3P3NA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1930-1949) peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3nA01
1H2NA 2YDEA 4JAAA 2YC0A 4QU2A 4B7EA 1IZ3A 3D8CA 2ILMA 3OD4A 4Z2WA 1MZEA 2XUMA 3KCYA 3KCXA 4BIOA 2WA3A 4Z1VA 2CGNA 4B7KA 1MZFA 3P3PA 4AI8A 1H2MA 1H2LA 1YCIA 1H2KA 2WA4A 2W0XA 3P3NA 2Y0IA 4NR1A 2CGOA 5JWPA
chains in the Genus database with same CATH superfamily
3ZR5A 3LSQA 5FP3A 4KGGA 2EVXA 1IBMO 1MABG 4K8XA 4WM8B 2RS53 1XE7A 5GTIZ 1ZTEA 2W1QA 5KXDA 3P30A 1MZFA 1FD9A 5JJEB 4EFEA 1OQ1A 1DG6A 3QTCA 1LOCA 2EXIA 4YW7A 4CCLA 2X0LA 2VZ1A 2VS0A 2DUQA 2ZM6O 4CEYA 2A06H 3ZHUA 3M3EA 3PL0A 3K5OA 4X9QA 4DRXA 1BEV2 2ATFA 2DYRB 2ZMKA 1Y4MA 4QPIB 1JYNA 2W87A 1HN1A 2BU9A 2VZRA 2UUBB 5F8PA 4QDQA 2LS6A 3BODA 4INDA 5FZOB 2HWB1 5L3GA 4MS2A 1XJAA 2C6SA 2QKDA 1W2TA 4Q4Y3 1DGRN 1QHTA 2BTQB 1TZOA 3TETA 3AKRA 1GQHA 5J2UB 1HQNA 4YLZA 3VBHC 5EPAA 1DDLA 4KHPO 4RFRB 1QBZA 3AYDA 4HBNA 4IL6Z 4M0NA 4PDVA 3ZFEB 3AYEA 1OBNA 3WB1A 3AP9A 2ZD9A 4QX0A 4EWDA 1KJLA 1RUH1 1US3A 1AR71 4CDWA 5FQ0A 1R6KA 4UUJC 4LORA 4YZ4A 2RS13 1PGW1 3NNFA 5FYUA 1J84A 3N9PA 2P3IA 1W8ZA 1MR5A 2E26A 1R1BA 2HWD1 4JGYA 1KU9A 3DV8A 4WV8A 1XMQO 3S0MA 3ZHTA 1GQGA 1ALYA 3T09A 5JSPA 4XZUG 3VQVA 2EILC 4OZXA 4RO2A 5EK0A 2QBXA 5FZCA 1NLQA 1JUIA 1V6KA 4UBHA 2LM3A 4BK5A 3WUDA 2Q7GA 1UFIA 2C5DA 2X29A 2DTWA 3U4SA 2RM23 5FMBA 4Q0PA 2IJKA 3H1HH 3MICA 3CXHF 5ERLA 2E7AA 1XB9A 4HKOA 4PLOA 1NI8A 4FSJA 1H38A 1H2NA 5DZEA 1YIJV 1RP3B 1OT5A 2I2SA 3NQHA 1F23A 1HRI2 4YVWB 3PVOA 4MT8A 1POQA 2BOCC 1DQ1A 1JCHA 3HKEA 1S72V 3ZJZA 3VD3A 1AX0A 1AJOA 5K0UA 1E1RG 3WG7C 3O14A 1NQDA 4O2BB 4KBBA 2BCCH 2Q68A 3AG3B 2FBEA 1NA1C 2B45X 2CNAA 3EXAA 1ASJ2 4GKXA 1H4HA 2DCJA 4H0LB 2XLAA 4LA3A 2RVAA 3HPLC 2YPDA 3PTYA 3ETQA 3WP3A 4TV8B 1HRI1 2B9ZA 4YW2A 1VQOV 3LDBA 2A6YA 3JBG3 4BPZA 1EN4A 1AYN3 5H9QA 3BPZA 3KVBA 2ADPA 5CA0A 4AE2A 2XOMA 1W05A 4MG2A 4P9OA 2J42A 1XNQO 1JZ5A 5CKNA 3OCPA 5DZFA 5HBAA 1RHI1 3O1UA 2UURA 3FHQA 5JI9A 1UPSA 4TLGA 4AEDB 4FTEA 2WNVA 3K4AA 2XL7A 3WG2A 4PQ9A 3M3OA 1JZ2A 1RVF2 4FLTA 4AI1A 2DN9A 5LRSA 3WEZA 2E7TA 4FPCA 4DV5O 1LESA 4XE9A 4PA7A 3N9QA 2WO7A 3C3SA 2WKKA 3U10A 1CVNA 1VAMA 1I5PA 3D0SA 4ASKA 2ZGTA 1VQ4V 3CCMV 4Y5SA 4CS2A 5DUXA 1PO22 4AQSA 2ZGRA 1VAKA 1FYUA 3CS5A 1LHOA 1SBEA 2JDYA 4MGQA 1UO9A 1W8TA 2IXIA 4CCCA 2Q6AA 4IDZA 3SKJE 4NE9A 4K1ZA 4NTXA 2QM7A 4FFIA 2QE7G 2P4VA 1CX1A 4CCDA 1PMJX 1M5IA 1ND3C 3WF0A 3M3IA 5EZYA 2VVFA 3CMGA 2WLQA 4RHV2 3UKTA 4Y24A 1C5HA 2WNUC 3LOBA 2DFBA 2RG4A 3VBOB 3FMGA 2CK3G 1FMD3 3PJSK 1H8VA 1TME3 3IDAA 1HNXO 4MYEA 3SCFA 5J96B 3GB7C 1S76D 3T1YO 5IUQA 4GB31 1W3VA 1VMGA 3A4UA 4FPJA 4UI9L 3AL6A 4BWAA 2W91A 3C7FA 1KECA 3POIA 5CVRA 3H9AA 4N8MA 2YEVA 4XIKA 1S0BA 1L8DA 3MIHA 2F93B 4B3NA 2PHXA 3PJYA 4DS0A 1JPXA 5LA6A 1QH7A 2H8PC 1JX9A 4CDQC 3B9IA 3VBFA 4WVZA 1AI6A 5IVEA 2PYJA 3E22B 4MGYE 1US6A 1ULFA 3VL8A 2C2AA 2GDFA 3IJ4A 1KQSU 2WFPA 4ORFA 4QX3A 4XTPA 5EIBD 2LW7A 1W6MA 1PPJH 2I74A 4UYBA 1DQ0A 1R093 4TQFA 1Q8IA 2VQTA 3QO5A 3MV01 3ZHQA 1RUG3 3B69A 2OQ6A 2DBNA 3CP1A 4RR3A 4N53B 5LB6A 1RL3A 2QWQB 1AR91 3VZJA 4QE7A 1TQ5A 2HEWF 4X6QB 2W46A 2BGCA 3CCUV 1OA3A 4O2AA 2CDPA 1N3PA 2VJXA 1IBLO 2O57A 5FZMA 2Q8EA 4XJZA 4IEUA 1DGLA 4GT1A 4M01A 3GXUA 4JGYB 1LUWA 2QWRB 5IDJA 3ABZA 5EYPA 3IT8A 5CA3A 2GV9A 3O12A 3R4DB 3B5LB 2CWSA 2XWBB 2IXHA 4MTGA 1V6MA 1HV0A 4KWJA 1GN2A 4FQ4A 1CAXA 1BT8A 1GBGA 4DOUA 2YU2A 2LO1A 1T5EA 4HSJA 5LRRA 3S30A 1BYHA 3ZRXA 5KMGA 5C93A 2HG5C 3WB0A 4NTWA 4D7SA 1UX6A 5B66Z 4QNHB 2VW0A 1CONA 2VBPA 2MPFA 4K9SA 3SNMA 1R73A 2QTSA 4UW6A 4FLVA 4PA4A 5B5EZ 3LFMA 3OMNB 1APNA 1NU1H 3AMQA 1P84F 2EIKC 1O9HA 1FFXB 2JS5A 2P34A 2VO5A 4CDXB 4A7KA 4XOGA 3Q4HB 3SYPA 1X9PA 5LOVA 2HWC3 2LQTA 4AVVA 2D6MA 2Z4FA 5CFDB 4JQRA 3RN4A 2E74B 1IOAA 2QQVA 2X05A 2DWEC 4URAA 5B1NA 2WLMA 2BWCA 1STMA 4DRRA 3RMYA 3VDBA 3I54A 5B4NA 2HHHB 4IEOA 4Y22A 3GJAA 5LY1A 1ODMA 1CJPA 3Q9OA 4RN5A 2YC0A 1IPKA 2CU5A 1E79G 3BU7A 2WAOA 2WINB 1YO8A 4DR2O 4X1IB 2EALA 3JD1A 3WZ1A 4K8ZA 4UV9A 2IJIA 2QQMA 3RZGA 1YCIA 5I93A 5KUKA 1JYTA 2KA3A 4YZ1A 4F6RA 1SBFA 2ZX1A 5H6QA 4O61A 1GMMA 1R1A3 5JOZA 3WFVA 4IEPA 3UK9A 3VLBB 2VVEA 4RYDA 2ODMA 4V2WA 1BKZA 2R0FA 3L75H 3BHPA 5DN2A 1HV1A 3ZVXA 4TT3G 1IPJA 5EYXA 1WLEA 4META 3C3VA 3K03A 3IC7A 2CTWA 4IW3A 5JCOC 5JWPA 4GWMA 2YIBD 1J1LA 5K0UC 2CHHA 1WP8A 3OBAA 2Y8KA 3CZUA 4HKWA 4R8HA 2Y60A 3DYPA 3ES1A 1YRZA 3FHIB 3SYCA 1CAUB 3OY8B 1LOAA 4CDUC 1QDCA 4KMQA 1SHWB 1HR0B 5DUVA 3ZRWA 1Z78A 4AAXA 3S6PA 1I6XA 1O8PA 2JG9A 5I0SA 3MIDA 5DAVA 1H30A 2VQ0A 2ES3A 2Y33A 4H44B 1VQMV 1VBE2 1YJWV 4AI8A 5IYBO 4CXXA 2ARHA 3C7HA 4NTYA 5FTTC 3GNEA 2HH9A 3RBZA 5ISLA 4EFBA 1TMF3 5JPMB 5LP6C 3CCSV 4AEKA 3O1SA 4XFCA 1SC5B 2BEOA 4ZY9A 2BNMA 3NJVA 1DQ2A 5LA6B 4MGTA 4DR5B 2UXNA 1RUI3 1SQFA 1KC8W 5FNVB 4PA6A 2DVDA 5IVBA 3RZLA 5DG1A 5JVDA 1BEV3 4IESA 3C90A 5IWAB 3VKMA 5D5QA 1Y3TA 3PTRB 3VGIA 1X59A 2WQZC 2ZKLA 2GC0A 4DR6B 4QQ2A 5JR7B 3HKCB 1M1KW 1C8M1 3I59A 4FZ0A 2JDPA 1VBC3 4LOSA 5C70A 5CA6A 5KA5A 4RQEA 3AKPA 4WFEA 2VAUA 4P08A 1OUXA 4UFLA 2O14A 4KWKA 2IFRA 1VQ8V 1POV1 2PAKA 4Z1MG 1CPMA 3A21A 3X2QB 5LMUB 4PI0A 2KSDA 1OCOB 2NN4A 3ZR6A 1FPN1 4TXWA 1HR0O 4BQ3A 2W6IG 2P67A 1YXBA 3EVKA 1J58A 3PDQA 1REFA 2PHFA 2DCTA 3QVNA 4Y1UA 2QUOA 5IJRA 5JSRA 4YG0A 4AW7A 1AX2A 3M3CA 1O4TA 2VPVA 3AKSA 2ZHMA 4DEVA 3LDDA 1AR81 1GFF2 4K20A 2A71A 2EIMB 4M4PA 2A73B 5C8CC 2D3OW 2ZR3A 3EHBB 3VBFC 3H1WA 4K3UA 3MIBA 1LGCA 1PO23 4P9WA 2R041 3GBGA 1FOD2 4F7ZA 1RPOA 5JZGA 2JDMA 5J98B 2F4VB 4DV1B 1IVSA 2Y26A 4I9WA 2W6JG 4CVUA 5L3BA 3WDTA 1SQQH 1E5IA 2Y6HA 1CIYA 1D4M2 1LCLA 3NRUA 4XFAA 4X20A 2ZTNA 2EZOA 3DYMA 3FBYA 3FUQA 2UU9B 3IDEA 1S2KA 2VMCA 4OPHA 2ZINA 2ZX0A 2KXLA 3ZMTA 3MIGA 5IK8A 3T0DA 2UXXA 2ZAAA 4RR3B 4BLJA 4PD4F 1GYKA 4PCRA 5FNVA 2R072 4XUTA 2WLJA 4X6RB 3CCLV 1PIV1 1K5MA 4AGVA 4YVSC 1RJ8A 3POFA 4JI5B 3KM5A 1TG7A 4ZZ5A 3E8GA 2OQ7A 1OPOA 4OI0A 2PHTA 1H8TB 2VE1A 1FI2A 3P3PA 5KLVH 3RYIA 2OZ6A 3RPQA 2R9RB 4W8JA 3RZHA 2Z2SB 2LGQA 2KR2A 4Q0QA 1RUD3 1K33A 4FFBB 4OQ9A 3T1CA 1QOTA 1CGPA 5BXZA 2E3CA 3RMXA 4DB5A 2WNOA 4A41A 5JH7B 5FZKA 3O0WA 2LALA 2XVLA 3ICXA 2B4KA 3N7MA 4YY3B 2VECA 3KQRA 4YVWA 4DK1A 5FLHA 4LNUB 4DR1B 5FZ4A 4AK3A 3WF1A 1U97A 2XG3A 4E2LA 1N0NA 1RUF2 2XKPA 1VRH2 1D4VB 5HV4A 4JQTA 4GJYA 1PNGA 1M57C 3SJBC 1R083 4N7UA 4BIUA 5FZ0A 5DXDA 4LUKA 1HW7A 1I5ZA 5FLJA 5BNPC 1HXS3 2HHHO 1AYM3 2DCYA 2FZ2A 4OUEA 1L1FA 2A3XA 4DV2O 4BIOA 2P5OA 1ZLZA 3HPNA 5FPXA 4XURA 4YHHO 3ZN4A 3VQWA 1QJEA 4DK0A 2L6LA 3IKWA 3AG1B 4Q8LA 3O0XA 3K57A 1OHFA 1DCSA 1A6CA 3N9LA 1YFXA 4DW0A 1PVC1 5K8SA 1BZKA 2ADQB 1TVKA 4KWLA 3OM3B 2OCCB 3PUQA 2B39A 4RS5B 1GQPA 4X62O 4UXAA 2W39A 5FYZA 3POGA 1EAH3 2J1SA 4WFBV 4LF8B 2WLIA 5DDJ1 2XQXA 1W9FA 1HB4A 1PNKA 1XMOB 3K77A 2O8OA 2FMYA 2ZIOA 2PAMA 1AR63 3D3AA 1AR82 2WT2A 4FFBA 2IXKA 4JF3A 1DLLA 1O5LA 4QKNA 1W6QB 3HN1A 1VBD1 3UM7A 2G9FA 2OT5A 3POEA 3CNAA 5B1BC 4JI0B 4CU8A 4O2BA 5KHJA 2JJ1G 4FMTA 1MNGA 1DLCA 5JOXA 1VAVA 2CL2A 1N33B 2V4AA 3CJHB 2UY8A 3AKQA 5B1OA 3HT2A 2A3WA 1QQCA 4GUNA 2BQPA 1UYXA 1MQTC 3M1HA 2D3RA 3WP6A 2PELA 5FZEA 1TUEB 2XJTA 3KLSA 5F37A 4IEQA 2VCMA 2PAEA 5DZGA 5CMUA 4GCZA 2LJ2A 3ZXEA 5L73A 2VY0A 2VWJA 5LK7B 2W2IA 4MW3A 4QM8A 4AOCA 3J80N 5FPUA 2AEYA 4ICGA 1JMKC 1W59A 5FZ9A 2UYBA 4LBEC 3ECQA 2W68A 4ZI7A 2IH3C 5E1RA 1DYKA 1K3EA 1UPIA 4DUVA 2EA7A 3H1LH 5FYSA 1UWWA 1OD5A 1Q43A 5FPRA 2OA2A 1V55C 1H2LA 3VBHA 1PNLA 1UF2C 3QO8A 3GM8A 3OTOO 2VW2A 5CA1B 3QH6A 2D6OX 3ACGA 4H14A 1GP6A 2XUMA 4XFGA 5D1IA 4ARXA 3AG2B 4BLIA 2UUCO 4HVQA 1JVMA 3IPVB 5A3WA 4JHTA 4JGZC 3H9VA 4R52A 5LOVB 1V54C 1LOBA 2RDRA 1ORQC 4R6ZA 4C8DA 3TB0A 4PV1B 2VTFA 4HK9A 4QXKA 4AVCA 1ZZ8A 4Q2FA 3WV6A 2VRZA 4LLOA 3K46A 5FK8A 5CFCB 3HKCA 4DR1O 4LBJA 4KNCA 4NMIA 1ND2A 2AENA 3FZ3A 5F3GA 5FZAA 2YXHA 4D6TH 4OI1A 3IAQA 1FT9A 3O65A 2V7QG 3OUHA 3RWRD 4XBQA 1MS1A 3GZEA 3AK1A 4KQ7A 3LWCA 2WIIB 4Q4W1 4W6YA 5GLUA 3IGAC 1A3KA 3IWZA 5F6LB 4LFBO 1HX6A 2P6HA 1QLEC 1WD3A 2WDBA 4UFMA 1PL4A 1Y4WA 3BFRA 3KT7A 1S0EA 2HWD3 4EZ4A 2RR11 3K75B 4GKJB 2VTXJ 5L9BA 1HP8A 4NRQA 4DINB 1X9TA 3GHNA 2FCVA 3DC6A 4MO3M 2W1WA 2QQPA 2WABA 3APOA 1JYXA 3ASOB 3CRRA 4LF8O 4B1LA 2EIGA 3RYCB 5DUWA 2NYYA 4GXLA 4CPBA 3NVCA 3L9JT 1JFFA 1HDJA 4YGEA 5BNQA 4PF1A 1QJY1 4K0KB 1S0FA 4MGSA 3UGHA 5IJ0A 1BK1A 4CP9A 5LASA 2ZGQA 2RS31 3ZN1A 2OIIA 1QY4A 1VRH3 4CYDA 1W8FA 4EN7B 1SLLA 1WA4A 1QH6A 1NLRA 1IS5A 4TZDA 3USSA 4IETA 5FZBA 2NMNA 3FX7A 2R1BA 5AG2A 3AVSA 1IXMA 5K0UB 5HFLA 1US2A 5A70A 3PVBB 2E32A 2R70A 1UXXX 2Z0AA 2VC9A 2BSKA 3VOUA 4NB5A 1U96A 1SETA 3LKJA 3MD0A 1IG0A 3HNBM 1AILA 3N7KA 4EWEA 2OIEA 4DPNA 2WFF1 4CUAA 2XJPA 3W59A 3I2GA 4LOTA 4GH4A 4CS4A 4Q4V3 4LBQA 4XAAA 4LO6B 5CFCA 1YUDA 3S5AA 4KUMA 1HDKA 4ES8A 3H7JA 5JMCA 4JYYA 3UESA 3OJBA 3PLQA 5FY1A 2X7RB 3V0BA 4J25A 2BGPA 3LFIA 1VBE3 3QF7A 5CA1A 3LOIA 5AC93 1NYWA 1AX1A 5FZLA 1UKGA 1UN1A 3RGBA 1GZ9A 2WR9A 1WCQA 1R3JC 1W2AX 5CU1A 5C4WB 3OD0A 4BQ5A 3MDSA 4COWA 1HW5A 3CIHA 4CDWC 1P7GA 3A8TA 1GZTA 5I91A 2WQ8A 3K2OA 5FXZA 3PNAA 3L9DA 5T50A 1NCRB 4DEQA 3OYWB 3H7YA 3LCPA 4NHLA 4DIQA 2Y69B 3KV4A 5HI0A 4P2ZA 4AXOA 1ZZ9A 1VE0A 1H6YA 2Z3YA 4B4RA 4HMZA 3CCVV 3MYXA 1OLRA 3OEEG 1G6UA 4GWJA 1ZA7A 2ZE5A 3VD5A 3K4ZA 4J6GA 3ABLB 1DF0A 1UU4A 5TSWA 2RMU2 4ZHQA 4DV4B 5KXCA 4JYAB 1BL8A 1SDWA 1C28A 4PHZA 3D36C 2G19A 1MZ5A 3SMHA 2GZWA 4LLFA 1XQNA 1OJHA 1WMFA 3OUJA 3EBRA 3QCWA 4FPFA 3V64A 5LGTA 4JYAO 3PIGA 1COV3 3KS7A 3ZXDA 3OOXA 2ZOEB 4Q1PA 1HKDA 1AL23 1SFYA 5B3SC 1W9TA 4N7IA 5C8CB 4YFZA 1CPYA 3WG3A 2XMLA 3FN9A 4XF1A 1VBC2 5FOBB 3MI8A 2UWBA 5LGUA 1E5HA 1COV2 2B7YA 2YC4A 4O4HB 1X8EA 2TEPA 4KHPB 1X7NA 1SS3A 5EHDA 5IATA 4CH4A 1D2DA 4QX7A 3ZYBA 3J8F2 1BMV2 5IVFA 1V9U3 1W3XA 2G38A 4XJAA 4UCVA 1T6GC 5CNAA 4JI1B 4QB2A 4JI4B 3UGGA 2IJJA 5F2SA 4I2OA 3I3MA 2AW9A 3OR7C 4PELA 3AFGA 2UUBO 2CTVA 4RR3C 1O3RA 1TE1B 4IHJA 5FZHA 3K06A 3UT5A 4TLFA 4HN0A 3VKOA 3UCSC 1W06A 4LULA 3LNNA 2X5IB 2QQWA 1OOPA 1QIQA 2ZXWC 3ABKC 4BB3A 3FYEB 2W52A 1TUBA 4RHV1 2JE7A 2Q8CA 3ZYIB 2Q8VA 1BSMA 3NKGA 1JZ6A 2PQQA 1T6BX 1MS0A 2PMWB 3FC0A 4XDPA 5CYYA 4LTAA 2HEPA 1AJKA 5EZYB 4R4ZA 1HNXB 4FOVA 5FY7A 1R3IC 1TGOA 3JD72 2LUWA 2YU1A 1VR3A 3AP4A 2R32A 3ETGA 1ZBE2 2YXYA 4LF7B 4CEWA 4XUQA 4AI9A 1U5YA 2WZ8A 2BFUL 1GP5A 2H94A 2A0LA 1PM7A 1N36O 1W8UA 1XMQB 4JI8B 4BA6A 1CAWB 1ULGA 1YTFB 3JD0A 1RUG2 3QG5A 2CE4A 5KHGA 4COVA 1WCKA 2CV6A 3FJSA 4PJYA 5GJ6A 4MVSA 5FPVA 4NXNO 4HSLA 5C3SA 2DUPA 1W39A 1DK1A 1QNWA 3K08A 2D6PA 2HWB3 4Q4Y2 1VP6A 4E2GA 3OB8A 1GLHA 3SCGA 5JLVA 4B29A 1JW6A 3CMAV 2LFSA 3JU9A 2QR4A 2QE3A 3IAPA 1N32B 1F4MA 3TEXA 2JKBA 4GKJO 4WVMA 2FCUA 4AYUA 4LO5B 3CPWU 5FP9A 1NBMG 1NX9A 2AH2A 3IN9A 5KC6A 1RSOB 3KD4A 3U14A 1UY3A 5CB4A 1SESA 2J22A 4Z1VA 4FAGA 3CEIA 4JCKA 4BK4A 2Y0OA 1Q6UA 1C1LA 5GONB 4MVMA 4JI7O 1KP3A 4LO7A 4CZSA 3F7YC 5F2VO 3UNPA 2EILB 2X09A 4MGKE 4TWKA 1AZDA 3O1TA 4Y3OA 3R66A 1RYYA 1WA8A 5F5IA 2A70A 4F6RB 3SR2C 5CADA 2ZT9B 3A7QA 1SFPA 4XCBA 1CEZA 3TXQA 3GGLA 3K79A 5DN6G 3LZZA 5BY5A 2J1RA 3NNJA 2J1TA 1OD3A 4CU6A 3T1YB 3CRCA 5IY5C 5JJNB 2W47A 1IBLB 4DR2B 1LAJA 3LPGA 5DQ0A 2Y64A 3T2OA 1CP9A 1UPGA 1NH2B 1Q6IA 3J7AU 4DO2A 1NH2D 3G7DA 1MEC3 2BPA2 3ASNB 5SV5A 4FO9A 4EN8B 4XPVA 3D5OA 1R3KC 1LHVA 4FVVA 3ZYGA 4UV8A 3KMHA 3TEZA 3O1RA 2ZIMA 1VIWB 1WKYA 5HCFA 5BY1A 2VR4A 1MVQA 2VG9A 1FFXA 5T55A 3BGAA 4Q0UA 2WA3A 4JI3O 1BS3A 2HWE1 2R16A 1ST8A 1YQ6A 3A0RA 4PDMA 3FWEA 1Y9QA 3JD3A 1THZA 4L0PA 5C7GA 1U5IA 5C71A 5T54A 4UCSA 3IDBB 1RVF3 4QDSA 4TTGA 2WRAA 3ZX7A 2OXBA 5CA0B 4YW5A 2LROA 3ZN5A 1DQ6A 1X36A 1EY2A 1RUH3 4PIYA 2WNVC 4LCUC 1K9MW 4LBKA 2VQEO 3OMAB 3U78A 3MHHC 3CDZB 4L97A 4ARYA 2WSSG 2WSUA 4IERA 4H13B 3M7MX 3WQBA 2WZPP 1HQLA 4QX2A 2WWUA 1NY71 4XJWA 5H2FZ 2HLEA 1JZ7A 3TGUH 5CFCC 3VUOA 3M8LA 1NCRA 3ZYFA 3PUSA 3MBWA 2RNBA 5K7PA 4ZBMA 4F4LA 3AVRA 4J11A 4FAHA 2RM21 4O7XA 1LRHA 2CTRA 1WJZA 4HZ3A 4PIXA 4R7CA 3SC7X 5A3MA 4JI6O 3T0AA 2WQ4A 2BOJA 3U1XA 2R9AA 2FKXA 1PK6B 4RWUA 5BNOA 3CZJA 5A32A 3M70A 4KU8A 5EXOA 4ITCA 1OA2A 1X8MA 4QQHA 1AVBA 1MS9A 4PLMA 3PUHA 2WZR1 2FDKA 4JI8O 4X89A 4I02A 3B9CA 5FZ8A 2PLV1 3HJRA 4FXKB 1AR1B 4E27A 2CTQA 1RXFA 4C1WA 2QKSA 4WBNB 4IL7A 3HN3A 4J7ZA 2ZHNA 1VBA3 4MSWC 5CG8A 2GMMA 4FPYA 3S57A 3JD4A 1WUVA 2YV8A 3ACIA 1U5ZA 4M00A 3TEYA 3BALA 5J2UA 2DURA 2VQAA 2RS12 1SCRA 2WLPA 4J41A 1Z7S1 5ITZA 4HANA 2YFUA 1RUC1 3JALA 2R061 2XJVA 1KQRA 1QVFU 2BVBA 4XJ9A 4E4EA 2RDNA 3ZFEA 4DUZO 4B3RO 1G6NA 4EB6B 2NPIA 4Y1VA 1MSDA 1QNMA 3SPJA 4K35A 3NV2A 4W6XA 5BMVB 3NW4A 2R043 3V65A 1UZWA 2LW8A 4GIQA 4DV7B 2C0ZA 4NN0A 2ZHKA 3SPCA 3PVEA 5C4WA 3AZYA 3SPHA 2JG9C 2HWE2 2GP5A 2VMEA 2A5ZA 1UW8A 1LTEA 3I59B 2PN5A 3TK1A 1NR7A 3GJBA 5F3EA 4OHZA 3OEAA 4YW4A 4BQXA 5FZIA 1NVPD 1KDMA 4WM7C 1IHMA 5KX5B 2YROA 2WN2A 3PHMA 5DDJ2 4HOOA 2OYZA 1GN6A 5T3NA 5FO7B 4BIZA 3W5NA 2DVAA 1OLMA 1HWYA 1NVPB 3J8F3 1RJ7A 3FYIB 1CR7A 1F15A 3ML0A 1JBCA 4R9CA 1B35C 2CGOA 4ZKTB 2X6BA 5C4WC 1ZUQA 1SZXA 1G9DA 1D7PM 2X5IA 3E83A 1K45A 4FFGA 1S5LZ 1HNWB 4DR4B 5I0TA 5GALA 4CCOA 5BUVA 3SGIA 4WVWA 4J7JA 4L8QA 4LH7A 1VB2A 3RI8A 1M93A 3N4MA 2FDHA 5LXTA 2VWKA 3HBZA 4CTEA 3AMHA 2EZPA 2YIAA 3LDCA 3AMMA 4CEWC 3SEEA 1WMEA 2Q73A 4EN9B 4LF4B 4R50A 2ZMLA 1E1QG 1T2XA 3T1LA 2IUWA 1SQBH 1LENA 1ULOA 1Y43B 4B8EA 1EYBA 1C5IA 2N05A 3OT7A 1ODNA 1JJ2U 2JJ6A 1XYOA 1DLBA 2P90A 4HONA 2YEVB 1OMIA 1XMOO 1WBLA 1WNSA 5APAA 3OEBA 5JQGA 1PX4A 1RUE2 1H2KA 4IV3A 2A75A 1W8NA 3ZOIA 2DVFA 2W95A 4LHNA 2UUCB 1GK9A 4QU1A 2DYRC 4S2DA 4GALA 1JOJA 1RSOA 1XDCA 1Q8PA 4JTCB 4LBLA 4YJ2A 1XC6A 3ME2A 3LSDA 5JZGB 1DBNA 2EJRA 2A6XA 4LKDA 3URFA 4B08A 2GN3A 1LOFC 4IEWA 1XQ8A 4OFGA 3CQOA 1NAEA 1NA1A 1UMZA 3AXDA 4BH9A 2D7FA 2XGXA 2E5LB 3AZZA 4PI2A 1I5YA 2P7TC 2WLHA 3VBHB 1NS1A 1YFUA 1PV0A 4O4HA 2B5HA 2ETNA 4BIFA 5A7WB 5AVAA 2FCTA 3R65A 1PGSA 3CBNA 4BQYA 2F4LA 4Q4X1 2ZGOA 3B01A 4XETA 4RA0A 5E6HA 3CSXA 4LF6O 5CN0A 2V5YA 4GKKB 1ENVA 2VCAA 2IJHA 3C7GA 5G05L 2Q7HA 4LF5O 2C9KA 2X5IC 4XBNA 1AR61 5GZGA 1VIBA 5IFTA 3I97A 1H2SB 1QVGU 4KGQA 4DV4O 4YGDA 3G71V 2H0BA 4CC6A 3K9SA 2VMHA 4KXRA 1VBD3 3WF4A 4Z2WA 1P49A 1YI2V 1YVWA 1FXVA 4GMP3 4GAZA 1HB1A 5F7UA 1DU3D 4LEJA 2QKCA 4ATFA 3E2EA 4FLXA 5B4XA 2QDNA 1OH4A 3DN7A 1RUOA 2QGNA 4L92A 5C8WA 2YIBA 1SLCA 3AFKA 3WNNA 3ZKUA 1AROP 4PA3A 3BN6A 1UY1A 4FBFA 4MXWB 4CCEA 4FZ1A 3DGTA 4QPGB 4CRQA 4E2SA 4RUEA 2WBKA 4LKFA 4J9ZB 1VBB1 3WDXA 1J1TA 3LB9A 4LFBB 1GU3A 2DUOA 5GLTA 3QNEA 2V5DA 3DPRA 1R3LC 2R073 4JPRA 2VU9A 3GF6A 1XU2A 4FM1A 3OAAG 2VBDA 1QR9A 1Z5VA 1GZWB 2XL9A 3CEWA 1K5SA 2BZDA 3D36A 4NHXA 1FXZA 5ACA3 3CJXA 1AI7A 1AJNA 1B06A 5B1AC 1Q82W 1W6MB 3AEIA 3E5XA 2V09A 5L19A 3FB7C 4GQ7A 5GLWA 2EICA 5FMOS 4RQPA 2JVDA 2CDYA 1VQLV 2BRTA 1K5QA 4UOJA 4LWSA 3DKQA 1TAEA 3ZYJB 4DR5O 2XR4A 1LJ7A 1K5MB 2VW1A 1W6PA 1OF3A 1W6PB 1C4RA 3SPGA 5J48A 1LU1A 3ZPYA 3CL1A 4RL7A 4Z07A 3VZKA 3VD9A 2G9ZA 5L7OC 2F66C 1SERA 1YZBA 2YBKA 2NR5A 5LBCA 5LCWL 2E5LO 1VALA 1L7LA 2DJVA 3ZMNA 1SLBA 3WW2A 3BTYA 2JIGA 1NXD1 2JGDA 3LDEA 1FAYA 2D44A 1YJ9V 3OD4A 2MEV3 4YZ3A 4M3CF 4I3GA 4Q4Y1 5A1LA 4QXBA 4JI1O 1LUVA 5FPAA 5JH7A 4YYOA 2GHYA 3TN91 3OGGA 4LK6A 2TNFA 4NR1A 5LATA 4WZCA 1YQ5A 2UUAO 4GMP0 1F5FA 3KCXA 3ASNC 4O4LB 3MW3A 4RAIA 5LBFA 4AHXA 4GJZA 3RYRA 2W5FA 5FPLA 5IWAO 2W0XA 1BZWA 1UKRA 4XZPA 5CBLA 2A3QA 2RDSA 1ZBE3 3CKHA 4LITA 2OPWA 4BE3A 3AP7A 1XNRB 3BVOA 5IAVA 3DGEA 5DECA 2CYFA 5A6QA 5FWJA 3OR6C 2PXJA 1LOEA 4YG6A 3VHPA 1L7RA 1JOPA 2BBAA 1QJX1 2MK3A 2AXTZ 1QWRA 2RR12 3HQUA 4D3WA 3BAAA 1FNYA 3ZHVA 2JXAA 2DYSC 4MXWA 2ENRA 5BZBA 1AP5A 2PHWA 4NPLA 4AF9A 2YXSA 5C9AB 5CBGA 3RFRA 4Q4W2 1YJKA 5IT9N 1UIJA 2Z5UA 4K7JA 5EV7A 1WD4A 2GC1A 3E35A 2QZ2A 4IYIA 2AZ5A 5FYTA 4QT6A 4GLXA 3ZFFB 2WNVB 1MZEA 4BW9A 4K0KO 5F5AA 3IAYA 2AC1A 1NTMH 1MACA 1FOD1 4BXFA 5SV8A 2K1EA 4CDQB 5JVVA 1WZXA 3BI3A 2Q9LA 2RN9A 3ZDSA 4UW5A 4PDWC 3MIFA 4AFCA 4H2AA 4UVBA 5GLVA 4Q8KA 3L70H 1MMMA 4I55B 2MHFA 1GWMA 3H01A 1OLQA 2RS52 3KGLA 4DNYA 4XQDA 3L74H 2QQUA 2L9LA 4DUXA 1OCRB 1P7BA 4AFMA 2DU0A 4LR4A 1W6OB 4U3JA 1AUYA 4HZFA 3T2QA 4LR3A 1H8HG 3NXSA 4JGYC 2KQXA 3M8AA 1I9RA 4K1YA 3JBG1 4QB1A 3B00A 2JGDB 5EBLC 3JZVA 2A3YA 2LGWA 5FMOL 1OZ0A 4WF9V 3USUA 1FKAO 3L71H 5J7MA 4ZXKA 5JQGB 2J1UA 2YYOA 3P1IA 1N1TA 2XVKA 3DXTA 2BSKB 4WVMB 3SYQA 3LDRA 4NIAA 1J59A 1UZ0A 3F5WC 4AL9A 3JAWA 2H3OA 2R6QA 4AR2A 5GM0A 4P9XA 4QWNA 4JRLA 2OTLV 1R081 1SG3A 3I2OA 1SZTA 3J9SA 2WO1A 4ZI7B 5I8YA 3V56A 2WLKA 4OX9O 1LGNA 1W6NA 3WNLA 4A7ZA 1BHAA 4X64B 2JS3A 1O3TA 4DV6B 2V4DA 2E9QA 4CSWA 3O7OA 3ZFFA 2OZJA 1S5JA 1G7YA 3B7MA 3OSDA 5LK5A 4X8PA 1FJGB 1G8WA 4UVCA 2XONA 1XOYA 4ZS3A 2Y6KA 3MHSC 4CDXC 1RUJ2 2XHKA 1VQ9V 5BMVA 4FIPC 3CRAA 3HQRA 1IKPA 5KAIZ 4GYCB 4K40A 3LDKA 2JIZG 1MS5A 4CPBD 2W1UA 3GZTB 5L9VA 3OGIB 3N36A 4DXZA 3WG1A 1NCQB 1ND2C 2HVJC 1V0AA 4MTOA 2XNDG 3P3NA 3ZXJA 4R8CA 2VZPA 5B1BB 1GANA 2XWJB 3GDBA 2ZGUA 4HVRA 1OXCA 5J36A 1JFFB 2FYUH 3VDDB 2ZEXA 4X1IA 4AVTA 4LBMA 2AR6A 1W28A 1Q81W 2QCSB 2B8MA 5BNOB 2D93A 1WP7A 4KP4A 3IIAA 1PKXA 2FD8A 2DVBA 3QOPA 4NHKA 4UXNA 3NV3A 1QDOA 5IAXA 4C90A 4QPKA 3HKEB 2JENA 2Q1FA 3STLC 4X62B 3PIJA 3I2FA 4KH9A 2EULA 5H9SA 2HWF1 2VMGA 3AM2A 3DPRC 5K1PA 4LFAO 1UY0A 1XEQA 4Q0SA 4NAOA 4UB6Z 2E31A 3CJIA 1W0NA 3T2MA 4LA2A 5E79Z 3H8UA 2JE9A 2MNGA 3HBKA 4LMFA 1O4YA 3BKZA 1RIRA 2ZE7A 4FP2A 4LFCB 3WF2A 1BMFG 1K4CC 2QTOA 5JXJA 3G80A 5I8SA 4P9YA 2VMIA 4JGZB 4CDUB 1ASJ3 1OCZB 3WP4A 1U0AA 1GTOA 2VNVA 1WLDA 3LAGA 4KL1A 2RDCA 3S5QA 2RS51 2GBOA 1S4CA 2YIDA 2E53A 4NRPA 4I0AA 3AYAA 1WA8B 1S0JA 5TISZ 2Q30A 4YGBA 3WW3A 2WLIB 2BJSA 4YIOA 3KZ4C 4CUCA 3N9NA 1JR9A 2ITDC 1W6QA 2DTYA 3JCUZ 3LNMB 1LEMA 1UJWB 2FQPA 3VDDA 4DFSA 5LP6B 3CC4V 1DQ5A 3ZYRA 3ZPOA 4TSFG 1LR5A 4L8JA 3WR0A 3NAPA 1OFNA 4JTOA 2ZA9A 5EQUA 3RWKX 4HYOA 2YZ4A 4XJUA 4DR4O 1PIV2 3TYJA 2IXLA 5FKCA 1ZA4A 3HAGA 5BYNA 3FL7A 1UZYA 2F17A 1S55A 4JI5O 4QPIA 1SPPB 2FZ1A 4OHVA 5K9YA 5LXTB 3VDAA 1UY4A 1KP2A 3ZRWB 1RITA 3JALB 2P3KA 3BPSA 3IMMA 3H1KH 4JAUA 1VQ5V 2ZGPA 2ZGMA 2GH8A 3AK3A 1WCUA 5L3EA 5FZOA 4PJ0Z 2EJ7A 1I7FA 2YSUB 2YC2A 3X2QC 1VRH1 1YQ8A 1CJDA 3ZO0B 2BUKA 5JIAA 3N2GB 2D5FA 2RMU1 1XXNA 1GKFA 2GSYA 3O1MA 1PZ7A 1OQEA 3SITA 5FYBA 3N3HA 5JSOA 3BB6A 4CEYC 1J3RA 4NPMA 5I0RA 4DR7B 1KITA 3PN1A 1IX9A 3ZRVA 2UY9A 3CJIB 1BBT1 5CG9A 4OPAA 4E2QA 4QPYA 3VBFB 3AXEA 1XL6A 4LPLA 2A6VA 4YRDA 5BR8B 4ATEA 4O65A 5GKAC 4FM2A 3LEGA 4DR3O 1WB8A 3SEPA 5M0TA 2QZ3A 1XYNA 1XSRA 2VOTA 1PL0A 1O59A 1UMIA 2DCZA 1VRBA 1VBC1 3AZWA 3GVMA 5EIYB 3OUSA 3DYOA 3ZDVA 1Z2GA 4Z82A 4R9DA 2ARXA 2R7EB 4CA9A 2QWNB 2YXLA 2DOSA 3ZHRA 4UW4A 2AHZA 2VVDA 3JD73 3OUIA 1CN1A 2AZ0A 5LWBA 1ZL8B 4O9GA 4XYXA 1HQWA 4JKKA 4PLNA 4B3MB 4JZRA 2R1DA 4BISA 1AP6A 2HWC2 3LA7A 3JQWA 5FYYA 1AXZA 1AR72 4ASLA 1UOGA 1JA8A 1A8DA 3VV1A 2NLRA 1XREA 2FDGA 1MQTA 3ABMC 2IWGB 3CB2A 1D0HA 3K5MA 4GX1A 3UT5B 5I8TA 2AGSA 4BQWA 5D8AC 4E4ZA 2WL1A 5EBMC 4X1YB 3F2ZA 1HB3A 5IVVA 3PURA 4J9YB 3D82A 5JUVA 3E8BA 1LGBA 3SKVA 1SPPA 2WFF2 5IYYA 4ASMB 4ET7A 1CX4A 3T0BA 3AJYA 5B3SB 4EWAA 4BDVB 1KRIA 4LBNA 4NXMO 5LGNA 5FUIA 1K92A 2OVUA 1XHXA 4UFHA 1N1YA 4BOWA 4IGPA 1PO11 4FFKA 4XABA 1XL4A 1AL21 5LHIA 1XNCA 2YICA 5DG2A 4PQQA 3MF6A 5CB7A 3NL1A 4CH3A 3C7EA 5ABJB 1FS0G 4L99A 5C3RA 1S5HC 5FZFA 3OW2U 2R042 5FY0A 4NIGA 5JI7A 4XFBA 2ZKNA 3KHBA 5FZDA 4GKYA 1CQ9A 2OX0A 5K4LA 3VBRC 3W21A 3E8HA 2DF7A 4XFFA 1N1VA 4QGLA 4AQYO 1R082 2FMDA 4XDOA 5EYYA 5G04L 2ZXWB 1GRJA 3RNSA 1B3QA 3ZFFC 4BWOA 5I0UA 1D5NA 5A32B 2P5BA 2B1IA 4AG4A 2QNKA 3ZFGB 2DQ3A 1GZCA 4OHYA 4CU7A 2L35A 1RM1B 4IXLA 4LF5B 2Z42A 2Y4TA 4EZHA 1AL0G 4M0HA 2XHBA 5F1RA 5FY8A 1GR3A 3ST7A 4WFFA 5IYZB 4BQ1A 3ZSLA 2OS2A 2QDOA 4YGCA 4X66B 1N47A 2Y0PA 1UU6A 3CHXA 1W90A 2A7WA 4KWUA 3ZXGA 1FYJA 4ZZ8A 1X4TA 3HR9A 3HR0A 4CCNA 1OCRC 4Y26A 4XQ4A 2QJVA 3JCZA 5EYPB 3BTAA 5GTHZ 3T2TA 1AYN1 1A34A 2VBBA 4DXWA 4XQWA 4S2FA 3CCRV 5IT6A 4I4TA 5F32A 4QE9A 1RHI3 3ES4A 3JCIA 3MEPA 3KV5A 1C8NA 2WAMA 3K3OA 3INAA 5FOJB 3WU2Z 2ID4A 3WXPA 1PHMA 2A6ZA 2BWAA 1TNRA 3E8FA 2ZE6A 1QOOA 4LE3A 1OCCC 3ZMZA 1FXKA 4JZ2A 1MS3A 2UYAA 4HLTA 2HVKC 4DV3B 2BERA 1VQNV 3RYHB 4QJFB 1EUUA 4O4JA 1V00A 2BVVA 3ZSJA 4AEDC 1IKQA 4GZRB 5LY2A 3OEHG 1VBB2 2RE9A 3H3LA 5A33B 1WLCA 3OUFA 3IPVA 1GOGA 3E86A 4IIJB 3OGJA 5L3DA 4GB33 2AYHA 4JGSA 2VOWA 4DUZB 4NRMA 4FPGA 4MUVA 1SRYA 3UT0A 2IC1A 4L9BA 2KD7A 1QXPA 2UXDB 4KFMA 3KSCA 1YITV 1PVC2 4MZUA 2J1AA 3ZXAC 3M4FA 4N43C 4TYSA 1NUKA 1QLNA 1XNAA 1PNFA 1VQ7V 3DXUA 4WFHA 2D6LX 2NMOA 5AVPA 4OUSA 2YUAA 5F6KA 2GMPA 4NAMA 3WOGA 3ZIWA 4X65O 5JOWA 1G9CA 4WFGA 2A9HA 2WNUA 5CZKA 1HRV2 2KG7B 5BNOC 4ES9A 5EWSA 3SQOA 3H1MA 1WN7A 5KHIA 2R49A 5E1AC 3NNLA 3G6BA 1RMU1 3W7SA 1HNZB 2GU9A 3BYWA 2TBVA 3HKBA 4S2HA 1N34B 1LODA 3AP5A 1OUSA 3QH7A 2XJRA 1PVC3 4MHUA 4QPIC 3Q4HA 3AMPA 1J3PA 4GH4B 1S0VA 4UF0B 1ENSA 2Q67A 3NKTA 4PF5A 4Q0VA 1QMJA 1SQVH 2HJFC 1ZZ6A 1GWKA 2XBO1 1SLTA 3H1JH 1DYOA 4TOIA 4KU7A 3DTUB 1YQCA 3AK0A 5EJ1B 4R4XA 2Y4UA 4Q20A 3I3QA 1O8SA 2C26A 4C91A 2N74A 4DUYO 3NV4A 1BK0A 3ILRA 3KF5A 4GD4A 1YNAA 2QQLA 3F95A 2XBO2 4AEDA 2DWRA 2DWDC 3MV11 3ZFEC 4QX5A 4J10A 2O8QA 4K8FA 5HCBA 1RUE3 5LEJA 5BNNB 4FLYA 4EE2A 3OBRA 3MF9A 1W2UA 3RJRA 1GM9A 1UYZA 3ZYHA 2IM9A 4PT6A 1N32O 2JX9A 4IGQA 3I2IA 2WLLA 5JJJB 1NLSA 1EV12 1OV9A 3ORJA 2I45A 2BBVA 4I0BA 3ZSEA 3SH4A 3ACFA 1DZQA 2QA4V 3U37A 3LSEA 1PK6C 3C3TA 4UCTA 4A42A 4E8DA 1AYM2 2VZSA 4D7TA 2JDKA 3Q8EA 4ONUA 3DC5A 4YW6A 3ZBHA 3RVYA 5A80A 5FZ6A 4FLZA 2KG7A 4HETA 3BIWE 5FBJA 2ZNIA 3W7XA 3OGCC 3ROUA 4Y1YA 4OXSA 4YHHB 5A7NA 5FREA 4AAPA 3JAMN 1R1A2 3WW4A 2RQ6A 5FZ1A 1N1SA 5A1FA 5EIBC 4RGGA 5HXVA 5FK7A 4LFCO 4MTXA 1CAUA 2WZR3 3N27A 3VD7A 4NHMA 3E1F1 4JKLA 4XTMA 5T5JA 2QKAA 5ANQA 4LQRA 4RD7A 3L73H 4X65B 4XILA 5CIRA 1PM9A 3PMEA 5FKBA 1UD1A 1Q6HA 3NMBA 1WLTA 1NQTA 1M06G 5A3OA 4IE7A 3RZKA 1DTOA 2GUZA 4LBQB 1F9KA 2ZCEA 2PHLA 1Q56A 1KS5A 3KVAA 5F5QA 4TV9A 2ARCA 1VF6A 1HRV1 3ZM8A 1W03A 1JHJA 4MVZA 1K3IA 5H6RA 1O5UA 4AEMA 5CEHA 2OT7A 1Z7S3 5CISA 4P5YA 1Y67A 1I5XA 2EIEA 1IS4A 1VF6C 1HXS2 5FY4A 4XJ8A 4UB8Z 1M56B 1F4HA 4G9SB 4XDLA 1W8WA 3P6BA 2UXBO 3KB5A 2ZS6B 5A33A 1FX5A 2ET1A 4FK5C 2F43G 3EQEA 3W5MA 3ZMUA 1R092 1V6OA 3VBRA 3OGSA 3NWKA 3SISA 3APBA 1ZZCA 1ZM1A 3WY6A 3IFXA 2RMKB 3N9OA 2VZ3A 1AL22 4CH5A 2Q1ZB 3T4VA 2DE0X 1FFTB 1REDA 3PMSA 4SBVA 3J4UH 1PGL2 2OWOA 1W99A 1ZBA3 4I0XB 2IFWA 4I7ZB 4I50A 2J7MA 3KKYA 2EAAA 1GICA 1W9SA 4LNVA 4UFIA 1FOD3 2JEXA 5L9RA 4P9JA 4NXNB 4IV1B 5FPOA 4LO4B 1ZZ7A 1WPBA 3LPFA 2ZEZA 1H4GA 3H3UA 1W0PA 1XE0A 4MVTA 3FB5C 4OVEA 4IV3C 3ZEDA 1OSGA 4GULA 1RUC2 5JAXA 1D5AA 1VJ2A 2X10A 4BQ4A 5FMDA 4LNUA 5FL7G 3ZMOA 4BHPA 1AR73 4NIIA 3B09A 2GTAA 2Q7EA 1VBA1 2RS11 3E5UA 2X53S 3L72H 4I4TB 2WT1A 3NNMA 1K34A 4JYBA 4AI3A 2VZOA 2R0HA 3MUZ1 1XNQB 5A7OA 2UWAA 3BIEA 3ABMB 2JICA 3D3IA 2WNUB 2NNUA 1O4ZA 3VBOC 1Y9GA 4XCAA 3LSUA 4QIWF 3CCJV 1W9YA 5DAQA 1VQ6V 1NE4A 2WS93 2CAVA 2OCHA 3T1HB 3KV6A 1YI9A 1A78A 1OKQA 5JZGC 4TQDA 4CDXA 2VZTA 5F39A 3WQ1A 1IGOA 4ZPIA 4YJ2B 3EFFK 1FJGO 1BEV1 5FYVA 1ONAA 2V1DA 3P32A 4JI4O 4Q29A 1BCCH 1F4AA 2YS8A 3J7HA 1EZVH 3BY6A 3O1OA 1WBFA 4AFBA 5FMCA 3ETDA 3NV1A 3PUAA 1AB3A 1SLAA 5FZ3A 1UXZA 2QM4A 2PF4E 3CLPA 2PTMA 1TMF2 1H8EG 4RQPC 3QO7A 4XDKA 3GWKC 5IYZA 3WP5A 3VB9A 4EKWA 2GH2A 1CAXB 2O1QA 3S3WA 2P06A 1FMD1 2ZPXA 1FPN3 4DR7O 1NY72 4OYUA 1OLME 2BW8A 4CC5A 1YEWA 2HKOA 4ZU5A 4JV5B 4NXMB 2VGDA 1RINA 4IE5A 4JDMA 2ETEA 3H8OA 4BM8A 3JBG2 2ZGKA 2OKXA 2P22C 3OFNG 2YY1A 1RMU2 2LP7A 1MEC2 3WVJA 3EJKA 5A7QA 4P9LA 1XHZA 2XJSA 5D5PA 1AF9A 2HEVF 3FAVB 1ENXA 4CXYA 3EYPA 2ZZJA 1R6NA 3HB3B 5F3CA 4ABMA 1H1IA 3O1PA 1VLNA 2JDUA 4AQYB 1S0DA 4I01A 3HIFA 3MPBA 2DW4A 1PIV3 3K0DA 2W9XA 3IIIA 5GZDA 3B94A 1JYCA 1J83A 2CDOA 1D4M1 2ATKC 3ZN6B 4LF9B 2JEMA 4EN6B 4LKSA 3NNGA 1IBKO 2R9IA 3JATA 4X1YA 4IE4A 4J1WA 4XUOA 3WNOA 4DO0A 2DV9A 1BHBA 3CMEV 3TBDA 2JECA 3OE7G 1ND3A 1I94O 2VZVA 2Q0OC 3PU8A 4ZOLB 3BU0A 1VBB3 2XDVA 3GZUC 3DF0A 3UV9A 2RM22 1URXA 3GBWA 3JASB 1S3JA 3VZNA 5B1AB 3WCSA 5LYJA 4XIOA 5HV0A 3O5SA 4HG6B 4Q26A 2HBUA 1PGL1 5JMOA 4IHJB 3WNKA 2G9GA 3GCWA 3T08A 3I2JA 2EF6A 4DR6O 3C8XA 5ACA1 1GM8A 3VZLA 4Y5Z0 2QFEA 1DZTA 2NN8A 3LD8A 4U3FH 3AMNA 2B9VA 5E89A 1Q8OA 2ZX4A 2XKOA 5L7OB 4XFIA 3OTOB 3BABA 1H8TC 2DMXA 3SYOA 4QX8A 5T5PA 1Y66A 4XDJA 1DGWX 3RI9A 2WPDG 3K59A 2JKXA 1XNBA 2QWPB 3NJYA 1NR1A 2JDZA 3V0AB 1OQDA 4LUMA 1N4CA 3F5TA 4P9IA 3SPIA 1GP4A 2JWPA 4KI5M 2GALA 3NSTA 1XE8A 2HWB2 4P5HA 2GNBA 1RUF1 4XHXA 3T4ZA 1WCDJ 4QQOA 2RCVA 2PA7A 3K0GA 4FLWA 1NXMA 2QDRA 3AK2A 3SJCC 1ZBA2 2W92A 1AR4A 2F95B 1EPZA 2GP3A 1NT2B 3TNQA 1AVMA 2VD7A 1AI4A 5FXVA 1QJU1 3J81N 4FVMA 4UBGA 2AGAA 1N0JA 1L3JA 4O4IA 4I9QA 1M57B 1PX3A 1DYPA 3I4IA 1JOBA 2D5HA 1R1A1 4TUYB 1QQP3 1N33O 1P8JA 2ERFA 4B3SB 3LUTB 3CRQA 3ABTA 3JARB 4JI0O 1KDKA 3M99B 3T1MA 2XAGA 5FYMA 1D0GA 1B09A 1ZX5A 5FQ0B 1F5JA 1NJIW 3AYCA 2ZGNA 4CCJA 1JZ3A 3OG2A 4QM9A 1CAVB 4RFT0 4COZA 2WSVA 4FT8A 3H0OA 2P3JA 1URFA 4FPLA 1RPRA 4A6OA 3WCRA 1FXKB 1MVEA 5FXWA 2Y6GA 4DUWA 1OVPA 1S1AA 2JE8A 2YGLA 2Y6FA 2K0GA 2I07B 4IGOA 4JX0A 4B1MA 4LIUA 1PO12 3KT1A 5GZFA 2ZAHA 1VPHA 2WLNA 1MEC1 2V72A 4AQ6A 1V9U2 1SQXH 5HCHA 5BNNC 1E57A 5FUNA 1LOFA 2QM8A 4QHOA 4MVUA 4PDLA 4G2KA 1QF3A 2EAKA 2W1SA 1VP7A 4MSVA 4XEZA 4NWVA 5CBFA 3ASIA 5IK7A 4WBBA 1GOHA 3HQXA 2CAZC 4CP2A 3B02A 2VNGA 1PK6A 2GDSA 5FYCA 4WM7B 5KMGB 4XXAA 4AVAA 3OGVA 3TWIA 5I0DA 3I55V 4KBZA 4G27B 3VBOA 4Q4X2 5EC1C 4IV1A 1YF2A 4L87A 3HT1A 1RVF1 4UFKA 2ZGSA 3RYPA 5ITZB 4LP8A 1C8M3 3JATB 2R72A 4OUMA 1XYPA 4MLOA 1AJQA 2JG8C 4N43A 4C0HA 3Q8FA 3KWVA 1FXHA 4U36A 3SXWA 4D6QA 1EM1A 2IU0A 1HLCA 3BOPA 3HKDB 5AC92 1XBFA 3VDCA 5IVCA 2IXJA 3DSQA 5CKMA 2WA4A 3W7WA 3X29B 4ZKIA 5FLXN 2Z79A 1QJX3 1YJNV 2OTJV 2HWF2 1F2NA 2XAFA 4K3AA 4YG3A 2BTVC 2CY6A 1FPN2 5F3IA 3OMIB 1YDXA 1DIWA 3MLKA 1R1ZA 2GNTA 1LULA 4QQPA 5H5NA 1ZRFA 4GZ9A 4QMAA 3JAWB 1X33A 4Q4W3 1XSQA 4K21A 3FB6C 3B40A 4B4PA 3N2KB 1M4UA 4I30A 4LFAB 5A7PA 5KHHA 1VMJA 5IFPA 1PMHX 1NCQC 5LYJB 2BNNA 2WO2A 1ND2B 2QQKA 4HXCA 3J8F1 4HKLA 5H9RA 5E88A 2EXKA 4Y22B 4CCMA 4LBOA 3M7AA 2A79B 3KHCA 3DUIA 4OX9B 5A7WA 3DXRB 4Q5OA 3VDDC 4RSUA 4S2GA 4WM8C 3L2YA 2EIJC 3JAKB 1I08A 1GAXA 4XMAA 1IURA 1WCSA 3NO8A 5DUUA 2WUHA 3CC2V 4MXVA 1GSLA 3RT3C 4U3JB 1H2GA 1PNMA 1OKOA 4QHZA 1Q90D 3N9MA 5F9TA 1O91A 4IV1C 4CCKA 1RTVA 4TSVA 3UJOA 1Y74A 3CD6V 3WHUA 4LXLA 2UUAB 4V1PA 1JYIA 2Y0IA 4GB32 2HKXA 2JDHA 1Q3EA 1QXRA 1CZTA 4DY5A 2WT0A 5C8YB 4WM8A 4JI3B 1N8RW 1Q5OA 1H1MA 3PUIA 3GZAA 2PGGA 4UF0A 3PJQA 1VQKV 3K5NA 3I5DA 1W6NB 2P6JA 2BFUS 4NROA 2KM2A 4DXRA 3ZMSA 5HFMA 4DV6O 5ABJA 3EMRA 4X1KA 4MTFA 3ILFA 3KCYA 5JCTA 3A23A 5BNPB 3MLJA 2QTWB 2WLLB 3G4SV 4ZU7A 1NTKH 4QPGC 1MZ6A 3BCCH 2UWCA 5A3NA 3VZMA 3T30A 1UZVA 4MOAA 5ACA2 3ZXLA 5FJHA 1XNKA 1MPXA 3RJ2X 4FP3A 3MW4A 3THCA 4X1KB 1Z5WA 2ZX2A 4OZOA 3CE2A 1KUQA 3LIGA 1WMDA 1AYM1 4I0WB 3DCQA 1N3QA 2YHJA 2WYSA 3JAKA 1SZBA 4A7YA 2K2SA 3WNMA 2A1XA 3HNYM 4LWSB 4JZGA 1COWG 4D7YA 1COV1 3LEMA 1FPOA 4RQPB 4XF9A 3EHKA 1CD3G 4JI7B 5LA2A 2UXCB 2XPJA 3IB3A 3GBFA 4CDWB 2ZJCA 2XTAA 1G9BA 3ILNA 4LF4O 4PA9A 5LZ6A 4DY3A 3HD8B 4HFSA 1QJU2 2YB7A 3ATGA 3SCHA 4A4AA 1REEA 4LHLA 2NZ9A 1K5MC 4D6RA 2C24A 3SHRA 3APQA 2D40A 5C5UA 2Q0AA 5FR3A 3IMNA 3K04A 4M3CA 1TEIA 4MX3A 3A22A 1GKBA 3POSA 4J42A 4DZGA 5LA1A 1B04A 3MUY1 5DMYA 1MQTB 1S0GA 4HPKB 4AGRA 2GAUA 4XBFA 4XDQA 3NJZA 2BV4A 3VBSC 4XF0A 1YXWA 2P4EA 2TUNA 5B2GB 4TN7A 4JI2B 2QQIA 4NUBA 2E33A 2X8KA 4CEYB 3KV9A 4LO8A 5DDJ3 4X64O 3CX5F 1CPNA 1HJGA 4Q6GA 3ITQA 1RUJ3 3FFZA 3CJIC 3ZIXA 3ZRSA 1YTFD 2W94A 2XHNA 3JB4C 4LH6A 3ZIAG 5GLZA 1YJLA 2HYKA 4YWAA 2X6AA 1EV13 1J3QA 5HCAA 2AREA 3RYFB 4J80A 1WGPA 1F35A 4B3SO 4OLLA 3UGFA 4QGPA 2Y34A 3UKVA 5FWEA 4CDQA 4ZIBA 1IS6A 1U12A 5CBHA 1JZ8A 1PMIA 2Z5WA 3I3EA 3AG2C 3FLPA 1XRUA 4AGGA 4TV8A 3R4SA 2WZR2 1GZWA 3IM0A 2AHYA 4FJCC 4Q1RA 4D0QA 3R4UA 2GC2A 4MADA 3RZJA 1OOPC 3POBA 4FXGB 3N2KA 4JDNA 4WFAV 3K58A 1LOGA 5EJ3A 4A45A 5AFBA 5KXEA 2Y6LA 1HXS1 4E8CA 4J7KA 3KG2A 4F8AA 1RC6A 4H7LA 2D43A 1H8TA 3Q8CA 4RQFA 1QNYA 1TME2 2JDAA 1KKDA 1VBA2 4PDRA 1R091 2XVGA 3TN92 1RUG1 1XPWA 2VOKA 2RJKA 1AR93 1XNDA 3RSJA 4XF4A 5D8AB 1SACA 3BVCA 3WF3A 1K7DA 4QX1A 5K1XA 2P4KA 2WC2A 3WSOA 2ZGLA 3ETEA 3CWBH 5LEKA 3CJHA 1F7YA 4COYA 4NJ4A 2GN7A 3BTXA 3I2DA 2PFWA 1A32A 5IJ9A 1UU5A 1CIWA 2ZQMA 1W0JG 1UL9A 1DHKB 2ZABA 3H1IH 3TEWA 2MEV2 1BVVA 2H0VA 1WPXA 2ZE8A 5LBEA 4M3CE 3AKTA 2YPJA 1PZ9A 3FB8C 1DZRA 5LL6Y 3OPWA 1MA1A 2QVSB 4IUGA 3BEHA 2GNMA 3N7LA 5IW0A 2GMEA 2RS32 2RR13 3VBRB 3G6EV 3VBBA 4P9PA 2GC3A 3WW1A 3N35A 2PHRA 3WD5A 3UO2A 3WNXA 2ZKOA 2JD4A 1GH6A 1VF5B 2QQJA 2CUGA 4N53C 5J37A 2YI9A 4GX5A 4U7OA 1QJX2 2ET7A 3BOWA 5C3PA 2EBOA 5LMUO 1KGYA 1GMGA 3BCWA 4P30A 3SJQC 4DV7O 2JGUA 2UU8A 2YBSA 1Q8VA 4DRVA 1Q7YW 4F3JA 1IXBA 3H3ZA 4V2VA 4B7KA 4N53A 2D97A 3ZFGC 3JSLA 1KBHA 4XVHA 4AQTA 4QQLA 1FAFA 2DCKA 1M4WA 1K4DC 4DV0O 3ON7A 5A3LA 2ZDIC 2WO3A 1YI7A 2VQFO 4PDWA 4YXWG 4IE0A 4JV5O 1TMF1 2HWD2 1ZBE1 4KG0A 2XAHA 1RUC3 2XQRA 3HNMA 1C1FA 4X66O 4EJRA 1G8MA 5A6YA 5GW7A 3SYAA 4N9IA 1L0LH 3U0ZA 4FQZA 4YSFA 3I7DA 4UAPA 1JYVA 2WJSA 1PZ8A 3EXUA 2VQFB 3SH3A 2ZDIA 4NO4A 1F4NA 4DRXB 3VD4A 4AQ2A 2QQOA 4FOYA 1WB7A 3RYCA 4IYHA 2PI5A 2O0OA 2EIKB 1I1EA 3ZN0A 2IBZH 1IDSA 1RUI2 3OY8A 1VBD2 3RVHA 4YM0A 1NZ6A 2ZEWA 3SJAC 2BYVE 2JG8B 1NZCA 1POV3 4JI6B 1OCCB 4LHSA 4CP9B 1POV0 3DPRB 3LSSA 2VCCA 5JXHA 1SFNA 2BTQA 5CFDC 4MHRA 2WN3A 2C4XA 3K3WA 4CP0A 4A3XA 3H42B 3D0JA 2ARBA 5H9PA 2AACA 4AILC 2ZMNA 2VMFA 4UFZA 4ZS2A 1Y6XA 4MVQA 5HPOA 3W20A 3CCEV 3JUUA 5FYHA 1OPMA 1V6IA 1Z7S2 3CF6E 2FHRA 1OI6A 5FIXA 2XJQA 1Y76A 2RS33 2QQNA 4QKDA 4K8RB 1M9NA 1LNQA 2IH1C 1MSWD 2VQEB 3ALQA 4COUA 1R64A 1BBT2 2NM1A 1JU3A 4FFHA 2ILMA 5L3CA 3R6SA 4RUFA 3J7MA 3HEIA 4C0BA 4W6WA 4YM1A 4K6BA 1SA0A 1RGSA 4GKKO 1BQ0A 5BR8O 2WFF3 2IXCA 2EINC 1IS3A 3GWOA 4CZZA 3ABKB 4I55A 1BHGA 1GV9A 4BXSV 2P1BA 3RZZA 4JVAA 1WA6X 2EIJB 2OUHA 4P14A 1NKGA 1UY2A 1N34O 5CKQA 1NG0A 4YJ3B 4WM7A 1XILA 5T5LA 4AI0A 3TOJA 1NKDA 4P9GA 1ZREA 4UVAA 4QXCA 4XHBA 2GSMB 1Z0HA 2R062 1KKCA 5E8AA 5AC91 1BQPA 4U7NA 4F83A 2HLDG 3W58A 3THTA 2D6NA 3WB2A 1TNFA 2M7WA 4OGQB 3H8RA 1GN3A 4UWDA 4IEVA 1H0BA 1XU1A 5A2QN 1DFQA 3POWA 1S2EA 1YIPA 4QPJA 5LMNB 3AC0A 2D6KA 2HFEC 3JSNA 4A5UB 5A3UA 5C8YA 1YHFA 2VUDA 2ZZQA 1G9FA 4MVOA 1NZIA 5CFDA 2A6WA 3THPA 3TJTA 1K8AW 1NA1B 5IJ9B 3T3YA 2B1GA 3VKLA 2XBO3 5BNPA 4ZXEA 3ZYPA 4WZFA 1LKNA 1QU7A 3K5LA 2QEXV 4NKGB 4UFJA 5FLIA 1EZJA 2RJZA 1PO21 4ISQA 2JG9B 5D21A 2KKWA 4QAWA 2X6CA 5GONA 1X50A 2GNDA 2Q8OA 3OBTA 1W8HA 2YBPA 2B42B 3IDCB 3PVNA 2PY5A 1KEXA 1ZNPA 4G4FA 2E6VA 4NVPA 4IE6A 5FZGA 1JJOA 1LECA 4JI2O 1W8OA 2E7QA 3H1YA 4YZ2A 2E51A 4TWTA 2VUAA 2G1MA 1JMUB 4LHKA 3KT4A 1QCEA 2P17A 1ZRIA 1TVKB 4N21A 3JB8A 3JYCA 4OMDA 2XXZA 2RDQA 1Q8QA 2VULA 3QBQA 1HB2A 2CH7A 3ZMVA 1S2BA 2WNEA 2R30A 2AZ2A 4AWDA 1EFRG 3MFAA 1EAH1 3KQ4B 4GX0A 5C6CA 1ZZBA 5L3FA 1CZSA 4BMBA 2JB8A 1G86A 1RUD1 4AVBA 1JHNA 1LB2A 3B93A 1OVSA 1SQGA 3ABUA 4XBLA 1ASJ1 1ULDA 1TME1 2UXBB 5JCOA 1DGSA 1BE3H 4EV0A 3VHOA 4HL0A 2D2CB 1ND3B 3MZHA 2UXCO 2H6BA 5FO9B 4YM2A 1U5XA 1IBMB 1YIFA 4B3RB 5L36A 4AHWA 3EO6A 1BBT3 4ZHQB 5LA0A 3IZOA 3RDIA 5T52A 1VQPV 4LKEA 4XACA 3QACA 4FI9A 2F4PA 1JH5A 4CUBA 5FPZA 4DR3B 2ORXA 1M56C 4CP1A 4O4JB 3R0RA 3JQXA 4DV0B 3V0BB 3U4XA 4AHCA 1QR8A 4NPRA 4FOWA 2EIDA 4XC9A 5GZCA 5IYDO 3LQCA 1A8MA 3U11A 4XW3A 2BTOA 3HWJA 4Y20A 4YVSB 2BGOA 2MEV1 1Q8SA 5KAFZ 1NT0A 3F7VC 2CGPA 2VZQA 3A2FA 4LE4A 1UNBA 3LIHA 2HWC1 4Y1XA 1EN6A 4GWNA 3AB0A 2OW4A 1O3QA 3A0KA 4H55A 1N3OA 4DV3O 3FE5A 5ABJC 3RZMA 3A0NA 4X20B 2SBAA 1ENRA 4MH0E 4J1XA 1O6UA 3BA8A 3WUCA 1IQAA 5EBWC 2DDUA 2XAQA 1I0HA 3LA3A 1ZBA1 2JK5C 3MO4A 1RUH2 1AR5A 3ZX6A 2ADDA 5E16A 1ULPA 3AG4B 3NAPB 1SMVA 1ULCA 3S7EA 5FDBA 1EUTA 1V6NA 2UU9O 2J1VA 1UOBA 1XUQA 4DXTA 1KMIZ 1KD1W 4FPEA 2D3SA 1ZRRA 3K48A 1W2OA 4O4LA 2UXDO 4IQPA 3AL5A 2ZEYA 2XT9A 2ORZA 1PVXA 2FDIA 4N90A 2VM9A 4A2UA 2IW5A 2JDNA 4LF7O 1WWYA 1JQ0A 4DV1O 1ZVFA 1D2QA 4YNIA 3RG0A 2P37A 4BMEA 4LJHA 4IEYA 2NP0A 3ACHA 3CCQV 5FY9A 5EC2C 4X88A 1PO13 5KUMA 2JRIA 2VTXA 4DXSA 2VNRA 2P6CA 4CE8A 1LU2A 1KFUL 4OHWA 4BU2A 2FTKA 3VBUB 5BPXA 1HRV3 3HMYA 2P3YA 3I3DA 5FUPA 1KD7A 5F2WA 2PYLA 3E6CC 4B3MO 4TV9B 2D98A 4N9HA 4F6EA 1O7FA 4L2NA 1J95A 3UKNA 3UQ8A 4A3ZA 3ACLA 5FBZA 3FX3A 5FO8B 3POJA 3C2UA 2PYTA 2DVGA 4FTSA 4HT1T 1QJY3 1QGLA 4RS5C 4Y20B 4YVSA 3JASA 2HP8A 1LEDA 3TN93 5C3OA 2RJ2A 4BQ2A 1M90W 4EEQA 5IE9A 3FHAA 4BZ4A 2XUEA 2IVIB 2F6BA 4FPPA 3JD2A 4RS5A 1GNZA 4ZONA 4PIZA 3RQ0A 1L7QA 5DM6V 1K5JA 3THOA 1OA4A 2PLV2 1K42A 5A1AA 3E97A 2F1MA 4FM0A 1SEFA 3MW2A 1FV2A 4HN1A 4FFFA 4HK8A 1JYWA 5JR2A 2VUCA 1CXZB 1AYN2 5A6XA 4X8AA 2ZBJA 2C9AA 1AXYA 2WS92 4Y33A 2EXHA 1L0NH 1H6XA 1W6OA 2NQYA 4YY3O 3GCXA 3AP6A 5LW9A 1Y74B 5IVYA 4QKFA 4M3CB 1E5RA 1OURA 3SLIA 5D8AA 3AJZA 1W2NA 4N43B 4UCOA 3VBSA 4PBOA 3UKMA 2VL4A 4JTAB 1DGRA 4YFWA 1D2SA 3U75A 3I8TA 3KF3A 5IJ0B 1BLZA 4CEWB 2LTNA 5LHHA 3RYFA 4IEXA 4OI4A 2B9UA 2E76B 4AEJA 3BTZA 4B3TO 1XOUA 1V55B 3T4DA 3OPTA 2WS91 4D8MA 1HRI3 1CZVA 1AHSA 4W4ZA 1R6TA 4ZOLA 3K9AA 4IT5A 1UQXA 1AR83 2PI4A 3FLRA 4OMCA 2PQSA 1OHHG 3I2KA 4XAEA 3D3QA 3I3BA 1WAZA 3TAYA 1Q86W 1HN0A 5C5TA 4D94A 3D6EA 2OYQA 2QJ1A 1LR1A 4JRAA 1EN5A 3CU7A 1V54B 2DBIA 4E4SA 5KA6A 3ELNA 2JG8A 4Y4YA 5FJKA 1BMV1 3MFCA 2K9ZA 4GH4C 4NHYA 5C9AC 5LHGA 5J09A 5JXGA 2VUJA 3D8CA 5J3UA 1G1XB 2Q5ZA 3ZLIA 2CTPA 3I56V 2Q8DA 2QSAA 5H9CA 4P00B 1YLLA 1BQZA 2SLIA 2IVJA 4AHZA 1RUI1 4P02B 3LE0A 1YHQV 1QLEB 3FFQA 1J5EO 2IZWA 1OC1A 2V4VA 4I09A 4O2AB 4URTA 5KC5A 1VARA 1SCSA 2ZR2A 4I50B 4E9KA 4QHBA 1P4RA 5FRAA 4PDWB 3K3NA 1KFXL 2CSGA 4JAAA 2JEUA 4DYLA 5LBBA 2B5UA 1RUD2 3MIEA 3RYIB 1QQP2 5C9AA 3WLUA 3LGRA 5JXIA 4D69A 1GO3F 1ZRDA 3UJQA 1KS4A 5J9PC 2JIJA 4CXWA 1RMU3 1KJRA 4FTBA 4YZ5A 3U07A 3EB7A 3WT3A 2JDIG 2EINB 4KG8A 4JASA 2Y48A 1SLIA 3VN4A 3BUCA 2FB5A 4AVSA 4NYKA 3ZFGA 5KBFA 4C7UA 3IBMA 1RXGA 1TUBB 1NQJA 4W4LA 2VCBA 1W2BU 3VL9A 3ZS8C 1O9GA 4PBPA 1TA8A 1OCOC 1QJU3 4I5SA 4OULA 5FPBA 2H6CA 3SH5A 4NOTA 2JB4A 3RVZA 1ACCA 3RRDA 5FCCA 3QLQA 4NIDA 4XUPA 3J26N 3G6JB 2C1FA 1GM7A 2EIMC 3DKWA 1QJY2 2EIBA 1EAH2 1Y9MA 3RW0A 4EN0A 3AX4A 5KHKA 4B4QA 1PP9H 4RGAA 3HVDA 5D2AA 1UOFA 2WYFA 4JV4A 5ANNA 1RUJ1 1SQ4A 2ARAA 1V6JA 4OHXA 3VKNA 1KB9F 1V9PA 1X82A 2IU3A 4WVVA 2HR3A 1RB8G 1SKVA 5FP8A 5FP4A 4QD2A 5T5OA 4LIVA 3RS6A 4IIJA 3OBZA 4W65A 2EX3A 4CUGA 4CU9A 3QD6A 1YSCA 1HIXA 4LC1A 1YYNA 1BJQA 2MW2B 2KB1A 3HOBA 1JU4A 1QJFA 4QU2A 5BXXA 2Q4PA 3RYHA 4DQAA 1QHDA 1MOFA 1JZ4A 2Y69C 1K73W 5EZWA 3K51A 4DV2B 1ZL8A 1AI5A 4Q4V2 1YWKA 2RMU3 3OYWA 2XB6C 1WW7A 3DXRA 4JTDB 3MPPG 3E89A 5C3QA 3WDVA 1UIKA 4R9AA 4AZZA 3JXSA 4MGZE 4HAMA 5JVDB 2JJ2G 5L7OA 4Y4RA 2CAUA 4JYCA 2P2KA 1UAIA 2B46X 2R071 3VHRA 4QXHA 4QDRA 2Q4SA 1FMD2 1BGYH 3ZN6A 5LBQA 1IQDC 3MGUA 5A3PA 5JOYA 1UOJA 3A0BZ 3OGRA 3T1HO 2FL4A 2J1EA 1K97A 3SDLA 4WCEV 1JTZX 1SBDA 4CH6A 3IC9A 2WWJA 1QU0A 5DAWA 1WMXA 5KWRA 2OIGA 1H1AA 4IGGA 4IV3B 1LHNA 4UCUA 1V6LA 4XXPA 2OPKA 3CXCU 3L2HA 4OCTA 3I2HA 4HPKA 1J5EB 3S3XA 1RUE1 2LW1A 1MS8A 3TXSA 1DQ4A 3W7UA 1UYPA 1BXHA 4Y5TA 2PUSA 2BOIA 1IG3A 1CESA 5EP9A 2YFZA 3N2GA 3E6DA 4DW1A 3TNPB 3ZSMA 1EBOA 4AHYA 1RUNA 4FPOB 3GYDA 3VZOA 2YGMA 3R05A 4YW1A 1TVGA 4QPGA 3O9OA 1YFYA 3CO2A 5IK4A 3HKDA 2YDEA 3WHTA 2K9PA 4AI2A 4H7MA 1H9PA 2DYSB 2FMLA 1H9WA 3ZXKA 3TCUA 2XJUA 4Z8BA 1Y7BA 1ZRCA 2E75B 3M3QA 2NLJC 3OF1A 1I94B 2DYCA 3AG1C 1VF7A 3KCCA 1UX7A 2XLGA 2K46A 2Q1MA 2VOVA 5IK5A 1IBKB 3WQ0A 2ZXQA 2XAJA 4B3TB 2OCCC 4CBCA 1QOSA 3LA2A 4JTNA 2E63A 3WINE 2HEYF 5A3TA 1W0OA 1OH3A 4HVOA 1KYOF 1FATA 3K4DA 3FLTA 2WWSA 5EFUA 1I3HA 1S0IA 2FDFA 4OI2A 1S0CA 1KXGA 4B7EA 4QKBA 2VMDA 5BNNA 1BCXA 5J2TA 2LRPA 1XNRO 1C8M2 4XUNA 2Z69A 1DF5A 1AR92 4YVWC 3AG4C 3NAPC 3KZIZ 4JKMA 4O9EA 2RV9A 1ZYBA 1GNYA 3THDA 5IHRA 2AUYA 3G67A 4UT5A 3WG7B 5IYCO 1XI1A 4LF6B 2VNOA 3BRCA 1ZX3A 4EYUA 4YM3A 5FAXA 3VKFC 3AG3C 4E4HA 2DQ0A 4LT5A 3ENRA 3VBUA 1ROPA 1W9WA 2VOXA 5FZ7A 1AXKA 1UYYA 4QGMA 3ZKYA 4JAVA 3LEKA 5A9GA 3NR7A 5DAXA 1YQ2A 1B6QA 4H33A 3I49A 3VBUC 3M2MA 1QJZA 1H2MA 1DF4A 2CWMA 2RJLA 2PLV3 3MLLA 1JODA 3J7NA 1LHUA 2N7GA 2VQUA 3CYOA 4CS3A 4H37A 2HWE3 5JDBA 5GZEA 4QGNA 3JD71 4L11A 2CGNA 4LBQD 5KR7A 3DEMA 4G28B 5A7SA 4Q4V1 1MG1A 5J1XA 1GWLA 1CAVA 2HYXA 1LNSA 1IZ3A 4I3PA 4HNAA 4MGIE 2HJIA 5FYIA 4AFDA 3H8XA 4YPJA 3ZXFA 4ASUG 2GTSA 1XBLA 5IY5B 3V0AA 1IPSA 2R063 2LFRA 1UZZA 3B8MA 4GX2A 2YI8A 1VMFA 1WW6A 1C57A 1B35A 5CB4B 1F31A 1ZWIC 1GNHA 5DPNA 1SF9A 3FBMA 2VH9A 5LP6A 2YUEA 1ULEA 5BV6A 2VZUA 5AFEA 1ZAUA 4W4KA 2QWOB 3WDYA 1YFWA 5IWFA 3B8NA 3RWNA 4DUYB 2W0FC 3OPZA 2HJDA 2DU1A 4Z2AA 3DECA 2G4IA 2BP6A 4O4IB 2Y38A 4RGKA 1CAWA 4Z92B 3TRSB 2ADEA 3S7IA 2WWWA 3VBSB 3GALA 1NOVA 3W7TA 1RFYA 1NTZH 2XLFA 3ASOC 1HJFA 3E5QA 5LMNO 1AR62 1LHWA 1NE6A 4CDUA 1GUIA 2XH6A 2FDJA 4IEZA 1MS4A 2VXRA 2ITCC 5FXXA 4UW3A 5HXMA 4U2AA 4JHZA 5KXBA 1O3SA 4MW8A 3UYJA 3WQ7A 4DV5B 2RHPA 2D3PA 2PHDA 5FV3A 1WLWA 5FFOC 3VHNA 1FV3A 3STZC 1UMHA 3JARA 2BDRA 4LK7A 3USUB 4WBNA 3J7LA 1JOYA 4QB6A 2BOBC 4EQVA 2V73A 2GUZB 2OUJA 4FPKA 4QPWA 2ZACA 4JGZA 4BAYA 4E4DX 3E6BA 3O0VA 1EV11 2VXJA 3KGZA 4BW5A 3FD9A 3MAQA 5A6ZA 3LF7A 1OCZC 2HBTA 2XOKG 3PU3A 5LA9A 2W3JA 1ENQA 2Y6JA 1OOPB 3CRMA 1S77D 3WNPA 1OFSA 1VBE1 2EXJA 4FLUA 1C3HA 2ZX3A 2WAAA 2W08A 5CAZA 2PHUA 3D4KA 5DAPA 1JUHA 4SLIA 3VQYA 2F23A 1F8VA 4A6SA 1FXKC 3P5BA 3FUOA 3POYA 3W9AA 4D6SA 3T4HB 4NWWA 4W50A 3C7OA 4MV2A 4EROA 1RUF3 1RM1C 2BNOA 3GHMA 3UETA 2CH7B 4NIHA 3B77A 4BCUA 1D4M3 1HNZO 4BYYA 1XNTA 3LEIA 3O1VA 2ZNJA 5F5CA 4M4RA 1NCQA 3ZSKA 1G4YB 2AEZA 2DFCA 1VMHA 4X8NA 5DEDA 2ZHLA 4RHV3 1GOFA 4LF9O 4G3YC 4FOQA 2XASA 5DABA 4DMIA 3AZVA 3HKBB 1NCRC 4JDOA 5JPNB 2JD9A 2Q5TA 4MVRA 3ZHSA 1QQP1 1JI6A 3T2PA 4ISRA 3UL2A 4A44A 1QEXA 1FNZA 4UCRA 1YC61 4YW3A 4YJ3A 3ETPA 2YG0A 2ZCWA 3H50A 5C8CA 3WDUA 4H3WA 1JN2P 1QXJA 3ABLC 1K12A 1JXNA 3MDPA 1SDDB 1HNWO 2M6YA 1N36B 5C33A 3N7JA 1PM4A 1DGWA 1EP0A 4C1XA 5JIUA 4FCAA 4GA9A 1DP0A 3FKSG 2F4VO 3WG4A 5FP7A 1PGW2 2YMZA 1G9AA 3Q8BA 4YARA 1UCXA 4TUYA 4BR6A 1WW4A 1W04A 1Y76B 4GMP1 5IVJA 5EJZB 1SQPH 1PD3A 4ZU4A 4AFAA 3E22A 1QKQA 1AJPA 3MHZA 2Q69A 3RYKA 5FY5A 4R9BA 1V70A 4XMIA 1V9U1 3B3QE 3DL3A 2N04A 4XFHA 1E5SA 3WX5A 3A0HZ 4HNAB 4Y1ZA 4ZHNA 1JS9A 4OQ8A 4N23A 2HWF3 3B2EE 4I0XA 4EB6A 1OF4A 3FAVA 5KX5A 3CC7V 4FPHA 3AG7A 4JC1A 1GN4A 4BJ0A 4XF3A 3UO3A 4YIPA 1B35B 3BA9A 3VQXA 1BVP1 3B4SA 5J2TB 1VB4A 1WW5A 2A7AA 1CWPA 1RHI2 1VEWA 1F51A 3AZXA 2PZSA 1ZSPA 2ZM6B 1EPWA 3Q8AA 3WDWA 2BE3A 1W0KG 4Q27A 1SA0B 3ZCCA 4GWIA 3OTFA 2WZEA 3NJXA 4Q4X3
chains in the Genus database with same CATH topology
4KG0A 1RUC3 4BQ1A 3ZSLA 4KGGA 4YGCA 2EVXA 4LTAA 1N47A 1AJKA 4R4ZA 1C1FA 4WM8B 2RS53 4FOVA 1UU6A 1XE7A 5KXDA 4EJRA 1MZFA 5HSXA 3JD72 2LUWA 3ZXGA 1VR3A 3AP4A 2R32A 1OQ1A 4N9IA 1ZBE2 1DG6A 2R6SA 1LOCA 2EXIA 3U0ZA 3HR9A 4CEWA 4FQZA 4YSFA 1U5YA 2DUQA 3I7DA 4C5WA 4CEYA 2BFUL 4Y26A 4XQ4A 2QJVA 3M3EA 2WJSA 1PM7A 1PZ8A 3EXUA 3BTAA 3SH3A 3T2TA 1AYN1 4BA6A 4NO4A 1CAWB 1ULGA 1BEV2 4AQ2A 2ATFA 4FOYA 2ZMKA 4QPIB 1RUG2 2O0OA 5KHGA 4XQWA 4COVA 1WCKA 2CV6A 4S2FA 1I1EA 3FJSA 4PJYA 5IT6A 1RUI2 5GJ6A 1RHI3 3ES4A 3OY8A 1VBD2 3BODA 3JCIA 4YM0A 4INDA 4HSLA 3MEPA 2HWB1 2DUPA 2BYVE 2JG8B 1NZCA 1C8NA 1POV3 1W39A 2QKDA 1POV0 1QNWA 3DPRB 3INAA 5FOJB 2D6PA 4Q4Y3 2HWB3 4Q4Y2 3WXPA 1SFNA 1DGRN 5CFDC 1VP6A 1PHMA 2A6ZA 4E2GA 1GLHA 2BWAA 4CP0A 4A3XA 3SCGA 5JLVA 4B29A 1TNRA 3AKRA 1JW6A 1GQHA 3D0JA 1HQNA 1QOOA 4YLZA 2ARBA 3VBHC 4LE3A 3JU9A 1DDLA 5H9PA 2QE3A 1MS3A 3AYDA 2UYAA 4HBNA 4HLTA 2ZMNA 4M0NA 4M23A 3ZFEB 4M2GA 3AYEA 3JUUA 2JKBA 1V00A 2BVVA 3AP9A 3ZSJA 4AEDC 1OPMA 4WVMA 1IKQA 1V6IA 1Z7S2 3CF6E 4EWDA 1KJLA 1RUH1 4AYUA 4LO5B 1VBB2 2FHRA 1OI6A 2AH2A 2XJQA 2RE9A 3IN9A 5KC6A 5A33B 3KD4A 1AR71 2RS33 1WLCA 4CDWA 5FQ0A 3IPVA 4Z1VA 4FAGA 4JCKA 4YZ4A 2RS13 1PGW1 2Y0OA 1C1LA 3OGJA 4GB33 2P3IA 3ALQA 4LO7A 4CZSA 2AYHA 4COUA 2VOWA 1MR5A 4MGKE 1BBT2 4FPGA 4MUVA 2NM1A 1AZDA 2HWD1 4JGYA 2IC1A 4L9BA 1QXPA 3DV8A 4WV8A 3S0MA 1GQGA 2ILMA 2A70A 3KSCA 1ALYA 5CADA 1PVC2 5JSPA 1VZ5A 3R6SA 4MZUA 3ZXAC 4C0BA 4W6WA 3M4FA 4YM1A 4K6BA 3LZZA 4N43C 4OZXA 4TYSA 5BY5A 1RGSA 1JUIA 1V6KA 4UBHA 1PNFA 2LM3A 3WUDA 2WFF3 2IXCA 1IS3A 1GV9A 2D6LX 2C5DA 2X29A 2NMOA 4M27A 2DTWA 5AVPA 3RZZA 2RM23 4OUSA 4Q0PA 5F6KA 2GMPA 4JVAA 3MICA 2OUHA 4P14A 3WOGA 3ZIWA 5JOWA 1NG0A 1G9CA 2E7AA 4HKOA 4PLOA 3G7DA 1MEC3 2WNUA 4WM7A 2BPA2 4FSJA 1H2NA 5T5LA 5DZEA 4AI0A 3TOJA 2I2SA 1HRV2 4P9GA 1ZREA 5SV5A 4FO9A 4EN8B 4ES9A 4XPVA 5BNOC 5EWSA 3D5OA 4XHBA 3H1MA 1HRI2 1LHVA 1Z0HA 2R062 4YVWB 4FVVA 3PVOA 5KHIA 1DQ1A 2R49A 5E8AA 3ZYGA 5AC91 3KMHA 1BQPA 4F83A 1RMU1 3W58A 3THTA 1OIJA 2GU9A 1VIWB 2D6NA 1TNFA 5HCFA 1AX0A 1AJOA 2TBVA 5K0UA 4S2HA 1MVQA 1LODA 4IEVA 3AP5A 1H0BA 1XU1A 3O14A 1DFQA 1NQDA 2VG9A 3POWA 1YIPA 3QH7A 2XJRA 5T55A 4Q0UA 2WA3A 1PVC3 2D6KA 4QPIC 4KBBA 3AMPA 2HWE1 1J3PA 2R16A 4GH4B 3V17A 1YHFA 2FBEA 1ENSA 1NA1C 2B45X 2ZZQA 1G9FA 3FWEA 3NKTA 1Y9QA 4PF5A 2CNAA 4Q0VA 1QMJA 1ASJ2 4GKXA 5CFDA 1H4HA 1U5IA 2DCJA