1B6QA

Alanine 31 proline mutant of rop protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords ROP
publication title Protein plasticity to the extreme: changing the topology of a 4-alpha-helical bundle with a single amino acid substitution.
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1b6qA00
1GMGA 1GTOA 1B6QA 1PD3A 2IJJA 1NKDA 1F4MA 1RPRA 2GHYA 1RPOA 2IJHA 3K79A 1ROPA 1F4NA 2IJKA 4DO2A 2IJIA
chains in the Genus database with same CATH superfamily
3AG2B 1N8RW 5LP6A 5DEDA 2HKOA 1QCEA 3CC2V 4GX0A 2QM4A 5L3BA 4YHHB 2E75B 5KX5B 1FXKB 5CBGA 4DV7O 4IIJA 2QA4V 2XAFA 1TGOA 1UPGA 3K0DA 1VIBA 3K57A 2UU9B 4JASA 1ZTEA 4KXRA 4AI8A 3KCXA 4DK0A 3CCMV 1OCOB 3CRCA 3JAWB 1JVMA 1RP3B 3OT7A 3AG1C 4H0LB 1SQFA 3AG3C 4MW3A 2P5OA 1PPJH 4O4LA 2ITDC 3BA8A 4GUNA 3K5LA 2M7WA 3CC4V 4NXNO 4LR3A 3W7UA 1BSMA 1S77D 3J80N 1KKCA 2QWQB 2P06A 4WFHA 3FB8C 2DQ3A 3RBZA 1TVKA 1EZVH 3SPGA 1WP7A 1WAZA 5KHJA 2UUBB 2EJRA 3O65A 1YSCA 4OGQB 5EYPB 2DQ0A 3S3XA 1K34A 4LWSB 5JQGB 2E3CA 3F7YC 3LSSA 1L0NH 3HKBA 4F6EA 3L9DA 3JD3A 4JI7O 1QU7A 4NXNB 4K3AA 2Y69B 2RN9A 4ZKIA 3AK3A 4I0XB 1B06A 3K0GA 3VOUA 1BHAA 3JSLA 2E74B 2HFEC 2G38A 1NR1A 2BOCC 4EB6A 3QF7A 3HKEA 3BRCA 4LFCB 3CXHF 1ZWIC 2ZDIA 1I7FA 2BCCH 4YIPA 2QDOA 1Q6UA 3OE7G 1IBKO 3SJQC 3ZMVA 4JI4O 2ETNA 3WB0A 1N33B 3GB7C 4P2ZA 1N36B 4DO2A 5EBMC 5J9PC 1AVMA 4X1YB 4QGPA 1OCZB 1WPXA 4H37A 1IBKB 2JEXA 1P4RA 1Q3EA 1H38A 4MS2A 1XMOO 3N2GB 2ZE5A 4JI4B 3W7TA 4MSWC 3OM3B 1VP7A 4XBFA 2DOSA 4UFZA 4WF9V 3ZHSA 1FAFA 3UM7A 1B04A 4PI0A 4W4LA 1XI1A 1SZTA 3ABLB 1VQ6V 2YDEA 4TSFG 1W2BU 2AW9A 3JYCA 5E79Z 2IU0A 1Q90D 4I5SA 1XMOB 3FKSG 1LUWA 1Q86W 2F66C 4JYAB 2JK5C 5CA1A 3AG2C 1SRYA 1Q43A 4Q20A 1V54B 1VQ8V 2ZT9B 2LO1A 3CEIA 3B2EE 4GCZA 5B1AB 4Z1VA 2EZPA 3BEHA 2Q7HA 2EBOA 3TGUH 4YY3B 3UT5A 1MSWD 2XAHA 1Y67A 5JCOA 1FXKC 3SPJA 5IE9A 1ZUQA 3DSQA 2JJ2G 1Q5OA 3BHPA 4JI2B 4B3RB 4FMTA 1QQCA 2ZNJA 1HDJA 1Y66A 2UUAO 2WLHA 3CXCU 2OWOA 3HPLC 1QBZA 3SR2C 4O4LB 2Q7EA 1Z2GA 2WLJA 4LNUB 1XREA 4B3TO 1EN4A 5LHIA 3ZRWB 4X88A 3LSUA 4R8CA 4GX5A 4B7EA 2XHBA 4TT3G 1H2SB 1UJWB 2BSKA 3R65A 1K9MW 4J9YB 3ML0A 4FFBB 2P22C 3HKBB 4NKGB 4FLXA 1GK9A 3G4SV 2HEPA 1CPYA 3QO5A 3JAKB 1DF5A 2X6AA 1K97A 2BE3A 4O2AA 2NLJC 3JAMN 3M99B 5K1XA 3CRMA 2IBZH 3ASNB 2IJJA 2FTKA 4J7KA 2PF4E 4U3FH 2WA3A 1I5YA 3CCUV 4EB6B 3CRAA 1K3EA 1ZAUA 5H2FZ 3ZMZA 1XMQB 3H1JH 4QNHB 3RN4A 4O4JB 4BIZA 3H1IH 1GKFA 4LH7A 3OR6C 5GONA 3RYCA 1P49A 1WB7A 4PA4A 5DM6V 3K59A 1YTFB 1EFRG 4DW1A 1KECA 4DK1A 1AR1B 5CBHA 1BCCH 1SKVA 4IL6Z 1WA8B 4B3MO 3T1CA 1JQ0A 4DR3B 1YTFD 1HNZB 5EZYB 4NXMO 1MZEA 2AHZA 2Q7GA 4TQDA 5EIBD 1VQ5V 5KUMA 3CCQV 1BL8A 4FZ0A 2P6JA 1KB9F 1FFXB 4DR1O 2OCCB 1AI7A 5BR8O 3VQYA 2R9AA 1KQSU 3WU2Z 1Y76B 5KHGA 1YJNV 3ABLC 1OCCB 5DN6G 4GX1A 1G1XB 4NXMB 1Q82W 4MVRA 4O2BA 4ABMA 1GRJA 5BR8B 1JFFA 3H1LH 1V54C 2YXLA 3P32A 2ADQB 2GDSA 2P7TC 3GWKC 2UXNA 1Q6IA 4GKKB 2WAMA 2JIZG 2DMXA 1NQTA 5B1AC 2WLKA 1TA8A 1QLEC 2VQEB 2RDCA 2E76B 4WFEA 2Y4UA 4BW5A 3ETDA 1XDCA 3N2KA 4TV8B 1JMKC 3L71H 2B1IA 5CB4A 5EC1C 4GLXA 2EILC 1HWYA 4CS3A 3E2EA 5B1BB 2MK3A 2WLLA 2Q69A 3DC6A 5H6QA 1HNXO 1U97A 2A9HA 2YIBA 5IWAO 5H9CA 4TUYB 3T4DA 1OJHA 3L74H 1H2MA 3BVOA 4KP4A 1AI6A 4RO2A 3ABTA 2L35A 2ITCC 4LFBB 4WFBV 2FMLA 4QPJA 5L3EA 3D3IA 4OPHA 5GTHZ 3IFXA 4J10A 1SZXA 3ZEDA 1SQXH 5IWAB 4I55B 5KAFZ 1WB8A 1P7GA 1NKDA 3ZHVA 4HNAB 4HZ3A 3L70H 1IBLO 3T1YO 3BY6A 1DF4A 3TETA 3OTOB 4ZBMA 2AHYA 2CH7B 5BZBA 3ASNC 5KUKA 1YXBA 1AJNA 3E8HA 4Z2WA 2Y48A 4H44B 4UVCA 1ZL8B 3B40A 5CA0A 2GV9A 2OIGA 3OW2U 4NTWA 1PV0A 1JR9A 1IBLB 1R3IC 3T1YB 3EVKA 1GMGA 5KMGA 4JZ2A 3CSXA 4Q6GA 2HJDA 3FAVB 4DUZB 4MTFA 1M93A 2AZ2A 1H2GA 1TUBA 5B1NA 1YJWV 4PDRA 2DYRB 1RM1B 2ZINA 1QLNA 1AJPA 1XNRB 4CH4A 3G71V 4LF6O 3JD0A 5BMVB 3ZHTA 2M6YA 2A79B 3Q4HA 1BQZA 1V9PA 4X64O 2DWEC 4FZ1A 5LOVB 4JAAA 3ZMTA 2GHYA 1I94O 1QVGU 1VQNV 3CHXA 2WA4A 1MSDA 2RCVA 3ZHUA 1OCCC 1BGYH 1M57B 4O4HA 2P90A 4X64B 4ZI7A 3RYIA 3K9SA 5JJNB 2UXDO 1JFFB 3CWBH 3E35A 3ZHQA 1YF2A 4WFFA 3JARB 1K33A 1K8AW 2F93B 3GWOA 3NR7A 4MVMA 3D36A 3JASA 2GUZB 1Y4MA 3DTUB 3F5WC 5KHIA 3ZN1A 2PYJA 3OD4A 2QM8A 3RW0A 4YHHO 4GKJO 2XAJA 2EIKB 2Q67A 4X20B 4O4IA 4ZOLB 4IYIA 1KP2A 4J80A 3T1HO 1M9NA 3C3TA 3KZIZ 3UO2A 2VWKA 3JALB 1ORQC 5KHKA 1OZ0A 2UU9O 1M56B 2QKCA 3ZJZA 2ZIOA 5C8YA 1M5IA 4B08A 2F23A 4C7UA 4GKJB 1VF5B 5FNVB 1FS0G 4J9ZB 3I56V 4WFAV 4FPPA 3T1HB 5IYCO 1M90W 2OTLV 1V55B 4JI6O 4LF5B 4I4TA 5LMUO 2DWDC 3L73H 1F51A 2UUBO 4K8ZA 5F2VO 3ZX6A 2FB5A 2HP8A 4UCSA 4PA7A 5LXTA 4JI6B 4ZHQA 3UCSC 3QVNA 2O57A 3CC7V 4JV5O 5LMUB 1RSOA 5IJ9A 4RQEA 1Y6XA 1R1BA 5IY5B 2ATKC 1VF6C 4NTYA 2YEVB 1Q8IA 2R72A 3DXRA 1AB3A 4UCTA 2UXCB 4P9OA 4LBEC 5J2TA 1GAXA 3H1HH 3ETEA 4I50B 1US6A 2EX3A 2LP7A 4JV5B 4LFCO 5KLVH 1AI5A 1CEZA 1PM9A 1SQQH 3T4ZA 1OHHG 4X1KA 1S76D 2LQTA 2VS0A 1HNWB 1G4YB 2DYRC 4PI2A 4X9QA 3AEIA 3OTFA 4DV6B 1N33O 4KHPO 2CTQA 3H1KH 1MOFA 1ZLZA 4H13B 1N36O 4MTXA 2W0XA 2B9ZA 3Q4HB 4MTOA 3E86A 2KKWA 1IURA 2IM9A 4J41A 3CD6V 4D6TH 4WBNB 3K08A 1EZJA 2YIDA 2QKSA 4JI8B 4OX9B 1EN5A 4DV1B 4KHPB 2DE0X 5AG2A 5CN0A 3SYQA 1M57C 2QWOB 3A8TA 2QWRB 3NXSA 3U11A 4UB6Z 2N05A 3ZN0A 2QR4A 1YIJV 1MABG 4ZI7B 2Z3YA 1H2KA 4RUEA 1I08A 3RWRD 1GM9A 4FM2A 4DR2O 1OV9A 2JEUA 2W0FC 2JDIG 1W59A 1URFA 4PV1B 1BT8A 4JYAO 1KUQA 2Q4PA 4JYYA 3JASB 4G27B 1QR9A 3S3WA 4JTCB 4JI5B 1AILA 4DUYB 5FL7G 2RJZA 2A3QA 4OXSA 4YY3O 5IJ0B 3W7XA 5FPOA 2QTSA 4DR2B 1NU1H 4JI2O 5JJEB 4CC5A 4U3JB 5CA3A 1MG1A 1M56C 4B3RO 4FLWA 5JVDA 3ZRSA 5LP6B 3P3PA 3APQA 4PA3A 4P9PA 4MVUA 1AR5A 4IIJB 3WB2A 2E5LO 3G6EV 1FD9A 1Y74A 3RVYA 5GTIZ 1V55C 4CC6A 2L6LA 1HR0B 4CZZA 2DN9A 5BXZA 4KUMA 1H2NA 4TQFA 1N0NA 1SA0A 3CYOA 1WPBA 3BABA 1OCOC 1R6KA 1DTOA 1X4TA 3ETQA 3G67A 2XT9A 4X1IA 1SQVH 2R9RB 4CS2A 3MDSA 2E5LB 3CMEV 4EEQA 1KMIZ 5LXTB 4G2KA 2BTQA 4DR4O 3C3SA 2X6CA 4PDMA 3I55V 1RSOB 3CCJV 1TVKB 2AZ0A 2F4VO 1KD1W 5IY5C 1R3KC 1H2LA 3AG7A 2P4KA 3RYFA 2BOBC 4LP8A 2YS8A 1VQMV 5CMUA 2Y0PA 1RPOA 4UVBA 4DR4B 2W6JG 2Q5ZA 3K58A 2Y69C 3W7SA 1XMQO 2EINB 5FPRA 2F4VB 2B5UA 4DR5O 4X1KB 4F4LA 3KG2A 2DW4A 4JI1B 4N21A 1G6UA 1SQPH 3L72H 1COWG 2ZXWB 2JGUA 2Z0AA 4NTXA 1W0KG 1PL4A 1WLEA 2EZOA 3HKEB 5TISZ 2KSDA 3CPWU 4HAMA 4DR3O 2XAGA 1HNZO 4DR5B 3K9AA 2ILMA 5B5EZ 3MD0A 3TXQA 4I9WA 1QNMA 5EK0A 2DYSB 3K3WA 2CE4A 1IDSA 4XDLA 3U10A 3E22A 5IYZA 3T2MA 4JI0B 1AP5A 5H5NA 2YIAA 2HJFC 3K5NA 4EKWA 1OCZC 4Z1MG 1EN6A 2GSMB 4FLVA 1J95A 1PNKA 5GW7A 1NR7A 2YUAA 1NH2B 1XNQO 2IJHA 4JGSA 4GKKO 3JATA 2B1GA 2EULA 4MT8A 3B09A 1WJZA 2D3OW 1MA1A 5J2UA 2OCHA 4DR6B 1J5EO 4PDLA 2VQEO 3E8FA 4GZRB 1Q6HA 3ASOB 4JI3O 3WB1A 4RWUA 2ODMA 5CA1B 4NYKA 4LFAB 1P7BA 1SETA 4YJ2A 1YDXA 5LP6C 1XNQB 1R73A 5IYBO 4JYCA 3SJAC 3UT5B 3TJTA 2XTAA 1J5EB 2RNBA 2NR5A 4X89A 1IBMB 4IHJA 5LL6Y 4JI3B 4LC1A 1XQ8A 4BR6A 1Z5VA 4RQFA 3CB2A 2JGDA 5B66Z 3D8CA 2CTWA 4FLTA 3FX7A 3X2QB 4LFBO 2A7WA 2LFSA 4DV5O 2VWJA 1M1KW 2ZR3A 3FYEB 4X8AA 4BW9A 1FXVA 1SERA 3JCUZ 2YI8A 3CP1A 5LGTA 2N74A 3U0ZA 3B8NA 1JX9A 2N04A 2C2AA 1T5EA 3OTOO 2BSKB 3R66A 4JPRA 4UB8Z 4DV5B 1OCRB 1FJGB 5KX5A 4H33A 1FXKA 4QPKA 2PYLA 4PA6A 4JAVA 5JH7A 4X66O 2ZE8A 1YVWA 4LF4O 2HG5C 1VQLV 2ADPA 2Q8VA 3AK2A 3WFVA 1AP6A 1DGSA 2EINC 4O2AB 4QE9A 3LSQA 1IVSA 2CGNA 1JA8A 1UFIA 2P67A 3JAWA 3SJCC 3ZS8C 1GN2A 3DC5A 3TCUA 1A32A 4DUZO 3AG1B 5CBFA 2ZE7A 3LNMB 4X66B 2CGOA 4LF4B 3FB7C 3ZHRA 3L75H 4JTDB 2H94A 3JD1A 1XNRO 2ZDIC 1AR4A 1YZBA 1ZX3A 2LGQA 3LDEA 2QM7A 5L3CA 4MVSA 3E8BA 4B3SB 2HLDG 5GONB 3RYCB 3CCLV 1B6QA 4DR7O 2DYSC 5JJJB 3QO7A 2Y0IA 1VF7A 5EIBC 4LH6A 5EYPA 2ARHA 1IZ3A 1YITV 5KAIZ 3A0BZ 4LWSA 5IYZB 3SPCA 3AK1A 3J81N 4LF7B 1R3JC 2W6IG 3ICXA 1BQ0A 1N32B 4I0XA 5DECA 4DR7B 3CJHA 3ZRXA 4X62B 2OCCC 3OUFA 3M7MX 1YEWA 2FL4A 1D5AA 3VQWA 2HVJC 4JAUA 4KFMA 1AROP 3JATB 5LGUA 2QE7G 3CCRV 4R7CA 4O2BB 3QNEA 4JZGA 1CXZB 4MTGA 4MVQA 4BWAA 3ASOC 1YJ9V 3WG7B 1RPRA 2NNUA 3IC9A 1FFTB 4UV8A 4EFEA 4F6RA 3E89A 4X1YA 5HFLA 5JCOC 3IGAC 3STZC 1S5LZ 3CCVV 4DYLA 1NTMH 2HR3A 4CBCA 3P30A 3ETGA 1N34B 2ZNIA 1LR1A 3N2KB 4FJCC 2JGDB 1RFYA 4ICGA 5CB4B 5KA6A 3MHHC 4LF5O 1M4UA 1B3QA 4BIOA 3SGIA 5B1BC 4UUJC 3B4SA 2WLMA 5K1PA 2WLLB 2PI4A 1NZ6A 3C90A 4FM0A 2PTMA 2WWWA 1Q81W 3CCEV 4R50A 2HVKC 4ASUG 1IX9A 2Q0AA 2AGAA 1VEWA 4A5UB 3G80A 1D2DA 2H3OA 3SPIA 3TK1A 3HKCA 4G28B 4RAIA 3LUTB 1KBHA 3OR7C 3QO8A 1Q7YW 2YIBD 4XDKA 2YC0A 2VQFO 1OCRC 4DV3B 2IW5A 1PP9H 2QWPB 5LBQA 5JH7B 1NI8A 1GTOA 1U96A 2UUCO 2EJ7A 2RQ6A 1W0JG 2UXCO 3AG4B 3THOA 1N0JA 5BY1A 2R70A 2ZQMA 4DV4O 1S72V 2HHHB 3BPZA 3OEEG 5KHHA 2UXBO 3OEHG 3ABMB 3MHSC 3F7VC 4J7ZA 1VQ7V 1EM1A 2EIJB 4FK5C 2VQFB 3FFQA 3ZCCA 2GTAA 4DV7B 3SYAA 4LNUA 4UV9A 2UUCB 1HNWO 5CA0B 4I9QA 4DV6O 4R6ZA 1CP9A 3MAQA 1WNSA 4DV4B 3ZRWA 3OMIB 3ZIAG 2UXBB 1G8MA 5KMGB 2A0LA 2K1EA 3E8GA 5IT9N 1XEQA 1DK1A 2ZIMA 2F43G 2FKXA 3G6BA 3QTCA 4K35A 4FFBA 1TUBB 1NJIW 1RM1C 4JI8O 1KYOF 4OX9O 1ZSPA 4DV1O 4AHCA 1AI4A 3JAKA 5D5PA 3VQVA 2K9PA 3CJHB 1NBMG 4AILC 4QE7A 3UO3A 3SJBC 4LCUC 1KC8W 5EBLC 4N23A 1VQPV 4I7ZB 5KA5A 3I5DA 1DLBA 1XL4A 3BA9A 4JI7B 3A0RA 4J7JA 4CH5A 2OT5A 1HW7A 2JS5A 4O4HB 4UCRA 2X0LA 3RVZA 1YCIA 2YI9A 5LA6A 4O4JA 3ABKB 4JI5O 4DUYO 3RYIB 2V4DA 1QVFU 4EFBA 1SS3A 4FIPC 2AXTZ 4GT1A 1FKAO 2JRIA 1SQGA 3WG7C 4IYHA 1NS1A 1ROPA 2IJKA 2LW7A 1MMMA 3W7WA 4F6RB 4PJ0Z 1WA8A 1E79G 4J42A 3CMAV 1FYJA 4YXWG 3HKDA 5B1OA 3K03A 1F23A 5EZYA 2Q6AA 1I0HA 3KKYA 2MW2B 2OTJV 4DW0A 2EIKC 2CDYA 1FFXA 1L8DA 4O4IB 3ZRVA 2ZE6A 1JJ2U 3A2FA 2YICA 4J11A 3BFRA 1HR0O 1Y76A 3K79A 2JJ1G 2PUSA 1H8HG 1N4CA 3OGIB 4UCVA 3F5TA 5C8YB 2PI5A 1VQKV 1SF9A 2ZCEA 4K8XA 3RT3C 4IGGA 1QHTA 2PGGA 2VRZA 4CH3A 1S5HC 4DRXA 3IJ4A 3HKCB 4BIUA 2DJVA 1KKDA 4I4TB 2EIMB 4WCEV 2CUGA 4RUFA 4QIWF 1QLEB 3VBBA 2XASA 1S3JA 1SQBH 1GN3A 4X65O 3DGEA 4NB5A 1NVPB 3OMNB 3AG4C 1FXHA 4GYCB 3J7AU 2RMKB 4ZHQB 4TV8A 5D5QA 2IU3A 3ABMC 3STLC 2EIJC 2KG7A 3CRRA 5L3GA 5IJ9B 1NT2B 2EILB 1NVPD 3SYOA 3H01A 2BTOA 3LDDA 4OPAA 3ZMUA 5EC2C 2ZD9A 3BAAA 3DXRB 1FPOA 4X65B 2ZKOA 1S0VA 4JI1O 4P30A 2JS3A 4ZIBA 2CTRA 2XNDG 1R6TA 4B7KA 2WLNA 4W4KA 1L1FA 2XOKG 3M8AA 1GH6A 1XHZA 5J2TB 3JD2A 4TUYA 1K73W 4YIOA 1BHBA 2UUAB 1GM7A 3LNNA 5B3SB 2CAZC 2X7RB 2NN4A 4PA9A 1LNQA 4PELA 4B3TB 5LHGA 5FLXN 4E2LA 3EFFK 4I55A 4XDJA 1K4DC 2QEXV 4HNAA 1XL6A 4JI0O 1ENVA 2Q9LA 2ZR2A 3RYHA 2P4VA 2XAQA 1R6NA 3K5OA 1F4MA 2CH7A 2ZM6O 1MNGA 3RGBA 4TWKA 5LYJA 2OIEA 1VF6A 3D3QA 3EXAA 1XHXA 1ZL8A 2FYUH 3GVMA 3SYPA 3UQ8A 5HFMA 2V7QG 3IC7A 1BZKA 1E1RG 5LA6B 1GN6A 4FLYA 2LFRA 3ABKC 1IXBA 1GM8A 3P3NA 5LGNA 3CE2A 4BAYA 4PD4F 2ZM6B 3IAYA 4LF9O 4DR6O 4D7SA 2WPDG 3FAVA 4YJ3A 1F7YA 1VMGA 2V1DA 1QR8A 4UXNA 3E83A 1PKXA 3K06A 1TAEA 1K5QA 3FB5C 1BS3A 1EBOA 4LFAO 3D36C 4L8JA 3HKDB 5BMVA 4LF8O 1K7DA 3LDCA 1AJQA 3HR0A 3OMAB 3CCSV 2A06H 1PNMA 4LF9B 1L0LH 3QG5A 5LOVA 3ZBHA 4FFKA 1H8EG 1IBMO 3A0HZ 1NH2D 5C93A 2GBOA 2QWNB 4CS4A 4AQYO 2IH1C 2CK3G 4B3MB 4TV9A 4L87A 5JVDB 4JTAB 3OAAG 3HB3B 1THZA 4LF8B 3SYCA 3TXSA 2QSAA 2WLIA 2Q0OC 4K0KO 5ITZA 4DR1B 1Z5WA 1KP3A 2QGNA 1Y74B 2F95B 2Q73A 3OGCC 1K5SA 3K04A 4AQYB 4DRXB 3JARA 1K4CC 1SA0B 3FYIB 3VQXA 1MZFA 2EIMC 4MW8A 1HP8A 2YSUB 3CX5F 2GUZA 4X1IB 3ABUA 1YI2V 5L3DA 4DXWA 4K0KB 4E4EA 1JJOA 2UXXA 3RFRA 1FJGO 2QKAA 4X20A 4ZOLA 2BTQB 3KCYA 5EBWC 2KG7B 1K92A 3JALA 4HYOA 1WN7A 3B77A 4MVZA 1S5JA 4IT5A 3RYFB 1O9HA 2Z5UA 4FM1A 1NTKH 5FNVA 1BMFG 3OFNG 2LJ2A 1LUVA 4FLZA 2F1MA 4PDVA 2Y4TA 4FVMA 1R3LC 1O9GA 5B3SC 1JOYA 2PZSA 4B3SO 1YHQV 1XOUA 3K5MA 1PL0A 2QJ1A 3ZMSA 1HNXB 5H6RA 3AG3B 2X6BA 2ZXWC 3N27A 5LHHA 4NR1A 4FLUA 1JPXA 3O9OA 3JSNA 4U7OA 1XBLA 2LW1A 3RYHB 4QJFB 5L3FA 2YXHA 1XUQA 4LF7O 2XUMA 4HBNA 1F4NA 1N32O 5LYJB 3BCCH 4X62O 3H9VA 2YEVA 4TOIA 3FB6C 4JYBA 2Q68A 1BE3H 1VQ4V 1GO3F 3PN1A 1SESA 2KQXA 3FD9A 5JQGA 3E22B 2CTPA 2PY5A 5LMNO 4I50A 4UVAA 4UCUA 2OYQA 1VQ9V 4KL1A 4YJ3B 1VARA 2QTOA 3JCZA 1TUEB 1D5NA 5A2QN 4GX2A 4JF3A 4U7NA 1E1QG 2WSSG 3EHBB 2KB1A 3UKMA 5LMNB 5A9GA 5J2UB 4DV2O 1NTZH 2JVDA 1VQOV 1XILA 4WFGA 1IXMA 1I5XA 4CH6A 1N34O 4WBNA 2D2CB 1KU9A 4D7TA 4TV9B 2YXYA 4YJ2B 1SC5B 2IJIA 4LF6B 2LGWA 5JWPA 1X59A 2WLIB 4DV2B 4PHZA 5ITZB 3CRQA 3B8MA 1P84F 2H8PC 1I94B 3JD4A 4IHJB 3N2GA 5IYDO 3PJSK 2R9IA 1PD3A 3CS5A 3SDLA 4DV0O 1JCHA 2IH3C 1GN4A 1PNLA 2GTSA 3X2QC 4NVPA 5IDJA 4UCOA 3OUSA 2UXDB 4DV3O 3APOA 5IJ0A 4MVOA 1WP8A 3SPHA 4U3JA 5E1AC 4DV0B 2HHHO
chains in the Genus database with same CATH topology
3AG2B 4I9WA 2Q6AA 5EK0A 2DYSB 1NKDA 3K3WA 1N8RW 4HZ3A 2HKOA 1QCEA 3CC2V 2OTJV 3BY6A 4XDLA 2EIKC 4GX0A 1DF4A 5L3BA 3TETA 3ZRVA 4ZBMA 1JJ2U 2AHYA 3T2MA 1FXKB 5CBGA 5BZBA 2HJFC 3ASNC 4EKWA 1OCZC 2QA4V 2XAFA 5KUKA 1AJNA 3K79A 2JJ1G 3E8HA 3K0DA 4Z1MG 2GSMB 1H8HG 2Y48A 4UVCA 1J95A 4JASA 2PI5A 1PNKA 3OW2U 1VQKV 3CCMV 1OCOB 1R3IC 1JVMA 5GW7A 1NR7A 1GMGA 3AG1C 1NH2B 2IJHA 3AG3C 4MW3A 4JGSA 1S5HC 2B1GA 4MT8A 2ITDC 4MTFA 4BIUA 2D3OW 1KKDA 1H2GA 2EIMB 2M7WA 5B1NA 4RUFA 4PDLA 4WCEV 1YJWV 3CC4V 4PDRA 2DYRB 3E8FA 3W7UA 1RM1B 4QIWF 1S77D 1QLEB 1AJPA 1QLNA 3VBBA 3ASOB 2XASA 4WFHA 3G71V 1S3JA 2DQ3A 3FB8C 3RBZA 3JD0A 3SPGA 1P7BA 1SETA 3DGEA 1NVPB 2EJRA 3OMNB 1YSCA 1FXHA 3AG4C 1R73A 2A79B 5IYBO 2DQ0A 4JYCA 2DWEC 1K34A 3F7YC 3ZMTA 3LSSA 2GHYA 2IU3A 3ABMC 3STLC 2EIJC 3JD3A 5L3GA 1QVGU 2EILB 1VQNV 1NVPD 4X89A 3SYOA 2Y69B 3H01A 3LDDA 4ZKIA 1OCCC 4LC1A 3ZMUA 4RQFA 5EC2C 2ZD9A 3K0GA 3VOUA 1S0VA 1M57B 1BHAA 4P30A 2XNDG 2WLNA 1L1FA 2P90A 2XOKG 2HFEC 3JD2A 1K73W 1NR1A 3E35A 2BOCC 3X2QB 4WFFA 1BHBA 1GM7A 2LFSA 5B3SB 2X7RB 1K33A 2ZDIA 1ZWIC 1M1KW 2ZR3A 1K8AW 4PA9A 3FYEB 1LNQA 3GWOA 3OE7G 4X8AA 3SJQC 4MVMA 3ZMVA 3D36A 4PELA 1FXVA 5LHGA 1SERA 1Y4MA 3DTUB 3F5WC 3CP1A 4E2LA 5LGTA 3ZN1A 3B8NA 3EFFK 1JX9A 4XDJA 2QM8A 2C2AA 1K4DC 2QEXV 3RW0A 1XL6A 1ENVA 2XAJA 2ZR2A 3GB7C 2EIKB 2Q67A 4P2ZA 4JPRA 4DO2A 5EBMC 1KP2A 1OCRB 5J9PC 2XAQA 1R6NA 4H33A 1M9NA 1FXKA 1F4MA 4QPKA 4PA6A 4JAVA 1OCZB 1WPXA 4H37A 4TWKA 1ORQC 1OZ0A 2HG5C 1M56B 2JEXA 1P4RA 1VQLV 3ZJZA 1H38A 4MS2A 3WFVA 2EINC 4QE9A 3LSQA 3W7TA 3SYPA 4MSWC 5HFMA 3OM3B 2V7QG 3IC7A 4XBFA 1E1RG 2P67A 1FS0G 4WF9V 2LFRA 3ABKC 4J9ZB 3UM7A 3I56V 4WFAV 3TCUA 4FPPA 1GM8A 3AG1B 5IYCO 1M90W 1SZTA 5LGNA 2OTLV 5CBFA 4BAYA 3ABLB 1V55B 3LNMB 1VQ6V 2WPDG 4TSFG 2V1DA 1QR8A 3FB7C 1W2BU 3JYCA 3E83A 1PKXA 3K06A 4JTDB 4UXNA 2IU0A 2H94A 1K5QA 3JD1A 2DWDC 3FB5C 3FKSG 4I5SA 2ZDIC 3LDEA 2QM7A 1F51A 1EBOA 1Q86W 5L3CA 4MVSA 3E8BA 2HLDG 3CCLV 2JK5C 1B6QA 1K7DA 1SRYA 3AG2C 1AJQA 3LDCA 3OMAB 2DYSC 1V54B 4Q20A 3CCSV 1VQ8V 3QO7A 1PNMA 4PA7A 1YITV 4GCZA 5B1AB 2EZPA 3BEHA 2EBOA 3CC7V 1MSWD 1H8EG 2XAHA 3SPCA 3SPJA 1FXKC 5C93A 1NH2D 4RQEA 2JJ2G 2IH1C 2CK3G 1R3JC 2W6IG 5IY5B 4L87A 2ATKC 2YEVB 4JTAB 3OAAG 3HB3B 1THZA 3ZRXA 4FMTA 3SYCA 2OCCC 4P9OA 2WLIA 3OUFA 1Y66A 4LBEC 2HVJC 4JAUA 1KP3A 4KFMA 3ETEA 2WLHA 3CXCU 2LP7A 3HPLC 1QBZA 3OGCC 1K5SA 1AROP 1AI5A 1CEZA 3K04A 5LGUA 2QE7G 2WLJA 1K4CC 3T4ZA 3CCRV 4R7CA 3FYIB 1OHHG 2EIMC 4MW8A 1S76D 5LHIA 3QNEA 4MTGA 1G4YB 4MVQA 2DYRC 2YSUB 4X88A 3AEIA 3ZRWB 4R8CA 4GX5A 3ASOC 4TT3G 1YJ9V 3ABUA 1YI2V 5L3DA 4DXWA 1MOFA 1UJWB 3WG7B 2UXXA 3R65A 4MTXA 1K9MW 1RPRA 4J9YB 2NNUA 3ML0A 1FFTB 4MTOA 4UV8A 3E86A 3E89A 5HFLA 5EBWC 3IGAC 1K92A 3STZC 3CD6V 1GK9A 3CCVV 3G4SV 3K08A 1EZJA 4HYOA 1CPYA 2QKSA 3QO5A 1DF5A 3B77A 2X6AA 2HR3A 1K97A 4MVZA 4CBCA 3P30A 3ETGA 2NLJC 3M99B 5CN0A 4FJCC 1M57C 3SYQA 2Z5UA 3NXSA 1BMFG 3ASNB 3ZN0A 3OFNG 5KA6A 1YIJV 1MABG 2IJJA 3MHHC 2FTKA 2Z3YA 4RUEA 1I5YA 3CCUV 5B1BC 4UUJC 4PDVA 2WLMA 1R3LC 1K3EA 5B3SC 2WLLB 2PI4A 1JOYA 1GM9A 3ZMZA 2JEUA 2W0FC 2WWWA 1Q81W 2JDIG 3CCEV 4R50A 4QNHB 1YHQV 2HVKC 4BIZA 4ASUG 1PL0A 1GKFA 3ZMSA 4G27B 3OR6C 1QR9A 5H6RA 3AG3B 2X6BA 2ZXWC 4JTCB 4PA4A 3SPIA 3TK1A 5LHHA 5FL7G 5DM6V 1YTFB 1JPXA 4G28B 1EFRG 4OXSA 3LUTB 4RAIA 4U7OA 1KECA 3OR7C 3QO8A 4QJFB 5L3FA 1AR1B 1Q7YW 5CBHA 4XDKA 3W7XA 1OCRC 2IW5A 1F4NA 5LBQA 3T1CA 1JQ0A 1GTOA 5CA3A 1YTFD 1MG1A 1M56C 1W0JG 2AHZA 3AG4B 3ZRSA 1VQ5V 5KUMA 2YEVA 3CCQV 3FB6C 4JYBA 1BL8A 2Q68A 1VQ4V 2P6JA 1GO3F 2ZQMA 4PA3A 4P9PA 1S72V 1SESA 3OEEG 2OCCB 1AI7A 3OEHG 4MVUA 3ABMB 3MHSC 3F7VC 1VQ7V 1KQSU 2EIJB 4FK5C 3ZCCA 4UVAA 3G6EV 3RVYA 1VQ9V 1YJNV 3ABLC 1V55C 3SYAA 1OCCB 4CZZA 4UV9A 5DN6G 2QTOA 4GX1A 4KUMA 1Q82W 3JCZA 1TUEB 3CYOA 4MVRA 1OCOC 1R6KA 4R6ZA 1DTOA 1CP9A 3ZRWA 3OMIB 3ZIAG 1G8MA 4GX2A 2A0LA 2K1EA 3E8GA 4JF3A 4U7NA 1E1QG 2R9RB 2WSSG 3EHBB 2KB1A 3UKMA 2F43G 1V54C 3CMEV 3P32A 2P7TC 2UXNA 4G2KA 2WAMA 2JIZG 1NQTA 5B1AC 1VQOV 2X6CA 4PDMA 2WLKA 3I55V 1NJIW 1RM1C 1QLEC 4WFGA 1IXMA 1I5XA 3CCJV 1AI4A 1KD1W 4WFEA 5IY5C 1R3KC 2IJIA 4BW5A 3ETDA 2BOBC 4LP8A 1NBMG 4QE7A 1VQMV 2WLIB 2B1IA 5CMUA 5EC1C 4LCUC 1KC8W 5EBLC 1RPOA 2EILC 4N23A 4UVBA 3B8MA 1VQPV 5KA5A 2W6JG 1HWYA 2H8PC 2Y69C 3JD4A 3W7SA 1DLBA 1XL4A 2EINB 5IYDO 3A0RA 3PJSK 5B1BB 3E2EA 2R9IA 2MK3A 2OT5A 2B5UA 1PD3A 2WLLA 2Q69A 5H6QA 2X0LA 3RVZA 4F4LA 2A9HA 3KG2A 2DW4A 3ABKB 1JCHA 4N21A 5H9CA 3T4DA 2IH3C 1PNLA 1COWG 1QVFU 2ZXWB 3X2QC 4FIPC 4GT1A 5IDJA 1W0KG 1WLEA 3OUSA 4KP4A 3WG7C 1AI6A 4RO2A 1ROPA 2EZOA 2IJKA 3ABTA 2ITCC 4WFBV 3CPWU 3W7WA 4HAMA 4QPJA 2XAGA 5L3EA 3D3IA 1E79G 3IFXA 3CMAV 3K9AA 4YXWG 4MVOA 3SPHA 5B1OA 3K03A 5E1AC 3MD0A 1F23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMG A;  1GTO A;  1B6Q A;  1PD3 A;  2IJJ A;  1NKD A;  1F4M A;  1RPR A;  2GHY A;  1RPO A;  2IJH A;  3K79 A;  1ROP A;  1F4N A;  2IJK A;  4DO2 A;  2IJI A; 
#chains in the Genus database with same CATH topology
 3AG2 B;  1N8R W;  5LP6 A;  5DED A;  2HKO A;  1QCE A;  3CC2 V;  4GX0 A;  2QM4 A;  5L3B A;  4YHH B;  2E75 B;  5KX5 B;  1FXK B;  5CBG A;  4DV7 O;  4IIJ A;  2QA4 V;  2XAF A;  1TGO A;  1UPG A;  3K0D A;  1VIB A;  3K57 A;  2UU9 B;  4JAS A;  1ZTE A;  4KXR A;  4AI8 A;  3KCX A;  4DK0 A;  3CCM V;  1OCO B;  3CRC A;  3JAW B;  1JVM A;  1RP3 B;  3OT7 A;  3AG1 C;  4H0L B;  1SQF A;  3AG3 C;  4MW3 A;  2P5O A;  1PPJ H;  4O4L A;  2ITD C;  3BA8 A;  4GUN A;  3K5L A;  2M7W A;  3CC4 V;  4NXN O;  4LR3 A;  3W7U A;  1BSM A;  1S77 D;  3J80 N;  1KKC A;  2QWQ B;  2P06 A;  4WFH A;  3FB8 C;  2DQ3 A;  3RBZ A;  1TVK A;  1EZV H;  3SPG A;  1WP7 A;  1WAZ A;  5KHJ A;  2UUB B;  2EJR A;  3O65 A;  1YSC A;  4OGQ B;  5EYP B;  2DQ0 A;  3S3X A;  1K34 A;  4LWS B;  5JQG B;  2E3C A;  3F7Y C;  3LSS A;  1L0N H;  3HKB A;  4F6E A;  3L9D A;  3JD3 A;  4JI7 O;  1QU7 A;  4NXN B;  4K3A A;  2Y69 B;  2RN9 A;  4ZKI A;  3AK3 A;  4I0X B;  1B06 A;  3K0G A;  3VOU A;  1BHA A;  3JSL A;  2E74 B;  2HFE C;  2G38 A;  1NR1 A;  2BOC C;  4EB6 A;  3QF7 A;  3HKE A;  3BRC A;  4LFC B;  3CXH F;  1ZWI C;  2ZDI A;  1I7F A;  2BCC H;  4YIP A;  2QDO A;  1Q6U A;  3OE7 G;  1IBK O;  3SJQ C;  3ZMV A;  4JI4 O;  2ETN A;  3WB0 A;  1N33 B;  3GB7 C;  4P2Z A;  1N36 B;  4DO2 A;  5EBM C;  5J9P C;  1AVM A;  4X1Y B;  4QGP A;  1OCZ B;  1WPX A;  4H37 A;  1IBK B;  2JEX A;  1P4R A;  1Q3E A;  1H38 A;  4MS2 A;  1XMO O;  3N2G B;  2ZE5 A;  4JI4 B;  3W7T A;  4MSW C;  3OM3 B;  1VP7 A;  4XBF A;  2DOS A;  4UFZ A;  4WF9 V;  3ZHS A;  1FAF A;  3UM7 A;  1B04 A;  4PI0 A;  4W4L A;  1XI1 A;  1SZT A;  3ABL B;  1VQ6 V;  2YDE A;  4TSF G;  1W2B U;  2AW9 A;  3JYC A;  5E79 Z;  2IU0 A;  1Q90 D;  4I5S A;  1XMO B;  3FKS G;  1LUW A;  1Q86 W;  2F66 C;  4JYA B;  2JK5 C;  5CA1 A;  3AG2 C;  1SRY A;  1Q43 A;  4Q20 A;  1V54 B;  1VQ8 V;  2ZT9 B;  2LO1 A;  3CEI A;  3B2E E;  4GCZ A;  5B1A B;  4Z1V A;  2EZP A;  3BEH A;  2Q7H A;  2EBO A;  3TGU H;  4YY3 B;  3UT5 A;  1MSW D;  2XAH A;  1Y67 A;  5JCO A;  1FXK C;  3SPJ A;  5IE9 A;  1ZUQ A;  3DSQ A;  2JJ2 G;  1Q5O A;  3BHP A;  4JI2 B;  4B3R B;  4FMT A;  1QQC A;  2ZNJ A;  1HDJ A;  1Y66 A;  2UUA O;  2WLH A;  3CXC U;  2OWO A;  3HPL C;  1QBZ A;  3SR2 C;  4O4L B;  2Q7E A;  1Z2G A;  2WLJ A;  4LNU B;  1XRE A;  4B3T O;  1EN4 A;  5LHI A;  3ZRW B;  4X88 A;  3LSU A;  4R8C A;  4GX5 A;  4B7E A;  2XHB A;  4TT3 G;  1H2S B;  1UJW B;  2BSK A;  3R65 A;  1K9M W;  4J9Y B;  3ML0 A;  4FFB B;  2P22 C;  3HKB B;  4NKG B;  4FLX A;  1GK9 A;  3G4S V;  2HEP A;  1CPY A;  3QO5 A;  3JAK B;  1DF5 A;  2X6A A;  1K97 A;  2BE3 A;  4O2A A;  2NLJ C;  3JAM N;  3M99 B;  5K1X A;  3CRM A;  2IBZ H;  3ASN B;  2IJJ A;  2FTK A;  4J7K A;  2PF4 E;  4U3F H;  2WA3 A;  1I5Y A;  3CCU V;  4EB6 B;  3CRA A;  1K3E A;  1ZAU A;  5H2F Z;  3ZMZ A;  1XMQ B;  3H1J H;  4QNH B;  3RN4 A;  4O4J B;  4BIZ A;  3H1I H;  1GKF A;  4LH7 A;  3OR6 C;  5GON A;  3RYC A;  1P49 A;  1WB7 A;  4PA4 A;  5DM6 V;  3K59 A;  1YTF B;  1EFR G;  4DW1 A;  1KEC A;  4DK1 A;  1AR1 B;  5CBH A;  1BCC H;  1SKV A;  4IL6 Z;  1WA8 B;  4B3M O;  3T1C A;  1JQ0 A;  4DR3 B;  1YTF D;  1HNZ B;  5EZY B;  4NXM O;  1MZE A;  2AHZ A;  2Q7G A;  4TQD A;  5EIB D;  1VQ5 V;  5KUM A;  3CCQ V;  1BL8 A;  4FZ0 A;  2P6J A;  1KB9 F;  1FFX B;  4DR1 O;  2OCC B;  1AI7 A;  5BR8 O;  3VQY A;  2R9A A;  1KQS U;  3WU2 Z;  1Y76 B;  5KHG A;  1YJN V;  3ABL C;  1OCC B;  5DN6 G;  4GX1 A;  1G1X B;  4NXM B;  1Q82 W;  4MVR A;  4O2B A;  4ABM A;  1GRJ A;  5BR8 B;  1JFF A;  3H1L H;  1V54 C;  2YXL A;  3P32 A;  2ADQ B;  2GDS A;  2P7T C;  3GWK C;  2UXN A;  1Q6I A;  4GKK B;  2WAM A;  2JIZ G;  2DMX A;  1NQT A;  5B1A C;  2WLK A;  1TA8 A;  1QLE C;  2VQE B;  2RDC A;  2E76 B;  4WFE A;  2Y4U A;  4BW5 A;  3ETD A;  1XDC A;  3N2K A;  4TV8 B;  1JMK C;  3L71 H;  2B1I A;  5CB4 A;  5EC1 C;  4GLX A;  2EIL C;  1HWY A;  4CS3 A;  3E2E A;  5B1B B;  2MK3 A;  2WLL A;  2Q69 A;  3DC6 A;  5H6Q A;  1HNX O;  1U97 A;  2A9H A;  2YIB A;  5IWA O;  5H9C A;  4TUY B;  3T4D A;  1OJH A;  3L74 H;  1H2M A;  3BVO A;  4KP4 A;  1AI6 A;  4RO2 A;  3ABT A;  2L35 A;  2ITC C;  4LFB B;  4WFB V;  2FML A;  4QPJ A;  5L3E A;  3D3I A;  4OPH A;  5GTH Z;  3IFX A;  4J10 A;  1SZX A;  3ZED A;  1SQX H;  5IWA B;  4I55 B;  5KAF Z;  1WB8 A;  1P7G A;  1NKD A;  3ZHV A;  4HNA B;  4HZ3 A;  3L70 H;  1IBL O;  3T1Y O;  3BY6 A;  1DF4 A;  3TET A;  3OTO B;  4ZBM A;  2AHY A;  2CH7 B;  5BZB A;  3ASN C;  5KUK A;  1YXB A;  1AJN A;  3E8H A;  4Z2W A;  2Y48 A;  4H44 B;  4UVC A;  1ZL8 B;  3B40 A;  5CA0 A;  2GV9 A;  2OIG A;  3OW2 U;  4NTW A;  1PV0 A;  1JR9 A;  1IBL B;  1R3I C;  3T1Y B;  3EVK A;  1GMG A;  5KMG A;  4JZ2 A;  3CSX A;  4Q6G A;  2HJD A;  3FAV B;  4DUZ B;  4MTF A;  1M93 A;  2AZ2 A;  1H2G A;  1TUB A;  5B1N A;  1YJW V;  4PDR A;  2DYR B;  1RM1 B;  2ZIN A;  1QLN A;  1AJP A;  1XNR B;  4CH4 A;  3G71 V;  4LF6 O;  3JD0 A;  5BMV B;  3ZHT A;  2M6Y A;  2A79 B;  3Q4H A;  1BQZ A;  1V9P A;  4X64 O;  2DWE C;  4FZ1 A;  5LOV B;  4JAA A;  3ZMT A;  2GHY A;  1I94 O;  1QVG U;  1VQN V;  3CHX A;  2WA4 A;  1MSD A;  2RCV A;  3ZHU A;  1OCC C;  1BGY H;  1M57 B;  4O4H A;  2P90 A;  4X64 B;  4ZI7 A;  3RYI A;  3K9S A;  5JJN B;  2UXD O;  1JFF B;  3CWB H;  3E35 A;  3ZHQ A;  1YF2 A;  4WFF A;  3JAR B;  1K33 A;  1K8A W;  2F93 B;  3GWO A;  3NR7 A;  4MVM A;  3D36 A;  3JAS A;  2GUZ B;  1Y4M A;  3DTU B;  3F5W C;  5KHI A;  3ZN1 A;  2PYJ A;  3OD4 A;  2QM8 A;  3RW0 A;  4YHH O;  4GKJ O;  2XAJ A;  2EIK B;  2Q67 A;  4X20 B;  4O4I A;  4ZOL B;  4IYI A;  1KP2 A;  4J80 A;  3T1H O;  1M9N A;  3C3T A;  3KZI Z;  3UO2 A;  2VWK A;  3JAL B;  1ORQ C;  5KHK A;  1OZ0 A;  2UU9 O;  1M56 B;  2QKC A;  3ZJZ A;  2ZIO A;  5C8Y A;  1M5I A;  4B08 A;  2F23 A;  4C7U A;  4GKJ B;  1VF5 B;  5FNV B;  1FS0 G;  4J9Z B;  3I56 V;  4WFA V;  4FPP A;  3T1H B;  5IYC O;  1M90 W;  2OTL V;  1V55 B;  4JI6 O;  4LF5 B;  4I4T A;  5LMU O;  2DWD C;  3L73 H;  1F51 A;  2UUB O;  4K8Z A;  5F2V O;  3ZX6 A;  2FB5 A;  2HP8 A;  4UCS A;  4PA7 A;  5LXT A;  4JI6 B;  4ZHQ A;  3UCS C;  3QVN A;  2O57 A;  3CC7 V;  4JV5 O;  5LMU B;  1RSO A;  5IJ9 A;  4RQE A;  1Y6X A;  1R1B A;  5IY5 B;  2ATK C;  1VF6 C;  4NTY A;  2YEV B;  1Q8I A;  2R72 A;  3DXR A;  1AB3 A;  4UCT A;  2UXC B;  4P9O A;  4LBE C;  5J2T A;  1GAX A;  3H1H H;  3ETE A;  4I50 B;  1US6 A;  2EX3 A;  2LP7 A;  4JV5 B;  4LFC O;  5KLV H;  1AI5 A;  1CEZ A;  1PM9 A;  1SQQ H;  3T4Z A;  1OHH G;  4X1K A;  1S76 D;  2LQT A;  2VS0 A;  1HNW B;  1G4Y B;  2DYR C;  4PI2 A;  4X9Q A;  3AEI A;  3OTF A;  4DV6 B;  1N33 O;  4KHP O;  2CTQ A;  3H1K H;  1MOF A;  1ZLZ A;  4H13 B;  1N36 O;  4MTX A;  2W0X A;  2B9Z A;  3Q4H B;  4MTO A;  3E86 A;  2KKW A;  1IUR A;  2IM9 A;  4J41 A;  3CD6 V;  4D6T H;  4WBN B;  3K08 A;  1EZJ A;  2YID A;  2QKS A;  4JI8 B;  4OX9 B;  1EN5 A;  4DV1 B;  4KHP B;  2DE0 X;  5AG2 A;  5CN0 A;  3SYQ A;  1M57 C;  2QWO B;  3A8T A;  2QWR B;  3NXS A;  3U11 A;  4UB6 Z;  2N05 A;  3ZN0 A;  2QR4 A;  1YIJ V;  1MAB G;  4ZI7 B;  2Z3Y A;  1H2K A;  4RUE A;  1I08 A;  3RWR D;  1GM9 A;  4FM2 A;  4DR2 O;  1OV9 A;  2JEU A;  2W0F C;  2JDI G;  1W59 A;  1URF A;  4PV1 B;  1BT8 A;  4JYA O;  1KUQ A;  2Q4P A;  4JYY A;  3JAS B;  4G27 B;  1QR9 A;  3S3W A;  4JTC B;  4JI5 B;  1AIL A;  4DUY B;  5FL7 G;  2RJZ A;  2A3Q A;  4OXS A;  4YY3 O;  5IJ0 B;  3W7X A;  5FPO A;  2QTS A;  4DR2 B;  1NU1 H;  4JI2 O;  5JJE B;  4CC5 A;  4U3J B;  5CA3 A;  1MG1 A;  1M56 C;  4B3R O;  4FLW A;  5JVD A;  3ZRS A;  5LP6 B;  3P3P A;  3APQ A;  4PA3 A;  4P9P A;  4MVU A;  1AR5 A;  4IIJ B;  3WB2 A;  2E5L O;  3G6E V;  1FD9 A;  1Y74 A;  3RVY A;  5GTI Z;  1V55 C;  4CC6 A;  2L6L A;  1HR0 B;  4CZZ A;  2DN9 A;  5BXZ A;  4KUM A;  1H2N A;  4TQF A;  1N0N A;  1SA0 A;  3CYO A;  1WPB A;  3BAB A;  1OCO C;  1R6K A;  1DTO A;  1X4T A;  3ETQ A;  3G67 A;  2XT9 A;  4X1I A;  1SQV H;  2R9R B;  4CS2 A;  3MDS A;  2E5L B;  3CME V;  4EEQ A;  1KMI Z;  5LXT B;  4G2K A;  2BTQ A;  4DR4 O;  3C3S A;  2X6C A;  4PDM A;  3I55 V;  1RSO B;  3CCJ V;  1TVK B;  2AZ0 A;  2F4V O;  1KD1 W;  5IY5 C;  1R3K C;  1H2L A;  3AG7 A;  2P4K A;  3RYF A;  2BOB C;  4LP8 A;  2YS8 A;  1VQM V;  5CMU A;  2Y0P A;  1RPO A;  4UVB A;  4DR4 B;  2W6J G;  2Q5Z A;  3K58 A;  2Y69 C;  3W7S A;  1XMQ O;  2EIN B;  5FPR A;  2F4V B;  2B5U A;  4DR5 O;  4X1K B;  4F4L A;  3KG2 A;  2DW4 A;  4JI1 B;  4N21 A;  1G6U A;  1SQP H;  3L72 H;  1COW G;  2ZXW B;  2JGU A;  2Z0A A;  4NTX A;  1W0K G;  1PL4 A;  1WLE A;  2EZO A;  3HKE B;  5TIS Z;  2KSD A;  3CPW U;  4HAM A;  4DR3 O;  2XAG A;  1HNZ O;  4DR5 B;  3K9A A;  2ILM A;  5B5E Z;  3MD0 A;  3TXQ A;  4I9W A;  1QNM A;  5EK0 A;  2DYS B;  3K3W A;  2CE4 A;  1IDS A;  4XDL A;  3U10 A;  3E22 A;  5IYZ A;  3T2M A;  4JI0 B;  1AP5 A;  5H5N A;  2YIA A;  2HJF C;  3K5N A;  4EKW A;  1OCZ C;  4Z1M G;  1EN6 A;  2GSM B;  4FLV A;  1J95 A;  1PNK A;  5GW7 A;  1NR7 A;  2YUA A;  1NH2 B;  1XNQ O;  2IJH A;  4JGS A;  4GKK O;  3JAT A;  2B1G A;  2EUL A;  4MT8 A;  3B09 A;  1WJZ A;  2D3O W;  1MA1 A;  5J2U A;  2OCH A;  4DR6 B;  1J5E O;  4PDL A;  2VQE O;  3E8F A;  4GZR B;  1Q6H A;  3ASO B;  4JI3 O;  3WB1 A;  4RWU A;  2ODM A;  5CA1 B;  4NYK A;  4LFA B;  1P7B A;  1SET A;  4YJ2 A;  1YDX A;  5LP6 C;  1XNQ B;  1R73 A;  5IYB O;  4JYC A;  3SJA C;  3UT5 B;  3TJT A;  2XTA A;  1J5E B;  2RNB A;  2NR5 A;  4X89 A;  1IBM B;  4IHJ A;  5LL6 Y;  4JI3 B;  4LC1 A;  1XQ8 A;  4BR6 A;  1Z5V A;  4RQF A;  3CB2 A;  2JGD A;  5B66 Z;  3D8C A;  2CTW A;  4FLT A;  3FX7 A;  3X2Q B;  4LFB O;  2A7W A;  2LFS A;  4DV5 O;  2VWJ A;  1M1K W;  2ZR3 A;  3FYE B;  4X8A A;  4BW9 A;  1FXV A;  1SER A;  3JCU Z;  2YI8 A;  3CP1 A;  5LGT A;  2N74 A;  3U0Z A;  3B8N A;  1JX9 A;  2N04 A;  2C2A A;  1T5E A;  3OTO O;  2BSK B;  3R66 A;  4JPR A;  4UB8 Z;  4DV5 B;  1OCR B;  1FJG B;  5KX5 A;  4H33 A;  1FXK A;  4QPK A;  2PYL A;  4PA6 A;  4JAV A;  5JH7 A;  4X66 O;  2ZE8 A;  1YVW A;  4LF4 O;  2HG5 C;  1VQL V;  2ADP A;  2Q8V A;  3AK2 A;  3WFV A;  1AP6 A;  1DGS A;  2EIN C;  4O2A B;  4QE9 A;  3LSQ A;  1IVS A;  2CGN A;  1JA8 A;  1UFI A;  2P67 A;  3JAW A;  3SJC C;  3ZS8 C;  1GN2 A;  3DC5 A;  3TCU A;  1A32 A;  4DUZ O;  3AG1 B;  5CBF A;  2ZE7 A;  3LNM B;  4X66 B;  2CGO A;  4LF4 B;  3FB7 C;  3ZHR A;  3L75 H;  4JTD B;  2H94 A;  3JD1 A;  1XNR O;  2ZDI C;  1AR4 A;  1YZB A;  1ZX3 A;  2LGQ A;  3LDE A;  2QM7 A;  5L3C A;  4MVS A;  3E8B A;  4B3S B;  2HLD G;  5GON B;  3RYC B;  3CCL V;  1B6Q A;  4DR7 O;  2DYS C;  5JJJ B;  3QO7 A;  2Y0I A;  1VF7 A;  5EIB C;  4LH6 A;  5EYP A;  2ARH A;  1IZ3 A;  1YIT V;  5KAI Z;  3A0B Z;  4LWS A;  5IYZ B;  3SPC A;  3AK1 A;  3J81 N;  4LF7 B;  1R3J C;  2W6I G;  3ICX A;  1BQ0 A;  1N32 B;  4I0X A;  5DEC A;  4DR7 B;  3CJH A;  3ZRX A;  4X62 B;  2OCC C;  3OUF A;  3M7M X;  1YEW A;  2FL4 A;  1D5A A;  3VQW A;  2HVJ C;  4JAU A;  4KFM A;  1ARO P;  3JAT B;  5LGU A;  2QE7 G;  3CCR V;  4R7C A;  4O2B B;  3QNE A;  4JZG A;  1CXZ B;  4MTG A;  4MVQ A;  4BWA A;  3ASO C;  1YJ9 V;  3WG7 B;  1RPR A;  2NNU A;  3IC9 A;  1FFT B;  4UV8 A;  4EFE A;  4F6R A;  3E89 A;  4X1Y A;  5HFL A;  5JCO C;  3IGA C;  3STZ C;  1S5L Z;  3CCV V;  4DYL A;  1NTM H;  2HR3 A;  4CBC A;  3P30 A;  3ETG A;  1N34 B;  2ZNI A;  1LR1 A;  3N2K B;  4FJC C;  2JGD B;  1RFY A;  4ICG A;  5CB4 B;  5KA6 A;  3MHH C;  4LF5 O;  1M4U A;  1B3Q A;  4BIO A;  3SGI A;  5B1B C;  4UUJ C;  3B4S A;  2WLM A;  5K1P A;  2WLL B;  2PI4 A;  1NZ6 A;  3C90 A;  4FM0 A;  2PTM A;  2WWW A;  1Q81 W;  3CCE V;  4R50 A;  2HVK C;  4ASU G;  1IX9 A;  2Q0A A;  2AGA A;  1VEW A;  4A5U B;  3G80 A;  1D2D A;  2H3O A;  3SPI A;  3TK1 A;  3HKC A;  4G28 B;  4RAI A;  3LUT B;  1KBH A;  3OR7 C;  3QO8 A;  1Q7Y W;  2YIB D;  4XDK A;  2YC0 A;  2VQF O;  1OCR C;  4DV3 B;  2IW5 A;  1PP9 H;  2QWP B;  5LBQ A;  5JH7 B;  1NI8 A;  1GTO A;  1U96 A;  2UUC O;  2EJ7 A;  2RQ6 A;  1W0J G;  2UXC O;  3AG4 B;  3THO A;  1N0J A;  5BY1 A;  2R70 A;  2ZQM A;  4DV4 O;  1S72 V;  2HHH B;  3BPZ A;  3OEE G;  5KHH A;  2UXB O;  3OEH G;  3ABM B;  3MHS C;  3F7V C;  4J7Z A;  1VQ7 V;  1EM1 A;  2EIJ B;  4FK5 C;  2VQF B;  3FFQ A;  3ZCC A;  2GTA A;  4DV7 B;  3SYA A;  4LNU A;  4UV9 A;  2UUC B;  1HNW O;  5CA0 B;  4I9Q A;  4DV6 O;  4R6Z A;  1CP9 A;  3MAQ A;  1WNS A;  4DV4 B;  3ZRW A;  3OMI B;  3ZIA G;  2UXB B;  1G8M A;  5KMG B;  2A0L A;  2K1E A;  3E8G A;  5IT9 N;  1XEQ A;  1DK1 A;  2ZIM A;  2F43 G;  2FKX A;  3G6B A;  3QTC A;  4K35 A;  4FFB A;  1TUB B;  1NJI W;  1RM1 C;  4JI8 O;  1KYO F;  4OX9 O;  1ZSP A;  4DV1 O;  4AHC A;  1AI4 A;  3JAK A;  5D5P A;  3VQV A;  2K9P A;  3CJH B;  1NBM G;  4AIL C;  4QE7 A;  3UO3 A;  3SJB C;  4LCU C;  1KC8 W;  5EBL C;  4N23 A;  1VQP V;  4I7Z B;  5KA5 A;  3I5D A;  1DLB A;  1XL4 A;  3BA9 A;  4JI7 B;  3A0R A;  4J7J A;  4CH5 A;  2OT5 A;  1HW7 A;  2JS5 A;  4O4H B;  4UCR A;  2X0L A;  3RVZ A;  1YCI A;  2YI9 A;  5LA6 A;  4O4J A;  3ABK B;  4JI5 O;  4DUY O;  3RYI B;  2V4D A;  1QVF U;  4EFB A;  1SS3 A;  4FIP C;  2AXT Z;  4GT1 A;  1FKA O;  2JRI A;  1SQG A;  3WG7 C;  4IYH A;  1NS1 A;  1ROP A;  2IJK A;  2LW7 A;  1MMM A;  3W7W A;  4F6R B;  4PJ0 Z;  1WA8 A;  1E79 G;  4J42 A;  3CMA V;  1FYJ A;  4YXW G;  3HKD A;  5B1O A;  3K03 A;  1F23 A;  5EZY A;  2Q6A A;  1I0H A;  3KKY A;  2MW2 B;  2OTJ V;  4DW0 A;  2EIK C;  2CDY A;  1FFX A;  1L8D A;  4O4I B;  3ZRV A;  2ZE6 A;  1JJ2 U;  3A2F A;  2YIC A;  4J11 A;  3BFR A;  1HR0 O;  1Y76 A;  3K79 A;  2JJ1 G;  2PUS A;  1H8H G;  1N4C A;  3OGI B;  4UCV A;  3F5T A;  5C8Y B;  2PI5 A;  1VQK V;  1SF9 A;  2ZCE A;  4K8X A;  3RT3 C;  4IGG A;  1QHT A;  2PGG A;  2VRZ A;  4CH3 A;  1S5H C;  4DRX A;  3IJ4 A;  3HKC B;  4BIU A;  2DJV A;  1KKD A;  4I4T B;  2EIM B;  4WCE V;  2CUG A;  4RUF A;  4QIW F;  1QLE B;  3VBB A;  2XAS A;  1S3J A;  1SQB H;  1GN3 A;  4X65 O;  3DGE A;  4NB5 A;  1NVP B;  3OMN B;  3AG4 C;  1FXH A;  4GYC B;  3J7A U;  2RMK B;  4ZHQ B;  4TV8 A;  5D5Q A;  2IU3 A;  3ABM C;  3STL C;  2EIJ C;  2KG7 A;  3CRR A;  5L3G A;  5IJ9 B;  1NT2 B;  2EIL B;  1NVP D;  3SYO A;  3H01 A;  2BTO A;  3LDD A;  4OPA A;  3ZMU A;  5EC2 C;  2ZD9 A;  3BAA A;  3DXR B;  1FPO A;  4X65 B;  2ZKO A;  1S0V A;  4JI1 O;  4P30 A;  2JS3 A;  4ZIB A;  2CTR A;  2XND G;  1R6T A;  4B7K A;  2WLN A;  4W4K A;  1L1F A;  2XOK G;  3M8A A;  1GH6 A;  1XHZ A;  5J2T B;  3JD2 A;  4TUY A;  1K73 W;  4YIO A;  1BHB A;  2UUA B;  1GM7 A;  3LNN A;  5B3S B;  2CAZ C;  2X7R B;  2NN4 A;  4PA9 A;  1LNQ A;  4PEL A;  4B3T B;  5LHG A;  5FLX N;  4E2L A;  3EFF K;  4I55 A;  4XDJ A;  1K4D C;  2QEX V;  4HNA A;  1XL6 A;  4JI0 O;  1ENV A;  2Q9L A;  2ZR2 A;  3RYH A;  2P4V A;  2XAQ A;  1R6N A;  3K5O A;  1F4M A;  2CH7 A;  2ZM6 O;  1MNG A;  3RGB A;  4TWK A;  5LYJ A;  2OIE A;  1VF6 A;  3D3Q A;  3EXA A;  1XHX A;  1ZL8 A;  2FYU H;  3GVM A;  3SYP A;  3UQ8 A;  5HFM A;  2V7Q G;  3IC7 A;  1BZK A;  1E1R G;  5LA6 B;  1GN6 A;  4FLY A;  2LFR A;  3ABK C;  1IXB A;  1GM8 A;  3P3N A;  5LGN A;  3CE2 A;  4BAY A;  4PD4 F;  2ZM6 B;  3IAY A;  4LF9 O;  4DR6 O;  4D7S A;  2WPD G;  3FAV A;  4YJ3 A;  1F7Y A;  1VMG A;  2V1D A;  1QR8 A;  4UXN A;  3E83 A;  1PKX A;  3K06 A;  1TAE A;  1K5Q A;  3FB5 C;  1BS3 A;  1EBO A;  4LFA O;  3D36 C;  4L8J A;  3HKD B;  5BMV A;  4LF8 O;  1K7D A;  3LDC A;  1AJQ A;  3HR0 A;  3OMA B;  3CCS V;  2A06 H;  1PNM A;  4LF9 B;  1L0L H;  3QG5 A;  5LOV A;  3ZBH A;  4FFK A;  1H8E G;  1IBM O;  3A0H Z;  1NH2 D;  5C93 A;  2GBO A;  2QWN B;  4CS4 A;  4AQY O;  2IH1 C;  2CK3 G;  4B3M B;  4TV9 A;  4L87 A;  5JVD B;  4JTA B;  3OAA G;  3HB3 B;  1THZ A;  4LF8 B;  3SYC A;  3TXS A;  2QSA A;  2WLI A;  2Q0O C;  4K0K O;  5ITZ A;  4DR1 B;  1Z5W A;  1KP3 A;  2QGN A;  1Y74 B;  2F95 B;  2Q73 A;  3OGC C;  1K5S A;  3K04 A;  4AQY B;  4DRX B;  3JAR A;  1K4C C;  1SA0 B;  3FYI B;  3VQX A;  1MZF A;  2EIM C;  4MW8 A;  1HP8 A;  2YSU B;  3CX5 F;  2GUZ A;  4X1I B;  3ABU A;  1YI2 V;  5L3D A;  4DXW A;  4K0K B;  4E4E A;  1JJO A;  2UXX A;  3RFR A;  1FJG O;  2QKA A;  4X20 A;  4ZOL A;  2BTQ B;  3KCY A;  5EBW C;  2KG7 B;  1K92 A;  3JAL A;  4HYO A;  1WN7 A;  3B77 A;  4MVZ A;  1S5J A;  4IT5 A;  3RYF B;  1O9H A;  2Z5U A;  4FM1 A;  1NTK H;  5FNV A;  1BMF G;  3OFN G;  2LJ2 A;  1LUV A;  4FLZ A;  2F1M A;  4PDV A;  2Y4T A;  4FVM A;  1R3L C;  1O9G A;  5B3S C;  1JOY A;  2PZS A;  4B3S O;  1YHQ V;  1XOU A;  3K5M A;  1PL0 A;  2QJ1 A;  3ZMS A;  1HNX B;  5H6R A;  3AG3 B;  2X6B A;  2ZXW C;  3N27 A;  5LHH A;  4NR1 A;  4FLU A;  1JPX A;  3O9O A;  3JSN A;  4U7O A;  1XBL A;  2LW1 A;  3RYH B;  4QJF B;  5L3F A;  2YXH A;  1XUQ A;  4LF7 O;  2XUM A;  4HBN A;  1F4N A;  1N32 O;  5LYJ B;  3BCC H;  4X62 O;  3H9V A;  2YEV A;  4TOI A;  3FB6 C;  4JYB A;  2Q68 A;  1BE3 H;  1VQ4 V;  1GO3 F;  3PN1 A;  1SES A;  2KQX A;  3FD9 A;  5JQG A;  3E22 B;  2CTP A;  2PY5 A;  5LMN O;  4I50 A;  4UVA A;  4UCU A;  2OYQ A;  1VQ9 V;  4KL1 A;  4YJ3 B;  1VAR A;  2QTO A;  3JCZ A;  1TUE B;  1D5N A;  5A2Q N;  4GX2 A;  4JF3 A;  4U7N A;  1E1Q G;  2WSS G;  3EHB B;  2KB1 A;  3UKM A;  5LMN B;  5A9G A;  5J2U B;  4DV2 O;  1NTZ H;  2JVD A;  1VQO V;  1XIL A;  4WFG A;  1IXM A;  1I5X A;  4CH6 A;  1N34 O;  4WBN A;  2D2C B;  1KU9 A;  4D7T A;  4TV9 B;  2YXY A;  4YJ2 B;  1SC5 B;  2IJI A;  4LF6 B;  2LGW A;  5JWP A;  1X59 A;  2WLI B;  4DV2 B;  4PHZ A;  5ITZ B;  3CRQ A;  3B8M A;  1P84 F;  2H8P C;  1I94 B;  3JD4 A;  4IHJ B;  3N2G A;  5IYD O;  3PJS K;  2R9I A;  1PD3 A;  3CS5 A;  3SDL A;  4DV0 O;  1JCH A;  2IH3 C;  1GN4 A;  1PNL A;  2GTS A;  3X2Q C;  4NVP A;  5IDJ A;  4UCO A;  3OUS A;  2UXD B;  4DV3 O;  3APO A;  5IJ0 A;  4MVO A;  1WP8 A;  3SPH A;  4U3J A;  5E1A C;  4DV0 B;  2HHH O; 
#chains in the Genus database with same CATH homology
 3AG2 B;  4I9W A;  2Q6A A;  5EK0 A;  2DYS B;  1NKD A;  3K3W A;  1N8R W;  4HZ3 A;  2HKO A;  1QCE A;  3CC2 V;  2OTJ V;  3BY6 A;  4XDL A;  2EIK C;  4GX0 A;  1DF4 A;  5L3B A;  3TET A;  3ZRV A;  4ZBM A;  1JJ2 U;  2AHY A;  3T2M A;  1FXK B;  5CBG A;  5BZB A;  2HJF C;  3ASN C;  4EKW A;  1OCZ C;  2QA4 V;  2XAF A;  5KUK A;  1AJN A;  3K79 A;  2JJ1 G;  3E8H A;  3K0D A;  4Z1M G;  2GSM B;  1H8H G;  2Y48 A;  4UVC A;  1J95 A;  4JAS A;  2PI5 A;  1PNK A;  3OW2 U;  1VQK V;  3CCM V;  1OCO B;  1R3I C;  1JVM A;  5GW7 A;  1NR7 A;  1GMG A;  3AG1 C;  1NH2 B;  2IJH A;  3AG3 C;  4MW3 A;  4JGS A;  1S5H C;  2B1G A;  4MT8 A;  2ITD C;  4MTF A;  4BIU A;  2D3O W;  1KKD A;  1H2G A;  2EIM B;  2M7W A;  5B1N A;  4RUF A;  4PDL A;  4WCE V;  1YJW V;  3CC4 V;  4PDR A;  2DYR B;  3E8F A;  3W7U A;  1RM1 B;  4QIW F;  1S77 D;  1QLE B;  1AJP A;  1QLN A;  3VBB A;  3ASO B;  2XAS A;  4WFH A;  3G71 V;  1S3J A;  2DQ3 A;  3FB8 C;  3RBZ A;  3JD0 A;  3SPG A;  1P7B A;  1SET A;  3DGE A;  1NVP B;  2EJR A;  3OMN B;  1YSC A;  1FXH A;  3AG4 C;  1R73 A;  2A79 B;  5IYB O;  2DQ0 A;  4JYC A;  2DWE C;  1K34 A;  3F7Y C;  3ZMT A;  3LSS A;  2GHY A;  2IU3 A;  3ABM C;  3STL C;  2EIJ C;  3JD3 A;  5L3G A;  1QVG U;  2EIL B;  1VQN V;  1NVP D;  4X89 A;  3SYO A;  2Y69 B;  3H01 A;  3LDD A;  4ZKI A;  1OCC C;  4LC1 A;  3ZMU A;  4RQF A;  5EC2 C;  2ZD9 A;  3K0G A;  3VOU A;  1S0V A;  1M57 B;  1BHA A;  4P30 A;  2XND G;  2WLN A;  1L1F A;  2P90 A;  2XOK G;  2HFE C;  3JD2 A;  1K73 W;  1NR1 A;  3E35 A;  2BOC C;  3X2Q B;  4WFF A;  1BHB A;  1GM7 A;  2LFS A;  5B3S B;  2X7R B;  1K33 A;  2ZDI A;  1ZWI C;  1M1K W;  2ZR3 A;  1K8A W;  4PA9 A;  3FYE B;  1LNQ A;  3GWO A;  3OE7 G;  4X8A A;  3SJQ C;  4MVM A;  3ZMV A;  3D36 A;  4PEL A;  1FXV A;  5LHG A;  1SER A;  1Y4M A;  3DTU B;  3F5W C;  3CP1 A;  4E2L A;  5LGT A;  3ZN1 A;  3B8N A;  3EFF K;  1JX9 A;  4XDJ A;  2QM8 A;  2C2A A;  1K4D C;  2QEX V;  3RW0 A;  1XL6 A;  1ENV A;  2XAJ A;  2ZR2 A;  3GB7 C;  2EIK B;  2Q67 A;  4P2Z A;  4JPR A;  4DO2 A;  5EBM C;  1KP2 A;  1OCR B;  5J9P C;  2XAQ A;  1R6N A;  4H33 A;  1M9N A;  1FXK A;  1F4M A;  4QPK A;  4PA6 A;  4JAV A;  1OCZ B;  1WPX A;  4H37 A;  4TWK A;  1ORQ C;  1OZ0 A;  2HG5 C;  1M56 B;  2JEX A;  1P4R A;  1VQL V;  3ZJZ A;  1H38 A;  4MS2 A;  3WFV A;  2EIN C;  4QE9 A;  3LSQ A;  3W7T A;  3SYP A;  4MSW C;  5HFM A;  3OM3 B;  2V7Q G;  3IC7 A;  4XBF A;  1E1R G;  2P67 A;  1FS0 G;  4WF9 V;  2LFR A;  3ABK C;  4J9Z B;  3UM7 A;  3I56 V;  4WFA V;  3TCU A;  4FPP A;  1GM8 A;  3AG1 B;  5IYC O;  1M90 W;  1SZT A;  5LGN A;  2OTL V;  5CBF A;  4BAY A;  3ABL B;  1V55 B;  3LNM B;  1VQ6 V;  2WPD G;  4TSF G;  2V1D A;  1QR8 A;  3FB7 C;  1W2B U;  3JYC A;  3E83 A;  1PKX A;  3K06 A;  4JTD B;  4UXN A;  2IU0 A;  2H94 A;  1K5Q A;  3JD1 A;  2DWD C;  3FB5 C;  3FKS G;  4I5S A;  2ZDI C;  3LDE A;  2QM7 A;  1F51 A;  1EBO A;  1Q86 W;  5L3C A;  4MVS A;  3E8B A;  2HLD G;  3CCL V;  2JK5 C;  1B6Q A;  1K7D A;  1SRY A;  3AG2 C;  1AJQ A;  3LDC A;  3OMA B;  2DYS C;  1V54 B;  4Q20 A;  3CCS V;  1VQ8 V;  3QO7 A;  1PNM A;  4PA7 A;  1YIT V;  4GCZ A;  5B1A B;  2EZP A;  3BEH A;  2EBO A;  3CC7 V;  1MSW D;  1H8E G;  2XAH A;  3SPC A;  3SPJ A;  1FXK C;  5C93 A;  1NH2 D;  4RQE A;  2JJ2 G;  2IH1 C;  2CK3 G;  1R3J C;  2W6I G;  5IY5 B;  4L87 A;  2ATK C;  2YEV B;  4JTA B;  3OAA G;  3HB3 B;  1THZ A;  3ZRX A;  4FMT A;  3SYC A;  2OCC C;  4P9O A;  2WLI A;  3OUF A;  1Y66 A;  4LBE C;  2HVJ C;  4JAU A;  1KP3 A;  4KFM A;  3ETE A;  2WLH A;  3CXC U;  2LP7 A;  3HPL C;  1QBZ A;  3OGC C;  1K5S A;  1ARO P;  1AI5 A;  1CEZ A;  3K04 A;  5LGU A;  2QE7 G;  2WLJ A;  1K4C C;  3T4Z A;  3CCR V;  4R7C A;  3FYI B;  1OHH G;  2EIM C;  4MW8 A;  1S76 D;  5LHI A;  3QNE A;  4MTG A;  1G4Y B;  4MVQ A;  2DYR C;  2YSU B;  4X88 A;  3AEI A;  3ZRW B;  4R8C A;  4GX5 A;  3ASO C;  4TT3 G;  1YJ9 V;  3ABU A;  1YI2 V;  5L3D A;  4DXW A;  1MOF A;  1UJW B;  3WG7 B;  2UXX A;  3R65 A;  4MTX A;  1K9M W;  1RPR A;  4J9Y B;  2NNU A;  3ML0 A;  1FFT B;  4MTO A;  4UV8 A;  3E86 A;  3E89 A;  5HFL A;  5EBW C;  3IGA C;  1K92 A;  3STZ C;  3CD6 V;  1GK9 A;  3CCV V;  3G4S V;  3K08 A;  1EZJ A;  4HYO A;  1CPY A;  2QKS A;  3QO5 A;  1DF5 A;  3B77 A;  2X6A A;  2HR3 A;  1K97 A;  4MVZ A;  4CBC A;  3P30 A;  3ETG A;  2NLJ C;  3M99 B;  5CN0 A;  4FJC C;  1M57 C;  3SYQ A;  2Z5U A;  3NXS A;  1BMF G;  3ASN B;  3ZN0 A;  3OFN G;  5KA6 A;  1YIJ V;  1MAB G;  2IJJ A;  3MHH C;  2FTK A;  2Z3Y A;  4RUE A;  1I5Y A;  3CCU V;  5B1B C;  4UUJ C;  4PDV A;  2WLM A;  1R3L C;  1K3E A;  5B3S C;  2WLL B;  2PI4 A;  1JOY A;  1GM9 A;  3ZMZ A;  2JEU A;  2W0F C;  2WWW A;  1Q81 W;  2JDI G;  3CCE V;  4R50 A;  4QNH B;  1YHQ V;  2HVK C;  4BIZ A;  4ASU G;  1PL0 A;  1GKF A;  3ZMS A;  4G27 B;  3OR6 C;  1QR9 A;  5H6R A;  3AG3 B;  2X6B A;  2ZXW C;  4JTC B;  4PA4 A;  3SPI A;  3TK1 A;  5LHH A;  5FL7 G;  5DM6 V;  1YTF B;  1JPX A;  4G28 B;  1EFR G;  4OXS A;  3LUT B;  4RAI A;  4U7O A;  1KEC A;  3OR7 C;  3QO8 A;  4QJF B;  5L3F A;  1AR1 B;  1Q7Y W;  5CBH A;  4XDK A;  3W7X A;  1OCR C;  2IW5 A;  1F4N A;  5LBQ A;  3T1C A;  1JQ0 A;  1GTO A;  5CA3 A;  1YTF D;  1MG1 A;  1M56 C;  1W0J G;  2AHZ A;  3AG4 B;  3ZRS A;  1VQ5 V;  5KUM A;  2YEV A;  3CCQ V;  3FB6 C;  4JYB A;  1BL8 A;  2Q68 A;  1VQ4 V;  2P6J A;  1GO3 F;  2ZQM A;  4PA3 A;  4P9P A;  1S72 V;  1SES A;  3OEE G;  2OCC B;  1AI7 A;  3OEH G;  4MVU A;  3ABM B;  3MHS C;  3F7V C;  1VQ7 V;  1KQS U;  2EIJ B;  4FK5 C;  3ZCC A;  4UVA A;  3G6E V;  3RVY A;  1VQ9 V;  1YJN V;  3ABL C;  1V55 C;  3SYA A;  1OCC B;  4CZZ A;  4UV9 A;  5DN6 G;  2QTO A;  4GX1 A;  4KUM A;  1Q82 W;  3JCZ A;  1TUE B;  3CYO A;  4MVR A;  1OCO C;  1R6K A;  4R6Z A;  1DTO A;  1CP9 A;  3ZRW A;  3OMI B;  3ZIA G;  1G8M A;  4GX2 A;  2A0L A;  2K1E A;  3E8G A;  4JF3 A;  4U7N A;  1E1Q G;  2R9R B;  2WSS G;  3EHB B;  2KB1 A;  3UKM A;  2F43 G;  1V54 C;  3CME V;  3P32 A;  2P7T C;  2UXN A;  4G2K A;  2WAM A;  2JIZ G;  1NQT A;  5B1A C;  1VQO V;  2X6C A;  4PDM A;  2WLK A;  3I55 V;  1NJI W;  1RM1 C;  1QLE C;  4WFG A;  1IXM A;  1I5X A;  3CCJ V;  1AI4 A;  1KD1 W;  4WFE A;  5IY5 C;  1R3K C;  2IJI A;  4BW5 A;  3ETD A;  2BOB C;  4LP8 A;  1NBM G;  4QE7 A;  1VQM V;  2WLI B;  2B1I A;  5CMU A;  5EC1 C;  4LCU C;  1KC8 W;  5EBL C;  1RPO A;  2EIL C;  4N23 A;  4UVB A;  3B8M A;  1VQP V;  5KA5 A;  2W6J G;  1HWY A;  2H8P C;  2Y69 C;  3JD4 A;  3W7S A;  1DLB A;  1XL4 A;  2EIN B;  5IYD O;  3A0R A;  3PJS K;  5B1B B;  3E2E A;  2R9I A;  2MK3 A;  2OT5 A;  2B5U A;  1PD3 A;  2WLL A;  2Q69 A;  5H6Q A;  2X0L A;  3RVZ A;  4F4L A;  2A9H A;  3KG2 A;  2DW4 A;  3ABK B;  1JCH A;  4N21 A;  5H9C A;  3T4D A;  2IH3 C;  1PNL A;  1COW G;  1QVF U;  2ZXW B;  3X2Q C;  4FIP C;  4GT1 A;  5IDJ A;  1W0K G;  1WLE A;  3OUS A;  4KP4 A;  3WG7 C;  1AI6 A;  4RO2 A;  1ROP A;  2EZO A;  2IJK A;  3ABT A;  2ITC C;  4WFB V;  3CPW U;  3W7W A;  4HAM A;  4QPJ A;  2XAG A;  5L3E A;  3D3I A;  1E79 G;  3IFX A;  3CMA V;  3K9A A;  4YXW G;  4MVO A;  3SPH A;  5B1O A;  3K03 A;  5E1A C;  3MD0 A;  1F23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...