2Q9LA

Crystal structure of imazg from vibrio dat 722: ctag-imazg (p43212)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
MKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTHELKEVLNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
molecule tags Hydrolase
total genus 33
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q9lA00
2YXHA 2Q4PA 4QGPA 1Y6XA 2Q9LA 2Q5ZA 5IE9A 2OIGA 2A3QA 3C90A 2P06A 2A7WA 2GTAA 2Q73A 1YXBA 2OIEA 1YVWA 3CRAA 3CRCA 1VMGA
chains in the Genus database with same CATH superfamily
1P7GA 5B5EZ 5IYCO 3CRQA 1IXMA 2PF4E 4PJ0Z 1COWG 4L8JA 2HFEC 2YXLA 1V54B 2HEPA 1OJHA 2WLMA 3P30A 4UXNA 3OE7G 1UPGA 2BTQA 3DXRB 5KUKA 4PHZA 1NBMG 1N0JA 1RPOA 3SGIA 3ASNB 2QWPB 5IWAB 4DV4O 3AG3B 1NTZH 1AB3A 4DK0A 1HNWO 4UV9A 1VQNV 3F7VC 3BY6A 1FFXA 1SQGA 2Q0AA 2A06H 2YIAA 1FKAO 3L72H 3GVMA 4U7OA 3DGEA 3HB3B 4ZI7A 4LF7B 1SERA 4W4LA 2A79B 2HJDA 2W6IG 3X2QC 3MHHC 4O2BB 1XL4A 1H2NA 4QNHB 1GM9A 1J5EO 2HP8A 5DN6G 4TT3G 4P9OA 2UXBB 1ORQC 3Q4HA 4MTGA 1P49A 2YI8A 1GAXA 5EIBC 5CB4A 3MAQA 1VQ5V 4DUZB 4MVQA 2RJZA 3RYFB 2GHYA 2UUBB 2JVDA 4FLVA 4X65O 3HPLC 5FLXN 5AG2A 4GUNA 2UUCB 2DE0X 1LUWA 2JGDA 2Y48A 4DR2O 4RUFA 1AI4A 4JI5B 1MZEA 4X9QA 2VQFB 1MNGA 1BHAA 1K97A 4JYBA 1R6KA 4JYAO 4IHJA 4WBNB 1M57B 4HAMA 1X59A 3DXRA 3HKCB 2JDIG 2P22C 3T1YB 4Q20A 1PNLA 4B7EA 3RGBA 4B3SO 1ZX3A 3EVKA 1M90W 5LP6B 3E2EA 4FFKA 2N04A 2Q7GA 3SPIA 1XMQO 3L71H 2LFSA 4DW0A 4O4HB 2EIMB 3OUSA 4LWSB 4JI3B 4MVZA 1N33O 1WP7A 3UM7A 4C7UA 4DV7B 1KC8W 2P4KA 4O2BA 4B3TO 2Z5UA 3G67A 1W59A 1Q90D 2IW5A 4LH7A 1AP5A 2YIBD 1AR5A 4DR1B 2A9HA 4KFMA 4DV3B 2YIBA 4JI1O 3B40A 3UKMA 3RYFA 3TK1A 4F6RB 1AJNA 4K3AA 3QF7A 4MVUA 3GWKC 3NR7A 4JASA 2LW7A 4F6EA 3CCRV 1H8EG 2YIDA 5H9CA 1R3KC 4LCUC 4X66O 5IT9N 2GUZB 2H94A 3K58A 3JAWB 1YSCA 5IYZB 4WBNA 2A7WA 4PA9A 4F4LA 3P3PA 1F4MA 3HKCA 2F4VB 2ZM6B 1BS3A 1Y4MA 2EINC 4ZIBA 4AQYO 3A0BZ 3CRAA 2ILMA 5LP6A 1QU7A 5KX5B 4UVBA 1QR9A 4DR3O 3K5LA 5LMNB 4O4HA 1VQOV 4LWSA 3ZHUA 3OGCC 4BWAA 4CZZA 2RDCA 5JJNB 2Q0OC 3UO2A 3P3NA 1WNSA 2EIKB 4D7TA 1JPXA 1XDCA 4I55B 4FLXA 1AR1B 2NR5A 4NXMB 5B3SC 3ETGA 3OMAB 4B3RO 1KB9F 4F6RA 4KHPO 3IJ4A 4NYKA 4LFAB 3D36C 4LFBB 1EN4A 1Q7YW 3J80N 4GX0A 4GZRB 3J7AU 2PGGA 2FL4A 2ATKC 3G80A 3RW0A 4X64O 4ABMA 1B04A 3CXCU 4FMTA 2GUZA 3JAWA 3WG7C 4QE9A 3ZRWB 4J7ZA 5IYZA 2E75B 3BPZA 4B3MB 1HNZB 2F1MA 4TSFG 3ZMUA 4R50A 5LBQA 2LGQA 1K3EA 3ZHRA 1OCCB 1V9PA 3DSQA 3DTUB 3FB7C 5KA5A 1W2BU 2ZDIA 2IJJA 4MT8A 3H1HH 3K06A 3KCYA 4MVOA 4JI7O 2QE7G 4J10A 1KP2A 3KG2A 4LF5O 4E4EA 4UUJC 1GO3F 4XDKA 4EFEA 2E76B 5DEDA 2HVKC 1MZFA 2YEVB 3I5DA 2WPDG 2R9IA 3CC4V 4QIWF 4I55A 3ASOC 5JCOA 2PYLA 3CCSV 1YHQV 5KA6A 1GN4A 3K9AA 3OMIB 4U3JB 4J9ZB 1XMOO 2VWKA 1HDJA 3K9SA 4IL6Z 1QQCA 3BABA 4I9QA 3B8NA 3MDSA 1TUEB 3WU2Z 1TUBB 4NVPA 3CMEV 5FL7G 4K35A 2AZ2A 3R66A 3FAVA 2OCCB 3K0DA 2DQ0A 2YUAA 1QLNA 3BFRA 1THZA 1JCHA 3ZRWA 1E1RG 4JI8B 1ZTEA 4XDJA 4DR7B 3LSQA 4O4JA 4DR4B 3WB2A 1M93A 5KHIA 5JJJB 4X20B 2DYSB 3RBZA 3CPWU 4JAUA 1NTMH 5BZBA 1M56C 1HNXO 4TQDA 3N2KB 1IBLO 1BCCH 4W4KA 4DO2A 3A8TA 2UXCB 2CE4A 2F95B 1WJZA 3N2GB 1VF6A 1BSMA 4OGQB 3RYCB 2R70A 2LW1A 2CUGA 3K57A 4FK5C 4I5SA 4NTWA 2QR4A 2CTPA 2GSMB 2YEVA 3SJQC 4R8CA 2UU9O 1JX9A 5L3CA 4LF8B 1N8RW 5EBWC 3WB1A 4LFCB 2PZSA 3ETDA 5EBLC 4JI6O 1PP9H 1TGOA 1S5JA 3F7YC 4Z2WA 3JASB 4LBEC 4EB6B 4NR1A 1LNQA 4ZKIA 2NNUA 4NB5A 5GW7A 3L9DA 4BR6A 2WSSG 1WA8B 1B06A 1JOYA 4PDVA 4IYIA 3AG4C 3HKBB 2IH1C 2Q67A 1N34B 2V1DA 4DR6O 1DGSA 2BSKB 5CBFA 2UUAO 4H33A 5IY5C 2RQ6A 3OAAG 4J80A 5B1OA 1XI1A 4TOIA 4LF9B 2E5LB 2LJ2A 2PI5A 5EC1C 2ZE8A 1U96A 1GN3A 1FYJA 1V54C 5LXTB 3K5MA 3U0ZA 4JTAB 4UCOA 4JAVA 4QPJA 5BR8O 3ABMB 1TAEA 2K1EA 2PY5A 1MABG 3ZHVA 4UCUA 3IAYA 3N2KA 1MG1A 1OCRB 4FM1A 1I0HA 4Z1VA 4CH5A 1AVMA 2EIJB 2IJKA 2CK3G 3N2GA 2QA4V 3ASNC 3RYCA 1AI6A 1DK1A 3AG3C 1U97A 1WAZA 2BE3A 5L3GA 2ZKOA 4FVMA 3SYPA 3CCUV 2BTOA 5IYBO 1IVSA 2EBOA 4OPAA 2ODMA 2HR3A 1X4TA 3VQVA 1SZTA 1Y76B 1K7DA 3MD0A 2RCVA 2CGOA 3B4SA 4MW8A 1EBOA 4EB6A 4NTXA 3D8CA 4UCTA 5D5QA 3W7WA 2ADPA 1XQ8A 3KCXA 3Q4HB 3VQXA 1N4CA 4GCZA 4NTYA 1EN6A 2EX3A 3BA9A 3HKBA 5CB4B 4D7SA 1KYOF 2BSKA 3CC2V 1NT2B 2F43G 1CP9A 2KKWA 1I5XA 2P7TC 3SJCC 3ABKB 4YY3B 4JI0O 1N32O 3RN4A 3OTFA 4G2KA 4PDMA 4X88A 1VQ9V 2CTQA 1KQSU 3A0HZ 1R6TA 4ASUG 4DW1A 4FPPA 2ZE7A 3JD0A 4AHCA 5LXTA 3CCVV 5E1AC 2CH7B 1VQMV 1OCZB 2F23A 4PI0A 1DF5A 4IHJB 2YC0A 3JD1A 1M57C 1W0JG 3A2FA 1J95A 1IBKO 4WFEA 3CRCA 3JD4A 4OX9O 4BIUA 2KSDA 2L35A 2BOCC 2QWRB 4Q6GA 2AW9A 4BW5A 1D2DA 5LP6C 3ZRXA 3E8GA 3EHBB 4X8AA 2F93B 4DV4B 4JI4O 3BVOA 2ZINA 2AGAA 1HNWB 3NXSA 4FZ1A 2EIMC 4GLXA 1SQQH 4P9PA 4KUMA 2A0LA 4MSWC 1H2KA 5IWAO 1SQVH 3E35A 4DRXB 1Y76A 1YJ9V 1R1BA 2KG7B 5DM6V 2D3OW 1GK9A 1N36O 1VQLV 3LSUA 4FLWA 2L6LA 2Q7EA 1R3IC 3FB6C 2CTRA 1PV0A 4RO2A 3OMNB 1JR9A 4MTXA 3B77A 3OD4A 3TCUA 1YZBA 5B1BC 5H6QA 1NR7A 2Q5ZA 4X65B 4DV5O 2YICA 1XL6A 3O9OA 5LL6Y 5CA1B 2JJ1G 2VRZA 4DR2B 5BXZA 4PV1B 2DOSA 5JWPA 1DF4A 3JATA 2W0FC 2PYJA 2P6JA 1S0VA 1YCIA 2CH7A 1LUVA 1YEWA 3G6BA 2IM9A 4LF6O 3DC5A 1A32A 1XNRO 2OTJV 4B3SB 4G27B 3G6EV 1H2LA 1I94B 1WB8A 5HFLA 3E89A 3LNNA 1EZVH 1XBLA 3HR0A 3VOUA 3UT5B 4TQFA 1RPRA 1VEWA 3EFFK 3D3QA 4K0KO 1AR4A 5LGUA 4DRXA 1N33B 3B2EE 2KG7A 2DYRB 1VF7A 2WLNA 3S3WA 3CSXA 1BMFG 1L0LH 2EIKC 1NJIW 3H1JH 4BW9A 5JCOC 1NZ6A 4JF3A 2QSAA 4WFFA 5KMGA 3QTCA 2W0XA 3SYAA 3H01A 3ZRSA 1O9HA 4QJFB 4J9YB 4JI1B 3JALA 5B1BB 3BAAA 2IBZH 4FLZA 1G6UA 4JAAA 5CA1A 1YTFD 4DR1O 5L3DA 2LO1A 4J42A 3QO5A 2H8PC 2R9AA 5LHHA 2JEXA 2YS8A 3T1HO 3CWBH 1F7YA 4I4TB 1D5AA 4X66B 1Z5WA 2E74B 1DLBA 1F4NA 4CC6A 3FFQA 3C90A 2P06A 4PDRA 2YI9A 1NVPD 1XNQB 1K9MW 2D2CB 3OEHG 3W7SA 4X62O 4DV1O 3S3XA 2ITCC 2UXDO 2VWJA 3OGIB 3CCEV 2P90A 1OCCC 4J7KA 4LC1A 4OPHA 4AQYB 5CA0B 2ZM6O 3BCCH 4IGGA 5IJ9B 3UT5A 1B6QA 4DR3B 2FB5A 5ITZB 2CTWA 1GH6A 1URFA 1VF6C 1Y66A 1DTOA 1XOUA 1CPYA 4JZ2A 1VQ6V 2EULA 1WB7A 4JI2O 5TISZ 3ZRVA 1FS0G 3AG2B 4GKJO 3OTOB 4JTCB 5KAFZ 5KHHA 1F23A 2Y4TA 1VQ8V 4B3RB 2AZ0A 1FXVA 3LUTB 3G71V 4AILC 2IJHA 4KHPB 3SPHA 4DV0O 5LOVB 4KL1A 5EIBD 2RN9A 1GRJA 3VQWA 1MA1A 1OCOB 1PNKA 2AHYA 3CEIA 1SA0B 2EJ7A 3FAVB 5L3FA 2OCCC 2X0LA 4I4TA 5LMUB 1YXBA 1EFRG 2R9RB 3L74H 4CH4A 3SYQA 4O4JB 3CP1A 3F5WC 4YIOA 5EYPA 1KECA 2BCCH 4YJ3B 2DYSC 3K5NA 3PN1A 1YITV 1S72V 1VARA 5CA0A 1VF5B 1M5IA 2Y69B 1VQ4V 2JK5C 4GKKB 2NLJC 2EILB 3CRRA 4HNAB 3QG5A 5IJ9A 4MS2A 3LDDA 5ITZA 1IZ3A 1FJGO 1K4CC 4WFBV 1SS3A 3K0GA 1AILA 3QO7A 4UFZA 4H0LB 4XBFA 3FX7A 3W7UA 2WAMA 1AJPA 2ZCEA 5HFMA 2QM4A 1OZ0A 2RMKB 1KBHA 4LP8A 1L8DA 4WF9V 2R72A 3U10A 4N21A 1IBMB 5IE9A 4YIPA 1VQPV 2V7QG 3DC6A 4I9WA 1XMOB 2FYUH 3M7MX 3VBBA 1EM1A 5LOVA 5E79Z 3K5OA 3SYOA 4DR5O 1BGYH 2Q7HA 3ETEA 1W0KG 4O4LB 1SA0A 1BHBA 2KQXA 2IJIA 4UVCA 4PI2A 5GONB 1WPXA 1GTOA 2DMXA 1SQPH 4NXNO 4JYCA 2A3QA 3E22B 3JAMN 1BZKA 3UCSC 3HKDB 2Q6AA 3APOA 1NU1H 1UFIA 4DV2O 4YHHB 4YJ3A 2OIEA 1SQXH 5KUMA 3W7TA 3SJBC 2IU0A 4PA3A 4K8ZA 3ABMC 2WA3A 1OCRC 1K73W 4HNAA 4DR4O 2F66C 1HNXB 2OIGA 1IBLB 1S76D 1XILA 2EIJC 3K08A 1R3JC 4MTOA 5J2UB 3IC7A 1TVKB 5IDJA 4DV6O 1NTKH 2XTAA 1P7BA 2X6AA 4KP4A 4KXRA 1LR1A 3N27A 1WP8A 1PL4A 2W6JG 4RAIA 1BQZA 5FPRA 2OCHA 2UU9B 2JJ2G 4LF4O 2UXCO 2HJFC 2EZPA 2XAGA 1GM8A 3BRCA 1QLEB 2Q69A 3E8FA 4JI6B 2B5UA 5J9PC 4GYCB 3SDLA 2DW4A 3CYOA 1Q5OA 1HP8A 3A0RA 3CCQV 3BA8A 4MTFA 5JH7B 5K1XA 1S5HC 1EZJA 1P4RA 5LA6B 1SESA 4QGPA 4O4LA 2HHHO 4WFGA 3TGUH 1PL0A 4DR6B 5GONA 3ABKC 2Q73A 1M1KW 1NI8A 1V55B 3E22A 1Q86W 1ZSPA 1N34O 3GB7C 3OUFA 2JRIA 3VQYA 4BIOA 3HKDA 1KU9A 2ADQB 2XAJA 3CD6V 2DJVA 1OCZC 2N74A 1AI5A 1SQBH 5CN0A 5B66Z 4PELA 5CA3A 1RSOB 5BR8B 3UQ8A 2PI4A 1O9GA 3CX5F 2PUSA 4FM2A 2GBOA 4E2LA 4TV8B 2XAHA 4JV5O 1RFYA 5J2UA 1TVKA 1PPJH 5GTIZ 1VP7A 1NR1A 3AG1B 4X1IB 2WLLB 2XASA 2EJRA 4YJ2B 4PA7A 4LR3A 2AXTZ 2DWDC 3E86A 3STZC 1KKCA 4ZHQB 5A9GA 2JS3A 4N23A 3E83A 4PA4A 5L3EA 1OHHG 1RM1B 4DUYO 1YDXA 1CEZA 2OWOA 2ZR2A 5JH7A 1IXBA 4PDLA 5LA6A 2JEUA 4TV9A 1IURA 5BMVA 3CE2A 2Z3YA 1HR0O 3CJHB 3H9VA 2Y4UA 2G38A 1XUQA 2O57A 3QVNA 1BE3H 3ABUA 3OT7A 1GN6A 1Q6HA 4Z1MG 4JI0B 1N32B 2VQEO 4L87A 1RP3B 1ZLZA 5KHKA 3QO8A 1G4YB 4CH6A 3JATB 1XHXA 3U11A 3K04A 3LDEA 3ABLB 2JGUA 2JS5A 4YY3O 1YIJV 1VIBA 2NN4A 2GDSA 1YVWA 3CRMA 3K79A 3C3SA 4WFAV 5B1AB 5L3BA 3OR6C 1RSOA 5FNVB 1JA8A 1IBKB 2ZXWB 2QWNB 4TV8A 1K4DC 4YXWG 1K8AW 1Z2GA 4OX9B 1Q43A 5EZYB 3T4ZA 5EC2C 2KB1A 4UCRA 2Y0PA 3H1KH 2GTAA 1NH2B 4JI4B 3ZX6A 4X1IA 2QDOA 4TUYB 2WLLA 1FXKB 2GTSA 5F2VO 4UB6Z 3CC7V 5D5PA 3E8HA 3ZS8C 4YJ2A 2ZQMA 3JD2A 2IH3C 3JCZA 4PA6A 4ZHQA 1VMGA 3OFNG 2DYRC 4GT1A 1I08A 3K3WA 4BAYA 2HKOA 3JCUZ 3B8MA 2B9ZA 4R7CA 2Q68A 5LGNA 1J5EB 2N05A 3FD9A 1G8MA 1N36B 5KMGB 3G4SV 4LF7O 4X1YB 3ICXA 4JZGA 1NS1A 5KLVH 2CAZC 3SPGA 3B09A 3RT3C 2PTMA 1QVGU 3CJHA 1JQ0A 3JALB 4IT5A 3M8AA 4CC5A 3I56V 2UXBO 2XAQA 1UJWB 4DV5B 3T2MA 4DXWA 2WLKA 4DUZO 1YTFB 3APQA 2UUBO 1HWYA 5KAIZ 1SZXA 3KKYA 3GWOA 1CXZB 4EKWA 2UUCO 2DQ3A 1AJQA 4X89A 4LH6A 3ZMSA 4JYAB 1ENVA 3CXHF 5FNVA 3FKSG 4LF6B 3ZBHA 3FB5C 4JI5O 1NVPB 1XNRB 1PNMA 2VQFO 1AP6A 4I7ZB 3EXAA 4ICGA 2QJ1A 2ZNIA 4RQEA 5EZYA 2QWQB 2QKSA 3OW2U 2YSUB 1NH2D 4J11A 2ZDIC 3MHSC 3QNEA 4H13B 4TUYA 4WCEV 1FXKA 3T1YO 1XMQB 3RYHB 2BOBC 1I94O 1D5NA 4XDLA 4K0KB 3ZHQA 4BIZA 2ZE5A 1SF9A 1M4UA 4B3TB 4AI8A 1GN2A 4UVAA 4JI3O 4B08A 2Y0IA 3L70H 4DV7O 3IGAC 4X1YA 3AG2C 4P2ZA 3X2QB 1MSDA 2C2AA 3ZIAG 1K92A 5EK0A 3AG7A 4TWKA 4DK1A 3T1CA 3CCJV 1Q6UA 5EBMC 1Q8IA 3CB2A 1OCOC 4DV3O 2LP7A 4FJCC 3R65A 4JTDB 1OV9A 5DECA 3CHXA 2UXNA 3T1HB 4OXSA 3OEEG 5JQGB 2WLJA 3TJTA 2FMLA 1KUQA 1KP3A 4R6ZA 4A5UB 1H38A 4J7JA 1ZUQA 1GMGA 2LFRA 5EYPB 5J2TB 4X62B 4DV1B 2UXDB 4GX2A 2GV9A 1L0NH 3E8BA 4H44B 2Y69C 1XEQA 2IU3A 4HZ3A 5BY1A 3IC9A 3AK1A 1FXHA 2EILC 3TXQA 1XNQO 4FLYA 2F4VO 1FD9A 2FKXA 3RYHA 3ZMZA 2ZR3A 2P4VA 1ZWIC 5IYDO 3JSLA 1SRYA 3ZCCA 3AEIA 4I0XB 1YI2V 1IX9A 2YXHA 1B3QA 3WFVA 4MVSA 5GTHZ 5LMNO 4UCVA 1AROP 3SYCA 4JI2B 1S77D 2Z0AA 3RYIB 1BL8A 1I5YA 3CCLV 2LQTA 2FTKA 3JAKB 4G28B 4GKJB 1Y74B 1EN5A 1G1XB 2QM7A 4PD4F 3O65A 2ARHA 3ZMVA 2QWOB 4WFHA 1SETA 4NXMO 3H1LH 4DV0B 3OTOO 1R73A 4HBNA 4UCSA 4X64B 2DWEC 4I50B 1Q3EA 4RQFA 4LFAO 1MSWD 1BT8A 4LFBO 1ROPA 1JJ2U 1Q6IA 5JQGA 2ZNJA 3CCMV 2EZOA 5K1PA 2Q8VA 4MW3A 2P5OA 1K5QA 3ZEDA 1Y6XA 1TA8A 4B7KA 5J2TA 5LMUO 4QE7A 1HW7A 3K03A 2WWWA 4FLTA 1M9NA 1H8HG 1IDSA 4K8XA 4FZ0A 3SR2C 3JSNA 3FYIB 2UXXA 3BHPA 4IIJB 4B3MO 1HNZO 1K33A 3OM3B 4FIPC 4O2AB 3JYCA 4JI7B 1XREA 1NKDA 2XNDG 4LF5B 1YJNV 4LNUB 3SPJA 2H3OA 2EINB 3RVYA 1GM7A 4P30A 1FJGB 1YJWV 3ZMTA 4I0XA 4GKKO 1QCEA 1L1FA 5KX5A 1US6A 1H2SB 1PM9A 1PD3A 2HG5C 4FFBB 3WB0A 3RYIA 4UV8A 1JVMA 1QLEC 5LHIA 1MMMA 3JAKA 2YDEA 1Y74A 1GKFA 3W7XA 2MK3A 1K5SA 3CMAV 4RWUA 2M6YA 5KHJA 5H2FZ 2XUMA 1Z5VA 3D3IA 3FB8C 3BEHA 3ETQA 3SJAC 3STLC 5CBGA 5B3SB 4D6TH 2RNBA 4O4IB 1IBMO 4DR5B 2X6CA 4I50A 3ZHSA 1SKVA 2ZIOA 4JGSA 3CS5A 1QNMA 1V55C 3C3TA 4NXNB 1Q81W 4EFBA 1QBZA 1E79G 5H5NA 3L75H 1K34A 4CS3A 4DYLA 1JMKC 1JFFB 4DV2B 1WLEA 2WLIB 1SQFA 2YXYA 3WG7B 4JI8O 1R6NA 2QKAA 4IIJA 4DR7O 2Q9LA 4O2AA 2XOKG 2MW2B 4LNUA 4YHHO 2XHBA 1KKDA 4CH3A 4DV6B 4CBCA 3AG1C 1S5LZ 4JPRA 4GX1A 3JD3A 1JJOA 1KMIZ 3ZHTA 1H2GA 4GX5A 4HYOA 4FFBA 4LF4B 3RFRA 2B1GA 5JVDB 4IYHA 5A2QN 5FPOA 3J81N 2QKCA 1E1QG 1QVFU 1RM1C 1F51A 2ZE6A 1N0NA 1S3JA 1WN7A 3OR7C 3SPCA 4LF8O 5IJ0B 4X1KB 2V4DA 5B1NA 1Q82W 4LFCO 3ASOB 2CGNA 2M7WA 5CBHA 1QR8A 4ZBMA 4CS4A 2ZIMA 4TV9B 4O4IA 5BMVB 4U3JA 3M99B 1ZL8B 3PJSK 2HHHB 2ITDC 2VS0A 1FAFA 2UUAB 3D36A 4UB8Z 2ZT9B 2QTSA 3I55V 1BQ0A 2K9PA 5JJEB 4J41A 3HKEB 5KHGA 4MVMA 1TUBA 1YF2A 4FM0A 2X7RB 2CDYA 3L73H 5LYJB 2B1IA 2HVJC 1JFFA 3K59A 3ABLC 4EEQA 2WLIA 4U7NA 3JARB 5C8YB 4ZOLB 2WLHA 2QTOA 5LGTA 2OT5A 5B1AC 4LF9O 2E5LO 3ZN1A 2ZXWC 3H1IH 2HLDG 1T5EA 3AK3A 3ZJZA 1VQ7V 2OTLV 4JYYA 5H6RA 5LHGA 4X20A 4JV5B 3KZIZ 3RVZA 2Q4PA 3UO3A 2BTQB 1M56B 1FXKC 2E3CA 4QPKA 1KD1W 1ZAUA 1AI7A 1XHZA 2QM8A 1FPOA 3LDCA 5JVDA 3FYEB 2P67A 2AHZA 3TETA 2XAFA 2ETNA 3LNMB 2XT9A 2OYQA 2X6BA 1FFXB 4DUYB 5IJ0A 4X1KA 3RWRD 3THOA 4FLUA 3AK2A 4ZI7B 3T4DA 4RUEA 3TXSA 3IFXA 1ZL8A 3JASA 1HR0B 1PKXA 5CMUA 1FFTB 3ML0A 2QEXV 1R3LC 2QGNA 3LSSA 1WA8A 4H37A 1NQTA 1H2MA 3HKEA 1QHTA 4CS2A 3AG4B 4NKGB 2VQEB 2ZD9A 1P84F 4U3FH 3F5TA 5LYJA 1WPBA 5C93A 1MOFA 2LGWA 3ABTA 2JIZG 1I7FA 1Y67A 3JARA 5IY5B 4MVRA 5C8YA 4ZOLA 3P32A 2WA4A 2DN9A 3ZN0A 1VQKV 2JGDB 1SC5B
chains in the Genus database with same CATH topology
2YXHA 2Q4PA 4QGPA 1Y6XA 2Q9LA 2Q5ZA 5IE9A 2OIGA 2A3QA 3C90A 2P06A 2A7WA 2GTAA 2Q73A 1YXBA 2OIEA 1YVWA 3CRAA 3CRCA 1VMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXH A;  2Q4P A;  4QGP A;  1Y6X A;  2Q9L A;  2Q5Z A;  5IE9 A;  2OIG A;  2A3Q A;  3C90 A;  2P06 A;  2A7W A;  2GTA A;  2Q73 A;  1YXB A;  2OIE A;  1YVW A;  3CRA A;  3CRC A;  1VMG A; 
#chains in the Genus database with same CATH topology
 1P7G A;  5B5E Z;  5IYC O;  3CRQ A;  1IXM A;  2PF4 E;  4PJ0 Z;  1COW G;  4L8J A;  2HFE C;  2YXL A;  1V54 B;  2HEP A;  1OJH A;  2WLM A;  3P30 A;  4UXN A;  3OE7 G;  1UPG A;  2BTQ A;  3DXR B;  5KUK A;  4PHZ A;  1NBM G;  1N0J A;  1RPO A;  3SGI A;  3ASN B;  2QWP B;  5IWA B;  4DV4 O;  3AG3 B;  1NTZ H;  1AB3 A;  4DK0 A;  1HNW O;  4UV9 A;  1VQN V;  3F7V C;  3BY6 A;  1FFX A;  1SQG A;  2Q0A A;  2A06 H;  2YIA A;  1FKA O;  3L72 H;  3GVM A;  4U7O A;  3DGE A;  3HB3 B;  4ZI7 A;  4LF7 B;  1SER A;  4W4L A;  2A79 B;  2HJD A;  2W6I G;  3X2Q C;  3MHH C;  4O2B B;  1XL4 A;  1H2N A;  4QNH B;  1GM9 A;  1J5E O;  2HP8 A;  5DN6 G;  4TT3 G;  4P9O A;  2UXB B;  1ORQ C;  3Q4H A;  4MTG A;  1P49 A;  2YI8 A;  1GAX A;  5EIB C;  5CB4 A;  3MAQ A;  1VQ5 V;  4DUZ B;  4MVQ A;  2RJZ A;  3RYF B;  2GHY A;  2UUB B;  2JVD A;  4FLV A;  4X65 O;  3HPL C;  5FLX N;  5AG2 A;  4GUN A;  2UUC B;  2DE0 X;  1LUW A;  2JGD A;  2Y48 A;  4DR2 O;  4RUF A;  1AI4 A;  4JI5 B;  1MZE A;  4X9Q A;  2VQF B;  1MNG A;  1BHA A;  1K97 A;  4JYB A;  1R6K A;  4JYA O;  4IHJ A;  4WBN B;  1M57 B;  4HAM A;  1X59 A;  3DXR A;  3HKC B;  2JDI G;  2P22 C;  3T1Y B;  4Q20 A;  1PNL A;  4B7E A;  3RGB A;  4B3S O;  1ZX3 A;  3EVK A;  1M90 W;  5LP6 B;  3E2E A;  4FFK A;  2N04 A;  2Q7G A;  3SPI A;  1XMQ O;  3L71 H;  2LFS A;  4DW0 A;  4O4H B;  2EIM B;  3OUS A;  4LWS B;  4JI3 B;  4MVZ A;  1N33 O;  1WP7 A;  3UM7 A;  4C7U A;  4DV7 B;  1KC8 W;  2P4K A;  4O2B A;  4B3T O;  2Z5U A;  3G67 A;  1W59 A;  1Q90 D;  2IW5 A;  4LH7 A;  1AP5 A;  2YIB D;  1AR5 A;  4DR1 B;  2A9H A;  4KFM A;  4DV3 B;  2YIB A;  4JI1 O;  3B40 A;  3UKM A;  3RYF A;  3TK1 A;  4F6R B;  1AJN A;  4K3A A;  3QF7 A;  4MVU A;  3GWK C;  3NR7 A;  4JAS A;  2LW7 A;  4F6E A;  3CCR V;  1H8E G;  2YID A;  5H9C A;  1R3K C;  4LCU C;  4X66 O;  5IT9 N;  2GUZ B;  2H94 A;  3K58 A;  3JAW B;  1YSC A;  5IYZ B;  4WBN A;  2A7W A;  4PA9 A;  4F4L A;  3P3P A;  1F4M A;  3HKC A;  2F4V B;  2ZM6 B;  1BS3 A;  1Y4M A;  2EIN C;  4ZIB A;  4AQY O;  3A0B Z;  3CRA A;  2ILM A;  5LP6 A;  1QU7 A;  5KX5 B;  4UVB A;  1QR9 A;  4DR3 O;  3K5L A;  5LMN B;  4O4H A;  1VQO V;  4LWS A;  3ZHU A;  3OGC C;  4BWA A;  4CZZ A;  2RDC A;  5JJN B;  2Q0O C;  3UO2 A;  3P3N A;  1WNS A;  2EIK B;  4D7T A;  1JPX A;  1XDC A;  4I55 B;  4FLX A;  1AR1 B;  2NR5 A;  4NXM B;  5B3S C;  3ETG A;  3OMA B;  4B3R O;  1KB9 F;  4F6R A;  4KHP O;  3IJ4 A;  4NYK A;  4LFA B;  3D36 C;  4LFB B;  1EN4 A;  1Q7Y W;  3J80 N;  4GX0 A;  4GZR B;  3J7A U;  2PGG A;  2FL4 A;  2ATK C;  3G80 A;  3RW0 A;  4X64 O;  4ABM A;  1B04 A;  3CXC U;  4FMT A;  2GUZ A;  3JAW A;  3WG7 C;  4QE9 A;  3ZRW B;  4J7Z A;  5IYZ A;  2E75 B;  3BPZ A;  4B3M B;  1HNZ B;  2F1M A;  4TSF G;  3ZMU A;  4R50 A;  5LBQ A;  2LGQ A;  1K3E A;  3ZHR A;  1OCC B;  1V9P A;  3DSQ A;  3DTU B;  3FB7 C;  5KA5 A;  1W2B U;  2ZDI A;  2IJJ A;  4MT8 A;  3H1H H;  3K06 A;  3KCY A;  4MVO A;  4JI7 O;  2QE7 G;  4J10 A;  1KP2 A;  3KG2 A;  4LF5 O;  4E4E A;  4UUJ C;  1GO3 F;  4XDK A;  4EFE A;  2E76 B;  5DED A;  2HVK C;  1MZF A;  2YEV B;  3I5D A;  2WPD G;  2R9I A;  3CC4 V;  4QIW F;  4I55 A;  3ASO C;  5JCO A;  2PYL A;  3CCS V;  1YHQ V;  5KA6 A;  1GN4 A;  3K9A A;  3OMI B;  4U3J B;  4J9Z B;  1XMO O;  2VWK A;  1HDJ A;  3K9S A;  4IL6 Z;  1QQC A;  3BAB A;  4I9Q A;  3B8N A;  3MDS A;  1TUE B;  3WU2 Z;  1TUB B;  4NVP A;  3CME V;  5FL7 G;  4K35 A;  2AZ2 A;  3R66 A;  3FAV A;  2OCC B;  3K0D A;  2DQ0 A;  2YUA A;  1QLN A;  3BFR A;  1THZ A;  1JCH A;  3ZRW A;  1E1R G;  4JI8 B;  1ZTE A;  4XDJ A;  4DR7 B;  3LSQ A;  4O4J A;  4DR4 B;  3WB2 A;  1M93 A;  5KHI A;  5JJJ B;  4X20 B;  2DYS B;  3RBZ A;  3CPW U;  4JAU A;  1NTM H;  5BZB A;  1M56 C;  1HNX O;  4TQD A;  3N2K B;  1IBL O;  1BCC H;  4W4K A;  4DO2 A;  3A8T A;  2UXC B;  2CE4 A;  2F95 B;  1WJZ A;  3N2G B;  1VF6 A;  1BSM A;  4OGQ B;  3RYC B;  2R70 A;  2LW1 A;  2CUG A;  3K57 A;  4FK5 C;  4I5S A;  4NTW A;  2QR4 A;  2CTP A;  2GSM B;  2YEV A;  3SJQ C;  4R8C A;  2UU9 O;  1JX9 A;  5L3C A;  4LF8 B;  1N8R W;  5EBW C;  3WB1 A;  4LFC B;  2PZS A;  3ETD A;  5EBL C;  4JI6 O;  1PP9 H;  1TGO A;  1S5J A;  3F7Y C;  4Z2W A;  3JAS B;  4LBE C;  4EB6 B;  4NR1 A;  1LNQ A;  4ZKI A;  2NNU A;  4NB5 A;  5GW7 A;  3L9D A;  4BR6 A;  2WSS G;  1WA8 B;  1B06 A;  1JOY A;  4PDV A;  4IYI A;  3AG4 C;  3HKB B;  2IH1 C;  2Q67 A;  1N34 B;  2V1D A;  4DR6 O;  1DGS A;  2BSK B;  5CBF A;  2UUA O;  4H33 A;  5IY5 C;  2RQ6 A;  3OAA G;  4J80 A;  5B1O A;  1XI1 A;  4TOI A;  4LF9 B;  2E5L B;  2LJ2 A;  2PI5 A;  5EC1 C;  2ZE8 A;  1U96 A;  1GN3 A;  1FYJ A;  1V54 C;  5LXT B;  3K5M A;  3U0Z A;  4JTA B;  4UCO A;  4JAV A;  4QPJ A;  5BR8 O;  3ABM B;  1TAE A;  2K1E A;  2PY5 A;  1MAB G;  3ZHV A;  4UCU A;  3IAY A;  3N2K A;  1MG1 A;  1OCR B;  4FM1 A;  1I0H A;  4Z1V A;  4CH5 A;  1AVM A;  2EIJ B;  2IJK A;  2CK3 G;  3N2G A;  2QA4 V;  3ASN C;  3RYC A;  1AI6 A;  1DK1 A;  3AG3 C;  1U97 A;  1WAZ A;  2BE3 A;  5L3G A;  2ZKO A;  4FVM A;  3SYP A;  3CCU V;  2BTO A;  5IYB O;  1IVS A;  2EBO A;  4OPA A;  2ODM A;  2HR3 A;  1X4T A;  3VQV A;  1SZT A;  1Y76 B;  1K7D A;  3MD0 A;  2RCV A;  2CGO A;  3B4S A;  4MW8 A;  1EBO A;  4EB6 A;  4NTX A;  3D8C A;  4UCT A;  5D5Q A;  3W7W A;  2ADP A;  1XQ8 A;  3KCX A;  3Q4H B;  3VQX A;  1N4C A;  4GCZ A;  4NTY A;  1EN6 A;  2EX3 A;  3BA9 A;  3HKB A;  5CB4 B;  4D7S A;  1KYO F;  2BSK A;  3CC2 V;  1NT2 B;  2F43 G;  1CP9 A;  2KKW A;  1I5X A;  2P7T C;  3SJC C;  3ABK B;  4YY3 B;  4JI0 O;  1N32 O;  3RN4 A;  3OTF A;  4G2K A;  4PDM A;  4X88 A;  1VQ9 V;  2CTQ A;  1KQS U;  3A0H Z;  1R6T A;  4ASU G;  4DW1 A;  4FPP A;  2ZE7 A;  3JD0 A;  4AHC A;  5LXT A;  3CCV V;  5E1A C;  2CH7 B;  1VQM V;  1OCZ B;  2F23 A;  4PI0 A;  1DF5 A;  4IHJ B;  2YC0 A;  3JD1 A;  1M57 C;  1W0J G;  3A2F A;  1J95 A;  1IBK O;  4WFE A;  3CRC A;  3JD4 A;  4OX9 O;  4BIU A;  2KSD A;  2L35 A;  2BOC C;  2QWR B;  4Q6G A;  2AW9 A;  4BW5 A;  1D2D A;  5LP6 C;  3ZRX A;  3E8G A;  3EHB B;  4X8A A;  2F93 B;  4DV4 B;  4JI4 O;  3BVO A;  2ZIN A;  2AGA A;  1HNW B;  3NXS A;  4FZ1 A;  2EIM C;  4GLX A;  1SQQ H;  4P9P A;  4KUM A;  2A0L A;  4MSW C;  1H2K A;  5IWA O;  1SQV H;  3E35 A;  4DRX B;  1Y76 A;  1YJ9 V;  1R1B A;  2KG7 B;  5DM6 V;  2D3O W;  1GK9 A;  1N36 O;  1VQL V;  3LSU A;  4FLW A;  2L6L A;  2Q7E A;  1R3I C;  3FB6 C;  2CTR A;  1PV0 A;  4RO2 A;  3OMN B;  1JR9 A;  4MTX A;  3B77 A;  3OD4 A;  3TCU A;  1YZB A;  5B1B C;  5H6Q A;  1NR7 A;  2Q5Z A;  4X65 B;  4DV5 O;  2YIC A;  1XL6 A;  3O9O A;  5LL6 Y;  5CA1 B;  2JJ1 G;  2VRZ A;  4DR2 B;  5BXZ A;  4PV1 B;  2DOS A;  5JWP A;  1DF4 A;  3JAT A;  2W0F C;  2PYJ A;  2P6J A;  1S0V A;  1YCI A;  2CH7 A;  1LUV A;  1YEW A;  3G6B A;  2IM9 A;  4LF6 O;  3DC5 A;  1A32 A;  1XNR O;  2OTJ V;  4B3S B;  4G27 B;  3G6E V;  1H2L A;  1I94 B;  1WB8 A;  5HFL A;  3E89 A;  3LNN A;  1EZV H;  1XBL A;  3HR0 A;  3VOU A;  3UT5 B;  4TQF A;  1RPR A;  1VEW A;  3EFF K;  3D3Q A;  4K0K O;  1AR4 A;  5LGU A;  4DRX A;  1N33 B;  3B2E E;  2KG7 A;  2DYR B;  1VF7 A;  2WLN A;  3S3W A;  3CSX A;  1BMF G;  1L0L H;  2EIK C;  1NJI W;  3H1J H;  4BW9 A;  5JCO C;  1NZ6 A;  4JF3 A;  2QSA A;  4WFF A;  5KMG A;  3QTC A;  2W0X A;  3SYA A;  3H01 A;  3ZRS A;  1O9H A;  4QJF B;  4J9Y B;  4JI1 B;  3JAL A;  5B1B B;  3BAA A;  2IBZ H;  4FLZ A;  1G6U A;  4JAA A;  5CA1 A;  1YTF D;  4DR1 O;  5L3D A;  2LO1 A;  4J42 A;  3QO5 A;  2H8P C;  2R9A A;  5LHH A;  2JEX A;  2YS8 A;  3T1H O;  3CWB H;  1F7Y A;  4I4T B;  1D5A A;  4X66 B;  1Z5W A;  2E74 B;  1DLB A;  1F4N A;  4CC6 A;  3FFQ A;  3C90 A;  2P06 A;  4PDR A;  2YI9 A;  1NVP D;  1XNQ B;  1K9M W;  2D2C B;  3OEH G;  3W7S A;  4X62 O;  4DV1 O;  3S3X A;  2ITC C;  2UXD O;  2VWJ A;  3OGI B;  3CCE V;  2P90 A;  1OCC C;  4J7K A;  4LC1 A;  4OPH A;  4AQY B;  5CA0 B;  2ZM6 O;  3BCC H;  4IGG A;  5IJ9 B;  3UT5 A;  1B6Q A;  4DR3 B;  2FB5 A;  5ITZ B;  2CTW A;  1GH6 A;  1URF A;  1VF6 C;  1Y66 A;  1DTO A;  1XOU A;  1CPY A;  4JZ2 A;  1VQ6 V;  2EUL A;  1WB7 A;  4JI2 O;  5TIS Z;  3ZRV A;  1FS0 G;  3AG2 B;  4GKJ O;  3OTO B;  4JTC B;  5KAF Z;  5KHH A;  1F23 A;  2Y4T A;  1VQ8 V;  4B3R B;  2AZ0 A;  1FXV A;  3LUT B;  3G71 V;  4AIL C;  2IJH A;  4KHP B;  3SPH A;  4DV0 O;  5LOV B;  4KL1 A;  5EIB D;  2RN9 A;  1GRJ A;  3VQW A;  1MA1 A;  1OCO B;  1PNK A;  2AHY A;  3CEI A;  1SA0 B;  2EJ7 A;  3FAV B;  5L3F A;  2OCC C;  2X0L A;  4I4T A;  5LMU B;  1YXB A;  1EFR G;  2R9R B;  3L74 H;  4CH4 A;  3SYQ A;  4O4J B;  3CP1 A;  3F5W C;  4YIO A;  5EYP A;  1KEC A;  2BCC H;  4YJ3 B;  2DYS C;  3K5N A;  3PN1 A;  1YIT V;  1S72 V;  1VAR A;  5CA0 A;  1VF5 B;  1M5I A;  2Y69 B;  1VQ4 V;  2JK5 C;  4GKK B;  2NLJ C;  2EIL B;  3CRR A;  4HNA B;  3QG5 A;  5IJ9 A;  4MS2 A;  3LDD A;  5ITZ A;  1IZ3 A;  1FJG O;  1K4C C;  4WFB V;  1SS3 A;  3K0G A;  1AIL A;  3QO7 A;  4UFZ A;  4H0L B;  4XBF A;  3FX7 A;  3W7U A;  2WAM A;  1AJP A;  2ZCE A;  5HFM A;  2QM4 A;  1OZ0 A;  2RMK B;  1KBH A;  4LP8 A;  1L8D A;  4WF9 V;  2R72 A;  3U10 A;  4N21 A;  1IBM B;  5IE9 A;  4YIP A;  1VQP V;  2V7Q G;  3DC6 A;  4I9W A;  1XMO B;  2FYU H;  3M7M X;  3VBB A;  1EM1 A;  5LOV A;  5E79 Z;  3K5O A;  3SYO A;  4DR5 O;  1BGY H;  2Q7H A;  3ETE A;  1W0K G;  4O4L B;  1SA0 A;  1BHB A;  2KQX A;  2IJI A;  4UVC A;  4PI2 A;  5GON B;  1WPX A;  1GTO A;  2DMX A;  1SQP H;  4NXN O;  4JYC A;  2A3Q A;  3E22 B;  3JAM N;  1BZK A;  3UCS C;  3HKD B;  2Q6A A;  3APO A;  1NU1 H;  1UFI A;  4DV2 O;  4YHH B;  4YJ3 A;  2OIE A;  1SQX H;  5KUM A;  3W7T A;  3SJB C;  2IU0 A;  4PA3 A;  4K8Z A;  3ABM C;  2WA3 A;  1OCR C;  1K73 W;  4HNA A;  4DR4 O;  2F66 C;  1HNX B;  2OIG A;  1IBL B;  1S76 D;  1XIL A;  2EIJ C;  3K08 A;  1R3J C;  4MTO A;  5J2U B;  3IC7 A;  1TVK B;  5IDJ A;  4DV6 O;  1NTK H;  2XTA A;  1P7B A;  2X6A A;  4KP4 A;  4KXR A;  1LR1 A;  3N27 A;  1WP8 A;  1PL4 A;  2W6J G;  4RAI A;  1BQZ A;  5FPR A;  2OCH A;  2UU9 B;  2JJ2 G;  4LF4 O;  2UXC O;  2HJF C;  2EZP A;  2XAG A;  1GM8 A;  3BRC A;  1QLE B;  2Q69 A;  3E8F A;  4JI6 B;  2B5U A;  5J9P C;  4GYC B;  3SDL A;  2DW4 A;  3CYO A;  1Q5O A;  1HP8 A;  3A0R A;  3CCQ V;  3BA8 A;  4MTF A;  5JH7 B;  5K1X A;  1S5H C;  1EZJ A;  1P4R A;  5LA6 B;  1SES A;  4QGP A;  4O4L A;  2HHH O;  4WFG A;  3TGU H;  1PL0 A;  4DR6 B;  5GON A;  3ABK C;  2Q73 A;  1M1K W;  1NI8 A;  1V55 B;  3E22 A;  1Q86 W;  1ZSP A;  1N34 O;  3GB7 C;  3OUF A;  2JRI A;  3VQY A;  4BIO A;  3HKD A;  1KU9 A;  2ADQ B;  2XAJ A;  3CD6 V;  2DJV A;  1OCZ C;  2N74 A;  1AI5 A;  1SQB H;  5CN0 A;  5B66 Z;  4PEL A;  5CA3 A;  1RSO B;  5BR8 B;  3UQ8 A;  2PI4 A;  1O9G A;  3CX5 F;  2PUS A;  4FM2 A;  2GBO A;  4E2L A;  4TV8 B;  2XAH A;  4JV5 O;  1RFY A;  5J2U A;  1TVK A;  1PPJ H;  5GTI Z;  1VP7 A;  1NR1 A;  3AG1 B;  4X1I B;  2WLL B;  2XAS A;  2EJR A;  4YJ2 B;  4PA7 A;  4LR3 A;  2AXT Z;  2DWD C;  3E86 A;  3STZ C;  1KKC A;  4ZHQ B;  5A9G A;  2JS3 A;  4N23 A;  3E83 A;  4PA4 A;  5L3E A;  1OHH G;  1RM1 B;  4DUY O;  1YDX A;  1CEZ A;  2OWO A;  2ZR2 A;  5JH7 A;  1IXB A;  4PDL A;  5LA6 A;  2JEU A;  4TV9 A;  1IUR A;  5BMV A;  3CE2 A;  2Z3Y A;  1HR0 O;  3CJH B;  3H9V A;  2Y4U A;  2G38 A;  1XUQ A;  2O57 A;  3QVN A;  1BE3 H;  3ABU A;  3OT7 A;  1GN6 A;  1Q6H A;  4Z1M G;  4JI0 B;  1N32 B;  2VQE O;  4L87 A;  1RP3 B;  1ZLZ A;  5KHK A;  3QO8 A;  1G4Y B;  4CH6 A;  3JAT B;  1XHX A;  3U11 A;  3K04 A;  3LDE A;  3ABL B;  2JGU A;  2JS5 A;  4YY3 O;  1YIJ V;  1VIB A;  2NN4 A;  2GDS A;  1YVW A;  3CRM A;  3K79 A;  3C3S A;  4WFA V;  5B1A B;  5L3B A;  3OR6 C;  1RSO A;  5FNV B;  1JA8 A;  1IBK B;  2ZXW B;  2QWN B;  4TV8 A;  1K4D C;  4YXW G;  1K8A W;  1Z2G A;  4OX9 B;  1Q43 A;  5EZY B;  3T4Z A;  5EC2 C;  2KB1 A;  4UCR A;  2Y0P A;  3H1K H;  2GTA A;  1NH2 B;  4JI4 B;  3ZX6 A;  4X1I A;  2QDO A;  4TUY B;  2WLL A;  1FXK B;  2GTS A;  5F2V O;  4UB6 Z;  3CC7 V;  5D5P A;  3E8H A;  3ZS8 C;  4YJ2 A;  2ZQM A;  3JD2 A;  2IH3 C;  3JCZ A;  4PA6 A;  4ZHQ A;  1VMG A;  3OFN G;  2DYR C;  4GT1 A;  1I08 A;  3K3W A;  4BAY A;  2HKO A;  3JCU Z;  3B8M A;  2B9Z A;  4R7C A;  2Q68 A;  5LGN A;  1J5E B;  2N05 A;  3FD9 A;  1G8M A;  1N36 B;  5KMG B;  3G4S V;  4LF7 O;  4X1Y B;  3ICX A;  4JZG A;  1NS1 A;  5KLV H;  2CAZ C;  3SPG A;  3B09 A;  3RT3 C;  2PTM A;  1QVG U;  3CJH A;  1JQ0 A;  3JAL B;  4IT5 A;  3M8A A;  4CC5 A;  3I56 V;  2UXB O;  2XAQ A;  1UJW B;  4DV5 B;  3T2M A;  4DXW A;  2WLK A;  4DUZ O;  1YTF B;  3APQ A;  2UUB O;  1HWY A;  5KAI Z;  1SZX A;  3KKY A;  3GWO A;  1CXZ B;  4EKW A;  2UUC O;  2DQ3 A;  1AJQ A;  4X89 A;  4LH6 A;  3ZMS A;  4JYA B;  1ENV A;  3CXH F;  5FNV A;  3FKS G;  4LF6 B;  3ZBH A;  3FB5 C;  4JI5 O;  1NVP B;  1XNR B;  1PNM A;  2VQF O;  1AP6 A;  4I7Z B;  3EXA A;  4ICG A;  2QJ1 A;  2ZNI A;  4RQE A;  5EZY A;  2QWQ B;  2QKS A;  3OW2 U;  2YSU B;  1NH2 D;  4J11 A;  2ZDI C;  3MHS C;  3QNE A;  4H13 B;  4TUY A;  4WCE V;  1FXK A;  3T1Y O;  1XMQ B;  3RYH B;  2BOB C;  1I94 O;  1D5N A;  4XDL A;  4K0K B;  3ZHQ A;  4BIZ A;  2ZE5 A;  1SF9 A;  1M4U A;  4B3T B;  4AI8 A;  1GN2 A;  4UVA A;  4JI3 O;  4B08 A;  2Y0I A;  3L70 H;  4DV7 O;  3IGA C;  4X1Y A;  3AG2 C;  4P2Z A;  3X2Q B;  1MSD A;  2C2A A;  3ZIA G;  1K92 A;  5EK0 A;  3AG7 A;  4TWK A;  4DK1 A;  3T1C A;  3CCJ V;  1Q6U A;  5EBM C;  1Q8I A;  3CB2 A;  1OCO C;  4DV3 O;  2LP7 A;  4FJC C;  3R65 A;  4JTD B;  1OV9 A;  5DEC A;  3CHX A;  2UXN A;  3T1H B;  4OXS A;  3OEE G;  5JQG B;  2WLJ A;  3TJT A;  2FML A;  1KUQ A;  1KP3 A;  4R6Z A;  4A5U B;  1H38 A;  4J7J A;  1ZUQ A;  1GMG A;  2LFR A;  5EYP B;  5J2T B;  4X62 B;  4DV1 B;  2UXD B;  4GX2 A;  2GV9 A;  1L0N H;  3E8B A;  4H44 B;  2Y69 C;  1XEQ A;  2IU3 A;  4HZ3 A;  5BY1 A;  3IC9 A;  3AK1 A;  1FXH A;  2EIL C;  3TXQ A;  1XNQ O;  4FLY A;  2F4V O;  1FD9 A;  2FKX A;  3RYH A;  3ZMZ A;  2ZR3 A;  2P4V A;  1ZWI C;  5IYD O;  3JSL A;  1SRY A;  3ZCC A;  3AEI A;  4I0X B;  1YI2 V;  1IX9 A;  2YXH A;  1B3Q A;  3WFV A;  4MVS A;  5GTH Z;  5LMN O;  4UCV A;  1ARO P;  3SYC A;  4JI2 B;  1S77 D;  2Z0A A;  3RYI B;  1BL8 A;  1I5Y A;  3CCL V;  2LQT A;  2FTK A;  3JAK B;  4G28 B;  4GKJ B;  1Y74 B;  1EN5 A;  1G1X B;  2QM7 A;  4PD4 F;  3O65 A;  2ARH A;  3ZMV A;  2QWO B;  4WFH A;  1SET A;  4NXM O;  3H1L H;  4DV0 B;  3OTO O;  1R73 A;  4HBN A;  4UCS A;  4X64 B;  2DWE C;  4I50 B;  1Q3E A;  4RQF A;  4LFA O;  1MSW D;  1BT8 A;  4LFB O;  1ROP A;  1JJ2 U;  1Q6I A;  5JQG A;  2ZNJ A;  3CCM V;  2EZO A;  5K1P A;  2Q8V A;  4MW3 A;  2P5O A;  1K5Q A;  3ZED A;  1Y6X A;  1TA8 A;  4B7K A;  5J2T A;  5LMU O;  4QE7 A;  1HW7 A;  3K03 A;  2WWW A;  4FLT A;  1M9N A;  1H8H G;  1IDS A;  4K8X A;  4FZ0 A;  3SR2 C;  3JSN A;  3FYI B;  2UXX A;  3BHP A;  4IIJ B;  4B3M O;  1HNZ O;  1K33 A;  3OM3 B;  4FIP C;  4O2A B;  3JYC A;  4JI7 B;  1XRE A;  1NKD A;  2XND G;  4LF5 B;  1YJN V;  4LNU B;  3SPJ A;  2H3O A;  2EIN B;  3RVY A;  1GM7 A;  4P30 A;  1FJG B;  1YJW V;  3ZMT A;  4I0X A;  4GKK O;  1QCE A;  1L1F A;  5KX5 A;  1US6 A;  1H2S B;  1PM9 A;  1PD3 A;  2HG5 C;  4FFB B;  3WB0 A;  3RYI A;  4UV8 A;  1JVM A;  1QLE C;  5LHI A;  1MMM A;  3JAK A;  2YDE A;  1Y74 A;  1GKF A;  3W7X A;  2MK3 A;  1K5S A;  3CMA V;  4RWU A;  2M6Y A;  5KHJ A;  5H2F Z;  2XUM A;  1Z5V A;  3D3I A;  3FB8 C;  3BEH A;  3ETQ A;  3SJA C;  3STL C;  5CBG A;  5B3S B;  4D6T H;  2RNB A;  4O4I B;  1IBM O;  4DR5 B;  2X6C A;  4I50 A;  3ZHS A;  1SKV A;  2ZIO A;  4JGS A;  3CS5 A;  1QNM A;  1V55 C;  3C3T A;  4NXN B;  1Q81 W;  4EFB A;  1QBZ A;  1E79 G;  5H5N A;  3L75 H;  1K34 A;  4CS3 A;  4DYL A;  1JMK C;  1JFF B;  4DV2 B;  1WLE A;  2WLI B;  1SQF A;  2YXY A;  3WG7 B;  4JI8 O;  1R6N A;  2QKA A;  4IIJ A;  4DR7 O;  2Q9L A;  4O2A A;  2XOK G;  2MW2 B;  4LNU A;  4YHH O;  2XHB A;  1KKD A;  4CH3 A;  4DV6 B;  4CBC A;  3AG1 C;  1S5L Z;  4JPR A;  4GX1 A;  3JD3 A;  1JJO A;  1KMI Z;  3ZHT A;  1H2G A;  4GX5 A;  4HYO A;  4FFB A;  4LF4 B;  3RFR A;  2B1G A;  5JVD B;  4IYH A;  5A2Q N;  5FPO A;  3J81 N;  2QKC A;  1E1Q G;  1QVF U;  1RM1 C;  1F51 A;  2ZE6 A;  1N0N A;  1S3J A;  1WN7 A;  3OR7 C;  3SPC A;  4LF8 O;  5IJ0 B;  4X1K B;  2V4D A;  5B1N A;  1Q82 W;  4LFC O;  3ASO B;  2CGN A;  2M7W A;  5CBH A;  1QR8 A;  4ZBM A;  4CS4 A;  2ZIM A;  4TV9 B;  4O4I A;  5BMV B;  4U3J A;  3M99 B;  1ZL8 B;  3PJS K;  2HHH B;  2ITD C;  2VS0 A;  1FAF A;  2UUA B;  3D36 A;  4UB8 Z;  2ZT9 B;  2QTS A;  3I55 V;  1BQ0 A;  2K9P A;  5JJE B;  4J41 A;  3HKE B;  5KHG A;  4MVM A;  1TUB A;  1YF2 A;  4FM0 A;  2X7R B;  2CDY A;  3L73 H;  5LYJ B;  2B1I A;  2HVJ C;  1JFF A;  3K59 A;  3ABL C;  4EEQ A;  2WLI A;  4U7N A;  3JAR B;  5C8Y B;  4ZOL B;  2WLH A;  2QTO A;  5LGT A;  2OT5 A;  5B1A C;  4LF9 O;  2E5L O;  3ZN1 A;  2ZXW C;  3H1I H;  2HLD G;  1T5E A;  3AK3 A;  3ZJZ A;  1VQ7 V;  2OTL V;  4JYY A;  5H6R A;  5LHG A;  4X20 A;  4JV5 B;  3KZI Z;  3RVZ A;  2Q4P A;  3UO3 A;  2BTQ B;  1M56 B;  1FXK C;  2E3C A;  4QPK A;  1KD1 W;  1ZAU A;  1AI7 A;  1XHZ A;  2QM8 A;  1FPO A;  3LDC A;  5JVD A;  3FYE B;  2P67 A;  2AHZ A;  3TET A;  2XAF A;  2ETN A;  3LNM B;  2XT9 A;  2OYQ A;  2X6B A;  1FFX B;  4DUY B;  5IJ0 A;  4X1K A;  3RWR D;  3THO A;  4FLU A;  3AK2 A;  4ZI7 B;  3T4D A;  4RUE A;  3TXS A;  3IFX A;  1ZL8 A;  3JAS A;  1HR0 B;  1PKX A;  5CMU A;  1FFT B;  3ML0 A;  2QEX V;  1R3L C;  2QGN A;  3LSS A;  1WA8 A;  4H37 A;  1NQT A;  1H2M A;  3HKE A;  1QHT A;  4CS2 A;  3AG4 B;  4NKG B;  2VQE B;  2ZD9 A;  1P84 F;  4U3F H;  3F5T A;  5LYJ A;  1WPB A;  5C93 A;  1MOF A;  2LGW A;  3ABT A;  2JIZ G;  1I7F A;  1Y67 A;  3JAR A;  5IY5 B;  4MVR A;  5C8Y A;  4ZOL A;  3P32 A;  2WA4 A;  2DN9 A;  3ZN0 A;  1VQK V;  2JGD B;  1SC5 B; 
#chains in the Genus database with same CATH homology
 2YXH A;  2Q4P A;  4QGP A;  1Y6X A;  2Q9L A;  2Q5Z A;  5IE9 A;  2OIG A;  2A3Q A;  3C90 A;  2P06 A;  2A7W A;  2GTA A;  2Q73 A;  1YXB A;  2OIE A;  1YVW A;  3CRA A;  3CRC A;  1VMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...