3P3NA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1930-1949) peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3nA01
3KCXA 1H2LA 2ILMA 2WA4A 4AI8A 4NR1A 2YC0A 3KCYA 4Z1VA 1IZ3A 5JWPA 4BIOA 1YCIA 3P3NA 4Z2WA 3P3PA 2YDEA 1H2MA 2W0XA 4B7EA 2CGNA 2WA3A 2Y0IA 1H2KA 4QU2A 4B7KA 3OD4A 1H2NA 2CGOA 3D8CA 4JAAA 1MZEA 1MZFA 2XUMA
chains in the Genus database with same CATH superfamily
5KUKA 3AJYA 4V2WA 5GLWA 3ZSMA 1MG1A 2LROA 2ZOEB 3T0AA 4B1LA 5IYBO 3PUAA 1AR81 2D5FA 5GLZA 2DYSC 3B5LB 3POBA 2LO1A 1UY4A 4LO6B 2O1QA 5LMUO 1HB4A 1YJWV 1GP4A 1S0GA 4H7MA 2V7QG 4XFHA 4JC1A 5LW9A 1DGWA 5J96B 3RFRA 1ULFA 4BISA 4TV8B 2KM2A 2UUAO 1Y9GA 5J09A 3WDVA 1CZSA 1JZ3A 3WEZA 4CPBA 4LE4A 2CDOA 2LW1A 2FMYA 4FXKB 3NNGA 1WCSA 2ZE6A 5C8CA 3Q8CA 2PHTA 2ZR3A 3BTZA 5FYSA 3PL0A 4NRQA 2YGMA 1XNQB 4I01A 4IE0A 2Q8DA 5F32A 2CK3G 1GQHA 2EZOA 3RWKX 4QX3A 1KU9A 1RUE2 2KSDA 4AXOA 1W0NA 1F8VA 5FMDA 5D1IA 3N7MA 3W20A 2VU9A 3AYDA 4DZGA 5FOJB 5A3UA 1NA1C 3PUQA 2PAMA 1N0NA 1GZ9A 5C3PA 2EIGA 3ZXJA 1IPJA 2BNNA 1V6LA 5CFCC 4K40A 4HL0A 2YROA 1WW6A 3POJA 1UKRA 3SYOA 1W2AX 1TMF3 3JASA 4QPKA 1QXPA 2G1MA 3CNAA 1LHUA 5TSWA 2FMLA 1VRH1 3AL6A 5J9PC 2W2IA 2YDEA 4LF6B 4FFKA 1MR5A 1UNBA 4J9YB 3S7IA 3KS7A 1ZREA 4IEQA 1WLDA 1JYVA 3KSCA 4JKKA 3WW1A 5EXOA 5F3GA 2YIBD 3GNEA 5L9RA 2WYFA 1GTOA 2PN5A 1N4CA 2RE9A 3A8TA 3NO8A 2H6CA 4ZPIA 3UO3A 3A2FA 3M3CA 1R1A3 2JDHA 4WBBA 1NOVA 2ATFA 1POV1 3DXRA 2A0LA 1AXZA 3OEBA 1KBHA 3GZUC 3ITQA 1NR1A 4U7NA 4URAA 3JARB 4AVCA 4E8DA 1POQA 3RVHA 1VF7A 3LWCA 5DZGA 4FTBA 4QMAA 1H8HG 3BABA 2W46A 3ILFA 3HNYM 2Y0IA 1RUNA 4QX8A 4CEYA 5IJRA 5C70A 3C3SA 2ES3A 3A22A 3E8GA 5C8YB 4I50A 1DGWX 4MS2A 1ROPA 4U3FH 3MHZA 1SLAA 4F3JA 2CH7A 4LF4O 4EKWA 2WWJA 3TBDA 3WXPA 3QF7A 2X10A 2UXDB 1G7YA 5JVDA 1I94B 1XE0A 4JDMA 1XOUA 5FPVA 1FKAO 1J84A 5FUPA 2NYYA 3DXRB 1D4VB 1K4DC 4IGOA 5DAWA 4DUWA 3GB7C 3A0NA 1N1YA 3B9CA 2ZXQA 3V65A 5JXJA 2WA3A 3ZFFA 3RBZA 4E2QA 3THDA 2BGOA 1HWYA 2DBIA 3GWKC 4RHV3 2Y4UA 3RWRD 3VKFC 2R72A 5I91A 4QHBA 3JD1A 2D3OW 2BNMA 4I3GA 4BLIA 1E5IA 4CEYB 4I50B 1WJZA 4B7KA 4HN0A 2FL4A 2IH1C 4Q0QA 2CH7B 2UXCB 3H1IH 4NXMO 4AI0A 2QDRA 5GALA 1JTZX 4QXKA 4J42A 5KX5A 1PVC2 2A6ZA 2Y33A 2XJVA 3WT3A 5JVDB 3ETDA 3A0RA 2K1EA 4XHXA 3OBRA 3I2GA 2OA2A 4FLUA 3KVBA 4H37A 5FBJA 3LOIA 1DLLA 3FLTA 2WSVA 1AR83 1AJKA 1V6MA 1GZCA 3WP6A 4BQ5A 1QH6A 1I5PA 5JI7A 5A7NA 4QM9A 3WB0A 4E4SA 2P3IA 2YXHA 4GJYA 5KXBA 5IYZA 5EV7A 1BQZA 3KF3A 1M06G 1W05A 3JALA 4HMZA 1YFYA 4C7UA 5CA3A 1IS5A 1Q8VA 4GKJO 3KV6A 1H8VA 3RVYA 1EAH1 2J1RA 3CHXA 2W3JA 4OX9O 1QIQA 4Y24A 1V0AA 2Q8OA 3LQCA 4MW3A 2E53A 1L0NH 5KX5B 1PGW2 2BYVE 4H13B 4LIVA 5IVBA 3MIGA 2BPA2 4QKBA 4ES9A 5DDJ1 4D3WA 3MLLA 4AHCA 4FI9A 5BNPC 3UQ8A 3ZN0A 3D0SA 4JI3B 1EPZA 3WY6A 2HYKA 3ETGA 5FY7A 5FPRA 5IYZB 4SLIA 1WA6X 3JALB 4LO5B 4OCTA 4LNUA 3SPGA 1H6XA 2VL4A 4X9QA 4I55B 3TEWA 4XF0A 3APOA 1A32A 5CB4B 1Y43B 3K0DA 1UU6A 1V9U2 1RUH3 2V5DA 3R66A 3ZRVA 3ZYGA 4UV8A 2YPJA 1SQQH 4JASA 1X50A 3ECQA 3PU3A 4AQ6A 5SV5A 1VRH3 3LA2A 1S5JA 4YW5A 4Y20A 1GAXA 1OQ1A 3DL3A 1OCRB 3I3MA 1VQ8V 4TZDA 1OD3A 5K7PA 3HJRA 4BCUA 3HB3B 5EYYA 1UZYA 2HFEC 5KAIZ 1L3JA 4YHHB 1G8MA 4KXRA 3K5LA 1POV3 2Q7EA 4WV8A 4EWEA 3FKSG 2PGGA 4LOSA 3OMIB 5KR7A 3E35A 1RUJ2 3SNMA 4UAPA 4AGGA 5FPAA 2B5HA 4AL9A 2VBPA 3ZIXA 1J3RA 3QO8A 4IL7A 3I2KA 2MW2B 4FO9A 1XNRO 4YSFA 4AEDA 4GZ9A 4YM2A 2JG9C 3GALA 4Y20B 3TJTA 4CYDA 1PO12 1AR62 4LO7A 2HR3A 2LUWA 2A1XA 4ZKTB 4DK0A 3PUIA 2CTVA 1AJOA 2I45A 3ORJA 1UY0A 2R32A 3WR0A 1VMFA 2RMU2 3KHBA 1LU2A 4ASLA 2A70A 4D0QA 1UZ0A 3ENRA 3F7YC 1KJRA 1BQPA 5JSRA 1OCRC 1K45A 3FJSA 3OMAB 2VZSA 4X1YB 2HBTA 3CIHA 1OH3A 1US2A 2OQ6A 4NO4A 3U37A 4XTMA 3OBZA 5GONA 5JCOA 3B7MA 1JODA 3J8F2 1Q6UA 1XE8A 4FFGA 4IW3A 1HV0A 4UCSA 2W6JG 1XDCA 2E26A 1IOAA 3CRCA 4NPRA 2TNFA 1MZFA 2BFUS 3UT5A 4BMEA 2ADEA 2IU3A 1GO3F 4KQ7A 3HBZA 2XWBB 5A3MA 4GA9A 3WNNA 5IW0A 1RUF1 5FPLA 4WVMA 1CPMA 2Y26A 1SEFA 4FTSA 3CSXA 2WS91 3JD0A 4IESA 4UXAA 4XQWA 1X7NA 3LSEA 2EIDA 2WFF2 4N9IA 1Z78A 3AG7A 2OT5A 1X82A 3I55V 1A3KA 2LP7A 5GONB 3VZKA 2O8QA 4JI2O 5T5LA 4A7YA 3H8OA 5GLUA 3MPBA 2ZEZA 2X0LA 1EAH3 4IV3A 5JLVA 1W0OA 1O8SA 5JXGA 2UXBB 2J22A 5I8SA 1SBFA 4RGKA 3KV4A 3BVOA 3ZHRA 1SG3A 2Q6AA 1RJ8A 3BOWA 3OPTA 1EUTA 3UT5B 1QR8A 4AEKA 2L35A 4I0AA 5FXWA 2QDNA 1E1QG 1ZBE1 2KG7A 5JCTA 3K03A 4JDOA 4WVMB 4AVSA 4W4LA 4Q0SA 4QX2A 5DDJ3 1OBNA 1WWYA 1X9PA 1EBOA 4YLZA 1XYPA 5L3EA 2ZKLA 3H1KH 4GB33 3RYIA 4UF0A 2P67A 2VNGA 3VQXA 4XXPA 4PI2A 4DRRA 1N1VA 1TG7A 4QAWA 2GU9A 3JU9A 3M7MX 4MLOA 1AYN3 1CPNA 3ATGA 2YEVA 3MLKA 2E75B 4MGKE 2BOCC 4IV3B 1O3TA 1FATA 1OLME 4QQOA 2WO2A 3BIWE 1IDSA 4X65O 4XF3A 4HZ3A 3ABTA 2PQSA 5JH7B 2UWBA 1DQ6A 2WNVC 3STLC 1VF6C 3U78A 2QQMA 1N33O 2QM4A 4QT6A 4CZZA 3KVAA 4FPJA 3IPVA 4CSWA 5L7OB 2ZGNA 3CCLV 2KG7B 3IJ4A 3NW4A 4NPMA 4P5YA 3Q8EA 4Q4Y2 4B3SB 3AMHA 4KGGA 3RYIB 1S0CA 4QB2A 4HNAA 2R1DA 4UF0B 2ITCC 3GDBA 1RB8G 4YM0A 4YFWA 5DECA 4PDMA 2DJVA 2PHDA 4XMAA 2XJSA 4Y1XA 4OYUA 5A7QA 3GHMA 1Y7BA 2R9RB 3SEEA 3LZZA 2BOIA 4GMP0 3AXEA 2JK5C 3ZEDA 1NY71 4YGEA 3M8LA 4K21A 3T08A 3OGSA 4XURA 2WPDG 3IPVB 1S0EA 4AQTA 4IV3C 4MV2A 4QDSA 3OEEG 4BQ4A 4K6BA 2BOJA 1SPPA 4QQHA 1ALYA 4BQXA 3GF6A 4XF4A 2VZUA 4MTOA 4ZBMA 3RT3C 2HHHB 4C90A 3QTCA 4XBNA 4LHSA 4ASKA 1FPN2 3AM2A 5L7OC 1ZRIA 3AK3A 1VQKV 3ZYPA 4FPPA 1F7YA 1D7PM 2AW9A 5KWRA 1M9NA 1VQLV 1K33A 5JOWA 1E5SA 3UGFA 4HAMA 1H8TA 1YCIA 4U36A 1QXJA 1TNRA 3KMHA 1UKGA 1RVF1 5F9TA 4UWDA 4G28B 1JXNA 1XNQO 2Y6LA 1AR4A 3POWA 1D4M3 3RYKA 2LW8A 3T1CA 1VQ6V 2VZ1A 1IX9A 3SPJA 3GWOA 1DQ4A 3DKQA 2JG8B 1RUOA 4MSVA 1UWWA 1AI5A 2EIJB 1OFSA 4NXNB 2EICA 2IUWA 4R52A 4FFFA 3CDZB 2CTWA 4GWJA 1ZAUA 2RR12 2WWUA 2HWE1 2HYXA 3WINE 2V73A 1RUF3 1QJU1 4S2FA 2W87A 5KHHA 5K0UC 2F17A 1UYXA 5F8PA 1PV0A 2OS2A 4NKGB 3Q8FA 1DK1A 1WNSA 2Z5UA 2R071 4RUFA 4RSUA 1JOBA 2A6WA 1K73W 3BI3A 5CIRA 2UXXA 2VE1A 3QG5A 5FWEA 2XQXA 2P6CA 1QOTA 1DGLA 2BTQB 4LF6O 4JVAA 1K42A 3VD3A 3M3EA 2QSAA 3FX7A 4MUVA 1U97A 5FY0A 1ZZ6A 4AQ2A 4X64B 3ABMC 2EAKA 2UUBO 3L9JT 3MIBA 2YIAA 4Y4RA 4BK4A 1BHBA 3FB7C 3NXSA 4E9KA 4KHPB 1G8WA 1W8ZA 3EHKA 4F4LA 1YI9A 1SQPH 3ZRXA 1RMU2 3SJQC 1ZBE3 1IVSA 2VTXA 4FPYA 4MOAA 3WNMA 3W7XA 4Z2AA 4E4ZA 5DZEA 4Y5Z0 2VQ0A 2JG8C 4RQPA 4BXSV 4LKFA 2BJSA 5E88A 1R1BA 4GCZA 1SQGA 1RUE1 4M0HA 4XDQA 4JQRA 2XPJA 2IXIA 4Q4W3 3P6BA 4P14A 1NTZH 5B1BB 3AC0A 5I93A 3CMEV 3KGLA 2DF7A 4X6QB 3NJXA 1L8DA 2UXDO 1I94O 1VBA3 1HXS2 3VL8A 3I2OA 2C5DA 1TVGA 2WQZC 2UWAA 2IM9A 3FN9A 4LKSA 4BIOA 3ICXA 4XCAA 2BBAA 5J2TA 1JH5A 4EEQA 1H2GA 4FZ1A 3CCRV 3L2HA 4RGAA 1H2KA 3LD8A 4H0LB 4DR1O 3GGLA 4DV4B 4RQPB 1JR9A 4NVPA 5GM0A 1XE7A 5EQUA 1Q7YW 2ETEA 2BGPA 2YXLA 3N9MA 1SFNA 2FZ1A 5CA0A 2FCTA 2ATKC 3CWBH 1XB9A 2VECA 4GWMA 1PPJH 2IXHA 2R0HA 4JI8B 1JZ2A 3L70H 4JZ2A 1Y74A 2QWRB 1XNDA 3VDDB 2ZE7A 1E57A 4UVBA 2F66C 3NAPC 2PAEA 4QKNA 4DY5A 1QCEA 1XBFA 4MTXA 5FZKA 3ML0A 2Z42A 1VLNA 3MD0A 5B1BC 5LRRA 3AG4C 4LWSA 2ZJCA 5J2TB 1CAWA 1HRV2 1JZ5A 1BZWA 2EINB 5LGNA 1W8TA 5ITZA 2W92A 2ZHNA 3USSA 2VMCA 4XJWA 4ATEA 3MF6A 5A1AA 1JYXA 1N3PA 3B01A 2JS5A 2P4EA 4W50A 3VHPA 1UQXA 4KWLA 4TLFA 4CS2A 1O4YA 5FZGA 5LY1A 5HCHA 4RQPC 4LBQB 3MIDA 2AXTZ 1Y74B 1W9FA 3CC4V 3ZS8C 2FCVA 5DMYA 3K9SA 4FM1A 1WMXA 4NOTA 1RVF3 2MEV2 1ONAA 3BCWA 4BU2A 3AG1C 3BA9A 2OQ7A 4LWSB 1CAWB 2XVGA 2R042 1YEWA 4J6GA 4D6RA 5B4XA 1MEC3 4XYXA 3VDDC 5AFEA 5DZFA 1G1XB 3TN92 5ITZB 4H7LA 2VG9A 4HLTA 5FZCA 1SKVA 5K4LA 3D36A 2HWE3 1PVC1 5KXEA 4B3MB 1F15A 1QJU3 1BVP1 4O4JA 1F35A 1OC1A 5A6QA 3ABLB 5C3RA 1NLSA 3UKVA 2EINC 2R073 3VBUB 4JV5B 2XAGA 5J2UB 4LHNA 3MV11 5IYCO 3AZVA 4BIZA 3OY8A 4D8MA 1JUHA 4J1XA 4PDWA 5F7UA 2AACA 3HR9A 1QJX2 4UB6Z 3ACLA 1PK6A 3D0JA 2Y6HA 3I49A 4I02A 4JAAA 4DR2O 4CCMA 4FT8A 4A7KA 4NE9A 4XZPA 2GN3A 1ZVFA 2CTQA 2JDAA 1GSLA 5GZDA 1ODMA 4YHHO 1BEV3 2Y64A 4HPKA 1WD3A 3QBQA 3ZN1A 1BJQA 3ES4A 3U14A 2C24A 4AI9A 1PGW1 1E79G 3GCXA 4UW3A 4O4JB 1SBDA 4A3XA 4QDQA 4CCLA 3AP9A 4DV6B 4XIOA 2VQUA 4TWTA 2Q8VA 2EIEA 1GBGA 1NTMH 2Z4FA 3TRSB 1RUE3 1MS1A 2DU0A 1GK9A 3OY8B 2RDRA 4XBQA 2ET7A 4PDWB 1VB4A 2Q9LA 3C8XA 3ABLC 4YVSA 1HNXO 1SFYA 2FDGA 4B1MA 4DR7B 3W7WA 1PK6B 4V2VA 4GKKB 1OPMA 2QA4V 5E1RA 3VBUC 2ZEYA 2HEWF 3WG7C 2OUJA 5H6RA 1LUWA 4N90A 2BE3A 3B02A 3FHIB 4R9CA 1DQ5A 3F5WC 1SZBA 1RUI3 3RJRA 5FQ0A 4WFBV 1ENQA 3SITA 2JKXA 1N34B 3IC7A 3ZKYA 1C5IA 2DURA 1MS9A 4KH9A 3CRRA 2B46X 4YIOA 2ARHA 3CJHA 4XFCA 1TQ5A 3E8HA 3DUIA 4JF3A 4U7OA 1LTEA 2BGCA 4QHOA 3LA7A 4MGZE 4LJHA 3M4FA 5FYBA 3CLPA 5FY1A 3WW4A 5EYPA 2VJXA 4YVSB 1ZM1A 4N43A 4MXWA 3E6CC 1YWKA 4HVOA 1ZL8A 3EHBB 4B4PA 2V1DA 3E89A 4OQ9A 4W6YA 5BNNA 3UKTA 4F7ZA 4BH9A 1XHXA 4E4EA 3LF7A 3OGCC 2CTRA 1XYOA 3CQOA 3CU7A 2LJ2A 3UJOA 4PDWC 2XUMA 3KCXA 5HCBA 2XJUA 1BZKA 2XJTA 4TXWA 1PK6C 1UOFA 5F3EA 2E31A 1L7RA 4K8XA 2R9AA 1PO11 1FS0G 1AR61 1H1MA 3B2EE 1W03A 3IIAA 3CJHB 1B6QA 4LO4B 1VEWA 3LOBA 5J3UA 3CXCU 4HKLA 3ETPA 4AI3A 4KI5M 4Y5SA 3IDCB 2UXBO 2X7RB 2VQAA 5JZGA 4I5SA 4OUMA 3J26N 5GZGA 5EYPB 4J7JA 2JDUA 2WT0A 4N43B 3QCWA 4MXWB 1VRBA 5FY8A 4M3CE 1ZL8B 3AZXA 3VBHA 4I0WB 5HBAA 1QDOA 3BEHA 5BNNB 5CVRA 2FKXA 1YJLA 3B69A 1AHSA 3ZR6A 3MV01 1UPSA 2B39A 3USUA 1HKDA 3J8F1 4JYCA 3CYOA 2VO5A 2RJLA 1JCHA 2BUKA 3WB2A 4RQEA 1UCXA 3L2YA 4JQTA 4GZRB 3KCYA 2E9QA 5LA2A 2GP3A 2MPFA 1BL8A 4A45A 3CRMA 4QNHB 1L0LH 3IBMA 3T1LA 3V64A 1JFFA 4FLXA 2AEYA 5HXMA 2DVAA 4JTCB 4GUNA 4JI6B 5JZGB 1XL6A 5EIYB 3I3QA 4K7JA 4WM7B 4AI1A 1LEDA 2H6BA 3OR6C 1FYUA 1RHI2 2QGNA 3VBHB 4FPHA 2WFF1 2X29A 5LK5A 1HN1A 3G71V 3MUY1 4LK7A 4LE3A 4M4PA 3IC9A 1OKQA 1GMGA 4LF5B 5F5AA 3C7OA 1P7GA 1VMJA 4WVWA 5AVPA 4N43C 2WLIA 1WLTA 1AI6A 3FFQA 4INDA 1YI2V 2GN7A 5BNNC 2UY8A 1C1LA 2NQYA 4WF9V 2VNVA 4ORFA 2L9LA 1KKCA 3ABZA 3AVSA 3OUSA 2XAFA 4ZI7A 2VC9A 3UO2A 4UW4A 2P2KA 4J41A 4Y1UA 2NMOA 1S2BA 4RO2A 5K9YA 1IQAA 5FKCA 2ZMKA 3SH5A 1U5IA 4HFSA 2Q68A 3KCCA 1QU0A 3QH6A 3AP6A 5LA9A 3I5DA 1Z2GA 2BTOA 3OM3B 4META 1YQ5A 4AQYO 5K1XA 4Y26A 1R092 3EXUA 1XMOB 3KT4A 2TBVA 4DUVA 4WM7C 3WQ7A 2HHHO 2CE4A 1PL4A 2PYTA 5GJ6A 1Y3TA 2Q1ZB 1UU5A 2UYBA 3LPFA 3VBHC 4LXLA 4CCNA 2EIBA 4OPHA 4DUXA 3BCCH 3MDSA 1FPOA 3RN4A 4XQDA 1T2XA 4AHXA 4AZZA 5IVEA 1TMF2 4ZI7B 4CS4A 4JI7O 3G67A 3QACA 3RZLA 5HV4A 1JQ0A 1DP0A 4MADA 1UX6A 2WLMA 5CG8A 3LE0A 4Q4Y1 3KHCA 2WYSA 5L9BA 3K46A 4PQQA 1H4GA 2WZR1 4TV9A 5D5PA 2P3JA 2J1TA 4MVZA 3EJKA 4Y1VA 5LBQA 3PVNA 2BWAA 1P7BA 4NXNO 1R1A2 1F23A 1LCLA 5FKBA 4R50A 2W47A 3LSSA 4DXTA 1DF0A 1CAXB 5LOVA 1HW7A 5B3SB 1W04A 3T2TA 5CYYA 1GV9A 5LY2A 3HKBA 1XHZA 1ND3B 4OVEA 3NVCA 4FXGB 1D5AA 3WX5A 5KLVH 1W6MA 1V00A 3V0AA 1G86A 5FP7A 3ZOIA 1LUVA 1AR63 1PO13 1K4CC 1OCZB 2ZGRA 3OT7A 4FOYA 4BWOA 2IVIB 4X64O 3AEIA 3P30A 2WC2A 4AHZA 3C2UA 4CRQA 4LBOA 5G05L 1CD3G 5EFUA 1FPN1 4LF9B 2YUAA 4KHPO 3T4VA 4LKDA 4NWWA 1PM4A 4XHBA 5LOVB 1QQP1 4DR5O 4Y22A 2ZD9A 4XJUA 1WA8A 4AILC 4QKDA 5K8SA 2P7TC 1T6BX 4XAEA 1GOHA 5J1XA 4RHV2 4KFMA 3J8F3 1W6MB 2EBOA 4WZFA 3V0AB 1MZEA 4QM8A 4QGMA 5H2FZ 1KGYA 5H5NA 2B45X 2YU1A 1S76D 3ZHVA 4ZZ8A 1CAVA 5H9QA 3SGIA 1ND3C 2C9KA 2QZ3A 5FLJA 3B94A 4R8CA 5EPAA 1SERA 2G9FA 1F4AA 2PHRA 1ZZ7A 4WVZA 2SLIA 4XABA 5D8AA 3ME2A 5IY5B 1C4RA 1QEXA 4YRDA 3KZ4C 4MTFA 2RS33 3M7AA 1OCZC 4CBCA 2BCCH 1G9DA 1GANA 2WFF3 5FP3A 3ZIWA 2EZPA 5F3CA 4K8ZA 4X66B 4J11A 3T2OA 4Y22B 5DXDA 3T1HB 1AYM1 2WR9A 5KMGB 4DV4O 2V4VA 2GDSA 1BKZA 1SLBA 4MSWC 3ZX7A 2GHYA 2IW5A 3A0KA 2VZPA 4E2SA 3RZHA 1GN3A 4NTWA 2J1EA 2WIIB 2DWRA 3OUFA 3O5SA 3HN3A 4I09A 4JI8O 2RM23 3NL1A 2XAQA 1FV2A 1Y4WA 1D2DA 3SPHA 3KM5A 4IEOA 1HW5A 3SJBC 4GXLA 2ZABA 4RGGA 3ZYFA 4BQ1A 3RZMA 3FYEB 1UY1A 1LGCA 1RUD3 2HJFC 1YSCA 1N1TA 2XASA 3DC6A 1SLTA 4JI5O 3RWNA 1FMD2 1PL0A 1Q6IA 4V1PA 5A32A 2ZX4A 4DV0O 3A4UA 1EN5A 5IK8A 2PI5A 4C0BA 4ZZ5A 3FWEA 5IY5C 4OFGA 2WLKA 5DAXA 3SCGA 3K5MA 2XKPA 3VBFA 2DVGA 2QWPB 1YRZA 3VKLA 1HXS1 1RUH2 5ANQA 2KXLA 2A6YA 4M0NA 1LB2A 2EF6A 1V6JA 2DW4A 3LA3A 1YO8A 1VP6A 1WN7A 5LA6A 5F37A 4IEWA 4CP2A 4PD4F 1XNCA 3ETEA 3G4SV 1HV1A 3AYAA 3AMNA 4Q4Y3 5L3GA 3RVZA 2ZHMA 3OD0A 2WZR3 1VR3A 3HR0A 2EALA 2ENRA 3MO4A 1VQ4V 3CEWA 5A32B 3CPWU 2F4VB 4PA3A 1EM1A 1L7LA 5A6YA 4B3MO 2ZNJA 5IVJA 3VZNA 3VBFB 3LDDA 2E5LB 2X8KA 2VUCA 3T09A 2VH9A 5FZ3A 1P8JA 4TOIA 1I08A 2QVSB 2JS3A 1Y66A 4FLWA 3MF9A 1Z7S1 1DLBA 1S2KA 2N05A 2PHLA 1HRV1 1K5MC 2WRAA 5LA6B 4J7ZA 5FZOB 4FVMA 3NKGA 3H3ZA 2AEZA 2IJJA 3OFNG 4BW5A 4DV3B 2UU9O 4HONA 1GN2A 4YW7A 1XNAA 2PLV1 3NQHA 4CDXA 3VLBB 1F31A 2E3CA 3FZ3A 3OTFA 1DIWA 1VAVA 3VL9A 3PUHA 1FPN3 2XNDG 2D2CB 2A3YA 1FT9A 1JBCA 1YJ9V 4MVSA 4RA0A 1EY2A 1UYPA 4MHRA 5L3DA 1QQP3 1YHQV 5C8WA 3MDPA 2JB8A 1WBFA 2GDFA 1ZRCA 2YBKA 2ZIMA 4DV6O 1ULCA 1MS5A 2OCCC 2MEV1 4J1WA 1SQXH 3F95A 1JYCA 2Q69A 4COZA 1CXZB 4RS5A 4LNVA 3DC5A 3POIA 3I3DA 1O4ZA 2R041 4ASUG 2YC2A 3VBFC 2QQLA 1SCRA 5DN2A 2GMEA 3TN91 1X4TA 4DR7O 4OHYA 4GKKO 1BVVA 1JX9A 4Z92B 2JDIG 1SLCA 2YBPA 4UFHA 4N23A 4L11A 2VULA 1H2SB 5KHJA 1V6NA 2QQVA 4DO2A 3EVKA 5J48A 2YIDA 1LGBA 1ZNPA 5A3OA 3RYFA 5JI9A 2JVDA 3OOXA 2A79B 4MZUA 4MYEA 1ZZCA 3NWKA 2JE7A 4AF9A 3QVNA 5BZBA 1AYM3 4LBLA 1TVKA 1YTFB 4G4FA 2VCCA 1QJX1 2O8OA 4CXYA 1UN1A 3ZN6A 4NIIA 3WW2A 3OMNB 4RS5B 1HX6A 1QNYA 1TUBA 5B66Z 2I2SA 2B42B 2QQIA 3H8RA 4X1IB 4UFJA 1URFA 2QDOA 3J7MA 3UT0A 1J59A 4C8DA 4FPOB 1EZJA 1ORQC 3FBMA 3J7HA 4TUYB 4WVVA 1S3JA 3DGTA 2CGOA 5HFMA 1OF4A 2CNAA 3G6JB 1UX7A 3G6BA 4JDNA 3RYFB 4GB32 2RJZA 2ZGMA 3H50A 4LF7B 4KGQA 1K7DA 4D6TH 4EYUA 1AYN2 4O61A 3O65A 3ZN6B 2HVKC 2YHJA 2LTNA 3PJQA 2YIBA 4Q0VA 1AR73 4P9LA 4QKFA 1PMJX 1US3A 4YIPA 4KWUA 5A3WA 2VMFA 4IEXA 1LHOA 3GHNA 3K57A 4AR2A 3P1IA 2ZE8A 4LP8A 1WMFA 3HVDA 5I0TA 4UW6A 3AMPA 3JUUA 3S3WA 3SJAC 3LGRA 4B8EA 1IPKA 1Y6XA 3VDBA 4XDJA 5FZ6A 5FZMA 1AROP 1G9FA 4GT1A 5FMOL 1CONA 1J3PA 1NTKH 4CA9A 5LA1A 2DVDA 1NYWA 4YJ3B 1JMUB 4UBHA 4ZIBA 1NX9A 5JOZA 1L1FA 3DKWA 1PHMA 4FSJA 5T54A 3Q9OA 3ZXAC 4IIJA 4JI6O 4BAYA 1EPWA 4HVRA 3RMYA 3BUCA 1W9SA 4FFIA 1Z7S3 5LYJA 5FBZA 3ABUA 2ZXWB 3AP7A 2DVBA 1HRV3 5E16A 2XWJB 1SZXA 4LC1A 3MW3A 4X1KB 1I5XA 4JGYA 4DR6B 5L3BA 4LF5O 3R0RA 4BMBA 3B77A 5FY4A 3SYPA 2L6LA 2PLV3 2HWB1 2CL2A 3U4XA 5HXVA 3NNJA 4NJ4A 3BTXA 2HJDA 4AFCA 5CMUA 3PIJA 5GKAC 1BSMA 2Z5WA 3VBOA 2P4KA 3UGHA 4DO0A 4GAZA 5T55A 2NN8A 2QKAA 1CX4A 4IIJB 1IKPA 1U5ZA 4O9EA 2Q0AA 5C7GA 2O57A 1LOFA 4GH4A 4B4RA 1D4M2 2WLJA 2VCBA 2ZTNA 2R043 3GJAA 4IYIA 4GX5A 5FJHA 4MT8A 1F9KA 5FMCA 3TN93 2W95A 3VBSA 4LF8O 1XMOO 3ZYRA 4BIUA 3MICA 4Z2WA 4AVTA 2IFWA 4XW3A 4PBOA 4NHLA 4I0BA 1OA2A 2XR4A 4XF9A 3VD7A 4TWKA 3OD4A 2HWD3 1K3EA 5DG2A 1MZ6A 3GZAA 1GKBA 5FO9B 2EAAA 3TYJA 3IMMA 4K8FA 1RHI1 4PLOA 2ZGQA 4X20A 3SCFA 2OZ6A 2VQEB 3LIGA 4BLJA 2E76B 4IL6Z 2AGAA 1QJX3 1SDDB 4GH4B 3VOUA 4LITA 2J42A 2X5IA 3J4UH 5A7OA 3RZZA 1YHFA 3OB8A 5LGTA 5FZ1A 5LEKA 4CEWC 2DYRB 4XFBA 5IDJA 1UMHA 4XFIA 4RR3A 4D7TA 3NNFA 4BYYA 3BTYA 2VMHA 2OIIA 3SR2C 3GCWA 5HCAA 2HBUA 1VALA 1NZIA 2DFCA 5CZKA 3AMQA 3JB4C 1DF5A 1UXZA 2K2SA 1ZBE2 2YBSA 1P4RA 1RTVA 5IK7A 3AZYA 3LAGA 3E86A 2VM9A 1K8AW 1CAUB 3D8CA 2RNBA 4X6RB 2Q67A 3JYCA 3MBWA 4IHJA 4F83A 4CCKA 4FLYA 4X20B 1ZZ9A 4Q29A 3MHHC 1X8MA 4EN6B 1V6OA 2PHWA 4Q4W2 1R091 4ARXA 3DGEA 5CBGA 3T0DA 3K9AA 2X5IB 4ZU4A 4AGVA 1VQOV 1WMEA 4BR6A 2CY6A 5FZFA 1VF5B 2PY5A 1KUQA 1VBA2 4LF9O 3TWIA 1MVQA 4BQ3A 4IEYA 1QGLA 4RR3B 3WQBA 1OF3A 4CUCA 2OUHA 1QU7A 1LOFC 3OEHG 3HNBM 4CCEA 3FL7A 2BQPA 4DMIA 2GUZA 3CO2A 1VPHA 2WNUA 4Q6GA 1MS8A 2GH8A 4JX0A 2VZ3A 3KT1A 4UCOA 3EXAA 5EP9A 1HRI2 1YYNA 4OHZA 3LFMA 3POYA 2DYRC 3NJVA 2RHPA 2O0OA 3SJCC 4UI9L 3QH7A 3T0BA 4IHJB 3WQ0A 1C5HA 4XUQA 1CIWA 2XDVA 3PTYA 4IE4A 1YUDA 1NLQA 1PZ8A 2R7EB 3DPRA 2WAMA 2D98A 3B40A 4O2AA 4AOCA 1NE4A 4LBNA 4PDRA 4LIUA 1NXD1 5F5QA 2VOTA 4XJ8A 3O0WA 2LQTA 3TCUA 4DRVA 4FP2A 1UYYA 1HQWA 4DK1A 1NY72 5CADA 5FYZA 1PGSA 3M1HA 3JD72 5EYXA 1XJAA 4OI0A 1UY3A 3HQXA 2A7WA 3RPQA 2XJPA 4K3AA 2X5IC 4AVAA 1Q8IA 2GUZB 4X66O 1QJY2 5CFDB 3S57A 4O4IA 3ZJZA 4B3RB 3T1HO 4FIPC 4YGBA 5LASA 5JMOA 1XSRA 5IJ9A 3K58A 2GZWA 1H2MA 1W9YA 3SCHA 2HWB3 3CCUV 1AF9A 1ZA7A 4AQSA 3K3OA 4QE7A 5BY1A 1IG3A 3DPRB 4HVQA 2QQUA 3PTRB 5DAPA 2W08A 3OJBA 4O2AB 3ZN4A 4B29A 4EV0A 3MPPG 4QPIB 2O14A 3CKHA 1N1SA 2ITDC 4D94A 1KD7A 1LOAA 3OGIB 2Z79A 3T2QA 3FHQA 1UMZA 3RI9A 4MVOA 2B1IA 3SPIA 1NH2D 3KGZA 4OLLA 2ARCA 1QLNA 1MEC2 4ZHNA 5IJ9B 2BEOA 2OIEA 4OMCA 3ACIA 3B8MA 4C1XA 5FZ9A 3P3NA 3K4ZA 1PKXA 2Q1FA 4W8JA 2YGLA 1EN6A 3HQUA 4MVTA 3LEKA 3JAMN 4GQ7A 1X8EA 5CFDC 3GZEA 4DQAA 3J7AU 2R072 2ZNIA 2LRPA 1RHI3 3BU0A 1ZUQA 5GW7A 4MW8A 5FZHA 2JGDB 1R081 2NLJC 4Z07A 5FOBB 2R062 2QWQB 3LIHA 2VBBA 4AEJA 3PJYA 4N7IA 5JPMB 5CG9A 2RJKA 3ZCCA 3DPRC 2AZ2A 4G3YC 4DUZB 1A8MA 5C9AA 4BW9A 4LLOA 3MHSC 5CU1A 1BEV2 2F4VO 2BDRA 1BE3H 4QPIC 4CC6A 3CC7V 4BDVB 1FJGB 4CU8A 1XEQA 3AZZA 2M7WA 1MSWD 1KQRA 1JOJA 2JDKA 2W39A 3B09A 5C4WB 1PGL2 4BQWA 4LBQD 1MABG 2VUDA 4L97A 4CDUA 2OT7A 1QVGU 2EIMB 1EV12 4LR3A 2DVFA 2UWCA 1GMMA 1GWLA 5C6CA 3RYHA 2IJHA 1FMD1 1VBE2 2NN4A 1PO21 4RD7A 1R093 1KC8W 1IS3A 2RDQA 4DV3O 3AFGA 3E8BA 4PHZA 4YNIA 2HKOA 5C9AB 4FTEA 4GKXA 1SS3A 1R3LC 2R0FA 3R65A 1PNGA 1RUH1 1S0DA 1RUI2 5AVAA 4O4HA 2F23A 3VD9A 1R73A 2QM7A 4JHZA 5KBFA 3E8FA 3E22A 3N7LA 3B4SA 3ZO0B 3FC0A 5C8CB 2GALA 3VKNA 2YC0A 5LA0A 2AGSA 1ENRA 1NI8A 4FLVA 2VWJA 4TQFA 2VMIA 4E27A 3K51A 2QKCA 2VZOA 2F93B 2WO7A 5BXZA 1POV0 2LALA 1S55A 1H2NA 3VHRA 4JTDB 4EQVA 3A0HZ 3E2EA 4QDRA 1PNKA 1IXBA 3WG1A 2V09A 1ZX5A 3TETA 3JQWA 5C4WC 5FXZA 4BHPA 5I0DA 1KITA 4XBFA 3ZXFA 4XDKA 5E1AC 3ACHA 5CBFA 4EN9B 2EIMC 3AK0A 4ABMA 4ISRA 4RWUA 3HN1A 3FUOA 3O1PA 3O1VA 3AKTA 2ZDIA 1W59A 2OTJV 4O4HB 2JE9A 1SHWB 1W06A 1RIRA 3JASB 1TZOA 3JCIA 3FD9A 5A1FA 2HWC1 3H1WA 4ISQA 4WFAV 2QQNA 3ZYIB 5C9AC 3LSDA 3VKMA 3HT1A 2ZM6B 3IIIA 5EIBC 1JUIA 1UF2C 4CU9A 1UIJA 5TISZ 4LBJA 4MG2A 2IH3C 1IBKB 2E7QA 2XQRA 4X88A 4KWJA 5C8CC 3LDRA 2OX0A 2FMDA 3FB6C 1F2NA 4CVUA 2JD9A 1FFXA 3M8AA 1TME2 1J1TA 3CF6E 4J25A 4BWAA 1GKFA 5A6ZA 2YY1A 5IWAB 2QQPA 3UJQA 3HT2A 1GM9A 1VE0A 1VBC2 1JI6A 1NZCA 1BXHA 4DUYB 3T2MA 4G9SB 1RXFA 4NAMA 2DTWA 1O5LA 3K0GA 3X29B 3OGVA 3AK2A 4LF7O 4D7YA 4JRAA 1VQ7V 2VQTA 5IFTA 1PD3A 2XMLA 1H0BA 3MIFA 2JGUA 4AWDA 4P9XA 5KHGA 1XC6A 5JAXA 2V4AA 4XCBA 5FAXA 4AW7A 3DF0A 3WOGA 3KQRA 3ST7A 1FFXB 2OYZA 2XAHA 1OD5A 1NZ6A 4R9DA 1N32B 1OJHA 5L36A 2YZ4A 4X62O 2DWDC 1R083 3GZTB 4UCTA 2AH2A 1LULA 2MNGA 3ZFFB 5LHHA 1J1LA 3RQ0A 4QU2A 1RM1B 4DR3B 3SEPA 1AUYA 2YC4A 1BMV1 1UPIA 2DCTA 3TEZA 3T1YO 3ZM8A 3ES1A 3UK9A 3S30A 2FDIA 4YGDA 1P84F 2W1QA 5FPUA 1XMQB 1QNWA 2Q73A 3GYDA 3K08A 2N7GA 3U75A 3ZRWA 3OCPA 5A70A 3I2JA 2E7AA 5LRSA 2AZ0A 5FZLA 1C8NA 4BA6A 2WQ8A 4QPGA 4DV1B 3EB7A 3KV9A 4CEYC 2WLLA 5FREA 2JXAA 5FPZA 4XJAA 1Y4MA 2P6JA 2YI9A 2ZAAA 1B04A 4IETA 4FOWA 4GB31 3N7JA 2GC1A 4IGGA 4CUAA 3QOPA 2W68A 1FMD3 5F2VO 3CEIA 1VBB2 1PO23 1IS4A 3AYEA 4DR6O 3LFIA 1DGSA 5JUVA 1KS5A 2G9GA 1C3HA 1AYN1 2ARBA 2KB1A 4I9QA 1KS4A 1NCRA 4K0KB 1RUC3 2XUEA 3AG2B 1Q43A 1V6KA 3ZFGA 3O0XA 2P3KA 2JEMA 4XJZA 5FPOA 2DCZA 3ZMSA 4FJCC 3ZFFC 2XB6C 3QO7A 3ZRWB 1H38A 5JJEB 2QBXA 1RM1C 1DTOA 1YDXA 1GFF2 4BK5A 4DNYA 3RZJA 5JJNB 2WZEA 5IYDO 4QPGB 1WLWA 3NJZA 2EULA 3N9LA 2WLLB 5FMBA 4CCCA 3THTA 2PFWA 2E33A 3PUSA 2A71A 5AC92 5FWJA 5LHGA 4UV9A 5CNAA 3ZHSA 1GM7A 5F6KA 1BYHA 4I7ZB 3WUCA 1ND2A 5EC1C 3TGUH 1T6GC 4JCKA 4YZ3A 3CB2A 3OTOO 4LNUB 3LDEA 3MAQA 2XLAA 3VHOA 1N47A 3TB0A 3ZFGB 3N2KA 3SH4A 1WB7A 3WG4A 4CXWA 2WN2A 3AFKA 2Q8EA 1GN4A 5FNVA 4W6WA 2YXYA 1KXGA 1JZ4A 1ULDA 1QWRA 1GN6A 1WCUA 1LOCA 4K8RB 2HWC3 5IUQA 5IE9A 2VQEO 4NHXA 3CC2V 2DUQA 3AG2C 1TAEA 1D5NA 1VQPV 4N7UA 4W4ZA 2BZDA 1JHJA 5JQGA 3OPWA 1ZRDA 2DU1A 2PHFA 1AR92 1R6KA 3ZHUA 2KD7A 1SFPA 3JATA 5BR8B 1I0HA 1RGSA 4QPGC 3GBFA 2IXKA 1F51A 4KUMA 3DEMA 1ND2B 3K77A 2WSUA 3POFA 2HEPA 2VQFB 2ORXA 4TSFG 5FZIA 4M3CF 1MMMA 4P02B 1AR5A 1FOD2 1NBMG 4Q0UA 2JDMA 5FNVB 2N04A 5LBBA 3OSDA 2IXCA 1D4M1 5BY5A 1Q86W 2CU5A 1O9HA 3NKTA 5D5QA 4AEDB 2B8MA 3HPNA 3ZFGC 2X6CA 1F5FA 3OGRA 3WCRA 4CE8A 4YM3A 2W94A 3AK1A 4JKLA 1H8EG 1K5QA 1GP5A 3OUHA 1RJ7A 3POEA 4IE6A 1F4HA 1IURA 3HKDA 2MHFA 4NHKA 2RS32 1K3IA 2YB7A 1UMIA 1HNZB 2R70A 2ERFA 1CR7A 4EN0A 3WF0A 1AXYA 4NIGA 4P9YA 2G19A 2ZZJA 5L19A 4HOOA 3E5XA 3IAQA 4IEVA 3ZMZA 1DZTA 5JVVA 1ND2C 4CCOA 3VZLA 4OHVA 1GWKA 1TNFA 1BHAA 3THCA 4XUPA 5BNQA 3ASOB 1JYTA 2YUEA 1PX3A 2JDNA 3BRCA 2JJ1G 1PNLA 4KWKA 1IS6A 2VCAA 2ZBJA 3LB9A 2RM22 4HZFA 1W8WA 3QO5A 3DXTA 4GIQA 1IPSA 4AEDC 3C7GA 2W1SA 2UUCB 1UD1A 2A9HA 2D97A 2ZE5A 3CJIA 4GX0A 5DN6G 4AHYA 2WT1A 1RUD2 1HB1A 2QQKA 4LFBB 4ZU7A 5L3CA 2ZA9A 4ZXEA 4B3RO 3ACGA 4QQ2A 4LLFA 4Q4W1 3AZWA 4MGQA 1KP3A 4R9BA 1C8M2 3HQRA 4NHYA 3CCMV 3X2QB 4WFHA 1FI2A 1OI6A 5FYCA 1HJFA 1VBA1 2YV8A 4GALA 5FZAA 5GTIZ 2VMDA 3WP5A 2X09A 3WQ1A 2ZPXA 3UGGA 5JCOC 4BXFA 3VQYA 2ADQB 1IG0A 3ZPOA 1JS9A 3ACFA 4RL7A 2CHHA 1MPXA 4ZHQA 1HRI1 5C5UA 1M56B 3ASOC 3CJIB 4LFCB 3LEGA 1B35A 2MK3A 2WZR2 4MGIE 2P6HA 2OPKA 4FAHA 1HR0B 5KA5A 2CWMA 4PA7A 2R6QA 2GNDA 2YEVB 4PJ0Z 1MOFA 1O7FA 2ZGOA 1QF3A 3HWJA 4YZ4A 4CP0A 4FPKA 4B08A 3B00A 3STZC 3APBA 2X53S 1W3VA 4Z8BA 3JD71 1SESA 2HEYF 3SISA 3OEAA 3JD3A 3B9IA 3E5QA 3X2QC 3D3IA 2WZ8A 1QJY1 2VWKA 2IJIA 3MIEA 4O9GA 2E32A 4ZHQB 4Q4X2 5F1RA 1LKNA 1H9PA 5A3TA 1I6XA 4M00A 3I8TA 5EJ3A 1AI7A 4C1WA 1B35B 3ZSEA 4HNAB 1WW4A 2Q4PA 2HH9A 5FP8A 4R8HA 1WZXA 3BTAA 4AVVA 1W0KG 1HQNA 2D6MA 4QX7A 1FJGO 1GQPA 1M56C 5EHDA 4EN8B 4XDPA 3CJIC 5FZ8A 2Q1MA 4JI1B 1QQP2 4KG0A 5C33A 2FCUA 2H0VA 5LBEA 3Q4HA 3KT7A 1REEA 1ULGA 1ODNA 1LGNA 2JECA 5FZBA 2H3OA 3RRDA 5EZWA 2D93A 3OBTA 2VY0A 1A8DA 1DYPA 1MEC1 1K92A 1WKYA 5HV0A 4LBEC 1SPPB 2GNMA 3ZFEA 4IGPA 4AHWA 1FXHA 2QZ2A 3OG2A 3WF2A 1ZBA2 4O7XA 3VUOA 5FK8A 1YQCA 4I0XA 1EFRG 4HKOA 4IXLA 4YY3B 2PTMA 1HNWB 2IFRA 3EBRA 4JI2B 2WL1A 5GZFA 1H8TB 1IGOA 4A6OA 1S4CA 3WNXA 1GNHA 3H3LA 2R061 3M2MA 4PLMA 1TA8A 1WB8A 1NVPD 4JYAB 1AYM2 3NV4A 3Q4HB 4ZU5A 1FD9A 3F5TA 4PF5A 5B5EZ 3T4HB 2PELA 2D5HA 3W58A 3VD5A 3K4AA 1YQ6A 1BEV1 4IQPA 1I3HA 2JX9A 4XILA 1ULEA 3ZFEB 2DOSA 2ZGLA 1UFIA 4N53A 1W2OA 1XRUA 3ZKUA 3I4IA 4CP9A 4MH0E 3ZXKA 1BMFG 4DEQA 4I0XB 2LFRA 1AL0G 1ASJ2 4LA3A 1PGL1 5JMCA 2EIJC 3O9OA 3SPCA 2J1SA 2JRIA 2VW1A 4DB5A 1MNGA 4NIAA 1AVMA 3L73H 1EV11 4BIFA 4OUEA 4XFAA 3CD6V 4OPAA 1VBE1 2VZVA 4CH3A 1JOYA 3KQ4B 3N2GA 1SQBH 4X65B 2ZM6O 5B1OA 1UIKA 2XGXA 3MUZ1 3H9AA 2EXIA 4CU7A 1KDMA 5CFCA 4DY3A 4UBGA 1XPWA 1IBKO 1S77D 4LKEA 1H8TC 1J83A 4P5HA 1SETA 2QE7G 4LHKA 1RUI1 3AP5A 2GSYA 5LWBA 1AR72 2RS12 4A44A 4UYBA 3E1F1 4N53B 1BK1A 5M0TA 3WNKA 5CBLA 5IWAO 1UY2A 2B5UA 4CP9B 3KV5A 2DN9A 3AYCA 4TV8A 3UL2A 3JCZA 1CVNA 2X05A 2LM3A 1HRI3 2WWSA 5FYIA 2ZCWA 4HN1A 2Y48A 3T30A 2BVVA 3ZRSA 1CP9A 4DUYO 2JDYA 5J37A 2D6LX 4TTGA 3ZFEC 2JJ6A 1LOEA 3JBG1 1YTFD 1GU3A 4IYHA 3I7DA 5LP6A 1H1AA 1F4NA 4NB5A 3WF4A 5E8AA 5A9GA 1HIXA 2AYHA 3N2GB 2A06H 2UXCO 3FLRA 3VV1A 3ZLIA 5CFCB 1H6YA 1WCKA 3WD5A 1LR1A 5BMVA 4DRXA 2D43A 4EFBA 4A5UB 3J81N 1COWG 2DCJA 1XYNA 2YYOA 3O1MA 4H55A 2ETNA 4DR4B 2P4VA 4Q20A 3APQA 1AVBA 2RG4A 2JEXA 3JD73 1Z7S2 4D6QA 1N32O 1QJFA 4MVQA 4XZUG 1QJY3 3S6PA 2HLDG 2GC0A 4Q4V3 4R9AA 2D6KA 4MHUA 2FDKA 4IEUA 4DR3O 4LH7A 3U10A 2PLV2 5C93A 5E89A 3D5OA 2IBZH 1XMQO 4N53C 4XFGA 5LMNB 4J7KA 5LP6B 5CA0B 2BP6A 2B7YA 1KYOF 4AG4A 3GVMA 1YI7A 1O91A 4A4AA 1TME1 4DV7B 1PM9A 1Q82W 4CCJA 5BMVB 4DRXB 2FDFA 4CH5A 1DBNA 3KF5A 4BQ2A 1JYNA 4DV1O 1GNYA 2QE3A 2AHYA 2G38A 1YIPA 2XVLA 4QXHA 4URTA 1CIYA 1VBC1 1DYKA 1LAJA 4JI3O 4XPVA 3JCUZ 4IEPA 2VW2A 1NT0A 3JARA 5F5IA 3MLJA 4YZ1A 1CWPA 1TE1B 1G9AA 4ARYA 4ZS3A 3SXWA 2IXJA 4K0KO 3SHRA 4HANA 1M1KW 3UNPA 3ZHQA 5C8YA 2ZR2A 3ZMOA 2HWD2 4OZOA 1W9WA 2JB4A 1CZTA 4CH4A 4Q26A 3N7KA 4MGTA 2ZGKA 3CCQV 1RL3A 1URXA 2FDHA 5HI0A 4SBVA 3R4DB 3AP4A 3N3HA 5FZDA 1RUG2 2UUBB 2R063 1IZ3A 1SDWA 2ZX1A 4QPWA 3LNNA 2LGQA 5LP6C 1N8RW 1Z5WA 3TXQA 1KB9F 4P9IA 4DS0A 1MS0A 3R4SA 1BT8A 2JIZG 5B4NA 4AAXA 4FPLA 3H7YA 4NTYA 5KA6A 4XQ4A 3HNMA 2RDCA 2W91A 5CKMA 4XOGA 4XUTA 4CU6A 2YFUA 4LFAB 2XH6A 1VAKA 1FAYA 3S3XA 4BPZA 1YZBA 1D2SA 3BGAA 4HK9A 1QHTA 1RSOA 4NN0A 4DV2B 4HK8A 5BNPA 1ST8A 1YFUA 3ZVXA 1EV13 4FP3A 5DAQA 3PMEA 2JENA 2W52A 1VBE3 1VBB1 1A78A 4QQLA 1AJPA 2PI4A 3WDXA 5JJJB 4CP1A 2KQXA 2XOKG 5IJ0A 1CZVA 2DWEC 1PIV2 4P2ZA 1QDCA 5FXXA 3N9OA 2YICA 2ZKNA 4JZGA 1S72V 5BR8O 4WM8A 3G6EV 3O7OA 4HPKB 4DR1B 2Q4SA 2GTAA 3WDTA 3EYPA 2P3YA 4PJYA 2VQFO 1ENXA 5A80A 3ZXEA 1Z5VA 1V54B 3K3NA 4QHZA 3H8XA 4EE2A 1RSOB 2ZS6B 5BNPB 1OHHG 3E6BA 4L2NA 1BBT2 3M3OA 4NPLA 1LESA 3JBG3 4MXVA 3CXHF 1E5RA 1PMIA 3N9QA 5FYYA 5AC91 1GOGA 3D36C 1S0JA 3RMXA 3K59A 4HKWA 1FFTB 2PYJA 3B8NA 5H9RA 4DXWA 3M99B 3WP3A 4K1ZA 1KJLA 5FUIA 1W2NA 2CV6A 2OIGA 5IJ0B 3JB8A 1JYWA 4YYOA 2G9ZA 3R6SA 3WHUA 2OPWA 2XHBA 4WM8B 5F5CA 1US6A 1F5JA 5FQ0B 3T1MA 3POGA 5FY5A 2WAAA 4PA9A 2ZEWA 3WSOA 3OUIA 1HNZO 2ILMA 3TEYA 4I55A 2JG9A 3LUTB 3K79A 1DF4A 3WNOA 3CCEV 4AEMA 4COWA 5CB4A 4UCVA 5EBWC 4DXSA 1NG0A 4Q1PA 1OCCB 3ZSLA 4G2KA 2D44A 2F6BA 3U0ZA 5FV3A 1FV3A 1GZTA 5DABA 2ZX3A 2XTAA 2HWB2 4AI8A 3DTUB 1K5JA 3IM0A 1LEMA 3FFZA 1S1AA 1AR91 4YWAA 5BPXA 5FYTA 2Q8CA 5KAFZ 1V54C 5LHIA 1FYJA 1TME3 4X8NA 1NJIW 3SC7X 4RAIA 1NS1A 1MVEA 2IJKA 3DYMA 4CUBA 1BCXA 1KMIZ 4FM0A 1WBLA 1W99A 2A6XA 5FMOS 1VBC3 1FOD1 4FOVA 2UUCO 3PN1A 4FPEA 3GXUA 1W8OA 5FYVA 4DIQA 5A3PA 4Z1MG 1W0PA 4QGNA 4YVSC 5BV6A 2K9PA 3RGBA 3IAPA 3SYAA 5FP9A 4LFBO 2JG9B 4ZXKA 1QJEA 3UV9A 4YW3A 4JTOA 1W8NA 3H1MA 1ZYBA 4UOJA 4LBKA 5F3IA 4WM8C 1R3IC 1NAEA 2W9XA 2BU9A 2WZPP 2DYCA 1OUXA 2XJRA 2HJIA 2K46A 2Y0PA 3JQXA 1W2UA 2TEPA 4C91A 4Q1RA 1I9RA 4PELA 1OCCC 3PVEA 1THZA 4J9ZB 1XNBA 1GLHA 2RS31 2P22C 4Q8LA 2DTYA 1N3OA 4EROA 3G7DA 4DR2B 5I8TA 2QNKA 2VTXJ 3KG2A 4XVHA 4CC5A 1NE6A 2GC3A 1Y9MA 3K48A 3USUB 4DOUA 5IWFA 2B1GA 4B3SO 4LFCO 4I3PA 5FK7A 2YXSA 5JIUA 2VTFA 4Y4YA 1NCQA 3JD4A 5GZCA 1OFNA 1Q8QA 1WCDJ 4X1YA 4TT3G 1UW8A 3VBBA 1AJNA 5FYMA 1K97A 1HR0O 2WFPA 1ENSA 4ASMB 3ALQA 4FBFA 5C3OA 1KECA 2X6BA 3N35A 4FLTA 1HDKA 1VQNV 1ZZBA 2D3PA 2UXNA 3VZOA 1Q56A 2RM21 4XETA 2XG3A 1JFFB 1UAIA 3BA8A 1V55B 4XDOA 1J5EB 3T3YA 5IT6A 1HP8A 1HNXB 1ZWIC 1JMKC 5BNOA 1XOYA 2P1BA 5FDBA 5FO8B 1V9PA 1RUD1 3O1TA 3UKNA 1VBB3 4WFFA 1OQDA 3ASNB 4QB1A 1C8M1 5FY9A 5JZGC 5IYYA 3IZOA 4W65A 4COUA 3IFXA 2WLIB 2R49A 1NCQB 2YI8A 3U07A 3AB0A 2VBDA 1FNZA 4P9PA 3CCSV 3PVOA 2WNVA 4I4TA 1VF6A 5I0RA 3NNLA 3K5NA 2PYLA 2QWOB 4JI1O 3W7TA 1G9CA 4U2AA 4TSVA 1M90W 2VR4A 3PMSA 4F6EA 4K35A 4LEJA 1NR7A 3GM8A 5FIXA 1CX1A 2RN9A 5D21A 2G4IA 1DGRN 3I2IA 5BNOB 1YLLA 4CUGA 4JZRA 3L72H 3C7HA 2VCMA 2HEVF 5AC93 2AZ5A 4IT5A 4D7SA 1UJWB 3J80N 2WLNA 3OR7C 3DYPA 1V55C 1VIWB 4RYDA 2GC2A 1UU4A 3BALA 2ZT9B 1KP2A 2DMXA 1HLCA 5DEDA 2TUNA 1R6TA 1G4YB 2AREA 2OWOA 4P30A 3ZPYA 4YY3O 2WNVB 4S2DA 4I4TB 3ASNC 1HNWO 4ATFA 4AFDA 5CA1A 4JHTA 3SKVA 4OMDA 1JZ6A 1OURA 3WF1A 1WP8A 2CUGA 4LUMA 5FCCA 1WPXA 2UURA 2DUOA 3HBKA 2A73B 1NCQC 2Y6FA 3DSQA 4QPYA 1AILA 1EYBA 4JYAO 4Q4X1 1AR1B 5HCFA 5KXDA 5JH7A 4TYSA 3WDUA 4PQ9A 1E1RG 4R6ZA 4NRPA 4CDWA 4TV9B 1AR93 5T52A 3VZJA 4GX2A 1KD1W 5L7OA 4XFFA 3WW3A 5A3LA 2JEUA 1VBD1 5E6HA 2XAJA 5IT9N 4JKMA 3BY6A 1GM8A 3H1LH 5BNOC 4J80A 5EIBD 2EA7A 5CA6A 3VHNA 4UFMA 5BXXA 1VJ2A 5DQ0A 4CPBD 3MYXA 1FOD3 3H01A 3HKBB 5JOYA 1AZDA 2QJVA 2A7AA 3JD2A 1DGRA 1CPYA 5CA1B 4QXBA 5I0UA 3FE5A 3I2FA 4M4RA 4XMIA 2BWCA 3IKWA 3PIGA 4P9WA 1NQJA 5B3SC 1MQTA 2ARXA 5IK4A 3HPLC 2KA3A 3AG3B 3I3EA 4CDWB 1GH6A 1ZBA1 5K0UA 2J1UA 4CTEA 3D6EA 4QD2A 1DHKB 1JZ8A 3IGAC 1YC61 4XAAA 5C5TA 1QY4A 3KD4A 4XXAA 1R082 2VD7A 4L9BA 1QXRA 1G6UA 1WA8B 2Y6JA 3MFCA 3KKYA 1MACA 2BSKA 4HT1T 1IBLB 2ZKOA 3F7VC 5H9PA 4L0PA 4XE9A 4KNCA 1QOOA 4L8JA 1OH4A 5LBCA 4UVCA 1MQTB 1ZA4A 4FK5C 1GNZA 1CAVB 1XI1A 3IT8A 3CCJV 1MA1A 1WPBA 1OKOA 3IDBB 1GWMA 1R3JC 5K0UB 4GMP1 4DR4O 4YM1A 5D8AB 3H42B 3LPGA 1O8PA 2JG8A 1ASJ1 5CB7A 5GZEA 3CZJA 4AQYB 3RNSA 2RVAA 1DCSA 5A1LA 3AX4A 5FL7G 3AG3C 5G04L 4ZS2A 4CDWC 5IFPA 2D6OX 1PO22 3MI8A 3KWVA 1YFWA 3O1RA 1C8M3 4RUEA 2VNRA 2BSKB 4Q0PA 5KXCA 3D82A 4QE9A 2FYUH 3ABMB 2KKWA 4P9OA 2WDBA 4O4LA 1RUC2 1WA4A 2E7TA 4JYBA 4JI7B 5LMNO 1FX5A 3R05A 1SBEA 1W9TA 2JDPA 4N8MA 2CGNA 2NMNA 2BTQA 1AR71 2RS11 4DV7O 3IDAA 5AFBA 4B3TB 5CBHA 2OXBA 1ZRFA 1H4HA 3WDYA 2IWGB 4Y1YA 1ENVA 2EXJA 2W1UA 4KBBA 2YS8A 3K04A 1MQTC 3N36A 2ARAA 2Y34A 1J95A 2JKBA 5ACA2 1QQCA 2HKXA 2Y38A 4K20A 3UCSC 2SBAA 5CAZA 3N27A 1D2QA 2YG0A 2PXJA 4QX1A 5D8AC 2WS93 1W6PA 4XF1A 5B2GB 3H1JH 1BK0A 5IVYA 1PNFA 1C1FA 4O4LB 2ZGPA 3WV6A 1JYIA 1S0FA 1GRJA 2OKXA 2A3WA 3NAPA 5B1NA 3RDIA 1IBMB 5HPOA 3BPZA 4D69A 4JV5O 1BGYH 1R6NA 5IAVA 4DEVA 5DUXA 5FFOC 2HWC2 4YZ5A 1AP6A 5IVFA 4Q4X3 5EC2C 5EBMC 4N9HA 3BN6A 3M70A 2WNEA 2A3QA 4QIWF 1FNYA 5F39A 2NPIA 1OCOB 2ZMNA 2Q5TA 2PQQA 2EILB 2ZHKA 4YW1A 2GH2A 4X8PA 3VDAA 4A6SA 2C9AA 5CN0A 1HDJA 4JRLA 4DR5B 4RFT0 3OAAG 3CBNA 1VBD3 1S0IA 2W0FC 1QLEB 4YGCA 3P32A 3PNAA 4LFAO 1W6PB 3QLQA 3C90A 4FAGA 1LENA 4X89A 3K06A 4JI0B 4E2LA 2Y60A 3ZIAG 1FAFA 1REDA 3NAPB 1YJKA 3D3QA 3HIFA 4DV2O 2RCVA 3WCSA 4FFBA 3AG4B 1A6CA 4OHWA 2W0XA 1LNQA 4PBPA 5C3SA 2BW8A 1I1EA 2GTSA 2Y8KA 1Q81W 1XQNA 4IDZA 1UO9A 3JXSA 2P5OA 3VDDA 4JI4B 1B09A 1JW6A 2R16A 2CAUA 1JVMA 5IK5A 1CJDA 5EJZB 1WLEA 1OPOA 4YG0A 1SLIA 3I3BA 4FLZA 3ZSKA 3OE7G 4DW1A 1ZBA3 5FO7B 4CDXB 4UB8Z 3I59A 4H2AA 1VARA 2Y4TA 2HWD1 2RS52 3NSTA 4NR1A 3AKRA 5FRAA 3N9PA 1ZLZA 1NH2B 1N34O 4OUSA 1W28A 5LGUA 3CMAV 2VAUA 2YU2A 1OCOC 1AL22 4IUGA 1RUG1 2EILC 3WU2Z 1U12A 4UFLA 3ZMNA 5DM6V 4FVVA 4UUJC 3TEXA 2NM1A 1PZ9A 5LCWL 4FFBB 3AG1B 1BMV2 3BU7A 2Z2SB 1QLEC 4OULA 3Q8BA 4LBQA 1Q6HA 1TGOA 3UKMA 1MS4A 2J1AA 2A75A 3SYCA 2B9VA 3IAYA 2Y6KA 4PDLA 1LHVA 2W5FA 3A21A 1QBZA 2BTVC 2XL7A 3SYQA 3H1YA 1OA4A 1BQ0A 4H3WA 2HWF2 3VD4A 4GMP3 4FPGA 2DBNA 3AKPA 2BV4A 3I59B 4QB6A 4JI5B 2VMGA 1ASJ3 1GR3A 1W90A 2ZACA 1EP0A 5GTHZ 2F95B 4DV0B 3S5AA 3BFRA 3CS5A 1H30A 2V5YA 1CGPA 3UM7A 1WAZA 3BIEA 2AC1A 3M3QA 2QWNB 2AUYA 2FDJA 5DUWA 2LW7A 4HBNA 3VGIA 4CDXC 3AMMA 1M4UA 2FQPA 3FMGA 1TVKB 5SV8A 3VBUA 3IWZA 3A0BZ 3LSUA 5J2UA 1PIV1 2RMKB 1U96A 3B3QE 4COYA 3ASIA 2Z3YA 1W8UA 1NQDA 4Q27A 1R1ZA 1TUBB 1SF9A 2GNBA 3K3WA 2RS13 2XL9A 4CZSA 4GJZA 2XKOA 3AVRA 3CCVV 2J1VA 1QR9A 1OV9A 3J9SA 1QKQA 3I54A 4RQFA 2QQOA 4RS5C 2JD4A 2HG5C 1H1IA 2XONA 1FXVA 4XEZA 1W8HA 1N0JA 1NUKA 1UL9A 3U11A 1OVSA 1AX2A 1BBT1 2XOMA 4YG3A 2I07B 1DQ0A 2ADPA 4WFGA 3O1OA 1OQEA 1Y9QA 4LPLA 3RW0A 5EJ1B 5FZ0A 1AX1A 3WG7B 2J7MA 4KMQA 3OUJA 2JDZA 3RSJA 1GICA 1Q3EA 4LULA 1BS3A 1RPOA 3THPA 3P3PA 2Q30A 3FYIB 2UU9B 3N9NA 3WNPA 3CMGA 4E4HA 1LR5A 3AKQA 3T4DA 2YSUB 4G27B 2WKKA 4UCUA 4CS3A 3DECA 1K34A 1WLCA 3RG0A 2X6AA 1W0JG 3OGJA 2FD8A 3TOJA 2ZGTA 4YPJA 1PVXA 4E4DX 3S7EA 1KKDA 4UT5A 1BCCH 3AJZA 1V6IA 2A3XA 2WAOA 1FXKA 1YITV 1COV2 2XBO2 3HKCA 3JAWA 1S5LZ 2WT2A 4LR4A 2QM8A 2WJSA 2C6SA 5EWSA 1DDLA 3FAVA 1J5EO 4FFHA 2FZ2A 1AI4A 2QCSB 4OI4A 2VZRA 3R4UA 5LYJB 4H33A 1ZX3A 1F4MA 2DQ0A 5C71A 4AYUA 1W2TA 1LHWA 4A42A 2WABA 1M93A 1O3RA 3SLIA 2Y69B 1V9U1 4JGYB 4BQYA 4DINB 4JGSA 4EB6A 1FXZA 1KQSU 4LBMA 1VMGA 5ERLA 3IMNA 3LEMA 3A7QA 1DYOA 4HETA 5AG2A 2ZXWC 4MVRA 4YJ2A 4ZKIA 2GV9A 3RZKA 4J10A 3E97A 3ZXLA 1H2LA 3OGGA 1MSDA 3E83A 2IVJA 1FXKB 2QEXV 3VBOB 3HKCB 3JAWB 1WUVA 1RUG3 4P9JA 3U1XA 4L92A 4OZXA 3FB8C 2VS0A 1CEZA 1ZTEA 3FAVB 1QJZA 4XUNA 3EO6A 1U0AA 4Z1VA 4AFMA 5BUVA 1OZ0A 2JE8A 1HB2A 1XILA 5F2SA 1RUJ1 4DXZA 3FUQA 1SQ4A 3RZGA 2R30A 1OLMA 1Q8PA 4LUKA 2PHUA 4EB6B 2BFUL 3VBSB 1UPGA 1UZVA 5H9SA 1S2EA 4R4ZA 3RYRA 3GBGA 4WFEA 4CXXA 2AHZA 4GKYA 4JYYA 2H8PC 4L87A 4HSJA 4YJ2B 1XXNA 4K9SA 4YG6A 2VZQA 1IQDC 3KZIZ 4CDQA 2P5BA 4Y5TA 2CDPA 3IDEA 2Y69C 4JGYC 4ET7A 3RI8A 5JXIA 3MFAA 1UZZA 5IVCA 2RMU1 4A41A 2BOBC 3OYWA 4BM8A 3S0MA 4OI1A 4W4KA 4GLXA 2QUOA 2VVEA 4GULA 4WM7A 4Q5OA 3HEIA 3F2ZA 1UOBA 4ES8A 1FXKC 1PIV3 2XJQA 3VBOC 2ZMLA 1R3KC 1Q8SA 4O2BA 3IN9A 1IKQA 1RFYA 1O5UA 4AK3A 1WMDA 4KBZA 4NYKA 4GH4C 4AI2A 2GAUA 2NP0A 4H44B 4DV5B 1UOJA 3WHTA 1RYYA 4KL1A 5A7SA 4UW5A 2CAVA 4CDQB 2XHNA 1SQFA 2WN3A 4JPRA 5D2AA 3EFFK 3VBSC 1BBT3 4OQ8A 1PVC3 2Q5ZA 2CTPA 4EZ4A 2PF4E 1VB2A 5A7PA 1G6NA 3OYWB 4RN5A 4JV4A 2EJ7A 3C3TA 1AXKA 1X33A 4GX1A 5FLXN 2Y0OA 4PI0A 4Q2FA 2UY9A 1OHFA 4PV1B 3I56V 3W7UA 1TEIA 5FP4A 4O2BB 3VQWA 2NNUA 4GYCB 5IAXA 4OXSA 4AFAA 1ULPA 5FZ7A 4ITCA 4YW6A 2XT9A 1LOGA 4FCAA 4L8QA 1NKGA 2WNUB 1GP6A 4Q4V2 2WBKA 5L3FA 1UYZA 1LJ7A 4QGPA 4XDLA 5EK0A 1IBLO 1AX0A 1JU3A 2M6YA 1DFQA 1CJPA 3O1UA 1LU1A 4RR3C 5DPNA 1Y67A 3M3IA 1EUUA 5JIAA 2A6VA 1YIJV 2QKSA 3OPZA 3ILRA 2JICA 1U5YA 5JOXA 1ZRRA 3RJ2X 4CDQC 5FYHA 2C26A 5CEHA 4D6SA 4QGLA 3OF1A 3DN7A 1ZSPA 1Z0HA 4LF8B 3ZMVA 1A34A 2C1FA 4M01A 4NMIA 2D7FA 1CAXA 1LNSA 1MZ5A 4QU1A 5IATA 4O4IB 1T5EA 5LATA 1V9U3 1CN1A 2BERA 1C57A 3VN4A 2R9IA 1ND3A 4NAOA 3N4MA 1QH7A 1SA0A 1SRYA 3Q8AA 4LHLA 2DE0X 5FR3A 5GLTA 1X59A 2WNUC 2GNTA 3FBYA 4CCDA 1XNKA 1SQVH 4FOQA 2VZTA 4NTXA 1LHNA 4O65A 3MIHA 4YFZA 4B3TO 4I9WA 1W3XA 4C0HA 3H3UA 1I5ZA 5CISA 5FTTC 1YXWA 2P34A 4P00B 2QKDA 4WCEV 2EXHA 3ZYHA 5APAA 2QQWA 5JSPA 2CSGA 1RUJ3 2XVKA 1X9TA 5LXTA 4QXCA 1SMVA 2Z0AA 3H9VA 1KDKA 5L73A 2VUAA 4DPNA 2WQ4A 3S5QA 2E5LO 1SA0B 1W6QA 4EZHA 4ONUA 4Y3OA 4LT5A 4F8AA 4YARA 4WBNA 1IBMO 4LH6A 4E2GA 3W9AA 5J36A 1KFXL 1X36A 4IV1A 2GMPA 1XL4A 2RMU3 3ZXGA 3VB9A 5T5JA 2HP8A 1N3QA 1EN4A 5A33A 4UVAA 1DQ2A 1L7QA 5JXHA 1M4WA 1YF2A 1RUC1 1VQ9V 2D3SA 3GBWA 5LXTB 1RC6A 2NZ9A 4XC9A 4R4XA 3ZDVA 1N36B 1DLCA 5KMGA 4UFKA 3POSA 3OBAA 3I2DA 3WG3A 2ZCEA 3SDLA 3BHPA 2OZJA 4JI0O 1GQGA 1W6QB 2ORZA 3AL5A 2D6PA 2WO1A 3PVBB 1RXGA 1VIBA 4WBNB 2VRZA 3FHAA 1EZVH 5I0SA 1STMA 2IU0A 4CDUB 5JR7B 4IV1B 4IEZA 3HKEA 2RR11 3JBG2 5ACA1 5FYUA 3RYHB 3BB6A 4JI4O 2D3RA 3H8UA 4Y1ZA 5A33B 3LSQA 2WSSG 3HAGA 2QTOA 3INAA 2CAZC 3ROUA 3ZYBA 3BVCA 1AR82 2OVUA 2GSMB 1JZ7A 5JSOA 3NRUA 2C2AA 2WNOA 3ZHTA 5T50A 5T3NA 3SH3A 2DQ3A 4ZONA 2B9UA 1K5MA 4PT6A 1QOSA 3E22B 1W6NA 3QNEA 5FPBA 4BJ0A 2NR5A 2CYFA 2EVXA 4DFSA 3ZMUA 2DFBA 2QR4A 5IVVA 1O6UA 3RYPA 3EMRA 1LOBA 4IGQA 3FX3A 1RINA 3WG2A 2F4PA 3K5OA 1B06A 2AR6A 2VPVA 3HKEB 1RMU1 1W2BU 2ZZQA 2FBEA 5J7MA 1HN0A 3T4ZA 5KHIA 2PZSA 1MS3A 5JPNB 1WCQA 1JN2P 3EQEA 1XU2A 4CDUC 3O1SA 4IV1C 1S0BA 1OT5A 5FLHA 2ZQMA 2N74A 1NU1H 2E6VA 5C3QA 1U5XA 4JTNA 2IC1A 3O0VA 2LS6A 1K5MB 4EN7B 1W6NB 1SLLA 1AB3A 2P17A 4FM2A 4BE3A 4NHMA 2JIGA 4Y33A 3LEIA 1YQ2A 1JHNA 4LK6A 4YXWG 1Y76A 3MZHA 4FPCA 1QMJA 1OLQA 1XNTA 3LKJA 3NV1A 3W5NA 2I74A 4R7CA 2WLHA 3I2HA 3K4DA 2C4XA 1XBLA 1PMHX 3D3AA 5FZOA 4I30A 4LMFA 4CH6A 5LMUB 4LA2A 3BODA 1VRH2 2E63A 2RS51 2CWSA 4ICGA 2EX3A 3CX5F 1J3QA 1RP3B 5KHKA 4FMTA 2LFSA 1S0VA 1K12A 1YJNV 4UCRA 1AL21 2F1MA 2V4DA 2WINB 4GWIA 2D6NA 1UZWA 2OCCB 4HSLA 2UUAB 2ZIOA 1KFUL 2FHRA 3CZUA 3BAAA 4GWNA 2XLFA 3J7LA 3VDCA 4QX5A 1JOPA 3MGUA 4Q8KA 3WDWA 4U3JA 4EJRA 1I7FA 3CE2A 3E6DA 1Q90D 4HXCA 3ON7A 5H6QA 2D40A 3PURA 3ZN5A 5LEJA 1Y76B 3ETQA 5LL6Y 5H9CA 2ZDIC 1JA8A 1NVPB 2GBOA 2WA4A 2HWF1 5LK7B 2ODMA 1YQ8A 4A2UA 1BHGA 2B9ZA 2Q7HA 3HD8B 4QQPA 4KG8A 4MGSA 2JJ2G 4JAVA 1DZRA 3WVJA 2PUSA 2RV9A 1OXCA 3SQOA 5FJKA 3NR7A 3MW2A 5L9VA 4HYOA 4ZY9A 3ZSJA 1YVWA 4YW4A 4MVUA 4X8AA 3TNQA 1P49A 4F6RA 1WD4A 2EJRA 1O9GA 1IHMA 5E79Z 3CRAA 3C7EA 4U3JB 4P08A 3GJBA 1NKDA 5JDBA 3RS6A 4YZ2A 2WLQA 4HG6B 2DV9A 1XUQA 1M5IA 5FXVA 5FZEA 2QJ1A 2P06A 2K0GA 2QTWB 3P5BA 1DU3D 1PZ7A 3JSNA 2WO3A 4X1IA 3L75H 1NQTA 1DG6A 4PF1A 4XTPA 2RR13 5ACA3 3JSLA 2RDNA 3CRQA 4DXRA 3NV2A 2LGWA 4XACA 4TUYA 3O12A 2DCYA 2DUPA 5F6LB 3JZVA 1OSGA 4F6RB 1LRHA 4M3CA 3ELNA 3SKJE 1NCRB 2VOKA 4LOTA 3J7NA 5DUVA 4OGQB 1PM7A 4PIZA 3LDBA 3WZ1A 4LF4B 1WW7A 2Y6GA 5F2WA 3PLQA 1S5HC 3WF3A 4DW0A 1EAH2 3LDCA 3URFA 2GMMA 3C7FA 1Q8OA 1OVPA 3PHMA 1PP9H 3TXSA 3I97A 1ZZ8A 1RMU3 3NJYA 1OMIA 2VGDA 3WNLA 2VVFA 1XSQA 5A2QN 3LDKA 3BKZA 1KEXA 3NV3A 3UETA 2BRTA 2IZWA 5DDJ2 3ZMTA 1GOFA 4LTAA 2RQ6A 1R64A 4M3CB 3A23A 1COV1 2XBO1 1AJQA 3PJSK 3T2PA 5JR2A 1GZWA 3VQVA 3N2KB 4IE5A 2BBVA 2ID4A 4OI2A 1YXBA 3UESA 2Z69A 4YJ3A 4JGZA 4NXMB 1IXMA 2H0BA 3L74H 4LQRA 4YW2A 3K75B 1YIFA 2EIKB 1NCRC 1HXS3 2OTLV 3KLSA 4I2OA 2VUJA 4N21A 1NT2B 1VQMV 3ZBHA 4QJFB 2HLEA 5K1PA 2WUHA 3KB5A 2BVBA 4PCRA 3CP1A 5BYNA 4EFEA 5JQGB 1OA3A 4MX3A 1VQ5V 1UOGA 4AFBA 4X62B 3H0OA 3G80A 3HOBA 2RS53 4X1KA 5FLIA 3JATB 2VOWA 3T1YB 4DV5O 1AL23 4GKJB 2QQJA 4UXNA 3NNMA 1VP7A 2E74B 3DXUA 1GZWB 2B4KA 4GD4A 2PHXA 3B93A 2VW0A 4OX9B 3AKSA 4B3NA 2Q7GA 2EXKA 1QNMA 1M57B 1UXXX 1SCSA 4JGZB 4CEWA 4AVBA 4TQDA 5HFLA 2E51A 1W6OA 2VVDA 3FLPA 4AE2A 3AXDA 2W1WA 3ZR5A 2WLPA 2F43G 2VMEA 2VXRA 4H14A 4A7ZA 1SZTA 4TLGA 2HWF3 5LBFA 2PMWB 2ZX2A 1REFA 4E8CA 1NXMA 2EIKC 2V72A 4L99A 1I5YA 3HKDB 2FTKA 4EWDA 5ANNA 5A6XA 4QX0A 4A3ZA 2XXZA 2YMZA 2OYQA 1O4TA 2C0ZA 5JWPA 2ZGUA 1HB3A 5KUMA 3ABKB 4XUOA 4MGYE 4K3UA 3NMBA 3C3VA 1V70A 4KU7A 3CL1A 3WLUA 4CEWB 3BPSA 1W6OB 4FZ0A 3RYCA 2K9ZA 4ZOLA 4BZ4A 2MEV3 1M57C 4S2HA 4FPFA 4JGZC 5KC6A 5FUNA 4NUBA 4AGRA 1APNA 2YPDA 1W8FA 3WUDA 1RPRA 2Q0OC 4QWNA 4XBLA 1LECA 4PA4A 5A3NA 3OTOB 2F4LA 3E5UA 1HQLA 4PDVA 1RUF2 1XQ8A 4S2GA 1H9WA 1GUIA 1W39A 2DCKA 3TK1A 1CAUA 2WS92 3V56A 2PA7A 2QFEA 3ZYJB 2UYAA 2ZAHA 2CDYA 4NIDA 3MEPA 1K9MW 1XNRB 3DCQA 2BNOA 5DAVA 4LCUC 4UFZA 4AAPA 3LNMB 1HJGA 2WWWA 3RYCB 4B4QA 4ZOLB 3DYOA 4MVMA 4LO8A 3O14A 3ILNA 3W5MA 4P9GA 1OOPA 3ABKC 3PU8A 3TNPB 1KRIA 1VMHA 5ABJA 2CGPA 4Q4V1 3D4KA 4KP4A 1JJ2U 1NLRA 3V0BA 2R1BA 4DUZO 3OW2U 3VBRA 2ZINA 5FPXA 4NWVA 4XJ9A 5EBLC 3JAKA 4NRMA 4YVWA 5CKNA 1PX4A 2JWPA 1CQ9A 1VBD2 1DQ1A 2VOVA 2JIJA 4XIKA 5FZ4A 3FB5C 1COV3 1XU1A 2XBO3 1SC5B 5IHRA 3ZX6A 1ULOA 5B1AB 2PAKA 5CKQA 3K2OA 1RITA 3UYJA 3L9DA 1QHDA 4RFRB 2ET1A 4WZCA 4UFIA 1WGPA 1O3SA 4PIXA 1OOPB 3MW4A 1JJOA 3LCPA 4PLNA 1OLRA 4IE7A 5ABJB 3H1HH 1C28A 1D0HA 1YFXA 4JAUA 3THOA 4JTAB 1JU4A 3IB3A 1XREA 3V0BB 2ZHLA 1TMF1 3VBRB 3H7JA 2HVJC 2VOXA 1PNMA 3JAKB 5CFDA 4W6XA 4YVWB 5GLVA 1Q5OA 2H94A 5LB6A 1N36O 1SACA 4COVA 3SMHA 5A7WA 4BB3A 2W6IG 2DDUA 2FB5A 1B35C 2OW4A 1G9BA 4OHXA 4FQ4A 5T5PA 1R1A1 5ISLA 1O3QA 3BYWA 4B7EA 1OUSA 3WB1A 5EZYA 2ZEXA 4LORA 1WW5A 4QPJA 4FQZA 5B1AC 2OCHA 1BLZA 1J58A 3TAYA 5KC5A 4QPIA 4PIYA 2RJ2A 4K1YA 3HMYA 4NROA 3ZDSA 5I8YA 4PA6A 2GP5A 1WP7A 1OOPC 2VNOA 4TN7A 4EWAA 5ABJC 3U4SA 3QD6A 2XLGA 5A7WB 3BOPA 3WFVA 3ZXDA 3DV8A 2DYSB 5LZ6A 2ZX0A 2UU8A 1DZQA 2RDSA 2A5ZA 3VKOA 1ACCA 5T5OA 1NA1A 3VBRC 1QVFU 4YVWC 3PDQA 1E5HA 3VZMA 5EZYB 4KU8A 4BOWA 3L71H 3WP4A 2JGDA 5DUUA 1N33B 1YNAA 1D0GA 1K5SA 2VXJA 1RVF2 3W59A 1LODA 1CESA 2QTSA 4MTGA 4RHV1 3W7SA 4IERA 2IXLA 4Z82A 1JPXA 1O59A 5DG1A 1GYKA 2P37A 1TUEB 3W21A 2XHKA 1VAMA 2AENA 2ADDA 2HWE2 2ZGSA 1QJU2 3CJXA 2P90A 4DYLA 1B3QA 1NA1B 4MO3M 2NLRA 1AP5A 2YFZA 5J98B 5C4WA 2KR2A 4NIHA
chains in the Genus database with same CATH topology
1RGSA 4QPGC 3AJYA 3GBFA 2IXKA 5GLWA 4XQDA 1LHVA 2BTVC 2XL7A 4AHXA 3H1YA 3ZSMA 1ND2B 1OA4A 1TMF2 2ZOEB 4H3WA 1AR81 2D5FA 2HWF2 2WSUA 5GLZA 4GMP3 4FPGA 3B5LB 3AKPA 3QACA 3I59B 4LO6B 1DRTA 4M3CF 2VMGA 2O1QA 1ASJ3 1UX6A 1GR3A 1FOD2 2ZACA 1EP0A 4Q0UA 1H30A 1S0GA 4H7MA 5CG8A 2V5YA 1CGPA 4Q4Y1 4XFHA 4JC1A 2IXCA 3M3QA 4CWDA 1D4M1 2AUYA 5BY5A 1DGWA 1H4GA 2WZR1 3NKTA 2P3JA 5DUWA 5J96B 4HBNA 4AEDB 3EJKA 4Y1VA 1ULFA 3VGIA 4CDXC 2B8MA 3PVNA 3AMMA 2KM2A 2BWAA 3ZFGC 1F5FA 2FQPA 3FMGA 1R1A2 3WCRA 4YM3A 1LCLA 5J09A 5SV8A 3WDVA 3VBUA 3IWZA 4LE4A 2FMYA 4FXKB 1WCSA 1PIV1 1DF0A 5C8CA 1CAXB 1RJ7A 3B3QE 4COYA 3ASIA 3MS5A 2PHTA 1NQDA 4Q27A 1R1ZA 3T2TA 1GV9A 2GNBA 1ND3B 4OVEA 3NVCA 2RS13 4FXGB 2MHFA 3WX5A 2XL9A 2OG6A 4NHKA 1W6MA 4CZSA 2YGMA 2RS32 4I01A 1V00A 2XKOA 1GQHA 2ERFA 3V0AA 3J9SA 1CR7A 1QKQA 1RUE2 1G86A 3I54A 4EN0A 4AXOA 4RS5C 1AXYA 1F8VA 2JD4A 5D1IA 3N7MA 2VU9A 4P9YA 1PO13 1AR63 3AYDA 1H1IA 4DZGA 5FOJB 1NA1C 4XEZA 2ZZJA 5L19A 2ZGRA 2PAMA 3E5XA 1GZ9A 4IEVA 4FOYA 1UL9A 2EIGA 3U11A 3ZXJA 1AX2A 1IPJA 2BNNA 1DZTA 5JVVA 1BBT1 4BWOA 1V6LA 1ND2C 4YG3A 5CFCC 2I07B 1DQ0A 4K40A 3VZLA 4OHVA 2WC2A 4AHZA 3C2UA 1TNFA 4HL0A 4CRQA 5BNQA 4LBOA 1OQEA 2YROA 1CD3G 5EFUA 1FPN1 1Y9QA 2OG5A 1WW6A 2YUEA 1UKRA 4NWWA 4KWKA 1AX1A 4BGMA 1TMF3 1IS6A 4XHBA 2JDZA 2ZBJA 3LB9A 2RM22 3RSJA 1GICA 1Q3EA 4HZFA 4LULA 1QQP1 1QXPA 4Y22A 3CNAA 4GIQA 4XJUA 1LHUA 5TSWA 3THPA 5K8SA 1VRH1 4AEDC 3P3PA 2Q30A 1UD1A 2YDEA 2D97A 1MR5A 3CJIA 4RHV2 3J8F3 1W6MB 3S7IA 3KS7A 1ZREA 4AHYA 2WT1A 4IEQA 1WLDA 4WZFA 1RUD2 3KSCA 3V0AB 1MZEA 3WW1A 4ZU7A 5EXOA 1LR5A 2ZA9A 4QM8A 3AKQA 3GNEA 4QGMA 1VZ5A 2PN5A 2WKKA 2RE9A 4M2FA 1WLCA 3NO8A 2H6CA 4QQ2A 3RG0A 4LLFA 4Q4W1 3AZWA 3M3CA 1R1A3 4R9BA 1C8M2 4WBBA 2B45X 1NOVA 2ATFA 1POV1 3OGJA 1AXZA 1CAVA 5H9QA 1ND3C 2QZ3A 5FLJA 3GZUC 3B94A 1FI2A 2G9FA 3TOJA 1OI6A 2PHRA 2ZGTA 1ZZ7A 4WVZA 2SLIA 4AVCA 1VBA1 2YV8A 1PVXA 5D8AA 3ME2A 4GALA 4E4DX 1NX4A 3S7EA 3WP5A 3AJZA 1V6IA 3WQ1A 2A3XA 3LWCA 5DZGA 4FTBA 1C4RA 2ZPXA 4YRDA 3KZ4C 4QMAA 2RS33 3ILFA 3M7AA 1COV2 1G9DA 2XBO2 1GANA 2WFF3 3ZIWA 2WT2A 4LR4A 2WJSA 2Y0IA 4M2EA 1RUNA 4CEYA 2Q4AA 2ES3A 4RL7A 1DGWX 4Y22B 5EWSA 5DXDA 3PVJA 1DDLA 2FZ2A 1AYM1 1HRI1 1SLAA 2QCSB 4F3JA 4OI4A 3TBDA 1BKZA 1SLBA 3CJIB 3R4UA 3WXPA 3ZX7A 1B35A 3A0KA 2WZR2 4MGIE 4AYUA 4E2SA 1LHWA 1G7YA 2OPKA 4JDMA 4FAHA 1O3RA 3SLIA 1V9U1 2CWMA 4JGYB