3P3NA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1930-1949) peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/transcription
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3nA01
3KCXA 4Z2WA 3OD4A 4B7KA 2XUMA 1MZEA 2CGNA 2W0XA 2WA4A 1H2MA 4Z1VA 2ILMA 2Y0IA 1MZFA 4NR1A 3KCYA 4AI8A 4BIOA 2WA3A 3P3PA 5JWPA 4B7EA 1H2KA 1H2LA 3P3NA 1YCIA 2YC0A 1H2NA 2CGOA 4QU2A 3D8CA 4JAAA 2YDEA 1IZ3A
chains in the Genus database with same CATH superfamily
1ZBE1 1TNFA 3WW4A 3JD4A 2ORXA 3JCZA 1NLQA 1RXGA 4QU1A 3VZLA 4Y33A 1BT8A 1CAVB 1AR83 1ZL8B 2XKOA 1CESA 5DUVA 5F6LB 4Y5Z0 2ZT9B 1SETA 1GP5A 4LF8B 1XSQA 5FZMA 3RRDA 1WBFA 3VQYA 4XABA 4AVSA 5FYIA 2VBDA 2GNMA 2VWJA 1COV1 3PU3A 2GV9A 2G1MA 2IFRA 1PPJH 1UWWA 1DLBA 3D82A 4DV5O 3LA2A 4JI6B 3K3WA 4QPIA 4RUEA 3STLC 3H9AA 1HNZO 1QU0A 4J9YB 1VQPV 4XJWA 1Y66A 4R7CA 4ARYA 3UK9A 2KG7A 4R4ZA 5T5JA 1FMD2 1GN3A 3DV8A 3OMNB 4XFCA 1KFXL 3SGIA 4HSLA 3FLPA 2QQKA 3AVRA 4UOJA 4MTXA 2VRZA 3LEIA 1TMF3 4TXWA 4FTBA 3POGA 1LULA 1D4M2 3FBYA 3K3NA 2L35A 1AL0G 3RYRA 3RYIA 1D4VB 3ACLA 1H6YA 5IW0A 4QPIB 2CDOA 3LOBA 3ZMOA 4AQYB 1J5EO 2JENA 4AI0A 2KG7B 1EV12 4UW3A 2QCSB 2VZQA 2RJZA 1UZ0A 3U78A 2PQQA 4FLZA 2HJIA 4DMIA 2W87A 1S5HC 1F4MA 4QHOA 3IDEA 1ZAUA 1JBCA 4JX0A 4J1WA 4LBQA 2HP8A 1D2QA 1DCSA 1ENSA 2ENRA 2HWF2 4LFAO 2GHYA 1GWLA 1CJPA 5LGUA 1AF9A 3RYIB 3J4UH 1NXMA 1OOPA 2QR4A 1PIV2 1HLCA 1K5MA 2P1BA 3I49A 2F95B 3MIEA 1WCDJ 1G1XB 2VMGA 5T5LA 4XJUA 4B3SB 2RS32 5AFEA 2YICA 1ULOA 3ZSKA 1K9MW 3RZHA 2E32A 2HWD3 4B3NA 2WFF2 4MTFA 3ETQA 4H3WA 5LMNO 4UFHA 2GUZA 1GBGA 1N1VA 1F4NA 4FPYA 1PVXA 4XACA 3AKSA 4MG2A 4LBQB 2XQRA 1HXS3 1OH4A 1C8M2 3ACIA 4A41A 4JQTA 3ZYFA 1UMZA 2ZXQA 2VOXA 1OQ1A 1BE3H 2EIDA 1SCRA 1OOPB 4MVRA 3UGHA 4Y3OA 1GKFA 1K5MB 4QX5A 5KWRA 1DFQA 1QNWA 1LOAA 3WSOA 5IDJA 3EXAA 1D2SA 4UXNA 4HK9A 1QOTA 4NIDA 2JXAA 2QJVA 1AJKA 1S0FA 1U97A 1MS1A 1PZ7A 5LYJA 2RMU3 5F2WA 4OI2A 3OMIB 2GUZB 4MV2A 4AFMA 1MEC2 5H9RA 4PA3A 5D1IA 5FZ9A 3MO4A 1NLSA 1R083 5FDBA 2QKSA 4L0PA 3GGLA 2ZM6B 3BRCA 1GQPA 3ZXLA 4I30A 5B3SC 3E35A 4RAIA 4WFAV 1Z5VA 4DR3B 3WG7B 3HBKA 1QJY2 4Y22A 5CVRA 4Q4Y2 3C7GA 5LYJB 5AC92 3WD5A 2EICA 4FP3A 1FXKC 2MPFA 2R70A 4OZOA 3O1OA 3NRUA 2GAUA 1JI6A 2Q7HA 1C3HA 1AR81 1O5UA 3DXTA 1DF5A 4NB5A 3LIGA 3VDCA 4FM0A 2P7TC 3WR0A 2VD7A 2FCTA 3AXEA 3NJXA 1RTVA 1RVF2 1NJIW 1FYUA 2BOIA 4QAWA 5FBJA 4LBLA 5C3OA 4Y22B 3OJBA 1NZCA 3E8BA 2DYSB 2YMZA 4E27A 2OCHA 3K4DA 3W20A 5JCOC 1UYYA 4KHPB 3HQXA 2W1SA 4HSJA 3TK1A 1W9FA 1WW7A 1K34A 1N36B 4C1XA 5ABJA 1Y3TA 4YW6A 3HBZA 4AHCA 4PELA 3CBNA 3K0DA 2IU0A 3B09A 4DNYA 2JEMA 3LEMA 2AZ2A 4CEWA 1JJ2U 1B09A 5FAXA 3AMNA 4ZONA 1UZYA 4ES9A 3T1MA 4DV6B 2OA2A 3R4UA 4OMDA 4LOSA 2LFRA 3UETA 1CZVA 2GU9A 3U10A 4JGZA 3FL7A 2ZGMA 5ABJB 4LO5B 4I0WB 3CXHF 3W21A 2A75A 1IS5A 1R64A 3MV01 2A6ZA 4PCRA 5DZFA 3P1IA 4PV1B 4QX1A 4YFWA 1OD3A 1SFYA 3MFAA 4QB1A 4OFGA 4CEWB 3NXSA 3K9SA 1ZBA3 4LK6A 2B45X 2ATKC 2JS5A 4XDLA 4E2QA 1ZRFA 2UY8A 4IESA 5IJ9A 4M3CE 2WNEA 4JGZB 3W9AA 3WNLA 3BIWE 3IDAA 5EXOA 4EQVA 4V2WA 1KJLA 1V6KA 2HWD1 2WYSA 1ZRIA 4QPYA 4X1YA 1I9RA 4CS2A 2XUEA 1XE8A 3WP6A 3WG4A 3THTA 1BCCH 2LJ2A 1YQ5A 1ROPA 1HXS1 4META 4RS5C 1IQDC 1H2KA 5JVVA 4NXNO 2XDVA 1D0HA 2ARCA 3OBZA 3VL8A 1V00A 4JHZA 5IJRA 1SEFA 4TN7A 1P49A 1GP4A 4P9XA 5IJ9B 3DECA 2W6JG 1XREA 1LOFC 3O1PA 3VKNA 4Q2FA 1AI4A 4W6YA 1JH5A 4EJRA 2P3IA 1SQFA 1J1TA 4DK0A 1RUJ3 4CS4A 3JAWA 1UN1A 4KBZA 3ST7A 1ZA4A 2ZGRA 1UOJA 4AEDC 1KS5A 1W2BU 3KF3A 1Q6HA 2RMU1 3AKPA 2AEYA 3K59A 5L36A 3N36A 4PQ9A 4DR5O 5KAIZ 5B1BB 2UU9B 4MSWC 3QTCA 3SCHA 5DMYA 1XMQB 2C9KA 5FZ0A 3SKJE 1RUD3 5L3DA 5JJJB 4A3XA 4KXRA 4NHYA 5IK7A 5IFPA 4KGQA 3POJA 4WBNA 3DKQA 2HLDG 3FHQA 4JYAB 1RM1B 1VAKA 1MVQA 3FE5A 1WP8A 3I54A 3JAWB 1SRYA 2Y69B 2XAQA 3PMEA 4LFBO 5FMCA 3B01A 1WMEA 4YG3A 4BISA 4XPVA 4IQPA 3STZC 4R8HA 4GB33 5T54A 5FBZA 2Q68A 3SQOA 3F95A 1ENVA 1BVVA 3E5QA 4WBNB 1MS8A 4EWDA 3MIGA 2JGDA 2VU9A 4LBJA 3VBFC 4MGTA 2UUBB 1DF4A 4GD4A 3V0BA 4BK4A 3AZYA 3OD0A 2D3SA 1NR7A 3B9CA 4CUAA 5K7PA 3L9DA 3ZX6A 4NWWA 4OI4A 5C8CC 1UU6A 2WWJA 4Q1RA 1VBD2 1K42A 4NPMA 1HNXB 2EAKA 1IPSA 3J81N 1V9U1 1SS3A 4FPHA 4ES8A 3QNEA 1RHI2 3LSQA 2JGDB 4DXRA 5FR3A 5C71A 1DLCA 1VBC3 2WS91 1GLHA 4O9GA 2ZE6A 3UKVA 3V0BB 4H44B 5BR8B 3WG2A 4I3GA 5ISLA 1OQDA 1PGSA 5E88A 1PNGA 2EALA 2EULA 2E7QA 5A6ZA 2JRIA 4GJYA 1LTEA 4R4XA 5J98B 4CZSA 3WQ1A 4PA4A 1IBMB 2DCZA 3H9VA 1BBT3 2D97A 2A6WA 4FTSA 2CE4A 4B3MO 3I2JA 4Z2WA 3JAMN 2D6NA 4YVSB 2RDRA 1ND3C 1R092 4LA3A 4WVZA 3F5TA 1OA4A 1ULEA 1UD1A 4FO9A 2Q8CA 4MXVA 1QBZA 4IE5A 1AR92 1STMA 3ACFA 3KT1A 3SPGA 2DU1A 2ZHKA 3RZGA 5T5PA 1ZBA1 4UXAA 3VZNA 3GALA 2ZD9A 4TSFG 2VOWA 4BW9A 3FC0A 4D6QA 3HT2A 1Q82W 1I5XA 1R1BA 1MPXA 2QDOA 3E5XA 2LRPA 4UF0A 2UXNA 4FIPC 5DUUA 1S0JA 2WC2A 1XUQA 3IB3A 4NOTA 4RWUA 3PTRB 4JGSA 2R1BA 1SCSA 4XETA 2KKWA 1PM4A 4WZFA 3H1YA 1ZVFA 1IS4A 2V5YA 2VXJA 5FZCA 1NCQC 3DSQA 2HWB2 3SCFA 3ZBHA 1N3QA 1H4HA 3VBUC 4MZUA 1W05A 4OI0A 1VR3A 5FP3A 2P37A 5L3CA 1RUJ1 4TV8A 4AQTA 3R66A 1DQ4A 4DUYO 3RYPA 5IVJA 1JU4A 3PVEA 4AI2A 4M4RA 4XFIA 4QE9A 2VZOA 1ULDA 1UQXA 3C7OA 1VBB3 1US6A 4PA7A 1UF2C 4RA0A 4ZPIA 4JYCA 2MEV2 2R49A 3CO2A 2D5FA 3S7IA 4X66O 1RUD1 3E22A 4JYYA 2ZIOA 3QO7A 1C1LA 1FXKA 1Q8SA 1NA1C 2OZ6A 4OMCA 4N90A 2YROA 1S0GA 4ZU4A 5GM0A 2WL1A 3LDCA 4TV8B 3CP1A 4MGKE 4P14A 2E7AA 3EHBB 3KT7A 3UNPA 2G4IA 2OZJA 5B3SB 3L71H 4A7KA 2OYZA 2WN3A 4IHJA 4FM2A 1U5XA 1REFA 2GSMB 4GB31 3G67A 3FD9A 2UWAA 1HRI2 2FDIA 3M3EA 4CXXA 2UXXA 2R9IA 1Y9QA 1LHOA 3ZXJA 2IBZH 4FT8A 3E22B 3TN93 1FXKB 2EBOA 3CE2A 2K9PA 5JCOA 1Y43B 2LROA 2FMDA 3JBG2 2WAAA 5L3FA 2JJ2G 3JD73 4XOGA 5IYYA 5T3NA 4P9LA 2J1RA 3LSEA 4HANA 4AI8A 1NYWA 2DUQA 4CCNA 3A0NA 3AYDA 4R9CA 1CAUA 4IHJB 4JI1B 3CRRA 2CSGA 3ZHRA 2JEUA 3BOPA 1TVKA 1QXRA 4LF5O 3HNBM 3T1YO 4BE3A 1NCRB 1LAJA 5L3GA 2PHRA 5FY4A 1OVSA 3PU8A 5IWAB 1IURA 4ZI7A 4X20A 1BMFG 2LO1A 2VQUA 2QM8A 1JUIA 3DF0A 3RNSA 2FCVA 1CAUB 1D2DA 4PIZA 2WFPA 5GLTA 5CKQA 5J2UA 2PUSA 4ASMB 3ZMTA 2ZAAA 3TBDA 1P4RA 2HBTA 2QEXV 4CP0A 2QQOA 1ACCA 1TVKB 1XEQA 3QACA 1XMQO 1R1A3 4DYLA 4YW3A 3JYCA 1XQNA 2GDFA 2SBAA 2JIZG 3NAPC 2W2IA 4ZI7B 5DZGA 3AG1C 4X20B 2TUNA 1M5IA 4U36A 2PHTA 4WVVA 4XMAA 4XF3A 3OE7G 4XUOA 3PIJA 5LMUO 5J2UB 5F2VO 5FYZA 4GX1A 1MS0A 1LECA 1JZ3A 5GJ6A 3ZYIB 4B3RO 4RS5A 1QJU2 4U7OA 2MHFA 3ZR6A 5EZYB 4B7EA 5FP8A 2TEPA 1RUG3 2IXLA 3EXUA 1OPOA 1OA2A 1DTOA 4O4LA 2Y6FA 5F8PA 1YTFD 4PHZA 1LOFA 2MW2B 2F1MA 1OKOA 4H13B 3MAQA 3Q8BA 1UKRA 4QGLA 2VS0A 1DGRN 3WF4A 4AVBA 2QZ2A 3POSA 1REDA 1QMJA 4A42A 2IJHA 4AEDA 1N47A 3I7DA 5ACA3 1W8TA 4Q4V2 1W39A 3OGJA 1OCOC 3K48A 1XL4A 3LFIA 4GMP0 3AMMA 2WO7A 3DUIA 3QCWA 5ANQA 4RS5B 2YBSA 5T52A 1CZSA 1JZ5A 4GX2A 4LITA 4IYHA 2BV4A 1OMIA 3G6BA 4DR1O 3I8TA 3CKHA 2ZX4A 4GWIA 4BAYA 1VBB1 4NUBA 3RFRA 3MGUA 4IE6A 4MHUA 3AZXA 1NZIA 3SYQA 1AR1B 3ZXKA 5BNNC 2NLJC 4A3ZA 4AEDB 1RUH3 4XAAA 3UKTA 3MIHA 4G4FA 3AEIA 3MV11 5KX5A 3BU0A 1S0VA 3AYAA 3M99B 4KH9A 1TUBA 2B42B 1QU7A 1YHFA 3R4SA 4DUZO 5CG9A 1NT2B 3WQ7A 3DCQA 4NKGB 3M7AA 2V73A 1ZBE2 1ZZ6A 1EN6A 3WCSA 4NYKA 1YQ2A 5C9AC 5JIUA 1NS1A 2VW0A 3VKOA 4P9OA 3VBFA 4W6XA 2WNUC 2F4LA 1Z78A 1W9WA 2P5OA 3TN91 2QQWA 1VBE3 3TCUA 2KM2A 5D5PA 5KX5B 1QVGU 1CPYA 1QR9A 1TUBB 5LHIA 1SLAA 2B8MA 5C8CA 2E75B 4IGPA 4L87A 2V7QG 3KKYA 1NH2B 3JD71 1COV2 2HWE3 1AR73 1MOFA 4R52A 1IX9A 1HP8A 4JV5B 5DEDA 3IM0A 4W4LA 4UYBA 4IEXA 2D3PA 4ABMA 2D40A 4DV0B 1QR8A 2BGCA 1KGYA 2E9QA 3ZMVA 2IUWA 5FUPA 5GW7A 2HVKC 1JOBA 1UW8A 4XC9A 4G2KA 5GTIZ 5BUVA 3VBFB 2Q1ZB 5BNOC 2CL2A 3RJRA 5BMVB 1KUQA 3VHNA 3SKVA 3QD6A 1DZRA 2VZRA 4XHXA 4WFGA 4FFBA 1QLNA 4NN0A 4FLWA 2EIKC 5C8CB 1KITA 4C7UA 4JI5O 4BIFA 1RMU3 2GC2A 3NNFA 1NE4A 1V6LA 3OW2U 2PY5A 4DV7B 2FMLA 2UYAA 4U7NA 3ICXA 4ZU7A 4U2AA 1AROP 4IEZA 1ND3A 2F43G 5K9YA 1X33A 3K9AA 2YIDA 2HWC3 4UCTA 5JXIA 4XXPA 4J42A 1XNAA 4DQAA 4GZRB 5CIRA 5FY0A 4CXYA 2IXHA 1AX1A 4OCTA 4P08A 1N32O 2A0LA 5FKBA 4J7ZA 4PD4F 3I2OA 2A1XA 5IYBO 2XPJA 3HN1A 3LFMA 3ZFGC 4DV1O 2H3OA 2Z2SB 4GH4C 4GCZA 5GLZA 2VM9A 2WLNA 3O1MA 1LHVA 2ADDA 3T2QA 2DUPA 2RVAA 3ZVXA 2KD7A 5GTHZ 1H2LA 3IPVA 4W4ZA 3RPQA 2ARHA 4J11A 1BZKA 1FPN3 3CCEV 3DN7A 2EILB 2Q8OA 5L19A 1YJWV 3GDBA 1GZTA 1YWKA 3AG2C 1RUG1 2VZ3A 3RMYA 1PVC3 1NCQA 3VBUA 4QKNA 2BNNA 4LF6B 3FFQA 4IGOA 4ZS2A 4MGQA 4BWAA 2W1WA 1WLCA 4JI0B 4J80A 1XHZA 2QM4A 2YG0A 1H1MA 4N21A 4AZZA 2WYFA 4E4ZA 1QDCA 5A2QN 1YC61 1X9PA 1LOBA 5JVDA 3OEAA 3P3PA 2ZGLA 4CU6A 2ZKOA 3IPVB 3U4XA 1NT0A 5ACA1 1CD3G 2DJVA 4LE3A 3WT3A 4YG0A 2JEXA 4O4HA 4PQQA 2WA4A 2Z5WA 3EVKA 1NCQB 1NA1A 4IEPA 1W9SA 2VECA 3W7XA 3S5QA 2NYYA 5I0DA 1X82A 2B9VA 5CADA 3WP3A 2A3YA 4GKXA 1JW6A 2ZKNA 2VOTA 5IWAO 4KWJA 4GZ9A 1RFYA 1GZCA 1WMFA 5JVDB 3M8LA 3CCLV 4F3JA 5GKAC 1RUH1 4BJ0A 1F2NA 4QX2A 4J25A 1DG6A 1DQ1A 4CPBA 3K46A 3NJZA 4LKEA 3FBMA 2ZMLA 4DR2B 2CWMA 4O4HB 1QNMA 3C7EA 3I3DA 1JMUB 2GP5A 1NA1B 1ZZ8A 3KGZA 4QQLA 1AJQA 1NBMG 5SV8A 4ICGA 1UY2A 5F2SA 3TNPB 4CU8A 3WP4A 3K2OA 4WM7C 1AR82 3JALB 2HEWF 1CAXA 5C33A 1ORQC 1YJKA 5I0TA 4XILA 5GALA 4COYA 3V65A 2G19A 1VBE1 1MACA 3A2FA 2ID4A 3NV4A 3SCGA 2XHBA 4JI3O 3NNGA 2W6IG 3UO3A 1FAYA 1VAMA 2HWE1 4DXWA 1AR71 3ABUA 4RD7A 2OQ7A 5FY8A 2LGQA 5FPOA 4DV4O 5BPXA 5FQ0A 2JDPA 3FYIB 3KB5A 5FLXN 2YEVA 3ZN0A 2J1AA 2UURA 2D44A 1UZVA 3EHKA 2AC1A 3G6JB 3SYAA 1CAXB 1WCUA 4RL7A 1FV2A 1IBKB 3I2FA 2XQXA 4NPLA 4Q0PA 1AVBA 3LB9A 2JDYA 1QNYA 4MS2A 1W99A 4PJYA 1PMJX 4HK8A 1BHAA 2ZX1A 1RMU1 3WNMA 1TVGA 2DN9A 4LORA 4XJAA 3IN9A 5A6XA 3SJCC 1CONA 4DR6B 5FQ0B 1KQRA 2E33A 2A71A 3CEWA 2VTXJ 1GM8A 2YEVB 4X88A 2CTQA 3ZDSA 2VQAA 3NAPA 3B5LB 1MSDA 3CJIB 3N2KA 2RS13 4GUNA 2JECA 4RHV3 2IU3A 5FZ6A 1GV9A 3K0GA 5AG2A 3HNMA 4R8CA 2PLV3 3WINE 4I3PA 5A3WA 1FI2A 3U4SA 2VOVA 1JZ4A 4OUEA 1OHHG 1OFSA 1L7RA 3IZOA 2E74B 1OVPA 3K4AA 4LT5A 3P3NA 1BHBA 1DU3D 1VPHA 4IXLA 5LRRA 3C7HA 5C3RA 4OHVA 2RM21 3GF6A 2JG8C 2BVVA 1QOOA 1W6QA 3NAPB 5KUKA 2GZWA 4K35A 4JRAA 5APAA 3AG1B 3N2KB 1MSWD 1FPN1 1K73W 1O9GA 1GYKA 5CG8A 5KMGA 4QGNA 1OUXA 1DGSA 2Q4SA 4NE9A 1M4UA 2HWD2 3D3AA 2X0LA 2GC3A 4JASA 3IMMA 3POIA 2HKOA 1PVC1 2P3JA 4MT8A 1VQ9V 3MEPA 4NAOA 1F8VA 1U5YA 1XNDA 2YIBD 3JSLA 1HXS2 1I5YA 4OPHA 2B9UA 1O59A 3LGRA 4CS3A 5CBFA 4YZ3A 4JF3A 2RDSA 1B35C 1OC1A 4PJ0Z 4BU2A 1W6QB 3HNYM 4YGCA 1EPWA 3GWKC 4QDRA 5T55A 3I3EA 4LH6A 2WUHA 2O1QA 5KMGB 3MUZ1 4QQPA 3C8XA 4XVHA 2OT5A 2BNOA 3QO5A 5BNNA 2W91A 1G4YB 3CZUA 2XOKG 2RMU2 4RFRB 1S1AA 3VBBA 1OCOB 4JI8O 4Z1MG 3J7AU 2CNAA 5GZFA 1S2BA 2H0VA 3T4VA 4JRLA 5FP4A 5A7QA 3GHMA 4QXCA 1QJX3 4NTWA 1MQTC 2XJQA 1GICA 3H50A 2ZHLA 5LATA 5C4WC 2JJ6A 2V5DA 3ZPOA 5C9AA 1G6UA 3ZHSA 3NSTA 5BNNB 2YC2A 2WNUA 5FZBA 2E6VA 3PUAA 1QOSA 4DOUA 4CTEA 4DEQA 4WF9V 4FPJA 4TOIA 1YJ9V 4P2ZA 2W92A 2Y0OA 1WLWA 1HN1A 2UXCO 1W2UA 3NKGA 1G9CA 2XWBB 2BOBC 1PD3A 3W5NA 3DPRC 1JPXA 3KLSA 3B02A 3SC7X 1SLTA 1DIWA 2FBEA 5EC2C 1GTOA 3O1UA 4YHHB 5C9AB 3ALQA 5FO8B 2V09A 4X64B 2WNUB 4EWEA 5BNOA 5IT9N 4YIOA 2XUMA 4IEVA 2IC1A 4OZXA 2R9RB 4HT1T 2IWGB 3K3OA 5A6YA 3OGRA 1L8DA 3DEMA 2W46A 3WDXA 3JXSA 3QVNA 3R65A 1X7NA 2DYCA 4MUVA 1UKGA 1CX1A 1OLQA 1V9U2 2GMPA 4GIQA 3UGGA 4B4RA 1XMOO 4LA2A 3MLJA 4FFIA 1ULPA 2RR13 3NMBA 4MLOA 3HOBA 1O9HA 2V4AA 2WS92 3EB7A 5BNOB 3I5DA 2K1EA 1US3A 2QWPB 3H8OA 2ZMNA 2HJDA 2AACA 1FT9A 1WD3A 1YJLA 3LDBA 5B2GB 2WO1A 2GSYA 1O3QA 2XMLA 5TISZ 3DYOA 2EIKB 4G3YC 4GKKB 3MYXA 4EB6A 3ZFGA 5JQGA 3BALA 2YXHA 4GH4A 3L70H 2RS11 2OUJA 2B1IA 2VMIA 1VF6C 4P9PA 4IEQA 5HCFA 1OSGA 2PLV1 4AQ2A 4EFBA 4K6BA 1HKDA 3ZRWA 3IT8A 1TG7A 4E8CA 4A6SA 3WHTA 2Y6HA 4LLFA 1FD9A 3E8GA 2H0BA 1X9TA 2LP7A 1ZBA2 4E2GA 1Y4MA 1Q56A 4EB6B 3B00A 3WZ1A 5FZIA 5FZFA 5LGTA 1PX4A 3H01A 3WDUA 3ASOC 2Q30A 4JZGA 5H9PA 5KBFA 3ZRWB 2XAFA 2NPIA 1VEWA 4DUWA 1D0GA 1SMVA 2ZGNA 4DEVA 3APQA 3SXWA 3AG2B 4YRDA 3ZSLA 1A32A 2ZIMA 2PHXA 2QQLA 3HKEA 3OUHA 1C1FA 1WN7A 4HPKB 5IVVA 5LY1A 3CMAV 3AZZA 3ZRXA 1XJAA 4LJHA 3HIFA 1RUJ2 5JXHA 1GQHA 4DR4B 3VZJA 5EIBC 2ZS6B 4JI7O 2DTYA 2TBVA 5IYDO 1XPWA 1LU2A 3WOGA 1AYM3 4A2UA 2ZABA 2RCVA 4OX9O 2J1SA 1AR62 1QHTA 1I6XA 2Q9LA 1MS9A 1RUD2 4KU7A 4Y4RA 2CGOA 1QJX1 1FX5A 1V9PA 5BXZA 3VD5A 3A4UA 3AP6A 1US2A 2VUAA 5IHRA 3ZIWA 4JDNA 2VCCA 1FV3A 4WM7A 5CKNA 3CPWU 2BCCH 1Z0HA 5JAXA 1O8PA 2WNVC 3O0VA 2W3JA 3CWBH 4GB32 3IKWA 4HOOA 1AX2A 5D5QA 4A7ZA 4HLTA 1UPSA 1OLMA 2BPA2 3A0BZ 2QTWB 3ZKUA 1G9BA 2BOJA 5J1XA 2F66C 3AP4A 4WM7B 2DWEC 4FPFA 2BYVE 3U14A 2N74A 4UFLA 4XIKA 1SLLA 2KXLA 1FFXA 4LFCO 5I0SA 3USSA 4EV0A 3E2EA 2Y6JA 2AEZA 4NTYA 1CJDA 1YI7A 3LNMB 1GKBA 4YNIA 4TTGA 2QA4V 2GC0A 4H14A 3KVAA 4FPPA 4QPJA 4BDVB 1WNSA 3OYWA 3TNQA 4LF4B 1W6OA 4Y1UA 3VKFC 3EQEA 1HW5A 1PM9A 2Q7EA 4IEOA 4A7YA 5L3EA 2BNMA 1FFTB 3PTYA 1Q6UA 4LULA 2RR11 2IXKA 1E57A 2XJPA 1I08A 3HVDA 1CXZB 2WQZC 4JC1A 1RUF3 1X36A 1FFXB 5LBFA 3DGTA 4X6RB 1J83A 2E5LB 1XNTA 1V54C 3TYJA 5J96B 2Y26A 1ZRRA 1NH2D 5C8WA 5E8AA 2QSAA 1S4CA 5FYBA 1SG3A 3CJXA 1IKPA 3P32A 3OYWB 1JVMA 4JYBA 1ZZBA 4UV9A 2R063 2XG3A 5JXJA 5D8AC 5FP7A 5HI0A 2NZ9A 2VZPA 2JG8A 4AK3A 2CTRA 4YW5A 5IY5C 2RDNA 2EXJA 1Z7S3 4TV9A 1Y9GA 3PIGA 5FPZA 2PGGA 3H8XA 1QH7A 4Y20A 4J7JA 5FZOA 2Q8DA 4BHPA 1R1ZA 4FP2A 2V4DA 2ZNIA 4P02B 3KWVA 3DKWA 2XJRA 4ET7A 3RYKA 2CAUA 1YSCA 2UXDO 1NTZH 3ORJA 1G86A 5F3GA 2JG8B 2A06H 1B35A 1W8FA 3HWJA 4IGGA 3WLUA 4XF9A 4TV9B 1WD4A 5CU1A 3NL1A 4AFCA 1JA8A 1N1TA 4FLUA 4XJ8A 3O0WA 4X64O 3B4SA 1X50A 3ETEA 4Y20B 2DVDA 5FZOB 4O4JB 4PIXA 3LDDA 4OHYA 4X8PA 2IVIB 4IERA 5I91A 4FVVA 4OULA 4XUPA 3K58A 5IUQA 3S57A 3OGSA 2CH7A 3B7MA 1MQTA 2IXJA 3OOXA 2AR6A 1SQXH 1S0CA 2VQEO 1AYM1 3T0BA 2WZ8A 5BZBA 1L1FA 5C4WA 2UY9A 1VBB2 3WVJA 2P6HA 5LHHA 1RIRA 2VR4A 1F31A 4RR3C 5C70A 4IL6Z 5HCHA 4NVPA 1S0BA 1CAWB 4AI1A 2UXBB 1GWMA 3D5OA 3J7NA 1IBLO 1JZ8A 1MMMA 4JTCB 3N9OA 3T1HO 2QNKA 4MVMA 2CH7B 1ZRCA 2VMCA 3ZYGA 3DPRA 2Z3YA 1MQTB 4NO4A 4QPGC 4YFZA 3AYCA 4LF7B 4AGVA 2WZR3 1VRBA 3ZSEA 2JE9A 2VC9A 3CCUV 5C4WB 1FNZA 3S3WA 4FCAA 3IAYA 2BDRA 4Q27A 2D6OX 5B5EZ 1SBDA 1W6PA 4TQFA 1IG0A 3V0AA 3NV1A 2GTAA 5B66Z 4AILC 3TN92 2VQ0A 2XHNA 5IJ0A 1YIJV 3JD72 3PMSA 1JTZX 3OUIA 4P30A 4Z92B 3FLTA 4YGDA 1Q8PA 1AL23 3DPRB 1V6JA 3WNPA 3LOIA 2VMEA 1N8RW 1RUE1 4CUBA 5CA1A 5LASA 4NMIA 3GM8A 5FMOS 4EZ4A 2RMKB 4UB6Z 3DL3A 4C91A 1W0KG 3CB2A 3CRAA 2JB4A 1WWYA 1W6PB 3LDKA 3SH5A 3ZYHA 3ZXDA 4R9AA 3V0AB 1UNBA 3PJQA 3SLIA 2LQTA 3FN9A 4XBLA 1OD5A 5FWJA 5IJ0B 1NQDA 1QEXA 1XOYA 4TLFA 3FHIB 2M6YA 5M0TA 1M56C 4KGGA 1EV13 1RUF1 5IVEA 4I2OA 5F6KA 1H1AA 2AENA 1AR4A 1VF6A 2VW1A 2B39A 5FV3A 4CPBD 2EZOA 5CA1B 3KV5A 4PLMA 1NKDA 4QQ2A 4BMEA 1VMFA 5K0UC 5FZEA 4CCCA 1YQCA 5A3LA 2FDKA 3P30A 4GX0A 3ZN4A 4GKYA 2W1QA 4YYOA 2CU5A 1YQ8A 2R061 4D3WA 1JZ2A 5EJZB 3G6EV 3ME2A 5CA0A 2P90A 1WGPA 1YXBA 4RGGA 3T4ZA 4FM1A 1Z7S1 1C4RA 1TZOA 4QHZA 2WFF3 3MPBA 5CB7A 4S2DA 2X05A 5CBGA 1IGOA 4LKDA 3WF0A 3VBRC 3POFA 4UI9L 3W7UA 1UU5A 1NY71 3CZJA 4YARA 1HWYA 1O91A 4JZRA 4N7IA 5FCCA 5HFMA 1ZX5A 4WFEA 4CZZA 1JYWA 2ZR2A 5EPAA 2DDUA 4FLYA 4O7XA 4BCUA 4JI2B 3RYHA 1D5NA 1VE0A 3M8AA 1RUG2 1QF3A 4B3TB 2VUDA 4AHXA 4P9WA 4CCJA 4BQYA 4PDLA 4QX8A 2R073 5CZKA 3NWKA 4FQ4A 2YUEA 5CA0B 2ADEA 2ZNJA 4XCAA 1FJGO 4R50A 1RUC3 3ZX7A 1EUTA 5A1FA 1IHMA 2EAAA 3FX3A 5L9BA 3L2HA 2JIJA 3O1VA 1MEC3 4FFGA 2ZAHA 3BVOA 1JYIA 2FTKA 3ASOB 2A5ZA 1RJ8A 3ZIAG 5ACA2 4DW1A 4QQOA 3CNAA 3VN4A 5CYYA 5IK8A 4ZU5A 5F5CA 1O4TA 3RYHB 1N1YA 2XLAA 1O3TA 4O4IA 4UBGA 3R4DB 2FDHA 4UFIA 3DXUA 2IXIA 1VF5B 1H2GA 2XT9A 4XXAA 3GB7C 3ACHA 3N9QA 1XNQB 1XU1A 2BEOA 3PHMA 3OGCC 4OQ9A 2PAEA 3CLPA 1LOCA 1UZZA 4MGSA 2H6CA 3NJVA 2GTSA 3OUFA 2UUAB 4DR7O 3OTOO 4XQ4A 4H7MA 1IPJA 3ENRA 4PF1A 1CIWA 3ZFEC 2PHUA 4HXCA 2WNVA 2UYBA 2ZGKA 5AVAA 1W8OA 4BXSV 1J59A 1JMKC 5C5UA 2QE3A 4O4IB 3VHRA 4L11A 3RZJA 4QPWA 3CC7V 4UB8Z 4XJZA 3PLQA 1KECA 2ZE8A 3E1F1 5KHHA 2WZR1 3LSSA 2IXCA 4Q29A 1YNAA 1LHUA 4HKOA 3AMQA 1XNBA 5HXVA 1SZBA 3C7FA 2LW8A 4QNHB 4N7UA 1JQ0A 1NR1A 2WNVB 1VBE2 5C3PA 4MADA 1NUKA 1UYPA 4DV2O 3KHCA 3JD3A 5FL7G 1RJ7A 2PA7A 4OI1A 1CEZA 3N9MA 2HWE2 4LP8A 1AR72 1OF3A 2ZHNA 3E8FA 4H33A 4HVOA 4NXMB 4Q4X1 1AL21 1S3JA 2ZX2A 3J80N 5CBLA 4NHLA 4YLZA 2ZACA 2PAKA 1V55C 1WPBA 3T0DA 4W8JA 5KHIA 4GKJO 4Q4W3 2HH9A 1SDWA 4DV3O 3O5SA 2ZDIC 1SFPA 1AXYA 4LTAA 3G7DA 2ZGQA 4TZDA 1Q8IA 1M57C 1WJZA 4IL7A 2VZVA 3W5MA 2FCUA 3GBWA 5GLWA 3E89A 2EA7A 4LF9B 2WBKA 1RMU2 4BXFA 3BIEA 3ILNA 4Y26A 1GM9A 4BZ4A 2VZTA 4ZKIA 2MK3A 4LK7A 1FYJA 4JI4B 3NVCA 5J36A 5DECA 4Y1ZA 5D8AA 1UOBA 3PUIA 4YG6A 1VQ6V 1H30A 2PYTA 1HQWA 1ZA7A 4EN7B 2VVFA 3VLBB 3KM5A 2IZWA 1YF2A 4WV8A 2WZPP 5FK7A 2F93B 1V54B 1BZWA 4YGBA 4C8DA 1J95A 1ASJ1 1YI2V 3TEYA 5DDJ3 2C4XA 5CA3A 4U3JA 2QJ1A 2UXBO 3AFGA 1KEXA 1W28A 2O0OA 2CUGA 3WG1A 1MA1A 1H8HG 3KCXA 1LGCA 2JKBA 5D8AB 1EAH3 1QQCA 2RM22 1KC8W 1GMMA 3ZYBA 2OYQA 2NLRA 2J1TA 2VZSA 2QZ3A 1Q8OA 1OJHA 4LBKA 5IY5B 1POV3 3C2UA 3KV9A 4KU8A 4Q0UA 4J9ZB 4RGAA 1XNRB 3GJAA 3I2IA 1UX7A 1WCQA 3MLLA 5A80A 1YO8A 5KAFZ 3TAYA 2DVGA 4CDWC 1K92A 5EYXA 1IKQA 4OUMA 2UUCB 3ZR5A 3HB3B 2R071 1PVC2 2VL4A 3OCPA 2BQPA 3B8NA 2Z5UA 1RUC1 4NTXA 4IV3C 1QVFU 4LLOA 3JZVA 4BLIA 3WUDA 4YZ2A 3JARA 3H7YA 4WVWA 1Q86W 2A73B 3T1CA 5FJHA 3SHRA 2CTVA 4MXWA 4S2FA 2RS51 3I55V 4PA6A 1Y7BA 3PUHA 1OKQA 1AP5A 3SISA 3FB5C 3H8UA 3SYCA 4K0KO 4RR3A 5L3BA 4DO0A 4EN8B 3QBQA 1VBA3 4YPJA 3N2GA 2AHZA 4E2SA 2Y38A 5FZ8A 3MPPG 4W50A 3JARB 2VWKA 4AL9A 2VMFA 1HIXA 3AK2A 4XFBA 4SBVA 3WFVA 1UY4A 4QKBA 4MXWB 3MD0A 3ILFA 2D6MA 4XZUG 1C28A 4QPGA 2YU1A 1EYBA 3BI3A 1P7GA 3O1SA 3NV2A 1RPRA 3JCUZ 1IXMA 2XHKA 3TEWA 4NIGA 2PI5A 1YQ6A 4CE8A 4XFFA 4X65B 5EIYB 1YIFA 4RR3B 1T5EA 3ZMUA 1RB8G 1F9KA 3WF2A 3WP5A 1ALYA 3N2GB 1ZWIC 1FKAO 3AVSA 4UBHA 4HAMA 2ZPXA 4CP9A 4CEYC 2V72A 4LUKA 4RGKA 2C9AA 3W59A 3MHSC 1SLBA 4URAA 3OT7A 3MHHC 4QGPA 3CCRV 3T2TA 4QPGB 3ML0A 1UXZA 1PV0A 3WUCA 5FIXA 1QJEA 4JTAB 1M93A 2JICA 4NHKA 3FB8C 1U5IA 2VAUA 2WKKA 5LA2A 5JSRA 1DP0A 1QDOA 4P5HA 2VQFB 5A3PA 2BE3A 4JVAA 2HEPA 4GWMA 2GNBA 1SESA 1YZBA 2UWCA 1OV9A 4LIUA 2YXYA 4Q4W1 3UESA 1PNFA 2EINC 1NVPD 1MZFA 5DN6G 4OHZA 3ZHUA 3D3QA 1DYOA 4NIHA 4XHBA 2DCKA 1JN2P 3RWNA 3WNOA 1G9FA 2X10A 3J7LA 2WINB 1W59A 4M3CA 2P17A 1H8VA 5K0UA 4XFGA 5CFDC 3CCJV 1YFWA 2O14A 1KP2A 1SKVA 4LHKA 4TSVA 1AILA 5HFLA 3HPNA 3FAVA 2VVDA 2RJKA 3A0RA 4DW0A 2VPVA 4CH6A 3WNNA 2FZ2A 1M56B 2RE9A 5FWEA 4K9SA 4DPNA 1E1QG 2RS12 4CA9A 4LNUA 4I4TA 3M3OA 4FLXA 4D0QA 2FKXA 3L75H 3VBRA 1Y67A 4JDOA 1CPMA 4RSUA 5FXWA 1DGLA 2QWQB 2PLV2 2GNDA 4M3CB 5DDJ1 5ERLA 1XSRA 3WF3A 4KL1A 2RQ6A 2X7RB 1GOHA 2EX3A 1J3PA 3O14A 1QIQA 4W4KA 2OIIA 5JR2A 3FAVB 2VO5A 4AHZA 1EAH1 1W9TA 4QB6A 1AR5A 1LHNA 1E5HA 5G04L 4YVWC 1XE0A 4QIWF 3J7MA 1POV1 3EJKA 4XQDA 1TMF1 2WO3A 1ZLZA 1L7LA 4LNUB 5DZEA 2IW5A 3KT4A 1LENA 3RJ2X 1JODA 3VBRB 1ZTEA 2ES3A 2EIMC 4DXSA 1W6NA 5J3UA 5DN2A 2VH9A 1FAFA 1DLLA 2OPKA 3J26N 2CYFA 3PDQA 4LHSA 1NQTA 3BTYA 3GZTB 4QQHA 3SPJA 2WO2A 4PBOA 4E2LA 3ELNA 2VE1A 4X62B 1EPZA 1TNRA 1HR0O 2ZJCA 2VTXA 2CAVA 2EVXA 5FFOC 1N34O 3KCCA 2Q7GA 3BY6A 1I94O 1VF7A 1RPOA 3HT1A 4TYSA 4ZOLA 3E5UA 1PNKA 4L9BA 4LO6B 5HXMA 4AEMA 1S77D 1W6NB 2DBIA 4PDWC 3ZFEA 1Q8VA 4L2NA 1JZ7A 1S2EA 1VBA1 2E63A 1WB7A 1LUWA 1K45A 2H6BA 3CCSV 3RN4A 1RUNA 3LZZA 1QQP3 1HX6A 1YEWA 4LF8O 3U75A 3BCCH 3JU9A 1QJX2 2HEYF 2Q67A 4QHBA 3KS7A 2D7FA 3H3LA 1HRI3 1FS0G 4ZOLB 3OY8A 4LXLA 5E79Z 3WV6A 3URFA 2Y6LA 5E1AC 5D2AA 5ITZA 4GYCB 3ZFEB 3UT5A 5LA9A 3WNXA 4PIYA 2HYXA 4S2GA 4JI6O 2C24A 1S2KA 1H38A 4AEJA 2WLIA 1NX9A 2O8QA 1SDDB 3Q8AA 4BQWA 4X1YB 3D0JA 4GA9A 2KSDA 1Q90D 1RINA 2R7EB 4N8MA 2E76B 2DE0X 2ARAA 4K20A 3LWCA 1F15A 4YGEA 2A6VA 3OY8B 4HN0A 1R081 4I9QA 2KA3A 1AYN3 3CEIA 2ZDIA 2QWNB 3ZRVA 3M2MA 5JOZA 5ITZB 1PK6C 5F5QA 4GT1A 1VQ4V 2VVEA 3UT5B 4LWSA 3LDEA 5B1AC 3BKZA 1YHQV 3OMAB 5H9QA 3IFXA 1E1RG 3OG2A 1LRHA 4IEYA 2WLIB 1H1IA 4ORFA 4YY3B 3WB1A 1G6NA 4AQYO 3M3IA 2AZ0A 2W95A 2OCCC 3DXRA 1W6MA 1HDKA 4RFT0 2LGWA 1L3JA 1BS3A 2QKCA 4DUXA 1V55B 2RR12 2VXRA 3EO6A 5F37A 4A6OA 2P6JA 2NMNA 5IWFA 1WAZA 1AJOA 1M57B 1UXXX 4HYOA 5FPUA 5FPXA 4LWSB 4DUVA 5A6QA 4AQSA 4CYDA 5FYCA 4N53C 3RGBA 5JSOA 3TRSB 4B3SO 1ENRA 3VZMA 3I2DA 2VCMA 3CXCU 1VP7A 2A9HA 3J8F3 5IATA 3DXRB 1W6MB 2WWUA 4KWUA 1H8EG 1IQAA 4UFMA 1L0NH 4UCRA 4QX7A 3LD8A 1HQLA 2WN2A 4FJCC 1R3LC 3WXPA 5FO7B 3HR0A 2D3OW 1QJU3 1POQA 2XTAA 2X6BA 5EHDA 1V6MA 4DV5B 3FZ3A 3USUA 1LHWA 3D3IA 3FYEB 1LOGA 4CDWA 2B7YA 1HNZB 2FQPA 5DUXA 2D93A 4BPZA 2WSSG 1A8MA 3E6DA 3N7JA 1GRJA 3D0SA 3IC7A 4IV3A 2WAOA 4QM8A 1N0NA 3B3QE 2Y6GA 5IE9A 3WW2A 1QKQA 2NN4A 2QQNA 3U1XA 4FFFA 4C0BA 4BQ2A 3JD0A 4YJ3A 5JSPA 1KJRA 1QY4A 1SQBH 3LQCA 5KXCA 2C2AA 3USUB 5CFCC 1NU1H 4I09A 2ZE5A 5FPRA 4XJ9A 1O5LA 3LSDA 4CCOA 2ZM6O 1N1SA 3O7OA 4I02A 2K46A 4LKFA 1J5EB 2BWAA 1I3HA 3UYJA 1GR3A 4IV3B 5IVFA 4DR3O 1IZ3A 4UVBA 2XLGA 4B1MA 1H4GA 2ZX0A 2D6KA 3U07A 5LRSA 4QDQA 2B1GA 3IDCB 1GNZA 4Q6GA 3HKBA 4AAPA 2QQJA 4LO4B 1IOAA 4FLVA 3WB0A 2HYKA 4YJ3B 3KMHA 1HB1A 3MZHA 1AYM2 5LA6A 3UJOA 1ULGA 4CCKA 4ASUG 4R6ZA 1URFA 2ZBJA 4XDOA 5FNVA 3GYDA 5EJ3A 5FUIA 1QQP1 5EP9A 3IBMA 2JG9C 2FD8A 1W2TA 2P2KA 5FXXA 4CH5A 2WWSA 4AAXA 3K51A 4Y4YA 1OHFA 1ODMA 1HRI1 5FYTA 4ZXEA 4FFHA 1X8EA 3Q8EA 5LMNB 1XNCA 2VOKA 4CEYA 3ABZA 4GXLA 1NKGA 3VDDC 4UFKA 4AI9A 5EV7A 3HKBB 4CDXC 1H9WA 2I74A 3FWEA 5LCWL 3AKRA 1LEMA 2VBBA 4KHPO 1COV3 2VUCA 2DYRC 5LA6B 2R043 5DAVA 4E4EA 4LNVA 3NNLA 4UF0B 1R3IC 2BSKA 2ORZA 2WT1A 1CZTA 5FNVB 4C0HA 1ZZ9A 3APBA 1N36O 4AFAA 1HRV3 2W1UA 1CPNA 4IV1C 3TB0A 2ZA9A 4JAUA 3B8MA 4MVOA 2MNGA 4COWA 2E31A 2XJVA 2CAZC 2W52A 3TEXA 1K3IA 1AX0A 1K5JA 4CEYB 3K57A 1MZEA 3T2OA 1AYN1 3QH6A 5LK7B 2M7WA 5LBBA 4H2AA 5LK5A 2JDIG 3Q4HA 1RUE2 1W8NA 4DV6O 3S0MA 2GP3A 2WAMA 2R30A 4D6SA 1FXHA 4COVA 4E8DA 2PHFA 5CFDA 2BSKB 5B1OA 2P22C 2P4EA 4MW8A 3CX5F 4YZ1A 3G4SV 3H1LH 2FDGA 5H9CA 1IS6A 4V1PA 4DK1A 2X6AA 5FTTC 1K7DA 1GN2A 2AYHA 5LWBA 4LO8A 4NHMA 3ABLC 2EINB 1RUF2 1W8HA 1LESA 4UCVA 2F4PA 3Q4HB 2ZGOA 2YXLA 4BQ1A 3BVCA 1ODNA 3ITQA 1DQ0A 5CFDB 1NTMH 1JYVA 4FTEA 5FPAA 1BL8A 3SPIA 1ZREA 1IVSA 3PVOA 3KD4A 4E9KA 3J8F1 2YBPA 2R062 3VKLA 3ECQA 5GZCA 3RVYA 4TLGA 1NQJA 1V6OA 4DRXA 4YVWA 3LEGA 5T50A 3C3SA 4WCEV 2RJLA 4FI9A 5FYMA 1URXA 1TME3 1AI6A 1Z7S2 3KQRA 1QLEC 4ONUA 5L7OC 4FFKA 2EIJC 4TT3G 5JCTA 4C90A 2GN7A 4BR6A 1NY72 5BNQA 5DXDA 4QMAA 5JZGC 3I97A 1VBC1 5FZLA 1APNA 3OSDA 1M4WA 1X59A 2HVJC 3KV4A 2WJSA 1GNHA 1OCZC 4ZIBA 1J58A 2ZINA 1QJZA 4K8RB 4TQDA 4DRXB 4YVWB 5C7GA 1YITV 3AC0A 3LSUA 1BBT1 2FDJA 5B1BC 4DFSA 1O3RA 1XU2A 4L92A 2XKPA 4D69A 5DAXA 5H9SA 2UU9O 3T2PA 4H0LB 2DV9A 1XYPA 4I50A 5FK8A 3GNEA 5KA6A 2EF6A 4PDWA 4DINB 3E86A 1PGW1 2ZGUA 3IDBB 2BWCA 2Y60A 5CMUA 4JYAO 2XAGA 1ZL8A 1BSMA 1VB2A 1W2AX 4QXKA 3M4FA 1UU4A 4DY3A 4GLXA 2GALA 4O2BA 1G8WA 3MW4A 3T09A 1ND2C 2ZXWC 1BJQA 1BYHA 2QQIA 1Q3EA 1VJ2A 1KP3A 1KB9F 4BQ3A 3GZAA 1RUI3 4HBNA 3TETA 3BFRA 4MX3A 3LNNA 4I50B 2GNTA 3N7MA 4ZKTB 5GZDA 4K3AA 4PDWB 3B40A 1YLLA 3CQOA 3I2HA 3PL0A 4CH4A 1P84F 3UKMA 2R16A 5FXZA 3SR2C 3MICA 2UUBO 5EWSA 5L73A 4O2BB 1VIBA 1YI9A 2DF7A 1VQ7V 2Q1MA 3D36C 1HN0A 5FYSA 3H1JH 3BB6A 2WZR2 5CB4A 1AUYA 2R041 4ISRA 4NXNB 4K1YA 1BKZA 3A22A 2OWOA 3DTUB 4O4LB 1HNXO 4UW6A 1KMIZ 4BLJA 3H8RA 1HRV1 1PK6A 2WLKA 3FLRA 1E79G 2VZUA 5EC1C 4BIOA 3L72H 4B4PA 2CDYA 2ZGSA 2I2SA 4UFJA 4OVEA 5FZHA 4FOWA 5BR8O 4Q4X2 4LBQD 1AL22 1VP6A 4DR5B 3EBRA 3ABMC 5CB4B 1IBMO 2EIGA 4PLOA 3KG2A 3F2ZA 1WKYA 3A0KA 1PK6B 3I3QA 4YVSC 2W0XA 2VUJA 2Y8KA 2J1EA 5B1AB 3QG5A 2P4KA 3K06A 1YTFB 2XLFA 1SQPH 3RT3C 4N53A 3ABKC 4LFBB 5ANNA 4ZBMA 5K1PA 2ZHMA 4AHYA 1H8TC 2OCCB 5JLVA 3JASA 2VZ1A 3M1HA 2CGPA 1MVEA 3M3QA 2ZEWA 3BTAA 1VQ5V 1R6NA 4WFHA 2D2CB 2H94A 2XBO3 4M0NA 3T3YA 1DHKB 1R3JC 3ZN6A 2NR5A 4B29A 3BUCA 5JPNB 1W2OA 3U0ZA 1MS4A 2G9GA 1RL3A 4UVAA 4FZ1A 2Y0PA 2O57A 1R73A 1WPXA 4N43C 2HHHB 2E53A 5LW9A 1ASJ2 3IMNA 4CP1A 2ARBA 4N53B 2OS2A 3FB7C 1WLEA 1ONAA 3JQWA 2ZMKA 5IYZA 4I0AA 4K7JA 2XL9A 3MFCA 3ZPYA 3K03A 3LA7A 1I0HA 3OGVA 1TME1 1N33B 3JASB 1XOUA 3RVHA 5KC5A 5DG1A 3WDWA 1HV0A 4E4HA 3ZN6B 2FB5A 2YPJA 2JD4A 2OW4A 1THZA 4LE4A 2VTFA 5CFCA 3WDYA 1KRIA 1UMIA 2ZX3A 1DYPA 2XB6C 1B6QA 5DAWA 1W8ZA 2DBNA 2R072 1F5JA 2YBKA 5IYZB 2LW1A 3O12A 1CVNA 4J7KA 1RUC2 3J9SA 2N04A 3RZZA 5J37A 3RWRD 4FFBB 2DUOA 3ZKYA 1R1A1 3RI9A 1N4CA 2ZEYA 5A3UA 3VZOA 2PFWA 3OGGA 3SEEA 5LA0A 2RS52 4GJZA 2XVLA 3B77A 3SJAC 3BODA 4B3MB 2FL4A 1YVWA 4FVMA 1YDXA 1JJOA 1NLRA 4BQ5A 2WLLA 3WG3A 5CFCB 4X6QB 2AGAA 3QOPA 2QKDA 2Q69A 1ND3B 5EZWA 1CR7A 2WA3A 3EYPA 1WW5A 2JG9A 4J1XA 3AP7A 4QU2A 2JKXA 5F3EA 4PI0A 1AI7A 4IGQA 4QGMA 1T6BX 4E4SA 4Y24A 1WMDA 1LJ7A 3I56V 1RUI1 1BK0A 3VDDA 1XHXA 3JQXA 4CDXA 1YCIA 2J7MA 1JFFA 4LR3A 1HDJA 2KQXA 5FMDA 4RYDA 2WQ4A 2WLLB 2ZKLA 4KI5M 1HJGA 4DZGA 4X1IA 2Y34A 1W03A 3KSCA 5EYPA 1GK9A 3BU7A 2YU2A 2G9ZA 2JG9B 5LA1A 3MBWA 2SLIA 4IV1A 2FYUH 2AGSA 1YXWA 1OI6A 4AG4A 3U37A 3CRCA 4JI1O 1XNKA 2W68A 2VBPA 1EBOA 1FPOA 1KKCA 2QWOB 4BH9A 1ZUQA 5C8YA 3I2GA 2V4VA 3VDDB 4XUTA 4LIVA 4CDXB 1G9DA 2YZ4A 1NCRC 3CIHA 3K5NA 3VBUB 4Q5OA 3LPFA 1PKXA 1PZ8A 3VD4A 1JFFB 1HV1A 3POYA 1UJWB 2DYRB 1IPKA 1ULCA 4DUYB 4BM8A 4X1IB 5CISA 1AJNA 3K79A 3I4IA 5EYPB 1V9U3 2F6BA 3AP5A 1GANA 1GZ9A 3V56A 1OURA 4Y5TA 5HV4A 3MDPA 4IV1B 1QCEA 2UWBA 2FDFA 2WS93 1KS4A 1PM7A 3QLQA 4X66B 2Q1FA 1UO9A 2NNUA 4Q4W2 5C8YB 5DUWA 1WBLA 3ZSMA 1KD7A 2N7GA 1WA8A 3OGIB 4UCUA 4GULA 5FYYA 4JTNA 1ULFA 3K77A 4MTGA 2VW2A 3VBHC 2YGLA 2JDHA 4GAZA 3GVMA 4COUA 2ZQMA 3FB6C 2HLEA 4Z2AA 3DC6A 4N9HA 1WA4A 4DXTA 4OGQB 1G7YA 4H7LA 1FNYA 2XBO1 5I8TA 1VAVA 2RNBA 4GQ7A 3ABLB 1W06A 2C0ZA 1VQNV 3AXDA 5FUNA 2GC1A 1VRH3 4BW5A 3POBA 2YFZA 5L7OA 5L9VA 5JOWA 5LEKA 1WA8B 2DCYA 3ZXAC 3LPGA 3S6PA 3VQXA 1EFRG 5JZGA 1QXPA 4LBEC 4KWKA 4AE2A 5DDJ2 1U5ZA 2JS3A 5FYVA 3C3VA 4XDJA 3KCYA 3PUQA 5J2TA 3ASNC 2B9ZA 5GZEA 2O8OA 4Q1PA 1KDKA 4XDQA 1Q5OA 2Q0AA 3AK0A 4YW7A 3AJZA 1EAH2 2DCTA 4YW4A 4IEWA 1WZXA 1MS5A 4LF5B 4XEZA 4NPRA 2EJ7A 1TMF2 2W47A 3T1YB 2NM1A 1QLEB 1WUVA 5FLIA 3WCRA 2I45A 4F6EA 4D94A 5L7OB 4XURA 2EIJB 1K5SA 2UU8A 3DC5A 3LF7A 3L73H 5JZGB 3ETPA 1XE7A 2HWC1 4ARXA 5IAXA 3S5AA 1SZTA 3MF6A 1XI1A 5J2TB 3L2YA 1GN6A 2ATFA 3LA3A 3GCXA 3B2EE 3AG3C 1OCZB 4MTOA 5FLHA 2PHLA 3THPA 4WM8C 4XF0A 1BK1A 3JATA 1GFF2 5KR7A 1ND2A 2Y4UA 5LOVA 4HVQA 3ZYRA 1PP9H 4IUGA 1AR63 2C5DA 4OUSA 2OX0A 1Z2GA 3ZHQA 3NNJA 2PI4A 4R9DA 2DMXA 2ZEXA 4MGYE 4ATFA 2QVSB 3N7LA 4E4DX 2AXTZ 4INDA 3A7QA 2FHRA 3MLKA 1R3KC 3H7JA 1JCHA 2IJJA 1VBA2 4Y1YA 4XDKA 1QGLA 3IGAC 3UL2A 2XONA 2VNVA 2HJFC 4RQPC 5LMUB 3BA8A 3THCA 2CWSA 5FP9A 3T08A 3SMHA 1OA3A 1KU9A 3JATB 4I7ZB 1ND2B 2ZXWB 5LOVB 4EROA 4FZ0A 3N9PA 4L99A 4B3RB 5K4LA 3D36A 2VQTA 1GOGA 1T2XA 5CNAA 4FAHA 3M7MX 2F17A 4HKWA 1U12A 1VALA 2K0GA 3B9IA 3M70A 3JUUA 5EBMC 4JV5O 1XB9A 4W6WA 1JHNA 4RUFA 5CN0A 3SH4A 4PDRA 3VD3A 3GBGA 1XXNA 3FUQA 5LZ6A 4DV0O 4M00A 2HHHO 2WPDG 3SITA 3O9OA 3OBTA 1SQGA 1LU1A 4RQFA 4ISQA 3ZEDA 1P7BA 1KDMA 1TQ5A 4FK5C 1N33O 1LOEA 3HD8B 4F6RA 3VUOA 4BB3A 2A7WA 3LCPA 1R082 3IAPA 1OF4A 1OXCA 2YIBA 1J1LA 3Q8CA 2BOCC 3JAKA 4N23A 3AG4C 1NG0A 4DV7O 4DR1B 1UIJA 1GO3F 2LFSA 2PTMA 4YVSA 2R6QA 4XDPA 3SYPA 4HONA 2AUYA 2BP6A 1GUIA 1Q8QA 3QF7A 1H8TA 2A79B 2C6SA 1H6XA 1AJPA 5BYNA 4F6RB 4M4PA 5KLVH 1KQSU 5LXTA 3ABMB 1YFUA 5I8YA 4DUZB 4ZXKA 1X8MA 3OBRA 5K8SA 2YI9A 1WCSA 1HB3A 3JAKB 1TGOA 3S7EA 3PJYA 3JSNA 1S0DA 1LGNA 2A7AA 4N43A 1S55A 4WVMA 5A7NA 1I7FA 3ABKB 4K40A 1JUHA 1OH3A 2QQMA 3J7HA 2EILC 5GONA 2QQUA 1H8TB 3FFZA 3GHNA 1RITA 1VRH1 2H8PC 3ZHTA 1VLNA 4AF9A 4KQ7A 4H55A 4LUMA 3RWKX 5LXTB 4QDSA 2BUKA 2GDSA 2X09A 1J3RA 4NAMA 3IIAA 3H1MA 3I2KA 1DQ6A 4LF6O 3IJ4A 4MGZE 2NP0A 3GBFA 2JX9A 1E5SA 5DAQA 4JI0O 2ERFA 1OQEA 3K04A 4K8XA 3OAAG 3CRQA 4WBBA 3CU7A 2DCJA 4N43B 3M3CA 4WVMB 1FOD3 2Y64A 1A6CA 4CUCA 4MSVA 5DG2A 1TAEA 1AVMA 5GONB 2VNRA 3HQUA 3PJSK 3ZFFC 4X8NA 2BBAA 1W3VA 4BOWA 4CUGA 4X9QA 4K1ZA 3FMGA 3ES1A 2B5HA 5FMOL 4JI5B 2C26A 4MVQA 2QFEA 1LR5A 3OTFA 1M1KW 2QTSA 1DGWA 2DQ3A 4XFHA 4OPAA 4XBQA 2W0FC 4RHV1 1ENXA 3RYCA 4OLLA 4UW4A 3B69A 2VNOA 4UAPA 4SLIA 2IJKA 3ZOIA 1AI5A 3Q9OA 4NRPA 1L0LH 1AR61 1W0OA 3H3UA 4L8QA 1N32B 1TE1B 2JVDA 1RGSA 4DR2O 1BMV1 4Z8BA 5IVYA 4S2HA 2BZDA 4XUQA 2J1VA 2YSUB 2EXIA 5IAVA 3U11A 4JHTA 4CSWA 4MH0E 1ZSPA 5I93A 4DV1B 1WCKA 3ZFGB 2GN3A 4Q0QA 3N7KA 2XJTA 5JQGB 4GH4B 2IH1C 2VGDA 3V64A 3B94A 2OQ6A 3X29B 4IE0A 2XAJA 4NROA 3EMRA 3ZLIA 4Q8LA 3VOUA 4O65A 1SQ4A 5FRAA 1D7PM 3UJQA 5FMBA 2QQPA 3RYCB 1QQP2 1BEV3 5SV5A 1XQ8A 3DYMA 2JE7A 2XOMA 2W5FA 1CN1A 5E1RA 4ATEA 1EZVH 1DZQA 3GXUA 1IS3A 3HMYA 4Z1VA 2KR2A 1VQKV 5A3MA 2WDBA 1VQMV 4COZA 3AZVA 1NCRA 1MG1A 2CTPA 1OBNA 2FZ1A 4TWKA 1NOVA 1PZ9A 1SLIA 1C5HA 3ACGA 4Q0VA 4MVZA 3HQRA 2DWDC 3WW3A 1QJFA 5GLUA 2WWWA 4R9BA 2WT2A 3CDZB 4UWDA 3VD7A 1H2SB 1IBKO 1OCRC 3MIFA 3W58A 2JK5C 3UQ8A 3BPZA 3WQBA 4Q20A 4QWNA 4P00B 4MVSA 1AYN2 1O6UA 4JTDB 2GH2A 4GWJA 2BRTA 4Q0SA 3HKEB 1G9AA 3GZEA 1GAXA 4DR6O 3POWA 4C1WA 1QWRA 5IVCA 4AW7A 3RSJA 2QWRB 3TXSA 1H0BA 1BVP1 3CJIC 3VBHA 4ZHNA 3SJBC 3ETDA 2YB7A 4FPCA 3E6CC 2R32A 2PF4E 2K2SA 5F3CA 1E5IA 2DQ0A 2YFUA 2AW9A 5A7PA 3RS6A 3RDIA 4YZ5A 5EZYA 2N05A 1SQVH 1FXVA 2ZCEA 1UOFA 1N3OA 4ZHQA 2CDPA 1DGRA 1LCLA 3P6BA 2ITDC 4CC5A 4ITCA 4P9JA 4QD2A 5FZ3A 3VBHB 4W65A 4A45A 4P9GA 2BBVA 1O4YA 4AVTA 4QM9A 1H2NA 3J8F2 1M90W 3ZN5A 4JI3B 4PBPA 3AKQA 3WY6A 3ZJZA 2C1FA 4EN6B 5A3OA 4CH3A 2YV8A 3SH3A 4DV4B 2Y6KA 4MO3M 1PO13 3WDVA 4BK5A 4ZHQB 5HPOA 1I1EA 4J41A 3C3TA 2PYLA 3VBSC 1PO23 1UYXA 2YIAA 4X8AA 1FOD1 2WABA 4CCMA 1VBC2 2OKXA 3ASNB 3KV6A 1YRZA 3R05A 3HEIA 2GMMA 4NRQA 4QE7A 2LUWA 4WM8A 3HR9A 4F83A 2JDZA 4DO2A 3ZO0B 2X5IC 3WQ0A 5FXVA 4FAGA 3O1TA 3VDAA 4G28B 1BBT2 5FZDA 2A3QA 2RG4A 1W6OB 3JB4C 3IWZA 1F35A 4XYXA 1HNWB 3MF9A 3HJRA 1XYNA 3AX4A 2PZSA 3OBAA 1PGW2 3ABTA 1OFNA 1PHMA 4UFZA 2QE7G 1SBFA 1DQ2A 4RO2A 3A23A 3AG3B 4RQPA 4WM8B 4MVUA 4LHNA 2D5HA 2D43A 4J6GA 1WMXA 2PHDA 3MDSA 1J3QA 4AFBA 5F9TA 2OXBA 2A6YA 2CY6A 5IFTA 1QXJA 4G27B 1RYYA 2ZE7A 1BEV1 3T30A 5H2FZ 2HFEC 5DM6V 3BTZA 1ZX3A 1YJNV 5FO9B 3DGEA 1XBFA 3KF5A 4YHHO 1XDCA 3F5WC 5GZGA 4NWVA 4Z82A 4RQPB 5BMVA 2WR9A 1UZWA 1JOJA 1W0PA 4D6RA 2BGPA 1LB2A 2BTOA 2XXZA 3CYOA 4HFSA 2ZR3A 2R042 1Y76A 1A8DA 1H9PA 4K21A 4GMP3 4B4QA 5AFBA 5DPNA 4JQRA 1B35B 3SDLA 1JR9A 4OYUA 1HRV2 5JJEB 1BCXA 2G38A 5HV0A 2VCBA 5FY5A 4KMQA 3LIHA 3FJSA 2VY0A 1F4HA 5EK0A 3ETGA 4NIIA 1K12A 1NZ6A 1PMHX 2IH3C 4JI8B 1WB8A 3FKSG 1TEIA 4TUYA 3G71V 3IIIA 2QKAA 3H1IH 4MW3A 4FPLA 1Y76B 4GKKO 5LY2A 3AG4B 2IFWA 4BQXA 1A34A 1Q81W 1Q43A 1W0NA 1NTKH 5DQ0A 1YFYA 5B4NA 2QUOA 4V2VA 5A7OA 2EIBA 4DY5A 4YXWG 5FZ1A 5KUMA 2WLJA 3OR7C 1X4TA 5H6RA 2JB8A 4TUYB 1DYKA 3B93A 1VMJA 2Q5TA 3OFNG 1VB4A 1LEDA 2D6PA 2UXCB 2OIGA 3K5MA 1CX4A 3I3MA 1FMD3 4YWAA 4DRVA 4XBNA 5JDBA 3X2QC 2OIEA 3N4MA 2RM23 3DYPA 3VHOA 4JZ2A 3CCQV 4JKKA 4EN0A 3WHUA 2ZZQA 4XQWA 5EJ1B 4NIAA 3CS5A 4AFDA 1D4M3 2F4VB 2R72A 3I59A 3WU2Z 3ZFFA 1TME2 3HPLC 1KD1W 1ZZ7A 1PO11 4HMZA 2QBXA 4HKLA 5CKMA 5I8SA 1JYXA 3ZXEA 3L74H 2DURA 2TNFA 2YY1A 5A3TA 4UV8A 4FLTA 1PO21 3KQ4B 2DOSA 3HKCA 1VIWB 4NJ4A 1PGL1 4ASLA 1JOYA 5CEHA 4EEQA 3T4DA 2JD9A 5FPBA 1XMOB 1YIPA 1VQOV 4A4AA 4DR4O 4P9YA 4YM0A 5HBAA 5JMCA 2HWF3 3I59B 4QXHA 4CP2A 3K5OA 3MW2A 1S5LZ 1GOFA 3ZFFB 2R1DA 1PIV3 1ZZCA 2BU9A 1D5AA 4I5SA 5C5TA 3FUOA 2W94A 4IETA 1TUEB 2VNGA 1R1A2 2RS33 3NQHA 4AGGA 3UM7A 3E8HA 3HKCB 3VB9A 1I5PA 5A32A 2LS6A 2WZEA 3UT0A 3ES4A 4U3FH 3JALA 2P3KA 1O7FA 1GSLA 3ZYPA 1VARA 1C8M3 5A1LA 2DFCA 4L8JA 2PYJA 3H1HH 1Y74A 2E26A 5FREA 4JDMA 3VQWA 3VD9A 3OEBA 2V1DA 5EYYA 2Q73A 1RUI2 3K5LA 2BERA 1SPPA 1V70A 2KB1A 1PMIA 5A32B 3CMEV 2WSUA 3QO8A 5T5OA 2DWRA 3ZMZA 1W0JG 3MUY1 1LNSA 1UMHA 5JI7A 3S3XA 5JUVA 1B3QA 1RSOA 1Z5WA 3LEKA 2YC0A 4XTMA 1NE6A 3BHPA 1F51A 1WA6X 4HNAA 3OR6C 1Y74B 5JPMB 2HR3A 5FZGA 3OUSA 3INAA 1UPGA 1JU3A 4FPEA 4GWNA 5JR7B 4CXWA 1IXBA 5KHGA 1O3SA 1BGYH 2R0HA 5J7MA 4GMP1 4LF4O 1SPPB 4UCOA 4D7TA 1OUSA 1PNMA 3SPCA 5HCBA 1QJY3 3ZIXA 3SPHA 2QGNA 1MS3A 3CL1A 4Q4Y3 3BA9A 2ODMA 5AC93 3AFKA 3I3BA 1RSOB 2CTWA 3CJIA 1C8NA 4JI7B 1RXFA 1WLTA 1Y6XA 1RUH2 3H1KH 4HNAB 1UIKA 1F23A 5A3NA 5C6CA 4P9IA 2E5LO 3OEHG 1OCRB 4OX9B 4GX5A 3OM3B 4AXOA 2HBUA 5KC6A 1K97A 5LGNA 4XFAA 3PURA 4HL0A 2YUAA 2XJSA 5FZ4A 1HNWO 1RVF3 1UAIA 3CMGA 4LR4A 1DDLA 2LM3A 4BA6A 5KXBA 5E89A 5LB6A 1SZXA 4PA9A 2ET7A 4XUNA 4FSJA 4JAVA 4I55A 3RVZA 3K75B 1AZDA 5HCAA 4URTA 2P3YA 1F4AA 4DB5A 4EN9B 5KXDA 3CD6V 4EZHA 2XBO2 3A8TA 3RI8A 4IDZA 2YGMA 1IG3A 2YYOA 3ZM8A 1POV0 2OT7A 1FMD1 2Z0AA 3ZCCA 1UPIA 4LEJA 1XBLA 4OHXA 4XAEA 2VULA 2WNOA 3VHPA 3MIDA 3VBSA 3WW1A 5FPLA 3AMPA 1RP3B 1BQPA 4CU7A 2GMEA 1D4M1 4I9WA 4LFCB 4F7ZA 1M9NA 4JCKA 4CCDA 5KXEA 4I55B 3SNMA 4QKDA 1IDSA 3R6SA 1RC6A 1NI8A 2X5IA 3GZUC 2XL7A 4LO7A 3RZLA 1ST8A 2K9ZA 1EV11 4D8MA 1KFUL 4MGIE 1JYCA 3VBSB 1S72V 5F7UA 2WLPA 2AH2A 1DGWX 2IVJA 1H2MA 4LCUC 3W7SA 1GQGA 4FOQA 4CDUC 4KBBA 2HWC2 2HWF1 3RMXA 3T2MA 2DW4A 3CC4V 5F32A 1W04A 4UW5A 4YW1A 1PIV1 1XC6A 2W08A 4PDMA 4B7KA 2RS31 2X5IB 3ON7A 3RZMA 4YIPA 2PELA 2WFF1 4BIZA 3O0XA 5JOYA 1KKDA 5B1NA 1VQLV 2E51A 4H37A 2RJ2A 5H5NA 3D4KA 4LC1A 2BFUL 4AHWA 1GH6A 1BQ0A 3TXQA 1C8M1 4LF7O 4MVTA 3BOWA 1FPN2 2ZGTA 1MR5A 3O65A 1SHWB 5K1XA 2BTVC 4FXKB 1HJFA 3BGAA 3QH7A 1V6IA 3E6BA 1W90A 2YXSA 2Q6AA 1Q6IA 4U3JB 4FPGA 3MIBA 2XWJB 1E5RA 4YZ4A 1SERA 3PVNA 2UXDB 4HZFA 3W7TA 2BGOA 5A7SA 4D7YA 1MEC1 1GM7A 2WLMA 2DFBA 2D6LX 4ZZ5A 2VG9A 3RQ0A 1ZM1A 4ZY9A 3VDBA 4PT6A 4DS0A 3OPZA 1LR1A 2XNDG 2L9LA 1K33A 2B4KA 3AM2A 4HG6B 4NRMA 5F5IA 5A9GA 2F4VO 1LGBA 2ETNA 2RV9A 1R6KA 2Z4FA 2BVBA 1UY3A 3G80A 2I07B 3ZXGA 4LOTA 1C57A 1QJY1 1JYTA 4Q4Y1 5AC91 4UUJC 4B8EA 3TGUH 2ITCC 3RW0A 1CP9A 2P6CA 2VQEB 4QB2A 2VCAA 3AP9A 4HN1A 4X1KA 4D6TH 1JYNA 4JKLA 4JAAA 2QQVA 5LHGA 4EKWA 5E6HA 1PL0A 4EYUA 1AXZA 1KXGA 1CIYA 3LDRA 2YPDA 4AI3A 4IIJA 1IBLB 4HETA 1HQNA 1RVF1 2AZ5A 2DU0A 4UVCA 4YM2A 2W9XA 3T1HB 3A21A 5FOJB 3AL5A 3BPSA 5J9PC 2X29A 3L9JT 5BNPC 5GLVA 4HVRA 2E3CA 2OPWA 4WZCA 4NR1A 2NN8A 5EFUA 1GU3A 3N9LA 3VBOC 1VBD3 3R0RA 3SEPA 2QDRA 3W7WA 4X1KB 4GALA 3H42B 4AVAA 2G9FA 3OEEG 1F7YA 1EY2A 2NQYA 1AHSA 1DQ5A 3NJYA 3Q8FA 5KHKA 4JI2O 1RHI3 2JDNA 3T1LA 2XH6A 4IIJB 1VRH2 3EFFK 2P67A 3JCIA 3BYWA 3UGFA 4B3TO 3THOA 1HB2A 4AVCA 4CP9B 5JH7A 3P5BA 1G8MA 1VMHA 5H6QA 4HPKA 4QT6A 4JGYC 3HN3A 4I0XA 4YSFA 2CGNA 3X2QB 4JKMA 2X53S 5F3IA 1UFIA 4IE4A 4XF1A 3MI8A 4BWOA 3T0AA 3ZSJA 2WLHA 3VL9A 5I0UA 3OF1A 2W39A 3FHAA 2A3WA 3OUJA 5C3SA 1N3PA 1S5JA 3ROUA 3CF6E 5JIAA 3UCSC 4Y1VA 3ASIA 4LBOA 4QKFA 1R093 5FZ7A 1COWG 3GCWA 5L9RA 4HZ3A 2JE8A 4K8ZA 2Z79A 3UO2A 4RQEA 1AP6A 3CJHA 2JIGA 3JD1A 5JMOA 1AR93 5JH7B 4CDQC 2OTLV 5LBEA 1XL6A 4LBNA 1A78A 1K4CC 1XNQO 4I0XB 3A0HZ 1REEA 3C90A 1JZ6A 5IK4A 2X6CA 4F8AA 1UY1A 4RHV2 2VJXA 2R9AA 4XW3A 3ILRA 5JOXA 2UUAO 2OUHA 4CC6A 3BAAA 3KVBA 2WT0A 4KG0A 5K0UB 4CCEA 2D3RA 1UOGA 3AK1A 2DVFA 1VQ8V 1BMV2 2LW7A 4A5UB 5BXXA 1DF0A 1T6GC 3N9NA 3CJHB 1AB3A 2A3XA 4D7SA 3OD4A 1SQQH 3AYEA 3PVBB 1OLRA 4I4TB 3SYOA 4N9IA 1W3XA 2D98A 2HWB3 2ZZJA 5IK5A 1NVPB 1OCCC 5FYHA 1OPMA 5FY1A 3IAQA 4I0BA 4A44A 3WX5A 2BJSA 3ZMSA 4F4LA 3OPWA 5IYCO 2QDNA 1SA0A 3AG7A 2CK3G 1CGPA 2ADPA 2PMWB 3NV3A 4OHWA 2B5UA 1HW7A 2Q4PA 1FJGB 4NXMO 4FOVA 4YM1A 2MEV3 4YJ2A 3LE0A 5FY9A 3TEZA 2ZTNA 1UX6A 1SC5B 5LP6C 4DIQA 5JI9A 1YUDA 2EIEA 3RZKA 2DTWA 4LPLA 4NHXA 2WIIB 3WB2A 2R0FA 4I01A 1RUE3 1JX9A 4XMIA 3CSXA 2J42A 3NNMA 3H0OA 4Z07A 3E97A 3CRMA 1XILA 1SA0B 1XYOA 4MYEA 3JD2A 1BHGA 4PLNA 4LF9O 2XJUA 3AJYA 4IW3A 3CCVV 3K08A 1K4DC 2JGUA 1VMGA 4FPKA 5LBQA 1C5IA 2JDKA 4JI4O 3TOJA 1EZJA 4FPOB 5A7WA 3AZWA 4YJ2B 5I0RA 2HKXA 4Y5SA 4DR7B 4KNCA 3OTOB 3IC9A 4OXSA 3CC2V 5D21A 3JBG3 4XF4A 1HB4A 5IT6A 2P5BA 3ZS8C 3CHXA 3BN6A 4AR2A 2XAHA 4BYYA 2WSVA 4Y1XA 1DBNA 4DXZA 2EZPA 2J1UA 4QX0A 4O9EA 2ZCWA 5A7WB 2LTNA 1VBD1 1B04A 2Q5ZA 1FXZA 4M01A 1XNRO 5CA6A 2LALA 4CCLA 1RHI1 4EWAA 5EBLC 2A70A 4ASKA 1CQ9A 4DV2B 1W2NA 4QPIC 5BY5A 2UUCO 2P4VA 4O4JA 2PN5A 1ZNPA 4IYIA 3HAGA 2EXKA 1UYZA 1JS9A 3ZHVA 1OLME 1WW4A 1SLCA 4PDVA 2EXHA 4M3CF 2VMDA 3CCMV 2ET1A 4GKJB 4YW2A 4CDUA 1FOD2 4DV3B 4ZS3A 1PX3A 3KZIZ 1DK1A 1YYNA 3GJBA 2BTQA 2RN9A 1PL4A 4DRRA 1ZRDA 2OVUA 4QPKA 1R091 1F5FA 3RYFA 1CAWA 1A3KA 2BFUS 1O4ZA 1AR91 1DZTA 3LUTB 1YFXA 2VMHA 1SACA 2PXJA 1EM1A 4MOAA 2FMYA 3BCWA 1Y9MA 2Y33A 3E83A 3D6EA 5A70A 1LODA 2Y0IA 5KA5A 4EFEA 1JXNA 1NAEA 4CDUB 3T4HB 1GP6A 1KBHA 1WLDA 4KUMA 3H3ZA 2BTQB 1FATA 1M06G 4JV4A 4M0HA 1OOPC 2HG5C 4X65O 1K5MC 4KFMA 4IT5A 2QTOA 2Y4TA 3AL6A 3RYFB 2WQ8A 5JWPA 1JHJA 3NR7A 2OTJV 4UCSA 5G05L 3F7YC 4LMFA 3NKTA 1UY0A 5KHJA 4Q4V3 4XZPA 4MHRA 3VKMA 1WW6A 2HWB1 5TSWA 4BMBA 4FQZA 2XVGA 1BEV2 1OT5A 4AWDA 5A33A 3D8CA 4RN5A 4KWLA 3LAGA 2P34A 4YM3A 5B4XA 4CDWB 3KZ4C 3OPTA 4O2AA 3TWIA 1U96A 5JJNB 4JPRA 2VQFO 5FYUA 4FOYA 1Y4WA 3NO8A 4TWTA 3WG7C 2MEV1 3RG0A 4QX3A 3VGIA 4KP4A 2Z42A 4LQRA 4Q4X3 4QXBA 1GZWA 1EUUA 4IE7A 2PQSA 5A33B 1K3EA 4LFAB 4K8FA 1N0JA 4B1LA 1J84A 1SBEA 4K0KB 1QHDA 2RHPA 2YC4A 3ZMNA 1UCXA 5F1RA 2A6XA 4O2AB 1ZBE3 1K8AW 1O8SA 5J09A 1MZ5A 1V0AA 2PAMA 3ZN1A 2JJ1G 4KG8A 2YDEA 2P06A 2Q8VA 5E16A 2QM7A 4XTPA 1W9YA 2ADQB 4FMTA 3NW4A 2DYSC 5BNPA 1GZWB 5FPVA 1KYOF 3MHZA 4O61A 3ZRSA 3JBG1 3KGLA 4Q8KA 3VBOA 4IEUA 1S0IA 2ZOEB 4WFFA 4CVUA 5J48A 2YI8A 2AREA 1JOPA 4PI2A 4WFBV 4PF5A 2E7TA 2JWPA 1CWPA 3POEA 3JB8A 4J10A 2F23A 4K3UA 3RBZA 1ASJ3 3VQVA 2GBOA 1EN5A 3BABA 4B08A 1MABG 2NMOA 2DVBA 5DAPA 3THDA 5EQUA 3ZYJB 1SF9A 5EIBD 4JGYA 1P8JA 5BNPB 1SFNA 1W8UA 3PN1A 3AKTA 2XR4A 5FOBB 2YHJA 5F5AA 3H1WA 2RDCA 3SJQC 3VBOB 4Q26A 3WF1A 3AK3A 5CBHA 1R6TA 3K4ZA 2Y48A 3MW3A 3KHBA 2J22A 2PHWA 4AOCA 1MNGA 1BLZA 5CAZA 1BXHA 5FKCA 5ABJC 2IJIA 1V6NA 4X62O 1PO12 4BIUA 2Z69A 1U0AA 5A1AA 1W8WA 1LNQA 1OZ0A 4XBFA 3WDTA 3LKJA 1PO22 4XCBA 2CHHA 4CDQA 1PGL2 3N27A 5IVBA 5F39A 4CEWC 4JGYB 1BQZA 5DABA 2X8KA 2ZGPA 2Q0OC 2WLQA 2YS8A 2RS53 1UL9A 3ZXFA 2ZEZA 4XE9A 4G9SB 1RUOA 4JGZC 1GNYA 1ZYBA 1Q7YW 4OQ8A 3HKDA 1EP0A 4LH7A 3N35A 1S76D 3FX7A 2GH8A 3UV9A 4AYUA 2XASA 3BEHA 1LUVA 1B06A 4LBMA 1I5ZA 4XIOA 3OB8A 2JDMA 4CDQB 1PNLA 4EE2A 3UKNA 1QJU1 1S0EA 1LKNA 2IM9A 4CBCA 4CU9A 3ZDVA 2WRAA 5LBCA 3TJTA 4AGRA 1QH6A 1GWKA 2L6LA 1L7QA 1TA8A 4AQ6A 1XRUA 4LKSA 4BQ4A 1MZ6A 2DVAA 5BV6A 3HKDB 3AMHA 5C93A 2CV6A 1WP7A 4QJFB 2JDAA 4Q4V1 2RDQA 5FZAA 4LHLA 3ATGA 3GWOA 4CRQA 3WEZA 2ILMA 4X89A 1AXKA 5AVPA 5C3QA 2Q8EA 5LP6A 2XVKA 3S30A 5LEJA 4ZZ8A 4AVVA 3VV1A 2JDUA 1OCCB 2EIMB 2ETEA 3PNAA 4JTOA 5BY1A 2ARXA 3WNKA 1RM1C 3BTXA 3PUSA 2XGXA 1CAVA 3APOA 2AHYA 3O1RA 5FJKA 2Y69C 5LL6Y 1HR0B 3N3HA 3VZKA 1GMGA 2BW8A 5JXGA 5EBWC 4FBFA 1N34B 4YY3O 5FZKA 5FY7A 1K5QA 1I94B 1ENQA 1GN4A 2HEVF 4UT5A 3F7VC 3AB0A 4P5YA 4L97A 1EN4A 5LP6B 2EJRA 4FXGB 1NXD1 2B46X 5FLJA 4AEKA
chains in the Genus database with same CATH topology
2JG8C 1ZBE1 2LUWA 4WM8A 2BVVA 3HR9A 1QOOA 2JDZA 1TNFA 4F83A 3WW4A 1W6QA 4K20A 3ZO0B 2X5IC 3LWCA 3NAPB 3WQ0A 4YGEA 2GZWA 3VZLA 1CAVB 2A6VA 1AR83 4FAGA 4JRAA 3OY8B 2XKOA 4HN0A 1BBT2 1R081 1CESA 2KA3A 1FPN1 1AYN3 5DUVA 1W6OB 3JB4C 1GYKA 3IWZA 5F6LB 4Y5Z0 5CG8A 4QGNA 2Q4SA 4XYXA 3MF9A 3M2MA 3RRDA 5JOZA 2HWD2 2GC3A 1PK6C 5F5QA 1WBFA 2VVEA 1XYNA 1PVC1 2P3JA 4AVSA 3AX4A 2GNMA 1PGW2 3MEPA 1COV1 1U5YA 1F8VA 1OFNA 1XNDA 5H9QA 1PHMA 1HXS2 2IFRA 1LRHA 4IEYA 1H1IA 1SBFA 1DQ2A 2B9UA 4ORFA 1G6NA 3M3IA 3D82A 4RQPA 3LGRA 1W6MA 4YZ3A 1HDKA 4WM8B 3LA2A 1B35C 4LHNA 4RFT0 2D5HA 1L3JA 1W6QB 2D43A 4YGCA 4QPIA 4J6GA 1EPWA 3H9AA 2PHDA 5T55A 2RR12 2VXRA 3EO6A 1QU0A 1J3QA 4XJWA 2NMNA 2O1QA 4QQPA 4AFBA 1AJOA 5F9TA 3UK9A 2BNOA 4R4ZA 5T5JA 5BNNA 1FMD2 3DV8A 2A6YA 2CY6A 5FPXA 1QXJA 4XFCA 1KFXL 2RMU2 1S1AA 1BEV1 4HSLA 4AQSA 4CYDA 3FLPA 2CNAA 4N53C 5GZFA 5FO9B 1S2BA 2H0VA 4JRLA 5JSOA 3TRSB 1TMF3 1ENRA 3VZMA 4FTBA 4BHGA 3I2DA 3GHMA 4M27A 5GZGA 1LULA 3J8F3 1OIIA 1D4M2 4NWVA 4Z82A 3FBYA 4RQPB 1AL0G 3RYRA 1W6MB 3R1JA 1IQAA 1D4VB 1QJX3 3ACLA 1MQTC 1JOJA 1W0PA 2XJQA 4QPIB 1GICA 1HQLA 2ZHLA 3H50A 3LOBA 3WXPA 1LB2A 5FO7B 3ZMOA 5C4WC 1OTJA 2JJ6A 5C9AA 1QJU3 4HFSA 4AI0A 2JENA 2R042 3NSTA 1A8DA 1V6MA 5BNNB 4J5IA 1H9PA 1EV12 3FZ3A 2QCSB 4UW3A 3USUA 2WNUA 1LHWA 4K21A 2PQQA 4GMP3 2E6VA 2HJIA 4B4QA 4DMIA 5AFBA 1QOSA 4DOUA 4JQRA 1B35B 1LOGA 4CDWA 4CTEA 4FPJA 1HRV2 2B7YA 3IDEA 2FQPA 1JBCA 1BCXA 5DUXA 4J1WA 4LBQA 2D93A 2Y0OA 4BPZA 1A8MA 1D2QA 3E6DA 5KEUA 3N7JA 1ENSA 2ENRA 1WLWA 2HWF2 3D0SA 4IV3A 3FJSA 4QM8A 2VY0A 1W2UA 1CJPA 3NKGA 3B3QE 1G9CA 2XWBB 1AF9A 3J4UH 1NXMA 3DPRC 3KLSA 1OOPA 3WW2A 1PIV2 1QKQA 1HLCA 1TEIA 3B02A 1K5MA 1SLTA 1DIWA 2FBEA 3MIEA 1WCDJ 4C0BA 2VMGA 5T5LA 4XJUA 2RS32 5AFEA 5C9AB 3ALQA 5FO8B 5JSPA 4FPLA 1KJRA 1QY4A 5KXCA 3ZSKA 2V09A 3USUB 2WNUB 4EWEA 5BNOA 5CFCC 2HWD3 4I09A 4B3NA 2WFF2 3ETQA 2XUMA 4H3WA 4XJ9A 4IEVA 2IFWA 1O5LA 3LSDA 2IC1A 1N1SA 4OZXA 3O7OA 1GBGA 1N1VA 4FPYA 4HT1T 1PVXA 1Q43A 3AKSA 4I02A 4LBQB 2IWGB 1HXS3 2BWAA 1I3HA 1C8M2 1DRYA 3WDXA 1YFYA 1GR3A 4IV3B 2QUOA 1X7NA 1UMZA 2DYCA 2VOXA 1OQ1A 1IZ3A 4DY5A 4MUVA 1UKGA 2XLGA 1OLQA 1SCRA 1H4GA 2ZX0A 2D6KA 1OOPB 3U07A 5LRSA 1V9U2 2GMPA 1K5MB 3IDCB 4GIQA 4B4RA 4LA2A 4QX5A 1OS7A 1GNZA 5KWRA 3MLJA 1DYKA 3B93A 4LO4B 1DFQA 1IOAA 1QNWA 1LOAA 2Q5TA 2HYKA 1D2SA 3KMHA 2RR13 4MLOA 4HK9A 3MZHA 1QOTA