2YXYA

Crystarl structure of hypothetical conserved protein, gk0453
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
EQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYMLNPADFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISLLRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the hypothetical DUF1811-family protein GK0453 from Geobacillus kaustophilus HTA426
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical conserved protein, GK0453
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08838 DUF1811 Protein of unknown function (DUF1811)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.880 Mainly Alpha Orthogonal Bundle Helix Hairpins Hypothetical protein YfhH domain 2yxyA01
2.30.30.340 Mainly Beta Roll SH3 type barrels. Hypothetical protein YfhH like domains 2yxyA02
1SF9A 2YXYA
chains in the Genus database with same CATH superfamily
1V55C 2LQNA 3UT5B 4HXJA 4LUEA 1GBRA 4B3RB 2RJCA 2G38A 1Q8IA 1GK9A 2GCXA 1YI2T 2X51A 1KP2A 4PA4A 1D1AA 1NE8A 3JARB 3ZIAG 2JS3A 3RBBB 4F17A 2QM8A 2RK2A 3FB6C 1JEGA 3D3QA 1YJ9T 4XAXB 3RMQA 4RUFA 2MWOA 4RTUA 1M1KR 1PSFA 1RI9A 3M0TA 2QR4A 4LDWA 1FXKB 3WB1A 1G3TA 1PG5B 1I94O 4G2KA 5B1AB 4B3TB 1SRYA 1HR0O 1PHTA 1WXTA 3FYEB 2OJ2A 4IUTA 3AK2A 5I22A 1MHNA 3SJAC 4JI8B 3E1SA 4K3AA 1QVGS 2LGWA 2VQFO 4M7AE 3R65A 1SF9A 3B09A 4BIUA 4DR5O 5FWCA 3CCSV 2QA4A 3CE2A 2K6DA 5FPRA 2DL4A 1PP9H 1BL8A 1SQFA 2EILB 1I0HA 2L3RA 4OMOA 5CAIA 2YI9A 2MK3A 1JR9A 1VQNQ 3G6EA 1URFA 4OPAA 4OB2B 3OS1A 4YJ3A 4EMKA 1FFXA 1U5SA 1XMOO 4JJDA 3BAAA 4MVRA 4ZOLA 1M90C 3OFNG 1VQNV 2HKNA 1YITQ 3STZC 3V7RA 4GKKB 5C93A 2COWA 3OAAG 2WSFE 2ZPIB 2EVRA 4FFBB 4FIBA 4I50B 2B86A 5CBGA 2CP3A 2J6FA 1TSFA 3CC2A 4J7FA 4JI5B 2HBPA 4TSFG 2JXBA 3ZRVA 4FW2A 3B8NA 1JCHA 2WPDG 3B40A 1M1FA 1NZ6A 4WFGA 2CT3A 1TUDA 4E4EA 4L87A 4RTVA 1I5OB 3CPFA 1X2KA 5CKFA 4UCTA 1WJSA 4PK4A 4DV5B 1VYUA 2EYWA 2LJ1A 4M78C 4DR7O 3VUBA 5GAMd 1KC8R 5IHNA 2A7WA 4J7ZA 2HR3A 5DLQE 2V4DA 5GANf 4H13B 2MWPA 3OYLA 3B2EE 1VQ6V 2J05A 1K73C 1VQLA 4X1VA 1ZWIC 2UXCO 4JZ3A 4C0DB 3NHNA 1YHQQ 2LMJA 4NTYA 3VJPA 2DBKA 1MMAA 1JJ2A 1AWOA 1K0SA 3BFRA 1VQ7T 2IU0A 1V9PA 5GANh 3JCMW 3UO2A 3WFVA 5D7UA 5IN1A 3G4SA 4E7IA 4C8QF 1SSHA 3APQA 1Z5VA 2A06H 4P9OA 2OTJQ 4X9QA 3ABUA 2ZDIA 5DLOA 4IIJB 1N32B 4FT4A 3ZHUA 4J7IA 4AFUC 2PUOB 1GH6A 1Y6XA 1ZTEA 4C92B 5LMUB 1VQ9Q 3MKDA 4JASA 4NXNO 1VP7A 1FWZA 2KEAA 1P92A 2ED1A 3QO5A 2FTKA 4F6EA 5KMGA 1M3CA 1I08A 3U10A 2EQKA 2M51A 4KGZB 2A9HA 5LYJA 1QWFA 1HXDA 5CO7A 4ZN3A 4R8CA 2Z3YA 3EG2A 3M99B 1OYXA 5H2FZ 2GQVA 3NFCA 1VQOT 4ZI7A 2RH2A 1JXOA 2RHYA 1VQMV 1N32O 1XQ8A 5J2TA 1OULA 5B3SB 5GMKh 2HL5C 2RI5A 3OTFA 5EC1C 1OCZC 2CDTA 2R5AA 1XHXA 3ABMC 3OEHG 4D8KA 3OSSC 3PNWC 1G1XB 5GMKj 2K1EA 4GLKA 4J83A 2FRYA 3EHRA 2CGNA 4JI7O 2JIZG 2QKAA 5C0MA 4UC4A 1PPJH 3ER0A 2UUAO 3SEMA 3PVQA 1EIFA 5HY6A 2CP2A 3HSBA 3J81E 2ZDIC 3OS2A 1PL4A 4M4ZA 4U7NA 5CK9A 3UWNA 1SKUB 2YIDA 3BRCA 5BMVA 4M75G 4F6RA 3CCMQ 2CZ6B 3L2QA 3S3NA 1PNLA 3CMEA 4ZHQB 2A08A 4IUPA 4C8QC 4MTFA 3Q4HB 3CYOA 5A9GA 1M3AA 1VQLV 3TEEA 4JPBW 2BTTA 1VQ6A 1ENVA 2H8PC 2QWNB 5EYPA 2WSCE 3MHXA 4BW5A 1NH2D 4M75B 2QJ1A 1C1AA 2XD0A 1QCNA 4WFBV 4RUEA 2VV5A 3JB9I 1AZEA 1BU1A 5LL6Y 1I1JA 3CRRA 4M77F 1K8AU 2H3JA 3L72H 4V2SA 1BYMA 1NS1A 4C8QG 1QVFS 1MZEA 1QVGP 5IWAB 5EZYB 5H9CA 4P2ZA 1NVPD 3IC9A 4J5YA 1UUEA 2FYKA 9ATCB 3CEYA 5CB4B 1T0HA 4PA3A 2X35A 3OYBA 2JRIA 2IPOB 5GW7A 2EJGA 5HCKA 5FROA 4C0GA 3H1LH 2KBTA 4J9ZB 1BBZA 3M0SA 3C90A 4IYIA 3C94A 2HEQA 3QBYA 2P06A 2DXTA 1SHGA 1B34B 5GAMe 4JI6B 4EMGA 2BZXA 3OBWA 4JI3B 4F7UE 3G6EV 1PNKA 4PJOG 3VQVA 5EBLC 1FJGB 1WLEA 2H3OA 4HA8A 3ZBHA 5LL6S 4II1A 4NL3A 1QVFU 2WWWA 4WFHA 1VQ4T 2DERA 2FHDA 4M78E 5JCOC 3Q4HA 2FO0A 5EK0A 4B9XA 3DC5A 3HPWA 3OYEA 2XICA 1AR1B 1I07A 2J6KA 3C3TA 2F66C 1VQMA 5LHGA 4K11A 5B1NA 2BTQA 3K0DA 4U3JA 1BI0A 1GXIE 1XEQA 2HEPA 4RO2A 4QVDA 3ASOC 2FPDA 2XHBA 1D1CA 1UGSB 3JSCA 1E79G 2VVKA 4B3RO 1MABG 2OCCC 3HR0A 5FNVB 1A32A 2RNBA 2FZKB 1M57B 1RADB 3MEWA 4OF1A 5KYWA 4O4HA 5LGTA 4FPPA 3CMAA 1SQPH 2KRSA 2XDDA 2V8KA 1VARA 1UHCA 4Y92A 1S1NA 4MDXA 3NPFA 2KSDA 2XDPA 1UEBA 2ZXWB 1Q86R 5H6RA 1BKBA 3KBGA 4DV0O 5DM7R 2AXTZ 2EZPA 3D7SB 2D6FA 3VYGA 4CS4A 3OD4A 4M78D 3UT1A 1QLNA 4LCUC 4X1YA 4WF2A 1RAIB 4JLIA 2L5QA 2O88A 2F2WA 3CC4A 2E12A 3GNGA 1WP8A 1ZX3A 2KG7A 1BZKA 2WLIA 5LXTA 2M0YA 2RHZA 1W4SA 3VQWA 2E65A 1WXBA 1MMMA 3OYFA 4FIPC 2EGCA 1M56C 3N2KA 1B7TA 5ECAA 2RQUA 2IIMA 3RFRA 4CH6A 4N0AA 2GQIA 1UFFA 4JLGA 4XDJA 2K7AA 4LDUA 4C92E 2AGAA 4LF9O 1E6HA 3OMAB 2QEXA 1GAXA 1NZ9A 4JAVA 4K8ZA 1QP3A 2YDEA 3LX7A 2MMPA 3AG7A 3ZJZA 2IJJA 4LN2A 3K0GA 3H1JH 5IJ0B 1F4MA 3DC6A 4KH1B 4PFZA 1X01A 2XTAA 2L3SA 1NYGA 3HKCA 2XDBA 2EULA 3GVMA 2HZYA 3M54A 2P4KA 1D5NA 4CC4B 2Q5ZA 4P30A 4PJ0Z 3L73H 2COYA 2EKHA 4HCKA 1B34A 5I2MA 2AW9A 3CCST 4DV6O 3JCMe 3PFSA 2FG0A 2JUFA 3SPHA 3M0QA 4OP0A 4UFZA 3FAVA 2MOXA 5KE2A 5GMKl 5CKEA 3OA6A 3TK1A 1BI2A 5GAN6 2RPNA 3LSUA 1UPGA 3WB0A 4W4LA 4DV3O 2HL3A 2YSQA 2BUDA 3OMCA 4OVAA 1ZBXA 3KXTA 2YEVA 1G3YA 3JB9J 1YTFD 3ZHTA 2P4RA 1SQQH 4PA7A 2N05A 1C6VX 4C92A 1SESA 2JN0A 3H0IA 4HAMA 1YITT 3VRZA 4A4GA 3JCMd 2R9AA 3RWRD 1IGQA 3ICXA 5KLVH 2X4XA 5DECA 4TVRA 5KHGA 5GANe 4XQ3A 1VQLQ 2KY9A 2R5MA 4UXNA 5LOVB 1YJNT 4AFQC 2PTKA 3RDVA 4JUVA 4CC2A 1VQ8A 4B7EA 4IUQA 2JEUA 3QWXX 3ZMTA 2DVJA 2O01E 3OGIB 1IXBA 5K1PA 1D3BA 4JJNK 4LF8O 4A54A 1OZ0A 3ETDA 1N36O 3BFMA 5KHJA 4HYOA 4JV5B 1ZHIA 1HP8A 4BAYA 3W7UA 3CBMA 2E10A 1Q7YC 1WB8A 2IH3C 5GANg 1UG1A 4RUGA 3ZRWA 3VS3A 1N6AA 1M8MA 1X75C 1OCOB 3JCMc 4L8JA 2ZZDA 4D7TA 2AT1B 4O4JB 1NTMH 2GTJA 2DZCA 2RJFA 3H0FA 4PKCC 4DBHA 1RL2A 4E7SA 3CXCU 4LFAO 4DK0A 1AB3A 5GAOp 1Q6UA 2ZKOA 2DYRB 3QDRB 3ABKC 2RMKB 4P5NA 4I0XB 1I8FA 4PNOA 2C0TA 5IXBA 1OPKA 1S72Q 2I2LA 1XMQO 1ZSZC 2HQEA 2CKKA 3JALB 4Y28E 3IGAC 1VQ8T 2R9RB 5C8YB 3H6ZA 1VF7A 2V1DA 4O4HB 2DW4A 4NKGB 2QEXT 5C6SA 1FKAO 2EINC 4B3MB 3H1KH 2YUQA 1YIJV 4UVAA 2FL4A 4YHHO 2OTLQ 4IKFA 2ROLA 3TU4K 5IJ0A 3H9NA 1YDXA 1E1QG 4AFSC 3E35A 3H8ZA 3PT9A 1V76A 3ZMUA 1K33A 2YI8A 3ETGA 2QKCA 2HG5C 3ABLC 4FJCC 1FXVA 3CCLV 4CH4A 1VQ4V 2DKGA 3G1JA 1VQKT 5FRNA 4DUYB 4PJOA 1H3HA 4RTTA 2ADQB 2JGDA 2VXEA 3U11A 3TVTA 3DXRA 1SQVH 2QWPB 3E89A 3W7WA 2QASA 1VQ4A 5LMNB 1Q86W 4O4LA 5AYFA 5LJ3h 3HRUA 2L35A 4DUZO 1RAHB 4PJMA 3OTOB 5IY5C 2CK3G 5GJWB 4K0KO 1RFYA 2YIBD 2KDSA 4LD6A 4F4LA 5HK0A 3ZMZA 2QGGA 2RI3A 1BGYH 2K2VA 2A0LA 1MNGA 4LFCB 4JAUA 3CS5A 4QPJA 1MUZA 1GN4A 4TT3G 2VB6A 3GLXA 3RYHA 1RP3B 2WSEE 1R3JC 1YHQV 1HNZO 5KA5A 1WYXA 1N34B 5EBWC 1WXUA 4ICGA 3RN4A 1NPRA 2Y69C 1UGQB 1NPPA 2XG8D 4AMCA 2ZPHB 1YJNQ 5LXTB 1V29B 1COWG 1BCCH 4MVUA 1PD1A 2KGTA 8AT1B 3BEHA 3OYCA 2DMOA 3CCMT 4JRQA 4DR2B 1UE9A 4QT7A 4C8QA 5FU6B 3A8GB 1H2MA 2WLHA 1OQKA 4YJ2A 1KD1R 4CBCA 4BR6A 1U96A 3A98A 3H01A 1ZBJA 4GCZA 2GGRA 4HVUA 4RQFA 1GM8A 3A5ZB 1NLOC 1PKXA 4BE2A 4MSWC 4JZ2A 4JI6O 3QUIA 4EPCA 1Q82C 1AZGB 4UVCA 5EIBC 1UGVA 1IXDA 1M5IA 1M5Q1 3MP8A 4DBRA 4EIKA 2O4XB 4E7JA 3OUSA 4NTXA 2BCCH 1VMGA 1XNIA 4ZN1A 3T2MA 4JI0B 3SHWA 2ZE8A 3L2WA 3JD0A 3OT7A 2PYJA 3MD0A 2DYSC 4YXWG 2Y4YA 2AK5A 5LBQA 2RI2A 3QZ9B 2JJ2G 3QG5A 1OU8A 3CMAV 3QG1A 1RABB 4BUGA 1RSOA 1ZSPA 3WG7B 2JVDA 1RLQC 4HCZA 1M90U 1YHQT 2V26A 2GSMB 1WJZA 1K4CC 1W6XA 3QYGB 2CGOA 1K92A 3UCSC 1QCOA 3TXQA 3JASB 2DAQA 2E5KA 3OB9A 4JRKA 3K59A 1VQ8V 4FLWA 1ZX6A 3AG4B 1N33B 3U0ZA 2LJ0A 1TH7A 2QDYB 5KCHA 3RYFA 4MDWA 3EG1A 5GAOr 2BSKA 5JQGA 4TQDA 4IURA 1Y76B 4Z2WA 1WQWA 2D0QB 2DFUA 1US6A 3LH0A 2O9VA 2DLPA 1SC5B 1OCCB 3HB3B 2JTEA 4R56A 1VQMT 1SRLA 3GP8A 2GNCA 3I55T 3VRYA 1Q81W 2GBQA 3CCUT 4FZ0A 3A0BZ 2Q7EA 1ACMB 4J42A 4WCEV 2UUBB 4B9WA 1S3JA 1KP3A 3H0HA 1Q86C 3SWNA 3K5MA 4XDKA 3TETA 4KT0E 2A7YA 3K03A 4RKUE 4C0FA 5GAN4 3C3SA 3FX7A 2OT5A 3CRCA 1IO6A 4O2BB 3JATB 5D5PA 4JI7B 1O9GA 2DE0X 1S0VA 2HBWA 3NTHA 3RNJA 3RERA 3CPWA 4PL6A 1T0JA 4GYCB 4NS5A 3SPCA 4MVOA 2FB5A 4RAIA 4LFAB 2P0QA 2W10A 4FSSA 1EFNA 4HT8A 4YIPA 1LR1A 4CC6A 2V8JA 2Y48A 2HJFC 2DPPB 2L3PA 5LP6C 5KH6A 3GF5A 3STLC 4LF5B 4LNUA 2C2AA 3JASA 2JM9A 4J9YB 5FW9A 1QLEC 3LNMB 1VUBA 2HSEB 3OW2U 2RN8A 5GTIZ 4DV7O 4LF6B 4A4EA 4A4HA 4RCBA 4EDUA 3EH1A 2DQ3A 1YI2A 2DA9A 3RYHB 3BCCH 2VKNA 3I56V 1JBMA 1RUWA 4Y91A 3FJ5A 3ZEDA 2PU9B 1H2KA 2P84A 3PJSK 5GAN7 3AK1A 3JCMV 3SYQA 3FIFA 3X20B 3OYDA 2HHHB 3CC4V 3CMEV 4HVVA 4FYVB 2B5UA 2COZA 2KXCA 2MPXC 2QYZA 2QM7A 2RA2A 2YRDA 5I21A 1XREA 2LTOA 1QNMA 1H8HG 3IAYA 1EZZB 1K9MU 4LH6A 1DF4A 3HHTB 2WACA 1EFRG 1QP2A 3MO8A 1OOTA 2VASA 1UJWB 2JS5A 3LUTB 5DY9A 3X2QB 2EIKB 3CCMV 4BIZA 4MMKA 1XILA 3JCZA 5AT1B 4N0AC 4B3SB 5J2TB 2CE4A 2NUZA 3G4ST 3CCVT 2AHZA 4X65O 1GFCA 4KRTA 3OYIA 1Q7YR 3K08A 4JF3A 5LOVA 2BOBC 4O2AA 1KKDA 1XNRO 2RHXA 5LMUO 1MMNA 4XTYA 3APOA 2JM8A 5FU7C 2VQFB 1WHKA 2XMFA 3F7YC 2HLDG 1VQLT 1N5ZA 2DTHA 1YNZA 1N33O 2C0OA 2NR5A 1VQOA 2D3OW 3O8VA 4FLUA 2QSAA 1JJ2P 5GONA 1VQKV 1NG2A 4JRIA 3CC7T 2O2OA 1SSFA 4PFPA 5KUKA 4M7DC 2SEMA 4RCCA 2RD1A 1NJIR 2EIMC 1Q90D 1AHJB 3L2ZA 4HNAB 4PLLA 2AIRB 4TOIA 4X1KB 3AG2B 3TGUH 3JD3A 4FM1A 3CCMA 3M9QA 2LW1A 2YIAA 4BI8B 3AG1B 2W6JG 1JX9A 4DOWA 4G28B 4JYBA 1KD1C 2MIOA 5L8RE 2UXNA 2K79A 1ROPA 4GKJO 4M7AF 1H2NA 4N23A 2QWOB 1P84F 1ZAUA 3AG3C 4OMQA 2WLLA 3OEEG 5CA1B 2B1IA 1U1SA 4CS2A 1BI1A 1RAFB 3G6ET 3E22A 4JI4B 4ZIBA 4QJFB 3QWYA 4PJJA 1H92A 4KUIA 3CD6A 4JYCA 1JO8A 1Q95G 1AP6A 3T1YB 1IDSA 2HQXA 4EMKB 1OI1A 2PF4E 2PVDB 1FMKA 2YRVA 2A28A 3SJQC 3T4DA 5IAYA 2CTRA 3CX5F 2L2PA 4E2FB 3AHUA 4H44B 2E6ZA 2F2XA 3B4SA 1K1ZA 5KHKA 5D6XA 1J3TA 1XQHA 1V54C 1IZ6A 4FM4B 4DUZB 4BWAA 4XBFA 3EFSA 4M7AB 4C8QD 4YTLA 2DL8A 2CAZC 3CC2V 4C0ZA 1MG1A 5A0DA 1GL5A 2EBOA 1TAEA 1NKDA 1KECA 5BR8B 4LFBO 1KJWA 2NUTB 3M4YA 2HAXA 4ASUG 2FKXA 1KBHA 2EYYA 3CJHB 4CH5A 2K4YA 5LMNO 1IHVA 2YDLA 1VQNA 2DN9A 2DX1A 4A5UB 2PVOB 2LP7A 3JCMP 2EJFA 3X28B 3CCSQ 1PRMC 3OUFA 3JCMb 3ULRB 2ZE6A 4JI8O 3BVOA 3ML0A 1NTZH 4DK1A 4F7UG 3HPLC 3CXHF 2NNUA 4LF8B 3CCVV 1VEWA 4DR2O 2H3EB 1AEYA 4IUVA 3TSWA 5LJ3g 3CD6T 4J41A 1K5QA 2VS0A 1S72A 5KYUB 3MCAB 2WLJA 5KYYB 2ZPBB 1K97A 1WAZA 3SJBC 4PJNA 4X66B 4GLMA 3WXMB 4EEQA 1ORQC 3I55V 1NBMG 3G71V 3GB7C 3K9SA 4AI8A 2B8AA 1N8RW 4O4IB 1UTIA 1SPKA 1RPRA 1BI3A 1QQJA 4NXMO 2F4VO 4WF9V 1AD5A 4JI0O 3CB2A 1FMWA 2LRQA 5J2UB 1XMQB 3HRTA 2E4HA 3I35A 1F23A 4C8QE 5LJ3j 4X34A 4MVZA 2XIDA 3JAMN 5CIUA 3ETQA 1WB7A 1AWXA 4ME7A 3CD6Q 3M8AA 1SQGA 4X66O 1KU9A 2EGAA 1JA8A 3JAWA 4M7DD 1YITA 1B6QA 1H8KA 1P7BA 4YY3O 3QJYA 1OX8A 3IFXA 4GLXA 3M57A 4KHPO 1TG0A 2WLNA 2EQJA 5KHHA 3ZHVA 1QR9A 1OZ3A 2DYBA 4I55B 2RHIA 4P9PA 3QO8A 4JI1B 4ZGJB 2LQTA 3N27A 2O9SA 4LFBB 2V7QG 3F5WC 3GWKC 1QQCA 4XDLA 1VQ9A 2R9IA 3E8HA 2M1HA 1RM1C 2X6BA 2CH7B 2DL3A 2XI9A 3I56A 1H38A 2KAFA 3V8LA 2FRWA 3J80N 4PI2A 3OTOO 1VQ7Q 4UCRA 1BIAA 4A4KA 2ADPA 3L9DA 5JVDA 1NJIW 2R57A 3G4SQ 1KC8U 5IXFA 4MW3A 1QKXA 3C12A 1VQOQ 2DWEC 2WSSG 5DN6G 5GAN2 2W0FC 4CC3A 1ZUUA 1KC8W 4EMHA 5KCOA 2DTIA 2XUMA 4AHCA 4DR3O 3VUZA 4KBMB 2VUBA 1V55B 1XDCA 2CH4W 1G8MA 1IX9A 2HHHO 2ZIOA 4MTXA 5J2UA 2RO0A 4M77D 5GJVB 2DL5A 1GRIA 4IIOA 4QE7A 4DR5B 1IXMA 1I81A 1MZFA 5GMKe 4DR1B 4O4IA 4DV0B 3L75H 5J26A 2HJDA 4Z02A 1FXKC 1Q81C 3CCJV 1LCKA 1R3LC 4JTCB 5KYYA 5LJ5e 3JAME 1WFWA 1FYJA 4E47A 3DLMA 1PKTA 2B9ZA 4RQEA 2ESWA 1H2SB 3CXCA 2LX9A 1KQSU 1K8AW 1LUVA 3T1HO 4NL2A 3UQ8A 5BR8O 2ZNJA 5GAN3 1B07A 1THZA 3GWOA 3JAKB 5E79Z 5GAOm 3CC2T 1P49A 2DRKA 2A36A 4LWSB 2DVEA 4BACA 1NR1A 1PNMA 1KQSA 2EIJC 1VYTA 2MF2A 4NVPA 4DV3B 1IB8A 4J9GA 4LP8A 1RACB 4E7HA 3TREA 4N4GA 1XL4A 2CREA 2KNBB 2YUNA 2HKQB 1GCQA 1VQPV 5GAN8 3EGXB 3S3MA 3SD4A 1W2BP 5KMGB 3MJXA 2E3HA 3CC7Q 3CMAQ 1YJWA 2K5FA 3RW0A 4M75D 5I11A 2MW2B 5EC7A 2LO1A 5KAFZ 1W70A 4DV1B 4LE9A 1W59A 5DEDA 4LF7B 4DOVA 4M78F 1FJGO 3VS2A 4J6WA 2QWQB 4X1IA 2PTMA 1Y07A 2LVMA 2D1XA 3JRZA 3SB2A 3CC7A 1M93A 3ME9A 1W0KG 1JQQA 1Q82U 2E3IA 1WZOA 2DXBA 1W2BS 2QKSA 5EBMC 1GM7A 3CCJQ 3J7AF 1FAFA 5BZBA 2GTOA 3ZCCA 2FB7A 4NTWA 4AILC 2OAUA 1LNQA 3AT1B 2FZGB 2UUAB 4R55A 5EZYA 2IG0A 1OCRB 2EQUA 4BE1A 3BDLA 3JB9F 3RKWA 1VQ5V 3REBB 1YFNA 4E7KA 1M2OA 3JCMh 2QEXQ 2GV9A 3CRMA 2FL7A 4JGSA 3H41A 1YSCA 2LT4A 3ZFJA 4LH7A 3I9QA 2E76B 4LDVA 1VQPA 1VQ5Q 1N0NA 2NN4A 2VWFA 4J9FA 2LCCA 3ASKA 1N8RR 3ZEHA 4JI1O 1PM9A 4LF4B 3CCRT 1HNXB 2QDLA 3MEUA 3THOA 1KUQA 4FL6A 1N8RC 3VOUA 4Q6GA 4I50A 1T5EA 1OU9A 4F7UB 1DF5A 1VQ4Q 3BA9A 1F51A 4PJLA 2M6YA 4DQ2A 4H37A 5JWPA 3M56A 5JJEB 2WLLB 3G6BA 1AOJA 1YI2Q 2GUZA 4M77C 5BY1A 2IVWA 4X62B 2VWKA 3JCMg 2E64A 2FEIA 3OMIB 1ZL8B 4YJ3B 4UUJC 1Y71A 3M0PA 5HFLA 2KB1A 1XBLA 3O9OA 4DV2O 5GAOq 3PE0A 3V7CA 3HKBA 3OYYA 4N4HA 2AKKA 4EB6A 3ZRXA 4E7ZA 4O4LB 1I7FA 3P30A 2IH1C 2M16A 1JJOA 1R6NA 3C95A 4FLTA 2KQXA 3JCMJ 2YXLA 1K7DA 3CMET 5B3SC 3LW5E 4X64B 3MP1A 1KK7A 3FFQA 3A8HB 3JCMQ 4BDYA 3CMEQ 2QK0A 3ABMB 3HL8A 5IJ9B 4O2AB 4X62O 4JI2O 1GFDA 4KFMA 3ZN1A 2YT6A 2XNDG 3CCQA 2DIGA 3BDUA 1WHMA 3EVKA 2GFUA 1MMDA 3VBBA 3ETEA 1BB9A 2F43G 3QYHB 2RJEA 3EGXA 1YJNA 3BW1A 1Q6IA 1NR7A 2IJHA 2K3YA 1JQ0A 2JZ2A 3KKYA 4GZRB 4OX9B 4KGVB 1IRXA 2KK4A 2GTSA 2EKOA 5FWBA 4X65B 4DR1O 4LF4O 1VQ9V 2J6OA 2VC8A 4G27B 2LZ6B 2PZ1A 2HKOA 3VS6A 1VQ5A 4BDZA 4AG1C 3OR6C 4LWSA 3LH5A 1Y7XA 1ZUYA 5LJ5f 4M75C 3OGCC 1N0JA 4GKKO 2YUPA 2OTJT 2LC4A 3K06A 1VIFA 1YCYA 1PL0A 4TV8A 4ZTJA 4LR3A 1H2LA 1TGOA 4FFBA 3CC7V 2EAYA 4OB3B 4AFZC 4NYKA 1LOJA 5JJJB 1QW1A 3HKSA 3I5SA 4IUUA 4I7ZB 4C5GA 3GIBA 3JD4A 2BTQB 4U3JB 2KXDA 1M4UA 2YXYA 4BD3A 5GAN5 1R73A 1YJWV 3A1PA 5CN0A 3CCEV 4PJOF 2OIEA 1HD3A 2OCHA 2ED0A 4F7UF 5GONB 4MVSA 3RVZA 3EGDA 4ORZA 4EB6B 1L0LH 2QQ9A 2O31A 3M5AA 2CTWA 4ESRA 1Q82R 1YJWQ 3TSZA 3G71A 5LGNA 1Q5OA 2XAJA 4JI2B 3UPUA 2DJZA 5IT9E 2VYTA 3OYNA 3H1IH 4LNUB 5FL7G 3JATA 3G71T 3N2KB 1B3QA 3MHHC 1S72V 4LFCO 1H641 4J9HA 2ZE7A 4PJOD 3J7AU 1BS3A 1NU1H 3SWNB 4AT1B 1QHTA 3BY6A 2IJKA 3T9NA 1WNSA 4DR4B 3E83A 3CMAT 1NYFA 4BE0A 1M9SA 4MZPA 4FZ1A 1XOUA 3CC4T 3QIIA 2K9GA 5HKCA 2E75B 3A8MB 4BY6C 2DO3A 1N8RU 1PKSA 4FFKA 4QW2A 1RAEB 4L59A 3CHXA 4JTDB 1NEGA 1Q7YW 4GBQA 1KC8C 5DM6V 3P3NA 4N21A 3LDEA 1X43A 1VQPT 1BHBA 1B04A 2RQRA 4EKWA 3UDCA 4JJBA 3CC2Q 1YVWA 1CSKA 1XJWB 2YUAA 1F7YA 2K57A 3OW2S 3R6NA 4J9BA 1N36B 4J9DA 2IJIA 4DV6B 3Q1JA 2QM4A 3ZHSA 1SG5A 4M75A 3OSVA 1KQSS 3LYIA 3MHSC 2BOCC 2ZXWC 1HNXO 3TQ7P 2BZ8A 5CA3A 7AT1B 1Q81U 1SS3A 3DTUB 1HSQA 2MCNA 2ZQMA 4MW8A 3SGIA 2P5OA 2HMAA 2UU9O 1JMKC 5CQXA 4JYAO 4PA6A 2K9PA 1VQ6Q 3QVNA 1M27C 3FB8C 1QVFP 4R50A 1M1GA 3T1HB 3A0RA 2EJ7A 4KGXB 4XU2A 2YS8A 1M56B 2QTOA 2E5LO 3VQXA 2EQMA 2G3RA 2LFSA 4VUBA 3OW2A 1KQ2A 1UGPB 5E1AC 4I4TA 4AG2C 3JSNA 2F5TX 1O75A 1KD1U 1M90W 2ETNA 2JOYA 3CCLQ 3OS5A 3RKXA 2CGHA 1N9RA 4JI4O 1BCMA 2QTVA 3LNNA 3L2RA 4KHPB 5JCOA 3T4ZA 4GX0A 4I4TB 3KUFA 4PJOB 4LF5O 2X6AA 1VQMQ 4LF7O 1XNQB 2DD5A 1CXZB 3GNFB 4PDLA 2Q68A 2OAWA 1PD3A 1UHFA 4I5SA 1XI1A 1GTOA 4TV9B 4KULA 2CDYA 4RTXA 3HRSA 1J95A 1IBKB 5BXZA 3JD1A 2D9TA 1NJIU 3DXRB 4DYLA 5B5EZ 5B1BC 5IYZB 2M0OA 4LF9B 1R0BG 2Y0IA 2RJZA 4J9IA 3FD9A 4LDXA 1TUCA 1DTOA 5CKDA 3UF4A 2L6LA 4NB5A 1QU7A 1YWPA 4DRXB 5KX5B 2LNHB 3WVEB 3ASNC 1UJ0A 2Q69A 5CMUA 1JB0E 2O57A 5J9PC 2YLCA 3VS0A 2CTPA 2Z0AA 4OMNA 3G4SV 2F1MA 2EJ9A 1MMGA 4YJ2B 4M75E 4PV1B 3ZL7C 1RLPC 2JS2A 1DGSA 3VU3C 3MDSA 5IDJA 2Z5UA 1L8DA 4U3FH 1TWBA 4QIWF 2BIVA 3KZIZ 2EGEA 3G80A 3W7XA 1HYOA 5L3DA 5CA0B 4JYYA 5JVDB 5I2SA 4FM0A 4J7KA 3CQTA 4CC5A 2QTSA 1KSWA 1WLPB 2JMAA 1Y0MA 2JS0A 2JMCA 4RG8A 1Q86U 3K79A 3RYCB 4YIOA 2P4TA 1JFFB 2OTLT 2KKWA 1AJQA 2J06A 5EIBD 4OMMA 1AR5A 3INZA 5GANj 4FLVA 1NH2B 2RCVA 2YSUB 1K9MW 2P90A 3D8CA 3E8GA 3WB2A 2EYXA 3CCQT 2L3QA 4ZI7B 5LA6A 2F4VB 1RPOA 4IT5A 1E6GA 5L3BA 3V7SA 1VQKQ 1KQ1A 1OCOC 1NM7A 1R1BA 5B1AC 3EAEA 4DR4O 1NQTA 2PUSA 1SHFA 2PVGB 3FDRA 3GOXA 5IHIA 4OPHA 4DW0A 2IU3A 3SYCA 1QR8A 4H0LB 4UB8Z 2WA3A 2JTMA 3EG9A 3VS1A 2DYRC 2KE9A 1D2DA 1Q7YU 3CXCP 4WFEA 5IYDO 2YLBA 3SYOA 4JZ4A 5CVIA 4D6WA 1V1CA 1M9NA 4A63B 2JTFA 1JPXA 4JV5O 2K3XA 1UB4A 3ZRSA 2AZSA 3IC7A 1HNWO 1NI8A 2EILC 2DILA 5IH2A 4XTXA 3JB9H 3RYCA 1SKVA 2HFEC 3E22B 3SJCC 1M30A 1I0CA 2AZ0A 1HWYA 2E3CA 3B77A 4BI4A 3ZS8C 5FLXE 3PGGA 4JTAB 3CSXA 1G8XA 3E9GA 1EZVH 1VQOV 1AR4A 5LJ3e 4LDYA 4ZTFA 4TUYB 2ZGWA 3RIRA 1KQSP 3ABLB 2GUZB 3QNEA 1ABOA 3WU2Z 3NXSA 3LDCA 1RI0A 3JARA 2DNUA 3T1CA 1N9SA 4NXMB 5JJNB 1IBKO 2CUBA 3A2FA 2EW3A 5K1XA 3EG9B 3FC3A 2B1GA 3X25B 2JEXA 4HBNA 1GO3F 4I0XA 5IY5B 2QI2A 2EBPA 2GHYA 3X24B 2ZT9B 3EFOA 2HDAA 4O5VA 4QPKA 2FZCB 3NTIA 2XAFA 2PZSA 4M78B 1R6KA 1OHHG 2GTAA 3BE3A 2RQVA 3ABTA 1IURA 5GAOn 5LJ5d 1YEWA 1U3OA 1NBEB 4R6ZA 3ZHRA 1IREB 3N5BB 4Q5WA 3O65A 1G3WA 3VS4A 4D6TH 3GBQA 2KRNA 3IJ4A 1Q43A 1BCOA 1WDXA 3UKMA 2QQRA 3CCVQ 2CP7A 5KYXB 4C0DC 1PD0A 1TUGB 1DK1A 3K04A 2DBMA 4M78G 1TVKA 5FU6C 3QHSA 3E86A 1IGUA 3SPGA 5B66Z 1D3BB 3F5TA 2SRCA 2UXXA 2A0FB 4DEXA 2EX3A 2W0ZA 1M1KU 1KKCA 1SQXH 1NTKH 2DRMA 2VGMA 2JVVA 3QPHA 4FK5C 4LC1A 4OMLA 1I5YA 5CA1A 1HW7A 1YI2V 1IBLO 4RTYA 4PJOE 2D8JA 4EFEA 3E2UA 2XAQA 1TA8A 1UGRB 1E7OA 1AI4A 1EX4A 2QXFA 2R70A 5A2QE 2Q73A 3CCQV 5LJ3d 4KUMA 1OPLA 1GCPA 2DJQA 4E2LA 1VQ7V 4C92C 1YJ9A 5L3FA 3UM7A 2RB6A 5D6YA 3FB5C 3K5NA 3DB4A 4QVZA 5IWAO 4W4KA 1AVMA 2P0KA 3EXAA 4DV7B 1WHLA 4X1KA 2EWNA 1IHWA 4QQDA 3A8TA 1QVGU 2G6FX 3W7SA 2MYSA 1XNRB 2DYIA 2L8DA 3A8LB 3LGLA 3OM3B 2LGQA 5IYZA 1Z9ZA 4HT9A 2HVKC 4I9WA 4J80A 2F2VA 1JXMA 4F04B 3ZX6A 3OYGA 1S5JA 2QTXA 2LFRA 4LXCA 1QVGA 3AG4C 3RT3C 3S3WA 1EZJA 3CCLA 5KX5A 2JK5C 1FD9A 3JV3A 1OCZB 1M90R 2KROA 3UT5A 5D6WA 2WLKA 4DEYA 2VQEO 3K3WA 4K35A 3F7VC 1HNZB 3OR7C 3I5RA 2RQ6A 2F69A 2KR3A 3LSQA 4PA9A 4Z1VA 2BE9B 2FPFA 3JYCA 3CBOA 2NUPA 1LJOA 1JVMA 3FLGA 2ZE5A 3OS0A 1EBOA 2EZOA 2DETA 1VQNT 4JS5A 4FT2A 3VYHB 3PTAA 5F2VO 2HSPA 3L70H 4MVQA 4DO2A 2KSSA 1AI5A 1ABQA 2YRCA 3KCYA 3OMGA 4DR6O 1U8RA 5IYBO 4LBEC 1B06A 2DXUA 4C8QB 3CEIA 2HCKA 1M2VB 4X1IB 1BK2A 2Y0PA 2DF6A 1OX9A 1Y96A 3E9FA 4CC7A 4CZZA 3AEIA 2P22C 2CT4A 2BSKB 5JQGB 1BSMA 4QQGA 3M7MX 2K2MA 1D0XA 1VQ9T 5IHKA 2ZD9A 4NXNB 2CH4A 1LPLA 4QVCA 5KYWB 3A0HZ 2Y4TA 2UUCB 2PNIA 4X9DA 4M75F 5LP6B 4QNHB 2QGFB 2Q67A 4DV1O 3CXCS 1NEBA 2PQWA 4GX2A 4J7JA 4DR6B 1QBZA 1Y76A 1SERA 3TCUA 1WHJA 1YWOA 4B3SO 3EGDB 2RK1A 1QCFA 1DJ7B 2C0IA 4U7OA 4M7AD 2JGDB 1WPYA 3MEVA 4X20A 4MMLA 2DXCA 2NUTA 2KVQG 1H8EG 5KYXA 5KYNA 3R66A 3S3XA 4M7AA 4J9EA 2OTLA 3CCRQ 1SA0B 3C4SA 4FYXB 1RSOB 4PD4F 2VQEB 2UUBO 4OB1B 3I56Q 3EFRA 3EG3A 4DW1A 3URGA 5CBFA 2YXHA 2Q9LA 4TV9A 2EFIA 3M4GA 3PMTA 4J6YA 3S6WA 1X59A 3VS7A 1SQBH 1YN8A 1Q3EA 1WPXA 1FPOA 4ZNXA 2V8IA 3QXEB 1M8VA 4F6RB 1TU0B 3D36A 4OX9O 3P32A 1Y74A 2P4VA 1CKBA 4LF6O 4DXWA 3F70A 1YHQA 1G83A 5EYPB 2RN9A 1WGSA 4JI5O 3V8JA 3QSUA 2DQ0A 1WIEA 4C5HA 4CI0C 4UB6Z 3N2GA 1QLYA 3L1AA 2KQWA 2ECZA 2E6NA 3DGEA 1YCSB 1ZA1B 3ZN0A 1K9MC 2P67A 3ASOB 1FMVA 4JS4A 1AJNA 2YHTA 1GBQA 4IIMA 4MTOA 2OCCB 2ZINA 1TUBA 2RQWA 1XUQA 2EJRA 4DR3B 2PI5A 1I5LA 4JJCA 1M57C 3B8MA 2DM1A 1KIKA 2HD0A 2E1HA 2RQTA 1PNJA 3P8DA 3JCUZ 3D3IA 1ZSZA 1SETA 1EM1A 1CP9A 2RMOA 4L5GA 3CC4Q 3CCRV 2CP6A 2EIMB 2LQWA 1BMFG 1FFTB 1W0JG 1YJ9V 4ZGEB 5GAMj 1WHHA 2YICA 3SR2C 3AG2C 3QKJA 1NT2B 3QZ5B 4M7DG 4PLIA 2LQ8A 5GAMh 3NR7A 1R8OB 5BMVB 2BKDN 1D5AA 2LW7A 5GAOl 2LDMA 2OYQA 4M7DE 2IM9A 4FCYA 1EN6A 3FB7C 1WJRA 3HP9A 2OTLV 1I94B 2ATKC 4B3TO 2J7IA 3M55A 3META 2O4XA 3NTKA 3OYMA 3S3OA 2ZM6O 1O9SA 1Q6HA 5C8YA 4FLXA 4UCVA 2PY5A 3AG3B 1FX7A 2YEVB 4K8XA 2P6JA 2DTOA 1AP5A 3U23A 2CS7A 3SPJA 1IBMO 4DV4O 1GN6A 4IIJA 4PI0A 1MNDA 2NWMA 4M7AG 5L3CA 1W1FA 4OMFB 1QVFA 1X4TA 2Z0WA 3VQYA 1AI6A 1JFFA 4A4FA 3E19A 3BPZA 1YITV 4A53A 4E6RA 1M1KC 4BW9A 4IHJB 4XTWA 4J10A 5GAMg 4C92D 5CBHA 4GT1A 1SRMA 3LLRA 1WN7A 1PWTA 4DUYO 1MGQA 4QKUA 2Y4XA 5B1OA 3VV0A 2DZ9A 4X9CA 4HNAA 4M7AC 3THKA 2AZVA 8ATCB 4J9CA 1RAGB 2ZCFB 1PRLC 1WI7A 3MEAA 1BQ0A 1X69A 3VKIA 4WTOB 4PDMA 3UA6A 1GN2A 1N4CA 5KHIA 3ZRWB 2VGNA 5CCAA 1VQ8Q 2PGGA 3L71H 4D8DA 4IL6Z 1HNWB 3I55A 1Y66A 1D0YA 4MVMA 1AILA 3DSQA 4EFBA 4MTGA 4I9QA 2FVUA 1YP5A 2BTOA 4HKEA 2HQHA 1KMIZ 3QO7A 3BHPA 2LT1A 3G6EQ 1N34O 1S77D 3KFVA 5GMKm 2DWDC 3E2EA 3CCVA 5H5NA 2W6IG 2KI7A 1W2BA 1FXKA 1FFXB 2QA4Q 2RDCA 5EC2C 4AQYB 2F1LA 3EFOB 1NJIC 2K3BA 1YIJQ 4UCUA 1K73R 2P7TC 4JYAB 5J3BA 1JOYA 4WCIA 3N2GB 3D36C 2YC0A 4M7DA 4WFFA 2UU9B 4QQ6A 4F7UA 2Q0AA 2VWJA 2ITDC 1N27A 1SEMA 3CCET 2CSIA 4RG2A 4ATOA 1MSDA 1OZ2A 2E74B 3DLLA 4KH0B 4MT8A 4GX1A 1I4K1 1ZSGA 2DEQA 4RMOA 2ZAEA 4TUYA 1VIEA 1ZL8A 3JCMX 1HK9A 3FAVB 2X0LA 3BY7A 1ARKA 2EYZA 4B3MO 4NOYA 4CRIA 1QVPA 1MV3A 1U1TA 4UCSA 2Q8VA 3M58A 5IT9N 5IJ9A 3RUXA 5LJ3f 1S5LZ 2X6CA 2RM4A 2XKOC 3QDFA 2EPDA 3CCUQ 3ABKB 1Y67A 4PELA 3CBPA 4C92G 4LUDA 1ZLZA 1ZSZB 5CKHA 3JB9G 4GUNA 4WBNB 2Q7GA 2VRZA 3TCJA 5JH7B 1U97A 3EFFK 2I0NA 3K5OA 1ZA2B 3CPWU 2OTJV 2AKLA 1FXHA 3K9AA 1RM1B 2UXCB 3SFMA 2WLIB 4KXRA 3E8FA 2EINB 3L42A 1R3KC 1I5XA 3LDDA 2PYLA 3J81N 4ZOLB 3V8KA 3BA8A 4DV4B 1X2QA 4FW1A 1S5HC 2VXFA 2Y90A 3UA7A 2X4JA 2ZCEA 2MK5A 5L3GA 1XL6A 3P3PA 4JRPA 4D7SA 1Y4MA 5A2QN 1ZQ1A 3LWHA 3TJTA 2L89A 3M53A 2CP5A 3P8HA 1GRJA 1M4ZA 1R0CB 3RKYA 3H9VA 3CCUA 1VQKA 2DMXA 4JPRA 5LJ5h 1GM9A 1FYNA 3GPLA 2JT4A 3ZBDA 2LJ3A 2PI4A 4M7DF 4QE9A 2CSQA 4FYYB 2FMLA 2F93B 3LWIA 3OYHA 2GF7A 1K4US 1D1BA 2RJDA 2NUPB 1J5EO 2KYMA 3CCUV 1BIBA 1O9HA 1U06A 1AI7A 3W7TA 3PIOA 1IZ3A 1IVSA 1D0ZA 1VYVA 3PN1A 3MPUB 3OBYA 4C92F 1KYOF 2YUOA 3RR6A 2Y69B 3HKDB 4X20B 3R6OA 4X89A 1X6OA 2DOSA 1C0MA 2LP5A 4OMPA 1BT8A 1VIBA 2QQAA 1IBLB 4E7LA 2YWWA 2C06A 2XHCA 4IGGA 1UECA 4XTUA 4KP4A 2NLJC 3QO3A 2D2CB 3HKDA 4OGCA 2EIJB 3HFOA 3L74H 3OYKA 4CH3A 2XAHA 1SZXA 2QG9B 1XHZA 2KRMA 3A8OB 2F95B 3ZMVA 4C5IA 4LD9K 1WP7A 2H8HA 4WFAV 2M02A 4F16A 1R3IC 1P4RA 4LNPA 3EGUA 2E70A 1K34A 1TS9A 2HNIA 4PFOA 2CH7A 1MA1A 2H94A 2HVJC 2UXDO 2UXBB 1CEZA 1MSWD 3I55Q 2OWOA 3DB3A 4TV8B 1Q81R 1K5SA 2DYSB 2HP8A 4JI3O 5J39A 1GMGA 2QAZA 4FM2A 1PM3A 4OB0B 1YTFB 4BB7A 2ZPGB 3WG7C 2LQKA 2X4YA 3JB9D 1VQ5T 2ZIMA 3I56T 2GBOA 4C5EA 4X64O 1M2VA 3SDLA 2ZNIA 5CQYA 2Q6AA 3KCXA 5LP6A 2V1RA 4GY5A 1OCRC 3OW2P 2KYBA 4PDVA 2DEUA 2ABLA 1VOMA 1F1BB 4FU6A 4TWKA 2MAMA 1TTHB 4FSXA 3HKEA 2R58A 4ZBMA 4Z88A 4DV2B 3EG0A 4XTVA 1BQZA 2AZ2A 1WPBA 1MV0B 3K5LA 1OCCC 2ZR3A 3SYPA 3JAWB 1E1RG 1QKWA 4DR7B 3HTRA 4J8OA 4ELYC 2GFAA 4DV5O 4RWUA 4WBNA 1GKFA 3BABA 2M9UA 2LCSA 2QE7G 4B6MA 1WJQA 3NMZC 3FB9A 2JGUA 3O5ZA 3TXSA 3DKMA 1RAAB 4I55A 1KB9F 2BE7D 3RBZA 1TOVA 3LSSA 2QA4V 3CCSA 3RESA 5HFMA 5JH7A 4TQFA 4ZHQA 2LNVA 1D09B 1WA7A 4HVWA 3M59A 2WA4A 3AK3A 5KYUA 1GN3A 3MAQA 4M78A 3VS5A 4UCOA 2JW4A 5ITZB 4M77B 1OV9A 1WA8B 2CYZB 4ELZC 2QQBA 2PUKB 4ANJA 2BZYA 4OGQB 2X3XD 3CCEA 1WNLA 4K0KB 1IBMB 6AT1B 1JJ2S 2NYSA 1M1KW 2LX7A 4MZMA 1MOFA 2A37A 1LVKA 3T1YO 1J5EB 2F5KA 2ZPEB 2ITCC 1L1FA 4FYWB 5CB4A 1QLEB 4N4IA 1ZLMA 3RYIB 2BE3A 2FYUH 1VA7A 4O4JA 1G6UA 1UFIA 1JRIA 2JNGA 3FYIB 3JALA 3CD6V 4FLYA 2R72A 2WLMA 1F4NA 2N74A 1YIJT 2OIGA 2X3WD 1X27A 1OJHA 4UV9A 5FRMA 2LCLA 4IYHA 4CS3A 2OI3A 2OTJA 3P8BB 2CUGA 1A0NB 3PVLA 1PSEA 5EG2A 2XASA 4C7UA 4QGPA 5LGUA 2KT8A 3QJ6A 1K8AC 1K76A 3REAB 5KE3A 3CCQQ 4X88A 3CCLT 3HKBB 1Z5WA 3FRNA 1NLPC 3PMIA 4KL1A 5KAIZ 3CJHA 4MS2A 3X2QC 2EIKC 4PHZA 1VF6C 1QWEA 3H1HH 4Q20A 3CPWS 1ZUQA 2YIBA 3FJPA 4M77G 2GDSA 4B08A 3CCRA 5GANd 5CKBA 1QCEA 3OE7G 3SDZA 2EIFA 2JDIG 2EYQA 1XTDA 2UXDB 2UXBO 1K4DC 3K58A 4J6XA 4IHJA 1WHGA 5FU7B 3RYIA 1G2BA 4M77A 3X26B 5LJ5j 2UUCO 5ITZA 3SYAA 2XU8A 3HKCB 1JJ2U 3JSLA 3RGBA 3CP1A 1K0XA 1K9MR 3PIPA 2OX7A 1JU5C 4O6JA 4JAAA 1X6GA 1FXXA 2RNAA 5M9OA 5L3EA 2ARHA 4HZ3A 3C0CA 1CPYA 1WQ7A 3CCEQ 4KUDK 3JAKA 2CZ7B 2A3QA 4M7DB 2Q7HA 1TUEB 2P0PA 1H3ZA 3RMSA 5LHIA 3OYJA 1AJPA 1LUWA 2EQIA 5D5QA 5LYJB 2D0NA 4OGEA 3CRQA 2E5LB 1EN5A 2Q0OC 3AG1C 5LJ5g 4HCBA 1BHAA 3OQ5A 1VQPQ 4DBQA 2KG7B 1LNXA 2DL7A 1AWJA 1PCXA 1WX6A 1TXQA 4DRXA 4ZKIA 4OXSA 3SWNC 1WA8A 2MI6A 1K8AR 2A79B 4XTZA 1EN4A 2ZR2A 4O2BA 2DK3A 3E8BA 5GTHZ 5CR2A 2ILMA 1L0NH 3JD2A 5AG2A 4BY6B 5A0GA 4R0KA 2CZ1B 3EHBB 3SPIA 3OMNB 3LGFA 4JDSA 2E41A 2M7WA 1OV3A 1VF6A 5CA0A 4B7KA 3CPWP 3KG2A 4EMKC 1AWWA 1FS0G 3G71Q 1MNEA 1BE3H 5FPOA 2XAGA 5KUMA 2QDOA 3G67A 3NGPA 1SZTA 1K73U 3ZMSA 2RHUA 1V54B 2QGNA 2XT9A 1VQ6T 5TISZ 5H6QA 5LA6B 2N04A 5GMKi 1K3EA 3JCMf 3HKEB 1Y96B 1XMOB 1KHIA 2KT1A 2XK0A 4HCCA 3J80E 4H33A 4FLZA 2X7RB 1K9AA 2JJ9A 3OY9A 4Z1MG 4J11A 1OEBA 2X4WA 4AQYO 1NVPB 2ZPFB 4M77E 2NLUA 4FVMA 1YJ9Q 2CZ0B 1KD1W 1Z9QA 1PC0A 1T3SA 1YJWT 4L6V5 1YXBA 2WAMA 1YJNV 3ZHQA 2ATCB 1UDLA 2ENMA 1Y57A 5A0LA 1K73W 1YCIA 2ODMA 3MP6A 3I5DA 3FEOA 2FPEA 2QQSA 1H2GA 4BIOA 1R77A 5KA6A 1UJYA 5L23A 3HFNA 2ZM6B 3CRAA 1HJDA 1YF2A 5IE9A 3WVDB 2LJ2A 1SA0A 4YHHB 1X6BA 1G3SA 1GCQC 1T3LA 2DD4A 4YY3B 3L2UA 2V1QA 2Y4UA 1CKAA 3FKSG 2L0AA 3CCJT 1KHCA 2AHJB 4PJOC 1VF5B 3CWBH 4NR1A 4ABMA 4Z89A 2KMTA 1Z2GA 2QA4T 2AHYA 1R6TA 3CCJA 2W0XA 3QF7A 4GX5A 3G7ZA 2QWRB 4ZGDB 2RF0A 1TUBB 3RVYA 5IYCO 5FLXN 1YBYA 1AVZC 3QTCA 2Q4PA 4UV8A 2D8HA 3L2VA 1KFZA 1YZBA 5LHHA 3UO3A 3EH2A 4X1YB 2CP0A 5B1BB 3M0RA 4BI3A 4XK8E 4F14A 1AROP 2QEXV 5HK3A 2XOKG 1VQ7A 1G5VA 1YIJA 4X8AA 3K57A 3OYAA 2F23A 1QMCA 1HDJA 3RYFB 4FMTA 4R7CA 1XOVA 4RTWA 1DLBA 4DBFA 3ASNB 1PV0A 1G4YB 1Q82W 4JZGA 2CUDA 2E5QA 1XNQO 2A3LA 4XU3A 1TVKB 4XU1A 1S76D 2K5IA 2X9HA 1Y74B 3IQLA 4Z8AA 1KG1A 2DJVA 1M3BA 1ZUKA 1AT1B 1HR0B 2IW5A 4UVBA 2CTQA 2DIQA 4MZTA 5FNVA 3UATA 3EHQA 4XU0A 5GAMf 4DA4A 3M0UA 4PDRA 2JJ1G 1W2BU 4GKJB 4RTZA 2IBZH 1P7GA 1S72T 2ROTA 2K5LA
chains in the Genus database with same CATH topology
1SF9A 2YXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SF9 A;  2YXY A; 
#chains in the Genus database with same CATH topology
 1V55 C;  2LQN A;  3UT5 B;  4HXJ A;  4LUE A;  1GBR A;  4B3R B;  2RJC A;  2G38 A;  1Q8I A;  1GK9 A;  2GCX A;  1YI2 T;  2X51 A;  1KP2 A;  4PA4 A;  1D1A A;  1NE8 A;  3JAR B;  3ZIA G;  2JS3 A;  3RBB B;  4F17 A;  2QM8 A;  2RK2 A;  3FB6 C;  1JEG A;  3D3Q A;  1YJ9 T;  4XAX B;  3RMQ A;  4RUF A;  2MWO A;  4RTU A;  1M1K R;  1PSF A;  1RI9 A;  3M0T A;  2QR4 A;  4LDW A;  1FXK B;  3WB1 A;  1G3T A;  1PG5 B;  1I94 O;  4G2K A;  5B1A B;  4B3T B;  1SRY A;  1HR0 O;  1PHT A;  1WXT A;  3FYE B;  2OJ2 A;  4IUT A;  3AK2 A;  5I22 A;  1MHN A;  3SJA C;  4JI8 B;  3E1S A;  4K3A A;  1QVG S;  2LGW A;  2VQF O;  4M7A E;  3R65 A;  1SF9 A;  3B09 A;  4BIU A;  4DR5 O;  5FWC A;  3CCS V;  2QA4 A;  3CE2 A;  2K6D A;  5FPR A;  2DL4 A;  1PP9 H;  1BL8 A;  1SQF A;  2EIL B;  1I0H A;  2L3R A;  4OMO A;  5CAI A;  2YI9 A;  2MK3 A;  1JR9 A;  1VQN Q;  3G6E A;  1URF A;  4OPA A;  4OB2 B;  3OS1 A;  4YJ3 A;  4EMK A;  1FFX A;  1U5S A;  1XMO O;  4JJD A;  3BAA A;  4MVR A;  4ZOL A;  1M90 C;  3OFN G;  1VQN V;  2HKN A;  1YIT Q;  3STZ C;  3V7R A;  4GKK B;  5C93 A;  2COW A;  3OAA G;  2WSF E;  2ZPI B;  2EVR A;  4FFB B;  4FIB A;  4I50 B;  2B86 A;  5CBG A;  2CP3 A;  2J6F A;  1TSF A;  3CC2 A;  4J7F A;  4JI5 B;  2HBP A;  4TSF G;  2JXB A;  3ZRV A;  4FW2 A;  3B8N A;  1JCH A;  2WPD G;  3B40 A;  1M1F A;  1NZ6 A;  4WFG A;  2CT3 A;  1TUD A;  4E4E A;  4L87 A;  4RTV A;  1I5O B;  3CPF A;  1X2K A;  5CKF A;  4UCT A;  1WJS A;  4PK4 A;  4DV5 B;  1VYU A;  2EYW A;  2LJ1 A;  4M78 C;  4DR7 O;  3VUB A;  5GAM d;  1KC8 R;  5IHN A;  2A7W A;  4J7Z A;  2HR3 A;  5DLQ E;  2V4D A;  5GAN f;  4H13 B;  2MWP A;  3OYL A;  3B2E E;  1VQ6 V;  2J05 A;  1K73 C;  1VQL A;  4X1V A;  1ZWI C;  2UXC O;  4JZ3 A;  4C0D B;  3NHN A;  1YHQ Q;  2LMJ A;  4NTY A;  3VJP A;  2DBK A;  1MMA A;  1JJ2 A;  1AWO A;  1K0S A;  3BFR A;  1VQ7 T;  2IU0 A;  1V9P A;  5GAN h;  3JCM W;  3UO2 A;  3WFV A;  5D7U A;  5IN1 A;  3G4S A;  4E7I A;  4C8Q F;  1SSH A;  3APQ A;  1Z5V A;  2A06 H;  4P9O A;  2OTJ Q;  4X9Q A;  3ABU A;  2ZDI A;  5DLO A;  4IIJ B;  1N32 B;  4FT4 A;  3ZHU A;  4J7I A;  4AFU C;  2PUO B;  1GH6 A;  1Y6X A;  1ZTE A;  4C92 B;  5LMU B;  1VQ9 Q;  3MKD A;  4JAS A;  4NXN O;  1VP7 A;  1FWZ A;  2KEA A;  1P92 A;  2ED1 A;  3QO5 A;  2FTK A;  4F6E A;  5KMG A;  1M3C A;  1I08 A;  3U10 A;  2EQK A;  2M51 A;  4KGZ B;  2A9H A;  5LYJ A;  1QWF A;  1HXD A;  5CO7 A;  4ZN3 A;  4R8C A;  2Z3Y A;  3EG2 A;  3M99 B;  1OYX A;  5H2F Z;  2GQV A;  3NFC A;  1VQO T;  4ZI7 A;  2RH2 A;  1JXO A;  2RHY A;  1VQM V;  1N32 O;  1XQ8 A;  5J2T A;  1OUL A;  5B3S B;  5GMK h;  2HL5 C;  2RI5 A;  3OTF A;  5EC1 C;  1OCZ C;  2CDT A;  2R5A A;  1XHX A;  3ABM C;  3OEH G;  4D8K A;  3OSS C;  3PNW C;  1G1X B;  5GMK j;  2K1E A;  4GLK A;  4J83 A;  2FRY A;  3EHR A;  2CGN A;  4JI7 O;  2JIZ G;  2QKA A;  5C0M A;  4UC4 A;  1PPJ H;  3ER0 A;  2UUA O;  3SEM A;  3PVQ A;  1EIF A;  5HY6 A;  2CP2 A;  3HSB A;  3J81 E;  2ZDI C;  3OS2 A;  1PL4 A;  4M4Z A;  4U7N A;  5CK9 A;  3UWN A;  1SKU B;  2YID A;  3BRC A;  5BMV A;  4M75 G;  4F6R A;  3CCM Q;  2CZ6 B;  3L2Q A;  3S3N A;  1PNL A;  3CME A;  4ZHQ B;  2A08 A;  4IUP A;  4C8Q C;  4MTF A;  3Q4H B;  3CYO A;  5A9G A;  1M3A A;  1VQL V;  3TEE A;  4JPB W;  2BTT A;  1VQ6 A;  1ENV A;  2H8P C;  2QWN B;  5EYP A;  2WSC E;  3MHX A;  4BW5 A;  1NH2 D;  4M75 B;  2QJ1 A;  1C1A A;  2XD0 A;  1QCN A;  4WFB V;  4RUE A;  2VV5 A;  3JB9 I;  1AZE A;  1BU1 A;  5LL6 Y;  1I1J A;  3CRR A;  4M77 F;  1K8A U;  2H3J A;  3L72 H;  4V2S A;  1BYM A;  1NS1 A;  4C8Q G;  1QVF S;  1MZE A;  1QVG P;  5IWA B;  5EZY B;  5H9C A;  4P2Z A;  1NVP D;  3IC9 A;  4J5Y A;  1UUE A;  2FYK A;  9ATC B;  3CEY A;  5CB4 B;  1T0H A;  4PA3 A;  2X35 A;  3OYB A;  2JRI A;  2IPO B;  5GW7 A;  2EJG A;  5HCK A;  5FRO A;  4C0G A;  3H1L H;  2KBT A;  4J9Z B;  1BBZ A;  3M0S A;  3C90 A;  4IYI A;  3C94 A;  2HEQ A;  3QBY A;  2P06 A;  2DXT A;  1SHG A;  1B34 B;  5GAM e;  4JI6 B;  4EMG A;  2BZX A;  3OBW A;  4JI3 B;  4F7U E;  3G6E V;  1PNK A;  4PJO G;  3VQV A;  5EBL C;  1FJG B;  1WLE A;  2H3O A;  4HA8 A;  3ZBH A;  5LL6 S;  4II1 A;  4NL3 A;  1QVF U;  2WWW A;  4WFH A;  1VQ4 T;  2DER A;  2FHD A;  4M78 E;  5JCO C;  3Q4H A;  2FO0 A;  5EK0 A;  4B9X A;  3DC5 A;  3HPW A;  3OYE A;  2XIC A;  1AR1 B;  1I07 A;  2J6K A;  3C3T A;  2F66 C;  1VQM A;  5LHG A;  4K11 A;  5B1N A;  2BTQ A;  3K0D A;  4U3J A;  1BI0 A;  1GXI E;  1XEQ A;  2HEP A;  4RO2 A;  4QVD A;  3ASO C;  2FPD A;  2XHB A;  1D1C A;  1UGS B;  3JSC A;  1E79 G;  2VVK A;  4B3R O;  1MAB G;  2OCC C;  3HR0 A;  5FNV B;  1A32 A;  2RNB A;  2FZK B;  1M57 B;  1RAD B;  3MEW A;  4OF1 A;  5KYW A;  4O4H A;  5LGT A;  4FPP A;  3CMA A;  1SQP H;  2KRS A;  2XDD A;  2V8K A;  1VAR A;  1UHC A;  4Y92 A;  1S1N A;  4MDX A;  3NPF A;  2KSD A;  2XDP A;  1UEB A;  2ZXW B;  1Q86 R;  5H6R A;  1BKB A;  3KBG A;  4DV0 O;  5DM7 R;  2AXT Z;  2EZP A;  3D7S B;  2D6F A;  3VYG A;  4CS4 A;  3OD4 A;  4M78 D;  3UT1 A;  1QLN A;  4LCU C;  4X1Y A;  4WF2 A;  1RAI B;  4JLI A;  2L5Q A;  2O88 A;  2F2W A;  3CC4 A;  2E12 A;  3GNG A;  1WP8 A;  1ZX3 A;  2KG7 A;  1BZK A;  2WLI A;  5LXT A;  2M0Y A;  2RHZ A;  1W4S A;  3VQW A;  2E65 A;  1WXB A;  1MMM A;  3OYF A;  4FIP C;  2EGC A;  1M56 C;  3N2K A;  1B7T A;  5ECA A;  2RQU A;  2IIM A;  3RFR A;  4CH6 A;  4N0A A;  2GQI A;  1UFF A;  4JLG A;  4XDJ A;  2K7A A;  4LDU A;  4C92 E;  2AGA A;  4LF9 O;  1E6H A;  3OMA B;  2QEX A;  1GAX A;  1NZ9 A;  4JAV A;  4K8Z A;  1QP3 A;  2YDE A;  3LX7 A;  2MMP A;  3AG7 A;  3ZJZ A;  2IJJ A;  4LN2 A;  3K0G A;  3H1J H;  5IJ0 B;  1F4M A;  3DC6 A;  4KH1 B;  4PFZ A;  1X01 A;  2XTA A;  2L3S A;  1NYG A;  3HKC A;  2XDB A;  2EUL A;  3GVM A;  2HZY A;  3M54 A;  2P4K A;  1D5N A;  4CC4 B;  2Q5Z A;  4P30 A;  4PJ0 Z;  3L73 H;  2COY A;  2EKH A;  4HCK A;  1B34 A;  5I2M A;  2AW9 A;  3CCS T;  4DV6 O;  3JCM e;  3PFS A;  2FG0 A;  2JUF A;  3SPH A;  3M0Q A;  4OP0 A;  4UFZ A;  3FAV A;  2MOX A;  5KE2 A;  5GMK l;  5CKE A;  3OA6 A;  3TK1 A;  1BI2 A;  5GAN 6;  2RPN A;  3LSU A;  1UPG A;  3WB0 A;  4W4L A;  4DV3 O;  2HL3 A;  2YSQ A;  2BUD A;  3OMC A;  4OVA A;  1ZBX A;  3KXT A;  2YEV A;  1G3Y A;  3JB9 J;  1YTF D;  3ZHT A;  2P4R A;  1SQQ H;  4PA7 A;  2N05 A;  1C6V X;  4C92 A;  1SES A;  2JN0 A;  3H0I A;  4HAM A;  1YIT T;  3VRZ A;  4A4G A;  3JCM d;  2R9A A;  3RWR D;  1IGQ A;  3ICX A;  5KLV H;  2X4X A;  5DEC A;  4TVR A;  5KHG A;  5GAN e;  4XQ3 A;  1VQL Q;  2KY9 A;  2R5M A;  4UXN A;  5LOV B;  1YJN T;  4AFQ C;  2PTK A;  3RDV A;  4JUV A;  4CC2 A;  1VQ8 A;  4B7E A;  4IUQ A;  2JEU A;  3QWX X;  3ZMT A;  2DVJ A;  2O01 E;  3OGI B;  1IXB A;  5K1P A;  1D3B A;  4JJN K;  4LF8 O;  4A54 A;  1OZ0 A;  3ETD A;  1N36 O;  3BFM A;  5KHJ A;  4HYO A;  4JV5 B;  1ZHI A;  1HP8 A;  4BAY A;  3W7U A;  3CBM A;  2E10 A;  1Q7Y C;  1WB8 A;  2IH3 C;  5GAN g;  1UG1 A;  4RUG A;  3ZRW A;  3VS3 A;  1N6A A;  1M8M A;  1X75 C;  1OCO B;  3JCM c;  4L8J A;  2ZZD A;  4D7T A;  2AT1 B;  4O4J B;  1NTM H;  2GTJ A;  2DZC A;  2RJF A;  3H0F A;  4PKC C;  4DBH A;  1RL2 A;  4E7S A;  3CXC U;  4LFA O;  4DK0 A;  1AB3 A;  5GAO p;  1Q6U A;  2ZKO A;  2DYR B;  3QDR B;  3ABK C;  2RMK B;  4P5N A;  4I0X B;  1I8F A;  4PNO A;  2C0T A;  5IXB A;  1OPK A;  1S72 Q;  2I2L A;  1XMQ O;  1ZSZ C;  2HQE A;  2CKK A;  3JAL B;  4Y28 E;  3IGA C;  1VQ8 T;  2R9R B;  5C8Y B;  3H6Z A;  1VF7 A;  2V1D A;  4O4H B;  2DW4 A;  4NKG B;  2QEX T;  5C6S A;  1FKA O;  2EIN C;  4B3M B;  3H1K H;  2YUQ A;  1YIJ V;  4UVA A;  2FL4 A;  4YHH O;  2OTL Q;  4IKF A;  2ROL A;  3TU4 K;  5IJ0 A;  3H9N A;  1YDX A;  1E1Q G;  4AFS C;  3E35 A;  3H8Z A;  3PT9 A;  1V76 A;  3ZMU A;  1K33 A;  2YI8 A;  3ETG A;  2QKC A;  2HG5 C;  3ABL C;  4FJC C;  1FXV A;  3CCL V;  4CH4 A;  1VQ4 V;  2DKG A;  3G1J A;  1VQK T;  5FRN A;  4DUY B;  4PJO A;  1H3H A;  4RTT A;  2ADQ B;  2JGD A;  2VXE A;  3U11 A;  3TVT A;  3DXR A;  1SQV H;  2QWP B;  3E89 A;  3W7W A;  2QAS A;  1VQ4 A;  5LMN B;  1Q86 W;  4O4L A;  5AYF A;  5LJ3 h;  3HRU A;  2L35 A;  4DUZ O;  1RAH B;  4PJM A;  3OTO B;  5IY5 C;  2CK3 G;  5GJW B;  4K0K O;  1RFY A;  2YIB D;  2KDS A;  4LD6 A;  4F4L A;  5HK0 A;  3ZMZ A;  2QGG A;  2RI3 A;  1BGY H;  2K2V A;  2A0L A;  1MNG A;  4LFC B;  4JAU A;  3CS5 A;  4QPJ A;  1MUZ A;  1GN4 A;  4TT3 G;  2VB6 A;  3GLX A;  3RYH A;  1RP3 B;  2WSE E;  1R3J C;  1YHQ V;  1HNZ O;  5KA5 A;  1WYX A;  1N34 B;  5EBW C;  1WXU A;  4ICG A;  3RN4 A;  1NPR A;  2Y69 C;  1UGQ B;  1NPP A;  2XG8 D;  4AMC A;  2ZPH B;  1YJN Q;  5LXT B;  1V29 B;  1COW G;  1BCC H;  4MVU A;  1PD1 A;  2KGT A;  8AT1 B;  3BEH A;  3OYC A;  2DMO A;  3CCM T;  4JRQ A;  4DR2 B;  1UE9 A;  4QT7 A;  4C8Q A;  5FU6 B;  3A8G B;  1H2M A;  2WLH A;  1OQK A;  4YJ2 A;  1KD1 R;  4CBC A;  4BR6 A;  1U96 A;  3A98 A;  3H01 A;  1ZBJ A;  4GCZ A;  2GGR A;  4HVU A;  4RQF A;  1GM8 A;  3A5Z B;  1NLO C;  1PKX A;  4BE2 A;  4MSW C;  4JZ2 A;  4JI6 O;  3QUI A;  4EPC A;  1Q82 C;  1AZG B;  4UVC A;  5EIB C;  1UGV A;  1IXD A;  1M5I A;  1M5Q 1;  3MP8 A;  4DBR A;  4EIK A;  2O4X B;  4E7J A;  3OUS A;  4NTX A;  2BCC H;  1VMG A;  1XNI A;  4ZN1 A;  3T2M A;  4JI0 B;  3SHW A;  2ZE8 A;  3L2W A;  3JD0 A;  3OT7 A;  2PYJ A;  3MD0 A;  2DYS C;  4YXW G;  2Y4Y A;  2AK5 A;  5LBQ A;  2RI2 A;  3QZ9 B;  2JJ2 G;  3QG5 A;  1OU8 A;  3CMA V;  3QG1 A;  1RAB B;  4BUG A;  1RSO A;  1ZSP A;  3WG7 B;  2JVD A;  1RLQ C;  4HCZ A;  1M90 U;  1YHQ T;  2V26 A;  2GSM B;  1WJZ A;  1K4C C;  1W6X A;  3QYG B;  2CGO A;  1K92 A;  3UCS C;  1QCO A;  3TXQ A;  3JAS B;  2DAQ A;  2E5K A;  3OB9 A;  4JRK A;  3K59 A;  1VQ8 V;  4FLW A;  1ZX6 A;  3AG4 B;  1N33 B;  3U0Z A;  2LJ0 A;  1TH7 A;  2QDY B;  5KCH A;  3RYF A;  4MDW A;  3EG1 A;  5GAO r;  2BSK A;  5JQG A;  4TQD A;  4IUR A;  1Y76 B;  4Z2W A;  1WQW A;  2D0Q B;  2DFU A;  1US6 A;  3LH0 A;  2O9V A;  2DLP A;  1SC5 B;  1OCC B;  3HB3 B;  2JTE A;  4R56 A;  1VQM T;  1SRL A;  3GP8 A;  2GNC A;  3I55 T;  3VRY A;  1Q81 W;  2GBQ A;  3CCU T;  4FZ0 A;  3A0B Z;  2Q7E A;  1ACM B;  4J42 A;  4WCE V;  2UUB B;  4B9W A;  1S3J A;  1KP3 A;  3H0H A;  1Q86 C;  3SWN A;  3K5M A;  4XDK A;  3TET A;  4KT0 E;  2A7Y A;  3K03 A;  4RKU E;  4C0F A;  5GAN 4;  3C3S A;  3FX7 A;  2OT5 A;  3CRC A;  1IO6 A;  4O2B B;  3JAT B;  5D5P A;  4JI7 B;  1O9G A;  2DE0 X;  1S0V A;  2HBW A;  3NTH A;  3RNJ A;  3RER A;  3CPW A;  4PL6 A;  1T0J A;  4GYC B;  4NS5 A;  3SPC A;  4MVO A;  2FB5 A;  4RAI A;  4LFA B;  2P0Q A;  2W10 A;  4FSS A;  1EFN A;  4HT8 A;  4YIP A;  1LR1 A;  4CC6 A;  2V8J A;  2Y48 A;  2HJF C;  2DPP B;  2L3P A;  5LP6 C;  5KH6 A;  3GF5 A;  3STL C;  4LF5 B;  4LNU A;  2C2A A;  3JAS A;  2JM9 A;  4J9Y B;  5FW9 A;  1QLE C;  3LNM B;  1VUB A;  2HSE B;  3OW2 U;  2RN8 A;  5GTI Z;  4DV7 O;  4LF6 B;  4A4E A;  4A4H A;  4RCB A;  4EDU A;  3EH1 A;  2DQ3 A;  1YI2 A;  2DA9 A;  3RYH B;  3BCC H;  2VKN A;  3I56 V;  1JBM A;  1RUW A;  4Y91 A;  3FJ5 A;  3ZED A;  2PU9 B;  1H2K A;  2P84 A;  3PJS K;  5GAN 7;  3AK1 A;  3JCM V;  3SYQ A;  3FIF A;  3X20 B;  3OYD A;  2HHH B;  3CC4 V;  3CME V;  4HVV A;  4FYV B;  2B5U A;  2COZ A;  2KXC A;  2MPX C;  2QYZ A;  2QM7 A;  2RA2 A;  2YRD A;  5I21 A;  1XRE A;  2LTO A;  1QNM A;  1H8H G;  3IAY A;  1EZZ B;  1K9M U;  4LH6 A;  1DF4 A;  3HHT B;  2WAC A;  1EFR G;  1QP2 A;  3MO8 A;  1OOT A;  2VAS A;  1UJW B;  2JS5 A;  3LUT B;  5DY9 A;  3X2Q B;  2EIK B;  3CCM V;  4BIZ A;  4MMK A;  1XIL A;  3JCZ A;  5AT1 B;  4N0A C;  4B3S B;  5J2T B;  2CE4 A;  2NUZ A;  3G4S T;  3CCV T;  2AHZ A;  4X65 O;  1GFC A;  4KRT A;  3OYI A;  1Q7Y R;  3K08 A;  4JF3 A;  5LOV A;  2BOB C;  4O2A A;  1KKD A;  1XNR O;  2RHX A;  5LMU O;  1MMN A;  4XTY A;  3APO A;  2JM8 A;  5FU7 C;  2VQF B;  1WHK A;  2XMF A;  3F7Y C;  2HLD G;  1VQL T;  1N5Z A;  2DTH A;  1YNZ A;  1N33 O;  2C0O A;  2NR5 A;  1VQO A;  2D3O W;  3O8V A;  4FLU A;  2QSA A;  1JJ2 P;  5GON A;  1VQK V;  1NG2 A;  4JRI A;  3CC7 T;  2O2O A;  1SSF A;  4PFP A;  5KUK A;  4M7D C;  2SEM A;  4RCC A;  2RD1 A;  1NJI R;  2EIM C;  1Q90 D;  1AHJ B;  3L2Z A;  4HNA B;  4PLL A;  2AIR B;  4TOI A;  4X1K B;  3AG2 B;  3TGU H;  3JD3 A;  4FM1 A;  3CCM A;  3M9Q A;  2LW1 A;  2YIA A;  4BI8 B;  3AG1 B;  2W6J G;  1JX9 A;  4DOW A;  4G28 B;  4JYB A;  1KD1 C;  2MIO A;  5L8R E;  2UXN A;  2K79 A;  1ROP A;  4GKJ O;  4M7A F;  1H2N A;  4N23 A;  2QWO B;  1P84 F;  1ZAU A;  3AG3 C;  4OMQ A;  2WLL A;  3OEE G;  5CA1 B;  2B1I A;  1U1S A;  4CS2 A;  1BI1 A;  1RAF B;  3G6E T;  3E22 A;  4JI4 B;  4ZIB A;  4QJF B;  3QWY A;  4PJJ A;  1H92 A;  4KUI A;  3CD6 A;  4JYC A;  1JO8 A;  1Q95 G;  1AP6 A;  3T1Y B;  1IDS A;  2HQX A;  4EMK B;  1OI1 A;  2PF4 E;  2PVD B;  1FMK A;  2YRV A;  2A28 A;  3SJQ C;  3T4D A;  5IAY A;  2CTR A;  3CX5 F;  2L2P A;  4E2F B;  3AHU A;  4H44 B;  2E6Z A;  2F2X A;  3B4S A;  1K1Z A;  5KHK A;  5D6X A;  1J3T A;  1XQH A;  1V54 C;  1IZ6 A;  4FM4 B;  4DUZ B;  4BWA A;  4XBF A;  3EFS A;  4M7A B;  4C8Q D;  4YTL A;  2DL8 A;  2CAZ C;  3CC2 V;  4C0Z A;  1MG1 A;  5A0D A;  1GL5 A;  2EBO A;  1TAE A;  1NKD A;  1KEC A;  5BR8 B;  4LFB O;  1KJW A;  2NUT B;  3M4Y A;  2HAX A;  4ASU G;  2FKX A;  1KBH A;  2EYY A;  3CJH B;  4CH5 A;  2K4Y A;  5LMN O;  1IHV A;  2YDL A;  1VQN A;  2DN9 A;  2DX1 A;  4A5U B;  2PVO B;  2LP7 A;  3JCM P;  2EJF A;  3X28 B;  3CCS Q;  1PRM C;  3OUF A;  3JCM b;  3ULR B;  2ZE6 A;  4JI8 O;  3BVO A;  3ML0 A;  1NTZ H;  4DK1 A;  4F7U G;  3HPL C;  3CXH F;  2NNU A;  4LF8 B;  3CCV V;  1VEW A;  4DR2 O;  2H3E B;  1AEY A;  4IUV A;  3TSW A;  5LJ3 g;  3CD6 T;  4J41 A;  1K5Q A;  2VS0 A;  1S72 A;  5KYU B;  3MCA B;  2WLJ A;  5KYY B;  2ZPB B;  1K97 A;  1WAZ A;  3SJB C;  4PJN A;  4X66 B;  4GLM A;  3WXM B;  4EEQ A;  1ORQ C;  3I55 V;  1NBM G;  3G71 V;  3GB7 C;  3K9S A;  4AI8 A;  2B8A A;  1N8R W;  4O4I B;  1UTI A;  1SPK A;  1RPR A;  1BI3 A;  1QQJ A;  4NXM O;  2F4V O;  4WF9 V;  1AD5 A;  4JI0 O;  3CB2 A;  1FMW A;  2LRQ A;  5J2U B;  1XMQ B;  3HRT A;  2E4H A;  3I35 A;  1F23 A;  4C8Q E;  5LJ3 j;  4X34 A;  4MVZ A;  2XID A;  3JAM N;  5CIU A;  3ETQ A;  1WB7 A;  1AWX A;  4ME7 A;  3CD6 Q;  3M8A A;  1SQG A;  4X66 O;  1KU9 A;  2EGA A;  1JA8 A;  3JAW A;  4M7D D;  1YIT A;  1B6Q A;  1H8K A;  1P7B A;  4YY3 O;  3QJY A;  1OX8 A;  3IFX A;  4GLX A;  3M57 A;  4KHP O;  1TG0 A;  2WLN A;  2EQJ A;  5KHH A;  3ZHV A;  1QR9 A;  1OZ3 A;  2DYB A;  4I55 B;  2RHI A;  4P9P A;  3QO8 A;  4JI1 B;  4ZGJ B;  2LQT A;  3N27 A;  2O9S A;  4LFB B;  2V7Q G;  3F5W C;  3GWK C;  1QQC A;  4XDL A;  1VQ9 A;  2R9I A;  3E8H A;  2M1H A;  1RM1 C;  2X6B A;  2CH7 B;  2DL3 A;  2XI9 A;  3I56 A;  1H38 A;  2KAF A;  3V8L A;  2FRW A;  3J80 N;  4PI2 A;  3OTO O;  1VQ7 Q;  4UCR A;  1BIA A;  4A4K A;  2ADP A;  3L9D A;  5JVD A;  1NJI W;  2R57 A;  3G4S Q;  1KC8 U;  5IXF A;  4MW3 A;  1QKX A;  3C12 A;  1VQO Q;  2DWE C;  2WSS G;  5DN6 G;  5GAN 2;  2W0F C;  4CC3 A;  1ZUU A;  1KC8 W;  4EMH A;  5KCO A;  2DTI A;  2XUM A;  4AHC A;  4DR3 O;  3VUZ A;  4KBM B;  2VUB A;  1V55 B;  1XDC A;  2CH4 W;  1G8M A;  1IX9 A;  2HHH O;  2ZIO A;  4MTX A;  5J2U A;  2RO0 A;  4M77 D;  5GJV B;  2DL5 A;  1GRI A;  4IIO A;  4QE7 A;  4DR5 B;  1IXM A;  1I81 A;  1MZF A;  5GMK e;  4DR1 B;  4O4I A;  4DV0 B;  3L75 H;  5J26 A;  2HJD A;  4Z02 A;  1FXK C;  1Q81 C;  3CCJ V;  1LCK A;  1R3L C;  4JTC B;  5KYY A;  5LJ5 e;  3JAM E;  1WFW A;  1FYJ A;  4E47 A;  3DLM A;  1PKT A;  2B9Z A;  4RQE A;  2ESW A;  1H2S B;  3CXC A;  2LX9 A;  1KQS U;  1K8A W;  1LUV A;  3T1H O;  4NL2 A;  3UQ8 A;  5BR8 O;  2ZNJ A;  5GAN 3;  1B07 A;  1THZ A;  3GWO A;  3JAK B;  5E79 Z;  5GAO m;  3CC2 T;  1P49 A;  2DRK A;  2A36 A;  4LWS B;  2DVE A;  4BAC A;  1NR1 A;  1PNM A;  1KQS A;  2EIJ C;  1VYT A;  2MF2 A;  4NVP A;  4DV3 B;  1IB8 A;  4J9G A;  4LP8 A;  1RAC B;  4E7H A;  3TRE A;  4N4G A;  1XL4 A;  2CRE A;  2KNB B;  2YUN A;  2HKQ B;  1GCQ A;  1VQP V;  5GAN 8;  3EGX B;  3S3M A;  3SD4 A;  1W2B P;  5KMG B;  3MJX A;  2E3H A;  3CC7 Q;  3CMA Q;  1YJW A;  2K5F A;  3RW0 A;  4M75 D;  5I11 A;  2MW2 B;  5EC7 A;  2LO1 A;  5KAF Z;  1W70 A;  4DV1 B;  4LE9 A;  1W59 A;  5DED A;  4LF7 B;  4DOV A;  4M78 F;  1FJG O;  3VS2 A;  4J6W A;  2QWQ B;  4X1I A;  2PTM A;  1Y07 A;  2LVM A;  2D1X A;  3JRZ A;  3SB2 A;  3CC7 A;  1M93 A;  3ME9 A;  1W0K G;  1JQQ A;  1Q82 U;  2E3I A;  1WZO A;  2DXB A;  1W2B S;  2QKS A;  5EBM C;  1GM7 A;  3CCJ Q;  3J7A F;  1FAF A;  5BZB A;  2GTO A;  3ZCC A;  2FB7 A;  4NTW A;  4AIL C;  2OAU A;  1LNQ A;  3AT1 B;  2FZG B;  2UUA B;  4R55 A;  5EZY A;  2IG0 A;  1OCR B;  2EQU A;  4BE1 A;  3BDL A;  3JB9 F;  3RKW A;  1VQ5 V;  3REB B;  1YFN A;  4E7K A;  1M2O A;  3JCM h;  2QEX Q;  2GV9 A;  3CRM A;  2FL7 A;  4JGS A;  3H41 A;  1YSC A;  2LT4 A;  3ZFJ A;  4LH7 A;  3I9Q A;  2E76 B;  4LDV A;  1VQP A;  1VQ5 Q;  1N0N A;  2NN4 A;  2VWF A;  4J9F A;  2LCC A;  3ASK A;  1N8R R;  3ZEH A;  4JI1 O;  1PM9 A;  4LF4 B;  3CCR T;  1HNX B;  2QDL A;  3MEU A;  3THO A;  1KUQ A;  4FL6 A;  1N8R C;  3VOU A;  4Q6G A;  4I50 A;  1T5E A;  1OU9 A;  4F7U B;  1DF5 A;  1VQ4 Q;  3BA9 A;  1F51 A;  4PJL A;  2M6Y A;  4DQ2 A;  4H37 A;  5JWP A;  3M56 A;  5JJE B;  2WLL B;  3G6B A;  1AOJ A;  1YI2 Q;  2GUZ A;  4M77 C;  5BY1 A;  2IVW A;  4X62 B;  2VWK A;  3JCM g;  2E64 A;  2FEI A;  3OMI B;  1ZL8 B;  4YJ3 B;  4UUJ C;  1Y71 A;  3M0P A;  5HFL A;  2KB1 A;  1XBL A;  3O9O A;  4DV2 O;  5GAO q;  3PE0 A;  3V7C A;  3HKB A;  3OYY A;  4N4H A;  2AKK A;  4EB6 A;  3ZRX A;  4E7Z A;  4O4L B;  1I7F A;  3P30 A;  2IH1 C;  2M16 A;  1JJO A;  1R6N A;  3C95 A;  4FLT A;  2KQX A;  3JCM J;  2YXL A;  1K7D A;  3CME T;  5B3S C;  3LW5 E;  4X64 B;  3MP1 A;  1KK7 A;  3FFQ A;  3A8H B;  3JCM Q;  4BDY A;  3CME Q;  2QK0 A;  3ABM B;  3HL8 A;  5IJ9 B;  4O2A B;  4X62 O;  4JI2 O;  1GFD A;  4KFM A;  3ZN1 A;  2YT6 A;  2XND G;  3CCQ A;  2DIG A;  3BDU A;  1WHM A;  3EVK A;  2GFU A;  1MMD A;  3VBB A;  3ETE A;  1BB9 A;  2F43 G;  3QYH B;  2RJE A;  3EGX A;  1YJN A;  3BW1 A;  1Q6I A;  1NR7 A;  2IJH A;  2K3Y A;  1JQ0 A;  2JZ2 A;  3KKY A;  4GZR B;  4OX9 B;  4KGV B;  1IRX A;  2KK4 A;  2GTS A;  2EKO A;  5FWB A;  4X65 B;  4DR1 O;  4LF4 O;  1VQ9 V;  2J6O A;  2VC8 A;  4G27 B;  2LZ6 B;  2PZ1 A;  2HKO A;  3VS6 A;  1VQ5 A;  4BDZ A;  4AG1 C;  3OR6 C;  4LWS A;  3LH5 A;  1Y7X A;  1ZUY A;  5LJ5 f;  4M75 C;  3OGC C;  1N0J A;  4GKK O;  2YUP A;  2OTJ T;  2LC4 A;  3K06 A;  1VIF A;  1YCY A;  1PL0 A;  4TV8 A;  4ZTJ A;  4LR3 A;  1H2L A;  1TGO A;  4FFB A;  3CC7 V;  2EAY A;  4OB3 B;  4AFZ C;  4NYK A;  1LOJ A;  5JJJ B;  1QW1 A;  3HKS A;  3I5S A;  4IUU A;  4I7Z B;  4C5G A;  3GIB A;  3JD4 A;  2BTQ B;  4U3J B;  2KXD A;  1M4U A;  2YXY A;  4BD3 A;  5GAN 5;  1R73 A;  1YJW V;  3A1P A;  5CN0 A;  3CCE V;  4PJO F;  2OIE A;  1HD3 A;  2OCH A;  2ED0 A;  4F7U F;  5GON B;  4MVS A;  3RVZ A;  3EGD A;  4ORZ A;  4EB6 B;  1L0L H;  2QQ9 A;  2O31 A;  3M5A A;  2CTW A;  4ESR A;  1Q82 R;  1YJW Q;  3TSZ A;  3G71 A;  5LGN A;  1Q5O A;  2XAJ A;  4JI2 B;  3UPU A;  2DJZ A;  5IT9 E;  2VYT A;  3OYN A;  3H1I H;  4LNU B;  5FL7 G;  3JAT A;  3G71 T;  3N2K B;  1B3Q A;  3MHH C;  1S72 V;  4LFC O;  1H64 1;  4J9H A;  2ZE7 A;  4PJO D;  3J7A U;  1BS3 A;  1NU1 H;  3SWN B;  4AT1 B;  1QHT A;  3BY6 A;  2IJK A;  3T9N A;  1WNS A;  4DR4 B;  3E83 A;  3CMA T;  1NYF A;  4BE0 A;  1M9S A;  4MZP A;  4FZ1 A;  1XOU A;  3CC4 T;  3QII A;  2K9G A;  5HKC A;  2E75 B;  3A8M B;  4BY6 C;  2DO3 A;  1N8R U;  1PKS A;  4FFK A;  4QW2 A;  1RAE B;  4L59 A;  3CHX A;  4JTD B;  1NEG A;  1Q7Y W;  4GBQ A;  1KC8 C;  5DM6 V;  3P3N A;  4N21 A;  3LDE A;  1X43 A;  1VQP T;  1BHB A;  1B04 A;  2RQR A;  4EKW A;  3UDC A;  4JJB A;  3CC2 Q;  1YVW A;  1CSK A;  1XJW B;  2YUA A;  1F7Y A;  2K57 A;  3OW2 S;  3R6N A;  4J9B A;  1N36 B;  4J9D A;  2IJI A;  4DV6 B;  3Q1J A;  2QM4 A;  3ZHS A;  1SG5 A;  4M75 A;  3OSV A;  1KQS S;  3LYI A;  3MHS C;  2BOC C;  2ZXW C;  1HNX O;  3TQ7 P;  2BZ8 A;  5CA3 A;  7AT1 B;  1Q81 U;  1SS3 A;  3DTU B;  1HSQ A;  2MCN A;  2ZQM A;  4MW8 A;  3SGI A;  2P5O A;  2HMA A;  2UU9 O;  1JMK C;  5CQX A;  4JYA O;  4PA6 A;  2K9P A;  1VQ6 Q;  3QVN A;  1M27 C;  3FB8 C;  1QVF P;  4R50 A;  1M1G A;  3T1H B;  3A0R A;  2EJ7 A;  4KGX B;  4XU2 A;  2YS8 A;  1M56 B;  2QTO A;  2E5L O;  3VQX A;  2EQM A;  2G3R A;  2LFS A;  4VUB A;  3OW2 A;  1KQ2 A;  1UGP B;  5E1A C;  4I4T A;  4AG2 C;  3JSN A;  2F5T X;  1O75 A;  1KD1 U;  1M90 W;  2ETN A;  2JOY A;  3CCL Q;  3OS5 A;  3RKX A;  2CGH A;  1N9R A;  4JI4 O;  1BCM A;  2QTV A;  3LNN A;  3L2R A;  4KHP B;  5JCO A;  3T4Z A;  4GX0 A;  4I4T B;  3KUF A;  4PJO B;  4LF5 O;  2X6A A;  1VQM Q;  4LF7 O;  1XNQ B;  2DD5 A;  1CXZ B;  3GNF B;  4PDL A;  2Q68 A;  2OAW A;  1PD3 A;  1UHF A;  4I5S A;  1XI1 A;  1GTO A;  4TV9 B;  4KUL A;  2CDY A;  4RTX A;  3HRS A;  1J95 A;  1IBK B;  5BXZ A;  3JD1 A;  2D9T A;  1NJI U;  3DXR B;  4DYL A;  5B5E Z;  5B1B C;  5IYZ B;  2M0O A;  4LF9 B;  1R0B G;  2Y0I A;  2RJZ A;  4J9I A;  3FD9 A;  4LDX A;  1TUC A;  1DTO A;  5CKD A;  3UF4 A;  2L6L A;  4NB5 A;  1QU7 A;  1YWP A;  4DRX B;  5KX5 B;  2LNH B;  3WVE B;  3ASN C;  1UJ0 A;  2Q69 A;  5CMU A;  1JB0 E;  2O57 A;  5J9P C;  2YLC A;  3VS0 A;  2CTP A;  2Z0A A;  4OMN A;  3G4S V;  2F1M A;  2EJ9 A;  1MMG A;  4YJ2 B;  4M75 E;  4PV1 B;  3ZL7 C;  1RLP C;  2JS2 A;  1DGS A;  3VU3 C;  3MDS A;  5IDJ A;  2Z5U A;  1L8D A;  4U3F H;  1TWB A;  4QIW F;  2BIV A;  3KZI Z;  2EGE A;  3G80 A;  3W7X A;  1HYO A;  5L3D A;  5CA0 B;  4JYY A;  5JVD B;  5I2S A;  4FM0 A;  4J7K A;  3CQT A;  4CC5 A;  2QTS A;  1KSW A;  1WLP B;  2JMA A;  1Y0M A;  2JS0 A;  2JMC A;  4RG8 A;  1Q86 U;  3K79 A;  3RYC B;  4YIO A;  2P4T A;  1JFF B;  2OTL T;  2KKW A;  1AJQ A;  2J06 A;  5EIB D;  4OMM A;  1AR5 A;  3INZ A;  5GAN j;  4FLV A;  1NH2 B;  2RCV A;  2YSU B;  1K9M W;  2P90 A;  3D8C A;  3E8G A;  3WB2 A;  2EYX A;  3CCQ T;  2L3Q A;  4ZI7 B;  5LA6 A;  2F4V B;  1RPO A;  4IT5 A;  1E6G A;  5L3B A;  3V7S A;  1VQK Q;  1KQ1 A;  1OCO C;  1NM7 A;  1R1B A;  5B1A C;  3EAE A;  4DR4 O;  1NQT A;  2PUS A;  1SHF A;  2PVG B;  3FDR A;  3GOX A;  5IHI A;  4OPH A;  4DW0 A;  2IU3 A;  3SYC A;  1QR8 A;  4H0L B;  4UB8 Z;  2WA3 A;  2JTM A;  3EG9 A;  3VS1 A;  2DYR C;  2KE9 A;  1D2D A;  1Q7Y U;  3CXC P;  4WFE A;  5IYD O;  2YLB A;  3SYO A;  4JZ4 A;  5CVI A;  4D6W A;  1V1C A;  1M9N A;  4A63 B;  2JTF A;  1JPX A;  4JV5 O;  2K3X A;  1UB4 A;  3ZRS A;  2AZS A;  3IC7 A;  1HNW O;  1NI8 A;  2EIL C;  2DIL A;  5IH2 A;  4XTX A;  3JB9 H;  3RYC A;  1SKV A;  2HFE C;  3E22 B;  3SJC C;  1M30 A;  1I0C A;  2AZ0 A;  1HWY A;  2E3C A;  3B77 A;  4BI4 A;  3ZS8 C;  5FLX E;  3PGG A;  4JTA B;  3CSX A;  1G8X A;  3E9G A;  1EZV H;  1VQO V;  1AR4 A;  5LJ3 e;  4LDY A;  4ZTF A;  4TUY B;  2ZGW A;  3RIR A;  1KQS P;  3ABL B;  2GUZ B;  3QNE A;  1ABO A;  3WU2 Z;  3NXS A;  3LDC A;  1RI0 A;  3JAR A;  2DNU A;  3T1C A;  1N9S A;  4NXM B;  5JJN B;  1IBK O;  2CUB A;  3A2F A;  2EW3 A;  5K1X A;  3EG9 B;  3FC3 A;  2B1G A;  3X25 B;  2JEX A;  4HBN A;  1GO3 F;  4I0X A;  5IY5 B;  2QI2 A;  2EBP A;  2GHY A;  3X24 B;  2ZT9 B;  3EFO A;  2HDA A;  4O5V A;  4QPK A;  2FZC B;  3NTI A;  2XAF A;  2PZS A;  4M78 B;  1R6K A;  1OHH G;  2GTA A;  3BE3 A;  2RQV A;  3ABT A;  1IUR A;  5GAO n;  5LJ5 d;  1YEW A;  1U3O A;  1NBE B;  4R6Z A;  3ZHR A;  1IRE B;  3N5B B;  4Q5W A;  3O65 A;  1G3W A;  3VS4 A;  4D6T H;  3GBQ A;  2KRN A;  3IJ4 A;  1Q43 A;  1BCO A;  1WDX A;  3UKM A;  2QQR A;  3CCV Q;  2CP7 A;  5KYX B;  4C0D C;  1PD0 A;  1TUG B;  1DK1 A;  3K04 A;  2DBM A;  4M78 G;  1TVK A;  5FU6 C;  3QHS A;  3E86 A;  1IGU A;  3SPG A;  5B66 Z;  1D3B B;  3F5T A;  2SRC A;  2UXX A;  2A0F B;  4DEX A;  2EX3 A;  2W0Z A;  1M1K U;  1KKC A;  1SQX H;  1NTK H;  2DRM A;  2VGM A;  2JVV A;  3QPH A;  4FK5 C;  4LC1 A;  4OML A;  1I5Y A;  5CA1 A;  1HW7 A;  1YI2 V;  1IBL O;  4RTY A;  4PJO E;  2D8J A;  4EFE A;  3E2U A;  2XAQ A;  1TA8 A;  1UGR B;  1E7O A;  1AI4 A;  1EX4 A;  2QXF A;  2R70 A;  5A2Q E;  2Q73 A;  3CCQ V;  5LJ3 d;  4KUM A;  1OPL A;  1GCP A;  2DJQ A;  4E2L A;  1VQ7 V;  4C92 C;  1YJ9 A;  5L3F A;  3UM7 A;  2RB6 A;  5D6Y A;  3FB5 C;  3K5N A;  3DB4 A;  4QVZ A;  5IWA O;  4W4K A;  1AVM A;  2P0K A;  3EXA A;  4DV7 B;  1WHL A;  4X1K A;  2EWN A;  1IHW A;  4QQD A;  3A8T A;  1QVG U;  2G6F X;  3W7S A;  2MYS A;  1XNR B;  2DYI A;  2L8D A;  3A8L B;  3LGL A;  3OM3 B;  2LGQ A;  5IYZ A;  1Z9Z A;  4HT9 A;  2HVK C;  4I9W A;  4J80 A;  2F2V A;  1JXM A;  4F04 B;  3ZX6 A;  3OYG A;  1S5J A;  2QTX A;  2LFR A;  4LXC A;  1QVG A;  3AG4 C;  3RT3 C;  3S3W A;  1EZJ A;  3CCL A;  5KX5 A;  2JK5 C;  1FD9 A;  3JV3 A;  1OCZ B;  1M90 R;  2KRO A;  3UT5 A;  5D6W A;  2WLK A;  4DEY A;  2VQE O;  3K3W A;  4K35 A;  3F7V C;  1HNZ B;  3OR7 C;  3I5R A;  2RQ6 A;  2F69 A;  2KR3 A;  3LSQ A;  4PA9 A;  4Z1V A;  2BE9 B;  2FPF A;  3JYC A;  3CBO A;  2NUP A;  1LJO A;  1JVM A;  3FLG A;  2ZE5 A;  3OS0 A;  1EBO A;  2EZO A;  2DET A;  1VQN T;  4JS5 A;  4FT2 A;  3VYH B;  3PTA A;  5F2V O;  2HSP A;  3L70 H;  4MVQ A;  4DO2 A;  2KSS A;  1AI5 A;  1ABQ A;  2YRC A;  3KCY A;  3OMG A;  4DR6 O;  1U8R A;  5IYB O;  4LBE C;  1B06 A;  2DXU A;  4C8Q B;  3CEI A;  2HCK A;  1M2V B;  4X1I B;  1BK2 A;  2Y0P A;  2DF6 A;  1OX9 A;  1Y96 A;  3E9F A;  4CC7 A;  4CZZ A;  3AEI A;  2P22 C;  2CT4 A;  2BSK B;  5JQG B;  1BSM A;  4QQG A;  3M7M X;  2K2M A;  1D0X A;  1VQ9 T;  5IHK A;  2ZD9 A;  4NXN B;  2CH4 A;  1LPL A;  4QVC A;  5KYW B;  3A0H Z;  2Y4T A;  2UUC B;  2PNI A;  4X9D A;  4M75 F;  5LP6 B;  4QNH B;  2QGF B;  2Q67 A;  4DV1 O;  3CXC S;  1NEB A;  2PQW A;  4GX2 A;  4J7J A;  4DR6 B;  1QBZ A;  1Y76 A;  1SER A;  3TCU A;  1WHJ A;  1YWO A;  4B3S O;  3EGD B;  2RK1 A;  1QCF A;  1DJ7 B;  2C0I A;  4U7O A;  4M7A D;  2JGD B;  1WPY A;  3MEV A;  4X20 A;  4MML A;  2DXC A;  2NUT A;  2KVQ G;  1H8E G;  5KYX A;  5KYN A;  3R66 A;  3S3X A;  4M7A A;  4J9E A;  2OTL A;  3CCR Q;  1SA0 B;  3C4S A;  4FYX B;  1RSO B;  4PD4 F;  2VQE B;  2UUB O;  4OB1 B;  3I56 Q;  3EFR A;  3EG3 A;  4DW1 A;  3URG A;  5CBF A;  2YXH A;  2Q9L A;  4TV9 A;  2EFI A;  3M4G A;  3PMT A;  4J6Y A;  3S6W A;  1X59 A;  3VS7 A;  1SQB H;  1YN8 A;  1Q3E A;  1WPX A;  1FPO A;  4ZNX A;  2V8I A;  3QXE B;  1M8V A;  4F6R B;  1TU0 B;  3D36 A;  4OX9 O;  3P32 A;  1Y74 A;  2P4V A;  1CKB A;  4LF6 O;  4DXW A;  3F70 A;  1YHQ A;  1G83 A;  5EYP B;  2RN9 A;  1WGS A;  4JI5 O;  3V8J A;  3QSU A;  2DQ0 A;  1WIE A;  4C5H A;  4CI0 C;  4UB6 Z;  3N2G A;  1QLY A;  3L1A A;  2KQW A;  2ECZ A;  2E6N A;  3DGE A;  1YCS B;  1ZA1 B;  3ZN0 A;  1K9M C;  2P67 A;  3ASO B;  1FMV A;  4JS4 A;  1AJN A;  2YHT A;  1GBQ A;  4IIM A;  4MTO A;  2OCC B;  2ZIN A;  1TUB A;  2RQW A;  1XUQ A;  2EJR A;  4DR3 B;  2PI5 A;  1I5L A;  4JJC A;  1M57 C;  3B8M A;  2DM1 A;  1KIK A;  2HD0 A;  2E1H A;  2RQT A;  1PNJ A;  3P8D A;  3JCU Z;  3D3I A;  1ZSZ A;  1SET A;  1EM1 A;  1CP9 A;  2RMO A;  4L5G A;  3CC4 Q;  3CCR V;  2CP6 A;  2EIM B;  2LQW A;  1BMF G;  1FFT B;  1W0J G;  1YJ9 V;  4ZGE B;  5GAM j;  1WHH A;  2YIC A;  3SR2 C;  3AG2 C;  3QKJ A;  1NT2 B;  3QZ5 B;  4M7D G;  4PLI A;  2LQ8 A;  5GAM h;  3NR7 A;  1R8O B;  5BMV B;  2BKD N;  1D5A A;  2LW7 A;  5GAO l;  2LDM A;  2OYQ A;  4M7D E;  2IM9 A;  4FCY A;  1EN6 A;  3FB7 C;  1WJR A;  3HP9 A;  2OTL V;  1I94 B;  2ATK C;  4B3T O;  2J7I A;  3M55 A;  3MET A;  2O4X A;  3NTK A;  3OYM A;  3S3O A;  2ZM6 O;  1O9S A;  1Q6H A;  5C8Y A;  4FLX A;  4UCV A;  2PY5 A;  3AG3 B;  1FX7 A;  2YEV B;  4K8X A;  2P6J A;  2DTO A;  1AP5 A;  3U23 A;  2CS7 A;  3SPJ A;  1IBM O;  4DV4 O;  1GN6 A;  4IIJ A;  4PI0 A;  1MND A;  2NWM A;  4M7A G;  5L3C A;  1W1F A;  4OMF B;  1QVF A;  1X4T A;  2Z0W A;  3VQY A;  1AI6 A;  1JFF A;  4A4F A;  3E19 A;  3BPZ A;  1YIT V;  4A53 A;  4E6R A;  1M1K C;  4BW9 A;  4IHJ B;  4XTW A;  4J10 A;  5GAM g;  4C92 D;  5CBH A;  4GT1 A;  1SRM A;  3LLR A;  1WN7 A;  1PWT A;  4DUY O;  1MGQ A;  4QKU A;  2Y4X A;  5B1O A;  3VV0 A;  2DZ9 A;  4X9C A;  4HNA A;  4M7A C;  3THK A;  2AZV A;  8ATC B;  4J9C A;  1RAG B;  2ZCF B;  1PRL C;  1WI7 A;  3MEA A;  1BQ0 A;  1X69 A;  3VKI A;  4WTO B;  4PDM A;  3UA6 A;  1GN2 A;  1N4C A;  5KHI A;  3ZRW B;  2VGN A;  5CCA A;  1VQ8 Q;  2PGG A;  3L71 H;  4D8D A;  4IL6 Z;  1HNW B;  3I55 A;  1Y66 A;  1D0Y A;  4MVM A;  1AIL A;  3DSQ A;  4EFB A;  4MTG A;  4I9Q A;  2FVU A;  1YP5 A;  2BTO A;  4HKE A;  2HQH A;  1KMI Z;  3QO7 A;  3BHP A;  2LT1 A;  3G6E Q;  1N34 O;  1S77 D;  3KFV A;  5GMK m;  2DWD C;  3E2E A;  3CCV A;  5H5N A;  2W6I G;  2KI7 A;  1W2B A;  1FXK A;  1FFX B;  2QA4 Q;  2RDC A;  5EC2 C;  4AQY B;  2F1L A;  3EFO B;  1NJI C;  2K3B A;  1YIJ Q;  4UCU A;  1K73 R;  2P7T C;  4JYA B;  5J3B A;  1JOY A;  4WCI A;  3N2G B;  3D36 C;  2YC0 A;  4M7D A;  4WFF A;  2UU9 B;  4QQ6 A;  4F7U A;  2Q0A A;  2VWJ A;  2ITD C;  1N27 A;  1SEM A;  3CCE T;  2CSI A;  4RG2 A;  4ATO A;  1MSD A;  1OZ2 A;  2E74 B;  3DLL A;  4KH0 B;  4MT8 A;  4GX1 A;  1I4K 1;  1ZSG A;  2DEQ A;  4RMO A;  2ZAE A;  4TUY A;  1VIE A;  1ZL8 A;  3JCM X;  1HK9 A;  3FAV B;  2X0L A;  3BY7 A;  1ARK A;  2EYZ A;  4B3M O;  4NOY A;  4CRI A;  1QVP A;  1MV3 A;  1U1T A;  4UCS A;  2Q8V A;  3M58 A;  5IT9 N;  5IJ9 A;  3RUX A;  5LJ3 f;  1S5L Z;  2X6C A;  2RM4 A;  2XKO C;  3QDF A;  2EPD A;  3CCU Q;  3ABK B;  1Y67 A;  4PEL A;  3CBP A;  4C92 G;  4LUD A;  1ZLZ A;  1ZSZ B;  5CKH A;  3JB9 G;  4GUN A;  4WBN B;  2Q7G A;  2VRZ A;  3TCJ A;  5JH7 B;  1U97 A;  3EFF K;  2I0N A;  3K5O A;  1ZA2 B;  3CPW U;  2OTJ V;  2AKL A;  1FXH A;  3K9A A;  1RM1 B;  2UXC B;  3SFM A;  2WLI B;  4KXR A;  3E8F A;  2EIN B;  3L42 A;  1R3K C;  1I5X A;  3LDD A;  2PYL A;  3J81 N;  4ZOL B;  3V8K A;  3BA8 A;  4DV4 B;  1X2Q A;  4FW1 A;  1S5H C;  2VXF A;  2Y90 A;  3UA7 A;  2X4J A;  2ZCE A;  2MK5 A;  5L3G A;  1XL6 A;  3P3P A;  4JRP A;  4D7S A;  1Y4M A;  5A2Q N;  1ZQ1 A;  3LWH A;  3TJT A;  2L89 A;  3M53 A;  2CP5 A;  3P8H A;  1GRJ A;  1M4Z A;  1R0C B;  3RKY A;  3H9V A;  3CCU A;  1VQK A;  2DMX A;  4JPR A;  5LJ5 h;  1GM9 A;  1FYN A;  3GPL A;  2JT4 A;  3ZBD A;  2LJ3 A;  2PI4 A;  4M7D F;  4QE9 A;  2CSQ A;  4FYY B;  2FML A;  2F93 B;  3LWI A;  3OYH A;  2GF7 A;  1K4U S;  1D1B A;  2RJD A;  2NUP B;  1J5E O;  2KYM A;  3CCU V;  1BIB A;  1O9H A;  1U06 A;  1AI7 A;  3W7T A;  3PIO A;  1IZ3 A;  1IVS A;  1D0Z A;  1VYV A;  3PN1 A;  3MPU B;  3OBY A;  4C92 F;  1KYO F;  2YUO A;  3RR6 A;  2Y69 B;  3HKD B;  4X20 B;  3R6O A;  4X89 A;  1X6O A;  2DOS A;  1C0M A;  2LP5 A;  4OMP A;  1BT8 A;  1VIB A;  2QQA A;  1IBL B;  4E7L A;  2YWW A;  2C06 A;  2XHC A;  4IGG A;  1UEC A;  4XTU A;  4KP4 A;  2NLJ C;  3QO3 A;  2D2C B;  3HKD A;  4OGC A;  2EIJ B;  3HFO A;  3L74 H;  3OYK A;  4CH3 A;  2XAH A;  1SZX A;  2QG9 B;  1XHZ A;  2KRM A;  3A8O B;  2F95 B;  3ZMV A;  4C5I A;  4LD9 K;  1WP7 A;  2H8H A;  4WFA V;  2M02 A;  4F16 A;  1R3I C;  1P4R A;  4LNP A;  3EGU A;  2E70 A;  1K34 A;  1TS9 A;  2HNI A;  4PFO A;  2CH7 A;  1MA1 A;  2H94 A;  2HVJ C;  2UXD O;  2UXB B;  1CEZ A;  1MSW D;  3I55 Q;  2OWO A;  3DB3 A;  4TV8 B;  1Q81 R;  1K5S A;  2DYS B;  2HP8 A;  4JI3 O;  5J39 A;  1GMG A;  2QAZ A;  4FM2 A;  1PM3 A;  4OB0 B;  1YTF B;  4BB7 A;  2ZPG B;  3WG7 C;  2LQK A;  2X4Y A;  3JB9 D;  1VQ5 T;  2ZIM A;  3I56 T;  2GBO A;  4C5E A;  4X64 O;  1M2V A;  3SDL A;  2ZNI A;  5CQY A;  2Q6A A;  3KCX A;  5LP6 A;  2V1R A;  4GY5 A;  1OCR C;  3OW2 P;  2KYB A;  4PDV A;  2DEU A;  2ABL A;  1VOM A;  1F1B B;  4FU6 A;  4TWK A;  2MAM A;  1TTH B;  4FSX A;  3HKE A;  2R58 A;  4ZBM A;  4Z88 A;  4DV2 B;  3EG0 A;  4XTV A;  1BQZ A;  2AZ2 A;  1WPB A;  1MV0 B;  3K5L A;  1OCC C;  2ZR3 A;  3SYP A;  3JAW B;  1E1R G;  1QKW A;  4DR7 B;  3HTR A;  4J8O A;  4ELY C;  2GFA A;  4DV5 O;  4RWU A;  4WBN A;  1GKF A;  3BAB A;  2M9U A;  2LCS A;  2QE7 G;  4B6M A;  1WJQ A;  3NMZ C;  3FB9 A;  2JGU A;  3O5Z A;  3TXS A;  3DKM A;  1RAA B;  4I55 A;  1KB9 F;  2BE7 D;  3RBZ A;  1TOV A;  3LSS A;  2QA4 V;  3CCS A;  3RES A;  5HFM A;  5JH7 A;  4TQF A;  4ZHQ A;  2LNV A;  1D09 B;  1WA7 A;  4HVW A;  3M59 A;  2WA4 A;  3AK3 A;  5KYU A;  1GN3 A;  3MAQ A;  4M78 A;  3VS5 A;  4UCO A;  2JW4 A;  5ITZ B;  4M77 B;  1OV9 A;  1WA8 B;  2CYZ B;  4ELZ C;  2QQB A;  2PUK B;  4ANJ A;  2BZY A;  4OGQ B;  2X3X D;  3CCE A;  1WNL A;  4K0K B;  1IBM B;  6AT1 B;  1JJ2 S;  2NYS A;  1M1K W;  2LX7 A;  4MZM A;  1MOF A;  2A37 A;  1LVK A;  3T1Y O;  1J5E B;  2F5K A;  2ZPE B;  2ITC C;  1L1F A;  4FYW B;  5CB4 A;  1QLE B;  4N4I A;  1ZLM A;  3RYI B;  2BE3 A;  2FYU H;  1VA7 A;  4O4J A;  1G6U A;  1UFI A;  1JRI A;  2JNG A;  3FYI B;  3JAL A;  3CD6 V;  4FLY A;  2R72 A;  2WLM A;  1F4N A;  2N74 A;  1YIJ T;  2OIG A;  2X3W D;  1X27 A;  1OJH A;  4UV9 A;  5FRM A;  2LCL A;  4IYH A;  4CS3 A;  2OI3 A;  2OTJ A;  3P8B B;  2CUG A;  1A0N B;  3PVL A;  1PSE A;  5EG2 A;  2XAS A;  4C7U A;  4QGP A;  5LGU A;  2KT8 A;  3QJ6 A;  1K8A C;  1K76 A;  3REA B;  5KE3 A;  3CCQ Q;  4X88 A;  3CCL T;  3HKB B;  1Z5W A;  3FRN A;  1NLP C;  3PMI A;  4KL1 A;  5KAI Z;  3CJH A;  4MS2 A;  3X2Q C;  2EIK C;  4PHZ A;  1VF6 C;  1QWE A;  3H1H H;  4Q20 A;  3CPW S;  1ZUQ A;  2YIB A;  3FJP A;  4M77 G;  2GDS A;  4B08 A;  3CCR A;  5GAN d;  5CKB A;  1QCE A;  3OE7 G;  3SDZ A;  2EIF A;  2JDI G;  2EYQ A;  1XTD A;  2UXD B;  2UXB O;  1K4D C;  3K58 A;  4J6X A;  4IHJ A;  1WHG A;  5FU7 B;  3RYI A;  1G2B A;  4M77 A;  3X26 B;  5LJ5 j;  2UUC O;  5ITZ A;  3SYA A;  2XU8 A;  3HKC B;  1JJ2 U;  3JSL A;  3RGB A;  3CP1 A;  1K0X A;  1K9M R;  3PIP A;  2OX7 A;  1JU5 C;  4O6J A;  4JAA A;  1X6G A;  1FXX A;  2RNA A;  5M9O A;  5L3E A;  2ARH A;  4HZ3 A;  3C0C A;  1CPY A;  1WQ7 A;  3CCE Q;  4KUD K;  3JAK A;  2CZ7 B;  2A3Q A;  4M7D B;  2Q7H A;  1TUE B;  2P0P A;  1H3Z A;  3RMS A;  5LHI A;  3OYJ A;  1AJP A;  1LUW A;  2EQI A;  5D5Q A;  5LYJ B;  2D0N A;  4OGE A;  3CRQ A;  2E5L B;  1EN5 A;  2Q0O C;  3AG1 C;  5LJ5 g;  4HCB A;  1BHA A;  3OQ5 A;  1VQP Q;  4DBQ A;  2KG7 B;  1LNX A;  2DL7 A;  1AWJ A;  1PCX A;  1WX6 A;  1TXQ A;  4DRX A;  4ZKI A;  4OXS A;  3SWN C;  1WA8 A;  2MI6 A;  1K8A R;  2A79 B;  4XTZ A;  1EN4 A;  2ZR2 A;  4O2B A;  2DK3 A;  3E8B A;  5GTH Z;  5CR2 A;  2ILM A;  1L0N H;  3JD2 A;  5AG2 A;  4BY6 B;  5A0G A;  4R0K A;  2CZ1 B;  3EHB B;  3SPI A;  3OMN B;  3LGF A;  4JDS A;  2E41 A;  2M7W A;  1OV3 A;  1VF6 A;  5CA0 A;  4B7K A;  3CPW P;  3KG2 A;  4EMK C;  1AWW A;  1FS0 G;  3G71 Q;  1MNE A;  1BE3 H;  5FPO A;  2XAG A;  5KUM A;  2QDO A;  3G67 A;  3NGP A;  1SZT A;  1K73 U;  3ZMS A;  2RHU A;  1V54 B;  2QGN A;  2XT9 A;  1VQ6 T;  5TIS Z;  5H6Q A;  5LA6 B;  2N04 A;  5GMK i;  1K3E A;  3JCM f;  3HKE B;  1Y96 B;  1XMO B;  1KHI A;  2KT1 A;  2XK0 A;  4HCC A;  3J80 E;  4H33 A;  4FLZ A;  2X7R B;  1K9A A;  2JJ9 A;  3OY9 A;  4Z1M G;  4J11 A;  1OEB A;  2X4W A;  4AQY O;  1NVP B;  2ZPF B;  4M77 E;  2NLU A;  4FVM A;  1YJ9 Q;  2CZ0 B;  1KD1 W;  1Z9Q A;  1PC0 A;  1T3S A;  1YJW T;  4L6V 5;  1YXB A;  2WAM A;  1YJN V;  3ZHQ A;  2ATC B;  1UDL A;  2ENM A;  1Y57 A;  5A0L A;  1K73 W;  1YCI A;  2ODM A;  3MP6 A;  3I5D A;  3FEO A;  2FPE A;  2QQS A;  1H2G A;  4BIO A;  1R77 A;  5KA6 A;  1UJY A;  5L23 A;  3HFN A;  2ZM6 B;  3CRA A;  1HJD A;  1YF2 A;  5IE9 A;  3WVD B;  2LJ2 A;  1SA0 A;  4YHH B;  1X6B A;  1G3S A;  1GCQ C;  1T3L A;  2DD4 A;  4YY3 B;  3L2U A;  2V1Q A;  2Y4U A;  1CKA A;  3FKS G;  2L0A A;  3CCJ T;  1KHC A;  2AHJ B;  4PJO C;  1VF5 B;  3CWB H;  4NR1 A;  4ABM A;  4Z89 A;  2KMT A;  1Z2G A;  2QA4 T;  2AHY A;  1R6T A;  3CCJ A;  2W0X A;  3QF7 A;  4GX5 A;  3G7Z A;  2QWR B;  4ZGD B;  2RF0 A;  1TUB B;  3RVY A;  5IYC O;  5FLX N;  1YBY A;  1AVZ C;  3QTC A;  2Q4P A;  4UV8 A;  2D8H A;  3L2V A;  1KFZ A;  1YZB A;  5LHH A;  3UO3 A;  3EH2 A;  4X1Y B;  2CP0 A;  5B1B B;  3M0R A;  4BI3 A;  4XK8 E;  4F14 A;  1ARO P;  2QEX V;  5HK3 A;  2XOK G;  1VQ7 A;  1G5V A;  1YIJ A;  4X8A A;  3K57 A;  3OYA A;  2F23 A;  1QMC A;  1HDJ A;  3RYF B;  4FMT A;  4R7C A;  1XOV A;  4RTW A;  1DLB A;  4DBF A;  3ASN B;  1PV0 A;  1G4Y B;  1Q82 W;  4JZG A;  2CUD A;  2E5Q A;  1XNQ O;  2A3L A;  4XU3 A;  1TVK B;  4XU1 A;  1S76 D;  2K5I A;  2X9H A;  1Y74 B;  3IQL A;  4Z8A A;  1KG1 A;  2DJV A;  1M3B A;  1ZUK A;  1AT1 B;  1HR0 B;  2IW5 A;  4UVB A;  2CTQ A;  2DIQ A;  4MZT A;  5FNV A;  3UAT A;  3EHQ A;  4XU0 A;  5GAM f;  4DA4 A;  3M0U A;  4PDR A;  2JJ1 G;  1W2B U;  4GKJ B;  4RTZ A;  2IBZ H;  1P7G A;  1S72 T;  2ROT A;  2K5L A; 
#chains in the Genus database with same CATH homology
 1SF9 A;  2YXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...