1B6QA

Alanine 31 proline mutant of rop protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
b'MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP
publication title Protein plasticity to the extreme: changing the topology of a 4-alpha-helical bundle with a single amino acid substitution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 23
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1b6qA00
1GTOA 1F4NA 2IJIA 4DO2A 2GHYA 1ROPA 1RPRA 1NKDA 1F4MA 1B6QA 1PD3A 1RPOA 2IJKA 2IJHA 2IJJA 3K79A 1GMGA
chains in the Genus database with same CATH superfamily
2A3QA 4JYYA 4DV3O 3CMEV 2QTOA 5HFLA 4R50A 2ZR2A 4DV6B 3BPZA 2VQFB 1GRJA 1XNRO 3IJ4A 3H1IH 1R6NA 1WA8A 1HNXB 2PGGA 3LDDA 1TAEA 3A0BZ 1L0NH 1AI4A 4NR1A 3K59A 4GUNA 4G28B 2UUCO 3FX7A 3CMAV 2F23A 5LMNB 2B1IA 3AG1C 3E22A 3L72H 4K8XA 1Y6XA 3ML0A 2D3OW 3X2QC 4K35A 3MHSC 5JJNB 1SQGA 2FMLA 3AG3C 5CB4B 4TQDA 4B3MO 1FYJA 1RFYA 2IJJA 3CC7V 4OPHA 3CCLV 5IT9N 4DR1B 4RUFA 1WJZA 3CJHA 3RYIA 3BAAA 1QNMA 3D3IA 4X62O 4PELA 2PTMA 4GT1A 2QEXV 2A79B 3OUSA 3AG4B 1SQVH 2R9IA 4LF6B 2YI9A 3CCRV 3G6BA 3DC6A 1P7GA 2N04A 4OGQB 3U11A 4DUYB 4I55A 4XDLA 3JARA 4ZI7B 1AJNA 3OM3B 1O9GA 1KUQA 4MTXA 1PNLA 2YC0A 1NQTA 5KA5A 1Q5OA 4MVMA 2YIAA 2UXCB 3OMNB 4NXMO 1QLEC 1IZ3A 1YF2A 2WLJA 5GONB 1YVWA 2GUZB 1MABG 2OTJV 3LSUA 3RGBA 1PPJH 2JEUA 3JYCA 4DV5O 4LNUA 1NH2B 2PYLA 2GV9A 1K3EA 4LFBO 3ZHQA 2BCCH 4J11A 4DR6O 2ZQMA 1KECA 4YJ3B 2JGDA 2QWQB 1EZJA 2UUAB 4DV1B 1SS3A 3AK2A 5EYPB 3J81N 4JI5B 5JCOA 3UKMA 4DR5B 3S3WA 3H1LH 5CA0A 4O2AB 4X65O 1KBHA 5CN0A 3K57A 1J5EB 1HDJA 4X1KA 1TUBA 1Q43A 2QTSA 5DEDA 5A9GA 4K0KO 1FFXB 4J9YB 5KAIZ 3CCUV 2WA4A 4JF3A 3AG2C 4EB6A 3BCCH 1L8DA 2WLLA 3FAVB 3ZRXA 3OGCC 1N36B 1U97A 3T2MA 2UXDB 4YHHO 1KMIZ 2QM4A 5B1AC 4C7UA 5KLVH 1NU1H 3SR2C 2VS0A 1WP7A 5JH7B 1N34B 2ZE8A 2BTOA 3FYEB 1N33B 2QJ1A 5KHKA 3W7UA 1S72V 1LNQA 4FJCC 1Y76B 2VQEO 1VQ5V 2CDYA 4UB8Z 1VQPV 1XNRB 1KKCA 3QO7A 3ZHVA 3FKSG 2EJRA 2HP8A 3FB5C 1IURA 5B1BC 4W4LA 2YI8A 4R6ZA 2AZ2A 3RN4A 2ODMA 2UUCB 4IIJB 4FLYA 4FLXA 3DGEA 4XDJA 3QF7A 2P5OA 1NZ6A 1X4TA 1OCRB 3A2FA 3E86A 1L1FA 2QKCA 3N2GA 1V54B 4QJFB 4U3JB 2HJFC 2EX3A 1F7YA 2YS8A 1SZXA 2EULA 3AG7A 5GTHZ 5J2UA 1BQZA 5CA3A 3CX5F 5LA6B 3RVZA 2PZSA 4JAUA 3ETQA 4JPRA 4QIWF 5FPRA 5LL6Y 4WFAV 1XHZA 4DW0A 1SETA 3K9SA 2DYSC 2HKOA 2Q7HA 3CCVV 1AI7A 4D7SA 2H94A 3ZN0A 3TXQA 1MOFA 1EM1A 5L3FA 1K92A 5IJ9B 4DR3O 2HHHO 3FB8C 1Q86W 3JAWB 4ZI7A 1X59A 3PJSK 1JPXA 2FYUH 1VF7A 4JI7O 2LW1A 3CXHF 4LFAB 1XMOO 2XHBA 4LF5O 4FM1A 4O4HB 5JVDA 1SQPH 3HR0A 3K06A 2Q9LA 2QKAA 3O9OA 4FZ0A 1PNKA 1SA0B 3ZEDA 3JD0A 4DV5B 3CS5A 1G8MA 3DXRB 4JV5O 1XHXA 2JS5A 4JZ2A 4CS3A 4JTDB 4LFBB 1Q8IA 4XBFA 4DV4B 1SQFA 4JZGA 4QE7A 3BEHA 1AR4A 2UXNA 5C8YB 2F4VB 2P90A 4CH5A 4JI4O 3O65A 5JWPA 3IGAC 1AROP 3UO2A 1M56B 3D8CA 4PJ0Z 3TCUA 1ZTEA 2DWEC 4ICGA 1NVPB 4X65B 1NJIW 3LNMB 4AQYB 3ABKC 1OCRC 3B77A 2LO1A 3OT7A 1M5IA 3CWBH 3OTOO 4B3TB 4LFCB 4B3SB 2QWRB 4PA4A 5IYBO 1BHBA 2QWPB 4K0KB 2JIZG 3VQYA 3WB0A 3B2EE 1NVPD 1S3JA 1GO3F 2YDEA 1P7BA 2XAJA 1FPOA 2QWOB 1QCEA 4JI2B 3IC9A 1F4NA 1BMFG 4YHHB 3T1HB 1SC5B 1Y67A 2QGNA 4ZHQA 4G27B 1JJOA 2ZE5A 3QTCA 3ZHUA 2ZXWB 4DV6O 5KMGA 1K4CC 2VQFO 4H33A 4TQFA 1OHHG 1BCCH 2VQEB 1HNXO 1YJWV 3HKBB 1P84F 2P67A 1N32O 4JAAA 1ENVA 1Q82W 3RYHA 2GTSA 4UFZA 2ZDIC 3SYPA 1Y66A 2UXBO 4EFBA 5LMNO 1N4CA 2IH1C 3E22B 1A32A 5B3SC 1M4UA 2RDCA 2WLKA 2P06A 1CEZA 3BABA 1OCCB 3P3NA 1XILA 1YCIA 4EKWA 2VRZA 4MVQA 4LH6A 1PD3A 2XAFA 2BSKB 1YJNV 3THOA 1AI5A 1R3KC 1JQ0A 1OJHA 4U3JA 4DR1O 1Q90D 2YIBD 1NBMG 3CRRA 5KUMA 2Y4UA 1S76D 3CC2V 3M8AA 5KA6A 3DSQA 2Q8VA 2CAZC 1ZUQA 1WLEA 5IY5B 4DW1A 2KQXA 4I55B 3HPLC 4TV9B 2DJVA 5LA6A 3BFRA 2WLMA 2LGQA 3RYFB 5EIBD 2Y0IA 4L87A 5IJ0B 1IBMB 5EBMC 2H3OA 1JVMA 5DECA 1TUEB 2UXCO 4FZ1A 2ATKC 2HHHB 3B8MA 5IJ9A 1IBLO 1SQBH 1KP2A 2RQ6A 4PDVA 5JJJB 1R6KA 3JAWA 1WNSA 4JI7B 5KHGA 5FPOA 3OE7G 4LF5B 4WFHA 5H6QA 1W59A 2G38A 2JGDB 4GKJB 4KFMA 4PV1B 2Z5UA 3OD4A 2VWJA 1SA0A 1WPXA 3KG2A 4TUYA 2UUAO 4DV1O 1PM9A 5CA0B 3CYOA 4JI5O 4MVUA 4J7ZA 1BL8A 4P30A 4P2ZA 3SPIA 4JYBA 1K33A 4DR5O 2P4VA 4X1KB 5DM6V 1TUBB 3ASOB 3K0DA 2ADPA 1M57B 1VF6C 1JJ2U 5AG2A 3ZHTA 4WF9V 5CBFA 4LCUC 1OCZC 1AR5A 3U10A 3CCMV 4FM2A 3D3QA 4EB6B 1G4YB 4Q20A 4X8AA 4LF4O 3AK1A 4CC5A 3K5OA 1KYOF 5LMUB 4GZRB 2O57A 2UXDO 3PN1A 4YJ2A 4DR7O 4FLUA 3L73H 2JJ2G 1N34O 1U96A 4PHZA 1GKFA 4PD4F 1IVSA 1K9MW 3JASA 4JYCA 3OGIB 4I4TB 1VEWA 5JQGA 4GKKO 3CCQV 4I50B 3SPJA 1GN6A 1SESA 3ABMB 2LGWA 3ZMZA 2EIMC 2E5LB 5BZBA 4BW5A 1YZBA 4UCVA 2Z3YA 2OWOA 1N32B 4W4KA 1HNZO 3HKBA 4FIPC 2UXBB 2E3CA 3WG7C 3N2GB 1H2GA 2HJDA 2X7RB 3ZMSA 1I0HA 2OCCB 4BWAA 1S5LZ 2MW2B 5J2UB 3SPGA 3SJAC 4UV8A 3K5NA 2YIBA 1ZL8A 5JCOC 4ZBMA 1S0VA 4JTAB 1JMKC 2ZR3A 1UFIA 3SYAA 5LOVB 2IBZH 2EINB 1D5AA 1Q6HA 1S5JA 5KHHA 2BSKA 2Q69A 3JSLA 4JI6O 4J9ZB 1VQMV 3UO3A 3WB1A 1GM8A 1SQXH 3UCSC 1M90W 5EBWC 4WBNB 3ZRWA 1V55B 4QE9A 2K9PA 5H6RA 4JAVA 4TV9A 4JYAB 1CP9A 2P6JA 4MTFA 1NR1A 1I08A 3RYFA 1L0LH 3C90A 5IJ0A 4A5UB 3NXSA 4X64B 4BIUA 2A06H 4GX1A 3RWRD 1BE3H 3L74H 2AW9A 1IBLB 5JVDB 4LFAO 2GSMB 2DQ0A 3JCZA 4MVSA 1VQ4V 2JGUA 4UXNA 3MDSA 2DYRB 4NXNB 2R9AA 5IYZA 1E79G 1K8AW 2M6YA 3LNNA 2HG5C 2CH7B 4DV4O 4L8JA 3ABMC 1K97A 4LH7A 2JS3A 2XAGA 1YIJV 3ZMUA 2F4VO 2A9HA 3QO8A 2PY5A 4ZOLA 3T1YB 2HR3A 4Q6GA 3L70H 1Q7YW 2B1GA 2ZE6A 2EIKB 1AR1B 2FTKA 4N23A 3B8NA 3EXAA 3OFNG 3ZRSA 4X88A 2W6JG 4AQYO 3CRQA 1CXZB 2CTWA 1E1QG 1H8EG 4MVOA 2OCCC 3K04A 4B3TO 4LFCO 1OV9A 4B3SO 2IM9A 2ZD9A 3ABTA 3R66A 1ZAUA 4LF4B 2LP7A 2CTQA 5J9PC 1H2LA 2CE4A 1KQSU 4JI2O 5D5QA 4ZHQB 1NS1A 1AJQA 1QR8A 3T1HO 4DR7B 4IYHA 1BGYH 4J41A 3AG4C 5KMGB 1MG1A 4I0XB 2GDSA 4NTYA 2Q6AA 3AK3A 5CA1A 2YXYA 4YIOA 4OX9B 1Y74A 4KP4A 3ICXA 3SYOA 1Q6UA 1LUWA 4GKKB 3RYHB 4DXWA 2RMKB 2QA4V 4HNAA 2N74A 2DMXA 4PA3A 5IDJA 1KC8W 4I4TA 3CHXA 3LUTB 2QM8A 4I50A 3K9AA 5BR8B 1PP9H 2H8PC 2IJHA 4WFEA 5B1NA 1DLBA 1HNZB 1H8HG 3OW2U 3CPWU 1FFTB 4IGGA 3SJQC 1YXBA 2CTPA 3RFRA 4UCTA 1Y4MA 4TOIA 5KX5A 2RN9A 1VQNV 1PV0A 1VQOV 2PYJA 4TSFG 4U3FH 4E2LA 4ZKIA 4DV2O 5IWAO 3UT5A 4DO2A 4PDLA 1AB3A 4GX0A 2BTQB 4PI0A 4B3RB 5L3BA 1XUQA 1XEQA 4N21A 3OEHG 5LOVA 3ZIAG 3ZX6A 2PI4A 1VIBA 2W0XA 4JI6B 3W7WA 4O2BA 3CB2A 4BR6A 3LSQA 4YY3B 1IBMO 1DK1A 1H2KA 1YHQV 2PUSA 3KCYA 3JD4A 1YTFB 5E79Z 4NYKA 3H9VA 2CK3G 1S5HC 4WBNA 3P30A 4FM0A 4O4LA 2N05A 1EZVH 4CS4A 4DUZO 1OCOB 4X1YA 3K0GA 4AHCA 1YTFD 1K34A 4UCRA 1AP5A 3CC4V 4DR2O 2QWNB 4IHJA 4RUEA 3E8GA 2YXHA 3RBZA 5LXTB 1MA1A 4DRXB 4GKJO 4TUYB 3KZIZ 1W2BU 1Q6IA 4MVZA 2PF4E 4UCOA 3Q4HB 4MVRA 2KKWA 4KHPB 5LP6A 2CH7A 3ETGA 3GVMA 2HVKC 4CZZA 1UJWB 4I9WA 1YSCA 4WFBV 4I5SA 5L3CA 5LHIA 4FFKA 1N0NA 1XOUA 1I5XA 4WCEV 1GN2A 3J80N 4KUMA 1FJGB 2RJZA 5K1PA 3JATA 5CBGA 1V54C 3LDCA 3F5WC 1MMMA 4YJ2B 1FD9A 1AVMA 5LYJB 5LMUO 3T4DA 3KCXA 4QPJA 1NI8A 1H38A 1FXKA 2NN4A 4AILC 2YIDA 3SYQA 3L9DA 3CE2A 2ZCEA 3JASB 4I7ZB 2QM7A 4F6EA 3RYCB 4D6TH 4UVCA 4RAIA 5JQGB 1HR0B 5B66Z 2E76B 4I0XA 3HKDA 1FXVA 5BMVA 1VQKV 2E5LO 2EILB 4PA7A 1AP6A 4H44B 5IYDO 4GX5A 2K1EA 4FPPA 3W7SA 4LWSA 2EIJB 4J7JA 1OCOC 3A8TA 3H1HH 4HZ3A 1ORQC 2F1MA 2PI5A 3ABLB 3C3TA 1EFRG 4DV7B 2E74B 2WPDG 1F23A 1ZL8B 1XMQB 1WB7A 3FB6C 4FMTA 2DOSA 1SQQH 1IX9A 5B5EZ 2EZPA 1LUVA 4XDKA 3CSXA 2WLIB 4OXSA 1THZA 2EZOA 2AXTZ 3DTUB 1COWG 3ZJZA 4DV2B 5IWAB 3UQ8A 2YXLA 3E8BA 3SJBC 4MW3A 5KUKA 1TVKA 3W7XA 1XREA 2IH3C 2Q73A 1M56C 2Y4TA 5A2QN 1XQ8A 2BTQA 2QR4A 3ZRWB 3T1CA 2OIEA 1H2SB 1AI6A 4X66B 4TV8A 2YEVB 3A0RA 1H2NA 4JYAO 5FNVA 5BY1A 3ASNB 5KAFZ 1GK9A 3I55V 3BY6A 3QVNA 4X64O 2X6CA 4NB5A 3SPHA 3CCSV 4UV9A 2MK3A 3OUFA 1DTOA 1XL4A 4FK5C 5ITZB 3VOUA 3HKCB 4UCUA 4DUZB 5IYZB 1XNQB 4DR2B 4NXNO 4R7CA 3IAYA 1D2DA 4UB6Z 1R3IC 5LHGA 2ZXWC 2LFSA 4O4IB 5KHIA 4UUJC 1BT8A 1PNMA 5LXTA 4LF9B 4RWUA 4JI3B 2UU9B 2B5UA 2D2CB 4ZOLB 4QPKA 2EILC 4DRXA 5FLXN 3BA8A 4AI8A 2DN9A 3G6EV 3T1YO 2IU0A 2ZT9B 4QGPA 3AG1B 3I56V 3Q4HA 4CC6A 2CUGA 1DF5A 1VARA 4X1IB 3RT3C 4MTOA 3ABLC 2QE7G 2ZM6O 3AG3B 4X20A 4CH3A 1OCCC 1QHTA 2V1DA 1KP3A 4DV0B 3E83A 1PKXA 2X0LA 1GM7A 1R6TA 3CD6V 4LF7O 1XDCA 1MZEA 1TA8A 5J2TB 2ZINA 3VQWA 3JCUZ 3E2EA 5EIBC 5LYJA 1VMGA 2LQTA 1JFFA 4D7TA 5CA1B 4U7OA 5IY5C 2L6LA 4O4JA 1Y74B 2X6BA 1RPOA 4I9QA 4OX9O 2LFRA 4HNAB 3RYCA 3I5DA 2Q0AA 2R70A 3FD9A 4PI2A 2KSDA 3OEEG 3ZHRA 2AHZA 1XI1A 2HLDG 4FFBB 1IBKO 1H2MA 1TGOA 3FB7C 5BR8O 3FYIB 1SF9A 2NR5A 1WB8A 4ABMA 4K8ZA 5KX5B 1I5YA 1Q81W 1BS3A 4FLTA 3K03A 1P49A 2C2AA 1N0JA 2AGAA 3ZS8C 3BRCA 2IJIA 1BZKA 1ROPA 3UT5B 2AZ0A 1AILA 3BA9A 1NT2B 1RSOA 1KKDA 3CXCU 3ZMTA 3APQA 3QG5A 2ZNIA 4R8CA 1MSWD 5LHHA 2Q4PA 1F4MA 4B3RO 3MHHC 2WLIA 3P32A 3SYCA 2GBOA 4O2BB 1BHAA 1VF6A 3ASOC 3EVKA 1M57C 1JCHA 3D36A 3C3SA 2CGNA 2Q67A 2RNBA 2W6IG 4YY3O 3SDLA 3WFVA 3AG2B 3GWKC 3L75H 2A0LA 2F93B 5H2FZ 3CRMA 1JX9A 5GTIZ 3QO5A 3JAMN 3CEIA 1RP3B 4O4LB 5GW7A 2OT5A 3SJCC 2YEVA 4KL1A 5B1AB 3UM7A 4X1YB 3HKEA 1NTKH 2XAQA 4IHJB 1B6QA 2R9RB 5F2VO 1YJ9V 1YEWA 2EJ7A 4H0LB 3S3XA 2IU3A 4RQEA 1US6A 2XNDG 5ITZA 3HKCA 1VQ9V 4NKGB 2XOKG 4BAYA 1YDXA 1HP8A 1QU7A 3A0HZ 4TT3G 5LP6B 3N2KB 3STLC 2ZKOA 3E89A 5B1BB 1BSMA 4KHPO 3G71V 4LF8B 4NVPA 2HVJC 1MZFA 3SPCA 3VQVA 5IE9A 2KG7A 1Q3EA 4O4IA 3K5LA 2JVDA 4JI1B 4G2KA 3JD3A 3TJTA 4GLXA 2UUBB 3JATB 2IJKA 5FL7G 3OMIB 2DQ3A 5B1OA 5IYCO 1FJGO 3AEIA 3CP1A 1QBZA 3JAKB 2ZM6B 3U0ZA 2FB5A 2IW5A 2LW7A 4X1IA 2L35A 1GM9A 3MD0A 4HAMA 1I94O 2F95B 1DGSA 1FXKB 4JI0B 1DF4A 4MTGA 1NH2D 1NTMH 2ZIOA 2BOBC 3R65A 2QDOA 4LF7B 4DK0A 3JALB 4FLVA 5H9CA 2EINC 4CBCA 2DYSB 4LP8A 3MAQA 5J2TA 3E35A 3EHBB 4JTCB 3H1JH 4JI8B 3TGUH 2HFEC 3GB7C 3HKDB 3ABUA 3RVYA 1R1BA 5BMVB 1HR0O 3KKYA 4FLWA 4B7EA 3L71H 1P4RA 1V55C 5TISZ 5L3GA 5EBLC 4E4EA 5D5PA 3IFXA 1S77D 1YITV 4LWSB 5CBHA 4CH4A 2OYQA 2Q68A 2Z0AA 3APOA 3K5MA 1IBKB 3OAAG 4HBNA 1IXMA 2KB1A 2XAHA 1Z2GA 1QVGU 1JA8A 4OPAA 4J10A 5EC2C 4FFBA 2V7QG 2XUMA 1QLNA 4DV3B 4F6RB 4DV7O 4JGSA 4IYIA 2DYRC 1XMQO 2LJ2A 1FAFA 1VQ6V 4QNHB 5LP6C 5BXZA 3HB3B 1PL0A 1RPRA 1M1KW 1K5SA 1TVKB 3G4SV 3F7YC 2NLJC 1K73W 2OIGA 2B9ZA 1G6UA 2Y69B 4ZIBA 3ABKB 3CCEV 4TV8B 1GN3A 2EIKC 2ZE7A 2YSUB 4DR4O 1MSDA 2NNUA 4X66O 2P7TC 5FNVB 5LGNA 2DWDC 1KB9F 4B3MB 1D5NA 5LBQA 5DN6G 2JEXA 1FXKC 2AHYA 5CB4A 1JR9A 3VBBA 3ZRVA 3DC5A 1BQ0A 4X62B 4MSWC 2X6AA 4CH6A 1EN4A 4MT8A 1HNWO 1XNQO 3WU2Z 1EN6A 3F7VC 2FL4A 2ITCC 3JD1A 1NTZH 5C93A 4UVAA 2ILMA 4WFGA 2Q5ZA 2WSSG 1WPBA 2EBOA 5LGUA 4LF9O 4NXMB 4JI3O 2UU9O 2F66C 1K5QA 1WN7A 1XL6A 2E75B 5B3SB 1W0KG 2R72A 3N2KA 4IT5A 3K3WA 5LGTA 1QVFU 3JD2A 1GMGA 1Z5VA 2GHYA 1W0JG 5GONA 2GUZA 4TWKA 1RM1B 4JASA 4X20B 1O9HA 3B09A 4RQFA 3CCJV 3ETDA 1GTOA 3WB2A 1VQ8V 2YICA 1ZSPA 4FVMA 2WA3A 4B7KA 3TXSA 3CRAA 4DR6B 5EZYB 3OR7C 1SRYA 4DV0O 2WAMA 2BOCC 1T5EA 2ZIMA 4RO2A 4Z1MG 2Q7GA 3JAKA 1I94B 1UPGA 3SGIA 4X89A 3E8HA 3P3PA 4YJ3A 4B08A 3K08A 2JDIG 3IC7A 2W0FC 1JFFB 2VWKA 3OR6C 5EYPA 1HWYA 5L3EA 2Y69C 4O4JB 3EFFK 4O2AA 3JALA 2CTRA 1GN4A 1XBLA 3K79A 2HEPA 2JRIA 2BE3A 1SKVA 2WWWA 3B4SA 5EC1C 4YIPA 1FFXA 2YUAA 1J95A 2ADQB 2P22C 3RW0A 2F43G 3ZBHA 3FAVA 3VQXA 3TK1A 1VP7A 4J42A 4DK1A 3F5TA 2A7WA 5L3DA 5KHJA 4IL6Z 5JH7A 1VF5B 1WA8B 1N8RW 4NTWA 4LC1A 1B06A 2V4DA 3H1KH 1I7FA 1RSOB 4F6RA 1NKDA 1Y76A 4UCSA 5H5NA 1KD1W 1EBOA 1V9PA 1F51A 3N27A 3W7TA 1VQ7V 2JJ1G 2OTLV 1FXHA 4H13B 1OCZB 1KU9A 2XTAA 4X9QA 3T4ZA 3OMAB 5E1AC 1RM1C 4IIJA 1G1XB 3BHPA 4BW9A 4DR4B 4HYOA 1R73A 3LSSA 3CJHB 4PDRA 4FLZA 3RYIB 2OCHA 4MW8A 3CRCA 3HKEB 3M7MX 3NR7A 4F4LA 3E8FA 4YXWG 4BIOA 1LR1A 1M93A 2Q7EA 2GTAA 3K58A 4CS2A 1ZLZA 2Y0PA 4J80A 4LF6O 3JARB 1WAZA 4PDMA 4DUYO 3FFQA 4GYCB 3TETA 1K4DC 1HNWB 5EK0A 4P9OA 3QNEA 4UVBA 1ZX3A 2UXXA 3GWOA 4DR3B 2EIMB 1IXBA 4KXRA 1CPYA 5JJEB 1MNGA 1GH6A 1GAXA 2KG7B 4LF8O 2XASA 2DW4A 4K3AA 3ZMVA 4LBEC 1R3LC 4J7KA 2CGOA 3ZN1A 4H37A 1AJPA 2P4KA 1EN5A 3WG7B 4LNUB 4JI1O 1B04A 3M99B 1XMOB 4ASUG 2ZDIA 2EIJC 2ZNJA 3G80A 4EFEA 3ETEA 2UUBO 2M7WA 3X2QB 4GCZA 5CMUA 4O4HA 3ZHSA 4GX2A 1SZTA 4JV5B 2Y48A 1QR9A 3OTFA 2Q0OC 1ZWIC 3DXRA 4JI0O 3LDEA 2QKSA 5EZYA 4JI4B 3G67A 3BVOA 1J5EO 1FS0G 1URFA 2WLHA 5C8YA 1QQCA 3D36C 1WP8A 1OZ0A 2RCVA 1FKAO 1E1RG 4BIZA 4WFFA 2WLLB 4JI8O 3H01A 3OTOB 1PL4A 2JK5C 1HW7A 4PA9A 3STZC 4P9PA 1JOYA 3ZCCA 1YI2V 5HFMA 4EEQA 1N36O 5K1XA 3B40A 3JSNA 4MS2A 2ITDC 2ARHA 3ASNC 4DYLA 1QLEB 1VQLV 4LR3A 4U7NA 1IDSA 4Z2WA 2DE0X 1R3JC 1K7DA 1B3QA 4NTXA 2WLNA 3J7AU 2ETNA 1NR7A 1M9NA 4PA6A 2FKXA 1Z5WA 1SERA 1N33O 2XT9A 2QSAA 4Z1VA
chains in the Genus database with same CATH topology
4RUEA 3E8GA 2BOBC 3R65A 3RBZA 1NBMG 3CMEV 2QTOA 5HFLA 5KUMA 4R50A 2ZR2A 5H9CA 2EINC 1S76D 3CC2V 5KA6A 1R6NA 4CBCA 1W2BU 2DYSB 4LP8A 1WLEA 5IY5B 4MVZA 3LDDA 3HPLC 3E35A 3EHBB 4MVRA 4JTCB 2WLMA 1AI4A 2HFEC 4G28B 3GB7C 3ETGA 4L87A 3ABUA 3RVYA 5EBMC 3CMAV 1JVMA 2HVKC 2B1IA 4CZZA 1P4RA 1UJWB 4I9WA 1V55C 1YSCA 3AG1C 4I5SA 5L3CA 5LHIA 4WFBV 1TUEB 5L3GA 5EBLC 1I5XA 4WCEV 3IFXA 2ATKC 1YITV 1S77D 3ML0A 5CBHA 3B8MA 2D3OW 4KUMA 3X2QC 3MHSC 1KP2A 2Q68A 4PDVA 5CBGA 3AG3C 1V54C 1R6KA 3OAAG 1IXMA 3LDCA 2KB1A 2XAHA 1QVGU 3F5WC 2IJJA 3CC7V 5EC2C 3OE7G 3CCLV 3T4DA 4RUFA 4WFHA 2V7QG 1QLNA 4QPJA 5H6QA 1H38A 1FXKA 3D3IA 4JGSA 2DYRC 4PELA 4GT1A 3SYQA 2QEXV 1VQ6V 2A79B 4KFMA 3OUSA 3AG4B 2Z5UA 4QNHB 2R9IA 1WPXA 3KG2A 3CCRV 2QM7A 3HB3B 4UVCA 4RAIA 1PL0A 1RPRA 3CYOA 1M1KW 4MVUA 1BL8A 1K5SA 4XDLA 3G4SV 3F7YC 2NLJC 4P30A 4P2ZA 1AJNA 4JYBA 3SPIA 1K33A 3OM3B 1K73W 4MTXA 1PNLA 5DM6V 1NQTA 3ASOB 3K0DA 1M57B 2Y69B 5KA5A 4MTGA 1JJ2U 1FXVA 3ABKB 4MVMA 4WF9V 5CBFA 3OMNB 1OCZC 4LCUC 3CCEV 1NH2D 2EIKC 1VQKV 1QLEC 2YSUB 2EILB 4PA7A 3CCMV 2NNUA 2WLJA 2P7TC 5IYDO 4GX5A 2K1EA 1G4YB 1MABG 4FPPA 5LGNA 3W7SA 4Q20A 4X8AA 2OTJV 2EIJB 2DWDC 1OCOC 4HZ3A 1ORQC 5LBQA 5DN6G 2JEXA 1FXKC 2PI5A 2AHYA 3VBBA 3ABLB 2JEUA 3JYCA 3ZRVA 1EFRG 1NH2B 2WPDG 1K3EA 1F23A 3FB6C 4MSWC 4FMTA 2JJ2G 2X6AA 4MT8A 2ZQMA 2EZPA 1KECA 4XDKA 1GKFA 2WLIB 4OXSA 1THZA 1EZJA 2EZOA 3DTUB 1COWG 1K9MW 3ZJZA 3F7VC 2ITCC 3JD1A 3UKMA 4JYCA 5C93A 3E8BA 4UVAA 4MW3A 4WFGA 5CN0A 5KUKA 3CCQV 2WSSG 3W7XA 3SPJA 2IH3C 1SESA 2EBOA 1M56C 3ABMB 5LGUA 3ZMZA 3ZRWB 2EIMC 3T1CA 5BZBA 1K5QA 4BW5A 1AI6A 2Z3YA 1XL6A 5B3SB 1W0KG 2YEVB 4J9YB 3A0RA 3K3WA 5LGTA 1QVFU 3JD2A 3CCUV 4FIPC 1GMGA 4JF3A 2GHYA 1W0JG 3AG2C 3ASNB 2WLLA 4TWKA 1GK9A 3WG7C 4JASA 1RM1B 3I55V 1H2GA 4RQFA 3CCJV 3ETDA 1GTOA 3BY6A 3ZRXA 1VQ8V 3OGCC 2X6CA 2X7RB 3T2MA 3CCSV 3SPHA 4UV9A 2MK3A 3OUFA 3ZMSA 1DTOA 1XL4A 2OCCB 4FK5C 5B1AC 3VOUA 3SPGA 3OR7C 1SRYA 2WAMA 4UV8A 2BOCC 4ZBMA 1S0VA 4JTAB 2ZR3A 4RO2A 3FYEB 3SYAA 4Z1MG 4X89A 3E8HA 2EINB 3K08A 4R7CA 2JDIG 3IC7A 3W7UA 1S72V 1LNQA 2W0FC 1R3IC 4FJCC 5LHGA 2Q69A 3OR6C 1VQ5V 2ZXWC 2LFSA 1HWYA 5L3EA 2Y69C 4J9ZB 4UUJC 1VQMV 1VQPV 1PNMA 3EFFK 1GM8A 2B5UA 3QO7A 3K79A 3FKSG 4QPKA 2EILC 1M90W 2EJRA 3FB5C 5EBWC 5B1BC 3G6EV 4R6ZA 2IU0A 3ZRWA 1V55B 4QE9A 3AG1B 2WWWA 5H6RA 3I56V 4JAVA 5EC1C 1CP9A 2P6JA 3DGEA 4XDJA 4MTFA 1NR1A 1DF5A 4MTOA 3ABLC 1J95A 3NXSA 1OCRB 4BIUA 2QE7G 3E86A 1L1FA 4GX1A 3AG3B 1V54B 2F43G 3RW0A 4QJFB 1OCCC 3TK1A 2V1DA 1KP3A 2HJFC 2GSMB 2DQ0A 3JCZA 4MVSA 3E83A 5L3DA 1PKXA 2X0LA 1GM7A 3CD6V 1VQ4V 4UXNA 1N8RW 5CA3A 2DYRB 4LC1A 1E79G 3RVZA 1K8AW 4JAUA 3E2EA 2HG5C 4JPRA 4QIWF 4WFAV 1NKDA 3ABMC 1K97A 1SETA 2DYSC 2HKOA 4U7OA 2XAGA 5IY5C 1EBOA 1YIJV 1KD1W 3ZMUA 3CCVV 1F51A 1RPOA 1AI7A 2X6BA 3W7TA 2A9HA 3QO8A 1VQ7V 2JJ1G 2H94A 3ZN0A 2HR3A 1MOFA 1Q7YW 2OTLV 2B1GA 1FXHA 5L3FA 2LFRA 1K92A 1OCZB 2EIKB 3T4ZA 1AR1B 2FTKA 3FB8C 3B8NA 3OFNG 3OMAB 4N23A 5E1AC 3ZRSA 1RM1C 1Q86W 4X88A 2W6JG 3PJSK 1JPXA 3OEEG 2AHZA 1E1QG 2HLDG 1H8EG 4MVOA 2OCCC 3K04A 4HYOA 3FB7C 1R73A 2ZD9A 3ABTA 3LSSA 3FYIB 4PDRA 4MW8A 1I5YA 2LP7A 4F4LA 1Q81W 3K06A 3E8FA 4YXWG 5J9PC 3K03A 2C2AA 1PNKA 1KQSU 3JD0A 1AJQA 1G8MA 1QR8A 2IJIA 4JTDB 1ROPA 4XBFA 4PDMA 3AG4C 3TETA 1MG1A 1K4DC 3BEHA 4QE7A 3CXCU 1KKDA 2UXNA 5EK0A 4P9OA 3ZMTA 2Q6AA 3QNEA 2P90A 4R8CA 1MSWD 4UVBA 5LHHA 1F4MA 2UXXA 3IGAC 1AROP 1M56B 3MHHC 4KP4A 3GWOA 2WLIA 3P32A 3SYCA 3SYOA 3TCUA 2EIMB 2DWEC 1NVPB 1BHAA 3ASOC 4DXWA 1CPYA 2QA4V 1NJIW 1M57C 4PA3A 3LNMB 1JCHA 3D36A 5IDJA 1KC8W 2XASA 3ABKC 1OCRC 2DW4A 3B77A 3ZMVA 4LBEC 1R3LC 2Q67A 3LUTB 2QM8A 3ZN1A 2W6IG 4H37A 3WFVA 1AJPA 3K9AA 3AG2B 4PA4A 5IYBO 2H8PC 1BHBA 2A0LA 2IJHA 3WG7B 3M99B 1JX9A 2JIZG 4ASUG 2ZDIA 4WFEA 5B1NA 1DLBA 1S3JA 1H8HG 1GO3F 2EIJC 3QO5A 1NVPD 3OW2U 3CPWU 5GW7A 2OT5A 1FFTB 2YEVA 3ETEA 1P7BA 3SJQC 1Y4MA 2M7WA 2XAJA 5B1AB 3UM7A 3X2QB 4GCZA 1QCEA 5CMUA 4GX2A 1SZTA 1F4NA 1BMFG 2XAQA 1VQNV 1VQOV 2Y48A 1QR9A 1B6QA 4TSFG 2R9RB 4E2LA 1ZWIC 4ZKIA 1YJ9V 4RQEA 2IU3A 4G27B 2XNDG 4DO2A 3LDEA 2QKSA 4PDLA 4GX0A 1VQ9V 2ZXWB 2XOKG 1K4CC 4BAYA 5L3BA 1FS0G 4H33A 2WLHA 4N21A 3OEHG 1OZ0A 1OHHG 4TT3G 3ZIAG 3STLC 1YJWV 1E1RG 2PI4A 3E89A 5B1BB 2P67A 4BIZA 1ENVA 3G71V 4WFFA 3W7WA 1Q82W 2WLLB 2HVJC 3SPCA 3H01A 3LSQA 2ZDIC 3SYPA 1Y66A 2JK5C 2IH1C 4PA9A 1YHQV 3STZC 4P9PA 1JOYA 5B3SC 4G2KA 3ZCCA 1YI2V 5HFMA 3JD4A 1YTFB 2WLKA 3JD3A 4MS2A 2ITDC 2CK3G 1S5HC 1CEZA 3ASNC 1QLEB 3P30A 1VQLV 4U7NA 2IJKA 1OCCB 5FL7G 3OMIB 2DQ3A 5B1OA 5IYCO 3AEIA 3CP1A 1QBZA 1R3JC 4EKWA 2IW5A 1K7DA 1OCOB 3K0GA 1GM9A 2WLNA 1YTFD 1NR7A 1M9NA 4PA6A 4MVQA 1K34A 3MD0A 4HAMA 1PD3A 2XAFA 3CC4V 1YJNV 1FXKB 1SERA 1DF4A 1AI5A 1R3KC 1JQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTO A;  1F4N A;  2IJI A;  4DO2 A;  2GHY A;  1ROP A;  1RPR A;  1NKD A;  1F4M A;  1B6Q A;  1PD3 A;  1RPO A;  2IJK A;  2IJH A;  2IJJ A;  3K79 A;  1GMG A; 
#chains in the Genus database with same CATH topology
 2A3Q A;  4JYY A;  4DV3 O;  3CME V;  2QTO A;  5HFL A;  4R50 A;  2ZR2 A;  4DV6 B;  3BPZ A;  2VQF B;  1GRJ A;  1XNR O;  3IJ4 A;  3H1I H;  1R6N A;  1WA8 A;  1HNX B;  2PGG A;  3LDD A;  1TAE A;  3A0B Z;  1L0N H;  1AI4 A;  4NR1 A;  3K59 A;  4GUN A;  4G28 B;  2UUC O;  3FX7 A;  3CMA V;  2F23 A;  5LMN B;  2B1I A;  3AG1 C;  3E22 A;  3L72 H;  4K8X A;  1Y6X A;  3ML0 A;  2D3O W;  3X2Q C;  4K35 A;  3MHS C;  5JJN B;  1SQG A;  2FML A;  3AG3 C;  5CB4 B;  4TQD A;  4B3M O;  1FYJ A;  1RFY A;  2IJJ A;  3CC7 V;  4OPH A;  3CCL V;  5IT9 N;  4DR1 B;  4RUF A;  1WJZ A;  3CJH A;  3RYI A;  3BAA A;  1QNM A;  3D3I A;  4X62 O;  4PEL A;  2PTM A;  4GT1 A;  2QEX V;  2A79 B;  3OUS A;  3AG4 B;  1SQV H;  2R9I A;  4LF6 B;  2YI9 A;  3CCR V;  3G6B A;  3DC6 A;  1P7G A;  2N04 A;  4OGQ B;  3U11 A;  4DUY B;  4I55 A;  4XDL A;  3JAR A;  4ZI7 B;  1AJN A;  3OM3 B;  1O9G A;  1KUQ A;  4MTX A;  1PNL A;  2YC0 A;  1NQT A;  5KA5 A;  1Q5O A;  4MVM A;  2YIA A;  2UXC B;  3OMN B;  4NXM O;  1QLE C;  1IZ3 A;  1YF2 A;  2WLJ A;  5GON B;  1YVW A;  2GUZ B;  1MAB G;  2OTJ V;  3LSU A;  3RGB A;  1PPJ H;  2JEU A;  3JYC A;  4DV5 O;  4LNU A;  1NH2 B;  2PYL A;  2GV9 A;  1K3E A;  4LFB O;  3ZHQ A;  2BCC H;  4J11 A;  4DR6 O;  2ZQM A;  1KEC A;  4YJ3 B;  2JGD A;  2QWQ B;  1EZJ A;  2UUA B;  4DV1 B;  1SS3 A;  3AK2 A;  5EYP B;  3J81 N;  4JI5 B;  5JCO A;  3UKM A;  4DR5 B;  3S3W A;  3H1L H;  5CA0 A;  4O2A B;  4X65 O;  1KBH A;  5CN0 A;  3K57 A;  1J5E B;  1HDJ A;  4X1K A;  1TUB A;  1Q43 A;  2QTS A;  5DED A;  5A9G A;  4K0K O;  1FFX B;  4J9Y B;  5KAI Z;  3CCU V;  2WA4 A;  4JF3 A;  3AG2 C;  4EB6 A;  3BCC H;  1L8D A;  2WLL A;  3FAV B;  3ZRX A;  3OGC C;  1N36 B;  1U97 A;  3T2M A;  2UXD B;  4YHH O;  1KMI Z;  2QM4 A;  5B1A C;  4C7U A;  5KLV H;  1NU1 H;  3SR2 C;  2VS0 A;  1WP7 A;  5JH7 B;  1N34 B;  2ZE8 A;  2BTO A;  3FYE B;  1N33 B;  2QJ1 A;  5KHK A;  3W7U A;  1S72 V;  1LNQ A;  4FJC C;  1Y76 B;  2VQE O;  1VQ5 V;  2CDY A;  4UB8 Z;  1VQP V;  1XNR B;  1KKC A;  3QO7 A;  3ZHV A;  3FKS G;  2EJR A;  2HP8 A;  3FB5 C;  1IUR A;  5B1B C;  4W4L A;  2YI8 A;  4R6Z A;  2AZ2 A;  3RN4 A;  2ODM A;  2UUC B;  4IIJ B;  4FLY A;  4FLX A;  3DGE A;  4XDJ A;  3QF7 A;  2P5O A;  1NZ6 A;  1X4T A;  1OCR B;  3A2F A;  3E86 A;  1L1F A;  2QKC A;  3N2G A;  1V54 B;  4QJF B;  4U3J B;  2HJF C;  2EX3 A;  1F7Y A;  2YS8 A;  1SZX A;  2EUL A;  3AG7 A;  5GTH Z;  5J2U A;  1BQZ A;  5CA3 A;  3CX5 F;  5LA6 B;  3RVZ A;  2PZS A;  4JAU A;  3ETQ A;  4JPR A;  4QIW F;  5FPR A;  5LL6 Y;  4WFA V;  1XHZ A;  4DW0 A;  1SET A;  3K9S A;  2DYS C;  2HKO A;  2Q7H A;  3CCV V;  1AI7 A;  4D7S A;  2H94 A;  3ZN0 A;  3TXQ A;  1MOF A;  1EM1 A;  5L3F A;  1K92 A;  5IJ9 B;  4DR3 O;  2HHH O;  3FB8 C;  1Q86 W;  3JAW B;  4ZI7 A;  1X59 A;  3PJS K;  1JPX A;  2FYU H;  1VF7 A;  4JI7 O;  2LW1 A;  3CXH F;  4LFA B;  1XMO O;  2XHB A;  4LF5 O;  4FM1 A;  4O4H B;  5JVD A;  1SQP H;  3HR0 A;  3K06 A;  2Q9L A;  2QKA A;  3O9O A;  4FZ0 A;  1PNK A;  1SA0 B;  3ZED A;  3JD0 A;  4DV5 B;  3CS5 A;  1G8M A;  3DXR B;  4JV5 O;  1XHX A;  2JS5 A;  4JZ2 A;  4CS3 A;  4JTD B;  4LFB B;  1Q8I A;  4XBF A;  4DV4 B;  1SQF A;  4JZG A;  4QE7 A;  3BEH A;  1AR4 A;  2UXN A;  5C8Y B;  2F4V B;  2P90 A;  4CH5 A;  4JI4 O;  3O65 A;  5JWP A;  3IGA C;  1ARO P;  3UO2 A;  1M56 B;  3D8C A;  4PJ0 Z;  3TCU A;  1ZTE A;  2DWE C;  4ICG A;  1NVP B;  4X65 B;  1NJI W;  3LNM B;  4AQY B;  3ABK C;  1OCR C;  3B77 A;  2LO1 A;  3OT7 A;  1M5I A;  3CWB H;  3OTO O;  4B3T B;  4LFC B;  4B3S B;  2QWR B;  4PA4 A;  5IYB O;  1BHB A;  2QWP B;  4K0K B;  2JIZ G;  3VQY A;  3WB0 A;  3B2E E;  1NVP D;  1S3J A;  1GO3 F;  2YDE A;  1P7B A;  2XAJ A;  1FPO A;  2QWO B;  1QCE A;  4JI2 B;  3IC9 A;  1F4N A;  1BMF G;  4YHH B;  3T1H B;  1SC5 B;  1Y67 A;  2QGN A;  4ZHQ A;  4G27 B;  1JJO A;  2ZE5 A;  3QTC A;  3ZHU A;  2ZXW B;  4DV6 O;  5KMG A;  1K4C C;  2VQF O;  4H33 A;  4TQF A;  1OHH G;  1BCC H;  2VQE B;  1HNX O;  1YJW V;  3HKB B;  1P84 F;  2P67 A;  1N32 O;  4JAA A;  1ENV A;  1Q82 W;  3RYH A;  2GTS A;  4UFZ A;  2ZDI C;  3SYP A;  1Y66 A;  2UXB O;  4EFB A;  5LMN O;  1N4C A;  2IH1 C;  3E22 B;  1A32 A;  5B3S C;  1M4U A;  2RDC A;  2WLK A;  2P06 A;  1CEZ A;  3BAB A;  1OCC B;  3P3N A;  1XIL A;  1YCI A;  4EKW A;  2VRZ A;  4MVQ A;  4LH6 A;  1PD3 A;  2XAF A;  2BSK B;  1YJN V;  3THO A;  1AI5 A;  1R3K C;  1JQ0 A;  1OJH A;  4U3J A;  4DR1 O;  1Q90 D;  2YIB D;  1NBM G;  3CRR A;  5KUM A;  2Y4U A;  1S76 D;  3CC2 V;  3M8A A;  5KA6 A;  3DSQ A;  2Q8V A;  2CAZ C;  1ZUQ A;  1WLE A;  5IY5 B;  4DW1 A;  2KQX A;  4I55 B;  3HPL C;  4TV9 B;  2DJV A;  5LA6 A;  3BFR A;  2WLM A;  2LGQ A;  3RYF B;  5EIB D;  2Y0I A;  4L87 A;  5IJ0 B;  1IBM B;  5EBM C;  2H3O A;  1JVM A;  5DEC A;  1TUE B;  2UXC O;  4FZ1 A;  2ATK C;  2HHH B;  3B8M A;  5IJ9 A;  1IBL O;  1SQB H;  1KP2 A;  2RQ6 A;  4PDV A;  5JJJ B;  1R6K A;  3JAW A;  1WNS A;  4JI7 B;  5KHG A;  5FPO A;  3OE7 G;  4LF5 B;  4WFH A;  5H6Q A;  1W59 A;  2G38 A;  2JGD B;  4GKJ B;  4KFM A;  4PV1 B;  2Z5U A;  3OD4 A;  2VWJ A;  1SA0 A;  1WPX A;  3KG2 A;  4TUY A;  2UUA O;  4DV1 O;  1PM9 A;  5CA0 B;  3CYO A;  4JI5 O;  4MVU A;  4J7Z A;  1BL8 A;  4P30 A;  4P2Z A;  3SPI A;  4JYB A;  1K33 A;  4DR5 O;  2P4V A;  4X1K B;  5DM6 V;  1TUB B;  3ASO B;  3K0D A;  2ADP A;  1M57 B;  1VF6 C;  1JJ2 U;  5AG2 A;  3ZHT A;  4WF9 V;  5CBF A;  4LCU C;  1OCZ C;  1AR5 A;  3U10 A;  3CCM V;  4FM2 A;  3D3Q A;  4EB6 B;  1G4Y B;  4Q20 A;  4X8A A;  4LF4 O;  3AK1 A;  4CC5 A;  3K5O A;  1KYO F;  5LMU B;  4GZR B;  2O57 A;  2UXD O;  3PN1 A;  4YJ2 A;  4DR7 O;  4FLU A;  3L73 H;  2JJ2 G;  1N34 O;  1U96 A;  4PHZ A;  1GKF A;  4PD4 F;  1IVS A;  1K9M W;  3JAS A;  4JYC A;  3OGI B;  4I4T B;  1VEW A;  5JQG A;  4GKK O;  3CCQ V;  4I50 B;  3SPJ A;  1GN6 A;  1SES A;  3ABM B;  2LGW A;  3ZMZ A;  2EIM C;  2E5L B;  5BZB A;  4BW5 A;  1YZB A;  4UCV A;  2Z3Y A;  2OWO A;  1N32 B;  4W4K A;  1HNZ O;  3HKB A;  4FIP C;  2UXB B;  2E3C A;  3WG7 C;  3N2G B;  1H2G A;  2HJD A;  2X7R B;  3ZMS A;  1I0H A;  2OCC B;  4BWA A;  1S5L Z;  2MW2 B;  5J2U B;  3SPG A;  3SJA C;  4UV8 A;  3K5N A;  2YIB A;  1ZL8 A;  5JCO C;  4ZBM A;  1S0V A;  4JTA B;  1JMK C;  2ZR3 A;  1UFI A;  3SYA A;  5LOV B;  2IBZ H;  2EIN B;  1D5A A;  1Q6H A;  1S5J A;  5KHH A;  2BSK A;  2Q69 A;  3JSL A;  4JI6 O;  4J9Z B;  1VQM V;  3UO3 A;  3WB1 A;  1GM8 A;  1SQX H;  3UCS C;  1M90 W;  5EBW C;  4WBN B;  3ZRW A;  1V55 B;  4QE9 A;  2K9P A;  5H6R A;  4JAV A;  4TV9 A;  4JYA B;  1CP9 A;  2P6J A;  4MTF A;  1NR1 A;  1I08 A;  3RYF A;  1L0L H;  3C90 A;  5IJ0 A;  4A5U B;  3NXS A;  4X64 B;  4BIU A;  2A06 H;  4GX1 A;  3RWR D;  1BE3 H;  3L74 H;  2AW9 A;  1IBL B;  5JVD B;  4LFA O;  2GSM B;  2DQ0 A;  3JCZ A;  4MVS A;  1VQ4 V;  2JGU A;  4UXN A;  3MDS A;  2DYR B;  4NXN B;  2R9A A;  5IYZ A;  1E79 G;  1K8A W;  2M6Y A;  3LNN A;  2HG5 C;  2CH7 B;  4DV4 O;  4L8J A;  3ABM C;  1K97 A;  4LH7 A;  2JS3 A;  2XAG A;  1YIJ V;  3ZMU A;  2F4V O;  2A9H A;  3QO8 A;  2PY5 A;  4ZOL A;  3T1Y B;  2HR3 A;  4Q6G A;  3L70 H;  1Q7Y W;  2B1G A;  2ZE6 A;  2EIK B;  1AR1 B;  2FTK A;  4N23 A;  3B8N A;  3EXA A;  3OFN G;  3ZRS A;  4X88 A;  2W6J G;  4AQY O;  3CRQ A;  1CXZ B;  2CTW A;  1E1Q G;  1H8E G;  4MVO A;  2OCC C;  3K04 A;  4B3T O;  4LFC O;  1OV9 A;  4B3S O;  2IM9 A;  2ZD9 A;  3ABT A;  3R66 A;  1ZAU A;  4LF4 B;  2LP7 A;  2CTQ A;  5J9P C;  1H2L A;  2CE4 A;  1KQS U;  4JI2 O;  5D5Q A;  4ZHQ B;  1NS1 A;  1AJQ A;  1QR8 A;  3T1H O;  4DR7 B;  4IYH A;  1BGY H;  4J41 A;  3AG4 C;  5KMG B;  1MG1 A;  4I0X B;  2GDS A;  4NTY A;  2Q6A A;  3AK3 A;  5CA1 A;  2YXY A;  4YIO A;  4OX9 B;  1Y74 A;  4KP4 A;  3ICX A;  3SYO A;  1Q6U A;  1LUW A;  4GKK B;  3RYH B;  4DXW A;  2RMK B;  2QA4 V;  4HNA A;  2N74 A;  2DMX A;  4PA3 A;  5IDJ A;  1KC8 W;  4I4T A;  3CHX A;  3LUT B;  2QM8 A;  4I50 A;  3K9A A;  5BR8 B;  1PP9 H;  2H8P C;  2IJH A;  4WFE A;  5B1N A;  1DLB A;  1HNZ B;  1H8H G;  3OW2 U;  3CPW U;  1FFT B;  4IGG A;  3SJQ C;  1YXB A;  2CTP A;  3RFR A;  4UCT A;  1Y4M A;  4TOI A;  5KX5 A;  2RN9 A;  1VQN V;  1PV0 A;  1VQO V;  2PYJ A;  4TSF G;  4U3F H;  4E2L A;  4ZKI A;  4DV2 O;  5IWA O;  3UT5 A;  4DO2 A;  4PDL A;  1AB3 A;  4GX0 A;  2BTQ B;  4PI0 A;  4B3R B;  5L3B A;  1XUQ A;  1XEQ A;  4N21 A;  3OEH G;  5LOV A;  3ZIA G;  3ZX6 A;  2PI4 A;  1VIB A;  2W0X A;  4JI6 B;  3W7W A;  4O2B A;  3CB2 A;  4BR6 A;  3LSQ A;  4YY3 B;  1IBM O;  1DK1 A;  1H2K A;  1YHQ V;  2PUS A;  3KCY A;  3JD4 A;  1YTF B;  5E79 Z;  4NYK A;  3H9V A;  2CK3 G;  1S5H C;  4WBN A;  3P30 A;  4FM0 A;  4O4L A;  2N05 A;  1EZV H;  4CS4 A;  4DUZ O;  1OCO B;  4X1Y A;  3K0G A;  4AHC A;  1YTF D;  1K34 A;  4UCR A;  1AP5 A;  3CC4 V;  4DR2 O;  2QWN B;  4IHJ A;  4RUE A;  3E8G A;  2YXH A;  3RBZ A;  5LXT B;  1MA1 A;  4DRX B;  4GKJ O;  4TUY B;  3KZI Z;  1W2B U;  1Q6I A;  4MVZ A;  2PF4 E;  4UCO A;  3Q4H B;  4MVR A;  2KKW A;  4KHP B;  5LP6 A;  2CH7 A;  3ETG A;  3GVM A;  2HVK C;  4CZZ A;  1UJW B;  4I9W A;  1YSC A;  4WFB V;  4I5S A;  5L3C A;  5LHI A;  4FFK A;  1N0N A;  1XOU A;  1I5X A;  4WCE V;  1GN2 A;  3J80 N;  4KUM A;  1FJG B;  2RJZ A;  5K1P A;  3JAT A;  5CBG A;  1V54 C;  3LDC A;  3F5W C;  1MMM A;  4YJ2 B;  1FD9 A;  1AVM A;  5LYJ B;  5LMU O;  3T4D A;  3KCX A;  4QPJ A;  1NI8 A;  1H38 A;  1FXK A;  2NN4 A;  4AIL C;  2YID A;  3SYQ A;  3L9D A;  3CE2 A;  2ZCE A;  3JAS B;  4I7Z B;  2QM7 A;  4F6E A;  3RYC B;  4D6T H;  4UVC A;  4RAI A;  5JQG B;  1HR0 B;  5B66 Z;  2E76 B;  4I0X A;  3HKD A;  1FXV A;  5BMV A;  1VQK V;  2E5L O;  2EIL B;  4PA7 A;  1AP6 A;  4H44 B;  5IYD O;  4GX5 A;  2K1E A;  4FPP A;  3W7S A;  4LWS A;  2EIJ B;  4J7J A;  1OCO C;  3A8T A;  3H1H H;  4HZ3 A;  1ORQ C;  2F1M A;  2PI5 A;  3ABL B;  3C3T A;  1EFR G;  4DV7 B;  2E74 B;  2WPD G;  1F23 A;  1ZL8 B;  1XMQ B;  1WB7 A;  3FB6 C;  4FMT A;  2DOS A;  1SQQ H;  1IX9 A;  5B5E Z;  2EZP A;  1LUV A;  4XDK A;  3CSX A;  2WLI B;  4OXS A;  1THZ A;  2EZO A;  2AXT Z;  3DTU B;  1COW G;  3ZJZ A;  4DV2 B;  5IWA B;  3UQ8 A;  2YXL A;  3E8B A;  3SJB C;  4MW3 A;  5KUK A;  1TVK A;  3W7X A;  1XRE A;  2IH3 C;  2Q73 A;  1M56 C;  2Y4T A;  5A2Q N;  1XQ8 A;  2BTQ A;  2QR4 A;  3ZRW B;  3T1C A;  2OIE A;  1H2S B;  1AI6 A;  4X66 B;  4TV8 A;  2YEV B;  3A0R A;  1H2N A;  4JYA O;  5FNV A;  5BY1 A;  3ASN B;  5KAF Z;  1GK9 A;  3I55 V;  3BY6 A;  3QVN A;  4X64 O;  2X6C A;  4NB5 A;  3SPH A;  3CCS V;  4UV9 A;  2MK3 A;  3OUF A;  1DTO A;  1XL4 A;  4FK5 C;  5ITZ B;  3VOU A;  3HKC B;  4UCU A;  4DUZ B;  5IYZ B;  1XNQ B;  4DR2 B;  4NXN O;  4R7C A;  3IAY A;  1D2D A;  4UB6 Z;  1R3I C;  5LHG A;  2ZXW C;  2LFS A;  4O4I B;  5KHI A;  4UUJ C;  1BT8 A;  1PNM A;  5LXT A;  4LF9 B;  4RWU A;  4JI3 B;  2UU9 B;  2B5U A;  2D2C B;  4ZOL B;  4QPK A;  2EIL C;  4DRX A;  5FLX N;  3BA8 A;  4AI8 A;  2DN9 A;  3G6E V;  3T1Y O;  2IU0 A;  2ZT9 B;  4QGP A;  3AG1 B;  3I56 V;  3Q4H A;  4CC6 A;  2CUG A;  1DF5 A;  1VAR A;  4X1I B;  3RT3 C;  4MTO A;  3ABL C;  2QE7 G;  2ZM6 O;  3AG3 B;  4X20 A;  4CH3 A;  1OCC C;  1QHT A;  2V1D A;  1KP3 A;  4DV0 B;  3E83 A;  1PKX A;  2X0L A;  1GM7 A;  1R6T A;  3CD6 V;  4LF7 O;  1XDC A;  1MZE A;  1TA8 A;  5J2T B;  2ZIN A;  3VQW A;  3JCU Z;  3E2E A;  5EIB C;  5LYJ A;  1VMG A;  2LQT A;  1JFF A;  4D7T A;  5CA1 B;  4U7O A;  5IY5 C;  2L6L A;  4O4J A;  1Y74 B;  2X6B A;  1RPO A;  4I9Q A;  4OX9 O;  2LFR A;  4HNA B;  3RYC A;  3I5D A;  2Q0A A;  2R70 A;  3FD9 A;  4PI2 A;  2KSD A;  3OEE G;  3ZHR A;  2AHZ A;  1XI1 A;  2HLD G;  4FFB B;  1IBK O;  1H2M A;  1TGO A;  3FB7 C;  5BR8 O;  3FYI B;  1SF9 A;  2NR5 A;  1WB8 A;  4ABM A;  4K8Z A;  5KX5 B;  1I5Y A;  1Q81 W;  1BS3 A;  4FLT A;  3K03 A;  1P49 A;  2C2A A;  1N0J A;  2AGA A;  3ZS8 C;  3BRC A;  2IJI A;  1BZK A;  1ROP A;  3UT5 B;  2AZ0 A;  1AIL A;  3BA9 A;  1NT2 B;  1RSO A;  1KKD A;  3CXC U;  3ZMT A;  3APQ A;  3QG5 A;  2ZNI A;  4R8C A;  1MSW D;  5LHH A;  2Q4P A;  1F4M A;  4B3R O;  3MHH C;  2WLI A;  3P32 A;  3SYC A;  2GBO A;  4O2B B;  1BHA A;  1VF6 A;  3ASO C;  3EVK A;  1M57 C;  1JCH A;  3D36 A;  3C3S A;  2CGN A;  2Q67 A;  2RNB A;  2W6I G;  4YY3 O;  3SDL A;  3WFV A;  3AG2 B;  3GWK C;  3L75 H;  2A0L A;  2F93 B;  5H2F Z;  3CRM A;  1JX9 A;  5GTI Z;  3QO5 A;  3JAM N;  3CEI A;  1RP3 B;  4O4L B;  5GW7 A;  2OT5 A;  3SJC C;  2YEV A;  4KL1 A;  5B1A B;  3UM7 A;  4X1Y B;  3HKE A;  1NTK H;  2XAQ A;  4IHJ B;  1B6Q A;  2R9R B;  5F2V O;  1YJ9 V;  1YEW A;  2EJ7 A;  4H0L B;  3S3X A;  2IU3 A;  4RQE A;  1US6 A;  2XND G;  5ITZ A;  3HKC A;  1VQ9 V;  4NKG B;  2XOK G;  4BAY A;  1YDX A;  1HP8 A;  1QU7 A;  3A0H Z;  4TT3 G;  5LP6 B;  3N2K B;  3STL C;  2ZKO A;  3E89 A;  5B1B B;  1BSM A;  4KHP O;  3G71 V;  4LF8 B;  4NVP A;  2HVJ C;  1MZF A;  3SPC A;  3VQV A;  5IE9 A;  2KG7 A;  1Q3E A;  4O4I A;  3K5L A;  2JVD A;  4JI1 B;  4G2K A;  3JD3 A;  3TJT A;  4GLX A;  2UUB B;  3JAT B;  2IJK A;  5FL7 G;  3OMI B;  2DQ3 A;  5B1O A;  5IYC O;  1FJG O;  3AEI A;  3CP1 A;  1QBZ A;  3JAK B;  2ZM6 B;  3U0Z A;  2FB5 A;  2IW5 A;  2LW7 A;  4X1I A;  2L35 A;  1GM9 A;  3MD0 A;  4HAM A;  1I94 O;  2F95 B;  1DGS A;  1FXK B;  4JI0 B;  1DF4 A;  4MTG A;  1NH2 D;  1NTM H;  2ZIO A;  2BOB C;  3R65 A;  2QDO A;  4LF7 B;  4DK0 A;  3JAL B;  4FLV A;  5H9C A;  2EIN C;  4CBC A;  2DYS B;  4LP8 A;  3MAQ A;  5J2T A;  3E35 A;  3EHB B;  4JTC B;  3H1J H;  4JI8 B;  3TGU H;  2HFE C;  3GB7 C;  3HKD B;  3ABU A;  3RVY A;  1R1B A;  5BMV B;  1HR0 O;  3KKY A;  4FLW A;  4B7E A;  3L71 H;  1P4R A;  1V55 C;  5TIS Z;  5L3G A;  5EBL C;  4E4E A;  5D5P A;  3IFX A;  1S77 D;  1YIT V;  4LWS B;  5CBH A;  4CH4 A;  2OYQ A;  2Q68 A;  2Z0A A;  3APO A;  3K5M A;  1IBK B;  3OAA G;  4HBN A;  1IXM A;  2KB1 A;  2XAH A;  1Z2G A;  1QVG U;  1JA8 A;  4OPA A;  4J10 A;  5EC2 C;  4FFB A;  2V7Q G;  2XUM A;  1QLN A;  4DV3 B;  4F6R B;  4DV7 O;  4JGS A;  4IYI A;  2DYR C;  1XMQ O;  2LJ2 A;  1FAF A;  1VQ6 V;  4QNH B;  5LP6 C;  5BXZ A;  3HB3 B;  1PL0 A;  1RPR A;  1M1K W;  1K5S A;  1TVK B;  3G4S V;  3F7Y C;  2NLJ C;  1K73 W;  2OIG A;  2B9Z A;  1G6U A;  2Y69 B;  4ZIB A;  3ABK B;  3CCE V;  4TV8 B;  1GN3 A;  2EIK C;  2ZE7 A;  2YSU B;  4DR4 O;  1MSD A;  2NNU A;  4X66 O;  2P7T C;  5FNV B;  5LGN A;  2DWD C;  1KB9 F;  4B3M B;  1D5N A;  5LBQ A;  5DN6 G;  2JEX A;  1FXK C;  2AHY A;  5CB4 A;  1JR9 A;  3VBB A;  3ZRV A;  3DC5 A;  1BQ0 A;  4X62 B;  4MSW C;  2X6A A;  4CH6 A;  1EN4 A;  4MT8 A;  1HNW O;  1XNQ O;  3WU2 Z;  1EN6 A;  3F7V C;  2FL4 A;  2ITC C;  3JD1 A;  1NTZ H;  5C93 A;  4UVA A;  2ILM A;  4WFG A;  2Q5Z A;  2WSS G;  1WPB A;  2EBO A;  5LGU A;  4LF9 O;  4NXM B;  4JI3 O;  2UU9 O;  2F66 C;  1K5Q A;  1WN7 A;  1XL6 A;  2E75 B;  5B3S B;  1W0K G;  2R72 A;  3N2K A;  4IT5 A;  3K3W A;  5LGT A;  1QVF U;  3JD2 A;  1GMG A;  1Z5V A;  2GHY A;  1W0J G;  5GON A;  2GUZ A;  4TWK A;  1RM1 B;  4JAS A;  4X20 B;  1O9H A;  3B09 A;  4RQF A;  3CCJ V;  3ETD A;  1GTO A;  3WB2 A;  1VQ8 V;  2YIC A;  1ZSP A;  4FVM A;  2WA3 A;  4B7K A;  3TXS A;  3CRA A;  4DR6 B;  5EZY B;  3OR7 C;  1SRY A;  4DV0 O;  2WAM A;  2BOC C;  1T5E A;  2ZIM A;  4RO2 A;  4Z1M G;  2Q7G A;  3JAK A;  1I94 B;  1UPG A;  3SGI A;  4X89 A;  3E8H A;  3P3P A;  4YJ3 A;  4B08 A;  3K08 A;  2JDI G;  3IC7 A;  2W0F C;  1JFF B;  2VWK A;  3OR6 C;  5EYP A;  1HWY A;  5L3E A;  2Y69 C;  4O4J B;  3EFF K;  4O2A A;  3JAL A;  2CTR A;  1GN4 A;  1XBL A;  3K79 A;  2HEP A;  2JRI A;  2BE3 A;  1SKV A;  2WWW A;  3B4S A;  5EC1 C;  4YIP A;  1FFX A;  2YUA A;  1J95 A;  2ADQ B;  2P22 C;  3RW0 A;  2F43 G;  3ZBH A;  3FAV A;  3VQX A;  3TK1 A;  1VP7 A;  4J42 A;  4DK1 A;  3F5T A;  2A7W A;  5L3D A;  5KHJ A;  4IL6 Z;  5JH7 A;  1VF5 B;  1WA8 B;  1N8R W;  4NTW A;  4LC1 A;  1B06 A;  2V4D A;  3H1K H;  1I7F A;  1RSO B;  4F6R A;  1NKD A;  1Y76 A;  4UCS A;  5H5N A;  1KD1 W;  1EBO A;  1V9P A;  1F51 A;  3N27 A;  3W7T A;  1VQ7 V;  2JJ1 G;  2OTL V;  1FXH A;  4H13 B;  1OCZ B;  1KU9 A;  2XTA A;  4X9Q A;  3T4Z A;  3OMA B;  5E1A C;  1RM1 C;  4IIJ A;  1G1X B;  3BHP A;  4BW9 A;  4DR4 B;  4HYO A;  1R73 A;  3LSS A;  3CJH B;  4PDR A;  4FLZ A;  3RYI B;  2OCH A;  4MW8 A;  3CRC A;  3HKE B;  3M7M X;  3NR7 A;  4F4L A;  3E8F A;  4YXW G;  4BIO A;  1LR1 A;  1M93 A;  2Q7E A;  2GTA A;  3K58 A;  4CS2 A;  1ZLZ A;  2Y0P A;  4J80 A;  4LF6 O;  3JAR B;  1WAZ A;  4PDM A;  4DUY O;  3FFQ A;  4GYC B;  3TET A;  1K4D C;  1HNW B;  5EK0 A;  4P9O A;  3QNE A;  4UVB A;  1ZX3 A;  2UXX A;  3GWO A;  4DR3 B;  2EIM B;  1IXB A;  4KXR A;  1CPY A;  5JJE B;  1MNG A;  1GH6 A;  1GAX A;  2KG7 B;  4LF8 O;  2XAS A;  2DW4 A;  4K3A A;  3ZMV A;  4LBE C;  1R3L C;  4J7K A;  2CGO A;  3ZN1 A;  4H37 A;  1AJP A;  2P4K A;  1EN5 A;  3WG7 B;  4LNU B;  4JI1 O;  1B04 A;  3M99 B;  1XMO B;  4ASU G;  2ZDI A;  2EIJ C;  2ZNJ A;  3G80 A;  4EFE A;  3ETE A;  2UUB O;  2M7W A;  3X2Q B;  4GCZ A;  5CMU A;  4O4H A;  3ZHS A;  4GX2 A;  1SZT A;  4JV5 B;  2Y48 A;  1QR9 A;  3OTF A;  2Q0O C;  1ZWI C;  3DXR A;  4JI0 O;  3LDE A;  2QKS A;  5EZY A;  4JI4 B;  3G67 A;  3BVO A;  1J5E O;  1FS0 G;  1URF A;  2WLH A;  5C8Y A;  1QQC A;  3D36 C;  1WP8 A;  1OZ0 A;  2RCV A;  1FKA O;  1E1R G;  4BIZ A;  4WFF A;  2WLL B;  4JI8 O;  3H01 A;  3OTO B;  1PL4 A;  2JK5 C;  1HW7 A;  4PA9 A;  3STZ C;  4P9P A;  1JOY A;  3ZCC A;  1YI2 V;  5HFM A;  4EEQ A;  1N36 O;  5K1X A;  3B40 A;  3JSN A;  4MS2 A;  2ITD C;  2ARH A;  3ASN C;  4DYL A;  1QLE B;  1VQL V;  4LR3 A;  4U7N A;  1IDS A;  4Z2W A;  2DE0 X;  1R3J C;  1K7D A;  1B3Q A;  4NTX A;  2WLN A;  3J7A U;  2ETN A;  1NR7 A;  1M9N A;  4PA6 A;  2FKX A;  1Z5W A;  1SER A;  1N33 O;  2XT9 A;  2QSA A;  4Z1V A; 
#chains in the Genus database with same CATH homology
 4RUE A;  3E8G A;  2BOB C;  3R65 A;  3RBZ A;  1NBM G;  3CME V;  2QTO A;  5HFL A;  5KUM A;  4R50 A;  2ZR2 A;  5H9C A;  2EIN C;  1S76 D;  3CC2 V;  5KA6 A;  1R6N A;  4CBC A;  1W2B U;  2DYS B;  4LP8 A;  1WLE A;  5IY5 B;  4MVZ A;  3LDD A;  3HPL C;  3E35 A;  3EHB B;  4MVR A;  4JTC B;  2WLM A;  1AI4 A;  2HFE C;  4G28 B;  3GB7 C;  3ETG A;  4L87 A;  3ABU A;  3RVY A;  5EBM C;  3CMA V;  1JVM A;  2HVK C;  2B1I A;  4CZZ A;  1P4R A;  1UJW B;  4I9W A;  1V55 C;  1YSC A;  3AG1 C;  4I5S A;  5L3C A;  5LHI A;  4WFB V;  1TUE B;  5L3G A;  5EBL C;  1I5X A;  4WCE V;  3IFX A;  2ATK C;  1YIT V;  1S77 D;  3ML0 A;  5CBH A;  3B8M A;  2D3O W;  4KUM A;  3X2Q C;  3MHS C;  1KP2 A;  2Q68 A;  4PDV A;  5CBG A;  3AG3 C;  1V54 C;  1R6K A;  3OAA G;  1IXM A;  3LDC A;  2KB1 A;  2XAH A;  1QVG U;  3F5W C;  2IJJ A;  3CC7 V;  5EC2 C;  3OE7 G;  3CCL V;  3T4D A;  4RUF A;  4WFH A;  2V7Q G;  1QLN A;  4QPJ A;  5H6Q A;  1H38 A;  1FXK A;  3D3I A;  4JGS A;  2DYR C;  4PEL A;  4GT1 A;  3SYQ A;  2QEX V;  1VQ6 V;  2A79 B;  4KFM A;  3OUS A;  3AG4 B;  2Z5U A;  4QNH B;  2R9I A;  1WPX A;  3KG2 A;  3CCR V;  2QM7 A;  3HB3 B;  4UVC A;  4RAI A;  1PL0 A;  1RPR A;  3CYO A;  1M1K W;  4MVU A;  1BL8 A;  1K5S A;  4XDL A;  3G4S V;  3F7Y C;  2NLJ C;  4P30 A;  4P2Z A;  1AJN A;  4JYB A;  3SPI A;  1K33 A;  3OM3 B;  1K73 W;  4MTX A;  1PNL A;  5DM6 V;  1NQT A;  3ASO B;  3K0D A;  1M57 B;  2Y69 B;  5KA5 A;  4MTG A;  1JJ2 U;  1FXV A;  3ABK B;  4MVM A;  4WF9 V;  5CBF A;  3OMN B;  1OCZ C;  4LCU C;  3CCE V;  1NH2 D;  2EIK C;  1VQK V;  1QLE C;  2YSU B;  2EIL B;  4PA7 A;  3CCM V;  2NNU A;  2WLJ A;  2P7T C;  5IYD O;  4GX5 A;  2K1E A;  1G4Y B;  1MAB G;  4FPP A;  5LGN A;  3W7S A;  4Q20 A;  4X8A A;  2OTJ V;  2EIJ B;  2DWD C;  1OCO C;  4HZ3 A;  1ORQ C;  5LBQ A;  5DN6 G;  2JEX A;  1FXK C;  2PI5 A;  2AHY A;  3VBB A;  3ABL B;  2JEU A;  3JYC A;  3ZRV A;  1EFR G;  1NH2 B;  2WPD G;  1K3E A;  1F23 A;  3FB6 C;  4MSW C;  4FMT A;  2JJ2 G;  2X6A A;  4MT8 A;  2ZQM A;  2EZP A;  1KEC A;  4XDK A;  1GKF A;  2WLI B;  4OXS A;  1THZ A;  1EZJ A;  2EZO A;  3DTU B;  1COW G;  1K9M W;  3ZJZ A;  3F7V C;  2ITC C;  3JD1 A;  3UKM A;  4JYC A;  5C93 A;  3E8B A;  4UVA A;  4MW3 A;  4WFG A;  5CN0 A;  5KUK A;  3CCQ V;  2WSS G;  3W7X A;  3SPJ A;  2IH3 C;  1SES A;  2EBO A;  1M56 C;  3ABM B;  5LGU A;  3ZMZ A;  3ZRW B;  2EIM C;  3T1C A;  5BZB A;  1K5Q A;  4BW5 A;  1AI6 A;  2Z3Y A;  1XL6 A;  5B3S B;  1W0K G;  2YEV B;  4J9Y B;  3A0R A;  3K3W A;  5LGT A;  1QVF U;  3JD2 A;  3CCU V;  4FIP C;  1GMG A;  4JF3 A;  2GHY A;  1W0J G;  3AG2 C;  3ASN B;  2WLL A;  4TWK A;  1GK9 A;  3WG7 C;  4JAS A;  1RM1 B;  3I55 V;  1H2G A;  4RQF A;  3CCJ V;  3ETD A;  1GTO A;  3BY6 A;  3ZRX A;  1VQ8 V;  3OGC C;  2X6C A;  2X7R B;  3T2M A;  3CCS V;  3SPH A;  4UV9 A;  2MK3 A;  3OUF A;  3ZMS A;  1DTO A;  1XL4 A;  2OCC B;  4FK5 C;  5B1A C;  3VOU A;  3SPG A;  3OR7 C;  1SRY A;  2WAM A;  4UV8 A;  2BOC C;  4ZBM A;  1S0V A;  4JTA B;  2ZR3 A;  4RO2 A;  3FYE B;  3SYA A;  4Z1M G;  4X89 A;  3E8H A;  2EIN B;  3K08 A;  4R7C A;  2JDI G;  3IC7 A;  3W7U A;  1S72 V;  1LNQ A;  2W0F C;  1R3I C;  4FJC C;  5LHG A;  2Q69 A;  3OR6 C;  1VQ5 V;  2ZXW C;  2LFS A;  1HWY A;  5L3E A;  2Y69 C;  4J9Z B;  4UUJ C;  1VQM V;  1VQP V;  1PNM A;  3EFF K;  1GM8 A;  2B5U A;  3QO7 A;  3K79 A;  3FKS G;  4QPK A;  2EIL C;  1M90 W;  2EJR A;  3FB5 C;  5EBW C;  5B1B C;  3G6E V;  4R6Z A;  2IU0 A;  3ZRW A;  1V55 B;  4QE9 A;  3AG1 B;  2WWW A;  5H6R A;  3I56 V;  4JAV A;  5EC1 C;  1CP9 A;  2P6J A;  3DGE A;  4XDJ A;  4MTF A;  1NR1 A;  1DF5 A;  4MTO A;  3ABL C;  1J95 A;  3NXS A;  1OCR B;  4BIU A;  2QE7 G;  3E86 A;  1L1F A;  4GX1 A;  3AG3 B;  1V54 B;  2F43 G;  3RW0 A;  4QJF B;  1OCC C;  3TK1 A;  2V1D A;  1KP3 A;  2HJF C;  2GSM B;  2DQ0 A;  3JCZ A;  4MVS A;  3E83 A;  5L3D A;  1PKX A;  2X0L A;  1GM7 A;  3CD6 V;  1VQ4 V;  4UXN A;  1N8R W;  5CA3 A;  2DYR B;  4LC1 A;  1E79 G;  3RVZ A;  1K8A W;  4JAU A;  3E2E A;  2HG5 C;  4JPR A;  4QIW F;  4WFA V;  1NKD A;  3ABM C;  1K97 A;  1SET A;  2DYS C;  2HKO A;  4U7O A;  2XAG A;  5IY5 C;  1EBO A;  1YIJ V;  1KD1 W;  3ZMU A;  3CCV V;  1F51 A;  1RPO A;  1AI7 A;  2X6B A;  3W7T A;  2A9H A;  3QO8 A;  1VQ7 V;  2JJ1 G;  2H94 A;  3ZN0 A;  2HR3 A;  1MOF A;  1Q7Y W;  2OTL V;  2B1G A;  1FXH A;  5L3F A;  2LFR A;  1K92 A;  1OCZ B;  2EIK B;  3T4Z A;  1AR1 B;  2FTK A;  3FB8 C;  3B8N A;  3OFN G;  3OMA B;  4N23 A;  5E1A C;  3ZRS A;  1RM1 C;  1Q86 W;  4X88 A;  2W6J G;  3PJS K;  1JPX A;  3OEE G;  2AHZ A;  1E1Q G;  2HLD G;  1H8E G;  4MVO A;  2OCC C;  3K04 A;  4HYO A;  3FB7 C;  1R73 A;  2ZD9 A;  3ABT A;  3LSS A;  3FYI B;  4PDR A;  4MW8 A;  1I5Y A;  2LP7 A;  4F4L A;  1Q81 W;  3K06 A;  3E8F A;  4YXW G;  5J9P C;  3K03 A;  2C2A A;  1PNK A;  1KQS U;  3JD0 A;  1AJQ A;  1G8M A;  1QR8 A;  2IJI A;  4JTD B;  1ROP A;  4XBF A;  4PDM A;  3AG4 C;  3TET A;  1MG1 A;  1K4D C;  3BEH A;  4QE7 A;  3CXC U;  1KKD A;  2UXN A;  5EK0 A;  4P9O A;  3ZMT A;  2Q6A A;  3QNE A;  2P90 A;  4R8C A;  1MSW D;  4UVB A;  5LHH A;  1F4M A;  2UXX A;  3IGA C;  1ARO P;  1M56 B;  3MHH C;  4KP4 A;  3GWO A;  2WLI A;  3P32 A;  3SYC A;  3SYO A;  3TCU A;  2EIM B;  2DWE C;  1NVP B;  1BHA A;  3ASO C;  4DXW A;  1CPY A;  2QA4 V;  1NJI W;  1M57 C;  4PA3 A;  3LNM B;  1JCH A;  3D36 A;  5IDJ A;  1KC8 W;  2XAS A;  3ABK C;  1OCR C;  2DW4 A;  3B77 A;  3ZMV A;  4LBE C;  1R3L C;  2Q67 A;  3LUT B;  2QM8 A;  3ZN1 A;  2W6I G;  4H37 A;  3WFV A;  1AJP A;  3K9A A;  3AG2 B;  4PA4 A;  5IYB O;  2H8P C;  1BHB A;  2A0L A;  2IJH A;  3WG7 B;  3M99 B;  1JX9 A;  2JIZ G;  4ASU G;  2ZDI A;  4WFE A;  5B1N A;  1DLB A;  1S3J A;  1H8H G;  1GO3 F;  2EIJ C;  3QO5 A;  1NVP D;  3OW2 U;  3CPW U;  5GW7 A;  2OT5 A;  1FFT B;  2YEV A;  3ETE A;  1P7B A;  3SJQ C;  1Y4M A;  2M7W A;  2XAJ A;  5B1A B;  3UM7 A;  3X2Q B;  4GCZ A;  1QCE A;  5CMU A;  4GX2 A;  1SZT A;  1F4N A;  1BMF G;  2XAQ A;  1VQN V;  1VQO V;  2Y48 A;  1QR9 A;  1B6Q A;  4TSF G;  2R9R B;  4E2L A;  1ZWI C;  4ZKI A;  1YJ9 V;  4RQE A;  2IU3 A;  4G27 B;  2XND G;  4DO2 A;  3LDE A;  2QKS A;  4PDL A;  4GX0 A;  1VQ9 V;  2ZXW B;  2XOK G;  1K4C C;  4BAY A;  5L3B A;  1FS0 G;  4H33 A;  2WLH A;  4N21 A;  3OEH G;  1OZ0 A;  1OHH G;  4TT3 G;  3ZIA G;  3STL C;  1YJW V;  1E1R G;  2PI4 A;  3E89 A;  5B1B B;  2P67 A;  4BIZ A;  1ENV A;  3G71 V;  4WFF A;  3W7W A;  1Q82 W;  2WLL B;  2HVJ C;  3SPC A;  3H01 A;  3LSQ A;  2ZDI C;  3SYP A;  1Y66 A;  2JK5 C;  2IH1 C;  4PA9 A;  1YHQ V;  3STZ C;  4P9P A;  1JOY A;  5B3S C;  4G2K A;  3ZCC A;  1YI2 V;  5HFM A;  3JD4 A;  1YTF B;  2WLK A;  3JD3 A;  4MS2 A;  2ITD C;  2CK3 G;  1S5H C;  1CEZ A;  3ASN C;  1QLE B;  3P30 A;  1VQL V;  4U7N A;  2IJK A;  1OCC B;  5FL7 G;  3OMI B;  2DQ3 A;  5B1O A;  5IYC O;  3AEI A;  3CP1 A;  1QBZ A;  1R3J C;  4EKW A;  2IW5 A;  1K7D A;  1OCO B;  3K0G A;  1GM9 A;  2WLN A;  1YTF D;  1NR7 A;  1M9N A;  4PA6 A;  4MVQ A;  1K34 A;  3MD0 A;  4HAM A;  1PD3 A;  2XAF A;  3CC4 V;  1YJN V;  1FXK B;  1SER A;  1DF4 A;  1AI5 A;  1R3K C;  1JQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...