Q95G 3BEHA 3JAKA 4DV5O 2JIZG 4YJ3B 1R3IC 4GBQA 1KD1C 3PJSK 3ZHRA 3E83A 5CA3A 1VQMT 3GF5A 2YHTA 1YI2T 4PJOG 4DV6O 2OTLA 1YJNQ 3CC2A 3JCZA 3FD9A 5D5PA 1UJYA 4NXMB 4DBFA 4J7JA 2GTSA 1SQPH 2A7WA 4JI4B 4EIKA 4DBQA 1OU8A 2L89A 1M1KR 3RVYA 3M56A 5IAYA 5GAOm 4PJNA 3C90A 4JJCA 3CD6T 3SJCC 2P22C 1QMCA 1GFDA 1QVGS 1BIBA 1PRMC 1S5LZ 1OOTA 1FFTB 1N0NA 1IGQA 1TTHB 1K0SA 3JARA 1XUQA 3A5ZB 3WG7C 1XQHA 3C0CA 1B3QA 4L8JA 2DEUA 3M53A 4BI8B 2OTLQ 1FYNA 1PRLC 1YHQT 4JPRA 1FXHA 2WLMA 1N5ZA 2F2XA 3CC2Q 2CTPA 1OU9A 2GV9A 2UUBB 2QDYB 4X89A 4GT1A 2LJ1A 3EFFK 4KRTA 1PD1A 4XAXB 4J11A 5DLOA 4RG8A 3I5SA 5CN0A 1BIAA 3K57A 1SG5A 3UM7A 1D1BA 4AFSC 1DTOA 1O9HA 2JGDA 2GFAA 3L9DA 4JV5B 2VQEB 3QHSA 1WP8A 2ZINA 3MKDA 3UA6A 4PJOD 5GAMf 2M7WA 1BBZA 2CP0A 4M7AD 1R0BG 1E7OA 2JVDA 1I0CA 1WZOA 5CK9A 3C3TA 2DZCA 2F2WA 2DL5A 1AP6A 2IW5A 5GAN5 2ZIOA 1JQ0A 4DV3B 2EULA 3NXSA 2NR5A 2RK1A 4BD3A 3CXCU 1FJGB 3G67A 2Y69B 3VQWA 2DZ9A 1WPBA 1M2OA 1OJHA 1QVPA 1ZQ1A 1WAZA 3APOA 4HAMA 4IIOA 3G4ST 1NEGA 1AI6A 1J95A 3SPHA 3AHUA 1JJ2S 2ESWA 3C94A 4A4HA 4JI7O 3UF4A 2Q7EA 1X27A 2KMTA 2RCVA 3E89A 3X20B 4QPJA 1ZL8A 2O57A 4NL3A 1IXMA 1XNIA 4HVUA 1UGRB 4R8CA 1K8AU 1IREB 2QKAA 3TCJA 3H9VA 2JJ9A 4KFMA 3JAWA 2LVMA 5I11A 3LWHA 4FFBB 2RI2A 1YHQA 2F1MA 3KG2A 3ZRWB 4GZRB 1U97A 3G6EV 5FRMA 4AMCA 2ZNJA 3N2GB 5LHIA 2Q69A 4UCOA 1HYOA 1M9NA 3FB7C 1IO6A 5KX5B 2ROTA 2PZ1A 2FZKB 4I4TB 3ZRSA 1MMGA 4FSSA 2KNBB 4E2FB 2QWQB 1VUBA 3RKWA 1VQ8T 4KULA 2KVQG 1JO8A 3ER0A 1DK1A 2OTJT 1YEWA 1VYVA 2LMJA 2PQWA 5LJ3g 2WLHA 4I0XA 1H8EG 3AG4C 3OD4A 4J9HA 1UB4A 1H2MA 3SYOA 3BFMA 3V7SA 2L3PA 1V55C 1WHLA 2QASA 4HVVA 3MEAA 2QM7A 1ZBXA 1UPGA 2XG8D 3GBQA 1YNZA 3ZBHA 1KQSP 2RJEA 4Z02A 5BY1A 5LP6C 4IURA 1KECA 4D7SA 3THOA 1PSFA 4QT7A 1QKWA 4M7AG 4LH6A 2NUTB 1S5HC 2X9HA 4B3MO 3I56T 2HQEA 4LDXA 1OCZC 3MCAB 1IXBA 1MNEA 2RQ6A 3OS0A 5LHHA 2QGNA 2CGHA 4ESRA 1M57C 2UUAB 4LNPA 2W0XA 4F16A 1VQ9A 1V54C 1OZ0A 4DRXA 1ZA1B 3CXCS 3PVQA 4FYXB 3H1KH 1WB8A 1TG0A 3H41A 4M75D 5EBWC 2R9IA 2QYZA 1M2VA 4BE0A 3P32A 5KMGA 3E2EA 1WJSA 2QQAA 4XU2A 2BTQB 4DOWA 2EILC 3E8HA 2LCSA 4J7IA 3ABLC 1VYTA 4JJNK 2ROLA 3LSQA 1FD9A 1UGSB 5KCHA 1VQPA 3MDSA 4XDKA 1KC8C 1M4ZA 5GMKm 1TS9A 1WHHA 1K5QA 1PCXA 4XTYA 1TVKB 3LLRA 1LUWA 1F51A 5CA0B 1W1FA 3AK2A 2JS2A 2P4RA 2AXTZ 2HD0A 2P84A 2YUAA 2ZPEB 2CYZB 3OW2U 1YFNA 1VQ6Q 4MTXA 3I55A 4LF6O 4HZ3A 4C0GA 4DR6O 1VQLT 1BS3A 1MMAA 1VIFA 3CHXA 4DW1A 2WACA 3A8GB 4WCIA 3ZEHA 3BABA 4TOIA 4ZKIA 2WSSG 3MP8A 3ZHTA 5KYNA 1IB8A 2LP7A 3JCUZ 4XTXA 4JASA 4QVCA 2VQEO 1XMOO 1CP9A 3H1JH 2J6OA 3OYNA 3CCLQ 5GAOl 1EN5A 3PIOA 1FXKC 5GANg 2PGGA 3FRNA 3KCYA 4AQYO 3K03A 2QAZA 2UU9O 2N74A 2LQNA 1JOYA 1VQ6A 3HPLC 2P0KA 2CE4A 2GTAA 2F95B 2HVKC 3CD6V 4C92F 3M59A 3ULRB 4F14A 1NG2A 1KD1U 3VUBA 2ZIMA 1D0ZA 2GF7A 5KYXA 1VQ9T 2DJVA 4A63B 5BMVB 3MAQA 5FROA 4MDWA 1R6TA 2JS3A 5JQGA 4MVUA 5KAIZ 5H9CA 1I94B 1LVKA 2XMFA 3PNWC 3K04A 4PK4A 2HSPA 2IIMA 2VS0A 3EG3A 5A2QE 1SS3A 3BY7A 3CCLA 4U3JB 4PDVA 2EIFA 1XMOB 1JB0E 2YSUB 3CC7Q 5GANf 1VEWA 4GX2A 4YJ2B 1P7GA 5EIBC 1VQ7A 4TSFG 4HNAA 4R50A 5IYZA 2DE0X 1OZ3A 3JD0A 1VQ7V 4OVAA 4FLYA 2KSSA 3RR6A 3E8FA 2FPEA 2YXHA 4HT8A 1YJ9T 2P90A 4DV2B 1EN6A 2XASA 1Y07A 2WLIA 1ZSPA 2E3IA 3OYJA 4IKFA 3A8OB 4CC6A 3J80E 1AVZC 5C8YA 1M56C 3L2ZA 4JDSA 3OR7C 2ZR3A 4RG2A 4RUEA 4FM0A 2WPDG 1WJQA 1SQBH 4CS4A 3E35A 1H8KA 4M77A 1AZEA 3NMZC 2QI2A 1SSHA 5HK0A 5EYPA 4LFCB 1ZX3A 1JRIA 3P8HA 2JUFA 1YIJV 5D5QA 3QDFA 3CC7A 1IXDA 4JI1O 4YTLA 4J83A 1H92A 1SQGA 4ZBMA 2HKQB 3KFVA 5L23A 3LUTB 1BYMA 3TCUA 1VOMA 2QKCA 3OMNB 1S77D 3OB9A 3OBYA 2HL3A 3OTFA 3V8LA 3IC7A 1N36O 4OMQA 1JXOA 4X1IB 1WXBA 2DBMA 4A53A 3W7WA 2EIMB 1AP5A 1XMQO 4GLMA 1M1KC 2HHHO 3CCVQ 2EQMA 1QNMA 1M3CA 1AI4A 3E19A 3DTUB 1QKXA 1U3OA 5I2MA 1NM7A 2YICA 4BI3A 3LSSA 1LR1A 1NVPB 3JCMc 1K9MC 3DC6A 1ROPA 1AOJA 1BB9A 3VUZA 4I9QA 5EG2A 5EBMC 2KT1A 4DR3O 5IWAO 2VGNA 1R1BA 3PN1A 1U5SA 4M75F 2DKGA 2VVKA 1L8DA 2KQXA 4NL2A 2F2VA 4R56A 4JZ2A 4EEQA 1K0XA 3AG3C 1JU5C 1ZHIA 3MD0A 5LXTB 4JV5O 2QGFB 4KUMA 3OUSA 3A8LB 4Z88A 2MF2A 2LO1A 4Z1MG 4DR2B 2ODMA 4R6ZA 4DXWA 1WLEA 2R70A 2DYRC 3HTRA 4RO2A 2M1HA 4IIJA 4OPHA 1KQ1A 2GFUA 2V1RA 4LD6A 2MYSA 2D6FA 2E5QA 5CB4A 3OGIB 4M75G 5GW7A 5IDJA 2JN0A 4QIWF 1QCNA 1M5Q1 3OGCC 4FCYA 1RADB 3MEUA 3QG1A 5IXBA 1XEQA 1Y96A 3VQVA 3RKXA 4MTFA 1B34A 2EZOA 2M6YA 3RYHA 1Q81U 1WIEA 5CVIA 1VQNV 4B3SB 2E5KA 2ITDC 3E2UA 3CCRA 1VMGA 1M8MA 3UO3A 4BIOA 3OE7G 4C92G 2IU0A 2LQTA 3D3QA 1WHKA 3A0HZ 2D1XA 1HR0B 3CCUT 2JGUA 3ICXA 5IJ0B 1UFIA 3CRMA 1RP3B 3CXHF 4P2ZA 1UJWB 3ABKC 3EH2A 3T4ZA 2DRKA 5GONA 2BOCC 2VRZA 1YJWV 3CRAA 4O4JB 4VUBA 3JB9J 1Q86R 1J3TA 5GMKi 4LF5B 3QJYA 1NBEB 2OCCC 4QJFB 1KQSU 4DUYB 1IHVA 4QVDA 4FYYB 4EMKC 1N8RU 3L2VA 2LT4A 2VYTA 3X2QB 4LXCA 3JATA 1W2BA 5EBLC 2EYQA 3CYOA 3ML0A 4Z2WA 2BTOA 2RQWA 1YBYA 3S6WA 2GBOA 4Q6GA 1S5JA 2PTKA 3SJQC 1A0NB 2X35A 3QNEA 5IE9A 3ZHSA 1BCMA 3SYAA 1WJZA 1QHTA 5A2QN 4M78D 1NS1A 2YRDA 3A8MB 3K9SA 1KD1R 4NTXA 1X2KA 2VGMA 1SQVH 4ANJA 5GAOq 4J7ZA 3CC4V 4R7CA 3RYFB 2CZ1B 2HQHA 3DXRB 2I2LA 1LOJA 1Y66A 5EC2C 1SKVA 2YIDA 3R65A 3TGUH 1NPPA 2E70A 5LMNB 4JYYA 1Y0MA 2X7RB 1E6GA 1G3WA 4C8QE 4DV7O 2P4KA 5K1XA 4KH0B 1ZSZB 2GQVA 3M0UA 3JARB 2LJ3A 4B6MA 3RNJA 3F5TA 1JFFB 3CD6Q 2OT5A 4ZI7B 2CZ6B 1D3BA 5BR8B 2ZE6A 4FL6A 1XHZA 1JR9A 5FNVA 5B5EZ 4X66B 1M5IA 4UCRA 1MHNA 5LJ3j 1YWPA 5GANh 2QTOA 2FTKA 4HA8A 4LF6B 3VYHB 1GK9A 3LGLA 5KE3A 1XREA 3N5BB 4PI0A 3EGXB 4OB0B 4LDUA 2ADPA 4N4GA 1N33B 1XTDA 3UATA 1Q82U 4JZGA 1TSFA 2CZ0B 1PWTA 3W7TA 4U3FH 3EFRA 4CC3A 4B3RB 5L3BA 4HXJA 3ZX6A 2FYKA 2GNCA 1K7DA 2L0AA 1K8AC 2MK5A 3CD6A 2EFIA 3Q4HA 3TSZA 4AFQC 5C0MA 4HCBA 2QQSA 1JJ2P 3A8TA 1PV0A 2NNUA 2XKOC 1QVGP 2O4XA 2COZA 2W0FC 2K1EA 3FAVA 4OGQB 4PDLA 4J9CA 1Z5WA 4M77D 3AEIA 4JZ3A 4PJOF 1WA7A 1YITV 1S72V 1EM1A 4FLUA 2J06A 3DGEA 3VYGA 2E74B 3L75H 4HCZA 2A0FB 1JJ2U 2LNVA 4WFAV 4BACA 2VB6A 4JI0B 1AZGB 4I9WA 3BFRA 2R5MA 2SRCA 3M0SA 4GKKB 2YC0A 3NPFA 4A4FA 1LCKA 2JVVA 3LWIA 4DQ2A 5FU7B 4C0DC 4DR6B 1D0YA 2QK0A 2WSEE 5B1AC 2YEVA 2Q8VA 4DOVA 5LYJB 3CC2V 4JTAB 4HBNA 3EFSA 3VS1A 4C5IA 3LNMB 5GTIZ 3CJHB 2FEIA 1VQMQ 4DBHA 4XU3A 3JYCA 2HNIA 2IBZH 2JNGA 3V7RA 1PKXA 5LGTA 3FFQA 2K5IA 4F6EA 1OCCC 4QKUA 3TU4K 2DFUA 4DR4O 4LH7A 1KQSA 3HKDA 1Y6XA 3JD1A 3QTCA 1D0XA 2E6NA 2R72A 1FXKB 5JH7A 3CBMA 5FLXN 1YI2A 1K76A 1W59A 2HHHB 1Q90D 1G6UA 4JAAA 4N23A 1KKCA 1OCRC 2EIJB 1M93A 4G2KA 4PA4A 1J5EB 4PJLA 5H6RA 4J6XA 5HCKA 2F93B 2P0PA 1BKBA 4MVQA 5GAN3 4OMNA 2CTQA 2XNDG 4EMKB 3REAB 3GIBA 5LOVA 4YIPA 4AG2C 4RTVA 9ATCB 4O5VA 1WYXA 4O6JA 2RN8A 2HG5C 2QM4A 4G28B 4B3TB 1WB7A 3L74H 1Q86W 5IH2A 4PFOA 3HRUA 1KIKA 1OV9A 4XDLA 2FPDA 2YUNA 4JLGA 3JD4A 4M78G 4DR5O 2K9GA 5CQXA 1YI2Q 3G1JA 1RL2A 3MP1A 1H2LA 1XOVA 2CT4A 2DQ3A 4F6RA 2ETNA 2BZYA 2E6ZA 3ETGA 2R5AA 4AFUC 4JI2B 4M7DG 4MTGA 3CCRV 2EJ7A 4J9IA 1RAAB 3OY9A 3CWBH 5FPRA 3D36A 4IUUA 1M30A 3JCMg 5B1OA 2YWWA 4TV9B 3ZCCA 3BE3A 4X65O 3O5ZA 1KB9F 1D5AA 1B7TA 4B3RO 3REBB 4DK0A 4M78F 1K4US 4LR3A 4M7DB 3FYIB 3VQYA 3RMSA 2ZAEA 3CE2A 4J9BA 4LDYA 2X4YA 5CA1B 1YHQQ 1FMKA 1AJQA 4O2AB 1IBKO 4ELZC 4WFFA 3VQXA 4LF9B 1WQ7A 2Q67A 2RN9A 4DRXB 3L70H 3CPWU 1QWEA 2FRYA 3EG9A 3GLXA 4PLIA 3AK3A 3OTOO 4JI5O 1PNJA 2W10A 2BUDA 1YN8A 2A3QA 4DV1B 2XOKG 1I5XA 3CS5A 3ETDA 5JCOC 1IVSA 1M2VB 4J9ZB 3RYIB 5E1AC 4FVMA 3OYHA 2AHYA 4MZMA 1NJIC 1SQQH 4DYLA 4RMOA 1OI1A 3WG7B 4BI4A 2KR3A 3CCRT 1OX8A 1L1FA 3WVDB 3J7AU 4MVMA 1RACB 3SFMA 4JRQA 4FM4B 3CCQT 2KKWA 1VQKV 3HFOA 2GSMB 1K4DC 2K2VA 3UA7A 1SC5B 5B1BC 4DV5B 2JZ2A 2M0OA 4UVBA 4RTWA 3ETEA 1G8MA 4JYAO 1UDLA 4MT8A 2ZGWA 2AZ2A 1XI1A 2ITCC 2PYLA 1KP3A 3PMTA 1N33O 2L3SA 4FYWB 2HBPA 1P49A 2ECZA 3H1LH 2IG0A 4FIBA 2AKKA 2M51A 1UHCA 2SEMA 1WN7A 2KB1A 4J6WA 4C8QA 2XHCA 5GANe 3EFOB 1BHBA 4ZHQA 5B3SB 3OFNG 4PFPA 3SHWA 5B1BB 4LNUB 2O9VA 3G71T 4X88A 2GBQA 1QVFU 5L3EA 3CCMT 4I5SA 3JASA 2EYXA 2JEUA 5EZYA 4UCSA 2EX3A 2WAMA 4FT2A 2CH4W 2K5FA 4I50A 3WB2A 2DXUA 1T5EA 4BE1A 3CCRQ 4K11A 4EB6A 1ZUQA 2GTOA 4M75B 5CCAA 2CKKA 3LX7A 1JQQA 1ZTEA 4J5YA 3CCJT 3CC4A 1YXBA 1Q7YC 1WPXA 2KG7B 1LJOA 1M1FA 4C5EA 1AWXA 3VOUA 5LJ3f 4K3AA 1HNXO 1SSFA 1K1ZA 3P8BB 4IYIA 4C0ZA 4FK5C 2UXNA 4WFBV 2MWOA 4ATOA 5GAMh 2DOSA 3IQLA 2YS8A 1Q7YW 1WDXA 4M7DC 4YY3O 2DQ0A 3RYCB 1BK2A 1PM9A 4PNOA 2XUMA 2X4XA 4M77C 1HXDA 1ORQC 2EYYA 1XJWB 2ZNIA 3CRQA 4AT1B 2P5OA 1F4NA 3DSQA 2BTTA 3META 2BE3A 1YITT 1S72T 1S1NA 1X6GA 3N2KA 2E10A 5J39A 5LJ5h 3T1YO 1TUDA 2JS0A 1Q6UA 2HLDG 3OYAA 2DBKA 3FEOA 2P0QA 4JI3O 3ZHQA 1TH7A 4JI5B 3OTOB 2D3OW 2MOXA 1QVFS 1FAFA 1GH6A 1K34A 1N0JA 2YIBA 1GCQC 2GUZA 3FB6C 3FKSG 4F04B 1XL6A 4IHJB 3CMAQ 2DXCA 5GAN8 1VQMV 1RPOA 3GB7C 1M57B 3C3SA 2RM4A 4LUDA 2LJ0A 1VQ9V 3EG2A 2M16A 1WP7A 1M8VA 3TEEA 4XTZA 3JB9I 1AEYA 5LBQA 1XL4A 2PI4A 2P4VA 5L3DA 5JWPA 3FB8C 2ADQB 3AG3B 1TUBA 3OS5A 5CQYA 4WTOB 1SPKA 2KROA 4M7DF 3CMEA 1PHTA 1N34B 1KMIZ 2MW2B 4JI0O 5C93A 1KFZA 3U23A 2FZGB 3QXEB 3M57A 1KC8U 3T1HO 2ZKOA 4X66O 1YCYA 2Y4YA 3OW2S 1PM3A 1V55B 3CPWA 1BSMA 1GRIA 5H2FZ 1FS0G 1XNQO 1X01A 3QIIA 4D6WA 2A9HA 2Q68A 3AG7A 2CK3G 3L1AA 5CAIA 5KYWB 4X34A 2ARHA 1RAHB 3RBBB 3HHTB 1LPLA 2WLLA 4MW8A 2BZ8A 4A54A 3GVMA 2RHYA 1EZZB 1VF6C 1G4YB 4BW9A 2CH7A 2H8HA 2KRNA 4TUYB 2MK3A 3OBWA 3ABTA 1MSWD 1H3ZA 5L3FA 5LA6A 4OXSA 2EJFA 4M7DD 2K5LA 1ZBJA 4O4IB 4ZNXA 5IHIA 4FFKA 4BDZA 2UXCB 4DV1O 3P3NA 2XICA 1VQ5T 3KZIZ 3F70A 4J8OA 4MMKA 3SWNA 1NU1H 1K73W 1Q8IA 2VUBA 3ZEDA 3OYKA 2BOBC 5EK0A 3KBGA 3OMGA 1QVGA 4LFAO 2RB6A 3HKSA 4J9DA 2NWMA 1OCOC 3CCLT 3IJ4A 2VV5A 4JI6B 3X26B 1H2NA 4OMMA 3OYFA 5FW9A 3F5WC 3SWNC 3UO2A 2LRQA 1YJNA 4MTOA 2CREA 4UXNA 1Q86C 2BE7D 1AR1B 2UXBO 2AZ0A 4YXWG 4DUZB 3WB0A 3UWNA 2RNBA 3JD2A 1M56B 1N36B 1E6HA 5KYYB 2JXBA 1SRYA 2QTSA 1YI2V 3FB9A 2CDTA 3VBBA 4C7UA 3ZMSA 1EN4A 2NUPB 1OCOB 3O65A 5IJ0A 4M75E 2EJ9A 1VQKA 2Y4UA 4LCUC 5B3SC 2L3RA 2DPPB 1IBLB 3PFSA 3HKCA 2IH1C 3APQA 3H8ZA 3HFNA 4C5HA 2DN9A 1HNWO 2RQUA 4RTXA 1L0NH 1P7BA 2BKDN 2CSQA 1C1AA 4ZOLA 3L2UA 5JJEB 2Y0IA 1AI7A 4HCKA 3HB3B 4MSWC 5IJ9B 4QQGA 5KHJA 3QG5A 4FLTA 1WX6A 3QKJA 1M9SA 3GNGA 1MOFA 3RIRA 3OS2A 3M0TA 4O4LB 5GTHZ 3UT5A 4JI7B 2WWWA 3B4SA 2YDLA 1VQKQ 1XHXA 2OTJV 4X20B 4UC4A 4KGVB 3G6EQ 3R66A 3EVKA 3E22B 5IY5C 4ABMA 4C8QG 1MABG 2XAGA 3VS3A 2M9UA 2ZE8A 2QWRB 1C0MA 1NR7A 4BIUA 3W7UA 2ZZDA 4NVPA 3DC5A 4TT3G 2V8IA 2X3WD 3OYIA 1G5VA 3D8CA 3OR6C 4GYCB 4W4KA 4FM2A 1BQ0A 1Y57A 1XMQB 3QO7A 1YJWQ 3OAAG 2AK5A 4O4HB 5GMKh 5DLQE 2K4YA 3CPFA 2KQWA 2WLNA 3W7XA 5LMUO 4CC5A 5IYDO 3KKYA 5FNVB 4X65B 1I94O 3HKEA 1K9MR 5KHHA 3I9QA 1Q3EA 2KY9A 3LW5E 3JAMN 1NKDA 1K8AW 3H6ZA 4J9GA 4HNAB 1IRXA 3EGXA 1Q82W 3INZA 2PTMA 3ZFJA 1M90C 1FKAO 4JI8O 1GM8A 5KA5A 3CMET 4MZPA 4DEYA 4OX9B 2KYMA 2VC8A 2DMXA 1I5OB 4A4KA 3QF7A 2PUOB 1YIJT 3CB2A 2Q0AA 1KHCA 3CCEA 1AJNA 2FG0A 4J9YB 1QQJA 2R58A 3NTIA 4DR2O 1NTZH 4LF8O 4H37A 4HYOA 1Z9ZA 4QW2A 4N4IA 3CXCP 3Q4HB 1PNLA 1QLEB 3PT9A 4F7UA 5EYPB 5FL7G 4M4ZA 2DETA 4KL1A 2FHDA 2CP6A 5AYFA 3LSUA 2D8JA 2K3XA 5KLVH 2V26A 5FLXE 4O2BB 1JX9A 1I8FA 5LGNA 1M3AA 3M5AA 4WF2A 1Q81C 1QBZA 4JTCB 4OX9O 1WHGA 2E5LO 2RI3A 4M77E 1Q43A 3CC2T 2LGQA 4LFBO 2NUZA 1QR9A 1SA0A 2A37A 1HNWB 1YVWA 1GL5A 3M4YA 4LN2A 4F7UG 3KXTA 1R6NA 2YRCA 2DWDC 1F4MA 2WLJA 5TISZ 1MMNA 3CXCA 1GMGA 2KAFA 3QPHA 4FJCC 3HL8A 1VQ8A 2DTHA 1SZXA 1MUZA 4UB8Z 2EW3A 1NEBA 2RHUA 3ZMZA 3AG4B 2UXDB 1I4K1 3R6OA 4BY6B 1QLNA 1N8RW 1G3TA 3ZMVA 4EFBA 3JSNA 3H01A 4IT5A 3SGIA 1VF7A 4CZZA 2YUPA 4J9FA 2Z0AA 3ABLB 2RMOA 1SHFA 3DLLA 3U0ZA 4RCCA 1QR8A 5JJJB 5GMKj 3JCMb 3VS6A 2JK5C 2RJZA 4EMKA 4JZ4A 1UJ0A 2HL5C 4DR3B 2R9AA 4B7EA 1PKSA 3ZN0A 3E86A 2HZYA 5IHNA 2Z3YA 1VQOQ 4J7KA 1ZA2B 2D8HA 3TXQA 3E9FA 2ATKC 4E2LA 4PI2A 5CB4B 1KG1A 1Y67A 5GAOp 2KXDA 5KHGA 5CBHA 3EHQA 3VS5A 2Q4PA 3OYDA 2EQJA 2LNHB 4CC4B 1VQ6V 3MPUB 1YJNV 2Q7GA 3BRCA 4M77G 5KH6A 2Q73A 3GOXA 5CBFA 2GTJA 1VP7A 2FO0A 2NLUA 2EQIA 2JJ1G 5KMGB 1G83A 2IVWA 1NJIU 1VQMA 2OCCB 1NE8A 3DLMA 2B1IA 3CCST 4TV9A 1MNGA 2ZD9A 4D7TA 3JV3A 4XK8E 4X1KB 2IPOB 3JB9H 1JMKC 2EGEA 2DVJA 1H38A 2DX1A 4E4EA 4RQEA 3PTAA 1VQ7T 1U06A 3STLC 4FLWA 4A5UB 2ZPFB 1KC8R 1HNZB 3EHBB 2F43G 4LWSB 1N6AA 4E7KA 2F23A 3EAEA 4NXNB 1RABB 2HQXA 4B3SO 2PUKB 1YJ9A 4M7AC 5J2TA 2YRVA 1V9PA 3M0PA 3EG9B 2QWOB 3J80N 1M27C 4PELA 1ZWIC 2GDSA 2HSEB 4DUZO 2H8PC 3O9OA 4CS2A 2QM8A 1U96A 2W6JG 2KDSA 1K9MW 4NR1A 4RTTA 1V29B 4X62O 3TK1A 3BA9A 3ASOC 4DV2O 1GFCA 3M8AA 3JSCA 1N34O 1H2SB 2LQWA 4JAVA 1Q82R 3VS0A 4F7UF 2WSFE 2IJIA 4UVCA 3QSUA 4QE9A 4GLKA 4KBMB 1O9GA 1YIJA 1XDCA 3U10A 3E9GA 4C92A 2HVJC 1KD1W 3OQ5A 1I81A 3G7ZA 3GP8A 3L42A 3CCSQ 4E7JA 3F7VC 2DF6A 1D09B 3OYBA 1K97A 4CC7A 1Q7YU 3K0GA 1PSEA 5KYXB 2DLPA 1BCCH 1KQ2A 1AI5A 2HJFC 2LGWA 1SZTA 2O9SA 2AKLA 2K6DA 3L2RA 5IYCO 2PNIA 4E7ZA 2J05A 1JFFA 3TVTA 2XIDA 4X1YA 2DD5A 3UKMA 1YSCA 1OV3A 3QO5A 2JDIG 3S3XA 2QSAA 2MCNA 5LMNO 3AG1C 2ZPBB 5IYZB 4DR1O 3FC3A 2RPNA 4DK1A 3QUIA 2KI7A 1N32O 1TUCA 5DECA 2IJJA 3CC7V 3OS1A 2WLIB 2KRMA 3X24B 2CTWA 3OYLA 2AW9A 2NYSA 2KSDA 3J81E 1GO3F 4ASUG 3G71V 2JOYA 2X4WA 4LF5O 4OB2B 3OSVA 3OYEA 5ITZB 3EGUA 4M75A 2JJ2G 3IGAC 4FM1A 1VIEA 4OGCA 3A0RA 4X9DA 5KYUB 1YP5A 5CKDA 2KG7A 5DN6G 3KUFA 5GAMe 4M77B 4B7KA 2LQKA 5DEDA 3FLGA 4GUNA 2J6FA 4WBNB 2FMLA 3SYCA 5JJNB 4NKGB 4M78A 3IC9A 2Z5UA 2QA4T 3M0QA 1N8RR 1MG1A 1I5YA 2OIGA 2QQ9A 3L2QA 3WXMB 1ZUUA 2YI8A 1FJGO 5L3GA 2COWA 2RA2A 2JMCA 2O31A 2YUQA 4PLLA 4UV8A 3T9NA 3CCVA 1W0KG 2D0NA 1UTIA 2OI3A 3VS4A 3BPZA 2RHXA 2DL3A 3SJAC 4X8AA 1QCOA 2QTXA 4XBFA 4J80A 1WNSA 4I4TA 4PL6A 1VQNA 1GM7A 3RN4A 1W6XA 2K7AA 2XD0A 1D2DA 1F7YA 1VQ5V 4P30A 4CS3A 2XAHA 2PI5A 2JM9A 3OYGA 3G4SA 3ZS8C 4ICGA 3OMIB 2OTLT 2G3RA 3JB9G 1BGYH 2Y0PA 2DVEA 5DM7R 3JCMh 3QO8A 3ZHUA 2J7IA 1BE3H 2KK4A 3FDRA 2RF0A 2JW4A 3DB4A 3SPCA 4N0AC 2HJDA 4BWAA 4IUVA 4RUFA 1UGVA 2N04A 4P5NA 1YJWA 2ABLA 2VKNA 3OA6A 3ZBDA 1JPXA 1K4CC 2DXTA 3EG0A 1KJWA 4BY6C 1VQ6T 4FFBA 5K1PA 3CP1A 3JALB 2LX9A 2QGGA 3OMCA 1FWZA 1WA8B 1MMMA 4H44B 1RUWA 3LH5A 1KC8W 4QNHB 4C92C 1M1GA 2XU8A 3EGDB 1X6BA 4B08A 3LGFA 2YIAA 1R3JC 2YDEA 1NTKH 2LW7A 3N2GA 4NTYA 4DEXA 4X64B 1P92A 3CCMQ 2YXLA 4JYCA 4J7FA 2AGAA 4ZN3A 4YIOA 1H8HG 2CDYA 2PVDB 1SRLA 1VF5B 4F6RB 4PJ0Z 2D9TA 4XTUA 2DAQA 2QEXT 2YT6A 2WLLB 3F7YC 3RYHB 2M0YA 3JCMJ 3CCJQ 3M9QA 3CCMV 2W0ZA 1BU1A 4I0XB 1PD0A 3CCQQ 4JI2O 4JJDA 4B3TO 1M90R 2CZ7B 3JD3A 3JCMX 3BVOA 2LW1A 5H5NA 4M7AA 2B8AA 2COYA 3RESA 4JTDB 2MWPA 2CUGA 1OPKA 3CCUA 1VYUA 2DK3A 2OIEA 3I5RA 3MJXA 2JM8A 4X9CA 3SPGA 3M99B 1BQZA 3JCMP 2DA9A 4PA9A 1TU0B 3OYYA 2QA4V 5CKBA 1R77A 3RKYA 4M7DA 1K9MU 4E47A 3ZMTA 3M0RA 1MA1A 1U1SA 4M7AE 2RNAA 4E7IA 3PGGA 4KGXB 4FZ1A 2QG9B 4Z89A 8ATCB 5J2UA 1K73U 4RWUA 5EC7A 5KHIA 2QEXV 1JBMA 2FL7A 3MHXA 4FMTA 2CSIA 3HKBB 1PKTA 4LFBB 3QDRB 1HD3A 3QWYA 4C92E 4JJBA 2MPXC 1GBRA 1IURA 3K9AA 1OX9A 2VWJA 5D6WA 3V7CA 1EZVH 2L2PA 2NUPA 3GNFB 1QWFA 1NH2B 4YJ3A 3NTKA 3I55V 4BDYA 2XHBA 2C06A 1Y7XA 1EX4A 2Q9LA 3FIFA 2IJHA 2PUSA 1JVMA 2OAUA 1AT1B 2FYUH 3G80A 3SYPA 1VQPT 4I55B 1MZFA 2QJ1A 1CEZA 2WSCE 1XOUA 1TVKA 3CMEV 4U3JA 4GKKO 2QE7G 5CA0A 4IYHA 2HEQA 2Q5ZA 4IUQA 1PP9H 1KKDA 1R73A 4N0AA 4O4LA 1UGPB 2F5TX 4JS4A 1IGUA 1WI7A 4ZHQB 4JYAB 1YDXA 3SDLA 2ZDIC 1FMVA 3K0DA 5JVDB 1Y74A 4DV4O 1I5LA 1FMWA 4DO2A 1IDSA 5CBGA 2ENMA 1ARKA 3D7SB 4GX5A 5DM6V 3I56V 1ABQA 2RHIA 3BDUA 5KCOA 3UPUA 1VQKT 3JB9F 2JRIA 1K33A 4Y28E 5C8YB 1UUEA 1SF9A 3SB2A 2EILB 3K58A 1SETA 2MI6A 4WF9V 3CC7T 1I7FA 2BIVA 4OMLA 5CKFA 2HEPA 4JI6O 4LDWA 5CO7A 3A8HB 3G71Q 4K8XA 1LNXA 1O75A 3TQ7P 2JGDB 1T3SA 4L6V5 5FU6B 1YJ9Q 3HKEB 3M58A 3J7AF 1HK9A 5IWAB 4JRKA 1NZ9A 1RI9A 3EHRA 3PMIA 4RKUE 3QO3A 3CCVV 1Q7YR 2DIGA 2N05A 1Q81W 5E79Z 4DV0B 4PJOB 3HR0A 2HMAA 3BCCH 1DJ7B 3RW0A 3DKMA 2UUCO 2DYSC 2LJ2A 1URFA 1UFFA 2HBWA 3AG2B 1RM1B 2DYRB 2H3OA 4L5GA 4PJMA 5LP6B 1DLBA 4J42A 5HK3A 3MEWA 3I56Q 2H3EB 3QZ9B 4KH1B 1VQ5A 2BSKA 3L2WA 3K08A 3ZRXA 4NOYA 1Z9QA 5HFMA 5EC1C 4YHHB 3G71A 3SPIA 4P9PA 1NI8A 1YTFB 1HWYA 3B2EE 1N32B 3OEEG 2EJGA 4KGZB 4PFZA 4QVZA 3L71H 4UCTA 4TV8B 2WLKA 2GUZB 4LFCO 3HPWA 2W6IG 4LF4O 1JEGA 4IHJA 1KK7A 3BHPA 4GKJB 4AHCA 2Y48A 3HKDB 1IZ6A 1Y76A 4GCZA 1WFWA 1K92A 3GWOA 5JH7B 4NTWA 1YF2A 1QP2A 4X1VA 2DL4A 1M90W 2EIKC 1Q82C 2B5UA 3K5LA 5J3BA 1RSOB 4HCCA 2OX7A 5LXTA 1OULA 3UDCA 2VASA 4FSXA 4ZTJA 1ZSZC 5KAFZ 4LF9O 3JSLA 3KCXA 2L5QA 2GCXA 4OP0A 3K5NA 5LJ5f 3OYMA 2AZVA 1COWG 4E7SA 4JRIA 1VQNT 1JJ2A 2RO0A 1TXQA 2EYZA 2KXCA 2PY5A 2QWNB 2GGRA 2EJRA 2G6FX 4QQ6A 2O2OA 2QWPB 4DV6B 4JF3A 4N21A 2Z0WA 2NN4A 3EG1A 5KYWA 3NFCA 2QQRA 1X43A 4ZGEB 1VQ4Q 1QW1A 2DILA 1KP2A 2RH2A 4ZIBA 3CCEQ 1X2QA 4MVRA 4K35A 2QQBA 1QQCA 1MZEA 4KP4A 2UU9B 1ENVA 1GKFA 2DL8A 3LH0A 4DA4A 4WFEA 3T1YB 4C0FA 1GBQA 2AHJB 4TQFA 1VQ4V 4OB3B 1GRJA 1WNLA 3E1SA 1IBLO 4C8QD 4UCVA 3ASOB 1K73R 5CA1A 1IBMO 2E4HA 4O2AA 3CEYA 1HJDA 1GAXA 2EYWA 2K2MA 4J6YA 2P6JA 3OW2P 1L0LH 3ABMC 1W2BU 2MMPA 3LYIA 4E6RA 2DRMA 2DTIA 1G3SA 2VQFO 2ZPGB 4KUIA 4UFZA 3VU3C 4IIJB 1YHQV 4BUGA 1X75C 5LHGA 3K06A 3V8JA 5A0LA 2V8KA 3CRRA 3CMAV 4DV0O 3RYIA 1VQLA 1X59A 3JATB 5FPOA 2YSQA 4M78C 5D6YA 1CKBA 1CPYA 1WHJA 2A08A 2QR4A 1GXIE 5GMKe 1DGSA 1NLOC 4LFAB 1BMFG 1R3LC 2XTAA 1D1CA 2AZSA 4OF1A 3RT3C 2DW4A 2FPFA 3JAKB 3RMQA 2DTOA 1IBMB 3IFXA 2IU3A 2RQVA 1GCPA 1Q6HA 4DV4B 4UVAA 4ZN1A 1SRMA 1G8XA 2HKNA 4LF8B 5IJ9A 5GONB 2ZDIA 4FU6A 4B9XA 3CX5F 4L59A 3VV0A 4JRPA 1ZX6A 2CP7A 1S76D 1NPRA 3NHNA 1Q81R 3VS7A 1KUQA 1I1JA 1PC0A 3VKIA 2Y90A 4IUPA 1JXMA 2F69A 1AILA 4XTVA 5LJ5e 5CR2A 5CMUA 2CS7A 3JASB 1NBMG 3T4DA 1T3LA 2KRSA 5J26A 1UECA 6AT1B 4QGPA 4LF7O 1AHJB 3CCJV 3ME9A 4PJJA 2E65A 3CCQA 4PJOE 4FPPA 5KHKA 4PA7A 2PYJA 1TOVA 1JA8A 2ZM6B 2JTFA 2ED0A 3VJPA 4R55A 4QPKA 2X3XD 2GQIA 1CKAA 1H2GA 4F7UE 3RYFA 1QCFA 1QVGU 4MMLA 1AR5A 1M1KU 4PHZA 4XTWA 2O88A 4H13B 1NLPC 2P67A 4D8DA 1XNRB 5JQGB 5IYBO 2ZPIB 5IXFA 4DV3O 2RQTA 4DBRA 2A06H 4E7HA 1K8AR 1R8OB 5GAN4 3A1PA 3WFVA 2DJQA 3BA8A 1D3BB 2RI5A 1F23A 5CIUA 2PF4E 4KHPO 4XDJA 2Q0OC 1W4SA 1AROP 4GKJO 3BAAA 2CUBA 1YTFD 4NB5A 4YJ2A 5F2VO 2F1LA 2OAWA 2DYSB 3OEHG 1FXVA 1R3KC 1XBLA 5ITZA 3MHHC 1YCIA 2WA4A 4NXNO 2RJCA 5KUKA 4OPAA 4ME7A 4FW2A 4EMGA 5KYUA 1VIBA 3OW2A 4Z1VA 1EFNA 4NS5A 3C12A 3ZIAG 4II1A 1S3JA 4PKCC 1RAEB 5FU6C 3WB1A 4EPCA 1E1QG 3FJ5A 5ECAA 5A9GA 1ZL8B 4LBEC 2UXDO 5L8RE 1UEBA 2E64A 4B3MB 2FL4A 4IGGA 1AWJA 4UV9A 4AILC 4HVWA 4E7LA 3H1IH 1BCOA 2O4XB 3TETA 2EGAA 2IJKA 4IIMA 3VRZA 2CP3A 3H1HH 3G6BA 4J10A 2M02A 4LE9A 1UGQB 3NGPA 2OTJQ 3CCUQ 5FWCA 5LGUA 5FWBA 1W0JG 2LX7A 3RBZA 3ZRWA 4G27B 4Q20A 1G3YA 2ZXWC 1IX9A 3CEIA 2ZCEA 4OB1B 1J5EO 2CH4A 3EXAA 1Y71A 1WQWA 1FFXA 2X51A 4DUYO 2XAQA 1RAFB 1YWOA 3X28B 1NT2B 3THKA 2KEAA 3VRYA 3SD4A 4A4GA 4DR7O 2AHZA 2YEVB 1SKUB 2XDPA 2YLBA 5GAOr 5LYJA 5AT1B 2P4TA 3RGBA 4X9QA 1NQTA 4JI8B 3WU2Z 2EINC 2EINB 1OCRB 2CH7B 4M78E 3C95A 3HSBA 4FT4A 1BHAA 4U7OA 1S0VA 5LJ3e 2O01E 1TUGB 3A0BZ 2VQFB 4O4IA 3HRTA 1N9RA 1Z2GA 4RTUA 1HNZO 1N8RC 2C0OA 2ZXWB 4ZTFA 2EZPA 2EKHA 2JT4A 4UB6Z 4DV7B 2P06A 2DEQA 3RVZA 2DIQA 4RQFA 5LJ3d 4U7NA 1QLEC 3CCEV 3TSWA 2Q7HA 2B1GA 2KE9A 4BB7A 3G4SV 1YZBA 3M7MX 4LC1A 1CSKA 2EPDA 1DF4A 3I56A 3AT1B 3HRSA 3S3OA 3ABMB 3CCLV 2X6CA 1FXXA 1R0CB 2E76B 3CCSV 4QE7A 4FIPC 5GAMj 2ZQMA 2BE9B 2XDBA 1F1BB 3SPJA 3ASKA 7AT1B 3URGA 3G4SQ 2DL7A 4EFEA 1B34B 3FJPA 1W2BP 3OSSC 1YJNT 2KT8A 2F4VO 1GM9A 2BTQA 5HKCA 5LJ5j 2LP5A 3A2FA 4MVOA 5BXZA 3TJTA 3W7SA 2K3YA 2QKSA 2ZE5A 5J2UB 3ZMUA 2E1HA 1ZAUA 3QVNA 2YI9A 2K79A 4JUVA 1M3BA 4UUJC 5LL6S 4Y91A 3K3WA 3G6EA 4O4JA 3P30A 2QXFA 2D0QB 2LDMA 3N27A 3UT5B 1WXTA 2C2AA 1AWOA 3S3NA 4KXRA 3CCMA 2KYBA 2DYIA 1X69A 2DMOA 2YLCA 3JRZA 4WFGA 2CGOA 3P3PA 1MV0B 3I5DA 5EZYB 1ZLMA 2AT1B 2ZCFB 4CH3A 2G38A 2QA4Q 5DY9A 3B8NA 2XK0A 1I07A 1UG1A 3M55A 3OMAB 4X64O 4RUGA 4DR7B 1U8RA 2EIKB 1EFRG 4BE2A 1WHMA 2EIMC 3MO8A 4I55A 1B6QA 1ABOA 1Q86U 4PA3A 2DJZA 2A79B 4M7AF 1IBKB 2A36A 3E8GA 1MSDA 3LDCA 3MHSC 2ATCB 2E5LB 4OMOA 1GN2A 1YCSB 1T0JA 3RYCA 1GCQA 4AI8A 1BT8A 1Y74B 3B40A 3LDEA 1V76A 1ZUYA 2QEXQ 2QDOA 1GN3A 2D2CB 1EBOA 2GHYA 5C6SA 1UE9A 1W2BS 1RAGB 3QBYA 4OMPA 1P84F 3JCMV 3AG2C 2EAYA 1VQLQ 2Q6AA 2Y4TA 5GAN2 4D6TH 5IT9N 4LNUA 2PVOB 1FPOA 4XU0A 3CBPA 4PJOC 4JYBA 3T1HB 4QQDA 1FYJA 3ASNB 5I2SA 2R57A 1HP8A 1NYGA 2YXYA 1JJOA 2K9PA 4ELYC 4I50B 4WBNA 1BI0A 4M78B 4NYKA 4EB6B 2UUAO 2V4DA 2Y69C 2RQRA 4C5GA 4CH5A 1YITQ 1S72Q 2Y4XA 2I0NA 2QEXA 2XI9A 2DWEC 4O2BA 5J9PC 2AIRB 1VARA 2CP5A 3OT7A 4M7DE 3NTHA 2LTOA 2OTLV 1Y4MA 1MNDA 8AT1B 1VA7A 4GX0A 1VQOV 5HFLA 3JAWB 1I0HA 1G2BA 4OGEA 1BZKA 3NR7A 5AG2A 2KBTA 5D7UA 1AWWA 2HP8A 4V2SA 3M54A 5LP6A 2VWFA 1VQ9Q 3S3MA 2CAZC 1SERA 1GN6A 1HW7A 2X0LA 1XNRO 5A0DA 1X4TA 3IAYA 1VQ8Q 1NYFA 4JI3B 2C0TA 5KX5A 2RHZA 2OYQA 1X6OA
chains in the Genus database with same CATH topology
2YXYA 1SF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXY A;  1SF9 A; 
#chains in the Genus database with same CATH topology
 3MP6 A;  3GPL A;  1YIT A;  1S72 A;  1K3E A;  3SEM A;  1QCE A;  1N4C A;  2A7Y A;  1HR0 O;  2H94 A;  4BW5 A;  4C8Q C;  2XAF A;  2RJF A;  1PPJ H;  3CJH A;  2K3B A;  4XU1 A;  1NR1 A;  4CI0 C;  3L73 H;  1Y76 B;  1ZUK A;  3CBO A;  4MZT A;  3JCM d;  1K73 C;  1M90 U;  1VQP Q;  3X2Q C;  2EBP A;  2VWK A;  5B66 Z;  4LF7 B;  1H3H A;  4JI4 O;  1NVP D;  3FYE B;  3LDD A;  3QYH B;  4CRI A;  2ZM6 O;  4BIZ A;  2EBO A;  2R9R B;  1RAI B;  5IT9 E;  1VQO A;  1NJI R;  3GWK C;  5LMU B;  3K79 A;  1FXK A;  2V7Q G;  5GJV B;  1VQP V;  4Y92 A;  5IY5 B;  4EDU A;  1MMD A;  3ZN1 A;  3VS2 A;  2ZT9 B;  3RFR A;  2LQ8 A;  4K0K B;  2RMK B;  4FW1 A;  4AQY B;  2PU9 B;  4LDV A;  3UQ8 A;  1KSW A;  4N4H A;  4BR6 A;  4DW0 A;  1TUE B;  1RPR A;  2NUT A;  2FZC B;  1JCH A;  3G6E T;  3JCM f;  4IUT A;  5M9O A;  4KHP B;  3BDL A;  3QJ6 A;  3V8K A;  4CC2 A;  3HP9 A;  1A32 A;  1PD3 A;  1RFY A;  1MV3 A;  1VQ5 Q;  2E3C A;  4FLZ A;  1E79 G;  3UCS C;  4M7A B;  1BI3 A;  5KYY A;  2UXX A;  1KQS S;  3ASN C;  2DNU A;  1H64 1;  5EIB D;  3SR2 C;  1Y96 B;  2L8D A;  2DXB A;  5KUM A;  4LUE A;  2UXC O;  1KU9 A;  2E12 A;  2EKO A;  3I35 A;  3RER A;  4J41 A;  4TUY A;  1US6 A;  1XIL A;  3QYG B;  4K0K O;  1AVM A;  1O9S A;  3E8B A;  3ABU A;  5LA6 B;  1W70 A;  5KE2 A;  3CMA T;  4PD4 F;  3RDV A;  3FB5 C;  5KA6 A;  5H6Q A;  2OTJ A;  2IM9 A;  3SDZ A;  4CH4 A;  3SWN B;  1Q5O A;  5BZB A;  2BCC H;  1B04 A;  2F66 C;  3H0I A;  3H9N A;  3H0F A;  4YY3 B;  1I08 A;  2VXF A;  4TQD A;  4IL6 Z;  1XNQ B;  2XT9 A;  3UT1 A;  1OQK A;  5GJW B;  5GMK l;  1YIJ Q;  4LP8 A;  2UUB O;  4J9E A;  2HR3 A;  2ED1 A;  3JCM W;  2EQK A;  2UXB B;  2EQU A;  2KGT A;  4JI1 B;  3CCS A;  2B9Z A;  3SJB C;  1G1X B;  1HDJ A;  3E22 A;  2XDD A;  3L72 H;  1N9S A;  3R6N A;  3TRE A;  1ACM B;  4I7Z B;  1V1C A;  4C92 B;  2ZPH B;  4AG1 C;  4P9O A;  4BAY A;  2HFE C;  1OZ2 A;  3C4S A;  2RDC A;  2UUC B;  1WLP B;  1ZSG A;  1NZ6 A;  3STZ C;  1VQ4 A;  4D8K A;  5GAN 7;  3PE0 A;  4C92 D;  1R6K A;  4FYV B;  4ZGD B;  5A0G A;  2JTE A;  4PA6 A;  3ZRV A;  5IN1 A;  2JEX A;  3ETQ A;  1AJP A;  3AG1 B;  2A28 A;  1QLY A;  5I22 A;  1E1R G;  2F4V B;  2V8J A;  3K59 A;  4WCE V;  3DXR A;  2DO3 A;  2HAX A;  3HKC B;  4A4E A;  4W4L A;  4X1Y B;  5CKH A;  3CC4 T;  3FX7 A;  3WVE B;  1EIF A;  5BMV A;  2CP2 A;  4ZOL B;  3JAM E;  1Q6I A;  3B8M A;  4UCU A;  5LJ5 g;  1D1A A;  1Z5V A;  4MVS A;  1ZSZ A;  4RTZ A;  5JVD A;  3ZJZ A;  1RI0 A;  1TWB A;  4PV1 B;  4ZI7 A;  1U1T A;  1PNK A;  2DD4 A;  2FB7 A;  1BI2 A;  2VXE A;  1AB3 A;  3CQT A;  1LUV A;  4K8Z A;  1PL0 A;  2BZX A;  3RWR D;  3CRC A;  1SEM A;  4CBC A;  4C8Q B;  2QTV A;  2YUO A;  3EFO A;  5LJ3 h;  5GAN j;  3CCE T;  5HY6 A;  2OWO A;  4YHH O;  5GAM g;  4X20 A;  1SQF A;  4F17 A;  4HT9 A;  1KBH A;  2FRW A;  1AD5 A;  1K9A A;  2HDA A;  3JB9 D;  1QVF P;  1DF5 A;  4GX1 A;  2JS5 A;  3DB3 A;  2EWN A;  1M1K W;  4AFZ C;  1K5S A;  4Z8A A;  1WGS A;  2EGC A;  2DM1 A;  3OYC A;  4M77 F;  3ABK B;  4LD9 K;  3B09 A;  2J6K A;  3EH1 A;  1BL8 A;  4H33 A;  1XQ8 A;  4O4H A;  2LCL A;  2LZ6 B;  2A3L A;  2HKO A;  3O8V A;  4PJO A;  3FAV B;  3TXS A;  3CC4 Q;  2L35 A;  1VQN Q;  1QU7 A;  1D5N A;  4KUD K;  3K5O A;  1NJI W;  3H0H A;  5FU7 C;  5B1N A;  4C0D B;  3Q1J A;  2RJD A;  4ZGJ B;  2LCC A;  1SA0 B;  1HSQ A;  1VQL V;  4CH6 A;  4FLX A;  5LL6 Y;  2BSK B;  3JCM Q;  4OMF B;  3CCV T;  1SQX H;  2CGN A;  4FZ0 A;  2PVG B;  1VQ4 T;  4PDR A;  2L3Q A;  4TVR A;  1RLQ C;  4X1I A;  3S3W A;  1UHF A;  4DR4 B;  2X4J A;  3U11 A;  3A98 A;  3N2K B;  4TV8 A;  1TAE A;  3OUF A;  1N27 A;  2E75 B;  1V54 B;  4MVZ A;  1IHW A;  4NXM O;  2V1D A;  4JS5 A;  4R0K A;  2LFS A;  1P4R A;  1H2K A;  2DYB A;  3QZ5 B;  2ILM A;  2QA4 A;  1EZJ A;  4EKW A;  1KHI A;  2QDL A;  2RK2 A;  5BR8 O;  2CUD A;  5GAO n;  1VF6 A;  3OM3 B;  4LF4 B;  4Q5W A;  4F7U B;  2C0I A;  1QP3 A;  2MAM A;  2IH3 C;  3BW1 A;  3M4G A;  4B9W A;  1RSO A;  2X6B A;  2EIJ C;  2X6A A;  2HCK A;  1TA8 A;  2CT3 A;  3JAL A;  3CPW P;  2WA3 A;  1WA8 A;  1THZ A;  4ORZ A;  3AK1 A;  1TGO A;  1YJW T;  3X25 B;  3EGD A;  3CSX A;  1OCC B;  1HNX B;  1GN4 A;  2ZE7 A;  4L87 A;  5CKE A;  3CMA A;  4JLI A;  2PZS A;  3QWX X;  4WFH A;  3ZHV A;  2E3H A;  2LC4 A;  2RD1 A;  3I55 Q;  1FFX B;  1KYO F;  2FB5 A;  4DR5 B;  1MGQ A;  5D6X A;  3T2M A;  1OEB A;  1OPL A;  1B06 A;  1TUB B;  3SYQ A;  3CCU V;  1C6V X;  1WJR A;  3CCQ V;  2JMA A;  3CCJ A;  5LOV B;  1T0H A;  2K57 A;  2H3J A;  3D3I A;  1B07 A;  3LNN A;  4MW3 A;  4FLV A;  5L3C A;  4KT0 E;  2A0L A;  4F4L A;  2NLJ C;  1WPY A;  3B77 A;  5B1A B;  4H0L B;  3CME Q;  1QVF A;  1ZLZ A;  4X62 B;  5JCO A;  2LT1 A;  1SES A;  4TWK A;  1NH2 D;  5GAN 6;  5FRN A;  4RAI A;  4X1K A;  1VQO T;  1RLP C;  4JAU A;  2B86 A;  5LJ5 d;  1SHG A;  2FKX A;  1AR4 A;  1OYX A;  4HKE A;  3ZL7 C;  1LNQ A;  1IZ3 A;  4LWS A;  4JGS A;  2EVR A;  2JTM A;  2FVU A;  5GAN d;  1WXU A;  3K5M A;  1M4U A;  3T1C A;  1OCZ B;  5J2T B;  2E41 A;  1GTO A;  1RM1 C;  4MDX A;  1VQ8 V;  3JCM e;  2YIB D;  4C8Q F;  5I21 A;  3BY6 A;  1FX7 A;  5GAM d;  2L6L A;  2P7T C;  4PDM A;  3J81 N;  2MIO A;  4M75 C;  2ZR2 A;  3I55 T;  3D36 C;  1PG5 B;  2XAJ A;  3HKB A;  4MS2 A;  3CPW S;  2DER A;  1CXZ B;  2LFR A;  2OCH A;  3PVL A;  1OHH G;  3PIP A;  1VQ7 Q;  4GLX A;  1BI1 A;  4GY5 A;  4RTY A;  4XQ3 A;  1YJ9 V;  2V1Q A;  3P8D A;  2OJ2 A;  4JPB W;  2CTR A;  4RCB A;  3MEV A;  2F5K A;  3RUX A;  4DR1 B;  1PNM A;  5IHK A;  4EMH A;  1NTM H;  1PL4 A;  1Q95 G;  3BEH A;  3JAK A;  4DV5 O;  2JIZ G;  4YJ3 B;  1R3I C;  4GBQ A;  1KD1 C;  3PJS K;  3ZHR A;  3E83 A;  5CA3 A;  1VQM T;  3GF5 A;  2YHT A;  1YI2 T;  4PJO G;  4DV6 O;  2OTL A;  1YJN Q;  3CC2 A;  3JCZ A;  3FD9 A;  5D5P A;  1UJY A;  4NXM B;  4DBF A;  4J7J A;  2GTS A;  1SQP H;  2A7W A;  4JI4 B;  4EIK A;  4DBQ A;  1OU8 A;  2L89 A;  1M1K R;  3RVY A;  3M56 A;  5IAY A;  5GAO m;  4PJN A;  3C90 A;  4JJC A;  3CD6 T;  3SJC C;  2P22 C;  1QMC A;  1GFD A;  1QVG S;  1BIB A;  1PRM C;  1S5L Z;  1OOT A;  1FFT B;  1N0N A;  1IGQ A;  1TTH B;  1K0S A;  3JAR A;  1XUQ A;  3A5Z B;  3WG7 C;  1XQH A;  3C0C A;  1B3Q A;  4L8J A;  2DEU A;  3M53 A;  4BI8 B;  2OTL Q;  1FYN A;  1PRL C;  1YHQ T;  4JPR A;  1FXH A;  2WLM A;  1N5Z A;  2F2X A;  3CC2 Q;  2CTP A;  1OU9 A;  2GV9 A;  2UUB B;  2QDY B;  4X89 A;  4GT1 A;  2LJ1 A;  3EFF K;  4KRT A;  1PD1 A;  4XAX B;  4J11 A;  5DLO A;  4RG8 A;  3I5S A;  5CN0 A;  1BIA A;  3K57 A;  1SG5 A;  3UM7 A;  1D1B A;  4AFS C;  1DTO A;  1O9H A;  2JGD A;  2GFA A;  3L9D A;  4JV5 B;  2VQE B;  3QHS A;  1WP8 A;  2ZIN A;  3MKD A;  3UA6 A;  4PJO D;  5GAM f;  2M7W A;  1BBZ A;  2CP0 A;  4M7A D;  1R0B G;  1E7O A;  2JVD A;  1I0C A;  1WZO A;  5CK9 A;  3C3T A;  2DZC A;  2F2W A;  2DL5 A;  1AP6 A;  2IW5 A;  5GAN 5;  2ZIO A;  1JQ0 A;  4DV3 B;  2EUL A;  3NXS A;  2NR5 A;  2RK1 A;  4BD3 A;  3CXC U;  1FJG B;  3G67 A;  2Y69 B;  3VQW A;  2DZ9 A;  1WPB A;  1M2O A;  1OJH A;  1QVP A;  1ZQ1 A;  1WAZ A;  3APO A;  4HAM A;  4IIO A;  3G4S T;  1NEG A;  1AI6 A;  1J95 A;  3SPH A;  3AHU A;  1JJ2 S;  2ESW A;  3C94 A;  4A4H A;  4JI7 O;  3UF4 A;  2Q7E A;  1X27 A;  2KMT A;  2RCV A;  3E89 A;  3X20 B;  4QPJ A;  1ZL8 A;  2O57 A;  4NL3 A;  1IXM A;  1XNI A;  4HVU A;  1UGR B;  4R8C A;  1K8A U;  1IRE B;  2QKA A;  3TCJ A;  3H9V A;  2JJ9 A;  4KFM A;  3JAW A;  2LVM A;  5I11 A;  3LWH A;  4FFB B;  2RI2 A;  1YHQ A;  2F1M A;  3KG2 A;  3ZRW B;  4GZR B;  1U97 A;  3G6E V;  5FRM A;  4AMC A;  2ZNJ A;  3N2G B;  5LHI A;  2Q69 A;  4UCO A;  1HYO A;  1M9N A;  3FB7 C;  1IO6 A;  5KX5 B;  2ROT A;  2PZ1 A;  2FZK B;  4I4T B;  3ZRS A;  1MMG A;  4FSS A;  2KNB B;  4E2F B;  2QWQ B;  1VUB A;  3RKW A;  1VQ8 T;  4KUL A;  2KVQ G;  1JO8 A;  3ER0 A;  1DK1 A;  2OTJ T;  1YEW A;  1VYV A;  2LMJ A;  2PQW A;  5LJ3 g;  2WLH A;  4I0X A;  1H8E G;  3AG4 C;  3OD4 A;  4J9H A;  1UB4 A;  1H2M A;  3SYO A;  3BFM A;  3V7S A;  2L3P A;  1V55 C;  1WHL A;  2QAS A;  4HVV A;  3MEA A;  2QM7 A;  1ZBX A;  1UPG A;  2XG8 D;  3GBQ A;  1YNZ A;  3ZBH A;  1KQS P;  2RJE A;  4Z02 A;  5BY1 A;  5LP6 C;  4IUR A;  1KEC A;  4D7S A;  3THO A;  1PSF A;  4QT7 A;  1QKW A;  4M7A G;  4LH6 A;  2NUT B;  1S5H C;  2X9H A;  4B3M O;  3I56 T;  2HQE A;  4LDX A;  1OCZ C;  3MCA B;  1IXB A;  1MNE A;  2RQ6 A;  3OS0 A;  5LHH A;  2QGN A;  2CGH A;  4ESR A;  1M57 C;  2UUA B;  4LNP A;  2W0X A;  4F16 A;  1VQ9 A;  1V54 C;  1OZ0 A;  4DRX A;  1ZA1 B;  3CXC S;  3PVQ A;  4FYX B;  3H1K H;  1WB8 A;  1TG0 A;  3H41 A;  4M75 D;  5EBW C;  2R9I A;  2QYZ A;  1M2V A;  4BE0 A;  3P32 A;  5KMG A;  3E2E A;  1WJS A;  2QQA A;  4XU2 A;  2BTQ B;  4DOW A;  2EIL C;  3E8H A;  2LCS A;  4J7I A;  3ABL C;  1VYT A;  4JJN K;  2ROL A;  3LSQ A;  1FD9 A;  1UGS B;  5KCH A;  1VQP A;  3MDS A;  4XDK A;  1KC8 C;  1M4Z A;  5GMK m;  1TS9 A;  1WHH A;  1K5Q A;  1PCX A;  4XTY A;  1TVK B;  3LLR A;  1LUW A;  1F51 A;  5CA0 B;  1W1F A;  3AK2 A;  2JS2 A;  2P4R A;  2AXT Z;  2HD0 A;  2P84 A;  2YUA A;  2ZPE B;  2CYZ B;  3OW2 U;  1YFN A;  1VQ6 Q;  4MTX A;  3I55 A;  4LF6 O;  4HZ3 A;  4C0G A;  4DR6 O;  1VQL T;  1BS3 A;  1MMA A;  1VIF A;  3CHX A;  4DW1 A;  2WAC A;  3A8G B;  4WCI A;  3ZEH A;  3BAB A;  4TOI A;  4ZKI A;  2WSS G;  3MP8 A;  3ZHT A;  5KYN A;  1IB8 A;  2LP7 A;  3JCU Z;  4XTX A;  4JAS A;  4QVC A;  2VQE O;  1XMO O;  1CP9 A;  3H1J H;  2J6O A;  3OYN A;  3CCL Q;  5GAO l;  1EN5 A;  3PIO A;  1FXK C;  5GAN g;  2PGG A;  3FRN A;  3KCY A;  4AQY O;  3K03 A;  2QAZ A;  2UU9 O;  2N74 A;  2LQN A;  1JOY A;  1VQ6 A;  3HPL C;  2P0K A;  2CE4 A;  2GTA A;  2F95 B;  2HVK C;  3CD6 V;  4C92 F;  3M59 A;  3ULR B;  4F14 A;  1NG2 A;  1KD1 U;  3VUB A;  2ZIM A;  1D0Z A;  2GF7 A;  5KYX A;  1VQ9 T;  2DJV A;  4A63 B;  5BMV B;  3MAQ A;  5FRO A;  4MDW A;  1R6T A;  2JS3 A;  5JQG A;  4MVU A;  5KAI Z;  5H9C A;  1I94 B;  1LVK A;  2XMF A;  3PNW C;  3K04 A;  4PK4 A;  2HSP A;  2IIM A;  2VS0 A;  3EG3 A;  5A2Q E;  1SS3 A;  3BY7 A;  3CCL A;  4U3J B;  4PDV A;  2EIF A;  1XMO B;  1JB0 E;  2YSU B;  3CC7 Q;  5GAN f;  1VEW A;  4GX2 A;  4YJ2 B;  1P7G A;  5EIB C;  1VQ7 A;  4TSF G;  4HNA A;  4R50 A;  5IYZ A;  2DE0 X;  1OZ3 A;  3JD0 A;  1VQ7 V;  4OVA A;  4FLY A;  2KSS A;  3RR6 A;  3E8F A;  2FPE A;  2YXH A;  4HT8 A;  1YJ9 T;  2P90 A;  4DV2 B;  1EN6 A;  2XAS A;  1Y07 A;  2WLI A;  1ZSP A;  2E3I A;  3OYJ A;  4IKF A;  3A8O B;  4CC6 A;  3J80 E;  1AVZ C;  5C8Y A;  1M56 C;  3L2Z A;  4JDS A;  3OR7 C;  2ZR3 A;  4RG2 A;  4RUE A;  4FM0 A;  2WPD G;  1WJQ A;  1SQB H;  4CS4 A;  3E35 A;  1H8K A;  4M77 A;  1AZE A;  3NMZ C;  2QI2 A;  1SSH A;  5HK0 A;  5EYP A;  4LFC B;  1ZX3 A;  1JRI A;  3P8H A;  2JUF A;  1YIJ V;  5D5Q A;  3QDF A;  3CC7 A;  1IXD A;  4JI1 O;  4YTL A;  4J83 A;  1H92 A;  1SQG A;  4ZBM A;  2HKQ B;  3KFV A;  5L23 A;  3LUT B;  1BYM A;  3TCU A;  1VOM A;  2QKC A;  3OMN B;  1S77 D;  3OB9 A;  3OBY A;  2HL3 A;  3OTF A;  3V8L A;  3IC7 A;  1N36 O;  4OMQ A;  1JXO A;  4X1I B;  1WXB A;  2DBM A;  4A53 A;  3W7W A;  2EIM B;  1AP5 A;  1XMQ O;  4GLM A;  1M1K C;  2HHH O;  3CCV Q;  2EQM A;  1QNM A;  1M3C A;  1AI4 A;  3E19 A;  3DTU B;  1QKX A;  1U3O A;  5I2M A;  1NM7 A;  2YIC A;  4BI3 A;  3LSS A;  1LR1 A;  1NVP B;  3JCM c;  1K9M C;  3DC6 A;  1ROP A;  1AOJ A;  1BB9 A;  3VUZ A;  4I9Q A;  5EG2 A;  5EBM C;  2KT1 A;  4DR3 O;  5IWA O;  2VGN A;  1R1B A;  3PN1 A;  1U5S A;  4M75 F;  2DKG A;  2VVK A;  1L8D A;  2KQX A;  4NL2 A;  2F2V A;  4R56 A;  4JZ2 A;  4EEQ A;  1K0X A;  3AG3 C;  1JU5 C;  1ZHI A;  3MD0 A;  5LXT B;  4JV5 O;  2QGF B;  4KUM A;  3OUS A;  3A8L B;  4Z88 A;  2MF2 A;  2LO1 A;  4Z1M G;  4DR2 B;  2ODM A;  4R6Z A;  4DXW A;  1WLE A;  2R70 A;  2DYR C;  3HTR A;  4RO2 A;  2M1H A;  4IIJ A;  4OPH A;  1KQ1 A;  2GFU A;  2V1R A;  4LD6 A;  2MYS A;  2D6F A;  2E5Q A;  5CB4 A;  3OGI B;  4M75 G;  5GW7 A;  5IDJ A;  2JN0 A;  4QIW F;  1QCN A;  1M5Q 1;  3OGC C;  4FCY A;  1RAD B;  3MEU A;  3QG1 A;  5IXB A;  1XEQ A;  1Y96 A;  3VQV A;  3RKX A;  4MTF A;  1B34 A;  2EZO A;  2M6Y A;  3RYH A;  1Q81 U;  1WIE A;  5CVI A;  1VQN V;  4B3S B;  2E5K A;  2ITD C;  3E2U A;  3CCR A;  1VMG A;  1M8M A;  3UO3 A;  4BIO A;  3OE7 G;  4C92 G;  2IU0 A;  2LQT A;  3D3Q A;  1WHK A;  3A0H Z;  2D1X A;  1HR0 B;  3CCU T;  2JGU A;  3ICX A;  5IJ0 B;  1UFI A;  3CRM A;  1RP3 B;  3CXH F;  4P2Z A;  1UJW B;  3ABK C;  3EH2 A;  3T4Z A;  2DRK A;  5GON A;  2BOC C;  2VRZ A;  1YJW V;  3CRA A;  4O4J B;  4VUB A;  3JB9 J;  1Q86 R;  1J3T A;  5GMK i;  4LF5 B;  3QJY A;  1NBE B;  2OCC C;  4QJF B;  1KQS U;  4DUY B;  1IHV A;  4QVD A;  4FYY B;  4EMK C;  1N8R U;  3L2V A;  2LT4 A;  2VYT A;  3X2Q B;  4LXC A;  3JAT A;  1W2B A;  5EBL C;  2EYQ A;  3CYO A;  3ML0 A;  4Z2W A;  2BTO A;  2RQW A;  1YBY A;  3S6W A;  2GBO A;  4Q6G A;  1S5J A;  2PTK A;  3SJQ C;  1A0N B;  2X35 A;  3QNE A;  5IE9 A;  3ZHS A;  1BCM A;  3SYA A;  1WJZ A;  1QHT A;  5A2Q N;  4M78 D;  1NS1 A;  2YRD A;  3A8M B;  3K9S A;  1KD1 R;  4NTX A;  1X2K A;  2VGM A;  1SQV H;  4ANJ A;  5GAO q;  4J7Z A;  3CC4 V;  4R7C A;  3RYF B;  2CZ1 B;  2HQH A;  3DXR B;  2I2L A;  1LOJ A;  1Y66 A;  5EC2 C;  1SKV A;  2YID A;  3R65 A;  3TGU H;  1NPP A;  2E70 A;  5LMN B;  4JYY A;  1Y0M A;  2X7R B;  1E6G A;  1G3W A;  4C8Q E;  4DV7 O;  2P4K A;  5K1X A;  4KH0 B;  1ZSZ B;  2GQV A;  3M0U A;  3JAR B;  2LJ3 A;  4B6M A;  3RNJ A;  3F5T A;  1JFF B;  3CD6 Q;  2OT5 A;  4ZI7 B;  2CZ6 B;  1D3B A;  5BR8 B;  2ZE6 A;  4FL6 A;  1XHZ A;  1JR9 A;  5FNV A;  5B5E Z;  4X66 B;  1M5I A;  4UCR A;  1MHN A;  5LJ3 j;  1YWP A;  5GAN h;  2QTO A;  2FTK A;  4HA8 A;  4LF6 B;  3VYH B;  1GK9 A;  3LGL A;  5KE3 A;  1XRE A;  3N5B B;  4PI0 A;  3EGX B;  4OB0 B;  4LDU A;  2ADP A;  4N4G A;  1N33 B;  1XTD A;  3UAT A;  1Q82 U;  4JZG A;  1TSF A;  2CZ0 B;  1PWT A;  3W7T A;  4U3F H;  3EFR A;  4CC3 A;  4B3R B;  5L3B A;  4HXJ A;  3ZX6 A;  2FYK A;  2GNC A;  1K7D A;  2L0A A;  1K8A C;  2MK5 A;  3CD6 A;  2EFI A;  3Q4H A;  3TSZ A;  4AFQ C;  5C0M A;  4HCB A;  2QQS A;  1JJ2 P;  3A8T A;  1PV0 A;  2NNU A;  2XKO C;  1QVG P;  2O4X A;  2COZ A;  2W0F C;  2K1E A;  3FAV A;  4OGQ B;  4PDL A;  4J9C A;  1Z5W A;  4M77 D;  3AEI A;  4JZ3 A;  4PJO F;  1WA7 A;  1YIT V;  1S72 V;  1EM1 A;  4FLU A;  2J06 A;  3DGE A;  3VYG A;  2E74 B;  3L75 H;  4HCZ A;  2A0F B;  1JJ2 U;  2LNV A;  4WFA V;  4BAC A;  2VB6 A;  4JI0 B;  1AZG B;  4I9W A;  3BFR A;  2R5M A;  2SRC A;  3M0S A;  4GKK B;  2YC0 A;  3NPF A;  4A4F A;  1LCK A;  2JVV A;  3LWI A;  4DQ2 A;  5FU7 B;  4C0D C;  4DR6 B;  1D0Y A;  2QK0 A;  2WSE E;  5B1A C;  2YEV A;  2Q8V A;  4DOV A;  5LYJ B;  3CC2 V;  4JTA B;  4HBN A;  3EFS A;  3VS1 A;  4C5I A;  3LNM B;  5GTI Z;  3CJH B;  2FEI A;  1VQM Q;  4DBH A;  4XU3 A;  3JYC A;  2HNI A;  2IBZ H;  2JNG A;  3V7R A;  1PKX A;  5LGT A;  3FFQ A;  2K5I A;  4F6E A;  1OCC C;  4QKU A;  3TU4 K;  2DFU A;  4DR4 O;  4LH7 A;  1KQS A;  3HKD A;  1Y6X A;  3JD1 A;  3QTC A;  1D0X A;  2E6N A;  2R72 A;  1FXK B;  5JH7 A;  3CBM A;  5FLX N;  1YI2 A;  1K76 A;  1W59 A;  2HHH B;  1Q90 D;  1G6U A;  4JAA A;  4N23 A;  1KKC A;  1OCR C;  2EIJ B;  1M93 A;  4G2K A;  4PA4 A;  1J5E B;  4PJL A;  5H6R A;  4J6X A;  5HCK A;  2F93 B;  2P0P A;  1BKB A;  4MVQ A;  5GAN 3;  4OMN A;  2CTQ A;  2XND G;  4EMK B;  3REA B;  3GIB A;  5LOV A;  4YIP A;  4AG2 C;  4RTV A;  9ATC B;  4O5V A;  1WYX A;  4O6J A;  2RN8 A;  2HG5 C;  2QM4 A;  4G28 B;  4B3T B;  1WB7 A;  3L74 H;  1Q86 W;  5IH2 A;  4PFO A;  3HRU A;  1KIK A;  1OV9 A;  4XDL A;  2FPD A;  2YUN A;  4JLG A;  3JD4 A;  4M78 G;  4DR5 O;  2K9G A;  5CQX A;  1YI2 Q;  3G1J A;  1RL2 A;  3MP1 A;  1H2L A;  1XOV A;  2CT4 A;  2DQ3 A;  4F6R A;  2ETN A;  2BZY A;  2E6Z A;  3ETG A;  2R5A A;  4AFU C;  4JI2 B;  4M7D G;  4MTG A;  3CCR V;  2EJ7 A;  4J9I A;  1RAA B;  3OY9 A;  3CWB H;  5FPR A;  3D36 A;  4IUU A;  1M30 A;  3JCM g;  5B1O A;  2YWW A;  4TV9 B;  3ZCC A;  3BE3 A;  4X65 O;  3O5Z A;  1KB9 F;  1D5A A;  1B7T A;  4B3R O;  3REB B;  4DK0 A;  4M78 F;  1K4U S;  4LR3 A;  4M7D B;  3FYI B;  3VQY A;  3RMS A;  2ZAE A;  3CE2 A;  4J9B A;  4LDY A;  2X4Y A;  5CA1 B;  1YHQ Q;  1FMK A;  1AJQ A;  4O2A B;  1IBK O;  4ELZ C;  4WFF A;  3VQX A;  4LF9 B;  1WQ7 A;  2Q67 A;  2RN9 A;  4DRX B;  3L70 H;  3CPW U;  1QWE A;  2FRY A;  3EG9 A;  3GLX A;  4PLI A;  3AK3 A;  3OTO O;  4JI5 O;  1PNJ A;  2W10 A;  2BUD A;  1YN8 A;  2A3Q A;  4DV1 B;  2XOK G;  1I5X A;  3CS5 A;  3ETD A;  5JCO C;  1IVS A;  1M2V B;  4J9Z B;  3RYI B;  5E1A C;  4FVM A;  3OYH A;  2AHY A;  4MZM A;  1NJI C;  1SQQ H;  4DYL A;  4RMO A;  1OI1 A;  3WG7 B;  4BI4 A;  2KR3 A;  3CCR T;  1OX8 A;  1L1F A;  3WVD B;  3J7A U;  4MVM A;  1RAC B;  3SFM A;  4JRQ A;  4FM4 B;  3CCQ T;  2KKW A;  1VQK V;  3HFO A;  2GSM B;  1K4D C;  2K2V A;  3UA7 A;  1SC5 B;  5B1B C;  4DV5 B;  2JZ2 A;  2M0O A;  4UVB A;  4RTW A;  3ETE A;  1G8M A;  4JYA O;  1UDL A;  4MT8 A;  2ZGW A;  2AZ2 A;  1XI1 A;  2ITC C;  2PYL A;  1KP3 A;  3PMT A;  1N33 O;  2L3S A;  4FYW B;  2HBP A;  1P49 A;  2ECZ A;  3H1L H;  2IG0 A;  4FIB A;  2AKK A;  2M51 A;  1UHC A;  2SEM A;  1WN7 A;  2KB1 A;  4J6W A;  4C8Q A;  2XHC A;  5GAN e;  3EFO B;  1BHB A;  4ZHQ A;  5B3S B;  3OFN G;  4PFP A;  3SHW A;  5B1B B;  4LNU B;  2O9V A;  3G71 T;  4X88 A;  2GBQ A;  1QVF U;  5L3E A;  3CCM T;  4I5S A;  3JAS A;  2EYX A;  2JEU A;  5EZY A;  4UCS A;  2EX3 A;  2WAM A;  4FT2 A;  2CH4 W;  2K5F A;  4I50 A;  3WB2 A;  2DXU A;  1T5E A;  4BE1 A;  3CCR Q;  4K11 A;  4EB6 A;  1ZUQ A;  2GTO A;  4M75 B;  5CCA A;  2CKK A;  3LX7 A;  1JQQ A;  1ZTE A;  4J5Y A;  3CCJ T;  3CC4 A;  1YXB A;  1Q7Y C;  1WPX A;  2KG7 B;  1LJO A;  1M1F A;  4C5E A;  1AWX A;  3VOU A;  5LJ3 f;  4K3A A;  1HNX O;  1SSF A;  1K1Z A;  3P8B B;  4IYI A;  4C0Z A;  4FK5 C;  2UXN A;  4WFB V;  2MWO A;  4ATO A;  5GAM h;  2DOS A;  3IQL A;  2YS8 A;  1Q7Y W;  1WDX A;  4M7D C;  4YY3 O;  2DQ0 A;  3RYC B;  1BK2 A;  1PM9 A;  4PNO A;  2XUM A;  2X4X A;  4M77 C;  1HXD A;  1ORQ C;  2EYY A;  1XJW B;  2ZNI A;  3CRQ A;  4AT1 B;  2P5O A;  1F4N A;  3DSQ A;  2BTT A;  3MET A;  2BE3 A;  1YIT T;  1S72 T;  1S1N A;  1X6G A;  3N2K A;  2E10 A;  5J39 A;  5LJ5 h;  3T1Y O;  1TUD A;  2JS0 A;  1Q6U A;  2HLD G;  3OYA A;  2DBK A;  3FEO A;  2P0Q A;  4JI3 O;  3ZHQ A;  1TH7 A;  4JI5 B;  3OTO B;  2D3O W;  2MOX A;  1QVF S;  1FAF A;  1GH6 A;  1K34 A;  1N0J A;  2YIB A;  1GCQ C;  2GUZ A;  3FB6 C;  3FKS G;  4F04 B;  1XL6 A;  4IHJ B;  3CMA Q;  2DXC A;  5GAN 8;  1VQM V;  1RPO A;  3GB7 C;  1M57 B;  3C3S A;  2RM4 A;  4LUD A;  2LJ0 A;  1VQ9 V;  3EG2 A;  2M16 A;  1WP7 A;  1M8V A;  3TEE A;  4XTZ A;  3JB9 I;  1AEY A;  5LBQ A;  1XL4 A;  2PI4 A;  2P4V A;  5L3D A;  5JWP A;  3FB8 C;  2ADQ B;  3AG3 B;  1TUB A;  3OS5 A;  5CQY A;  4WTO B;  1SPK A;  2KRO A;  4M7D F;  3CME A;  1PHT A;  1N34 B;  1KMI Z;  2MW2 B;  4JI0 O;  5C93 A;  1KFZ A;  3U23 A;  2FZG B;  3QXE B;  3M57 A;  1KC8 U;  3T1H O;  2ZKO A;  4X66 O;  1YCY A;  2Y4Y A;  3OW2 S;  1PM3 A;  1V55 B;  3CPW A;  1BSM A;  1GRI A;  5H2F Z;  1FS0 G;  1XNQ O;  1X01 A;  3QII A;  4D6W A;  2A9H A;  2Q68 A;  3AG7 A;  2CK3 G;  3L1A A;  5CAI A;  5KYW B;  4X34 A;  2ARH A;  1RAH B;  3RBB B;  3HHT B;  1LPL A;  2WLL A;  4MW8 A;  2BZ8 A;  4A54 A;  3GVM A;  2RHY A;  1EZZ B;  1VF6 C;  1G4Y B;  4BW9 A;  2CH7 A;  2H8H A;  2KRN A;  4TUY B;  2MK3 A;  3OBW A;  3ABT A;  1MSW D;  1H3Z A;  5L3F A;  5LA6 A;  4OXS A;  2EJF A;  4M7D D;  2K5L A;  1ZBJ A;  4O4I B;  4ZNX A;  5IHI A;  4FFK A;  4BDZ A;  2UXC B;  4DV1 O;  3P3N A;  2XIC A;  1VQ5 T;  3KZI Z;  3F70 A;  4J8O A;  4MMK A;  3SWN A;  1NU1 H;  1K73 W;  1Q8I A;  2VUB A;  3ZED A;  3OYK A;  2BOB C;  5EK0 A;  3KBG A;  3OMG A;  1QVG A;  4LFA O;  2RB6 A;  3HKS A;  4J9D A;  2NWM A;  1OCO C;  3CCL T;  3IJ4 A;  2VV5 A;  4JI6 B;  3X26 B;  1H2N A;  4OMM A;  3OYF A;  5FW9 A;  3F5W C;  3SWN C;  3UO2 A;  2LRQ A;  1YJN A;  4MTO A;  2CRE A;  4UXN A;  1Q86 C;  2BE7 D;  1AR1 B;  2UXB O;  2AZ0 A;  4YXW G;  4DUZ B;  3WB0 A;  3UWN A;  2RNB A;  3JD2 A;  1M56 B;  1N36 B;  1E6H A;  5KYY B;  2JXB A;  1SRY A;  2QTS A;  1YI2 V;  3FB9 A;  2CDT A;  3VBB A;  4C7U A;  3ZMS A;  1EN4 A;  2NUP B;  1OCO B;  3O65 A;  5IJ0 A;  4M75 E;  2EJ9 A;  1VQK A;  2Y4U A;  4LCU C;  5B3S C;  2L3R A;  2DPP B;  1IBL B;  3PFS A;  3HKC A;  2IH1 C;  3APQ A;  3H8Z A;  3HFN A;  4C5H A;  2DN9 A;  1HNW O;  2RQU A;  4RTX A;  1L0N H;  1P7B A;  2BKD N;  2CSQ A;  1C1A A;  4ZOL A;  3L2U A;  5JJE B;  2Y0I A;  1AI7 A;  4HCK A;  3HB3 B;  4MSW C;  5IJ9 B;  4QQG A;  5KHJ A;  3QG5 A;  4FLT A;  1WX6 A;  3QKJ A;  1M9S A;  3GNG A;  1MOF A;  3RIR A;  3OS2 A;  3M0T A;  4O4L B;  5GTH Z;  3UT5 A;  4JI7 B;  2WWW A;  3B4S A;  2YDL A;  1VQK Q;  1XHX A;  2OTJ V;  4X20 B;  4UC4 A;  4KGV B;  3G6E Q;  3R66 A;  3EVK A;  3E22 B;  5IY5 C;  4ABM A;  4C8Q G;  1MAB G;  2XAG A;  3VS3 A;  2M9U A;  2ZE8 A;  2QWR B;  1C0M A;  1NR7 A;  4BIU A;  3W7U A;  2ZZD A;  4NVP A;  3DC5 A;  4TT3 G;  2V8I A;  2X3W D;  3OYI A;  1G5V A;  3D8C A;  3OR6 C;  4GYC B;  4W4K A;  4FM2 A;  1BQ0 A;  1Y57 A;  1XMQ B;  3QO7 A;  1YJW Q;  3OAA G;  2AK5 A;  4O4H B;  5GMK h;  5DLQ E;  2K4Y A;  3CPF A;  2KQW A;  2WLN A;  3W7X A;  5LMU O;  4CC5 A;  5IYD O;  3KKY A;  5FNV B;  4X65 B;  1I94 O;  3HKE A;  1K9M R;  5KHH A;  3I9Q A;  1Q3E A;  2KY9 A;  3LW5 E;  3JAM N;  1NKD A;  1K8A W;  3H6Z A;  4J9G A;  4HNA B;  1IRX A;  3EGX A;  1Q82 W;  3INZ A;  2PTM A;  3ZFJ A;  1M90 C;  1FKA O;  4JI8 O;  1GM8 A;  5KA5 A;  3CME T;  4MZP A;  4DEY A;  4OX9 B;  2KYM A;  2VC8 A;  2DMX A;  1I5O B;  4A4K A;  3QF7 A;  2PUO B;  1YIJ T;  3CB2 A;  2Q0A A;  1KHC A;  3CCE A;  1AJN A;  2FG0 A;  4J9Y B;  1QQJ A;  2R58 A;  3NTI A;  4DR2 O;  1NTZ H;  4LF8 O;  4H37 A;  4HYO A;  1Z9Z A;  4QW2 A;  4N4I A;  3CXC P;  3Q4H B;  1PNL A;  1QLE B;  3PT9 A;  4F7U A;  5EYP B;  5FL7 G;  4M4Z A;  2DET A;  4KL1 A;  2FHD A;  2CP6 A;  5AYF A;  3LSU A;  2D8J A;  2K3X A;  5KLV H;  2V26 A;  5FLX E;  4O2B B;  1JX9 A;  1I8F A;  5LGN A;  1M3A A;  3M5A A;  4WF2 A;  1Q81 C;  1QBZ A;  4JTC B;  4OX9 O;  1WHG A;  2E5L O;  2RI3 A;  4M77 E;  1Q43 A;  3CC2 T;  2LGQ A;  4LFB O;  2NUZ A;  1QR9 A;  1SA0 A;  2A37 A;  1HNW B;  1YVW A;  1GL5 A;  3M4Y A;  4LN2 A;  4F7U G;  3KXT A;  1R6N A;  2YRC A;  2DWD C;  1F4M A;  2WLJ A;  5TIS Z;  1MMN A;  3CXC A;  1GMG A;  2KAF A;  3QPH A;  4FJC C;  3HL8 A;  1VQ8 A;  2DTH A;  1SZX A;  1MUZ A;  4UB8 Z;  2EW3 A;  1NEB A;  2RHU A;  3ZMZ A;  3AG4 B;  2UXD B;  1I4K 1;  3R6O A;  4BY6 B;  1QLN A;  1N8R W;  1G3T A;  3ZMV A;  4EFB A;  3JSN A;  3H01 A;  4IT5 A;  3SGI A;  1VF7 A;  4CZZ A;  2YUP A;  4J9F A;  2Z0A A;  3ABL B;  2RMO A;  1SHF A;  3DLL A;  3U0Z A;  4RCC A;  1QR8 A;  5JJJ B;  5GMK j;  3JCM b;  3VS6 A;  2JK5 C;  2RJZ A;  4EMK A;  4JZ4 A;  1UJ0 A;  2HL5 C;  4DR3 B;  2R9A A;  4B7E A;  1PKS A;  3ZN0 A;  3E86 A;  2HZY A;  5IHN A;  2Z3Y A;  1VQO Q;  4J7K A;  1ZA2 B;  2D8H A;  3TXQ A;  3E9F A;  2ATK C;  4E2L A;  4PI2 A;  5CB4 B;  1KG1 A;  1Y67 A;  5GAO p;  2KXD A;  5KHG A;  5CBH A;  3EHQ A;  3VS5 A;  2Q4P A;  3OYD A;  2EQJ A;  2LNH B;  4CC4 B;  1VQ6 V;  3MPU B;  1YJN V;  2Q7G A;  3BRC A;  4M77 G;  5KH6 A;  2Q73 A;  3GOX A;  5CBF A;  2GTJ A;  1VP7 A;  2FO0 A;  2NLU A;  2EQI A;  2JJ1 G;  5KMG B;  1G83 A;  2IVW A;  1NJI U;  1VQM A;  2OCC B;  1NE8 A;  3DLM A;  2B1I A;  3CCS T;  4TV9 A;  1MNG A;  2ZD9 A;  4D7T A;  3JV3 A;  4XK8 E;  4X1K B;  2IPO B;  3JB9 H;  1JMK C;  2EGE A;  2DVJ A;  1H38 A;  2DX1 A;  4E4E A;  4RQE A;  3PTA A;  1VQ7 T;  1U06 A;  3STL C;  4FLW A;  4A5U B;  2ZPF B;  1KC8 R;  1HNZ B;  3EHB B;  2F43 G;  4LWS B;  1N6A A;  4E7K A;  2F23 A;  3EAE A;  4NXN B;  1RAB B;  2HQX A;  4B3S O;  2PUK B;  1YJ9 A;  4M7A C;  5J2T A;  2YRV A;  1V9P A;  3M0P A;  3EG9 B;  2QWO B;  3J80 N;  1M27 C;  4PEL A;  1ZWI C;  2GDS A;  2HSE B;  4DUZ O;  2H8P C;  3O9O A;  4CS2 A;  2QM8 A;  1U96 A;  2W6J G;  2KDS A;  1K9M W;  4NR1 A;  4RTT A;  1V29 B;  4X62 O;  3TK1 A;  3BA9 A;  3ASO C;  4DV2 O;  1GFC A;  3M8A A;  3JSC A;  1N34 O;  1H2S B;  2LQW A;  4JAV A;  1Q82 R;  3VS0 A;  4F7U F;  2WSF E;  2IJI A;  4UVC A;  3QSU A;  4QE9 A;  4GLK A;  4KBM B;  1O9G A;  1YIJ A;  1XDC A;  3U10 A;  3E9G A;  4C92 A;  2HVJ C;  1KD1 W;  3OQ5 A;  1I81 A;  3G7Z A;  3GP8 A;  3L42 A;  3CCS Q;  4E7J A;  3F7V C;  2DF6 A;  1D09 B;  3OYB A;  1K97 A;  4CC7 A;  1Q7Y U;  3K0G A;  1PSE A;  5KYX B;  2DLP A;  1BCC H;  1KQ2 A;  1AI5 A;  2HJF C;  2LGW A;  1SZT A;  2O9S A;  2AKL A;  2K6D A;  3L2R A;  5IYC O;  2PNI A;  4E7Z A;  2J05 A;  1JFF A;  3TVT A;  2XID A;  4X1Y A;  2DD5 A;  3UKM A;  1YSC A;  1OV3 A;  3QO5 A;  2JDI G;  3S3X A;  2QSA A;  2MCN A;  5LMN O;  3AG1 C;  2ZPB B;  5IYZ B;  4DR1 O;  3FC3 A;  2RPN A;  4DK1 A;  3QUI A;  2KI7 A;  1N32 O;  1TUC A;  5DEC A;  2IJJ A;  3CC7 V;  3OS1 A;  2WLI B;  2KRM A;  3X24 B;  2CTW A;  3OYL A;  2AW9 A;  2NYS A;  2KSD A;  3J81 E;  1GO3 F;  4ASU G;  3G71 V;  2JOY A;  2X4W A;  4LF5 O;  4OB2 B;  3OSV A;  3OYE A;  5ITZ B;  3EGU A;  4M75 A;  2JJ2 G;  3IGA C;  4FM1 A;  1VIE A;  4OGC A;  3A0R A;  4X9D A;  5KYU B;  1YP5 A;  5CKD A;  2KG7 A;  5DN6 G;  3KUF A;  5GAM e;  4M77 B;  4B7K A;  2LQK A;  5DED A;  3FLG A;  4GUN A;  2J6F A;  4WBN B;  2FML A;  3SYC A;  5JJN B;  4NKG B;  4M78 A;  3IC9 A;  2Z5U A;  2QA4 T;  3M0Q A;  1N8R R;  1MG1 A;  1I5Y A;  2OIG A;  2QQ9 A;  3L2Q A;  3WXM B;  1ZUU A;  2YI8 A;  1FJG O;  5L3G A;  2COW A;  2RA2 A;  2JMC A;  2O31 A;  2YUQ A;  4PLL A;  4UV8 A;  3T9N A;  3CCV A;  1W0K G;  2D0N A;  1UTI A;  2OI3 A;  3VS4 A;  3BPZ A;  2RHX A;  2DL3 A;  3SJA C;  4X8A A;  1QCO A;  2QTX A;  4XBF A;  4J80 A;  1WNS A;  4I4T A;  4PL6 A;  1VQN A;  1GM7 A;  3RN4 A;  1W6X A;  2K7A A;  2XD0 A;  1D2D A;  1F7Y A;  1VQ5 V;  4P30 A;  4CS3 A;  2XAH A;  2PI5 A;  2JM9 A;  3OYG A;  3G4S A;  3ZS8 C;  4ICG A;  3OMI B;  2OTL T;  2G3R A;  3JB9 G;  1BGY H;  2Y0P A;  2DVE A;  5DM7 R;  3JCM h;  3QO8 A;  3ZHU A;  2J7I A;  1BE3 H;  2KK4 A;  3FDR A;  2RF0 A;  2JW4 A;  3DB4 A;  3SPC A;  4N0A C;  2HJD A;  4BWA A;  4IUV A;  4RUF A;  1UGV A;  2N04 A;  4P5N A;  1YJW A;  2ABL A;  2VKN A;  3OA6 A;  3ZBD A;  1JPX A;  1K4C C;  2DXT A;  3EG0 A;  1KJW A;  4BY6 C;  1VQ6 T;  4FFB A;  5K1P A;  3CP1 A;  3JAL B;  2LX9 A;  2QGG A;  3OMC A;  1FWZ A;  1WA8 B;  1MMM A;  4H44 B;  1RUW A;  3LH5 A;  1KC8 W;  4QNH B;  4C92 C;  1M1G A;  2XU8 A;  3EGD B;  1X6B A;  4B08 A;  3LGF A;  2YIA A;  1R3J C;  2YDE A;  1NTK H;  2LW7 A;  3N2G A;  4NTY A;  4DEX A;  4X64 B;  1P92 A;  3CCM Q;  2YXL A;  4JYC A;  4J7F A;  2AGA A;  4ZN3 A;  4YIO A;  1H8H G;  2CDY A;  2PVD B;  1SRL A;  1VF5 B;  4F6R B;  4PJ0 Z;  2D9T A;  4XTU A;  2DAQ A;  2QEX T;  2YT6 A;  2WLL B;  3F7Y C;  3RYH B;  2M0Y A;  3JCM J;  3CCJ Q;  3M9Q A;  3CCM V;  2W0Z A;  1BU1 A;  4I0X B;  1PD0 A;  3CCQ Q;  4JI2 O;  4JJD A;  4B3T O;  1M90 R;  2CZ7 B;  3JD3 A;  3JCM X;  3BVO A;  2LW1 A;  5H5N A;  4M7A A;  2B8A A;  2COY A;  3RES A;  4JTD B;  2MWP A;  2CUG A;  1OPK A;  3CCU A;  1VYU A;  2DK3 A;  2OIE A;  3I5R A;  3MJX A;  2JM8 A;  4X9C A;  3SPG A;  3M99 B;  1BQZ A;  3JCM P;  2DA9 A;  4PA9 A;  1TU0 B;  3OYY A;  2QA4 V;  5CKB A;  1R77 A;  3RKY A;  4M7D A;  1K9M U;  4E47 A;  3ZMT A;  3M0R A;  1MA1 A;  1U1S A;  4M7A E;  2RNA A;  4E7I A;  3PGG A;  4KGX B;  4FZ1 A;  2QG9 B;  4Z89 A;  8ATC B;  5J2U A;  1K73 U;  4RWU A;  5EC7 A;  5KHI A;  2QEX V;  1JBM A;  2FL7 A;  3MHX A;  4FMT A;  2CSI A;  3HKB B;  1PKT A;  4LFB B;  3QDR B;  1HD3 A;  3QWY A;  4C92 E;  4JJB A;  2MPX C;  1GBR A;  1IUR A;  3K9A A;  1OX9 A;  2VWJ A;  5D6W A;  3V7C A;  1EZV H;  2L2P A;  2NUP A;  3GNF B;  1QWF A;  1NH2 B;  4YJ3 A;  3NTK A;  3I55 V;  4BDY A;  2XHB A;  2C06 A;  1Y7X A;  1EX4 A;  2Q9L A;  3FIF A;  2IJH A;  2PUS A;  1JVM A;  2OAU A;  1AT1 B;  2FYU H;  3G80 A;  3SYP A;  1VQP T;  4I55 B;  1MZF A;  2QJ1 A;  1CEZ A;  2WSC E;  1XOU A;  1TVK A;  3CME V;  4U3J A;  4GKK O;  2QE7 G;  5CA0 A;  4IYH A;  2HEQ A;  2Q5Z A;  4IUQ A;  1PP9 H;  1KKD A;  1R73 A;  4N0A A;  4O4L A;  1UGP B;  2F5T X;  4JS4 A;  1IGU A;  1WI7 A;  4ZHQ B;  4JYA B;  1YDX A;  3SDL A;  2ZDI C;  1FMV A;  3K0D A;  5JVD B;  1Y74 A;  4DV4 O;  1I5L A;  1FMW A;  4DO2 A;  1IDS A;  5CBG A;  2ENM A;  1ARK A;  3D7S B;  4GX5 A;  5DM6 V;  3I56 V;  1ABQ A;  2RHI A;  3BDU A;  5KCO A;  3UPU A;  1VQK T;  3JB9 F;  2JRI A;  1K33 A;  4Y28 E;  5C8Y B;  1UUE A;  1SF9 A;  3SB2 A;  2EIL B;  3K58 A;  1SET A;  2MI6 A;  4WF9 V;  3CC7 T;  1I7F A;  2BIV A;  4OML A;  5CKF A;  2HEP A;  4JI6 O;  4LDW A;  5CO7 A;  3A8H B;  3G71 Q;  4K8X A;  1LNX A;  1O75 A;  3TQ7 P;  2JGD B;  1T3S A;  4L6V 5;  5FU6 B;  1YJ9 Q;  3HKE B;  3M58 A;  3J7A F;  1HK9 A;  5IWA B;  4JRK A;  1NZ9 A;  1RI9 A;  3EHR A;  3PMI A;  4RKU E;  3QO3 A;  3CCV V;  1Q7Y R;  2DIG A;  2N05 A;  1Q81 W;  5E79 Z;  4DV0 B;  4PJO B;  3HR0 A;  2HMA A;  3BCC H;  1DJ7 B;  3RW0 A;  3DKM A;  2UUC O;  2DYS C;  2LJ2 A;  1URF A;  1UFF A;  2HBW A;  3AG2 B;  1RM1 B;  2DYR B;  2H3O A;  4L5G A;  4PJM A;  5LP6 B;  1DLB A;  4J42 A;  5HK3 A;  3MEW A;  3I56 Q;  2H3E B;  3QZ9 B;  4KH1 B;  1VQ5 A;  2BSK A;  3L2W A;  3K08 A;  3ZRX A;  4NOY A;  1Z9Q A;  5HFM A;  5EC1 C;  4YHH B;  3G71 A;  3SPI A;  4P9P A;  1NI8 A;  1YTF B;  1HWY A;  3B2E E;  1N32 B;  3OEE G;  2EJG A;  4KGZ B;  4PFZ A;  4QVZ A;  3L71 H;  4UCT A;  4TV8 B;  2WLK A;  2GUZ B;  4LFC O;  3HPW A;  2W6I G;  4LF4 O;  1JEG A;  4IHJ A;  1KK7 A;  3BHP A;  4GKJ B;  4AHC A;  2Y48 A;  3HKD B;  1IZ6 A;  1Y76 A;  4GCZ A;  1WFW A;  1K92 A;  3GWO A;  5JH7 B;  4NTW A;  1YF2 A;  1QP2 A;  4X1V A;  2DL4 A;  1M90 W;  2EIK C;  1Q82 C;  2B5U A;  3K5L A;  5J3B A;  1RSO B;  4HCC A;  2OX7 A;  5LXT A;  1OUL A;  3UDC A;  2VAS A;  4FSX A;  4ZTJ A;  1ZSZ C;  5KAF Z;  4LF9 O;  3JSL A;  3KCX A;  2L5Q A;  2GCX A;  4OP0 A;  3K5N A;  5LJ5 f;  3OYM A;  2AZV A;  1COW G;  4E7S A;  4JRI A;  1VQN T;  1JJ2 A;  2RO0 A;  1TXQ A;  2EYZ A;  2KXC A;  2PY5 A;  2QWN B;  2GGR A;  2EJR A;  2G6F X;  4QQ6 A;  2O2O A;  2QWP B;  4DV6 B;  4JF3 A;  4N21 A;  2Z0W A;  2NN4 A;  3EG1 A;  5KYW A;  3NFC A;  2QQR A;  1X43 A;  4ZGE B;  1VQ4 Q;  1QW1 A;  2DIL A;  1KP2 A;  2RH2 A;  4ZIB A;  3CCE Q;  1X2Q A;  4MVR A;  4K35 A;  2QQB A;  1QQC A;  1MZE A;  4KP4 A;  2UU9 B;  1ENV A;  1GKF A;  2DL8 A;  3LH0 A;  4DA4 A;  4WFE A;  3T1Y B;  4C0F A;  1GBQ A;  2AHJ B;  4TQF A;  1VQ4 V;  4OB3 B;  1GRJ A;  1WNL A;  3E1S A;  1IBL O;  4C8Q D;  4UCV A;  3ASO B;  1K73 R;  5CA1 A;  1IBM O;  2E4H A;  4O2A A;  3CEY A;  1HJD A;  1GAX A;  2EYW A;  2K2M A;  4J6Y A;  2P6J A;  3OW2 P;  1L0L H;  3ABM C;  1W2B U;  2MMP A;  3LYI A;  4E6R A;  2DRM A;  2DTI A;  1G3S A;  2VQF O;  2ZPG B;  4KUI A;  4UFZ A;  3VU3 C;  4IIJ B;  1YHQ V;  4BUG A;  1X75 C;  5LHG A;  3K06 A;  3V8J A;  5A0L A;  2V8K A;  3CRR A;  3CMA V;  4DV0 O;  3RYI A;  1VQL A;  1X59 A;  3JAT B;  5FPO A;  2YSQ A;  4M78 C;  5D6Y A;  1CKB A;  1CPY A;  1WHJ A;  2A08 A;  2QR4 A;  1GXI E;  5GMK e;  1DGS A;  1NLO C;  4LFA B;  1BMF G;  1R3L C;  2XTA A;  1D1C A;  2AZS A;  4OF1 A;  3RT3 C;  2DW4 A;  2FPF A;  3JAK B;  3RMQ A;  2DTO A;  1IBM B;  3IFX A;  2IU3 A;  2RQV A;  1GCP A;  1Q6H A;  4DV4 B;  4UVA A;  4ZN1 A;  1SRM A;  1G8X A;  2HKN A;  4LF8 B;  5IJ9 A;  5GON B;  2ZDI A;  4FU6 A;  4B9X A;  3CX5 F;  4L59 A;  3VV0 A;  4JRP A;  1ZX6 A;  2CP7 A;  1S76 D;  1NPR A;  3NHN A;  1Q81 R;  3VS7 A;  1KUQ A;  1I1J A;  1PC0 A;  3VKI A;  2Y90 A;  4IUP A;  1JXM A;  2F69 A;  1AIL A;  4XTV A;  5LJ5 e;  5CR2 A;  5CMU A;  2CS7 A;  3JAS B;  1NBM G;  3T4D A;  1T3L A;  2KRS A;  5J26 A;  1UEC A;  6AT1 B;  4QGP A;  4LF7 O;  1AHJ B;  3CCJ V;  3ME9 A;  4PJJ A;  2E65 A;  3CCQ A;  4PJO E;  4FPP A;  5KHK A;  4PA7 A;  2PYJ A;  1TOV A;  1JA8 A;  2ZM6 B;  2JTF A;  2ED0 A;  3VJP A;  4R55 A;  4QPK A;  2X3X D;  2GQI A;  1CKA A;  1H2G A;  4F7U E;  3RYF A;  1QCF A;  1QVG U;  4MML A;  1AR5 A;  1M1K U;  4PHZ A;  4XTW A;  2O88 A;  4H13 B;  1NLP C;  2P67 A;  4D8D A;  1XNR B;  5JQG B;  5IYB O;  2ZPI B;  5IXF A;  4DV3 O;  2RQT A;  4DBR A;  2A06 H;  4E7H A;  1K8A R;  1R8O B;  5GAN 4;  3A1P A;  3WFV A;  2DJQ A;  3BA8 A;  1D3B B;  2RI5 A;  1F23 A;  5CIU A;  2PF4 E;  4KHP O;  4XDJ A;  2Q0O C;  1W4S A;  1ARO P;  4GKJ O;  3BAA A;  2CUB A;  1YTF D;  4NB5 A;  4YJ2 A;  5F2V O;  2F1L A;  2OAW A;  2DYS B;  3OEH G;  1FXV A;  1R3K C;  1XBL A;  5ITZ A;  3MHH C;  1YCI A;  2WA4 A;  4NXN O;  2RJC A;  5KUK A;  4OPA A;  4ME7 A;  4FW2 A;  4EMG A;  5KYU A;  1VIB A;  3OW2 A;  4Z1V A;  1EFN A;  4NS5 A;  3C12 A;  3ZIA G;  4II1 A;  1S3J A;  4PKC C;  1RAE B;  5FU6 C;  3WB1 A;  4EPC A;  1E1Q G;  3FJ5 A;  5ECA A;  5A9G A;  1ZL8 B;  4LBE C;  2UXD O;  5L8R E;  1UEB A;  2E64 A;  4B3M B;  2FL4 A;  4IGG A;  1AWJ A;  4UV9 A;  4AIL C;  4HVW A;  4E7L A;  3H1I H;  1BCO A;  2O4X B;  3TET A;  2EGA A;  2IJK A;  4IIM A;  3VRZ A;  2CP3 A;  3H1H H;  3G6B A;  4J10 A;  2M02 A;  4LE9 A;  1UGQ B;  3NGP A;  2OTJ Q;  3CCU Q;  5FWC A;  5LGU A;  5FWB A;  1W0J G;  2LX7 A;  3RBZ A;  3ZRW A;  4G27 B;  4Q20 A;  1G3Y A;  2ZXW C;  1IX9 A;  3CEI A;  2ZCE A;  4OB1 B;  1J5E O;  2CH4 A;  3EXA A;  1Y71 A;  1WQW A;  1FFX A;  2X51 A;  4DUY O;  2XAQ A;  1RAF B;  1YWO A;  3X28 B;  1NT2 B;  3THK A;  2KEA A;  3VRY A;  3SD4 A;  4A4G A;  4DR7 O;  2AHZ A;  2YEV B;  1SKU B;  2XDP A;  2YLB A;  5GAO r;  5LYJ A;  5AT1 B;  2P4T A;  3RGB A;  4X9Q A;  1NQT A;  4JI8 B;  3WU2 Z;  2EIN C;  2EIN B;  1OCR B;  2CH7 B;  4M78 E;  3C95 A;  3HSB A;  4FT4 A;  1BHA A;  4U7O A;  1S0V A;  5LJ3 e;  2O01 E;  1TUG B;  3A0B Z;  2VQF B;  4O4I A;  3HRT A;  1N9R A;  1Z2G A;  4RTU A;  1HNZ O;  1N8R C;  2C0O A;  2ZXW B;  4ZTF A;  2EZP A;  2EKH A;  2JT4 A;  4UB6 Z;  4DV7 B;  2P06 A;  2DEQ A;  3RVZ A;  2DIQ A;  4RQF A;  5LJ3 d;  4U7N A;  1QLE C;  3CCE V;  3TSW A;  2Q7H A;  2B1G A;  2KE9 A;  4BB7 A;  3G4S V;  1YZB A;  3M7M X;  4LC1 A;  1CSK A;  2EPD A;  1DF4 A;  3I56 A;  3AT1 B;  3HRS A;  3S3O A;  3ABM B;  3CCL V;  2X6C A;  1FXX A;  1R0C B;  2E76 B;  3CCS V;  4QE7 A;  4FIP C;  5GAM j;  2ZQM A;  2BE9 B;  2XDB A;  1F1B B;  3SPJ A;  3ASK A;  7AT1 B;  3URG A;  3G4S Q;  2DL7 A;  4EFE A;  1B34 B;  3FJP A;  1W2B P;  3OSS C;  1YJN T;  2KT8 A;  2F4V O;  1GM9 A;  2BTQ A;  5HKC A;  5LJ5 j;  2LP5 A;  3A2F A;  4MVO A;  5BXZ A;  3TJT A;  3W7S A;  2K3Y A;  2QKS A;  2ZE5 A;  5J2U B;  3ZMU A;  2E1H A;  1ZAU A;  3QVN A;  2YI9 A;  2K79 A;  4JUV A;  1M3B A;  4UUJ C;  5LL6 S;  4Y91 A;  3K3W A;  3G6E A;  4O4J A;  3P30 A;  2QXF A;  2D0Q B;  2LDM A;  3N27 A;  3UT5 B;  1WXT A;  2C2A A;  1AWO A;  3S3N A;  4KXR A;  3CCM A;  2KYB A;  2DYI A;  1X69 A;  2DMO A;  2YLC A;  3JRZ A;  4WFG A;  2CGO A;  3P3P A;  1MV0 B;  3I5D A;  5EZY B;  1ZLM A;  2AT1 B;  2ZCF B;  4CH3 A;  2G38 A;  2QA4 Q;  5DY9 A;  3B8N A;  2XK0 A;  1I07 A;  1UG1 A;  3M55 A;  3OMA B;  4X64 O;  4RUG A;  4DR7 B;  1U8R A;  2EIK B;  1EFR G;  4BE2 A;  1WHM A;  2EIM C;  3MO8 A;  4I55 A;  1B6Q A;  1ABO A;  1Q86 U;  4PA3 A;  2DJZ A;  2A79 B;  4M7A F;  1IBK B;  2A36 A;  3E8G A;  1MSD A;  3LDC A;  3MHS C;  2ATC B;  2E5L B;  4OMO A;  1GN2 A;  1YCS B;  1T0J A;  3RYC A;  1GCQ A;  4AI8 A;  1BT8 A;  1Y74 B;  3B40 A;  3LDE A;  1V76 A;  1ZUY A;  2QEX Q;  2QDO A;  1GN3 A;  2D2C B;  1EBO A;  2GHY A;  5C6S A;  1UE9 A;  1W2B S;  1RAG B;  3QBY A;  4OMP A;  1P84 F;  3JCM V;  3AG2 C;  2EAY A;  1VQL Q;  2Q6A A;  2Y4T A;  5GAN 2;  4D6T H;  5IT9 N;  4LNU A;  2PVO B;  1FPO A;  4XU0 A;  3CBP A;  4PJO C;  4JYB A;  3T1H B;  4QQD A;  1FYJ A;  3ASN B;  5I2S A;  2R57 A;  1HP8 A;  1NYG A;  2YXY A;  1JJO A;  2K9P A;  4ELY C;  4I50 B;  4WBN A;  1BI0 A;  4M78 B;  4NYK A;  4EB6 B;  2UUA O;  2V4D A;  2Y69 C;  2RQR A;  4C5G A;  4CH5 A;  1YIT Q;  1S72 Q;  2Y4X A;  2I0N A;  2QEX A;  2XI9 A;  2DWE C;  4O2B A;  5J9P C;  2AIR B;  1VAR A;  2CP5 A;  3OT7 A;  4M7D E;  3NTH A;  2LTO A;  2OTL V;  1Y4M A;  1MND A;  8AT1 B;  1VA7 A;  4GX0 A;  1VQO V;  5HFL A;  3JAW B;  1I0H A;  1G2B A;  4OGE A;  1BZK A;  3NR7 A;  5AG2 A;  2KBT A;  5D7U A;  1AWW A;  2HP8 A;  4V2S A;  3M54 A;  5LP6 A;  2VWF A;  1VQ9 Q;  3S3M A;  2CAZ C;  1SER A;  1GN6 A;  1HW7 A;  2X0L A;  1XNR O;  5A0D A;  1X4T A;  3IAY A;  1VQ8 Q;  1NYF A;  4JI3 B;  2C0T A;  5KX5 A;  2RHZ A;  2OYQ A;  1X6O A; 
#chains in the Genus database with same CATH homology
 2YXY A;  1SF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...