2YXYA

Crystarl structure of hypothetical conserved protein, gk0453
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
EQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYMLNPADFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISLLRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical conserved protein, GK0453
publication title Structure of the hypothetical DUF1811-family protein GK0453 from Geobacillus kaustophilus HTA426
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08838 DUF1811 Protein of unknown function (DUF1811)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.880 Mainly Alpha Orthogonal Bundle Helix Hairpins Hypothetical protein YfhH domain 2yxyA01
2.30.30.340 Mainly Beta Roll SH3 type barrels. Hypothetical protein YfhH like domains 2yxyA02
1SF9A 2YXYA
chains in the Genus database with same CATH superfamily
1GN4A 4DR6B 1BI2A 1RAIB 4X9CA 2RQ6A 3I35A 5GAMd 1UFIA 5GW7A 4PLLA 4MW3A 2DJVA 4BUGA 4LDWA 5IYBO 4FMTA 4WFHA 3OM3B 2D2CB 4DV2B 1K97A 1ZX3A 1M2OA 1OOTA 1PSEA 2DXBA 2K5FA 5KAFZ 4NXNB 2JJ9A 1JR9A 3P3PA 4M77G 4KHPB 2V8IA 1Z9QA 3O8VA 3L2UA 2BSKA 2ZXWC 3UO3A 1LNXA 1JMKC 3F5TA 4PJLA 2KE9A 3CCVA 4DEYA 1Q86R 3CE2A 1NBMG 5D5PA 4FZ0A 1W59A 2X3XD 3G6EA 2RJCA 2W0FC 1XBLA 1K76A 4XTZA 2ZINA 4X1KA 3RDVA 2XU8A 2F2WA 2A7WA 2VWFA 1VQKV 5HK0A 2LRQA 1ZUUA 3CYOA 1EZJA 2ATCB 4ZGJB 2EILC 3OYIA 3CCUA 2C06A 4M77E 3TQ7P 5EBLC 1VQNA 2HKOA 1RL2A 2DETA 1AJNA 4XTVA 1UGRB 1RAHB 4YHHO 3EGUA 1UEBA 3A0HZ 4LUDA 5GAN4 1M1KU 1AR4A 5GAN7 2W6JG 1PD0A 3M0SA 1RAEB 4TV9A 1WX6A 2ZPFB 3OBYA 4A4FA 2QEXT 4FJCC 2OTLV 4QW2A 1KC8R 4J9CA 2P84A 1FXVA 4WCEV 1M8MA 5I21A 2VASA 1QHTA 1QKWA 4DR5B 3PN1A 1D5NA 2ED0A 2GHYA 4CC6A 2LJ3A 3E2UA 3L72H 2JMCA 2YIBA 1FXHA 3B4SA 4WBNB 1YJWQ 2CP0A 3X2QB 2Y4UA 4GX1A 4TSFG 4XTWA 4C92A 3BDUA 4BDZA 4WFEA 4F6EA 1PNJA 3M7MX 2SEMA 2YRCA 2BTQB 3GP8A 4E47A 4E7KA 5L3EA 1UGVA 5LJ5g 5GMKe 2YIDA 4BWAA 2ZDIA 5DN6G 2VKNA 1H8EG 3QNEA 2UUCB 2PI4A 1QP3A 2DX1A 5B1NA 3ZN1A 3GWOA 4M77B 3CCRQ 1MMNA 1XJWB 2M51A 4P9PA 5H9CA 1Q7YW 2WA4A 2QG9B 1GXIE 2OAUA 4K11A 4MW8A 3HP9A 2ITDC 5LMUB 4K8ZA 1G2BA 2GQIA 1WPBA 5FROA 1X4TA 2NLUA 5EYPA 3SPCA 1HDJA 1VQOV 4L87A 2HQXA 1H38A 2KI7A 1U1TA 4OB1B 4P30A 4QIWF 5CBFA 1UG1A 5CCAA 4PJOD 1FYNA 2HL3A 2PF4E 2DL8A 1R3IC 2KYMA 3RBZA 1KJWA 5AT1B 2LQ8A 4J8OA 3EGDA 2CAZC 4IT5A 1R73A 4DOWA 1I5LA 1QVFS 4PJOC 3F7VC 4XTYA 2IH3C 1I5XA 5LGNA 1KIKA 2RHUA 1AROP 4A53A 3H1KH 3W7XA 2BE3A 3JB9F 3CMAA 5GAMh 1VQ6V 4DK1A 4J7ZA 1OEBA 3E8GA 1PD1A 2LCLA 3OSVA 3OYYA 1IBKO 3OGIB 2BZYA 4C8QG 2RPNA 1NEBA 3M4GA 4O2BB 1UECA 4CH6A 2YRDA 3ASKA 4KGZB 2P4RA 4IUTA 1VQ4T 4B9XA 1EN4A 1PL0A 5JVDA 1KQSU 3SPGA 4JI5O 1VQ5Q 2DMOA 1SZXA 4UC4A 2DQ0A 3SFMA 5JJEB 1P92A 3KUFA 4FFBA 1IXBA 3C4SA 3K9SA 5IWAB 3JCMh 1IREB 3CCSQ 1K5QA 2GTSA 2V1RA 1YSCA 3UM7A 4JI4O 4JASA 1I8FA 2KRNA 1VQ7A 2MK3A 5KYWB 2KKWA 1MHNA 4QGPA 2RQUA 2NUTA 5KMGB 4OPAA 3CC2V 4N0AC 4JUVA 4EPCA 1LPLA 3K79A 1NKDA 3OTOO 1QLYA 3G7ZA 4QQDA 1TTHB 4C0ZA 3PIPA 2X0LA 4PJ0Z 1M93A 4Q20A 1YHQQ 4UXNA 1RSOA 2FKXA 4X20A 4QPKA 4MTOA 3JCMc 1Z2GA 4RMOA 1YITQ 5LP6A 1G6UA 4I50A 3B8NA 4NL3A 1AI6A 1MNGA 2CGNA 1YJNV 1VQLQ 3ZRXA 3ABLB 1RM1C 2J6KA 2RM4A 4DBHA 2QTSA 4I50B 2EIJB 4OB3B 2X6BA 3TSZA 4IYHA 1SHGA 5DM6V 1B34B 4IIJA 5LJ3g 3CJHA 2E76B 2PUKB 4JYYA 4J9YB 1IHVA 3CJHB 2K5LA 2HFEC 4GKJO 4LH6A 3TCJA 5IDJA 2JRIA 5L23A 5J26A 2PUSA 3S3OA 1YTFD 2F4VB 3EG9A 4UV9A 1V9PA 1N6AA 1WP8A 4MVOA 2DA9A 5EC7A 2OTJQ 1W4SA 5IY5B 2L3SA 1J3TA 2ATKC 2JM9A 4BE0A 2GV9A 4LF9B 2RMKB 5B3SB 2IU3A 1OU8A 3M0QA 4LC1A 1XREA 2HJFC 3HKCA 4X89A 3RYFA 1OPKA 2XDDA 1VQ9V 3FRNA 2QWRB 1Q82W 5B1BB 1SQFA 5JQGB 1VOMA 3KKYA 4H44B 1XMOO 2LJ2A 3P3NA 1X43A 7AT1B 3SGIA 4PV1B 3DKMA 3CC4Q 2ZR3A 3CCET 2UUAO 4DUYO 1HR0B 1GM8A 1I94B 2XKOC 4C8QB 2PNIA 1YIJT 3PT9A 2EPDA 1Q90D 1XTDA 4DUZB 1GFDA 1SERA 5FPRA 3IQLA 3N5BB 3M99B 3LDCA 2NWMA 3OYLA 1WHKA 3D36A 2DWDC 1U3OA 2IVWA 4JJCA 1HNZB 2V8JA 1BK2A 1I0CA 3JCMW 1WB7A 2ODMA 5KHJA 1JO8A 1ZSZC 1COWG 3OFNG 5IYZB 2F2VA 5B1AB 1VYTA 2YLBA 4HCKA 1EM1A 4JI8B 2O88A 4E6RA 3EFSA 1Z5VA 2JTEA 2ZGWA 4D7SA 3CMET 2QWNB 4LF8B 4DR1B 2ZPEB 2DXUA 1PCXA 4ZOLB 2P4KA 2ZM6O 1N8RR 4Y28E 3RYHA 1PKTA 1GL5A 3CCVV 3K59A 2RI3A 3CCMV 4PJOG 3VYGA 2DYRC 2FB7A 1OCRB 2ZKOA 2VS0A 1TU0B 2HAXA 1JB0E 3G6EV 4C0DC 2GCXA 2DPPB 1T0JA 3E9FA 3BHPA 3RIRA 4FIBA 1M1KC 2JXBA 3JSLA 1YJWA 5JCOC 1Z9ZA 4DV3B 3JCZA 4EFEA 3P8DA 5J3BA 3ZMUA 3K58A 5KE2A 2Q5ZA 4MZTA 3BW1A 3OA6A 4DV0B 2ADPA 4JZ4A 1GO3F 2LDMA 1T0HA 2HBWA 4M4ZA 4JRKA 4KGVB 4GUNA 3L42A 3C0CA 3CCRA 1ARKA 4JYAB 4R6ZA 3APQA 3OW2A 2VYTA 5GAMe 2A7YA 3OYKA 2QEXQ 1WPXA 2CE4A 2QM7A 3RVYA 3ZHVA 3AG2B 1GH6A 2XT9A 2IIMA 1HJDA 3LSQA 1QP2A 1M1KR 2LQKA 3LGLA 4GX2A 3JD2A 3DGEA 1N9RA 2ZAEA 2OI3A 1M90W 2AT1B 2JEUA 4M7AD 3ZRWA 4KGXB 3IJ4A 3HKBA 2J05A 1JA8A 2D0NA 2P4TA 1KP2A 2AKKA 4LD6A 4DR7B 1KD1U 1PHTA 3RMQA 4M7AC 4LFBO 5LMNB 1Q81W 1PM9A 4ME7A 1NR1A 3JCMQ 3SJQC 2AZ0A 4K0KO 1OZ2A 3VUBA 1R3KC 4BIUA 5LL6S 5D7UA 2OIEA 4GLKA 4DQ2A 1K9MU 1AEYA 1XOUA 1DF4A 2OCHA 5GANd 1JXMA 1M57B 4CC4B 3E89A 4UCOA 1NM7A 2O2OA 4IHJB 2HNIA 4BY6C 5CA0A 4RG8A 1WLEA 3CXCS 3BABA 2IBZH 1AI7A 5KHIA 1RPOA 1K4US 3HKDB 2QWOB 4J9IA 4OF1A 4GBQA 1VQ5A 4OMMA 1PRLC 3LYIA 2WSFE 5DY9A 3CRQA 3N2KA 4QE9A 4DR3B 3VU3C 4DV2O 2PYJA 4C0FA 3OYBA 2KSDA 2X6AA 4NXNO 2YI9A 2EJRA 4U3JB 3RW0A 3STLC 1VQMV 4KHPO 3HFNA 1QQJA 1U06A 2PVDB 3GLXA 1R6TA 4E7ZA 2GTAA 2ZR2A 2OJ2A 3PE0A 3VJPA 1YHQA 2OX7A 2KROA 2CUBA 1YITA 2WSSG 2KYBA 1VQLA 1CP9A 3FB7C 3I5RA 4J9BA 3V8KA 4E7LA 3RYIA 4CBCA 3APOA 3SPJA 2CP2A 2ARHA 3CMAV 4ZGEB 3K5OA 4A4HA 4MDWA 3VRYA 5LJ5f 1KQ2A 1UE9A 3ETEA 4X62B 4FT4A 1VQ4Q 2JS0A 1BIBA 3M56A 1ZLMA 2PGGA 1R0CB 1YWPA 3JAMN 4L6V5 1WI7A 4C92F 4KUDK 4K35A 2RJZA 4PDRA 1W2BA 2R5AA 4MS2A 3OUFA 3EVKA 1WFWA 2COWA 4YJ2B 3AG3B 2OTJA 2E3IA 4O4HB 3M0UA 3NHNA 1GM7A 1VQ7V 3B8MA 1BCOA 2RK2A 3LWHA 1XILA 2H3OA 2YEVA 5BMVA 5GAOm 3CPWU 4NTYA 2KXDA 1UJ0A 3JCMX 1OJHA 3I55A 3FIFA 5EZYA 3H0IA 3VS3A 1AJQA 3C12A 1Y0MA 2DYIA 1R8OB 3SPHA 3JD3A 4F7UF 2MI6A 4DR5O 1R0BG 2NR5A 3CC4A 2X7RB 5K1XA 1IXDA 2CT3A 2LC4A 1SQPH 2LQWA 2F93B 2DIQA 2NUZA 1EN5A 1H3HA 2VQEO 2M1HA 1AWWA 4NTWA 4AG2C 5KX5B 1JEGA 1WHGA 1K1ZA 1WHLA 1JXOA 1BYMA 1RI0A 2FPEA 2AW9A 4CRIA 4XQ3A 4RTTA 5CBGA 4KFMA 1IBMB 4NTXA 3X28B 3OS0A 4X64B 1GMGA 1LNQA 5JH7B 1N27A 3KFVA 4BI4A 1OCOB 4D6WA 2R70A 3L70H 2Q7EA 4XDLA 3NMZC 2YLCA 2B5UA 3RGBA 3WXMB 1O9SA 4OGCA 4QE7A 4M7DA 5GMKj 4MMLA 2XAGA 1G3YA 2Z3YA 3BDLA 4CC7A 2Y90A 5LMUO 2RMOA 3CC7T 3I56V 1WA8B 3RUXA 4BIOA 5DLQE 5KYYA 1YP5A 2IJIA 2M0YA 3CXHF 5IYCO 2F69A 5IE9A 4ASUG 3L2QA 1E6HA 3CXCU 1WXTA 2LMJA 3CCEQ 5FPOA 2K3BA 4QPJA 4I55B 2XHBA 3THOA 1JOYA 4HVVA 1YIJQ 2ZQMA 2W10A 3MD0A 2J7IA 1IBLB 1M30A 2I0NA 2B8AA 1BS3A 1GCQC 2FMLA 5H6RA 1YNZA 2EWNA 3X2QC 5LJ3f 1LOJA 3OD4A 1S72T 1RACB 1PV0A 3AK2A 1WA7A 2HG5C 4W4KA 2P5OA 3P32A 5LJ5e 2W0XA 2FL4A 2Q67A 4DBRA 4NOYA 1G83A 2A9HA 3OW2U 3NFCA 4O4JA 1BQZA 4M77D 2JGDB 1MGQA 2EYQA 4LUEA 1YJ9T 2QEXA 3OR6C 1V76A 2VQFO 3CMEQ 4O2AA 1VYVA 4DV6B 2Q8VA 3L73H 1TUBB 2Y4YA 4M77C 2NLJC 2ZDIC 4XBFA 2QA4V 2EYXA 1YVWA 3ZHTA 1ZUYA 1NBEB 1NYFA 4E7SA 3DTUB 4B08A 1ZSGA 4O2AB 2MAMA 2X4JA 1K73R 5IWAO 3B2EE 1R1BA 3OS1A 1D0XA 3A8OB 1TVKA 3ZS8C 2HLDG 2L5QA 1X69A 3RVZA 5I11A 3QO3A 5CKFA 3ZHSA 3QDRB 1S0VA 1R77A 4NYKA 2ROLA 2DE0X 5LHGA 4JDSA 5GAOq 4KP4A 4LFAB 2DZ9A 3QKJA 4ZHQB 1XNIA 1P4RA 2YUOA 4PD4F 3JALA 5GAMg 1RPRA 2MWOA 2ZE5A 1OYXA 5GANf 4BW5A 1E79G 3FAVB 1U8RA 4UV8A 2NUPA 2WLLA 4RTZA 4JI3B 2EQIA 1VA7A 5KLVH 2R9RB 2HVKC 1KD1C 2QTOA 1NPPA 1X59A 1JRIA 3M53A 3W7TA 2NUPB 1SA0A 3QUIA 4WCIA 4O4LA 1UB4A 4R55A 3OW2P 1VQ6Q 2CUGA 3SDLA 2EIMC 3OYJA 3LWIA 1BMFG 5GAOp 3X26B 4FLTA 1EFNA 2VXEA 4LH7A 2BE9B 4CH5A 2DJZA 2E65A 1NLOC 4LDVA 1FMVA 2KGTA 3HSBA 3CCJV 5B66Z 3PGGA 2OYQA 1QCOA 5CVIA 3RKXA 5FNVB 4YY3O 1X27A 4U3FH 3Q1JA 2LQNA 3EAEA 8ATCB 1XMQO 4YXWG 1YXBA 1M1GA 1AZEA 1M9SA 1OZ3A 1D5AA 4ANJA 4AFZC 1AT1B 3E35A 4JPRA 1Q86W 3OS2A 4RTVA 4LDUA 2FL7A 4PL6A 1Q6HA 3E2EA 4C5HA 1HR0O 1VQPT 2JGUA 1I94O 1IX9A 3S6WA 1RADB 1VQ4A 1K9MR 3ABLC 3TCUA 3ZRSA 1AR1B 5LJ3e 1MMDA 4IL6Z 4CS4A 1VQ5V 3I9QA 2RDCA 4J5YA 2K5IA 3EHQA 2EIJC 4FM4B 1PNKA 2RF0A 3WVEB 1JPXA 2H94A 4IYIA 2LQTA 2RNBA 1HNZO 5GAOl 3CRMA 1Y67A 2ETNA 1ZL8A 3JASA 3K5MA 2UUBB 3N27A 3C94A 5DECA 4ZI7B 4FM1A 1U5SA 4LR3A 4LF8O 4DR1O 3QSUA 1VIFA 2BE7D 4R0KA 5IY5C 2F95B 1QWFA 2GFAA 4I7ZB 1PNMA 2CREA 2CH4W 4QQ6A 3BEHA 2COYA 1PM3A 2K2VA 3B09A 1VQLV 1ZX6A 3OMIB 4KH1B 5B3SC 5GJWB 4J9DA 2QASA 5L3DA 1B7TA 1WIEA 3ZN0A 2DMXA 4C92G 3RT3C 3JV3A 4C8QD 5B1BC 2X6CA 3H9VA 4PA4A 4DV3O 2CH7A 2MOXA 2YIAA 4TV8A 3VQXA 4PLIA 3J7AF 4KXRA 3WB1A 4HBNA 1D1AA 3L74H 1QLEB 4DV0O 2BZXA 4AT1B 5GANe 2OIGA 2COZA 2DRMA 4EDUA 1PL4A 5IXBA 4C8QC 2FG0A 1KECA 1CEZA 3JSCA 4F16A 3IGAC 1M3AA 4XU3A 3JCMd 3CRRA 2KR3A 1IB8A 2BSKB 4J9FA 3NGPA 1KQSS 4JYAO 4BIZA 1KC8C 2QGNA 4MVQA 2DZCA 2LCSA 3VRZA 4MZPA 4KULA 2OTLT 3I55V 2QK0A 2C0TA 5D5QA 5B1AC 2ZNJA 2JS2A 4OGQB 1D09B 4MTXA 4X1KB 5IAYA 3ZX6A 2Q69A 3EHRA 3FYEB 3UQ8A 3DLMA 4C92E 1ACMB 3H8ZA 3UATA 3G4ST 1K34A 1WJQA 4UVBA 3CCEA 5GAMj 2QI2A 3VQVA 5BY1A 1OCRC 5E79Z 5CB4A 2DYBA 3MP8A 4FIPC 1YIJA 2QYZA 3K57A 4FVMA 3GOXA 2DL3A 3AK3A 4X34A 1QVGA 4PI2A 3BY6A 4GLMA 4RQFA 2DD5A 2K9GA 1SSHA 2KBTA 3LSSA 4MDXA 2RA2A 2WLNA 2WAMA 4F7UE 3ZHUA 3SPIA 4E2FB 2F5TX 1X6BA 1K8AU 1N0NA 4YJ3A 4NS5A 3ZMVA 3MDSA 4TV9B 5KAIZ 2AK5A 4M78E 4RUEA 1VMGA 2KDSA 3CCQV 2B1GA 2FRYA 3F70A 3CMEA 1AP5A 4JZGA 1IVSA 4MT8A 3TXQA 1R3JC 3QHSA 5KH6A 5DLOA 4WFFA 2DL7A 4LF4O 4AFUC 3TXSA 5GAN6 1RLPC 3CC7Q 3NR7A 2WSCE 3EXAA 3ZCCA 4WFBV 5KA6A 2O01E 2NN4A 3T1HB 4LF5O 1ZHIA 2YXHA 3QPHA 1D1BA 2DNUA 3AG2C 3M9QA 5I2SA 1EBOA 2ZNIA 1I0HA 4PDVA 4C92B 4QQGA 4TWKA 3K06A 1YN8A 1OCCB 2X9HA 2IJJA 4DBFA 3CCLV 1QVFA 2R5MA 2SRCA 1SQGA 3ABTA 3M0PA 4PJNA 1Q95G 1GK9A 3M55A 1Y74A 3UCSC 2YXLA 5LHIA 1AVZC 2WLIA 2Z0WA 1FFXA 3BFMA 2RJFA 4JJNK 5LGUA 1UDLA 3THKA 4F7UA 5C0MA 1S72Q 4BACA 4RAIA 1LR1A 5BR8B 2KEAA 1VQ6T 1FFXB 1NS1A 5KHHA 2DM1A 1CKBA 1L0NH 1I08A 1WLPB 2CTWA 3J81N 4M78A 1WQWA 1K7DA 3QVNA 1M57C 4GKKO 4J9HA 2QEXV 1QQCA 1YJ9Q 3LGFA 4N21A 4X65O 2A37A 2GFUA 3V7RA 3DSQA 1VIEA 4UUJC 3OYMA 1WN7A 3OEEG 4QVZA 1KKDA 5J2UA 1W1FA 3UA7A 5EYPB 1AP6A 3CEYA 4P2ZA 1M1FA 1TSFA 1H2MA 2A0FB 4PJMA 5J2UB 2K79A 3RKYA 3JAME 1H2KA 2JS5A 3JCUZ 2JUFA 3EGDB 3CC2T 3W7WA 3JCMP 3ABUA 4IUVA 3OT7A 4IKFA 3VBBA 1V29B 2EIMB 2PVGB 1VP7A 1Y6XA 1BI1A 1YI2Q 1WDXA 1NR7A 3UA6A 4AQYB 4M7DF 3CPFA 4FT2A 4J7JA 4DV1B 1YJNT 3TREA 1QBZA 4B3SB 3LLRA 2DEQA 4DR4B 4M75A 3E22A 1HNXB 3SWNA 2DEUA 3JCMb 4J80A 3OSSC 2L35A 3AG4B 5JVDB 1SF9A 2UXXA 4TVRA 3OB9A 4OX9O 3QWYA 1I07A 4OMNA 4FFBB 2DTOA 3R6NA 4C7UA 2X51A 2YWWA 5EIBD 5HCKA 3U10A 1BT8A 2E5LB 2DWEC 2CUDA 3VS6A 4MVRA 4X64O 2M0OA 2NUTB 4RKUE 1IHWA 2YI8A 3EFOA 5EIBC 1SC5B 3MHSC 3T1YB 4HKEA 4CC5A 2CP6A 2XASA 4Z2WA 2XK0A 3AG3C 4HA8A 2K3YA 1RSOB 2H8HA 3WG7B 4X20B 2E41A 1V55B 3UT5A 4VUBA 4J9EA 5LP6B 3H1LH 2QQRA 3BY7A 5FW9A 4FLUA 1VQ9T 4F6RA 1I5OB 2JN0A 3H0FA 8AT1B 2GTOA 2VVKA 5CKBA 4FYVB 1JJOA 2DLPA 1AR5A 5GAMf 1MOFA 4RTYA 4IIJB 4F6RB 3W7SA 2P22C 3CSXA 1JVMA 3OTFA 4JZ3A 4EMGA 1VQPQ 3PIOA 3U11A 3CD6V 2F1MA 2I2LA 3SHWA 2QSAA 3M0TA 3LH5A 1ZTEA 1IBLO 3ASOB 1WXUA 3JAWA 3KBGA 1GTOA 3RWRD 4JI6O 2F5KA 1G4YB 1PG5B 1SRMA 1N33B 3EG9B 3EH2A 2WWWA 5A0LA 1KUQA 3A8GB 3L2WA 2Y69B 2Q0AA 2QJ1A 4WFGA 4EMHA 3JCMf 1FJGO 1SKUB 1WNSA 3QJ6A 1BE3H 1YCSB 3MO8A 1MMAA 1N8RC 1NPRA 1VQ8T 3H0HA 1M4UA 3L2VA 4TUYA 3QXEB 2JJ1G 2ZCFB 2V1QA 4DV6O 3HKCB 3RYFB 3OQ5A 4BR6A 2XAQA 1OCOC 4LCUC 3ZIAG 2PY5A 1D1CA 2PVOB 5LJ5j 4TUYB 3CCMT 3CCVT 2QDLA 1H8HG 1XNRB 3SYAA 1ORQC 3G71V 5GANg 2QTVA 4OP0A 3LNMB 1M1KW 2RN8A 2CP5A 3JYCA 5C8YA 1NQTA 1Q6IA 4JV5O 1M27C 3STZC 4Z02A 2XIDA 5KYNA 1XDCA 3AEIA 5J39A 1V54B 1ABQA 5CQXA 2CP3A 4LFAO 3A0BZ 2R9AA 1WQ7A 3C3TA 3I5SA 4IIOA 5CIUA 3BVOA 1IZ3A 1DF5A 4JLIA 4NR1A 5KHKA 2H3JA 2KRSA 1K73U 1YEWA 1WB8A 2UXDO 2JT4A 3RYCA 3AHUA 2QR4A 3FYIB 4ZN1A 1UGPB 3JATA 4J9ZB 3LDEA 2L2PA 4N4GA 1RAGB 2CH4A 1WJRA 4WF2A 1BCMA 2RQTA 4MMKA 4EMKA 3RYHB 5GTIZ 2RHZA 4LDYA 4D8KA 1VF7A 2L3PA 3HRUA 1BZKA 4JZ2A 1UPGA 2OTLQ 4EMKB 2UXCB 3CC7A 3H9NA 2WACA 2MF2A 4ZGDB 1DK1A 3MJXA 1SRYA 2KK4A 3OR7C 1D0ZA 3NPFA 3UF4A 1SETA 2LNHB 3G4SQ 1KHIA 3CPWS 4JS4A 3S3NA 1LUWA 3CCEV 4EKWA 5GTHZ 3CCUV 1GN2A 2DBKA 3V8LA 4JI7B 3L2RA 5GONA 4PA6A 2G38A 2CZ7B 3GVMA 1YCIA 5HFLA 1VQNV 1YBYA 2LZ6B 4HNAA 1MZFA 1QVGP 3A2FA 3SYQA 4UCTA 4KUIA 5KHGA 1TAEA 4LNPA 1RLQC 1S72A 5LGTA 5LA6A 3AT1B 3RESA 4B3RB 4X1YA 3VUZA 5DM7R 3U23A 3MCAB 1W70A 4NKGB 2GBOA 2RQWA 4L5GA 3OY9A 1MUZA 4DR2B 2JVDA 4X1YB 3CRAA 2P0KA 3K0DA 2ZZDA 2FYUH 1BL8A 1YJ9A 2L6LA 4JI2B 2JTMA 4M78G 1Y96A 3HRTA 3IC9A 5LOVA 2LCCA 1KB9F 9ATCB 3JCMe 3QYHB 3SJBC 2RJDA 1SKVA 3ZRWB 4I9QA 4BW9A 2L0AA 3H41A 3HKBB 4OMFB 2UUBO 2WLKA 1VQMT 2DERA 5LJ3j 3BPZA 1TS9A 3V8JA 4FPPA 1TG0A 2VUBA 3DLLA 3SYCA 1J5EO 2DBMA 1L0LH 2BTTA 1AD5A 3VKIA 1QVFP 4PFOA 1NT2B 1NTZH 5HKCA 1AILA 2BCCH 2P4VA 2HVJC 4IGGA 4CS3A 4AFQC 1YI2A 3JB9J 5KYXA 2CSIA 1S5LZ 4O4IA 4LF7B 4H37A 1ABOA 4DR6O 1ZA2B 1J95A 2GDSA 2W6IG 1VF6C 2AHJB 5CA0B 1I7FA 3U0ZA 1ZSPA 2QXFA 2ZPHB 1HWYA 5IJ9A 3ZEHA 2MPXC 3SEMA 1JQ0A 1SQXH 4ELYC 3ZEDA 2ADQB 3FFQA 4YHHB 3CCSA 1WJSA 4DA4A 1NJIU 3VS7A 1IDSA 2Q4PA 1O9GA 2CZ0B 5JWPA 2OT5A 2ZE6A 2L89A 5KA5A 5FU6B 4JI1B 2ENMA 1ZUQA 3GPLA 4D8DA 2MW2B 3N2KB 2QWQB 4JGSA 4JI0B 1LVKA 2D3OW 4G28B 1URFA 3OUSA 1WHHA 3REAB 3OW2S 4GZRB 3C95A 4PJJA 2Y0IA 3UPUA 3OYEA 4F4LA 2A08A 3JB9G 1C6VX 4PJOA 4RTUA 5LXTA 3HPWA 3JB9H 1QCNA 3E9GA 1N36B 1HYOA 4O5VA 4JTDB 1VQ7T 2PZSA 1AZGB 5GANj 4M7DG 2Q73A 2IJHA 3FB5C 1LUVA 2HSEB 2ILMA 1K9AA 3CC2Q 4UCVA 3X20B 3O5ZA 1Y4MA 5KYUA 4DXWA 4BE1A 3RYIB 1SEMA 3H1JH 3M8AA 1M3BA 2XICA 2OCCB 3GNFB 4XU2A 3L71H 4W4LA 1YJNQ 1GN6A 3BE3A 2XAFA 3GB7C 4A63B 2DJQA 1VQPA 2D8JA 1K0XA 2EINB 4DV5B 1LCKA 4LWSA 2YDEA 4HXJA 2EGAA 2N74A 5A2QN 3HPLC 1X6GA 4GX5A 1S5JA 2AXTZ 3QZ5B 4PKCC 1NH2B 3QBYA 2BIVA 1OI1A 4N0AA 3JCMJ 4ZIBA 3O65A 3Q4HA 2Y4XA 3MPUB 1XOVA 4M7DE 1QLEC 2CZ6B 1NZ9A 1THZA 3UDCA 1ZAUA 2MIOA 3FLGA 3P8BB 1KFZA 4AMCA 2YEVB 4X9DA 5BMVB 5F2VO 1X01A 4JAAA 5EZYB 1RUWA 2XG8D 1JU5C 3A8TA 3QO5A 2DRKA 3ZBHA 1M2VA 4M78F 1QW1A 3O9OA 2V1DA 4EEQA 5CBHA 4A5UB 5IT9N 4ABMA 1EX4A 5FLXN 4DV7B 3I56T 4FCYA 2D6FA 1QU7A 1M2VB 2JVVA 1VQ9Q 2A3QA 2MYSA 1F4NA 1VF5B 4OPHA 2DOSA 3HR0A 3JD4A 1IBKB 5GMKi 1NVPB 1Y71A 5IJ0A 2UUCO 4PFZA 3WB2A 4PDLA 1YF2A 5B5EZ 4IUUA 4JI5B 4EB6A 1OX8A 1N9SA 4Q5WA 3CBPA 3E8FA 1OU9A 2RJEA 1SQVH 2EW3A 4TOIA 3E19A 3KCYA 4QJFB 1FXXA 1Q43A 1RABB 4M7DB 1VQ8Q 3PTAA 4M75F 2OTLA 1B04A 2Y48A 4UB6Z 3OTOB 2KXCA 1N34B 3J81E 1K73C 1NTMH 3AG1B 4N4IA 2K6DA 4DBQA 5KYYB 2QA4T 5J9PC 1UJWB 3CCVQ 1WNLA 3CCMQ 2DILA 3RN4A 3G4SA 2ZPBB 3L9DA 4HAMA 1RI9A 3MHXA 2O57A 2EYYA 2LX7A 2AGAA 1YCYA 1D3BA 1H2SB 2P0QA 2YIBD 2PYLA 2VGMA 1OQKA 2DIGA 1BI3A 4LE9A 2R72A 4C92D 3H1HH 3OYGA 2A28A 1MSDA 2CTQA 1D3BB 2FYKA 2XOKG 1ZA1B 5CO7A 2HEQA 4JAUA 1XHZA 1KK7A 2RQVA 3REBB 4A4GA 4C92C 2VGNA 1OCCC 3CBOA 4HT9A 4AQYO 2YC0A 4J6XA 3AK1A 2DL5A 3A1PA 1XL6A 4O4JB 2WA3A 5ITZA 4DR4O 1KD1W 2CTPA 1HD3A 5L8RE 2OWOA 4FM0A 2FPDA 4X1IA 1JJ2A 3EG1A 4KH0B 4E7HA 4RO2A 3ICXA 2AZ2A 2RI5A 3J7AU 4X9QA 4Q6GA 1V1CA 4DRXA 1TWBA 1Y07A 4FSSA 2M7WA 3R6OA 5AYFA 5CKDA 5D6YA 2YS8A 5JCOA 5CA1A 2ZIMA 3EH1A 1PSFA 1YWOA 1YJWV 3CC7V 3M5AA 1Y57A 4I4TA 1TVKB 3TVTA 2KG7A 2ZIOA 3CX5F 1XMOB 2P90A 3K04A 3T1YO 3CP1A 3HKEA 2UUAB 5FU7B 1X2KA 4F14A 3OYHA 3CCJT 2HHHB 2Q0OC 3JALB 4LD9K 1JFFA 3SYPA 3HKEB 1TA8A 3LH0A 4X1VA 3CCRV 3D3IA 4LFCB 5GMKm 3FJ5A 2WLLB 3GNGA 4LNUA 4CI0C 4J10A 2YUAA 4RQEA 4HYOA 2K2MA 1VQ6A 3JCMg 2XTAA 4DW0A 1XL4A 5J2TA 1SA0B 2B9ZA 1N32B 1RAAB 2E3HA 4O4LB 2G6FX 2QM8A 5EK0A 4LP8A 2F4VO 2GUZA 3JAKA 4PHZA 5EC2C 1VARA 4XAXB 1BB9A 2HZYA 1VQ5T 3FEOA 4DYLA 5JJNB 1NZ6A 4UVAA 4M7AA 3IAYA 1N33O 1KBHA 1KYOF 3AG4C 1K8AC 1BCCH 2HR3A 5EC1C 1XNQB 2EQKA 2VC8A 4LF9O 2E10A 1MG1A 5AG2A 4FLWA 1U96A 3DC6A 2LP5A 3JARA 1QMCA 1Q7YU 5LHHA 1NJIC 4AI8A 1VQMQ 2RD1A 1GAXA 2YSUB 4ZN3A 3S3MA 3CC2A 1H8KA 2E74B 2ESWA 2JNGA 3A0RA 5GMKh 1Q5OA 2PTMA 1YI2V 1NLPC 1E1RG 5GAOn 1G8XA 2J06A 3ABKB 1XNRO 4HT8A 4H13B 3KZIZ 4DUZO 1HK9A 3WG7C 5LBQA 1V55C 3ZL7C 4FK5C 4WF9V 2GGRA 5LP6C 2KRMA 1M5Q1 1FFTB 2IU0A 1W2BU 2CYZB 2CDTA 1N0JA 5FRMA 1FYJA 1NYGA 3CCSV 1SESA 5L3CA 4CC2A 1IGUA 3CS5A 4DO2A 1PC0A 3JD0A 4AG1C 4RTWA 1K8AR 2CGHA 2KY9A 2XAHA 1B06A 1I4K1 1PP9H 3G80A 4JI8O 4QKUA 3VS2A 1ZL8B 3JASB 1JBMA 1KQSA 1OHHG 2LGQA 1NJIR 2QM4A 1YHQV 2F23A 3ASOC 3JSNA 2AKLA 2JZ2A 4KRTA 3LNNA 1Q3EA 1H3ZA 5LL6Y 1KC8W 3ABMB 1YITV 1US6A 3RR6A 3X24B 2Y69C 3F7YC 1VQ7Q 2QDOA 4BB7A 4B9WA 1XEQA 3HTRA 3ZHRA 4HVWA 1G8MA 3JD1A 4EFBA 4AFSC 3I55T 2UXCO 3DXRA 1VQKT 1SZTA 2QE7G 4R50A 1VYUA 4MSWC 1VQ9A 1H2NA 4UCUA 3VQYA 2E64A 2UXNA 1QWEA 1OZ0A 3K9AA 1XUQA 2BOBC 3ETDA 1KHCA 2A3LA 3FJPA 2CH7B 2RN9A 4JI7O 4TV8B 1VQPV 1E6GA 1G3TA 2VV5A 4ZKIA 2V8KA 3ME9A 2GTJA 1EZZB 3S3XA 4B3TB 1GRJA 4WTOB 1W2BP 2OTJV 1MZEA 4RWUA 2CP7A 2B1IA 1CPYA 2D8HA 1VEWA 4F7UG 3TU4K 4I0XA 2QAZA 5KE3A 1V54C 3B77A 1GKFA 3VOUA 5A0DA 4B3RO 1QCFA 4U7OA 2ZT9B 1UJYA 3PNWC 3D36C 1TUEB 2DF6A 2AHZA 2HP8A 2KMTA 4I0XB 3QJYA 1AOJA 1HSQA 4XTXA 1TXQA 2LX9A 4DR2O 2YXYA 3CCQT 4B6MA 1VQ8A 1YFNA 2FTKA 1GRIA 4JI2O 3CC4V 2R9IA 2QQSA 3J80N 1XQHA 4IURA 2EX3A 3G6BA 2AIRB 2LNVA 3MEWA 3CCMA 4DR7O 2M16A 1M56B 2Q7HA 4IIMA 5LMNO 2DL4A 2A79B 1GBRA 4DEXA 3I56Q 4FYYB 3LDDA 4CH3A 4DK0A 5CB4B 1UGQB 2RH2A 4EMKC 3GBQA 3WU2Z 5C6SA 4PJOF 4YIPA 1ZWIC 4RCCA 3CCLT 4FM2A 2BKDN 3URGA 3M4YA 4BD3A 2YSQA 1Q82U 2PZ1A 3INZA 2E70A 2MMPA 1ZUKA 4FL6A 1H92A 2E75B 3OBWA 4YJ3B 4LF7O 2EKHA 1SPKA 3ASNB 4M75G 1XHXA 3D3QA 5H6QA 1JJ2U 3IFXA 1TUDA 1N5ZA 3ZJZA 4L8JA 2LTOA 3D8CA 2AHYA 2P67A 4DR3O 2P0PA 2RNAA 3QF7A 2Q6AA 1SQBH 4JI1O 5I2MA 4OMQA 4JI0O 1VQOT 3K0GA 3K3WA 5FL7G 4FYXB 3NTIA 2WLMA 4FLXA 1TUGB 2GQVA 2W0ZA 2QA4Q 1DTOA 3G4SV 2K7AA 4WBNA 4CH4A 1GCQA 2EZOA 2CS7A 3L75H 1N36O 4CC3A 4JRIA 2EGCA 3MEVA 5GMKl 2Q68A 3TK1A 1BBZA 1M5IA 1Y7XA 4FW1A 3M54A 1Y74B 1OCZB 2BTQA 2DYSB 2VQEB 1O75A 2DD4A 2WLIB 3PMTA 4M75E 1K4DC 4ICGA 3EGXA 3V7SA 3SD4A 4F7UB 1K92A 2ROTA 4K3AA 5CR2A 4UCRA 1PKXA 1QVGS 1WYXA 4X62O 4Z88A 4M77A 3EGXB 5IHKA 4NB5A 2E5KA 2Q7GA 3LSUA 2YDLA 3H6ZA 3ETGA 4M78B 1MA1A 1T3LA 3F5WC 2FEIA 2V4DA 4DV5O 2KT8A 2DW4A 3SYOA 5JJJB 3OMCA 1JJ2P 2F43G 3META 2EBOA 3FDRA 3VS4A 2ZPIB 1AHJB 2VRZA 5A2QE 5GAN2 2QKCA 2DFUA 3JCMV 4IUPA 2PUOB 3OAAG 2LP7A 2R57A 2JDIG 4DV4B 3LW5E 3QG1A 3MAQA 3HRSA 5FU6C 4JS5A 3OYFA 1VQMA 1K4CC 1EIFA 2EVRA 2VWKA 4B3MB 3CCJQ 1IXMA 2X35A 3OYNA 1BHBA 2M02A 5CMUA 1PRMC 2QQAA 2PU9B 2RK1A 1M90U 3FB8C 4NVPA 4DV7O 1RP3B 4J7IA 3TJTA 1UHCA 3VS1A 5IT9E 4M75B 3E22B 1C1AA 5EG2A 3SWNB 4O2BA 3R66A 5FLXE 1Q7YC 4ORZA 4O6JA 1FWZA 1Q81U 4G2KA 4Z1VA 2UXBB 1M8VA 3E8HA 1HW7A 1O9HA 3FX7A 3ETQA 1CXZB 2OCCC 4PA3A 5E1AC 1CSKA 2M9UA 1IBMO 3CD6T 4ZTJA 2XDPA 2VQFB 4KBMB 2O9SA 2LGWA 3OMAB 1NH2D 4NXMB 2EINC 2E4HA 3QTCA 2C0OA 2X4WA 2EBPA 2HCKA 4FSXA 2DO3A 5KYWA 1H2GA 3EFOB 1ZBXA 4R8CA 3UT1A 1WXBA 1KQ1A 1AVMA 2VWJA 4HVUA 5KMGA 2GBQA 1YZBA 1FD9A 4TQFA 2EIKB 3PJSK 1N8RW 3M58A 2QKSA 1WHJA 1P49A 3E83A 4FYWB 3CB2A 1G3SA 3T4ZA 2EQMA 3UT5B 4QVDA 1N34O 1MMMA 4FLYA 3D7SB 1I81A 1L1FA 2KAFA 1K0SA 2DK3A 4BE2A 1Q7YR 3BAAA 2ITCC 2IW5A 3E1SA 4C8QE 1VQ4V 2XAJA 1U97A 2LW1A 4XU0A 2YHTA 3G71T 5IXFA 4JJDA 2QQ9A 1SG5A 3IC7A 1B34A 2ZPGB 1QNMA 1WAZA 1PWTA 2C2AA 4YIOA 1Q8IA 4CZZA 5LJ5d 2CGOA 5D6XA 3TETA 1BI0A 1NVPD 3JAWB 3MP1A 4F04B 1M3CA 2NNUA 3ML0A 1KMIZ 2XHCA 1W0JG 4OVAA 4XTUA 5IHIA 1FXKA 4FLVA 2FB5A 5CN0A 2JK5C 4QNHB 5D6WA 1SRLA 2QGGA 1NE8A 3OGCC 3FB9A 2EFIA 4E2LA 1KQSP 1FXKB 5FRNA 1GN3A 3QZ9B 1HP8A 4L59A 3JB9D 3QO7A 4LF6B 5CKEA 1DGSA 1W6XA 4FW2A 4ZNXA 2H8PC 3G6ET 3CQTA 4M7DD 3T9NA 1WGSA 1BSMA 1Q6UA 2RQRA 4YY3B 3QIIA 3FD9A 2E6ZA 5JQGA 3I55Q 4DOVA 2RHYA 1QVGU 1XMQB 3CPWA 2UU9B 4M7DC 2E3CA 4H33A 2RB6A 3I56A 1VQKQ 3NTKA 5C8YB 1XI1A 3G1JA 3UWNA 2JM8A 4C8QA 1MMGA 3SDZA 4ZTFA 4M7AF 1K3EA 3AG1C 1NU1H 3DC5A 2KNBB 3DB4A 1F23A 3CCUT 3JRZA 4PELA 2HHHO 2G3RA 1T5EA 4LXCA 3UO2A 1VQNT 2VB6A 2ZXWB 3BRCA 4JI3O 4KL1A 1U1SA 2P6JA 4J83A 1AWOA 3RYCB 1HNWB 2DTIA 3EHBB 4LFCO 1G3WA 3JATB 3FKSG 1IGQA 2BUDA 4Z89A 1KU9A 2O9VA 1RAFB 5IYZA 1E1QG 2A36A 2HQHA 3QG5A 3MEAA 2RI2A 1N32O 2AZSA 1JX9A 4J7KA 4ZOLA 2EJ7A 4JRQA 1B6QA 1VQ8V 1KG1A 3CCQQ 4GX0A 3RFRA 2EAYA 3A8HB 1Q82C 3A8MB 4J6YA 1PD3A 2MCNA 2E1HA 3ZFJA 3FB6C 1QVFU 3NXSA 3RMSA 4X66B 2QA4A 1UTIA 3OS5A 1EFRG 2EYZA 2EILB 3S3WA 1OV3A 1YIJV 2FRWA 1XNQO 3L2ZA 4C5IA 4J9GA 4KT0E 2XUMA 4ELZC 5GONB 3V7CA 1SS3A 4PDMA 3OYCA 3VQWA 1ROPA 1BHAA 3P30A 2J6OA 3ZRVA 4XU1A 2RCVA 4HNAB 4N4HA 2DVEA 1OV9A 1PPJH 2IH1C 3CXCA 2KQXA 3CCLQ 1VIBA 3OEHG 1S1NA 2DN9A 1FAFA 4PFPA 5LA6B 3CRCA 5FU7C 4E4EA 1IURA 3CEIA 5LJ3d 3W7UA 3CMEV 2E5QA 3VYHB 1FS0G 1E7OA 1PNLA 5M9OA 1NEGA 4PNOA 2F1LA 4BDYA 1M9NA 2JOYA 3M0RA 1BQ0A 5HFMA 4UCSA 1Q82R 3PMIA 2A06H 2QGFB 4PJOE 1FMKA 1Y96B 2JTFA 2LJ0A 2DXTA 4RG2A 1KKCA 5LOVB 2K1EA 1I5YA 2RHIA 1VQOQ 1S5HC 4G27B 4OB2B 3EFRA 3G67A 1ZQ1A 4P5NA 2HD0A 4GY5A 3QO8A 2XMFA 2IM9A 1TOVA 1ZBJA 4YTLA 2ZE8A 2HJDA 3KG2A 1BGYH 1MABG 3EFFK 1FKAO 3T1CA 4J42A 2L8DA 3QWXX 3CCJA 2LFRA 2K4YA 2D1XA 2BOCC 1QKXA 5KYXB 1Q86C 3UKMA 4A4EA 3CMAT 3N2GA 4I9WA 4D6TH 2LJ1A 5LJ5h 4O4IB 4GT1A 2IJKA 1D0YA 2ED1A 4IHJA 1NTKH 3N2GB 2CK3G 2GSMB 5IJ9B 5A0GA 4FLZA 4OMLA 3KXTA 1G1XB 2X4XA 2KVQG 5EBMC 3HKDA 3ABKC 2RO0A 4BAYA 2FZKB 4JTAB 3OYDA 4N23A 4B3TO 4FFKA 1HXDA 1R6KA 5IHNA 2YT6A 1M90C 2EULA 5LYJA 4LF4B 1S77D 2PQWA 4U3JA 2K57A 4PJOB 3MEUA 4ESRA 5LXTB 1MNEA 3ZMZA 3EG3A 1IZ6A 4FZ1A 4QVCA 3K08A 3LUTB 5LYJB 4JLGA 4LF5B 3RBBB 1N4CA 2HBPA 1Q81C 2WLHA 2LO1A 2PI5A 3VS0A 3I5DA 4GLXA 1N8RU 3M59A 2F66C 5KYUB 4D7TA 3MKDA 2JEXA 3SJCC 3GWKC 2JMAA 3ABMC 2QQBA 2EJ9A 3TSWA 4HCBA 5TISZ 1WHMA 2C0IA 6AT1B 2CKKA 3J80E 2FZCB 1K9MC 3A5ZB 1X2QA 1XQ8A 2LT4A 5IYDO 4QT7A 4LWSB 2D0QB 5FWCA 4MVSA 3K5NA 3QYGB 1M90R 3RNJA 1IO6A 4KUMA 1F1BB 3HHTB 4GKKB 3T2MA 3WFVA 1Q86U 1ENVA 3CD6Q 5HY6A 2Y4TA 4X65B 3Q4HB 3RKWA 2X4YA 4YJ2A 1Q81R 2FVUA 3OYAA 2MK5A 4O4HA 1BU1A 4P9OA 4DW1A 3DB3A 5B1OA 1AI5A 3PVLA 3TEEA 4LDXA 1NI8A 2O4XA 1RM1B 1SSFA 1EZVH 4XDKA 4HCCA 4M77F 2XDBA 3H01A 4TT3G 2R58A 3EG2A 4IUQA 3T1HO 2O4XB 3ZHQA 1K73W 3L1AA 4LN2A 1T3SA 1Y76A 3C90A 1VQKA 3ZMTA 2EQUA 1SHFA 5IN1A 4B7KA 1WPYA 4FU6A 2K9PA 4Y91A 2EJGA 1L8DA 1Y76B 4PA9A 4RTXA 4OXSA 1GCPA 3G71Q 2BTOA 3CHXA 3BCCH 5LJ3h 3VV0A 4ATOA 5IJ0B 1M56C 5KX5A 2EIFA 2KSSA 4II1A 2O31A 4X88A 1KC8U 5DEDA 1YTFB 1NG2A 1LJOA 5BR8O 2CSQA 4JI4B 4OX9B 4EB6B 4GYCB 4TQDA 1GBQA 2KB1A 3CBMA 1W2BS 2XI9A 3QDFA 1RFYA 5JH7A 4MZMA 2AZVA 2KT1A 4Z8AA 2GF7A 2N05A 2IG0A 1A0NB 1GM9A 1D2DA 5IH2A 1W0KG 3T4DA 1F7YA 2EKOA 1R3LC 1I1JA 1QR8A 3E86A 4PA7A 4HCZA 2VXFA 3CCQA 3ASNC 1X75C 3X25B 4U7NA 3TGUH 4M7AG 3G6EQ 2DVJA 1WA8A 2A0LA 4E7IA 1R6NA 5H5NA 3LX7A 3NTHA 4MTGA 4JF3A 3H1IH 3BFRA 2K3XA 4AILC 1YJWT 4X8AA 1H641 1QVPA 3CPWP 3RERA 1A32A 1ZSZA 2BZ8A 1OX9A 4JRPA 4DV4O 1EN6A 4I55A 2QWPB 3FC3A 5KUKA 3OMNB 3PVQA 1ZSZB 1B3QA 5GANh 2ZD9A 4XDJA 2MWPA 4GKJB 3CCUQ 2JIZG 5L3BA 4B3MO 1SQQH 4DV1O 2CT4A 2L3QA 3CCLA 3BA9A 4B3SO 1WJZA 1VQNQ 3HB3B 1ZLZA 1HNXO 1BIAA 2H3EB 1AI4A 1KSWA 3CCRT 5CA3A 4JI6B 2JJ2G 2P7TC 2RHXA 2E6NA 1DLBA 2DYSC 1OCZC 2N04A 2P06A 1AWXA 5L3GA 4JYCA 2DYRB 4CS2A 5ITZB 2B86A 3HKSA 4OB0B 1G5VA 3M57A 1FX7A 4C0DB 2JGDA 2FZGB 4X1IB 1K9MW 4M7AE 4M78D 4UFZA 1FJGB 2OAWA 5L3FA 2UXBO 4DRXB 1P7BA 1AWJA 1GFCA 1TUBA 2E5LO 5KCOA 2WLJA 5CA1B 5A9GA 4BI8B 2IPOB 4M78C 4J6WA 2CDYA 4JYBA 1JQQA 4I4TB 1VQOA 4NXMO 2Z0AA 4MVZA 1MV0B 1MV3A 4DUYB 4ZBMA 3ZMSA 1AJPA 1K8AW 2YUNA 4I5SA 3VS5A 2KG7B 1H2LA 4V2SA 2YICA 2QTXA 1PKSA 5GAN8 4J41A 4HZ3A 2ZCEA 3SR2C 1NJIW 4JAVA 1P7GA 4ZHQA 2J6FA 1JFFB 4JV5B 1S72V 3WVDB 4RUGA 1X6OA 1Y66A 2JW4A 2YUQA 2Q9LA 1AB3A 1FMWA 3CXCP 4AHCA 1TGOA 5C93A 1C0MA 2LFSA 1OPLA 3FAVA 2Y0PA 2FO0A 2HKQB 1YI2T 4LNUB 2PTKA 4OGEA 1WP7A 2DQ3A 2UXDB 5FWBA 1YJ9V 5I22A 2ZE7A 2ABLA 5J2TB 1TH7A 4M75D 3K5LA 5BZBA 1CKAA 2ZM6B 2Z5UA 5CKHA 2QKAA 1B07A 3HL8A 2DXCA 5BXZA 1FPOA 2GUZB 3JAKB 4RUFA 4LBEC 1M4ZA 2D9TA 4C8QF 3CCST 2HDAA 2X3WD 5K1PA 4JPBW 2HSPA 2HMAA 4M75C 5ECAA 3SWNC 2XD0A 3EG0A 4M7AB 5GAOr 2LW7A 5H2FZ 1JJ2S 1OULA 3A98A 2EQJA 5GJVB 3OMGA 3MHHC 4JTCB 2DTHA 1S3JA 1MSWD 4J7FA 3JARB 2DAQA 2QDYB 4Y92A 4F17A 4E7JA 2F2XA 2HQEA 3BA8A 1YHQT 2M6YA 4LF6O 1YDXA 4K8XA 5FNVA 1YITT 5GAN3 1VF6A 5CQYA 4BY6B 4C5GA 2XNDG 3WB0A 2LVMA 4A4KA 2NYSA 4BI3A 1VQLT 2KQWA 4UB8Z 1YJNA 1QR9A 2CZ1B 3SB2A 2ECZA 2YUPA 2EIKC 2L3RA 3ER0A 4MVMA 3CMAQ 1S76D 2UU9O 2HKNA 4R56A 4WFAV 4C5EA 2GNCA 4PK4A 4PI0A 2CTRA 3OE7G 4OMOA 1JCHA 1KD1R 4R7CA 2V26A 4UVCA 2DKGA 5CK9A 5GAN5 1UUEA 2LT1A 3B40A 3ULRB 3KCXA 1DJ7B 2EJFA 3GIBA 2FHDA 1UGSB 3CD6A 4RCBA 3SJAC 4Z1MG 1WZOA 4JJBA 1UHFA 2OTJT 1HNWO 2FPFA 2EZPA 4J11A 2E12A 1MNDA 4GCZA 2YRVA 5KCHA 4EIKA 3P8HA 4OMPA 2HEPA 1QLNA 4ZI7A 4H0LB 4LFBB 4A54A 4MTFA 4B7EA 3K03A 2EGEA 3JB9I 2HL5C 3ZBDA 4K0KB 1F4MA 2WSEE 3MP6A 5CAIA 1FXKC 1TUCA 5EBWC 5KUMA 3HFOA 1J5EB 1K5SA 1P84F 3DXRB 1K33A 3R65A 4MVUA 1KP3A 1BKBA 3A8LB 3CC4T 2JS3A 1QCEA 4X66O 2EYWA 4NL2A 1IRXA 3E8BA 3AG7A 1F51A 2V7QG 3C3SA 1UFFA 3GF5A 3CWBH 3PFSA 4C0GA 1VUBA 4XK8E 1Z5WA 2WPDG 3G71A 5HK3A
chains in the Genus database with same CATH topology
1SF9A 2YXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SF9 A;  2YXY A; 
#chains in the Genus database with same CATH topology
 1GN4 A;  4DR6 B;  1BI2 A;  1RAI B;  4X9C A;  2RQ6 A;  3I35 A;  5GAM d;  1UFI A;  5GW7 A;  4PLL A;  4MW3 A;  2DJV A;  4BUG A;  4LDW A;  5IYB O;  4FMT A;  4WFH A;  3OM3 B;  2D2C B;  4DV2 B;  1K97 A;  1ZX3 A;  1M2O A;  1OOT A;  1PSE A;  2DXB A;  2K5F A;  5KAF Z;  4NXN B;  2JJ9 A;  1JR9 A;  3P3P A;  4M77 G;  4KHP B;  2V8I A;  1Z9Q A;  3O8V A;  3L2U A;  2BSK A;  2ZXW C;  3UO3 A;  1LNX A;  1JMK C;  3F5T A;  4PJL A;  2KE9 A;  3CCV A;  4DEY A;  1Q86 R;  3CE2 A;  1NBM G;  5D5P A;  4FZ0 A;  1W59 A;  2X3X D;  3G6E A;  2RJC A;  2W0F C;  1XBL A;  1K76 A;  4XTZ A;  2ZIN A;  4X1K A;  3RDV A;  2XU8 A;  2F2W A;  2A7W A;  2VWF A;  1VQK V;  5HK0 A;  2LRQ A;  1ZUU A;  3CYO A;  1EZJ A;  2ATC B;  4ZGJ B;  2EIL C;  3OYI A;  3CCU A;  2C06 A;  4M77 E;  3TQ7 P;  5EBL C;  1VQN A;  2HKO A;  1RL2 A;  2DET A;  1AJN A;  4XTV A;  1UGR B;  1RAH B;  4YHH O;  3EGU A;  1UEB A;  3A0H Z;  4LUD A;  5GAN 4;  1M1K U;  1AR4 A;  5GAN 7;  2W6J G;  1PD0 A;  3M0S A;  1RAE B;  4TV9 A;  1WX6 A;  2ZPF B;  3OBY A;  4A4F A;  2QEX T;  4FJC C;  2OTL V;  4QW2 A;  1KC8 R;  4J9C A;  2P84 A;  1FXV A;  4WCE V;  1M8M A;  5I21 A;  2VAS A;  1QHT A;  1QKW A;  4DR5 B;  3PN1 A;  1D5N A;  2ED0 A;  2GHY A;  4CC6 A;  2LJ3 A;  3E2U A;  3L72 H;  2JMC A;  2YIB A;  1FXH A;  3B4S A;  4WBN B;  1YJW Q;  2CP0 A;  3X2Q B;  2Y4U A;  4GX1 A;  4TSF G;  4XTW A;  4C92 A;  3BDU A;  4BDZ A;  4WFE A;  4F6E A;  1PNJ A;  3M7M X;  2SEM A;  2YRC A;  2BTQ B;  3GP8 A;  4E47 A;  4E7K A;  5L3E A;  1UGV A;  5LJ5 g;  5GMK e;  2YID A;  4BWA A;  2ZDI A;  5DN6 G;  2VKN A;  1H8E G;  3QNE A;  2UUC B;  2PI4 A;  1QP3 A;  2DX1 A;  5B1N A;  3ZN1 A;  3GWO A;  4M77 B;  3CCR Q;  1MMN A;  1XJW B;  2M51 A;  4P9P A;  5H9C A;  1Q7Y W;  2WA4 A;  2QG9 B;  1GXI E;  2OAU A;  4K11 A;  4MW8 A;  3HP9 A;  2ITD C;  5LMU B;  4K8Z A;  1G2B A;  2GQI A;  1WPB A;  5FRO A;  1X4T A;  2NLU A;  5EYP A;  3SPC A;  1HDJ A;  1VQO V;  4L87 A;  2HQX A;  1H38 A;  2KI7 A;  1U1T A;  4OB1 B;  4P30 A;  4QIW F;  5CBF A;  1UG1 A;  5CCA A;  4PJO D;  1FYN A;  2HL3 A;  2PF4 E;  2DL8 A;  1R3I C;  2KYM A;  3RBZ A;  1KJW A;  5AT1 B;  2LQ8 A;  4J8O A;  3EGD A;  2CAZ C;  4IT5 A;  1R73 A;  4DOW A;  1I5L A;  1QVF S;  4PJO C;  3F7V C;  4XTY A;  2IH3 C;  1I5X A;  5LGN A;  1KIK A;  2RHU A;  1ARO P;  4A53 A;  3H1K H;  3W7X A;  2BE3 A;  3JB9 F;  3CMA A;  5GAM h;  1VQ6 V;  4DK1 A;  4J7Z A;  1OEB A;  3E8G A;  1PD1 A;  2LCL A;  3OSV A;  3OYY A;  1IBK O;  3OGI B;  2BZY A;  4C8Q G;  2RPN A;  1NEB A;  3M4G A;  4O2B B;  1UEC A;  4CH6 A;  2YRD A;  3ASK A;  4KGZ B;  2P4R A;  4IUT A;  1VQ4 T;  4B9X A;  1EN4 A;  1PL0 A;  5JVD A;  1KQS U;  3SPG A;  4JI5 O;  1VQ5 Q;  2DMO A;  1SZX A;  4UC4 A;  2DQ0 A;  3SFM A;  5JJE B;  1P92 A;  3KUF A;  4FFB A;  1IXB A;  3C4S A;  3K9S A;  5IWA B;  3JCM h;  1IRE B;  3CCS Q;  1K5Q A;  2GTS A;  2V1R A;  1YSC A;  3UM7 A;  4JI4 O;  4JAS A;  1I8F A;  2KRN A;  1VQ7 A;  2MK3 A;  5KYW B;  2KKW A;  1MHN A;  4QGP A;  2RQU A;  2NUT A;  5KMG B;  4OPA A;  3CC2 V;  4N0A C;  4JUV A;  4EPC A;  1LPL A;  3K79 A;  1NKD A;  3OTO O;  1QLY A;  3G7Z A;  4QQD A;  1TTH B;  4C0Z A;  3PIP A;  2X0L A;  4PJ0 Z;  1M93 A;  4Q20 A;  1YHQ Q;  4UXN A;  1RSO A;  2FKX A;  4X20 A;  4QPK A;  4MTO A;  3JCM c;  1Z2G A;  4RMO A;  1YIT Q;  5LP6 A;  1G6U A;  4I50 A;  3B8N A;  4NL3 A;  1AI6 A;  1MNG A;  2CGN A;  1YJN V;  1VQL Q;  3ZRX A;  3ABL B;  1RM1 C;  2J6K A;  2RM4 A;  4DBH A;  2QTS A;  4I50 B;  2EIJ B;  4OB3 B;  2X6B A;  3TSZ A;  4IYH A;  1SHG A;  5DM6 V;  1B34 B;  4IIJ A;  5LJ3 g;  3CJH A;  2E76 B;  2PUK B;  4JYY A;  4J9Y B;  1IHV A;  3CJH B;  2K5L A;  2HFE C;  4GKJ O;  4LH6 A;  3TCJ A;  5IDJ A;  2JRI A;  5L23 A;  5J26 A;  2PUS A;  3S3O A;  1YTF D;  2F4V B;  3EG9 A;  4UV9 A;  1V9P A;  1N6A A;  1WP8 A;  4MVO A;  2DA9 A;  5EC7 A;  2OTJ Q;  1W4S A;  5IY5 B;  2L3S A;  1J3T A;  2ATK C;  2JM9 A;  4BE0 A;  2GV9 A;  4LF9 B;  2RMK B;  5B3S B;  2IU3 A;  1OU8 A;  3M0Q A;  4LC1 A;  1XRE A;  2HJF C;  3HKC A;  4X89 A;  3RYF A;  1OPK A;  2XDD A;  1VQ9 V;  3FRN A;  2QWR B;  1Q82 W;  5B1B B;  1SQF A;  5JQG B;  1VOM A;  3KKY A;  4H44 B;  1XMO O;  2LJ2 A;  3P3N A;  1X43 A;  7AT1 B;  3SGI A;  4PV1 B;  3DKM A;  3CC4 Q;  2ZR3 A;  3CCE T;  2UUA O;  4DUY O;  1HR0 B;  1GM8 A;  1I94 B;  2XKO C;  4C8Q B;  2PNI A;  1YIJ T;  3PT9 A;  2EPD A;  1Q90 D;  1XTD A;  4DUZ B;  1GFD A;  1SER A;  5FPR A;  3IQL A;  3N5B B;  3M99 B;  3LDC A;  2NWM A;  3OYL A;  1WHK A;  3D36 A;  2DWD C;  1U3O A;  2IVW A;  4JJC A;  1HNZ B;  2V8J A;  1BK2 A;  1I0C A;  3JCM W;  1WB7 A;  2ODM A;  5KHJ A;  1JO8 A;  1ZSZ C;  1COW G;  3OFN G;  5IYZ B;  2F2V A;  5B1A B;  1VYT A;  2YLB A;  4HCK A;  1EM1 A;  4JI8 B;  2O88 A;  4E6R A;  3EFS A;  1Z5V A;  2JTE A;  2ZGW A;  4D7S A;  3CME T;  2QWN B;  4LF8 B;  4DR1 B;  2ZPE B;  2DXU A;  1PCX A;  4ZOL B;  2P4K A;  2ZM6 O;  1N8R R;  4Y28 E;  3RYH A;  1PKT A;  1GL5 A;  3CCV V;  3K59 A;  2RI3 A;  3CCM V;  4PJO G;  3VYG A;  2DYR C;  2FB7 A;  1OCR B;  2ZKO A;  2VS0 A;  1TU0 B;  2HAX A;  1JB0 E;  3G6E V;  4C0D C;  2GCX A;  2DPP B;  1T0J A;  3E9F A;  3BHP A;  3RIR A;  4FIB A;  1M1K C;  2JXB A;  3JSL A;  1YJW A;  5JCO C;  1Z9Z A;  4DV3 B;  3JCZ A;  4EFE A;  3P8D A;  5J3B A;  3ZMU A;  3K58 A;  5KE2 A;  2Q5Z A;  4MZT A;  3BW1 A;  3OA6 A;  4DV0 B;  2ADP A;  4JZ4 A;  1GO3 F;  2LDM A;  1T0H A;  2HBW A;  4M4Z A;  4JRK A;  4KGV B;  4GUN A;  3L42 A;  3C0C A;  3CCR A;  1ARK A;  4JYA B;  4R6Z A;  3APQ A;  3OW2 A;  2VYT A;  5GAM e;  2A7Y A;  3OYK A;  2QEX Q;  1WPX A;  2CE4 A;  2QM7 A;  3RVY A;  3ZHV A;  3AG2 B;  1GH6 A;  2XT9 A;  2IIM A;  1HJD A;  3LSQ A;  1QP2 A;  1M1K R;  2LQK A;  3LGL A;  4GX2 A;  3JD2 A;  3DGE A;  1N9R A;  2ZAE A;  2OI3 A;  1M90 W;  2AT1 B;  2JEU A;  4M7A D;  3ZRW A;  4KGX B;  3IJ4 A;  3HKB A;  2J05 A;  1JA8 A;  2D0N A;  2P4T A;  1KP2 A;  2AKK A;  4LD6 A;  4DR7 B;  1KD1 U;  1PHT A;  3RMQ A;  4M7A C;  4LFB O;  5LMN B;  1Q81 W;  1PM9 A;  4ME7 A;  1NR1 A;  3JCM Q;  3SJQ C;  2AZ0 A;  4K0K O;  1OZ2 A;  3VUB A;  1R3K C;  4BIU A;  5LL6 S;  5D7U A;  2OIE A;  4GLK A;  4DQ2 A;  1K9M U;  1AEY A;  1XOU A;  1DF4 A;  2OCH A;  5GAN d;  1JXM A;  1M57 B;  4CC4 B;  3E89 A;  4UCO A;  1NM7 A;  2O2O A;  4IHJ B;  2HNI A;  4BY6 C;  5CA0 A;  4RG8 A;  1WLE A;  3CXC S;  3BAB A;  2IBZ H;  1AI7 A;  5KHI A;  1RPO A;  1K4U S;  3HKD B;  2QWO B;  4J9I A;  4OF1 A;  4GBQ A;  1VQ5 A;  4OMM A;  1PRL C;  3LYI A;  2WSF E;  5DY9 A;  3CRQ A;  3N2K A;  4QE9 A;  4DR3 B;  3VU3 C;  4DV2 O;  2PYJ A;  4C0F A;  3OYB A;  2KSD A;  2X6A A;  4NXN O;  2YI9 A;  2EJR A;  4U3J B;  3RW0 A;  3STL C;  1VQM V;  4KHP O;  3HFN A;  1QQJ A;  1U06 A;  2PVD B;  3GLX A;  1R6T A;  4E7Z A;  2GTA A;  2ZR2 A;  2OJ2 A;  3PE0 A;  3VJP A;  1YHQ A;  2OX7 A;  2KRO A;  2CUB A;  1YIT A;  2WSS G;  2KYB A;  1VQL A;  1CP9 A;  3FB7 C;  3I5R A;  4J9B A;  3V8K A;  4E7L A;  3RYI A;  4CBC A;  3APO A;  3SPJ A;  2CP2 A;  2ARH A;  3CMA V;  4ZGE B;  3K5O A;  4A4H A;  4MDW A;  3VRY A;  5LJ5 f;  1KQ2 A;  1UE9 A;  3ETE A;  4X62 B;  4FT4 A;  1VQ4 Q;  2JS0 A;  1BIB A;  3M56 A;  1ZLM A;  2PGG A;  1R0C B;  1YWP A;  3JAM N;  4L6V 5;  1WI7 A;  4C92 F;  4KUD K;  4K35 A;  2RJZ A;  4PDR A;  1W2B A;  2R5A A;  4MS2 A;  3OUF A;  3EVK A;  1WFW A;  2COW A;  4YJ2 B;  3AG3 B;  2OTJ A;  2E3I A;  4O4H B;  3M0U A;  3NHN A;  1GM7 A;  1VQ7 V;  3B8M A;  1BCO A;  2RK2 A;  3LWH A;  1XIL A;  2H3O A;  2YEV A;  5BMV A;  5GAO m;  3CPW U;  4NTY A;  2KXD A;  1UJ0 A;  3JCM X;  1OJH A;  3I55 A;  3FIF A;  5EZY A;  3H0I A;  3VS3 A;  1AJQ A;  3C12 A;  1Y0M A;  2DYI A;  1R8O B;  3SPH A;  3JD3 A;  4F7U F;  2MI6 A;  4DR5 O;  1R0B G;  2NR5 A;  3CC4 A;  2X7R B;  5K1X A;  1IXD A;  2CT3 A;  2LC4 A;  1SQP H;  2LQW A;  2F93 B;  2DIQ A;  2NUZ A;  1EN5 A;  1H3H A;  2VQE O;  2M1H A;  1AWW A;  4NTW A;  4AG2 C;  5KX5 B;  1JEG A;  1WHG A;  1K1Z A;  1WHL A;  1JXO A;  1BYM A;  1RI0 A;  2FPE A;  2AW9 A;  4CRI A;  4XQ3 A;  4RTT A;  5CBG A;  4KFM A;  1IBM B;  4NTX A;  3X28 B;  3OS0 A;  4X64 B;  1GMG A;  1LNQ A;  5JH7 B;  1N27 A;  3KFV A;  4BI4 A;  1OCO B;  4D6W A;  2R70 A;  3L70 H;  2Q7E A;  4XDL A;  3NMZ C;  2YLC A;  2B5U A;  3RGB A;  3WXM B;  1O9S A;  4OGC A;  4QE7 A;  4M7D A;  5GMK j;  4MML A;  2XAG A;  1G3Y A;  2Z3Y A;  3BDL A;  4CC7 A;  2Y90 A;  5LMU O;  2RMO A;  3CC7 T;  3I56 V;  1WA8 B;  3RUX A;  4BIO A;  5DLQ E;  5KYY A;  1YP5 A;  2IJI A;  2M0Y A;  3CXH F;  5IYC O;  2F69 A;  5IE9 A;  4ASU G;  3L2Q A;  1E6H A;  3CXC U;  1WXT A;  2LMJ A;  3CCE Q;  5FPO A;  2K3B A;  4QPJ A;  4I55 B;  2XHB A;  3THO A;  1JOY A;  4HVV A;  1YIJ Q;  2ZQM A;  2W10 A;  3MD0 A;  2J7I A;  1IBL B;  1M30 A;  2I0N A;  2B8A A;  1BS3 A;  1GCQ C;  2FML A;  5H6R A;  1YNZ A;  2EWN A;  3X2Q C;  5LJ3 f;  1LOJ A;  3OD4 A;  1S72 T;  1RAC B;  1PV0 A;  3AK2 A;  1WA7 A;  2HG5 C;  4W4K A;  2P5O A;  3P32 A;  5LJ5 e;  2W0X A;  2FL4 A;  2Q67 A;  4DBR A;  4NOY A;  1G83 A;  2A9H A;  3OW2 U;  3NFC A;  4O4J A;  1BQZ A;  4M77 D;  2JGD B;  1MGQ A;  2EYQ A;  4LUE A;  1YJ9 T;  2QEX A;  3OR6 C;  1V76 A;  2VQF O;  3CME Q;  4O2A A;  1VYV A;  4DV6 B;  2Q8V A;  3L73 H;  1TUB B;  2Y4Y A;  4M77 C;  2NLJ C;  2ZDI C;  4XBF A;  2QA4 V;  2EYX A;  1YVW A;  3ZHT A;  1ZUY A;  1NBE B;  1NYF A;  4E7S A;  3DTU B;  4B08 A;  1ZSG A;  4O2A B;  2MAM A;  2X4J A;  1K73 R;  5IWA O;  3B2E E;  1R1B A;  3OS1 A;  1D0X A;  3A8O B;  1TVK A;  3ZS8 C;  2HLD G;  2L5Q A;  1X69 A;  3RVZ A;  5I11 A;  3QO3 A;  5CKF A;  3ZHS A;  3QDR B;  1S0V A;  1R77 A;  4NYK A;  2ROL A;  2DE0 X;  5LHG A;  4JDS A;  5GAO q;  4KP4 A;  4LFA B;  2DZ9 A;  3QKJ A;  4ZHQ B;  1XNI A;  1P4R A;  2YUO A;  4PD4 F;  3JAL A;  5GAM g;  1RPR A;  2MWO A;  2ZE5 A;  1OYX A;  5GAN f;  4BW5 A;  1E79 G;  3FAV B;  1U8R A;  4UV8 A;  2NUP A;  2WLL A;  4RTZ A;  4JI3 B;  2EQI A;  1VA7 A;  5KLV H;  2R9R B;  2HVK C;  1KD1 C;  2QTO A;  1NPP A;  1X59 A;  1JRI A;  3M53 A;  3W7T A;  2NUP B;  1SA0 A;  3QUI A;  4WCI A;  4O4L A;  1UB4 A;  4R55 A;  3OW2 P;  1VQ6 Q;  2CUG A;  3SDL A;  2EIM C;  3OYJ A;  3LWI A;  1BMF G;  5GAO p;  3X26 B;  4FLT A;  1EFN A;  2VXE A;  4LH7 A;  2BE9 B;  4CH5 A;  2DJZ A;  2E65 A;  1NLO C;  4LDV A;  1FMV A;  2KGT A;  3HSB A;  3CCJ V;  5B66 Z;  3PGG A;  2OYQ A;  1QCO A;  5CVI A;  3RKX A;  5FNV B;  4YY3 O;  1X27 A;  4U3F H;  3Q1J A;  2LQN A;  3EAE A;  8ATC B;  1XMQ O;  4YXW G;  1YXB A;  1M1G A;  1AZE A;  1M9S A;  1OZ3 A;  1D5A A;  4ANJ A;  4AFZ C;  1AT1 B;  3E35 A;  4JPR A;  1Q86 W;  3OS2 A;  4RTV A;  4LDU A;  2FL7 A;  4PL6 A;  1Q6H A;  3E2E A;  4C5H A;  1HR0 O;  1VQP T;  2JGU A;  1I94 O;  1IX9 A;  3S6W A;  1RAD B;  1VQ4 A;  1K9M R;  3ABL C;  3TCU A;  3ZRS A;  1AR1 B;  5LJ3 e;  1MMD A;  4IL6 Z;  4CS4 A;  1VQ5 V;  3I9Q A;  2RDC A;  4J5Y A;  2K5I A;  3EHQ A;  2EIJ C;  4FM4 B;  1PNK A;  2RF0 A;  3WVE B;  1JPX A;  2H94 A;  4IYI A;  2LQT A;  2RNB A;  1HNZ O;  5GAO l;  3CRM A;  1Y67 A;  2ETN A;  1ZL8 A;  3JAS A;  3K5M A;  2UUB B;  3N27 A;  3C94 A;  5DEC A;  4ZI7 B;  4FM1 A;  1U5S A;  4LR3 A;  4LF8 O;  4DR1 O;  3QSU A;  1VIF A;  2BE7 D;  4R0K A;  5IY5 C;  2F95 B;  1QWF A;  2GFA A;  4I7Z B;  1PNM A;  2CRE A;  2CH4 W;  4QQ6 A;  3BEH A;  2COY A;  1PM3 A;  2K2V A;  3B09 A;  1VQL V;  1ZX6 A;  3OMI B;  4KH1 B;  5B3S C;  5GJW B;  4J9D A;  2QAS A;  5L3D A;  1B7T A;  1WIE A;  3ZN0 A;  2DMX A;  4C92 G;  3RT3 C;  3JV3 A;  4C8Q D;  5B1B C;  2X6C A;  3H9V A;  4PA4 A;  4DV3 O;  2CH7 A;  2MOX A;  2YIA A;  4TV8 A;  3VQX A;  4PLI A;  3J7A F;  4KXR A;  3WB1 A;  4HBN A;  1D1A A;  3L74 H;  1QLE B;  4DV0 O;  2BZX A;  4AT1 B;  5GAN e;  2OIG A;  2COZ A;  2DRM A;  4EDU A;  1PL4 A;  5IXB A;  4C8Q C;  2FG0 A;  1KEC A;  1CEZ A;  3JSC A;  4F16 A;  3IGA C;  1M3A A;  4XU3 A;  3JCM d;  3CRR A;  2KR3 A;  1IB8 A;  2BSK B;  4J9F A;  3NGP A;  1KQS S;  4JYA O;  4BIZ A;  1KC8 C;  2QGN A;  4MVQ A;  2DZC A;  2LCS A;  3VRZ A;  4MZP A;  4KUL A;  2OTL T;  3I55 V;  2QK0 A;  2C0T A;  5D5Q A;  5B1A C;  2ZNJ A;  2JS2 A;  4OGQ B;  1D09 B;  4MTX A;  4X1K B;  5IAY A;  3ZX6 A;  2Q69 A;  3EHR A;  3FYE B;  3UQ8 A;  3DLM A;  4C92 E;  1ACM B;  3H8Z A;  3UAT A;  3G4S T;  1K34 A;  1WJQ A;  4UVB A;  3CCE A;  5GAM j;  2QI2 A;  3VQV A;  5BY1 A;  1OCR C;  5E79 Z;  5CB4 A;  2DYB A;  3MP8 A;  4FIP C;  1YIJ A;  2QYZ A;  3K57 A;  4FVM A;  3GOX A;  2DL3 A;  3AK3 A;  4X34 A;  1QVG A;  4PI2 A;  3BY6 A;  4GLM A;  4RQF A;  2DD5 A;  2K9G A;  1SSH A;  2KBT A;  3LSS A;  4MDX A;  2RA2 A;  2WLN A;  2WAM A;  4F7U E;  3ZHU A;  3SPI A;  4E2F B;  2F5T X;  1X6B A;  1K8A U;  1N0N A;  4YJ3 A;  4NS5 A;  3ZMV A;  3MDS A;  4TV9 B;  5KAI Z;  2AK5 A;  4M78 E;  4RUE A;  1VMG A;  2KDS A;  3CCQ V;  2B1G A;  2FRY A;  3F70 A;  3CME A;  1AP5 A;  4JZG A;  1IVS A;  4MT8 A;  3TXQ A;  1R3J C;  3QHS A;  5KH6 A;  5DLO A;  4WFF A;  2DL7 A;  4LF4 O;  4AFU C;  3TXS A;  5GAN 6;  1RLP C;  3CC7 Q;  3NR7 A;  2WSC E;  3EXA A;  3ZCC A;  4WFB V;  5KA6 A;  2O01 E;  2NN4 A;  3T1H B;  4LF5 O;  1ZHI A;  2YXH A;  3QPH A;  1D1B A;  2DNU A;  3AG2 C;  3M9Q A;  5I2S A;  1EBO A;  2ZNI A;  1I0H A;  4PDV A;  4C92 B;  4QQG A;  4TWK A;  3K06 A;  1YN8 A;  1OCC B;  2X9H A;  2IJJ A;  4DBF A;  3CCL V;  1QVF A;  2R5M A;  2SRC A;  1SQG A;  3ABT A;  3M0P A;  4PJN A;  1Q95 G;  1GK9 A;  3M55 A;  1Y74 A;  3UCS C;  2YXL A;  5LHI A;  1AVZ C;  2WLI A;  2Z0W A;  1FFX A;  3BFM A;  2RJF A;  4JJN K;  5LGU A;  1UDL A;  3THK A;  4F7U A;  5C0M A;  1S72 Q;  4BAC A;  4RAI A;  1LR1 A;  5BR8 B;  2KEA A;  1VQ6 T;  1FFX B;  1NS1 A;  5KHH A;  2DM1 A;  1CKB A;  1L0N H;  1I08 A;  1WLP B;  2CTW A;  3J81 N;  4M78 A;  1WQW A;  1K7D A;  3QVN A;  1M57 C;  4GKK O;  4J9H A;  2QEX V;  1QQC A;  1YJ9 Q;  3LGF A;  4N21 A;  4X65 O;  2A37 A;  2GFU A;  3V7R A;  3DSQ A;  1VIE A;  4UUJ C;  3OYM A;  1WN7 A;  3OEE G;  4QVZ A;  1KKD A;  5J2U A;  1W1F A;  3UA7 A;  5EYP B;  1AP6 A;  3CEY A;  4P2Z A;  1M1F A;  1TSF A;  1H2M A;  2A0F B;  4PJM A;  5J2U B;  2K79 A;  3RKY A;  3JAM E;  1H2K A;  2JS5 A;  3JCU Z;  2JUF A;  3EGD B;  3CC2 T;  3W7W A;  3JCM P;  3ABU A;  4IUV A;  3OT7 A;  4IKF A;  3VBB A;  1V29 B;  2EIM B;  2PVG B;  1VP7 A;  1Y6X A;  1BI1 A;  1YI2 Q;  1WDX A;  1NR7 A;  3UA6 A;  4AQY B;  4M7D F;  3CPF A;  4FT2 A;  4J7J A;  4DV1 B;  1YJN T;  3TRE A;  1QBZ A;  4B3S B;  3LLR A;  2DEQ A;  4DR4 B;  4M75 A;  3E22 A;  1HNX B;  3SWN A;  2DEU A;  3JCM b;  4J80 A;  3OSS C;  2L35 A;  3AG4 B;  5JVD B;  1SF9 A;  2UXX A;  4TVR A;  3OB9 A;  4OX9 O;  3QWY A;  1I07 A;  4OMN A;  4FFB B;  2DTO A;  3R6N A;  4C7U A;  2X51 A;  2YWW A;  5EIB D;  5HCK A;  3U10 A;  1BT8 A;  2E5L B;  2DWE C;  2CUD A;  3VS6 A;  4MVR A;  4X64 O;  2M0O A;  2NUT B;  4RKU E;  1IHW A;  2YI8 A;  3EFO A;  5EIB C;  1SC5 B;  3MHS C;  3T1Y B;  4HKE A;  4CC5 A;  2CP6 A;  2XAS A;  4Z2W A;  2XK0 A;  3AG3 C;  4HA8 A;  2K3Y A;  1RSO B;  2H8H A;  3WG7 B;  4X20 B;  2E41 A;  1V55 B;  3UT5 A;  4VUB A;  4J9E A;  5LP6 B;  3H1L H;  2QQR A;  3BY7 A;  5FW9 A;  4FLU A;  1VQ9 T;  4F6R A;  1I5O B;  2JN0 A;  3H0F A;  8AT1 B;  2GTO A;  2VVK A;  5CKB A;  4FYV B;  1JJO A;  2DLP A;  1AR5 A;  5GAM f;  1MOF A;  4RTY A;  4IIJ B;  4F6R B;  3W7S A;  2P22 C;  3CSX A;  1JVM A;  3OTF A;  4JZ3 A;  4EMG A;  1VQP Q;  3PIO A;  3U11 A;  3CD6 V;  2F1M A;  2I2L A;  3SHW A;  2QSA A;  3M0T A;  3LH5 A;  1ZTE A;  1IBL O;  3ASO B;  1WXU A;  3JAW A;  3KBG A;  1GTO A;  3RWR D;  4JI6 O;  2F5K A;  1G4Y B;  1PG5 B;  1SRM A;  1N33 B;  3EG9 B;  3EH2 A;  2WWW A;  5A0L A;  1KUQ A;  3A8G B;  3L2W A;  2Y69 B;  2Q0A A;  2QJ1 A;  4WFG A;  4EMH A;  3JCM f;  1FJG O;  1SKU B;  1WNS A;  3QJ6 A;  1BE3 H;  1YCS B;  3MO8 A;  1MMA A;  1N8R C;  1NPR A;  1VQ8 T;  3H0H A;  1M4U A;  3L2V A;  4TUY A;  3QXE B;  2JJ1 G;  2ZCF B;  2V1Q A;  4DV6 O;  3HKC B;  3RYF B;  3OQ5 A;  4BR6 A;  2XAQ A;  1OCO C;  4LCU C;  3ZIA G;  2PY5 A;  1D1C A;  2PVO B;  5LJ5 j;  4TUY B;  3CCM T;  3CCV T;  2QDL A;  1H8H G;  1XNR B;  3SYA A;  1ORQ C;  3G71 V;  5GAN g;  2QTV A;  4OP0 A;  3LNM B;  1M1K W;  2RN8 A;  2CP5 A;  3JYC A;  5C8Y A;  1NQT A;  1Q6I A;  4JV5 O;  1M27 C;  3STZ C;  4Z02 A;  2XID A;  5KYN A;  1XDC A;  3AEI A;  5J39 A;  1V54 B;  1ABQ A;  5CQX A;  2CP3 A;  4LFA O;  3A0B Z;  2R9A A;  1WQ7 A;  3C3T A;  3I5S A;  4IIO A;  5CIU A;  3BVO A;  1IZ3 A;  1DF5 A;  4JLI A;  4NR1 A;  5KHK A;  2H3J A;  2KRS A;  1K73 U;  1YEW A;  1WB8 A;  2UXD O;  2JT4 A;  3RYC A;  3AHU A;  2QR4 A;  3FYI B;  4ZN1 A;  1UGP B;  3JAT A;  4J9Z B;  3LDE A;  2L2P A;  4N4G A;  1RAG B;  2CH4 A;  1WJR A;  4WF2 A;  1BCM A;  2RQT A;  4MMK A;  4EMK A;  3RYH B;  5GTI Z;  2RHZ A;  4LDY A;  4D8K A;  1VF7 A;  2L3P A;  3HRU A;  1BZK A;  4JZ2 A;  1UPG A;  2OTL Q;  4EMK B;  2UXC B;  3CC7 A;  3H9N A;  2WAC A;  2MF2 A;  4ZGD B;  1DK1 A;  3MJX A;  1SRY A;  2KK4 A;  3OR7 C;  1D0Z A;  3NPF A;  3UF4 A;  1SET A;  2LNH B;  3G4S Q;  1KHI A;  3CPW S;  4JS4 A;  3S3N A;  1LUW A;  3CCE V;  4EKW A;  5GTH Z;  3CCU V;  1GN2 A;  2DBK A;  3V8L A;  4JI7 B;  3L2R A;  5GON A;  4PA6 A;  2G38 A;  2CZ7 B;  3GVM A;  1YCI A;  5HFL A;  1VQN V;  1YBY A;  2LZ6 B;  4HNA A;  1MZF A;  1QVG P;  3A2F A;  3SYQ A;  4UCT A;  4KUI A;  5KHG A;  1TAE A;  4LNP A;  1RLQ C;  1S72 A;  5LGT A;  5LA6 A;  3AT1 B;  3RES A;  4B3R B;  4X1Y A;  3VUZ A;  5DM7 R;  3U23 A;  3MCA B;  1W70 A;  4NKG B;  2GBO A;  2RQW A;  4L5G A;  3OY9 A;  1MUZ A;  4DR2 B;  2JVD A;  4X1Y B;  3CRA A;  2P0K A;  3K0D A;  2ZZD A;  2FYU H;  1BL8 A;  1YJ9 A;  2L6L A;  4JI2 B;  2JTM A;  4M78 G;  1Y96 A;  3HRT A;  3IC9 A;  5LOV A;  2LCC A;  1KB9 F;  9ATC B;  3JCM e;  3QYH B;  3SJB C;  2RJD A;  1SKV A;  3ZRW B;  4I9Q A;  4BW9 A;  2L0A A;  3H41 A;  3HKB B;  4OMF B;  2UUB O;  2WLK A;  1VQM T;  2DER A;  5LJ3 j;  3BPZ A;  1TS9 A;  3V8J A;  4FPP A;  1TG0 A;  2VUB A;  3DLL A;  3SYC A;  1J5E O;  2DBM A;  1L0L H;  2BTT A;  1AD5 A;  3VKI A;  1QVF P;  4PFO A;  1NT2 B;  1NTZ H;  5HKC A;  1AIL A;  2BCC H;  2P4V A;  2HVJ C;  4IGG A;  4CS3 A;  4AFQ C;  1YI2 A;  3JB9 J;  5KYX A;  2CSI A;  1S5L Z;  4O4I A;  4LF7 B;  4H37 A;  1ABO A;  4DR6 O;  1ZA2 B;  1J95 A;  2GDS A;  2W6I G;  1VF6 C;  2AHJ B;  5CA0 B;  1I7F A;  3U0Z A;  1ZSP A;  2QXF A;  2ZPH B;  1HWY A;  5IJ9 A;  3ZEH A;  2MPX C;  3SEM A;  1JQ0 A;  1SQX H;  4ELY C;  3ZED A;  2ADQ B;  3FFQ A;  4YHH B;  3CCS A;  1WJS A;  4DA4 A;  1NJI U;  3VS7 A;  1IDS A;  2Q4P A;  1O9G A;  2CZ0 B;  5JWP A;  2OT5 A;  2ZE6 A;  2L89 A;  5KA5 A;  5FU6 B;  4JI1 B;  2ENM A;  1ZUQ A;  3GPL A;  4D8D A;  2MW2 B;  3N2K B;  2QWQ B;  4JGS A;  4JI0 B;  1LVK A;  2D3O W;  4G28 B;  1URF A;  3OUS A;  1WHH A;  3REA B;  3OW2 S;  4GZR B;  3C95 A;  4PJJ A;  2Y0I A;  3UPU A;  3OYE A;  4F4L A;  2A08 A;  3JB9 G;  1C6V X;  4PJO A;  4RTU A;  5LXT A;  3HPW A;  3JB9 H;  1QCN A;  3E9G A;  1N36 B;  1HYO A;  4O5V A;  4JTD B;  1VQ7 T;  2PZS A;  1AZG B;  5GAN j;  4M7D G;  2Q73 A;  2IJH A;  3FB5 C;  1LUV A;  2HSE B;  2ILM A;  1K9A A;  3CC2 Q;  4UCV A;  3X20 B;  3O5Z A;  1Y4M A;  5KYU A;  4DXW A;  4BE1 A;  3RYI B;  1SEM A;  3H1J H;  3M8A A;  1M3B A;  2XIC A;  2OCC B;  3GNF B;  4XU2 A;  3L71 H;  4W4L A;  1YJN Q;  1GN6 A;  3BE3 A;  2XAF A;  3GB7 C;  4A63 B;  2DJQ A;  1VQP A;  2D8J A;  1K0X A;  2EIN B;  4DV5 B;  1LCK A;  4LWS A;  2YDE A;  4HXJ A;  2EGA A;  2N74 A;  5A2Q N;  3HPL C;  1X6G A;  4GX5 A;  1S5J A;  2AXT Z;  3QZ5 B;  4PKC C;  1NH2 B;  3QBY A;  2BIV A;  1OI1 A;  4N0A A;  3JCM J;  4ZIB A;  3O65 A;  3Q4H A;  2Y4X A;  3MPU B;  1XOV A;  4M7D E;  1QLE C;  2CZ6 B;  1NZ9 A;  1THZ A;  3UDC A;  1ZAU A;  2MIO A;  3FLG A;  3P8B B;  1KFZ A;  4AMC A;  2YEV B;  4X9D A;  5BMV B;  5F2V O;  1X01 A;  4JAA A;  5EZY B;  1RUW A;  2XG8 D;  1JU5 C;  3A8T A;  3QO5 A;  2DRK A;  3ZBH A;  1M2V A;  4M78 F;  1QW1 A;  3O9O A;  2V1D A;  4EEQ A;  5CBH A;  4A5U B;  5IT9 N;  4ABM A;  1EX4 A;  5FLX N;  4DV7 B;  3I56 T;  4FCY A;  2D6F A;  1QU7 A;  1M2V B;  2JVV A;  1VQ9 Q;  2A3Q A;  2MYS A;  1F4N A;  1VF5 B;  4OPH A;  2DOS A;  3HR0 A;  3JD4 A;  1IBK B;  5GMK i;  1NVP B;  1Y71 A;  5IJ0 A;  2UUC O;  4PFZ A;  3WB2 A;  4PDL A;  1YF2 A;  5B5E Z;  4IUU A;  4JI5 B;  4EB6 A;  1OX8 A;  1N9S A;  4Q5W A;  3CBP A;  3E8F A;  1OU9 A;  2RJE A;  1SQV H;  2EW3 A;  4TOI A;  3E19 A;  3KCY A;  4QJF B;  1FXX A;  1Q43 A;  1RAB B;  4M7D B;  1VQ8 Q;  3PTA A;  4M75 F;  2OTL A;  1B04 A;  2Y48 A;  4UB6 Z;  3OTO B;  2KXC A;  1N34 B;  3J81 E;  1K73 C;  1NTM H;  3AG1 B;  4N4I A;  2K6D A;  4DBQ A;  5KYY B;  2QA4 T;  5J9P C;  1UJW B;  3CCV Q;  1WNL A;  3CCM Q;  2DIL A;  3RN4 A;  3G4S A;  2ZPB B;  3L9D A;  4HAM A;  1RI9 A;  3MHX A;  2O57 A;  2EYY A;  2LX7 A;  2AGA A;  1YCY A;  1D3B A;  1H2S B;  2P0Q A;  2YIB D;  2PYL A;  2VGM A;  1OQK A;  2DIG A;  1BI3 A;  4LE9 A;  2R72 A;  4C92 D;  3H1H H;  3OYG A;  2A28 A;  1MSD A;  2CTQ A;  1D3B B;  2FYK A;  2XOK G;  1ZA1 B;  5CO7 A;  2HEQ A;  4JAU A;  1XHZ A;  1KK7 A;  2RQV A;  3REB B;  4A4G A;  4C92 C;  2VGN A;  1OCC C;  3CBO A;  4HT9 A;  4AQY O;  2YC0 A;  4J6X A;  3AK1 A;  2DL5 A;  3A1P A;  1XL6 A;  4O4J B;  2WA3 A;  5ITZ A;  4DR4 O;  1KD1 W;  2CTP A;  1HD3 A;  5L8R E;  2OWO A;  4FM0 A;  2FPD A;  4X1I A;  1JJ2 A;  3EG1 A;  4KH0 B;  4E7H A;  4RO2 A;  3ICX A;  2AZ2 A;  2RI5 A;  3J7A U;  4X9Q A;  4Q6G A;  1V1C A;  4DRX A;  1TWB A;  1Y07 A;  4FSS A;  2M7W A;  3R6O A;  5AYF A;  5CKD A;  5D6Y A;  2YS8 A;  5JCO A;  5CA1 A;  2ZIM A;  3EH1 A;  1PSF A;  1YWO A;  1YJW V;  3CC7 V;  3M5A A;  1Y57 A;  4I4T A;  1TVK B;  3TVT A;  2KG7 A;  2ZIO A;  3CX5 F;  1XMO B;  2P90 A;  3K04 A;  3T1Y O;  3CP1 A;  3HKE A;  2UUA B;  5FU7 B;  1X2K A;  4F14 A;  3OYH A;  3CCJ T;  2HHH B;  2Q0O C;  3JAL B;  4LD9 K;  1JFF A;  3SYP A;  3HKE B;  1TA8 A;  3LH0 A;  4X1V A;  3CCR V;  3D3I A;  4LFC B;  5GMK m;  3FJ5 A;  2WLL B;  3GNG A;  4LNU A;  4CI0 C;  4J10 A;  2YUA A;  4RQE A;  4HYO A;  2K2M A;  1VQ6 A;  3JCM g;  2XTA A;  4DW0 A;  1XL4 A;  5J2T A;  1SA0 B;  2B9Z A;  1N32 B;  1RAA B;  2E3H A;  4O4L B;  2G6F X;  2QM8 A;  5EK0 A;  4LP8 A;  2F4V O;  2GUZ A;  3JAK A;  4PHZ A;  5EC2 C;  1VAR A;  4XAX B;  1BB9 A;  2HZY A;  1VQ5 T;  3FEO A;  4DYL A;  5JJN B;  1NZ6 A;  4UVA A;  4M7A A;  3IAY A;  1N33 O;  1KBH A;  1KYO F;  3AG4 C;  1K8A C;  1BCC H;  2HR3 A;  5EC1 C;  1XNQ B;  2EQK A;  2VC8 A;  4LF9 O;  2E10 A;  1MG1 A;  5AG2 A;  4FLW A;  1U96 A;  3DC6 A;  2LP5 A;  3JAR A;  1QMC A;  1Q7Y U;  5LHH A;  1NJI C;  4AI8 A;  1VQM Q;  2RD1 A;  1GAX A;  2YSU B;  4ZN3 A;  3S3M A;  3CC2 A;  1H8K A;  2E74 B;  2ESW A;  2JNG A;  3A0R A;  5GMK h;  1Q5O A;  2PTM A;  1YI2 V;  1NLP C;  1E1R G;  5GAO n;  1G8X A;  2J06 A;  3ABK B;  1XNR O;  4HT8 A;  4H13 B;  3KZI Z;  4DUZ O;  1HK9 A;  3WG7 C;  5LBQ A;  1V55 C;  3ZL7 C;  4FK5 C;  4WF9 V;  2GGR A;  5LP6 C;  2KRM A;  1M5Q 1;  1FFT B;  2IU0 A;  1W2B U;  2CYZ B;  2CDT A;  1N0J A;  5FRM A;  1FYJ A;  1NYG A;  3CCS V;  1SES A;  5L3C A;  4CC2 A;  1IGU A;  3CS5 A;  4DO2 A;  1PC0 A;  3JD0 A;  4AG1 C;  4RTW A;  1K8A R;  2CGH A;  2KY9 A;  2XAH A;  1B06 A;  1I4K 1;  1PP9 H;  3G80 A;  4JI8 O;  4QKU A;  3VS2 A;  1ZL8 B;  3JAS B;  1JBM A;  1KQS A;  1OHH G;  2LGQ A;  1NJI R;  2QM4 A;  1YHQ V;  2F23 A;  3ASO C;  3JSN A;  2AKL A;  2JZ2 A;  4KRT A;  3LNN A;  1Q3E A;  1H3Z A;  5LL6 Y;  1KC8 W;  3ABM B;  1YIT V;  1US6 A;  3RR6 A;  3X24 B;  2Y69 C;  3F7Y C;  1VQ7 Q;  2QDO A;  4BB7 A;  4B9W A;  1XEQ A;  3HTR A;  3ZHR A;  4HVW A;  1G8M A;  3JD1 A;  4EFB A;  4AFS C;  3I55 T;  2UXC O;  3DXR A;  1VQK T;  1SZT A;  2QE7 G;  4R50 A;  1VYU A;  4MSW C;  1VQ9 A;  1H2N A;  4UCU A;  3VQY A;  2E64 A;  2UXN A;  1QWE A;  1OZ0 A;  3K9A A;  1XUQ A;  2BOB C;  3ETD A;  1KHC A;  2A3L A;  3FJP A;  2CH7 B;  2RN9 A;  4JI7 O;  4TV8 B;  1VQP V;  1E6G A;  1G3T A;  2VV5 A;  4ZKI A;  2V8K A;  3ME9 A;  2GTJ A;  1EZZ B;  3S3X A;  4B3T B;  1GRJ A;  4WTO B;  1W2B P;  2OTJ V;  1MZE A;  4RWU A;  2CP7 A;  2B1I A;  1CPY A;  2D8H A;  1VEW A;  4F7U G;  3TU4 K;  4I0X A;  2QAZ A;  5KE3 A;  1V54 C;  3B77 A;  1GKF A;  3VOU A;  5A0D A;  4B3R O;  1QCF A;  4U7O A;  2ZT9 B;  1UJY A;  3PNW C;  3D36 C;  1TUE B;  2DF6 A;  2AHZ A;  2HP8 A;  2KMT A;  4I0X B;  3QJY A;  1AOJ A;  1HSQ A;  4XTX A;  1TXQ A;  2LX9 A;  4DR2 O;  2YXY A;  3CCQ T;  4B6M A;  1VQ8 A;  1YFN A;  2FTK A;  1GRI A;  4JI2 O;  3CC4 V;  2R9I A;  2QQS A;  3J80 N;  1XQH A;  4IUR A;  2EX3 A;  3G6B A;  2AIR B;  2LNV A;  3MEW A;  3CCM A;  4DR7 O;  2M16 A;  1M56 B;  2Q7H A;  4IIM A;  5LMN O;  2DL4 A;  2A79 B;  1GBR A;  4DEX A;  3I56 Q;  4FYY B;  3LDD A;  4CH3 A;  4DK0 A;  5CB4 B;  1UGQ B;  2RH2 A;  4EMK C;  3GBQ A;  3WU2 Z;  5C6S A;  4PJO F;  4YIP A;  1ZWI C;  4RCC A;  3CCL T;  4FM2 A;  2BKD N;  3URG A;  3M4Y A;  4BD3 A;  2YSQ A;  1Q82 U;  2PZ1 A;  3INZ A;  2E70 A;  2MMP A;  1ZUK A;  4FL6 A;  1H92 A;  2E75 B;  3OBW A;  4YJ3 B;  4LF7 O;  2EKH A;  1SPK A;  3ASN B;  4M75 G;  1XHX A;  3D3Q A;  5H6Q A;  1JJ2 U;  3IFX A;  1TUD A;  1N5Z A;  3ZJZ A;  4L8J A;  2LTO A;  3D8C A;  2AHY A;  2P67 A;  4DR3 O;  2P0P A;  2RNA A;  3QF7 A;  2Q6A A;  1SQB H;  4JI1 O;  5I2M A;  4OMQ A;  4JI0 O;  1VQO T;  3K0G A;  3K3W A;  5FL7 G;  4FYX B;  3NTI A;  2WLM A;  4FLX A;  1TUG B;  2GQV A;  2W0Z A;  2QA4 Q;  1DTO A;  3G4S V;  2K7A A;  4WBN A;  4CH4 A;  1GCQ A;  2EZO A;  2CS7 A;  3L75 H;  1N36 O;  4CC3 A;  4JRI A;  2EGC A;  3MEV A;  5GMK l;  2Q68 A;  3TK1 A;  1BBZ A;  1M5I A;  1Y7X A;  4FW1 A;  3M54 A;  1Y74 B;  1OCZ B;  2BTQ A;  2DYS B;  2VQE B;  1O75 A;  2DD4 A;  2WLI B;  3PMT A;  4M75 E;  1K4D C;  4ICG A;  3EGX A;  3V7S A;  3SD4 A;  4F7U B;  1K92 A;  2ROT A;  4K3A A;  5CR2 A;  4UCR A;  1PKX A;  1QVG S;  1WYX A;  4X62 O;  4Z88 A;  4M77 A;  3EGX B;  5IHK A;  4NB5 A;  2E5K A;  2Q7G A;  3LSU A;  2YDL A;  3H6Z A;  3ETG A;  4M78 B;  1MA1 A;  1T3L A;  3F5W C;  2FEI A;  2V4D A;  4DV5 O;  2KT8 A;  2DW4 A;  3SYO A;  5JJJ B;  3OMC A;  1JJ2 P;  2F43 G;  3MET A;  2EBO A;  3FDR A;  3VS4 A;  2ZPI B;  1AHJ B;  2VRZ A;  5A2Q E;  5GAN 2;  2QKC A;  2DFU A;  3JCM V;  4IUP A;  2PUO B;  3OAA G;  2LP7 A;  2R57 A;  2JDI G;  4DV4 B;  3LW5 E;  3QG1 A;  3MAQ A;  3HRS A;  5FU6 C;  4JS5 A;  3OYF A;  1VQM A;  1K4C C;  1EIF A;  2EVR A;  2VWK A;  4B3M B;  3CCJ Q;  1IXM A;  2X35 A;  3OYN A;  1BHB A;  2M02 A;  5CMU A;  1PRM C;  2QQA A;  2PU9 B;  2RK1 A;  1M90 U;  3FB8 C;  4NVP A;  4DV7 O;  1RP3 B;  4J7I A;  3TJT A;  1UHC A;  3VS1 A;  5IT9 E;  4M75 B;  3E22 B;  1C1A A;  5EG2 A;  3SWN B;  4O2B A;  3R66 A;  5FLX E;  1Q7Y C;  4ORZ A;  4O6J A;  1FWZ A;  1Q81 U;  4G2K A;  4Z1V A;  2UXB B;  1M8V A;  3E8H A;  1HW7 A;  1O9H A;  3FX7 A;  3ETQ A;  1CXZ B;  2OCC C;  4PA3 A;  5E1A C;  1CSK A;  2M9U A;  1IBM O;  3CD6 T;  4ZTJ A;  2XDP A;  2VQF B;  4KBM B;  2O9S A;  2LGW A;  3OMA B;  1NH2 D;  4NXM B;  2EIN C;  2E4H A;  3QTC A;  2C0O A;  2X4W A;  2EBP A;  2HCK A;  4FSX A;  2DO3 A;  5KYW A;  1H2G A;  3EFO B;  1ZBX A;  4R8C A;  3UT1 A;  1WXB A;  1KQ1 A;  1AVM A;  2VWJ A;  4HVU A;  5KMG A;  2GBQ A;  1YZB A;  1FD9 A;  4TQF A;  2EIK B;  3PJS K;  1N8R W;  3M58 A;  2QKS A;  1WHJ A;  1P49 A;  3E83 A;  4FYW B;  3CB2 A;  1G3S A;  3T4Z A;  2EQM A;  3UT5 B;  4QVD A;  1N34 O;  1MMM A;  4FLY A;  3D7S B;  1I81 A;  1L1F A;  2KAF A;  1K0S A;  2DK3 A;  4BE2 A;  1Q7Y R;  3BAA A;  2ITC C;  2IW5 A;  3E1S A;  4C8Q E;  1VQ4 V;  2XAJ A;  1U97 A;  2LW1 A;  4XU0 A;  2YHT A;  3G71 T;  5IXF A;  4JJD A;  2QQ9 A;  1SG5 A;  3IC7 A;  1B34 A;  2ZPG B;  1QNM A;  1WAZ A;  1PWT A;  2C2A A;  4YIO A;  1Q8I A;  4CZZ A;  5LJ5 d;  2CGO A;  5D6X A;  3TET A;  1BI0 A;  1NVP D;  3JAW B;  3MP1 A;  4F04 B;  1M3C A;  2NNU A;  3ML0 A;  1KMI Z;  2XHC A;  1W0J G;  4OVA A;  4XTU A;  5IHI A;  1FXK A;  4FLV A;  2FB5 A;  5CN0 A;  2JK5 C;  4QNH B;  5D6W A;  1SRL A;  2QGG A;  1NE8 A;  3OGC C;  3FB9 A;  2EFI A;  4E2L A;  1KQS P;  1FXK B;  5FRN A;  1GN3 A;  3QZ9 B;  1HP8 A;  4L59 A;  3JB9 D;  3QO7 A;  4LF6 B;  5CKE A;  1DGS A;  1W6X A;  4FW2 A;  4ZNX A;  2H8P C;  3G6E T;  3CQT A;  4M7D D;  3T9N A;  1WGS A;  1BSM A;  1Q6U A;  2RQR A;  4YY3 B;  3QII A;  3FD9 A;  2E6Z A;  5JQG A;  3I55 Q;  4DOV A;  2RHY A;  1QVG U;  1XMQ B;  3CPW A;  2UU9 B;  4M7D C;  2E3C A;  4H33 A;  2RB6 A;  3I56 A;  1VQK Q;  3NTK A;  5C8Y B;  1XI1 A;  3G1J A;  3UWN A;  2JM8 A;  4C8Q A;  1MMG A;  3SDZ A;  4ZTF A;  4M7A F;  1K3E A;  3AG1 C;  1NU1 H;  3DC5 A;  2KNB B;  3DB4 A;  1F23 A;  3CCU T;  3JRZ A;  4PEL A;  2HHH O;  2G3R A;  1T5E A;  4LXC A;  3UO2 A;  1VQN T;  2VB6 A;  2ZXW B;  3BRC A;  4JI3 O;  4KL1 A;  1U1S A;  2P6J A;  4J83 A;  1AWO A;  3RYC B;  1HNW B;  2DTI A;  3EHB B;  4LFC O;  1G3W A;  3JAT B;  3FKS G;  1IGQ A;  2BUD A;  4Z89 A;  1KU9 A;  2O9V A;  1RAF B;  5IYZ A;  1E1Q G;  2A36 A;  2HQH A;  3QG5 A;  3MEA A;  2RI2 A;  1N32 O;  2AZS A;  1JX9 A;  4J7K A;  4ZOL A;  2EJ7 A;  4JRQ A;  1B6Q A;  1VQ8 V;  1KG1 A;  3CCQ Q;  4GX0 A;  3RFR A;  2EAY A;  3A8H B;  1Q82 C;  3A8M B;  4J6Y A;  1PD3 A;  2MCN A;  2E1H A;  3ZFJ A;  3FB6 C;  1QVF U;  3NXS A;  3RMS A;  4X66 B;  2QA4 A;  1UTI A;  3OS5 A;  1EFR G;  2EYZ A;  2EIL B;  3S3W A;  1OV3 A;  1YIJ V;  2FRW A;  1XNQ O;  3L2Z A;  4C5I A;  4J9G A;  4KT0 E;  2XUM A;  4ELZ C;  5GON B;  3V7C A;  1SS3 A;  4PDM A;  3OYC A;  3VQW A;  1ROP A;  1BHA A;  3P30 A;  2J6O A;  3ZRV A;  4XU1 A;  2RCV A;  4HNA B;  4N4H A;  2DVE A;  1OV9 A;  1PPJ H;  2IH1 C;  3CXC A;  2KQX A;  3CCL Q;  1VIB A;  3OEH G;  1S1N A;  2DN9 A;  1FAF A;  4PFP A;  5LA6 B;  3CRC A;  5FU7 C;  4E4E A;  1IUR A;  3CEI A;  5LJ3 d;  3W7U A;  3CME V;  2E5Q A;  3VYH B;  1FS0 G;  1E7O A;  1PNL A;  5M9O A;  1NEG A;  4PNO A;  2F1L A;  4BDY A;  1M9N A;  2JOY A;  3M0R A;  1BQ0 A;  5HFM A;  4UCS A;  1Q82 R;  3PMI A;  2A06 H;  2QGF B;  4PJO E;  1FMK A;  1Y96 B;  2JTF A;  2LJ0 A;  2DXT A;  4RG2 A;  1KKC A;  5LOV B;  2K1E A;  1I5Y A;  2RHI A;  1VQO Q;  1S5H C;  4G27 B;  4OB2 B;  3EFR A;  3G67 A;  1ZQ1 A;  4P5N A;  2HD0 A;  4GY5 A;  3QO8 A;  2XMF A;  2IM9 A;  1TOV A;  1ZBJ A;  4YTL A;  2ZE8 A;  2HJD A;  3KG2 A;  1BGY H;  1MAB G;  3EFF K;  1FKA O;  3T1C A;  4J42 A;  2L8D A;  3QWX X;  3CCJ A;  2LFR A;  2K4Y A;  2D1X A;  2BOC C;  1QKX A;  5KYX B;  1Q86 C;  3UKM A;  4A4E A;  3CMA T;  3N2G A;  4I9W A;  4D6T H;  2LJ1 A;  5LJ5 h;  4O4I B;  4GT1 A;  2IJK A;  1D0Y A;  2ED1 A;  4IHJ A;  1NTK H;  3N2G B;  2CK3 G;  2GSM B;  5IJ9 B;  5A0G A;  4FLZ A;  4OML A;  3KXT A;  1G1X B;  2X4X A;  2KVQ G;  5EBM C;  3HKD A;  3ABK C;  2RO0 A;  4BAY A;  2FZK B;  4JTA B;  3OYD A;  4N23 A;  4B3T O;  4FFK A;  1HXD A;  1R6K A;  5IHN A;  2YT6 A;  1M90 C;  2EUL A;  5LYJ A;  4LF4 B;  1S77 D;  2PQW A;  4U3J A;  2K57 A;  4PJO B;  3MEU A;  4ESR A;  5LXT B;  1MNE A;  3ZMZ A;  3EG3 A;  1IZ6 A;  4FZ1 A;  4QVC A;  3K08 A;  3LUT B;  5LYJ B;  4JLG A;  4LF5 B;  3RBB B;  1N4C A;  2HBP A;  1Q81 C;  2WLH A;  2LO1 A;  2PI5 A;  3VS0 A;  3I5D A;  4GLX A;  1N8R U;  3M59 A;  2F66 C;  5KYU B;  4D7T A;  3MKD A;  2JEX A;  3SJC C;  3GWK C;  2JMA A;  3ABM C;  2QQB A;  2EJ9 A;  3TSW A;  4HCB A;  5TIS Z;  1WHM A;  2C0I A;  6AT1 B;  2CKK A;  3J80 E;  2FZC B;  1K9M C;  3A5Z B;  1X2Q A;  1XQ8 A;  2LT4 A;  5IYD O;  4QT7 A;  4LWS B;  2D0Q B;  5FWC A;  4MVS A;  3K5N A;  3QYG B;  1M90 R;  3RNJ A;  1IO6 A;  4KUM A;  1F1B B;  3HHT B;  4GKK B;  3T2M A;  3WFV A;  1Q86 U;  1ENV A;  3CD6 Q;  5HY6 A;  2Y4T A;  4X65 B;  3Q4H B;  3RKW A;  2X4Y A;  4YJ2 A;  1Q81 R;  2FVU A;  3OYA A;  2MK5 A;  4O4H A;  1BU1 A;  4P9O A;  4DW1 A;  3DB3 A;  5B1O A;  1AI5 A;  3PVL A;  3TEE A;  4LDX A;  1NI8 A;  2O4X A;  1RM1 B;  1SSF A;  1EZV H;  4XDK A;  4HCC A;  4M77 F;  2XDB A;  3H01 A;  4TT3 G;  2R58 A;  3EG2 A;  4IUQ A;  3T1H O;  2O4X B;  3ZHQ A;  1K73 W;  3L1A A;  4LN2 A;  1T3S A;  1Y76 A;  3C90 A;  1VQK A;  3ZMT A;  2EQU A;  1SHF A;  5IN1 A;  4B7K A;  1WPY A;  4FU6 A;  2K9P A;  4Y91 A;  2EJG A;  1L8D A;  1Y76 B;  4PA9 A;  4RTX A;  4OXS A;  1GCP A;  3G71 Q;  2BTO A;  3CHX A;  3BCC H;  5LJ3 h;  3VV0 A;  4ATO A;  5IJ0 B;  1M56 C;  5KX5 A;  2EIF A;  2KSS A;  4II1 A;  2O31 A;  4X88 A;  1KC8 U;  5DED A;  1YTF B;  1NG2 A;  1LJO A;  5BR8 O;  2CSQ A;  4JI4 B;  4OX9 B;  4EB6 B;  4GYC B;  4TQD A;  1GBQ A;  2KB1 A;  3CBM A;  1W2B S;  2XI9 A;  3QDF A;  1RFY A;  5JH7 A;  4MZM A;  2AZV A;  2KT1 A;  4Z8A A;  2GF7 A;  2N05 A;  2IG0 A;  1A0N B;  1GM9 A;  1D2D A;  5IH2 A;  1W0K G;  3T4D A;  1F7Y A;  2EKO A;  1R3L C;  1I1J A;  1QR8 A;  3E86 A;  4PA7 A;  4HCZ A;  2VXF A;  3CCQ A;  3ASN C;  1X75 C;  3X25 B;  4U7N A;  3TGU H;  4M7A G;  3G6E Q;  2DVJ A;  1WA8 A;  2A0L A;  4E7I A;  1R6N A;  5H5N A;  3LX7 A;  3NTH A;  4MTG A;  4JF3 A;  3H1I H;  3BFR A;  2K3X A;  4AIL C;  1YJW T;  4X8A A;  1H64 1;  1QVP A;  3CPW P;  3RER A;  1A32 A;  1ZSZ A;  2BZ8 A;  1OX9 A;  4JRP A;  4DV4 O;  1EN6 A;  4I55 A;  2QWP B;  3FC3 A;  5KUK A;  3OMN B;  3PVQ A;  1ZSZ B;  1B3Q A;  5GAN h;  2ZD9 A;  4XDJ A;  2MWP A;  4GKJ B;  3CCU Q;  2JIZ G;  5L3B A;  4B3M O;  1SQQ H;  4DV1 O;  2CT4 A;  2L3Q A;  3CCL A;  3BA9 A;  4B3S O;  1WJZ A;  1VQN Q;  3HB3 B;  1ZLZ A;  1HNX O;  1BIA A;  2H3E B;  1AI4 A;  1KSW A;  3CCR T;  5CA3 A;  4JI6 B;  2JJ2 G;  2P7T C;  2RHX A;  2E6N A;  1DLB A;  2DYS C;  1OCZ C;  2N04 A;  2P06 A;  1AWX A;  5L3G A;  4JYC A;  2DYR B;  4CS2 A;  5ITZ B;  2B86 A;  3HKS A;  4OB0 B;  1G5V A;  3M57 A;  1FX7 A;  4C0D B;  2JGD A;  2FZG B;  4X1I B;  1K9M W;  4M7A E;  4M78 D;  4UFZ A;  1FJG B;  2OAW A;  5L3F A;  2UXB O;  4DRX B;  1P7B A;  1AWJ A;  1GFC A;  1TUB A;  2E5L O;  5KCO A;  2WLJ A;  5CA1 B;  5A9G A;  4BI8 B;  2IPO B;  4M78 C;  4J6W A;  2CDY A;  4JYB A;  1JQQ A;  4I4T B;  1VQO A;  4NXM O;  2Z0A A;  4MVZ A;  1MV0 B;  1MV3 A;  4DUY B;  4ZBM A;  3ZMS A;  1AJP A;  1K8A W;  2YUN A;  4I5S A;  3VS5 A;  2KG7 B;  1H2L A;  4V2S A;  2YIC A;  2QTX A;  1PKS A;  5GAN 8;  4J41 A;  4HZ3 A;  2ZCE A;  3SR2 C;  1NJI W;  4JAV A;  1P7G A;  4ZHQ A;  2J6F A;  1JFF B;  4JV5 B;  1S72 V;  3WVD B;  4RUG A;  1X6O A;  1Y66 A;  2JW4 A;  2YUQ A;  2Q9L A;  1AB3 A;  1FMW A;  3CXC P;  4AHC A;  1TGO A;  5C93 A;  1C0M A;  2LFS A;  1OPL A;  3FAV A;  2Y0P A;  2FO0 A;  2HKQ B;  1YI2 T;  4LNU B;  2PTK A;  4OGE A;  1WP7 A;  2DQ3 A;  2UXD B;  5FWB A;  1YJ9 V;  5I22 A;  2ZE7 A;  2ABL A;  5J2T B;  1TH7 A;  4M75 D;  3K5L A;  5BZB A;  1CKA A;  2ZM6 B;  2Z5U A;  5CKH A;  2QKA A;  1B07 A;  3HL8 A;  2DXC A;  5BXZ A;  1FPO A;  2GUZ B;  3JAK B;  4RUF A;  4LBE C;  1M4Z A;  2D9T A;  4C8Q F;  3CCS T;  2HDA A;  2X3W D;  5K1P A;  4JPB W;  2HSP A;  2HMA A;  4M75 C;  5ECA A;  3SWN C;  2XD0 A;  3EG0 A;  4M7A B;  5GAO r;  2LW7 A;  5H2F Z;  1JJ2 S;  1OUL A;  3A98 A;  2EQJ A;  5GJV B;  3OMG A;  3MHH C;  4JTC B;  2DTH A;  1S3J A;  1MSW D;  4J7F A;  3JAR B;  2DAQ A;  2QDY B;  4Y92 A;  4F17 A;  4E7J A;  2F2X A;  2HQE A;  3BA8 A;  1YHQ T;  2M6Y A;  4LF6 O;  1YDX A;  4K8X A;  5FNV A;  1YIT T;  5GAN 3;  1VF6 A;  5CQY A;  4BY6 B;  4C5G A;  2XND G;  3WB0 A;  2LVM A;  4A4K A;  2NYS A;  4BI3 A;  1VQL T;  2KQW A;  4UB8 Z;  1YJN A;  1QR9 A;  2CZ1 B;  3SB2 A;  2ECZ A;  2YUP A;  2EIK C;  2L3R A;  3ER0 A;  4MVM A;  3CMA Q;  1S76 D;  2UU9 O;  2HKN A;  4R56 A;  4WFA V;  4C5E A;  2GNC A;  4PK4 A;  4PI0 A;  2CTR A;  3OE7 G;  4OMO A;  1JCH A;  1KD1 R;  4R7C A;  2V26 A;  4UVC A;  2DKG A;  5CK9 A;  5GAN 5;  1UUE A;  2LT1 A;  3B40 A;  3ULR B;  3KCX A;  1DJ7 B;  2EJF A;  3GIB A;  2FHD A;  1UGS B;  3CD6 A;  4RCB A;  3SJA C;  4Z1M G;  1WZO A;  4JJB A;  1UHF A;  2OTJ T;  1HNW O;  2FPF A;  2EZP A;  4J11 A;  2E12 A;  1MND A;  4GCZ A;  2YRV A;  5KCH A;  4EIK A;  3P8H A;  4OMP A;  2HEP A;  1QLN A;  4ZI7 A;  4H0L B;  4LFB B;  4A54 A;  4MTF A;  4B7E A;  3K03 A;  2EGE A;  3JB9 I;  2HL5 C;  3ZBD A;  4K0K B;  1F4M A;  2WSE E;  3MP6 A;  5CAI A;  1FXK C;  1TUC A;  5EBW C;  5KUM A;  3HFO A;  1J5E B;  1K5S A;  1P84 F;  3DXR B;  1K33 A;  3R65 A;  4MVU A;  1KP3 A;  1BKB A;  3A8L B;  3CC4 T;  2JS3 A;  1QCE A;  4X66 O;  2EYW A;  4NL2 A;  1IRX A;  3E8B A;  3AG7 A;  1F51 A;  2V7Q G;  3C3S A;  1UFF A;  3GF5 A;  3CWB H;  3PFS A;  4C0G A;  1VUB A;  4XK8 E;  1Z5W A;  2WPD G;  3G71 A;  5HK3 A; 
#chains in the Genus database with same CATH homology
 1SF9 A;  2YXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...