2YXYA

Crystarl structure of hypothetical conserved protein, gk0453
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
EQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYMLNPADFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISLLRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein, GK0453
publication title Structure of the hypothetical DUF1811-family protein GK0453 from Geobacillus kaustophilus HTA426
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08838 DUF1811 Protein of unknown function (DUF1811)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.880 Mainly Alpha Orthogonal Bundle Helix Hairpins Hypothetical protein YfhH domain 2yxyA01
2.30.30.340 Mainly Beta Roll SH3 type barrels. Hypothetical protein YfhH like domains 2yxyA02
1SF9A 2YXYA
chains in the Genus database with same CATH superfamily
2KYBA 1S0VA 2FB5A 1SF9A 3CCLT 1YITA 4TSFG 5LJ3j 2FRWA 2EILC 2IJJA 4JAUA 1JJOA 1K4DC 2VRZA 5HK3A 3W7UA 1HNZO 1YJWV 1U06A 2DMXA 2M02A 2XUMA 2RK2A 3GF5A 1MG1A 3JCMh 1WNLA 4Z8AA 5JJJB 1X43A 3QZ9B 2VWFA 3JCMg 4A53A 1WGSA 4XQ3A 1W0KG 3LGFA 2DXUA 2QQ9A 2YC0A 3UF4A 2OCHA 4DR6B 4DW0A 1L0NH 4DV2O 3ZJZA 1JBMA 2Y69B 1L1FA 1V76A 5KYNA 3G4SQ 4DV0B 3NMZC 2JNGA 2ECZA 3AG2C 4LFBO 1VQNT 3KUFA 2JM9A 3H0HA 1M3AA 4U3JA 4RTUA 2JDIG 2EGCA 1ZA2B 2ZZDA 1VF5B 3EFOA 1HNWO 2QDYB 2FTKA 4OB2B 1GRJA 2CGOA 1XNRO 1VQ8T 4JZ4A 4AFQC 1YITQ 2YIBA 4DV6O 4WTOB 3CRCA 1QVGS 2H8HA 1SQBH 2PQWA 2VUBA 4H37A 3CBPA 1KIKA 4L5GA 3UO3A 1Z5WA 2UU9O 1QVFA 1KKCA 3FKSG 1W1FA 1M2VA 3ZL7C 1LUWA 1YWPA 4O4HB 3ETGA 1ZA1B 2ADPA 3BY7A 1Y57A 2RI2A 3TCJA 3CJHB 2V8KA 3V8KA 2E3HA 3L73H 3SPGA 2G3RA 2DN9A 1VQ5Q 4I0XB 1YWOA 3HPLC 4AFZC 1ARKA 4I55A 3MPUB 4FYXB 3ASKA 1I1JA 3ABKB 2VXFA 2F93B 1YP5A 1NZ9A 4ME7A 3OBWA 3MHSC 1V55C 4JI2O 2CDYA 2PI5A 1VQPV 3QO3A 2KT1A 3U23A 3OYCA 2EQUA 4ZOLA 4JI5O 1I07A 1PHTA 2HZYA 4JI3O 1AR5A 2UXBB 2CH7A 2F23A 3FB9A 2P67A 2DWDC 4UV8A 2HKOA 1M57C 2P4TA 2FPEA 2W6IG 3CC7Q 4NTWA 2B5UA 5BR8B 4MMKA 5CKBA 2D6FA 1K8AW 3ABMB 2K3XA 3SYOA 2Z0AA 2DM1A 2C0TA 5LMNB 3VS0A 2VWKA 2LQNA 2QA4T 1FXKC 1K3EA 3BA9A 2GNCA 5FNVB 1OCRB 2KRMA 2CP2A 1AJNA 4DYLA 5CKHA 2Z3YA 4MMLA 1WYXA 1M56B 1EZZB 1OU8A 1KFZA 4X9QA 5GJVB 3K03A 4XU0A 5JJNB 3SEMA 3A0HZ 3IJ4A 1SPKA 1MSDA 1GH6A 4X1IB 5H5NA 4LF4B 5KHJA 5EG2A 1K73U 4G27B 4JI1O 5LP6B 2QQBA 2VV5A 3I55V 1SEMA 4LDVA 5J2TA 2P0QA 4JYAO 5KYYA 1J3TA 2CE4A 1N33B 3EG2A 3RVZA 3JSLA 4GLKA 2KE9A 1W2BA 4GZRB 3O65A 4D7TA 4PK4A 3CCVT 2AXTZ 2QDOA 1M93A 2E76B 2KRSA 3QSUA 1ROPA 2ZXWC 2D9TA 4M7AB 3R66A 1HYOA 3SWNC 4OGCA 4Z89A 2DK3A 3ME9A 1XHZA 2KXCA 3RESA 3SJQC 3HKCB 1T0HA 4BR6A 4I9QA 2QYZA 4RUGA 4MT8A 1K76A 3CP1A 3IGAC 3JATB 1HNZB 5J3BA 1VQOT 1VQKA 1FYNA 3UT5A 1HR0B 1VQ4T 3MKDA 2DBMA 5CBGA 3OYMA 1OYXA 1VQ9A 1Q6HA 3FAVB 1M90W 4LFAB 5H9CA 4XTYA 1R6TA 1S72A 1GXIE 3EFSA 3FLGA 4JDSA 1TOVA 2ABLA 3EAEA 3HTRA 2HBWA 2F4VO 4I50B 2WAMA 1TUBA 1BBZA 3QHSA 4D8KA 4LFBB 4X34A 4DV4O 2L3QA 2CTQA 4NTYA 3HRUA 1H8EG 3V7RA 4F6EA 3ZMUA 4A4GA 2CP6A 2CDTA 2FYKA 1FMKA 2NUPA 4DBRA 2L35A 4LD9K 4M7DB 1PD1A 1TTHB 5JH7B 1X4TA 3U0ZA 4ZTFA 4P30A 3L2ZA 1KMIZ 2UUBO 3ZHUA 1M1KC 1AHJB 4X88A 5LJ3f 4PLLA 4GKKO 2PU9B 2E6NA 1JQQA 4EMHA 1VQKQ 2L5QA 4J42A 5LJ3d 2JGDA 2KROA 3EG1A 1JA8A 4BI8B 3OY9A 3L9DA 2P0KA 1KQ1A 1ZL8A 1WJQA 2ROLA 3P8HA 3A8MB 3QBYA 3LNMB 3T1HB 3PVQA 4BDZA 5IJ9A 1QVGP 3MDSA 4BIUA 4M75B 4X1YB 2H8PC 3JCMb 2Q7HA 1G83A 5CCAA 3VQVA 3I35A 2XU8A 1R77A 1RAIB 1AP5A 3B4SA 5ITZB 3K58A 4RMOA 1AT1B 3JB9D 4WBNB 3ASNB 3ZHTA 4UVAA 4C8QC 1WHMA 4TOIA 2KY9A 4DRXB 1BI2A 2PF4E 4LCUC 3C90A 2HSPA 2CTWA 4FYYB 2NUZA 5BZBA 4JUVA 4JJBA 3M4GA 2EPDA 4PDLA 3EHQA 5LJ5h 4I4TB 4IIMA 3BRCA 3ASOB 5LJ5g 2JS2A 2QK0A 3V7CA 2HQHA 2PYJA 4J5YA 3BA8A 5M9OA 3RBBB 5GMKi 2CSIA 5CKEA 4X65B 1NLPC 5CA0A 2EIFA 1FJGB 5KYXB 1OCOB 2R57A 5IYZB 1KKDA 3HKDB 3PGGA 3K08A 1J5EO 2BZ8A 3X20B 3JCMX 1OHHG 1N0JA 4C8QD 5IY5C 3OA6A 1V54B 3R6OA 3A0BZ 4RCCA 5I11A 4DV1O 2RN9A 3SWNA 1M1FA 5JWPA 1F51A 1KC8C 2IH3C 3ZBHA 3VU3C 3FYIB 3ZRVA 1X69A 2ZPEB 1MA1A 4BD3A 4HNAB 1WA7A 4YXWG 2LO1A 2PVOB 1WQWA 2EULA 2CKKA 3K5OA 1UGPB 1AZGB 1AJQA 1WHGA 1K9MW 2D1XA 1X6GA 2EBPA 1Y4MA 1NT2B 3D36C 5FPOA 2X3WD 2Q7GA 2QWPB 4GUNA 4XDJA 2D3OW 4A4HA 2JM8A 5CO7A 2I0NA 1B04A 3D8CA 1FFTB 4R0KA 1BSMA 1IHWA 2YUNA 4OMOA 4QPJA 1LNXA 3ABUA 4B08A 1N34O 4KHPO 2QTXA 4FLUA 1OZ2A 4PA7A 1GFCA 2C06A 3T9NA 4RCBA 1U5SA 2Q0AA 1YJ9T 1WJRA 1NU1H 2W0FC 1VIEA 3EGDA 2F4VB 4UCVA 5EK0A 4B3MO 4DUYB 1YJNA 4FLYA 4U7OA 5FU7B 3WB1A 1BQ0A 1UJYA 1NLOC 1Y0MA 4MDWA 1N8RC 4F16A 2BTQB 1ZBJA 2RPNA 1E6HA 2QWNB 4OMLA 4FU6A 3K5LA 3H41A 5CKDA 1VQ6A 4J7JA 2E41A 2VASA 3TU4K 4LN2A 1QLEC 5GONA 4PA3A 5H2FZ 2K3BA 5FRMA 4DV7B 2XAFA 4OX9O 1VQ7T 4PV1B 3H1KH 3FJPA 5KYUB 3FD9A 1G3YA 4LF7B 2KSSA 1S77D 1BZKA 5GANj 4CS3A 4GX0A 3RYHB 3LH0A 4FFBA 4F7UG 3CC4A 1KD1C 3G71A 1Q81R 1IB8A 2DERA 4ZNXA 3CXHF 5C6SA 4C8QA 2HL5C 4MVRA 4NXNO 1ZSZB 1YJNQ 4AG1C 2HCKA 1GBRA 2RHZA 1NTZH 1M5IA 3LW5E 5KYWA 5IT9N 3H1JH 1VUBA 5JVDA 5GMKl 1VQMA 4M78G 5BY1A 4F6RA 1KSWA 2ED1A 4Q6GA 4JI4O 2XDDA 4AFSC 1TG0A 3CCEA 3CCUT 1U8RA 1SHFA 1WAZA 1RI0A 4O4LA 4XAXB 1YJWA 3FB5C 3CXCP 5CBFA 4ZGEB 3L2VA 3RT3C 3H1HH 4NOYA 2Q67A 3P30A 1HXDA 2KYMA 1I08A 2ZIMA 4PA6A 2K3YA 2L3PA 4GLMA 3G6ET 5FLXN 2AKLA 2EYXA 3LGLA 3S6WA 4YHHB 3AG3C 3H01A 3NXSA 4F14A 2E5LB 3RYCB 4C8QF 3HKBA 2IH1C 1W6XA 3JALB 2RM4A 1RM1B 4QVCA 5LGNA 1HJDA 2EFIA 4DK0A 1H38A 4PD4F 1YHQT 1VEWA 2LFSA 3LH5A 4IURA 2LQWA 2Q6AA 4W4LA 5JCOA 1IO6A 2XKOC 2BSKB 2AZVA 1PG5B 3CPWP 1IBLO 3JV3A 4X64O 1TUGB 4L59A 5GAN3 4E7LA 4TV8A 2QI2A 1PNKA 3TXQA 3SYPA 2MK3A 2DXBA 2AHJB 2A3QA 1VMGA 3CCJV 1NS1A 2A3LA 1TUCA 3F70A 4X20A 1MABG 2HAXA 1YJWQ 1Q3EA 3K0DA 4M7AE 3M0UA 1OU9A 3T1YB 4MTOA 1H8KA 3GIBA 3ZRXA 2YEVA 3EG0A 4ZN3A 2XAQA 4XTXA 1IBKO 3QPHA 1GN4A 1K4CC 2ATCB 4C92D 3AEIA 5B5EZ 1GCQA 1GBQA 2HSEB 2DA9A 2DETA 3K06A 1P7GA 2QGGA 2CK3G 4FSXA 5B1NA 3OGIB 2RA2A 1YZBA 3CEIA 2WLKA 5DM6V 1N34B 1VQPA 1I4K1 1QCNA 3MD0A 2KXDA 2Y69C 1W4SA 4JI0B 3ZRWB 3WU2Z 5CBHA 1RUWA 4PKCC 2YUQA 2UUCB 4BE2A 2N04A 1M3BA 3BCCH 2EQKA 2DMOA 4XBFA 1RSOB 2YUAA 1O75A 1YCIA 2EJGA 4JLIA 3OW2U 1Q86C 1WA8B 2NN4A 3DLMA 4JRPA 1M4ZA 2XHCA 1YITT 1MSWD 2JIZG 1K5SA 4JZ3A 4ZHQA 3PJSK 4FLTA 1PC0A 2O4XB 2WACA 1QVGA 4DUZO 1FD9A 1KHIA 2VGMA 4NTXA 1MMMA 4FPPA 1I8FA 1VYVA 4YY3B 2O31A 1XMQB 2X4WA 1M30A 1QKWA 2RF0A 4AQYO 4OX9B 1N0NA 5EYPB 4M77D 2WPDG 2DL7A 5B3SB 3OR7C 1MMDA 3PIOA 4UC4A 2F1LA 2Q69A 3LSSA 2YSUB 2DEUA 2L2PA 2O01E 2DE0X 1VQ5T 2Q8VA 4BY6B 1S3JA 3ZHQA 2JTEA 1VQPQ 1QVFP 3OTOB 2F2XA 2JMCA 3J80E 5DLOA 1RLQC 1TAEA 3ABKC 1XNQO 1VQ9V 1LR1A 2EQJA 3E8FA 1S72V 4TQDA 4UCOA 1IVSA 1PSFA 3CBOA 1SQQH 1RABB 3L72H 4EPCA 4FLVA 2AT1B 2AGAA 2QSAA 4NXMO 2QEXV 1NVPB 1BQZA 1ZUYA 1YTFB 1NYGA 3CCQT 2EWNA 2QKCA 1Z9ZA 3E86A 3NPFA 1GN2A 1GN3A 1YXBA 3CC7T 5HK0A 3STLC 3VS7A 2P5OA 3SR2C 4C92A 3ABMC 3A2FA 4EB6B 4UUJC 1I5XA 3VQYA 1MHNA 1VIBA 4O4IA 2DQ0A 4LFCB 5IHKA 3BHPA 2DILA 1OCRC 5DM7R 3J81E 4Z88A 3ZBDA 1BE3H 1M56C 4IHJA 5DECA 1QU7A 3A0RA 3I55Q 4MVOA 1MZEA 3CE2A 1XNIA 2YRVA 1URFA 1XMOB 1FX7A 5GANf 5KMGB 1JXMA 4J9BA 1BHAA 1YCYA 1TSFA 3QYHB 5GANd 2W0XA 4UCUA 5B1AB 3WFVA 1E6GA 5LP6C 2QAZA 3E22B 2JGUA 5GANe 4PJOA 3NTKA 4C0FA 1ACMB 1JVMA 1NJIC 1AI6A 1QKXA 1SKUB 2CAZC 3META 1HSQA 1BCMA 5D6XA 1BKBA 4DR2B 3RW0A 3APOA 3U11A 4M7AC 1SC5B 1VF6A 4FM0A 4GYCB 4ZI7B 1QP3A 4O2BA 1N6AA 3ABLB 4M77A 5GMKm 1JJ2U 7AT1B 1AWJA 1DJ7B 5A0DA 1WFWA 4UVBA 4IGGA 1GTOA 4DO2A 3A8LB 3ZEHA 5LHGA 2UUAO 1NBEB 3CMAA 1I5YA 4O5VA 3MP6A 1M8VA 1GN6A 2GGRA 3ER0A 3REAB 3LSQA 2RH2A 3HKEB 4KFMA 4MDXA 2JJ2G 2OAWA 2LCLA 1Q90D 5JJEB 3CYOA 3X28B 4PI2A 3S3XA 2E75B 5IAYA 2DNUA 3E8BA 1WJZA 4UFZA 4X9DA 3F5TA 1QVPA 3DSQA 4MTGA 3N27A 3HFNA 5GAOm 4J41A 4Y92A 2E6ZA 4C5GA 1Q7YC 4FLXA 4NYKA 2LRQA 4M7DC 1PL4A 1GM7A 3ZHRA 3TQ7P 4NL3A 4JS4A 1IZ6A 2JTMA 3QO7A 4IL6Z 4MW3A 3E2UA 2A7YA 3KBGA 5DY9A 4DA4A 2ESWA 3QDFA 1CSKA 2EYZA 1NG2A 1G6UA 2RJZA 3BAAA 1R8OB 1VQKT 1GFDA 2DEQA 3DXRB 1H641 4XTVA 3CC2V 5AYFA 4IYIA 1R73A 4O2AB 2W0ZA 1KC8R 4LF9O 1AI4A 1QQJA 1M27C 2VB6A 3OMNB 3L2RA 1RAEB 3EGUA 1SQVH 4AI8A 4M75C 3CXCA 1HNXO 3HFOA 2QE7G 1JPXA 4O4JB 2AZSA 3CCRT 1KP3A 1XNQB 4J10A 2DQ3A 1NTKH 4LWSB 4JV5O 2EVRA 3QXEB 3LLRA 4M7DD 3D3QA 3ASNC 5FL7G 5I22A 2EQIA 4RTVA 3EVKA 3OYAA 3F7YC 1UUEA 5D7UA 1IRXA 2XAGA 2JXBA 2VS0A 3NTHA 4KUDK 4RTYA 4G28B 3VS6A 1F4NA 2BOBC 1R3KC 3OYIA 2FEIA 4GX5A 1JMKC 4TVRA 1VQ6V 3PTAA 1M1KW 3CPWA 1AR4A 4B7EA 1FPOA 2F69A 1F4MA 2YWWA 3QO8A 4JTAB 2CGHA 4DBHA 1JFFA 1JOYA 1ABOA 1GL5A 4K0KO 4WCEV 2WSFE 3BW1A 1UFFA 4DW1A 2OI3A 4M75D 4ANJA 1R3IC 4PI0A 4DR7O 4ZN1A 4DR1B 1OCOC 4CS2A 4FM2A 2ZD9A 2YIAA 4LNUB 4AFUC 2FYUH 4PHZA 1ENVA 2A28A 2GSMB 2M6YA 4YJ2B 4PL6A 1YDXA 2GBQA 3EGXA 4V2SA 1NI8A 1YN8A 3CC4V 2XHBA 3G71V 3TGUH 3P3PA 1GMGA 4OGQB 4MVZA 2BIVA 1V54C 2DTHA 4K8ZA 1K73C 4UCRA 3EG9A 2CTPA 3C95A 1OPLA 1QNMA 2FL4A 1S5LZ 1ABQA 4CRIA 2GQVA 2QA4V 4DV3O 1VQMV 1XI1A 2EGEA 2OIGA 2M0YA 3N2GA 2LT1A 3AG1B 3PVLA 4R8CA 2JW4A 5LA6B 4GKJB 1QWEA 2KAFA 3CCEV 2V4DA 2ENMA 3B8MA 2KT8A 2L8DA 5C8YA 4WCIA 1I0HA 2KQXA 2HVJC 1LNQA 3QDRB 4E6RA 1O9HA 4R6ZA 5CA1B 2E3IA 5L3DA 2FHDA 4M7AF 4FLWA 3RDVA 2GF7A 1V1CA 4E7SA 1OCCB 3TK1A 4LH6A 4H0LB 4X62O 4F7UB 1AVZC 1Y74A 2DF6A 3OW2S 2AZ2A 2IBZH 2BCCH 1NPPA 4M7DA 2MCNA 2QM8A 3CCVV 1U1TA 2PZSA 3QG1A 3BEHA 4J8OA 5KA6A 1ZSPA 3P8BB 3NGPA 1WJSA 1V9PA 4K3AA 2JZ2A 1Q7YU 3K9SA 1M90R 1CKAA 4M78B 2E70A 3QUIA 1VOMA 2DD5A 3BVOA 4B3SO 2GFUA 3RYFB 1KC8W 1EN6A 2QWOB 3A8HB 5A9GA 1E1RG 4FVMA 4QE9A 1Q8IA 4HVWA 1ZX6A 2BTOA 1VQ4V 2RB6A 2EYWA 3VOUA 1D3BA 3P8DA 2J06A 2P90A 2V1QA 1R6KA 4L6V5 3JAWA 3Q1JA 3B40A 4JPBW 2VWJA 4M75A 4JF3A 3ML0A 3M8AA 5LYJB 4M7DF 2HEPA 1I94O 4FJCC 1X6BA 1K33A 3GWKC 1ZQ1A 4F04B 4OMPA 2ZM6O 4CC3A 3CD6A 4X66O 1K0XA 2MWPA 5A2QE 1K97A 1PD0A 1I5LA 3JARB 3VYGA 2IG0A 4IIJA 1ZUKA 3V8LA 1FKAO 2MK5A 1JB0E 1H2GA 3SD4A 3CCJA 5J26A 4CH3A 4HCKA 2CH4W 3VRZA 2YICA 4JZ2A 3JD3A 1KBHA 4JV5B 3M4YA 1YIJA 4J7FA 1LCKA 4B3RB 1K7DA 2R70A 4I4TA 4A63B 5KH6A 1N8RW 5HFLA 2CP7A 4A54A 4M75F 3H8ZA 2NYSA 2EIMB 1IBMO 4PJMA 5GMKh 3CMEV 1IURA 1KHCA 3OT7A 2WA4A 1TUEB 5LMUO 1AR1B 1NM7A 3CCMA 2Q7EA 2X3XD 4N4IA 3KXTA 2WLIB 2QXFA 2XT9A 1AWWA 3JB9G 2ZNIA 4DV5O 2X4JA 3L2QA 1RM1C 1H3HA 2RHYA 3I56V 3OSVA 2J6FA 4PA9A 1AD5A 3MEWA 2X4YA 3O8VA 3LWIA 1Q6IA 1WNSA 4MS2A 1KD1W 3P32A 1RAHB 2XTAA 3CCJQ 5EBLC 1P84F 3OEHG 2YI8A 1X01A 1VQLA 3H0IA 5IXFA 5EC7A 2UXDO 5FU6B 4BDYA 3APQA 5IJ0B 4JYBA 1Y07A 5L3FA 3IQLA 5LL6Y 3RWRD 2DTIA 5KHIA 1UE9A 2LQ8A 1TVKA 1QCFA 1JJ2S 3SGIA 3EFFK 1S5HC 5L3EA 2A0FB 2F2WA 3HKSA 2E10A 3CCST 3LUTB 2ED0A 3BFMA 2LQTA 2ETNA 4PDRA 4QNHB 1Q95G 4AMCA 1PPJH 5E1AC 4C8QG 1W59A 1Z2GA 5CB4B 2P84A 2WLLA 3G80A 4N0AC 1Q81U 1JU5C 1BMFG 4C0GA 1YFNA 4EMGA 5EZYA 3F7VC 5I21A 3HPWA 2XNDG 5FWBA 3NTIA 4QKUA 4B9WA 3E35A 5GAN8 2WSSG 3Q4HB 4KH0B 3OS0A 4BE1A 4NB5A 4DV2B 4PJLA 3IC7A 3QZ5B 1W2BU 2F5KA 1ZUQA 2E74B 2QEXA 1K9MR 2R9AA 4Q20A 4EMKC 5LOVA 1UGSB 5K1XA 4OB1B 2XMFA 1PL0A 5IE9A 2HHHO 4NS5A 3JD2A 1HNWB 2QWRB 3MHHC 3UDCA 1XNRB 3GWOA 1Y7XA 5KUKA 4CC5A 3N2KA 1BI1A 4DV6B 2VYTA 4B3SB 2ZE8A 1AOJA 2MAMA 3AT1B 4GX2A 2RMOA 1AP6A 2UU9B 2LZ6B 3SPJA 3FB7C 3QO5A 3K04A 4UV9A 1SA0A 3E2EA 1EFNA 1CKBA 1VP7A 2N74A 3OYLA 4RG2A 1THZA 3TSZA 2H94A 2DYBA 1PRMC 1VQ9Q 5LJ3e 3HP9A 3FB6C 2FB7A 2YUPA 3PMTA 1S72Q 4ZKIA 2XG8D 2OTJT 2CT3A 2ATKC 2MW2B 2KKWA 1IGQA 2AK5A 3ICXA 4U3JB 1NJIR 4RTTA 4BY6C 3EFOB 3SPCA 1OV9A 2QEXQ 3CMAV 4D6WA 4ZGJB 1NH2D 4TUYA 1PCXA 2DRKA 2H3EB 4LF8O 2YXYA 1KQSU 1YI2T 3JAME 2ZT9B 5DN6G 4JI2B 3TJTA 4JI5B 5B1OA 2EJRA 4JI3B 3F5WC 1FXKA 2EGAA 2VC8A 2GBOA 2J6OA 4YIOA 2MYSA 1M2VB 2KR3A 3E1SA 1HP8A 1SZXA 1Q86W 1SQFA 2V1DA 3QJ6A 1N9SA 1H92A 1AWXA 1KB9F 1G3SA 1IBMB 2HQEA 4ABMA 4JI8O 1DGSA 3C3TA 4O6JA 2QM4A 2DX1A 4WF2A 5FWCA 5CMUA 2QTVA 4N4GA 2DJVA 4EFEA 2DLPA 3UT1A 1EN5A 4I55B 1P4RA 3CSXA 3WG7B 4GT1A 2DO3A 2K9GA 4GY5A 2ZPGB 1JO8A 4JI7O 4J9DA 3CCLA 4Z1VA 2K5LA 1COWG 3WB2A 8AT1B 3CRMA 3OB9A 3I55T 4JI6O 2N05A 2WSEE 2O9SA 2IPOB 4ZOLB 1RAFB 1R0BG 2FVUA 5IWAO 2CH7B 1N36O 2DL8A 3CCUV 1I5OB 5B1AC 1JCHA 4JI1B 4LBEC 1BIAA 3CBMA 1O9SA 1Q82U 2B1IA 1YBYA 4JYAB 1MMNA 2FZKB 5GAMj 4OF1A 1TH7A 1WQ7A 3CRQA 4X1KA 3TXSA 3H9VA 3OMGA 4A4FA 4MVQA 2KBTA 4FW2A 4JJCA 3BDLA 2ZKOA 4LE9A 5IHIA 3A8GB 4AG2C 2HLDG 1VQNA 1OEBA 3CC2A 3B2EE 4C0ZA 1VARA 4IYHA 1QR8A 4J11A 3STZC 3OS1A 3KZIZ 3J80N 2FZCB 2PYLA 2V26A 2Q0OC 2LJ2A 4EMKA 1EZVH 2B86A 2ZPFB 4IT5A 5ECAA 3UCSC 4PLIA 4F7UE 5J2TB 4JRIA 5KYYB 2HMAA 4PJOE 1CPYA 2AHYA 2IW5A 1T3LA 2LW1A 1WHJA 1P7BA 1UEBA 4DV4B 4XDLA 1D5AA 3K3WA 1FS0G 5C93A 4OMNA 4C92G 5H6QA 2BZYA 4KP4A 1XDCA 4M78E 4JJNK 4C5EA 3ZRSA 2P0PA 1K0SA 4GCZA 2OTLV 5CVIA 4C0DB 3RN4A 2VQFO 1SESA 4OPAA 1NJIW 2O2OA 2RQUA 4FW1A 4M77E 4CH6A 3J81N 2JUFA 1KUQA 2P4RA 2UUBB 3UT5B 3CC2Q 1GK9A 1NEBA 1WP7A 4GKKB 3LDEA 1B34A 1K92A 2DIGA 3CPFA 3EXAA 2HR3A 4D7SA 3JD0A 5KHHA 2DXCA 1TUBB 1WHKA 4PJOG 2DWEC 2R9IA 5EIBC 2P4VA 1E7OA 4FZ1A 4FFKA 3WB0A 1RAAB 1QWFA 4J7KA 2D8JA 4BW9A 4B3TO 2NUPB 2QA4A 2K9PA 4DR3O 1L8DA 1Y96A 1V29B 5KAFZ 2YHTA 2X4XA 2Y90A 3MHXA 2OYQA 4EB6A 1C0MA 1G3TA 4M77G 1OZ0A 3UKMA 2C0IA 3L2UA 1IXMA 1SQPH 4YIPA 4DR4O 4DEXA 1VQ6Q 4KL1A 3RYIA 4BIZA 3E8HA 2X6CA 1M9NA 2K2VA 1FWZA 2JGDB 3ETQA 1US6A 4RTZA 4FCYA 1OV3A 4JI8B 1NR7A 2HQXA 3MEUA 1ZL8B 4RTWA 3LDDA 2NUTA 4PFPA 4UCSA 5IJ9B 3NFCA 5EIBD 4X9CA 4PNOA 2VQEO 3CC4Q 2UXNA 3R65A 3G71Q 3CCVA 2RMKB 1WPBA 1WN7A 2R58A 3HRTA 1BI3A 2K6DA 2CUDA 2CSQA 3G67A 3JSNA 3MCAB 4QE7A 2OJ2A 4PA4A 3LYIA 4JI6B 1UHCA 1WI7A 3CCQV 2ZGWA 5LJ3g 3CD6V 4BIOA 1J5EB 2QA4Q 2CZ6B 4GBQA 1VQMQ 3A1PA 2DKGA 5IWAB 2O57A 1T5EA 3L70H 1BK2A 1VQOA 1QLYA 5KE3A 4DV1B 2SEMA 2JRIA 3PMIA 1VQ4A 4ASUG 4ZI7A 2CTRA 3CCEQ 1U3OA 3D36A 4DR5O 3VRYA 4HZ3A 3JD4A 3OMCA 1FXXA 2A9HA 1MV3A 3A8TA 1YIJV 5EC1C 5LXTA 3NHNA 4ZTJA 4BACA 3AG1C 1X59A 4Q5WA 1RP3B 2KI7A 3ZMZA 2EINB 3E9FA 3ZMVA 1GKFA 1DK1A 2E1HA 5CA0B 5J2UA 2LX9A 2WWWA 2CH4A 2DPPB 1W2BS 2OT5A 3DB4A 2YIDA 1MV0B 4QVDA 3CCVQ 3CCMV 1BS3A 2EBOA 1H2LA 2M1HA 1G1XB 5LHHA 2X0LA 3LDCA 3M5AA 4OB0B 4DOWA 5GAOn 4KHPB 2ZXWB 3TEEA 1VYUA 1OCCC 2JT4A 3CEYA 4UB8Z 4JAAA 2LW7A 1WPYA 4KGVB 3AG4B 3G4ST 1MGQA 3VBBA 1Y76A 4P9OA 4B3MB 1A32A 1MNEA 1L0LH 4HAMA 2CS7A 2GUZA 1NBMG 5CQYA 3M59A 3UATA 3M0RA 1VQ4Q 1YEWA 1OOTA 3CMEA 4N4HA 4M78C 1VQLV 1BT8A 2ADQB 1XEQA 2JS3A 1K73W 2QDLA 4J83A 3JRZA 5IH2A 1XHXA 4QVZA 5GAMf 2LP7A 1KP2A 2QASA 3DXRA 4BW5A 2K5FA 3OYKA 3LWHA 3MP1A 4K11A 4H13B 5GAMd 3I56A 2E3CA 3B77A 2V8IA 4DQ2A 2IU0A 4TV9A 3AK1A 2CUBA 2CZ1B 5GAMe 1K8AU 1B3QA 4DBFA 4HA8A 1YSCA 2DYRB 1C1AA 1WZOA 1LOJA 5GW7A 5KHKA 1KQSS 3ZS8C 2GCXA 4XTZA 2QM7A 4ATOA 2HNIA 5C0MA 4N21A 3JASA 5TISZ 4NXNB 1PWTA 2B1GA 1IREB 2D0NA 1H2MA 2Y4TA 4B7KA 4CBCA 5JQGA 5KX5A 4R56A 3OS2A 4R55A 4J80A 3CMEQ 1WLPB 1TS9A 1AILA 4JI4B 2LT4A 1A0NB 5GONB 2HDAA 2R5MA 1XREA 4IUUA 5HY6A 4DR4B 2EIMC 5J9PC 2HJDA 1AI5A 3P3NA 5IYBO 5BMVA 4CC6A 3I9QA 3RKWA 2PI4A 2KG7A 3FFQA 4HYOA 2XDBA 3I56Q 1VA7A 1XOUA 1LUVA 4FFBB 3VYHB 3ZN1A 2RO0A 3TETA 1YNZA 1GM8A 4G2KA 3W7SA 2V7QG 5LHIA 2F2VA 3M0TA 4QQDA 1HW7A 4II1A 4PFOA 3JCMf 5GTHZ 4C8QB 3CCRV 2WLJA 2YDEA 1QLNA 2BZXA 3PE0A 1JEGA 1JX9A 3MJXA 5KYWB 3JCMd 4KBMB 5CR2A 5JVDB 3OYNA 1XL6A 3K5MA 1XTDA 4E4EA 2EW3A 4F6RB 2RJFA 3JCMJ 3L2WA 1M1KR 1R1BA 1M90U 1BU1A 2BKDN 1IBLB 2MMPA 4X64B 3C0CA 2PTKA 2E5KA 3G6BA 5FU6C 4O4LB 3PIPA 1DTOA 5GAN4 2EX3A 4MTXA 4BAYA 1PD3A 1TA8A 4JRQA 4WFGA 1ZSGA 1R6NA 1EIFA 2IU3A 3C12A 3VQWA 1QCOA 4UVCA 3FDRA 1WB8A 5J39A 4M75G 1GRIA 1PSEA 4CH5A 5LJ5j 2RJCA 2XDPA 3UA7A 3H0FA 3ZHVA 3HKBB 3OYYA 4RKUE 1H2NA 1YJ9A 2A06H 5KAIZ 1IBKB 2HP8A 2R72A 5D6WA 1NR1A 2ITCC 2X51A 4E7KA 2HBPA 1OX9A 3ZCCA 4XDKA 4KGZB 4NKGB 4JYYA 4EDUA 1M3CA 4CS4A 2DJQA 3G6EV 2LVMA 4X8AA 4E7ZA 4TV8B 3ZEDA 4CC4B 3W7WA 3IC9A 3ZN0A 1F7YA 3UPUA 4QGPA 1KQ2A 3CCLV 4BB7A 4LDUA 2E64A 2COZA 1OQKA 5EC2C 5A0LA 1B7TA 3K79A 4YJ3B 1B06A 2PY5A 4X20B 1D1AA 1VQ7A 4VUBA 2X35A 2ZPBB 3OR6C 1Q6UA 1ZTEA 4M7AD 1M9SA 2YEVB 2HL3A 4C5HA 4O4HA 1T3SA 4DR6O 3TSWA 4F7UF 4HCBA 1ZLZA 1RFYA 4TT3G 2LTOA 3WXMB 4DOVA 2YRCA 3CJHA 4DV0O 4DUZB 4JZGA 3SYQA 1UFIA 1GAXA 4I0XA 5D5QA 5L3BA 1JXOA 4MSWC 3IAYA 2RJEA 3BPZA 4LH7A 4I7ZB 4AQYB 4M78F 3CMAQ 1G4YB 3JARA 1VQNV 2LJ0A 1D0XA 3D7SB 4B9XA 1VQ9T 4FK5C 1S72T 2CT4A 3CCUA 1N32O 4MZTA 3HB3B 3CX5F 1VQ8V 5GAN2 4OMQA 4NVPA 2RQVA 2FL7A 1K5QA 3M99B 4J7ZA 4B6MA 4UXNA 4FL6A 3T1CA 5I2SA 2L89A 4NXMB 3VS4A 2LNHB 2O9VA 2GTAA 3UA6A 3INZA 2AW9A 2K79A 1AI7A 3THOA 2EZPA 5FNVA 2FPFA 1PP9H 2VXEA 2YI9A 1SSHA 4HKEA 1YHQA 1KQSP 1SQXH 1UGQB 4JGSA 5CN0A 3ASOC 1EZJA 4C7UA 2CZ0B 3CXCU 2DXTA 1N8RR 2UXBO 3M56A 4X1IA 1NPRA 1BL8A 5LP6A 1UECA 2ZR3A 1OX8A 3O5ZA 3CCUQ 1K9MU 4EFBA 5BR8O 1F1BB 3QWYA 4IIOA 4BE0A 2BE9B 1T0JA 5LMNO 4ICGA 2JMAA 3VKIA 3AG3B 1NE8A 3JAKB 2GQIA 2CZ7B 4J6WA 2OTLA 4M7AA 1WPXA 1AVMA 1YCSB 3EH1A 1Y6XA 4FT4A 3HKCA 4C92B 1IZ3A 4OMFB 2RHUA 2LJ3A 3CPWU 1G5VA 3OE7G 3FEOA 5HKCA 3ZHSA 3JATA 4O4IB 2YRDA 3HRSA 1KD1R 2RQRA 4CH4A 3FAVA 4IUVA 4PDVA 2WLHA 4LF4O 1YF2A 4M4ZA 4IHJB 3JB9I 2DW4A 2KEAA 1N33O 4I50A 2RQTA 3K9AA 2A36A 4KRTA 2UUAB 3DLLA 1Q81C 4W4KA 3M57A 5AT1B 3W7XA 5GAN5 3AK2A 1RACB 3JAMN 1XL4A 4PJOB 1SZTA 2J05A 3X2QB 2RHIA 3OM3B 2UXXA 2R5AA 1I81A 3H1IH 5D5PA 5JH7A 2DVEA 4J9EA 5FU7C 2OTLQ 3GPLA 1HWYA 2WLMA 2EQMA 2QGFB 2NNUA 2MI6A 1ZX3A 3RGBA 1HR0O 4WF9V 4DEYA 1LPLA 4BWAA 1IXDA 4JTCB 1XILA 1RADB 2C0OA 2DIQA 2O88A 4LDXA 4R7CA 3CCSV 4LFAO 4Z02A 4J9ZB 4P9PA 1QQCA 3LNNA 3M7MX 4O2BB 5GANh 4CC2A 4M77B 1VQ5A 3BFRA 1VQOV 3EHRA 4C0DC 2F95B 5GANg 3IFXA 3RVYA 2DYSB 2DD4A 1PKXA 2DZCA 3CC2T 5LJ5f 1X6OA 2JTFA 4X1YA 2JN0A 4HVUA 2PTMA 2B8AA 3JCMV 1BGYH 4E7HA 5LJ5d 4Y28E 3CCQA 2W10A 1ZWIC 4RTXA 5LJ5e 5ITZA 3V8JA 4U7NA 2GFAA 3VUZA 4LF9B 4WBNA 3E9GA 1N32B 3JCMW 3CC7A 3MO8A 1ZSZC 3J7AU 1SQGA 4DRXA 1HNXB 3O9OA 1YJNT 2HVKC 4F17A 4KGXB 5GJWB 2P4KA 2XAJA 1QVFU 3SYCA 2FG0A 2LDMA 4JS5A 3S3NA 2L0AA 3SJBC 3GBQA 4PELA 4LC1A 3RNJA 3T1HO 5I2MA 1VQ6T 2K5IA 2RQWA 3OEEG 1RPRA 5F2VO 3URGA 1ORQC 3JCZA 3KCYA 4FZ0A 2DAQA 4JLGA 3J7AF 5KYXA 2OTJV 4ESRA 2YDLA 1GM9A 2YLBA 5IYZA 3UWNA 3B8NA 3HKDA 3M54A 3TREA 2SRCA 3VS3A 4E47A 4EIKA 5E79Z 4LDWA 5L23A 4C8QE 3CCQQ 2OWOA 2B9ZA 4K0KB 1CXZB 2I2LA 3GP8A 3CD6Q 1EFRG 3CC4T 1Q86R 1KYOF 5EBMC 3BE3A 3G71T 4QIWF 2JEUA 4RWUA 4DR7B 5IYDO 2XICA 1YI2V 2IVWA 4DBQA 1F23A 1KJWA 4WFBV 2EIJB 5KCHA 1XOVA 1CP9A 2QQRA 1PKTA 3EFRA 4HNAA 1VQMT 1YIJQ 1IDSA 1QR9A 5CAIA 3ABTA 3UQ8A 1Q82C 1MMGA 4X65O 2KQWA 2ZAEA 3CCET 1FJGO 3RKXA 3OYEA 3OGCC 4DV3B 2COYA 1YJWT 5LGTA 1WP8A 4RUEA 2OX7A 2ZE5A 4GLXA 4LF5O 3VJPA 1VF7A 1JFFB 1SHGA 2Z5UA 2C2AA 2EINC 1XJWB 3RFRA 3CCMQ 2ZDIC 1FFXB 2DL5A 4LXCA 1D0YA 5L3CA 5CQXA 2L3SA 1AWOA 1PM3A 1WXUA 2A0LA 1IX9A 1Y67A 3DKMA 1N4CA 5KHGA 2K4YA 3EGXB 1M2OA 2EYQA 4BI4A 1AZEA 1UG1A 3GNFB 3JCMP 3PFSA 2KDSA 2ARHA 2BTQA 5IDJA 2RNBA 4X62B 1KECA 4GX1A 3AG4C 2ZPHB 1MOFA 2QKSA 3EG9B 4A4KA 1VQLQ 4MW8A 2Q4PA 1SRLA 1KG1A 1M5Q1 3JB9H 1MZFA 4XU2A 2HG5C 2XIDA 1OCZB 3ETDA 1I0CA 1NZ6A 4HBNA 2JK5C 2DBKA 3N2GB 3SFMA 1RAGB 3DB3A 5LGUA 3E8GA 1ZUUA 1MNGA 3M53A 2EIKB 4CZZA 3RIRA 9ATCB 2F1MA 4UB6Z 5B1BB 2HKQB 5C8YB 2RNAA 3I5RA 4OP0A 5KYUA 3QKJA 2CUGA 1SSFA 3RYHA 3OW2P 1KU9A 4ZGDB 3CCRA 4H33A 4DUYO 4FYWB 2QJ1A 2OCCB 2RQ6A 3VV0A 3EHBB 3K0GA 2ZE7A 3PNWC 1WB7A 1ZSZA 3ZMTA 3FB8C 1YJ9V 5B3SC 3RUXA 3TCUA 1Y74B 2VGNA 1I94B 3RMQA 4MVUA 2LX7A 4KUIA 4Z2WA 4AT1B 2E12A 2J7IA 4QJFB 2DYRC 2HJFC 2ZM6B 2AZ0A 1X2QA 2PNIA 4RUFA 4X66B 2OAUA 1E1QG 4KULA 5IN1A 1M8MA 1VQPT 1I7FA 2EAYA 3KG2A 1KQSA 1D09B 2F43G 2AHZA 3REBB 2DVJA 2M16A 5KLVH 4DV7O 1LVKA 1UB4A 4FMTA 2GTJA 1AJPA 2GTOA 1BCOA 4LF7O 5CKFA 4QQGA 4JTDB 3OMAB 2LJ1A 3MP8A 1NTMH 3CMET 4KXRA 3CQTA 5L3GA 3T4ZA 4XTUA 4HCCA 4IUPA 1D3BB 1VQ7V 3RYCA 3OUSA 2LNVA 3CXCS 2P06A 2G6FX 3JAWB 3L42A 1KK7A 2MIOA 4FM4B 3JALA 4X1VA 3CCRQ 3OD4A 3QG5A 4ZBMA 5LMUB 1R0CB 2CP0A 4FT2A 3I56T 1ZBXA 2Q5ZA 2HD0A 3G6EA 2FZGB 4J9GA 1BB9A 2XAHA 2BSKA 4DV5B 4KH1B 4IIJB 5AG2A 4YTLA 3A8OB 2QTOA 4XU1A 1O9GA 4K8XA 3WVDB 1Q7YR 1S5JA 5IHNA 1N9RA 1K9AA 3VUBA 3G1JA 1RPOA 4YHHO 1NVPD 2PVDB 3SHWA 1YTFD 2RK1A 3CPWS 2JVVA 5B66Z 1ZLMA 3BDUA 4LD6A 2E5LO 4J9CA 2UXDB 4LF6O 4LR3A 3FC3A 4LUDA 1OPKA 2RCVA 2EKOA 3GVMA 1WXBA 4C92E 2LFRA 2ZDIA 3E19A 5GAN7 2Z0WA 1XQ8A 1UGRB 3K57A 4N0AA 1QW1A 1TGOA 1C6VX 2DFUA 3FRNA 1PKSA 4CC7A 2M7WA 2A08A 1UDLA 2AIRB 2MWOA 3MEVA 4LF5B 1WIEA 4P2ZA 3QWXX 3ABLC 2M0OA 2RHXA 3CWBH 3G6EQ 1YHQV 4DXWA 1D1CA 2YS8A 1RLPC 1VQ8A 2ZE6A 4PFZA 3ZRWA 1BCCH 4HVVA 3CCLQ 5JCOC 2GDSA 5FW9A 3G7ZA 1D0ZA 4JJDA 1HDJA 2DOSA 1PRLC 1JJ2P 1SS3A 1AB3A 3T1YO 3E89A 1RSOA 4I9WA 3DTUB 2EILB 4L8JA 2RN8A 1D1BA 4LUEA 1WA8A 3QF7A 4C5IA 2HEQA 2V8JA 1PNLA 1FAFA 3RERA 1Z5VA 4PJJA 1TVKB 2O4XA 3H6ZA 2XD0A 4MVSA 2HHHB 3THKA 3SJCC 2CP3A 2X6AA 2Q68A 2JJ1G 3M55A 3UM7A 1UHFA 4EEQA 2LQKA 3FYEB 5EYPA 4PJNA 4WFFA 4HT8A 4FIPC 1VQNQ 4U3FH 2WLLB 4JI0O 1GCQC 1ZHIA 3AG2B 1MUZA 4JASA 1OI1A 2UUCO 3V7SA 5EZYB 2KK4A 3MAQA 3RBZA 1VQ8Q 2L6LA 2A7WA 3VQXA 2JEXA 2G38A 3C94A 2E5QA 4LDYA 3G4SV 1K73R 3CMAT 4QPKA 5FRNA 3LSUA 2YXLA 3BY6A 4OB3B 1K8AC 5LOVB 2ZQMA 3ZIAG 3NR7A 3QNEA 1Y71A 1M1KU 1QVFS 1QCEA 1M4UA 2IJHA 2ILMA 1NEGA 1BIBA 4PJ0Z 4TWKA 1YITV 2KB1A 4YY3O 2V1RA 3OS5A 1XMQO 2R9RB 4KT0E 3N2KB 4LF8B 4J9HA 4P5NA 1Z9QA 3KKYA 1R3JC 5DLQE 3AHUA 3KFVA 2X7RB 4FIBA 1EN4A 1X75C 3JCMc 3JB9F 1DF5A 3C3SA 4MZPA 1SA0B 2KNBB 3JCUZ 3OTOO 2WA3A 3L74H 4UCTA 4F4LA 1Q7YW 4NL2A 3TVTA 4J6XA 2KVQG 1RI9A 2F5TX 3FJ5A 4E7JA 1VQ5V 1V55B 1NKDA 4OVAA 1SETA 4H44B 4J7IA 5KMGA 1GO3F 1G2BA 3VS1A 5CA3A 4JRKA 5KE2A 4TUYB 4J9YB 3HSBA 4JI7B 3CHXA 1M57B 3E22A 2QR4A 1IHVA 1JQ0A 1AEYA 5LJ3h 3OYFA 3QIIA 2PVGB 2RI3A 2LMJA 3CCSA 1FXKB 1N36B 1R3LC 4LFCO 2QWQB 3OBYA 3OYDA 2EYYA 6AT1B 3L71H 1OZ3A 1M90C 3CC7V 4LF6B 3JYCA 1MMAA 2NWMA 2Y0PA 4C92C 5GAOl 1UJ0A 5GMKj 3SPIA 1SRYA 1XMOO 8ATCB 1UGVA 4JAVA 2J6KA 2ZCFB 3AK3A 3OMIB 4ZIBA 3OAAG 1IXBA 3HKEA 1KC8U 1SERA 4Z1MG 1SG5A 3X25B 1B07A 4M7DG 1U1SA 2QQSA 3OUFA 3H9NA 2CREA 3QJYA 1K34A 4YJ3A 1D2DA 4DR2O 1HD3A 3M0PA 4TQFA 1SRMA 5GAOq 2NLJC 1HK9A 4PJOC 4ORZA 3SWNB 3GOXA 1Y66A 3X2QC 2VVKA 3CCSQ 3OW2A 2FKXA 4X1KB 3JD1A 3OFNG 3OTFA 2IJIA 4A4EA 3JB9J 1VQOQ 2OTLT 4AILC 1B6QA 1BHBA 3W7TA 3B09A 2ROTA 4D6TH 2JS5A 3E83A 1VF6C 2M9UA 2OTJA 4LP8A 3PT9A 2X9HA 4M77C 1K1ZA 3FIFA 2VQFB 3JCMQ 2Y48A 3M0QA 2IJKA 1YVWA 2DYSC 1TUDA 2ZCEA 1WLEA 4RAIA 1N8RU 2DYIA 4O2AA 1VYTA 3S3OA 4EMKB 2Y4YA 1K4US 5CIUA 3M9QA 1TXQA 1NH2B 1YI2A 1P92A 4O4JA 3DC6A 2DZ9A 3ZX6A 3EGDB 2XOKG 4PJOD 4M7AG 4M7DE 1PNMA 4LWSA 1G3WA 4IKFA 2UXCO 2XK0A 2HKNA 1Q82R 4HCZA 3A98A 1Q81W 4BUGA 3GNGA 4IUTA 1XBLA 1S1NA 2JVDA 4B3TB 1QVGU 1S76D 2BUDA 4M78D 4IUQA 3AG7A 2Y4UA 4DR3B 4RG8A 2KMTA 4FSSA 2LCSA 5KCOA 3I5SA 2E4HA 1KD1U 3SDLA 3CS5A 2M51A 1G8MA 2A37A 1NQTA 2P6JA 4I5SA 1FYJA 2ZPIB 4XTWA 1DLBA 2JJ9A 1IGUA 2OTJQ 3I55A 2LGWA 4KUMA 2WLNA 2GTSA 1VQKV 4JYCA 1B34B 5L8RE 4PDMA 4M75E 4HT9A 1D5NA 4FM1A 1PV0A 3LX7A 2KGTA 4CI0C 2NR5A 2PGGA 1W70A 4LNUA 1YI2Q 3OYBA 2W6JG 1RL2A 2GV9A 3SDZA 5KUMA 4YJ2A 2DJZA 2EJFA 3C4SA 2PUKB 5CK9A 2VQEB 3X24B 2X6BA 1EBOA 2QTSA 1N5ZA 3CD6T 3T4DA 3JAKA 1K9MC 2GHYA 3SJAC 2L3RA 2YXHA 2QKAA 1Y96B 4JPRA 3JCMe 1UJWB 3RKYA 3CB2A 4NR1A 2EIJC 3CCJT 3K5NA 2OIEA 4ELZC 3DC5A 3RR6A 1OJHA 2K1EA 2RD1A 3RYIB 1YIJT 2KSDA 4HXJA 5LA6A 4N23A 3OYHA 1BYMA 2P22C 5FPRA 2XI9A 2DRMA 3D3IA 4DR1O 4DR5B 1PNJA 3M58A 1JJ2A 2NUTB 1U97A 1X27A 2RJDA 4WFEA 1TWBA 3JSCA 1WX6A 1U96A 5HCKA 5CA1A 5HFMA 3S3WA 2FMLA 3CCMT 5IY5B 1XQHA 2EKHA 5GAN6 1DF4A 2QG9B 2BOCC 2ODMA 2VKNA 4D8DA 4F7UA 5A2QN 4MVMA 3CRRA 3WVEB 1H2SB 3HR0A 3KCXA 4C92F 1G8XA 2DTOA 2LC4A 2H3JA 2YSQA 2RI5A 3N5BB 5IT9E 2CGNA 1FXHA 3S3MA 3GB7C 2MPXC 4Y91A 4E2LA 2ZNJA 1PM9A 4WFHA 4DK1A 4GKJO 1QMCA 1WDXA 2CP5A 4M78A 2D2CB 4ELYC 3OYJA 3RYFA 1VQLT 2LP5A 1GCPA 2EJ7A 4MTFA 2PZ1A 1TU0B 2K2MA 1OCZC 5LXTB 1N27A 1W2BP 5LBQA 2ZIOA 4OMMA 1OULA 2EZOA 4AHCA 5FLXE 4QT7A 4XU3A 5IXBA 2QQAA 1WHHA 1SKVA 3CRAA 2EIKC 4PJOF 5B1BC 5J2UB 3UO2A 1Q82W 1UTIA 3HHTB 1Q5OA 5LYJA 1YJ9Q 4RQFA 2HFEC 2BTTA 2LCCA 1AROP 2Y0IA 5K1PA 5KA5A 3SPHA 2MOXA 2BE7D 4E2FB 4X89A 2OCCC 2FRYA 1Q86U 2K57A 1FMVA 1FMWA 2JOYA 2DL3A 3GLXA 3VS2A 5GMKe 2AKKA 2F66C 4M77F 1Y76B 3OQ5A 3ZFJA 3A5ZB 1JRIA 3VS5A 1E79G 2UXCB 1WXTA 4XK8E 3K59A 2QEXT 2GUZB 1WHLA 3QVNA 1QLEB 2NLUA 4QQ6A 2IIMA 3H1LH 3ULRB 5DEDA 1VQ7Q 4FYVB 2Q9LA 3PN1A 4ZHQB 1JR9A 1H2KA 2H3OA 2KRNA 2JS0A 5H6RA 2PUSA 1UPGA 2ZINA 1EM1A 3SYAA 2Y4XA 2Q73A 5EBWC 5GTIZ 2WLIA 2RDCA 4OXSA 4TV9B 3OSSC 1W0JG 2COWA 1ZAUA 3SB2A 2IM9A 3U10A 4OPHA 2LGQA 1BI0A 1EX4A 1LJOA 3QYGB 2K7AA 1H3ZA 3RMSA 2ZR2A 1X2KA 4RQEA 4J9FA 5GAOr 2PUOB 4R50A 5GAOp 1QBZA 4K35A 2BE3A 3ZMSA 4B3RO 3WG7C 1MNDA 2CYZB 4J6YA 3FX7A 4RO2A 1YJNV 5FROA 1J95A 1Q43A 3JASB 3M0SA 3L75H 5GAMh 4FLZA 2XASA 2WSCE 2YIBD 2YUOA 5GAMg 5IJ0A 1VIFA 2MF2A 5KX5B 3DGEA 5JQGB 5IYCO 2YLCA 2YT6A 2ITDC 1QP2A 2E65A 3MEAA 4J9IA 3BABA 1QHTA 2A79B 2D0QB 5BXZA 4E7IA 1M1GA 3QTCA 3EG3A 5BMVB 1NYFA 1FFXA 2KG7B 3OYGA 2P7TC 1FXVA 5CB4A 4A5UB 1YHQQ 2D8HA 3HL8A 4OGEA 4WFAV 3I5DA 3L1AA 3T2MA 1H8HG 2EJ9A 3X26B 4BI3A 1K8AR 1P49A 3R6NA 3G4SA 2QGNA 2FPDA 3EH2A 1CEZA 3ETEA 3Q4HA 2DL4A 5D6YA 5A0GA 4EKWA 4LNPA 4L87A 4MZMA 1NJIU 5LL6S 2FO0A 4QW2A 1XUQA
chains in the Genus database with same CATH topology
1SF9A 2YXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SF9 A;  2YXY A; 
#chains in the Genus database with same CATH topology
 2KYB A;  1S0V A;  2FB5 A;  1SF9 A;  3CCL T;  1YIT A;  4TSF G;  5LJ3 j;  2FRW A;  2EIL C;  2IJJ A;  4JAU A;  1JJO A;  1K4D C;  2VRZ A;  5HK3 A;  3W7U A;  1HNZ O;  1YJW V;  1U06 A;  2DMX A;  2M02 A;  2XUM A;  2RK2 A;  3GF5 A;  1MG1 A;  3JCM h;  1WNL A;  4Z8A A;  5JJJ B;  1X43 A;  3QZ9 B;  2VWF A;  3JCM g;  4A53 A;  1WGS A;  4XQ3 A;  1W0K G;  3LGF A;  2DXU A;  2QQ9 A;  2YC0 A;  3UF4 A;  2OCH A;  4DR6 B;  4DW0 A;  1L0N H;  4DV2 O;  3ZJZ A;  1JBM A;  2Y69 B;  1L1F A;  1V76 A;  5KYN A;  3G4S Q;  4DV0 B;  3NMZ C;  2JNG A;  2ECZ A;  3AG2 C;  4LFB O;  1VQN T;  3KUF A;  2JM9 A;  3H0H A;  1M3A A;  4U3J A;  4RTU A;  2JDI G;  2EGC A;  1ZA2 B;  2ZZD A;  1VF5 B;  3EFO A;  1HNW O;  2QDY B;  2FTK A;  4OB2 B;  1GRJ A;  2CGO A;  1XNR O;  1VQ8 T;  4JZ4 A;  4AFQ C;  1YIT Q;  2YIB A;  4DV6 O;  4WTO B;  3CRC A;  1QVG S;  2H8H A;  1SQB H;  2PQW A;  2VUB A;  4H37 A;  3CBP A;  1KIK A;  4L5G A;  3UO3 A;  1Z5W A;  2UU9 O;  1QVF A;  1KKC A;  3FKS G;  1W1F A;  1M2V A;  3ZL7 C;  1LUW A;  1YWP A;  4O4H B;  3ETG A;  1ZA1 B;  2ADP A;  3BY7 A;  1Y57 A;  2RI2 A;  3TCJ A;  3CJH B;  2V8K A;  3V8K A;  2E3H A;  3L73 H;  3SPG A;  2G3R A;  2DN9 A;  1VQ5 Q;  4I0X B;  1YWO A;  3HPL C;  4AFZ C;  1ARK A;  4I55 A;  3MPU B;  4FYX B;  3ASK A;  1I1J A;  3ABK B;  2VXF A;  2F93 B;  1YP5 A;  1NZ9 A;  4ME7 A;  3OBW A;  3MHS C;  1V55 C;  4JI2 O;  2CDY A;  2PI5 A;  1VQP V;  3QO3 A;  2KT1 A;  3U23 A;  3OYC A;  2EQU A;  4ZOL A;  4JI5 O;  1I07 A;  1PHT A;  2HZY A;  4JI3 O;  1AR5 A;  2UXB B;  2CH7 A;  2F23 A;  3FB9 A;  2P67 A;  2DWD C;  4UV8 A;  2HKO A;  1M57 C;  2P4T A;  2FPE A;  2W6I G;  3CC7 Q;  4NTW A;  2B5U A;  5BR8 B;  4MMK A;  5CKB A;  2D6F A;  1K8A W;  3ABM B;  2K3X A;  3SYO A;  2Z0A A;  2DM1 A;  2C0T A;  5LMN B;  3VS0 A;  2VWK A;  2LQN A;  2QA4 T;  1FXK C;  1K3E A;  3BA9 A;  2GNC A;  5FNV B;  1OCR B;  2KRM A;  2CP2 A;  1AJN A;  4DYL A;  5CKH A;  2Z3Y A;  4MML A;  1WYX A;  1M56 B;  1EZZ B;  1OU8 A;  1KFZ A;  4X9Q A;  5GJV B;  3K03 A;  4XU0 A;  5JJN B;  3SEM A;  3A0H Z;  3IJ4 A;  1SPK A;  1MSD A;  1GH6 A;  4X1I B;  5H5N A;  4LF4 B;  5KHJ A;  5EG2 A;  1K73 U;  4G27 B;  4JI1 O;  5LP6 B;  2QQB A;  2VV5 A;  3I55 V;  1SEM A;  4LDV A;  5J2T A;  2P0Q A;  4JYA O;  5KYY A;  1J3T A;  2CE4 A;  1N33 B;  3EG2 A;  3RVZ A;  3JSL A;  4GLK A;  2KE9 A;  1W2B A;  4GZR B;  3O65 A;  4D7T A;  4PK4 A;  3CCV T;  2AXT Z;  2QDO A;  1M93 A;  2E76 B;  2KRS A;  3QSU A;  1ROP A;  2ZXW C;  2D9T A;  4M7A B;  3R66 A;  1HYO A;  3SWN C;  4OGC A;  4Z89 A;  2DK3 A;  3ME9 A;  1XHZ A;  2KXC A;  3RES A;  3SJQ C;  3HKC B;  1T0H A;  4BR6 A;  4I9Q A;  2QYZ A;  4RUG A;  4MT8 A;  1K76 A;  3CP1 A;  3IGA C;  3JAT B;  1HNZ B;  5J3B A;  1VQO T;  1VQK A;  1FYN A;  3UT5 A;  1HR0 B;  1VQ4 T;  3MKD A;  2DBM A;  5CBG A;  3OYM A;  1OYX A;  1VQ9 A;  1Q6H A;  3FAV B;  1M90 W;  4LFA B;  5H9C A;  4XTY A;  1R6T A;  1S72 A;  1GXI E;  3EFS A;  3FLG A;  4JDS A;  1TOV A;  2ABL A;  3EAE A;  3HTR A;  2HBW A;  2F4V O;  4I50 B;  2WAM A;  1TUB A;  1BBZ A;  3QHS A;  4D8K A;  4LFB B;  4X34 A;  4DV4 O;  2L3Q A;  2CTQ A;  4NTY A;  3HRU A;  1H8E G;  3V7R A;  4F6E A;  3ZMU A;  4A4G A;  2CP6 A;  2CDT A;  2FYK A;  1FMK A;  2NUP A;  4DBR A;  2L35 A;  4LD9 K;  4M7D B;  1PD1 A;  1TTH B;  5JH7 B;  1X4T A;  3U0Z A;  4ZTF A;  4P30 A;  3L2Z A;  1KMI Z;  2UUB O;  3ZHU A;  1M1K C;  1AHJ B;  4X88 A;  5LJ3 f;  4PLL A;  4GKK O;  2PU9 B;  2E6N A;  1JQQ A;  4EMH A;  1VQK Q;  2L5Q A;  4J42 A;  5LJ3 d;  2JGD A;  2KRO A;  3EG1 A;  1JA8 A;  4BI8 B;  3OY9 A;  3L9D A;  2P0K A;  1KQ1 A;  1ZL8 A;  1WJQ A;  2ROL A;  3P8H A;  3A8M B;  3QBY A;  3LNM B;  3T1H B;  3PVQ A;  4BDZ A;  5IJ9 A;  1QVG P;  3MDS A;  4BIU A;  4M75 B;  4X1Y B;  2H8P C;  3JCM b;  2Q7H A;  1G83 A;  5CCA A;  3VQV A;  3I35 A;  2XU8 A;  1R77 A;  1RAI B;  1AP5 A;  3B4S A;  5ITZ B;  3K58 A;  4RMO A;  1AT1 B;  3JB9 D;  4WBN B;  3ASN B;  3ZHT A;  4UVA A;  4C8Q C;  1WHM A;  4TOI A;  2KY9 A;  4DRX B;  1BI2 A;  2PF4 E;  4LCU C;  3C90 A;  2HSP A;  2CTW A;  4FYY B;  2NUZ A;  5BZB A;  4JUV A;  4JJB A;  3M4G A;  2EPD A;  4PDL A;  3EHQ A;  5LJ5 h;  4I4T B;  4IIM A;  3BRC A;  3ASO B;  5LJ5 g;  2JS2 A;  2QK0 A;  3V7C A;  2HQH A;  2PYJ A;  4J5Y A;  3BA8 A;  5M9O A;  3RBB B;  5GMK i;  2CSI A;  5CKE A;  4X65 B;  1NLP C;  5CA0 A;  2EIF A;  1FJG B;  5KYX B;  1OCO B;  2R57 A;  5IYZ B;  1KKD A;  3HKD B;  3PGG A;  3K08 A;  1J5E O;  2BZ8 A;  3X20 B;  3JCM X;  1OHH G;  1N0J A;  4C8Q D;  5IY5 C;  3OA6 A;  1V54 B;  3R6O A;  3A0B Z;  4RCC A;  5I11 A;  4DV1 O;  2RN9 A;  3SWN A;  1M1F A;  5JWP A;  1F51 A;  1KC8 C;  2IH3 C;  3ZBH A;  3VU3 C;  3FYI B;  3ZRV A;  1X69 A;  2ZPE B;  1MA1 A;  4BD3 A;  4HNA B;  1WA7 A;  4YXW G;  2LO1 A;  2PVO B;  1WQW A;  2EUL A;  2CKK A;  3K5O A;  1UGP B;  1AZG B;  1AJQ A;  1WHG A;  1K9M W;  2D1X A;  1X6G A;  2EBP A;  1Y4M A;  1NT2 B;  3D36 C;  5FPO A;  2X3W D;  2Q7G A;  2QWP B;  4GUN A;  4XDJ A;  2D3O W;  4A4H A;  2JM8 A;  5CO7 A;  2I0N A;  1B04 A;  3D8C A;  1FFT B;  4R0K A;  1BSM A;  1IHW A;  2YUN A;  4OMO A;  4QPJ A;  1LNX A;  3ABU A;  4B08 A;  1N34 O;  4KHP O;  2QTX A;  4FLU A;  1OZ2 A;  4PA7 A;  1GFC A;  2C06 A;  3T9N A;  4RCB A;  1U5S A;  2Q0A A;  1YJ9 T;  1WJR A;  1NU1 H;  2W0F C;  1VIE A;  3EGD A;  2F4V B;  4UCV A;  5EK0 A;  4B3M O;  4DUY B;  1YJN A;  4FLY A;  4U7O A;  5FU7 B;  3WB1 A;  1BQ0 A;  1UJY A;  1NLO C;  1Y0M A;  4MDW A;  1N8R C;  4F16 A;  2BTQ B;  1ZBJ A;  2RPN A;  1E6H A;  2QWN B;  4OML A;  4FU6 A;  3K5L A;  3H41 A;  5CKD A;  1VQ6 A;  4J7J A;  2E41 A;  2VAS A;  3TU4 K;  4LN2 A;  1QLE C;  5GON A;  4PA3 A;  5H2F Z;  2K3B A;  5FRM A;  4DV7 B;  2XAF A;  4OX9 O;  1VQ7 T;  4PV1 B;  3H1K H;  3FJP A;  5KYU B;  3FD9 A;  1G3Y A;  4LF7 B;  2KSS A;  1S77 D;  1BZK A;  5GAN j;  4CS3 A;  4GX0 A;  3RYH B;  3LH0 A;  4FFB A;  4F7U G;  3CC4 A;  1KD1 C;  3G71 A;  1Q81 R;  1IB8 A;  2DER A;  4ZNX A;  3CXH F;  5C6S A;  4C8Q A;  2HL5 C;  4MVR A;  4NXN O;  1ZSZ B;  1YJN Q;  4AG1 C;  2HCK A;  1GBR A;  2RHZ A;  1NTZ H;  1M5I A;  3LW5 E;  5KYW A;  5IT9 N;  3H1J H;  1VUB A;  5JVD A;  5GMK l;  1VQM A;  4M78 G;  5BY1 A;  4F6R A;  1KSW A;  2ED1 A;  4Q6G A;  4JI4 O;  2XDD A;  4AFS C;  1TG0 A;  3CCE A;  3CCU T;  1U8R A;  1SHF A;  1WAZ A;  1RI0 A;  4O4L A;  4XAX B;  1YJW A;  3FB5 C;  3CXC P;  5CBF A;  4ZGE B;  3L2V A;  3RT3 C;  3H1H H;  4NOY A;  2Q67 A;  3P30 A;  1HXD A;  2KYM A;  1I08 A;  2ZIM A;  4PA6 A;  2K3Y A;  2L3P A;  4GLM A;  3G6E T;  5FLX N;  2AKL A;  2EYX A;  3LGL A;  3S6W A;  4YHH B;  3AG3 C;  3H01 A;  3NXS A;  4F14 A;  2E5L B;  3RYC B;  4C8Q F;  3HKB A;  2IH1 C;  1W6X A;  3JAL B;  2RM4 A;  1RM1 B;  4QVC A;  5LGN A;  1HJD A;  2EFI A;  4DK0 A;  1H38 A;  4PD4 F;  1YHQ T;  1VEW A;  2LFS A;  3LH5 A;  4IUR A;  2LQW A;  2Q6A A;  4W4L A;  5JCO A;  1IO6 A;  2XKO C;  2BSK B;  2AZV A;  1PG5 B;  3CPW P;  1IBL O;  3JV3 A;  4X64 O;  1TUG B;  4L59 A;  5GAN 3;  4E7L A;  4TV8 A;  2QI2 A;  1PNK A;  3TXQ A;  3SYP A;  2MK3 A;  2DXB A;  2AHJ B;  2A3Q A;  1VMG A;  3CCJ V;  1NS1 A;  2A3L A;  1TUC A;  3F70 A;  4X20 A;  1MAB G;  2HAX A;  1YJW Q;  1Q3E A;  3K0D A;  4M7A E;  3M0U A;  1OU9 A;  3T1Y B;  4MTO A;  1H8K A;  3GIB A;  3ZRX A;  2YEV A;  3EG0 A;  4ZN3 A;  2XAQ A;  4XTX A;  1IBK O;  3QPH A;  1GN4 A;  1K4C C;  2ATC B;  4C92 D;  3AEI A;  5B5E Z;  1GCQ A;  1GBQ A;  2HSE B;  2DA9 A;  2DET A;  3K06 A;  1P7G A;  2QGG A;  2CK3 G;  4FSX A;  5B1N A;  3OGI B;  2RA2 A;  1YZB A;  3CEI A;  2WLK A;  5DM6 V;  1N34 B;  1VQP A;  1I4K 1;  1QCN A;  3MD0 A;  2KXD A;  2Y69 C;  1W4S A;  4JI0 B;  3ZRW B;  3WU2 Z;  5CBH A;  1RUW A;  4PKC C;  2YUQ A;  2UUC B;  4BE2 A;  2N04 A;  1M3B A;  3BCC H;  2EQK A;  2DMO A;  4XBF A;  1RSO B;  2YUA A;  1O75 A;  1YCI A;  2EJG A;  4JLI A;  3OW2 U;  1Q86 C;  1WA8 B;  2NN4 A;  3DLM A;  4JRP A;  1M4Z A;  2XHC A;  1YIT T;  1MSW D;  2JIZ G;  1K5S A;  4JZ3 A;  4ZHQ A;  3PJS K;  4FLT A;  1PC0 A;  2O4X B;  2WAC A;  1QVG A;  4DUZ O;  1FD9 A;  1KHI A;  2VGM A;  4NTX A;  1MMM A;  4FPP A;  1I8F A;  1VYV A;  4YY3 B;  2O31 A;  1XMQ B;  2X4W A;  1M30 A;  1QKW A;  2RF0 A;  4AQY O;  4OX9 B;  1N0N A;  5EYP B;  4M77 D;  2WPD G;  2DL7 A;  5B3S B;  3OR7 C;  1MMD A;  3PIO A;  4UC4 A;  2F1L A;  2Q69 A;  3LSS A;  2YSU B;  2DEU A;  2L2P A;  2O01 E;  2DE0 X;  1VQ5 T;  2Q8V A;  4BY6 B;  1S3J A;  3ZHQ A;  2JTE A;  1VQP Q;  1QVF P;  3OTO B;  2F2X A;  2JMC A;  3J80 E;  5DLO A;  1RLQ C;  1TAE A;  3ABK C;  1XNQ O;  1VQ9 V;  1LR1 A;  2EQJ A;  3E8F A;  1S72 V;  4TQD A;  4UCO A;  1IVS A;  1PSF A;  3CBO A;  1SQQ H;  1RAB B;  3L72 H;  4EPC A;  4FLV A;  2AT1 B;  2AGA A;  2QSA A;  4NXM O;  2QEX V;  1NVP B;  1BQZ A;  1ZUY A;  1YTF B;  1NYG A;  3CCQ T;  2EWN A;  2QKC A;  1Z9Z A;  3E86 A;  3NPF A;  1GN2 A;  1GN3 A;  1YXB A;  3CC7 T;  5HK0 A;  3STL C;  3VS7 A;  2P5O A;  3SR2 C;  4C92 A;  3ABM C;  3A2F A;  4EB6 B;  4UUJ C;  1I5X A;  3VQY A;  1MHN A;  1VIB A;  4O4I A;  2DQ0 A;  4LFC B;  5IHK A;  3BHP A;  2DIL A;  1OCR C;  5DM7 R;  3J81 E;  4Z88 A;  3ZBD A;  1BE3 H;  1M56 C;  4IHJ A;  5DEC A;  1QU7 A;  3A0R A;  3I55 Q;  4MVO A;  1MZE A;  3CE2 A;  1XNI A;  2YRV A;  1URF A;  1XMO B;  1FX7 A;  5GAN f;  5KMG B;  1JXM A;  4J9B A;  1BHA A;  1YCY A;  1TSF A;  3QYH B;  5GAN d;  2W0X A;  4UCU A;  5B1A B;  3WFV A;  1E6G A;  5LP6 C;  2QAZ A;  3E22 B;  2JGU A;  5GAN e;  4PJO A;  3NTK A;  4C0F A;  1ACM B;  1JVM A;  1NJI C;  1AI6 A;  1QKX A;  1SKU B;  2CAZ C;  3MET A;  1HSQ A;  1BCM A;  5D6X A;  1BKB A;  4DR2 B;  3RW0 A;  3APO A;  3U11 A;  4M7A C;  1SC5 B;  1VF6 A;  4FM0 A;  4GYC B;  4ZI7 B;  1QP3 A;  4O2B A;  1N6A A;  3ABL B;  4M77 A;  5GMK m;  1JJ2 U;  7AT1 B;  1AWJ A;  1DJ7 B;  5A0D A;  1WFW A;  4UVB A;  4IGG A;  1GTO A;  4DO2 A;  3A8L B;  3ZEH A;  5LHG A;  2UUA O;  1NBE B;  3CMA A;  1I5Y A;  4O5V A;  3MP6 A;  1M8V A;  1GN6 A;  2GGR A;  3ER0 A;  3REA B;  3LSQ A;  2RH2 A;  3HKE B;  4KFM A;  4MDX A;  2JJ2 G;  2OAW A;  2LCL A;  1Q90 D;  5JJE B;  3CYO A;  3X28 B;  4PI2 A;  3S3X A;  2E75 B;  5IAY A;  2DNU A;  3E8B A;  1WJZ A;  4UFZ A;  4X9D A;  3F5T A;  1QVP A;  3DSQ A;  4MTG A;  3N27 A;  3HFN A;  5GAO m;  4J41 A;  4Y92 A;  2E6Z A;  4C5G A;  1Q7Y C;  4FLX A;  4NYK A;  2LRQ A;  4M7D C;  1PL4 A;  1GM7 A;  3ZHR A;  3TQ7 P;  4NL3 A;  4JS4 A;  1IZ6 A;  2JTM A;  3QO7 A;  4IL6 Z;  4MW3 A;  3E2U A;  2A7Y A;  3KBG A;  5DY9 A;  4DA4 A;  2ESW A;  3QDF A;  1CSK A;  2EYZ A;  1NG2 A;  1G6U A;  2RJZ A;  3BAA A;  1R8O B;  1VQK T;  1GFD A;  2DEQ A;  3DXR B;  1H64 1;  4XTV A;  3CC2 V;  5AYF A;  4IYI A;  1R73 A;  4O2A B;  2W0Z A;  1KC8 R;  4LF9 O;  1AI4 A;  1QQJ A;  1M27 C;  2VB6 A;  3OMN B;  3L2R A;  1RAE B;  3EGU A;  1SQV H;  4AI8 A;  4M75 C;  3CXC A;  1HNX O;  3HFO A;  2QE7 G;  1JPX A;  4O4J B;  2AZS A;  3CCR T;  1KP3 A;  1XNQ B;  4J10 A;  2DQ3 A;  1NTK H;  4LWS B;  4JV5 O;  2EVR A;  3QXE B;  3LLR A;  4M7D D;  3D3Q A;  3ASN C;  5FL7 G;  5I22 A;  2EQI A;  4RTV A;  3EVK A;  3OYA A;  3F7Y C;  1UUE A;  5D7U A;  1IRX A;  2XAG A;  2JXB A;  2VS0 A;  3NTH A;  4KUD K;  4RTY A;  4G28 B;  3VS6 A;  1F4N A;  2BOB C;  1R3K C;  3OYI A;  2FEI A;  4GX5 A;  1JMK C;  4TVR A;  1VQ6 V;  3PTA A;  1M1K W;  3CPW A;  1AR4 A;  4B7E A;  1FPO A;  2F69 A;  1F4M A;  2YWW A;  3QO8 A;  4JTA B;  2CGH A;  4DBH A;  1JFF A;  1JOY A;  1ABO A;  1GL5 A;  4K0K O;  4WCE V;  2WSF E;  3BW1 A;  1UFF A;  4DW1 A;  2OI3 A;  4M75 D;  4ANJ A;  1R3I C;  4PI0 A;  4DR7 O;  4ZN1 A;  4DR1 B;  1OCO C;  4CS2 A;  4FM2 A;  2ZD9 A;  2YIA A;  4LNU B;  4AFU C;  2FYU H;  4PHZ A;  1ENV A;  2A28 A;  2GSM B;  2M6Y A;  4YJ2 B;  4PL6 A;  1YDX A;  2GBQ A;  3EGX A;  4V2S A;  1NI8 A;  1YN8 A;  3CC4 V;  2XHB A;  3G71 V;  3TGU H;  3P3P A;  1GMG A;  4OGQ B;  4MVZ A;  2BIV A;  1V54 C;  2DTH A;  4K8Z A;  1K73 C;  4UCR A;  3EG9 A;  2CTP A;  3C95 A;  1OPL A;  1QNM A;  2FL4 A;  1S5L Z;  1ABQ A;  4CRI A;  2GQV A;  2QA4 V;  4DV3 O;  1VQM V;  1XI1 A;  2EGE A;  2OIG A;  2M0Y A;  3N2G A;  2LT1 A;  3AG1 B;  3PVL A;  4R8C A;  2JW4 A;  5LA6 B;  4GKJ B;  1QWE A;  2KAF A;  3CCE V;  2V4D A;  2ENM A;  3B8M A;  2KT8 A;  2L8D A;  5C8Y A;  4WCI A;  1I0H A;  2KQX A;  2HVJ C;  1LNQ A;  3QDR B;  4E6R A;  1O9H A;  4R6Z A;  5CA1 B;  2E3I A;  5L3D A;  2FHD A;  4M7A F;  4FLW A;  3RDV A;  2GF7 A;  1V1C A;  4E7S A;  1OCC B;  3TK1 A;  4LH6 A;  4H0L B;  4X62 O;  4F7U B;  1AVZ C;  1Y74 A;  2DF6 A;  3OW2 S;  2AZ2 A;  2IBZ H;  2BCC H;  1NPP A;  4M7D A;  2MCN A;  2QM8 A;  3CCV V;  1U1T A;  2PZS A;  3QG1 A;  3BEH A;  4J8O A;  5KA6 A;  1ZSP A;  3P8B B;  3NGP A;  1WJS A;  1V9P A;  4K3A A;  2JZ2 A;  1Q7Y U;  3K9S A;  1M90 R;  1CKA A;  4M78 B;  2E70 A;  3QUI A;  1VOM A;  2DD5 A;  3BVO A;  4B3S O;  2GFU A;  3RYF B;  1KC8 W;  1EN6 A;  2QWO B;  3A8H B;  5A9G A;  1E1R G;  4FVM A;  4QE9 A;  1Q8I A;  4HVW A;  1ZX6 A;  2BTO A;  1VQ4 V;  2RB6 A;  2EYW A;  3VOU A;  1D3B A;  3P8D A;  2J06 A;  2P90 A;  2V1Q A;  1R6K A;  4L6V 5;  3JAW A;  3Q1J A;  3B40 A;  4JPB W;  2VWJ A;  4M75 A;  4JF3 A;  3ML0 A;  3M8A A;  5LYJ B;  4M7D F;  2HEP A;  1I94 O;  4FJC C;  1X6B A;  1K33 A;  3GWK C;  1ZQ1 A;  4F04 B;  4OMP A;  2ZM6 O;  4CC3 A;  3CD6 A;  4X66 O;  1K0X A;  2MWP A;  5A2Q E;  1K97 A;  1PD0 A;  1I5L A;  3JAR B;  3VYG A;  2IG0 A;  4IIJ A;  1ZUK A;  3V8L A;  1FKA O;  2MK5 A;  1JB0 E;  1H2G A;  3SD4 A;  3CCJ A;  5J26 A;  4CH3 A;  4HCK A;  2CH4 W;  3VRZ A;  2YIC A;  4JZ2 A;  3JD3 A;  1KBH A;  4JV5 B;  3M4Y A;  1YIJ A;  4J7F A;  1LCK A;  4B3R B;  1K7D A;  2R70 A;  4I4T A;  4A63 B;  5KH6 A;  1N8R W;  5HFL A;  2CP7 A;  4A54 A;  4M75 F;  3H8Z A;  2NYS A;  2EIM B;  1IBM O;  4PJM A;  5GMK h;  3CME V;  1IUR A;  1KHC A;  3OT7 A;  2WA4 A;  1TUE B;  5LMU O;  1AR1 B;  1NM7 A;  3CCM A;  2Q7E A;  2X3X D;  4N4I A;  3KXT A;  2WLI B;  2QXF A;  2XT9 A;  1AWW A;  3JB9 G;  2ZNI A;  4DV5 O;  2X4J A;  3L2Q A;  1RM1 C;  1H3H A;  2RHY A;  3I56 V;  3OSV A;  2J6F A;  4PA9 A;  1AD5 A;  3MEW A;  2X4Y A;  3O8V A;  3LWI A;  1Q6I A;  1WNS A;  4MS2 A;  1KD1 W;  3P32 A;  1RAH B;  2XTA A;  3CCJ Q;  5EBL C;  1P84 F;  3OEH G;  2YI8 A;  1X01 A;  1VQL A;  3H0I A;  5IXF A;  5EC7 A;  2UXD O;  5FU6 B;  4BDY A;  3APQ A;  5IJ0 B;  4JYB A;  1Y07 A;  5L3F A;  3IQL A;  5LL6 Y;  3RWR D;  2DTI A;  5KHI A;  1UE9 A;  2LQ8 A;  1TVK A;  1QCF A;  1JJ2 S;  3SGI A;  3EFF K;  1S5H C;  5L3E A;  2A0F B;  2F2W A;  3HKS A;  2E10 A;  3CCS T;  3LUT B;  2ED0 A;  3BFM A;  2LQT A;  2ETN A;  4PDR A;  4QNH B;  1Q95 G;  4AMC A;  1PPJ H;  5E1A C;  4C8Q G;  1W59 A;  1Z2G A;  5CB4 B;  2P84 A;  2WLL A;  3G80 A;  4N0A C;  1Q81 U;  1JU5 C;  1BMF G;  4C0G A;  1YFN A;  4EMG A;  5EZY A;  3F7V C;  5I21 A;  3HPW A;  2XND G;  5FWB A;  3NTI A;  4QKU A;  4B9W A;  3E35 A;  5GAN 8;  2WSS G;  3Q4H B;  4KH0 B;  3OS0 A;  4BE1 A;  4NB5 A;  4DV2 B;  4PJL A;  3IC7 A;  3QZ5 B;  1W2B U;  2F5K A;  1ZUQ A;  2E74 B;  2QEX A;  1K9M R;  2R9A A;  4Q20 A;  4EMK C;  5LOV A;  1UGS B;  5K1X A;  4OB1 B;  2XMF A;  1PL0 A;  5IE9 A;  2HHH O;  4NS5 A;  3JD2 A;  1HNW B;  2QWR B;  3MHH C;  3UDC A;  1XNR B;  3GWO A;  1Y7X A;  5KUK A;  4CC5 A;  3N2K A;  1BI1 A;  4DV6 B;  2VYT A;  4B3S B;  2ZE8 A;  1AOJ A;  2MAM A;  3AT1 B;  4GX2 A;  2RMO A;  1AP6 A;  2UU9 B;  2LZ6 B;  3SPJ A;  3FB7 C;  3QO5 A;  3K04 A;  4UV9 A;  1SA0 A;  3E2E A;  1EFN A;  1CKB A;  1VP7 A;  2N74 A;  3OYL A;  4RG2 A;  1THZ A;  3TSZ A;  2H94 A;  2DYB A;  1PRM C;  1VQ9 Q;  5LJ3 e;  3HP9 A;  3FB6 C;  2FB7 A;  2YUP A;  3PMT A;  1S72 Q;  4ZKI A;  2XG8 D;  2OTJ T;  2CT3 A;  2ATK C;  2MW2 B;  2KKW A;  1IGQ A;  2AK5 A;  3ICX A;  4U3J B;  1NJI R;  4RTT A;  4BY6 C;  3EFO B;  3SPC A;  1OV9 A;  2QEX Q;  3CMA V;  4D6W A;  4ZGJ B;  1NH2 D;  4TUY A;  1PCX A;  2DRK A;  2H3E B;  4LF8 O;  2YXY A;  1KQS U;  1YI2 T;  3JAM E;  2ZT9 B;  5DN6 G;  4JI2 B;  3TJT A;  4JI5 B;  5B1O A;  2EJR A;  4JI3 B;  3F5W C;  1FXK A;  2EGA A;  2VC8 A;  2GBO A;  2J6O A;  4YIO A;  2MYS A;  1M2V B;  2KR3 A;  3E1S A;  1HP8 A;  1SZX A;  1Q86 W;  1SQF A;  2V1D A;  3QJ6 A;  1N9S A;  1H92 A;  1AWX A;  1KB9 F;  1G3S A;  1IBM B;  2HQE A;  4ABM A;  4JI8 O;  1DGS A;  3C3T A;  4O6J A;  2QM4 A;  2DX1 A;  4WF2 A;  5FWC A;  5CMU A;  2QTV A;  4N4G A;  2DJV A;  4EFE A;  2DLP A;  3UT1 A;  1EN5 A;  4I55 B;  1P4R A;  3CSX A;  3WG7 B;  4GT1 A;  2DO3 A;  2K9G A;  4GY5 A;  2ZPG B;  1JO8 A;  4JI7 O;  4J9D A;  3CCL A;  4Z1V A;  2K5L A;  1COW G;  3WB2 A;  8AT1 B;  3CRM A;  3OB9 A;  3I55 T;  4JI6 O;  2N05 A;  2WSE E;  2O9S A;  2IPO B;  4ZOL B;  1RAF B;  1R0B G;  2FVU A;  5IWA O;  2CH7 B;  1N36 O;  2DL8 A;  3CCU V;  1I5O B;  5B1A C;  1JCH A;  4JI1 B;  4LBE C;  1BIA A;  3CBM A;  1O9S A;  1Q82 U;  2B1I A;  1YBY A;  4JYA B;  1MMN A;  2FZK B;  5GAM j;  4OF1 A;  1TH7 A;  1WQ7 A;  3CRQ A;  4X1K A;  3TXS A;  3H9V A;  3OMG A;  4A4F A;  4MVQ A;  2KBT A;  4FW2 A;  4JJC A;  3BDL A;  2ZKO A;  4LE9 A;  5IHI A;  3A8G B;  4AG2 C;  2HLD G;  1VQN A;  1OEB A;  3CC2 A;  3B2E E;  4C0Z A;  1VAR A;  4IYH A;  1QR8 A;  4J11 A;  3STZ C;  3OS1 A;  3KZI Z;  3J80 N;  2FZC B;  2PYL A;  2V26 A;  2Q0O C;  2LJ2 A;  4EMK A;  1EZV H;  2B86 A;  2ZPF B;  4IT5 A;  5ECA A;  3UCS C;  4PLI A;  4F7U E;  5J2T B;  4JRI A;  5KYY B;  2HMA A;  4PJO E;  1CPY A;  2AHY A;  2IW5 A;  1T3L A;  2LW1 A;  1WHJ A;  1P7B A;  1UEB A;  4DV4 B;  4XDL A;  1D5A A;  3K3W A;  1FS0 G;  5C93 A;  4OMN A;  4C92 G;  5H6Q A;  2BZY A;  4KP4 A;  1XDC A;  4M78 E;  4JJN K;  4C5E A;  3ZRS A;  2P0P A;  1K0S A;  4GCZ A;  2OTL V;  5CVI A;  4C0D B;  3RN4 A;  2VQF O;  1SES A;  4OPA A;  1NJI W;  2O2O A;  2RQU A;  4FW1 A;  4M77 E;  4CH6 A;  3J81 N;  2JUF A;  1KUQ A;  2P4R A;  2UUB B;  3UT5 B;  3CC2 Q;  1GK9 A;  1NEB A;  1WP7 A;  4GKK B;  3LDE A;  1B34 A;  1K92 A;  2DIG A;  3CPF A;  3EXA A;  2HR3 A;  4D7S A;  3JD0 A;  5KHH A;  2DXC A;  1TUB B;  1WHK A;  4PJO G;  2DWE C;  2R9I A;  5EIB C;  2P4V A;  1E7O A;  4FZ1 A;  4FFK A;  3WB0 A;  1RAA B;  1QWF A;  4J7K A;  2D8J A;  4BW9 A;  4B3T O;  2NUP B;  2QA4 A;  2K9P A;  4DR3 O;  1L8D A;  1Y96 A;  1V29 B;  5KAF Z;  2YHT A;  2X4X A;  2Y90 A;  3MHX A;  2OYQ A;  4EB6 A;  1C0M A;  1G3T A;  4M77 G;  1OZ0 A;  3UKM A;  2C0I A;  3L2U A;  1IXM A;  1SQP H;  4YIP A;  4DR4 O;  4DEX A;  1VQ6 Q;  4KL1 A;  3RYI A;  4BIZ A;  3E8H A;  2X6C A;  1M9N A;  2K2V A;  1FWZ A;  2JGD B;  3ETQ A;  1US6 A;  4RTZ A;  4FCY A;  1OV3 A;  4JI8 B;  1NR7 A;  2HQX A;  3MEU A;  1ZL8 B;  4RTW A;  3LDD A;  2NUT A;  4PFP A;  4UCS A;  5IJ9 B;  3NFC A;  5EIB D;  4X9C A;  4PNO A;  2VQE O;  3CC4 Q;  2UXN A;  3R65 A;  3G71 Q;  3CCV A;  2RMK B;  1WPB A;  1WN7 A;  2R58 A;  3HRT A;  1BI3 A;  2K6D A;  2CUD A;  2CSQ A;  3G67 A;  3JSN A;  3MCA B;  4QE7 A;  2OJ2 A;  4PA4 A;  3LYI A;  4JI6 B;  1UHC A;  1WI7 A;  3CCQ V;  2ZGW A;  5LJ3 g;  3CD6 V;  4BIO A;  1J5E B;  2QA4 Q;  2CZ6 B;  4GBQ A;  1VQM Q;  3A1P A;  2DKG A;  5IWA B;  2O57 A;  1T5E A;  3L70 H;  1BK2 A;  1VQO A;  1QLY A;  5KE3 A;  4DV1 B;  2SEM A;  2JRI A;  3PMI A;  1VQ4 A;  4ASU G;  4ZI7 A;  2CTR A;  3CCE Q;  1U3O A;  3D36 A;  4DR5 O;  3VRY A;  4HZ3 A;  3JD4 A;  3OMC A;  1FXX A;  2A9H A;  1MV3 A;  3A8T A;  1YIJ V;  5EC1 C;  5LXT A;  3NHN A;  4ZTJ A;  4BAC A;  3AG1 C;  1X59 A;  4Q5W A;  1RP3 B;  2KI7 A;  3ZMZ A;  2EIN B;  3E9F A;  3ZMV A;  1GKF A;  1DK1 A;  2E1H A;  5CA0 B;  5J2U A;  2LX9 A;  2WWW A;  2CH4 A;  2DPP B;  1W2B S;  2OT5 A;  3DB4 A;  2YID A;  1MV0 B;  4QVD A;  3CCV Q;  3CCM V;  1BS3 A;  2EBO A;  1H2L A;  2M1H A;  1G1X B;  5LHH A;  2X0L A;  3LDC A;  3M5A A;  4OB0 B;  4DOW A;  5GAO n;  4KHP B;  2ZXW B;  3TEE A;  1VYU A;  1OCC C;  2JT4 A;  3CEY A;  4UB8 Z;  4JAA A;  2LW7 A;  1WPY A;  4KGV B;  3AG4 B;  3G4S T;  1MGQ A;  3VBB A;  1Y76 A;  4P9O A;  4B3M B;  1A32 A;  1MNE A;  1L0L H;  4HAM A;  2CS7 A;  2GUZ A;  1NBM G;  5CQY A;  3M59 A;  3UAT A;  3M0R A;  1VQ4 Q;  1YEW A;  1OOT A;  3CME A;  4N4H A;  4M78 C;  1VQL V;  1BT8 A;  2ADQ B;  1XEQ A;  2JS3 A;  1K73 W;  2QDL A;  4J83 A;  3JRZ A;  5IH2 A;  1XHX A;  4QVZ A;  5GAM f;  2LP7 A;  1KP2 A;  2QAS A;  3DXR A;  4BW5 A;  2K5F A;  3OYK A;  3LWH A;  3MP1 A;  4K11 A;  4H13 B;  5GAM d;  3I56 A;  2E3C A;  3B77 A;  2V8I A;  4DQ2 A;  2IU0 A;  4TV9 A;  3AK1 A;  2CUB A;  2CZ1 B;  5GAM e;  1K8A U;  1B3Q A;  4DBF A;  4HA8 A;  1YSC A;  2DYR B;  1C1A A;  1WZO A;  1LOJ A;  5GW7 A;  5KHK A;  1KQS S;  3ZS8 C;  2GCX A;  4XTZ A;  2QM7 A;  4ATO A;  2HNI A;  5C0M A;  4N21 A;  3JAS A;  5TIS Z;  4NXN B;  1PWT A;  2B1G A;  1IRE B;  2D0N A;  1H2M A;  2Y4T A;  4B7K A;  4CBC A;  5JQG A;  5KX5 A;  4R56 A;  3OS2 A;  4R55 A;  4J80 A;  3CME Q;  1WLP B;  1TS9 A;  1AIL A;  4JI4 B;  2LT4 A;  1A0N B;  5GON B;  2HDA A;  2R5M A;  1XRE A;  4IUU A;  5HY6 A;  4DR4 B;  2EIM C;  5J9P C;  2HJD A;  1AI5 A;  3P3N A;  5IYB O;  5BMV A;  4CC6 A;  3I9Q A;  3RKW A;  2PI4 A;  2KG7 A;  3FFQ A;  4HYO A;  2XDB A;  3I56 Q;  1VA7 A;  1XOU A;  1LUV A;  4FFB B;  3VYH B;  3ZN1 A;  2RO0 A;  3TET A;  1YNZ A;  1GM8 A;  4G2K A;  3W7S A;  2V7Q G;  5LHI A;  2F2V A;  3M0T A;  4QQD A;  1HW7 A;  4II1 A;  4PFO A;  3JCM f;  5GTH Z;  4C8Q B;  3CCR V;  2WLJ A;  2YDE A;  1QLN A;  2BZX A;  3PE0 A;  1JEG A;  1JX9 A;  3MJX A;  5KYW B;  3JCM d;  4KBM B;  5CR2 A;  5JVD B;  3OYN A;  1XL6 A;  3K5M A;  1XTD A;  4E4E A;  2EW3 A;  4F6R B;  2RJF A;  3JCM J;  3L2W A;  1M1K R;  1R1B A;  1M90 U;  1BU1 A;  2BKD N;  1IBL B;  2MMP A;  4X64 B;  3C0C A;  2PTK A;  2E5K A;  3G6B A;  5FU6 C;  4O4L B;  3PIP A;  1DTO A;  5GAN 4;  2EX3 A;  4MTX A;  4BAY A;  1PD3 A;  1TA8 A;  4JRQ A;  4WFG A;  1ZSG A;  1R6N A;  1EIF A;  2IU3 A;  3C12 A;  3VQW A;  1QCO A;  4UVC A;  3FDR A;  1WB8 A;  5J39 A;  4M75 G;  1GRI A;  1PSE A;  4CH5 A;  5LJ5 j;  2RJC A;  2XDP A;  3UA7 A;  3H0F A;  3ZHV A;  3HKB B;  3OYY A;  4RKU E;  1H2N A;  1YJ9 A;  2A06 H;  5KAI Z;  1IBK B;  2HP8 A;  2R72 A;  5D6W A;  1NR1 A;  2ITC C;  2X51 A;  4E7K A;  2HBP A;  1OX9 A;  3ZCC A;  4XDK A;  4KGZ B;  4NKG B;  4JYY A;  4EDU A;  1M3C A;  4CS4 A;  2DJQ A;  3G6E V;  2LVM A;  4X8A A;  4E7Z A;  4TV8 B;  3ZED A;  4CC4 B;  3W7W A;  3IC9 A;  3ZN0 A;  1F7Y A;  3UPU A;  4QGP A;  1KQ2 A;  3CCL V;  4BB7 A;  4LDU A;  2E64 A;  2COZ A;  1OQK A;  5EC2 C;  5A0L A;  1B7T A;  3K79 A;  4YJ3 B;  1B06 A;  2PY5 A;  4X20 B;  1D1A A;  1VQ7 A;  4VUB A;  2X35 A;  2ZPB B;  3OR6 C;  1Q6U A;  1ZTE A;  4M7A D;  1M9S A;  2YEV B;  2HL3 A;  4C5H A;  4O4H A;  1T3S A;  4DR6 O;  3TSW A;  4F7U F;  4HCB A;  1ZLZ A;  1RFY A;  4TT3 G;  2LTO A;  3WXM B;  4DOV A;  2YRC A;  3CJH A;  4DV0 O;  4DUZ B;  4JZG A;  3SYQ A;  1UFI A;  1GAX A;  4I0X A;  5D5Q A;  5L3B A;  1JXO A;  4MSW C;  3IAY A;  2RJE A;  3BPZ A;  4LH7 A;  4I7Z B;  4AQY B;  4M78 F;  3CMA Q;  1G4Y B;  3JAR A;  1VQN V;  2LJ0 A;  1D0X A;  3D7S B;  4B9X A;  1VQ9 T;  4FK5 C;  1S72 T;  2CT4 A;  3CCU A;  1N32 O;  4MZT A;  3HB3 B;  3CX5 F;  1VQ8 V;  5GAN 2;  4OMQ A;  4NVP A;  2RQV A;  2FL7 A;  1K5Q A;  3M99 B;  4J7Z A;  4B6M A;  4UXN A;  4FL6 A;  3T1C A;  5I2S A;  2L89 A;  4NXM B;  3VS4 A;  2LNH B;  2O9V A;  2GTA A;  3UA6 A;  3INZ A;  2AW9 A;  2K79 A;  1AI7 A;  3THO A;  2EZP A;  5FNV A;  2FPF A;  1PP9 H;  2VXE A;  2YI9 A;  1SSH A;  4HKE A;  1YHQ A;  1KQS P;  1SQX H;  1UGQ B;  4JGS A;  5CN0 A;  3ASO C;  1EZJ A;  4C7U A;  2CZ0 B;  3CXC U;  2DXT A;  1N8R R;  2UXB O;  3M56 A;  4X1I A;  1NPR A;  1BL8 A;  5LP6 A;  1UEC A;  2ZR3 A;  1OX8 A;  3O5Z A;  3CCU Q;  1K9M U;  4EFB A;  5BR8 O;  1F1B B;  3QWY A;  4IIO A;  4BE0 A;  2BE9 B;  1T0J A;  5LMN O;  4ICG A;  2JMA A;  3VKI A;  3AG3 B;  1NE8 A;  3JAK B;  2GQI A;  2CZ7 B;  4J6W A;  2OTL A;  4M7A A;  1WPX A;  1AVM A;  1YCS B;  3EH1 A;  1Y6X A;  4FT4 A;  3HKC A;  4C92 B;  1IZ3 A;  4OMF B;  2RHU A;  2LJ3 A;  3CPW U;  1G5V A;  3OE7 G;  3FEO A;  5HKC A;  3ZHS A;  3JAT A;  4O4I B;  2YRD A;  3HRS A;  1KD1 R;  2RQR A;  4CH4 A;  3FAV A;  4IUV A;  4PDV A;  2WLH A;  4LF4 O;  1YF2 A;  4M4Z A;  4IHJ B;  3JB9 I;  2DW4 A;  2KEA A;  1N33 O;  4I50 A;  2RQT A;  3K9A A;  2A36 A;  4KRT A;  2UUA B;  3DLL A;  1Q81 C;  4W4K A;  3M57 A;  5AT1 B;  3W7X A;  5GAN 5;  3AK2 A;  1RAC B;  3JAM N;  1XL4 A;  4PJO B;  1SZT A;  2J05 A;  3X2Q B;  2RHI A;  3OM3 B;  2UXX A;  2R5A A;  1I81 A;  3H1I H;  5D5P A;  5JH7 A;  2DVE A;  4J9E A;  5FU7 C;  2OTL Q;  3GPL A;  1HWY A;  2WLM A;  2EQM A;  2QGF B;  2NNU A;  2MI6 A;  1ZX3 A;  3RGB A;  1HR0 O;  4WF9 V;  4DEY A;  1LPL A;  4BWA A;  1IXD A;  4JTC B;  1XIL A;  1RAD B;  2C0O A;  2DIQ A;  2O88 A;  4LDX A;  4R7C A;  3CCS V;  4LFA O;  4Z02 A;  4J9Z B;  4P9P A;  1QQC A;  3LNN A;  3M7M X;  4O2B B;  5GAN h;  4CC2 A;  4M77 B;  1VQ5 A;  3BFR A;  1VQO V;  3EHR A;  4C0D C;  2F95 B;  5GAN g;  3IFX A;  3RVY A;  2DYS B;  2DD4 A;  1PKX A;  2DZC A;  3CC2 T;  5LJ5 f;  1X6O A;  2JTF A;  4X1Y A;  2JN0 A;  4HVU A;  2PTM A;  2B8A A;  3JCM V;  1BGY H;  4E7H A;  5LJ5 d;  4Y28 E;  3CCQ A;  2W10 A;  1ZWI C;  4RTX A;  5LJ5 e;  5ITZ A;  3V8J A;  4U7N A;  2GFA A;  3VUZ A;  4LF9 B;  4WBN A;  3E9G A;  1N32 B;  3JCM W;  3CC7 A;  3MO8 A;  1ZSZ C;  3J7A U;  1SQG A;  4DRX A;  1HNX B;  3O9O A;  1YJN T;  2HVK C;  4F17 A;  4KGX B;  5GJW B;  2P4K A;  2XAJ A;  1QVF U;  3SYC A;  2FG0 A;  2LDM A;  4JS5 A;  3S3N A;  2L0A A;  3SJB C;  3GBQ A;  4PEL A;  4LC1 A;  3RNJ A;  3T1H O;  5I2M A;  1VQ6 T;  2K5I A;  2RQW A;  3OEE G;  1RPR A;  5F2V O;  3URG A;  1ORQ C;  3JCZ A;  3KCY A;  4FZ0 A;  2DAQ A;  4JLG A;  3J7A F;  5KYX A;  2OTJ V;  4ESR A;  2YDL A;  1GM9 A;  2YLB A;  5IYZ A;  3UWN A;  3B8N A;  3HKD A;  3M54 A;  3TRE A;  2SRC A;  3VS3 A;  4E47 A;  4EIK A;  5E79 Z;  4LDW A;  5L23 A;  4C8Q E;  3CCQ Q;  2OWO A;  2B9Z A;  4K0K B;  1CXZ B;  2I2L A;  3GP8 A;  3CD6 Q;  1EFR G;  3CC4 T;  1Q86 R;  1KYO F;  5EBM C;  3BE3 A;  3G71 T;  4QIW F;  2JEU A;  4RWU A;  4DR7 B;  5IYD O;  2XIC A;  1YI2 V;  2IVW A;  4DBQ A;  1F23 A;  1KJW A;  4WFB V;  2EIJ B;  5KCH A;  1XOV A;  1CP9 A;  2QQR A;  1PKT A;  3EFR A;  4HNA A;  1VQM T;  1YIJ Q;  1IDS A;  1QR9 A;  5CAI A;  3ABT A;  3UQ8 A;  1Q82 C;  1MMG A;  4X65 O;  2KQW A;  2ZAE A;  3CCE T;  1FJG O;  3RKX A;  3OYE A;  3OGC C;  4DV3 B;  2COY A;  1YJW T;  5LGT A;  1WP8 A;  4RUE A;  2OX7 A;  2ZE5 A;  4GLX A;  4LF5 O;  3VJP A;  1VF7 A;  1JFF B;  1SHG A;  2Z5U A;  2C2A A;  2EIN C;  1XJW B;  3RFR A;  3CCM Q;  2ZDI C;  1FFX B;  2DL5 A;  4LXC A;  1D0Y A;  5L3C A;  5CQX A;  2L3S A;  1AWO A;  1PM3 A;  1WXU A;  2A0L A;  1IX9 A;  1Y67 A;  3DKM A;  1N4C A;  5KHG A;  2K4Y A;  3EGX B;  1M2O A;  2EYQ A;  4BI4 A;  1AZE A;  1UG1 A;  3GNF B;  3JCM P;  3PFS A;  2KDS A;  2ARH A;  2BTQ A;  5IDJ A;  2RNB A;  4X62 B;  1KEC A;  4GX1 A;  3AG4 C;  2ZPH B;  1MOF A;  2QKS A;  3EG9 B;  4A4K A;  1VQL Q;  4MW8 A;  2Q4P A;  1SRL A;  1KG1 A;  1M5Q 1;  3JB9 H;  1MZF A;  4XU2 A;  2HG5 C;  2XID A;  1OCZ B;  3ETD A;  1I0C A;  1NZ6 A;  4HBN A;  2JK5 C;  2DBK A;  3N2G B;  3SFM A;  1RAG B;  3DB3 A;  5LGU A;  3E8G A;  1ZUU A;  1MNG A;  3M53 A;  2EIK B;  4CZZ A;  3RIR A;  9ATC B;  2F1M A;  4UB6 Z;  5B1B B;  2HKQ B;  5C8Y B;  2RNA A;  3I5R A;  4OP0 A;  5KYU A;  3QKJ A;  2CUG A;  1SSF A;  3RYH A;  3OW2 P;  1KU9 A;  4ZGD B;  3CCR A;  4H33 A;  4DUY O;  4FYW B;  2QJ1 A;  2OCC B;  2RQ6 A;  3VV0 A;  3EHB B;  3K0G A;  2ZE7 A;  3PNW C;  1WB7 A;  1ZSZ A;  3ZMT A;  3FB8 C;  1YJ9 V;  5B3S C;  3RUX A;  3TCU A;  1Y74 B;  2VGN A;  1I94 B;  3RMQ A;  4MVU A;  2LX7 A;  4KUI A;  4Z2W A;  4AT1 B;  2E12 A;  2J7I A;  4QJF B;  2DYR C;  2HJF C;  2ZM6 B;  2AZ0 A;  1X2Q A;  2PNI A;  4RUF A;  4X66 B;  2OAU A;  1E1Q G;  4KUL A;  5IN1 A;  1M8M A;  1VQP T;  1I7F A;  2EAY A;  3KG2 A;  1KQS A;  1D09 B;  2F43 G;  2AHZ A;  3REB B;  2DVJ A;  2M16 A;  5KLV H;  4DV7 O;  1LVK A;  1UB4 A;  4FMT A;  2GTJ A;  1AJP A;  2GTO A;  1BCO A;  4LF7 O;  5CKF A;  4QQG A;  4JTD B;  3OMA B;  2LJ1 A;  3MP8 A;  1NTM H;  3CME T;  4KXR A;  3CQT A;  5L3G A;  3T4Z A;  4XTU A;  4HCC A;  4IUP A;  1D3B B;  1VQ7 V;  3RYC A;  3OUS A;  2LNV A;  3CXC S;  2P06 A;  2G6F X;  3JAW B;  3L42 A;  1KK7 A;  2MIO A;  4FM4 B;  3JAL A;  4X1V A;  3CCR Q;  3OD4 A;  3QG5 A;  4ZBM A;  5LMU B;  1R0C B;  2CP0 A;  4FT2 A;  3I56 T;  1ZBX A;  2Q5Z A;  2HD0 A;  3G6E A;  2FZG B;  4J9G A;  1BB9 A;  2XAH A;  2BSK A;  4DV5 B;  4KH1 B;  4IIJ B;  5AG2 A;  4YTL A;  3A8O B;  2QTO A;  4XU1 A;  1O9G A;  4K8X A;  3WVD B;  1Q7Y R;  1S5J A;  5IHN A;  1N9R A;  1K9A A;  3VUB A;  3G1J A;  1RPO A;  4YHH O;  1NVP D;  2PVD B;  3SHW A;  1YTF D;  2RK1 A;  3CPW S;  2JVV A;  5B66 Z;  1ZLM A;  3BDU A;  4LD6 A;  2E5L O;  4J9C A;  2UXD B;  4LF6 O;  4LR3 A;  3FC3 A;  4LUD A;  1OPK A;  2RCV A;  2EKO A;  3GVM A;  1WXB A;  4C92 E;  2LFR A;  2ZDI A;  3E19 A;  5GAN 7;  2Z0W A;  1XQ8 A;  1UGR B;  3K57 A;  4N0A A;  1QW1 A;  1TGO A;  1C6V X;  2DFU A;  3FRN A;  1PKS A;  4CC7 A;  2M7W A;  2A08 A;  1UDL A;  2AIR B;  2MWO A;  3MEV A;  4LF5 B;  1WIE A;  4P2Z A;  3QWX X;  3ABL C;  2M0O A;  2RHX A;  3CWB H;  3G6E Q;  1YHQ V;  4DXW A;  1D1C A;  2YS8 A;  1RLP C;  1VQ8 A;  2ZE6 A;  4PFZ A;  3ZRW A;  1BCC H;  4HVV A;  3CCL Q;  5JCO C;  2GDS A;  5FW9 A;  3G7Z A;  1D0Z A;  4JJD A;  1HDJ A;  2DOS A;  1PRL C;  1JJ2 P;  1SS3 A;  1AB3 A;  3T1Y O;  3E89 A;  1RSO A;  4I9W A;  3DTU B;  2EIL B;  4L8J A;  2RN8 A;  1D1B A;  4LUE A;  1WA8 A;  3QF7 A;  4C5I A;  2HEQ A;  2V8J A;  1PNL A;  1FAF A;  3RER A;  1Z5V A;  4PJJ A;  1TVK B;  2O4X A;  3H6Z A;  2XD0 A;  4MVS A;  2HHH B;  3THK A;  3SJC C;  2CP3 A;  2X6A A;  2Q68 A;  2JJ1 G;  3M55 A;  3UM7 A;  1UHF A;  4EEQ A;  2LQK A;  3FYE B;  5EYP A;  4PJN A;  4WFF A;  4HT8 A;  4FIP C;  1VQN Q;  4U3F H;  2WLL B;  4JI0 O;  1GCQ C;  1ZHI A;  3AG2 B;  1MUZ A;  4JAS A;  1OI1 A;  2UUC O;  3V7S A;  5EZY B;  2KK4 A;  3MAQ A;  3RBZ A;  1VQ8 Q;  2L6L A;  2A7W A;  3VQX A;  2JEX A;  2G38 A;  3C94 A;  2E5Q A;  4LDY A;  3G4S V;  1K73 R;  3CMA T;  4QPK A;  5FRN A;  3LSU A;  2YXL A;  3BY6 A;  4OB3 B;  1K8A C;  5LOV B;  2ZQM A;  3ZIA G;  3NR7 A;  3QNE A;  1Y71 A;  1M1K U;  1QVF S;  1QCE A;  1M4U A;  2IJH A;  2ILM A;  1NEG A;  1BIB A;  4PJ0 Z;  4TWK A;  1YIT V;  2KB1 A;  4YY3 O;  2V1R A;  3OS5 A;  1XMQ O;  2R9R B;  4KT0 E;  3N2K B;  4LF8 B;  4J9H A;  4P5N A;  1Z9Q A;  3KKY A;  1R3J C;  5DLQ E;  3AHU A;  3KFV A;  2X7R B;  4FIB A;  1EN4 A;  1X75 C;  3JCM c;  3JB9 F;  1DF5 A;  3C3S A;  4MZP A;  1SA0 B;  2KNB B;  3JCU Z;  3OTO O;  2WA3 A;  3L74 H;  4UCT A;  4F4L A;  1Q7Y W;  4NL2 A;  3TVT A;  4J6X A;  2KVQ G;  1RI9 A;  2F5T X;  3FJ5 A;  4E7J A;  1VQ5 V;  1V55 B;  1NKD A;  4OVA A;  1SET A;  4H44 B;  4J7I A;  5KMG A;  1GO3 F;  1G2B A;  3VS1 A;  5CA3 A;  4JRK A;  5KE2 A;  4TUY B;  4J9Y B;  3HSB A;  4JI7 B;  3CHX A;  1M57 B;  3E22 A;  2QR4 A;  1IHV A;  1JQ0 A;  1AEY A;  5LJ3 h;  3OYF A;  3QII A;  2PVG B;  2RI3 A;  2LMJ A;  3CCS A;  1FXK B;  1N36 B;  1R3L C;  4LFC O;  2QWQ B;  3OBY A;  3OYD A;  2EYY A;  6AT1 B;  3L71 H;  1OZ3 A;  1M90 C;  3CC7 V;  4LF6 B;  3JYC A;  1MMA A;  2NWM A;  2Y0P A;  4C92 C;  5GAO l;  1UJ0 A;  5GMK j;  3SPI A;  1SRY A;  1XMO O;  8ATC B;  1UGV A;  4JAV A;  2J6K A;  2ZCF B;  3AK3 A;  3OMI B;  4ZIB A;  3OAA G;  1IXB A;  3HKE A;  1KC8 U;  1SER A;  4Z1M G;  1SG5 A;  3X25 B;  1B07 A;  4M7D G;  1U1S A;  2QQS A;  3OUF A;  3H9N A;  2CRE A;  3QJY A;  1K34 A;  4YJ3 A;  1D2D A;  4DR2 O;  1HD3 A;  3M0P A;  4TQF A;  1SRM A;  5GAO q;  2NLJ C;  1HK9 A;  4PJO C;  4ORZ A;  3SWN B;  3GOX A;  1Y66 A;  3X2Q C;  2VVK A;  3CCS Q;  3OW2 A;  2FKX A;  4X1K B;  3JD1 A;  3OFN G;  3OTF A;  2IJI A;  4A4E A;  3JB9 J;  1VQO Q;  2OTL T;  4AIL C;  1B6Q A;  1BHB A;  3W7T A;  3B09 A;  2ROT A;  4D6T H;  2JS5 A;  3E83 A;  1VF6 C;  2M9U A;  2OTJ A;  4LP8 A;  3PT9 A;  2X9H A;  4M77 C;  1K1Z A;  3FIF A;  2VQF B;  3JCM Q;  2Y48 A;  3M0Q A;  2IJK A;  1YVW A;  2DYS C;  1TUD A;  2ZCE A;  1WLE A;  4RAI A;  1N8R U;  2DYI A;  4O2A A;  1VYT A;  3S3O A;  4EMK B;  2Y4Y A;  1K4U S;  5CIU A;  3M9Q A;  1TXQ A;  1NH2 B;  1YI2 A;  1P92 A;  4O4J A;  3DC6 A;  2DZ9 A;  3ZX6 A;  3EGD B;  2XOK G;  4PJO D;  4M7A G;  4M7D E;  1PNM A;  4LWS A;  1G3W A;  4IKF A;  2UXC O;  2XK0 A;  2HKN A;  1Q82 R;  4HCZ A;  3A98 A;  1Q81 W;  4BUG A;  3GNG A;  4IUT A;  1XBL A;  1S1N A;  2JVD A;  4B3T B;  1QVG U;  1S76 D;  2BUD A;  4M78 D;  4IUQ A;  3AG7 A;  2Y4U A;  4DR3 B;  4RG8 A;  2KMT A;  4FSS A;  2LCS A;  5KCO A;  3I5S A;  2E4H A;  1KD1 U;  3SDL A;  3CS5 A;  2M51 A;  1G8M A;  2A37 A;  1NQT A;  2P6J A;  4I5S A;  1FYJ A;  2ZPI B;  4XTW A;  1DLB A;  2JJ9 A;  1IGU A;  2OTJ Q;  3I55 A;  2LGW A;  4KUM A;  2WLN A;  2GTS A;  1VQK V;  4JYC A;  1B34 B;  5L8R E;  4PDM A;  4M75 E;  4HT9 A;  1D5N A;  4FM1 A;  1PV0 A;  3LX7 A;  2KGT A;  4CI0 C;  2NR5 A;  2PGG A;  1W70 A;  4LNU A;  1YI2 Q;  3OYB A;  2W6J G;  1RL2 A;  2GV9 A;  3SDZ A;  5KUM A;  4YJ2 A;  2DJZ A;  2EJF A;  3C4S A;  2PUK B;  5CK9 A;  2VQE B;  3X24 B;  2X6B A;  1EBO A;  2QTS A;  1N5Z A;  3CD6 T;  3T4D A;  3JAK A;  1K9M C;  2GHY A;  3SJA C;  2L3R A;  2YXH A;  2QKA A;  1Y96 B;  4JPR A;  3JCM e;  1UJW B;  3RKY A;  3CB2 A;  4NR1 A;  2EIJ C;  3CCJ T;  3K5N A;  2OIE A;  4ELZ C;  3DC5 A;  3RR6 A;  1OJH A;  2K1E A;  2RD1 A;  3RYI B;  1YIJ T;  2KSD A;  4HXJ A;  5LA6 A;  4N23 A;  3OYH A;  1BYM A;  2P22 C;  5FPR A;  2XI9 A;  2DRM A;  3D3I A;  4DR1 O;  4DR5 B;  1PNJ A;  3M58 A;  1JJ2 A;  2NUT B;  1U97 A;  1X27 A;  2RJD A;  4WFE A;  1TWB A;  3JSC A;  1WX6 A;  1U96 A;  5HCK A;  5CA1 A;  5HFM A;  3S3W A;  2FML A;  3CCM T;  5IY5 B;  1XQH A;  2EKH A;  5GAN 6;  1DF4 A;  2QG9 B;  2BOC C;  2ODM A;  2VKN A;  4D8D A;  4F7U A;  5A2Q N;  4MVM A;  3CRR A;  3WVE B;  1H2S B;  3HR0 A;  3KCX A;  4C92 F;  1G8X A;  2DTO A;  2LC4 A;  2H3J A;  2YSQ A;  2RI5 A;  3N5B B;  5IT9 E;  2CGN A;  1FXH A;  3S3M A;  3GB7 C;  2MPX C;  4Y91 A;  4E2L A;  2ZNJ A;  1PM9 A;  4WFH A;  4DK1 A;  4GKJ O;  1QMC A;  1WDX A;  2CP5 A;  4M78 A;  2D2C B;  4ELY C;  3OYJ A;  3RYF A;  1VQL T;  2LP5 A;  1GCP A;  2EJ7 A;  4MTF A;  2PZ1 A;  1TU0 B;  2K2M A;  1OCZ C;  5LXT B;  1N27 A;  1W2B P;  5LBQ A;  2ZIO A;  4OMM A;  1OUL A;  2EZO A;  4AHC A;  5FLX E;  4QT7 A;  4XU3 A;  5IXB A;  2QQA A;  1WHH A;  1SKV A;  3CRA A;  2EIK C;  4PJO F;  5B1B C;  5J2U B;  3UO2 A;  1Q82 W;  1UTI A;  3HHT B;  1Q5O A;  5LYJ A;  1YJ9 Q;  4RQF A;  2HFE C;  2BTT A;  2LCC A;  1ARO P;  2Y0I A;  5K1P A;  5KA5 A;  3SPH A;  2MOX A;  2BE7 D;  4E2F B;  4X89 A;  2OCC C;  2FRY A;  1Q86 U;  2K57 A;  1FMV A;  1FMW A;  2JOY A;  2DL3 A;  3GLX A;  3VS2 A;  5GMK e;  2AKK A;  2F66 C;  4M77 F;  1Y76 B;  3OQ5 A;  3ZFJ A;  3A5Z B;  1JRI A;  3VS5 A;  1E79 G;  2UXC B;  1WXT A;  4XK8 E;  3K59 A;  2QEX T;  2GUZ B;  1WHL A;  3QVN A;  1QLE B;  2NLU A;  4QQ6 A;  2IIM A;  3H1L H;  3ULR B;  5DED A;  1VQ7 Q;  4FYV B;  2Q9L A;  3PN1 A;  4ZHQ B;  1JR9 A;  1H2K A;  2H3O A;  2KRN A;  2JS0 A;  5H6R A;  2PUS A;  1UPG A;  2ZIN A;  1EM1 A;  3SYA A;  2Y4X A;  2Q73 A;  5EBW C;  5GTI Z;  2WLI A;  2RDC A;  4OXS A;  4TV9 B;  3OSS C;  1W0J G;  2COW A;  1ZAU A;  3SB2 A;  2IM9 A;  3U10 A;  4OPH A;  2LGQ A;  1BI0 A;  1EX4 A;  1LJO A;  3QYG B;  2K7A A;  1H3Z A;  3RMS A;  2ZR2 A;  1X2K A;  4RQE A;  4J9F A;  5GAO r;  2PUO B;  4R50 A;  5GAO p;  1QBZ A;  4K35 A;  2BE3 A;  3ZMS A;  4B3R O;  3WG7 C;  1MND A;  2CYZ B;  4J6Y A;  3FX7 A;  4RO2 A;  1YJN V;  5FRO A;  1J95 A;  1Q43 A;  3JAS B;  3M0S A;  3L75 H;  5GAM h;  4FLZ A;  2XAS A;  2WSC E;  2YIB D;  2YUO A;  5GAM g;  5IJ0 A;  1VIF A;  2MF2 A;  5KX5 B;  3DGE A;  5JQG B;  5IYC O;  2YLC A;  2YT6 A;  2ITD C;  1QP2 A;  2E65 A;  3MEA A;  4J9I A;  3BAB A;  1QHT A;  2A79 B;  2D0Q B;  5BXZ A;  4E7I A;  1M1G A;  3QTC A;  3EG3 A;  5BMV B;  1NYF A;  1FFX A;  2KG7 B;  3OYG A;  2P7T C;  1FXV A;  5CB4 A;  4A5U B;  1YHQ Q;  2D8H A;  3HL8 A;  4OGE A;  4WFA V;  3I5D A;  3L1A A;  3T2M A;  1H8H G;  2EJ9 A;  3X26 B;  4BI3 A;  1K8A R;  1P49 A;  3R6N A;  3G4S A;  2QGN A;  2FPD A;  3EH2 A;  1CEZ A;  3ETE A;  3Q4H A;  2DL4 A;  5D6Y A;  5A0G A;  4EKW A;  4LNP A;  4L87 A;  4MZM A;  1NJI U;  5LL6 S;  2FO0 A;  4QW2 A;  1XUQ A; 
#chains in the Genus database with same CATH homology
 1SF9 A;  2YXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...