3P3NA

Factor inhibiting hif-1 alpha in complex with notch 1 fragment mouse notch (1930-1949) peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
b'VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
molecule tags Oxidoreductase/transcription
source organism Homo sapiens
publication title Asparaginyl hydroxylation of the Notch ankyrin repeat domain by factor inhibiting hypoxia-inducible factor
pubmed rcsb
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3p3nA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3p3nA01
2Y0IA 2XUMA 1MZFA 2YDEA 4B7KA 4B7EA 4JAAA 3OD4A 4QU2A 3D8CA 2WA3A 2W0XA 3P3NA 4BIOA 4Z2WA 1YCIA 2ILMA 2YC0A 4NR1A 2WA4A 1IZ3A 4AI8A 1H2LA 2CGOA 3P3PA 4Z1VA 3KCXA 5JWPA 2CGNA 1H2KA 3KCYA 1H2MA 1H2NA 1MZEA
chains in the Genus database with same CATH superfamily
1SC5B 2EIMB 1UY4A 3TYJA 1CESA 1QVGU 4JKKA 4PIYA 1H2GA 3G6EV 3VBRA 4HANA 1IBMB 1TAEA 1POV1 1PNKA 2HWF1 1PL0A 2XWJB 3OGCC 3RYPA 1BEV2 4PA7A 4K0KO 4KGGA 4LA3A 4O4LA 2WLLA 3T08A 3LDRA 1N4CA 1GOGA 2E7QA 3ETPA 5K4LA 1ND3A 1CEZA 4MHRA 3GCXA 1YLLA 4FPEA 4P9PA 5KUMA 4JTDB 4AQ6A 1Y3TA 3H1IH 1NJIW 5HFMA 2UU9B 3N27A 1LOBA 5IJRA 1YIPA 2R9RB 2VO5A 4UF0B 3BFRA 2YBSA 4QE7A 3B9IA 5CKNA 1QDOA 3CC2V 5FYMA 3PMEA 3WXPA 4AHWA 3ABLC 1BT8A 1JZ2A 1VEWA 1CWPA 3KB5A 4I0XB 3RFRA 1S0GA 1VP7A 2C26A 2QQWA 1NTZH 1WMEA 4QQ2A 3KQRA 1YCIA 1DGSA 3ZYGA 4LF4O 3HR0A 1JXNA 2D98A 4S2HA 1JMKC 5C8CB 4CRQA 2Q8CA 3O1UA 4JI2B 2CGNA 4OZXA 1RMU2 2YMZA 1OCCB 2G19A 3OGGA 4QGNA 3LFIA 5FOJB 3RWNA 4LFAO 4GZRB 5BR8O 3JARA 3TOJA 5L9VA 5FYHA 3VBFB 2P7TC 2JD4A 2P3IA 5A2QN 4MOAA 2X6CA 1JBCA 4FI9A 1K45A 1HNXO 1TME3 1DF4A 5KAIZ 1Z7S3 3T1HB 5LA9A 1QQP1 3MF9A 4O4LB 1CAVA 4KQ7A 2IC1A 1W6PB 5AC92 3E5XA 3N9PA 1LJ7A 4QQPA 4XUTA 1JA8A 1FPN1 2XJPA 3S5AA 3B77A 3D0JA 1KECA 4O4JA 2FBEA 4O4IB 2VTXJ 1CZTA 2ZQMA 1HNWB 2P5BA 4MGIE 2UWCA 2WS93 2X10A 3KZIZ 1GV9A 4QX8A 3IAQA 1QU0A 1JPXA 1WPBA 1CD3G 2PA7A 3TN92 1QVFU 4D0QA 2RR13 4AFCA 3CMAV 4DV3B 1WKYA 3M4FA 3VBFC 3HMYA 1FXVA 2HYKA 4PLNA 5H6QA 1OLRA 2QA4V 1N3QA 4YXWG 2A71A 3ZHRA 1SKVA 5JDBA 5FBZA 3OMAB 4X66B 4B3RO 4ET7A 3M3OA 2X5IA 1BXHA 2IBZH 3EB7A 4MT8A 1DGLA 2FB5A 2W1SA 4PDRA 2ZEYA 4K40A 2WYFA 3UT5B 3LDCA 5FYCA 3E2EA 4YY3O 3SYCA 4XBLA 2YXYA 2W1UA 1ZBA2 2VBBA 3PJYA 4MVMA 1ENQA 3WD5A 1KKDA 3WUCA 3T2PA 4RS5B 2ZINA 3AKRA 5C6CA 5I8YA 4CPBD 3O0WA 3WNXA 1S0BA 1IG0A 4XFFA 1G8WA 1QCEA 3L73H 2QTSA 1W6PA 1P84F 5LMUB 2ZHLA 3RBZA 1ZYBA 3CQOA 4MW3A 2DTYA 2UY8A 4PDWC 2VQUA 3WLUA 1AI7A 1X8MA 2PAKA 2XJQA 4E2SA 4MXVA 2Y69C 3KM5A 4YGEA 5LL6Y 1LB2A 4I3GA 5C8YA 4LBLA 2B8MA 4GWNA 4M00A 4I3PA 4QPIB 4RYDA 4BQ1A 4WF9V 1QIQA 2ZNIA 5FO7B 1C4RA 4NMIA 3MDPA 4GX5A 4QNHB 4R6ZA 3WB1A 1COWG 3HKEB 4P14A 2UUBO 2LM3A 3IKWA 1SQVH 3PL0A 2QQUA 4JRLA 2ZM6O 5CFCB 4META 1YHQV 2PLV2 1NZ6A 3MICA 4Q0UA 2CTWA 4W50A 5FPVA 2GNTA 1X9TA 4AI2A 4HNAB 3E22A 3UT5A 2QKAA 3HBKA 4XQDA 1BEV1 4QXKA 2WLIA 3S57A 1ZBE1 3F95A 4H55A 2B7YA 3TXQA 2PLV1 3N7JA 3I5DA 2NN8A 4BIZA 2Y38A 3MIBA 4HK9A 3WUDA 1DIWA 3RT3C 3VZNA 3UV9A 2F43G 5GONA 3DGTA 2V4DA 1APNA 5A33B 2WABA 5FXXA 4YNIA 1H30A 2WLKA 2KKWA 1SZXA 3HKBB 4DW0A 1H4GA 4Q4Y1 4XFBA 3RS6A 3OAAG 3OGJA 1URFA 4TLFA 1IZ3A 1JFFA 2JDUA 2ZGNA 3GXUA 2H0VA 5LP6A 1OOPB 2PN5A 2WO3A 1EAH2 3ZKYA 2HWE2 4Y33A 4CH3A 5DAPA 1AX1A 5L36A 2BNOA 3WW4A 3PTYA 1EPZA 3RZKA 1K97A 4LH7A 4ASLA 2UXBB 1GFF2 1K3EA 1NOVA 4IE7A 1NY72 5GZFA 1OCOC 4NPLA 2YIDA 1W28A 4DV7B 5KA6A 1BQZA 1OXCA 5C8CA 3FUQA 1H6YA 3MV11 1SDWA 4LHSA 2AEZA 1EUUA 5A80A 2NPIA 2D6MA 2XOKG 1UY1A 4DXSA 2GP3A 1EFRG 1MR5A 2VQEB 1B35B 5FZLA 1HNWO 1CXZB 4B3TO 3PURA 4FK5C 1PZ9A 4JI5O 2IVJA 3H1MA 3TNPB 5JVVA 1UZWA 3U0ZA 2J1AA 1HRV3 1HJGA 1LGBA 4LQRA 1U97A 5DAQA 3M3CA 3OGIB 2VGDA 5BNOC 3T3YA 4DXZA 4LR3A 1J5EB 1SLBA 4WFEA 3ILRA 2BTOA 1TMF1 1HQWA 5AG2A 1RUG1 1XSRA 1SLCA 2XJTA 1MABG 5LB6A 4YJ3A 3WW2A 3VHNA 4DQAA 5HV4A 1K42A 4WBNA 3LSSA 4CEWB 2N74A 5F7UA 4IGOA 3D82A 4XF9A 3GCWA 2OIGA 2ZACA 1RXFA 3SR2C 2VVFA 4HVRA 2ARCA 1DZTA 4DUXA 2EA7A 1QWRA 3K04A 4IDZA 4NVPA 2YXLA 1W6OA 1QQP2 1RSOB 5BPXA 3KWVA 3T4ZA 3RYKA 2ATKC 4NWWA 4HVOA 2LW1A 4Y3OA 2E7AA 1KC8W 3WNMA 4Y22A 4UFJA 2WNUC 5K1XA 3ZX6A 3OSDA 4GKJB 2JE8A 1ZVFA 1YZBA 4OX9B 1DYOA 5J98B 4URTA 4XBNA 3V0AB 3DXTA 2D93A 3RSJA 3AZZA 4DK0A 3O9OA 2OX0A 4AVBA 1IVSA 3U1XA 5ANQA 3ZR5A 5G04L 1HDJA 3WDTA 3S30A 3ZSKA 3CXHF 4ZZ8A 2C5DA 3GWOA 3FYIB 1WW4A 3DPRB 3M3QA 1Y4MA 1VB2A 5FJHA 5EFUA 3BTAA 4H37A 1RXGA 3FJSA 4I0AA 4EQVA 4KXRA 3P5BA 2GN3A 1EV12 2IJJA 1OPMA 4LKEA 1W3VA 1XB9A 3C90A 1DYPA 2XMLA 5KXBA 4BXFA 5I91A 3RDIA 5FPOA 2GNMA 1W2BU 1AR83 4Q4V1 2V7QG 1R1BA 5LEKA 3PHMA 5FPAA 5CZKA 2ZAAA 2KB1A 1OQEA 2FDGA 1TNFA 5DM6V 2Y0PA 2F4PA 2PQSA 1LHNA 3K3WA 5E79Z 1VMFA 5IVJA 4JI0B 4Y22B 1HV0A 4AFMA 3CRQA 3K4AA 2WZPP 5BMVB 5CFDB 1AR72 4XUQA 4JI6B 1FAYA 3NKTA 2YBKA 2ZE7A 3QD6A 3JD72 4XDPA 4FFBA 2R062 3W7UA 2R16A 4FXGB 3D5OA 4RQPB 1T6BX 1VBE1 3OD4A 2Y4UA 5BY5A 3GZUC 4WFHA 4HYOA 1NA1A 4NYKA 2NLRA 5A9GA 3I2GA 2DVDA 5BYNA 1SACA 3VBUB 1CX4A 3MBWA 3E97A 2CAUA 4LO8A 5ITZA 4MLOA 3FFZA 1PO23 3AZVA 2ZGPA 4FLVA 4KNCA 4YM0A 1LRHA 3ZLIA 3ACIA 2XONA 4TSFG 3DF0A 5FREA 4RAIA 1CAWB 1XNTA 2NN4A 3SLIA 3FAVB 3AMMA 2WZEA 3JAKA 2G9ZA 1CGPA 4I4TB 2D3RA 4HN1A 1HRI1 3W5MA 1C1LA 1J1TA 1R3IC 2YICA 4CYDA 5JIUA 3VOUA 4HL0A 4DR1O 4XURA 3A0BZ 2DFCA 5LMNB 2ZS6B 5CNAA 3JSNA 4RQPC 2UWAA 1W6MB 4RWUA 5APAA 2JE7A 2ZABA 5A7PA 2ARHA 1SERA 1VQ5V 3DYMA 5ABJC 4M4PA 5A3LA 1D4M3 1URXA 5IK8A 3VBUC 4Q27A 4K21A 3HQUA 1LTEA 2YV8A 2Y69B 3AKTA 3ZXEA 1WMDA 2QQJA 5E16A 4LCUC 4WV8A 4IEXA 4MTGA 2A3WA 1PV0A 4X6RB 1AR63 4XF1A 4FP2A 5F3GA 5BMVA 5CFDA 1N33B 2EIGA 1JTZX 1LHWA 1DQ4A 4LTAA 4UVCA 1Y76A 3WSOA 4KWJA 1C5HA 4BMEA 1GN4A 5FP3A 4QJFB 1M4WA 2BCCH 4JDMA 1GQHA 4XFCA 1V9U1 3CDZB 3IAYA 1H1AA 4JGZB 4TV8A 1RUH2 1L7RA 1NR7A 4P9IA 4Y5Z0 4IGPA 4QHZA 1PGW2 1W0NA 3IDBB 4F7ZA 1HRV1 5FYVA 4QHBA 3N2KB 4OHXA 3WF4A 1X36A 3EMRA 1JZ6A 2O14A 2HHHB 1FKAO 4RS5C 4H3WA 4LF9B 1WMFA 2VG9A 1SA0A 3K5MA 3IB3A 1W8TA 3ENRA 3ALQA 2GALA 5DN2A 4QPGC 1H2NA 4OPAA 4LITA 2EINC 1IPSA 4J7ZA 1JODA 2OKXA 5H9PA 2CH7B 3VQVA 2CUGA 3ZXDA 3KT7A 3GHMA 1XYNA 1ENXA 3WQ1A 5FY5A 2WS92 2IXIA 4PDVA 4CP0A 3I3BA 1RUC2 1TEIA 5JPMB 5LHGA 1NCRA 4L92A 3H1HH 1TGOA 1Q6HA 2Y6GA 2H94A 4BHPA 1VMHA 2VE1A 4RGKA 3WP6A 1JZ5A 1I3HA 1K5QA 3JCIA 5GZGA 4JC1A 3LGRA 4EEQA 1PO11 4B1LA 2XAQA 1C8M3 1VB4A 5JLVA 3MIFA 4I09A 4GKYA 5JXIA 5FXWA 1LOGA 1WNSA 4ITCA 3T2OA 4N90A 5I93A 4LBQD 2ZXQA 2E32A 4GB32 4MGSA 5FO8B 1REFA 1M56B 2CDOA 4PIZA 1G4YB 3J81N 4KWUA 5GLZA 2O8QA 4OUEA 3AP9A 1QHTA 2GV9A 1XC6A 2ZCWA 2CDYA 5EYYA 2YEVA 3H1KH 2GBOA 1H2KA 1QH7A 3ACHA 5B1AC 1GSLA 2ARBA 1GLHA 2VC9A 3N2KA 4OQ9A 5G05L 1OOPC 3KV9A 3I3QA 3E8BA 1CQ9A 3I59A 4Z2WA 2DYSB 4AXOA 1H8EG 5EC2C 4KU7A 3B8NA 4JVAA 4XFIA 3T1YB 3SC7X 1OCOB 2VCBA 3K4DA 2IXCA 4UCVA 4XEZA 1GWMA 1WWYA 4MVUA 4N43C 2Q0OC 2HBUA 3P3NA 4PELA 2LFSA 1UL9A 5GONB 2CH7A 2RMU2 4Y1VA 4OHWA 1QXPA 1Z5VA 2B5HA 4KHPO 1W8UA 4TWKA 2XT9A 3CO2A 3HNYM 3GBWA 5LY2A 2HEWF 2GN7A 1SQXH 3GJBA 2YDEA 2EIJB 1ALYA 1N1YA 4LNVA 1JR9A 2WLQA 4HLTA 2DU0A 3FB6C 1MVEA 1FYUA 4QKBA 1WBLA 5FZFA 1V9PA 4CCEA 4E4EA 3CMEV 1AJPA 4CXXA 1SQBH 4J9YB 3DTUB 3U78A 4KG0A 4JGSA 1XYOA 5B4XA 1Q8SA 3ZMNA 1S4CA 1TZOA 4FCAA 3OEAA 5FZ0A 1ZNPA 1FMD2 1ULEA 4BCUA 5CG9A 2X5IB 5FWJA 3R4SA 1KITA 2Z69A 3WR0A 3VHOA 4OGQB 4NKGB 4H2AA 4GX1A 1V6KA 3S0MA 1FYJA 5JXJA 1PHMA 4DMIA 3UYJA 5BNPA 3RYHA 2RMKB 4DRVA 1V0AA 4YVSC 1LENA 2FCVA 2BFUL 5FXVA 4JGYB 3I59B 4Q4W3 1VR3A 1YIJV 4KWLA 1A78A 3LEIA 1DQ0A 4RQEA 3JYCA 4QIWF 3T4HB 4ZI7A 3S5QA 4RGAA 3K03A 3R65A 3OFNG 5FZDA 1SBDA 1QJX2 1UO9A 3A21A 1D7PM 5FAXA 1P8JA 2WYSA 2WLMA 1A3KA 1RUI2 3N9OA 3UT0A 5A3NA 2RR11 2RM23 4O2BB 2WWSA 2WZR3 2ZGMA 2A3XA 1SQPH 1VQPV 1LAJA 4CEWA 2A3YA 3N7MA 2E33A 1SBFA 1UD1A 2GTAA 1SETA 1RPOA 5D5PA 2HLDG 4BWOA 3I2IA 1KD7A 2PI4A 3ZRVA 5IK5A 4A45A 3QOPA 5J37A 4AI3A 5C5UA 3NNLA 4CUBA 1K33A 4D7TA 2IWGB 2JIGA 1UU5A 1TME1 3DXRA 3M8LA 1KBHA 5A7SA 3QVNA 2DN9A 2M6YA 4HNAA 2B39A 4CBCA 4FPYA 2Q8EA 1BBT3 2Y0IA 5A7OA 2UU9O 4PA4A 1ZTEA 1Q8OA 4D3WA 3MO4A 4EZ4A 1AP6A 5IW0A 3USSA 4FAHA 2VUCA 2QCSB 4MVTA 4MVOA 3ZIWA 1O4TA 3V0AA 4ZHQB 2ZE5A 2RVAA 3SHRA 1N3OA 4ISRA 4TQDA 3V56A 1J59A 1WA6X 2BOJA 1UX7A 4LIUA 4BR6A 4AEDA 1U12A 2YS8A 1FMD3 2DVFA 1XNQB 5EK0A 2XR4A 1CX1A 5KUKA 3GBGA 1F35A 3BCCH 3ITQA 2VQEO 3VQXA 3CJIA 5F3EA 1VBC1 3K48A 1IXBA 1COV3 4IQPA 3G6JB 3V0BB 5BV6A 4H7MA 4OI0A 3D3IA 2X8KA 5GTHZ 1UXXX 4JAAA 3JASB 3FLPA 4RFRB 1XNCA 3OB8A 2DWDC 4FOWA 5H9RA 3MI8A 2QM4A 1Q8IA 3HPNA 2FMLA 4UUJC 3MZHA 3TETA 4G28B 1MNGA 3GYDA 2QQKA 1RYYA 4LXLA 5JJJB 4QDRA 5E89A 1GZWA 2CYFA 2ZHMA 1BE3H 1M4UA 4HFSA 4B3NA 3I3DA 1FOD3 2E74B 1L7LA 1F4NA 3WP5A 1R093 3CXCU 1ZRRA 4XETA 2EAAA 2WZR2 5CA1B 5M0TA 5F3IA 2YU2A 4IGQA 3GB7C 4YVSA 4YARA 3OYWB 5LXTB 4ZXKA 2RMU3 4D6SA 3MV01 2ZGKA 4JI2O 1DGWX 2BVVA 4Q26A 2Q7GA 4HK8A 4O9GA 3GNEA 1Q6IA 1A34A 1UPGA 4A4AA 3KCYA 4HPKB 3AK3A 1RHI3 5HCBA 2YFZA 1W9TA 3ZN6B 2VMGA 5LA6B 2JJ6A 3SKJE 2ZBJA 3WDUA 3WW1A 1K73W 1US6A 4OI1A 4O2AB 4Y1UA 2QVSB 4WCEV 1GMGA 3WG3A 1NKDA 4X1KA 2BGPA 3RVHA 3KMHA 2WR9A 1BVVA 2R72A 1EBOA 4LBMA 3T30A 2BSKB 1H8HG 5LOVA 1HN1A 5DUXA 4HG6B 4N9IA 1BK0A 3EHBB 3FZ3A 2J1TA 4ZS3A 2WLNA 4UFLA 4H33A 3WDXA 4NRMA 2RS12 2F93B 4PI0A 2W46A 1JOPA 1QH6A 1LGCA 5F39A 3JD73 5JCOA 2ES3A 1O3TA 2A7AA 2XJVA 3UQ8A 1MZ6A 5B3SB 1C8M1 3FHQA 1W6MA 1VPHA 2ARXA 2BJSA 4LBJA 1SCRA 4TUYA 2R70A 1DFQA 3A23A 1GR3A 2DOSA 2KSDA 1JQ0A 1KP2A 3VL9A 3JU9A 1CAUA 5A6ZA 4QB2A 1UY0A 1G9DA 5FLXN 1ONAA 2FL4A 3JARB 4M0HA 4I50B 2R49A 4P9OA 4K8XA 4CUGA 1BKZA 3MDSA 2QJVA 3MIHA 2ATFA 3WNNA 2ZEXA 4YPJA 1FFXA 2QWPB 3G71V 2W0FC 4XJ9A 3W7XA 2R1BA 2WLJA 5T52A 3K9SA 5LXTA 4B1MA 1POV3 2RDCA 4YY3B 5BUVA 1HXS3 3MFCA 2IXJA 1GQPA 1PIV3 5BXZA 2QTOA 5JSOA 1V6MA 4O2BA 1DP0A 3C2UA 3ZM8A 5FZ3A 3HKBA 4MV2A 3P1IA 5CA6A 1F5JA 1OPOA 4WM8C 3IBMA 1HKDA 2VNVA 1AR61 5IAXA 3VZOA 1RUD3 3JD71 5J7MA 2AW9A 3OUHA 1Y6XA 5IVEA 1OD3A 5K0UC 3BEHA 1SA0B 5LA2A 3RYCB 2PHXA 1KKCA 1MQTA 5FYBA 5AC93 4MTXA 5FRAA 1UOBA 1UY2A 3CCLV 5TISZ 3CEWA 3ZX7A 3HPLC 4COUA 4JGZC 2W91A 2PLV3 1R6TA 1UZZA 4R50A 5B66Z 5JMOA 1VBB3 2WINB 1MS9A 2VS0A 4UCOA 3IN9A 5JH7A 1T6GC 1RHI1 5KLVH 3BU7A 4EFBA 4O61A 5DZEA 4NTYA 3S3XA 4RS5A 3RYIA 2CWMA 4HONA 1XRUA 5EWSA 1AR1B 4IIJA 3H3LA 1NU1H 5JCOC 5LBQA 4X8AA 2Y64A 1GMMA 4X20A 5FMOL 4YFWA 4PDLA 1M56C 4X88A 2X05A 3UJOA 2ADDA 1O3RA 5AFBA 1BBT2 2XNDG 2I07B 4JPRA 2DBIA 2JS5A 4OUSA 2XL9A 3CZJA 2YI9A 4DZGA 4J10A 2VOWA 2ZDIC 1N36B 4IV3C 2R0HA 1RVF1 5IWAB 4X6QB 4NTWA 1YFWA 5IT6A 3WNKA 4JI5B 4CDQA 4PBOA 5EBWC 1N33O 1VARA 4JQRA 3I54A 1K3IA 1NTMH 1M93A 4C1XA 1SZTA 3ZFFB 3AG7A 3VUOA 4YVWC 4GA9A 2LROA 3BN6A 4YW7A 4BA6A 3PMSA 1I9RA 3ZFEC 2K9ZA 4WFFA 5CFCA 1IBKO 2VMFA 5LP6C 3PUQA 4U7NA 4JYCA 5CA1A 1JJ2U 3ZMOA 2Q67A 4G27B 3HNMA 1OBNA 3SISA 3H3UA 2QSAA 2GZWA 4MGTA 4YJ2B 2JDYA 2JX9A 2A6WA 4U7OA 1J58A 5FLJA 1DGRA 3S7IA 4YZ1A 1H8TC 2WN2A 4XZPA 3ZN1A 5J9PC 5LWBA 4H44B 3SCGA 1M1KW 1AVMA 4HVQA 1UU4A 4XJAA 1D4M1 4MVQA 1ZZ8A 4AHYA 3M7MX 1IKQA 3ZXGA 3H8XA 3SYQA 1O5UA 5CEHA 3C8XA 3UKMA 3D3AA 5LBFA 3SITA 3I49A 3DXUA 1JFFB 1LGNA 2QQOA 4QQOA 5LP6B 4L97A 5A3WA 1PM4A 2NMNA 4IEVA 3TWIA 2ODMA 2Q5TA 4ORFA 1V54C 2IXHA 5BNPB 2JD9A 1HIXA 2B9UA 1CONA 1HR0B 1VIWB 2VMEA 3KGZA 3R4DB 4JF3A 4OMDA 3N9MA 3JD4A 3J8F2 2QWQB 2KR2A 3MIEA 4JTNA 2Z2SB 4FAGA 5D8AA 1RUC3 1BHGA 1LKNA 4ABMA 1RFYA 3VQYA 4QPIC 2DCZA 1UZ0A 1CPYA 5IUQA 4GX0A 4BISA 4Q8LA 3JBG3 4OHVA 1SLIA 3PUAA 5KHGA 5FWEA 2OYZA 1DTOA 5FLHA 5CG8A 1M5IA 3P32A 4B4QA 1ULPA 3VBHA 1CZVA 1BHAA 2VZQA 2YGLA 1GQGA 3JZVA 4QMAA 3RJ2X 5JOXA 4Q4W1 5LHHA 5HXVA 4BK5A 2P4VA 3PUIA 5FNVB 1AHSA 2YGMA 4GAZA 4I55A 2OUHA 3UM7A 2WLHA 2UURA 4E4SA 3KHCA 1CJPA 2GSMB 3D4KA 4KHPB 1JHNA 3RZGA 2R072 3TAYA 4MVRA 3MLKA 5CBFA 1OUXA 3AK1A 2XVKA 1WA4A 4LJHA 1YNAA 1SFNA 3HWJA 1MPXA 2QM8A 4RHV3 4FFGA 2ZD9A 4LFCO 4CEWC 4CDQC 3K57A 3JAKB 2IXLA 1LR5A 2WLLB 2P4KA 3QTCA 4ZHQA 3SH5A 1IQDC 5A3OA 3G6BA 3LD8A 1D2SA 5A1LA 4DW1A 3UGFA 3LNNA 4AEDB 5FMDA 3JALB 4TN7A 2A79B 1D2QA 1JH5A 5LK7B 2DVBA 4PI2A 4YWAA 1ULDA 4OFGA 3NL1A 1QKQA 4LLOA 2GAUA 1TG7A 3BABA 4GWIA 1OCRC 4NOTA 5A3TA 3RMYA 4GMP3 2W1WA 1NZCA 2OZ6A 3NO8A 2WDBA 3BTYA 5A3UA 4NXNO 2J1VA 2PMWB 4FPFA 1HW7A 4QPKA 1YJNV 1OKOA 1RUI1 5FZCA 2GNBA 1KD1W 2DU1A 3VBHB 5ABJB 1OKQA 3IJ4A 4O7XA 3IGAC 1DLCA 2H6CA 4NTXA 4FMTA 5LMNO 3GZEA 4DV3O 5GLUA 4H13B 3POIA 2WT0A 5LBCA 4LIVA 5LCWL 3TGUH 5L3GA 1IBLB 4AEMA 1QJZA 5IYZA 4JAUA 4QT6A 2CU5A 1R6NA 2EULA 5KAFZ 1GNYA 3SQOA 3O12A 2WNVA 3RYHB 1OF4A 2DJVA 1XU2A 4BYYA 2D43A 4AFAA 1DCSA 1EM1A 2HWD2 5H6RA 4XFHA 2LW7A 5BZBA 3MW3A 1MEC3 2GMEA 5L3DA 3AX4A 3QH6A 4G3YC 4DR7O 4LF7O 1B04A 5AVPA 4FP3A 4IERA 1YITV 2B42B 2A73B 1E5IA 1AI6A 1N1VA 2BEOA 2AR6A 3RPQA 5FMCA 2VTFA 1HV1A 4L11A 4O4JB 1QNMA 1ZZ7A 3H3ZA 1H2MA 3JB4C 5DECA 1LOFC 1B6QA 3C7FA 5FYYA 3A8TA 2RS33 4XQWA 4NR1A 4CUAA 2UXNA 1NCRB 2FCTA 4RQPA 5FZ6A 5F2WA 1Y67A 4CE8A 1HP8A 1SLTA 1RUOA 2DCYA 4GMP1 2P37A 4YW3A 1V70A 2BU9A 1AUYA 3NJVA 5FYUA 4A3ZA 3GWKC 5CBHA 4LBNA 4NROA 2UXCB 4AEKA 1MSWD 5EBMC 1R1A1 1ZRIA 1MS1A 2EIKC 3HOBA 5KXEA 4F8AA 5A6YA 2ZM6B 3B40A 1ZBA3 2YROA 4X8NA 3RZMA 5BNQA 3VGIA 1SLLA 4MADA 1KQRA 3LDKA 2RDNA 4LKDA 3FFQA 4AFBA 4M3CB 3Q8AA 3FB5C 2XHKA 5FPRA 3ZN5A 1KUQA 3UKVA 5K0UB 2IVIB 1LHUA 3NAPB 1WMXA 4C1WA 5EV7A 2IM9A 2F4VO 2MEV2 4X64O 3ZYBA 3ETDA 1OQDA 4UXAA 2P06A 1AJKA 1E5SA 2D6LX 1OMIA 2WNVC 4B3MO 2IJIA 1AR81 2E51A 2Q6AA 1BVP1 3FLRA 3OBAA 3IPVA 2ZKOA 2WFF2 3ZO0B 1G9CA 1RJ8A 3V0BA 1AR93 4XE9A 4LH6A 4XXAA 3N2GB 5EYXA 3JSLA 2ERFA 3AP7A 1MQTC 1EZJA 3ZEDA 4LF5O 4E2LA 2D5HA 1F15A 3QF7A 4UW6A 2WS91 2VUAA 3C3VA 2NM1A 1FOD2 3DYOA 3ZPOA 1FJGB 2B9VA 4JGZA 4YM1A 1GICA 3LA3A 2EIJC 3UKNA 4CS4A 4GWMA 2OTLV 5J1XA 2C9AA 4CDUC 1UYYA 1WZXA 5TSWA 5FZGA 4LLFA 1BSMA 4X1IB 2J42A 4BJ0A 1ZM1A 1I7FA 1VE0A 4HZFA 3AZXA 1NXD1 4KUMA 4DR6B 5CA3A 3OYWA 1OSGA 1AL23 5FQ0A 5JI9A 4NXNB 1SBEA 4BPZA 1LNQA 4JV5O 3RYIB 3R66A 1NXMA 1EYBA 1O91A 2AHYA 3K0DA 5F5AA 1C28A 2OPKA 1VBD2 4X20B 2IU3A 3BKZA 1R081 1VMJA 2JJ1G 3M2MA 4ZU5A 1PIV2 2WRAA 3ZFGA 5EC1C 1HNZO 2DUQA 1GKBA 3H7YA 2HJFC 4IV3A 3KQ4B 1BZWA 3E6BA 2JEMA 5BNPC 4XIKA 2FCUA 2JE9A 2P3KA 2ENRA 2BWCA 4E8CA 1I1EA 2R063 2WPDG 5BNOB 5K7PA 3EYPA 4DR3O 1H1MA 5CB4B 2WSVA 2ZGUA 4I0BA 3AVRA 3ZFFA 1GP5A 5EHDA 3KCXA 5DDJ3 4TUYB 3RG0A 1W3XA 4DV4B 5J2UA 2ITDC 3L75H 5C3RA 3THPA 4PJYA 4P9LA 4XDJA 1UCXA 4CP9A 1Q8VA 1YUDA 1W8WA 4PV1B 4HKOA 5FR3A 4HBNA 3NV4A 2I74A 3Q8EA 2W5FA 3T09A 4W4ZA 4JAVA 2UU8A 4YJ2A 3DECA 1XPWA 1RUE3 5GW7A 1WW6A 4RA0A 4GJYA 5HXMA 2E5LO 1LNSA 3CRAA 1NX9A 4W4KA 2GUZB 4Z1MG 2DVAA 5FP9A 3KGLA 3MPBA 1ACCA 3POEA 3W7WA 2VU9A 4YJ3B 3TNQA 3ACGA 1LHOA 5EIYB 3MHHC 2Z3YA 4CDWB 1XHXA 5B1BB 2ADPA 1N1TA 2OVUA 2R041 1VBB2 2JK5C 4KI5M 1MZ5A 3WX5A 4W6WA 3STLC 4LFAB 5CKMA 4P9WA 3K58A 3OUFA 3LWCA 1K5MB 5EYPB 1OH4A 2FDIA 5GZDA 2QQVA 1GKFA 3BTXA 2X6AA 2Q7HA 4QX1A 2JS3A 5T5OA 3JD1A 3IFXA 4AQ2A 2W0XA 1US3A 2QQPA 3GALA 4X64B 1OFNA 4GJZA 4U36A 1IS6A 4XTPA 5FY4A 1R3JC 2V5YA 2VCAA 1BMFG 1S1AA 4SLIA 1FNYA 3K75B 5IWAO 1UYXA 5FZIA 2ZA9A 3UJQA 3VBFA 4IEWA 4TTGA 4YW6A 3VBHC 3F5TA 1ZZBA 4M3CA 2R071 4JGYA 2RG4A 1XMQO 2RS52 1OLQA 4AF9A 1K5JA 3SGIA 5L19A 3USUB 4OXSA 2ZX2A 4JHZA 4YVSB 2WNOA 3DGEA 3ZHSA 2JEXA 4WZCA 4GXLA 1QJU1 3QLQA 3FHAA 2Z5UA 1BYHA 2C9KA 3AYCA 3G80A 1W2TA 1BMV2 4DV2O 2D3SA 5FY8A 4AEDC 4ONUA 2HWC2 4JASA 1WCKA 1EN5A 5L3CA 3FMGA 1NYWA 4MS2A 1NR1A 1JYIA 5LA6A 4GYCB 1U96A 3NQHA 2C4XA 3EHKA 4DB5A 2P1BA 3AK2A 2I45A 5FV3A 3KD4A 3BALA 4Q2FA 2VL4A 3CCUV 2FMDA 2Q30A 4A5UB 5GKAC 3JXSA 2P4EA 4COWA 1MS4A 4DUYB 1Y43B 3H1LH 4DO0A 1OJHA 1H9PA 2A7WA 1SZBA 2QQMA 4IEZA 1QJU2 5J48A 1W2UA 1OCZC 4QD2A 4JI3O 2CSGA 1AX0A 1FNZA 2WL1A 4EROA 2FHRA 1OHHG 1CAUB 3ZKUA 1U5IA 2V4VA 3HAGA 4PLOA 3SPGA 2UWBA 3WF3A 1DQ5A 4I50A 5I0SA 1V9U3 4IEUA 2E3CA 4HXCA 4YGBA 5KX5B 4IUGA 5CU1A 5B3SC 4MGZE 4IE4A 3SH4A 3T4VA 1LU1A 5L3FA 4ASMB 4HSJA 1FFXB 4DINB 4DR3B 2OT5A 3T0AA 5ABJA 1AXYA 1RITA 2JICA 2MW2B 4RQFA 5FUPA 2B9ZA 3VBUA 4QB1A 4QQLA 1H38A 1JYXA 3PN1A 1F31A 3APQA 4QXBA 1AF9A 4FT8A 3DKQA 3WDVA 1GOFA 1V6OA 1EZVH 3PUHA 5IYZB 4XHXA 4X9QA 2WBKA 3AYDA 4FM1A 1IPKA 2H0BA 2EIDA 1LULA 1JU3A 2HP8A 4PDMA 4DO2A 4ZONA 1F7YA 1YQ6A 4NHYA 5GZEA 1Q8PA 2A75A 1NLQA 1NCRC 4PDWA 3M1HA 1JOJA 1ZSPA 2JVDA 2ZGOA 1YQCA 3VDDA 3AMQA 3B02A 3B4SA 2XHBA 1HB1A 3H1JH 2K46A 5DG1A 4IEOA 1PK6C 4QPYA 5J2UB 1YRZA 4OPHA 3BPZA 4YIPA 2P6JA 3RYFA 4CP9B 1D2DA 1KU9A 2DMXA 3E22B 4WM8A 1RUE1 1WUVA 4FPJA 3POWA 1S5LZ 1FS0G 2LRPA 3AG1B 1BQPA 3WDYA 3AKPA 2Q1FA 1N34O 3FX7A 1JN2P 3OPZA 1W0OA 2OWOA 1RJ7A 5GJ6A 3H8UA 4D69A 2WWWA 1AVBA 1DZRA 4UVAA 4ZXEA 3RQ0A 4QKFA 3WQ7A 5B2GB 2WKKA 1W04A 3K9AA 2BVBA 4XUNA 3AJZA 1LHVA 4PA6A 3RZJA 1VBA1 1FV2A 3AB0A 1Z78A 4N53B 1PNLA 4XACA 2YB7A 1V6JA 2D7FA 4CCLA 2ADEA 1ULGA 4BB3A 4X1KB 1VF5B 4MYEA 1VQKV 4KBZA 3JUUA 3SPJA 2XLGA 4EWDA 2ZCEA 3ST7A 4K0KB 2JDKA 2OS2A 1GM7A 2QKDA 2GMMA 4XUOA 2VMHA 2XKPA 4AVCA 4LF8B 3VDDB 5K0UA 1QBZA 1EPWA 1L0NH 2FKXA 3K3NA 4L8QA 3A0RA 2AUYA 1I5YA 2OTJV 3G7DA 3M3EA 1LR1A 4LO4B 4D7SA 2EXKA 4P08A 3K06A 1AI4A 1R092 5IFPA 1WN7A 4V2VA 2ZX4A 3WB0A 2V72A 4NRPA 1QJY2 2XBO3 4GUNA 3SYAA 1IOAA 3X2QB 4WM8B 4UW3A 2WSSG 2WAAA 2VECA 4UOJA 3J7LA 4MUVA 3KV4A 1PGSA 4OZOA 1Q5OA 3H7JA 4HETA 3UKTA 1W9YA 2HH9A 4LF7B 2V1DA 4TQFA 1UX6A 2C1FA 3ZYHA 2PXJA 5FK8A 3B01A 4FZ1A 1F4HA 4JDOA 5LRRA 3PJQA 4N43B 4X65O 4X62B 2RM21 1S0DA 4NIIA 3OTOO 3NSTA 1RUJ3 1S0IA 1Y4WA 2YUAA 3C3TA 2C6SA 3MIDA 4CCMA 5KWRA 4EN9B 1K4CC 2PFWA 1VBB1 1NT2B 2YC2A 5C5TA 2VW2A 1O8SA 5D5QA 1L7QA 4A3XA 5FO9B 2P90A 3AYEA 1YXBA 2HEPA 3DL3A 4N23A 4EN6B 1MQTB 2QZ3A 4K1YA 2LGWA 1ASJ2 1ST8A 3BTZA 3LSUA 4JTOA 4LUKA 3ZMTA 2JDHA 2CL2A 3TJTA 4PCRA 5D8AB 4R9AA 1XU1A 1PK6A 1YTFB 2VTXA 4DFSA 2BP6A 1J84A 2RS13 3UO3A 2LFRA 3NR7A 4LUMA 3BA8A 1GM9A 1HX6A 3ZXJA 5CFCC 3CU7A 3VQWA 2QQIA 4IV3B 2WLPA 1G6UA 3U37A 4EN7B 2RS53 3KLSA 1TMF3 1UZYA 4E4DX 5FP8A 3HT1A 4LFBO 4BAYA 1VJ2A 3ZRSA 4E9KA 4NPRA 4LO6B 3L71H 1TE1B 4N7UA 1N47A 1XDCA 4EFEA 4IIJB 4EKWA 1YI2V 2FMYA 4PJ0Z 4A41A 5BNNC 2XJUA 4W8JA 4X66O 4B3RB 2ZPXA 3MLJA 2XHNA 4JZGA 4FLWA 1UIKA 5B5EZ 4YM2A 1TVGA 4RHV2 2E75B 3OUSA 2VCMA 3JAMN 5FUIA 1ZZCA 4JYYA 2E9QA 2YUEA 3E89A 5C3PA 1QJX3 2OZJA 4DV5O 3LDBA 3VD7A 5FDBA 1CIYA 1YTFD 1PVC3 1H2SB 2GC2A 1XXNA 4IE6A 4DUZB 3AG3B 1A8MA 2CE4A 3LEKA 1JU4A 2X09A 3H0OA 3FLTA 1Y66A 3FBYA 1GWKA 1QU7A 1ODNA 4CU9A 3CRMA 1XHZA 2ZNJA 4AHZA 5LASA 4AW7A 4DV1O 1MVQA 3ECQA 2BBVA 2QR4A 4GALA 1DGWA 1RVF2 4LA2A 1H6XA 2J1SA 3ZFFC 4DR4O 3JQWA 3KSCA 4C8DA 4RHV1 1JOYA 4NUBA 2JIJA 2EVXA 4FPKA 2NR5A 2VR4A 3MGUA 5E1AC 3S3WA 5E6HA 5A6QA 2EZPA 4N7IA 3UL2A 3NV3A 1HR0O 4Q4Y3 3BOPA 3BY6A 1UPSA 4URAA 2YIBA 3N2GA 4Y4RA 1COV2 1FAFA 1OVPA 1YEWA 4DK1A 5GM0A 1XSQA 3HKCB 2KM2A 4MXWA 1SRYA 4NN0A 4AGVA 2UUBB 1PZ7A 4OULA 2AENA 1N32B 2RN9A 2JWPA 5LHIA 2RMU1 3T2MA 1Q6UA 2JGUA 4XDLA 5DDJ2 3I3EA 2FDKA 4J11A 3R4UA 4LBQB 3K2OA 2DCJA 3OPWA 4FQ4A 4P00B 1PX3A 2CTQA 5FY1A 2ILMA 4K6BA 4IT5A 1CZSA 2DUOA 2VOVA 2BNMA 3ZRWA 2OYQA 3L9JT 1GO3F 5HCFA 3PUSA 5L3BA 4AWDA 1VF7A 2VMIA 2LUWA 4P9XA 2EIEA 1F51A 1PX4A 1SQ4A 5DZFA 5B1NA 2VQFO 1RUC1 1NLSA 1YI7A 4M3CF 4AE2A 3ZHTA 3DC5A 4A42A 2H6BA 4Y1ZA 3THTA 3PIJA 3USUA 3SNMA 3OG2A 1R091 2ZAHA 3POFA 1V6NA 1NZIA 3JBG2 3OPTA 2W52A 2XJRA 1SS3A 4DS0A 1I5XA 4E4HA 3W7SA 2PY5A 2W9XA 2MEV3 5AVAA 2HWC3 3CJIB 5J09A 4EWAA 1ZX3A 1FXKA 4Y5TA 3SJQC 1HJFA 1YJKA 1QJY3 2IJKA 4CC6A 2BERA 1XE0A 1R1A2 2BGCA 3BB6A 3R6SA 1BHBA 5HPOA 1AX2A 2ETNA 4DV7O 2VZ1A 1DBNA 1HRV2 1QJY1 2BDRA 4GH4C 5J2TB 5F3CA 1JYNA 1F23A 3SCFA 1ND3C 3VBOB 4OMCA 3ABKC 4KMQA 3CX5F 2MEV1 4ZPIA 1W0KG 1QNYA 5JXGA 2GDFA 4JI8O 5H9CA 2K0GA 2XLFA 1WCSA 1PMIA 1O9HA 1VBA2 2JDZA 4QX0A 1PGL1 5FIXA 2Z0AA 4X8PA 5IJ9B 3OBZA 5F5IA 3JB8A 5LZ6A 2OIEA 4DUWA 5JPNB 3VKMA 3Q8CA 1KS5A 3M70A 5JVDA 1VRBA 3K59A 2P6HA 3MHZA 5DMYA 4JV4A 2VZUA 2RS32 1Q90D 2JG8C 3K51A 1VAMA 1R1A3 5CBGA 4BQXA 2D2CB 2QM7A 1Q7YW 1OF3A 1US2A 5EJ3A 1REEA 2W47A 1ZUQA 1GUIA 1Z7S1 3ICXA 1DF0A 3ZVXA 1J3QA 1IBMO 4DIQA 3AC0A 5LA0A 3CEIA 4LP8A 1WLEA 1WLCA 4K35A 5K8SA 2EJRA 4U3FH 3ETEA 1D0GA 4QAWA 2HG5C 1XMQB 4YFZA 4E2QA 4UW4A 1HXS2 2WA3A 1S0CA 2HVJC 2VRZA 3ME2A 2RV9A 3P6BA 4Z8BA 4XOGA 3ZSMA 2IW5A 4LT5A 4CDXC 3IM0A 3EXUA 4RUFA 5J2TA 1FX5A 5D2AA 4ES8A 2E76B 5K1PA 4DV1B 4WVVA 1UY3A 1ASJ3 3LB9A 3DUIA 2BFUS 2RE9A 4Y4YA 2LW8A 1G1XB 1S0VA 2A6ZA 3NV1A 3L74H 5DEDA 4AI0A 1C57A 4J6GA 4Q4V3 4UFIA 4F3JA 1Q43A 3V64A 1UAIA 2VZSA 3SCHA 2W68A 2YPDA 3HQRA 2Q68A 3GDBA 1IDSA 1PVC1 4ZKIA 4IYHA 2KA3A 3OOXA 2UUAO 1VAVA 2JRIA 3H8OA 4NIGA 5FMOS 3J8F3 5F8PA 2KG7B 1ZZ6A 1W9SA 2HBTA 2VPVA 3N9NA 5BR8B 4WM7A 1R64A 4Z92B 1Y74B 1HNXB 2R32A 3AG4B 3I3MA 2ZGLA 1PGL2 4NE9A 1MZFA 1DZQA 5FKCA 4CH6A 4J25A 1YF2A 1W90A 3WT3A 4BWAA 3LKJA 2F17A 4LE4A 4CEYC 1IX9A 3ZN0A 2XTAA 3ABMB 4JCKA 3DEMA 1WD4A 3HKCA 3LZZA 4DR6O 3IAPA 2WSUA 4R8HA 1VIBA 3ZMVA 1NA1C 2ID4A 4NIAA 2OXBA 2RHPA 4YSFA 3NWKA 5D8AC 4BIUA 3CYOA 4H0LB 2CV6A 1W39A 5A6XA 2Q7EA 2HWF3 1OHFA 2WWJA 2DTWA 4C0HA 2XUEA 3WNPA 2IZWA 1JMUB 3TEZA 2JDAA 2PGGA 3VDAA 5JSRA 5IATA 3SMHA 1M06G 1HNZB 5HBAA 1BLZA 1UJWB 1XNBA 3OW2U 2PHRA 3OY8B 4ZY9A 2QE3A 1GYKA 4H14A 2FDHA 4UWDA 5I8SA 3B7MA 5A7QA 1XNDA 5C93A 2EIKB 5KX5A 1BQ0A 4Y1YA 2RJ2A 3K46A 1XYPA 3Q8FA 4LKFA 1VQOV 5FY9A 1HB3A 3ZFEA 1YYNA 1AYN3 1NVPB 4ZI7B 1BGYH 3AFKA 4Y1XA 1UKRA 3VDCA 4XDOA 2BGOA 5LBBA 2WFPA 2KG7A 1RM1C 2D5FA 3I2DA 4CP1A 5FXZA 4NB5A 4XFAA 3OR6C 2QQNA 1Y74A 1XE7A 1EUTA 4RGGA 4FLUA 4CDWA 1AR62 1C1FA 5T3NA 3T0DA 3ZYPA 4B8EA 4EB6A 2EXHA 4XABA 2ZGRA 3AP5A 2ZGTA 2PHWA 3ZSJA 3S7EA 3SH3A 2Y60A 4KBBA 3ZXKA 2LS6A 4AL9A 3I4IA 1N1SA 2BPA2 1AYM2 3DN7A 4RR3C 2XAJA 5LY1A 4XAAA 3VD4A 3B5LB 2Q69A 5JR7B 3LIHA 1ZX5A 4X1IA 1FPN2 4DEVA 4LHKA 5EZYA 3O1VA 4EN8B 3KHBA 1XREA 1WJZA 4NHMA 4CUCA 5BNNA 2VBDA 3VHPA 4NAMA 4ES9A 4RFT0 2EXIA 3PVBB 3J7HA 3WFVA 4KP4A 3M3IA 2EALA 4RL7A 1UU6A 1GBGA 3DC6A 2ZTNA 3TB0A 2WNUB 4UCUA 2YU1A 5I0DA 2D3OW 2VQ0A 2XDVA 5KR7A 4ARXA 5E8AA 2ET1A 4XCAA 1K4DC 4LF9O 4S2GA 2Y26A 4AAPA 1W06A 4TOIA 2VUJA 1RPRA 2WQ8A 4MSWC 5CA0A 1ASJ1 1RUF3 5FY7A 1FI2A 2XUMA 3O1RA 1UYZA 2HEVF 4F4LA 3DPRC 4P9YA 5J36A 1M57C 2PF4E 1R083 2XLAA 3B9CA 3HIFA 3N3HA 1VBC2 2C0ZA 2QQLA 3C7OA 5FL7G 3APOA 2X53S 4Z1VA 4IW3A 2JKBA 2VXJA 4B08A 5FZEA 3JBG1 1RUJ1 5FFOC 1UMZA 3RI8A 3WF2A 3L2HA 1WP8A 4Y20B 4JI1B 4BM8A 4UB8Z 3VN4A 4XJ8A 5EZYB 5L7OC 2CTVA 2Q8DA 1VQ9V 3TEYA 1QHDA 2VM9A 1PNMA 1S5HC 3N9LA 3LEMA 4EZHA 4PBPA 3E8GA 2O8OA 2W87A 4KG8A 4J42A 2GUZA 2QE7G 3GF6A 3LIGA 1XMOB 1ZAUA 4BOWA 5FZ7A 2JIZG 1QXJA 4HPKA 4BZ4A 5A32A 2H3OA 1XEQA 1X33A 3M99B 4CCJA 1PO21 3W9AA 2ZZJA 1Q8QA 2DBNA 2DYRB 3I8TA 2VD7A 3A7QA 1IG3A 1RUF2 4LFBB 1LOCA 1PM7A 3ZSLA 2R7EB 2BSKA 5ERLA 4NIDA 2WQZC 2VBPA 1NE4A 1MEC2 4AVTA 2Y6FA 1M90W 4PDWB 2NP0A 4N8MA 3OD0A 2Y6KA 4GH4B 4QU2A 2RQ6A 2B1IA 5FKBA 1K7DA 2W6JG 3OBTA 2QDRA 1RUF1 3G4SV 1AB3A 2OUJA 5KA5A 4G9SB 1PVC2 3OMIB 2NQYA 2CK3G 2VZOA 4UV9A 3HKDB 2AZ0A 1FV3A 3H1WA 4V2WA 2HEYF 3TEWA 4JHTA 2VJXA 4O65A 4PQ9A 2JG9C 1XL6A 4XDQA 4G2KA 1UNBA 4FOVA 1G9BA 1IKPA 3MEPA 3NJYA 2ZHKA 4Q4W2 3NNMA 3O5SA 2VNRA 2BWAA 3LPFA 3T1MA 5JMCA 2FDJA 3CCRV 4J7JA 4ICGA 4KH9A 1NT0A 1TME2 3WG1A 1UPIA 2L9LA 3VBOA 4X1YB 4DR4B 5CADA 4OX9O 4DR2O 3OUIA 1WCDJ 4EYUA 4QKDA 4LOSA 2DW4A 2ZMKA 3NRUA 1QJU3 1NH2D 3ZYJB 3SYOA 4NHLA 4AI8A 2WIIB 2F1MA 4BW9A 1RUJ2 4BLJA 3QO5A 3LSEA 1CJDA 3BUCA 5FPUA 2R042 3L9DA 2BW8A 2PHDA 2W2IA 4LR4A 4B7KA 4ZOLA 5C9AA 1O59A 4QX3A 2RDQA 3WHUA 1N8RW 2Z42A 3RYCA 1JW6A 3I56V 2O1QA 1GH6A 3AP4A 4R8CA 1Z7S2 1C8M2 3OBRA 2X29A 2GTSA 4AQTA 3H50A 2G9GA 3QO8A 5C3SA 3HN3A 3KZ4C 4COYA 1KS4A 2RS11 3E1F1 5KBFA 1ZL8B 3OEBA 1WCUA 1RUE2 1J3RA 4ZKTB 1EY2A 3N7KA 2N04A 4NIHA 3A0HZ 4DRRA 4O9EA 3ZYIB 3CMGA 3IMNA 1UZVA 2VW0A 4HOOA 2OCCC 2UYBA 3MFAA 4JYBA 5E88A 5LEJA 2M7WA 2QGNA 1AR92 1KDKA 1KJRA 4KL1A 4FFHA 5C71A 3ABZA 3AKQA 2VQFB 1UMIA 4GKKB 4DV6O 3VD9A 2F4LA 3QH7A 1HWYA 3PJSK 2B46X 2OCHA 2GC0A 2AZ2A 2QEXV 1VF6C 1CN1A 4IETA 4IE5A 3E6CC 4FIPC 2YXHA 5CB7A 1D5NA 1OD5A 1FXKC 3ZDSA 1FJGO 4E2GA 3WCRA 3ABTA 1N0NA 4JI4O 4LKSA 3CBNA 1JCHA 5FZOA 4IYIA 4GLXA 4XTMA 1V00A 2JKXA 1Z0HA 2XWBB 4ZU7A 2UUCO 3MW2A 4YZ4A 3STZC 2PQQA 3ZHQA 1POV0 2IXKA 5FOBB 5KMGB 4XAEA 2XKOA 4IL6Z 3NAPA 4AI1A 4PA3A 2VVEA 4UFZA 2O0OA 1ENVA 4MVSA 3IC7A 4HN0A 1RHI2 4X65B 4XILA 1XMOO 4X62O 4M3CE 4LWSB 1UMHA 3RYFB 4GT1A 5A1FA 1OVSA 4Y20A 5KHHA 4DR1B 3I2KA 2KD7A 1G86A 4A6OA 4M0NA 1FXKB 1GM8A 1X82A 4CA9A 1H4HA 3ZBHA 3ZN4A 4L87A 4CTEA 4XZUG 2DQ3A 4D6QA 4Q4V2 4FJCC 2HWE3 4CSWA 2PAMA 2OW4A 2E53A 3CB2A 2HVKC 2YYOA 4R9DA 3D36A 4LEJA 4BLIA 2RS51 3ZMUA 5KHKA 2G4IA 4Y26A 1W9WA 1XJAA 1LOEA 3MIGA 3O0VA 4MGYE 4BQYA 1I5PA 4ZS2A 3IDAA 2OQ6A 2IH1C 4GD4A 3KF5A 3L70H 1Y9GA 3O1OA 1E57A 4K9SA 3RW0A 4YIOA 2OPWA 3E5QA 5I0RA 2WFF3 3OF1A 4UFMA 1S5JA 2P2KA 4KGQA 4FLXA 1R3LC 4FBFA 3ABMC 4U3JA 3NJZA 4YZ3A 1YSCA 2A1XA 3A0KA 3ETGA 2ZMLA 4TZDA 3ASIA 3ZSEA 5HI0A 3PDQA 2ZR3A 1BEV3 1NI8A 4LBOA 2FDFA 1V6IA 5LW9A 2HHHO 3IT8A 1RUH1 3LDEA 4MX3A 4XC9A 4IEQA 4OYUA 3ZFGB 1QQCA 4LWSA 3S6PA 1FATA 2VQAA 4D94A 4I0WB 1D4M2 3AL5A 3NMBA 2ORZA 3IWZA 1YDXA 1V55C 2Q9LA 5GALA 4WFGA 2B5UA 2J1EA 3WCSA 3POSA 4G4FA 4FM2A 2JDIG 4X89A 5B1OA 1X7NA 2MPFA 5T5LA 1I94B 3TXSA 5BNOA 3WINE 1PZ8A 5CKQA 3H1YA 3X2QC 3WHTA 3IC9A 2YIAA 1AJOA 4RR3A 2ZKLA 1WGPA 2DWEC 3KG2A 2DV9A 2E7TA 3URFA 5FJKA 3OEEG 4IEYA 1RINA 2D6OX 4CZSA 3MUZ1 1K5SA 5EIBC 1CIWA 2BZDA 1KGYA 1JVMA 5I0TA 4TT3G 1LESA 1OT5A 2DQ0A 1AR91 3VD5A 2UXDO 1CVNA 5C9AB 4AVAA 1VBE2 1WPXA 3G67A 3ZRWB 4BW5A 1EAH3 4CS2A 3AG2B 2XASA 1VMGA 2R061 1N3PA 3HJRA 4QX7A 3RNSA 1VBC3 5BNNB 4FLZA 4I9WA 1FPOA 1OH3A 4QDSA 3O65A 4GKKO 1AYN2 5T54A 2V73A 1EAH1 1S76D 4FFIA 4DV5B 3INAA 3JAWB 4Z2AA 3R05A 3O7OA 5DUWA 3MHSC 1CPNA 5FY0A 2WNUA 5CVRA 1K92A 1WBFA 2FQPA 5KC6A 1VLNA 4Q1PA 5H9SA 3POYA 1XNAA 5KHIA 3T1YO 5EJ1B 5IVYA 4DXRA 1Y9MA 3F5WC 3WVJA 4XVHA 2X0LA 3K3OA 4I02A 5L7OB 1AR71 2XL7A 2RNBA 1M57B 3HVDA 1K5MA 4JKMA 3CCQV 2UUCB 4NXMO 2YY1A 4CXWA 3SPCA 1I08A 4DOUA 3MUY1 1IPJA 5EP9A 5CMUA 1RUH3 2VZ3A 1ZBE2 5FPXA 1O3SA 3WG2A 2Z4FA 3SJCC 2R0FA 1UXZA 1F5FA 2WZR1 1YFYA 4FZ0A 5SV8A 2VZTA 4M01A 4P02B 3PVNA 5FZOB 1FPN3 2VXRA 2JG9B 1W9FA 5IJ9A 2QWRB 4J1WA 3U4XA 4DV0B 2WT2A 3AXDA 5A3PA 1W8OA 2CAVA 1H0BA 1J3PA 4P9GA 1IURA 4NRQA 4AFDA 4QPJA 3W58A 2JDMA 3RMXA 2Q1MA 2OT7A 5IYBO 3VZMA 2LJ2A 1OURA 1W2AX 1HW5A 3AXEA 5B1AB 4ZIBA 4FOYA 2A5ZA 4UV8A 4BQ4A 1JOBA 1ND2A 5F9TA 5IK4A 5LRSA 4AAXA 2GMPA 2VULA 2WFF1 1H8VA 3CIHA 4Q6GA 1EN4A 1N36O 1YHFA 2ITCC 5F6LB 3I97A 5A32B 3JCUZ 4FPLA 3U75A 4L0PA 5HCHA 3CRRA 3BAAA 3ZXAC 4FTBA 1UOFA 2PYJA 1GK9A 5L3EA 4TXWA 2WT1A 2WA4A 3WF1A 2JG8B 3AJYA 4LNUB 2XGXA 1QLEC 4A6SA 3B69A 3HB3B 4YG0A 4WVWA 2ZE6A 3JCZA 5FP7A 2JXAA 3J7MA 2A06H 3TBDA 4B7EA 2A3QA 3OUJA 4BXSV 4DYLA 2ZT9B 5CN0A 2AREA 1KP3A 3NKGA 4F6RB 4QM8A 5IYDO 1MACA 2EILC 5DABA 3PIGA 3DSQA 2IUWA 3LAGA 3MLLA 3LOBA 1DQ1A 1W8HA 4GH4A 2YHJA 4OI4A 3J4UH 3E83A 3KT1A 3WDWA 1RUI3 4UFHA 4AHCA 2R30A 3VKNA 1QJX1 2WN3A 1VRH3 4GMP0 1VP6A 3ASNB 2X5IC 3CS5A 2JG9A 1G9AA 2ZGQA 3C7EA 3LA7A 4AVSA 1GWLA 4WVMB 2ZR2A 3KV5A 1K8AW 2ZMNA 3RGBA 5IFTA 1UWWA 1KFUL 2UY9A 4CPBA 3ML0A 3AKSA 4YHHB 1YJWV 3KF3A 5DZGA 3NNFA 1ZRDA 3VBOC 2YBPA 4UCSA 2MK3A 1I0HA 4PF1A 3J8F1 3W7TA 2DYSC 1Q82W 5LMUO 2D6NA 3FC0A 1S0EA 5CYYA 3VZLA 1AR4A 5F5QA 3FB8C 2W6IG 2WO7A 4HKWA 4XW3A 5CFDC 1XBLA 2IFRA 3CHXA 4BQ2A 1O7FA 2HWB2 4LNUA 4UCTA 3CCEV 1VAKA 2QDNA 3TK1A 4OCTA 1NCQA 2GP5A 3CD6V 3MPPG 5D1IA 1HLCA 1PO13 3HT2A 2YPJA 2QZ2A 2LTNA 3RN4A 3OJBA 1WLTA 3U14A 3AG4C 3OGVA 2JJ2G 4ARYA 1YI9A 1JYTA 4XUPA 5FZ4A 1DQ6A 4UI9L 4YYOA 2RJZA 4EN0A 4QHOA 4YG3A 1AL0G 1MOFA 3POJA 4YZ2A 2PHFA 3LPGA 5JZGB 3IIAA 1HRI3 4W6YA 4K3UA 5I8TA 2R9AA 1G9FA 1AL21 4QWNA 2JB4A 4KWKA 3NNGA 1AR73 1BL8A 4JQTA 3O1PA 4LBKA 1JUIA 3HNBM 1UKGA 4HMZA 4A7YA 4PA9A 1TA8A 4MHUA 5LK5A 3ZMZA 4UBHA 4RSUA 1MS3A 1C8NA 2BOBC 2VOXA 5IK7A 5JJNB 4HAMA 2DF7A 2HR3A 1WW7A 4N53A 3KV6A 4AK3A 3T2TA 5L9RA 1QDCA 3GGLA 2Z5WA 2BE3A 2TEPA 4B29A 2C2AA 1W99A 1SMVA 4YZ5A 3AVSA 1F9KA 2VZRA 5HCAA 3OR7C 3CL1A 1LU2A 1RIRA 2YFUA 1XQ8A 2PYTA 4QU1A 1ZA7A 2JENA 2JDPA 1TQ5A 1NUKA 1OLME 3B94A 4Q5OA 3ABLB 3OT7A 1AILA 3NVCA 3FYEB 4CU6A 4QGPA 5FZKA 4PQQA 2E5LB 4DNYA 3VLBB 1HB2A 1JYVA 4DR2B 3EXAA 1VBD1 3HKDA 2Q73A 2EF6A 5JQGB 4Q1RA 3DYPA 5DDJ1 1KQSU 5CAZA 5H5NA 4I30A 1LEMA 1PMHX 4GB31 1P7GA 2VNOA 4SBVA 4WBNB 1TUEB 1Y9QA 1VBA3 3ZYFA 3K5NA 1VQ8V 2YIBD 2VWJA 3U10A 2V09A 3VBRC 2HWC1 4OHYA 4LHLA 3K79A 3AMNA 1SFYA 5ACA3 3HEIA 1J5EO 1CPMA 4FTSA 4KFMA 3NAPC 5IJ0A 2MHFA 4MW8A 3W5NA 4XBQA 3PNAA 4WM7B 4XF0A 4IHJA 1LOFA 1W8NA 1RP3B 3AEIA 1QQP3 3ASOB 3AG2C 2ZIOA 3B09A 2GH2A 3WEZA 1H8TB 4ZOLB 5JIAA 5F5CA 5F2VO 5EYPA 3GBFA 4DEQA 1XNKA 5CA0B 1RGSA 4K20A 5C8WA 1WCQA 5A70A 1N0JA 2BYVE 3RJRA 3GZAA 2J22A 4B3SO 3E8HA 4CCDA 1ZL8A 4AYUA 1YJ9V 3FB7C 2PAEA 1IS5A 1AI5A 1C5IA 1RM1B 1V55B 3CRCA 4RO2A 3SPIA 2NNUA 4GB33 4JI4B 3LUTB 3E8FA 4AQYB 4ZHNA 1W8ZA 1VBE3 4YG6A 3CCSV 4UT5A 4CCNA 1VQLV 3HD8B 3T2QA 1UOJA 1RUNA 4XQ4A 1V9U2 3UCSC 1FXZA 3T1CA 2GC3A 3IIIA 4FOQA 1ORQC 4WVZA 3Q4HB 3ZFEB 3VL8A 4R52A 4LF4B 2NLJC 2W92A 5EIBD 4AGGA 3ZYRA 2AGAA 1KYOF 3ETQA 1UF2C 3J7NA 4DUYO 2K2SA 3APBA 3JATA 1G8MA 4J80A 4Z82A 1HXS1 5FPZA 2EX3A 4AZZA 1XQNA 2PHTA 3JD3A 2FYUH 2GC1A 2G9FA 3FN9A 4JDNA 1NCQB 5JCTA 3TEXA 1VQNV 2W95A 4FPPA 1PPJH 1X50A 5FZAA 4EJRA 2D44A 5IVBA 5FTTC 3C7HA 1RMU1 1VQ4V 1R082 3EVKA 5EPAA 2XAGA 4FQZA 4DUVA 3BRCA 2P5OA 2DUPA 4QPGB 1NA1B 1PKXA 1UIJA 2EINB 3CNAA 1AP5A 4XIOA 4P9JA 5ITZB 4FPCA 4RD7A 1VRH2 4TSVA 4UAPA 5FZHA 1V54B 5DAWA 3KKYA 2W3JA 3IDCB 3AK0A 2R073 3E5UA 4CDUB 2DCKA 1DQ2A 4MZUA 2Q8VA 3FKSG 4UBGA 2LGQA 4A44A 1XUQA 1V6LA 1I5ZA 1FD9A 1NVPD 4UB6Z 5L7OA 4N21A 1MS5A 2JB8A 3OM3B 2JGDB 1YFUA 2CDPA 3X29B 3BPSA 3VKOA 5EJZB 3Q4HA 5JAXA 4PD4F 4QPIA 3NV2A 5LA1A 1WLDA 4E4ZA 4Q4X3 1Q86W 2LP7A 4LBQA 4TLGA 3WOGA 4FPOB 4E27A 2J1RA 2JEUA 3CJIC 4R9CA 5JR2A 5C3OA 3DV8A 4I9QA 2KXLA 3CJHA 1W6QB 1X8EA 4O4HA 4JTAB 3CZUA 3OGSA 1NLRA 1JS9A 1QOOA 3SPHA 4BDVB 3N36A 2R043 1PO12 1AR82 5DXDA 1UYPA 2Q0AA 1SPPB 5GLTA 1MEC1 2WLIB 2VAUA 4CC5A 2N7GA 3D8CA 5FYIA 4LOTA 3VHRA 1YWKA 2AXTZ 2Y6LA 4C90A 4WZFA 3U07A 3W20A 1NQDA 4W4LA 1QOTA 1GOHA 1PL4A 1FOD1 1BJQA 1XL4A 1W59A 4YVWA 4P30A 2B45X 5ISLA 1PO22 1DYKA 3AP6A 4LBEC 3B00A 2Y34A 3QBQA 3GVMA 1OZ0A 3SKVA 4RUEA 2ET7A 2I2SA 4NO4A 4DR5B 3IZOA 2W94A 2X7RB 2V4AA 4CS3A 3OCPA 1SQQH 1AL22 1JUHA 4LF6O 2JG8A 1SG3A 3VBSC 3P3PA 2XAFA 4EWEA 5IY5B 1JYWA 5FZMA 1K9MW 4FO9A 3OMNB 4NPMA 4DV4O 4F6RA 4R9BA 1ZREA 1GN6A 4A2UA 1XE8A 3A2FA 4BIOA 3B2EE 3A4UA 2J1UA 4LC1A 2QNKA 2FTKA 3SXWA 5L9BA 1CAXA 3QO7A 1COV1 3A22A 4AQYO 5JVDB 1IS4A 4TWTA 1B35A 2A6XA 4DRXA 3ILFA 1OFSA 2RR12 2DFBA 4O4HB 2G38A 2PZSA 4WVMA 1AXKA 3K5LA 3VDBA 4WFBV 4QXHA 3LQCA 1O6UA 3M8AA 2PHUA 5DG2A 4DPNA 3O1TA 1FMD1 1STMA 4AI9A 1GNHA 4UXNA 2IH3C 1YJLA 3HBZA 3RWKX 3AL6A 5GLVA 1ZA4A 2UUAB 2K1EA 3OTOB 5HFLA 2ZIMA 4BK4A 4LHNA 4YVWB 1DDLA 1OA2A 3NW4A 3TN91 3O1SA 2OQ7A 3K77A 1HRI2 1O5LA 1PM9A 4R7CA 3GJAA 2YEVB 2UXBO 1ZBE3 2YI8A 2HLEA 3Q9OA 3CWBH 2SLIA 4N43A 5DQ0A 1ENRA 3CCJV 1OQ1A 2DDUA 5FCCA 3ZDVA 5LGTA 3LF7A 1MS0A 1MSDA 1O9GA 4XF3A 3N9QA 5FYZA 1IXMA 1XOYA 4GULA 2P17A 3ZIAG 4LORA 4B3TB 4CCKA 4BU2A 2WUHA 2UXXA 5FPLA 3CLPA 4CEYB 4DV6B 4LPLA 4MGKE 1YXWA 1R3KC 4JYAB 1R73A 2L35A 3N7LA 5IE9A 1VALA 1IBLO 4L8JA 2B1GA 2ORXA 1XI1A 1AR5A 1HQNA 4DRXB 5C4WC 3AZYA 4PHZA 1F8VA 4Y24A 5JOZA 5ACA1 2HWD3 5FPBA 3H42B 1ENSA 5LATA 4DV2B 1JJOA 2ARAA 5A1AA 1MMMA 1W6NA 2ETEA 4I0XA 5C8CC 4P2ZA 2GNDA 3W21A 2XVLA 3CC4V 3P30A 1GNZA 2CGPA 3RVYA 2HJIA 4XJWA 1PK6B 1ULCA 4IL7A 5CIRA 4W65A 3WF0A 4DR7B 3QCWA 1BMV1 3RVZA 1WA8B 3WG4A 1OCZB 3ZHVA 3QACA 3LDDA 1X9PA 1MS8A 4YLZA 3V65A 3UK9A 4MG2A 3AG1C 2E63A 2JGDA 4PT6A 2LO1A 4Q0QA 1SF9A 3U11A 3T0BA 2HKOA 3OE7G 1KB9F 3WB2A 4E8DA 4FTEA 3RWRD 4S2DA 4CU8A 2LALA 3VD3A 1R1ZA 3D36C 5JOWA 4JI3B 5T5PA 1FXHA 5LGUA 1AYM3 2O57A 4B4RA 4YW5A 4QE9A 5FBJA 4JTCB 3KVBA 1A8DA 1RVF3 1QJEA 3BVOA 4BQWA 5DPNA 3BHPA 1BCCH 2AACA 1EV13 1LCLA 2RJLA 2E26A 3OY8A 2ZJCA 3ZPYA 2QDOA 5CISA 4M4RA 4Q0SA 4AG4A 5KMGA 3ZXFA 4LF6B 1I94O 1KXGA 4HZ3A 2F23A 4YRDA 4COZA 1LUVA 2H8PC 1AJNA 3LA2A 3H01A 1NE6A 3LEGA 1WB7A 3WW3A 3ASOC 4P5HA 2JECA 1N32O 5IJ0B 1IS3A 3GM8A 2PUSA 3HQXA 4IHJB 4JZ2A 4ZBMA 1F4MA 1AYN1 1YQ5A 5JJEB 2F4VB 4L99A 2ZHNA 4OVEA 5JXHA 2XOMA 4OLLA 5AFEA 1SCSA 4IV1C 4DY3A 1SFPA 1H8TA 4XDKA 2NMOA 2PHLA 1PGW1 3ZMSA 3R0RA 3EFFK 4CCCA 1TNRA 4MXWB 2XH6A 2EICA 1X4TA 1HN0A 2DYCA 1XNRB 4B3MB 4C91A 1YQ2A 1E79G 1RUG2 1IQAA 4ZZ5A 2V5DA 5DUVA 3ZOIA 5E1RA 5KC5A 5C70A 2JDNA 3NXSA 1BZKA 1W2OA 3RYRA 2VWKA 1SHWB 4XXPA 3FHIB 1P49A 3VBBA 3CCVV 3RZHA 3VZKA 3WZ1A 4U3JB 1BK1A 2ZOEB 4A7ZA 1RUD1 1UQXA 1OCCC 2D97A 5C3QA 1NS1A 3EQEA 2VQTA 1W03A 4EV0A 4K1ZA 2W1QA 2VUDA 1BCXA 4HT1T 1Y76B 3MW4A 1XNQO 1XILA 4J9ZB 2VNGA 3VKFC 2UXDB 4CU7A 5IYCO 3BODA 1ND2B 1QMJA 2BOIA 3H9VA 3WQ0A 2OA2A 2EJ7A 1PIV1 1HB4A 4HSLA 4I2OA 1WAZA 1RMU3 4JX0A 1GZWB 1NY71 2Q8OA 3B93A 3WP4A 3D3QA 3AMPA 4ASKA 1OC1A 4AGRA 3H8RA 4GX2A 3IMMA 1JHJA 4XMIA 4FVVA 3SEPA 2XPJA 3LNMB 4LK6A 4J1XA 1GN3A 5T50A 3N35A 3ES4A 3UNPA 2HWB3 4YGCA 2TUNA 4D6RA 1ZRFA 2WAMA 1D4VB 1A32A 4N9HA 1CAVB 4GWJA 4NHKA 2Z79A 1GTOA 4GKXA 3ZS8C 3FUOA 3PLQA 1WW5A 2P3JA 4A7KA 2P3YA 5JQGA 3ON7A 5A33A 1YFXA 2WQ4A 5FUNA 4NXMB 2DYRC 2D40A 3ZN6A 3I2JA 4MGQA 4S2FA 1K5MC 5FYSA 1A6CA 3WY6A 4O2AA 4YM3A 3MF6A 5IAVA 5IY5C 2XXZA 4XCBA 2G1MA 4V1PA 2XB6C 5FP4A 1DG6A 1DGRN 3OGRA 1S2BA 1SEFA 2AH2A 2P22C 5BXXA 4KU8A 4R4XA 5LOVB 4IE0A 4PF5A 4W6XA 1SDDB 1VQ7V 4I5SA 1BBT1 1JZ3A 5FZ9A 3GZTB 3UGGA 2SBAA 2D6PA 2HWF2 5LYJA 2CNAA 3JAWA 2RDRA 3KVAA 1QJFA 3FE5A 4DV0O 3LOIA 1GZTA 5A7NA 2A9HA 3WU2Z 2VZVA 1W05A 1P4RA 1IHMA 2J7MA 5SV5A 3A0NA 3O14A 1OLMA 2L6LA 5DN6G 2Y33A 4AR2A 5D21A 1EV11 1YO8A 3ZFGC 1JZ8A 2Y6HA 1Q81W 4H7LA 2ZX1A 5T5JA 3KS7A 5IYYA 2XVGA 3VBSB 1CP9A 4J7KA 4NAOA 5JWPA 3PU3A 4OI2A 3QNEA 4L2NA 3MYXA 4K3AA 4F6EA 3K08A 4WFAV 1IGOA 1JX9A 1VQMV 2KQXA 2ADQB 2XJSA 1W0PA 5KXCA 3VZJA 1GRJA 4CDXA 1VF6A 1Y7BA 3K0GA 1QY4A 2Q4PA 2A0LA 1SESA 3WQBA 4QGMA 5JZGA 2YZ4A 1JYCA 1E1RG 2Q5ZA 4LULA 2NYYA 1YC61 2BRTA 2PTMA 3ABKB 3HN1A 4CCOA 2LQTA 2QKCA 1KRIA 5I0UA 3MD0A 3RRDA 4DXTA 1XNRO 2VH9A 2EIBA 1HQLA 3EJKA 3U4SA 4QKNA 2VOTA 1D5AA 3ABUA 1KEXA 2F95B 1S3JA 2N05A 2F66C 3SYPA 3ZIXA 3BA9A 4DUZO 1JZ4A 1OCRB 3GHNA 5H9QA 1T2XA 4UFKA 2X6BA 4RN5A 2CTRA 5JH7B 1ZBA1 3FL7A 2VVDA 2ZXWB 2BTQA 1S2KA 1JI6A 3KCCA 5C7GA 1QF3A 4QGLA 1H9WA 1OV9A 4K8ZA 4XHBA 5B1BC 2DURA 1B3QA 3VB9A 1XOUA 1QEXA 3TCUA 4XFGA 3EO6A 4QPGA 2D3PA 1ULFA 3FWEA 4FFFA 3I2HA 3EBRA 2Q4SA 4NHXA 1VQ6V 4AEJA 3CF6E 4AVVA 4IGGA 5A7WB 1QLNA 1GANA 1NAEA 2BV4A 3J26N 4DXWA 2FD8A 1S0FA 1NQJA 3O0XA 4O4IA 4OQ8A 1O8PA 1J95A 1OOPA 2BTVC 2P34A 3F2ZA 1LODA 3VDDC 2EZOA 4CDQB 5C4WB 1Q56A 2ZXWC 1FT9A 4BE3A 3ZXLA 4UW5A 1LOAA 4Q0PA 5IDJA 4JGYC 3SDLA 1DLLA 5GTIZ 3T1HO 2B4KA 2HYXA 3BVCA 1S2EA 5T55A 4XJUA 4MSVA 3WP3A 4BMBA 5B4NA 2ZX0A 1BS3A 4AILC 2OCCB 3DXRB 3RZZA 4YW4A 2HWE1 1Z2GA 5JZGC 1W6QA 3WG7B 1MA1A 3VBRB 1SQFA 4QPWA 3THOA 1G6NA 3CSXA 5FLIA 4FM0A 4EB6B 3SEEA 5EQUA 3PU8A 2ZDIA 1EN6A 1DF5A 3W59A 4J41A 1AZDA 4LK7A 2ZX3A 2BTQB 1S0JA 4P5YA 1RUG3 2Y48A 4FFBB 3ZJZA 3ACLA 5A3MA 3LSQA 5C33A 5KHJA 3ACFA 4N53C 4FSJA 2YC4A 1ND3B 1M9NA 1IBKB 1WLWA 1NQTA 5GZCA 4CXYA 4LO5B 5JSPA 1H1IA 2WNEA 2Y6JA 3UESA 4INDA 2RM22 4GKJO 1E5RA 1LEDA 3UO2A 1U5YA 5FK7A 2ZGSA 2GHYA 1B06A 3JD2A 3ORJA 4UVBA 1CAWA 1RL3A 1TUBB 3B8MA 1E1QG 1VRH1 3FAVA 4MH0E 5FZBA 5F32A 3I2FA 5ACA2 4I7ZB 1PD3A 5C8YB 1E5HA 4JI0O 1T5EA 2AEYA 4UYBA 4F83A 1B09A 1REDA 4B3SB 2TBVA 1RB8G 4LF5B 1YQ8A 3AYAA 5F37A 1SLAA 3PVEA 2R1DA 4TV9A 4QQHA 3HKEA 5JOYA 5F2SA 3DCQA 1UFIA 4C0BA 1X59A 1AROP 3T4DA 2R9IA 2CGOA 1J83A 1JZ7A 2RJKA 3DKWA 2WWUA 2BUKA 4HKLA 2VCCA 2HJDA 3LSDA 2EIMC 2WO2A 2Y8KA 4IV1B 5DAVA 2TNFA 1KDMA 1LUWA 2VY0A 5JI7A 4FVMA 1RUD2 3CE2A 4D7YA 2IJHA 3ZHUA 4MO3M 4BQ3A 2Y4TA 5FMBA 3ROUA 4TYSA 1Z5WA 2AC1A 1GP4A 1HDKA 3PVOA 4CDXB 4I55B 4L9BA 1SQGA 2GH8A 4ASUG 4XPVA 1PNGA 4R4ZA 3N4MA 2PYLA 3WNLA 3O1MA 4Q4X2 1J1LA 5CBLA 3I55V 3ZRXA 4Q29A 4LF8O 3ES1A 4FFKA 1F4AA 3RZLA 4CDUA 3MAQA 3D6EA 5J3UA 2YSUB 1DK1A 3VKLA 3CKHA 2QBXA 1RTVA 1OA4A 1CR7A 1TUBA 1KJLA 5BY1A 2W39A 4AQSA 3B3QE 1C3HA 4RR3B 3CPWU 1PVXA 4IEPA 3UETA 3F7VC 4FXKB 1U5XA 2VZPA 5IHRA 2NZ9A 3ATGA 1AYM1 1ND2C 3JD0A 2CAZC 3BI3A 1W8FA 3JALA 4TV9B 5ANNA 4CEYA 1U0AA 3ZR6A 1TMF2 4CH5A 1H2LA 3C3SA 4LFCB 4XBFA 1L8DA 4FLYA 2BQPA 4IV1A 1K12A 3BCWA 3CP1A 1SPPA 5FZ1A 1W6NB 3POGA 1XBFA 2XQXA 2IFWA 1O3QA 4MVZA 5A7WA 2C24A 2PELA 2A70A 4WBBA 2OIIA 4C7UA 2QWNB 1WA8A 3AMHA 4PLMA 3J7AU 1QGLA 1NKGA 3BIWE 3WNOA 4XJZA 4AOCA 1KMIZ 2GU9A 3F7YC 3AZWA 5IVCA 1S77D 2HWD1 5C9AC 3H9AA 4Q0VA 3IDEA 1POQA 2RDSA 2ZEZA 2WNVB 2EAKA 1YVWA 1DLBA 3NNJA 4XMAA 1K34A 2PI5A 5KXDA 1S72V 1GZCA 4Q20A 1QOSA 1NG0A 2CWSA 2D6KA 2XQRA 4COVA 3PTRB 2BBAA 1AXZA 4GCZA 4UCRA 5IVVA 3BOWA 4PIXA 1ZRCA 2P6CA 4I01A 4JI7B 4LO7A 1WB8A 4X1YA 3AM2A 2QJ1A 3JATB 1W6OB 4ZU4A 1RSOA 4CVUA 2E31A 1NTKH 1GN2A 1TVKA 4XYXA 2K9PA 4MTFA 3I7DA 3ILNA 4CDWC 2BOCC 4WM7C 3K5OA 2A6YA 4DR5O 1KFXL 3Q8BA 1OI6A 4Z07A 4IXLA 1CAXB 5DAXA 3POBA 4K8RB 2XBO2 1ULOA 1ODMA 2DWRA 2VMDA 4GQ7A 3LFMA 4Q8KA 5IVFA 2QUOA 3SJAC 2QFEA 4QX2A 2Q1ZB 3ELNA 4NWVA 1LECA 1I6XA 1NCQC 4BQ5A 3TN93 2VW1A 2XBO1 3BGAA 1ZWIC 1L0LH 1W2NA 4TV8B 4BIFA 4B4PA 3L2YA 2WAOA 2F6BA 4YHHO 4D6TH 5L73A 1F2NA 2YXSA 3D0SA 1THZA 1GP6A 4CZZA 3RI9A 2CTPA 2WZ8A 2VOKA 5HV0A 3ASNC 1NH2B 2GSYA 1U5ZA 1UOGA 1B35C 2ZZQA 3QG5A 1WP7A 3BYWA 4D8MA 1PNFA 1EP0A 2YG0A 3C7GA 3FD9A 1AJQA 4FPHA 4YW1A 1VBD3 3L72H 5EBLC 1R6KA 1QR9A 3THDA 1PMJX 3VBSA 2EXJA 1YIFA 1MG1A 2UXCO 2A6VA 1O4YA 4LMFA 3AFGA 5FZ8A 3CJHB 3E86A 5EZWA 1QR8A 2CHHA 1TVKB 3VV1A 2ZKNA 1O4ZA 2W08A 1QLEB 4QDQA 2HWB1 3OTFA 1S55A 5FYTA 3E6DA 2AGSA 5J96B 3IPVB 2HFEC 2WC2A 4YGDA 3THCA 4Y5SA 3I2OA 4GIQA 5EXOA 4IESA 1QXRA 2R6QA 4OHZA 3BU0A 2MNGA 2AYHA 4MTOA 4JRAA 2EILB 3FBMA 5IWFA 2YC0A 1ROPA 1OUSA 5F6KA 4XF4A 2XG3A 1OA3A 5JUVA 1W0JG 3K4ZA 4QX5A 1FFTB 5LBEA 4K8FA 2WJSA 4CH4A 4GZ9A 2P67A 4FLTA 1ZLZA 3NJXA 4ATFA 2QTWB 2GDSA 1UN1A 3JQXA 4QB6A 1ZZ9A 3HR9A 1P7BA 2RS31 4LE3A 2HKXA 2UYAA 4ISQA 4JYAO 2AZ5A 3J80N 5K9YA 3WV6A 3CC7V 1MZEA 2IU0A 4YW2A 4NJ4A 2DCTA 2WO1A 2DE0X 4JI6O 1QNWA 1GZ9A 2QWOB 3CJXA 1DU3D 4I4TA 5FQ0B 1PP9H 2XAHA 5IT9N 4QM9A 4AHXA 4OUMA 3J9SA 4JKLA 3KT4A 4FPGA 4CP2A 1G7YA 2EBOA 4JZRA 4JI1O 4BH9A 3CCMV 2ZEWA 3TRSB 5GLWA 5H2FZ 3UGHA 3E35A 1L1FA 1GU3A 2VMCA 2FZ2A 3BIEA 4EE2A 2FZ1A 2DVGA 3M7AA 4UF0A 5AC91 2AHZA 4QXCA 1DHKB 2QKSA 2Y0OA 2CY6A 5F1RA 3OEHG 1NBMG 5LGNA 4JV5B 4DY5A 4JI8B 3T1LA 1RC6A 2RCVA 4K7JA 4Q4X1 5C4WA 5LYJB 2BNNA 3FX3A 2E6VA 3LCPA 1N34B 1UW8A 4U2AA 3JASA 1GAXA 5CB4A 3AG3C 5FNVA 3LE0A 3DPRA 4JI7O 2ZE8A 4Q4Y2 1D0HA 5DUUA 4ATEA 1WD3A 3ZCCA 3WG7C 3SJBC 1Q3EA 1L3JA
chains in the Genus database with same CATH topology
2RS32 4JDNA 3UJOA 2JG8C 3K51A 1NCQB 5JCTA 1O3RA 1VAMA 1R1A3 5AFBA 3TYJA 1BBT2 1CESA 1X50A 2I07B 4EJRA 4M2EA 4PIYA 5EJ3A 2D44A 4OUSA 5FTTC 1REEA 2XL9A 1RMU1 4HANA 3VBRA 1POV1 1Z7S1 4DZGA 2VOWA 1DF0A 1R082 3ZVXA 2HWF1 1J3QA 4FQZA 4IV3C 4YLMX 2XWJB 2R0HA 1RVF1 4X6QB 3RYPA 2DUPA 4QPGB 1NA1B 1BEV2 1YFWA 5IT6A 1UIJA 4CDQA 4PBOA 1WLCA 4JQRA 3I54A 3CNAA 5K8SA 4KGGA 4LA3A 4XIOA 4P9JA 4FPCA 4RD7A 1VRH2 4TSVA 4C1XA 1D0GA 1OIJA 2E7QA 3ZFFB 3VUOA 4YVWC 4GA9A 4YFZA 1ND3A 3AK0A 3IDCB 1HXS2 4UW4A 4E2QA 2R073 2WA3A 3E5UA 4CDUB 2DCKA 1S0CA 1DQ2A 4BA6A 4MZUA 1YLLA 3ME2A 4UBGA 3PMSA 1DS0A 4FPEA 1V6LA 4Z8BA 1I5ZA 1I9RA 4XOGA 3ZSMA 3ZFEC 2K9ZA 4AQ6A 5L7OA 5CFCA 1MS5A 4LT5A 1Y3TA 4CDXC 3IM0A 3EXUA 1FX5A 1LOBA 4ES8A 4WVVA 1YFUA 3X29B 1ASJ3 1YIPA 3LB9A 3ZMOA 3VKOA 3DUIA 5JAXA 3B9IA 2BFUS 2RE9A 1QDOA 4QPIA 3NV2A 4Y4YA 1WLDA 3SISA 4E4ZA 4Q4X3 3H3UA 3PMEA 3WXPA 4AHWA 2GZWA 4LBQA 3WOGA 2JX9A 2A6WA 3KB5A 2A6ZA 3NV1A 4FPOB 1J58A 4E27A 5FLJA 4AI0A 1S0GA 3CJIC 4R9CA 1DGRA 1C57A 4J6GA 3S7IA 4Q4V3 4YZ1A 3DV8A 1WMEA 4F3JA 1H8TC 1Q43A 2KXLA 3V64A 1UAIA 3SCHA 4QQ2A 4XZPA 2W68A 3KQRA 1YCIA 3SCGA 3ZYGA 1JXNA 2D98A 4S2HA 1W6QB 1X8EA 5C8CB 1GVGA 1PVC1 4HVQA 1UU4A 1NLRA 4CRQA 4XJAA 1D4M1 1QOOA 2KA3A 1ZZ8A 2CGNA 4OZXA 3N36A 1RMU2 1PO12 1AR82 2R043 1IKQA 4AHYA 3ZXGA 5DXDA 2Q0AA 2YMZA 3OGGA 1MEC1 4QGNA 5GLTA 1VAVA 1O5UA 5FOJB 3RWNA 2N7GA 3D8CA 3TOJA 3SITA 3VHRA 1YWKA 5FMOS 3J8F3 1ZZ6A 2VPVA 3VBFB 1LGNA 4WM7A 4C90A 4QQOA 4WZFA 3U07A 1NQDA 2JD4A 4Z92B 1QOTA 4L97A 2P3IA 2NMNA 1FOD1 4IEVA 2R32A 1BJQA 3TWIA 1JBCA 2Q5TA 4ORFA 2ZGLA 1PGL2 1MZFA 1DZQA 2IXHA 4YVWA 1TME3 5BNPB 1Z7S3 2B45X 1OS7A 1PO22 1DYKA 3AP6A 1HIXA 1QQP1 2B9UA 1CONA 3B00A 3MF9A 3WT3A 3LKJA 4LE4A 4CEYC 3QBQA 1VIWB 3KGZA 1CAVA 2ET7A 2I2SA 1W6PB 2IC1A 4JCKA 4KQ7A 5AC92 4NO4A 3E5XA 1WD4A 1LJ7A 3R4DB 4QQPA 3LZZA 1FPN1 2WSUA 3J8F2 2XJPA 3MIEA 4JTNA 4R8HA 2Z2SB 3D0JA 4FAGA 2FBEA 1NA1C 5D8AA 1RUC3 3OCPA 1AL22 2RHPA 1JUHA 1LKNA 2JG8A 4YSFA 3NWKA 4MGIE 2UWCA 2WS93 5D8AC 4M25A 1GV9A 4QPIC 2CV6A 1W39A 2DCZA 3VBSC 5IUQA 3P3PA 2HWF3 1OHFA 2DTWA 4EWEA 4C0HA 4FO9A 4Q8LA 1QU0A 1OIIA 1CD3G 3JBG3 2PA7A 3TN92 2IZWA 4OHVA 1SLIA 2RR13 4AFCA 5KHGA 2OYZA 3M4FA 4R9BA 5FLHA 3VBFC 1ZREA 3HMYA 5JSRA 4A2UA 1XE8A 3SMHA 5CG8A 1M06G 2HYKA 4BIOA 4PLNA 5HBAA 4B4QA 1XNBA 1OLRA 1N3QA 4CWDA 3VBHA 2PHRA 3A4UA 3OY8B 2QNKA 2QE3A 2A71A