2Q9LA

Crystal structure of imazg from vibrio dat 722: ctag-imazg (p43212)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
MKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTHELKEVLNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hypothetical protein
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
total genus 33
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q9lA00
3CRAA 2Q9LA 1Y6XA 1VMGA 2YXHA 2GTAA 4QGPA 2OIEA 2Q73A 2Q5ZA 1YXBA 3C90A 2P06A 2A3QA 3CRCA 5IE9A 2Q4PA 2OIGA 2A7WA 1YVWA
chains in the Genus database with same CATH superfamily
1YITV 5JJEB 3SPJA 4CH3A 2YC0A 1L0NH 2RDCA 4PDLA 4DK0A 1N32O 5LMNO 4JYCA 4OX9B 5EC2C 1MG1A 2BSKA 3KCXA 2IH1C 4LF4B 3E2EA 4X1IB 1JQ0A 4PA6A 5LYJA 2CGOA 3STLC 1GTOA 4DRXB 3K04A 3MHHC 4LC1A 4X65O 4YY3B 4UCRA 3OM3B 2GUZA 4UVBA 1K8AW 1J5EO 3C3TA 5LBQA 4NB5A 1MZFA 1L0LH 4ZHQA 5BR8O 4UCUA 4HYOA 4PV1B 1YEWA 4WFBV 2GV9A 3HKCB 1I0HA 5LP6A 4DR7O 4FMTA 4IHJB 3ABTA 1IDSA 4B3RB 3M7MX 2Q8VA 3CX5F 2BOBC 2IU3A 3HB3B 4DR5O 4L87A 4HNAB 2OCCC 1YJNV 1Y76A 1IVSA 4A5UB 3U10A 4UCVA 1VQ6V 2NR5A 1IBLB 2YIBA 4QPKA 4X1KB 4AILC 2QWNB 2WLHA 2QWQB 2JDIG 3ABMC 2JK5C 4MSWC 4GKKO 1KECA 1QU7A 2YIAA 1AR1B 1W59A 5JJJB 4JI6B 1SRYA 3B8NA 1TVKB 1HNXO 4DV5O 5FPRA 1VF6A 1N33B 1NTMH 2GHYA 4JI8O 1XUQA 4FLXA 3K0DA 4MW3A 1EBOA 3CE2A 1SQQH 5LMNB 2R9AA 2QKCA 1LR1A 3JD0A 3SYPA 4UCSA 1QQCA 5LA6A 3SGIA 2VQFO 3K79A 4JAUA 1F51A 3QG5A 4NYKA 1OCRC 4AQYO 4TQDA 3JASA 2DWDC 2HP8A 4X65B 3ABUA 4WCEV 2UXDO 4BAYA 4TV9A 1PP9H 3RYFB 1H2NA 1R6TA 5J9PC 4JI7O 5GTIZ 2L6LA 2XAQA 4J9YB 3HKBA 3U0ZA 2YIBD 4JI5B 2A0LA 3B8MA 4CC6A 1V54C 2LO1A 2AHYA 4UVAA 3AG2B 2HVJC 2LGWA 1FXVA 5H6RA 2A7WA 2P90A 2EILC 4DR5B 1VQNV 4FPPA 4LP8A 4YJ3B 1MNGA 3DXRB 5ITZA 1XOUA 4O2AA 1S3JA 2GDSA 5CB4B 1H38A 4DUYO 3MAQA 2F4VO 1UPGA 2NLJC 3ABKB 3CCRV 5KA5A 3H1IH 3RT3C 1TUEB 2CE4A 3F5TA 2PUSA 4GKKB 2ITDC 1NKDA 4FLZA 5L3EA 2E76B 4G27B 4EFBA 4QIWF 1IBKO 3OE7G 3T1HB 1H8HG 1MA1A 1S5LZ 2GTAA 4AHCA 5IYZB 2ZIOA 1HNXB 3CMEV 1HP8A 4DV5B 5JJNB 2YSUB 2Q4PA 1NH2D 4JI8B 4G28B 4YXWG 2BOCC 4H37A 2EULA 2OTJV 5A9GA 1P7GA 3QNEA 1KD1W 4PA4A 1EZJA 5KHIA 4CH6A 5LOVB 2PI5A 3K5MA 3FKSG 4J41A 3F7VC 4FM0A 2KSDA 2JJ2G 1SETA 1JX9A 1VF6C 2EIJC 5KHJA 2Y4TA 1FXHA 1JOYA 1OCZC 2JGUA 1M56C 4JI7B 3K3WA 2DN9A 4YIPA 1HDJA 3G67A 2IU0A 1CPYA 4N23A 1BSMA 3QF7A 4LH6A 4DRXA 3TXSA 3N2GB 2HFEC 4X66O 4XDJA 1DTOA 2WPDG 4CS2A 3GWKC 4H0LB 5KX5B 3UO3A 1I5YA 5LXTB 1VQ9V 1WA8B 2OCCB 4LFAO 4J7JA 4I4TB 2F4VB 3BAAA 3SYCA 1QNMA 3OUSA 2E75B 4IHJA 5KUKA 2QWRB 2KG7B 3JD2A 1PNKA 3BPZA 1PNMA 2DW4A 4HNAA 1IBKB 1K3EA 3WU2Z 1JFFB 1NS1A 4FLUA 2WLMA 1P84F 1GH6A 4QE7A 2UU9O 1VMGA 5CBFA 3ZHTA 1AJPA 3D36A 3E8GA 4DUZB 4HZ3A 3G71V 5GONB 1WB8A 5J2TB 4X62O 1WAZA 1MOFA 4LFBO 1VQ8V 4GX0A 4UCOA 1Q8IA 3E22A 1H2SB 3RFRA 2A9HA 4AI8A 5IY5C 3ETEA 1PV0A 3OGIB 2QGNA 4FFKA 5KHGA 1TVKA 3CRMA 3ZRVA 1EN4A 2WLJA 3I5DA 1Y6XA 2PYJA 4LF7B 3W7UA 5C93A 5BMVB 5IJ9B 2XAGA 2DJVA 1SQFA 2ZM6O 1R1BA 4NVPA 5IWAO 5FLXN 4JYBA 2PTMA 4U3FH 4FZ0A 4GX2A 4P9OA 2ZQMA 4J7ZA 5JVDA 4JI3O 2B5UA 1A32A 2E74B 4UVCA 3ZEDA 2UXXA 4DR3O 4DV7O 5CBHA 1V54B 2BSKB 4X66B 3OAAG 2WA4A 1KC8W 1S0VA 4JV5O 2IBZH 4PDVA 1XQ8A 3RYFA 1AI6A 2EILB 1VQMV 4LFAB 4BIUA 3QVNA 2WSSG 5LGTA 1MSDA 3T2MA 1QR9A 3MDSA 3ZHRA 2JS3A 1P7BA 2ITCC 2GUZB 5TISZ 1QVFU 2YI9A 3IFXA 1GM9A 1NZ6A 4X20B 1ZUQA 4YJ3A 3RVZA 1F4MA 1H2KA 3DXRA 5CB4A 3U11A 2XAJA 2QE7G 2VRZA 1KYOF 3JARB 4X62B 1I94O 4LFBB 3AG3C 1M5IA 4FIPC 3CS5A 5H9CA 3TGUH 5B1BB 3ABLC 5FNVB 1DF4A 4FFBB 5IYZA 1SS3A 4Z2WA 5EYPB 5LL6Y 3APQA 3E8FA 1VEWA 5EIBD 3W7TA 2DQ0A 4GUNA 3H9VA 4NXNO 5L3CA 1SQXH 2M7WA 3D36C 5IWAB 2PGGA 1XBLA 4IGGA 3ZN0A 2ATKC 4NTXA 2EIJB 1S76D 4KFMA 4FLTA 2C2AA 3RBZA 4DW0A 1OCZB 4JI3B 1M56B 3B2EE 4B08A 2CGNA 5LOVA 2ZE8A 4DR3B 1Q3EA 2VWKA 1XREA 1ZAUA 4JV5B 1FXKC 3KG2A 2FMLA 3QO7A 2AZ0A 3E35A 3CC7V 4NTWA 4NXMO 2DWEC 2F95B 4LF5O 1RPRA 3E8HA 3ZRXA 3Q4HB 3ZMVA 3AG1C 1AI7A 3K9SA 4QE9A 3SYOA 3N2GA 5K1XA 3WB2A 2ZXWB 4X89A 1B06A 3HKBB 4MTXA 4BW5A 2B1IA 4LF9B 3JCZA 4X64O 5KX5A 5EIBC 4B7KA 1EN5A 1ORQC 5LXTA 1WA8A 4O4IB 5KAIZ 2UUCO 1LUVA 4I4TA 3T1YO 1M9NA 3RGBA 5F2VO 2AHZA 5E1AC 5ITZB 1I94B 4J80A 1HR0O 1EM1A 4CS4A 1PNLA 4L8JA 1AROP 2JJ1G 2KG7A 1AILA 2YXHA 3CEIA 2CTWA 1G6UA 1JFFA 4JI1B 2NN4A 1YXBA 5IY5B 2P06A 1GN4A 2H8PC 1PD3A 2XAFA 2EIMC 2FB5A 5D5PA 1YZBA 5J2TA 3GB7C 1S77D 1L8DA 3H1KH 1KBHA 3WFVA 3AG4C 1XHXA 1KKDA 4IYHA 2P4KA 2LQTA 4RWUA 3HR0A 4MT8A 2BTQB 2YDEA 1OJHA 5K1PA 2XT9A 4LFCO 1J95A 4K3AA 3UQ8A 2QTOA 5IJ9A 1H2MA 5CA1A 1SQVH 4JYAO 1KU9A 3JAKB 3K0GA 5C8YB 4LF8O 2ZNIA 4I0XA 2EIKC 4QGPA 1N34O 4R7CA 2P5OA 2F1MA 4IIJA 2LJ2A 2QWOB 3C90A 3MHSC 1YHQV 4F6RA 1FKAO 3QO8A 4MW8A 2Y0IA 2YUAA 2AGAA 4WFFA 1R73A 1DLBA 2GSMB 4GZRB 1W0KG 4MTGA 4FJCC 1K33A 3JYCA 3KCYA 3OR6C 4B3SO 3L9DA 5LHIA 5H2FZ 2DYSC 1NJIW 4EEQA 1IURA 2UUCB 2Z0AA 4PJ0Z 3ETGA 3T1YB 5LGNA 2W6IG 3HKEB 4P2ZA 5H5NA 1RPOA 4PA9A 5LGUA 2FKXA 3D3IA 2EINC 4UB6Z 3CCEV 2QKSA 4X20A 1TAEA 3AG3B 3D8CA 5DM6V 1FFXB 5J2UA 1HNZO 4EB6B 3ABLB 1ZX3A 1VQLV 2Q73A 2N74A 4LWSB 1JR9A 2UUBB 1BCCH 2HVKC 3JARA 1M4UA 4LF6O 1BHBA 1QLEC 1AJNA 2NNUA 2LP7A 2FYUH 1YVWA 4CZZA 3LDCA 5FNVA 4FFBA 1WNSA 4FZ1A 1D5AA 1NI8A 5EYPA 4LFCB 3BABA 1KKCA 4MVOA 3E22B 3K59A 1W2BU 4PA7A 1S5JA 1EZVH 3E89A 5JQGA 5IYBO 4JYAB 3ZS8C 1FXKB 2YXLA 4RQEA 4LF8B 5IYCO 4GX1A 3AK2A 3CCMV 1XNRO 3AG7A 3CXHF 4FVMA 1K5QA 3CCVV 1N34B 2Q7GA 3JAMN 5KLVH 2X7RB 4FM1A 4B7EA 1H8EG 2P7TC 1N32B 3P3PA 1YSCA 1KUQA 3AG1B 5JVDB 4DV0O 3B77A 1P49A 4X88A 1AVMA 4B3SB 1W0JG 3A8TA 4NR1A 2W0FC 3WG7C 2ZE7A 4WFEA 4U3JB 4Z1VA 3BHPA 3OMNB 3Q4HA 3EVKA 1EFRG 5CA3A 3ZHUA 1J5EB 4CH4A 1I7FA 4NKGB 4O4LB 4KUMA 4UV9A 5BR8B 1ROPA 4JZ2A 4DR1O 3ZHSA 4DR7B 5CN0A 1Z5VA 4JI0O 5BZBA 3FAVB 4O4IA 2ZDIC 4MS2A 4MTFA 5L3DA 2WAMA 1M90W 2EIMB 5BY1A 3IGAC 2CH7B 4O4JA 4UUJC 3TK1A 1XMQO 1K9MW 1XI1A 3AG4B 2HG5C 4TSFG 3LUTB 1QBZA 5DECA 4WF9V 3FB8C 1B6QA 4RQFA 1ZWIC 1VARA 4TT3G 4PELA 4PD4F 5KMGB 1NQTA 2ZR2A 3LNNA 3S3WA 5KUMA 3L72H 2VQEO 4LNUB 4OGQB 3OT7A 2BTQA 2EIKB 3CRAA 5B1BC 3CXCU 2UUAO 3JALB 3CB2A 4CS3A 4DV0B 1E79G 1FFTB 5JWPA 2VQFB 2K1EA 2ETNA 4BIOA 3CC4V 4AQYB 3RYHA 3PN1A 2Q68A 1K4DC 3JAKA 2QJ1A 5C8YA 1FJGO 4GLXA 2DYSB 3P30A 4QPJA 3JD4A 4KXRA 4D7TA 2UXDB 3ZMUA 1XNQO 2CUGA 5GTHZ 2R9IA 4I55B 1NU1H 1JVMA 1Z2GA 2QA4V 3K58A 3CMAV 5JH7B 4DV6O 5L3GA 4ICGA 2KB1A 4DR1B 2QM7A 2EINB 2YI8A 1BL8A 1WPBA 3JCUZ 2PYLA 4F6EA 5EZYA 1XMOO 3ZX6A 4YJ2A 1WB7A 1M93A 2PF4E 4JF3A 3HKEA 2FL4A 2Z3YA 5GW7A 3CHXA 3ICXA 2HKOA 1JCHA 3SJAC 3G6BA 3BVOA 3N27A 2WWWA 4DUYB 1XEQA 4X1YA 4YHHO 2XOKG 1QLEB 3CRRA 1XMQB 1MABG 1IBMO 3ETQA 1YDXA 4J42A 2ZXWC 1FFXA 1P4RA 4EB6A 3M8AA 3H1HH 4MVSA 3ZMZA 1X59A 4LWSA 3ZIAG 5CA0B 1QVGU 3A2FA 2P4VA 2LW1A 3IJ4A 3CCSV 3JD3A 1CEZA 1SERA 1KB9F 2VQEB 2OTLV 2UXBO 4KHPO 3ZHVA 2F66C 2B9ZA 3BA9A 1Q81W 3VOUA 2RCVA 1WN7A 2OYQA 2ZE6A 1VQ5V 2Y69C 1VQ4V 4OXSA 1R6KA 4IL6Z 3R65A 2PZSA 1HNWO 3THOA 3F5WC 1BGYH 3QO5A 3K9AA 3FX7A 1FXKA 1FPOA 1FJGB 1WLEA 2HLDG 1R3KC 2FTKA 3S3XA 5CA1B 3WG7B 4N21A 3H01A 4RUFA 1IXMA 2A3QA 4GT1A 4B3TO 4JI2O 1B04A 1OZ0A 3RYCA 2Q7EA 4MVUA 1GN2A 4I0XB 4U7OA 5EBLC 3RW0A 4FLVA 4JZGA 4JPRA 4IIJB 4F6RB 3ZRSA 4ZOLB 5D5QA 4GYCB 4IYIA 2P6JA 2IJIA 5E79Z 1SKVA 3AK3A 3APOA 4U3JA 3JATB 4OPAA 3JAWB 3VQYA 2AZ2A 4O4LA 4DR4O 3BRCA 4YHHB 2H94A 2PY5A 1DK1A 1IBMB 3OMAB 3FAVA 4JI4O 4YIOA 1GAXA 1GO3F 1Y66A 4O4HB 4DW1A 1E1QG 3OTFA 4BIZA 3W7WA 4Q6GA 5B3SB 5J2UB 2DYRC 2ZD9A 5CBGA 1GN6A 2UU9B 4ABMA 2BTOA 3LDDA 4O2BA 2CH7A 1AP6A 3R66A 3VQWA 1AR5A 4TWKA 5LHHA 3G80A 4XDLA 3ZBHA 1HNWB 3SJBC 3OUFA 5KMGA 5B1OA 5DEDA 2IJHA 3GVMA 2ZNJA 4MVQA 3TJTA 2QDOA 3X2QC 1BQ0A 3CRQA 4JTAB 5KA6A 1F23A 4X8AA 5IJ0B 4F4LA 2X6AA 3G4SV 4LNUA 1PL4A 1QR8A 5JQGB 2HJFC 2ZM6B 4UCTA 4B3TB 4JI2B 1UJWB 3LSQA 1SA0B 2Q0OC 4PI0A 3JALA 3L73H 4J9ZB 5A2QN 3ZHQA 2WA3A 1BS3A 4K0KO 2V1DA 2IJKA 3T4DA 3K08A 4DV7B 3JD1A 4DV4O 4UFZA 3CYOA 3CCJV 5EK0A 2Q9LA 4JASA 2DMXA 1V55C 3J81N 4I55A 3ZMSA 4ZBMA 3VQVA 4DR4B 4UV8A 2LW7A 1HW7A 5IE9A 1JJOA 1VF7A 2EX3A 5JH7A 5L3FA 3SYQA 4TUYB 3OR7C 1X4TA 1K92A 4FM2A 1B3QA 4MTOA 5H6QA 4JI4B 1BZKA 3E86A 3N2KB 3ASNC 2OT5A 1PL0A 2RN9A 2H3OA 3LSSA 3ASOB 5CMUA 3P3NA 1QLNA 1F4NA 4FLWA 3ZJZA 4H13B 3JSLA 4E2LA 5FPOA 3CJHB 3FD9A 2OIGA 3C3SA 3RVYA 2Y4UA 1O9HA 2O57A 4KL1A 1N36O 4LF4O 3STZC 4DR2O 4O4JB 2KQXA 3O9OA 3CP1A 2OIEA 5CA0A 2XTAA 1WPXA 2Y69B 2ZT9B 1YIJV 4PHZA 1TA8A 1RM1C 4C7UA 4FLYA 4NXNB 3BEHA 3QTCA 1K5SA 1EN6A 2EZPA 3HPLC 2D3OW 2ADQB 1BT8A 1PPJH 2QTSA 2XASA 3L74H 1U97A 4K0KB 4W4LA 3A0BZ 1JJ2U 4Q20A 1GRJA 3UM7A 3SJCC 1Q5OA 4D6TH 4DV4B 4GKJO 1WJZA 4JAVA 3RYHB 2CK3G 1YI2V 3K03A 4DO2A 4NXMB 4DV3O 1Y4MA 1KP3A 3AEIA 1T5EA 4ZKIA 4LF5B 3DTUB 2M6YA 1M57B 4ZOLA 1O9GA 2QM4A 3CD6V 2ODMA 3L70H 3JATA 2ZDIA 3B40A 1FD9A 3LNMB 3SPCA 1Q7YW 1D2DA 1N33O 4X64B 2DQ3A 5EZYB 3JAWA 1SC5B 3CCLV 2LFRA 2DE0X 1XL4A 1GMGA 4YJ2B 2DYRB 2QSAA 4ASUG 3CRCA 3CSXA 4HAMA 3OFNG 2JS5A 5IT9N 1N36B 1HR0B 2JEXA 1L1FA 4O4HA 4X1YB 4DR2B 1XDCA 2Y0PA 1AJQA 2JVDA 3OEHG 3K06A 3FB5C 1SF9A 3EXAA 4PA3A 2CTQA 1RP3B 1AB3A 1BE3H 3X2QB 4DR6O 4BWAA 1AI5A 1Q90D 4G2KA 3TXQA 2XHBA 1SZTA 4JYYA 4JI5O 3P32A 2CTPA 2ZIMA 4I9WA 5B1NA 3IC9A 4UB8Z 1S5HC 3BCCH 3KZIZ 4R50A 1RSOB 4XDKA 2P67A 4GKJB 5IJ0A 2QM8A 1OCCC 4CBCA 2Q67A 3UO2A 2WLKA 1UFIA 1AI4A 4P30A 4DK1A 1SQBH 2RMKB 1SA0A 4J11A 4QJFB 4DV3B 1V55B 3FB6C 1OCOC 3A0RA 3T4ZA 2F43G 3PJSK 4GX5A 4MVRA 2EJ7A 2WLIB 1Q6UA 3UT5B 3RN4A 3RYCB 1U96A 3T1HO 3FYIB 5B66Z 3OTOO 5KHHA 5LMUO 1K7DA 3ASNB 3BA8A 2OWOA 4EKWA 2AXTZ 4PDRA 2RQ6A 5EC1C 2A06H 2EBOA 1XILA 2EZOA 4H33A 4TUYA 4KP4A 1PKXA 5HFLA 1OV9A 1Y74A 3WB0A 4P9PA 3N2KA 1ZL8B 3A0HZ 2RNBA 3DC5A 1S72V 1TGOA 3K5OA 1IXBA 3ZCCA 4PI2A 4DYLA 1HNZB 1LUWA 5EBWC 3UCSC 3SPGA 1THZA 3OD4A 3FFQA 3CJHA 4ZI7A 4DR6B 1SESA 4B3MO 4LF6B 3K5LA 4JTCB 3SR2C 1F7YA 1RM1B 1K97A 4X9QA 1GM8A 4O2BB 4WBNB 2N05A 3F7YC 1K73W 2CDYA 3ZRWA 2P22C 1XHZA 2X0LA 1MZEA 5B3SC 1Q86W 3JSNA 3DC6A 1COWG 2W0XA 2Q6AA 3NR7A 3G6EV 3K5NA 1US6A 4TQFA 3DGEA 1NVPB 1XNRB 1Q43A 2YIDA 2XUMA 1VQPV 5LP6C 4CC5A 1WP8A 1VQOV 3H1LH 4CH5A 2F23A 2Z5UA 3OTOB 2Q0AA 2UXNA 2ARHA 5B1AC 5LMUB 1XL6A 2ADPA 2Q5ZA 1YTFB 1KQSU 1QHTA 2F93B 3BFRA 4DUZO 2YICA 4PDMA 3NXSA 4IT5A 2IJJA 3CC2V 1AR4A 2E3CA 1MMMA 2G38A 1I08A 2YEVB 4I50B 5IYDO 2JGDB 1CXZB 2JIZG 3OEEG 3CCQV 4K8ZA 1VIBA 4LF7O 4JI0B 4DXWA 2BE3A 3FB7C 1GN3A 2CTRA 2E5LO 3J80N 2VS0A 3UKMA 1SZXA 4B3MB 3LDEA 2XNDG 1KMIZ 3HKDB 3O65A 1Z5WA 1TUBB 4EFEA 4X1IA 3SYAA 4DV1O 2IW5A 2K9PA 3D3QA 5JCOA 2B1GA 4WFHA 3ASOC 1K4CC 1YJWV 1Q6IA 3K57A 3W7SA 2IM9A 4HBNA 4MVZA 1OCCB 3CPWU 1BMFG 3VBBA 3HKCA 1YJ9V 4D7SA 3TCUA 1SQPH 1OCOB 3LSUA 4Z1MG 1RSOA 3IC7A 1VP7A 3W7XA 3ABMB 2UUAB 1H2LA 1JMKC 3SJQC 4R8CA 3ML0A 1ZLZA 1N4CA 2QWPB 4X1KA 3ZMTA 1R6NA 3E83A 1M1KW 2KKWA 4K8XA 3EHBB 1VQKV 3RYIB 4TV8B 1GKFA 2GBOA 3CWBH 1XNQB 1G4YB 2WLIA 3UT5A 1R3IC 1FS0G 1GM7A 2Y48A 4QNHB 4DV6B 1AP5A 1GK9A 3E8BA 1E1RG 1OCRB 4WFAV 2Q7HA 2R70A 4K35A 3CCUV 1R3LC 2BCCH 2WLLB 2E5LB 1YF2A 1VQ7V 3I55V 1XMOB 4TOIA 3BY6A 3OW2U 4LR3A 4LBEC 4R6ZA 1ZL8A 1M57C 2CAZC 4DV1B 2UXCO 2ZKOA 1H2GA 1NR1A 2HEPA 1URFA 1CP9A 1Y67A 2DOSA 2HHHO 2QR4A 5LYJB 4OPHA 1WP7A 1NR7A 4DV2O 1N8RW 2X6CA 3L71H 1PM9A 2GTSA 4WBNA 1ENVA 2YXYA 2UXBB 2Q69A 1KP2A 4KHPB 1Q6HA 4LCUC 4ZHQB 5KHKA 2QKAA 4LF9O 3WB1A 3J7AU 5LP6B 4FK5C 5JCOC 1D5NA 3ETDA 2VWJA 5EBMC 1Q82W 5B1AB 2XAHA 2HJDA 2YS8A 1Y76B 2QEXV 3DSQA 3M99B 2JEUA 3MD0A 3SDLA 4UXNA 2N04A 4RAIA 5BXZA 2D2CB 4E4EA 3FYEB 4XBFA 4JI1O 2R9RB 5B5EZ 1JPXA 2LFSA 3IAYA 2ZINA 3VQXA 2HR3A 2EJRA 2PI4A 1FAFA 1NBMG 4MVMA 2R72A 1MSWD 3GWOA 3EFFK 4GCZA 3KKYA 1V9PA 2YEVA 2WLNA 3OGCC 2ZE5A 4I50A 1NT2B 2JGDA 4BR6A 5DN6G 1K34A 5KAFZ 1ZSPA 2UXCB 2RJZA 1Y74B 3T1CA 5LA6B 5L3BA 1YCIA 2HHHB 1N0JA 3AK1A 2AW9A 5IDJA 3JASB 4JGSA 4NTYA 2X6BA 3HKDA 4W4KA 1NH2B 1TUBA 4DV2B 4TV9B 1DF5A 2MW2B 3L75H 4LH7A 3B4SA 2ZCEA 1NVPD 4ZI7B 1RFYA 4OX9O 2IH3C 2OCHA 2ILMA 4JTDB 3TETA 1NTZH 2MK3A 1HWYA 1JA8A 2ZR3A 5HFMA 4ZIBA 1R3JC 1G1XB 1BHAA 2V7QG 3SPHA 1FYJA 1YTFD 4YY3O 1NTKH 3ZRWB 4I7ZB 2W6JG 2JRIA 1LNQA 4O2AB 2L35A 4I5SA 2LGQA 1VF5B 3AG2C 4J10A 3SPIA 4WFGA 1OHHG 4RUEA 1SQGA 4B3RO 1IZ3A 3RWRD 4U7NA 2UUBO 1N0NA 1ZTEA 5GONA 1IX9A 5FL7G 3ABKC 3RYIA 1DGSA 4TV8A 3H1JH 4JAAA 4RO2A 1IBLO 2V4DA 3B09A 3I56V 3OMIB 4BW9A 5AG2A 2A79B 3ZN1A 1QCEA 5BMVA 4J7KA 2WLLA 4H44B 1G8MA 1I5XA 4I9QA 5LHGA 4JI6O 1BQZA
chains in the Genus database with same CATH topology
3CRAA 2Q9LA 1Y6XA 1VMGA 2YXHA 2GTAA 4QGPA 2OIEA 2Q73A 2Q5ZA 1YXBA 3C90A 2P06A 2A3QA 3CRCA 5IE9A 2Q4PA 2OIGA 2A7WA 1YVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRA A;  2Q9L A;  1Y6X A;  1VMG A;  2YXH A;  2GTA A;  4QGP A;  2OIE A;  2Q73 A;  2Q5Z A;  1YXB A;  3C90 A;  2P06 A;  2A3Q A;  3CRC A;  5IE9 A;  2Q4P A;  2OIG A;  2A7W A;  1YVW A; 
#chains in the Genus database with same CATH topology
 1YIT V;  5JJE B;  3SPJ A;  4CH3 A;  2YC0 A;  1L0N H;  2RDC A;  4PDL A;  4DK0 A;  1N32 O;  5LMN O;  4JYC A;  4OX9 B;  5EC2 C;  1MG1 A;  2BSK A;  3KCX A;  2IH1 C;  4LF4 B;  3E2E A;  4X1I B;  1JQ0 A;  4PA6 A;  5LYJ A;  2CGO A;  3STL C;  1GTO A;  4DRX B;  3K04 A;  3MHH C;  4LC1 A;  4X65 O;  4YY3 B;  4UCR A;  3OM3 B;  2GUZ A;  4UVB A;  1K8A W;  1J5E O;  3C3T A;  5LBQ A;  4NB5 A;  1MZF A;  1L0L H;  4ZHQ A;  5BR8 O;  4UCU A;  4HYO A;  4PV1 B;  1YEW A;  4WFB V;  2GV9 A;  3HKC B;  1I0H A;  5LP6 A;  4DR7 O;  4FMT A;  4IHJ B;  3ABT A;  1IDS A;  4B3R B;  3M7M X;  2Q8V A;  3CX5 F;  2BOB C;  2IU3 A;  3HB3 B;  4DR5 O;  4L87 A;  4HNA B;  2OCC C;  1YJN V;  1Y76 A;  1IVS A;  4A5U B;  3U10 A;  4UCV A;  1VQ6 V;  2NR5 A;  1IBL B;  2YIB A;  4QPK A;  4X1K B;  4AIL C;  2QWN B;  2WLH A;  2QWQ B;  2JDI G;  3ABM C;  2JK5 C;  4MSW C;  4GKK O;  1KEC A;  1QU7 A;  2YIA A;  1AR1 B;  1W59 A;  5JJJ B;  4JI6 B;  1SRY A;  3B8N A;  1TVK B;  1HNX O;  4DV5 O;  5FPR A;  1VF6 A;  1N33 B;  1NTM H;  2GHY A;  4JI8 O;  1XUQ A;  4FLX A;  3K0D A;  4MW3 A;  1EBO A;  3CE2 A;  1SQQ H;  5LMN B;  2R9A A;  2QKC A;  1LR1 A;  3JD0 A;  3SYP A;  4UCS A;  1QQC A;  5LA6 A;  3SGI A;  2VQF O;  3K79 A;  4JAU A;  1F51 A;  3QG5 A;  4NYK A;  1OCR C;  4AQY O;  4TQD A;  3JAS A;  2DWD C;  2HP8 A;  4X65 B;  3ABU A;  4WCE V;  2UXD O;  4BAY A;  4TV9 A;  1PP9 H;  3RYF B;  1H2N A;  1R6T A;  5J9P C;  4JI7 O;  5GTI Z;  2L6L A;  2XAQ A;  4J9Y B;  3HKB A;  3U0Z A;  2YIB D;  4JI5 B;  2A0L A;  3B8M A;  4CC6 A;  1V54 C;  2LO1 A;  2AHY A;  4UVA A;  3AG2 B;  2HVJ C;  2LGW A;  1FXV A;  5H6R A;  2A7W A;  2P90 A;  2EIL C;  4DR5 B;  1VQN V;  4FPP A;  4LP8 A;  4YJ3 B;  1MNG A;  3DXR B;  5ITZ A;  1XOU A;  4O2A A;  1S3J A;  2GDS A;  5CB4 B;  1H38 A;  4DUY O;  3MAQ A;  2F4V O;  1UPG A;  2NLJ C;  3ABK B;  3CCR V;  5KA5 A;  3H1I H;  3RT3 C;  1TUE B;  2CE4 A;  3F5T A;  2PUS A;  4GKK B;  2ITD C;  1NKD A;  4FLZ A;  5L3E A;  2E76 B;  4G27 B;  4EFB A;  4QIW F;  1IBK O;  3OE7 G;  3T1H B;  1H8H G;  1MA1 A;  1S5L Z;  2GTA A;  4AHC A;  5IYZ B;  2ZIO A;  1HNX B;  3CME V;  1HP8 A;  4DV5 B;  5JJN B;  2YSU B;  2Q4P A;  1NH2 D;  4JI8 B;  4G28 B;  4YXW G;  2BOC C;  4H37 A;  2EUL A;  2OTJ V;  5A9G A;  1P7G A;  3QNE A;  1KD1 W;  4PA4 A;  1EZJ A;  5KHI A;  4CH6 A;  5LOV B;  2PI5 A;  3K5M A;  3FKS G;  4J41 A;  3F7V C;  4FM0 A;  2KSD A;  2JJ2 G;  1SET A;  1JX9 A;  1VF6 C;  2EIJ C;  5KHJ A;  2Y4T A;  1FXH A;  1JOY A;  1OCZ C;  2JGU A;  1M56 C;  4JI7 B;  3K3W A;  2DN9 A;  4YIP A;  1HDJ A;  3G67 A;  2IU0 A;  1CPY A;  4N23 A;  1BSM A;  3QF7 A;  4LH6 A;  4DRX A;  3TXS A;  3N2G B;  2HFE C;  4X66 O;  4XDJ A;  1DTO A;  2WPD G;  4CS2 A;  3GWK C;  4H0L B;  5KX5 B;  3UO3 A;  1I5Y A;  5LXT B;  1VQ9 V;  1WA8 B;  2OCC B;  4LFA O;  4J7J A;  4I4T B;  2F4V B;  3BAA A;  3SYC A;  1QNM A;  3OUS A;  2E75 B;  4IHJ A;  5KUK A;  2QWR B;  2KG7 B;  3JD2 A;  1PNK A;  3BPZ A;  1PNM A;  2DW4 A;  4HNA A;  1IBK B;  1K3E A;  3WU2 Z;  1JFF B;  1NS1 A;  4FLU A;  2WLM A;  1P84 F;  1GH6 A;  4QE7 A;  2UU9 O;  1VMG A;  5CBF A;  3ZHT A;  1AJP A;  3D36 A;  3E8G A;  4DUZ B;  4HZ3 A;  3G71 V;  5GON B;  1WB8 A;  5J2T B;  4X62 O;  1WAZ A;  1MOF A;  4LFB O;  1VQ8 V;  4GX0 A;  4UCO A;  1Q8I A;  3E22 A;  1H2S B;  3RFR A;  2A9H A;  4AI8 A;  5IY5 C;  3ETE A;  1PV0 A;  3OGI B;  2QGN A;  4FFK A;  5KHG A;  1TVK A;  3CRM A;  3ZRV A;  1EN4 A;  2WLJ A;  3I5D A;  1Y6X A;  2PYJ A;  4LF7 B;  3W7U A;  5C93 A;  5BMV B;  5IJ9 B;  2XAG A;  2DJV A;  1SQF A;  2ZM6 O;  1R1B A;  4NVP A;  5IWA O;  5FLX N;  4JYB A;  2PTM A;  4U3F H;  4FZ0 A;  4GX2 A;  4P9O A;  2ZQM A;  4J7Z A;  5JVD A;  4JI3 O;  2B5U A;  1A32 A;  2E74 B;  4UVC A;  3ZED A;  2UXX A;  4DR3 O;  4DV7 O;  5CBH A;  1V54 B;  2BSK B;  4X66 B;  3OAA G;  2WA4 A;  1KC8 W;  1S0V A;  4JV5 O;  2IBZ H;  4PDV A;  1XQ8 A;  3RYF A;  1AI6 A;  2EIL B;  1VQM V;  4LFA B;  4BIU A;  3QVN A;  2WSS G;  5LGT A;  1MSD A;  3T2M A;  1QR9 A;  3MDS A;  3ZHR A;  2JS3 A;  1P7B A;  2ITC C;  2GUZ B;  5TIS Z;  1QVF U;  2YI9 A;  3IFX A;  1GM9 A;  1NZ6 A;  4X20 B;  1ZUQ A;  4YJ3 A;  3RVZ A;  1F4M A;  1H2K A;  3DXR A;  5CB4 A;  3U11 A;  2XAJ A;  2QE7 G;  2VRZ A;  1KYO F;  3JAR B;  4X62 B;  1I94 O;  4LFB B;  3AG3 C;  1M5I A;  4FIP C;  3CS5 A;  5H9C A;  3TGU H;  5B1B B;  3ABL C;  5FNV B;  1DF4 A;  4FFB B;  5IYZ A;  1SS3 A;  4Z2W A;  5EYP B;  5LL6 Y;  3APQ A;  3E8F A;  1VEW A;  5EIB D;  3W7T A;  2DQ0 A;  4GUN A;  3H9V A;  4NXN O;  5L3C A;  1SQX H;  2M7W A;  3D36 C;  5IWA B;  2PGG A;  1XBL A;  4IGG A;  3ZN0 A;  2ATK C;  4NTX A;  2EIJ B;  1S76 D;  4KFM A;  4FLT A;  2C2A A;  3RBZ A;  4DW0 A;  1OCZ B;  4JI3 B;  1M56 B;  3B2E E;  4B08 A;  2CGN A;  5LOV A;  2ZE8 A;  4DR3 B;  1Q3E A;  2VWK A;  1XRE A;  1ZAU A;  4JV5 B;  1FXK C;  3KG2 A;  2FML A;  3QO7 A;  2AZ0 A;  3E35 A;  3CC7 V;  4NTW A;  4NXM O;  2DWE C;  2F95 B;  4LF5 O;  1RPR A;  3E8H A;  3ZRX A;  3Q4H B;  3ZMV A;  3AG1 C;  1AI7 A;  3K9S A;  4QE9 A;  3SYO A;  3N2G A;  5K1X A;  3WB2 A;  2ZXW B;  4X89 A;  1B06 A;  3HKB B;  4MTX A;  4BW5 A;  2B1I A;  4LF9 B;  3JCZ A;  4X64 O;  5KX5 A;  5EIB C;  4B7K A;  1EN5 A;  1ORQ C;  5LXT A;  1WA8 A;  4O4I B;  5KAI Z;  2UUC O;  1LUV A;  4I4T A;  3T1Y O;  1M9N A;  3RGB A;  5F2V O;  2AHZ A;  5E1A C;  5ITZ B;  1I94 B;  4J80 A;  1HR0 O;  1EM1 A;  4CS4 A;  1PNL A;  4L8J A;  1ARO P;  2JJ1 G;  2KG7 A;  1AIL A;  2YXH A;  3CEI A;  2CTW A;  1G6U A;  1JFF A;  4JI1 B;  2NN4 A;  1YXB A;  5IY5 B;  2P06 A;  1GN4 A;  2H8P C;  1PD3 A;  2XAF A;  2EIM C;  2FB5 A;  5D5P A;  1YZB A;  5J2T A;  3GB7 C;  1S77 D;  1L8D A;  3H1K H;  1KBH A;  3WFV A;  3AG4 C;  1XHX A;  1KKD A;  4IYH A;  2P4K A;  2LQT A;  4RWU A;  3HR0 A;  4MT8 A;  2BTQ B;  2YDE A;  1OJH A;  5K1P A;  2XT9 A;  4LFC O;  1J95 A;  4K3A A;  3UQ8 A;  2QTO A;  5IJ9 A;  1H2M A;  5CA1 A;  1SQV H;  4JYA O;  1KU9 A;  3JAK B;  3K0G A;  5C8Y B;  4LF8 O;  2ZNI A;  4I0X A;  2EIK C;  4QGP A;  1N34 O;  4R7C A;  2P5O A;  2F1M A;  4IIJ A;  2LJ2 A;  2QWO B;  3C90 A;  3MHS C;  1YHQ V;  4F6R A;  1FKA O;  3QO8 A;  4MW8 A;  2Y0I A;  2YUA A;  2AGA A;  4WFF A;  1R73 A;  1DLB A;  2GSM B;  4GZR B;  1W0K G;  4MTG A;  4FJC C;  1K33 A;  3JYC A;  3KCY A;  3OR6 C;  4B3S O;  3L9D A;  5LHI A;  5H2F Z;  2DYS C;  1NJI W;  4EEQ A;  1IUR A;  2UUC B;  2Z0A A;  4PJ0 Z;  3ETG A;  3T1Y B;  5LGN A;  2W6I G;  3HKE B;  4P2Z A;  5H5N A;  1RPO A;  4PA9 A;  5LGU A;  2FKX A;  3D3I A;  2EIN C;  4UB6 Z;  3CCE V;  2QKS A;  4X20 A;  1TAE A;  3AG3 B;  3D8C A;  5DM6 V;  1FFX B;  5J2U A;  1HNZ O;  4EB6 B;  3ABL B;  1ZX3 A;  1VQL V;  2Q73 A;  2N74 A;  4LWS B;  1JR9 A;  2UUB B;  1BCC H;  2HVK C;  3JAR A;  1M4U A;  4LF6 O;  1BHB A;  1QLE C;  1AJN A;  2NNU A;  2LP7 A;  2FYU H;  1YVW A;  4CZZ A;  3LDC A;  5FNV A;  4FFB A;  1WNS A;  4FZ1 A;  1D5A A;  1NI8 A;  5EYP A;  4LFC B;  3BAB A;  1KKC A;  4MVO A;  3E22 B;  3K59 A;  1W2B U;  4PA7 A;  1S5J A;  1EZV H;  3E89 A;  5JQG A;  5IYB O;  4JYA B;  3ZS8 C;  1FXK B;  2YXL A;  4RQE A;  4LF8 B;  5IYC O;  4GX1 A;  3AK2 A;  3CCM V;  1XNR O;  3AG7 A;  3CXH F;  4FVM A;  1K5Q A;  3CCV V;  1N34 B;  2Q7G A;  3JAM N;  5KLV H;  2X7R B;  4FM1 A;  4B7E A;  1H8E G;  2P7T C;  1N32 B;  3P3P A;  1YSC A;  1KUQ A;  3AG1 B;  5JVD B;  4DV0 O;  3B77 A;  1P49 A;  4X88 A;  1AVM A;  4B3S B;  1W0J G;  3A8T A;  4NR1 A;  2W0F C;  3WG7 C;  2ZE7 A;  4WFE A;  4U3J B;  4Z1V A;  3BHP A;  3OMN B;  3Q4H A;  3EVK A;  1EFR G;  5CA3 A;  3ZHU A;  1J5E B;  4CH4 A;  1I7F A;  4NKG B;  4O4L B;  4KUM A;  4UV9 A;  5BR8 B;  1ROP A;  4JZ2 A;  4DR1 O;  3ZHS A;  4DR7 B;  5CN0 A;  1Z5V A;  4JI0 O;  5BZB A;  3FAV B;  4O4I A;  2ZDI C;  4MS2 A;  4MTF A;  5L3D A;  2WAM A;  1M90 W;  2EIM B;  5BY1 A;  3IGA C;  2CH7 B;  4O4J A;  4UUJ C;  3TK1 A;  1XMQ O;  1K9M W;  1XI1 A;  3AG4 B;  2HG5 C;  4TSF G;  3LUT B;  1QBZ A;  5DEC A;  4WF9 V;  3FB8 C;  1B6Q A;  4RQF A;  1ZWI C;  1VAR A;  4TT3 G;  4PEL A;  4PD4 F;  5KMG B;  1NQT A;  2ZR2 A;  3LNN A;  3S3W A;  5KUM A;  3L72 H;  2VQE O;  4LNU B;  4OGQ B;  3OT7 A;  2BTQ A;  2EIK B;  3CRA A;  5B1B C;  3CXC U;  2UUA O;  3JAL B;  3CB2 A;  4CS3 A;  4DV0 B;  1E79 G;  1FFT B;  5JWP A;  2VQF B;  2K1E A;  2ETN A;  4BIO A;  3CC4 V;  4AQY B;  3RYH A;  3PN1 A;  2Q68 A;  1K4D C;  3JAK A;  2QJ1 A;  5C8Y A;  1FJG O;  4GLX A;  2DYS B;  3P30 A;  4QPJ A;  3JD4 A;  4KXR A;  4D7T A;  2UXD B;  3ZMU A;  1XNQ O;  2CUG A;  5GTH Z;  2R9I A;  4I55 B;  1NU1 H;  1JVM A;  1Z2G A;  2QA4 V;  3K58 A;  3CMA V;  5JH7 B;  4DV6 O;  5L3G A;  4ICG A;  2KB1 A;  4DR1 B;  2QM7 A;  2EIN B;  2YI8 A;  1BL8 A;  1WPB A;  3JCU Z;  2PYL A;  4F6E A;  5EZY A;  1XMO O;  3ZX6 A;  4YJ2 A;  1WB7 A;  1M93 A;  2PF4 E;  4JF3 A;  3HKE A;  2FL4 A;  2Z3Y A;  5GW7 A;  3CHX A;  3ICX A;  2HKO A;  1JCH A;  3SJA C;  3G6B A;  3BVO A;  3N27 A;  2WWW A;  4DUY B;  1XEQ A;  4X1Y A;  4YHH O;  2XOK G;  1QLE B;  3CRR A;  1XMQ B;  1MAB G;  1IBM O;  3ETQ A;  1YDX A;  4J42 A;  2ZXW C;  1FFX A;  1P4R A;  4EB6 A;  3M8A A;  3H1H H;  4MVS A;  3ZMZ A;  1X59 A;  4LWS A;  3ZIA G;  5CA0 B;  1QVG U;  3A2F A;  2P4V A;  2LW1 A;  3IJ4 A;  3CCS V;  3JD3 A;  1CEZ A;  1SER A;  1KB9 F;  2VQE B;  2OTL V;  2UXB O;  4KHP O;  3ZHV A;  2F66 C;  2B9Z A;  3BA9 A;  1Q81 W;  3VOU A;  2RCV A;  1WN7 A;  2OYQ A;  2ZE6 A;  1VQ5 V;  2Y69 C;  1VQ4 V;  4OXS A;  1R6K A;  4IL6 Z;  3R65 A;  2PZS A;  1HNW O;  3THO A;  3F5W C;  1BGY H;  3QO5 A;  3K9A A;  3FX7 A;  1FXK A;  1FPO A;  1FJG B;  1WLE A;  2HLD G;  1R3K C;  2FTK A;  3S3X A;  5CA1 B;  3WG7 B;  4N21 A;  3H01 A;  4RUF A;  1IXM A;  2A3Q A;  4GT1 A;  4B3T O;  4JI2 O;  1B04 A;  1OZ0 A;  3RYC A;  2Q7E A;  4MVU A;  1GN2 A;  4I0X B;  4U7O A;  5EBL C;  3RW0 A;  4FLV A;  4JZG A;  4JPR A;  4IIJ B;  4F6R B;  3ZRS A;  4ZOL B;  5D5Q A;  4GYC B;  4IYI A;  2P6J A;  2IJI A;  5E79 Z;  1SKV A;  3AK3 A;  3APO A;  4U3J A;  3JAT B;  4OPA A;  3JAW B;  3VQY A;  2AZ2 A;  4O4L A;  4DR4 O;  3BRC A;  4YHH B;  2H94 A;  2PY5 A;  1DK1 A;  1IBM B;  3OMA B;  3FAV A;  4JI4 O;  4YIO A;  1GAX A;  1GO3 F;  1Y66 A;  4O4H B;  4DW1 A;  1E1Q G;  3OTF A;  4BIZ A;  3W7W A;  4Q6G A;  5B3S B;  5J2U B;  2DYR C;  2ZD9 A;  5CBG A;  1GN6 A;  2UU9 B;  4ABM A;  2BTO A;  3LDD A;  4O2B A;  2CH7 A;  1AP6 A;  3R66 A;  3VQW A;  1AR5 A;  4TWK A;  5LHH A;  3G80 A;  4XDL A;  3ZBH A;  1HNW B;  3SJB C;  3OUF A;  5KMG A;  5B1O A;  5DED A;  2IJH A;  3GVM A;  2ZNJ A;  4MVQ A;  3TJT A;  2QDO A;  3X2Q C;  1BQ0 A;  3CRQ A;  4JTA B;  5KA6 A;  1F23 A;  4X8A A;  5IJ0 B;  4F4L A;  2X6A A;  3G4S V;  4LNU A;  1PL4 A;  1QR8 A;  5JQG B;  2HJF C;  2ZM6 B;  4UCT A;  4B3T B;  4JI2 B;  1UJW B;  3LSQ A;  1SA0 B;  2Q0O C;  4PI0 A;  3JAL A;  3L73 H;  4J9Z B;  5A2Q N;  3ZHQ A;  2WA3 A;  1BS3 A;  4K0K O;  2V1D A;  2IJK A;  3T4D A;  3K08 A;  4DV7 B;  3JD1 A;  4DV4 O;  4UFZ A;  3CYO A;  3CCJ V;  5EK0 A;  2Q9L A;  4JAS A;  2DMX A;  1V55 C;  3J81 N;  4I55 A;  3ZMS A;  4ZBM A;  3VQV A;  4DR4 B;  4UV8 A;  2LW7 A;  1HW7 A;  5IE9 A;  1JJO A;  1VF7 A;  2EX3 A;  5JH7 A;  5L3F A;  3SYQ A;  4TUY B;  3OR7 C;  1X4T A;  1K92 A;  4FM2 A;  1B3Q A;  4MTO A;  5H6Q A;  4JI4 B;  1BZK A;  3E86 A;  3N2K B;  3ASN C;  2OT5 A;  1PL0 A;  2RN9 A;  2H3O A;  3LSS A;  3ASO B;  5CMU A;  3P3N A;  1QLN A;  1F4N A;  4FLW A;  3ZJZ A;  4H13 B;  3JSL A;  4E2L A;  5FPO A;  3CJH B;  3FD9 A;  2OIG A;  3C3S A;  3RVY A;  2Y4U A;  1O9H A;  2O57 A;  4KL1 A;  1N36 O;  4LF4 O;  3STZ C;  4DR2 O;  4O4J B;  2KQX A;  3O9O A;  3CP1 A;  2OIE A;  5CA0 A;  2XTA A;  1WPX A;  2Y69 B;  2ZT9 B;  1YIJ V;  4PHZ A;  1TA8 A;  1RM1 C;  4C7U A;  4FLY A;  4NXN B;  3BEH A;  3QTC A;  1K5S A;  1EN6 A;  2EZP A;  3HPL C;  2D3O W;  2ADQ B;  1BT8 A;  1PPJ H;  2QTS A;  2XAS A;  3L74 H;  1U97 A;  4K0K B;  4W4L A;  3A0B Z;  1JJ2 U;  4Q20 A;  1GRJ A;  3UM7 A;  3SJC C;  1Q5O A;  4D6T H;  4DV4 B;  4GKJ O;  1WJZ A;  4JAV A;  3RYH B;  2CK3 G;  1YI2 V;  3K03 A;  4DO2 A;  4NXM B;  4DV3 O;  1Y4M A;  1KP3 A;  3AEI A;  1T5E A;  4ZKI A;  4LF5 B;  3DTU B;  2M6Y A;  1M57 B;  4ZOL A;  1O9G A;  2QM4 A;  3CD6 V;  2ODM A;  3L70 H;  3JAT A;  2ZDI A;  3B40 A;  1FD9 A;  3LNM B;  3SPC A;  1Q7Y W;  1D2D A;  1N33 O;  4X64 B;  2DQ3 A;  5EZY B;  3JAW A;  1SC5 B;  3CCL V;  2LFR A;  2DE0 X;  1XL4 A;  1GMG A;  4YJ2 B;  2DYR B;  2QSA A;  4ASU G;  3CRC A;  3CSX A;  4HAM A;  3OFN G;  2JS5 A;  5IT9 N;  1N36 B;  1HR0 B;  2JEX A;  1L1F A;  4O4H A;  4X1Y B;  4DR2 B;  1XDC A;  2Y0P A;  1AJQ A;  2JVD A;  3OEH G;  3K06 A;  3FB5 C;  1SF9 A;  3EXA A;  4PA3 A;  2CTQ A;  1RP3 B;  1AB3 A;  1BE3 H;  3X2Q B;  4DR6 O;  4BWA A;  1AI5 A;  1Q90 D;  4G2K A;  3TXQ A;  2XHB A;  1SZT A;  4JYY A;  4JI5 O;  3P32 A;  2CTP A;  2ZIM A;  4I9W A;  5B1N A;  3IC9 A;  4UB8 Z;  1S5H C;  3BCC H;  3KZI Z;  4R50 A;  1RSO B;  4XDK A;  2P67 A;  4GKJ B;  5IJ0 A;  2QM8 A;  1OCC C;  4CBC A;  2Q67 A;  3UO2 A;  2WLK A;  1UFI A;  1AI4 A;  4P30 A;  4DK1 A;  1SQB H;  2RMK B;  1SA0 A;  4J11 A;  4QJF B;  4DV3 B;  1V55 B;  3FB6 C;  1OCO C;  3A0R A;  3T4Z A;  2F43 G;  3PJS K;  4GX5 A;  4MVR A;  2EJ7 A;  2WLI B;  1Q6U A;  3UT5 B;  3RN4 A;  3RYC B;  1U96 A;  3T1H O;  3FYI B;  5B66 Z;  3OTO O;  5KHH A;  5LMU O;  1K7D A;  3ASN B;  3BA8 A;  2OWO A;  4EKW A;  2AXT Z;  4PDR A;  2RQ6 A;  5EC1 C;  2A06 H;  2EBO A;  1XIL A;  2EZO A;  4H33 A;  4TUY A;  4KP4 A;  1PKX A;  5HFL A;  1OV9 A;  1Y74 A;  3WB0 A;  4P9P A;  3N2K A;  1ZL8 B;  3A0H Z;  2RNB A;  3DC5 A;  1S72 V;  1TGO A;  3K5O A;  1IXB A;  3ZCC A;  4PI2 A;  4DYL A;  1HNZ B;  1LUW A;  5EBW C;  3UCS C;  3SPG A;  1THZ A;  3OD4 A;  3FFQ A;  3CJH A;  4ZI7 A;  4DR6 B;  1SES A;  4B3M O;  4LF6 B;  3K5L A;  4JTC B;  3SR2 C;  1F7Y A;  1RM1 B;  1K97 A;  4X9Q A;  1GM8 A;  4O2B B;  4WBN B;  2N05 A;  3F7Y C;  1K73 W;  2CDY A;  3ZRW A;  2P22 C;  1XHZ A;  2X0L A;  1MZE A;  5B3S C;  1Q86 W;  3JSN A;  3DC6 A;  1COW G;  2W0X A;  2Q6A A;  3NR7 A;  3G6E V;  3K5N A;  1US6 A;  4TQF A;  3DGE A;  1NVP B;  1XNR B;  1Q43 A;  2YID A;  2XUM A;  1VQP V;  5LP6 C;  4CC5 A;  1WP8 A;  1VQO V;  3H1L H;  4CH5 A;  2F23 A;  2Z5U A;  3OTO B;  2Q0A A;  2UXN A;  2ARH A;  5B1A C;  5LMU B;  1XL6 A;  2ADP A;  2Q5Z A;  1YTF B;  1KQS U;  1QHT A;  2F93 B;  3BFR A;  4DUZ O;  2YIC A;  4PDM A;  3NXS A;  4IT5 A;  2IJJ A;  3CC2 V;  1AR4 A;  2E3C A;  1MMM A;  2G38 A;  1I08 A;  2YEV B;  4I50 B;  5IYD O;  2JGD B;  1CXZ B;  2JIZ G;  3OEE G;  3CCQ V;  4K8Z A;  1VIB A;  4LF7 O;  4JI0 B;  4DXW A;  2BE3 A;  3FB7 C;  1GN3 A;  2CTR A;  2E5L O;  3J80 N;  2VS0 A;  3UKM A;  1SZX A;  4B3M B;  3LDE A;  2XND G;  1KMI Z;  3HKD B;  3O65 A;  1Z5W A;  1TUB B;  4EFE A;  4X1I A;  3SYA A;  4DV1 O;  2IW5 A;  2K9P A;  3D3Q A;  5JCO A;  2B1G A;  4WFH A;  3ASO C;  1K4C C;  1YJW V;  1Q6I A;  3K57 A;  3W7S A;  2IM9 A;  4HBN A;  4MVZ A;  1OCC B;  3CPW U;  1BMF G;  3VBB A;  3HKC A;  1YJ9 V;  4D7S A;  3TCU A;  1SQP H;  1OCO B;  3LSU A;  4Z1M G;  1RSO A;  3IC7 A;  1VP7 A;  3W7X A;  3ABM B;  2UUA B;  1H2L A;  1JMK C;  3SJQ C;  4R8C A;  3ML0 A;  1ZLZ A;  1N4C A;  2QWP B;  4X1K A;  3ZMT A;  1R6N A;  3E83 A;  1M1K W;  2KKW A;  4K8X A;  3EHB B;  1VQK V;  3RYI B;  4TV8 B;  1GKF A;  2GBO A;  3CWB H;  1XNQ B;  1G4Y B;  2WLI A;  3UT5 A;  1R3I C;  1FS0 G;  1GM7 A;  2Y48 A;  4QNH B;  4DV6 B;  1AP5 A;  1GK9 A;  3E8B A;  1E1R G;  1OCR B;  4WFA V;  2Q7H A;  2R70 A;  4K35 A;  3CCU V;  1R3L C;  2BCC H;  2WLL B;  2E5L B;  1YF2 A;  1VQ7 V;  3I55 V;  1XMO B;  4TOI A;  3BY6 A;  3OW2 U;  4LR3 A;  4LBE C;  4R6Z A;  1ZL8 A;  1M57 C;  2CAZ C;  4DV1 B;  2UXC O;  2ZKO A;  1H2G A;  1NR1 A;  2HEP A;  1URF A;  1CP9 A;  1Y67 A;  2DOS A;  2HHH O;  2QR4 A;  5LYJ B;  4OPH A;  1WP7 A;  1NR7 A;  4DV2 O;  1N8R W;  2X6C A;  3L71 H;  1PM9 A;  2GTS A;  4WBN A;  1ENV A;  2YXY A;  2UXB B;  2Q69 A;  1KP2 A;  4KHP B;  1Q6H A;  4LCU C;  4ZHQ B;  5KHK A;  2QKA A;  4LF9 O;  3WB1 A;  3J7A U;  5LP6 B;  4FK5 C;  5JCO C;  1D5N A;  3ETD A;  2VWJ A;  5EBM C;  1Q82 W;  5B1A B;  2XAH A;  2HJD A;  2YS8 A;  1Y76 B;  2QEX V;  3DSQ A;  3M99 B;  2JEU A;  3MD0 A;  3SDL A;  4UXN A;  2N04 A;  4RAI A;  5BXZ A;  2D2C B;  4E4E A;  3FYE B;  4XBF A;  4JI1 O;  2R9R B;  5B5E Z;  1JPX A;  2LFS A;  3IAY A;  2ZIN A;  3VQX A;  2HR3 A;  2EJR A;  2PI4 A;  1FAF A;  1NBM G;  4MVM A;  2R72 A;  1MSW D;  3GWO A;  3EFF K;  4GCZ A;  3KKY A;  1V9P A;  2YEV A;  2WLN A;  3OGC C;  2ZE5 A;  4I50 A;  1NT2 B;  2JGD A;  4BR6 A;  5DN6 G;  1K34 A;  5KAF Z;  1ZSP A;  2UXC B;  2RJZ A;  1Y74 B;  3T1C A;  5LA6 B;  5L3B A;  1YCI A;  2HHH B;  1N0J A;  3AK1 A;  2AW9 A;  5IDJ A;  3JAS B;  4JGS A;  4NTY A;  2X6B A;  3HKD A;  4W4K A;  1NH2 B;  1TUB A;  4DV2 B;  4TV9 B;  1DF5 A;  2MW2 B;  3L75 H;  4LH7 A;  3B4S A;  2ZCE A;  1NVP D;  4ZI7 B;  1RFY A;  4OX9 O;  2IH3 C;  2OCH A;  2ILM A;  4JTD B;  3TET A;  1NTZ H;  2MK3 A;  1HWY A;  1JA8 A;  2ZR3 A;  5HFM A;  4ZIB A;  1R3J C;  1G1X B;  1BHA A;  2V7Q G;  3SPH A;  1FYJ A;  1YTF D;  4YY3 O;  1NTK H;  3ZRW B;  4I7Z B;  2W6J G;  2JRI A;  1LNQ A;  4O2A B;  2L35 A;  4I5S A;  2LGQ A;  1VF5 B;  3AG2 C;  4J10 A;  3SPI A;  4WFG A;  1OHH G;  4RUE A;  1SQG A;  4B3R O;  1IZ3 A;  3RWR D;  4U7N A;  2UUB O;  1N0N A;  1ZTE A;  5GON A;  1IX9 A;  5FL7 G;  3ABK C;  3RYI A;  1DGS A;  4TV8 A;  3H1J H;  4JAA A;  4RO2 A;  1IBL O;  2V4D A;  3B09 A;  3I56 V;  3OMI B;  4BW9 A;  5AG2 A;  2A79 B;  3ZN1 A;  1QCE A;  5BMV A;  4J7K A;  2WLL A;  4H44 B;  1G8M A;  1I5X A;  4I9Q A;  5LHG A;  4JI6 O;  1BQZ A; 
#chains in the Genus database with same CATH homology
 3CRA A;  2Q9L A;  1Y6X A;  1VMG A;  2YXH A;  2GTA A;  4QGP A;  2OIE A;  2Q73 A;  2Q5Z A;  1YXB A;  3C90 A;  2P06 A;  2A3Q A;  3CRC A;  5IE9 A;  2Q4P A;  2OIG A;  2A7W A;  1YVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...