1B6QA

Alanine 31 proline mutant of rop protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP
publication title Protein plasticity to the extreme: changing the topology of a 4-alpha-helical bundle with a single amino acid substitution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 23
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1b6qA00
1PD3A 1ROPA 1RPRA 1B6QA 2GHYA 2IJIA 2IJJA 3K79A 2IJKA 1F4MA 1GMGA 2IJHA 1F4NA 1NKDA 4DO2A 1GTOA 1RPOA
chains in the Genus database with same CATH superfamily
4JAUA 1OCZB 1M9NA 2IH1C 1OCOB 2F95B 2GUZB 5EBWC 2QGNA 4X8AA 2IU0A 3ZMVA 1NZ6A 1BHAA 4DR2O 5KHIA 2Q0AA 4TV9B 2UUCB 4JI6B 4DV5O 5KMGB 1MSDA 1M56B 3L75H 4I5SA 2EILB 4RO2A 1BL8A 1AI5A 2JGDB 5FNVA 3X2QB 1ZAUA 1BHBA 4X1IB 2IJHA 1YJWV 2XHBA 1HNXB 4HNAB 1ZWIC 4YJ2A 3ZN1A 4DV0B 2W6IG 1FYJA 4J7KA 4HBNA 4R50A 4CS4A 2Q69A 3JD4A 3DSQA 1EN5A 5KX5B 3J80N 2JEUA 4DUYB 3JCUZ 3SYCA 2B9ZA 4DR7B 2ITCC 2LFSA 1VQOV 3CCEV 1M90W 2PY5A 1EBOA 1WLEA 1M57C 1O9HA 2Y0IA 1URFA 4O4HA 1NH2B 2LW7A 3BEHA 4PDMA 2EJRA 4DR4B 5FL7G 3CCJV 3T1YB 4JI7O 4RQEA 1IBMO 1XMOB 1KB9F 3Q4HA 1FFTB 4XDKA 2YS8A 3SYQA 1UPGA 2CTWA 4J10A 4LC1A 2JRIA 5B3SB 4MS2A 2IBZH 2LQTA 4WFGA 4TSFG 5JH7B 1Z5WA 3PJSK 3UKMA 4DV4O 3WB1A 1PNKA 1QLEC 3L72H 5J9PC 2HKOA 1RM1B 1D5AA 3ZHUA 4X20A 4FLXA 1ZL8B 3MAQA 4B3SO 2FTKA 4UCRA 2F23A 1JFFA 5JJNB 1VIBA 4QPKA 3QO7A 3N2GA 3OTOO 1NBMG 3H1KH 2F4VO 4X1KA 3KKYA 1RSOB 1H2SB 2KQXA 3ZIAG 2Q0OC 4X9QA 3JAWB 2F43G 2W0FC 4F6RA 1HR0O 1B04A 1K5QA 2VQEB 1K5SA 4ZHQB 3RVZA 5BXZA 3IC9A 3CC2V 2YICA 2PTMA 5BR8B 3SYOA 2DQ3A 3AG4C 1P7GA 3SPJA 3QNEA 3TETA 1EZJA 4XDLA 3U0ZA 1NR7A 1PNLA 2UXNA 4JV5O 2UU9O 2E75B 3RT3C 4QJFB 4ZKIA 4E4EA 1X59A 4OPAA 3CS5A 1M1KW 4LBEC 4GX1A 4KL1A 2M7WA 4LNUA 1UFIA 3CHXA 3OR7C 2OTJV 1CP9A 4DR3B 5EBLC 1NKDA 1IURA 1H8HG 4O2BB 4HZ3A 1AR4A 3CB2A 1P84F 3OAAG 5GONB 2HJDA 4H44B 4IT5A 2XT9A 1ZUQA 2YXYA 2GV9A 1IXBA 2EX3A 4H37A 3UQ8A 1SERA 1LNQA 2N74A 4CC6A 4LF4B 3M8AA 2BOBC 1HDJA 5JVDA 4X62B 4PD4F 4IHJA 2UUCO 3FAVA 4O4LB 4JI6O 3K79A 3H1HH 1AP5A 1KBHA 2K1EA 1Q86W 3B4SA 3HKCA 5JQGA 3EXAA 4CBCA 3K08A 3JAKA 4WCEV 4OXSA 5IYZB 3K5MA 4PA9A 4J7ZA 4WF9V 4DW0A 1CXZB 4LFAO 3AK2A 2Y4UA 1HNWB 2G38A 2Y4TA 4MVOA 1QVFU 3H9VA 2YXLA 4CZZA 2LGQA 2QA4V 3ZEDA 2QTSA 1F23A 4O4JA 2OT5A 1VF7A 3QO5A 4DUYO 1FXKC 3DXRA 2RQ6A 4XBFA 4MVQA 1FXKA 2GTSA 2PF4E 3RYHA 3SGIA 2HFEC 4DRXA 5L3DA 3CYOA 2Q8VA 2ZKOA 2MW2B 3E8FA 1TUBA 5LYJB 3OMAB 1JR9A 5E1AC 2DMXA 3JYCA 2KG7A 2O57A 2B1GA 2YIBA 4DUZB 1VEWA 5CA0A 3CX5F 2EINC 4ZI7B 1RFYA 3F5TA 2HHHO 3JALB 2Q9LA 1B3QA 4FVMA 1XMOO 4UVBA 2R72A 1W0JG 1DF5A 1WA8B 1SQBH 1RPRA 4AILC 3E83A 5A2QN 2OWOA 4B3MB 3FX7A 2YI9A 4LF7B 5DECA 1U97A 4JI1O 2P67A 1H2MA 3ZN0A 3H1IH 1N4CA 1YI2V 2Q6AA 2AZ2A 1V9PA 3ABKB 5KAFZ 5H6QA 5IY5C 5LP6C 5LP6A 1MG1A 1SQQH 1AJNA 2XAGA 3E8BA 5AG2A 1NVPB 5L3BA 3CMEV 1PP9H 2XNDG 3AG1B 4J42A 3KCXA 4HAMA 1TVKB 3RWRD 2UUBO 4DV5B 1PV0A 5IJ0B 2XAHA 3K58A 2CH7B 1PL4A 2YUAA 3CJHA 1KECA 2DW4A 2VQEO 1R6NA 2FMLA 2P7TC 3AG3C 2QWNB 1XL4A 2CE4A 5LMNB 3A0BZ 1L0LH 4UV8A 5LGNA 4UVAA 5CBGA 1QR8A 3HKBA 1KD1W 1FJGB 3K06A 4PA7A 2RDCA 2P5OA 5IE9A 3MD0A 4NB5A 5IT9N 1MA1A 2MK3A 5CBFA 4DR5O 2JS5A 1M93A 3E89A 2ZT9B 2QWRB 4ASUG 2DN9A 5EC1C 3BCCH 5IYBO 2UUAO 3CRAA 2BCCH 3BAAA 2AHYA 5B1OA 4EEQA 4ZOLB 3ZMZA 3ABLB 1AI4A 3CP1A 2LP7A 1MNGA 1Y4MA 4EB6B 4H13B 1IBMB 3K5OA 4ABMA 5BMVA 2JS3A 2P06A 4UB6Z 3CPWU 5H2FZ 4LWSB 3G6BA 1E1QG 2Y69B 3FB5C 5B1AB 1Q81W 2QKCA 1JVMA 3QVNA 4I50B 1K34A 2YXHA 3LSSA 2BTOA 3DGEA 2E76B 2ZIMA 1K9MW 2UXDO 1KUQA 4K8XA 4FLTA 4U3JA 2ZR2A 3D36C 1BZKA 3D36A 2HP8A 4JAVA 4K0KO 5LOVA 4U7OA 2WLLB 4O2AB 4JI5B 4TV8A 4JYCA 2PI5A 2XASA 4KFMA 3QG5A 3T1HB 5IJ9A 1YVWA 3HKEB 4B3SB 1HNWO 1TA8A 3UCSC 2PZSA 4MTGA 2PYLA 4H0LB 4X88A 1V54C 1XILA 3OTOB 1IBLO 2F4VB 4X66B 1SQVH 1GKFA 1ROPA 2A9HA 4K35A 1R73A 4RAIA 2VWKA 1RPOA 1HWYA 1WPXA 4X64B 2C2AA 5EYPA 1HR0B 3DTUB 2VS0A 1KU9A 3DC6A 1XOUA 1YXBA 2RMKB 1NJIW 3VQWA 1VARA 1WAZA 4DUZO 1XMQO 4PV1B 3CSXA 2BE3A 3WB2A 1BE3H 4JV5B 2UU9B 5J2UA 3LNNA 4B3MO 4I4TA 4LF7O 3RBZA 3ETQA 4LR3A 5C8YA 1BQZA 2Q73A 4BIZA 4O4IA 3K57A 1YTFB 3BVOA 1XHXA 3T1CA 4EFBA 2JJ1G 4LF5B 1W0KG 3R66A 2LGWA 1R3JC 1DTOA 1IDSA 4J9YB 5FNVB 3I55V 1JJ2U 1QNMA 4GZRB 3UO2A 4DW1A 1EN4A 1JQ0A 2IJKA 2GHYA 3JD2A 4DXWA 3O65A 5B66Z 4MVZA 4PDLA 2XUMA 3LSUA 4YJ2B 5H5NA 5GW7A 3T4ZA 2Y48A 1FAFA 3BA9A 5KA6A 3W7XA 3K04A 1KP3A 3F7YC 2VQFB 1I7FA 3UT5B 1WP8A 4UXNA 1F4NA 3ZMSA 2EIKC 4AQYO 4UVCA 2NN4A 4LFAB 3ABUA 1IBKB 1JX9A 4FFKA 4O4HB 5LMNO 1M57B 1FJGO 3VBBA 1N34O 1SQPH 1VQ6V 3ASOC 1GM7A 3OM3B 3W7TA 1Q7YW 2DWDC 4ICGA 1AI7A 2JJ2G 5KUMA 5TISZ 1Y6XA 3JSLA 1G6UA 4CS3A 3E22A 5CB4A 5KMGA 2Q68A 3S3XA 3TXSA 3QF7A 1AJQA 2UXBO 1HW7A 3ASNC 1E79G 1YEWA 2JGDA 1GK9A 2HHHB 3KG2A 4GX0A 1QLEB 5CBHA 4FM1A 4DR1B 5GTIZ 3JASB 4RUEA 5IDJA 3RYFA 2ZE7A 2ZXWC 3ZS8C 1BS3A 5LGUA 1KQSU 4DR6O 4X20B 3NR7A 1QVGU 3OFNG 2A7WA 4JI1B 1J5EB 4I0XA 2YIBD 3ZHRA 2EIMC 3SPCA 1F51A 3CC7V 5ITZB 2QWQB 3DC5A 2F93B 3I5DA 1IVSA 3N2GB 3OGIB 4X1KB 2CAZC 2DE0X 2ETNA 4TOIA 4DV3O 1AILA 2GTAA 4TQFA 1KYOF 3CMAV 1S5HC 1NS1A 4DO2A 2QWOB 4JI5O 1LUVA 3CXCU 1WJZA 1I94O 2P90A 1NT2B 2ZNJA 3CCMV 3T1HO 3SJAC 2FL4A 2HEPA 4FK5C 3G67A 1NR1A 2FKXA 3VOUA 4X65O 5B1BC 2UUBB 4D6TH 2X6CA 3GVMA 1THZA 4LP8A 1Y74A 4YY3B 2WAMA 3AG4B 4X66O 3R65A 2LW1A 4JI4O 3RW0A 3OR6C 4B3TB 4LF8O 1FXHA 3LUTB 4X64O 1MZFA 1I5XA 1EN6A 3CCLV 5JH7A 4MSWC 2YEVA 3APOA 3HKDA 2CDYA 1FFXA 4H33A 1QCEA 3D3QA 4LFBO 2H3OA 3LDDA 4IYHA 3VQVA 4JI0B 2OIGA 4Q6GA 1Y67A 3E86A 2DYSC 4DR5B 1VQPV 2WA3A 2DJVA 4MVUA 1N32O 2ATKC 2IJJA 4I9WA 5LA6A 2LJ2A 1QLNA 4GKJO 5EK0A 3OUSA 2KSDA 3F5WC 2UUAB 1AJPA 5JVDB 3FD9A 2PUSA 3FAVB 1H2LA 2V7QG 1UJWB 4LF5O 3HKCB 3D8CA 1K4CC 5JQGB 1PD3A 3ZRWB 3VQXA 1DK1A 3ICXA 2UXCO 4ZHQA 4G2KA 3P30A 4OGQB 3CC4V 3K9SA 2EULA 1XEQA 4YJ3A 4A5UB 5LHIA 4GCZA 3ABMC 3G80A 4PA4A 3I56V 1O9GA 2HLDG 4BIOA 2A79B 2UXDB 1Y76A 1YDXA 4X1YA 4K3AA 5IYDO 2VQFO 4UB8Z 3KZIZ 2NLJC 2BSKB 4O4JB 2OCCC 3CEIA 1VQKV 4NVPA 4WBNA 3STLC 3L70H 4K0KB 2X0LA 2GDSA 2XTAA 2X7RB 3DXRB 5CMUA 4RWUA 1FXKB 1WB7A 3RYHB 1S5JA 4OX9O 3ZMUA 1XQ8A 1JA8A 4DRXB 1XBLA 2JIZG 3STZC 1Q3EA 4YIOA 4KHPB 1XL6A 4JI8O 1IBKO 1TUBB 4NXMB 1R6KA 3JSNA 2EIJC 4O2BA 2DQ0A 2KG7B 1YZBA 4LF6O 4FLUA 2CTPA 1IBLB 4FMTA 2EINB 2IJIA 5J2TA 3RGBA 3SPIA 1VQMV 2XAJA 5EC2C 1SC5B 4B7KA 2ZR3A 3G6EV 4MVRA 4D7TA 4JASA 5EZYA 3AG7A 4O4LA 3JD0A 3CCUV 2ADQB 1US6A 2AGAA 1XMQB 3AG2C 4W4LA 2YDEA 2DYRC 5KA5A 2VWJA 1VMGA 3ZRXA 4BAYA 4DR1O 1IXMA 4FFBB 1IX9A 5IY5B 5LP6B 4LF9O 4N21A 1SS3A 3E2EA 1D5NA 2P6JA 2ADPA 3MHHC 4J7JA 5DN6G 1J5EO 4NTXA 1PNMA 4GKKO 3N2KA 4WFHA 1ORQC 2YI8A 3NXSA 1AB3A 2B5UA 1SA0A 2R9AA 2IW5A 2M6YA 4GX2A 4FLZA 2FB5A 4K8ZA 2WLIA 3ML0A 3ZBHA 4F6EA 3RYCA 3RN4A 1K7DA 1Q6HA 5LYJA 3SPHA 4J9ZB 2WWWA 4BW9A 1ENVA 1VF6C 3FB6C 3RFRA 1QR9A 1VF6A 5C93A 2L35A 3AG3B 1KC8W 3HKBB 2E3CA 3SYPA 4YY3O 2ZCEA 4DV6O 3OMNB 3CCRV 3G4SV 2YIDA 3ZCCA 4GLXA 2QSAA 4W4KA 4B3TO 1WNSA 5B5EZ 3IAYA 3JARA 4MVMA 2KKWA 1SQFA 4DV2B 2W0XA 4DV7B 4AQYB 4I7ZB 4JAAA 2BOCC 3BFRA 1SKVA 3GWOA 3P32A 3K0GA 4PHZA 3VQYA 1F7YA 1S0VA 4D7SA 2H8PC 2HVJC 2HG5C 3LDEA 1N34B 3W7UA 3L74H 1K4DC 4XDJA 2FYUH 2WPDG 5K1PA 3K9AA 4JI0O 1BT8A 2RN9A 5K1XA 3A0HZ 5BMVB 3OT7A 1H2KA 5CA1A 1K33A 1PM9A 1T5EA 1H2GA 3K03A 3MDSA 1GO3F 3W7WA 2DOSA 5IJ0A 2NNUA 4NXNO 1AI6A 1MABG 3K59A 2UXBB 3K3WA 1U96A 2CH7A 2ZD9A 2ILMA 5BZBA 1OCCC 4JTCB 5LBQA 3W7SA 4TQDA 5L3CA 2ZQMA 4JTDB 4TUYA 1K73W 5LOVB 3B8MA 4IIJB 5L3GA 1XNRB 4NYKA 1G1XB 4TV8B 4QNHB 4IGGA 4DR6B 1OHHG 4UCVA 4CH3A 2X6AA 2QWPB 2QE7G 2K9PA 2NR5A 4PDRA 4UFZA 1TAEA 3T2MA 2OYQA 4FPPA 1V54B 2A0LA 4IL6Z 2EZOA 1PL0A 2JVDA 1GN6A 4DV3B 3WG7C 3B09A 5LXTB 2QEXV 4P2ZA 4NR1A 1I94B 2Q7GA 1Q90D 4I55B 5EIBD 5CA3A 4KHPO 4C7UA 2Z3YA 2D3OW 4NXMO 2BTQB 5JJJB 1B06A 1FD9A 4FJCC 3O9OA 4X65B 1QQCA 1E1RG 3RYIA 3WB0A 4AI8A 1GM8A 4LWSA 4RUFA 1ZX3A 3K5LA 4JI4B 1OCRC 3WU2Z 2R9IA 4L8JA 4LF8B 3B77A 4I50A 4QE9A 1IZ3A 1XI1A 4YIPA 5J2UB 4UCOA 1JPXA 3L73H 2ZINA 4PJ0Z 4Z2WA 3EFFK 4I4TB 3A0RA 1AROP 2F1MA 5D5PA 1I08A 4GUNA 4YXWG 2E5LB 1J95A 4J41A 1K8AW 4MW8A 1MSWD 1NU1H 4JPRA 4LFCB 4O2AA 4DV1O 4LFBB 3CD6V 1YF2A 5JJEB 4BW5A 3JCZA 3F7VC 3AK3A 5E79Z 3LDCA 3ETGA 4JYYA 2EBOA 3UO3A 1YJNV 1S72V 1N32B 4MVSA 4Z1MG 3CRRA 1JMKC 4B7EA 4JYBA 2IH3C 3BRCA 1JJOA 4AHCA 4R8CA 4GKJB 2B1IA 2RCVA 2P4VA 4ZIBA 3ABTA 3OEEG 1LR1A 4LCUC 1YHQV 1M4UA 1Q6IA 3N27A 4U7NA 4R7CA 4PI0A 2UXCB 1N0JA 4YHHB 3E8GA 1V55C 2EIKB 2IU3A 1EFRG 2PI4A 2XAFA 2CGNA 3SJBC 1BGYH 1KMIZ 3UM7A 1TGOA 4EKWA 1GH6A 3ASOB 2L6LA 2D2CB 2H94A 1R1BA 3IFXA 1H8EG 3TCUA 3WFVA 5KAIZ 1Q6UA 4WFBV 1NI8A 4DV2O 4DV7O 4OX9B 4BIUA 3E22B 4B3RO 3C3SA 3ZRVA 3OMIB 1FS0G 2LFRA 3B8NA 5CB4B 3OD4A 2Q7HA 3TXQA 4JI8B 3APQA 4U3FH 3JATA 1OCZC 1OCOC 3CRQA 4LF6B 3OGCC 4LH6A 3PN1A 3SPGA 1OV9A 3ASNB 2GUZA 5CN0A 5KHJA 2OTLV 3CE2A 4NTWA 1R3LC 2CK3G 4L87A 2ODMA 3EVKA 3CXHF 3Q4HB 4X89A 4QGPA 3RYFB 4FLVA 2WLHA 1AR1B 4QE7A 5DEDA 4QIWF 2ZXWB 4TV9A 4MTXA 4CC5A 1M56C 2Q7EA 4PA6A 4IYIA 2PGGA 2EILC 2AHZA 4I0XB 3UT5A 2R70A 2UXXA 2QKAA 1AP6A 2GBOA 2EIMB 1KP2A 3KCYA 3OE7G 3FKSG 3X2QC 2ITDC 3H1LH 1VQ9V 3J81N 3S3WA 1NTZH 1COWG 4X1IA 1EM1A 5IWAB 1XNRO 1YJ9V 4TWKA 2A3QA 1LUWA 4HNAA 1SQXH 1I5YA 1SETA 4LF9B 5LHHA 3SYAA 2XAQA 4NKGB 5EIBC 2Y0PA 4JZ2A 5BY1A 3C3TA 3IJ4A 2W6JG 5FPRA 4GKKB 1JFFB 4E2LA 5HFMA 2WA4A 3BHPA 3GB7C 5KX5A 3RVYA 2DWEC 5B1BB 4OPHA 1Y74B 3SJCC 4HYOA 4G28B 4KUMA 3LSQA 1S5LZ 4P9PA 2X6BA 4FLWA 1WP7A 2OIEA 4F6RB 1BMFG 4MT8A 2RJZA 1MZEA 2YEVB 2CTRA 1GTOA 1XDCA 3CRCA 1N33O 1VQ5V 3HKDB 2ZDIC 1FFXB 2ZM6O 2ZDIA 3TJTA 4TT3G 4DV6B 2P4KA 3JASA 4JZGA 1KKCA 2Q4PA 1GMGA 5B3SC 5D5QA 2P22C 4MTOA 2DYSB 4LH7A 2N05A 1SZTA 5LA6B 1L1FA 2YIAA 3ZX6A 5ITZA 4JYAO 4LNUB 4MW3A 4P9OA 1L8DA 3E8HA 1FPOA 4DYLA 2E5LO 2HVKC 1OZ0A 3T4DA 1SF9A 4P30A 1BSMA 4LFCO 1EZVH 1RM1C 3FFQA 4GT1A 5KHKA 4JI2O 1GN2A 3MHSC 1JCHA 1P7BA 2ZE8A 3OEHG 1ZL8A 2A06H 1OJHA 3IC7A 1W2BU 3C90A 2Q67A 4YJ3B 4BR6A 3BABA 1W59A 3M99B 1VP7A 2WLJA 3ABMB 4NXNB 4IHJB 1RSOA 1Y76B 2JGUA 4UCUA 1GAXA 4X1YB 1N8RW 3SDLA 4B08A 1ZTEA 3JAMN 4J11A 2JK5C 3JAWA 4WBNB 2OCCB 2VRZA 4CS2A 1NVPD 1AR5A 1K92A 3JAKB 4YHHO 4JI3B 2GSMB 2HR3A 5LMUO 4CH4A 3D3IA 4FZ1A 1Z5VA 1P4RA 4FIPC 3G71V 2ZIOA 2EIJB 5FPOA 3JD1A 1YIJV 4CH5A 2V4DA 5J2TB 1Y66A 3K5NA 1H38A 2ARHA 4NTYA 1FKAO 1Q43A 5KLVH 3ETEA 2Z0AA 3A2FA 3ZRSA 1SESA 3ZHVA 1N36B 1RP3B 2QDOA 3HPLC 5EZYB 2QM7A 2ZE6A 1S3JA 3AEIA 3L71H 1VQ4V 1GN3A 2YC0A 3ZRWA 1F4MA 3LNMB 1FXVA 5GONA 1HNZB 5CA0B 2RNBA 3AG2B 4WFAV 4KP4A 2DYRB 3BY6A 2EZPA 1HNXO 4DV0O 1X4TA 1GM9A 4FZ0A 1WB8A 3N2KB 2BSKA 4G27B 4CH6A 3OW2U 1XNQB 1SA0B 2CGOA 1ZLZA 4DV1B 5IYZA 2WLIB 4UV9A 4DR7O 3JD3A 3RYCB 5IWAO 1DF4A 1Z2GA 3GWKC 1Q5OA 1SZXA 3HR0A 5H6RA 2JEXA 3A8TA 2N04A 1R3KC 4DR4O 3T1YO 2EJ7A 5LGTA 1VQNV 4R6ZA 4GX5A 3FYIB 3ZHQA 1CPYA 5B1NA 1NTMH 3CJHB 1TUEB 3JARB 3IGAC 1NQTA 2AXTZ 5IYCO 4WFEA 2WLNA 1XUQA 4ZI7A 4DK0A 4RQFA 3QTCA 3JALA 4MTFA 1WPBA 1M5IA 1QU7A 1XHZA 1WA8A 4FFBA 1K97A 3CCQV 3J7AU 1AVMA 1QBZA 1G4YB 3K0DA 3TK1A 2F66C 3OTFA 1VQ7V 3BA8A 1KKDA 2QTOA 2R9RB 4DR2B 5CA1B 4B3RB 2AZ0A 1R3IC 2WSSG 3ABKC 1A32A 3H1JH 4EFEA 3B2EE 2KB1A 1OCCB 5FLXN 3ZMTA 4TUYB 4UCSA 3ZJZA 3FB8C 2HJFC 3AG1C 4WFFA 1XREA 1YTFD 5BR8O 1TVKA 3THOA 1S76D 1Q8IA 2YSUB 1JOYA 2WLKA 1MOFA 3ZHSA 1GRJA 4U3JB 1YCIA 4PELA 3M7MX 4FM0A 1NTKH 4Z1VA 1G8MA 3WG7B 3U10A 3H01A 5EBMC 4JI3O 3BPZA 1D2DA 4UUJC 5LL6Y 4J80A 1PPJH 4DR3O 5IJ9B 4QPJA 1QHTA 3HB3B 4JI7B 4N23A 5JCOC 5KHHA 5A9GA 2CTQA 1YSCA 5JCOA 3RYIB 3CCSV 2QJ1A 1SQGA 3ETDA 1HP8A 4GYCB 1OCRB 4LF4O 3AK1A 4Q20A 5DM6V 4X62O 3ABLC 1N36O 5EYPB 4JGSA 4ZOLA 4F4LA 2Z5UA 3U11A 2XOKG 3OUFA 4DV4B 2JDIG 1K3EA 4PDVA 4EB6A 4FM2A 1N33B 1VQLV 1HNZO 2ZM6B 4PI2A 4DK1A 4IIJA 1YITV 1S77D 1VQ8V 5L3EA 1MMMA 2Y69C 5B1AC 5LHGA 3FYEB 2QKSA 1H2NA 2LO1A 3E35A 1DGSA 1NH2D 1WN7A 2E74B 3B40A 1CEZA 4BWAA 3P3PA 1SRYA 4JTAB 4JYAB 1BQ0A 5C8YB 4UCTA 1VF5B 3CCVV 4O4IB 3CWBH 1XNQO 2WLLA 5L3FA 2ZE5A 5LXTA 1R6TA 3SR2C 3P3NA 4I9QA 4JF3A 4JI2B 4I55A 2AW9A 2ZNIA 3QO8A 3HKEA 1ZSPA 5HFLA 5H9CA 2BTQA 3CRMA 5F2VO 1P49A 5KUKA 2PYJA 1V55B 1Q82W 2CUGA 3TGUH 2Q5ZA 2IM9A 1N0NA 1GN4A 3SJQC 2QM4A 3EHBB 4PA3A 5GTHZ 1BCCH 5JWPA 5LMUB 2QR4A 3FB7C 2V1DA 4KXRA 3L9DA 5KHGA 1DLBA 2OCHA 1PKXA 4FLYA 1I0HA 1B6QA 2WLMA 4ZBMA 3JATB 1L0NH 2QM8A 3ZHTA
chains in the Genus database with same CATH topology
3ABLB 4JAUA 1AI4A 3CP1A 1OCZB 1M9NA 2IH1C 4JASA 1OCOB 3JD0A 2LP7A 3CCUV 1GMGA 5B3SC 1Y4MA 5EBWC 4MTOA 2DYSB 4X8AA 2IU0A 3ZMVA 1BHAA 1SZTA 1L1FA 3AG2C 3CPWU 2DYRC 4MW3A 4P9OA 5KA5A 1E1QG 3E8HA 3ZRXA 2Y69B 2HVKC 3FB5C 5B1AB 1OZ0A 4BAYA 1Q81W 3T4DA 4P30A 1IXMA 1JVMA 1M56B 1K34A 5IY5B 3LSSA 1RM1C 3DGEA 4GT1A 4I5SA 2EILB 4RO2A 3MHSC 1K9MW 1JCHA 1BL8A 1AI5A 4N21A 1P7BA 3E2EA 2P6JA 3MHHC 5DN6G 3OEHG 3IC7A 2ZR2A 1W2BU 1PNMA 4WFHA 3X2QB 3D36A 4JAVA 1ORQC 1BHBA 2IJHA 3NXSA 2B5UA 2WLLB 4U7OA 2Q67A 1YJWV 3M99B 2WLJA 1ZWIC 3ZN1A 2W6IG 2IW5A 3ABMB 4GX2A 4JYCA 2PI5A 4R50A 2WLIA 3ML0A 2Q69A 3JD4A 2XASA 4KFMA 1K7DA 1N8RW 3SPHA 4MTGA 4J9ZB 2JK5C 2WWWA 2OCCB 4X88A 1NVPD 2JEUA 1V54C 1ENVA 1K92A 3FB6C 3SYCA 1QR9A 5C93A 2GSMB 2HR3A 3AG3B 1GKFA 2ITCC 1ROPA 1KC8W 2A9HA 1R73A 3D3IA 3SYPA 4RAIA 1P4RA 2LFSA 4FIPC 1RPOA 3OMNB 1HWYA 1WPXA 3CCRV 3CCEV 1VQOV 3G4SV 1M90W 1EBOA 3G71V 2C2AA 1M57C 1WLEA 3ZCCA 2EIJB 1NH2B 3DTUB 3JD1A 3BEHA 1YIJV 4PDMA 2EJRA 4MVMA 5FL7G 3CCJV 1Y66A 1H38A 1NJIW 2BOCC 4RQEA 3GWOA 3P32A 3K0GA 3ETEA 1S0VA 2H8PC 2HVJC 1FFTB 4XDKA 3ZRSA 2HG5C 1SESA 3LDEA 3HPLC 2QM7A 1S3JA 3SYQA 3W7UA 3AEIA 1K4DC 4XDJA 4LC1A 2WPDG 5B3SB 1VQ4V 4MS2A 3K9AA 3ZRWA 1F4MA 3LNMB 1FXVA 4WFGA 4TSFG 3AG2B 3PJSK 3RBZA 3UKMA 1K33A 1PNKA 4WFAV 4KP4A 1QLEC 2DYRB 3BY6A 4BIZA 1H2GA 3K03A 1YTFB 1GO3F 2EZPA 5J9PC 3W7WA 3T1CA 2HKOA 2JJ1G 2NNUA 1W0KG 1RM1B 1AI6A 1MABG 1R3JC 1DTOA 1GM9A 3K3WA 2ZD9A 4J9YB 5BZBA 1OCCC 3I55V 4JTCB 1JJ2U 5LBQA 2FTKA 3W7SA 5L3CA 2ZQMA 4JTDB 1K73W 4G27B 1JQ0A 2IJKA 2GHYA 3B8MA 3OW2U 3JD2A 4DXWA 4QPKA 5L3GA 3QO7A 4MVZA 4PDLA 1NBMG 5GW7A 3T4ZA 2Y48A 2WLIB 5KA6A 4UV9A 3W7XA 3JD3A 3K04A 4QNHB 1DF4A 1KP3A 1OHHG 3F7YC 3ZIAG 2X6AA 2QE7G 2F43G 2W0FC 4PDRA 1K5QA 3T2MA 1K5SA 4UXNA 5H6RA 1F4NA 2JEXA 1V54B 2A0LA 4FPPA 3RVZA 2EZOA 1PL0A 1R3KC 3ZMSA 2EIKC 5LGTA 1VQNV 4R6ZA 3CC2V 4UVCA 3SYOA 3WG7C 2DQ3A 3AG4C 2QEXV 4GX5A 3ABUA 3QNEA 1JX9A 4P2ZA 3SPJA 3FYIB 3TETA 1EZJA 4XDLA 1CPYA 1M57B 1NR7A 5CA3A 3VBBA 5B1NA 1VQ6V 1PNLA 2UXNA 2Z3YA 2D3OW 3ASOC 1TUEB 3IGAC 4FJCC 1NQTA 1GM7A 4QJFB 4ZKIA 3OM3B 3W7TA 1E1RG 5IYCO 1Q7YW 2DWDC 1AI7A 2JJ2G 4WFEA 2WLNA 1M1KW 1GM8A 4LBEC 5KUMA 4GX1A 2M7WA 4RUFA 4RQFA 3OR7C 2OTJV 1OCRC 4MTFA 2R9IA 1CP9A 5EBLC 1NKDA 3B77A 1H8HG 1K97A 2Q68A 3CCQV 4QE9A 1QBZA 1G4YB 4HZ3A 1JPXA 1AJQA 3K0DA 3TK1A 3OAAG 3EFFK 1VQ7V 3ZMZA 3ASNC 1E79G 3A0RA 2QTOA 1KKDA 1AROP 2R9RB 1GK9A 3KG2A 4H37A 4GX0A 1SERA 1QLEB 5CBHA 4YXWG 1J95A 1LNQA 1K8AW 4MW8A 1MSWD 2BOBC 4JPRA 1R3IC 4RUEA 2WSSG 5IDJA 3CD6V 2ZXWC 3ABKC 4BW5A 3JCZA 5LGUA 1KQSU 3K79A 3F7VC 2K1EA 1QVGU 3OFNG 1Q86W 2KB1A 1OCCB 3LDCA 3ETGA 3ZMTA 2EBOA 1YJNV 1S72V 4MVSA 4Z1MG 2EIMC 3SPCA 3ZJZA 1F51A 3FB8C 4CBCA 4JYBA 2IH3C 2HJFC 3CC7V 4R8CA 3K08A 2B1IA 3AG1C 4WFFA 4WCEV 3ABTA 3OEEG 4OXSA 4PA9A 1YTFD 4WF9V 3CMAV 1S5HC 4LCUC 4DO2A 2YSUB 1YHQV 1S76D 3CXCU 1JOYA 2WLKA 2P90A 3CCMV 1MOFA 4MVOA 1QVFU 4U7NA 4R7CA 4CZZA 4FK5C 4PELA 2QA4V 1F23A 3E8GA 1NR1A 2OT5A 3VOUA 1V55C 2EIKB 5B1BC 2IU3A 3QO5A 2X6CA 1G8MA 1FXKC 1THZA 1EFRG 4LP8A 4XBFA 2PI4A 4MVQA 3WG7B 1FXKA 3H01A 2WAMA 3AG4B 5EBMC 2XAFA 2HFEC 3R65A 4UUJC 5L3DA 3CYOA 3RW0A 3OR6C 3UM7A 1FXHA 4QPJA 3LUTB 3E8FA 4EKWA 3HB3B 3ASOB 3OMAB 5E1AC 3JYCA 4N23A 1I5XA 2H94A 2B1GA 3IFXA 1H8EG 3TCUA 1YSCA 3CCLV 2EINC 3WFVA 4MSWC 3CCSV 2YEVA 4WFBV 3ETDA 4BIUA 3ZRVA 4UVBA 3OMIB 1OCRB 1W0JG 1QCEA 1FS0G 1DF5A 2LFRA 3B8NA 4H33A 1RPRA 4Q20A 5DM6V 3ABLC 3LDDA 1OCZC 4JGSA 1OCOC 3E83A 3OGCC 4F4LA 2Z5UA 2XOKG 3SPGA 3ASNB 3E86A 2DYSC 3OUFA 1VQPV 5CN0A 4MVUA 2JDIG 1K3EA 2P67A 4PDVA 2OTLV 2ATKC 3ZN0A 1R3LC 1VQLV 2CK3G 2IJJA 4L87A 4I9WA 1QLNA 5EK0A 3OUSA 3F5WC 1YI2V 1AJPA 2Q6AA 4X89A 1YITV 1S77D 1VQ8V 5L3EA 2WLHA 1AR1B 2Y69C 4QE7A 4QIWF 5B1AC 2ZXWB 3ABKB 4MTXA 5LHGA 1M56C 2V7QG 3FYEB 5H6QA 5IY5C 1UJWB 4PA6A 2QKSA 2EILC 3E35A 1K4CC 1MG1A 2AHZA 1NH2D 1AJNA 2XAGA 1PD3A 2UXXA 3E8BA 3ZRWB 1CEZA 2EIMB 1KP2A 1SRYA 1NVPB 4JTAB 3OE7G 5L3BA 4G2KA 3CMEV 3P30A 3FKSG 2XNDG 2ITDC 3X2QC 1VQ9V 3CC4V 3AG1B 3CCVV 4HAMA 1COWG 2WLLA 1YJ9V 5L3FA 5LHIA 4TWKA 4GCZA 3ABMC 2XAHA 4PA4A 1I5YA 3I56V 1SETA 2HLDG 4JF3A 2A79B 3SYAA 5LHHA 2XAQA 5IYDO 3QO8A 2W6JG 2NLJC 5H9CA 5HFLA 1KECA 2OCCC 4E2LA 5HFMA 1VQKV 3STLC 3GB7C 2DW4A 1R6NA 2X0LA 5KUKA 1V55B 3RVYA 2DWEC 5B1BB 2X7RB 5CMUA 1Q82W 1FXKB 4HYOA 2P7TC 3G6EV 3AG3C 3ZMUA 4G28B 1XL4A 4KUMA 3LSQA 4UV8A 5LGNA 4UVAA 5CBGA 2JIZG 4P9PA 2X6BA 1QR8A 3STZC 1KD1W 1XL6A 1R6KA 2EIJC 3K06A 4PA7A 2DQ0A 1BMFG 4MT8A 3SJQC 3MD0A 3EHBB 4PA3A 2MK3A 5CBFA 2YEVB 4FMTA 1GTOA 2EINB 2IJIA 3FB7C 2V1DA 1VQ5V 3E89A 2ZDIC 4ASUG 1DLBA 5EC1C 3SPIA 2ZDIA 1VQMV 1PKXA 4TT3G 5IYBO 2XAJA 1B6QA 5EC2C 2WLMA 4ZBMA 2AHYA 2ZR3A 2QM8A 5B1OA 4MVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  1ROP A;  1RPR A;  1B6Q A;  2GHY A;  2IJI A;  2IJJ A;  3K79 A;  2IJK A;  1F4M A;  1GMG A;  2IJH A;  1F4N A;  1NKD A;  4DO2 A;  1GTO A;  1RPO A; 
#chains in the Genus database with same CATH topology
 4JAU A;  1OCZ B;  1M9N A;  2IH1 C;  1OCO B;  2F95 B;  2GUZ B;  5EBW C;  2QGN A;  4X8A A;  2IU0 A;  3ZMV A;  1NZ6 A;  1BHA A;  4DR2 O;  5KHI A;  2Q0A A;  4TV9 B;  2UUC B;  4JI6 B;  4DV5 O;  5KMG B;  1MSD A;  1M56 B;  3L75 H;  4I5S A;  2EIL B;  4RO2 A;  1BL8 A;  1AI5 A;  2JGD B;  5FNV A;  3X2Q B;  1ZAU A;  1BHB A;  4X1I B;  2IJH A;  1YJW V;  2XHB A;  1HNX B;  4HNA B;  1ZWI C;  4YJ2 A;  3ZN1 A;  4DV0 B;  2W6I G;  1FYJ A;  4J7K A;  4HBN A;  4R50 A;  4CS4 A;  2Q69 A;  3JD4 A;  3DSQ A;  1EN5 A;  5KX5 B;  3J80 N;  2JEU A;  4DUY B;  3JCU Z;  3SYC A;  2B9Z A;  4DR7 B;  2ITC C;  2LFS A;  1VQO V;  3CCE V;  1M90 W;  2PY5 A;  1EBO A;  1WLE A;  1M57 C;  1O9H A;  2Y0I A;  1URF A;  4O4H A;  1NH2 B;  2LW7 A;  3BEH A;  4PDM A;  2EJR A;  4DR4 B;  5FL7 G;  3CCJ V;  3T1Y B;  4JI7 O;  4RQE A;  1IBM O;  1XMO B;  1KB9 F;  3Q4H A;  1FFT B;  4XDK A;  2YS8 A;  3SYQ A;  1UPG A;  2CTW A;  4J10 A;  4LC1 A;  2JRI A;  5B3S B;  4MS2 A;  2IBZ H;  2LQT A;  4WFG A;  4TSF G;  5JH7 B;  1Z5W A;  3PJS K;  3UKM A;  4DV4 O;  3WB1 A;  1PNK A;  1QLE C;  3L72 H;  5J9P C;  2HKO A;  1RM1 B;  1D5A A;  3ZHU A;  4X20 A;  4FLX A;  1ZL8 B;  3MAQ A;  4B3S O;  2FTK A;  4UCR A;  2F23 A;  1JFF A;  5JJN B;  1VIB A;  4QPK A;  3QO7 A;  3N2G A;  3OTO O;  1NBM G;  3H1K H;  2F4V O;  4X1K A;  3KKY A;  1RSO B;  1H2S B;  2KQX A;  3ZIA G;  2Q0O C;  4X9Q A;  3JAW B;  2F43 G;  2W0F C;  4F6R A;  1HR0 O;  1B04 A;  1K5Q A;  2VQE B;  1K5S A;  4ZHQ B;  3RVZ A;  5BXZ A;  3IC9 A;  3CC2 V;  2YIC A;  2PTM A;  5BR8 B;  3SYO A;  2DQ3 A;  3AG4 C;  1P7G A;  3SPJ A;  3QNE A;  3TET A;  1EZJ A;  4XDL A;  3U0Z A;  1NR7 A;  1PNL A;  2UXN A;  4JV5 O;  2UU9 O;  2E75 B;  3RT3 C;  4QJF B;  4ZKI A;  4E4E A;  1X59 A;  4OPA A;  3CS5 A;  1M1K W;  4LBE C;  4GX1 A;  4KL1 A;  2M7W A;  4LNU A;  1UFI A;  3CHX A;  3OR7 C;  2OTJ V;  1CP9 A;  4DR3 B;  5EBL C;  1NKD A;  1IUR A;  1H8H G;  4O2B B;  4HZ3 A;  1AR4 A;  3CB2 A;  1P84 F;  3OAA G;  5GON B;  2HJD A;  4H44 B;  4IT5 A;  2XT9 A;  1ZUQ A;  2YXY A;  2GV9 A;  1IXB A;  2EX3 A;  4H37 A;  3UQ8 A;  1SER A;  1LNQ A;  2N74 A;  4CC6 A;  4LF4 B;  3M8A A;  2BOB C;  1HDJ A;  5JVD A;  4X62 B;  4PD4 F;  4IHJ A;  2UUC O;  3FAV A;  4O4L B;  4JI6 O;  3K79 A;  3H1H H;  1AP5 A;  1KBH A;  2K1E A;  1Q86 W;  3B4S A;  3HKC A;  5JQG A;  3EXA A;  4CBC A;  3K08 A;  3JAK A;  4WCE V;  4OXS A;  5IYZ B;  3K5M A;  4PA9 A;  4J7Z A;  4WF9 V;  4DW0 A;  1CXZ B;  4LFA O;  3AK2 A;  2Y4U A;  1HNW B;  2G38 A;  2Y4T A;  4MVO A;  1QVF U;  3H9V A;  2YXL A;  4CZZ A;  2LGQ A;  2QA4 V;  3ZED A;  2QTS A;  1F23 A;  4O4J A;  2OT5 A;  1VF7 A;  3QO5 A;  4DUY O;  1FXK C;  3DXR A;  2RQ6 A;  4XBF A;  4MVQ A;  1FXK A;  2GTS A;  2PF4 E;  3RYH A;  3SGI A;  2HFE C;  4DRX A;  5L3D A;  3CYO A;  2Q8V A;  2ZKO A;  2MW2 B;  3E8F A;  1TUB A;  5LYJ B;  3OMA B;  1JR9 A;  5E1A C;  2DMX A;  3JYC A;  2KG7 A;  2O57 A;  2B1G A;  2YIB A;  4DUZ B;  1VEW A;  5CA0 A;  3CX5 F;  2EIN C;  4ZI7 B;  1RFY A;  3F5T A;  2HHH O;  3JAL B;  2Q9L A;  1B3Q A;  4FVM A;  1XMO O;  4UVB A;  2R72 A;  1W0J G;  1DF5 A;  1WA8 B;  1SQB H;  1RPR A;  4AIL C;  3E83 A;  5A2Q N;  2OWO A;  4B3M B;  3FX7 A;  2YI9 A;  4LF7 B;  5DEC A;  1U97 A;  4JI1 O;  2P67 A;  1H2M A;  3ZN0 A;  3H1I H;  1N4C A;  1YI2 V;  2Q6A A;  2AZ2 A;  1V9P A;  3ABK B;  5KAF Z;  5H6Q A;  5IY5 C;  5LP6 C;  5LP6 A;  1MG1 A;  1SQQ H;  1AJN A;  2XAG A;  3E8B A;  5AG2 A;  1NVP B;  5L3B A;  3CME V;  1PP9 H;  2XND G;  3AG1 B;  4J42 A;  3KCX A;  4HAM A;  1TVK B;  3RWR D;  2UUB O;  4DV5 B;  1PV0 A;  5IJ0 B;  2XAH A;  3K58 A;  2CH7 B;  1PL4 A;  2YUA A;  3CJH A;  1KEC A;  2DW4 A;  2VQE O;  1R6N A;  2FML A;  2P7T C;  3AG3 C;  2QWN B;  1XL4 A;  2CE4 A;  5LMN B;  3A0B Z;  1L0L H;  4UV8 A;  5LGN A;  4UVA A;  5CBG A;  1QR8 A;  3HKB A;  1KD1 W;  1FJG B;  3K06 A;  4PA7 A;  2RDC A;  2P5O A;  5IE9 A;  3MD0 A;  4NB5 A;  5IT9 N;  1MA1 A;  2MK3 A;  5CBF A;  4DR5 O;  2JS5 A;  1M93 A;  3E89 A;  2ZT9 B;  2QWR B;  4ASU G;  2DN9 A;  5EC1 C;  3BCC H;  5IYB O;  2UUA O;  3CRA A;  2BCC H;  3BAA A;  2AHY A;  5B1O A;  4EEQ A;  4ZOL B;  3ZMZ A;  3ABL B;  1AI4 A;  3CP1 A;  2LP7 A;  1MNG A;  1Y4M A;  4EB6 B;  4H13 B;  1IBM B;  3K5O A;  4ABM A;  5BMV A;  2JS3 A;  2P06 A;  4UB6 Z;  3CPW U;  5H2F Z;  4LWS B;  3G6B A;  1E1Q G;  2Y69 B;  3FB5 C;  5B1A B;  1Q81 W;  2QKC A;  1JVM A;  3QVN A;  4I50 B;  1K34 A;  2YXH A;  3LSS A;  2BTO A;  3DGE A;  2E76 B;  2ZIM A;  1K9M W;  2UXD O;  1KUQ A;  4K8X A;  4FLT A;  4U3J A;  2ZR2 A;  3D36 C;  1BZK A;  3D36 A;  2HP8 A;  4JAV A;  4K0K O;  5LOV A;  4U7O A;  2WLL B;  4O2A B;  4JI5 B;  4TV8 A;  4JYC A;  2PI5 A;  2XAS A;  4KFM A;  3QG5 A;  3T1H B;  5IJ9 A;  1YVW A;  3HKE B;  4B3S B;  1HNW O;  1TA8 A;  3UCS C;  2PZS A;  4MTG A;  2PYL A;  4H0L B;  4X88 A;  1V54 C;  1XIL A;  3OTO B;  1IBL O;  2F4V B;  4X66 B;  1SQV H;  1GKF A;  1ROP A;  2A9H A;  4K35 A;  1R73 A;  4RAI A;  2VWK A;  1RPO A;  1HWY A;  1WPX A;  4X64 B;  2C2A A;  5EYP A;  1HR0 B;  3DTU B;  2VS0 A;  1KU9 A;  3DC6 A;  1XOU A;  1YXB A;  2RMK B;  1NJI W;  3VQW A;  1VAR A;  1WAZ A;  4DUZ O;  1XMQ O;  4PV1 B;  3CSX A;  2BE3 A;  3WB2 A;  1BE3 H;  4JV5 B;  2UU9 B;  5J2U A;  3LNN A;  4B3M O;  4I4T A;  4LF7 O;  3RBZ A;  3ETQ A;  4LR3 A;  5C8Y A;  1BQZ A;  2Q73 A;  4BIZ A;  4O4I A;  3K57 A;  1YTF B;  3BVO A;  1XHX A;  3T1C A;  4EFB A;  2JJ1 G;  4LF5 B;  1W0K G;  3R66 A;  2LGW A;  1R3J C;  1DTO A;  1IDS A;  4J9Y B;  5FNV B;  3I55 V;  1JJ2 U;  1QNM A;  4GZR B;  3UO2 A;  4DW1 A;  1EN4 A;  1JQ0 A;  2IJK A;  2GHY A;  3JD2 A;  4DXW A;  3O65 A;  5B66 Z;  4MVZ A;  4PDL A;  2XUM A;  3LSU A;  4YJ2 B;  5H5N A;  5GW7 A;  3T4Z A;  2Y48 A;  1FAF A;  3BA9 A;  5KA6 A;  3W7X A;  3K04 A;  1KP3 A;  3F7Y C;  2VQF B;  1I7F A;  3UT5 B;  1WP8 A;  4UXN A;  1F4N A;  3ZMS A;  2EIK C;  4AQY O;  4UVC A;  2NN4 A;  4LFA B;  3ABU A;  1IBK B;  1JX9 A;  4FFK A;  4O4H B;  5LMN O;  1M57 B;  1FJG O;  3VBB A;  1N34 O;  1SQP H;  1VQ6 V;  3ASO C;  1GM7 A;  3OM3 B;  3W7T A;  1Q7Y W;  2DWD C;  4ICG A;  1AI7 A;  2JJ2 G;  5KUM A;  5TIS Z;  1Y6X A;  3JSL A;  1G6U A;  4CS3 A;  3E22 A;  5CB4 A;  5KMG A;  2Q68 A;  3S3X A;  3TXS A;  3QF7 A;  1AJQ A;  2UXB O;  1HW7 A;  3ASN C;  1E79 G;  1YEW A;  2JGD A;  1GK9 A;  2HHH B;  3KG2 A;  4GX0 A;  1QLE B;  5CBH A;  4FM1 A;  4DR1 B;  5GTI Z;  3JAS B;  4RUE A;  5IDJ A;  3RYF A;  2ZE7 A;  2ZXW C;  3ZS8 C;  1BS3 A;  5LGU A;  1KQS U;  4DR6 O;  4X20 B;  3NR7 A;  1QVG U;  3OFN G;  2A7W A;  4JI1 B;  1J5E B;  4I0X A;  2YIB D;  3ZHR A;  2EIM C;  3SPC A;  1F51 A;  3CC7 V;  5ITZ B;  2QWQ B;  3DC5 A;  2F93 B;  3I5D A;  1IVS A;  3N2G B;  3OGI B;  4X1K B;  2CAZ C;  2DE0 X;  2ETN A;  4TOI A;  4DV3 O;  1AIL A;  2GTA A;  4TQF A;  1KYO F;  3CMA V;  1S5H C;  1NS1 A;  4DO2 A;  2QWO B;  4JI5 O;  1LUV A;  3CXC U;  1WJZ A;  1I94 O;  2P90 A;  1NT2 B;  2ZNJ A;  3CCM V;  3T1H O;  3SJA C;  2FL4 A;  2HEP A;  4FK5 C;  3G67 A;  1NR1 A;  2FKX A;  3VOU A;  4X65 O;  5B1B C;  2UUB B;  4D6T H;  2X6C A;  3GVM A;  1THZ A;  4LP8 A;  1Y74 A;  4YY3 B;  2WAM A;  3AG4 B;  4X66 O;  3R65 A;  2LW1 A;  4JI4 O;  3RW0 A;  3OR6 C;  4B3T B;  4LF8 O;  1FXH A;  3LUT B;  4X64 O;  1MZF A;  1I5X A;  1EN6 A;  3CCL V;  5JH7 A;  4MSW C;  2YEV A;  3APO A;  3HKD A;  2CDY A;  1FFX A;  4H33 A;  1QCE A;  3D3Q A;  4LFB O;  2H3O A;  3LDD A;  4IYH A;  3VQV A;  4JI0 B;  2OIG A;  4Q6G A;  1Y67 A;  3E86 A;  2DYS C;  4DR5 B;  1VQP V;  2WA3 A;  2DJV A;  4MVU A;  1N32 O;  2ATK C;  2IJJ A;  4I9W A;  5LA6 A;  2LJ2 A;  1QLN A;  4GKJ O;  5EK0 A;  3OUS A;  2KSD A;  3F5W C;  2UUA B;  1AJP A;  5JVD B;  3FD9 A;  2PUS A;  3FAV B;  1H2L A;  2V7Q G;  1UJW B;  4LF5 O;  3HKC B;  3D8C A;  1K4C C;  5JQG B;  1PD3 A;  3ZRW B;  3VQX A;  1DK1 A;  3ICX A;  2UXC O;  4ZHQ A;  4G2K A;  3P30 A;  4OGQ B;  3CC4 V;  3K9S A;  2EUL A;  1XEQ A;  4YJ3 A;  4A5U B;  5LHI A;  4GCZ A;  3ABM C;  3G80 A;  4PA4 A;  3I56 V;  1O9G A;  2HLD G;  4BIO A;  2A79 B;  2UXD B;  1Y76 A;  1YDX A;  4X1Y A;  4K3A A;  5IYD O;  2VQF O;  4UB8 Z;  3KZI Z;  2NLJ C;  2BSK B;  4O4J B;  2OCC C;  3CEI A;  1VQK V;  4NVP A;  4WBN A;  3STL C;  3L70 H;  4K0K B;  2X0L A;  2GDS A;  2XTA A;  2X7R B;  3DXR B;  5CMU A;  4RWU A;  1FXK B;  1WB7 A;  3RYH B;  1S5J A;  4OX9 O;  3ZMU A;  1XQ8 A;  1JA8 A;  4DRX B;  1XBL A;  2JIZ G;  3STZ C;  1Q3E A;  4YIO A;  4KHP B;  1XL6 A;  4JI8 O;  1IBK O;  1TUB B;  4NXM B;  1R6K A;  3JSN A;  2EIJ C;  4O2B A;  2DQ0 A;  2KG7 B;  1YZB A;  4LF6 O;  4FLU A;  2CTP A;  1IBL B;  4FMT A;  2EIN B;  2IJI A;  5J2T A;  3RGB A;  3SPI A;  1VQM V;  2XAJ A;  5EC2 C;  1SC5 B;  4B7K A;  2ZR3 A;  3G6E V;  4MVR A;  4D7T A;  4JAS A;  5EZY A;  3AG7 A;  4O4L A;  3JD0 A;  3CCU V;  2ADQ B;  1US6 A;  2AGA A;  1XMQ B;  3AG2 C;  4W4L A;  2YDE A;  2DYR C;  5KA5 A;  2VWJ A;  1VMG A;  3ZRX A;  4BAY A;  4DR1 O;  1IXM A;  4FFB B;  1IX9 A;  5IY5 B;  5LP6 B;  4LF9 O;  4N21 A;  1SS3 A;  3E2E A;  1D5N A;  2P6J A;  2ADP A;  3MHH C;  4J7J A;  5DN6 G;  1J5E O;  4NTX A;  1PNM A;  4GKK O;  3N2K A;  4WFH A;  1ORQ C;  2YI8 A;  3NXS A;  1AB3 A;  2B5U A;  1SA0 A;  2R9A A;  2IW5 A;  2M6Y A;  4GX2 A;  4FLZ A;  2FB5 A;  4K8Z A;  2WLI A;  3ML0 A;  3ZBH A;  4F6E A;  3RYC A;  3RN4 A;  1K7D A;  1Q6H A;  5LYJ A;  3SPH A;  4J9Z B;  2WWW A;  4BW9 A;  1ENV A;  1VF6 C;  3FB6 C;  3RFR A;  1QR9 A;  1VF6 A;  5C93 A;  2L35 A;  3AG3 B;  1KC8 W;  3HKB B;  2E3C A;  3SYP A;  4YY3 O;  2ZCE A;  4DV6 O;  3OMN B;  3CCR V;  3G4S V;  2YID A;  3ZCC A;  4GLX A;  2QSA A;  4W4K A;  4B3T O;  1WNS A;  5B5E Z;  3IAY A;  3JAR A;  4MVM A;  2KKW A;  1SQF A;  4DV2 B;  2W0X A;  4DV7 B;  4AQY B;  4I7Z B;  4JAA A;  2BOC C;  3BFR A;  1SKV A;  3GWO A;  3P32 A;  3K0G A;  4PHZ A;  3VQY A;  1F7Y A;  1S0V A;  4D7S A;  2H8P C;  2HVJ C;  2HG5 C;  3LDE A;  1N34 B;  3W7U A;  3L74 H;  1K4D C;  4XDJ A;  2FYU H;  2WPD G;  5K1P A;  3K9A A;  4JI0 O;  1BT8 A;  2RN9 A;  5K1X A;  3A0H Z;  5BMV B;  3OT7 A;  1H2K A;  5CA1 A;  1K33 A;  1PM9 A;  1T5E A;  1H2G A;  3K03 A;  3MDS A;  1GO3 F;  3W7W A;  2DOS A;  5IJ0 A;  2NNU A;  4NXN O;  1AI6 A;  1MAB G;  3K59 A;  2UXB B;  3K3W A;  1U96 A;  2CH7 A;  2ZD9 A;  2ILM A;  5BZB A;  1OCC C;  4JTC B;  5LBQ A;  3W7S A;  4TQD A;  5L3C A;  2ZQM A;  4JTD B;  4TUY A;  1K73 W;  5LOV B;  3B8M A;  4IIJ B;  5L3G A;  1XNR B;  4NYK A;  1G1X B;  4TV8 B;  4QNH B;  4IGG A;  4DR6 B;  1OHH G;  4UCV A;  4CH3 A;  2X6A A;  2QWP B;  2QE7 G;  2K9P A;  2NR5 A;  4PDR A;  4UFZ A;  1TAE A;  3T2M A;  2OYQ A;  4FPP A;  1V54 B;  2A0L A;  4IL6 Z;  2EZO A;  1PL0 A;  2JVD A;  1GN6 A;  4DV3 B;  3WG7 C;  3B09 A;  5LXT B;  2QEX V;  4P2Z A;  4NR1 A;  1I94 B;  2Q7G A;  1Q90 D;  4I55 B;  5EIB D;  5CA3 A;  4KHP O;  4C7U A;  2Z3Y A;  2D3O W;  4NXM O;  2BTQ B;  5JJJ B;  1B06 A;  1FD9 A;  4FJC C;  3O9O A;  4X65 B;  1QQC A;  1E1R G;  3RYI A;  3WB0 A;  4AI8 A;  1GM8 A;  4LWS A;  4RUF A;  1ZX3 A;  3K5L A;  4JI4 B;  1OCR C;  3WU2 Z;  2R9I A;  4L8J A;  4LF8 B;  3B77 A;  4I50 A;  4QE9 A;  1IZ3 A;  1XI1 A;  4YIP A;  5J2U B;  4UCO A;  1JPX A;  3L73 H;  2ZIN A;  4PJ0 Z;  4Z2W A;  3EFF K;  4I4T B;  3A0R A;  1ARO P;  2F1M A;  5D5P A;  1I08 A;  4GUN A;  4YXW G;  2E5L B;  1J95 A;  4J41 A;  1K8A W;  4MW8 A;  1MSW D;  1NU1 H;  4JPR A;  4LFC B;  4O2A A;  4DV1 O;  4LFB B;  3CD6 V;  1YF2 A;  5JJE B;  4BW5 A;  3JCZ A;  3F7V C;  3AK3 A;  5E79 Z;  3LDC A;  3ETG A;  4JYY A;  2EBO A;  3UO3 A;  1YJN V;  1S72 V;  1N32 B;  4MVS A;  4Z1M G;  3CRR A;  1JMK C;  4B7E A;  4JYB A;  2IH3 C;  3BRC A;  1JJO A;  4AHC A;  4R8C A;  4GKJ B;  2B1I A;  2RCV A;  2P4V A;  4ZIB A;  3ABT A;  3OEE G;  1LR1 A;  4LCU C;  1YHQ V;  1M4U A;  1Q6I A;  3N27 A;  4U7N A;  4R7C A;  4PI0 A;  2UXC B;  1N0J A;  4YHH B;  3E8G A;  1V55 C;  2EIK B;  2IU3 A;  1EFR G;  2PI4 A;  2XAF A;  2CGN A;  3SJB C;  1BGY H;  1KMI Z;  3UM7 A;  1TGO A;  4EKW A;  1GH6 A;  3ASO B;  2L6L A;  2D2C B;  2H94 A;  1R1B A;  3IFX A;  1H8E G;  3TCU A;  3WFV A;  5KAI Z;  1Q6U A;  4WFB V;  1NI8 A;  4DV2 O;  4DV7 O;  4OX9 B;  4BIU A;  3E22 B;  4B3R O;  3C3S A;  3ZRV A;  3OMI B;  1FS0 G;  2LFR A;  3B8N A;  5CB4 B;  3OD4 A;  2Q7H A;  3TXQ A;  4JI8 B;  3APQ A;  4U3F H;  3JAT A;  1OCZ C;  1OCO C;  3CRQ A;  4LF6 B;  3OGC C;  4LH6 A;  3PN1 A;  3SPG A;  1OV9 A;  3ASN B;  2GUZ A;  5CN0 A;  5KHJ A;  2OTL V;  3CE2 A;  4NTW A;  1R3L C;  2CK3 G;  4L87 A;  2ODM A;  3EVK A;  3CXH F;  3Q4H B;  4X89 A;  4QGP A;  3RYF B;  4FLV A;  2WLH A;  1AR1 B;  4QE7 A;  5DED A;  4QIW F;  2ZXW B;  4TV9 A;  4MTX A;  4CC5 A;  1M56 C;  2Q7E A;  4PA6 A;  4IYI A;  2PGG A;  2EIL C;  2AHZ A;  4I0X B;  3UT5 A;  2R70 A;  2UXX A;  2QKA A;  1AP6 A;  2GBO A;  2EIM B;  1KP2 A;  3KCY A;  3OE7 G;  3FKS G;  3X2Q C;  2ITD C;  3H1L H;  1VQ9 V;  3J81 N;  3S3W A;  1NTZ H;  1COW G;  4X1I A;  1EM1 A;  5IWA B;  1XNR O;  1YJ9 V;  4TWK A;  2A3Q A;  1LUW A;  4HNA A;  1SQX H;  1I5Y A;  1SET A;  4LF9 B;  5LHH A;  3SYA A;  2XAQ A;  4NKG B;  5EIB C;  2Y0P A;  4JZ2 A;  5BY1 A;  3C3T A;  3IJ4 A;  2W6J G;  5FPR A;  4GKK B;  1JFF B;  4E2L A;  5HFM A;  2WA4 A;  3BHP A;  3GB7 C;  5KX5 A;  3RVY A;  2DWE C;  5B1B B;  4OPH A;  1Y74 B;  3SJC C;  4HYO A;  4G28 B;  4KUM A;  3LSQ A;  1S5L Z;  4P9P A;  2X6B A;  4FLW A;  1WP7 A;  2OIE A;  4F6R B;  1BMF G;  4MT8 A;  2RJZ A;  1MZE A;  2YEV B;  2CTR A;  1GTO A;  1XDC A;  3CRC A;  1N33 O;  1VQ5 V;  3HKD B;  2ZDI C;  1FFX B;  2ZM6 O;  2ZDI A;  3TJT A;  4TT3 G;  4DV6 B;  2P4K A;  3JAS A;  4JZG A;  1KKC A;  2Q4P A;  1GMG A;  5B3S C;  5D5Q A;  2P22 C;  4MTO A;  2DYS B;  4LH7 A;  2N05 A;  1SZT A;  5LA6 B;  1L1F A;  2YIA A;  3ZX6 A;  5ITZ A;  4JYA O;  4LNU B;  4MW3 A;  4P9O A;  1L8D A;  3E8H A;  1FPO A;  4DYL A;  2E5L O;  2HVK C;  1OZ0 A;  3T4D A;  1SF9 A;  4P30 A;  1BSM A;  4LFC O;  1EZV H;  1RM1 C;  3FFQ A;  4GT1 A;  5KHK A;  4JI2 O;  1GN2 A;  3MHS C;  1JCH A;  1P7B A;  2ZE8 A;  3OEH G;  1ZL8 A;  2A06 H;  1OJH A;  3IC7 A;  1W2B U;  3C90 A;  2Q67 A;  4YJ3 B;  4BR6 A;  3BAB A;  1W59 A;  3M99 B;  1VP7 A;  2WLJ A;  3ABM B;  4NXN B;  4IHJ B;  1RSO A;  1Y76 B;  2JGU A;  4UCU A;  1GAX A;  4X1Y B;  1N8R W;  3SDL A;  4B08 A;  1ZTE A;  3JAM N;  4J11 A;  2JK5 C;  3JAW A;  4WBN B;  2OCC B;  2VRZ A;  4CS2 A;  1NVP D;  1AR5 A;  1K92 A;  3JAK B;  4YHH O;  4JI3 B;  2GSM B;  2HR3 A;  5LMU O;  4CH4 A;  3D3I A;  4FZ1 A;  1Z5V A;  1P4R A;  4FIP C;  3G71 V;  2ZIO A;  2EIJ B;  5FPO A;  3JD1 A;  1YIJ V;  4CH5 A;  2V4D A;  5J2T B;  1Y66 A;  3K5N A;  1H38 A;  2ARH A;  4NTY A;  1FKA O;  1Q43 A;  5KLV H;  3ETE A;  2Z0A A;  3A2F A;  3ZRS A;  1SES A;  3ZHV A;  1N36 B;  1RP3 B;  2QDO A;  3HPL C;  5EZY B;  2QM7 A;  2ZE6 A;  1S3J A;  3AEI A;  3L71 H;  1VQ4 V;  1GN3 A;  2YC0 A;  3ZRW A;  1F4M A;  3LNM B;  1FXV A;  5GON A;  1HNZ B;  5CA0 B;  2RNB A;  3AG2 B;  4WFA V;  4KP4 A;  2DYR B;  3BY6 A;  2EZP A;  1HNX O;  4DV0 O;  1X4T A;  1GM9 A;  4FZ0 A;  1WB8 A;  3N2K B;  2BSK A;  4G27 B;  4CH6 A;  3OW2 U;  1XNQ B;  1SA0 B;  2CGO A;  1ZLZ A;  4DV1 B;  5IYZ A;  2WLI B;  4UV9 A;  4DR7 O;  3JD3 A;  3RYC B;  5IWA O;  1DF4 A;  1Z2G A;  3GWK C;  1Q5O A;  1SZX A;  3HR0 A;  5H6R A;  2JEX A;  3A8T A;  2N04 A;  1R3K C;  4DR4 O;  3T1Y O;  2EJ7 A;  5LGT A;  1VQN V;  4R6Z A;  4GX5 A;  3FYI B;  3ZHQ A;  1CPY A;  5B1N A;  1NTM H;  3CJH B;  1TUE B;  3JAR B;  3IGA C;  1NQT A;  2AXT Z;  5IYC O;  4WFE A;  2WLN A;  1XUQ A;  4ZI7 A;  4DK0 A;  4RQF A;  3QTC A;  3JAL A;  4MTF A;  1WPB A;  1M5I A;  1QU7 A;  1XHZ A;  1WA8 A;  4FFB A;  1K97 A;  3CCQ V;  3J7A U;  1AVM A;  1QBZ A;  1G4Y B;  3K0D A;  3TK1 A;  2F66 C;  3OTF A;  1VQ7 V;  3BA8 A;  1KKD A;  2QTO A;  2R9R B;  4DR2 B;  5CA1 B;  4B3R B;  2AZ0 A;  1R3I C;  2WSS G;  3ABK C;  1A32 A;  3H1J H;  4EFE A;  3B2E E;  2KB1 A;  1OCC B;  5FLX N;  3ZMT A;  4TUY B;  4UCS A;  3ZJZ A;  3FB8 C;  2HJF C;  3AG1 C;  4WFF A;  1XRE A;  1YTF D;  5BR8 O;  1TVK A;  3THO A;  1S76 D;  1Q8I A;  2YSU B;  1JOY A;  2WLK A;  1MOF A;  3ZHS A;  1GRJ A;  4U3J B;  1YCI A;  4PEL A;  3M7M X;  4FM0 A;  1NTK H;  4Z1V A;  1G8M A;  3WG7 B;  3U10 A;  3H01 A;  5EBM C;  4JI3 O;  3BPZ A;  1D2D A;  4UUJ C;  5LL6 Y;  4J80 A;  1PPJ H;  4DR3 O;  5IJ9 B;  4QPJ A;  1QHT A;  3HB3 B;  4JI7 B;  4N23 A;  5JCO C;  5KHH A;  5A9G A;  2CTQ A;  1YSC A;  5JCO A;  3RYI B;  3CCS V;  2QJ1 A;  1SQG A;  3ETD A;  1HP8 A;  4GYC B;  1OCR B;  4LF4 O;  3AK1 A;  4Q20 A;  5DM6 V;  4X62 O;  3ABL C;  1N36 O;  5EYP B;  4JGS A;  4ZOL A;  4F4L A;  2Z5U A;  3U11 A;  2XOK G;  3OUF A;  4DV4 B;  2JDI G;  1K3E A;  4PDV A;  4EB6 A;  4FM2 A;  1N33 B;  1VQL V;  1HNZ O;  2ZM6 B;  4PI2 A;  4DK1 A;  4IIJ A;  1YIT V;  1S77 D;  1VQ8 V;  5L3E A;  1MMM A;  2Y69 C;  5B1A C;  5LHG A;  3FYE B;  2QKS A;  1H2N A;  2LO1 A;  3E35 A;  1DGS A;  1NH2 D;  1WN7 A;  2E74 B;  3B40 A;  1CEZ A;  4BWA A;  3P3P A;  1SRY A;  4JTA B;  4JYA B;  1BQ0 A;  5C8Y B;  4UCT A;  1VF5 B;  3CCV V;  4O4I B;  3CWB H;  1XNQ O;  2WLL A;  5L3F A;  2ZE5 A;  5LXT A;  1R6T A;  3SR2 C;  3P3N A;  4I9Q A;  4JF3 A;  4JI2 B;  4I55 A;  2AW9 A;  2ZNI A;  3QO8 A;  3HKE A;  1ZSP A;  5HFL A;  5H9C A;  2BTQ A;  3CRM A;  5F2V O;  1P49 A;  5KUK A;  2PYJ A;  1V55 B;  1Q82 W;  2CUG A;  3TGU H;  2Q5Z A;  2IM9 A;  1N0N A;  1GN4 A;  3SJQ C;  2QM4 A;  3EHB B;  4PA3 A;  5GTH Z;  1BCC H;  5JWP A;  5LMU B;  2QR4 A;  3FB7 C;  2V1D A;  4KXR A;  3L9D A;  5KHG A;  1DLB A;  2OCH A;  1PKX A;  4FLY A;  1I0H A;  1B6Q A;  2WLM A;  4ZBM A;  3JAT B;  1L0N H;  2QM8 A;  3ZHT A; 
#chains in the Genus database with same CATH homology
 3ABL B;  4JAU A;  1AI4 A;  3CP1 A;  1OCZ B;  1M9N A;  2IH1 C;  4JAS A;  1OCO B;  3JD0 A;  2LP7 A;  3CCU V;  1GMG A;  5B3S C;  1Y4M A;  5EBW C;  4MTO A;  2DYS B;  4X8A A;  2IU0 A;  3ZMV A;  1BHA A;  1SZT A;  1L1F A;  3AG2 C;  3CPW U;  2DYR C;  4MW3 A;  4P9O A;  5KA5 A;  1E1Q G;  3E8H A;  3ZRX A;  2Y69 B;  2HVK C;  3FB5 C;  5B1A B;  1OZ0 A;  4BAY A;  1Q81 W;  3T4D A;  4P30 A;  1IXM A;  1JVM A;  1M56 B;  1K34 A;  5IY5 B;  3LSS A;  1RM1 C;  3DGE A;  4GT1 A;  4I5S A;  2EIL B;  4RO2 A;  3MHS C;  1K9M W;  1JCH A;  1BL8 A;  1AI5 A;  4N21 A;  1P7B A;  3E2E A;  2P6J A;  3MHH C;  5DN6 G;  3OEH G;  3IC7 A;  2ZR2 A;  1W2B U;  1PNM A;  4WFH A;  3X2Q B;  3D36 A;  4JAV A;  1ORQ C;  1BHB A;  2IJH A;  3NXS A;  2B5U A;  2WLL B;  4U7O A;  2Q67 A;  1YJW V;  3M99 B;  2WLJ A;  1ZWI C;  3ZN1 A;  2W6I G;  2IW5 A;  3ABM B;  4GX2 A;  4JYC A;  2PI5 A;  4R50 A;  2WLI A;  3ML0 A;  2Q69 A;  3JD4 A;  2XAS A;  4KFM A;  1K7D A;  1N8R W;  3SPH A;  4MTG A;  4J9Z B;  2JK5 C;  2WWW A;  2OCC B;  4X88 A;  1NVP D;  2JEU A;  1V54 C;  1ENV A;  1K92 A;  3FB6 C;  3SYC A;  1QR9 A;  5C93 A;  2GSM B;  2HR3 A;  3AG3 B;  1GKF A;  2ITC C;  1ROP A;  1KC8 W;  2A9H A;  1R73 A;  3D3I A;  3SYP A;  4RAI A;  1P4R A;  2LFS A;  4FIP C;  1RPO A;  3OMN B;  1HWY A;  1WPX A;  3CCR V;  3CCE V;  1VQO V;  3G4S V;  1M90 W;  1EBO A;  3G71 V;  2C2A A;  1M57 C;  1WLE A;  3ZCC A;  2EIJ B;  1NH2 B;  3DTU B;  3JD1 A;  3BEH A;  1YIJ V;  4PDM A;  2EJR A;  4MVM A;  5FL7 G;  3CCJ V;  1Y66 A;  1H38 A;  1NJI W;  2BOC C;  4RQE A;  3GWO A;  3P32 A;  3K0G A;  3ETE A;  1S0V A;  2H8P C;  2HVJ C;  1FFT B;  4XDK A;  3ZRS A;  2HG5 C;  1SES A;  3LDE A;  3HPL C;  2QM7 A;  1S3J A;  3SYQ A;  3W7U A;  3AEI A;  1K4D C;  4XDJ A;  4LC1 A;  2WPD G;  5B3S B;  1VQ4 V;  4MS2 A;  3K9A A;  3ZRW A;  1F4M A;  3LNM B;  1FXV A;  4WFG A;  4TSF G;  3AG2 B;  3PJS K;  3RBZ A;  3UKM A;  1K33 A;  1PNK A;  4WFA V;  4KP4 A;  1QLE C;  2DYR B;  3BY6 A;  4BIZ A;  1H2G A;  3K03 A;  1YTF B;  1GO3 F;  2EZP A;  5J9P C;  3W7W A;  3T1C A;  2HKO A;  2JJ1 G;  2NNU A;  1W0K G;  1RM1 B;  1AI6 A;  1MAB G;  1R3J C;  1DTO A;  1GM9 A;  3K3W A;  2ZD9 A;  4J9Y B;  5BZB A;  1OCC C;  3I55 V;  4JTC B;  1JJ2 U;  5LBQ A;  2FTK A;  3W7S A;  5L3C A;  2ZQM A;  4JTD B;  1K73 W;  4G27 B;  1JQ0 A;  2IJK A;  2GHY A;  3B8M A;  3OW2 U;  3JD2 A;  4DXW A;  4QPK A;  5L3G A;  3QO7 A;  4MVZ A;  4PDL A;  1NBM G;  5GW7 A;  3T4Z A;  2Y48 A;  2WLI B;  5KA6 A;  4UV9 A;  3W7X A;  3JD3 A;  3K04 A;  4QNH B;  1DF4 A;  1KP3 A;  1OHH G;  3F7Y C;  3ZIA G;  2X6A A;  2QE7 G;  2F43 G;  2W0F C;  4PDR A;  1K5Q A;  3T2M A;  1K5S A;  4UXN A;  5H6R A;  1F4N A;  2JEX A;  1V54 B;  2A0L A;  4FPP A;  3RVZ A;  2EZO A;  1PL0 A;  1R3K C;  3ZMS A;  2EIK C;  5LGT A;  1VQN V;  4R6Z A;  3CC2 V;  4UVC A;  3SYO A;  3WG7 C;  2DQ3 A;  3AG4 C;  2QEX V;  4GX5 A;  3ABU A;  3QNE A;  1JX9 A;  4P2Z A;  3SPJ A;  3FYI B;  3TET A;  1EZJ A;  4XDL A;  1CPY A;  1M57 B;  1NR7 A;  5CA3 A;  3VBB A;  5B1N A;  1VQ6 V;  1PNL A;  2UXN A;  2Z3Y A;  2D3O W;  3ASO C;  1TUE B;  3IGA C;  4FJC C;  1NQT A;  1GM7 A;  4QJF B;  4ZKI A;  3OM3 B;  3W7T A;  1E1R G;  5IYC O;  1Q7Y W;  2DWD C;  1AI7 A;  2JJ2 G;  4WFE A;  2WLN A;  1M1K W;  1GM8 A;  4LBE C;  5KUM A;  4GX1 A;  2M7W A;  4RUF A;  4RQF A;  3OR7 C;  2OTJ V;  1OCR C;  4MTF A;  2R9I A;  1CP9 A;  5EBL C;  1NKD A;  3B77 A;  1H8H G;  1K97 A;  2Q68 A;  3CCQ V;  4QE9 A;  1QBZ A;  1G4Y B;  4HZ3 A;  1JPX A;  1AJQ A;  3K0D A;  3TK1 A;  3OAA G;  3EFF K;  1VQ7 V;  3ZMZ A;  3ASN C;  1E79 G;  3A0R A;  2QTO A;  1KKD A;  1ARO P;  2R9R B;  1GK9 A;  3KG2 A;  4H37 A;  4GX0 A;  1SER A;  1QLE B;  5CBH A;  4YXW G;  1J95 A;  1LNQ A;  1K8A W;  4MW8 A;  1MSW D;  2BOB C;  4JPR A;  1R3I C;  4RUE A;  2WSS G;  5IDJ A;  3CD6 V;  2ZXW C;  3ABK C;  4BW5 A;  3JCZ A;  5LGU A;  1KQS U;  3K79 A;  3F7V C;  2K1E A;  1QVG U;  3OFN G;  1Q86 W;  2KB1 A;  1OCC B;  3LDC A;  3ETG A;  3ZMT A;  2EBO A;  1YJN V;  1S72 V;  4MVS A;  4Z1M G;  2EIM C;  3SPC A;  3ZJZ A;  1F51 A;  3FB8 C;  4CBC A;  4JYB A;  2IH3 C;  2HJF C;  3CC7 V;  4R8C A;  3K08 A;  2B1I A;  3AG1 C;  4WFF A;  4WCE V;  3ABT A;  3OEE G;  4OXS A;  4PA9 A;  1YTF D;  4WF9 V;  3CMA V;  1S5H C;  4LCU C;  4DO2 A;  2YSU B;  1YHQ V;  1S76 D;  3CXC U;  1JOY A;  2WLK A;  2P90 A;  3CCM V;  1MOF A;  4MVO A;  1QVF U;  4U7N A;  4R7C A;  4CZZ A;  4FK5 C;  4PEL A;  2QA4 V;  1F23 A;  3E8G A;  1NR1 A;  2OT5 A;  3VOU A;  1V55 C;  2EIK B;  5B1B C;  2IU3 A;  3QO5 A;  2X6C A;  1G8M A;  1FXK C;  1THZ A;  1EFR G;  4LP8 A;  4XBF A;  2PI4 A;  4MVQ A;  3WG7 B;  1FXK A;  3H01 A;  2WAM A;  3AG4 B;  5EBM C;  2XAF A;  2HFE C;  3R65 A;  4UUJ C;  5L3D A;  3CYO A;  3RW0 A;  3OR6 C;  3UM7 A;  1FXH A;  4QPJ A;  3LUT B;  3E8F A;  4EKW A;  3HB3 B;  3ASO B;  3OMA B;  5E1A C;  3JYC A;  4N23 A;  1I5X A;  2H94 A;  2B1G A;  3IFX A;  1H8E G;  3TCU A;  1YSC A;  3CCL V;  2EIN C;  3WFV A;  4MSW C;  3CCS V;  2YEV A;  4WFB V;  3ETD A;  4BIU A;  3ZRV A;  4UVB A;  3OMI B;  1OCR B;  1W0J G;  1QCE A;  1FS0 G;  1DF5 A;  2LFR A;  3B8N A;  4H33 A;  1RPR A;  4Q20 A;  5DM6 V;  3ABL C;  3LDD A;  1OCZ C;  4JGS A;  1OCO C;  3E83 A;  3OGC C;  4F4L A;  2Z5U A;  2XOK G;  3SPG A;  3ASN B;  3E86 A;  2DYS C;  3OUF A;  1VQP V;  5CN0 A;  4MVU A;  2JDI G;  1K3E A;  2P67 A;  4PDV A;  2OTL V;  2ATK C;  3ZN0 A;  1R3L C;  1VQL V;  2CK3 G;  2IJJ A;  4L87 A;  4I9W A;  1QLN A;  5EK0 A;  3OUS A;  3F5W C;  1YI2 V;  1AJP A;  2Q6A A;  4X89 A;  1YIT V;  1S77 D;  1VQ8 V;  5L3E A;  2WLH A;  1AR1 B;  2Y69 C;  4QE7 A;  4QIW F;  5B1A C;  2ZXW B;  3ABK B;  4MTX A;  5LHG A;  1M56 C;  2V7Q G;  3FYE B;  5H6Q A;  5IY5 C;  1UJW B;  4PA6 A;  2QKS A;  2EIL C;  3E35 A;  1K4C C;  1MG1 A;  2AHZ A;  1NH2 D;  1AJN A;  2XAG A;  1PD3 A;  2UXX A;  3E8B A;  3ZRW B;  1CEZ A;  2EIM B;  1KP2 A;  1SRY A;  1NVP B;  4JTA B;  3OE7 G;  5L3B A;  4G2K A;  3CME V;  3P30 A;  3FKS G;  2XND G;  2ITD C;  3X2Q C;  1VQ9 V;  3CC4 V;  3AG1 B;  3CCV V;  4HAM A;  1COW G;  2WLL A;  1YJ9 V;  5L3F A;  5LHI A;  4TWK A;  4GCZ A;  3ABM C;  2XAH A;  4PA4 A;  1I5Y A;  3I56 V;  1SET A;  2HLD G;  4JF3 A;  2A79 B;  3SYA A;  5LHH A;  2XAQ A;  5IYD O;  3QO8 A;  2W6J G;  2NLJ C;  5H9C A;  5HFL A;  1KEC A;  2OCC C;  4E2L A;  5HFM A;  1VQK V;  3STL C;  3GB7 C;  2DW4 A;  1R6N A;  2X0L A;  5KUK A;  1V55 B;  3RVY A;  2DWE C;  5B1B B;  2X7R B;  5CMU A;  1Q82 W;  1FXK B;  4HYO A;  2P7T C;  3G6E V;  3AG3 C;  3ZMU A;  4G28 B;  1XL4 A;  4KUM A;  3LSQ A;  4UV8 A;  5LGN A;  4UVA A;  5CBG A;  2JIZ G;  4P9P A;  2X6B A;  1QR8 A;  3STZ C;  1KD1 W;  1XL6 A;  1R6K A;  2EIJ C;  3K06 A;  4PA7 A;  2DQ0 A;  1BMF G;  4MT8 A;  3SJQ C;  3MD0 A;  3EHB B;  4PA3 A;  2MK3 A;  5CBF A;  2YEV B;  4FMT A;  1GTO A;  2EIN B;  2IJI A;  3FB7 C;  2V1D A;  1VQ5 V;  3E89 A;  2ZDI C;  4ASU G;  1DLB A;  5EC1 C;  3SPI A;  2ZDI A;  1VQM V;  1PKX A;  4TT3 G;  5IYB O;  2XAJ A;  1B6Q A;  5EC2 C;  2WLM A;  4ZBM A;  2AHY A;  2ZR3 A;  2QM8 A;  5B1O A;  4MVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...