3P3NA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1930-1949) peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
b'VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3nA01
3P3PA 1H2KA 2W0XA 1H2LA 5JWPA 3OD4A 1MZEA 4AI8A 2CGNA 3KCXA 4B7KA 2XUMA 1H2NA 2YDEA 4BIOA 1H2MA 1YCIA 3KCYA 2WA4A 1IZ3A 2WA3A 1MZFA 2YC0A 4JAAA 4B7EA 4QU2A 4Z2WA 4Z1VA 2CGOA 3D8CA 4NR1A 2ILMA 3P3NA 2Y0IA
chains in the Genus database with same CATH superfamily
4MW8A 1GP4A 4IGPA 3CRAA 1US2A 2WNEA 3ZBHA 3CLPA 4AEKA 5A3WA 2X5IA 4CP9B 1OH4A 2E63A 3W5NA 3SJCC 1FNZA 2D43A 4DV7B 2W1QA 4P2ZA 4DV0B 3TYJA 4I3PA 2LW7A 4DV1B 3VBBA 4YPJA 1LHWA 4GX5A 2KA3A 4V2VA 3TETA 3TN91 1UPIA 2I45A 5JOYA 5LY2A 4AVBA 2WQZC 4QKDA 1ZRCA 5BY5A 1N32O 4XQ4A 4CCMA 1BSMA 1NX9A 5BNOA 2VE1A 5J48A 4O2AB 3T3YA 4MTGA 1U5XA 3THTA 3WQBA 3U14A 2WT2A 3L2HA 4MGSA 1RIRA 4JDOA 2W3JA 2QTOA 5LYJB 5IAVA 5CBHA 3SCHA 2F95B 1GN4A 1LENA 1VB2A 1QJX2 5C4WC 3B3QE 1OA3A 4D69A 2UURA 2BV4A 3UGGA 3WF2A 2CTQA 2YU1A 3VBHA 4C1WA 3BOPA 1M5IA 1X7NA 1YRZA 3GVMA 4AHYA 3WT3A 1HB4A 3UGFA 2J1EA 4XCBA 3ZN0A 2A5ZA 5FYIA 2WA3A 1LHNA 3OGRA 4FQZA 3GZEA 1HRI2 2WO3A 3Q8FA 2QM8A 1O4ZA 4PJYA 5LGNA 4DIQA 4LP8A 4DZGA 1SETA 3D36C 3ZMTA 3ASIA 1GWMA 2Q67A 1Q8SA 5CA1A 4Z07A 1RHI1 2WSVA 3UQ8A 1KC8W 1RVF3 4U7NA 4ZI7A 3PTYA 3LDRA 4PI0A 2DVFA 4CC6A 1DQ1A 3BRCA 3N7JA 4JV4A 3B7MA 1N1YA 5JXHA 3PVOA 4KHPO 4QX7A 5TISZ 2G9FA 4BQ4A 4WZCA 4MYEA 2HJFC 2D97A 1NA1A 3IDEA 3M4FA 2V1DA 1H9WA 4C90A 2ZEWA 1HQWA 2FDHA 3ZIAG 4GX0A 1H2SB 3ZDVA 4W65A 5FP3A 4O2BA 3H1IH 2DU1A 1VQ5V 2ITDC 4AFDA 1JZ7A 5JZGA 5GZFA 5H9PA 4GLXA 3T4VA 2XBO2 5BUVA 2YI8A 1PVC2 1C1LA 4I01A 5FMOS 5BZBA 4IE6A 1PHMA 4OHWA 1PGW2 1VBB3 4I09A 1D7PM 4P9GA 4RQPA 1HRV3 2MEV2 2BDRA 3V0BB 4K7JA 3DYOA 1AYN2 4WZFA 3TN92 1RUE2 4X20B 1V6MA 3TB0A 3WB1A 1P49A 2GC2A 1QLNA 4YYOA 4IUGA 3NV4A 3SITA 4QE9A 3JZVA 3CHXA 2ZE8A 4NHLA 4IV3B 1UIJA 3ZFGC 2VCAA 1IBMO 1JS9A 1LNSA 5LXTB 1DZQA 2P7TC 2VQ0A 4S2HA 2PHWA 1XNRB 4N9HA 1A32A 2DMXA 3VDDA 1O4YA 2VOKA 4OMCA 2OVUA 5DECA 4ARYA 4CCLA 2P3IA 1YJ9V 1JYTA 5EZWA 4JTAB 3SKJE 1JZ3A 4FTEA 4BOWA 3T4ZA 2BJSA 2DCZA 1YJKA 2DJVA 4BM8A 5IYDO 1SERA 3WLUA 5LW9A 4DRXA 1O5LA 1IGOA 3ITQA 3K0DA 3MV11 1BBT3 1NTKH 2GC3A 3ZN1A 3WVJA 1Q6IA 5FRAA 3FB7C 2VUDA 1JW6A 2LGWA 3HD8B 4JKLA 2ZNIA 5FAXA 5IUQA 2WLMA 2UUAO 1WZXA 1BEV3 2GMPA 3K48A 3SYQA 2WLLA 2V4VA 3O0VA 3P6BA 5IT6A 2PI5A 1D0GA 2YXLA 2DCYA 3POYA 3WOGA 3UK9A 3E89A 2IVJA 3GBFA 4ZBMA 4BHPA 4RD7A 5F2WA 1HDJA 1MG1A 1K92A 3O1MA 4UVAA 4CEYA 4PDMA 5L3EA 5C4WB 2RS31 3GZTB 2JGDB 5EWSA 2IFWA 4HSLA 2IXJA 2RS51 4IEXA 1VRBA 4QGLA 4GCZA 1F2NA 2P90A 3ABUA 3ZPOA 2WT1A 4EB6B 3LSUA 2EF6A 2Y33A 2QSAA 1ND2C 4OZXA 1BK0A 2WFPA 4Q4X3 4MHRA 4FM1A 1RXGA 5SV5A 4JAVA 4JI1O 1XU1A 4LULA 4LHLA 1O3TA 3W58A 3N4MA 5A7NA 3F7VC 2HEPA 4PF1A 5DN2A 4U3FH 5EK0A 4JTNA 4DXSA 2W92A 5DAWA 2WSUA 4I0BA 2F43G 2WAOA 4LHKA 2JB4A 1JX9A 5F39A 2OW4A 2EILB 2GALA 2NN4A 3ABMC 4JAUA 4JAAA 1VQLV 1DZTA 3VD5A 4AI9A 3E8GA 5LHHA 2WZR3 5KWRA 3P3PA 4O4JB 5IJ9B 4XTPA 1O4TA 1QQCA 3BN6A 3PUAA 4UF0B 1J59A 3UL2A 5J2TB 4QX8A 4INDA 1VE0A 2RJKA 3LAGA 4Q29A 3CSXA 1IS6A 4NJ4A 1Z7S3 1P7BA 4LFAB 1QNMA 4TV8A 1J58A 2GV9A 4FPKA 3NKGA 4IEUA 2NM1A 1IBLB 3OUIA 3ZYBA 2Q1ZB 4XYXA 4JI3O 3CEIA 5T5PA 1WLTA 1O8PA 4MVMA 1OFSA 5IYZA 1S0JA 4YG3A 2WQ4A 4CEWC 3V65A 4XJ9A 1GNZA 3M8AA 5FQ0A 2ILMA 4X1KB 3ZFGB 4FFBB 4UCVA 2IUWA 1I94O 2J22A 3O5SA 1RTVA 3VZMA 4YIPA 4X89A 5FZOB 4E8CA 1QU0A 4Q1PA 5E89A 1QEXA 1S1AA 3FX7A 1B6QA 4N43A 4LKFA 4YW6A 1JPXA 3E83A 4O4HA 4DV3O 4JI4O 1CVNA 5CFDA 4BW9A 1AL21 4MVOA 1I5ZA 3P3NA 1H8TA 4EWDA 3OAAG 3GHNA 3OE7G 4DK0A 1EBOA 4K1ZA 4XDJA 2B9ZA 2D3PA 2PI4A 5K1XA 1BVP1 4N23A 3JATB 1G8MA 3CCEV 1JOPA 5IYBO 2X6CA 1BQZA 1WLDA 1LKNA 4E4ZA 1M90W 1LU2A 3KGLA 1RVF1 3BFRA 3I54A 2JRIA 1B3QA 3AX4A 4Q6GA 1UYYA 1WMFA 5H9SA 1K5MC 4EZHA 2ADDA 2JD4A 4JF3A 4KG0A 5A32A 4H13B 3AKQA 4AVSA 1JYXA 2GNTA 4EN8B 4DW1A 4MLOA 3VUOA 4QXHA 1QU7A 5D5QA 4BAYA 1U5YA 1GNHA 2XJPA 3PMSA 4IEVA 5T5OA 3AEIA 3JASA 3FYEB 1ND2B 5LMNO 2RN9A 4JDMA 3Q8EA 3AKRA 2XGXA 5FMCA 4AE2A 1MS1A 5L19A 2FD8A 2CUGA 3KM5A 1EN6A 3ATGA 4J11A 1VP7A 1NG0A 3LZZA 3SQOA 2Y64A 2HEYF 5F1RA 5APAA 2FB5A 2RR13 1ASJ3 2WZEA 3ROUA 2CWMA 4LBEC 3N2GB 3JD2A 1QLEC 1QH6A 1LR5A 1JYVA 1OSGA 3AP5A 3RVHA 1WKYA 2OPKA 4LTAA 1MABG 1SS3A 2ETNA 1CZSA 3VZNA 2A3XA 4KHPB 3Q4HA 1NQTA 3ABMB 1KGYA 5FMBA 3MIHA 1NUKA 1Y4WA 3OPWA 4RYDA 5LGTA 2PUSA 5J9PC 3VBUA 4MTXA 1JVMA 3A21A 3VDAA 4FT8A 2H8PC 3J4UH 4QQOA 3ASNC 5DZEA 2ADEA 2UWCA 5FL7G 5AFEA 2QDOA 4MSWC 4I55A 5FTTC 4CEWA 2ZEXA 4DUXA 1W9WA 3SYCA 3AP4A 1EV13 4A6SA 1HX6A 2NN8A 1CONA 3WSOA 1ZREA 3LA2A 1JZ4A 1UZZA 2MW2B 3WF1A 1ZL8B 2XG3A 3LPGA 4R6ZA 4R4ZA 4HN1A 2PXJA 2XMLA 4TYSA 4GKJB 2BGPA 4LWSB 2VU9A 1GKFA 3U4XA 2RE9A 2OQ6A 2LW8A 5J37A 5KHGA 1W8UA 3BEHA 1M4WA 3CS5A 1RVF2 4BE3A 5GKAC 2B39A 4UFMA 1J5EB 2WS91 4AK3A 5JSOA 5A2QN 3WCSA 3ZMOA 4NHXA 2YPJA 4I0WB 1J95A 3HKBA 1L7RA 1BHAA 3OD0A 2X8KA 5CBGA 2VUCA 2IXHA 5K0UB 5JVDA 4JC1A 5JLVA 2R30A 1DYPA 1FOD3 2BGOA 2WLIB 3BUCA 2A3WA 2VH9A 3P5BA 5BPXA 4LHSA 1BYHA 3K57A 4AQSA 1XNTA 3SEPA 1YDXA 5AC92 4AI0A 4FM2A 3WNPA 3PL0A 3K3OA 1RM1C 1VBB2 4IGGA 2UWAA 2HKXA 2LP7A 4DR1O 1Q6HA 2ZGSA 3RN4A 2UUAB 2BQPA 1XMOO 3NWKA 1K8AW 1HRV2 4LT5A 3H1LH 5H9RA 4W4ZA 1QJY2 2F6BA 1ST8A 3EBRA 2EINC 2VZTA 1M1KW 2WYSA 3NNFA 1H1AA 1I5XA 2J1VA 5B1BC 2R1BA 4E4SA 4GWIA 1XILA 1VARA 4NO4A 3WW2A 3O1TA 4K21A 1FPN3 3GWKC 3OW2U 4XILA 1K5MB 4XMIA 3CRCA 2OTLV 2BRTA 2WZR1 1LTEA 4XC9A 3NL1A 2XOMA 3T0DA 4M4RA 2JE7A 1BKZA 2Z3YA 4DQAA 5J98B 3JBG1 5I91A 2VMHA 3CC7V 3K59A 4X6RB 3S5AA 1Z7S1 3VKOA 4DRVA 5FBJA 4KU7A 5CN0A 5LASA 1UYXA 3C3VA 3AG4C 5CYYA 2EIMC 4B4PA 1PO23 1GTOA 5I8TA 3B94A 4JTCB 3GBWA 1OA2A 1QQP3 3DCQA 4QPKA 1Y74A 4F8AA 3VBFC 1W9YA 4LNUA 5C7GA 3OEEG 4UCSA 5IK4A 1G7YA 2O8OA 4X9QA 4PA6A 1G9FA 3POGA 1BBT2 2AACA 1QLEB 3FZ3A 5A6QA 1HNWO 5JR7B 2B9VA 2VNRA 3H7YA 2CTRA 4EN9B 1JHNA 5LZ6A 1LRHA 4LBOA 1SZTA 3GNEA 3ZRXA 1GMGA 1V00A 5DAVA 4R52A 1BEV2 4Y20A 3WDVA 2LRPA 1XDCA 4LLOA 1IX9A 1GM8A 2Q69A 1U5ZA 2V4AA 1HKDA 5I8YA 3A0RA 1W0JG 2MHFA 5FWJA 2ES3A 1LGCA 3PURA 3SCGA 1I6XA 1V0AA 5FP8A 2EULA 4RA0A 2AGAA 3ASNB 5SV8A 2ZHMA 3ZFEA 2HYKA 3POJA 3BODA 5FYCA 2N04A 3VQVA 4N9IA 3EB7A 2VBDA 3RVZA 2UXNA 5LB6A 4U3JA 2HWF1 1H2GA 4R8CA 2K9PA 2L6LA 4MXVA 5F7UA 3AKSA 1L7QA 4DV2B 4K9SA 4JI3B 5EYPA 2IJKA 3OR6C 2V5YA 5E79Z 3AMNA 5FZEA 2W2IA 4Q4X2 3U07A 2UU9O 2OZ6A 3WG3A 3K4DA 5A33B 1SQVH 4BDVB 3AG3C 1ZLZA 2OIGA 2FDJA 1X50A 1TUEB 1I94B 4B29A 5EC2C 4U2AA 3PN1A 5C5TA 2LGQA 4JX0A 3W9AA 5I93A 2XUMA 1W6PB 3R6SA 5KX5B 1COV2 1SLCA 4UBHA 4OHVA 4XPVA 4B3SO 4CU6A 2HWC3 2JDNA 4AG4A 1UIKA 1PIV3 2NZ9A 4IGOA 3LF7A 2R6QA 2WZR2 5GONA 5JH7A 1KS4A 2NQYA 4DV3B 1VQ4V 4JI4B 2Y6KA 4TSFG 3E5XA 2R9RB 3E22B 3JD0A 1T6BX 4P02B 4LHNA 1OUXA 1ZZCA 3OMNB 1D4M1 4FCAA 1UNBA 1P84F 5FFOC 2QQJA 2TEPA 2W0XA 5C8CC 1VBD2 4QHBA 4HN0A 3SC7X 4PELA 1WAZA 4KXRA 5KBFA 1Z5VA 3OBAA 4YY3O 4KL1A 1AI7A 5CG8A 4CA9A 1Q81W 3GALA 2PQQA 2JG8C 2JWPA 2JDUA 1KITA 2YMZA 2JX9A 3K77A 4RS5B 2EINB 1N0JA 4WM8C 2CNAA 3OY8A 1PK6C 3PIJA 5DAXA 5B1BB 1F51A 2E75B 2P2KA 2ZCWA 4I0AA 3BVOA 3E8BA 3KQRA 3CB2A 1OUSA 3B9IA 1IBKB 4CC5A 2HR3A 1EUTA 1W2AX 4FTBA 3S6PA 4R50A 2PF4E 4WFHA 3UO2A 2MNGA 4FBFA 2OIIA 3MIGA 4F83A 1CAXB 3EO6A 1VEWA 2OX0A 5FO7B 3ZHSA 1JODA 1XL4A 3WQ1A 5KLVH 1WW5A 1RYYA 2GZWA 3T2MA 5FPBA 4WVMB 1NOVA 2VVDA 1K12A 5LMNB 2WO2A 2W95A 1VF7A 4OHYA 3W7SA 1GZTA 5DAPA 2EIMB 2XASA 2Q30A 1KECA 3K5LA 1CAVB 3KKYA 3RWNA 1R6KA 4Q4Y1 5FYHA 5FLXN 3IC9A 2EALA 3VHPA 3K5MA 4BH9A 5GZGA 2ZQMA 1ENSA 5CNAA 5JDBA 1CZVA 3DV8A 3IDBB 1CN1A 2D5FA 2XLFA 5D8AA 2Y6LA 3LSSA 3QF7A 3I59B 4E4DX 5HCHA 3BCWA 4X64O 3O14A 3B77A 1OOPA 1G86A 2ZD9A 3BIWE 3M8LA 1K4CC 5FUNA 4JGZC 4ZU7A 4SBVA 3JD4A 4B7EA 5FZ4A 5EIBD 3LEIA 3BU7A 4FOWA 2R073 2DWEC 1DU3D 5KAFZ 4L9BA 2Y0PA 2QZ2A 3CC4V 1PGL2 4O4IB 2UXBO 4ES9A 3OEHG 4QM8A 1AR82 3IPVA 4COVA 1GUIA 1HW5A 1QJZA 1NLQA 3HKEA 3LOIA 1VLNA 4GWJA 4MTFA 1O3RA 1FT9A 3AKTA 5C8YB 2ZGMA 3GZAA 5FV3A 1OCZC 5LRSA 2XLAA 3HT1A 1W05A 5LHIA 5I0UA 5CB4B 1FOD1 5ABJC 2H0VA 1E79G 4J1XA 4K8XA 5HV4A 3WW1A 2ZX1A 1UOBA 2TBVA 3KT7A 2R1DA 2F66C 3X29B 5F3CA 1YTFB 2QZ3A 4YVWA 2ZIMA 4CCDA 1F31A 5A7WB 2BYVE 1IS3A 4Y33A 2DWRA 1WPBA 4Y22A 1YNAA 4CS3A 2RR12 4KWKA 1ASJ2 5IT9N 1ZNPA 1ENVA 2JGUA 2B1GA 5JJNB 3VD7A 4MW3A 1YHQV 4RHV3 4PA9A 5FNVB 4MXWB 4FMTA 2EJRA 1FXHA 1CXZB 3WY6A 5DZFA 1C5HA 5I8SA 2DVAA 4QHZA 4LH6A 1XOUA 3DXRB 3BTZA 4UCTA 2CU5A 2Q0AA 1VJ2A 1FPN1 2LO1A 2PYLA 5A1FA 2XAGA 4B3MO 4E4EA 3OOXA 4DINB 2B8MA 2EXHA 1YVWA 2DUQA 1NR1A 2W47A 4K8FA 1GZ9A 3WUDA 1XQNA 5C8CB 4UCRA 5FP9A 3V56A 4IL6Z 2WO1A 4COUA 5DABA 4MVQA 1EV12 1O59A 1PO21 5EQUA 1XBLA 2F23A 3PU8A 4DR1B 1XPWA 1DLCA 1CGPA 3FX3A 2G4IA 2AHZA 3FBYA 1QH7A 2OYZA 4JTOA 3WP5A 4UFZA 1Q8OA 2JG9A 3KVBA 5FUIA 2Q8CA 3VQWA 1LNQA 5A3OA 5LA6B 1S2BA 2ETEA 1WD3A 4WM8B 3LA3A 5D1IA 1PK6B 5FXXA 2R70A 2UUBO 1PMHX 3BABA 4LO4B 4O4LA 3HT2A 4Q20A 1SMVA 1G9CA 4BQYA 1AR91 3AP6A 4PBOA 2H6CA 4RFT0 1AR1B 1ZBE2 3QO7A 4FI9A 3N9NA 4LE4A 4UF0A 2HWD3 3JAWB 5FZCA 4ICGA 1AILA 2P4EA 4G3YC 4ATEA 2JK5C 3F2ZA 2WFF3 2Q1MA 3WG2A 3DYPA 1W2TA 3PUSA 2A6ZA 4XJAA 2WNVA 3S57A 3OTFA 1S5LZ 3BB6A 3WD5A 5FJHA 1Y76A 4YM2A 3R65A 4GXLA 4IV1A 5CISA 3IAPA 1FOD2 2IH3C 3OBRA 3B8NA 4IEWA 1UCXA 5CKQA 1YIFA 1HWYA 5DDJ3 1S0FA 3B2EE 2QCSB 4XUTA 2QA4V 1H4HA 3I3BA 2DURA 1I1EA 1OPOA 4NIGA 2KG7B 3CDZB 4DXRA 1HNWB 1PL4A 3CP1A 3SH4A 3AZZA 4Q26A 5CKNA 1HV1A 1ULDA 2O8QA 3O0XA 3OD4A 4RQEA 1F8VA 3WNOA 3WNMA 2RM21 1FATA 1WMEA 4FPFA 2KD7A 3LEGA 1OLMA 4ZOLB 3JB4C 2EAKA 3CJIA 1RUG1 2C5DA 4UFHA 4JGZB 3VKFC 1ND3A 4R8HA 3A2FA 4JCKA 2IH1C 5ABJA 2LALA 1TEIA 4UFIA 2VTXJ 1FYJA 4PLOA 2EIKC 4I4TB 1VQMV 4TT3G 4DUZO 3BTAA 1PIV1 1PVXA 2K1EA 3NV2A 2E32A 1B35C 1BHGA 4KWUA 2QQUA 1OHHG 1OCZB 1XL6A 1EY2A 1VQ7V 1JOJA 4PLMA 5B5EZ 4LO6B 1N33B 1X82A 5IWFA 1SFPA 4XF3A 3ST7A 1VPHA 3E86A 2HWB3 2CDOA 2B7YA 3MICA 1W90A 3OMIB 1Q5OA 2WWWA 4AI8A 2HH9A 3E8HA 4CDXA 1W06A 2WRAA 1QQP2 3G6BA 3R66A 2QBXA 3RZHA 4BQ2A 1KP2A 4XQWA 1FX5A 1VRH1 1FD9A 2VZUA 5HI0A 2V5DA 1WB8A 1OA4A 3KGZA 3ZR6A 4DR6O 4WVWA 4AFBA 4FP3A 3DC5A 4M3CB 5FZ1A 4B3SB 1D2QA 1PNLA 3APBA 4YW3A 1O3SA 3S3WA 4A7ZA 2JDZA 1GSLA 2X09A 4DXWA 2XLGA 2HJIA 3TXQA 3HBKA 3SNMA 4XDKA 1XMQO 5H9CA 1UZ0A 4CXWA 4LBKA 4BB3A 1S0DA 3H9AA 3CCLV 2GTAA 1BL8A 2BNOA 3CE2A 2G38A 5FY5A 1OKQA 4NRPA 3A0NA 4LF6O 3LDBA 1PV0A 3H1KH 2Q9LA 3Q8BA 1C8M2 4QXKA 4J9ZB 3WFVA 4NIHA 4YY3B 4XEZA 1OI6A 3E35A 1YFYA 1AUYA 2E3CA 1Y3TA 2WABA 1AYM3 2PHFA 5EBLC 4XUQA 1GFF2 3C7EA 4AVVA 5CMUA 4KI5M 1REDA 1PNKA 1LOFC 5F3EA 2B46X 1RMU2 4L99A 3NV3A 4GJZA 5DAQA 2BU9A 3HNYM 1NT0A 3NR7A 1WW6A 1YC61 5BNPB 2RDCA 2Z5UA 2Z79A 2XR4A 3T30A 4FPHA 2Y6GA 2R071 1YXWA 1M06G 5FMDA 3NNLA 4DRRA 2Y38A 1Q82W 1AR63 3JXSA 2HWC2 1PIV2 3J7HA 4I30A 4J80A 3H8RA 1W28A 1YSCA 1W0NA 4JGYB 4XDOA 3VBOA 1FXVA 1O9HA 4BIZA 2IBZH 1BLZA 2VNVA 2XUEA 5FY1A 2D7FA 1MR5A 4FOYA 2AZ5A 4WBBA 2QQIA 2OXBA 5B4XA 4NIDA 3F7YC 2O1QA 2H94A 4LITA 3VQXA 3RVYA 2X6AA 4S2FA 5C93A 1LOCA 2A6XA 3H3LA 1MS8A 3USSA 1DQ2A 3PJQA 2JVDA 2IW5A 1TVKA 2VOXA 5FY4A 1GOGA 1JH5A 3B93A 1PP9H 4KMQA 4Q0UA 4NAMA 3ABKB 2HJDA 1PO13 4J41A 3CO2A 3FHQA 1W39A 4HNAA 1R083 1UPGA 4LF9O 1R64A 2UXBB 1XNKA 3JALB 4QX5A 3KV9A 1FXKC 2YXSA 2VMCA 4DR7O 2ZJCA 4PA3A 4GUNA 5FYBA 1W6OA 2VBPA 1W6NB 2VRZA 2DYCA 3ABTA 4UFLA 4Q8KA 4NUBA 3JB8A 4TV9B 2C9KA 1B35B 1JJ2U 2BTQA 5J7MA 1O3QA 2RDRA 4P00B 3A4UA 1O8SA 4LK6A 1KFXL 3AFKA 5F5AA 3C3TA 2E26A 4OFGA 1WWYA 1W2NA 2YC4A 2RVAA 5E1RA 5C3SA 3APQA 5T5LA 5A1LA 3VQYA 4HLTA 2WLJA 4HOOA 2FKXA 1CEZA 5FXWA 4MX3A 2FDKA 4QPIA 2G1MA 3NSTA 2VY0A 1TME1 4KGGA 4XJWA 2QQKA 2CGOA 1KD7A 3VLBB 4XFCA 5ANNA 5EYXA 1F15A 3POBA 5LK5A 5IW0A 3LNNA 1CPYA 2RMU1 4YFWA 2WAMA 1ROPA 4LO7A 3HJRA 4Q0PA 2IWGB 1LUVA 1OD5A 1SQBH 2FZ2A 4LBQA 5FBZA 5FCCA 4Z1VA 4RGGA 1DLLA 4I0XB 1M93A 4AHWA 1REFA 3T1LA 2VAUA 1SF9A 2ADPA 1C57A 2YEVB 2HWD1 1E57A 4BLIA 3I8TA 4HVQA 2YBKA 4CE8A 3J8F1 3OMAB 1W0KG 1A34A 1H2LA 4AOCA 1A3KA 2OT7A 1SFYA 4JVAA 4UBGA 5FZ0A 2OUHA 1RL3A 1RUI1 1AVBA 3W7UA 1AXKA 4BW5A 1GNYA 5DDJ1 3S7EA 1X36A 1WJZA 4DUVA 5GLVA 2ENRA 2QVSB 3H1HH 4NTYA 4CCOA 2IM9A 1S0BA 1Y7BA 4JI0O 4FJCC 2VCMA 1RXFA 2UUBB 2YV8A 4Z2AA 2CYFA 2QWOB 1OQEA 2IVIB 1OVPA 3JAKB 2G19A 3N9LA 4RHV2 4HMZA 1KDKA 3VD4A 4Z2WA 2R7EB 4KP4A 1XE8A 4EFBA 1YHFA 4DEQA 5DG2A 4NRMA 5FZFA 4FPLA 3PNAA 4CDUA 1CD3G 1LESA 2CH7A 5BR8O 2J1UA 5KHHA 5LCWL 2W1SA 1VMHA 2D6NA 3UV9A 2XJTA 4Q4W1 4O65A 3MPBA 5L3BA 1OVSA 2L9LA 3AXDA 2HWB1 2F17A 4GMP0 3S5QA 1YI9A 1NY71 3RI8A 4A5UB 2XL9A 2DBNA 5FYUA 4CVUA 4I50B 4XETA 4HKWA 1LR1A 5FYYA 1SDDB 1IOAA 3IIIA 4XUPA 1UD1A 3NJYA 3U4SA 2FL4A 3AYAA 1FFXB 1W99A 5FREA 1C3HA 2GSMB 2OPWA 4W8JA 2X0LA 1FXKB 1VP6A 2Y8KA 5FLJA 5L3DA 4DUZB 4LFCB 2H3OA 4ZPIA 3WUCA 1W3VA 3MLJA 1NQJA 3UT0A 3B09A 2YGLA 2BSKB 2UWBA 2GUZA 2Y4TA 3IDAA 1R3KC 4D7SA 2X05A 5CA0B 1MZEA 1XYPA 4YJ3B 2WFF2 4DXZA 2VZSA 3D6EA 4FP2A 2YXHA 2ZABA 3ZVXA 4LBQD 4QD2A 1MEC3 4N90A 1GU3A 4YLZA 2HBTA 4FFIA 2JDIG 3N9PA 2V72A 1W9SA 1GAXA 1SZXA 3ACFA 5DDJ2 4EEQA 1AYM1 1R093 1CWPA 4YSFA 2P1BA 4B3RB 2V09A 4DV1O 1WN7A 2VZ3A 1NI8A 5C71A 2FQPA 5FXVA 4JDNA 1UWWA 4AFCA 3CXCU 3OPZA 3FAVA 4QKBA 3ZSKA 4DR6B 3V0AA 4RS5A 3BCCH 2DVDA 3D4KA 4HK8A 4IHJA 1CAWB 4QPGC 5J36A 4Y4YA 3ZRWA 1XMQB 5F37A 1IPKA 4PBPA 1W0PA 2ZZJA 1SDWA 1Y67A 4AAPA 3I3DA 2W0FC 1OLRA 1FMD3 2ZINA 2XBO3 2HKOA 3O7OA 3K5OA 4P08A 2R9IA 1RUJ3 1ALYA 3MF6A 1GK9A 4HZ3A 4H7MA 3WG4A 1W8ZA 3AVRA 1UW8A 1JFFB 1AI6A 1WUVA 3VZKA 2NLJC 2IU3A 2CTVA 1APNA 4N53C 2MEV3 4ES8A 1SLIA 3TEXA 1RUF1 2HWB2 2VBBA 1UX6A 5DUVA 3M7MX 4X1YB 2ZT9B 1DZRA 1GOFA 3WZ1A 3UCSC 1NH2B 1LOBA 4XF1A 4L2NA 2VQUA 2YGMA 5H5NA 4OHZA 5CFCA 3GJAA 2LQTA 1S55A 4WF9V 4NOTA 1R081 1F35A 2DCKA 5A1AA 4JGSA 1YWKA 1WP7A 3POSA 1IKPA 4K0KO 2J1SA 1I5PA 3VN4A 1ZRFA 4DYLA 3GYDA 1KBHA 4MVTA 4J6GA 4X88A 3TEZA 3AC0A 5FO8B 1ZBA1 4BMBA 5BYNA 4IEYA 3KZ4C 3ZYGA 1WA8B 1DGWX 1LODA 5IVCA 3RG0A 4NWVA 2CAUA 5FP7A 3WXPA 4XF9A 5H9QA 2PGGA 1YITV 1XUQA 1XI1A 5A3NA 2VUAA 1SKVA 1Q8VA 4QQ2A 4NN0A 5FWEA 4MGTA 4FAGA 3OG2A 5A7WA 2CTWA 2LM3A 3I55V 2RDNA 1DQ6A 5FO9B 1SC5B 1MS0A 2YIBD 1R6TA 2BEOA 3ME2A 4X8NA 2QQMA 1X9TA 4LF9B 1Y9QA 1VF5B 2RJZA 2ZDIC 2NPIA 5AVAA 4HAMA 1XNQB 3L74H 4ET7A 4DR7B 4QGNA 3E2EA 1FAFA 4JYBA 2M6YA 3AG2C 2Z42A 4PDWA 3ZYFA 4AVTA 2DU0A 3KS7A 4HPKA 4EYUA 2YY1A 4YXWG 4AHCA 2K9ZA 1QVGU 4MGZE 1HN0A 5L7OA 4ZU5A 4X1IB 1XSRA 5K7PA 1AR62 1H0BA 1DF4A 2WNUA 4AQTA 3UKVA 2RS11 1W6MB 1BMFG 1SLLA 4PF5A 2P6HA 4AL9A 1UKRA 4JPRA 4PHZA 4LE3A 2E76B 4LR4A 2QGNA 3QH7A 2JJ6A 2N7GA 1YQ5A 1HB2A 1V70A 4KGQA 1MSDA 4JYYA 2O0OA 3CMAV 5L36A 4DY3A 2Q8VA 2X5IC 2F93B 5F6LB 5J2UA 4XJUA 4ZS2A 1RSOA 2QQLA 4B1MA 4JKMA 2ZR2A 4LOTA 1K9MW 3G4SV 1AF9A 4AEMA 1NZIA 1PO12 4UCOA 4QPGB 2XONA 1CAUB 5LEKA 1R082 1JZ5A 1NVPB 1NAEA 1UXXX 5A3PA 1A6CA 5T50A 3CF6E 5HPOA 3B69A 2X29A 4LK7A 1DCSA 2YFZA 2QWNB 1ZM1A 5BNOC 3LEMA 1W03A 2ZNJA 1QJU3 4XHXA 1NTMH 4CZZA 3F5WC 1BZWA 4MVZA 4XVHA 5D21A 2J7MA 3TRSB 4TOIA 3KSCA 5JQGB 3RZKA 1J3PA 3DGEA 4N53B 2FDIA 1Q8PA 4XF4A 3K9AA 5IWAB 2QJ1A 3BIEA 3ZYHA 1WGPA 4CDQB 2OUJA 1SA0A 4QB1A 3FB8C 3UO3A 1W9FA 3VBHC 1V6KA 1YQ6A 4YG6A 1V6OA 2JKXA 3ZSLA 4XBLA 3HKDA 5B3SC 2NLRA 3OPTA 2ZR3A 1RINA 4RGKA 1N36O 2FCUA 4IGQA 2ARXA 1S76D 4B7KA 1DQ4A 3LDEA 2F4VO 2W9XA 4FK5C 2R063 3JCZA 1V9PA 3ZHQA 1NCRA 4BCUA 2P3JA 4E27A 3C7HA 1X4TA 4K8ZA 1QJX1 1YTFD 1W2OA 3OCPA 5JXJA 1URFA 4FM0A 2VWKA 2XAHA 3JSNA 2IJHA 5BR8B 4Z8BA 4Y1UA 2GP3A 4LEJA 3WR0A 1KJLA 2QWQB 3LDCA 3CKHA 5J3UA 3HMYA 1HRI1 1SLTA 1X8MA 1J83A 1ZZ6A 4L97A 5IATA 4TUYB 4XFBA 4WM7A 5IJ0B 4H37A 1E1RG 1NA1C 1M57C 4MTOA 2VGDA 1IBLO 3I2DA 3AMPA 3FUQA 2XQRA 1W8HA 2UYBA 4AXOA 5JZGC 1F23A 3SYPA 1W3XA 4M0NA 1EP0A 1LULA 2RJLA 4FPPA 2BNNA 5IY5C 1F4AA 3RYCB 3RYIA 3D5OA 3N9QA 4YGEA 4DUYB 1UU6A 5FUPA 4OQ8A 3RMYA 1R1A3 3ZN4A 1TVGA 1YUDA 5FY7A 2G9ZA 2FBEA 1U96A 4RQPC 5GJ6A 1L0NH 2D2CB 3JARA 3IBMA 3SPHA 2GNMA 5AFBA 3RW0A 1C4RA 2Q1FA 1EYBA 2E7TA 2QWPB 4JZGA 1WW4A 3ZN6B 1NXD1 4UV9A 3PUIA 3ILRA 5I0SA 1YZBA 3H8XA 4F6RA 4A3XA 2XBO1 3ZEDA 3I2OA 1PVC1 4UV8A 2D3OW 1Q86W 5E8AA 4UW4A 2A1XA 5BNNA 1YXBA 2XDVA 4NPLA 4YHHO 1S0IA 3AMMA 3VDDC 1R3IC 1PGW1 2M7WA 3EHKA 5DMYA 3LKJA 2DFCA 2VC9A 2MEV1 2EXKA 1SEFA 1AYN1 2F1MA 2ZKNA 4X8PA 4BQXA 1RUE1 2FCVA 2WT0A 3O1OA 3LQCA 2X5IB 2ITCC 3LB9A 4XURA 5CB7A 3I2GA 4PA7A 3DEMA 3RZZA 2XOKG 2JDAA 4CPBD 2Q5TA 2IJIA 3DXUA 4NAOA 5BNPA 2QJVA 4BQ5A 3TGUH 3MZHA 2C26A 3AFGA 4LKSA 5JWPA 2GBOA 2D6KA 4EN7B 3ZHUA 1AJQA 1K5QA 5LHGA 2VS0A 2QQWA 4ZHQA 2YG0A 1XYOA 5BNOB 1YIPA 4P30A 2HWE3 4A7KA 2QM4A 1THZA 5EBMC 1GZWA 5C3PA 2UXDB 4LO8A 1N1TA 1DGSA 4ABMA 1TMF3 3ZX7A 1OCOC 1VBE3 5LP6A 1IURA 1VMJA 1CPMA 2QM7A 5FMOL 5ANQA 1UY0A 1GKBA 5FOJB 4WVVA 2VQFO 3PUQA 3K08A 4CP0A 3OEBA 4CEYC 1AP5A 3CIHA 1MEC2 4XE9A 2ZGRA 4F6EA 3POEA 3VBHB 3H0OA 5I0DA 1TZOA 1UXZA 5IK5A 4RFRB 1IS5A 1R092 2LJ2A 1FYUA 2CSGA 2BWCA 5B3SB 1ZVFA 5GLUA 3ZYPA 2QQOA 3G80A 2HVKC 3N36A 1LHVA 1MQTA 1ZRRA 2Z0AA 5L9RA 4W4LA 2EIDA 3K9SA 2A71A 5ACA3 2E74B 2R0FA 3RYHA 5BMVB 4DV5O 5L73A 1G9AA 1VMGA 4CDWA 1X9PA 4K0KB 3TJTA 1KEXA 3RYFA 3ZRSA 2X6BA 5CA1B 1AVMA 1DG6A 2AHYA 1JR9A 3ABZA 3NAPA 1HR0B 4N8MA 1UO9A 3RJRA 3MDPA 4ZI7B 1QR8A 1F5JA 2YUAA 4J10A 4LA3A 1FMD2 2WO7A 1RUJ2 1ZZ9A 3KB5A 4D3WA 5AC93 1DP0A 4JI2O 2ZMKA 4XXPA 1YFWA 3O1VA 2ZMLA 5D2AA 3CJHA 3K04A 3ETQA 4CCNA 3L71H 1NA1B 4FPOB 1LAJA 4QX3A 1M57B 1WNSA 1KMIZ 1R3LC 3ELNA 4GWNA 4O2BB 4XABA 1QJY3 3KD4A 2LFRA 4V2WA 3ETPA 2AREA 5JZGB 4YG0A 4MADA 2HLEA 4GKJO 5IY5B 2YU2A 4K8RB 4L92A 1AR73 4RR3A 4BK4A 1EPZA 4JYAB 3D3AA 3ACGA 1POV1 4J7JA 1W8WA 1V6LA 3JAMN 1GM9A 3CL1A 2AENA 2EIEA 4I2OA 4QHOA 3G67A 4RQPB 5FLIA 4I0XA 3CZUA 1J5EO 3VZLA 1Q90D 4OYUA 2IXLA 1GWLA 1XB9A 1XEQA 3MLLA 1Q8QA 2P37A 3WB0A 1UYZA 1Y43B 2K0GA 3AP9A 3KCYA 4BXFA 3KVAA 1F5FA 3WQ7A 5KC5A 4FFFA 1QJU1 1D2DA 3RJ2X 2PMWB 4LFBO 3VHRA 4NYKA 3VDDB 5FZAA 4DY5A 4HVRA 3MLKA 2R16A 2CAVA 2ZZQA 2RMKB 4MSVA 5J96B 4Y1ZA 2LROA 4JQRA 5GZCA 1JZ6A 2VECA 3H42B 3T0AA 4YRDA 4EROA 2YC2A 4N43C 1VBC3 2J1TA 2BPA2 4XAEA 4K3UA 4U7OA 5DXDA 2VZOA 1PMIA 2AC1A 4AR2A 1KXGA 2R043 1CR7A 4QT6A 5CFDC 3U0ZA 4ZHNA 1H8TC 3EJKA 2PA7A 4NHMA 1WMDA 4DRXB 2W39A 5FK7A 4TTGA 3JAKA 2WLQA 4RUEA 4R9CA 3IB3A 3ZRVA 4X8AA 1O7FA 3LA7A 4L8QA 3AG7A 4FPCA 5A6YA 1Z78A 3MIDA 3BPSA 2RCVA 3RMXA 2DYRC 1WCQA 1NLRA 1DK1A 1LCLA 1NU1H 3PDQA 4YM1A 3TXSA 3A8TA 4NB5A 3HQXA 4EN0A 2WLLB 3B40A 3TK1A 2GNDA 2EJ7A 3L9JT 5FYMA 4MH0E 4QX0A 5FYTA 2W68A 1S77D 4Y5SA 4CTEA 1PPJH 2D3SA 1OCOB 4H44B 1RUD3 1R1BA 2PLV3 3G6JB 4LR3A 1T6GC 2XVLA 4GULA 4CEYB 4TWTA 1WCSA 2JIJA 3L2YA 4GA9A 1SQGA 5FZHA 2VZPA 1IZ3A 3USUA 1DTOA 2A3QA 1N36B 2LUWA 1G9BA 1H4GA 4YVSA 3STZC 4GB33 3BHPA 1FFTB 1WLEA 1COV3 2F4VB 1FFXA 4ZZ5A 5AVPA 4BLJA 2Q0OC 1ZYBA 2UXCO 4QB6A 1OLME 2JEUA 3H8OA 3WP4A 2UYAA 4AEDA 2XVKA 1BHBA 3ZR5A 2BGCA 4GJYA 4G28B 3ZXGA 5B1AC 4ISRA 4OI4A 2NMOA 3ETGA 1US3A 4KQ7A 1VBD3 2XAFA 1L0LH 3W21A 4ZKIA 2EIJC 2OCCC 1MZ5A 1KDMA 1QJU2 4YJ2A 5H2FZ 2E31A 1LOGA 3VBUC 4IE4A 2WQ8A 4DV2O 5LBEA 2ZMNA 2NR5A 1R1ZA 3AM2A 2VL4A 4IESA 1GANA 2Z69A 3RS6A 5FKCA 1VF6A 3GB7C 1BT8A 1I7FA 1HXS3 1YI2V 4QKFA 4TV8B 2JD9A 2GMMA 4PCRA 1D2SA 4CBCA 2VZRA 3K06A 2ARHA 4XBNA 4FPGA 5LRRA 4RAIA 3CMEV 2DUOA 3I5DA 1WCDJ 4TQFA 2AUYA 1MMMA 2BOIA 4CUGA 3H50A 5FZGA 1YI7A 3PLQA 3TNPB 4V1PA 4FLYA 2R062 5JXIA 3ZYJB 5I0TA 4LF8B 1PX3A 4DUWA 3SKVA 4W6YA 1EUUA 3HOBA 5FQ0B 4AEJA 4YHHB 3MO4A 5T5JA 4D6QA 4JHZA 4NXNB 2A3YA 4KUMA 2ZHNA 4QMAA 4B8EA 2VOVA 3CPWU 2ORZA 1GLHA 2Y6JA 3UKTA 4Y1VA 2WLKA 3WW4A 3RZLA 4D7YA 5JCOC 5KHJA 1YQ2A 5HV0A 1BQPA 3ACHA 4O4HB 4AHZA 5JUVA 4HT1T 1EPWA 4Y5Z0 5CFDB 4FLTA 2G9GA 3NJZA 2Q7HA 1S72V 4Y1XA 1B06A 3WP3A 3FE5A 3C7FA 1AR83 3VKMA 4RN5A 2HBUA 4IIJA 2XHBA 1QMJA 1R1A2 4LIUA 1R3JC 3T2PA 4BIOA 1SBDA 2DYRB 1NCQA 1IBKO 3VBSA 2GP5A 1YJWV 1EZVH 3B5LB 3UT5A 1GV9A 3SHRA 3SGIA 4X6QB 5B2GB 3STLC 1GP6A 4BZ4A 1XOYA 4FLUA 2D5HA 4AYUA 4KWJA 1RPOA 4XBQA 2VQFB 4P9YA 4QDRA 3H3UA 2Y26A 3LD8A 4KNCA 3I3QA 2UU8A 5AC91 4NVPA 1OZ0A 2Q68A 1JU3A 1MS9A 1NZ6A 5A32B 2P67A 4MVSA 1RGSA 1CPNA 5LOVA 1SPPA 1VBB1 1CIWA 2HHHB 1HRV1 4Q27A 1C5IA 4DR5O 2WYFA 1EAH2 4GH4A 4NRQA 3HN3A 3QVNA 2JENA 1QJY1 1UMZA 1GN6A 3ZMUA 2ZGQA 2FYUH 1K73W 3JASB 4DV5B 4WBNA 1CP9A 2CWSA 3WF3A 2AH2A 4UCUA 3N7KA 2PELA 2DWDC 2NMNA 4M3CF 4P9PA 2J1AA 1H2KA 3B00A 3SEEA 1YQCA 5IDJA 1RHI3 1JYCA 1KQRA 4UT5A 1E5HA 5A7PA 2B9UA 1VAMA 3N35A 1PMJX 3FHIB 1C1FA 5GZEA 3KT1A 2D98A 5B1AB 3ZS8C 2DTYA 4HXCA 2J1RA 1TUBA 1X59A 1NKDA 1K34A 3CWBH 1D0HA 3Q4HB 2EIJB 2OCCB 4JI2B 3TBDA 3OYWA 2HWE2 4MV2A 5T55A 1KQSU 2VQTA 1Q3EA 2ZAHA 1OV9A 4CH3A 3DPRA 3N2KB 1W9TA 3VBUB 3WHTA 5DUUA 4LCUC 1TMF2 1JJOA 3ZKYA 2WINB 1VBE2 2P4KA 4Q4V3 4IL7A 1I08A 1SLAA 4NTWA 1D4VB 1BBT1 3ZFEC 4B1LA 4PIYA 5G04L 2ZPXA 3RT3C 3AZVA 4P5HA 1JYWA 3KT4A 4CEWB 3SJBC 4CU7A 1UX7A 5EIBC 3FMGA 2BFUS 1BEV1 5CA6A 4LNVA 4D8MA 1ZBE3 3BA8A 4QGPA 4YW2A 4WFAV 4EN6B 1BMV2 4XFFA 3HKCA 2SLIA 3LUTB 3CEWA 1A8MA 3ZPYA 3ZFFA 5KMGA 5KXDA 3HNBM 3APOA 1UMHA 5ACA2 4KFMA 4GKKO 1IPJA 4WFBV 5JCOA 2VQEB 3RI9A 1VQKV 1AX2A 1Z2GA 2Q4SA 3WX5A 1UMIA 1OT5A 1DF0A 2AEZA 5EZYA 2DFBA 1NH2D 2W1UA 1CZTA 4FLWA 3P1IA 4LFBB 4OLLA 4QQLA 3FLPA 2XJVA 3LDKA 3PVNA 5KXEA 3HKBB 2FMDA 4LF4O 1AB3A 4W6WA 1GQGA 1RC6A 4Q4X1 2VW1A 3N27A 1CIYA 4CS2A 3AXEA 3K0GA 1J3RA 2PLV1 3D8CA 5JVDB 2HP8A 1RJ8A 2ZEZA 5LA2A 3ZXEA 3HPLC 1KUQA 2PHRA 2D3RA 2YFUA 4GYCB 2Z5WA 4QE7A 2EXJA 2IXIA 5FK8A 3KG2A 2VM9A 1D5NA 1COV1 2W5FA 5IYYA 1AR72 3ASOC 5IVVA 4LJHA 1RP3B 3I2HA 3KV4A 1N1SA 1GR3A 3A7QA 4LKDA 3O9OA 5HXVA 4CZSA 1QOOA 3MGUA 5FOBB 1VB4A 2D6OX 3ZHRA 5FR3A 1PZ8A 2EX3A 3H1YA 1XNDA 3MEPA 1QGLA 4NPMA 1VBD1 4OGQB 5C9AA 2RDSA 1DF5A 2VOWA 4C1XA 4EZ4A 3T4DA 4LUMA 3WB2A 3ACLA 2A6YA 2RS53 3CBNA 4KWLA 2JIGA 4XW3A 2J42A 2D6PA 4K6BA 3RQ0A 3GM8A 2HLDG 3VBRA 1WW7A 4UXNA 2BOBC 4GX1A 3CD6V 4IE5A 2QDNA 4H3WA 4NHKA 1VIBA 1VBC2 5CIRA 4CCEA 2UXCB 3I3MA 2W6IG 2R042 1H6XA 2F4LA 2JDPA 2GH2A 2CK3G 5ISLA 1Y74B 1H38A 5C3QA 1P8JA 4LNUB 3X2QC 5BV6A 1NZCA 5EJ1B 3RZGA 3KV5A 3S7IA 5D8AC 2XT9A 4LQRA 4PDVA 2EAAA 2FMYA 3OTOO 5IJRA 3ZXLA 1C8M3 1OOPC 1YF2A 1VQ9V 4M0HA 4CP9A 2LW1A 4CU9A 4Y20B 1YJNV 4YM0A 5HCBA 2YSUB 4JASA 4TWKA 3URFA 1V55C 3AL5A 1N33O 3VGIA 3IN9A 4YGBA 3U78A 1K5JA 1NVPD 4OUSA 1RMU3 3MW3A 2XKPA 1RUD2 4JYCA 2PLV2 2BTVC 1MVQA 1TNFA 3ZFEB 4N7UA 3PIGA 4OMDA 4JRAA 1XU2A 3IJ4A 2WWUA 4E9KA 1OF4A 4O2AA 4U3JB 5GLZA 2P3KA 1RUC2 4AHXA 3J26N 1ONAA 3H8UA 2JJ1G 5EYPB 4GB32 1XXNA 4Z92B 3QACA 1PGL1 5LYJA 1HQNA 5C8WA 1AR81 5FPLA 3ZJZA 3EXUA 4MGQA 4YVWC 2VD7A 5FZ9A 5K8SA 3KV6A 1ZRIA 4NXMO 3WDXA 4LOSA 4B08A 3M3QA 2VXJA 1Y4MA 1LEMA 4BU2A 2YROA 1NBMG 1OXCA 3K3WA 2C1FA 3BVCA 3VKNA 1N4CA 1JOYA 4DXTA 3FJSA 1WCUA 1EN4A 3WG7C 2WZPP 1AJKA 5BY1A 2JS3A 2ZIOA 4NTXA 2IU0A 4CS4A 5IAXA 1OBNA 3AYCA 3IC7A 4XHBA 5HCFA 1BVVA 5T3NA 5A80A 2XHNA 4UOJA 5GONB 2D6MA 5JH7B 2Q8EA 3U1XA 1RM1B 4QAWA 2QUOA 3L72H 4WFFA 1AL23 1ZZ8A 2RR11 1ASJ1 3ZXFA 1QDCA 3LSEA 1HNZO 2PHDA 5HBAA 1KRIA 3T1YO 3OBZA 1VQ6V 3LIHA 3ON7A 1RB8G 4S2DA 5EBWC 1EN5A 4IEPA 3RSJA 2C24A 2VUJA 1HXS2 3TOJA 2ARBA 2E7QA 4QXBA 2PN5A 4R9AA 3RYKA 3ASOB 5BMVA 2IXKA 1G1XB 2LTNA 4CSWA 3ZXDA 1S0EA 2PAMA 2ZE5A 2BERA 4XCAA 2JG9C 2VXRA 2QFEA 2DV9A 3SMHA 4M00A 3N9OA 3OY8B 2YDEA 2CTPA 2EILC 1UFIA 2I2SA 3GWOA 1K97A 3T1HB 5JIAA 3O1SA 3ZLIA 3LIGA 4FZ1A 3SJAC 3BALA 3LEKA 2ARCA 4BQWA 3WNLA 5EXOA 2ZBJA 1AXZA 1EZJA 3AG4B 1QJFA 1EV11 3NJXA 2ATKC 1AZDA 3NW4A 3ZSJA 3GCWA 3OUFA 4CXXA 4UW6A 4IEOA 4DR5B 3VBFB 1ORQC 3V0BA 2WNVC 5CBFA 4Q0VA 4Q4V1 4X20A 1TGOA 2QTWB 2KKWA 5F5IA 1O9GA 1NQDA 2WSSG 1W2UA 3C7GA 2PY5A 3ZHVA 4IV1C 4GMP3 4IV3A 2L35A 2BE3A 2OIEA 5LXTA 5GW7A 3E8FA 2ZTNA 3ETEA 4XXAA 2QE3A 1VBA3 1YYNA 1SQ4A 3AP7A 1ZBE1 2IC1A 4FVMA 1PM4A 2I07B 1UAIA 3X2QB 3MIFA 1R6NA 1LJ7A 2ZE6A 1UPSA 2N74A 4DB5A 4AVCA 4NIIA 5D8AB 3KF5A 5L3GA 4GAZA 2Q73A 1SQFA 4YZ2A 1OOPB 2E5LO 4A41A 1OF3A 3CJIC 2VMFA 1ND3C 5JJEB 4ZU4A 3QO8A 2LS6A 4KG8A 2YPDA 1JOBA 2VR4A 1KD1W 4FPJA 1M56C 4YM3A 4AI3A 1W0OA 1OLQA 2ZXQA 2V7QG 4JI6B 3MHSC 4XAAA 1V55B 4YZ5A 4JRLA 2RG4A 3IPVB 3JQXA 3ZMNA 2NNUA 2HG5C 4Y3OA 4DV6O 4PQ9A 3HKEB 2NYYA 3QOPA 4H55A 4YW5A 3VB9A 4OVEA 1US6A 4A7YA 1S0CA 3AG3B 1ULEA 1LGNA 3K3NA 5JAXA 2W46A 1MA1A 3UESA 1AI5A 4LH7A 4IEQA 1GOHA 1XQ8A 4TXWA 1HNXO 3MI8A 4L8JA 3NO8A 1KB9F 4GKKB 2WZ8A 4CDXC 4E2GA 3AK1A 4YVWB 4GX2A 1DBNA 2V73A 2IJJA 2Y0IA 5KC6A 3ZSEA 4UAPA 5C4WA 4Y22B 2H6BA 2XXZA 2JGDA 2ZGTA 3ES1A 4FXKB 3MHHC 1RHI2 4DK1A 4AFMA 2ZX3A 1G6UA 1BXHA 1N47A 3MW4A 4J1WA 2WS93 1FPOA 4RO2A 4J42A 2YICA 4EB6A 3ILNA 3NQHA 3WG7B 5A7QA 1XE7A 4LF4B 1JYNA 4DV4B 4Y1YA 4IEZA 2EIGA 2OZJA 2DE0X 3W7TA 2QQNA 1NS1A 3J81N 2V4DA 2JG8B 3D36A 1QQP1 4LMFA 2DF7A 4Q4V2 3WDWA 3RWKX 1I3HA 2WR9A 5KHKA 1DGRA 1WLWA 3K5NA 2XJUA 2GDSA 2IZWA 1LEDA 2YHJA 4ZONA 2GTSA 3DUIA 3Q8AA 2UUCO 4PDRA 4LBNA 4AW7A 2ZKOA 1UOJA 5T54A 4DPNA 1AJPA 4O4JA 5IJ9A 3JD73 2DYSC 1UYPA 2Y60A 4FPEA 4FXGB 1AJOA 1QR9A 3F5TA 4GT1A 1C8NA 2ORXA 4D6RA 3ABLC 4HYOA 5J2TA 3ILFA 1E5RA 2JG9B 2AR6A 3M3CA 4G27B 3I4IA 3T2QA 4AQ2A 4KBZA 1OKOA 3GGLA 3WV6A 1C8M1 3DYMA 4G9SB 4OX9O 4O4LB 5IFPA 4I02A 4A6OA 4JI5O 2E6VA 5DEDA 3IDCB 2YI9A 4AI2A 2AXTZ 4CUCA 1POQA 1HJFA 1QNWA 3PVEA 3JBG3 5L9BA 2DBIA 3IKWA 2P4VA 4QNHB 2X10A 2WNVB 4QU2A 3W20A 1RMU1 3VBOC 1DLBA 3AK2A 5IE9A 3K4ZA 3CCUV 1OD3A 4KU8A 1Y76B 3ZMSA 4IV1B 4YWAA 3HPNA 4X1KA 3ZFGA 4FFBA 1NR7A 3ETDA 4AQ6A 4LIVA 5A6ZA 3OGVA 3THOA 4M3CE 1MACA 5JCTA 5FZOA 4Q1RA 1BJQA 1ZUQA 2QKAA 3FB5C 2PTMA 2HWC1 2VMIA 4LFCO 3WQ0A 3OTOB 3W7WA 3WINE 2DUPA 3VHOA 2JEXA 1E5IA 1AHSA 1H30A 4D94A 1ZZ7A 1SCRA 3CQOA 4MVRA 1AI4A 3CJIB 2BWAA 1ND3B 1RITA 4TN7A 1URXA 2QKDA 4BQ3A 2R49A 3QBQA 5ABJB 2ZEYA 1M56B 4COYA 2HYXA 4CUBA 4B3TO 1JI6A 2EVXA 3W59A 3CMGA 5K0UC 2RS32 3RZJA 3JATA 4JKKA 1PM7A 5EC1C 2RS52 1S5JA 4B3RO 2HWF3 3MPPG 2AYHA 2QDRA 3ALQA 2PYJA 5H6QA 3EVKA 1GRJA 1X33A 1YO8A 5FZDA 5A6XA 1FV3A 3OGGA 1XRUA 3HB3B 2WWJA 4LA2A 3H3ZA 1WBFA 3HR0A 4XDPA 1L7LA 4NXMB 1AROP 1POV0 3QTCA 4CDXB 2GHYA 1N3QA 3J80N 4QPIC 4DOUA 2A70A 5A70A 1N32B 2W87A 2QTSA 1NYWA 4BWOA 2Z2SB 4CXYA 3MAQA 1Z5WA 2ZCEA 1JTZX 2O14A 4MGKE 2A06H 3ZHTA 1DFQA 4TQDA 1JYIA 2CGPA 1JZ8A 4BA6A 3C3SA 5CAZA 3RWRD 3DF0A 2W6JG 5FPOA 4A3ZA 4OXSA 5ITZB 3VL9A 3BPZA 4OPHA 3JQWA 4P9OA 5GALA 1ND2A 3POWA 1FS0G 2JKBA 4QU1A 1HQLA 4FVVA 3H7JA 5EP9A 3U75A 5EV7A 3AZYA 4RUFA 3ZX6A 2VW0A 4GKXA 3LSQA 1FJGO 2GNBA 3NJVA 1AX1A 1D4M3 5DUXA 1HNZB 3M99B 3T1YB 3N2GA 1JMKC 4GIQA 3PHMA 4PIZA 3AB0A 4ZXKA 2JE9A 4URTA 5CG9A 1AJNA 4UW5A 4D0QA 3RRDA 1H8EG 4GMP1 5LBQA 3KWVA 3IT8A 5IHRA 4AGVA 3THDA 1O5UA 3JD3A 3NKTA 3LFIA 1WMXA 1FV2A 2WA4A 3QD6A 3FN9A 4X62O 5A3UA 2DYSB 1VBA1 1AXYA 3WP6A 1DIWA 3ABLB 1KYOF 4FLVA 4XUOA 4XOGA 4EWAA 5KAIZ 5LBBA 2Q8DA 3RDIA 4NIAA 4X66O 2B42B 4E8DA 5JOZA 3I49A 3CCSV 4PLNA 4AAXA 4QKNA 2PYTA 2MK3A 1AX0A 2R32A 2NP0A 4CH4A 3UGHA 3K4AA 4XQDA 2BOJA 1WP8A 3PVBB 1N3OA 3N2KA 1NJIW 1L3JA 3AYDA 4BIUA 4NE9A 3ES4A 3R05A 1YLLA 3M70A 3E6CC 2A79B 3S0MA 1ZL8A 3AKPA 4ARXA 1GP5A 3CCJV 4D6SA 1W8NA 4I9WA 3OSDA 4CDUC 2FDFA 5FLHA 4LWSA 3VBOB 1ZRDA 1V6JA 2AW9A 2ZGOA 3RNSA 4DMIA 5BXZA 1AL22 1RUOA 4DO0A 4Q4Y3 3B8MA 1CJDA 4CCKA 1UU5A 2B1IA 4Q0QA 4RHV1 3Q8CA 4PI2A 1UKGA 4I9QA 1MPXA 1XNQO 4OZOA 5JI9A 2ZM6O 3TWIA 2VNOA 3BA9A 1QHDA 2EIKB 5CEHA 4CH5A 3ZDSA 2Y34A 1TVKB 4WCEV 2WWSA 2YZ4A 5K0UA 4NHYA 2E5LB 2RNBA 1LB2A 5LMUO 1IBMB 2GC0A 3OGIB 4TSVA 4XIOA 4HNAB 5C33A 2WLIA 3ZMVA 5H6RA 4IW3A 1MZ6A 3VV1A 3QO5A 2A75A 1O91A 1K3EA 4DV6B 1W6OB 3DKWA 4ATFA 3W5MA 5FKBA 3QNEA 1K33A 1GH6A 3WNKA 2BTQB 2YBSA 5FY8A 2WAAA 1S3JA 1DHKB 2EZOA 5A7SA 2H0BA 5B1OA 1SFNA 1RUH3 1HNXB 1NT2B 2GN3A 4FLXA 2ZGUA 1GWKA 2A6WA 3L75H 3A0HZ 3S3XA 2XQXA 2VWJA 1MNGA 3D3IA 4LKEA 1K3IA 4G2KA 1K5MA 3WG1A 4XIKA 4MOAA 4QPIB 1VBA2 3JD71 4MHUA 4UB8Z 4L11A 4RS5C 1Q43A 5KA6A 2WFF1 2Q7EA 4KH9A 2VCCA 4EQVA 3DGTA 1SRYA 3EXAA 1W6QB 4BWAA 4LBQB 4H14A 1VQ8V 1AP6A 2GSYA 2ATFA 2JDMA 5FJKA 5IWAO 4META 2JDHA 5HXMA 4HONA 2XJQA 4PIXA 2E9QA 2R0HA 2CDYA 4IETA 4JI1B 3HWJA 2ZGLA 2UUCB 4ZXEA 4RSUA 3IIAA 1IHMA 5D5PA 2TUNA 1ZX5A 4YZ1A 5T52A 3ACIA 4BYYA 4PV1B 2FZ1A 4PD4F 4C8DA 2B5HA 2OKXA 3H01A 1ULOA 2F4PA 4COWA 3GF6A 1K45A 4PDLA 5F5QA 3NNMA 1UOGA 3OUSA 4RL7A 4NPRA 3K46A 4OX9B 3JD1A 4OI0A 1XREA 5CFCC 1NLSA 3DKQA 1AR93 5F8PA 4JI5B 4JHTA 3M3IA 5C70A 2VMGA 1DYKA 4DW0A 3UETA 3U10A 4XFIA 1LHUA 4E2LA 2WS92 5FPVA 3U37A 1LOAA 2ADQB 3OGJA 4E2QA 1U12A 1GM7A 2X7RB 2DOSA 4Q0SA 3OGSA 4UB6Z 4H33A 5EPAA 1QKQA 1BZKA 1VALA 5A33A 4Y26A 4CDUB 4NR1A 2CH7B 3NXSA 2WN2A 3THCA 1MVEA 3I2KA 2VO5A 3AZXA 3KLSA 3SPIA 4ZIBA 3NNJA 2VTXA 3TAYA 3I2FA 3GZUC 1W6PA 3N7LA 5KX5A 4LPLA 4DUYO 1HV0A 1CQ9A 3IAYA 2VPVA 4D6TH 5ERLA 3G7DA 5FZBA 3UKNA 1WD4A 2GMEA 1OQ1A 1DGLA 1BCCH 1QCEA 1EFRG 1KU9A 3OM3B 2RM23 5B1NA 1QJEA 3M7AA 3JD72 2CAZC 3UKMA 4AQYO 2YIBA 3E22A 1RUG3 4W6XA 5GLWA 2KM2A 3ZIXA 2QKSA 2JDKA 5C3RA 4B3TB 4PDWC 4QQPA 4DNYA 3N7MA 3CJXA 1J3QA 4OULA 1ZTEA 5L7OC 2GUZB 3SPJA 2B4KA 1MOFA 2JICA 2OT5A 1QXRA 2P5BA 2PHTA 3OUJA 1R73A 3JBG2 3O1UA 2W08A 2WNUC 1ULPA 4FAHA 4LF5O 5DZGA 1IG0A 1ULFA 3K58A 4DR4O 1Z7S2 4P9WA 1PD3A 4BR6A 3NV1A 5LBFA 5J09A 2ZHKA 4JQTA 3J7MA 3D3QA 3F95A 5K1PA 2VQAA 1PKXA 2C6SA 2ID4A 1QOTA 4W4KA 5A3MA 4IYIA 3C2UA 4MGIE 4NROA 3AMQA 1VRH3 2IFRA 4GD4A 1UQXA 3BTYA 3I3EA 2A7WA 1CAXA 3WDYA 3FAVB 3V0AB 1AR61 4Y4RA 1XHXA 5BNQA 2QQVA 4WVMA 4A4AA 4IHJB 1QVFU 1C28A 1HN1A 4XF0A 1SQXH 5DG1A 3T09A 3ZRWB 2UXDO 2XKOA 1CAVA 5C3OA 1IS4A 2HEVF 4TLFA 1JHJA 1W8FA 3MDSA 1FJGB 4BPZA 3WDUA 1QBZA 2BP6A 3VBFA 3ML0A 3FKSG 2XL7A 1FNYA 4HANA 1F4HA 3CYOA 3RBZA 1ENRA 2KXLA 3LE0A 4LORA 3FLRA 1XNBA 1IVSA 3IM0A 2D93A 5EJ3A 3I59A 4E2SA 1K5SA 4PT6A 2WL1A 1JXNA 3VD9A 2HWF2 2I74A 1PO11 1P7GA 2AZ0A 2OTJV 2CGNA 4MT8A 2PHXA 3SPCA 3TNQA 4X62B 4O4IA 1S0GA 1XNCA 5FZ8A 3T2TA 2XTAA 2BW8A 3C8XA 3K51A 1F4NA 2Y0OA 4BMEA 4F3JA 1DQ0A 5IFTA 4X66B 5C8YA 2XNDG 4DR3O 3HBZA 4ZY9A 1HR0O 5CFCB 4ASLA 1XNAA 5CB4A 1S4CA 5KA5A 5DM6V 3KMHA 5EYYA 1UY4A 1LU1A 2ZKLA 5DN6G 1NCRC 2PZSA 2PQSA 5GLTA 5JSPA 1EM1A 4P14A 4JI7O 2B5UA 5J1XA 2RV9A 2JE8A 3UYJA 2UY8A 4O61A 3J7NA 5JJJB 4R9DA 3GCXA 4CH6A 1FAYA 1YFXA 2DN9A 5LGUA 3PTRB 2K46A 1VIWB 2WPDG 1JQ0A 1QHTA 4QGMA 5GTHZ 2PAKA 3DTUB 3WF4A 1G4YB 4MGYE 2RQ6A 1PX4A 4UUJC 1D4M2 4FZ0A 3EMRA 1HP8A 3H1WA 4FQ4A 2EA7A 2Z4FA 4YW7A 2R72A 5FNVA 4MXWA 5FIXA 4XTMA 5DUWA 1RUH1 2ZM6B 3PJYA 3O1RA 4WM7C 3IGAC 3E5UA 2BOCC 4JYAO 2ZOEB 3KHBA 3BAAA 3MUZ1 3HN1A 1GQHA 3DXRA 2KSDA 5HFMA 3ZM8A 1OHFA 3TEYA 1S2EA 3V64A 1NXMA 5LMUB 2A7AA 4IERA 1JCHA 3OFNG 4DO2A 3A23A 4EE2A 4L87A 3DECA 1J1TA 3EYPA 1U97A 3K75B 1LGBA 3BTXA 2Y48A 1WA4A 4QQHA 5C8CA 4PDWB 3EQEA 4K3AA 3ZMZA 4JTDB 5JPMB 4AI1A 2CE4A 4HPKB 1VR3A 1G9DA 2C2AA 3ZO0B 2GU9A 4JI8O 3ZSMA 5L7OB 2JG8A 4CCCA 3OJBA 3POIA 4J25A 4YW1A 4DR2O 1V6NA 4K40A 2WJSA 5M0TA 2WNUB 4K20A 3J7AU 3MF9A 2Y69C 2QNKA 4P5YA 5BNNC 5FY9A 5LA6A 4N7IA 4WM8A 3D0JA 3GDBA 5K9YA 1PK6A 5IK8A 3ZOIA 1H2MA 3LCPA 4IYHA 3VHNA 4AGRA 3HEIA 4X65O 1E1QG 4Q4Y2 2OA2A 1A8DA 1N3PA 2QE7G 2FTKA 2XH6A 1XMOB 1ENQA 1TME3 3SJQC 2B45X 2K2SA 4HKLA 5IVJA 3JAWA 2BNMA 2Q6AA 2LFSA 1MS4A 4MS2A 2RMU3 3MUY1 4UVBA 3UNPA 5J2UB 5LEJA 3H9VA 2VZVA 1RSOB 5BNPC 3HIFA 5CZKA 3ZXAC 4CPBA 5FZ7A 4DEVA 4DS0A 2VCBA 2Q5ZA 3OGCC 5C5UA 2Q8OA 4UXAA 1PM9A 2D6LX 1V9U3 4I7ZB 5IVBA 3J8F3 2KG7A 4JGYC 1RPRA 1AR5A 4FLZA 2EICA 2ERFA 4XDLA 5L3CA 4HK9A 2IXCA 4RGAA 1IDSA 4FOVA 5KXCA 4ZOLA 2FDGA 5LP6C 1RUI3 4JGZA 2ZA9A 1RUH2 2JEMA 4OI1A 2EZPA 4XJZA 1ULGA 1SA0B 2ZX0A 1D5AA 1Y9GA 4I4TA 1UZYA 1SLBA 5LY1A 1K42A 3FFZA 4IE0A 4YZ3A 3MIEA 3HKDB 3ABKC 1I0HA 3DSQA 1OH3A 1TAEA 5AG2A 3DL3A 1G6NA 3RPQA 4AZZA 1MQTC 1OC1A 3BU0A 5EFUA 5LATA 1MSWD 3NMBA 3NVCA 4FO9A 3JU9A 1GICA 3CCVV 1NCRB 1W59A 4CDWC 3FC0A 4XFGA 2KB1A 5GZDA 3LWCA 2WLNA 4BQ1A 3W7XA 2X53S 2FMLA 5FP4A 5LA1A 3D82A 1SQPH 4NMIA 1TA8A 3E5QA 3PUHA 1MEC1 1FPN2 4BJ0A 3NAPC 5DQ0A 1H8VA 4URAA 2SBAA 4E4HA 1XC6A 4A2UA 1R091 2HVJC 1YCIA 1B09A 1UN1A 4Q4W3 2WC2A 4UYBA 3P30A 4L0PA 1M4UA 4OUEA 3MHZA 3R4DB 4M3CA 5JVVA 2A9HA 4WM7B 3AG2B 1HDKA 2UU9B 4CP1A 4C0HA 1ZWIC 5IVYA 2WLHA 2KR2A 1T5EA 2P17A 3SYOA 1PO22 1RFYA 1QXPA 4EV0A 3SR2C 4JZRA 3AJYA 3WF0A 1TQ5A 4AQYB 4S2GA 2QQPA 2YYOA 1Q7YW 5KR7A 5DPNA 3SXWA 1GBGA 2WUHA 4EWEA 4RR3C 3RYIB 4LF8O 1FMD1 1F9KA 2WIIB 4H0LB 5A7OA 1RUJ1 2WN3A 3FLTA 3ECQA 5ITZA 1GO3F 3ZN5A 2PAEA 2ARAA 4NXNO 4OPAA 1AR92 4LUKA 3JARB 4BK5A 4FPYA 4XDQA 4IDZA 4YNIA 4A42A 1HW7A 3BI3A 4P9XA 3HNMA 3OF1A 1CX1A 3FYIB 3GXUA 1EAH3 4A44A 2AEYA 4WFEA 1ODNA 3POFA 2VG9A 2YS8A 4N21A 4LF5B 3AK0A 1TG7A 4DR4B 4F6RB 1HJGA 2Y69B 1UL9A 5BNNB 3QG5A 1DQ5A 1W8OA 3CNAA 3FBMA 3WDTA 2RDQA 1GZCA 4OHXA 2VMDA 1H9PA 1WPXA 4C91A 1UF2C 3FL7A 4MZUA 3QLQA 1LHOA 4OQ9A 3SYAA 4Z1MG 3E1F1 2ZX4A 4ZKTB 3JCIA 1UJWB 3VOUA 3EFFK 4ASKA 4JGYA 1DDLA 1JA8A 5IVFA 3LSDA 3LGRA 2RM22 4D7TA 3I2IA 2ZX2A 1SESA 4K35A 1HLCA 3CU7A 1GN3A 1RUG2 2YIAA 4WV8A 4O9EA 1DYOA 2WLPA 4Z82A 3UJOA 2XJSA 1ODMA 2Q4PA 5FDBA 2YUEA 1Y6XA 4LBLA 4XFAA 3SISA 1YEWA 5LK7B 4QPYA 2ET7A 4O7XA 4TZDA 3FFQA 4HETA 2WKKA 1ZAUA 3KCXA 1JZ2A 3WU2Z 5LA0A 4ZHQB 5F9TA 4KBBA 1XHZA 3E6DA 2HHHO 2D40A 4YW4A 1GZWB 1OCCC 1XBFA 2AZ2A 1OFNA 3FUOA 2HFEC 2GAUA 1IG3A 4EKWA 5FPUA 3SCFA 5LP6B 4M4PA 1Q56A 1RUF3 4UWDA 2UXXA 3JALA 1OURA 1LECA 3JSLA 4YIOA 5KUMA 4ZZ8A 2PHUA 1W6NA 1L8DA 2YBPA 1QWRA 1DGWA 4LLFA 2BVVA 5A9GA 2VZQA 4X64B 4U36A 4DR3B 2GDFA 2JXAA 1AR4A 4YVSC 4TV9A 1F7YA 1B35A 2P3YA 2VNGA 1VRH2 3CRQA 1GMMA 3LOBA 1S5HC 3GHMA 5LWBA 3H1JH 4HBNA 4LC1A 5IYCO 3CXHF 1UY1A 1MQTB 2RJ2A 1ACCA 2XHKA 4JI7B 1CX4A 3RYHB 1OCRC 1GN2A 3KQ4B 4CDWB 1UZVA 2CY6A 2P34A 1H1IA 4AEDC 3A22A 4FTSA 5JI7A 5KHIA 3AVSA 3RYFB 3CRRA 4FSJA 1WB7A 3NAPB 5FYSA 4CU8A 1BS3A 1ZBA3 2XVGA 3A0KA 1N34O 3D0SA 3L70H 5G05L 1IPSA 1L1FA 3P32A 3WCRA 4QPJA 4I5SA 1JN2P 4M01A 3M1HA 4PJ0Z 3LFMA 3CJHB 4JV5O 5CBLA 3A0BZ 4CUAA 1JMUB 4QX2A 4EJRA 2TNFA 4GKYA 3ZYIB 5JIUA 1XE0A 4QJFB 2YC0A 4TLGA 1VF6C 1IQAA 3QH6A 2YEVA 5CKMA 3OR7C 2FCTA 3BKZA 3K03A 4RR3B 2ODMA 4H7LA 2VQEO 3G71V 1ZSPA 1Y9MA 2XB6C 3CZJA 1N0NA 1NKGA 2MPFA 4CRQA 5EHDA 3WNXA 1W6QA 4I3GA 2VULA 3ICXA 5JMOA 1K4DC 2P5OA 3AYEA 3K2OA 1TE1B 5E16A 3T0BA 2C9AA 4JI8B 2JDYA 2R072 1AL0G 5L3FA 2Y4UA 3ZKUA 4B3MB 3MW2A 4SLIA 4QPWA 4DR2B 3O65A 4UFKA 1V9U1 3WEZA 4EFEA 3OEAA 3RYRA 3AK3A 1GQPA 2JECA 1I5YA 2RS13 2R9AA 4UI9L 1LOFA 3OUHA 4HVOA 2Y6HA 5FPRA 2A73B 2W94A 3B02A 2WBKA 4LF7O 1WA6X 1NTZH 5C6CA 2P22C 4X65B 1XYNA 3K79A 4NWWA 2E33A 1X8EA 5FYZA 4IE7A 2VVEA 3AJZA 2R061 1OJHA 1U0AA 2XAQA 4YFZA 5JSRA 5TSWA 3WHUA 1OMIA 3WNNA 5JOWA 1SACA 1QXJA 1K7DA 3MBWA 1COWG 3G6EV 4P9LA 3CX5F 1STMA 4H2AA 1CJPA 1S2KA 2DCTA 4GALA 5CU1A 1SHWB 4Y5TA 3SLIA 3THPA 4QB2A 5B66Z 1NCQC 3VBSC 1ZA4A 3T2OA 2HEWF 1SBFA 3RGBA 1Q6UA 5F2SA 4Q8LA 4I50A 3KF3A 4JZ2A 3MD0A 1RUC3 4B4QA 1PZ9A 1OCCB 1CESA 1JUHA 1W2BU 3IFXA 4CYDA 1G8WA 1KP3A 2ZGNA 3VD3A 4FFHA 1DGRN 2VZ1A 1FXKA 3HQRA 1R1A1 4J7KA 3RZMA 3AMHA 1QNYA 1W8TA 3TEWA 5EIYB 1ENXA 4YARA 4FOQA 2BSKA 3USUB 4GH4C 3N3HA 1TME2 5IVEA 4YVSB 2YIDA 5LBCA 4PQQA 3MFCA 3MV01 1PZ7A 5CA0A 3INAA 4YJ3A 5CA3A 3RFRA 4ITCA 3HVDA 3VDBA 2RMU2 4PA4A 3FHAA 3JUUA 5F2VO 3BY6A 1QDOA 4XZPA 1YQ8A 1QJX3 1OCRB 2WDBA 3IMNA 1LUWA 5E88A 3DXTA 4AEDB 5F3GA 5FZKA 1KS5A 2CV6A 3B4SA 2P06A 1WBLA 2HWD2 1V9U2 2DVBA 2QKCA 4FIPC 1BGYH 1EAH1 4Y24A 3CCRV 3FD9A 3I97A 3J8F2 2ZACA 1HRI3 2DQ3A 1IXBA 4CCJA 3KHCA 1FKAO 1QIQA 4YJ2B 4QIWF 4ASMB 3DPRC 5B4NA 3ZIWA 4AVAA 1CAWA 1T2XA 3OBTA 1SCSA 3CRMA 4DV7O 2VVFA 4DV0O 1VQOV 1RUI2 3MFAA 3O0WA 5FPXA 5FZLA 3UM7A 3VZJA 5IYZB 3CC2V 4UFJA 3R4SA 2P6CA 4DFSA 3LDDA 3I7DA 4GZRB 4C0BA 4XMAA 3SH3A 5FXZA 4HSJA 2HWE1 2ET1A 1JFFA 4AGGA 2Y6FA 4MO3M 3ZFFC 5LL6Y 5F5CA 3KZIZ 3S30A 1TMF1 1ZX3A 1VBE1 3M3EA 4ASUG 1KKCA 3EHBB 3BGAA 2BTOA 2N05A 2ZXWC 1PVC3 1J1LA 4N43B 4X1YA 4LF6B 2A6VA 4BISA 4J9YB 4G4FA 5E6HA 1E5SA 4GWMA 3GBGA 1H8TB 3M2MA 2D44A 1PGSA 3NNGA 4LXLA 2QWRB 4Q4W2 3SDLA 3M3OA 1AYN3 3ZYRA 3R0RA 1BMV1 5FPZA 3N9MA 4CDQC 3TN93 1RUE3 2BVBA 1N1VA 2ZAAA 1V54C 1VAVA 5FYVA 2P6JA 1PNMA 3MYXA 2JB8A 1YFUA 4QDQA 5ACA1 2VMEA 1NY72 2VW2A 4P9IA 2W1WA 4P9JA 3BOWA 4COZA 4OI2A 1W04A 3VZOA 4Q5OA 4FFGA 5BXXA 4QM9A 2W91A 3UJQA 2DW4A 1KFUL 1WA8A 5FZ3A 3IWZA 2C0ZA 3T1HO 2O57A 4B3NA 4IIJB 1JBCA 1H6YA 4UW3A 2YB7A 4AWDA 3T1CA 1TNRA 3FWEA 1NCQB 3VBSB 4HL0A 3DC6A 1HB1A 3UT5B 2VTFA 1QOSA 4UVCA 1P4RA 3ZXKA 3LPFA 3BYWA 4AILC 2XPJA 1IQDC 2CHHA 3L9DA 4QXCA 1J84A 1UOFA 3ZXJA 1VMFA 5C9AC 3O1PA 4W50A 1AR71 4YGCA 3FB6C 2ZE7A 4IT5A 1LOEA 2BFUL 3J9SA 2DTWA 1BK1A 1BE3H 4NKGB 4B4RA 5LOVB 1SPPB 1SG3A 1AYM2 3VBRC 1JUIA 4IQPA 4GH4B 2DVGA 1QF3A 1RUNA 2DDUA 4ONUA 4HG6B 4MVUA 4X1IA 4MG2A 2WNOA 4LBJA 1XSQA 1PNGA 1W6MA 1KKDA 2FHRA 4WBNB 2JJ2G 4ORFA 4AFAA 2QR4A 3CCQV 4R4XA 2CL2A 4LO5B 1VQPV 1ZZBA 3AG1C 4C7UA 2OQ7A 1XNRO 4AF9A 5CVRA 2GC1A 5JOXA 1YJLA 5HCAA 3R4UA 4JI6O 1NE4A 3PJSK 5F32A 3NRUA 1N34B 1B04A 2ZHLA 3MIBA 5FZMA 4HZFA 2EIBA 4O9GA 4R9BA 1TUBB 4ZS3A 3C90A 4RWUA 4XUNA 1VBC1 4I55B 5KUKA 2OCHA 1NE6A 5JR2A 2R041 3OYWB 4JV5B 1Y66A 1OQDA 3DPRB 3VDCA 1IKQA 1MS5A 4QPGA 4J7ZA 5A3LA 1CAUA 1H2NA 3OB8A 3VKLA 3KCCA 1RUF2 3ORJA 1MZFA 3PU3A 4OCTA 1QY4A 5IK7A 3AZWA 2BBVA 1KJRA 3CCMV 5F3IA 2GH8A 4K1YA 3IMMA 3H1MA 1POV3 2JIZG 4QWNA 5E1AC 3O12A 4YGDA 4LBMA 5K4LA 1YIJV 1SQQH 4GQ7A 1M9NA 3ENRA 1PL0A 5JQGA 1HIXA 5KXBA 2OYQA 4HFSA 5F6KA 2RHPA 1H1MA 3HKCB 1MS3A 4N53A 3ZFFB 5KMGB 5CADA 1BCXA 1O6UA 4DV4O 1N8RW 4CDQA 2XWBB 1A78A 1RUD1 3LNMB 4RQFA 2ZXWB 1OPMA 4LF7B 4Q2FA 5GTIZ 5EZYB 3Q9OA 1ZA7A 4XZUG 1ZBA2 1RUC1 1SBEA 3U11A 3T08A 2XJRA 4GB31 2XAJA 1I9RA 5FZ6A 5GM0A 3E97A 3I56V 3B9CA 1UZWA 4GZ9A 1WLCA 3ZCCA 2AGSA 1V54B 4A45A 4FFKA 1F4MA 1H8HG 4XJ8A 5JPNB 4JI0B 5HFLA 5JMCA 4XFHA 4HKOA 4WVZA 5FY0A 2EBOA 1VQNV 1FXZA 4ISQA 2ZGKA 2BBAA 2C4XA 2OWOA 1UY3A 3L73H 1HB3A 2W52A 2DQ0A 1S0VA 1RJ7A 1UU4A 4F7ZA 1ULCA 3TCUA 4R7CA 2BCCH 3JYCA 5I0RA 4YZ4A 2QEXV 2PFWA 3SH5A 4TUYA 2RS33 1Z0HA 5IJ0A 2A0LA 3J7LA 1GYKA 4BXSV 2DCJA 2VOTA 1IXMA 4MUVA 3T4HB 3PMEA 5EJZB 5L9VA 2BZDA 4XBFA 2RS12 2PHLA 3RYCA 3AL6A 4LFAO 1REEA 1FI2A 2CDPA 1VAKA 5LA9A 2UY9A 1HXS1 2YXYA 3T1MA 2ZDIA 3JCUZ 4CP2A 4WFGA 5C9AB 2E7AA 3IAQA 1JU4A 2E53A 2EXIA 3IZOA 5FZIA 3DN7A 2VJXA 2OS2A 2ZGPA 5FPAA 1V6IA 3WW3A 3E6BA 2Q7GA 2E51A 3VBRB 1XJAA 3ZN6A 4F4LA 1UY2A 2ZS6B 4BIFA 2BUKA 3B01A 5A3TA 4IV3C 2XWJB 4QDSA 1SZBA 1WCKA 3OT7A 1BQ0A 2KQXA 2JS5A 3I2JA 4QX1A 3RYPA 2GN7A 1PNFA 4XACA 3VL8A 1U5IA 3AG1B 3HQUA 4IXLA 3C7OA 3GJBA 3QCWA 1Q8IA 3HAGA 3HR9A 5JXGA 4OUMA 3SPGA
chains in the Genus database with same CATH topology
1Q5OA 2DUOA 1WCDJ 1RUG3 4W6XA 2AUYA 5GLWA 2OG7A 4AI8A 2WNEA 2KM2A 3H50A 4CDXA 3CLPA 3ZIXA 4AEKA 1YI7A 2X5IA 3PLQA 3TNPB 4V1PA 4PDWC 1QQP2 4QQPA 4DNYA 1OIJA 2R062 2E63A 3ZYJB 4XQWA 1FNZA 1FX5A 1VRH1 3N7MA 5I0TA 2D43A 3CJXA 1J3QA 5HI0A 4OULA 1OA4A 3KGZA 3TYJA 4W6YA 4I3PA 4WVWA 5L7OC 4AFBA 4FP3A 5FQ0B 4AEJA 2JICA 4M3CB 1LHWA 1D2QA 2KA3A 3APBA 4YW3A 1QXRA 2PHTA 1O3SA 5T5JA 3JBG2 3TN91 2W08A 4A7ZA 2JDZA 2A3YA 1GSLA 2WNUC 1UPIA 1NX8A 2I45A 4FAHA 2ZHNA 5JOYA 4QMAA 4B8EA 2VOVA 4AVBA 5DZGA 1ULFA 2XLGA 2HJIA 2WQZC 1GLHA 1Z7S2 4P9WA 1ZRCA 3UKTA 3SNMA 5BY5A 3NV1A 4XQ4A 4Y1VA 2ZHKA 5BNOA 5J09A 3WW4A 5J48A 1U5XA 3THTA 4LBKA 4D7YA 2WT2A 3L2HA 1S0DA 3H9AA 2BNOA 5KHJA 1OKQA 2VQAA 1RIRA 3A0NA 1BQPA 1QOTA 4JDOA 3SCHA 4AHZA 5A3MA 3C2UA 4MGIE 4HT1T 1EPWA 1C8M2 3AMQA 1VRH3 4QXKA 2IFRA 4Y5Z0 5CFDB 2G9GA 3NJZA 4XEZA 1CAXA 1OI6A 3WDYA 1YFYA 1AUYA 1LENA 1VB2A 1QJX2 5C4WC 1Y3TA 4Y1XA 3B3QE 1OA3A 4D69A 2UURA 3V0AB 1AR61 1JR7A 1AYM3 2PHFA 3WP3A 5BNQA 3FE5A 3VBHA 4WVMA 4C1WA 1AR83 3VKMA 3BOPA 1GFF2 1C28A 1X7NA 1YRZA 4AVVA 1REDA 1QMJA 4AHYA 4XF0A 3WT3A 1LOFC 1R1A2 2B46X 5DG1A 1RMU2 2A5ZA 4BIOA 1SBDA 2XKOA 1CAVA 4L99A 2WA3A 1IS4A 1NCQA 2HEVF 4TLFA 1LHNA 3VBSA 4FQZA 1GY9A 3NV3A 3B5LB 1HRI2 1GV9A 3SHRA 4BPZA 3WDUA 3VBFA 4X6QB 1WW6A 2XL7A 1O4ZA 5B2GB 4PJYA 1FNYA 4HANA 5BNPB 2Z79A 4BZ4A 4DZGA 5KEUA 2D5HA 1ENRA 4AYUA 2KXLA 4FPHA 4KWJA 3FLRA 3ASIA 2R071 1XNBA 1Q8SA 1YXWA 3IM0A 4XBQA 2D93A 5EJ3A 3I59A 4E2SA 1M06G 4P9YA 4Z07A 3H3UA 1RHI1 2WSVA 2Y38A 4DRRA 2Y26A 2WL1A 4KNCA 1JXNA 1AR63 2HWF2 2UU8A 1RVF3 5AC91 2HWC2 4NVPA 1PIV2 4I30A 1MS9A 5A32B 2I74A 1PO11 3PTYA 1RGSA 2CGNA 1CPNA 2PHXA 2DVFA 3TNQA 1VBB1 4JGYB 3VBOA 1CIWA 1DQ1A 1S0GA 3N7JA 2D7FA 1HRV1 1XNCA 4Q27A 1C5IA 4JV4A 1MR5A 4FOYA 3B7MA 3T2TA 1N1YA 1EAH2 2AZ5A 4GH4A 2BW8A 3K51A 3PVOA 2Y0OA 4WBBA 4BMEA 2JENA 4F3JA 1QJY1 2G9FA 1UMZA 4WZCA 4MYEA 2O1QA 2D97A 4M2CA 1NA1A 2ZGQA 1DQ0A 3IDEA 3M4FA 1H9WA 4C90A 1HQWA 4S2FA 2CWSA 3HBZA 4W65A 2DU1A 1LOCA 2A6XA 2AH2A 5CFCB 3N7KA 2PELA 4ASLA 1MS8A 3USSA 4AFDA 5JZGA 2NMNA 1DQ2A 3PJQA 4M3CF 5GZFA 5H9PA 3KMHA 5EYYA 1LU1A 2XBO2 2ZKLA 5BUVA 1H2KA 3B00A 1PVC2 2VOXA 1C1LA 1NCRC 1JH5A 1RHI3 4I01A 5FMOS 1JYCA 1KQRA 5GLTA 3B93A 5JSPA 4P14A 4Q0UA 2B9UA 1VAMA 3N35A 3FHIB 1DRYA 1C1FA 1PO13 1PHMA 5GZEA 2UY8A 3CO2A 1PGW2 4OHWA 3KT1A 1W39A 2D98A 1VBB3 4I09A 1R083 2DTYA 4R9DA