2YXYA

Crystarl structure of hypothetical conserved protein, gk0453
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
b'EQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYMLNPADFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISLLRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein, GK0453
publication title Structure of the hypothetical DUF1811-family protein GK0453 from Geobacillus kaustophilus HTA426
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08838 DUF1811 Protein of unknown function (DUF1811)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.880 Mainly Alpha Orthogonal Bundle Helix Hairpins Hypothetical protein YfhH domain 2yxyA01
2.30.30.340 Mainly Beta Roll SH3 type barrels. Hypothetical protein YfhH like domains 2yxyA02
2YXYA 1SF9A
chains in the Genus database with same CATH superfamily
4Y92A 1Z9QA 2Z0AA 2AZ0A 3WVDB 4DV6O 3QDRB 2PUOB 1GO3F 2VGNA 1Q7YW 1JJ2S 1J3TA 1QCOA 2XIDA 4J83A 2QEXQ 1RLQC 1QCFA 4W4KA 2HR3A 3PN1A 2MK5A 5DM6V 1V54C 2X6AA 3M0UA 2X4WA 4CI0C 1YJWT 1ZSGA 3JCUZ 4MTXA 2EQIA 1Q86U 2JVDA 4BE0A 5CB4A 1OV3A 1JOYA 2EQMA 4JI1O 3PVQA 4I55B 1M1KR 1PD0A 3L2VA 2E41A 4QPKA 4HT8A 4AFZC 4M77A 2CS7A 4MZMA 2DW4A 3CE2A 4DYLA 5L3GA 1YTFB 2QXFA 1EZJA 2XAGA 1KQSU 2DD5A 4JI3B 4GKKB 3UT5B 1QMCA 4YIOA 4RCCA 4NS5A 2P90A 2I0NA 2RQ6A 1EM1A 1MNGA 1R3KC 3CCQV 3GLXA 3J80N 3JAWB 4FK5C 4MMKA 1WZOA 4E2FB 1PKSA 2FEIA 1B7TA 2YC0A 4FLVA 2VV5A 2KXCA 3X2QC 2PTKA 1FFXA 1E6GA 2AT1B 1MZFA 2XNDG 3SEMA 3IQLA 3CMEQ 4NTYA 4DR2B 3CJHA 2ZPBB 3OBWA 3D3IA 3H0IA 4BACA 1PC0A 1M56B 5ECAA 2ZE8A 1M2VA 2OIEA 2EGCA 2UUCB 5JCOA 1WHMA 4YHHO 5AG2A 3A2FA 4UVCA 4O5VA 3DC6A 1YHQA 5CB4B 1KKDA 2LZ6B 1M90W 3LGFA 1VQ4A 3LSQA 1UJWB 4UCSA 3CC7V 2YIDA 2QK0A 1J5EB 3LWIA 1M56C 1HP8A 4B3TB 4M77B 2KT8A 4CC4B 3QWXX 3TQ7P 3IC9A 4NXNO 3M57A 2HG5C 3AG4B 2RO0A 3NTKA 3PT9A 1S72Q 5EK0A 1RM1B 2DVEA 5LJ3h 5KCHA 3KCXA 4M7DE 3QG5A 1WQWA 4BR6A 1U96A 1ZLZA 1MSWD 1P7BA 1JMKC 2Q7EA 3ZMUA 3T2MA 1K9AA 2K2MA 2PVOB 4F14A 4M77C 2QR4A 2IW5A 1FJGO 3FEOA 4RTVA 1R8OB 1PKTA 3JSCA 3UA7A 1NJIR 4M75E 2OCHA 1RM1C 1FFXB 4P9PA 4MTOA 2RJEA 3M53A 4NTWA 4FYVB 1TUCA 4FL6A 4O2AA 2EJRA 4ZHQA 3CJHB 1LOJA 2AW9A 4JI7B 4X1VA 2RQTA 4ESRA 2RJDA 2DYRB 3LW5E 3H1IH 4LR3A 3ZMZA 2NUPA 2QQBA 2KAFA 4OGEA 3GBQA 4QQGA 2C0OA 4JJNK 2JW4A 1K4CC 2VGMA 1H2NA 4HKEA 2FRWA 1L1FA 4PV1B 2EQJA 2DYRC 1YIJQ 3DTUB 2XMFA 3DC5A 4DV4O 2ZINA 1BT8A 1QP2A 1YJNA 3A8LB 3CCEQ 1YVWA 1YXBA 1XILA 3MPUB 5JCOC 3VBBA 3E8BA 2RMKB 2DD4A 2WSCE 4LF6B 3A8HB 4J7FA 1CEZA 1QP3A 2HDAA 1KHCA 3H1JH 5DECA 2Y4UA 2DAQA 3MDSA 4YJ3A 2X6CA 3ABTA 5EZYA 1Y0MA 3NTHA 1YSCA 1PSFA 2A3QA 2PZ1A 4FLWA 4O2AB 4EB6A 4ZHQB 2ZR2A 4DV3B 3VV0A 2V7QG 5ITZA 1NTMH 2RCVA 2NUPB 2ED1A 4J9GA 4DUZO 4AT1B 2HJDA 2X4XA 3WFVA 1OCCB 5CMUA 2D8HA 4OMOA 3HKEA 1TUDA 5GANj 4JZ2A 2M0YA 1YHQT 4LN2A 5LOVA 5KX5A 4MVUA 3WG7B 3J81E 4B6MA 5LJ3g 3TCJA 4JTDB 1WA8A 1VQOQ 3I56A 1NBMG 2RQUA 1R6KA 2LFRA 7AT1B 4ZIBA 1SQBH 1R6NA 4C8QD 1OCCC 1I5LA 2ZT9B 3WU2Z 4DR6B 4PJ0Z 3ASKA 3IC7A 3QG1A 1TA8A 4BE1A 1M30A 2FZCB 2HBWA 3E19A 3WG7C 1WQ7A 4FIBA 4IUTA 1VQ4T 1I5YA 1U97A 3CEIA 1WJSA 2F4VB 1D2DA 1WDXA 5GANh 3R66A 3QO5A 4QGPA 4RMOA 4F7UF 2W10A 3OR6C 1NPPA 3CBMA 3QBYA 4C5GA 4R56A 4X1YA 4YJ3B 1SQQH 4U3JA 3TCUA 1ZHIA 2DTHA 3ASNB 5EZYB 3BPZA 4LWSA 3TJTA 2ZQMA 1KKCA 2J05A 5GMKm 1VQ7Q 2VRZA 4X8AA 1KC8R 1KQSS 4ZGEB 3PJSK 3OMAB 4EB6B 1DF4A 1G3SA 2HD0A 3L2WA 3ZEDA 5ITZB 3RVZA 3OY9A 1PPJH 1UDLA 3ASNC 4LUDA 5HKCA 3HKEB 5LOVB 5KX5B 1K76A 3T1YO 2CK3G 2IJJA 1W6XA 3BW1A 2JTEA 2L89A 4IIMA 1QQCA 1WA8B 4Z1VA 3NHNA 2QAZA 3H8ZA 1K9MW 1RSOB 1YCIA 3OB9A 3MO8A 2QKAA 1PL4A 2E12A 3ZBDA 1N8RU 2PYLA 4OF1A 1N4CA 1JFFA 3JD2A 4JI6O 1XMOB 3META 1M1KC 3MHSC 2KDSA 1COWG 3OE7G 2CTPA 4JI0O 1ZUKA 2HZYA 3ER0A 3L72H 1IHVA 5CIUA 4O6JA 1OPKA 3FRNA 3LWHA 1W2BU 2MOXA 1YJNT 2FL4A 4B7EA 2DRMA 4X1YB 1TOVA 1TWBA 3L75H 4U3JB 3OYCA 1Q82W 2EFIA 3C4SA 1YHQV 3ZRXA 2WSFE 4DV6B 1M2OA 1GM9A 4EFBA 2COZA 1B34A 1TS9A 2X7RB 4CRIA 2DE0X 3SPIA 4F7UG 1UHFA 2ZNIA 1NQTA 1MHNA 1SRLA 5EYPA 1D5AA 2A9HA 1Q43A 5KHHA 1S1NA 1S77D 3ABMB 4DOWA 3DKMA 3OMCA 4TV8A 2DPPB 1OI1A 5IAYA 2JMAA 1G1XB 1SQFA 4JI1B 5JVDA 4JJBA 4RTYA 1N0JA 2AHJB 2VS0A 3CCVA 3RYHA 1IX9A 2JDIG 3R6NA 4PLIA 2J6FA 4RWUA 4OPAA 3ABMC 5GANg 2FHDA 1GBRA 3E8FA 2OTLV 1W0KG 3HPLC 1JCHA 5DY9A 2Z0WA 2YXYA 4JRQA 1JFFB 3FJPA 2JGUA 2JT4A 2EZPA 4R0KA 2LW1A 5EG2A 2ZD9A 5I22A 1IREB 2LMJA 2JJ9A 1VQ9A 1D09B 4RCBA 4JZ4A 1Q81R 3VQYA 4ABMA 2K5FA 4ZN3A 4NXMO 1VQ6T 1TUGB 3W7TA 1O9SA 1Q86W 1B34B 2LX9A 5LBQA 3REBB 1JPXA 1I7FA 3E22A 4TSFG 1OPLA 2DO3A 3JCMW 1G4YB 5EYPB 1VQKV 1QCNA 5A0GA 1YJNV 3MEWA 3JAME 1TUBA 4YHHB 2R57A 1K4DC 1SRMA 2VWJA 4BI4A 3OW2P 1NZ9A 4ZKIA 5LL6Y 4DUYO 1JU5C 4TV8B 5GMKi 2EPDA 3OBYA 1U8RA 2DJZA 3UPUA 1M90R 5JVDB 4M78A 4PI0A 2YLBA 5CBGA 3RYHB 1HD3A 2XDPA 3RKYA 3I55A 1AR4A 1X69A 1SSHA 3C95A 2XAJA 2ZIMA 4NXNB 2OTJV 2R9AA 1XBLA 2QM8A 1M8MA 4X65B 2HSEB 2RQVA 3TREA 4KGVB 1PD3A 3OFNG 2UXDB 3GNGA 4J6YA 1PRLC 4FYWB 4QPJA 1VF5B 2XUMA 2KROA 1IO6A 1YF2A 2KR3A 4DBRA 4DR4O 4BY6B 5IT9E 4MVQA 1FJGB 1RAEB 3ZN0A 1SEMA 1TXQA 3EHQA 4AG1C 3JD3A 3CPWU 2JMCA 4RG8A 3L2UA 2XAQA 2E1HA 5D5QA 2L3RA 4CC5A 3ASOC 3E9FA 5CK9A 4MDXA 3A1PA 3JCMP 3U10A 3I56V 3E22B 5CQYA 3JRZA 4BWAA 1E7OA 3QF7A 3FB5C 5LGNA 4HVVA 1IXDA 3KKYA 3K5LA 5DN6G 1MNEA 1TUBB 3JYCA 1YFNA 3OYAA 4PJOA 1E1QG 1VQ6V 3QZ5B 1IBKO 2P6JA 2UUAO 4X20B 4LFBO 4M78B 1KQSP 1V55B 2EJ9A 3KZIZ 4DV4B 2YIAA 2R5MA 1I81A 4NVPA 1MUZA 5A9GA 3UA6A 3L70H 2JEXA 2UXBO 3CEYA 4JI8O 2JVVA 5CKEA 3LDCA 3CC7Q 3BDUA 3CCLA 1K97A 1TTHB 2RI2A 4MDWA 3EG1A 2HEQA 3AEIA 3P3NA 2DBMA 5GAN2 4M78C 8ATCB 5DLQE 3EAEA 3MEAA 1V55C 1AOJA 2K2VA 1H38A 4IYHA 4BI8B 2DXTA 2KYMA 1ZA1B 4LNUA 4HBNA 2DNUA 2VWKA 2D8JA 1VQ5A 1Z5WA 1QVFA 2PI4A 4C8QC 2FKXA 3BFRA 5GTIZ 1VQNT 4GX5A 5CO7A 3BE3A 4OMNA 4TWKA 5KHIA 1VQ9T 2NNUA 2UUBO 3MJXA 4H44B 4RUGA 3SYOA 1BB9A 4C92D 5KYNA 3QO7A 4EDUA 1W2BS 5AYFA 2CSIA 4M78F 4PJOB 4QIWF 1KC8C 4HA8A 4OP0A 3OMIB 1IHWA 4HZ3A 1OEBA 2WLHA 4LDYA 4RTZA 2OI3A 2Y4YA 1GH6A 1KD1R 3L74H 3V7CA 2M1HA 1OCZB 4PELA 3SD4A 1R0CB 3SDLA 4OMLA 1SZXA 2Y0IA 3RR6A 4UB6Z 3S6WA 4RUFA 3QO8A 2ED0A 4DW0A 4FMTA 4RO2A 1ZX3A 5L3FA 3M56A 2R5AA 1F51A 1LNQA 1SF9A 3PVLA 4IURA 4JLIA 4U7NA 3I55T 4PA4A 1M9SA 5GAMf 4LNUB 3U11A 2W0FC 4PFOA 4QKUA 2XHBA 5L3EA 2LCSA 5LXTA 3E83A 1T5EA 3CCSV 2QA4A 1UGSB 2ENMA 3CCVV 3ABUA 1X59A 4FM2A 1XQ8A 3OAAG 2KK4A 5LJ5e 1K5SA 2ZPFB 4PJOF 3PE0A 2XICA 4NR1A 1YI2T 3CCMV 1M5Q1 2GHYA 2O88A 1UE9A 3X20B 4LD9K 1BCCH 2PVGB 1Q7YC 3T1YB 1BE3H 4MVRA 3ML0A 3RW0A 1Z5VA 4GYCB 3OYBA 1VQ9V 4OMPA 1CKBA 5LJ5j 3UWNA 3CCJT 3QYGB 4QQ6A 2Q73A 4BUGA 4L6V5 4M7AB 2D0QB 5GAN6 1AR1B 4JI6B 2UUCO 1FYNA 4XU0A 1WLEA 3TSZA 1Q6IA 3SJBC 2WACA 2F1LA 2GQIA 3FB7C 3OQ5A 4JI0B 4UCUA 1MV3A 2DIGA 3TVTA 4MW8A 2IBZH 2KQWA 4A53A 3SGIA 4N4IA 5GAOq 1XREA 2GFUA 4B3TO 3K5OA 1UUEA 3NGPA 5LXTB 4OMFB 2XHCA 3CCLT 1Q82R 1BCOA 2M7WA 1B3QA 1XJWB 1D0ZA 2DETA 5LJ5h 1JX9A 3SJAC 2QQSA 3EH1A 3PFSA 4LXCA 4DXWA 1FXXA 2YUNA 3OSSC 3JB9I 1OHHG 1QVGU 1SHGA 1N32O 2EINB 3I55V 1YITV 2RHXA 3RT3C 2VYTA 1VYTA 3CQTA 3K79A 2CP2A 4CC3A 3UM7A 1W1FA 3S3NA 2EWNA 4KULA 2W6IG 3CPWS 4PJOG 1OJHA 2FPDA 1N8RW 2NLUA 1WP8A 1JJ2A 3I5DA 4M7AF 4GLMA 1RAIB 4J9BA 1AI7A 1R3LC 3G6BA 2O9VA 4E47A 4AFSC 2EINC 3N5BB 4PFZA 1ABOA 4XDLA 1AWJA 3VU3C 1AD5A 1OZ3A 2DEQA 3KBGA 1TG0A 1M90C 1S5LZ 2IJHA 4NYKA 5EIBD 2CUGA 1XOUA 1VQ8A 1OV9A 4HCBA 1UB4A 1SC5B 2DILA 4U7OA 3RUXA 5GMKh 4UC4A 2QM7A 1TVKB 1ZBXA 1RACB 2HP8A 3E35A 5KMGA 1NEGA 1URFA 4DV1O 2GTSA 5CR2A 4NXMB 2M02A 4C0DC 2HKNA 3CBPA 1WB8A 2E3HA 3LUTB 1N6AA 2KRNA 2KVQG 3SHWA 4ZOLA 1HNXO 4JLGA 4F6EA 3NXSA 4IL6Z 4AMCA 3HKBA 3K08A 2LNVA 1BSMA 1YJWA 2W0XA 1QVPA 1K34A 4DUYB 2VC8A 3SPJA 3CCLV 3FDRA 1Y57A 2QA4T 4KBMB 2XT9A 1TUEB 3GWOA 4KGZB 4DA4A 3JCMd 1RAHB 5L23A 3CMAQ 3JB9J 3CC2T 3ABKC 1Q90D 2EYXA 1U1TA 2E5QA 1LNXA 5CBHA 3CX5F 4FIPC 3JB9D 4LBEC 2MMPA 1WPXA 1YJ9T 1VQ5V 1IDSA 1K4US 4J6XA 4M7AG 2IM9A 3BY6A 2QGFB 3QJYA 2XDBA 4TT3G 3UO3A 2ZCEA 1AJNA 5KHGA 2O4XA 3K5NA 1AP6A 3G1JA 2DXCA 4DR4B 5LJ5g 2OTLQ 1PM3A 3X25B 1MNDA 2F23A 5KMGB 3G67A 3P8HA 1NBEB 1Y76A 5GAN7 2WSEE 1GRJA 3TU4K 2JZ2A 2ESWA 1K9MU 4Z1MG 3EFFK 3GOXA 2DIQA 3URGA 1X6GA 4ZOLB 1PWTA 2Y0PA 4JV5O 2P22C 3HKBB 1UJ0A 4PA7A 4PFPA 4KL1A 1NTZH 3K0DA 4EFEA 3OYFA 1AEYA 3SPHA 1J95A 3F5WC 5B3SB 3ZL7C 1IBKB 1VQKQ 4LFBB 3K0GA 3MD0A 5K1XA 4FLYA 1KFZA 5KE3A 2HFEC 2V1QA 4J9CA 3JCMb 3N27A 3VQVA 2UXBB 4JI8B 4JS5A 5E1AC 1NH2D 4CH5A 2RH2A 3MP1A 4C92C 5KAIZ 3B8MA 1NLPC 2C06A 2QA4V 3OEEG 3ZRSA 1OOTA 4BB7A 2COWA 2O4XB 4FW1A 3CD6Q 2OTJQ 1TAEA 1WYXA 2WWWA 4O2BA 2LRQA 4XTZA 3GPLA 1HJDA 1GM7A 4F6RA 3OW2U 1JQQA 6AT1B 3FC3A 4XDKA 1W59A 2R72A 4J8OA 2JK5C 2KI7A 4J9FA 3OM3B 1AJPA 2LQKA 1Y76B 4GUNA 5A2QN 3K59A 2RHUA 3EHRA 4XBFA 3A8MB 5FRMA 3H1HH 4WTOB 1FD9A 5CN0A 3U23A 3L2RA 1GRIA 5GAMh 3B4SA 1UPGA 2UUBB 1F1BB 2KE9A 3IAYA 1X75C 2C0IA 3PMIA 5H6RA 1TH7A 3LSSA 4BW9A 2HMAA 1V54B 1NE8A 4M7DD 3UF4A 4A54A 1VQLQ 3LNMB 1B04A 3I56Q 2BSKA 3VS1A 4QW2A 4X66O 1NT2B 4UCOA 2EIMC 2ODMA 1SPKA 2CGNA 2L35A 3FFQA 3QKJA 1OULA 1VUBA 1X2QA 4M75D 4J9ZB 1UEBA 1AI4A 2BZ8A 4G27B 4FFKA 1IBLO 4C0GA 1Y7XA 2KMTA 4IYIA 3CB2A 1IBMO 3CPWP 1WNLA 2DL5A 1P4RA 2L0AA 2EJ7A 2KB1A 5KYXB 1K9MC 1SRYA 1LJOA 4ZGJB 2BOBC 4O2BB 4Q6GA 5KA6A 3G4SV 5HFLA 5A0DA 4PDVA 1ENVA 4LF4B 2HQHA 2IJIA 1R1BA 3ETGA 3RKWA 4E2LA 3X2QB 5FROA 3C94A 5LL6S 5KHJA 1BHBA 1GFCA 4E7KA 4NL2A 4DOVA 4DW1A 3E2EA 3E86A 3M4GA 5GAN5 2EGEA 1N36O 3MHHC 1Q82C 2E5KA 4C0FA 1JRIA 4JI2O 2DWEC 2HEPA 2WA3A 1S0VA 1VQ8V 2KG7A 4EPCA 1KQSA 2BSKB 1AWOA 1QWFA 4CH3A 2IG0A 2RQRA 1VQPQ 4JAAA 3K5MA 2ZXWC 4F7UE 1OCRB 4X1KA 3REAB 5FNVA 3CCMT 3ZBHA 3WVEB 2RJCA 1GKFA 2CH7A 1I5XA 1HK9A 2HL3A 3RVYA 1WNSA 2CZ1B 5HFMA 4EIKA 4QVDA 4UB8Z 2K79A 5GAMg 1PP9H 4I5SA 4KXRA 4H33A 1OCRC 1YJWV 2FL7A 2H8PC 3VJPA 4FPPA 4DV7O 3QYHB 4X65O 4JAVA 5A0LA 1GN3A 2UXDO 3VS7A 3SJQC 2XOKG 1RL2A 2PZSA 2ZKOA 1N32B 1XNRO 2F5TX 3OMNB 3G6ET 2O31A 5AT1B 2YT6A 1AJQA 3CCSQ 3K04A 1EX4A 3T4ZA 3CCVQ 2BCCH 3L9DA 2ITCC 1PRMC 4YIPA 1Q86C 2ROLA 1HW7A 2NUTA 1IXBA 2GV9A 3G71A 1XHXA 2KG7B 4AILC 1N8RR 2XU8A 3DSQA 2ZDIC 2G38A 3CCMQ 3E1SA 2KSDA 1QLNA 1YN8A 3BVOA 3HKSA 1AI5A 4X1KB 5GTHZ 2P06A 1M2VB 4B3MO 4O4LA 3H41A 4OXSA 4FM0A 2CH4W 5FNVB 3DGEA 1BKBA 4OMMA 2YEVA 2QI2A 1NLOC 2IJKA 4Z89A 4I9WA 2CH7B 2VXFA 4OB3B 2JGDA 3UKMA 4M77F 2EJGA 3IGAC 4X64O 4NTXA 4QE9A 4KH0B 4DV1B 4PJMA 2PF4E 3AG1C 3BABA 2DF6A 2EYZA 2X0LA 2ZCFB 3CCRT 2QJ1A 2BE9B 3X26B 1MV0B 3BEHA 4JRKA 4L5GA 2FO0A 2H3OA 1XL4A 2DLPA 1HNXB 3SB2A 1YNZA 1NU1H 3OYYA 4U3FH 3ZRWA 2C0TA 2KQXA 4D6TH 3UO2A 5FW9A 5IHIA 3OW2S 2NUZA 2YXLA 4FZ1A 3IFXA 4WCEV 1PNKA 4UVAA 1Y96A 2RHIA 4IUVA 3V8JA 4M7DA 1KP2A 4CS3A 2NUTB 1K92A 1AP5A 1YITQ 5EBWC 2P7TC 3FB8C 1JR9A 4EKWA 2VB6A 4JTAB 1P84F 1N34O 4H37A 3I35A 5C6SA 3FYIB 2JTFA 2KEAA 4O4LB 4JYBA 3RDVA 3CRQA 2YEVB 3A0RA 4A4GA 1GTOA 1UTIA 2CGOA 4BIZA 4HCCA 3JCMc 3H9NA 2JGDB 1FX7A 1MMGA 2DL4A 2V26A 1HNWO 2KRMA 4LNPA 3S3OA 1DGSA 4DR7O 3I5RA 1QVGP 2SRCA 4M77G 1QW1A 1FFTB 2D3OW 1LUVA 3ZJZA 5GAOr 1D3BA 2CE4A 3OTOO 2RN8A 5IHNA 1OZ2A 1K73U 1L8DA 2P0QA 1FMWA 2L3PA 5H2FZ 4UVBA 5GW7A 4JV5B 1VF6A 3ZRWB 2VWFA 1SQGA 1YCSB 4E4EA 3A98A 3KUFA 1SS3A 1R6TA 1NVPB 4FSXA 4PD4F 2K1EA 3FB6C 3AK2A 3AT1B 2M9UA 1ZAUA 2FYUH 1N5ZA 1BI1A 1GCPA 2QKSA 1Y96B 5FWCA 5C0MA 4M7DB 2LVMA 2O9SA 1AILA 2W0ZA 4ORZA 4MMLA 2ECZA 2GNCA 5GAOl 4J7KA 1KIKA 2QEXA 5HCKA 3ZRVA 1R77A 3TSWA 3VKIA 3ZEHA 2B86A 4GT1A 4HVUA 3CXCU 4PA6A 5EC7A 2OYQA 4Z2WA 3G71T 1M57B 4M7DC 3JCMV 3RGBA 4LDUA 1S76D 2CDYA 3LX7A 5LJ3d 2Q4PA 1VQ5Q 4O4IA 4XAXB 2KXDA 2D2CB 3CC4Q 1I08A 5IJ9A 1D5NA 1M9NA 1WA7A 2OAUA 2F1MA 3JASA 1BL8A 4L87A 1M57C 1AWWA 3C3SA 3OGCC 3W7UA 1E1RG 1PD1A 3FB9A 2Y90A 4OMQA 4XU3A 1HR0O 1D3BB 5DLOA 1ARKA 2ZM6O 5IYDO 4J6WA 2QDLA 3RIRA 1P92A 2RPNA 2WA4A 3M99B 2QSAA 4M7DF 2HL5C 1MABG 2M16A 2YUAA 2CZ0B 3H1KH 3K3WA 4LWSB 4B7KA 5IY5C 1IGQA 1VQ4V 1NJIU 4M4ZA 2HLDG 2EBPA 4X66B 2CZ6B 2KRSA 3CMEA 3CRMA 3SYPA 5B5EZ 2DTIA 1Q7YR 2BE3A 2O01E 2B5UA 2LCLA 4E7LA 1VF6C 4TOIA 4KH1B 2ZE5A 1R73A 3RYCA 1BIAA 1W2BA 2Q69A 5B66Z 1IBLB 3AG7A 4BAYA 5HK0A 3LDDA 5L3CA 3ZX6A 1MMMA 2GTOA 4UV9A 3CCUQ 1IBMB 5J3BA 5BZBA 1XUQA 2V1DA 3LH5A 2IVWA 1V29B 2DBKA 2FZKB 3H6ZA 3B8NA 4O4IB 3RYIA 2QTSA 3S3WA 5IJ9B 1Q3EA 5IH2A 1AR5A 2DM1A 3K9SA 1RPOA 4C5HA 4XDJA 2P4VA 2P4TA 3JASB 1L0LH 4X89A 1S72A 5CA3A 1OQKA 1VQNA 2RA2A 5GMKl 4YXWG 4IGGA 4PA3A 3EG0A 1ZBJA 1FXVA 4PL6A 1H8EG 1N36B 2O2OA 1MA1A 4WFEA 2E6NA 2K3BA 5LJ5f 1GXIE 4CBCA 1NYFA 4JI2B 3ME9A 4C0ZA 4DV5O 1VQMQ 2WLKA 3M0RA 4C5EA 1RAGB 5EBLC 3F7YC 2QWOB 1Q95G 2RNBA 2D0NA 5IWAO 3F5TA 2H8HA 5D5PA 4J9EA 4XTYA 4PK4A 2YRDA 4DBQA 3RYCB 4RAIA 3NPFA 3BCCH 2DMXA 3A8TA 2MPXC 3E2UA 2PUKB 1N8RC 2LJ0A 3H01A 2LTOA 2PI5A 2RN9A 3FD9A 4GKJO 4IIOA 2J06A 3HRSA 4XQ3A 3TETA 3S3MA 4PJOE 5CKHA 3MEUA 3OYLA 2QEXT 2AGAA 3RYIB 1I07A 4R50A 4UUJC 2QTOA 1WLPB 2HVKC 4NB5A 1A32A 3CCEA 4FSSA 4DV7B 4LE9A 3O5ZA 5CKDA 1UGPB 4C8QA 3OS0A 3AK1A 3M0SA 2E5LO 3ASOB 4X9QA 2Q0OC 3G4SQ 3M5AA 1XNRB 4FLZA 4P30A 1VYVA 3MEVA 1JA8A 2DYSC 1D1BA 1YI2A 1AZEA 4P9OA 3QO3A 1QHTA 4W4LA 3TK1A 1BU1A 1I94O 1WIEA 3VS6A 3CCQQ 3BFMA 2XDDA 5H5NA 2E3IA 4XU1A 2GTJA 3CCJA 1OZ0A 2LP5A 1VQ8Q 2LQWA 4B3MB 2Y48A 2LO1A 1MMDA 4NOYA 2A28A 3CPWA 1AT1B 2CDTA 1QKXA 4CC2A 5LP6A 3CMET 4X64B 4E7ZA 3M8AA 1VQOA 3QSUA 5CQXA 1ZUYA 4A63B 4OGCA 3AG3B 3RERA 2DYIA 1IURA 5KH6A 2BTOA 3M0PA 4OX9O 4KHPB 1BI3A 1AROP 1E79G 3HR0A 1RP3B 1RPRA 3SDZA 4C8QB 3CXCS 2RD1A 1OX8A 2W6JG 4M7AE 2B9ZA 1JBMA 1M3BA 2SEMA 1YJWQ 4FU6A 4AHCA 1ZLMA 3BY7A 1V9PA 2DZ9A 3AG3C 2DFUA 3QXEB 4OB0B 1S72T 2M6YA 3KCYA 2JS3A 2DTOA 4WF9V 1VQ7A 3JAMN 2F2VA 3SYQA 4YTLA 1TU0B 2XAHA 5GAN8 1CKAA 3K9AA 4MVZA 4EMKA 1QCEA 2UXXA 4J10A 3EFOA 2Q0AA 1N34B 1BMFG 4N0AA 2RMOA 1K0SA 5IJ0A 3JCMe 4ZTFA 2FB5A 4AFUC 1KYOF 1WHHA 1CP9A 2DVJA 2CREA 1DF5A 1H8HG 3ZHUA 3OYKA 1B6QA 5LP6B 2LW7A 1HNWB 2F2XA 2LC4A 1MGQA 5KE2A 1T3LA 4DR7B 4BW5A 4C8QF 1O9GA 3AK3A 2YIBD 1RI9A 4Z8AA 1XL6A 3KXTA 4FJCC 5GAN3 2R58A 5IT9N 3JCMX 3OTOB 3OMGA 1VF7A 1NTKH 3CMEV 5LP6C 1AVMA 2DKGA 1E6HA 3NMZC 3UT1A 1YIJT 2Y4XA 3A8GB 2P67A 3APQA 1H641 2QTVA 1PG5B 2LX7A 2LQNA 3UATA 3CCET 1QKWA 3RFRA 1FWZA 2DL7A 3UDCA 1Q81U 1EN6A 4LF4O 2JN0A 5CVIA 1YWPA 2BE7D 2RDCA 4B08A 2QG9B 3CC2A 3P30A 2CP6A 2LJ3A 3N2KA 4D8DA 4LD6A 3PIPA 2KSSA 3EFOB 4A4EA 2RK2A 2GGRA 5FLXE 4JJDA 3EG9A 1JO8A 1ZX6A 2D9TA 2GQVA 4UCRA 1YJ9A 3BRCA 5IJ0B 1K8AU 2X9HA 2QDOA 2JRIA 1I8FA 2VXEA 2RQWA 1VQNV 3X24B 2YUOA 2KNBB 3STLC 5LMUB 3ZIAG 1ZQ1A 1VIEA 4EMKC 4JAUA 4ZI7A 1ZSZA 3QUIA 4M78G 2RI5A 2O57A 1O75A 1K9MR 2EIJB 4KP4A 1K73W 3M4YA 4N0AC 4AI8A 2H3EB 4F17A 2RB6A 2MYSA 5IHKA 1X01A 4MTFA 2KBTA 3SR2C 1HR0B 4ICGA 2CYZB 5KYWA 2ZM6B 4I9QA 5J2UA 2K9GA 1AI6A 1HWYA 4PA9A 4C8QG 1VQOT 4FVMA 2A37A 1G83A 2K7AA 4BDYA 2EIJC 1WN7A 3D36A 2EIFA 2JS5A 1FXKC 2XI9A 5HK3A 3OS2A 3OGIB 1BHAA 1VYUA 2D1XA 1D1AA 3L73H 1RADB 2HHHO 1UECA 3N2KB 1JXMA 4IUPA 2CH4A 4D7TA 3Q4HA 3ZHQA 4TVRA 3EG9B 1ZWIC 3CCEV 1U1SA 4FW2A 2HVJC 4B9XA 3RNJA 4FCYA 2EBOA 1BI2A 2GSMB 1MOFA 2MF2A 1YTFD 1VQ7T 3EH2A 4RG2A 4GX1A 2A7WA 2HBPA 1IB8A 2K5IA 2PVDB 2DQ0A 3CRAA 2ETNA 4ZGDB 3J7AF 4RQFA 4ZI7B 1ZSZB 2LQTA 2QWNB 1GFDA 3WXMB 1YI2V 1JJ2U 1YBYA 2LNHB 3HRUA 4AQYO 2QWPB 4C0DB 1B07A 1EN4A 1UFIA 1RUWA 1LVKA 3E89A 2FTKA 4LP8A 5J2UB 1M4UA 1S3JA 3CP1A 4LDVA 3RKXA 2QWRB 1NJIW 2J6KA 3CCJV 1KB9F 1ZSZC 2DOSA 1WX6A 4DV5B 3VUZA 3JCMg 3T1HO 1T0JA 3HRTA 3UCSC 3OYHA 3OA6A 2WLIA 2OAWA 1RABB 4JRPA 2HAXA 5IWAB 3CXCP 2ILMA 1Q86R 4J7JA 3GNFB 1VQOV 4ME7A 3ABKB 1S5JA 5LA6A 2XAFA 4YJ2A 1YHQQ 5C8YA 3D36C 2BUDA 3Q4HB 5FPOA 1VQ4Q 1R0BG 2ATCB 4C92A 5L3BA 3EGUA 1KK7A 4BE2A 2CKKA 3M55A 3ZMTA 4GKJB 2NN4A 3VS2A 1VP7A 2B1IA 4K11A 1HNZO 2QWQB 1RAAB 3JV3A 4B3RO 2RJZA 4R7CA 4Q5WA 2LGQA 4X34A 1KD1U 5KAFZ 1OYXA 1N27A 2YS8A 1GK9A 2EQKA 5I2SA 2YIBA 5EC1C 3LLRA 2E5LB 4UFZA 1YDXA 5EBMC 4KT0E 1VQ7V 1DK1A 2VKNA 4MT8A 2YDEA 1WJQA 4A4HA 2A3LA 3OS1A 4JI4O 1EN5A 3ZHVA 2X3XD 1PNMA 5KUKA 3S3XA 1G3WA 2FRYA 2Z3YA 1WHGA 3LYIA 5JQGA 2UU9O 3DB3A 3LH0A 4CC7A 3FKSG 1I94B 3L42A 4E7SA 3QTCA 4DEXA 4PJNA 4CC6A 3VRYA 5GAN4 4DV2O 2WLIB 4JPRA 1I0CA 1KSWA 2EX3A 4Y28E 4WFBV 1MSDA 1ZUUA 5LA6B 4YJ2B 5C8YB 1XNQB 4P5NA 4C92B 5H6QA 1RFYA 3AG2B 4QJFB 4JPBW 1YJNQ 2EYQA 2I2LA 1M5IA 2AHZA 2MW2B 4WBNA 2QGGA 1QR9A 3OYEA 3ZHTA 1QWEA 4OX9B 1SG5A 2FB7A 2CTRA 4J7IA 4LFCO 3JB9H 1PNLA 2OIGA 2OX7A 2RHYA 4LCUC 2AK5A 3AG2C 1FAFA 4JJCA 2X4YA 3CC2V 3HPWA 3B09A 2FG0A 3G6EA 4LC1A 3J80E 3B2EE 4HVWA 1YJ9V 1AVZC 2AIRB 4FLUA 5JQGB 1G8XA 2NYSA 3DLLA 1PHTA 2B1GA 1PM9A 5DM7R 1VARA 4ZN1A 3P3PA 4M77E 3VQXA 2QQ9A 2CP5A 2EIMB 4C92F 1PKXA 2K3YA 4N23A 4X88A 5FL7G 3M0QA 4N4HA 3SWNA 3OW2A 4JI5O 4OVAA 1Y67A 3H0FA 3BDLA 4GBQA 3TXSA 1WPBA 4DEYA 1QNMA 1YEWA 5B1AC 2K6DA 4XTUA 4WBNB 5IYCO 2RNAA 1AZGB 1VQ6Q 4WFAV 1QVGS 2RM4A 4J80A 1W0JG 3SJCC 3CCRA 4BI3A 1H3ZA 1UHCA 4TUYA 3MP6A 3RMSA 2E74B 3B40A 3M7MX 1P7GA 2CUBA 5LMNO 1ABQA 1L0NH 2P5OA 2QE7G 3OYDA 4F6RB 5LHHA 2OCCC 2DL8A 2ZR3A 1IGUA 5KHKA 1F7YA 3D7SB 3CC7T 2K3XA 3BA9A 3PIOA 4O4HA 3C90A 1EFRG 1Y4MA 4CZZA 4MS2A 1AHJB 2MAMA 4GX2A 2ZDIA 2Y69B 2CUDA 4J42A 4JYYA 2YUQA 1H2KA 1X27A 2ZXWB 2DN9A 2BIVA 5KA5A 4LF9O 3SWNB 2HQEA 3TXQA 3HFOA 4JS4A 3A0HZ 4PLLA 2KYBA 4C92G 4JGSA 2Y69C 3EGXA 1SKUB 4MVOA 4N21A 2JEUA 3JD1A 4XU2A 3BA8A 3SWNC 2BKDN 3JAKA 1K73R 5LJ3e 5KYUA 1XMQO 2CTQA 2E4HA 1ZUQA 4DO2A 2VQEO 4LH6A 4TUYB 3BAAA 1Q81W 2F2WA 4J5YA 2Q5ZA 5LYJA 3C0CA 2V8JA 5KYYA 4UCVA 4PNOA 3HKCA 3OYGA 3F7VC 3CRRA 3OUFA 1QVFP 2YLCA 1NEBA 4HCZA 5LJ3j 2DJVA 2IU0A 2P4RA 1G6UA 4O4HB 2PU9B 5EIBC 1K8AW 2L5QA 3IJ4A 4JYCA 1SSFA 2HHHB 5LHIA 5KUMA 3M9QA 3CXHF 2VQFO 2DMOA 4LDWA 1U5SA 2DYBA 3CYOA 1Y71A 1BYMA 4QVCA 9ATCB 4FZ0A 3LGLA 5IYBO 2YDLA 2D6FA 1OCOB 2PQWA 2Q7GA 4HNAA 3SPGA 2VASA 4DRXA 3CMAA 1N0NA 3EGXB 1BGYH 5D6XA 4KRTA 3WB2A 2QDYB 2ZPHB 1PL0A 3AG1B 4AQYB 1PCXA 1VQNQ 1SETA 3JAKB 2E75B 5KLVH 2DL3A 2JS0A 5KYUB 3NFCA 1OCOC 3ZHSA 3GF5A 1VQ9Q 2A7YA 3M59A 2N05A 1SQXH 2UXNA 4KFMA 4OPHA 5LYJB 2BZXA 2OTLA 5KYYB 3AG4C 4IHJA 2RHZA 4F7UA 5GAMd 4QVZA 1YCYA 3THKA 3HKCB 3GVMA 3T1HB 2EVRA 3MHXA 3H9VA 2P0PA 4KHPO 4QNHB 4DV0B 4DR5O 4UXNA 2RJFA 4I4TA 2ZPGB 3RMQA 2EQUA 5LGUA 4A4FA 1M27C 1VA7A 1NS1A 3LDEA 2F93B 5IXFA 1S5HC 3R65A 4B3SO 3QPHA 5GAOm 3C3TA 3FAVA 1VIBA 4DK1A 1KECA 1GM8A 2R9RB 1HNZB 4HNAB 5I2MA 3I55Q 4B3RB 1VQKA 4D7SA 3V7SA 4DRXB 4IT5A 3JB9F 3APOA 1M4ZA 3G6EV 1M8VA 2GBQA 3KFVA 1WAZA 2DX1A 5BXZA 1ZL8A 4M75A 1NR7A 4JZ3A 3CPFA 3CHXA 4P2ZA 3B77A 1NH2B 5CKBA 4AG2C 1EZZB 4J9DA 3FX7A 2LP7A 3K03A 4BD3A 3VS5A 5GANe 1JEGA 4QT7A 3ZMVA 1YI2Q 2JJ1G 5L3DA 4JI4B 3CD6A 2GCXA 2OTJA 3MP8A 4XTVA 1Q8IA 4IHJB 4F7UB 1M1KU 5BR8O 2KGTA 1IXMA 2UU9B 3ZMSA 4K0KO 3H0HA 3QVNA 1Y07A 3UQ8A 1MZEA 1GMGA 2A08A 2L6LA 4TQDA 2AZ2A 4DV2B 1NYGA 2V8IA 1QBZA 3CCJQ 2F66C 1BI0A 4HAMA 2M0OA 4I4TB 3SPCA 2Q68A 2QGNA 3SYAA 4DR3O 5J9PC 2AHYA 1WJZA 1N33B 1F23A 2ZAEA 3HTRA 4M78D 4JUVA 1UG1A 2EYWA 1KP3A 3CCRV 1XOVA 1KD1W 2WLJA 4K35A 2M51A 1VQLA 5DEDA 1GN2A 4WFHA 3JARA 3I9QA 4XTWA 4A4KA 5I11A 1JJ2P 1G5VA 1RSOA 3FAVB 1WFWA 4KUIA 3LSUA 1TGOA 3PNWC 3O9OA 2ZE7A 4LDXA 1XHZA 3T9NA 3KG2A 3K57A 1PNJA 1WI7A 4H13B 3CCLQ 1US6A 2MK3A 4QQDA 4RUEA 4LUEA 1THZA 4LFCB 3F70A 2X35A 2YI9A 5TISZ 1ZL8B 2BOCC 1QQJA 2V8KA 4M75B 5J39A 1GCQA 3L2QA 4O4JA 3DB4A 3W7SA 2ZGWA 2ZZDA 4EMHA 4CS4A 3OYIA 1JXOA 3CMAT 5LMUO 1X6BA 1BQZA 2IPOB 5D6YA 4E7HA 2ITDC 2FPFA 3QDFA 5HY6A 1FYJA 1O9HA 4M75C 3QIIA 2EILB 3CXCA 2IIMA 2E65A 1M3AA 4GY5A 5FU7B 1SKVA 5IY5B 1GAXA 4PJOD 4DR1O 2ZNJA 5EC2C 1FKAO 2FVUA 2MI6A 4ZTJA 3SYCA 4N4GA 2OTLT 4RTWA 3E8HA 3N2GA 3VOUA 1UFFA 3A5ZB 4JI5B 5GONA 2BZYA 4JTCB 2AKLA 2MIOA 2EILC 3ZN1A 3OYJA 5FU7C 3JCMf 1NM7A 1PV0A 5L8RE 3JARB 3QHSA 2AXTZ 3ETDA 2EGAA 5GJWB 2JJ2G 1XNIA 1NI8A 3GB7C 4K8ZA 2E3CA 1VQPA 2IH1C 2CP7A 1WGSA 2WLNA 3OSVA 4M75F 3J81N 3E9GA 2K57A 3INZA 3JD0A 1WB7A 4X62O 2A36A 3M54A 1KMIZ 3T4DA 3EFRA 1H2SB 1H3HA 3PGGA 2RK1A 1VQKT 3L2ZA 3EG3A 4FT2A 5LMNB 4O4JB 4TQFA 3JB9G 1G3TA 2JXBA 4F16A 2QASA 1K73C 5IYZA 2K9PA 2EJFA 2QA4Q 2N74A 1WHLA 2UXCO 1X2KA 2P4KA 4M78E 3CC2Q 2ABLA 3G71V 1ZTEA 1GCQC 1BQ0A 2L3SA 2X3WD 1KBHA 4C5IA 4I50A 4QE7A 2HJFC 4OGQB 3W7WA 1H2GA 2CTWA 3CMAV 1YZBA 2CP0A 1YJ9Q 2CGHA 3CD6T 4FYXB 3V8LA 4R8CA 2OTJT 4PHZA 3V7RA 3OD4A 3N2GB 4LF9B 2WSSG 4C8QE 3CCSA 1QLEB 2QYZA 1LR1A 2A79B 2PNIA 5D6WA 2COYA 2PGGA 5GONB 4M7AD 1BZKA 2Z5UA 1KHIA 3OUSA 1JQ0A 1Y74A 2DXBA 2XASA 4M7DG 3CCMA 2CP3A 2YSUB 4HYOA 1G8MA 4ELYC 1QLEC 3EVKA 2IU3A 1XMQB 2B8AA 1SERA 2MCNA 1VQLT 1ROPA 5CBFA 4LF7O 4CH6A 2VQEB 5GAOp 3I56T 1IZ3A 2XD0A 2E6ZA 1M93A 4M75G 2A0LA 4LFAO 2C2AA 3ZHRA 1YIJA 3EGDA 4MTGA 5IYZB 3JD4A 2XKOC 4B9WA 2DYSB 3OTFA 4JRIA 2F5KA 5GANd 5LGTA 1DTOA 1Q6UA 4OB2B 3Q1JA 3WB0A 2WLMA 4EEQA 4JASA 3W7XA 1YP5A 2ROTA 2X4JA 1NJIC 4R6ZA 3C12A 4I50B 2CSQA 2YRVA 1K8AR 2LT4A 1IRXA 5CA0A 2VQFB 2R9IA 2E10A 4IUUA 1LUWA 2Q7HA 2F95B 3ETQA 3NR7A 3O8VA 4FYYB 4WCIA 4X20A 2MWPA 2FPEA 1JVMA 4WFGA 1Y66A 1K7DA 2YXHA 3T1CA 1Z2GA 3CWBH 2DQ3A 1SA0A 1YITA 2FYKA 1Y74B 2PUSA 1XTDA 3CD6V 1KC8U 3ZFJA 3G7ZA 3I5SA 4K3AA 1P49A 5M9OA 2EKHA 5IXBA 1NR1A 1XNQO 4X9CA 3M58A 1MMAA 1Y6XA 1FMKA 2EZOA 2JUFA 4IKFA 1M1GA 4J9YB 1VOMA 1VQPT 1WXTA 3JALA 4PDRA 2WLLA 4GLXA 2XK0A 1XQHA 4ZBMA 1Z9ZA 3EGDB 4IUQA 2QKCA 4I7ZB 3D3QA 1I4K1 3OYMA 3RBZA 2MWOA 1VQLV 3MKDA 4DR5B 4LH7A 1KU9A 2JS2A 4BY6C 5CCAA 4BDZA 5LHGA 2E70A 4MSWC 1G3YA 4LF5O 4PDLA 2L8DA 4DQ2A 4DK0A 5B1BB 3CRCA 1K5QA 2Y4TA 5CA0B 1H2MA 2QEXV 2HNIA 1A0NB 1Q6HA 5GAOn 1BBZA 1C1AA 4B3SB 5K1PA 5CA1A 1WHKA 4LF8O 3RN4A 2DJQA 1C6VX 1SA0B 2G6FX 2LDMA 5B1BC 3BHPA 1QVFU 2YI8A 1IZ6A 2X51A 3QNEA 1EFNA 3ZS8C 1Q7YU 4NKGB 2HCKA 2ADPA 3H1LH 4ASUG 3CCST 3CCVT 2WAMA 5CAIA 1VIFA 3OS5A 3OT7A 1GBQA 4OB1B 2ZE6A 1SQVH 2Q6AA 2HQXA 4V2SA 2P0KA 1X4TA 1KQ1A 2YHTA 1XI1A 1K1ZA 2L3QA 1CXZB 2H94A 2LJ2A 3JALB 4PI2A 3TGUH 2Q8VA 2WLLB 1BIBA 2QTXA 5BR8B 3VS4A 4K0KB 1XDCA 4DBFA 1FXKA 1R3JC 1IVSA 1V1CA 4CS2A 1HDJA 3A8OB 4YY3O 4J7ZA 2JNGA 4RKUE 1W4SA 2K5LA 1BS3A 3J7AU 4Z02A 4DUZB 1GN4A 1AB3A 1WPYA 1VQPV 1UGVA 4JYAO 1HSQA 4DR3B 1SQPH 2QQRA 3RBBB 3ZCCA 2GUZA 4ATOA 4IIJA 4MZPA 3MCAB 1WJRA 3RESA 5CA1B 2G3RA 4AFQC 2ATKC 4BIUA 2QQAA 2ZPIB 2JM9A 3AHUA 4UV8A 2LFSA 3QJ6A 1OX9A 4M7AA 3FYEB 4DBHA 2Q9LA 3PMTA 1H8KA 2AKKA 1SESA 4PJOC 4EMKB 4FFBA 3JATA 3JCMh 1K33A 1MMNA 2CZ7B 2YSQA 1F4NA 1S72V 1MG1A 3L71H 4XK8E 1M1KW 4EMGA 3PTAA 2CAZC 3CCUA 1OCZC 1YITT 3THOA 1X43A 3G6EQ 4Y91A 3OEHG 8AT1B 1M90U 1I5OB 2N04A 2OT5A 3CSXA 5FPRA 4MVSA 1HYOA 4GLKA 4HXJA 1LCKA 1XEQA 4PJLA 3HSBA 4FM4B 4F04B 4JI3O 2F43G 4GKKO 1OU9A 1WP7A 1EIFA 1FXKB 1JJOA 4TV9A 2RI3A 2YUPA 5CKFA 5D7UA 3X28B 2DEUA 4DR1B 4JDSA 3VYGA 2V4DA 1VEWA 1RI0A 4GX0A 3LNNA 1N9RA 2NR5A 2EAYA 5GJVB 2FMLA 3DXRA 1K0XA 3VQWA 2GUZB 2GFAA 3QZ9B 4IIJB 5F2VO 1NG2A 4RTUA 3FJ5A 1K3EA 1CSKA 1VQMA 2LJ1A 4DR2O 1KG1A 3JCZA 2BTTA 3HL8A 1BK2A 1R3IC 5IE9A 1I1JA 1N9SA 1UGRB 2L2PA 1D0YA 3VRZA 2J7IA 1NKDA 3EG2A 1EBOA 4MVMA 1YIJV 3CCRQ 1TSFA 2X6BA 4FFBB 3JATB 4X62B 1ZSPA 1RLPC 2NWMA 3HKDA 1TVKA 2EULA 3E8GA 1WXUA 5GMKe 1YWOA 2RF0A 2DK3A 1H2LA 1J5EO 2LT1A 3A0BZ 3O65A 1AWXA 1C0MA 4M7AC 3P8DA 5FWBA 4E6RA 3V8KA 1BCMA 4C92E 1KJWA 4HT9A 1QVGA 2Q67A 4PJJA 2UXCB 3MAQA 3JCMQ 2BTQA 2E76B 1WXBA 2EIKB 4PDMA 4GCZA 4TV9B 1X6OA 1Q81C 1JB0E 5GMKj 2YRCA 3VS0A 5KYWB 5J2TA 2DZCA 3G4SA 2EKOA 1VQ5T 3CC4T 1GN6A 3GWKC 3RYFA 5JWPA 2JM8A 3DXRB 3K58A 3CC4A 4J9IA 3ETEA 2EIKC 1K8AC 2ARHA 1EZVH 3RWRD 5IDJA 5FLXN 4DV0O 4JI7O 3CCQA 3WB1A 5B1OA 4PKCC 5IN1A 1DJ7B 5BMVA 3HHTB 3ABLB 4J41A 5C93A 4FLTA 2KT1A 1OU8A 3D8CA 2VUBA 3FIFA 4I0XA 4LF7B 4K8XA 3HKDB 5JH7A 4D8KA 2A0FB 4M77D 2WPDG 5LJ3f 2ZIOA 4LFAB 3U0ZA 3JCMJ 1QR8A 1T0HA 3ABLC 1CPYA 3NTIA 1FMVA 3P32A 1PSEA 3FLGA 1NPRA 4MZTA 1DLBA 1QVFS 4LF6O 3STZC 3JSNA 2BTQB 4RTTA 1VMGA 4X1IA 3CC7A 5A2QE 1H92A 1KUQA 3CCUT 3HP9A 2CT3A 2KKWA 4E7IA 5J2TB 3R6OA 1U06A 4L59A 4J9HA 4XTXA 4JF3A 1D0XA 3RYFB 1RAFB 4II1A 3G71Q 3TEEA 4JZGA 1VQ6A 2XTAA 1UJYA 1ORQC 5FU6B 4DV3O 2GBOA 5E79Z 4FLXA 3M0TA 2LQ8A 1HXDA 4C7UA 2HKQB 5BMVB 4ANJA 2HKOA 3CC4V 3OR7C 5I21A 1W2BP 4FT4A 4GZRB 2VVKA 1V76A 1N33O 4F4LA 1KQ2A 2GTAA 4FM1A 2AZVA 5J26A 5BY1A 1VQMT 4I0XB 1I0HA 2GF7A 3QWYA 3SFMA 5FU6C 2PYJA 5JH7B 2J6OA 4KGXB 4MW3A 2K4YA 5JJJB 3GIBA 1NZ6A 2ADQB 2GDSA 1SHFA 1U3OA 2CT4A 5H9CA 4DR6O 2PY5A 2XG8D 4WF2A 2V1RA 1LPLA 4X9DA 2LCCA 4VUBA 5GAMe 4X1IB 4KUDK 2DRKA 5B1NA 4Q20A 2R70A 2F4VO 2IH3C 2F69A 3ULRB 4LF5B 1UGQB 2EW3A 2DERA 3HB3B 4UCTA 4J11A 2OJ2A 5LJ5d 1SZTA 3EXAA 1ZA2B 2EYYA 3P8BB 1F4MA 2JOYA 2PTMA 4E7JA 3L1AA 2UUAB 3HFNA 2FZGB 1KC8W 4CH4A 1FS0G 2A06H 2JIZG 2NLJC 1FXHA 4LF8B 4KUMA 1M1FA 2QM4A 1W70A 2AZSA 3CCUV 3EFSA 2H3JA 3EHBB 4RTXA 4HCKA 3JSLA 3CBOA 5GAMj 1Q82U 5JJNB 3VS3A 4G28B 3G4ST 3ICXA 3GP8A 1D1CA 5B1AB 2KY9A 5B3SC 4ZNXA 4Z88A 1KD1C 3OYNA 4RQEA 4G2KA 4L8JA 1T3SA 5KYXA 4I55A 1B06A 2P84A 2DXUA 1QLYA 3CCQT 2YICA 1M3CA 2YWWA 1GL5A 2E64A 1FPOA 3G80A 4BIOA 5GANf 1QU7A 3DLMA 2ZPEB 4NL3A 4R55A 3CS5A 1VQ8T 3UT5A 2OWOA 1XMOO 2OCCB 4H0LB 1VQMV 1G2BA 1WHJA 3VUBA 4YY3B 4D6WA 3K06A 2HSPA 2DA9A 1NVPD 3JAWA 2LGWA 4A5UB 1ACMB 1Q5OA 3VYHB 4JYAB 2DWDC 4ELZC 2JTMA 5JJEB 4WFFA 5FRNA 5KCOA
chains in the Genus database with same CATH topology
2YXYA 1SF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXY A;  1SF9 A; 
#chains in the Genus database with same CATH topology
 4Y92 A;  1Z9Q A;  2Z0A A;  2AZ0 A;  3WVD B;  4DV6 O;  3QDR B;  2PUO B;  1GO3 F;  2VGN A;  1Q7Y W;  1JJ2 S;  1J3T A;  1QCO A;  2XID A;  4J83 A;  2QEX Q;  1RLQ C;  1QCF A;  4W4K A;  2HR3 A;  3PN1 A;  2MK5 A;  5DM6 V;  1V54 C;  2X6A A;  3M0U A;  2X4W A;  4CI0 C;  1YJW T;  1ZSG A;  3JCU Z;  4MTX A;  2EQI A;  1Q86 U;  2JVD A;  4BE0 A;  5CB4 A;  1OV3 A;  1JOY A;  2EQM A;  4JI1 O;  3PVQ A;  4I55 B;  1M1K R;  1PD0 A;  3L2V A;  2E41 A;  4QPK A;  4HT8 A;  4AFZ C;  4M77 A;  2CS7 A;  4MZM A;  2DW4 A;  3CE2 A;  4DYL A;  5L3G A;  1YTF B;  2QXF A;  1EZJ A;  2XAG A;  1KQS U;  2DD5 A;  4JI3 B;  4GKK B;  3UT5 B;  1QMC A;  4YIO A;  4RCC A;  4NS5 A;  2P90 A;  2I0N A;  2RQ6 A;  1EM1 A;  1MNG A;  1R3K C;  3CCQ V;  3GLX A;  3J80 N;  3JAW B;  4FK5 C;  4MMK A;  1WZO A;  4E2F B;  1PKS A;  2FEI A;  1B7T A;  2YC0 A;  4FLV A;  2VV5 A;  2KXC A;  3X2Q C;  2PTK A;  1FFX A;  1E6G A;  2AT1 B;  1MZF A;  2XND G;  3SEM A;  3IQL A;  3CME Q;  4NTY A;  4DR2 B;  3CJH A;  2ZPB B;  3OBW A;  3D3I A;  3H0I A;  4BAC A;  1PC0 A;  1M56 B;  5ECA A;  2ZE8 A;  1M2V A;  2OIE A;  2EGC A;  2UUC B;  5JCO A;  1WHM A;  4YHH O;  5AG2 A;  3A2F A;  4UVC A;  4O5V A;  3DC6 A;  1YHQ A;  5CB4 B;  1KKD A;  2LZ6 B;  1M90 W;  3LGF A;  1VQ4 A;  3LSQ A;  1UJW B;  4UCS A;  3CC7 V;  2YID A;  2QK0 A;  1J5E B;  3LWI A;  1M56 C;  1HP8 A;  4B3T B;  4M77 B;  2KT8 A;  4CC4 B;  3QWX X;  3TQ7 P;  3IC9 A;  4NXN O;  3M57 A;  2HG5 C;  3AG4 B;  2RO0 A;  3NTK A;  3PT9 A;  1S72 Q;  5EK0 A;  1RM1 B;  2DVE A;  5LJ3 h;  5KCH A;  3KCX A;  4M7D E;  3QG5 A;  1WQW A;  4BR6 A;  1U96 A;  1ZLZ A;  1MSW D;  1P7B A;  1JMK C;  2Q7E A;  3ZMU A;  3T2M A;  1K9A A;  2K2M A;  2PVO B;  4F14 A;  4M77 C;  2QR4 A;  2IW5 A;  1FJG O;  3FEO A;  4RTV A;  1R8O B;  1PKT A;  3JSC A;  3UA7 A;  1NJI R;  4M75 E;  2OCH A;  1RM1 C;  1FFX B;  4P9P A;  4MTO A;  2RJE A;  3M53 A;  4NTW A;  4FYV B;  1TUC A;  4FL6 A;  4O2A A;  2EJR A;  4ZHQ A;  3CJH B;  1LOJ A;  2AW9 A;  4JI7 B;  4X1V A;  2RQT A;  4ESR A;  2RJD A;  2DYR B;  3LW5 E;  3H1I H;  4LR3 A;  3ZMZ A;  2NUP A;  2QQB A;  2KAF A;  4OGE A;  3GBQ A;  4QQG A;  2C0O A;  4JJN K;  2JW4 A;  1K4C C;  2VGM A;  1H2N A;  4HKE A;  2FRW A;  1L1F A;  4PV1 B;  2EQJ A;  2DYR C;  1YIJ Q;  3DTU B;  2XMF A;  3DC5 A;  4DV4 O;  2ZIN A;  1BT8 A;  1QP2 A;  1YJN A;  3A8L B;  3CCE Q;  1YVW A;  1YXB A;  1XIL A;  3MPU B;  5JCO C;  3VBB A;  3E8B A;  2RMK B;  2DD4 A;  2WSC E;  4LF6 B;  3A8H B;  4J7F A;  1CEZ A;  1QP3 A;  2HDA A;  1KHC A;  3H1J H;  5DEC A;  2Y4U A;  2DAQ A;  3MDS A;  4YJ3 A;  2X6C A;  3ABT A;  5EZY A;  1Y0M A;  3NTH A;  1YSC A;  1PSF A;  2A3Q A;  2PZ1 A;  4FLW A;  4O2A B;  4EB6 A;  4ZHQ B;  2ZR2 A;  4DV3 B;  3VV0 A;  2V7Q G;  5ITZ A;  1NTM H;  2RCV A;  2NUP B;  2ED1 A;  4J9G A;  4DUZ O;  4AT1 B;  2HJD A;  2X4X A;  3WFV A;  1OCC B;  5CMU A;  2D8H A;  4OMO A;  3HKE A;  1TUD A;  5GAN j;  4JZ2 A;  2M0Y A;  1YHQ T;  4LN2 A;  5LOV A;  5KX5 A;  4MVU A;  3WG7 B;  3J81 E;  4B6M A;  5LJ3 g;  3TCJ A;  4JTD B;  1WA8 A;  1VQO Q;  3I56 A;  1NBM G;  2RQU A;  1R6K A;  2LFR A;  7AT1 B;  4ZIB A;  1SQB H;  1R6N A;  4C8Q D;  1OCC C;  1I5L A;  2ZT9 B;  3WU2 Z;  4DR6 B;  4PJ0 Z;  3ASK A;  3IC7 A;  3QG1 A;  1TA8 A;  4BE1 A;  1M30 A;  2FZC B;  2HBW A;  3E19 A;  3WG7 C;  1WQ7 A;  4FIB A;  4IUT A;  1VQ4 T;  1I5Y A;  1U97 A;  3CEI A;  1WJS A;  2F4V B;  1D2D A;  1WDX A;  5GAN h;  3R66 A;  3QO5 A;  4QGP A;  4RMO A;  4F7U F;  2W10 A;  3OR6 C;  1NPP A;  3CBM A;  3QBY A;  4C5G A;  4R56 A;  4X1Y A;  4YJ3 B;  1SQQ H;  4U3J A;  3TCU A;  1ZHI A;  2DTH A;  3ASN B;  5EZY B;  3BPZ A;  4LWS A;  3TJT A;  2ZQM A;  1KKC A;  2J05 A;  5GMK m;  1VQ7 Q;  2VRZ A;  4X8A A;  1KC8 R;  1KQS S;  4ZGE B;  3PJS K;  3OMA B;  4EB6 B;  1DF4 A;  1G3S A;  2HD0 A;  3L2W A;  3ZED A;  5ITZ B;  3RVZ A;  3OY9 A;  1PPJ H;  1UDL A;  3ASN C;  4LUD A;  5HKC A;  3HKE B;  5LOV B;  5KX5 B;  1K76 A;  3T1Y O;  2CK3 G;  2IJJ A;  1W6X A;  3BW1 A;  2JTE A;  2L89 A;  4IIM A;  1QQC A;  1WA8 B;  4Z1V A;  3NHN A;  2QAZ A;  3H8Z A;  1K9M W;  1RSO B;  1YCI A;  3OB9 A;  3MO8 A;  2QKA A;  1PL4 A;  2E12 A;  3ZBD A;  1N8R U;  2PYL A;  4OF1 A;  1N4C A;  1JFF A;  3JD2 A;  4JI6 O;  1XMO B;  3MET A;  1M1K C;  3MHS C;  2KDS A;  1COW G;  3OE7 G;  2CTP A;  4JI0 O;  1ZUK A;  2HZY A;  3ER0 A;  3L72 H;  1IHV A;  5CIU A;  4O6J A;  1OPK A;  3FRN A;  3LWH A;  1W2B U;  2MOX A;  1YJN T;  2FL4 A;  4B7E A;  2DRM A;  4X1Y B;  1TOV A;  1TWB A;  3L75 H;  4U3J B;  3OYC A;  1Q82 W;  2EFI A;  3C4S A;  1YHQ V;  3ZRX A;  2WSF E;  4DV6 B;  1M2O A;  1GM9 A;  4EFB A;  2COZ A;  1B34 A;  1TS9 A;  2X7R B;  4CRI A;  2DE0 X;  3SPI A;  4F7U G;  1UHF A;  2ZNI A;  1NQT A;  1MHN A;  1SRL A;  5EYP A;  1D5A A;  2A9H A;  1Q43 A;  5KHH A;  1S1N A;  1S77 D;  3ABM B;  4DOW A;  3DKM A;  3OMC A;  4TV8 A;  2DPP B;  1OI1 A;  5IAY A;  2JMA A;  1G1X B;  1SQF A;  4JI1 B;  5JVD A;  4JJB A;  4RTY A;  1N0J A;  2AHJ B;  2VS0 A;  3CCV A;  3RYH A;  1IX9 A;  2JDI G;  3R6N A;  4PLI A;  2J6F A;  4RWU A;  4OPA A;  3ABM C;  5GAN g;  2FHD A;  1GBR A;  3E8F A;  2OTL V;  1W0K G;  3HPL C;  1JCH A;  5DY9 A;  2Z0W A;  2YXY A;  4JRQ A;  1JFF B;  3FJP A;  2JGU A;  2JT4 A;  2EZP A;  4R0K A;  2LW1 A;  5EG2 A;  2ZD9 A;  5I22 A;  1IRE B;  2LMJ A;  2JJ9 A;  1VQ9 A;  1D09 B;  4RCB A;  4JZ4 A;  1Q81 R;  3VQY A;  4ABM A;  2K5F A;  4ZN3 A;  4NXM O;  1VQ6 T;  1TUG B;  3W7T A;  1O9S A;  1Q86 W;  1B34 B;  2LX9 A;  5LBQ A;  3REB B;  1JPX A;  1I7F A;  3E22 A;  4TSF G;  1OPL A;  2DO3 A;  3JCM W;  1G4Y B;  5EYP B;  1VQK V;  1QCN A;  5A0G A;  1YJN V;  3MEW A;  3JAM E;  1TUB A;  4YHH B;  2R57 A;  1K4D C;  1SRM A;  2VWJ A;  4BI4 A;  3OW2 P;  1NZ9 A;  4ZKI A;  5LL6 Y;  4DUY O;  1JU5 C;  4TV8 B;  5GMK i;  2EPD A;  3OBY A;  1U8R A;  2DJZ A;  3UPU A;  1M90 R;  5JVD B;  4M78 A;  4PI0 A;  2YLB A;  5CBG A;  3RYH B;  1HD3 A;  2XDP A;  3RKY A;  3I55 A;  1AR4 A;  1X69 A;  1SSH A;  3C95 A;  2XAJ A;  2ZIM A;  4NXN B;  2OTJ V;  2R9A A;  1XBL A;  2QM8 A;  1M8M A;  4X65 B;  2HSE B;  2RQV A;  3TRE A;  4KGV B;  1PD3 A;  3OFN G;  2UXD B;  3GNG A;  4J6Y A;  1PRL C;  4FYW B;  4QPJ A;  1VF5 B;  2XUM A;  2KRO A;  1IO6 A;  1YF2 A;  2KR3 A;  4DBR A;  4DR4 O;  4BY6 B;  5IT9 E;  4MVQ A;  1FJG B;  1RAE B;  3ZN0 A;  1SEM A;  1TXQ A;  3EHQ A;  4AG1 C;  3JD3 A;  3CPW U;  2JMC A;  4RG8 A;  3L2U A;  2XAQ A;  2E1H A;  5D5Q A;  2L3R A;  4CC5 A;  3ASO C;  3E9F A;  5CK9 A;  4MDX A;  3A1P A;  3JCM P;  3U10 A;  3I56 V;  3E22 B;  5CQY A;  3JRZ A;  4BWA A;  1E7O A;  3QF7 A;  3FB5 C;  5LGN A;  4HVV A;  1IXD A;  3KKY A;  3K5L A;  5DN6 G;  1MNE A;  1TUB B;  3JYC A;  1YFN A;  3OYA A;  4PJO A;  1E1Q G;  1VQ6 V;  3QZ5 B;  1IBK O;  2P6J A;  2UUA O;  4X20 B;  4LFB O;  4M78 B;  1KQS P;  1V55 B;  2EJ9 A;  3KZI Z;  4DV4 B;  2YIA A;  2R5M A;  1I81 A;  4NVP A;  1MUZ A;  5A9G A;  3UA6 A;  3L70 H;  2JEX A;  2UXB O;  3CEY A;  4JI8 O;  2JVV A;  5CKE A;  3LDC A;  3CC7 Q;  3BDU A;  3CCL A;  1K97 A;  1TTH B;  2RI2 A;  4MDW A;  3EG1 A;  2HEQ A;  3AEI A;  3P3N A;  2DBM A;  5GAN 2;  4M78 C;  8ATC B;  5DLQ E;  3EAE A;  3MEA A;  1V55 C;  1AOJ A;  2K2V A;  1H38 A;  4IYH A;  4BI8 B;  2DXT A;  2KYM A;  1ZA1 B;  4LNU A;  4HBN A;  2DNU A;  2VWK A;  2D8J A;  1VQ5 A;  1Z5W A;  1QVF A;  2PI4 A;  4C8Q C;  2FKX A;  3BFR A;  5GTI Z;  1VQN T;  4GX5 A;  5CO7 A;  3BE3 A;  4OMN A;  4TWK A;  5KHI A;  1VQ9 T;  2NNU A;  2UUB O;  3MJX A;  4H44 B;  4RUG A;  3SYO A;  1BB9 A;  4C92 D;  5KYN A;  3QO7 A;  4EDU A;  1W2B S;  5AYF A;  2CSI A;  4M78 F;  4PJO B;  4QIW F;  1KC8 C;  4HA8 A;  4OP0 A;  3OMI B;  1IHW A;  4HZ3 A;  1OEB A;  2WLH A;  4LDY A;  4RTZ A;  2OI3 A;  2Y4Y A;  1GH6 A;  1KD1 R;  3L74 H;  3V7C A;  2M1H A;  1OCZ B;  4PEL A;  3SD4 A;  1R0C B;  3SDL A;  4OML A;  1SZX A;  2Y0I A;  3RR6 A;  4UB6 Z;  3S6W A;  4RUF A;  3QO8 A;  2ED0 A;  4DW0 A;  4FMT A;  4RO2 A;  1ZX3 A;  5L3F A;  3M56 A;  2R5A A;  1F51 A;  1LNQ A;  1SF9 A;  3PVL A;  4IUR A;  4JLI A;  4U7N A;  3I55 T;  4PA4 A;  1M9S A;  5GAM f;  4LNU B;  3U11 A;  2W0F C;  4PFO A;  4QKU A;  2XHB A;  5L3E A;  2LCS A;  5LXT A;  3E83 A;  1T5E A;  3CCS V;  2QA4 A;  1UGS B;  2ENM A;  3CCV V;  3ABU A;  1X59 A;  4FM2 A;  1XQ8 A;  3OAA G;  2KK4 A;  5LJ5 e;  1K5S A;  2ZPF B;  4PJO F;  3PE0 A;  2XIC A;  4NR1 A;  1YI2 T;  3CCM V;  1M5Q 1;  2GHY A;  2O88 A;  1UE9 A;  3X20 B;  4LD9 K;  1BCC H;  2PVG B;  1Q7Y C;  3T1Y B;  1BE3 H;  4MVR A;  3ML0 A;  3RW0 A;  1Z5V A;  4GYC B;  3OYB A;  1VQ9 V;  4OMP A;  1CKB A;  5LJ5 j;  3UWN A;  3CCJ T;  3QYG B;  4QQ6 A;  2Q73 A;  4BUG A;  4L6V 5;  4M7A B;  2D0Q B;  5GAN 6;  1AR1 B;  4JI6 B;  2UUC O;  1FYN A;  4XU0 A;  1WLE A;  3TSZ A;  1Q6I A;  3SJB C;  2WAC A;  2F1L A;  2GQI A;  3FB7 C;  3OQ5 A;  4JI0 B;  4UCU A;  1MV3 A;  2DIG A;  3TVT A;  4MW8 A;  2IBZ H;  2KQW A;  4A53 A;  3SGI A;  4N4I A;  5GAO q;  1XRE A;  2GFU A;  4B3T O;  3K5O A;  1UUE A;  3NGP A;  5LXT B;  4OMF B;  2XHC A;  3CCL T;  1Q82 R;  1BCO A;  2M7W A;  1B3Q A;  1XJW B;  1D0Z A;  2DET A;  5LJ5 h;  1JX9 A;  3SJA C;  2QQS A;  3EH1 A;  3PFS A;  4LXC A;  4DXW A;  1FXX A;  2YUN A;  3OSS C;  3JB9 I;  1OHH G;  1QVG U;  1SHG A;  1N32 O;  2EIN B;  3I55 V;  1YIT V;  2RHX A;  3RT3 C;  2VYT A;  1VYT A;  3CQT A;  3K79 A;  2CP2 A;  4CC3 A;  3UM7 A;  1W1F A;  3S3N A;  2EWN A;  4KUL A;  2W6I G;  3CPW S;  4PJO G;  1OJH A;  2FPD A;  1N8R W;  2NLU A;  1WP8 A;  1JJ2 A;  3I5D A;  4M7A F;  4GLM A;  1RAI B;  4J9B A;  1AI7 A;  1R3L C;  3G6B A;  2O9V A;  4E47 A;  4AFS C;  2EIN C;  3N5B B;  4PFZ A;  1ABO A;  4XDL A;  1AWJ A;  3VU3 C;  1AD5 A;  1OZ3 A;  2DEQ A;  3KBG A;  1TG0 A;  1M90 C;  1S5L Z;  2IJH A;  4NYK A;  5EIB D;  2CUG A;  1XOU A;  1VQ8 A;  1OV9 A;  4HCB A;  1UB4 A;  1SC5 B;  2DIL A;  4U7O A;  3RUX A;  5GMK h;  4UC4 A;  2QM7 A;  1TVK B;  1ZBX A;  1RAC B;  2HP8 A;  3E35 A;  5KMG A;  1NEG A;  1URF A;  4DV1 O;  2GTS A;  5CR2 A;  4NXM B;  2M02 A;  4C0D C;  2HKN A;  3CBP A;  1WB8 A;  2E3H A;  3LUT B;  1N6A A;  2KRN A;  2KVQ G;  3SHW A;  4ZOL A;  1HNX O;  4JLG A;  4F6E A;  3NXS A;  4IL6 Z;  4AMC A;  3HKB A;  3K08 A;  2LNV A;  1BSM A;  1YJW A;  2W0X A;  1QVP A;  1K34 A;  4DUY B;  2VC8 A;  3SPJ A;  3CCL V;  3FDR A;  1Y57 A;  2QA4 T;  4KBM B;  2XT9 A;  1TUE B;  3GWO A;  4KGZ B;  4DA4 A;  3JCM d;  1RAH B;  5L23 A;  3CMA Q;  3JB9 J;  3CC2 T;  3ABK C;  1Q90 D;  2EYX A;  1U1T A;  2E5Q A;  1LNX A;  5CBH A;  3CX5 F;  4FIP C;  3JB9 D;  4LBE C;  2MMP A;  1WPX A;  1YJ9 T;  1VQ5 V;  1IDS A;  1K4U S;  4J6X A;  4M7A G;  2IM9 A;  3BY6 A;  2QGF B;  3QJY A;  2XDB A;  4TT3 G;  3UO3 A;  2ZCE A;  1AJN A;  5KHG A;  2O4X A;  3K5N A;  1AP6 A;  3G1J A;  2DXC A;  4DR4 B;  5LJ5 g;  2OTL Q;  1PM3 A;  3X25 B;  1MND A;  2F23 A;  5KMG B;  3G67 A;  3P8H A;  1NBE B;  1Y76 A;  5GAN 7;  2WSE E;  1GRJ A;  3TU4 K;  2JZ2 A;  2ESW A;  1K9M U;  4Z1M G;  3EFF K;  3GOX A;  2DIQ A;  3URG A;  1X6G A;  4ZOL B;  1PWT A;  2Y0P A;  4JV5 O;  2P22 C;  3HKB B;  1UJ0 A;  4PA7 A;  4PFP A;  4KL1 A;  1NTZ H;  3K0D A;  4EFE A;  3OYF A;  1AEY A;  3SPH A;  1J95 A;  3F5W C;  5B3S B;  3ZL7 C;  1IBK B;  1VQK Q;  4LFB B;  3K0G A;  3MD0 A;  5K1X A;  4FLY A;  1KFZ A;  5KE3 A;  2HFE C;  2V1Q A;  4J9C A;  3JCM b;  3N27 A;  3VQV A;  2UXB B;  4JI8 B;  4JS5 A;  5E1A C;  1NH2 D;  4CH5 A;  2RH2 A;  3MP1 A;  4C92 C;  5KAI Z;  3B8M A;  1NLP C;  2C06 A;  2QA4 V;  3OEE G;  3ZRS A;  1OOT A;  4BB7 A;  2COW A;  2O4X B;  4FW1 A;  3CD6 Q;  2OTJ Q;  1TAE A;  1WYX A;  2WWW A;  4O2B A;  2LRQ A;  4XTZ A;  3GPL A;  1HJD A;  1GM7 A;  4F6R A;  3OW2 U;  1JQQ A;  6AT1 B;  3FC3 A;  4XDK A;  1W59 A;  2R72 A;  4J8O A;  2JK5 C;  2KI7 A;  4J9F A;  3OM3 B;  1AJP A;  2LQK A;  1Y76 B;  4GUN A;  5A2Q N;  3K59 A;  2RHU A;  3EHR A;  4XBF A;  3A8M B;  5FRM A;  3H1H H;  4WTO B;  1FD9 A;  5CN0 A;  3U23 A;  3L2R A;  1GRI A;  5GAM h;  3B4S A;  1UPG A;  2UUB B;  1F1B B;  2KE9 A;  3IAY A;  1X75 C;  2C0I A;  3PMI A;  5H6R A;  1TH7 A;  3LSS A;  4BW9 A;  2HMA A;  1V54 B;  1NE8 A;  4M7D D;  3UF4 A;  4A54 A;  1VQL Q;  3LNM B;  1B04 A;  3I56 Q;  2BSK A;  3VS1 A;  4QW2 A;  4X66 O;  1NT2 B;  4UCO A;  2EIM C;  2ODM A;  1SPK A;  2CGN A;  2L35 A;  3FFQ A;  3QKJ A;  1OUL A;  1VUB A;  1X2Q A;  4M75 D;  4J9Z B;  1UEB A;  1AI4 A;  2BZ8 A;  4G27 B;  4FFK A;  1IBL O;  4C0G A;  1Y7X A;  2KMT A;  4IYI A;  3CB2 A;  1IBM O;  3CPW P;  1WNL A;  2DL5 A;  1P4R A;  2L0A A;  2EJ7 A;  2KB1 A;  5KYX B;  1K9M C;  1SRY A;  1LJO A;  4ZGJ B;  2BOB C;  4O2B B;  4Q6G A;  5KA6 A;  3G4S V;  5HFL A;  5A0D A;  4PDV A;  1ENV A;  4LF4 B;  2HQH A;  2IJI A;  1R1B A;  3ETG A;  3RKW A;  4E2L A;  3X2Q B;  5FRO A;  3C94 A;  5LL6 S;  5KHJ A;  1BHB A;  1GFC A;  4E7K A;  4NL2 A;  4DOV A;  4DW1 A;  3E2E A;  3E86 A;  3M4G A;  5GAN 5;  2EGE A;  1N36 O;  3MHH C;  1Q82 C;  2E5K A;  4C0F A;  1JRI A;  4JI2 O;  2DWE C;  2HEP A;  2WA3 A;  1S0V A;  1VQ8 V;  2KG7 A;  4EPC A;  1KQS A;  2BSK B;  1AWO A;  1QWF A;  4CH3 A;  2IG0 A;  2RQR A;  1VQP Q;  4JAA A;  3K5M A;  2ZXW C;  4F7U E;  1OCR B;  4X1K A;  3REA B;  5FNV A;  3CCM T;  3ZBH A;  3WVE B;  2RJC A;  1GKF A;  2CH7 A;  1I5X A;  1HK9 A;  2HL3 A;  3RVY A;  1WNS A;  2CZ1 B;  5HFM A;  4EIK A;  4QVD A;  4UB8 Z;  2K79 A;  5GAM g;  1PP9 H;  4I5S A;  4KXR A;  4H33 A;  1OCR C;  1YJW V;  2FL7 A;  2H8P C;  3VJP A;  4FPP A;  4DV7 O;  3QYH B;  4X65 O;  4JAV A;  5A0L A;  1GN3 A;  2UXD O;  3VS7 A;  3SJQ C;  2XOK G;  1RL2 A;  2PZS A;  2ZKO A;  1N32 B;  1XNR O;  2F5T X;  3OMN B;  3G6E T;  2O31 A;  5AT1 B;  2YT6 A;  1AJQ A;  3CCS Q;  3K04 A;  1EX4 A;  3T4Z A;  3CCV Q;  2BCC H;  3L9D A;  2ITC C;  1PRM C;  4YIP A;  1Q86 C;  2ROL A;  1HW7 A;  2NUT A;  1IXB A;  2GV9 A;  3G71 A;  1XHX A;  2KG7 B;  4AIL C;  1N8R R;  2XU8 A;  3DSQ A;  2ZDI C;  2G38 A;  3CCM Q;  3E1S A;  2KSD A;  1QLN A;  1YN8 A;  3BVO A;  3HKS A;  1AI5 A;  4X1K B;  5GTH Z;  2P06 A;  1M2V B;  4B3M O;  4O4L A;  3H41 A;  4OXS A;  4FM0 A;  2CH4 W;  5FNV B;  3DGE A;  1BKB A;  4OMM A;  2YEV A;  2QI2 A;  1NLO C;  2IJK A;  4Z89 A;  4I9W A;  2CH7 B;  2VXF A;  4OB3 B;  2JGD A;  3UKM A;  4M77 F;  2EJG A;  3IGA C;  4X64 O;  4NTX A;  4QE9 A;  4KH0 B;  4DV1 B;  4PJM A;  2PF4 E;  3AG1 C;  3BAB A;  2DF6 A;  2EYZ A;  2X0L A;  2ZCF B;  3CCR T;  2QJ1 A;  2BE9 B;  3X26 B;  1MV0 B;  3BEH A;  4JRK A;  4L5G A;  2FO0 A;  2H3O A;  1XL4 A;  2DLP A;  1HNX B;  3SB2 A;  1YNZ A;  1NU1 H;  3OYY A;  4U3F H;  3ZRW A;  2C0T A;  2KQX A;  4D6T H;  3UO2 A;  5FW9 A;  5IHI A;  3OW2 S;  2NUZ A;  2YXL A;  4FZ1 A;  3IFX A;  4WCE V;  1PNK A;  4UVA A;  1Y96 A;  2RHI A;  4IUV A;  3V8J A;  4M7D A;  1KP2 A;  4CS3 A;  2NUT B;  1K92 A;  1AP5 A;  1YIT Q;  5EBW C;  2P7T C;  3FB8 C;  1JR9 A;  4EKW A;  2VB6 A;  4JTA B;  1P84 F;  1N34 O;  4H37 A;  3I35 A;  5C6S A;  3FYI B;  2JTF A;  2KEA A;  4O4L B;  4JYB A;  3RDV A;  3CRQ A;  2YEV B;  3A0R A;  4A4G A;  1GTO A;  1UTI A;  2CGO A;  4BIZ A;  4HCC A;  3JCM c;  3H9N A;  2JGD B;  1FX7 A;  1MMG A;  2DL4 A;  2V26 A;  1HNW O;  2KRM A;  4LNP A;  3S3O A;  1DGS A;  4DR7 O;  3I5R A;  1QVG P;  2SRC A;  4M77 G;  1QW1 A;  1FFT B;  2D3O W;  1LUV A;  3ZJZ A;  5GAO r;  1D3B A;  2CE4 A;  3OTO O;  2RN8 A;  5IHN A;  1OZ2 A;  1K73 U;  1L8D A;  2P0Q A;  1FMW A;  2L3P A;  5H2F Z;  4UVB A;  5GW7 A;  4JV5 B;  1VF6 A;  3ZRW B;  2VWF A;  1SQG A;  1YCS B;  4E4E A;  3A98 A;  3KUF A;  1SS3 A;  1R6T A;  1NVP B;  4FSX A;  4PD4 F;  2K1E A;  3FB6 C;  3AK2 A;  3AT1 B;  2M9U A;  1ZAU A;  2FYU H;  1N5Z A;  1BI1 A;  1GCP A;  2QKS A;  1Y96 B;  5FWC A;  5C0M A;  4M7D B;  2LVM A;  2O9S A;  1AIL A;  2W0Z A;  4ORZ A;  4MML A;  2ECZ A;  2GNC A;  5GAO l;  4J7K A;  1KIK A;  2QEX A;  5HCK A;  3ZRV A;  1R77 A;  3TSW A;  3VKI A;  3ZEH A;  2B86 A;  4GT1 A;  4HVU A;  3CXC U;  4PA6 A;  5EC7 A;  2OYQ A;  4Z2W A;  3G71 T;  1M57 B;  4M7D C;  3JCM V;  3RGB A;  4LDU A;  1S76 D;  2CDY A;  3LX7 A;  5LJ3 d;  2Q4P A;  1VQ5 Q;  4O4I A;  4XAX B;  2KXD A;  2D2C B;  3CC4 Q;  1I08 A;  5IJ9 A;  1D5N A;  1M9N A;  1WA7 A;  2OAU A;  2F1M A;  3JAS A;  1BL8 A;  4L87 A;  1M57 C;  1AWW A;  3C3S A;  3OGC C;  3W7U A;  1E1R G;  1PD1 A;  3FB9 A;  2Y90 A;  4OMQ A;  4XU3 A;  1HR0 O;  1D3B B;  5DLO A;  1ARK A;  2ZM6 O;  5IYD O;  4J6W A;  2QDL A;  3RIR A;  1P92 A;  2RPN A;  2WA4 A;  3M99 B;  2QSA A;  4M7D F;  2HL5 C;  1MAB G;  2M16 A;  2YUA A;  2CZ0 B;  3H1K H;  3K3W A;  4LWS B;  4B7K A;  5IY5 C;  1IGQ A;  1VQ4 V;  1NJI U;  4M4Z A;  2HLD G;  2EBP A;  4X66 B;  2CZ6 B;  2KRS A;  3CME A;  3CRM A;  3SYP A;  5B5E Z;  2DTI A;  1Q7Y R;  2BE3 A;  2O01 E;  2B5U A;  2LCL A;  4E7L A;  1VF6 C;  4TOI A;  4KH1 B;  2ZE5 A;  1R73 A;  3RYC A;  1BIA A;  1W2B A;  2Q69 A;  5B66 Z;  1IBL B;  3AG7 A;  4BAY A;  5HK0 A;  3LDD A;  5L3C A;  3ZX6 A;  1MMM A;  2GTO A;  4UV9 A;  3CCU Q;  1IBM B;  5J3B A;  5BZB A;  1XUQ A;  2V1D A;  3LH5 A;  2IVW A;  1V29 B;  2DBK A;  2FZK B;  3H6Z A;  3B8N A;  4O4I B;  3RYI A;  2QTS A;  3S3W A;  5IJ9 B;  1Q3E A;  5IH2 A;  1AR5 A;  2DM1 A;  3K9S A;  1RPO A;  4C5H A;  4XDJ A;  2P4V A;  2P4T A;  3JAS B;  1L0L H;  4X89 A;  1S72 A;  5CA3 A;  1OQK A;  1VQN A;  2RA2 A;  5GMK l;  4YXW G;  4IGG A;  4PA3 A;  3EG0 A;  1ZBJ A;  1FXV A;  4PL6 A;  1H8E G;  1N36 B;  2O2O A;  1MA1 A;  4WFE A;  2E6N A;  2K3B A;  5LJ5 f;  1GXI E;  4CBC A;  1NYF A;  4JI2 B;  3ME9 A;  4C0Z A;  4DV5 O;  1VQM Q;  2WLK A;  3M0R A;  4C5E A;  1RAG B;  5EBL C;  3F7Y C;  2QWO B;  1Q95 G;  2RNB A;  2D0N A;  5IWA O;  3F5T A;  2H8H A;  5D5P A;  4J9E A;  4XTY A;  4PK4 A;  2YRD A;  4DBQ A;  3RYC B;  4RAI A;  3NPF A;  3BCC H;  2DMX A;  3A8T A;  2MPX C;  3E2U A;  2PUK B;  1N8R C;  2LJ0 A;  3H01 A;  2LTO A;  2PI5 A;  2RN9 A;  3FD9 A;  4GKJ O;  4IIO A;  2J06 A;  3HRS A;  4XQ3 A;  3TET A;  3S3M A;  4PJO E;  5CKH A;  3MEU A;  3OYL A;  2QEX T;  2AGA A;  3RYI B;  1I07 A;  4R50 A;  4UUJ C;  2QTO A;  1WLP B;  2HVK C;  4NB5 A;  1A32 A;  3CCE A;  4FSS A;  4DV7 B;  4LE9 A;  3O5Z A;  5CKD A;  1UGP B;  4C8Q A;  3OS0 A;  3AK1 A;  3M0S A;  2E5L O;  3ASO B;  4X9Q A;  2Q0O C;  3G4S Q;  3M5A A;  1XNR B;  4FLZ A;  4P30 A;  1VYV A;  3MEV A;  1JA8 A;  2DYS C;  1D1B A;  1YI2 A;  1AZE A;  4P9O A;  3QO3 A;  1QHT A;  4W4L A;  3TK1 A;  1BU1 A;  1I94 O;  1WIE A;  3VS6 A;  3CCQ Q;  3BFM A;  2XDD A;  5H5N A;  2E3I A;  4XU1 A;  2GTJ A;  3CCJ A;  1OZ0 A;  2LP5 A;  1VQ8 Q;  2LQW A;  4B3M B;  2Y48 A;  2LO1 A;  1MMD A;  4NOY A;  2A28 A;  3CPW A;  1AT1 B;  2CDT A;  1QKX A;  4CC2 A;  5LP6 A;  3CME T;  4X64 B;  4E7Z A;  3M8A A;  1VQO A;  3QSU A;  5CQX A;  1ZUY A;  4A63 B;  4OGC A;  3AG3 B;  3RER A;  2DYI A;  1IUR A;  5KH6 A;  2BTO A;  3M0P A;  4OX9 O;  4KHP B;  1BI3 A;  1ARO P;  1E79 G;  3HR0 A;  1RP3 B;  1RPR A;  3SDZ A;  4C8Q B;  3CXC S;  2RD1 A;  1OX8 A;  2W6J G;  4M7A E;  2B9Z A;  1JBM A;  1M3B A;  2SEM A;  1YJW Q;  4FU6 A;  4AHC A;  1ZLM A;  3BY7 A;  1V9P A;  2DZ9 A;  3AG3 C;  2DFU A;  3QXE B;  4OB0 B;  1S72 T;  2M6Y A;  3KCY A;  2JS3 A;  2DTO A;  4WF9 V;  1VQ7 A;  3JAM N;  2F2V A;  3SYQ A;  4YTL A;  1TU0 B;  2XAH A;  5GAN 8;  1CKA A;  3K9A A;  4MVZ A;  4EMK A;  1QCE A;  2UXX A;  4J10 A;  3EFO A;  2Q0A A;  1N34 B;  1BMF G;  4N0A A;  2RMO A;  1K0S A;  5IJ0 A;  3JCM e;  4ZTF A;  2FB5 A;  4AFU C;  1KYO F;  1WHH A;  1CP9 A;  2DVJ A;  2CRE A;  1DF5 A;  1H8H G;  3ZHU A;  3OYK A;  1B6Q A;  5LP6 B;  2LW7 A;  1HNW B;  2F2X A;  2LC4 A;  1MGQ A;  5KE2 A;  1T3L A;  4DR7 B;  4BW5 A;  4C8Q F;  1O9G A;  3AK3 A;  2YIB D;  1RI9 A;  4Z8A A;  1XL6 A;  3KXT A;  4FJC C;  5GAN 3;  2R58 A;  5IT9 N;  3JCM X;  3OTO B;  3OMG A;  1VF7 A;  1NTK H;  3CME V;  5LP6 C;  1AVM A;  2DKG A;  1E6H A;  3NMZ C;  3UT1 A;  1YIJ T;  2Y4X A;  3A8G B;  2P67 A;  3APQ A;  1H64 1;  2QTV A;  1PG5 B;  2LX7 A;  2LQN A;  3UAT A;  3CCE T;  1QKW A;  3RFR A;  1FWZ A;  2DL7 A;  3UDC A;  1Q81 U;  1EN6 A;  4LF4 O;  2JN0 A;  5CVI A;  1YWP A;  2BE7 D;  2RDC A;  4B08 A;  2QG9 B;  3CC2 A;  3P30 A;  2CP6 A;  2LJ3 A;  3N2K A;  4D8D A;  4LD6 A;  3PIP A;  2KSS A;  3EFO B;  4A4E A;  2RK2 A;  2GGR A;  5FLX E;  4JJD A;  3EG9 A;  1JO8 A;  1ZX6 A;  2D9T A;  2GQV A;  4UCR A;  1YJ9 A;  3BRC A;  5IJ0 B;  1K8A U;  2X9H A;  2QDO A;  2JRI A;  1I8F A;  2VXE A;  2RQW A;  1VQN V;  3X24 B;  2YUO A;  2KNB B;  3STL C;  5LMU B;  3ZIA G;  1ZQ1 A;  1VIE A;  4EMK C;  4JAU A;  4ZI7 A;  1ZSZ A;  3QUI A;  4M78 G;  2RI5 A;  2O57 A;  1O75 A;  1K9M R;  2EIJ B;  4KP4 A;  1K73 W;  3M4Y A;  4N0A C;  4AI8 A;  2H3E B;  4F17 A;  2RB6 A;  2MYS A;  5IHK A;  1X01 A;  4MTF A;  2KBT A;  3SR2 C;  1HR0 B;  4ICG A;  2CYZ B;  5KYW A;  2ZM6 B;  4I9Q A;  5J2U A;  2K9G A;  1AI6 A;  1HWY A;  4PA9 A;  4C8Q G;  1VQO T;  4FVM A;  2A37 A;  1G83 A;  2K7A A;  4BDY A;  2EIJ C;  1WN7 A;  3D36 A;  2EIF A;  2JS5 A;  1FXK C;  2XI9 A;  5HK3 A;  3OS2 A;  3OGI B;  1BHA A;  1VYU A;  2D1X A;  1D1A A;  3L73 H;  1RAD B;  2HHH O;  1UEC A;  3N2K B;  1JXM A;  4IUP A;  2CH4 A;  4D7T A;  3Q4H A;  3ZHQ A;  4TVR A;  3EG9 B;  1ZWI C;  3CCE V;  1U1S A;  4FW2 A;  2HVJ C;  4B9X A;  3RNJ A;  4FCY A;  2EBO A;  1BI2 A;  2GSM B;  1MOF A;  2MF2 A;  1YTF D;  1VQ7 T;  3EH2 A;  4RG2 A;  4GX1 A;  2A7W A;  2HBP A;  1IB8 A;  2K5I A;  2PVD B;  2DQ0 A;  3CRA A;  2ETN A;  4ZGD B;  3J7A F;  4RQF A;  4ZI7 B;  1ZSZ B;  2LQT A;  2QWN B;  1GFD A;  3WXM B;  1YI2 V;  1JJ2 U;  1YBY A;  2LNH B;  3HRU A;  4AQY O;  2QWP B;  4C0D B;  1B07 A;  1EN4 A;  1UFI A;  1RUW A;  1LVK A;  3E89 A;  2FTK A;  4LP8 A;  5J2U B;  1M4U A;  1S3J A;  3CP1 A;  4LDV A;  3RKX A;  2QWR B;  1NJI W;  2J6K A;  3CCJ V;  1KB9 F;  1ZSZ C;  2DOS A;  1WX6 A;  4DV5 B;  3VUZ A;  3JCM g;  3T1H O;  1T0J A;  3HRT A;  3UCS C;  3OYH A;  3OA6 A;  2WLI A;  2OAW A;  1RAB B;  4JRP A;  2HAX A;  5IWA B;  3CXC P;  2ILM A;  1Q86 R;  4J7J A;  3GNF B;  1VQO V;  4ME7 A;  3ABK B;  1S5J A;  5LA6 A;  2XAF A;  4YJ2 A;  1YHQ Q;  5C8Y A;  3D36 C;  2BUD A;  3Q4H B;  5FPO A;  1VQ4 Q;  1R0B G;  2ATC B;  4C92 A;  5L3B A;  3EGU A;  1KK7 A;  4BE2 A;  2CKK A;  3M55 A;  3ZMT A;  4GKJ B;  2NN4 A;  3VS2 A;  1VP7 A;  2B1I A;  4K11 A;  1HNZ O;  2QWQ B;  1RAA B;  3JV3 A;  4B3R O;  2RJZ A;  4R7C A;  4Q5W A;  2LGQ A;  4X34 A;  1KD1 U;  5KAF Z;  1OYX A;  1N27 A;  2YS8 A;  1GK9 A;  2EQK A;  5I2S A;  2YIB A;  5EC1 C;  3LLR A;  2E5L B;  4UFZ A;  1YDX A;  5EBM C;  4KT0 E;  1VQ7 V;  1DK1 A;  2VKN A;  4MT8 A;  2YDE A;  1WJQ A;  4A4H A;  2A3L A;  3OS1 A;  4JI4 O;  1EN5 A;  3ZHV A;  2X3X D;  1PNM A;  5KUK A;  3S3X A;  1G3W A;  2FRY A;  2Z3Y A;  1WHG A;  3LYI A;  5JQG A;  2UU9 O;  3DB3 A;  3LH0 A;  4CC7 A;  3FKS G;  1I94 B;  3L42 A;  4E7S A;  3QTC A;  4DEX A;  4PJN A;  4CC6 A;  3VRY A;  5GAN 4;  4DV2 O;  2WLI B;  4JPR A;  1I0C A;  1KSW A;  2EX3 A;  4Y28 E;  4WFB V;  1MSD A;  1ZUU A;  5LA6 B;  4YJ2 B;  5C8Y B;  1XNQ B;  4P5N A;  4C92 B;  5H6Q A;  1RFY A;  3AG2 B;  4QJF B;  4JPB W;  1YJN Q;  2EYQ A;  2I2L A;  1M5I A;  2AHZ A;  2MW2 B;  4WBN A;  2QGG A;  1QR9 A;  3OYE A;  3ZHT A;  1QWE A;  4OX9 B;  1SG5 A;  2FB7 A;  2CTR A;  4J7I A;  4LFC O;  3JB9 H;  1PNL A;  2OIG A;  2OX7 A;  2RHY A;  4LCU C;  2AK5 A;  3AG2 C;  1FAF A;  4JJC A;  2X4Y A;  3CC2 V;  3HPW A;  3B09 A;  2FG0 A;  3G6E A;  4LC1 A;  3J80 E;  3B2E E;  4HVW A;  1YJ9 V;  1AVZ C;  2AIR B;  4FLU A;  5JQG B;  1G8X A;  2NYS A;  3DLL A;  1PHT A;  2B1G A;  1PM9 A;  5DM7 R;  1VAR A;  4ZN1 A;  3P3P A;  4M77 E;  3VQX A;  2QQ9 A;  2CP5 A;  2EIM B;  4C92 F;  1PKX A;  2K3Y A;  4N23 A;  4X88 A;  5FL7 G;  3M0Q A;  4N4H A;  3SWN A;  3OW2 A;  4JI5 O;  4OVA A;  1Y67 A;  3H0F A;  3BDL A;  4GBQ A;  3TXS A;  1WPB A;  4DEY A;  1QNM A;  1YEW A;  5B1A C;  2K6D A;  4XTU A;  4WBN B;  5IYC O;  2RNA A;  1AZG B;  1VQ6 Q;  4WFA V;  1QVG S;  2RM4 A;  4J80 A;  1W0J G;  3SJC C;  3CCR A;  4BI3 A;  1H3Z A;  1UHC A;  4TUY A;  3MP6 A;  3RMS A;  2E74 B;  3B40 A;  3M7M X;  1P7G A;  2CUB A;  5LMN O;  1ABQ A;  1L0N H;  2P5O A;  2QE7 G;  3OYD A;  4F6R B;  5LHH A;  2OCC C;  2DL8 A;  2ZR3 A;  1IGU A;  5KHK A;  1F7Y A;  3D7S B;  3CC7 T;  2K3X A;  3BA9 A;  3PIO A;  4O4H A;  3C90 A;  1EFR G;  1Y4M A;  4CZZ A;  4MS2 A;  1AHJ B;  2MAM A;  4GX2 A;  2ZDI A;  2Y69 B;  2CUD A;  4J42 A;  4JYY A;  2YUQ A;  1H2K A;  1X27 A;  2ZXW B;  2DN9 A;  2BIV A;  5KA5 A;  4LF9 O;  3SWN B;  2HQE A;  3TXQ A;  3HFO A;  4JS4 A;  3A0H Z;  4PLL A;  2KYB A;  4C92 G;  4JGS A;  2Y69 C;  3EGX A;  1SKU B;  4MVO A;  4N21 A;  2JEU A;  3JD1 A;  4XU2 A;  3BA8 A;  3SWN C;  2BKD N;  3JAK A;  1K73 R;  5LJ3 e;  5KYU A;  1XMQ O;  2CTQ A;  2E4H A;  1ZUQ A;  4DO2 A;  2VQE O;  4LH6 A;  4TUY B;  3BAA A;  1Q81 W;  2F2W A;  4J5Y A;  2Q5Z A;  5LYJ A;  3C0C A;  2V8J A;  5KYY A;  4UCV A;  4PNO A;  3HKC A;  3OYG A;  3F7V C;  3CRR A;  3OUF A;  1QVF P;  2YLC A;  1NEB A;  4HCZ A;  5LJ3 j;  2DJV A;  2IU0 A;  2P4R A;  1G6U A;  4O4H B;  2PU9 B;  5EIB C;  1K8A W;  2L5Q A;  3IJ4 A;  4JYC A;  1SSF A;  2HHH B;  5LHI A;  5KUM A;  3M9Q A;  3CXH F;  2VQF O;  2DMO A;  4LDW A;  1U5S A;  2DYB A;  3CYO A;  1Y71 A;  1BYM A;  4QVC A;  9ATC B;  4FZ0 A;  3LGL A;  5IYB O;  2YDL A;  2D6F A;  1OCO B;  2PQW A;  2Q7G A;  4HNA A;  3SPG A;  2VAS A;  4DRX A;  3CMA A;  1N0N A;  3EGX B;  1BGY H;  5D6X A;  4KRT A;  3WB2 A;  2QDY B;  2ZPH B;  1PL0 A;  3AG1 B;  4AQY B;  1PCX A;  1VQN Q;  1SET A;  3JAK B;  2E75 B;  5KLV H;  2DL3 A;  2JS0 A;  5KYU B;  3NFC A;  1OCO C;  3ZHS A;  3GF5 A;  1VQ9 Q;  2A7Y A;  3M59 A;  2N05 A;  1SQX H;  2UXN A;  4KFM A;  4OPH A;  5LYJ B;  2BZX A;  2OTL A;  5KYY B;  3AG4 C;  4IHJ A;  2RHZ A;  4F7U A;  5GAM d;  4QVZ A;  1YCY A;  3THK A;  3HKC B;  3GVM A;  3T1H B;  2EVR A;  3MHX A;  3H9V A;  2P0P A;  4KHP O;  4QNH B;  4DV0 B;  4DR5 O;  4UXN A;  2RJF A;  4I4T A;  2ZPG B;  3RMQ A;  2EQU A;  5LGU A;  4A4F A;  1M27 C;  1VA7 A;  1NS1 A;  3LDE A;  2F93 B;  5IXF A;  1S5H C;  3R65 A;  4B3S O;  3QPH A;  5GAO m;  3C3T A;  3FAV A;  1VIB A;  4DK1 A;  1KEC A;  1GM8 A;  2R9R B;  1HNZ B;  4HNA B;  5I2M A;  3I55 Q;  4B3R B;  1VQK A;  4D7S A;  3V7S A;  4DRX B;  4IT5 A;  3JB9 F;  3APO A;  1M4Z A;  3G6E V;  1M8V A;  2GBQ A;  3KFV A;  1WAZ A;  2DX1 A;  5BXZ A;  1ZL8 A;  4M75 A;  1NR7 A;  4JZ3 A;  3CPF A;  3CHX A;  4P2Z A;  3B77 A;  1NH2 B;  5CKB A;  4AG2 C;  1EZZ B;  4J9D A;  3FX7 A;  2LP7 A;  3K03 A;  4BD3 A;  3VS5 A;  5GAN e;  1JEG A;  4QT7 A;  3ZMV A;  1YI2 Q;  2JJ1 G;  5L3D A;  4JI4 B;  3CD6 A;  2GCX A;  2OTJ A;  3MP8 A;  4XTV A;  1Q8I A;  4IHJ B;  4F7U B;  1M1K U;  5BR8 O;  2KGT A;  1IXM A;  2UU9 B;  3ZMS A;  4K0K O;  3H0H A;  3QVN A;  1Y07 A;  3UQ8 A;  1MZE A;  1GMG A;  2A08 A;  2L6L A;  4TQD A;  2AZ2 A;  4DV2 B;  1NYG A;  2V8I A;  1QBZ A;  3CCJ Q;  2F66 C;  1BI0 A;  4HAM A;  2M0O A;  4I4T B;  3SPC A;  2Q68 A;  2QGN A;  3SYA A;  4DR3 O;  5J9P C;  2AHY A;  1WJZ A;  1N33 B;  1F23 A;  2ZAE A;  3HTR A;  4M78 D;  4JUV A;  1UG1 A;  2EYW A;  1KP3 A;  3CCR V;  1XOV A;  1KD1 W;  2WLJ A;  4K35 A;  2M51 A;  1VQL A;  5DED A;  1GN2 A;  4WFH A;  3JAR A;  3I9Q A;  4XTW A;  4A4K A;  5I11 A;  1JJ2 P;  1G5V A;  1RSO A;  3FAV B;  1WFW A;  4KUI A;  3LSU A;  1TGO A;  3PNW C;  3O9O A;  2ZE7 A;  4LDX A;  1XHZ A;  3T9N A;  3KG2 A;  3K57 A;  1PNJ A;  1WI7 A;  4H13 B;  3CCL Q;  1US6 A;  2MK3 A;  4QQD A;  4RUE A;  4LUE A;  1THZ A;  4LFC B;  3F70 A;  2X35 A;  2YI9 A;  5TIS Z;  1ZL8 B;  2BOC C;  1QQJ A;  2V8K A;  4M75 B;  5J39 A;  1GCQ A;  3L2Q A;  4O4J A;  3DB4 A;  3W7S A;  2ZGW A;  2ZZD A;  4EMH A;  4CS4 A;  3OYI A;  1JXO A;  3CMA T;  5LMU O;  1X6B A;  1BQZ A;  2IPO B;  5D6Y A;  4E7H A;  2ITD C;  2FPF A;  3QDF A;  5HY6 A;  1FYJ A;  1O9H A;  4M75 C;  3QII A;  2EIL B;  3CXC A;  2IIM A;  2E65 A;  1M3A A;  4GY5 A;  5FU7 B;  1SKV A;  5IY5 B;  1GAX A;  4PJO D;  4DR1 O;  2ZNJ A;  5EC2 C;  1FKA O;  2FVU A;  2MI6 A;  4ZTJ A;  3SYC A;  4N4G A;  2OTL T;  4RTW A;  3E8H A;  3N2G A;  3VOU A;  1UFF A;  3A5Z B;  4JI5 B;  5GON A;  2BZY A;  4JTC B;  2AKL A;  2MIO A;  2EIL C;  3ZN1 A;  3OYJ A;  5FU7 C;  3JCM f;  1NM7 A;  1PV0 A;  5L8R E;  3JAR B;  3QHS A;  2AXT Z;  3ETD A;  2EGA A;  5GJW B;  2JJ2 G;  1XNI A;  1NI8 A;  3GB7 C;  4K8Z A;  2E3C A;  1VQP A;  2IH1 C;  2CP7 A;  1WGS A;  2WLN A;  3OSV A;  4M75 F;  3J81 N;  3E9G A;  2K57 A;  3INZ A;  3JD0 A;  1WB7 A;  4X62 O;  2A36 A;  3M54 A;  1KMI Z;  3T4D A;  3EFR A;  1H2S B;  1H3H A;  3PGG A;  2RK1 A;  1VQK T;  3L2Z A;  3EG3 A;  4FT2 A;  5LMN B;  4O4J B;  4TQF A;  3JB9 G;  1G3T A;  2JXB A;  4F16 A;  2QAS A;  1K73 C;  5IYZ A;  2K9P A;  2EJF A;  2QA4 Q;  2N74 A;  1WHL A;  2UXC O;  1X2K A;  2P4K A;  4M78 E;  3CC2 Q;  2ABL A;  3G71 V;  1ZTE A;  1GCQ C;  1BQ0 A;  2L3S A;  2X3W D;  1KBH A;  4C5I A;  4I50 A;  4QE7 A;  2HJF C;  4OGQ B;  3W7W A;  1H2G A;  2CTW A;  3CMA V;  1YZB A;  2CP0 A;  1YJ9 Q;  2CGH A;  3CD6 T;  4FYX B;  3V8L A;  4R8C A;  2OTJ T;  4PHZ A;  3V7R A;  3OD4 A;  3N2G B;  4LF9 B;  2WSS G;  4C8Q E;  3CCS A;  1QLE B;  2QYZ A;  1LR1 A;  2A79 B;  2PNI A;  5D6W A;  2COY A;  2PGG A;  5GON B;  4M7A D;  1BZK A;  2Z5U A;  1KHI A;  3OUS A;  1JQ0 A;  1Y74 A;  2DXB A;  2XAS A;  4M7D G;  3CCM A;  2CP3 A;  2YSU B;  4HYO A;  1G8M A;  4ELY C;  1QLE C;  3EVK A;  2IU3 A;  1XMQ B;  2B8A A;  1SER A;  2MCN A;  1VQL T;  1ROP A;  5CBF A;  4LF7 O;  4CH6 A;  2VQE B;  5GAO p;  3I56 T;  1IZ3 A;  2XD0 A;  2E6Z A;  1M93 A;  4M75 G;  2A0L A;  4LFA O;  2C2A A;  3ZHR A;  1YIJ A;  3EGD A;  4MTG A;  5IYZ B;  3JD4 A;  2XKO C;  4B9W A;  2DYS B;  3OTF A;  4JRI A;  2F5K A;  5GAN d;  5LGT A;  1DTO A;  1Q6U A;  4OB2 B;  3Q1J A;  3WB0 A;  2WLM A;  4EEQ A;  4JAS A;  3W7X A;  1YP5 A;  2ROT A;  2X4J A;  1NJI C;  4R6Z A;  3C12 A;  4I50 B;  2CSQ A;  2YRV A;  1K8A R;  2LT4 A;  1IRX A;  5CA0 A;  2VQF B;  2R9I A;  2E10 A;  4IUU A;  1LUW A;  2Q7H A;  2F95 B;  3ETQ A;  3NR7 A;  3O8V A;  4FYY B;  4WCI A;  4X20 A;  2MWP A;  2FPE A;  1JVM A;  4WFG A;  1Y66 A;  1K7D A;  2YXH A;  3T1C A;  1Z2G A;  3CWB H;  2DQ3 A;  1SA0 A;  1YIT A;  2FYK A;  1Y74 B;  2PUS A;  1XTD A;  3CD6 V;  1KC8 U;  3ZFJ A;  3G7Z A;  3I5S A;  4K3A A;  1P49 A;  5M9O A;  2EKH A;  5IXB A;  1NR1 A;  1XNQ O;  4X9C A;  3M58 A;  1MMA A;  1Y6X A;  1FMK A;  2EZO A;  2JUF A;  4IKF A;  1M1G A;  4J9Y B;  1VOM A;  1VQP T;  1WXT A;  3JAL A;  4PDR A;  2WLL A;  4GLX A;  2XK0 A;  1XQH A;  4ZBM A;  1Z9Z A;  3EGD B;  4IUQ A;  2QKC A;  4I7Z B;  3D3Q A;  1I4K 1;  3OYM A;  3RBZ A;  2MWO A;  1VQL V;  3MKD A;  4DR5 B;  4LH7 A;  1KU9 A;  2JS2 A;  4BY6 C;  5CCA A;  4BDZ A;  5LHG A;  2E70 A;  4MSW C;  1G3Y A;  4LF5 O;  4PDL A;  2L8D A;  4DQ2 A;  4DK0 A;  5B1B B;  3CRC A;  1K5Q A;  2Y4T A;  5CA0 B;  1H2M A;  2QEX V;  2HNI A;  1A0N B;  1Q6H A;  5GAO n;  1BBZ A;  1C1A A;  4B3S B;  5K1P A;  5CA1 A;  1WHK A;  4LF8 O;  3RN4 A;  2DJQ A;  1C6V X;  1SA0 B;  2G6F X;  2LDM A;  5B1B C;  3BHP A;  1QVF U;  2YI8 A;  1IZ6 A;  2X51 A;  3QNE A;  1EFN A;  3ZS8 C;  1Q7Y U;  4NKG B;  2HCK A;  2ADP A;  3H1L H;  4ASU G;  3CCS T;  3CCV T;  2WAM A;  5CAI A;  1VIF A;  3OS5 A;  3OT7 A;  1GBQ A;  4OB1 B;  2ZE6 A;  1SQV H;  2Q6A A;  2HQX A;  4V2S A;  2P0K A;  1X4T A;  1KQ1 A;  2YHT A;  1XI1 A;  1K1Z A;  2L3Q A;  1CXZ B;  2H94 A;  2LJ2 A;  3JAL B;  4PI2 A;  3TGU H;  2Q8V A;  2WLL B;  1BIB A;  2QTX A;  5BR8 B;  3VS4 A;  4K0K B;  1XDC A;  4DBF A;  1FXK A;  1R3J C;  1IVS A;  1V1C A;  4CS2 A;  1HDJ A;  3A8O B;  4YY3 O;  4J7Z A;  2JNG A;  4RKU E;  1W4S A;  2K5L A;  1BS3 A;  3J7A U;  4Z02 A;  4DUZ B;  1GN4 A;  1AB3 A;  1WPY A;  1VQP V;  1UGV A;  4JYA O;  1HSQ A;  4DR3 B;  1SQP H;  2QQR A;  3RBB B;  3ZCC A;  2GUZ A;  4ATO A;  4IIJ A;  4MZP A;  3MCA B;  1WJR A;  3RES A;  5CA1 B;  2G3R A;  4AFQ C;  2ATK C;  4BIU A;  2QQA A;  2ZPI B;  2JM9 A;  3AHU A;  4UV8 A;  2LFS A;  3QJ6 A;  1OX9 A;  4M7A A;  3FYE B;  4DBH A;  2Q9L A;  3PMT A;  1H8K A;  2AKK A;  1SES A;  4PJO C;  4EMK B;  4FFB A;  3JAT A;  3JCM h;  1K33 A;  1MMN A;  2CZ7 B;  2YSQ A;  1F4N A;  1S72 V;  1MG1 A;  3L71 H;  4XK8 E;  1M1K W;  4EMG A;  3PTA A;  2CAZ C;  3CCU A;  1OCZ C;  1YIT T;  3THO A;  1X43 A;  3G6E Q;  4Y91 A;  3OEH G;  8AT1 B;  1M90 U;  1I5O B;  2N04 A;  2OT5 A;  3CSX A;  5FPR A;  4MVS A;  1HYO A;  4GLK A;  4HXJ A;  1LCK A;  1XEQ A;  4PJL A;  3HSB A;  4FM4 B;  4F04 B;  4JI3 O;  2F43 G;  4GKK O;  1OU9 A;  1WP7 A;  1EIF A;  1FXK B;  1JJO A;  4TV9 A;  2RI3 A;  2YUP A;  5CKF A;  5D7U A;  3X28 B;  2DEU A;  4DR1 B;  4JDS A;  3VYG A;  2V4D A;  1VEW A;  1RI0 A;  4GX0 A;  3LNN A;  1N9R A;  2NR5 A;  2EAY A;  5GJV B;  2FML A;  3DXR A;  1K0X A;  3VQW A;  2GUZ B;  2GFA A;  3QZ9 B;  4IIJ B;  5F2V O;  1NG2 A;  4RTU A;  3FJ5 A;  1K3E A;  1CSK A;  1VQM A;  2LJ1 A;  4DR2 O;  1KG1 A;  3JCZ A;  2BTT A;  3HL8 A;  1BK2 A;  1R3I C;  5IE9 A;  1I1J A;  1N9S A;  1UGR B;  2L2P A;  1D0Y A;  3VRZ A;  2J7I A;  1NKD A;  3EG2 A;  1EBO A;  4MVM A;  1YIJ V;  3CCR Q;  1TSF A;  2X6B A;  4FFB B;  3JAT B;  4X62 B;  1ZSP A;  1RLP C;  2NWM A;  3HKD A;  1TVK A;  2EUL A;  3E8G A;  1WXU A;  5GMK e;  1YWO A;  2RF0 A;  2DK3 A;  1H2L A;  1J5E O;  2LT1 A;  3A0B Z;  3O65 A;  1AWX A;  1C0M A;  4M7A C;  3P8D A;  5FWB A;  4E6R A;  3V8K A;  1BCM A;  4C92 E;  1KJW A;  4HT9 A;  1QVG A;  2Q67 A;  4PJJ A;  2UXC B;  3MAQ A;  3JCM Q;  2BTQ A;  2E76 B;  1WXB A;  2EIK B;  4PDM A;  4GCZ A;  4TV9 B;  1X6O A;  1Q81 C;  1JB0 E;  5GMK j;  2YRC A;  3VS0 A;  5KYW B;  5J2T A;  2DZC A;  3G4S A;  2EKO A;  1VQ5 T;  3CC4 T;  1GN6 A;  3GWK C;  3RYF A;  5JWP A;  2JM8 A;  3DXR B;  3K58 A;  3CC4 A;  4J9I A;  3ETE A;  2EIK C;  1K8A C;  2ARH A;  1EZV H;  3RWR D;  5IDJ A;  5FLX N;  4DV0 O;  4JI7 O;  3CCQ A;  3WB1 A;  5B1O A;  4PKC C;  5IN1 A;  1DJ7 B;  5BMV A;  3HHT B;  3ABL B;  4J41 A;  5C93 A;  4FLT A;  2KT1 A;  1OU8 A;  3D8C A;  2VUB A;  3FIF A;  4I0X A;  4LF7 B;  4K8X A;  3HKD B;  5JH7 A;  4D8K A;  2A0F B;  4M77 D;  2WPD G;  5LJ3 f;  2ZIO A;  4LFA B;  3U0Z A;  3JCM J;  1QR8 A;  1T0H A;  3ABL C;  1CPY A;  3NTI A;  1FMV A;  3P32 A;  1PSE A;  3FLG A;  1NPR A;  4MZT A;  1DLB A;  1QVF S;  4LF6 O;  3STZ C;  3JSN A;  2BTQ B;  4RTT A;  1VMG A;  4X1I A;  3CC7 A;  5A2Q E;  1H92 A;  1KUQ A;  3CCU T;  3HP9 A;  2CT3 A;  2KKW A;  4E7I A;  5J2T B;  3R6O A;  1U06 A;  4L59 A;  4J9H A;  4XTX A;  4JF3 A;  1D0X A;  3RYF B;  1RAF B;  4II1 A;  3G71 Q;  3TEE A;  4JZG A;  1VQ6 A;  2XTA A;  1UJY A;  1ORQ C;  5FU6 B;  4DV3 O;  2GBO A;  5E79 Z;  4FLX A;  3M0T A;  2LQ8 A;  1HXD A;  4C7U A;  2HKQ B;  5BMV B;  4ANJ A;  2HKO A;  3CC4 V;  3OR7 C;  5I21 A;  1W2B P;  4FT4 A;  4GZR B;  2VVK A;  1V76 A;  1N33 O;  4F4L A;  1KQ2 A;  2GTA A;  4FM1 A;  2AZV A;  5J26 A;  5BY1 A;  1VQM T;  4I0X B;  1I0H A;  2GF7 A;  3QWY A;  3SFM A;  5FU6 C;  2PYJ A;  5JH7 B;  2J6O A;  4KGX B;  4MW3 A;  2K4Y A;  5JJJ B;  3GIB A;  1NZ6 A;  2ADQ B;  2GDS A;  1SHF A;  1U3O A;  2CT4 A;  5H9C A;  4DR6 O;  2PY5 A;  2XG8 D;  4WF2 A;  2V1R A;  1LPL A;  4X9D A;  2LCC A;  4VUB A;  5GAM e;  4X1I B;  4KUD K;  2DRK A;  5B1N A;  4Q20 A;  2R70 A;  2F4V O;  2IH3 C;  2F69 A;  3ULR B;  4LF5 B;  1UGQ B;  2EW3 A;  2DER A;  3HB3 B;  4UCT A;  4J11 A;  2OJ2 A;  5LJ5 d;  1SZT A;  3EXA A;  1ZA2 B;  2EYY A;  3P8B B;  1F4M A;  2JOY A;  2PTM A;  4E7J A;  3L1A A;  2UUA B;  3HFN A;  2FZG B;  1KC8 W;  4CH4 A;  1FS0 G;  2A06 H;  2JIZ G;  2NLJ C;  1FXH A;  4LF8 B;  4KUM A;  1M1F A;  2QM4 A;  1W70 A;  2AZS A;  3CCU V;  3EFS A;  2H3J A;  3EHB B;  4RTX A;  4HCK A;  3JSL A;  3CBO A;  5GAM j;  1Q82 U;  5JJN B;  3VS3 A;  4G28 B;  3G4S T;  3ICX A;  3GP8 A;  1D1C A;  5B1A B;  2KY9 A;  5B3S C;  4ZNX A;  4Z88 A;  1KD1 C;  3OYN A;  4RQE A;  4G2K A;  4L8J A;  1T3S A;  5KYX A;  4I55 A;  1B06 A;  2P84 A;  2DXU A;  1QLY A;  3CCQ T;  2YIC A;  1M3C A;  2YWW A;  1GL5 A;  2E64 A;  1FPO A;  3G80 A;  4BIO A;  5GAN f;  1QU7 A;  3DLM A;  2ZPE B;  4NL3 A;  4R55 A;  3CS5 A;  1VQ8 T;  3UT5 A;  2OWO A;  1XMO O;  2OCC B;  4H0L B;  1VQM V;  1G2B A;  1WHJ A;  3VUB A;  4YY3 B;  4D6W A;  3K06 A;  2HSP A;  2DA9 A;  1NVP D;  3JAW A;  2LGW A;  4A5U B;  1ACM B;  1Q5O A;  3VYH B;  4JYA B;  2DWD C;  4ELZ C;  2JTM A;  5JJE B;  4WFF A;  5FRN A;  5KCO A; 
#chains in the Genus database with same CATH homology
 2YXY A;  1SF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...