3P3NA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1930-1949) peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3nA01
3D8CA 2CGNA 2YDEA 1MZEA 4Z2WA 3KCXA 2W0XA 2WA4A 2YC0A 2WA3A 5JWPA 1H2NA 1H2MA 4JAAA 4NR1A 4B7EA 4B7KA 4QU2A 1H2KA 4Z1VA 4BIOA 1YCIA 2XUMA 4AI8A 3P3PA 1IZ3A 3OD4A 3P3NA 1MZFA 2CGOA 1H2LA 2ILMA 2Y0IA 3KCYA
chains in the Genus database with same CATH superfamily
4FLVA 4LHKA 4AQSA 3NNGA 1COWG 4QX2A 5FY9A 5JR2A 4KHPB 4UFMA 4AVTA 2BPA2 3CCVV 2VNOA 1BMV1 2HWF1 1JHJA 2D5FA 1IURA 1MS9A 3GCWA 2MW2B 4GLXA 2VBDA 5F3GA 3PVBB 2QQPA 3R0RA 1WP8A 3HQXA 4I9QA 2ZNIA 5LMNB 2LW8A 2NR5A 4LNVA 2LUWA 2YIAA 3UKVA 2Z5WA 2ZIOA 2UUAO 3NKTA 5I0UA 1RUF3 1W59A 3BN6A 4JYAO 2A0LA 3QO5A 2VZ3A 2TUNA 4KU8A 3E6CC 1U5XA 1JYXA 2LGQA 3L74H 3KV4A 1TME2 4LORA 3JD0A 3AMHA 2CTPA 4IXLA 2VUAA 4EN6B 2RDCA 1ZZ9A 5JXHA 3T4VA 3MI8A 4IT5A 3EVKA 4N43B 2ENRA 4NPRA 2WIIB 3WNOA 3BFRA 2P4VA 5FJKA 3TGUH 4DV5O 3H50A 1W2AX 3WDVA 4DR7B 1JMUB 1ZRRA 1C28A 5F37A 2DTWA 3WX5A 3JAMN 3MDPA 5KMGA 4X8AA 1XYOA 3SPCA 1OCOC 1FKAO 1A6CA 2N04A 2VMDA 1I94O 1V0AA 1DGWX 2E7QA 4FZ1A 3A23A 2J1RA 1T6GC 2XNDG 4ZS3A 1RTVA 3CJIA 2H3OA 4OMCA 2Q8OA 3K2OA 1YEWA 2BUKA 4IE6A 3FJSA 2F4VO 5JJJB 1BZKA 4XDKA 1YI7A 2P6JA 4B4QA 1E5IA 1JFFB 4NXNB 1JOBA 2YI9A 3ABMB 4XEZA 1OCZB 1VALA 4QPGC 3ZHTA 3H1JH 2FMDA 5IVJA 3ACIA 4CBCA 3H8XA 3M3OA 1LODA 2RS51 3RWNA 1AL0G 2WLIA 3D3QA 3NJYA 2W0FC 1BHGA 5FZ6A 4DUZO 3ZFGB 4E9KA 3JAKA 4RQEA 4WM8C 4H44B 4UVAA 2ARHA 4CA9A 1R3LC 1JPXA 1UZZA 2BGPA 1U96A 5JQGB 4JI8B 2QWOB 1TNRA 1R6NA 5A3NA 1RM1B 1K8AW 3MYXA 1C8NA 4PA9A 1J5EB 3D0JA 4BQ5A 3CL1A 2VTXJ 2QFEA 4KWJA 1WCUA 2Y33A 3IM0A 2VD7A 4O2BB 4RS5C 1GN6A 1WW4A 3P6BA 1JJ2U 4CDUA 4XE9A 5EBLC 2D5HA 4OPHA 4INDA 5A7SA 2NZ9A 1QJU2 2WO2A 2X0LA 2QTWB 1DQ0A 4CP9A 1SLCA 4IW3A 3E22B 4Q29A 4D7SA 4BDVB 2YC4A 4RR3A 3VD7A 4FPJA 3DYMA 5FOJB 4JI7B 1RUH3 1K12A 2HG5C 3F5TA 3M3QA 4GMP1 4W4LA 3OUJA 4EJRA 1AROP 5DUXA 3QH7A 4K8FA 1Q6UA 2JIJA 1VBD3 1W9TA 1RUH1 4Q4V1 1BQZA 1CN1A 4FM2A 1DGRA 2XQRA 4FAHA 3LB9A 4TOIA 4BQYA 2HWD3 1S0JA 1MQTB 4M4RA 4LO6B 3T4DA 2E5LB 1Z5WA 4XJZA 1JS9A 2ZX1A 3E8HA 3RMXA 1SHWB 3DXUA 3GHNA 5IHRA 4UYBA 2RJLA 3E22A 3AVSA 1RVF2 2OIEA 2P34A 1UNBA 1R6TA 3JD73 1LHUA 1NLSA 4CEWA 3NKGA 2ADPA 4MHUA 4YW3A 4BQ4A 3PDQA 1US6A 5HI0A 2FDJA 4BWAA 5EV7A 3RSJA 1ASJ3 1TA8A 1SQBH 4DV3B 4DRRA 1GO3F 1EUTA 1HNXO 5CZKA 2UUAB 3N3HA 1LHNA 3HR0A 2CGOA 1VR3A 2VUCA 5C7GA 2AREA 4DV7O 2R72A 3SXWA 4AVBA 1NU1H 5DDJ1 2DF7A 4JI1B 3GZTB 4B3MO 4IUGA 5JZGC 3OUFA 2DN9A 1SZXA 3J81N 4FPGA 5A33A 1VQ5V 4LOTA 1H8EG 3QACA 5L3DA 1O5LA 4CC6A 4NHKA 5D8AA 2HEPA 5DN2A 2Y64A 3VKFC 2KB1A 4DR3O 4NRQA 2HWF3 5FKCA 1DU3D 4BQ2A 1GM7A 4C0BA 2WZR1 2AXTZ 4N7IA 3CWBH 4YZ4A 4HZFA 1M56C 5FP3A 3UESA 2XJUA 4M0HA 1UKRA 5LA2A 2W9XA 5GW7A 3ZDVA 3CMAV 2CWMA 1JUHA 3VD3A 4N53A 3OBTA 1KFUL 1GOGA 3U0ZA 4LF6O 1CX1A 3NSTA 2HEYF 2Y60A 4QDRA 4YNIA 3FB5C 5BNPA 3BU0A 1R73A 5LYJB 4AI2A 5K0UA 4QAWA 1OMIA 2QTOA 3LAGA 2ZAAA 3L2YA 2C26A 2ES3A 3ROUA 3CRQA 2VUJA 1CESA 2ITCC 1N32O 2YG0A 4DR1O 4AQTA 4NIGA 3HT2A 2SLIA 4P2ZA 3AZVA 2WT2A 3NAPB 1FX5A 1PPJH 4GD4A 1BMV2 4LFCB 3V0BB 4C0HA 1JTZX 3T09A 2RS31 3WY6A 1WBFA 2QKAA 3MLJA 4JI7O 1JVMA 1IG0A 4I50B 1YVWA 2EAAA 1NG0A 3KT4A 3BB6A 3SDLA 5BR8B 4K0KB 3OGRA 3VBOB 2PQSA 1J3RA 4CCJA 5JJEB 1IQAA 2R9IA 2XWBB 3CU7A 4ZU4A 1MSWD 1OKOA 5KHGA 3ETQA 3VQYA 2R062 4P00B 5CA0B 4F6RA 2UURA 1I6XA 1E5SA 1BZWA 1RITA 2JECA 1LESA 3S7EA 1TQ5A 3H7JA 5J37A 3VBHA 4MADA 4CPBA 1X4TA 4K1YA 1YTFD 5GLUA 2JDMA 2VRZA 5AC93 4LR4A 2UUBB 5FNVA 3CRRA 1V6IA 2R061 1ND2A 3ZJZA 2VU9A 1PGL2 1CXZB 3HPNA 3TAYA 5J48A 4CEYA 5FMDA 4CYDA 2L35A 3GGLA 1Y4WA 2DURA 4DV4B 4FXKB 3NNFA 2EIKB 1GV9A 3ML0A 1K5MA 5LMUO 3QF7A 4Z2AA 4ZXEA 2ARXA 4MXVA 3VHNA 4QPJA 1UYYA 2ZACA 4IE7A 1CX4A 3AG7A 1IDSA 4FFKA 1I5XA 3OUIA 4A4AA 3F7VC 1IBMB 1XPWA 3ACLA 5DAPA 3VBHB 4WFAV 4YXWG 3VBSC 2WZR3 5CEHA 1ALYA 2WNVC 3WF2A 5A32B 5BY5A 4LITA 1EV11 1AVBA 3I7DA 3B3QE 3A8TA 4ZI7B 1MOFA 3K04A 2HEWF 4CXWA 3ILNA 2LROA 4XF4A 4GH4A 3L70H 1LU2A 2VQEO 1XSQA 4QU1A 1C1FA 5ACA3 4RQPA 3CEWA 3FX3A 2GMEA 5A7NA 3VKNA 1ENSA 1F15A 2HWC1 2Q8EA 1B09A 4LBJA 2HYXA 3J26N 3E5XA 5CFDA 3JD1A 1I0HA 3CS5A 4YGBA 2E7AA 1CAVA 4P9YA 1H6YA 5HV4A 3SYOA 4DINB 3N9LA 4JHZA 3KV5A 2RR11 1XNQB 2JJ1G 1S2KA 2D6OX 3K03A 4XC9A 1FAFA 5A32A 1PGW2 4ZZ8A 4S2FA 4WM8A 1A34A 5BNOC 2HYKA 5IYYA 4M00A 1YIPA 3ZYHA 1KGYA 1Q43A 2WLIB 4GKJB 3I2JA 1FPN2 1R3KC 1LJ7A 1Y6XA 1KKDA 3O12A 3JAWB 1MS8A 1EN5A 4YFZA 2ZTNA 3V0BA 2W39A 3DTUB 1FNZA 3LA7A 2BFUS 3VLBB 3PUAA 2VNRA 4BH9A 4YW2A 3AEIA 5KXCA 1FOD2 1AVMA 2J1SA 5D1IA 1LKNA 3DKWA 4RHV1 5A6QA 3E35A 1AYM2 1P49A 1UKGA 5FOBB 5CBFA 4PBOA 3OEEG 1FXKC 1CJPA 2VW1A 3MLKA 3FD9A 4LF4O 3APBA 5ACA1 4LXLA 1N0JA 4MW8A 1ULEA 2X6BA 2IVIB 2OTLV 4FZ0A 1NVPD 3OR6C 4Y1YA 4B3NA 2DMXA 3IKWA 2Q8CA 3MICA 3O9OA 4YJ2A 4META 4FLXA 1W8HA 3AM2A 1GWLA 2P6HA 3M7AA 2RDRA 5IK5A 4IIJA 1RJ8A 1DF0A 5FWEA 3KV9A 2BZDA 3VBBA 5FUPA 2KA3A 4FM0A 1S2EA 4AQYO 4GB33 1ZAUA 2EIEA 1POV1 2YXYA 1D4M2 1G9FA 2D40A 5ACA2 4YIPA 1WP7A 3IN9A 3WHTA 2EXHA 4QQLA 4F6EA 3MBWA 3C7OA 1F5FA 5FZDA 1KRIA 2XHNA 2GC0A 1IS5A 3CZUA 3BPZA 1MQTA 4YM0A 4PQ9A 3ZXJA 1B04A 2WLLB 3QG5A 2A7WA 3ABZA 1OVSA 4Y1VA 2UXXA 1CQ9A 2Y69C 1YF2A 2LO1A 5C4WA 3I3EA 1WNSA 2ZKOA 4FOVA 4XUNA 4UVBA 3IB3A 2EIDA 1MEC3 1UXZA 1LHOA 5FWJA 3TBDA 2VNVA 4ITCA 4EN9B 1K42A 2W68A 3M8LA 2NN4A 2DQ3A 1W6QB 2R9RB 4RQFA 1JYVA 2WLQA 4UWDA 1HXS2 3ACGA 2QA4V 3TEXA 5HFMA 1S1AA 1CPMA 4L0PA 3WQ1A 1ULPA 1UY3A 2EINB 1YQCA 4Q4X1 4UFIA 3SEPA 2UXBO 1O3QA 1Q56A 2E51A 5FPUA 3LSEA 4N90A 1Q86W 3T1YB 3OF1A 5IJ9A 5CADA 4CP1A 4NRMA 3CJIB 3I49A 3AB0A 4HPKA 4B08A 2PHTA 4KHPO 3ASNB 2MPFA 5DQ0A 2B45X 1N1VA 2Q6AA 3ZRWA 1JFFA 4XW3A 1N3QA 2FQPA 1VLNA 3ORJA 4WM7B 3IIIA 4X6QB 2WAMA 5A80A 4KGGA 4E4ZA 1MG1A 1Y66A 4WFHA 4LT5A 1UO9A 4MT8A 5B5EZ 2B46X 2RS52 1OSGA 2EICA 3JASA 5EHDA 1UU6A 3UETA 4RS5B 1H1AA 1W0KG 2E33A 1Y9GA 5EZYB 1Y4MA 1C8M3 5JVDA 1W6QA 3BTAA 2WS92 2IFWA 4K20A 2B7YA 1DQ5A 2JK5C 4L87A 2CYFA 4UFZA 1W2OA 4ZHNA 3K08A 5A3MA 3EO6A 4MVMA 2DOSA 3WG2A 5EJZB 3W20A 2GTAA 1GN2A 2RS12 2HR3A 2HLDG 1HB2A 2WFF2 3LPGA 5DZGA 2UUCB 1M4UA 2YGLA 1H2NA 3THOA 5CYYA 3A22A 4GKJO 1VQPV 5CA6A 4G27B 2P4KA 2P3KA 4YY3O 4CSWA 4Y24A 4B3TO 5AFBA 2EIJB 5FPRA 1W05A 4MVTA 2KR2A 1R1BA 1WPBA 4LF6B 1P7GA 4J1XA 3IC7A 4Y5SA 4PDWC 1X7NA 5F39A 1NQTA 4ABMA 2VOKA 4ICGA 1XJAA 1QJX2 2R1DA 5BNNA 4BQWA 2GU9A 1XMOB 5DAWA 4AQYB 4FP3A 3BABA 5DM6V 2XR4A 2DWDC 1NX9A 3CXHF 2BEOA 3OPWA 1KJLA 2VMCA 4BAYA 1HQNA 5HV0A 5GJ6A 4FI9A 3V64A 3M7MX 2RS32 4LH7A 5CG9A 3RJRA 4ZHQA 2CL2A 4R8HA 3OBAA 4KH9A 3SYAA 4EN0A 4JAAA 2OIGA 3AZWA 4H33A 1DYKA 3GXUA 2DUOA 4LBQD 1YJWV 5F2SA 3VHOA 5L73A 4AEKA 3I3BA 5J36A 1ZBE1 2GC1A 5I0SA 5C8WA 1SPPA 3J8F1 3OTFA 3R4SA 1X59A 1DQ1A 2EVXA 5FPXA 5JOYA 1IPSA 3CF6E 2WLKA 1LOAA 2W52A 2BNOA 4JI2B 5JVDB 2VWJA 4J41A 5KUKA 2UY8A 3I2OA 4JI0O 2YUEA 4R9DA 2WAOA 1G9CA 1VF7A 1CEZA 2J42A 1YFXA 2J1EA 2H94A 3TEWA 1NZ6A 2ID4A 4F7ZA 4LF9O 3ZFFC 3K77A 4CCKA 4IL6Z 2WNUB 5GLZA 2WNVA 3ETGA 4X8NA 3ZXAC 2XHBA 2VOVA 3VDAA 2YBPA 1K3EA 3OYWB 5JI7A 2BE3A 1BE3H 3M3EA 2Q30A 5LGUA 4UXAA 3L72H 1AL21 5LEJA 1MS1A 3RYRA 5IVYA 1Z5VA 3P32A 1B35A 4UFJA 3FHAA 4SLIA 3A0BZ 3ZHRA 2HBTA 4ZXKA 4KWLA 4WVVA 4YG3A 5JXGA 3UGHA 5IVCA 3OY8B 2VVEA 3DC5A 4CDWA 2XBO2 3ILRA 2RG4A 2XL7A 1XREA 4C8DA 5GKAC 1KS4A 4AAPA 2GV9A 3ZXEA 1OH3A 1FJGB 4I3PA 5BY1A 3NV3A 2JRIA 5DDJ2 1XOUA 4TV8A 4DEVA 3C2UA 4LPLA 4ASMB 4BISA 3MPPG 4UBGA 1J3PA 1ND3C 3STLC 2IH3C 4LEJA 1SCRA 4J80A 4YZ2A 3WW2A 4I4TA 2DCKA 4LLFA 5FXWA 4I5SA 3O1VA 3K5OA 2WA3A 4WZFA 3E97A 1VBB3 4GB31 3PIJA 4QXCA 5IFTA 1AL22 1PK6C 2ZGSA 1LGCA 1LRHA 4HSJA 1AYN3 2LFSA 4LCUC 1QNWA 1Z7S1 2GAUA 3ZEDA 3UO3A 1CZVA 4X1YA 2DFCA 4JAVA 1FFXA 1RJ7A 3MUY1 3I2DA 3D36C 1OUXA 1TVKA 1RUI3 3VV1A 3LPFA 2O8OA 4Q4V3 1TUBA 4GB32 4UW6A 4I0WB 3PHMA 1T6BX 2QZ2A 3VZLA 1W6PB 5FYUA 1EN4A 3M3IA 4PT6A 3BA9A 2RS11 1S0EA 3V65A 1OF4A 3O1UA 4NWVA 4LBMA 5G05L 3HJRA 3LDCA 3WG7C 2FMLA 5CA3A 1KYOF 3AP5A 5A7WA 3D3AA 2DYCA 1SDWA 4KFMA 2R32A 4CDUB 1SG3A 2ZMNA 4PA7A 2WLLA 1BKZA 2DYRB 3BUCA 4R4ZA 3SHRA 3NW4A 2DVFA 1ND2B 1NXD1 2JG9A 4O4JA 1HR0O 4TTGA 3A0KA 5CKQA 4HKLA 1SCSA 4UFLA 4M3CA 2KSDA 4PI0A 2ETNA 5GZGA 4ZU5A 3ZYBA 3RGBA 4IYHA 3HVDA 2ZGQA 5C93A 1MQTC 2RMU3 3BAAA 1M90W 2JX9A 5A3WA 1VBC2 3HQUA 4ARXA 3AL5A 3RYFB 2XMLA 3WP5A 3VBOA 1SLLA 4YG0A 5C4WB 5JZGB 4MTOA 2A75A 3UT5A 4I0XB 1W6NB 4EQVA 2VW2A 1US3A 1QMJA 1YTFB 4Q4W2 1GMGA 3RZJA 2TEPA 1NLQA 2YXSA 5FZOA 4DFSA 4CDQB 5KHJA 4PIXA 4W6YA 4FBFA 3VUOA 4GALA 1GOHA 4DUZB 1R1A3 5EIYB 4JDMA 1PNMA 2OS2A 1WKYA 3VHRA 4FOYA 1HNZB 4AEDA 4BOWA 4U7OA 2FDKA 3AZXA 4AQ2A 2F6BA 5I8YA 1SACA 3GYDA 5ANQA 3RYFA 3DGTA 1FV2A 1E57A 2XUEA 1ZTEA 1CD3G 3GM8A 4KG8A 1GZWA 2XDVA 4U3JA 5B1OA 3CRCA 3CC2V 1PMIA 5FTTC 2IXIA 2RQ6A 3AXDA 1V00A 1G9DA 2X09A 4FTEA 2PTMA 1SBDA 4JGYC 3SJBC 3C3VA 2C6SA 1UOJA 3UT5B 2QCSB 5C9AA 5DAXA 2I07B 4Y5TA 4XDQA 2BOIA 1OQDA 4I0AA 1V6MA 3SPHA 4RUFA 2W1SA 2VZVA 5IVBA 2ZE6A 5KX5B 2E6VA 5C3OA 3H8UA 4FFHA 5FNVB 4BYYA 3HNBM 4Y4RA 2JDHA 1HNWO 3VDDB 3NWKA 5EZYA 2BGCA 3MEPA 4R7CA 3POWA 3R05A 1K45A 1ZZ8A 4DXWA 4P30A 5FZ8A 3AYCA 1RUF1 1RSOB 2CGNA 3O65A 5I8TA 4LK7A 3ZN6B 5BNPB 1DGSA 1NCQC 3RI9A 1RMU3 3CC7V 3OEBA 2RS33 4GX5A 1PIV2 1VAKA 1Y74A 1X8MA 3VZJA 3DCQA 2QUOA 1P4RA 4JI1O 2QJ1A 1OOPA 5FXVA 3UJOA 2JD9A 1ZL8A 4X89A 1OHFA 4P9WA 1BQ0A 4O4IA 4M3CE 2HWE3 1YXWA 2K9ZA 3F95A 1SQGA 4CCDA 1EUUA 5B1BC 4GX1A 1AHSA 3P5BA 4CZZA 1OLRA 3ZXFA 1LOFC 1TNFA 2H6BA 1UU5A 4G4FA 4X62B 2BNNA 1N33O 1KQRA 2D6NA 4WM8B 2ZMLA 4DPNA 4QPYA 1H0BA 2B39A 1W9FA 3DGEA 3D0SA 2B8MA 4Q4Y2 1SFYA 1QXJA 1XNCA 2E9QA 4H37A 4QPGB 2EZOA 2YSUB 3OEAA 2IXJA 1S0DA 2JG8B 1ZRIA 1VBE3 4TV9B 2G9GA 5JOXA 3T2TA 3PMSA 4CVUA 3OFNG 2R0HA 2VBBA 1DZRA 1BVP1 2QQWA 4FM1A 1UAIA 3CJIC 2R072 3PURA 3B02A 1U12A 5JI9A 1OZ0A 1E1RG 2FHRA 3H42B 1GZCA 1GM9A 3W58A 3PJSK 1BHAA 4ASKA 1RUD2 1JZ4A 5F2VO 2EINC 3OD4A 3ZM8A 1FT9A 4MUVA 4R9AA 3O0VA 4IEQA 1BS3A 1TMF3 5HCFA 5EC1C 5CU1A 2H6CA 5A6XA 4P9XA 1UF2C 1FI2A 1IPKA 5KXEA 4PV1B 4QQHA 1AX0A 2ZZQA 3RN4A 2IXLA 2RDNA 4JRAA 1GZWB 2ZCWA 4OUMA 5EP9A 3RFRA 5FYYA 3FAVB 4P9LA 5FYHA 3DF0A 1HNXB 2GDSA 4DW0A 2OW4A 3OYWA 5A70A 4DV7B 2XAGA 3BEHA 3TXQA 4JTOA 4F4LA 2JENA 4CDWC 5BYNA 1JZ6A 3UKMA 4O4IB 3QCWA 1K5SA 2D7FA 4RGKA 1ORQC 5L7OB 4BJ0A 3ILFA 4LKFA 1KDMA 4RR3B 5LA6B 3AK3A 5C70A 2GSMB 5CKNA 5EQUA 5FPLA 2UWCA 3WB1A 3TEZA 3Q4HB 4NJ4A 1L8DA 2DJVA 3WF0A 1IBKO 4CP9B 4KI5M 3DXRA 1SDDB 4FPPA 3N2KA 3OGIB 2D6LX 4GH4B 2QEXV 5JR7B 1GWKA 4L9BA 4TUYB 2Y0PA 2GN3A 3JB8A 2YPDA 1PO21 1Q8OA 1HX6A 2Y0OA 3BOPA 5FMCA 5ITZA 4YHHB 5L36A 5GTIZ 1HRV3 3T1HB 3OGCC 2P5OA 2OT5A 5LBEA 4P9JA 1EY2A 3WVJA 3LSDA 3GNEA 2Z2SB 4AVAA 1QLNA 1H1IA 1WPXA 4LK6A 4QE7A 2OCCB 1JODA 4TN7A 2DWEC 4B29A 1XNKA 1OLMA 3RYCA 2D3OW 3K59A 1M9NA 2QQNA 3U07A 3ZMNA 5EFUA 1QLEB 3CCUV 2ETEA 4UW3A 1S0CA 2QNKA 3WOGA 4CEWB 5C33A 1POQA 2IU0A 4DV4O 4BW5A 1OXCA 3S3WA 2JDZA 5FZ3A 1DZQA 3HKEA 4MXWB 2LS6A 3T1CA 4AOCA 1S4CA 3OG2A 4XUOA 3B8MA 1ZX3A 3HPLC 4DXRA 4AE2A 1OHHG 1Q8IA 2UUBO 4X66B 4TWKA 3ZDSA 4PIYA 2YZ4A 2PHFA 4QX1A 1PV0A 1J3QA 3ZMZA 1H2LA 2ILMA 4PI2A 4JZGA 1RHI1 1Q8SA 4CU8A 4WM7A 2FTKA 4A7KA 1YDXA 4NPLA 3AZZA 5FYSA 3PJQA 4ZOLB 3KKYA 2V5YA 1E5HA 1LULA 4BR6A 5LA6A 2VZUA 3ENRA 3USSA 3Q8CA 2ZCEA 4ATEA 3KHCA 3I2GA 1WW7A 2OPWA 2GN7A 1YQ8A 4CH4A 5JWPA 1ZREA 4CH3A 2OCHA 4I0XA 3K48A 1UCXA 5FKBA 3E6DA 2HVJC 3KV6A 4ZS2A 4DK1A 4AFCA 1BBT1 1UD1A 2EF6A 1QGLA 1NZIA 1W99A 3ZR5A 3KCCA 1W8ZA 1OLQA 3MLLA 1XBLA 2EILC 2K2SA 4CCNA 5IVVA 4E2QA 2WT1A 2E74B 4DMIA 5BNNB 3SJQC 2PI5A 1K92A 1AUYA 1HB1A 4GWNA 1IXMA 4LFAB 5AFEA 1IVSA 4PLOA 2J1AA 1N34B 1E1QG 4XF0A 4IIJB 5A3TA 3QVNA 4DRXB 5J2UA 1OKQA 4FK5C 2WR9A 4IHJB 3OAAG 1FXHA 4MTXA 1I5ZA 1JHNA 2JICA 2XLAA 4CH6A 5LP6C 4UW5A 5ANNA 1AI5A 5I0TA 3DXTA 4CUCA 1Q82W 1BCCH 4KP4A 1PHMA 2ZABA 1MEC2 2WQ4A 3F2ZA 1V70A 3ZIAG 1OA4A 1OQ1A 3GB7C 1V9PA 4WF9V 1FPOA 1QJY3 3MV01 2R073 3D5OA 2NMOA 5EBWC 4WVZA 1VP6A 3AG2B 3P3NA 3N9NA 4DR2O 4DO0A 2XKPA 5A9GA 1PL4A 2M7WA 3QD6A 1K5JA 4X9QA 3LSQA 4F6RB 5C5UA 4HT1T 4DR3B 4FOWA 2YGMA 5JCOC 1VQ8V 3EHBB 4B3TB 2B5HA 3F5WC 4FAGA 4PA6A 4Z92B 4XOGA 4PDWB 5IYCO 1OUSA 1A8DA 1QQP3 2PYLA 1TG7A 1I5PA 3ZX7A 3C7EA 2UUCO 2GNTA 3I97A 2Y4UA 3B00A 3WP4A 4FO9A 1YHFA 3AK0A 3NJZA 3VD5A 2PHWA 2ORXA 2XPJA 4H14A 2PN5A 2UXCO 4Q4Y3 3UQ8A 1F5JA 2WUHA 1NCQA 2DYSB 5TISZ 5FLXN 1W2NA 4R9CA 3K75B 2QQKA 4MVUA 4LE4A 3NRUA 3T1LA 4AL9A 2BOJA 4XUPA 5LHIA 5JJNB 1CJDA 5C8YB 1UMZA 1VARA 1RINA 4HKOA 1KUQA 1OOPC 1RUJ3 3ZN6A 4H13B 2AYHA 3ZS8C 5FMBA 4F83A 3P30A 5LRRA 3LFIA 1KFXL 3CCRV 1F2NA 1GQPA 3ZMOA 4XUTA 3VBFB 1VBA1 2RDQA 2Q73A 1N1YA 5E1RA 3FB7C 5EYXA 1BEV2 3RPQA 1SKVA 4JGZB 5ABJB 5FDBA 1KD1W 1EPWA 5FY7A 2ZGOA 1YIJV 2RM21 3SH4A 3VBHC 3FE5A 4NE9A 1I1EA 3PU8A 1VB4A 2JJ2G 2XAFA 2WRAA 4ES8A 3BRCA 4B7EA 2Q5TA 4W8JA 4H7LA 3CMEV 3B40A 5JPNB 2UU9O 5KHKA 1RHI3 1JZ3A 1UMHA 2IW5A 5F1RA 1LEDA 4NUBA 1GMMA 1QKQA 1RUE3 1S2BA 1K97A 4M01A 1TVGA 2JEMA 4YGEA 3AG4B 3HN3A 5BXXA 2Y6GA 3KMHA 5CVRA 2ZEYA 3IZOA 2LP7A 1XL4A 4LHLA 3BVCA 3EYPA 5A7WB 1AR81 4IV1A 3ZFEA 3SKVA 4WBNA 2WLHA 2NNUA 5JIUA 1G8WA 5K9YA 4O4LA 3T4ZA 1C1LA 3AFGA 1OCRC 4JGYB 2OQ7A 3BKZA 1QJX1 4LBOA 1GKFA 1Y7BA 3ZFGC 1KP2A 4DV1B 1V9U3 3PL0A 5LA1A 2JG9B 1NTMH 4O9EA 3WDYA 5IVFA 3I2KA 2L9LA 4CUBA 2Q0AA 3SJCC 4AHXA 1I5YA 4GH4C 5E89A 1GYKA 2A3XA 2JS3A 4JI2O 4OI0A 2WNVB 3ABKB 1OH4A 2PI4A 3NJVA 4FFBA 1LECA 5L9VA 1K33A 3UNPA 5FMOS 1SQ4A 1HKDA 1BEV1 5CFDC 2IU3A 3BTZA 5I0DA 3RVHA 1UYPA 4PF1A 4QGMA 1FS0G 3WT3A 1ZLZA 5F5AA 4AFBA 5L7OA 4XF1A 3A4UA 1K4CC 2WS91 1AYM1 1F31A 4IEXA 1B35B 4CCLA 3GVMA 1PO22 4H0LB 5FLIA 4UF0B 5FZ0A 3B93A 4DV0B 2ZIMA 3VL8A 2JEXA 2VTXA 1GNHA 2EXKA 2P3IA 3DKQA 4EWDA 1G9AA 3RYCB 1PK6A 1W9SA 3POIA 5KHHA 3N7JA 2HFEC 3WHUA 1PM4A 3DN7A 3I3DA 3W5MA 3ZYFA 5FXZA 1OCCC 1JN2P 4Q20A 2J22A 4JX0A 1N33B 3ZSKA 2WO3A 3SJAC 5KAFZ 2VW0A 4B1MA 1RIRA 5FZHA 4B4RA 2EXJA 3WFVA 2A3QA 3KCYA 3RZKA 3NMBA 2Y6JA 3WP6A 3ZR6A 2YIBD 3ZN5A 2JG8A 4XAEA 4RFT0 1REDA 4XMAA 2XJPA 5IJRA 3RZZA 4PA4A 5FZKA 2OZ6A 4G28B 5GZCA 3VBFC 1RUI2 2TNFA 3KGZA 2ZNJA 1AR62 1RUH2 1NQJA 4CS3A 4X1KA 4Y22B 4JGZA 4AFAA 5ABJA 4D6TH 1W9WA 4OI4A 2YU1A 3B7MA 1TEIA 5ISLA 4DR4B 2QKDA 5GLVA 3JXSA 2Q7GA 2C4XA 3U75A 2W95A 4GKYA 2JG9C 4XXPA 5LASA 2YEVA 1Y9MA 3UYJA 5DXDA 5IYZB 5LBCA 4DV3O 3OE7G 1R1ZA 1VQKV 4Q4W3 3H8OA 3I2FA 5CFCA 4WFGA 1W8UA 4XQWA 1JA8A 4AGGA 4AG4A 4AHCA 1A78A 4ZOLA 4MTFA 2VECA 2HJFC 4Z1VA 1GANA 3CCJV 3JASB 5FY8A 1PVC2 2ARCA 2QDRA 1W28A 5JDBA 2W5FA 2WO7A 1L0LH 4AI3A 2IJKA 2P7TC 3JD72 3O1PA 1COV3 2W6IG 2PHUA 2VY0A 3S7IA 4LF4B 1AJOA 1TZOA 4HPKB 3C3SA 3WSOA 2WWWA 5LCWL 1Q5OA 4D94A 2ZGLA 1UY1A 2HKOA 4MW3A 1LEMA 4JVAA 2J1TA 4IGPA 4Q4W1 2DWRA 2MEV3 1IBLB 1Y74B 3WF4A 3O14A 4HN1A 4DRXA 1W0OA 3VZOA 2P17A 3L73H 4N21A 3FKSG 4S2HA 1F4HA 3EQEA 1WJZA 4RWUA 5C8CA 3URFA 2N05A 1K73W 4Y1XA 1DHKB 5FZIA 3C3TA 1DQ2A 2PAMA 5B4NA 4XFGA 2DYSC 2AZ2A 3PVNA 1D0GA 3AP9A 2VZ1A 3JYCA 2QM7A 3JBG2 3WV6A 4FIPC 4J25A 4I7ZB 4CC5A 2NLRA 1RUE2 1TME1 4QX8A 4E4HA 3BVOA 3JD2A 5T5PA 3M8AA 3D8CA 3HKCA 2Y34A 1NS1A 1W6NA 2KG7B 2XG3A 1YZBA 1YJNV 5AVPA 2EBOA 1L0NH 2MEV1 2H0VA 1W6OA 2D98A 1NUKA 1HXS3 4LBLA 4JI6O 2M6YA 4MVSA 2DVAA 5C3PA 1LCLA 1K5QA 2FCTA 4JV5O 5KLVH 2ZE8A 2W92A 1VAVA 4JTNA 1N3PA 3L2HA 4D6RA 1GH6A 2E32A 2X7RB 4FPYA 2WZ8A 4QQPA 3VBUC 4LO5B 3OGGA 5EK0A 1QJFA 3LD8A 2Q4PA 3SNMA 3HOBA 2EIKC 1WA8B 1SLTA 3JUUA 1O6UA 1N36O 4IE5A 3E5QA 2QGNA 5CNAA 4QIWF 2ZE7A 3IT8A 2H0BA 2F23A 1VQMV 2P37A 3HNYM 1UZYA 4IEPA 3RI8A 4A7YA 2Y26A 1NYWA 2Y6FA 3GBFA 4JGSA 4KBBA 2ZGPA 4I0BA 3ZKUA 4FPKA 4L97A 1ZA7A 4GKKB 2VZOA 1OQEA 2ZGRA 4ZONA 4FMTA 4JDOA 2ARAA 5DECA 3THPA 2WNUA 1D0HA 3L75H 2WLNA 4YIOA 1NTKH 4XBQA 3RJ2X 1YQ6A 1PO11 1WWYA 2CTQA 4OHWA 1QEXA 4O65A 3B2EE 1ZRDA 3N35A 3TRSB 4NKGB 1B35C 1REFA 1UQXA 5BMVA 3SPIA 1IZ3A 3PTYA 3N2KB 3J7NA 2K0GA 3PJYA 2JGDA 1J1TA 4OZOA 1WB8A 3AK2A 1QCEA 3T0DA 1FFTB 5BR8O 2IVJA 2CTRA 2HWC2 2WA4A 1ULDA 5JAXA 4BA6A 4DR1B 1YCIA 4I09A 2A6ZA 5FQ0B 2R9AA 3VKOA 1ND3A 4YG6A 1LGBA 4W6WA 3H0OA 4W65A 1SF9A 5H9CA 1W03A 1Q6IA 2PELA 1VIBA 4AHWA 4QQOA 3ABTA 1A32A 1GN4A 4OI2A 5JLVA 2WN2A 4TXWA 3LEGA 4K21A 3ZYGA 1LOBA 4LUMA 3I59A 3VGIA 1TUBB 2D3RA 5JOZA 4E2LA 2FMYA 2PMWB 4X1YB 5EXOA 3FHIB 3IPVB 4FPEA 4QGNA 1FMD1 5C3QA 4S2DA 1PVC1 2CAUA 2CSGA 2IXCA 3IGAC 3EB7A 3KT1A 3CD6V 5EYPB 1H4HA 3HKEB 2VQEB 2F95B 4X65B 4UFKA 1O8PA 3T30A 3K46A 4OYUA 3M99B 4CRQA 1F9KA 3JSLA 4WVMB 1A8MA 3MFCA 5B1NA 4LFBB 4IETA 2BNMA 4LC1A 5FQ0A 3CEIA 1O4YA 2R0FA 2V4VA 4AI8A 4BB3A 4BMBA 4FLTA 3LEIA 4JYBA 1MMMA 2X10A 3J7HA 4QB1A 1PIV3 1HRV2 1AR4A 2IJHA 1EAH3 5CBGA 1KMIZ 1XBFA 5T50A 2JGDB 2ZGUA 2Y6KA 3PNAA 5FPBA 3SCGA 4L8JA 1QR8A 2WKKA 1O3TA 1UPSA 5F5QA 2P3JA 2E63A 2FDFA 2WFF3 5LGTA 1KXGA 3FAVA 3APOA 1S0FA 5LHHA 1R081 1RB8G 3ZPOA 3JCIA 2GALA 4IEWA 5IYZA 5LK5A 5KAIZ 2FCVA 3GJBA 1KD7A 1C3HA 1JYWA 4EN8B 4E4EA 4NROA 4DUYO 1FOD3 2ET7A 4EKWA 3B01A 4QHOA 4MO3M 3Q4HA 4MG2A 5B1AB 2XAJA 3CCSV 1WLCA 3C7GA 4YLZA 4GYCB 4G9SB 1FV3A 3U78A 2NYYA 2J1VA 3BYWA 1M93A 2RJZA 2QQVA 2A06H 3H01A 3ABMC 1SEFA 2DQ0A 2VXRA 4JV5B 1BT8A 4LA2A 4JTCB 4N9IA 4R4XA 3AL6A 3PMEA 4AEDC 2XOMA 4JQRA 1LR1A 3VBRA 1X82A 3CDZB 4Q0PA 1XNBA 4CXXA 2XAQA 3JBG1 3O7OA 2GNDA 1DCSA 4BZ4A 1WZXA 1PM7A 2EIMC 4KUMA 3CJXA 2BVBA 2W0XA 5JZGA 1HDKA 2YEVB 1YJ9V 1HB3A 2FD8A 3E8GA 3KLSA 4NHLA 5F8PA 4OQ9A 3ZFEB 1XB9A 3G80A 3MIFA 3W21A 1AR91 3TJTA 2ZX3A 4HETA 5LL6Y 3SC7X 4A2UA 4B3SB 2A6WA 4XUQA 4I02A 1TMF2 3W7TA 5FYBA 2VWKA 1PGL1 1SMVA 2VL4A 4B4PA 3K9AA 2A3WA 4UBHA 2BGOA 3EJKA 3JATB 2XL9A 1X8EA 2W1QA 1ZBA2 2ATKC 1EZJA 1UPGA 2VZSA 2WZR2 5LP6B 2Y8KA 1ENVA 4QDSA 3BODA 3JALB 3RVYA 1BK1A 4I50A 3I2IA 1AR71 4QT6A 2D6KA 5JMCA 1JH5A 4A45A 4MGTA 2P22C 3ZMUA 1GU3A 1WUVA 2AH2A 1D4M3 1DF4A 1UX6A 3JARB 2C5DA 4NAOA 3MW4A 3FN9A 4FFGA 4OULA 5LW9A 1UJWB 1GQGA 4Q27A 2B5UA 1UW8A 3IAYA 3VHPA 3CCQV 1NCRC 1LTEA 3B9IA 4IV3A 1R1A2 2W3JA 1S5HC 5IW0A 4XFCA 1CPYA 4S2GA 3HKDB 1OCOB 1XHZA 2CY6A 2PHXA 1RHI2 1KITA 4XABA 2JDYA 5FYIA 4XBNA 5AVAA 5BNOB 2WSSG 4LBQB 3RZMA 4MOAA 5KXDA 3OY8A 2YXHA 4CDQC 1NY72 2P67A 2ZM6O 4NHXA 4DQAA 4AAXA 4DR5B 5JSRA 2GZWA 1KP3A 5JH7A 2WS93 2HWD2 1KDKA 4J7KA 1HXS1 2GP3A 1O9GA 4XAAA 1S5JA 2BU9A 2VMFA 1FOD1 1GBGA 2VVDA 5FO8B 1LHVA 1VRH2 1AB3A 2ZEWA 4Z82A 3B9CA 2XUMA 1AR73 4FXGB 2D93A 4WBBA 2JDIG 2XVKA 5FJHA 2A6YA 3IMMA 4E2GA 1K4DC 1W2TA 4AEDB 3ETEA 1X36A 4AF9A 5IK8A 4L2NA 2PGGA 4P14A 5BZBA 5I0RA 1FPN1 3E6BA 3RZGA 1GFF2 4ZI7A 4C7UA 2EIGA 3RYKA 4QXKA 3ZBHA 1ZRCA 1LOFA 3KCXA 2WQ8A 2RR12 4YFWA 3JARA 5ERLA 5D2AA 3W7XA 5IY5B 1WBLA 1XQNA 1OD3A 3I56V 1BXHA 3ABLB 4K40A 1VBE2 4Q4V2 4BK4A 4DUXA 1GSLA 2KD7A 1AR93 4BU2A 2XHKA 2QE3A 1UIJA 1F4NA 3FYEB 4B3RB 3EFFK 3AK1A 1KS5A 1AR83 4LF7O 3QO8A 5FZ7A 2JD4A 4X8PA 4DV2B 1VF5B 3PVEA 5I93A 1FXZA 1N1SA 3W9AA 3RDIA 5E79Z 4JKMA 5DUUA 1XE7A 5EZWA 3HKDA 4JZ2A 4FLYA 3OSDA 4K0KO 2RJKA 1E5RA 2F93B 2VH9A 3AMMA 3AXEA 3PUSA 2W08A 5B66Z 1SLBA 3UK9A 3W5NA 5CBLA 3D4KA 2J7MA 5FY4A 3OPTA 3DPRB 2Z69A 1Z78A 1QLEC 1I3HA 1VF6C 3RG0A 3KGLA 4NIDA 1ZM1A 3HKCB 4XZUG 2QWRB 4JI0B 3Q8AA 2CV6A 2EXIA 5FK8A 2DU0A 2HP8A 2ZHLA 2OCCC 1EPZA 4NVPA 1JOJA 4MVZA 3G6EV 1UX7A 1HDJA 1ZX5A 2CTVA 3ZMSA 1GAXA 3UV9A 1WB7A 2CHHA 4RO2A 3THDA 4KG0A 1Q6HA 4DR4O 4R50A 4DV5B 4N43C 4Z2WA 1VRBA 3WU2Z 1V6NA 4RHV2 4IV3B 5FUIA 4WFBV 4FTSA 2QKSA 1W8TA 2LRPA 1MZ6A 1YNAA 3ABKC 5JSPA 3ZN0A 1H9WA 2MNGA 2HEVF 5J96B 2O57A 5FFOC 1AF9A 1NKGA 3IPVA 5T52A 3A0RA 5B1AC 2Q0OC 2OKXA 2UXDO 1AR72 1GKBA 1JZ2A 5KA6A 3V56A 1MS4A 1S0GA 2AW9A 2W94A 2HHHO 4EV0A 1C5IA 4OFGA 2VOWA 3QO7A 2VULA 2IZWA 2YB7A 3VKMA 1DTOA 2VMEA 2C24A 4F8AA 2BQPA 1RMU1 3MIEA 3E8BA 4NN0A 5IAVA 2ZDIA 1RUE1 3MIDA 3CJHB 3WNNA 4N23A 4OX9B 1EBOA 3ZIWA 2PYJA 1PNGA 4FLUA 1SFNA 2EX3A 3INAA 4LBEC 2GMPA 1WA4A 1U5YA 2UXDB 5BPXA 3I4IA 4I3GA 1LNQA 1W3XA 3J8F3 1VMFA 2VO5A 1NVPB 5DG2A 4YVSA 2ZX2A 5TSWA 3RYPA 5C4WC 4LF5O 2QWQB 3C8XA 1XNQO 1YUDA 1MA1A 1PK6B 4C1XA 2K9PA 3K57A 1VJ2A 3SCFA 2GMMA 1U0AA 2R043 3U10A 1O59A 2Y6LA 4W6XA 4DR7O 3EMRA 5A2QN 3ZRSA 4GAZA 3K79A 4MVQA 2I45A 3ZVXA 2GSYA 1DP0A 3KD4A 1R082 1K7DA 1JMKC 5EJ3A 4Z07A 1BGYH 1W0JG 1AILA 2E76B 3ELNA 4YM2A 5C8CB 4JYYA 2ZEZA 2ZT9B 4M3CB 1YSCA 3H1IH 1C8M1 4MH0E 3OBRA 2HKXA 3BI3A 4ZPIA 5APAA 2JIZG 2QDOA 4MGSA 4BPZA 2VQFB 5KHIA 4LULA 3K4AA 5CFCC 2Q7HA 4YZ3A 5LGNA 1AR63 3VQWA 2OPKA 4EE2A 1UFIA 2AR6A 5J2TB 4WVWA 3A0HZ 1V55C 1CPNA 3LEMA 3RMYA 1JQ0A 3N2GB 4O9GA 4UW4A 4Q0UA 1D2QA 3HNMA 3ZX6A 3PLQA 4DOUA 1DBNA 4X66O 2ZHKA 1SC5B 3LFMA 3JALA 1HJGA 2OZJA 1HV1A 3GZUC 3LWCA 1WCDJ 2VQ0A 4J10A 5AC92 4H7MA 4NXNO 4YY3B 2FL4A 2A9HA 4YVWC 2XLGA 3HMYA 4X20A 2RN9A 2QQUA 4O4JB 1SETA 3POBA 1M57B 2LW1A 5DPNA 3HKBA 1N8RW 4ZBMA 5F3IA 5FZCA 1ENRA 4PLNA 3KF3A 5A7OA 3M3CA 4CH5A 4HL0A 3JATA 4LOSA 1QIQA 1NCQB 1T5EA 3NVCA 4QXHA 1OVPA 3TNPB 1QOSA 5J2TA 5C8CC 3VBSB 3LUTB 5T54A 1IG3A 1OPMA 2FDHA 5IUQA 5A7PA 1IHMA 3SGIA 2Q1FA 3ZHVA 3LF7A 1Z0HA 2WINB 4A41A 1XC6A 4OQ8A 2Y0IA 4IERA 5C9AB 2WYFA 1IX9A 2QM8A 1QU0A 3O1TA 5KWRA 1K5MC 4PDWA 4EROA 1ST8A 2R30A 2E7TA 5CIRA 4QQ2A 3FMGA 5F32A 1KJRA 1ULGA 1LENA 1ZZ7A 3LZZA 2JWPA 3IDAA 5FLJA 2BTQA 2RS13 3NNLA 2PFWA 5CA1A 4EN7B 3OW2U 1RYYA 3B5LB 1NE4A 1JYNA 2R041 1IXBA 1PVC3 4IYIA 2PLV2 3DYPA 4HLTA 5FZGA 4CP0A 2ZHNA 3ATGA 4MXWA 4DB5A 1UZVA 1FMD2 3LOIA 2BTOA 4HNAB 2AZ0A 2VXJA 2LGWA 2QBXA 2VC9A 3BIEA 4A3XA 2YC2A 4YW7A 3JCZA 4UXNA 4FT8A 4Q5OA 4FPLA 2VMHA 3K4DA 2A71A 1GN3A 1SESA 3AFKA 3U4SA 4P5YA 2ZINA 2A7AA 2GH8A 3E5UA 1H2MA 1MNGA 1NT0A 3E8FA 2W47A 3UGGA 5F5IA 4O4LB 4I01A 3M1HA 1QQP2 5FCCA 5FY5A 1PZ9A 3T0BA 2JKBA 4HBNA 2P3YA 4HK8A 2R071 3MF6A 4DYLA 5C5TA 2IJIA 4LO7A 5LOVB 3ASNC 2C0ZA 4Y1ZA 2FCUA 2YICA 3I59B 4D7YA 3JCUZ 1BQPA 3GZAA 1AXKA 3NL1A 2L6LA 5C6CA 3ME2A 4NXMO 2XONA 2A6XA 2ZX4A 1LHWA 3MZHA 3H1YA 2V7QG 1PNFA 3VD4A 5J09A 3MHSC 2WT0A 3BALA 4EFEA 4YZ5A 1SFPA 4JI6B 4Y1UA 5IWAB 3DV8A 2VCCA 5H5NA 2BP6A 4FJCC 3UL2A 4NB5A 1URXA 5FYZA 5D5QA 5IVEA 1RL3A 4RS5A 2CGPA 4PELA 1AI4A 2VMGA 3WEZA 1XMOO 3MF9A 4CDUC 1F7YA 2AC1A 3WQ0A 4D6SA 3SCHA 5GZEA 1VIWB 1ACCA 4LKEA 1STMA 1QHDA 2BV4A 5IT9N 4CUGA 2E3CA 4K7JA 4RD7A 3FYIB 3U14A 5DABA 1FFXB 3LIHA 2VGDA 1VQ4V 1DLLA 4OPAA 4HSLA 5FYVA 5BV6A 5FZMA 4RL7A 5BNOA 4RQPB 1PVXA 4ZU7A 4YPJA 3H3LA 3ZXGA 1SBEA 2RR13 4LKSA 2IFRA 1PX4A 1V6OA 4QPKA 4AFDA 1DQ4A 3RRDA 2R7EB 1NT2B 2F4PA 2FDIA 2ZXQA 4FTBA 3JQXA 2YY1A 4IE0A 5IWFA 2OYZA 4CZSA 1J83A 1QNMA 3WG4A 3D82A 3BA8A 1BLZA 3GCXA 2RMKB 4JI5B 1OFSA 3BTXA 1O7FA 1O3SA 3OGVA 4OHYA 1SPPB 2X29A 2PQQA 4BIOA 3RW0A 3AKQA 2QZ3A 3T2QA 5L7OC 3FFQA 5SV5A 2R063 1YLLA 3VN4A 3LIGA 1G7YA 2A3YA 4X1KB 4Y22A 2UY9A 2ZA9A 4Y20A 3FB6C 4LLOA 4GWMA 5H9QA 4CEWC 1ND3B 1CAUA 1FPN3 4HNAA 3A2FA 1LR5A 1XEQA 2ZPXA 4OMDA 2KKWA 5IAXA 4KL1A 4XDOA 3SR2C 4UCSA 2Q4SA 1BEV3 1LU1A 4P9OA 1Q8QA 1SZTA 4QKFA 4WV8A 5LXTB 5FBZA 1WMFA 1L7LA 4LE3A 3ES4A 1B3QA 2R49A 3ASOB 4L92A 1SLAA 4QKDA 1JI6A 3M2MA 2WZEA 5CISA 3H1MA 2V4DA 4P02B 5L19A 3ZXKA 3VL9A 1EV12 1Y67A 3AG3C 3QLQA 1NR7A 2QWNB 2BOCC 1QBZA 1JYCA 1N1TA 1G8MA 4R6ZA 5FZLA 3TB0A 1W2UA 2JJ6A 1RP3B 3MDSA 3AG1C 1IS3A 1GRJA 4O4HB 2NN8A 1NZCA 4YRDA 4CDXA 2HJDA 1MPXA 4BQXA 4PDRA 2W2IA 4IGQA 3F7YC 2CH7B 1NR1A 4D69A 2VQUA 4AHZA 3CXCU 4MVRA 2QR4A 3CYOA 4HVQA 1MS3A 1KB9F 3K5NA 1WN7A 2QQLA 3WNPA 2LJ2A 3ABUA 3IC9A 3CNAA 2BCCH 1UZ0A 3MUZ1 1SS3A 4BW9A 3WUCA 3HWJA 2AGSA 4MZUA 4LFAO 1RUJ1 1BBT2 3C7HA 2OQ6A 4XZPA 2QSAA 3ZSJA 1XRUA 4XQ4A 3USUB 3KSCA 2KM2A 4W50A 1NA1A 2UYAA 5FP7A 4O61A 1HB4A 4D3WA 4B3RO 1S3JA 4UVCA 1I9RA 1M1KW 3K4ZA 1WMDA 2D2CB 3PVOA 3SISA 1PO12 1DYOA 2YDEA 1AJQA 1CR7A 2WLPA 4GKXA 1V9U2 3DPRA 3GWOA 3TETA 4UV8A 5C9AC 1DG6A 3HB3B 3PTRB 2X05A 1CONA 2C9AA 2LM3A 3AX4A 5JXJA 1L7RA 1ODNA 1VBA3 3GHMA 2HWE2 3AP7A 4QM8A 1UU4A 2JXAA 4YW4A 1HV0A 4BXFA 4HG6B 1UYXA 5BNQA 4U2AA 1E79G 5G04L 2EALA 3KG2A 4KU7A 1UZWA 3QTCA 5LWBA 3WCSA 4AHYA 2VPVA 1RUD1 3L9JT 4CCEA 3GF6A 1COV1 5FZEA 3CCMV 4GULA 1YQ5A 4OZXA 3PUQA 1NKDA 2WNOA 2XBO1 4LF5B 3T2PA 1R091 2VQAA 3TN91 4XHXA 3NAPC 3JQWA 2LTNA 1FD9A 2W1UA 5L3EA 3S30A 3K3OA 2ZS6B 2TBVA 1DF5A 3LNMB 1NCRA 3PUHA 4NIAA 1SA0A 4IV3C 2QE7G 5IATA 1C8M2 3DYOA 4LP8A 3ZSMA 3ZN4A 2ZQMA 4AFMA 4KNCA 1VBB1 3CMGA 5LMUB 4UAPA 2VTFA 5M0TA 4FFBB 4XFAA 4XQDA 5B2GB 4CDQA 4XILA 2BWAA 1JU4A 4K8ZA 4TV9A 5FL7G 3KZ4C 1YFUA 4J42A 4JC1A 3AMPA 1S55A 4AGVA 4LBNA 1WMXA 5LY2A 4PQQA 5LOVA 4FPOB 4AR2A 4XFIA 1HN0A 3LOBA 2ZMKA 2JDKA 1WLDA 2QKCA 2OYQA 3VBUA 3A21A 4RFRB 2QQOA 2VZPA 5FY1A 2PF4E 4NYKA 5C8YA 5L9BA 2HVKC 5FP8A 5CB4A 4BM8A 4UV9A 4LMFA 3ETPA 3O1OA 1DK1A 2JGUA 2P6CA 1RUOA 4IESA 5FIXA 2DCJA 1QHTA 2VCAA 3S5QA 1NOVA 1WD3A 5JXIA 1MS5A 3SKJE 3FHQA 1GR3A 4CXYA 3HR9A 3ZFFA 3RZHA 5AG2A 2O8QA 4HOOA 1D2DA 1OBNA 1HN1A 2WNUC 1HW7A 1ZZBA 3WDWA 1BBT3 3POJA 4PBPA 3HBKA 3WG7B 3OGSA 4DW1A 4QDQA 5FP9A 2ZGNA 4KWUA 3T4HB 4OVEA 2XGXA 2WO1A 1ZZ6A 1VEWA 1W8OA 2B1GA 4LQRA 1QH6A 4TWTA 3NV4A 3W59A 1Z7S3 1YQ2A 1Y3TA 3LEKA 4YW6A 1QOOA 2RV9A 3UCSC 3B77A 1D7PM 2VZRA 2B4KA 4GA9A 4CTEA 5K0UB 4IE4A 4NAMA 5GZDA 4NTXA 1Z2GA 3RQ0A 4FSJA 3QH6A 2Q8VA 5D5PA 1J58A 4N7UA 1N34O 2WWJA 4UCVA 5KX5A 2BFUL 2X8KA 3WNLA 3KHBA 1RFYA 2AEZA 1IPJA 1H1MA 4HXCA 3S6PA 2WDBA 1PD3A 5FPOA 5GZFA 5FZ1A 3H1HH 1NE6A 5F7UA 3R6SA 3RYHB 2EZPA 3ITQA 4W4KA 3IBMA 5LYJA 2ZE5A 3OEHG 1Q81W 5CA0A 1V6KA 1DGWA 4DV1O 3N9MA 3MW3A 4YSFA 3MHHC 3WW3A 2UYBA 3THCA 3CZJA 1C57A 1DLCA 4ASUG 1QJX3 1SA0B 4UOJA 1BHBA 4N8MA 5DUWA 3HAGA 3BOWA 1XU1A 3I54A 1PL0A 2FDGA 1M56B 2AENA 4YGDA 1ODMA 4HYOA 3WXPA 4V2WA 3WNXA 3ON7A 1G9BA 3LDEA 4TLFA 1QJY2 3CLPA 2XVLA 4DR6O 2WYSA 1J59A 1LOEA 1Q8PA 3HIFA 3SITA 3UM7A 3HEIA 2PAKA 3L71H 2CDOA 4LF9B 2YUAA 2UXNA 1UL9A 2XB6C 2ZM6B 1S76D 4I2OA 1ZA4A 3H9VA 4C91A 3OM3B 4FFFA 4LBKA 1YI2V 4H3WA 4UF0A 1V54C 2ZDIC 1ZL8B 1FNYA 5FZBA 2O0OA 4ORFA 1JYIA 1UOFA 3RVZA 2DFBA 4C90A 1RUF2 1YC61 2XJVA 1NXMA 2WABA 3OTOO 3MGUA 2WN3A 4QPWA 1PP9H 1L3JA 3ASIA 4KMQA 1HQLA 3KM5A 5H6QA 4OHZA 4YVSC 5EYYA 2A79B 1ZWIC 2P90A 2YV8A 2JKXA 3VBOC 2FZ2A 3T1MA 4XJ8A 3ZCCA 1U97A 4RN5A 4HN0A 4FQZA 2P06A 4PDVA 3KQ4B 4LHSA 5KBFA 4CUAA 4XXAA 3D3IA 2XJRA 4B1LA 1QWRA 2Q67A 3K51A 1DIWA 2BTQB 3CE2A 5KUMA 5C3SA 5C3RA 1NH2D 1HRI2 1XE8A 5AC91 4FPHA 3O0WA 4OCTA 4TUYA 1XU2A 3VBRC 1QQP1 3K3WA 5LP6A 1GOFA 1ULCA 1RVF1 1UOGA 4XFBA 1CGPA 3WQ7A 1WLWA 4URTA 2HHHB 1UMIA 2FZ1A 1JYTA 1XNRB 4COWA 4K3AA 3CP1A 4WZCA 2RE9A 3UKTA 4ET7A 1QJZA 5IYBO 5B3SB 2DUPA 1SQVH 1YITV 4N53B 3PUIA 1KC8W 1FATA 1D4M1 3ZMTA 2NM1A 1YJKA 4D7TA 4AWDA 4JTAB 2A73B 4QX5A 4A6SA 3ZIXA 1PGSA 2VNGA 5CAZA 3CX5F 1NA1B 1WW5A 1R64A 5FY0A 2RM22 1JW6A 2E53A 1XHXA 2W6JG 5L3GA 3SH3A 5A1AA 3OUSA 1RUG3 1W06A 2PHDA 5FYTA 2RMU1 2JE8A 3GALA 3MO4A 4YVSB 1YHQV 2DUQA 4XETA 2ZKLA 2N7GA 4J7JA 2EILB 3KF5A 2ORZA 5EYPA 3FLTA 4MX3A 3TN93 4UUJC 2XTAA 3OBZA 4FPCA 4GXLA 4Y20B 3BTYA 1JZ8A 1AI7A 3WQBA 5FZ9A 5JH7B 1CAUB 5IY5C 3OPZA 2VG9A 4U3JB 3ALQA 3VQXA 4K3UA 3AKRA 1O3RA 1ULFA 2PLV3 4GT1A 4QGPA 3VQVA 3MPBA 2JE7A 5E6HA 4XJAA 5L3BA 5JMOA 5KMGB 4A42A 1WGPA 2VZTA 2WJSA 1W8NA 4D8MA 2XJSA 1MSDA 4XPVA 1ZBA1 5FP4A 4AI9A 2JE9A 4LIUA 1TME3 4CPBD 1ONAA 1WCSA 4NRPA 5CKMA 3TYJA 4ES9A 3O1RA 4JYAB 3CCEV 1G6NA 4QU2A 3ZO0B 2B1IA 1Y43B 3K3NA 1LNSA 1BVVA 2FBEA 3IJ4A 3P1IA 5K7PA 2WSVA 5LB6A 4GWJA 2F4VB 4OXSA 1LOGA 3H3ZA 3BCWA 4FOQA 4HAMA 3IDCB 1VQLV 1D5NA 3OUHA 5GM0A 2BSKB 2DV9A 5H2FZ 3M4FA 1ENXA 4HKWA 2Q5ZA 4IV1B 5IT6A 1UXXX 4Q1PA 4COYA 1XMQO 4ZIBA 1H8TC 5J9PC 4YYOA 4CU7A 3NXSA 3ZHUA 4DR2B 2HWC3 3ZXDA 4K8XA 3ZSLA 5IJ0B 3RYIA 1NY71 4LFCO 2WFF1 2RCVA 2UU9B 4MYEA 3JBG3 1OA2A 5KC5A 2CDPA 2Y69B 3HBZA 2SBAA 3K5LA 4MV2A 4URAA 1HNZO 3X2QB 2DTYA 1YJLA 2CE4A 1PIV1 3MW2A 5F5CA 2UWAA 3B09A 1V6LA 1VB2A 3FL7A 1SQPH 3ZHSA 2XT9A 4LO4B 4EWAA 4UI9L 1X33A 4O2AB 1ZRFA 5JOWA 3AG3B 1CZTA 2ZR3A 3ES1A 3WF3A 2BWCA 4GMP3 3JU9A 2JEUA 1IS6A 2G4IA 5IJ9B 2BSKA 1VMHA 4A6OA 4QKBA 5GLWA 1S72V 4TZDA 2OX0A 3N9PA 4BIUA 1OCRB 1KECA 5FUNA 2LFRA 1V9U1 2G38A 3LDDA 2IXHA 1H9PA 1VQ7V 3OT7A 4N43A 1R3JC 2ODMA 5EJ1B 1PGW1 2ZZJA 3D36A 3I55V 4DUVA 4B3MB 3IDBB 4IHJA 1MVEA 5FO9B 3N7LA 3RWRD 1PNKA 4K8RB 1R092 3EBRA 3QNEA 4JI3B 4JI4B 2OXBA 1F4MA 5A3LA 1S0VA 2UU8A 1M4WA 4ZKIA 2UWBA 3JZVA 4YJ3A 3AG4C 2ZGMA 2BDRA 2Q9LA 4O2AA 4LHNA 1VF6A 1KBHA 4BLJA 1JXNA 2B9VA 5FR3A 4LF8B 3VD9A 1AR92 4HFSA 5HPOA 4JI8O 2C9KA 3H8RA 2P4EA 4JKKA 2JS5A 4IEOA 5FV3A 4X6RB 4Y3OA 1HW5A 3N7MA 4HMZA 3T2OA 3UGFA 4IEUA 4MGQA 3WNMA 4LWSA 3HN1A 1TAEA 3W7UA 1G4YB 3AKSA 3WUDA 2Q7EA 3J9SA 4UCTA 4ZZ5A 2ERFA 4CDXB 1M06G 2WPDG 5EWSA 2JB4A 3LDKA 1SLIA 1IOAA 2JG8C 1ZUQA 4NIHA 1JZ5A 1X9TA 1WCQA 2BOBC 5CB4B 1AYM3 1CWPA 5FXXA 3CHXA 4CU6A 1LB2A 2WL1A 3VBFA 4JTDB 4J1WA 2DDUA 2JB8A 1ROPA 4CDXC 1N0NA 3I5DA 1OT5A 3FBYA 3K58A 4WBNB 4QWNA 4ZKTB 2NQYA 5CFCB 2X5IC 5DAVA 4J6GA 1QQCA 4CCCA 2WLMA 1JUIA 2JVDA 2VMIA 4AVVA 2ZXWC 3S0MA 4GUNA 2NLJC 2PXJA 3RZLA 4TSFG 1U5ZA 2MK3A 5J1XA 1CZSA 3IWZA 1GM8A 4NOTA 4WM7C 5F2WA 4QX7A 4NIIA 2V5DA 4TQFA 1JX9A 2G9FA 2EJ7A 3AKPA 2VM9A 4JYCA 4OUEA 1NA1C 2R042 2FKXA 3POSA 5EC2C 1H30A 4FP2A 1O9HA 3VDDC 3RT3C 3B94A 3Q8EA 4E8CA 5A6ZA 1GQHA 1HJFA 3MV11 3UT0A 3MD0A 4BHPA 3K06A 3R4DB 2W46A 2V4AA 1C5HA 4M4PA 4JGYA 2P5BA 4MSWC 3N4MA 3VDBA 3Q9OA 4EEQA 3JAKB 3OMIB 3AVRA 1Z7S2 2AACA 3J7LA 1ASJ1 2G9ZA 1OJHA 4YVWA 4HVOA 3I2HA 5GONA 2Z0AA 1JCHA 1SQXH 2KQXA 3LDRA 1QXPA 1QJY1 2VAUA 4RGGA 1QVFU 3EXUA 2I74A 2C1FA 4PLMA 2BW8A 4GJYA 3ZYIB 1W6MA 2CAZC 2W1WA 4FQ4A 1W8WA 5IK7A 1NQDA 1RGSA 1LUVA 2PYTA 4YW5A 4PJYA 4XACA 4CEYB 2EULA 1R3IC 2D97A 2AGAA 4JPRA 2JDPA 4XHBA 5J3UA 2QQMA 1S0IA 1V54B 1CIWA 5DUVA 1QF3A 1Q90D 1FXVA 4W4ZA 3OGJA 4Y5Z0 1YRZA 4TV8B 4D6QA 5E88A 1UOBA 2Q1MA 4QNHB 4LTAA 1W2BU 1O5UA 1OPOA 2F17A 3N9QA 1MACA 1VQ9V 3DC6A 4MS2A 2EA7A 4A5UB 5CMUA 3AC0A 5FMOL 4NHYA 2EJRA 5J7MA 5A1LA 4QPIB 1MVQA 4O2BA 4D0QA 2E26A 1VE0A 4Z8BA 3MIHA 1QNYA 4GIQA 4AW7A 1OV9A 1WMEA 5GONB 3KS7A 4Q0VA 1ZYBA 2AZ5A 3S3XA 1YFWA 4XJUA 2Y48A 4PF5A 4LF8O 4LF7B 3NNJA 3SQOA 5F6KA 4XMIA 2D3PA 4IEVA 1I08A 4KBZA 1US2A 3DL3A 1H8HG 1IBMO 4CCOA 3BGAA 5JVVA 3K0DA 1AR5A 1H2GA 4E27A 2IBZH 4JI3O 4DNYA 2J1UA 1XYNA 2XOKG 2VQFO 2Z3YA 1CIYA 4LO8A 5I91A 1TUEB 2RNBA 4DZGA 1S0BA 5HCBA 5HCAA 1URFA 4CCMA 3AMNA 4DY3A 4X65O 2BYVE 1F35A 1R083 3N9OA 2JIGA 3WB0A 4P9IA 4LBQA 3RNSA 3FFZA 3I8TA 4GQ7A 2G19A 1O91A 1VAMA 4JF3A 4P9GA 1HP8A 4I30A 1UY2A 4MGIE 1LAJA 5IYDO 3T0AA 3ABLC 2HWD1 4LNUB 1QJU1 4DXTA 3J80N 3ZYJB 1EAH1 3KT7A 3WB2A 1CP9A 1F23A 1PZ8A 4QHZA 3VZMA 3RBZA 2GUZB 1ZZCA 1VBD1 1BMFG 5T3NA 2HH9A 1TGOA 4BQ3A 4XDLA 5H9SA 5F6LB 1OF3A 3LSSA 4AI1A 5LY1A 4Y33A 3ZKYA 3RS6A 2DE0X 2B42B 5J98B 1HRV1 3HKBB 3TNQA 2RHPA 3KVAA 4XF3A 5IJ0A 3C7FA 5FYMA 1S77D 1N36B 4ASLA 5A3PA 1SERA 1T2XA 4HZ3A 2XQXA 3WZ1A 2OUJA 1XNAA 3WW4A 4P9PA 2FB5A 1M5IA 4MGYE 2ZD9A 4CS4A 2MHFA 1L7QA 4PJ0Z 1WD4A 2K1EA 1GLHA 3JD4A 3NNMA 3A0NA 1W6MB 3EHKA 5FPAA 3R66A 1YWKA 3IMNA 1K5MB 4LNUA 4Q8KA 2BTVC 2Z4FA 3O1MA 2VBPA 4RYDA 3BIWE 4GMP0 3WW1A 3VDCA 1AJKA 2UXCB 2VJXA 3AMQA 4COUA 5KR7A 2Y4TA 3AKTA 3AYDA 3VBUB 4IL7A 3ACFA 2BJSA 3T1YO 4I4TB 2ZHMA 4N9HA 5CA1B 5JQGA 3ZYRA 1LUWA 3I3QA 4AVSA 2GTSA 3G71V 1TMF1 3SEEA 2XVGA 4Q6GA 1H38A 1X50A 1VQ6V 2EAKA 2A70A 4JZRA 1Q7YW 5JIAA 4YM3A 2X6AA 2YU2A 1HQWA 1H6XA 4RR3C 4JGZC 5ABJC 3E2EA 1FYUA 1CAWA 1OOPB 3ZFFB 4DR5O 1VBD2 3H1WA 4YARA 2YXLA 4QD2A 1IBLO 1D5AA 4L99A 2LW7A 1AL23 3WNKA 2Z5UA 5T5JA 1ZBA3 1PO13 3CB2A 2QWPB 3FZ3A 5FO7B 3SYCA 3GBGA 2ADQB 2BERA 1CAXB 1SQFA 3J7MA 1J84A 2VE1A 2YIDA 4RUEA 4DEQA 1K34A 4OHVA 3ZLIA 2VZQA 3JD3A 1FMD3 3T1HO 1GUIA 3GWKC 4J7ZA 1H4GA 1QJU3 4Q1RA 4K35A 1UYZA 3HT1A 3OTOB 4Q26A 4OUSA 3AG1B 1VMJA 3S5AA 3CIHA 4XDJA 2VCBA 5LBQA 4AEMA 3VKLA 4ISRA 4XYXA 2ARBA 4XURA 2N74A 3NQHA 2CH7A 4MVOA 1AP5A 4J11A 1QOTA 4AQ6A 3ZYPA 2V72A 4XJ9A 2ITDC 1Y76A 4FVMA 5A3UA 1AR82 1MS0A 4PCRA 2YBKA 3M70A 5HXMA 2ZXWB 4IGGA 3POFA 2XASA 3OD0A 2D6PA 2GP5A 1EN6A 1ASJ2 1ZSPA 4QHBA 1I94B 4AILC 5LBFA 2DVBA 4ARYA 3K9SA 1XI1A 1L1FA 2RMU2 3SMHA 3J4UH 4YVWB 2O14A 5A3OA 1CAXA 3B69A 2DBNA 3U1XA 5FZ4A 2IUWA 2CUGA 4DS0A 2ZX0A 3THTA 4GX2A 4OX9O 1RVF3 3WINE 4AGRA 1XMQB 3Q8FA 3ECQA 2YFUA 4KGQA 4EB6A 1XXNA 3UKNA 4H55A 4U7NA 2IXKA 3JB4C 1VQOV 4YM1A 4RGAA 1G6UA 2R16A 4BQ1A 5CBHA 1W90A 4K1ZA 3WF1A 2QJVA 4QMAA 3LA2A 4GZRB 2E5LO 2VOTA 4TLGA 2OTJV 4HK9A 1V6JA 2JDNA 3X2QC 4M3CF 3SPGA 1GWMA 2PHLA 4XFHA 1HR0B 2ADEA 5GLTA 1THZA 1NAEA 4CU9A 1PX3A 4DV6O 5LEKA 1G86A 3RWKX 5FPVA 4R52A 1YYNA 4XTMA 1NI8A 4UB8Z 2R6QA 3AP4A 3IFXA 3NR7A 1DDLA 1GK9A 4X62O 1OA3A 4UCRA 2D44A 4XDPA 3AP6A 1KU9A 1W39A 4TSVA 1GP4A 3H7YA 5BUVA 3NAPA 4QX0A 2H8PC 1KQSU 1UIKA 1BSMA 3MIGA 3LA3A 4B8EA 1OCCB 3APQA 4I9WA 3O1SA 2YS8A 4PDMA 3MFAA 1WCKA 1XNTA 3B4SA 3J8F2 4R9BA 2ZGKA 1NH2B 4Q0QA 4M0NA 4EWEA 5JCOA 3UJQA 4XIOA 3UO2A 1OLME 2QDNA 4DV6B 3WR0A 4QPIA 1U5IA 2HWB3 5EIBD 2OVUA 2WNEA 3DSQA 3DUIA 5DG1A 2VS0A 5H9PA 4Q4X3 3G4SV 1F4AA 2HLEA 2D3SA 5HXVA 2CDYA 3VBSA 3BU7A 3P3PA 1DQ6A 2X5IB 4JDNA 1DLBA 5F9TA 1AI6A 1O4TA 4BE3A 1YO8A 3QOPA 3N2GA 4OLLA 4EFBA 3WCRA 4PHZA 4AVCA 3G67A 4BK5A 5D21A 1QVGU 4NPMA 2WWSA 4X1IA 2ADDA 3T3YA 5IFPA 1POV0 1A3KA 5LXTA 4PDLA 1EP0A 1KEXA 4AYUA 3IAPA 4L11A 4RQPC 4UB6Z 1XNRO 3H1KH 3IDEA 5LA9A 2BRTA 4IEYA 2CU5A 3E86A 4YGCA 3SPJA 2ZR2A 1W6OB 1APNA 1VMGA 1AP6A 4IDZA 1JOPA 4BCUA 1N4CA 4I55A 4IV1C 1GNZA 2OIIA 4WCEV 1WLEA 4EYUA 3EXAA 4IGOA 4TYSA 4A7ZA 4QPGA 5E16A 2AHYA 4XCBA 4DO2A 2OT7A 3D6EA 1PM9A 4O4HA 3TOJA 3QBQA 2P1BA 5LMNO 2XWJB 3GBWA 1BL8A 2WAAA 1JZ7A 5JPMB 3OJBA 1WA8A 3KVBA 1AJNA 3MAQA 3JD71 4LA3A 5SV8A 3B8NA 1N32B 3G6JB 1XQ8A 4LFBO 2VUDA 2A1XA 3AJYA 3OOXA 2F4LA 2LQTA 2WBKA 3W7WA 3AZYA 1S5LZ 3CQOA 3FUOA 4PA3A 4NR1A 5K4LA 3WG1A 1R1A1 2WC2A 3TXSA 5J2UB 4HVRA 5T55A 1OD5A 3T2MA 4LH6A 1W0PA 1BK0A 3ZRVA 4U3FH 4OI1A 5A6YA 5DAQA 2DCZA 1XILA 2JDAA 4Q4X2 1IGOA 3VBRB 1AX2A 1SRYA 5FBJA 2GH2A 1EAH2 3PIGA 5A1FA 3I3MA 5B4XA 4E8DA 2OUHA 2XJTA 2PHRA 3CKHA 2NP0A 1XUQA 1OURA 4NXMB 1P8JA 2DVDA 4NTWA 4HONA 4A3ZA 4NMIA 3FUQA 3G6BA 4V1PA 1F8VA 2UXBB 2AUYA 2DCTA 4ONUA 4JKLA 4A44A 1N47A 4E4SA 4Y4YA 4ISQA 1YFYA 4FPFA 4GX0A 1NCRB 2AEYA 5KXBA 2BBAA 4Q2FA 3FLRA 1EYBA 4GCZA 5FYCA 2VCMA 1OCZC 3KB5A 4B3SO 3WD5A 4LUKA 3NV2A 3NO8A 2YC0A 1XOYA 2QQIA 4XJWA 5DMYA 1YI9A 3DECA 1SZBA 3GJAA 4B7KA 3N27A 3RYIB 4O7XA 1XYPA 5FZAA 2R1BA 4GZ9A 1MZFA 2GNMA 2A6VA 1AXYA 1SBFA 3BPSA 2Z42A 4JCKA 1MZEA 5B1BB 4EZHA 1ENQA 1PMHX 3ZPYA 3CPWU 4JI5O 2JDUA 4MSVA 2WSUA 3VZNA 4XIKA 2E31A 2MEV2 1RUI1 1QJEA 4MLOA 3CSXA 3O0XA 4YJ2B 1AJPA 2X53S 4LR3A 2CK3G 3H3UA 2ZGTA 4X64O 2X5IA 2G1MA 1AXZA 2P2KA 3U4XA 4FVVA 3W7SA 2RM23 4BWOA 1JR9A 1NJIW 3T08A 2RDSA 2PUSA 4X64B 5H9RA 4H2AA 4AZZA 4QB2A 1PZ7A 4RHV3 4ATFA 1QU7A 4MGKE 5JSOA 4CE8A 1MZ5A 1RUC3 1RUD3 3N36A 3CRMA 3OMNB 3SYPA 4JHTA 4COZA 4UCOA 4Z1MG 4QM9A 4TT3G 4LWSB 3MHZA 3SYQA 3TK1A 5LK7B 3C90A 5IE9A 3G7DA 4K6BA 2DW4A 3R65A 2K46A 4IQPA 4E4DX 1W8FA 2ZKNA 3X29B 2Q1ZB 4SBVA 4RA0A 5DZFA 1Y76B 3LKJA 3ZOIA 3IAQA 4ZY9A 4QB6A 3WDXA 1HLCA 5FREA 2IH1C 5DEDA 1TVKB 2OWOA 1RUJ2 2HWE1 1ZVFA 1V55B 2IJJA 1UY4A 4BMEA 1ULOA 3L9DA 3SH5A 3FLPA 3NJXA 4UT5A 4DUWA 5GALA 2CWSA 2YI8A 5FAXA 3WG3A 4XBLA 2I2SA 4J9ZB 1Q3EA 3TWIA 1X9PA 1VRH1 5K0UC 1VBA2 1AZDA 2Q69A 3VZKA 4RSUA 4GWIA 2YROA 2GDFA 2XH6A 3POEA 5FZFA 4Q0SA 1QH7A 1CVNA 4YHHO 2GC3A 5T5LA 4AI0A 4OGQB 2PLV1 5D8AC 3ZRWB 2QVSB 3CO2A 2YMZA 2VVFA 1GTOA 1NTZH 1W0NA 1RXFA 1VP7A 3H9AA 1RMU2 4G2KA 4JQTA 4XF9A 3KZIZ 3STZC 3FB8C 1RUC2 4N53C 3O5SA 2RVAA 4K9SA 1ZBE3 4JASA 2CTWA 4WFEA 2Y38A 1QDCA 4QX3A 3AG2C 1DFQA 1EM1A 5IDJA 5BXZA 5IK4A 4CS2A 4KWKA 2YIBA 2YBSA 1DGLA 1RXGA 2FYUH 3AJZA 2VR4A 3POYA 1VRH3 4P5HA 1AR1B 3USUA 2WQZC 5EPAA 4DXSA 2QTSA 4QGLA 1N3OA 4Y26A 1W04A 5CFDB 1ND2C 1IBKB 2ZEXA 4Q4Y1 3TEYA 3R4UA 2CAVA 4YW1A 3Q8BA 2WZPP 2BVVA 1FYJA 3AYEA 5FLHA 1LOCA 2V73A 5A33B 1G1XB 5T5OA 1HRI3 1M57C 1CAVB 4NTYA 1NLRA 4MGZE 4QJFB 4BIZA 2A5ZA 5BNNC 1GP5A 4KXRA 2ET1A 4QPIC 4BXSV 1RM1C 3E89A 5BMVB 1JU3A 2WFPA 1EFRG 3CJHA 4X1IB 4C1WA 4WFFA 5DDJ3 3VOUA 5JUVA 1MEC1 2GUZA 1UPIA 2DBIA 4FCAA 1Q8VA 3WDTA 4FLWA 3LGRA 1BYHA 1OI6A 2NPIA 3JAWA 1XNDA 1J5EO 3WP3A 1WW6A 3DXRB 4FLZA 1K9MW 4PIZA 1K3IA 1XL6A 3IIAA 2V09A 3K0GA 2XLFA 2WLJA 4JAUA 3SLIA 3U11A 1I7FA 3PU3A 2F1MA 5F3CA 1ZBE2 2ATFA 2YYOA 1RUC1 4ZHQB 4CEYC 3N7KA 3LQCA 1H8TB 4G3YC 3CC4V 2PA7A 1PNLA 3A7QA 1HWYA 2IM9A 1J1LA 1W3VA 1XSRA 3ACHA 1POV3 1AX1A 1J95A 2HWF2 3H1LH 2XXZA 3GDBA 3POGA 1QY4A 3FC0A 4NHMA 2KXLA 4PD4F 1W9YA 5EIBC 3ZFEC 3KWVA 3KQRA 1QDOA 2Q8DA 4CDWB 4DY5A 2XAHA 1RSOA 2Y6HA 5HCHA 2EIMB 2DU1A 4COVA 2HBUA 5I8SA 1P7BA 5CN0A 4OHXA 5E8AA 3V0AB 2LALA 5CG8A 3ZFGA 5C71A 1B06A 5CB7A 5H6RA 2QQJA 4L8QA 4IEZA 4NWWA 4WVMA 1GNYA 1IQDC 1R6KA 1H8TA 1PMJX 5K8SA 4DUYB 4DR6B 2DVGA 2IC1A 3PN1A 4QE9A 1UN1A 4U36A 1H8VA 1UY0A 2GHYA 4LKDA 1OFNA 1Y9QA 1GZTA 4F3JA 2B9ZA 2F66C 5LATA 4E2SA 3BHPA 2BBVA 1RPRA 1VBC3 2B9UA 2DCYA 1JOYA 1DGRN 1FAYA 2GNBA 2O1QA 4JRLA 2YPJA 1WLTA 4YJ3B 1FXKB 2E75B 1XDCA 4R8CA 4XCAA 2IWGB 3TCUA 4DK0A 2ZAHA 3FWEA 4MTGA 5KC6A 2GBOA 1VQNV 2X6CA 1NBMG 1DYPA 2HWB1 3ZRXA 1REEA 4Q8LA 1VBB2 2W87A 3J7AU 3OCPA 4XTPA 2YFZA 4XFFA 2KG7A 2YHJA 2HWB2 4CP2A 1RC6A 2XKOA 5LRSA 1EV13 2D43A 2QM4A 1OC1A 3ZXLA 4DRVA 4X20B 3LCPA 1HRI1 1P84F 3DEMA 3GZEA 4NO4A 4LJHA 1LGNA 2Q68A 5K1XA 1D2SA 2OA2A 4XBFA 4HANA 2W91A 4J9YB 4EB6B 1UWWA 1AYN1 4MHRA 1SQQH 1R093 1W6PA 2WWUA 3E83A 3ST7A 4DV0O 1FXKA 2XBO3 1GP6A 4YZ1A 4UFHA 5F3EA 1B6QA 3AYAA 3MIBA 5A7QA 1VBE1 2PZSA 4YWAA 1BJQA 4LIVA 3S57A 2V1DA 1O4ZA 3JSNA 1PO23 3LE0A 5EBMC 3RYHA 2VOXA 2R70A 1WA6X 3BY6A 2EIJC 1WAZA 1O8SA 3HQRA 1RUG2 2DYRC 3WLUA 1AYN2 1MR5A 1VBC1 5LA0A 3ZHQA 3CRAA 1RUNA 1JBCA 4DIQA 2ZOEB 4EZ4A 4DV2O 1HNWB 5IWAO 5L3CA 1QR9A 2XJQA 1IKQA 1RPOA 3BCCH 5E1AC 5D8AB 1C4RA 5DN6G 1DZTA 1TE1B 5LZ6A 5LBBA 5HFLA 1RUG1 1FJGO 4AEJA 1GZ9A 4FFIA 3OB8A 3ICXA 3OMAB 4JI4O 2CNAA 4X88A 2GC2A 4AK3A 2PAEA 5ITZB 4AXOA 3OR7C 1ZNPA 4V2VA 1XE0A 3ASOC 5FPZA 2C2AA 1D4VB 1YXBA 1IS4A 3TN92 4P08A 3V0AA 4KQ7A 1YIFA 2HJIA 5DZEA 2RS53 4QXBA 5FK7A 3VB9A 1GICA 4UCUA 2ZJCA 2RJ2A 1KKCA 5K1PA 1IKPA 1VPHA 5L9RA 2VQTA 3FBMA 4BIFA 3ZSEA 3LDBA 5FZOB 5JCTA 3LNNA 2AHZA 3ZN1A 1CAWB 1HIXA 2F43G 3E1F1 4XVHA 1MABG 4DXZA 4GKKO 5BNPC 1AR61 3U37A 5HBAA 3ETDA 3WDUA 5L3FA 5GTHZ 1BCXA 4QKNA 4TQDA 3CBNA 5LHGA 2Z79A 4BLIA 3CCLV 2EIBA 2PY5A 2ZBJA 3VDDA 1H2SB 3NV1A 4RAIA 5KA5A 2NMNA 3HD8B 2D6MA 3K5MA 1QXRA 3DPRC 1EZVH 1F51A 5B3SC 3LSUA 3ZMVA 4JV4A 1H2KA 4GJZA 4I55B 3FX7A 1COV2 1JJOA 1PKXA 5FRAA
chains in the Genus database with same CATH topology
1U5ZA 1UAIA 3CJIC 2R072 4N43C 3B02A 4Z2WA 1U12A 5JI9A 1V6NA 2FHRA 4RHV2 3IWZA 4IV3B 4NOTA 4LHKA 4WM7C 4AQSA 4FTSA 1GZCA 3W58A 1MZ6A 1YNAA 1RUD2 2G9FA 5JSPA 3AKPA 2MNGA 3OD4A 1H9WA 2HEVF 4AVTA 2BPA2 5J96B 2VNOA 5FFOC 1BMV1 1AF9A 3IPVA 2HWF1 5T52A 2D5FA 1NA1C 2R042 1FT9A 1MS9A 4MUVA 4R9AA 1AR72 3POSA 3O0VA 4IEQA 3PVBB 1H30A 2QQPA 4FP2A 1GKBA 3VDDC 1TMF3 3B94A 5HCFA 3V56A 3R0RA 1MS4A 3HQXA 5CU1A 1GQHA 4LNVA 2H6CA 4BHPA 1S0GA 4P9XA 1UF2C 2LUWA 3R4DB 4EV0A 1C5IA 1FI2A 3UKVA 2Z5WA 1IPKA 5KXEA 4QQHA 4OFGA 1AX0A 2ZZQA 3NKTA 1C5HA 2VOWA 2IXLA 5I0UA 2VULA 1RUF3 4JRAA 2IZWA 1GZWB 2ZCWA 4JGYA 4OUMA 3VKMA 4F8AA 3N4MA 2TUNA 4P9LA 2BQPA 4KU8A 3E6CC 3DF0A 4M23A 1RMU1 3Q9OA 3MIEA 1U5XA 2OW4A 4NN0A 5HSXA 1TME2 1RUE1 3MIDA 3OYWA 1Z7S2 1ASJ1 4JTOA 4YVWA 4HVOA 2JENA 4CDWC 3AMHA 5BYNA 4IXLA 3QCWA 3ZIWA 1PNGA 2D7FA 2VUAA 1SFNA 4EN6B 5L7OB 3INAA 1OIJC 2GMPA 1WA4A 1U5YA 1ZZ9A 3ILFA 1QXPA 5BPXA 3I4IA 4I3GA 3MI8A 4N43B 1QJY1 1KDMA 2ENRA 4RR3B 3J8F3 4NPRA 4RGGA 2UWCA 2WIIB 3EXUA 5DG2A 2I74A 4YVSA 2ZX2A 2C1FA 4PLMA 2BW8A 5TSWA 3RYPA 3H50A 3ZYIB 1W6MA 3WDVA 5C4WC 1ZRRA 1C28A 4FQ4A 5IK7A 2DTWA 1NQDA 1RGSA 2D6LX 1YUDA 2PYTA 4GH4B 4YW5A 1PK6B 4PJYA 2WBPA 5JR7B 3WX5A 4C1XA 4CEYB 3MDPA 2D97A 1VJ2A 4L9BA 3SCFA 4XHBA 2GMMA 5J3UA 1U0AA 2R043 1S0IA 1XYOA 3U10A 2GN3A 3JB8A 1CIWA 4W6XA 5DUVA 1A6CA 1QF3A 1PO21 1Q8OA 1HX6A 2Y0OA 2I45A 3BOPA 3OGJA 5L36A 3ZVXA 1GVGA 4Y5Z0 1YRZA 1DGWX 2GSYA 5E88A 1HRV3 3KD4A 1R082 2E7QA 2Q1MA 4OJ8A 1T6GC 4LTAA 5EJ3A 4Z07A 1O5UA 1OPOA 3ELNA 4YM2A 5C8CB 1RTVA 4P9JA 3CJIA 1OIIA 1MACA 2Q8OA 1EY2A 3WVJA 3LSDA 3GNEA 2Z2SB 4M3CB 1C8M1 2BUKA 4MH0E 2EA7A 3FJSA 4AVAA 1H1IA 3OBRA 2HKXA 5FMOL 5J7MA 1YI7A 4QPIB 1MVQA 4B4QA 4CWDA 4Z8BA 3MIHA 1QNYA 4GIQA 4AW7A 1AR62 4XEZA 1WMEA 1OIHA 4B29A 1XNKA 4BPZA 3KS7A 1VALA 5KHIA 4LULA 4Q0VA 4QPGC 5CFCC 1ZYBA 2AZ5A 1YFWA 2FMDA 4XJUA 1AR63 4YZ3A 3U07A 4PF5A 3ZMNA 5EFUA 2OPKA 2ETEA 5F6KA 3M3OA 1DRTA 2D3PA 4XMIA 2AR6A 4IEVA 4WVWA 4UW3A 1S0CA 2QNKA 1LODA 2RS51 3RWNA 1AL0G 1CPNA 3WOGA 3DL3A 3RMYA 4CEWB 4O9GA 5JVVA 5C33A 4UW4A 2WBQA 3ZFGB 4Q0UA 1D2QA 4E9KA 4E27A 2JDZA 4WM8C 1DZQA 4MXWB 4DNYA 1UZZA 3PLQA 4DOUA 1DBNA 2ZHKA 1XYNA 4AE2A 2OZJA 1HV1A 1TNRA 3GZUC 3LWCA 1WCDJ 3ZDSA 2VQ0A 4PIYA 2YZ4A 2PHFA 4BHGA 5AC92 4H7MA 1J3QA 3MYXA 4YVWC 1C8NA 2XLGA 3HMYA 4LO8A 1H2LA 2ILMA 5I91A 3D0JA 4DZGA 1S0BA 3CL1A 5HCBA 5HCAA