4J9YB

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
89
Chain Sequence
b'GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
molecule tags Transport protein/calcium binding
source organism Rattus norvegicus
publication title Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation.
pubmed doi rcsb
total genus 35
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2013-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4j9yB00
1OCRC 4HYOA 2H8PC 3UM7A 2X6CA 1OCCC 3T1CA 1R3IC 4ZBMA 4DXWA 3F5WC 1LNQA 4MW3A 2AHYA 3T2MA 3AG2C 3LDEA 4X89A 2A9HA 2JK5C 4XDJA 3RW0A 2WLLA 2Y69C 3E8FA 4LBEC 4MS2A 4X88A 3FB7C 4MTGA 4LP8A 3TCUA 4QNHB 4QE7A 2WLMA 3KG2A 3WG7C 5KUMA 3X2QC 3RVYA 2WLIA 2WLIB 1V54C 4PA4A 5CBHA 3K06A 4HZ3A 3K0DA 4PDVA 4P2ZA 3ZJZA 3LNMB 3AG1C 2YEVA 5EBWC 3UKMA 2BOBC 1J95A 4PDRA 4P9OA 2EIKC 2EINC 3K08A 4GX0A 2A79B 1KKDA 1P7BA 3BEHA 4P30A 3F7YC 4GX5A 4JTCB 2HG5C 4RO2A 2WLLB 4MVRA 4X8AA 4CBCA 4MVUA 3AG3C 3FB8C 3OUSA 3T4ZA 2EIMC 4RUFA 4LCUC 5J9PC 1G4YB 3OUFA 3ASNC 4P9PA 2X6AA 5B1AC 2WLNA 2HFEC 4MVSA 5B3SC 4H37A 4WFFA 1V55C 4MVQA 3SYCA 1ORQC 2P7TC 4PA3A 2R9RB 3SJQC 3E86A 2QTOA 3SYPA 1XL4A 4PDLA 4R7CA 5EC1C 4J9YB 4PDMA 3ABMC 1K4CC 2A0LA 3ABLC 5E1AC 2HVKC 3SYAA 2DYRC 4H33A 5EBMC 5KUKA 3FB5C 3ABKC 2WLKA 1JVMA 1OCZC 3IGAC 4WFHA 4R8CA 3T4DA 3E8GA 1M56C 4R50A 4WFGA 2ZXWC 4OXSA 2EIJC 2EILC 3K0GA 4J9ZB 2Q69A 4PA7A 3RBZA 2K1EA 4EKWA 1K4DC 2AHZA 3K04A 4MTFA 3SPIA 5BZBA 3AG4C 4MVMA 5B1BC 4I9WA 3JYCA 3ZRSA 3ASOC 4MSWC 3OR6C 4G27B 4QE9A 4XDKA 1OCOC 4GX1A 5IY5C 3E8BA 5CBFA 2BOCC 3E83A 3FB6C 4MVZA 4RAIA 3HPLC 2WLHA 3LUTB 5EC2C 4GX2A 4MVOA 3E8HA 4RUEA 1S5HC 3EFFK 2KB1A 2QKSA 1R3LC 1ZWIC 4JTAB 2ZD9A 4MTOA 4TWKA 1XL6A 2DWEC 2IH3C 4G28B 4BW5A 1QLEC 2Q68A 4MW8A 2ITDC 3VOUA 4PA6A 3OGCC 2X6BA 2ITCC 3K03A 5CBGA 4PA9A 3F7VC 1R3KC 3STLC 3TETA 3SYOA 3SPGA 4F4LA 4R6ZA 2OCCC 5EBLC 2NLJC 1BL8A 3IFXA 2HJFC 3OR7C 2HVJC 5EK0A 3R65A 4UUJC 3SPCA 3SPJA 2DYSC 2W0FC 3RVZA 3SPHA 3SYQA 4JTDB 4XDLA 1R3JC 2ATKC 3LDDA 2Q6AA 2IH1C 4WFEA 1M57C 3LDCA 3GB7C 2DWDC 4KFMA 3PJSK 3E89A 3STZC 2WLJA 2Q67A
chains in the Genus database with same CATH superfamily
4X1IA 1KD1W 4LF4B 5EZYB 3T1CA 4ZBMA 4BR6A 1WPBA 3F5WC 3HKEB 1YZBA 2H94A 1S3JA 2OTJV 3FB7C 2Q5ZA 1X4TA 4LF8B 1BT8A 5IE9A 1H2MA 1V54C 2B1GA 1GK9A 3C90A 2L6LA 3H01A 4X62O 2B1IA 3LNMB 4DR1B 4CS2A 1EBOA 2PZSA 4U3FH 1COWG 4LF5B 4BIZA 1QQCA 1H38A 1GN6A 5LOVB 4DV6B 1IZ3A 2R72A 1KKDA 3RYIB 2P22C 4MVRA 2EIMC 5J9PC 3UT5B 3OTOB 4DV0O 4P9PA 4NKGB 4GKKB 3DSQA 4O4JA 1HNZB 3SYCA 2P7TC 3RWRD 1VQLV 2CTPA 1OHHG 2C2AA 3EHBB 4X20A 2Y69B 3AG7A 2LQTA 4DV1O 3VQVA 1HDJA 4GYCB 5B1BC 1PV0A 1M4UA 4O4HB 3L73H 1BGYH 2OIGA 1FJGO 4MVZA 1YJ9V 2EINB 1XOUA 2GSMB 3JALB 1VQOV 3BPZA 4ICGA 1P7GA 4DRXA 3M7MX 1IVSA 5IYBO 2ZT9B 2NLJC 5BR8O 1UJWB 1VIBA 5KA6A 2YDEA 3L70H 3RVZA 1KMIZ 3K3WA 1MOFA 1M1KW 1Y4MA 2VQFO 2PGGA 3GWOA 3ZCCA 1OCCC 4DXWA 5FNVB 2Q73A 1K9MW 2JK5C 5CMUA 1I94B 4MS2A 1Q6IA 2LJ2A 1Q6HA 1GM8A 1B3QA 4UCTA 3JAKB 1PNKA 4LWSB 4X65B 2WPDG 3I55V 2QEXV 1QR9A 4FM0A 2IJJA 3H9VA 2UUCO 1MABG 1EN5A 4UCOA 4DR6O 5JCOC 2AZ0A 1JJOA 1I5YA 3ZMUA 1VF6A 4I55B 1AVMA 3M99B 5AG2A 2RQ6A 5K1PA 1ZAUA 5L3DA 3W7TA 3ZHVA 2PI5A 3O65A 1K7DA 4B3TO 5KUKA 3FB5C 2WLKA 1KC8W 2F1MA 4K8XA 3JD3A 3K59A 4U3JB 1SA0A 4DUZO 1SQXH 4O2AB 3UT5A 1JFFA 4RAIA 3E2EA 4GX2A 4AQYB 1ROPA 2ITDC 2RMKB 2ITCC 4AQYO 2LGWA 5DECA 4UFZA 3IFXA 2HJFC 3KKYA 1X59A 4TQDA 4DV5O 4GCZA 2Q7HA 4I4TA 1HNXO 3ZHTA 3OW2U 1N32B 2DWDC 5CN0A 4IIJA 3B2EE 5IJ0A 5D5QA 5JQGA 4JYCA 1OCRC 1V55B 1YIJV 1SS3A 2FYUH 4JI4B 2CUGA 1N32O 4X9QA 1K92A 3JATB 1IBKO 3LDEA 4DR5O 3JD4A 2RJZA 2WLMA 2E3CA 3FD9A 3HKCA 4LWSA 1PKXA 4PA4A 1VARA 3VQWA 4GKKO 2UXBB 3QO5A 2AXTZ 1M56B 2DN9A 4QJFB 2BTQA 2EIKC 1RM1B 3QG5A 2A79B 4UB8Z 1MMMA 5EYPA 2KQXA 2RN9A 5KX5B 4X8AA 1K5QA 3AG3C 4RUFA 1Q8IA 3OUFA 3ZRVA 2GTAA 3SJBC 4DR2B 5B3SC 2XUMA 3ZS8C 3OTFA 4AI8A 5H2FZ 2P4KA 4J42A 4DV7O 3N2GB 3MAQA 4JI7B 1I94O 4DV4B 4R7CA 4C7UA 4PDMA 2ZIOA 3IGAC 4O4IB 3CCVV 3RYCA 4KXRA 4WFGA 3ABUA 4PA7A 3B4SA 4NB5A 2UXCB 5J2UB 2E5LO 2M6YA 5LGTA 3BRCA 3JCUZ 1WNSA 5LP6B 2UXCO 1M57B 1D2DA 2GUZB 3BVOA 1UPGA 4FLUA 3BA8A 5GONA 2WLHA 5KHGA 4JI1O 3FAVB 1OV9A 1N0JA 1TUEB 1XEQA 3ZMTA 1JMKC 2PTMA 4YJ3A 1I08A 4PA9A 2LW7A 4LFBO 1DGSA 1V9PA 2CGOA 1FD9A 1I7FA 4GUNA 2HVJC 4DW1A 3T1HB 1MSDA 4CC5A 2ATKC 1XBLA 2W6IG 2PY5A 2IH1C 1JX9A 1NS1A 5GONB 4YY3B 3CPWU 1CXZB 1NJIW 2HR3A 2R9AA 5LOVA 2YIBD 4B3MO 2YIAA 3FYIB 1CP9A 5J2UA 2IU0A 3CRCA 4X64O 1HNZO 2IJKA 3CB2A 1H8HG 2RCVA 3N2KA 1PNLA 1IURA 1THZA 4ZIBA 1UFIA 2YEVA 1G6UA 1VQ9V 1SQVH 3F7YC 1VQ5V 3K5NA 1GTOA 2E75B 3C3TA 3FB8C 3HB3B 3E22A 2WWWA 4N21A 4I0XB 2LP7A 2DJVA 1MSWD 4DR4B 2Q7EA 3IC9A 4JYBA 1Y76B 3CCLV 3E8GA 1M56C 3M8AA 4EEQA 4FK5C 3E22B 2BSKA 1J5EO 2PYLA 4W4LA 3FFQA 4K3AA 4QE9A 2P06A 2IW5A 3ABKB 1M93A 5IJ0B 2ZCEA 2YEVB 2EZOA 2UU9O 2D3OW 2XAFA 2Q68A 3D3IA 4MW8A 4TV8A 1SKVA 1K5SA 3SDLA 4JPRA 3BABA 3G80A 4AILC 3C3SA 2YIDA 3ML0A 4JI2O 1BHAA 2F66C 3GWKC 4KL1A 3AK3A 4H13B 2WLJA 3CC7V 2DQ0A 2EBOA 4ZKIA 3CC4V 2YICA 3Q4HA 4LF9O 1YF2A 4DV5B 4WBNA 2BTOA 4LP8A 3CCSV 3P30A 5LXTB 4PHZA 5TISZ 3I5DA 3BY6A 1QCEA 4BIUA 2CTWA 4FLVA 2CE4A 2OT5A 1H2LA 2F43G 2GUZA 1W59A 2Z5UA 1P7BA 4GX5A 4H44B 2WLLB 4I55A 3CCUV 4TOIA 2UUBO 3ASNC 3CX5F 2XAQA 4X66B 2R9RB 3SJQC 1PPJH 3SYPA 5GW7A 4JYYA 4QIWF 2HVKC 3A8TA 4U7OA 1JVMA 4R8CA 3T4DA 2QKAA 1KECA 4X1KB 4E4EA 2ZINA 2K9PA 4NVPA 1Y66A 3AG3B 1WB7A 2A06H 5LA6B 3KCXA 2BOCC 4BWAA 1XREA 3FX7A 4NR1A 2OTLV 2KKWA 1R6KA 4GZRB 5JH7B 2QWRB 1Y74B 5IWAB 2HLDG 1FPOA 1YEWA 4JI6B 3K5LA 3A0RA 4D7TA 2QTSA 2X0LA 1SC5B 2YXYA 3SPCA 2W0FC 2CGNA 3JD2A 4UV9A 2DOSA 4GT1A 1DK1A 1JCHA 5JQGB 4TQFA 4LNUA 4Z1MG 2CH7B 1U97A 3B8NA 1YTFD 4DO2A 1V54B 1YVWA 2H8PC 2D2CB 3KZIZ 4L8JA 2GTSA 2WAMA 1Q7YW 5LYJB 3CCRV 2NNUA 1H2KA 2QM7A 4O4HA 4X89A 3VQXA 1VF7A 2ZDIC 1XHZA 1RP3B 4PI0A 3CWBH 4IGGA 5KHKA 3ABMB 4CH4A 4NXMO 2WLIA 3FYEB 2M7WA 4YY3O 1N8RW 1FS0G 1F23A 2WA3A 4IYIA 4I50B 4EFEA 1M9NA 1TAEA 1Y6XA 3SR2C 3I56V 1KUQA 1S5JA 5KAFZ 4JYAO 1O9HA 2CK3G 4OPAA 1N33B 4LFBB 2HG5C 5LGNA 4U3JA 4JI4O 1OCCB 1EZJA 2ODMA 3CP1A 5L3FA 2JS3A 5B1AC 2WLNA 1K97A 1HNXB 2HHHB 4NXMB 2CDYA 1DF5A 5EBMC 2YSUB 1XMOO 1M5IA 2Q69A 5B1NA 1VQMV 4ASUG 2ADQB 3CRRA 4OGQB 5KAIZ 4LFAB 2F4VB 4DV1B 3UQ8A 3RYFA 3B8MA 4X1IB 3CCJV 1F4MA 2UXDO 1U96A 3MDSA 4K35A 5K1XA 1R3LC 2ZD9A 4TWKA 1K34A 3ETGA 3VOUA 1QNMA 3ASOB 5B3SB 5CBGA 1Q81W 3L72H 1ZL8A 2YI9A 1US6A 5A9GA 3OE7G 5LL6Y 1K73W 3LNNA 1QBZA 2UXXA 4DR6B 5F2VO 1RFYA 3AK2A 3RYHA 3ZX6A 4WFBV 2GDSA 4YJ2B 2JEUA 3JCZA 3AG4B 1XUQA 2ZKOA 4XDJA 1PP9H 3RW0A 1G1XB 4MTGA 2O57A 3ZMZA 1XNQB 3CJHA 5CBHA 3HKDA 4EB6B 1ZUQA 1YITV 1XMQB 5EBWC 2BOBC 3CHXA 1BMFG 2ARHA 1XI1A 3CE2A 3W7UA 5DM6V 1NR7A 4JTCB 3K57A 2P6JA 3H1KH 1FXHA 4TV9B 3ABTA 1QR8A 4GKJB 4J7KA 1IXMA 1W0JG 5IYZA 1FXKA 4MVQA 5JJNB 5LXTA 1QLEB 4X20B 3SYAA 1BCCH 4DV2O 5BR8B 2ZXWC 3W7WA 1Z5WA 3K0GA 1BQZA 5KHJA 3OMAB 4ZOLB 5BZBA 4I9WA 5IT9N 3RYIA 3ZHUA 4CC6A 1N33O 5L3CA 3IJ4A 4WBNB 5JVDB 3TJTA 1NTMH 3FB6C 2LFSA 3JAWA 3APQA 3HPLC 1XNRB 3E8HA 4JASA 1F4NA 4CS4A 1NT2B 1K33A 2LO1A 4PA6A 2UUAB 3OD4A 3ZBHA 1AB3A 3LSQA 4F4LA 3OTOO 4DV0B 4NYKA 3ZHSA 4JI8B 2FB5A 3ABLB 1JA8A 5JCOA 4FLZA 2JIZG 4TT3G 4LF5O 1BQ0A 4LF6O 4X65O 4IL6Z 3D3QA 1GM9A 3W7SA 2FL4A 2UU9B 2IU3A 4JI5O 2FTKA 3AG2C 1F7YA 2A9HA 2V1DA 4LF8O 2UXDB 2Y69C 5H9CA 3RVYA 1J5EB 4JZGA 5EIBD 2F4VO 1LR1A 2RNBA 3U10A 5DN6G 3OMIB 2OYQA 1TVKB 2V4DA 3CSXA 4Z1VA 4DW0A 3OM3B 1Y76A 2HJDA 5J2TB 4I5SA 4NXNO 4AHCA 4RO2A 2GHYA 3APOA 3JSLA 1DLBA 4LF7B 1G4YB 1FFTB 3WFVA 2Q9LA 2YXHA 2MK3A 1YJWV 4I0XA 1VMGA 3A2FA 5BMVB 1Q43A 4FLTA 1XDCA 1AR1B 2JRIA 1VQPV 3THOA 2QWNB 3P3NA 1WJZA 3GVMA 4WFHA 1YTFB 3SPIA 3ASNB 5L3GA 4H0LB 4MSWC 3J80N 4LFAO 4JI0O 2P67A 2DYRB 4ZHQB 3E83A 4IT5A 4B7EA 1ZLZA 4UB6Z 1XMOB 3JAWB 2ZM6O 5JVDA 2QKSA 4TUYA 1S77D 3ZRWB 4BW5A 5CA1B 3CD6V 1Q3EA 3K03A 3SPGA 2G38A 1KP2A 3E35A 3FAVA 5EBLC 5KHHA 4DR3B 1RSOA 3SPJA 3SYQA 2EULA 4XDLA 1SQBH 2CTQA 5LP6A 1WN7A 2A7WA 4TUYB 1GKFA 1OCOB 1AJNA 1TUBB 3OMNB 5IYZB 2VQEO 3VQYA 2ZDIA 5C8YA 1MG1A 3JARA 3NR7A 3B77A 3WB2A 1FXVA 3S3XA 5L3BA 4X88A 1E1QG 2VQEB 3EVKA 4QE7A 1BSMA 3H1IH 4LFCB 3H1JH 3N2GA 3ETDA 3K0DA 1XQ8A 1FFXA 3N27A 2L35A 3UKMA 4DV3B 4OX9O 5KX5A 4LH6A 2RDCA 2Q7GA 4FPPA 3K08A 3QO7A 4GX0A 4P30A 3CMEV 5BXZA 4DV7B 1EN6A 2UXNA 5KLVH 5CA0A 3OUSA 3VBBA 4DV3O 4HNAB 2QWPB 2HFEC 1WA8B 3RGBA 4PA3A 3HKCB 4MTXA 3QO8A 1IDSA 5E79Z 2P4VA 3JD0A 1RPRA 3CEIA 1OCZC 2WSSG 1XNRO 4LR3A 3JATA 2EILC 3BAAA 3HR0A 2HHHO 2QJ1A 1H8EG 1K4DC 2F95B 5H5NA 3ASOC 1HWYA 1S0VA 1RPOA 1HW7A 4DK0A 2QM8A 5DEDA 4JAUA 4TSFG 1VQNV 4ZI7A 1XL6A 1AI6A 3ZN0A 2X6BA 1PNMA 2MW2B 3F7VC 4DK1A 3TETA 4JI1B 1FXKC 1L8DA 2FKXA 4DR7B 1BL8A 1B04A 4A5UB 1JFFB 4PJ0Z 4DV2B 4UCVA 1SRYA 1AILA 4Q6GA 2Z0AA 4RQFA 3T1HO 4Z2WA 1SA0B 1MNGA 1VF5B 3FKSG 1P4RA 1O9GA 1JPXA 2ZXWB 2OWOA 4BW9A 1TA8A 3CRMA 3CMAV 5D5PA 3WG7C 1TGOA 4O2AA 3K06A 3HKBA 3WB0A 1XNQO 1B06A 4O4LA 4KHPB 1N36O 1R1BA 3DC5A 3MHHC 1AJQA 3ETEA 2UXBO 2QKCA 2YXLA 2XTAA 4ABMA 4XBFA 1SQQH 1W2BU 4MVSA 1JQ0A 4U7NA 3JAKA 4WFFA 5LHHA 4JGSA 5IJ9B 1YI2V 2BCCH 2CH7A 4J9YB 1SESA 3ABKC 2UUCB 1H2SB 5IYDO 5FNVA 4LF4O 3UO3A 4BAYA 1NH2D 4J10A 5LHIA 2Y48A 1R73A 2Q0OC 1EN4A 1AR5A 4K8ZA 1N4CA 3AG4C 2V7QG 3L71H 5B1AB 3JYCA 4OX9B 1SERA 1N34O 2VQFB 1FYJA 2UUBB 5FLXN 4B3SO 4B7KA 1IXBA 3CC2V 5CBFA 4JV5O 4W4KA 1Q5OA 2W0XA 3T1YB 4LFCO 2BE3A 4MTOA 2ZQMA 4WCEV 1BS3A 1QLEC 2QSAA 2QWQB 1E79G 4E2LA 5EIBC 3CCEV 3NXSA 5LGUA 1SF9A 3OR7C 4FFBB 5B5EZ 1BZKA 2CTRA 1VQ4V 1OCRB 3G6BA 1WAZA 5LHGA 4NTWA 4YIOA 1VP7A 1AR4A 1D5NA 4L87A 4DRXB 4MW3A 3D36A 3JALA 3T2MA 3A0HZ 3L75H 3ZEDA 4DUYB 5KMGA 1VEWA 2ILMA 2WLLA 5ITZB 2Q8VA 4JAVA 5HFLA 1NQTA 4KUMA 2JJ2G 1HP8A 2ADPA 4UCUA 1WP8A 3ZMSA 1GN2A 2XAHA 3ZJZA 4IYHA 2AZ2A 2DW4A 2AW9A 1A32A 2Q4PA 4JI2B 1B6QA 3DTUB 4X1YA 2JGUA 1IX9A 4FM1A 4J11A 4D6TH 2DYSB 4HAMA 2YIBA 4K0KO 4PELA 4O4JB 2X6AA 3SGIA 4DR2O 3TK1A 2JEXA 2IJHA 2QTOA 3CCMV 3CCQV 3ABMC 4LF7O 4FIPC 4I50A 4WFAV 3BHPA 4OXSA 3RBZA 4UCRA 1G8MA 4EKWA 4FLYA 4ZI7B 1I5XA 4CH3A 4G27B 5BMVA 1ZTEA 5B1OA 4JI8O 1SETA 5LYJA 5IY5C 3LSUA 4DR7O 3OEHG 1EZVH 5EC2C 3UO2A 2CAZC 4G28B 4JI5B 1TVKA 1LUVA 1KYOF 2N04A 1GH6A 1FJGB 3QVNA 1K8AW 2ZE7A 4X64B 4UUJC 3G6EV 1I0HA 1E1RG 1QVFU 3MD0A 1R3JC 2QM4A 1L0NH 4HNAA 1AROP 3CXHF 1NTKH 4FZ0A 1QHTA 2OIEA 4HYOA 3UM7A 1IBLO 1KU9A 2N74A 4PD4F 1AI7A 4B3RO 4FZ1A 3QNEA 5IY5B 3KCYA 1FFXB 2YUAA 4X1KA 2EZPA 4I9QA 3CXCU 1HR0O 3U0ZA 5KHIA 3D36C 2HP8A 3QTCA 3DXRB 1J95A 1CEZA 3UCSC 4DV6O 3JARB 3L74H 2XNDG 1NI8A 1F51A 5C8YB 5FPRA 1TUBA 4DYLA 4LCUC 2DQ3A 4FVMA 1QLNA 1AI5A 4H37A 4O2BA 2E5LB 4CZZA 1NU1H 2ZNIA 2Y4UA 1YJNV 1XL4A 1YCIA 2A0LA 2EIKB 2PI4A 3EXAA 1M90W 3SJAC 1N36B 4R50A 4JI3O 3ZRWA 2AHZA 5CA1A 5KMGB 2ZR2A 2ZIMA 1KP3A 4DR1O 4YJ3B 3OR6C 1K3EA 1Z2GA 2QR4A 4ZHQA 3E8BA 4KP4A 4UV8A 4JI7O 4JTAB 1Q86W 1SZTA 5H6QA 1WB8A 2NR5A 2JGDA 4FFBA 4X62B 1VF6C 4JZ2A 3STLC 1VQ7V 1L0LH 1NKDA 3J7AU 3HKDB 3CJHB 1VQKV 3P32A 3SPHA 2KG7B 4DR4O 2PYJA 3G67A 1S72V 1YSCA 4WFEA 4I7ZB 4KFMA 1OZ0A 2YC0A 4UCSA 3J81N 4IHJB 2VS0A 3RFRA 4PV1B 1JOYA 1LNQA 2AHYA 4LH7A 3JSNA 2BSKB 2ZM6B 1RM1C 3D8CA 1JJ2U 2H3OA 2P5OA 4BIOA 1MZFA 2BTQB 3OAAG 4PDVA 1H2GA 1R6TA 5IJ9A 4JYAB 4P9OA 2PF4E 3DGEA 2XT9A 3ZIAG 1WLEA 1GMGA 3CYOA 4B3MB 3T4ZA 3TGUH 1EFRG 3H1HH 5LBQA 4O4LB 5EC1C 1S76D 4H33A 5IDJA 1H2NA 2OCHA 4J9ZB 1T5EA 1ENVA 3ZHQA 4MVMA 2IJIA 3ZRSA 5LMUB 2LFRA 2B9ZA 2EJ7A 4X1YB 3DC6A 5H6RA 4RUEA 2KB1A 3B40A 4JAAA 3B09A 2IH3C 2DMXA 2F23A 1AP5A 5JJJB 5ITZA 3AG2B 1Z5VA 1SQPH 2FMLA 1EM1A 3WB1A 1FXKB 2ZR3A 5A2QN 2EX3A 1NVPB 3BFRA 2Y0IA 1M57C 1WPXA 1S5LZ 3PJSK 3E89A 4NTYA 2P90A 1HR0B 1PL4A 2X6CA 1BE3H 3RT3C 4QPKA 2XAGA 4YHHO 5CB4A 2QGNA 2UUAO 1CPYA 4LNUB 1XHXA 4LBEC 1DF4A 1GN4A 4QNHB 3KG2A 4EB6A 4DUYO 3AEIA 3G71V 5B1BB 4F6RB 2LW1A 3RYCB 4O4IA 2EILB 4JF3A 1WP7A 3P3PA 1VQ8V 2E76B 1VQ6V 3TXQA 2X7RB 1Y74A 4YJ2A 4DR5B 4YIPA 3IAYA 3K5MA 1AJPA 4HBNA 3RYHB 1NTZH 4F6RA 3E86A 3ZRXA 4GKJO 2DYRC 3SJCC 4FFKA 4LC1A 1IBMO 2K1EA 4YHHB 1W0KG 4QGPA 2XHBA 1GM7A 1GRJA 1Y67A 3ZN1A 1SQGA 4UVCA 4GX1A 2A3QA 2YI8A 4NTXA 4YXWG 3RYFB 4IIJB 4UXNA 1ZWIC 5CB4B 4LF9B 2DWEC 3HKBB 2N05A 4I4TB 3OGCC 4JI3B 3O9OA 1GO3F 3SYOA 4B08A 3S3WA 2YS8A 5EK0A 2DYSC 4UVAA 2AGAA 3W7XA 1FKAO 2VRZA 3WU2Z 4UVBA 2VWJA 2Q6AA 1URFA 3H1LH 3LDCA 4CH5A 3A0BZ 1NBMG 1ZSPA 2ETNA 3K9AA 1YHQV 2W6JG 5LMUO 5C93A 1R3IC 2JS5A 2IM9A 1IBKB 2QDOA 3OGIB 2ZE5A 4DR3O 3RN4A 3X2QC 3ZMVA 2WLIB 1ZX3A 3L9DA 2B5UA 5LMNB 3PN1A 3AG1C 3OEEG 4F6EA 4PI2A 4K0KB 3IC7A 4TV8B 2EINC 2QE7G 1Q6UA 3CRQA 3BEHA 3OT7A 2ZE6A 4MVUA 4JI0B 1NVPD 3HKEA 1YDXA 1Q82W 2KSDA 3CS5A 1AI4A 1MA1A 5FL7G 3K5OA 5IYCO 4WF9V 1IBMB 4PDLA 1P84F 3WG7B 1K4CC 1KBHA 4J41A 1LUWA 2R70A 1IBLB 3ETQA 4DUZB 1OJHA 2EIJC 1WA8A 4MTFA 1NH2B 5JH7A 1QVGU 5CA0B 3JASA 1KQSU 2EIJB 2Q0AA 1BHBA 3K79A 2ZE8A 4XDKA 5LA6A 2DE0X 3OFNG 5B66Z 3LUTB 1S5HC 2HEPA 4JI6O 4J7JA 1NZ6A 2GV9A 1NR1A 2E74B 5CA3A 4IHJA 1Q90D 2JGDB 5LP6C 1R3KC 4FLWA 2OCCC 1L1FA 3N2KB 4J80A 1R6NA 2KG7A 2OCCB 3T1YO 4QPJA 3ICXA 4KHPO 3LDDA 4JV5B 3AG1B 3LSSA 1N0NA 4G2KA 3MHSC 2HKOA 3GB7C 4OPHA 2JDIG 4LF6B 3F5TA 3G4SV 1GN3A 3U11A 5KA5A 4FLXA 5JJEB 2LGQA 2Y4TA 5HFMA 4CH6A 1RSOB 3CRAA 5GTHZ 1KB9F 4CS3A 5BY1A 5IWAO 3E8FA 2IBZH 1PL0A 4ZOLA 1SZXA 3TCUA 3R66A 4X66O 2XOKG 5KUMA 4FJCC 4RQEA 1MZEA 1GAXA 4HZ3A 4GLXA 4P2ZA 2JJ1G 3JD1A 1KKCA 3ZHRA 4PDRA 3Q4HB 3K9SA 2EIMB 2Z3YA 4FM2A 2GBOA 4D7SA 4TV9A 4CBCA 1HNWO 2EJRA 2VWKA 4DV4O 2Y0PA 1AP6A 4O2BB 1JR9A 2QA4V 1V55C 1PM9A 3TXSA 1ORQC 3BA9A 1PD3A 3ABLC 5E1AC 4N23A 1QU7A 3K04A 2PUSA 2NN4A 3DXRA 4Q20A 3X2QB 1P49A 4EFBA 2F93B 4J7ZA 1OCOC 4RWUA 5J2TA 1SQFA 3JAMN 5EZYA 1FAFA 4B3RB 1OCZB 1XILA 4MVOA 2JVDA 5EYPB 3EFFK 2WA4A 4B3SB 3BCCH 2XASA 4MT8A 5GTIZ 5LMNO 3AK1A 5JWPA 3JASB 1ZL8B 2R9IA 5FPOA 2XAJA 4R6ZA 1DTOA 1YXBA 3K58A 3R65A 1HNWB 3QF7A 4JTDB 4B3TB 2ZNJA 4NXNB 1N34B 1XMQO 4FMTA 3STZC 2QWOB 1D5AA 5L3EA 2Q67A
chains in the Genus database with same CATH topology
3CC7V 3OMNB 1KD1W 2DQ0A 2EBOA 3T1CA 4ZKIA 4ZBMA 3CC4V 3F5WC 1JOYA 1LNQA 2ZDIA 1MG1A 2AHYA 2H94A 1S3JA 3B77A 1FXVA 2OTJV 5L3BA 4X88A 3FB7C 1E1QG 4LP8A 3CCSV 3P30A 1RM1C 4QE7A 1JJ2U 3ETDA 3BY6A 1QCEA 1V54C 2B1GA 4BIUA 3OAAG 1GK9A 3H01A 3K0DA 4PDVA 2B1IA 3LNMB 1H2GA 3UKMA 1EBOA 2OT5A 1COWG 4P9OA 4BIZA 3DGEA 1H38A 2F43G 4FPPA 3K08A 3QO7A 3ZIAG 4GX0A 1WLEA 2Z5UA 1KKDA 1P7BA 1GMGA 3CYOA 4P30A 4GX5A 3CMEV 2WLLB 4MVRA 2UXNA 3T4ZA 3OUSA 2EIMC 3VBBA 3CCUV 5J9PC 3ASNC 4P9PA 2XAQA 1EFRG 2HFEC 5LBQA 3SYCA 4PA3A 2P7TC 2R9RB 3SJQC 4MTXA 3SYPA 3QO8A 5EC1C 3JD0A 1VQLV 5GW7A 4QIWF 1OHHG 2HVKC 1S76D 4H33A 2C2AA 3EHBB 5IDJA 1RPRA 4U7OA 1JVMA 1OCZC 2WSSG 4R8CA 3T4DA 2Y69B 2EILC 4J9ZB 1KECA 1H8EG 1K4DC 1ENVA 4MVMA 5B1BC 2IJIA 3ZRSA 3ASOC 1HWYA 1Y66A 1S0VA 1RPOA 3AG3B 2LFRA 2QM8A 2BOCC 4JAUA 4MVZA 1YJ9V 5H6RA 2EINB 2GSMB 2OTLV 4TSFG 4RUEA 1R6KA 1VQNV 2KB1A 1VQOV 1XL6A 2IH3C 2HLDG 1AI6A 3ZN0A 2X6BA 1PNMA 3A0RA 3F7VC 3TETA 1FXKC 5IYBO 2NLJC 2X0LA 1UJWB 1BL8A 3AG2B 5KA6A 3SPCA 2W0FC 3RVZA 3K3WA 3JD2A 4UV9A 1MOFA 1FXKB 1SRYA 2ZR3A 4GT1A 1M1KW 1JCHA 4RQFA 1NVPB 1M57C 1WPXA 4Z1MG 3B8NA 1YTFD 3FKSG 1Y4MA 3E89A 3PJSK 4DO2A 2P90A 1V54B 2H8PC 1Q7YW 2WAMA 3GWOA 3ZCCA 2X6CA 1OCCC 4DXWA 1P4RA 3CCRV 4QPKA 2NNUA 2XAGA 1CPYA 2QM7A 1K9MW 4X89A 2JK5C 1JPXA 2ZDIC 2ZXWB 5CMUA 4LBEC 4MS2A 1DF4A 4QNHB 3KG2A 1GM8A 3CMAV 3ABMB 3WG7C 3AEIA 1PNKA 2WLIA 3G71V 2WPDG 5B1BB 3FYEB 3I55V 1QR9A 2QEXV 2M7WA 1N8RW 3K06A 1FS0G 1F23A 2EILB 2IJJA 4JF3A 1M9NA 1VQ8V 1VQ6V 3I56V 1MABG 2X7RB 3MHHC 1AJQA 3ETEA 2CK3G 1I5YA 2HG5C 3ZMUA 1AJPA 5LGNA 3M99B 1OCCB 1EZJA 4XBFA 3CP1A 5L3FA 5B1AC 2WLNA 1W2BU 4MVSA 1JQ0A 4U7NA 5L3DA 4WFFA 3W7TA 5LHHA 4JGSA 1K97A 2PI5A 1YI2V 3E86A 1K7DA 3ZRXA 4J9YB 1DF5A 1SESA 2DYRC 5EBMC 5KUKA 3FB5C 2YSUB 2WLKA 3ABKC 5IYDO 1KC8W 4LC1A 4BAYA 1NH2D 2Q69A 2Y48A 1R73A 2K1EA 5LHIA 5B1NA 1VQMV 1W0KG 3JD3A 3AG4C 4ASUG 2V7QG 5B1AB 3JYCA 1SERA 1GM7A 3B8MA 3ZN1A 3CC2V 4UVCA 4GX1A 3CCJV 5CBFA 1F4MA 4YXWG 4RAIA 3E2EA 4GX2A 4UXNA 1R3LC 1ZWIC 2ZQMA 2ZD9A 1ROPA 4MTOA 4TWKA 1K34A 2DWEC 3ETGA 4WCEV 1QLEC 3VOUA 2ITDC 3OGCC 1E79G 3ASOB 4E2LA 2ITCC 5B3SB 5CBGA 3CCEV 1Q81W 1GO3F 3SYOA 3NXSA 5LGUA 3IFXA 2HJFC 3OE7G 3OR7C 5EK0A 1K73W 2DYSC 1QBZA 2UXXA 4UVAA 4GCZA 3W7XA 1VQ4V 1OCRB 4UVBA 3OW2U 2Q6AA 3LDCA 2DWDC 5CN0A 5LHGA 1NBMG 3K9AA 1YHQV 4JYCA 4L87A 1OCRC 1V55B 2W6JG 4WFBV 1YIJV 5C93A 1R3IC 2JEUA 3JCZA 3AG4B 4MW3A 3D36A 1K92A 3T2MA 3LDEA 4XDJA 3RW0A 2WLLA 3JD4A 4JAVA 4MTGA 5HFLA 1NQTA 4KUMA 2WLMA 2JJ2G 3ZMZA 3X2QC 3ZMSA 3ZMVA 2WLIB 1PKXA 4PA4A 5CBHA 2XAHA 1YITV 3ZJZA 2B5UA 3QO5A 1M56B 3AG1C 3OEEG 2DW4A 5EBWC 2BOBC 4QJFB 1BMFG 1B6QA 3DTUB 3IC7A 2EIKC 2EINC 1RM1B 3W7UA 2QE7G 2A79B 5DM6V 3BEHA 1NR7A 4JTCB 2DYSB 4HAMA 2P6JA 4X8AA 1FXHA 1K5QA 4MVUA 3AG3C 3ABTA 4PELA 1QR8A 4RUFA 1NVPD 1IXMA 3OUFA 3ZRVA 1Q82W 2X6AA 1W0JG 1AI4A 5B3SC 3TK1A 5FL7G 1FXKA 2JEXA 2IJHA 5IYCO 4MVQA 1QLEB 4WF9V 2QTOA 4PDLA 4R7CA 3CCMV 3CCQV 4PDMA 3ABMC 1K4CC 4FIPC 3SYAA 3WG7B 3IGAC 3CCVV 4WFAV 4WFGA 2ZXWC 3W7WA 4OXSA 2EIJC 3K0GA 3RBZA 3ABUA 4PA7A 3OMAB 4EKWA 1G8MA 4MTFA 1NH2B 5BZBA 5LGTA 4I9WA 1QVGU 1I5XA 4G27B 1KQSU 2EIJB 1BHBA 3K79A 4XDKA 5B1OA 1SETA 1M57B 5IY5C 3OFNG 5L3CA 3FB6C 2LFSA 3OEHG 3HPLC 2WLHA 3LUTB 5EC2C 3E8HA 4JASA 1S5HC 1F4NA 1TUEB 4G28B 1NR1A 5CA3A 1K33A 4PA6A 3ZMTA 3LSQA 4PA9A 1R3KC 4F4LA 2OCCC 1L1FA 1K8AW 2HVJC 4UUJC 1R6NA 3G6EV 2OCCB 1E1RG 1QVFU 4QPJA 3MD0A 1R3JC 3ABLB 2ATKC 3LDDA 2W6IG 3AG1B 3LSSA 2JIZG 2IH1C 4G2KA 3MHSC 4TT3G 2HKOA 1JX9A 1AROP 3GB7C 3CPWU 2JDIG 4HYOA 3UM7A 1NJIW 3G4SV 5KA5A 1GM9A 2HR3A 3W7SA 2IU3A 5HFMA 2FTKA 3AG2C 2A9HA 1AI7A 3FYIB 1CP9A 2V1DA 3QNEA 5IY5B 2Y69C 3E8FA 2IU0A 1PL0A 3TCUA 2IJKA 1H8HG 5H9CA 2EZPA 2XOKG 5KUMA 3CXCU 4FJCC 3RVYA 4RQEA 1PNLA 5DN6G 4HZ3A 1THZA 4P2ZA 2JJ1G 3OMIB 2YEVA 3JD1A 1J95A 1CEZA 4PDRA 1VQ9V 2EIMB 2Z3YA 3OM3B 2XNDG 1F51A 4I5SA 3F7YC 4RO2A 2GHYA 1VQ5V 4CBCA 1GTOA 2EJRA 3FB8C 3HB3B 1DLBA 2DQ3A 2WWWA 1G4YB 1FFTB 1AI5A 4LCUC 3WFVA 1QLNA 4N21A 2MK3A 1YJWV 2LP7A 4H37A 4CZZA 2QA4V 1V55C 1MSWD 1ORQC 1YJNV 1PD3A 1AR1B 1XL4A 5L3EA 1VQPV 3ABLC 2A0LA 4JYBA 5E1AC 2EIKB 4N23A 2PI4A 1M90W 4WFHA 3CCLV 3E8GA 1M56C 4R50A 4FK5C 1YTFB 3ZRWA 2AHZA 3ASNB 3K04A 3SPIA 5L3GA 2ZR2A 4Q20A 3X2QB 1KP3A 4MSWC 3OR6C 1K3EA 4QE9A 1OCOC 2P67A 2IW5A 3ABKB 3E8BA 2DYRB 4KP4A 3E83A 1OCZB 4UV8A 4MVOA 2YEVB 2EZOA 3EFFK 2D3OW 2QKSA 4JTAB 1Q86W 1SZTA 2XASA 1S77D 2XAFA 4MT8A 3ZRWB 2Q68A 4BW5A 3D3IA 4MW8A 5H6QA 3CD6V 1K5SA 3K03A 2R9IA 3STLC 1VQ7V 3SPGA 1NKDA 2XAJA 4JPRA 3E35A 1KP2A 4R6ZA 1DTOA 5EBLC 1VQKV 3R65A 3SPJA 3P32A 3ML0A 3SPHA 3SYQA 4JTDB 4XDLA 1BHAA 1S72V 1YSCA 4WFEA 1GKFA 4KFMA 1OCOB 1OZ0A 4FMTA 3STZC 1AJNA 2WLJA 2Q67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR C;  4HYO A;  2H8P C;  3UM7 A;  2X6C A;  1OCC C;  3T1C A;  1R3I C;  4ZBM A;  4DXW A;  3F5W C;  1LNQ A;  4MW3 A;  2AHY A;  3T2M A;  3AG2 C;  3LDE A;  4X89 A;  2A9H A;  2JK5 C;  4XDJ A;  3RW0 A;  2WLL A;  2Y69 C;  3E8F A;  4LBE C;  4MS2 A;  4X88 A;  3FB7 C;  4MTG A;  4LP8 A;  3TCU A;  4QNH B;  4QE7 A;  2WLM A;  3KG2 A;  3WG7 C;  5KUM A;  3X2Q C;  3RVY A;  2WLI A;  2WLI B;  1V54 C;  4PA4 A;  5CBH A;  3K06 A;  4HZ3 A;  3K0D A;  4PDV A;  4P2Z A;  3ZJZ A;  3LNM B;  3AG1 C;  2YEV A;  5EBW C;  3UKM A;  2BOB C;  1J95 A;  4PDR A;  4P9O A;  2EIK C;  2EIN C;  3K08 A;  4GX0 A;  2A79 B;  1KKD A;  1P7B A;  3BEH A;  4P30 A;  3F7Y C;  4GX5 A;  4JTC B;  2HG5 C;  4RO2 A;  2WLL B;  4MVR A;  4X8A A;  4CBC A;  4MVU A;  3AG3 C;  3FB8 C;  3OUS A;  3T4Z A;  2EIM C;  4RUF A;  4LCU C;  5J9P C;  1G4Y B;  3OUF A;  3ASN C;  4P9P A;  2X6A A;  5B1A C;  2WLN A;  2HFE C;  4MVS A;  5B3S C;  4H37 A;  4WFF A;  1V55 C;  4MVQ A;  3SYC A;  1ORQ C;  2P7T C;  4PA3 A;  2R9R B;  3SJQ C;  3E86 A;  2QTO A;  3SYP A;  1XL4 A;  4PDL A;  4R7C A;  5EC1 C;  4J9Y B;  4PDM A;  3ABM C;  1K4C C;  2A0L A;  3ABL C;  5E1A C;  2HVK C;  3SYA A;  2DYR C;  4H33 A;  5EBM C;  5KUK A;  3FB5 C;  3ABK C;  2WLK A;  1JVM A;  1OCZ C;  3IGA C;  4WFH A;  4R8C A;  3T4D A;  3E8G A;  1M56 C;  4R50 A;  4WFG A;  2ZXW C;  4OXS A;  2EIJ C;  2EIL C;  3K0G A;  4J9Z B;  2Q69 A;  4PA7 A;  3RBZ A;  2K1E A;  4EKW A;  1K4D C;  2AHZ A;  3K04 A;  4MTF A;  3SPI A;  5BZB A;  3AG4 C;  4MVM A;  5B1B C;  4I9W A;  3JYC A;  3ZRS A;  3ASO C;  4MSW C;  3OR6 C;  4G27 B;  4QE9 A;  4XDK A;  1OCO C;  4GX1 A;  5IY5 C;  3E8B A;  5CBF A;  2BOC C;  3E83 A;  3FB6 C;  4MVZ A;  4RAI A;  3HPL C;  2WLH A;  3LUT B;  5EC2 C;  4GX2 A;  4MVO A;  3E8H A;  4RUE A;  1S5H C;  3EFF K;  2KB1 A;  2QKS A;  1R3L C;  1ZWI C;  4JTA B;  2ZD9 A;  4MTO A;  4TWK A;  1XL6 A;  2DWE C;  2IH3 C;  4G28 B;  4BW5 A;  1QLE C;  2Q68 A;  4MW8 A;  2ITD C;  3VOU A;  4PA6 A;  3OGC C;  2X6B A;  2ITC C;  3K03 A;  5CBG A;  4PA9 A;  3F7V C;  1R3K C;  3STL C;  3TET A;  3SYO A;  3SPG A;  4F4L A;  4R6Z A;  2OCC C;  5EBL C;  2NLJ C;  1BL8 A;  3IFX A;  2HJF C;  3OR7 C;  2HVJ C;  5EK0 A;  3R65 A;  4UUJ C;  3SPC A;  3SPJ A;  2DYS C;  2W0F C;  3RVZ A;  3SPH A;  3SYQ A;  4JTD B;  4XDL A;  1R3J C;  2ATK C;  3LDD A;  2Q6A A;  2IH1 C;  4WFE A;  1M57 C;  3LDC A;  3GB7 C;  2DWD C;  4KFM A;  3PJS K;  3E89 A;  3STZ C;  2WLJ A;  2Q67 A; 
#chains in the Genus database with same CATH topology
 4X1I A;  1KD1 W;  4LF4 B;  5EZY B;  3T1C A;  4ZBM A;  4BR6 A;  1WPB A;  3F5W C;  3HKE B;  1YZB A;  2H94 A;  1S3J A;  2OTJ V;  3FB7 C;  2Q5Z A;  1X4T A;  4LF8 B;  1BT8 A;  5IE9 A;  1H2M A;  1V54 C;  2B1G A;  1GK9 A;  3C90 A;  2L6L A;  3H01 A;  4X62 O;  2B1I A;  3LNM B;  4DR1 B;  4CS2 A;  1EBO A;  2PZS A;  4U3F H;  1COW G;  4LF5 B;  4BIZ A;  1QQC A;  1H38 A;  1GN6 A;  5LOV B;  4DV6 B;  1IZ3 A;  2R72 A;  1KKD A;  3RYI B;  2P22 C;  4MVR A;  2EIM C;  5J9P C;  3UT5 B;  3OTO B;  4DV0 O;  4P9P A;  4NKG B;  4GKK B;  3DSQ A;  4O4J A;  1HNZ B;  3SYC A;  2P7T C;  3RWR D;  1VQL V;  2CTP A;  1OHH G;  2C2A A;  3EHB B;  4X20 A;  2Y69 B;  3AG7 A;  2LQT A;  4DV1 O;  3VQV A;  1HDJ A;  4GYC B;  5B1B C;  1PV0 A;  1M4U A;  4O4H B;  3L73 H;  1BGY H;  2OIG A;  1FJG O;  4MVZ A;  1YJ9 V;  2EIN B;  1XOU A;  2GSM B;  3JAL B;  1VQO V;  3BPZ A;  4ICG A;  1P7G A;  4DRX A;  3M7M X;  1IVS A;  5IYB O;  2ZT9 B;  2NLJ C;  5BR8 O;  1UJW B;  1VIB A;  5KA6 A;  2YDE A;  3L70 H;  3RVZ A;  1KMI Z;  3K3W A;  1MOF A;  1M1K W;  1Y4M A;  2VQF O;  2PGG A;  3GWO A;  3ZCC A;  1OCC C;  4DXW A;  5FNV B;  2Q73 A;  1K9M W;  2JK5 C;  5CMU A;  1I94 B;  4MS2 A;  1Q6I A;  2LJ2 A;  1Q6H A;  1GM8 A;  1B3Q A;  4UCT A;  3JAK B;  1PNK A;  4LWS B;  4X65 B;  2WPD G;  3I55 V;  2QEX V;  1QR9 A;  4FM0 A;  2IJJ A;  3H9V A;  2UUC O;  1MAB G;  1EN5 A;  4UCO A;  4DR6 O;  5JCO C;  2AZ0 A;  1JJO A;  1I5Y A;  3ZMU A;  1VF6 A;  4I55 B;  1AVM A;  3M99 B;  5AG2 A;  2RQ6 A;  5K1P A;  1ZAU A;  5L3D A;  3W7T A;  3ZHV A;  2PI5 A;  3O65 A;  1K7D A;  4B3T O;  5KUK A;  3FB5 C;  2WLK A;  1KC8 W;  2F1M A;  4K8X A;  3JD3 A;  3K59 A;  4U3J B;  1SA0 A;  4DUZ O;  1SQX H;  4O2A B;  3UT5 A;  1JFF A;  4RAI A;  3E2E A;  4GX2 A;  4AQY B;  1ROP A;  2ITD C;  2RMK B;  2ITC C;  4AQY O;  2LGW A;  5DEC A;  4UFZ A;  3IFX A;  2HJF C;  3KKY A;  1X59 A;  4TQD A;  4DV5 O;  4GCZ A;  2Q7H A;  4I4T A;  1HNX O;  3ZHT A;  3OW2 U;  1N32 B;  2DWD C;  5CN0 A;  4IIJ A;  3B2E E;  5IJ0 A;  5D5Q A;  5JQG A;  4JYC A;  1OCR C;  1V55 B;  1YIJ V;  1SS3 A;  2FYU H;  4JI4 B;  2CUG A;  1N32 O;  4X9Q A;  1K92 A;  3JAT B;  1IBK O;  3LDE A;  4DR5 O;  3JD4 A;  2RJZ A;  2WLM A;  2E3C A;  3FD9 A;  3HKC A;  4LWS A;  1PKX A;  4PA4 A;  1VAR A;  3VQW A;  4GKK O;  2UXB B;  3QO5 A;  2AXT Z;  1M56 B;  2DN9 A;  4QJF B;  2BTQ A;  2EIK C;  1RM1 B;  3QG5 A;  2A79 B;  4UB8 Z;  1MMM A;  5EYP A;  2KQX A;  2RN9 A;  5KX5 B;  4X8A A;  1K5Q A;  3AG3 C;  4RUF A;  1Q8I A;  3OUF A;  3ZRV A;  2GTA A;  3SJB C;  4DR2 B;  5B3S C;  2XUM A;  3ZS8 C;  3OTF A;  4AI8 A;  5H2F Z;  2P4K A;  4J42 A;  4DV7 O;  3N2G B;  3MAQ A;  4JI7 B;  1I94 O;  4DV4 B;  4R7C A;  4C7U A;  4PDM A;  2ZIO A;  3IGA C;  4O4I B;  3CCV V;  3RYC A;  4KXR A;  4WFG A;  3ABU A;  4PA7 A;  3B4S A;  4NB5 A;  2UXC B;  5J2U B;  2E5L O;  2M6Y A;  5LGT A;  3BRC A;  3JCU Z;  1WNS A;  5LP6 B;  2UXC O;  1M57 B;  1D2D A;  2GUZ B;  3BVO A;  1UPG A;  4FLU A;  3BA8 A;  5GON A;  2WLH A;  5KHG A;  4JI1 O;  3FAV B;  1OV9 A;  1N0J A;  1TUE B;  1XEQ A;  3ZMT A;  1JMK C;  2PTM A;  4YJ3 A;  1I08 A;  4PA9 A;  2LW7 A;  4LFB O;  1DGS A;  1V9P A;  2CGO A;  1FD9 A;  1I7F A;  4GUN A;  2HVJ C;  4DW1 A;  3T1H B;  1MSD A;  4CC5 A;  2ATK C;  1XBL A;  2W6I G;  2PY5 A;  2IH1 C;  1JX9 A;  1NS1 A;  5GON B;  4YY3 B;  3CPW U;  1CXZ B;  1NJI W;  2HR3 A;  2R9A A;  5LOV A;  2YIB D;  4B3M O;  2YIA A;  3FYI B;  1CP9 A;  5J2U A;  2IU0 A;  3CRC A;  4X64 O;  1HNZ O;  2IJK A;  3CB2 A;  1H8H G;  2RCV A;  3N2K A;  1PNL A;  1IUR A;  1THZ A;  4ZIB A;  1UFI A;  2YEV A;  1G6U A;  1VQ9 V;  1SQV H;  3F7Y C;  1VQ5 V;  3K5N A;  1GTO A;  2E75 B;  3C3T A;  3FB8 C;  3HB3 B;  3E22 A;  2WWW A;  4N21 A;  4I0X B;  2LP7 A;  2DJV A;  1MSW D;  4DR4 B;  2Q7E A;  3IC9 A;  4JYB A;  1Y76 B;  3CCL V;  3E8G A;  1M56 C;  3M8A A;  4EEQ A;  4FK5 C;  3E22 B;  2BSK A;  1J5E O;  2PYL A;  4W4L A;  3FFQ A;  4K3A A;  4QE9 A;  2P06 A;  2IW5 A;  3ABK B;  1M93 A;  5IJ0 B;  2ZCE A;  2YEV B;  2EZO A;  2UU9 O;  2D3O W;  2XAF A;  2Q68 A;  3D3I A;  4MW8 A;  4TV8 A;  1SKV A;  1K5S A;  3SDL A;  4JPR A;  3BAB A;  3G80 A;  4AIL C;  3C3S A;  2YID A;  3ML0 A;  4JI2 O;  1BHA A;  2F66 C;  3GWK C;  4KL1 A;  3AK3 A;  4H13 B;  2WLJ A;  3CC7 V;  2DQ0 A;  2EBO A;  4ZKI A;  3CC4 V;  2YIC A;  3Q4H A;  4LF9 O;  1YF2 A;  4DV5 B;  4WBN A;  2BTO A;  4LP8 A;  3CCS V;  3P30 A;  5LXT B;  4PHZ A;  5TIS Z;  3I5D A;  3BY6 A;  1QCE A;  4BIU A;  2CTW A;  4FLV A;  2CE4 A;  2OT5 A;  1H2L A;  2F43 G;  2GUZ A;  1W59 A;  2Z5U A;  1P7B A;  4GX5 A;  4H44 B;  2WLL B;  4I55 A;  3CCU V;  4TOI A;  2UUB O;  3ASN C;  3CX5 F;  2XAQ A;  4X66 B;  2R9R B;  3SJQ C;  1PPJ H;  3SYP A;  5GW7 A;  4JYY A;  4QIW F;  2HVK C;  3A8T A;  4U7O A;  1JVM A;  4R8C A;  3T4D A;  2QKA A;  1KEC A;  4X1K B;  4E4E A;  2ZIN A;  2K9P A;  4NVP A;  1Y66 A;  3AG3 B;  1WB7 A;  2A06 H;  5LA6 B;  3KCX A;  2BOC C;  4BWA A;  1XRE A;  3FX7 A;  4NR1 A;  2OTL V;  2KKW A;  1R6K A;  4GZR B;  5JH7 B;  2QWR B;  1Y74 B;  5IWA B;  2HLD G;  1FPO A;  1YEW A;  4JI6 B;  3K5L A;  3A0R A;  4D7T A;  2QTS A;  2X0L A;  1SC5 B;  2YXY A;  3SPC A;  2W0F C;  2CGN A;  3JD2 A;  4UV9 A;  2DOS A;  4GT1 A;  1DK1 A;  1JCH A;  5JQG B;  4TQF A;  4LNU A;  4Z1M G;  2CH7 B;  1U97 A;  3B8N A;  1YTF D;  4DO2 A;  1V54 B;  1YVW A;  2H8P C;  2D2C B;  3KZI Z;  4L8J A;  2GTS A;  2WAM A;  1Q7Y W;  5LYJ B;  3CCR V;  2NNU A;  1H2K A;  2QM7 A;  4O4H A;  4X89 A;  3VQX A;  1VF7 A;  2ZDI C;  1XHZ A;  1RP3 B;  4PI0 A;  3CWB H;  4IGG A;  5KHK A;  3ABM B;  4CH4 A;  4NXM O;  2WLI A;  3FYE B;  2M7W A;  4YY3 O;  1N8R W;  1FS0 G;  1F23 A;  2WA3 A;  4IYI A;  4I50 B;  4EFE A;  1M9N A;  1TAE A;  1Y6X A;  3SR2 C;  3I56 V;  1KUQ A;  1S5J A;  5KAF Z;  4JYA O;  1O9H A;  2CK3 G;  4OPA A;  1N33 B;  4LFB B;  2HG5 C;  5LGN A;  4U3J A;  4JI4 O;  1OCC B;  1EZJ A;  2ODM A;  3CP1 A;  5L3F A;  2JS3 A;  5B1A C;  2WLN A;  1K97 A;  1HNX B;  2HHH B;  4NXM B;  2CDY A;  1DF5 A;  5EBM C;  2YSU B;  1XMO O;  1M5I A;  2Q69 A;  5B1N A;  1VQM V;  4ASU G;  2ADQ B;  3CRR A;  4OGQ B;  5KAI Z;  4LFA B;  2F4V B;  4DV1 B;  3UQ8 A;  3RYF A;  3B8M A;  4X1I B;  3CCJ V;  1F4M A;  2UXD O;  1U96 A;  3MDS A;  4K35 A;  5K1X A;  1R3L C;  2ZD9 A;  4TWK A;  1K34 A;  3ETG A;  3VOU A;  1QNM A;  3ASO B;  5B3S B;  5CBG A;  1Q81 W;  3L72 H;  1ZL8 A;  2YI9 A;  1US6 A;  5A9G A;  3OE7 G;  5LL6 Y;  1K73 W;  3LNN A;  1QBZ A;  2UXX A;  4DR6 B;  5F2V O;  1RFY A;  3AK2 A;  3RYH A;  3ZX6 A;  4WFB V;  2GDS A;  4YJ2 B;  2JEU A;  3JCZ A;  3AG4 B;  1XUQ A;  2ZKO A;  4XDJ A;  1PP9 H;  3RW0 A;  1G1X B;  4MTG A;  2O57 A;  3ZMZ A;  1XNQ B;  3CJH A;  5CBH A;  3HKD A;  4EB6 B;  1ZUQ A;  1YIT V;  1XMQ B;  5EBW C;  2BOB C;  3CHX A;  1BMF G;  2ARH A;  1XI1 A;  3CE2 A;  3W7U A;  5DM6 V;  1NR7 A;  4JTC B;  3K57 A;  2P6J A;  3H1K H;  1FXH A;  4TV9 B;  3ABT A;  1QR8 A;  4GKJ B;  4J7K A;  1IXM A;  1W0J G;  5IYZ A;  1FXK A;  4MVQ A;  5JJN B;  5LXT A;  1QLE B;  4X20 B;  3SYA A;  1BCC H;  4DV2 O;  5BR8 B;  2ZXW C;  3W7W A;  1Z5W A;  3K0G A;  1BQZ A;  5KHJ A;  3OMA B;  4ZOL B;  5BZB A;  4I9W A;  5IT9 N;  3RYI A;  3ZHU A;  4CC6 A;  1N33 O;  5L3C A;  3IJ4 A;  4WBN B;  5JVD B;  3TJT A;  1NTM H;  3FB6 C;  2LFS A;  3JAW A;  3APQ A;  3HPL C;  1XNR B;  3E8H A;  4JAS A;  1F4N A;  4CS4 A;  1NT2 B;  1K33 A;  2LO1 A;  4PA6 A;  2UUA B;  3OD4 A;  3ZBH A;  1AB3 A;  3LSQ A;  4F4L A;  3OTO O;  4DV0 B;  4NYK A;  3ZHS A;  4JI8 B;  2FB5 A;  3ABL B;  1JA8 A;  5JCO A;  4FLZ A;  2JIZ G;  4TT3 G;  4LF5 O;  1BQ0 A;  4LF6 O;  4X65 O;  4IL6 Z;  3D3Q A;  1GM9 A;  3W7S A;  2FL4 A;  2UU9 B;  2IU3 A;  4JI5 O;  2FTK A;  3AG2 C;  1F7Y A;  2A9H A;  2V1D A;  4LF8 O;  2UXD B;  2Y69 C;  5H9C A;  3RVY A;  1J5E B;  4JZG A;  5EIB D;  2F4V O;  1LR1 A;  2RNB A;  3U10 A;  5DN6 G;  3OMI B;  2OYQ A;  1TVK B;  2V4D A;  3CSX A;  4Z1V A;  4DW0 A;  3OM3 B;  1Y76 A;  2HJD A;  5J2T B;  4I5S A;  4NXN O;  4AHC A;  4RO2 A;  2GHY A;  3APO A;  3JSL A;  1DLB A;  4LF7 B;  1G4Y B;  1FFT B;  3WFV A;  2Q9L A;  2YXH A;  2MK3 A;  1YJW V;  4I0X A;  1VMG A;  3A2F A;  5BMV B;  1Q43 A;  4FLT A;  1XDC A;  1AR1 B;  2JRI A;  1VQP V;  3THO A;  2QWN B;  3P3N A;  1WJZ A;  3GVM A;  4WFH A;  1YTF B;  3SPI A;  3ASN B;  5L3G A;  4H0L B;  4MSW C;  3J80 N;  4LFA O;  4JI0 O;  2P67 A;  2DYR B;  4ZHQ B;  3E83 A;  4IT5 A;  4B7E A;  1ZLZ A;  4UB6 Z;  1XMO B;  3JAW B;  2ZM6 O;  5JVD A;  2QKS A;  4TUY A;  1S77 D;  3ZRW B;  4BW5 A;  5CA1 B;  3CD6 V;  1Q3E A;  3K03 A;  3SPG A;  2G38 A;  1KP2 A;  3E35 A;  3FAV A;  5EBL C;  5KHH A;  4DR3 B;  1RSO A;  3SPJ A;  3SYQ A;  2EUL A;  4XDL A;  1SQB H;  2CTQ A;  5LP6 A;  1WN7 A;  2A7W A;  4TUY B;  1GKF A;  1OCO B;  1AJN A;  1TUB B;  3OMN B;  5IYZ B;  2VQE O;  3VQY A;  2ZDI A;  5C8Y A;  1MG1 A;  3JAR A;  3NR7 A;  3B77 A;  3WB2 A;  1FXV A;  3S3X A;  5L3B A;  4X88 A;  1E1Q G;  2VQE B;  3EVK A;  4QE7 A;  1BSM A;  3H1I H;  4LFC B;  3H1J H;  3N2G A;  3ETD A;  3K0D A;  1XQ8 A;  1FFX A;  3N27 A;  2L35 A;  3UKM A;  4DV3 B;  4OX9 O;  5KX5 A;  4LH6 A;  2RDC A;  2Q7G A;  4FPP A;  3K08 A;  3QO7 A;  4GX0 A;  4P30 A;  3CME V;  5BXZ A;  4DV7 B;  1EN6 A;  2UXN A;  5KLV H;  5CA0 A;  3OUS A;  3VBB A;  4DV3 O;  4HNA B;  2QWP B;  2HFE C;  1WA8 B;  3RGB A;  4PA3 A;  3HKC B;  4MTX A;  3QO8 A;  1IDS A;  5E79 Z;  2P4V A;  3JD0 A;  1RPR A;  3CEI A;  1OCZ C;  2WSS G;  1XNR O;  4LR3 A;  3JAT A;  2EIL C;  3BAA A;  3HR0 A;  2HHH O;  2QJ1 A;  1H8E G;  1K4D C;  2F95 B;  5H5N A;  3ASO C;  1HWY A;  1S0V A;  1RPO A;  1HW7 A;  4DK0 A;  2QM8 A;  5DED A;  4JAU A;  4TSF G;  1VQN V;  4ZI7 A;  1XL6 A;  1AI6 A;  3ZN0 A;  2X6B A;  1PNM A;  2MW2 B;  3F7V C;  4DK1 A;  3TET A;  4JI1 B;  1FXK C;  1L8D A;  2FKX A;  4DR7 B;  1BL8 A;  1B04 A;  4A5U B;  1JFF B;  4PJ0 Z;  4DV2 B;  4UCV A;  1SRY A;  1AIL A;  4Q6G A;  2Z0A A;  4RQF A;  3T1H O;  4Z2W A;  1SA0 B;  1MNG A;  1VF5 B;  3FKS G;  1P4R A;  1O9G A;  1JPX A;  2ZXW B;  2OWO A;  4BW9 A;  1TA8 A;  3CRM A;  3CMA V;  5D5P A;  3WG7 C;  1TGO A;  4O2A A;  3K06 A;  3HKB A;  3WB0 A;  1XNQ O;  1B06 A;  4O4L A;  4KHP B;  1N36 O;  1R1B A;  3DC5 A;  3MHH C;  1AJQ A;  3ETE A;  2UXB O;  2QKC A;  2YXL A;  2XTA A;  4ABM A;  4XBF A;  1SQQ H;  1W2B U;  4MVS A;  1JQ0 A;  4U7N A;  3JAK A;  4WFF A;  5LHH A;  4JGS A;  5IJ9 B;  1YI2 V;  2BCC H;  2CH7 A;  4J9Y B;  1SES A;  3ABK C;  2UUC B;  1H2S B;  5IYD O;  5FNV A;  4LF4 O;  3UO3 A;  4BAY A;  1NH2 D;  4J10 A;  5LHI A;  2Y48 A;  1R73 A;  2Q0O C;  1EN4 A;  1AR5 A;  4K8Z A;  1N4C A;  3AG4 C;  2V7Q G;  3L71 H;  5B1A B;  3JYC A;  4OX9 B;  1SER A;  1N34 O;  2VQF B;  1FYJ A;  2UUB B;  5FLX N;  4B3S O;  4B7K A;  1IXB A;  3CC2 V;  5CBF A;  4JV5 O;  4W4K A;  1Q5O A;  2W0X A;  3T1Y B;  4LFC O;  2BE3 A;  4MTO A;  2ZQM A;  4WCE V;  1BS3 A;  1QLE C;  2QSA A;  2QWQ B;  1E79 G;  4E2L A;  5EIB C;  3CCE V;  3NXS A;  5LGU A;  1SF9 A;  3OR7 C;  4FFB B;  5B5E Z;  1BZK A;  2CTR A;  1VQ4 V;  1OCR B;  3G6B A;  1WAZ A;  5LHG A;  4NTW A;  4YIO A;  1VP7 A;  1AR4 A;  1D5N A;  4L87 A;  4DRX B;  4MW3 A;  3D36 A;  3JAL A;  3T2M A;  3A0H Z;  3L75 H;  3ZED A;  4DUY B;  5KMG A;  1VEW A;  2ILM A;  2WLL A;  5ITZ B;  2Q8V A;  4JAV A;  5HFL A;  1NQT A;  4KUM A;  2JJ2 G;  1HP8 A;  2ADP A;  4UCU A;  1WP8 A;  3ZMS A;  1GN2 A;  2XAH A;  3ZJZ A;  4IYH A;  2AZ2 A;  2DW4 A;  2AW9 A;  1A32 A;  2Q4P A;  4JI2 B;  1B6Q A;  3DTU B;  4X1Y A;  2JGU A;  1IX9 A;  4FM1 A;  4J11 A;  4D6T H;  2DYS B;  4HAM A;  2YIB A;  4K0K O;  4PEL A;  4O4J B;  2X6A A;  3SGI A;  4DR2 O;  3TK1 A;  2JEX A;  2IJH A;  2QTO A;  3CCM V;  3CCQ V;  3ABM C;  4LF7 O;  4FIP C;  4I50 A;  4WFA V;  3BHP A;  4OXS A;  3RBZ A;  4UCR A;  1G8M A;  4EKW A;  4FLY A;  4ZI7 B;  1I5X A;  4CH3 A;  4G27 B;  5BMV A;  1ZTE A;  5B1O A;  4JI8 O;  1SET A;  5LYJ A;  5IY5 C;  3LSU A;  4DR7 O;  3OEH G;  1EZV H;  5EC2 C;  3UO2 A;  2CAZ C;  4G28 B;  4JI5 B;  1TVK A;  1LUV A;  1KYO F;  2N04 A;  1GH6 A;  1FJG B;  3QVN A;  1K8A W;  2ZE7 A;  4X64 B;  4UUJ C;  3G6E V;  1I0H A;  1E1R G;  1QVF U;  3MD0 A;  1R3J C;  2QM4 A;  1L0N H;  4HNA A;  1ARO P;  3CXH F;  1NTK H;  4FZ0 A;  1QHT A;  2OIE A;  4HYO A;  3UM7 A;  1IBL O;  1KU9 A;  2N74 A;  4PD4 F;  1AI7 A;  4B3R O;  4FZ1 A;  3QNE A;  5IY5 B;  3KCY A;  1FFX B;  2YUA A;  4X1K A;  2EZP A;  4I9Q A;  3CXC U;  1HR0 O;  3U0Z A;  5KHI A;  3D36 C;  2HP8 A;  3QTC A;  3DXR B;  1J95 A;  1CEZ A;  3UCS C;  4DV6 O;  3JAR B;  3L74 H;  2XND G;  1NI8 A;  1F51 A;  5C8Y B;  5FPR A;  1TUB A;  4DYL A;  4LCU C;  2DQ3 A;  4FVM A;  1QLN A;  1AI5 A;  4H37 A;  4O2B A;  2E5L B;  4CZZ A;  1NU1 H;  2ZNI A;  2Y4U A;  1YJN V;  1XL4 A;  1YCI A;  2A0L A;  2EIK B;  2PI4 A;  3EXA A;  1M90 W;  3SJA C;  1N36 B;  4R50 A;  4JI3 O;  3ZRW A;  2AHZ A;  5CA1 A;  5KMG B;  2ZR2 A;  2ZIM A;  1KP3 A;  4DR1 O;  4YJ3 B;  3OR6 C;  1K3E A;  1Z2G A;  2QR4 A;  4ZHQ A;  3E8B A;  4KP4 A;  4UV8 A;  4JI7 O;  4JTA B;  1Q86 W;  1SZT A;  5H6Q A;  1WB8 A;  2NR5 A;  2JGD A;  4FFB A;  4X62 B;  1VF6 C;  4JZ2 A;  3STL C;  1VQ7 V;  1L0L H;  1NKD A;  3J7A U;  3HKD B;  3CJH B;  1VQK V;  3P32 A;  3SPH A;  2KG7 B;  4DR4 O;  2PYJ A;  3G67 A;  1S72 V;  1YSC A;  4WFE A;  4I7Z B;  4KFM A;  1OZ0 A;  2YC0 A;  4UCS A;  3J81 N;  4IHJ B;  2VS0 A;  3RFR A;  4PV1 B;  1JOY A;  1LNQ A;  2AHY A;  4LH7 A;  3JSN A;  2BSK B;  2ZM6 B;  1RM1 C;  3D8C A;  1JJ2 U;  2H3O A;  2P5O A;  4BIO A;  1MZF A;  2BTQ B;  3OAA G;  4PDV A;  1H2G A;  1R6T A;  5IJ9 A;  4JYA B;  4P9O A;  2PF4 E;  3DGE A;  2XT9 A;  3ZIA G;  1WLE A;  1GMG A;  3CYO A;  4B3M B;  3T4Z A;  3TGU H;  1EFR G;  3H1H H;  5LBQ A;  4O4L B;  5EC1 C;  1S76 D;  4H33 A;  5IDJ A;  1H2N A;  2OCH A;  4J9Z B;  1T5E A;  1ENV A;  3ZHQ A;  4MVM A;  2IJI A;  3ZRS A;  5LMU B;  2LFR A;  2B9Z A;  2EJ7 A;  4X1Y B;  3DC6 A;  5H6R A;  4RUE A;  2KB1 A;  3B40 A;  4JAA A;  3B09 A;  2IH3 C;  2DMX A;  2F23 A;  1AP5 A;  5JJJ B;  5ITZ A;  3AG2 B;  1Z5V A;  1SQP H;  2FML A;  1EM1 A;  3WB1 A;  1FXK B;  2ZR3 A;  5A2Q N;  2EX3 A;  1NVP B;  3BFR A;  2Y0I A;  1M57 C;  1WPX A;  1S5L Z;  3PJS K;  3E89 A;  4NTY A;  2P90 A;  1HR0 B;  1PL4 A;  2X6C A;  1BE3 H;  3RT3 C;  4QPK A;  2XAG A;  4YHH O;  5CB4 A;  2QGN A;  2UUA O;  1CPY A;  4LNU B;  1XHX A;  4LBE C;  1DF4 A;  1GN4 A;  4QNH B;  3KG2 A;  4EB6 A;  4DUY O;  3AEI A;  3G71 V;  5B1B B;  4F6R B;  2LW1 A;  3RYC B;  4O4I A;  2EIL B;  4JF3 A;  1WP7 A;  3P3P A;  1VQ8 V;  2E76 B;  1VQ6 V;  3TXQ A;  2X7R B;  1Y74 A;  4YJ2 A;  4DR5 B;  4YIP A;  3IAY A;  3K5M A;  1AJP A;  4HBN A;  3RYH B;  1NTZ H;  4F6R A;  3E86 A;  3ZRX A;  4GKJ O;  2DYR C;  3SJC C;  4FFK A;  4LC1 A;  1IBM O;  2K1E A;  4YHH B;  1W0K G;  4QGP A;  2XHB A;  1GM7 A;  1GRJ A;  1Y67 A;  3ZN1 A;  1SQG A;  4UVC A;  4GX1 A;  2A3Q A;  2YI8 A;  4NTX A;  4YXW G;  3RYF B;  4IIJ B;  4UXN A;  1ZWI C;  5CB4 B;  4LF9 B;  2DWE C;  3HKB B;  2N05 A;  4I4T B;  3OGC C;  4JI3 B;  3O9O A;  1GO3 F;  3SYO A;  4B08 A;  3S3W A;  2YS8 A;  5EK0 A;  2DYS C;  4UVA A;  2AGA A;  3W7X A;  1FKA O;  2VRZ A;  3WU2 Z;  4UVB A;  2VWJ A;  2Q6A A;  1URF A;  3H1L H;  3LDC A;  4CH5 A;  3A0B Z;  1NBM G;  1ZSP A;  2ETN A;  3K9A A;  1YHQ V;  2W6J G;  5LMU O;  5C93 A;  1R3I C;  2JS5 A;  2IM9 A;  1IBK B;  2QDO A;  3OGI B;  2ZE5 A;  4DR3 O;  3RN4 A;  3X2Q C;  3ZMV A;  2WLI B;  1ZX3 A;  3L9D A;  2B5U A;  5LMN B;  3PN1 A;  3AG1 C;  3OEE G;  4F6E A;  4PI2 A;  4K0K B;  3IC7 A;  4TV8 B;  2EIN C;  2QE7 G;  1Q6U A;  3CRQ A;  3BEH A;  3OT7 A;  2ZE6 A;  4MVU A;  4JI0 B;  1NVP D;  3HKE A;  1YDX A;  1Q82 W;  2KSD A;  3CS5 A;  1AI4 A;  1MA1 A;  5FL7 G;  3K5O A;  5IYC O;  4WF9 V;  1IBM B;  4PDL A;  1P84 F;  3WG7 B;  1K4C C;  1KBH A;  4J41 A;  1LUW A;  2R70 A;  1IBL B;  3ETQ A;  4DUZ B;  1OJH A;  2EIJ C;  1WA8 A;  4MTF A;  1NH2 B;  5JH7 A;  1QVG U;  5CA0 B;  3JAS A;  1KQS U;  2EIJ B;  2Q0A A;  1BHB A;  3K79 A;  2ZE8 A;  4XDK A;  5LA6 A;  2DE0 X;  3OFN G;  5B66 Z;  3LUT B;  1S5H C;  2HEP A;  4JI6 O;  4J7J A;  1NZ6 A;  2GV9 A;  1NR1 A;  2E74 B;  5CA3 A;  4IHJ A;  1Q90 D;  2JGD B;  5LP6 C;  1R3K C;  4FLW A;  2OCC C;  1L1F A;  3N2K B;  4J80 A;  1R6N A;  2KG7 A;  2OCC B;  3T1Y O;  4QPJ A;  3ICX A;  4KHP O;  3LDD A;  4JV5 B;  3AG1 B;  3LSS A;  1N0N A;  4G2K A;  3MHS C;  2HKO A;  3GB7 C;  4OPH A;  2JDI G;  4LF6 B;  3F5T A;  3G4S V;  1GN3 A;  3U11 A;  5KA5 A;  4FLX A;  5JJE B;  2LGQ A;  2Y4T A;  5HFM A;  4CH6 A;  1RSO B;  3CRA A;  5GTH Z;  1KB9 F;  4CS3 A;  5BY1 A;  5IWA O;  3E8F A;  2IBZ H;  1PL0 A;  4ZOL A;  1SZX A;  3TCU A;  3R66 A;  4X66 O;  2XOK G;  5KUM A;  4FJC C;  4RQE A;  1MZE A;  1GAX A;  4HZ3 A;  4GLX A;  4P2Z A;  2JJ1 G;  3JD1 A;  1KKC A;  3ZHR A;  4PDR A;  3Q4H B;  3K9S A;  2EIM B;  2Z3Y A;  4FM2 A;  2GBO A;  4D7S A;  4TV9 A;  4CBC A;  1HNW O;  2EJR A;  2VWK A;  4DV4 O;  2Y0P A;  1AP6 A;  4O2B B;  1JR9 A;  2QA4 V;  1V55 C;  1PM9 A;  3TXS A;  1ORQ C;  3BA9 A;  1PD3 A;  3ABL C;  5E1A C;  4N23 A;  1QU7 A;  3K04 A;  2PUS A;  2NN4 A;  3DXR A;  4Q20 A;  3X2Q B;  1P49 A;  4EFB A;  2F93 B;  4J7Z A;  1OCO C;  4RWU A;  5J2T A;  1SQF A;  3JAM N;  5EZY A;  1FAF A;  4B3R B;  1OCZ B;  1XIL A;  4MVO A;  2JVD A;  5EYP B;  3EFF K;  2WA4 A;  4B3S B;  3BCC H;  2XAS A;  4MT8 A;  5GTI Z;  5LMN O;  3AK1 A;  5JWP A;  3JAS B;  1ZL8 B;  2R9I A;  5FPO A;  2XAJ A;  4R6Z A;  1DTO A;  1YXB A;  3K58 A;  3R65 A;  1HNW B;  3QF7 A;  4JTD B;  4B3T B;  2ZNJ A;  4NXN B;  1N34 B;  1XMQ O;  4FMT A;  3STZ C;  2QWO B;  1D5A A;  5L3E A;  2Q67 A; 
#chains in the Genus database with same CATH homology
 3CC7 V;  3OMN B;  1KD1 W;  2DQ0 A;  2EBO A;  3T1C A;  4ZKI A;  4ZBM A;  3CC4 V;  3F5W C;  1JOY A;  1LNQ A;  2ZDI A;  1MG1 A;  2AHY A;  2H94 A;  1S3J A;  3B77 A;  1FXV A;  2OTJ V;  5L3B A;  4X88 A;  3FB7 C;  1E1Q G;  4LP8 A;  3CCS V;  3P30 A;  1RM1 C;  4QE7 A;  1JJ2 U;  3ETD A;  3BY6 A;  1QCE A;  1V54 C;  2B1G A;  4BIU A;  3OAA G;  1GK9 A;  3H01 A;  3K0D A;  4PDV A;  2B1I A;  3LNM B;  1H2G A;  3UKM A;  1EBO A;  2OT5 A;  1COW G;  4P9O A;  4BIZ A;  3DGE A;  1H38 A;  2F43 G;  4FPP A;  3K08 A;  3QO7 A;  3ZIA G;  4GX0 A;  1WLE A;  2Z5U A;  1KKD A;  1P7B A;  1GMG A;  3CYO A;  4P30 A;  4GX5 A;  3CME V;  2WLL B;  4MVR A;  2UXN A;  3T4Z A;  3OUS A;  2EIM C;  3VBB A;  3CCU V;  5J9P C;  3ASN C;  4P9P A;  2XAQ A;  1EFR G;  2HFE C;  5LBQ A;  3SYC A;  4PA3 A;  2P7T C;  2R9R B;  3SJQ C;  4MTX A;  3SYP A;  3QO8 A;  5EC1 C;  3JD0 A;  1VQL V;  5GW7 A;  4QIW F;  1OHH G;  2HVK C;  1S76 D;  4H33 A;  2C2A A;  3EHB B;  5IDJ A;  1RPR A;  4U7O A;  1JVM A;  1OCZ C;  2WSS G;  4R8C A;  3T4D A;  2Y69 B;  2EIL C;  4J9Z B;  1KEC A;  1H8E G;  1K4D C;  1ENV A;  4MVM A;  5B1B C;  2IJI A;  3ZRS A;  3ASO C;  1HWY A;  1Y66 A;  1S0V A;  1RPO A;  3AG3 B;  2LFR A;  2QM8 A;  2BOC C;  4JAU A;  4MVZ A;  1YJ9 V;  5H6R A;  2EIN B;  2GSM B;  2OTL V;  4TSF G;  4RUE A;  1R6K A;  1VQN V;  2KB1 A;  1VQO V;  1XL6 A;  2IH3 C;  2HLD G;  1AI6 A;  3ZN0 A;  2X6B A;  1PNM A;  3A0R A;  3F7V C;  3TET A;  1FXK C;  5IYB O;  2NLJ C;  2X0L A;  1UJW B;  1BL8 A;  3AG2 B;  5KA6 A;  3SPC A;  2W0F C;  3RVZ A;  3K3W A;  3JD2 A;  4UV9 A;  1MOF A;  1FXK B;  1SRY A;  2ZR3 A;  4GT1 A;  1M1K W;  1JCH A;  4RQF A;  1NVP B;  1M57 C;  1WPX A;  4Z1M G;  3B8N A;  1YTF D;  3FKS G;  1Y4M A;  3E89 A;  3PJS K;  4DO2 A;  2P90 A;  1V54 B;  2H8P C;  1Q7Y W;  2WAM A;  3GWO A;  3ZCC A;  2X6C A;  1OCC C;  4DXW A;  1P4R A;  3CCR V;  4QPK A;  2NNU A;  2XAG A;  1CPY A;  2QM7 A;  1K9M W;  4X89 A;  2JK5 C;  1JPX A;  2ZDI C;  2ZXW B;  5CMU A;  4LBE C;  4MS2 A;  1DF4 A;  4QNH B;  3KG2 A;  1GM8 A;  3CMA V;  3ABM B;  3WG7 C;  3AEI A;  1PNK A;  2WLI A;  3G71 V;  2WPD G;  5B1B B;  3FYE B;  3I55 V;  1QR9 A;  2QEX V;  2M7W A;  1N8R W;  3K06 A;  1FS0 G;  1F23 A;  2EIL B;  2IJJ A;  4JF3 A;  1M9N A;  1VQ8 V;  1VQ6 V;  3I56 V;  1MAB G;  2X7R B;  3MHH C;  1AJQ A;  3ETE A;  2CK3 G;  1I5Y A;  2HG5 C;  3ZMU A;  1AJP A;  5LGN A;  3M99 B;  1OCC B;  1EZJ A;  4XBF A;  3CP1 A;  5L3F A;  5B1A C;  2WLN A;  1W2B U;  4MVS A;  1JQ0 A;  4U7N A;  5L3D A;  4WFF A;  3W7T A;  5LHH A;  4JGS A;  1K97 A;  2PI5 A;  1YI2 V;  3E86 A;  1K7D A;  3ZRX A;  4J9Y B;  1DF5 A;  1SES A;  2DYR C;  5EBM C;  5KUK A;  3FB5 C;  2YSU B;  2WLK A;  3ABK C;  5IYD O;  1KC8 W;  4LC1 A;  4BAY A;  1NH2 D;  2Q69 A;  2Y48 A;  1R73 A;  2K1E A;  5LHI A;  5B1N A;  1VQM V;  1W0K G;  3JD3 A;  3AG4 C;  4ASU G;  2V7Q G;  5B1A B;  3JYC A;  1SER A;  1GM7 A;  3B8M A;  3ZN1 A;  3CC2 V;  4UVC A;  4GX1 A;  3CCJ V;  5CBF A;  1F4M A;  4YXW G;  4RAI A;  3E2E A;  4GX2 A;  4UXN A;  1R3L C;  1ZWI C;  2ZQM A;  2ZD9 A;  1ROP A;  4MTO A;  4TWK A;  1K34 A;  2DWE C;  3ETG A;  4WCE V;  1QLE C;  3VOU A;  2ITD C;  3OGC C;  1E79 G;  3ASO B;  4E2L A;  2ITC C;  5B3S B;  5CBG A;  3CCE V;  1Q81 W;  1GO3 F;  3SYO A;  3NXS A;  5LGU A;  3IFX A;  2HJF C;  3OE7 G;  3OR7 C;  5EK0 A;  1K73 W;  2DYS C;  1QBZ A;  2UXX A;  4UVA A;  4GCZ A;  3W7X A;  1VQ4 V;  1OCR B;  4UVB A;  3OW2 U;  2Q6A A;  3LDC A;  2DWD C;  5CN0 A;  5LHG A;  1NBM G;  3K9A A;  1YHQ V;  4JYC A;  4L87 A;  1OCR C;  1V55 B;  2W6J G;  4WFB V;  1YIJ V;  5C93 A;  1R3I C;  2JEU A;  3JCZ A;  3AG4 B;  4MW3 A;  3D36 A;  1K92 A;  3T2M A;  3LDE A;  4XDJ A;  3RW0 A;  2WLL A;  3JD4 A;  4JAV A;  4MTG A;  5HFL A;  1NQT A;  4KUM A;  2WLM A;  2JJ2 G;  3ZMZ A;  3X2Q C;  3ZMS A;  3ZMV A;  2WLI B;  1PKX A;  4PA4 A;  5CBH A;  2XAH A;  1YIT V;  3ZJZ A;  2B5U A;  3QO5 A;  1M56 B;  3AG1 C;  3OEE G;  2DW4 A;  5EBW C;  2BOB C;  4QJF B;  1BMF G;  1B6Q A;  3DTU B;  3IC7 A;  2EIK C;  2EIN C;  1RM1 B;  3W7U A;  2QE7 G;  2A79 B;  5DM6 V;  3BEH A;  1NR7 A;  4JTC B;  2DYS B;  4HAM A;  2P6J A;  4X8A A;  1FXH A;  1K5Q A;  4MVU A;  3AG3 C;  3ABT A;  4PEL A;  1QR8 A;  4RUF A;  1NVP D;  1IXM A;  3OUF A;  3ZRV A;  1Q82 W;  2X6A A;  1W0J G;  1AI4 A;  5B3S C;  3TK1 A;  5FL7 G;  1FXK A;  2JEX A;  2IJH A;  5IYC O;  4MVQ A;  1QLE B;  4WF9 V;  2QTO A;  4PDL A;  4R7C A;  3CCM V;  3CCQ V;  4PDM A;  3ABM C;  1K4C C;  4FIP C;  3SYA A;  3WG7 B;  3IGA C;  3CCV V;  4WFA V;  4WFG A;  2ZXW C;  3W7W A;  4OXS A;  2EIJ C;  3K0G A;  3RBZ A;  3ABU A;  4PA7 A;  3OMA B;  4EKW A;  1G8M A;  4MTF A;  1NH2 B;  5BZB A;  5LGT A;  4I9W A;  1QVG U;  1I5X A;  4G27 B;  1KQS U;  2EIJ B;  1BHB A;  3K79 A;  4XDK A;  5B1O A;  1SET A;  1M57 B;  5IY5 C;  3OFN G;  5L3C A;  3FB6 C;  2LFS A;  3OEH G;  3HPL C;  2WLH A;  3LUT B;  5EC2 C;  3E8H A;  4JAS A;  1S5H C;  1F4N A;  1TUE B;  4G28 B;  1NR1 A;  5CA3 A;  1K33 A;  4PA6 A;  3ZMT A;  3LSQ A;  4PA9 A;  1R3K C;  4F4L A;  2OCC C;  1L1F A;  1K8A W;  2HVJ C;  4UUJ C;  1R6N A;  3G6E V;  2OCC B;  1E1R G;  1QVF U;  4QPJ A;  3MD0 A;  1R3J C;  3ABL B;  2ATK C;  3LDD A;  2W6I G;  3AG1 B;  3LSS A;  2JIZ G;  2IH1 C;  4G2K A;  3MHS C;  4TT3 G;  2HKO A;  1JX9 A;  1ARO P;  3GB7 C;  3CPW U;  2JDI G;  4HYO A;  3UM7 A;  1NJI W;  3G4S V;  5KA5 A;  1GM9 A;  2HR3 A;  3W7S A;  2IU3 A;  5HFM A;  2FTK A;  3AG2 C;  2A9H A;  1AI7 A;  3FYI B;  1CP9 A;  2V1D A;  3QNE A;  5IY5 B;  2Y69 C;  3E8F A;  2IU0 A;  1PL0 A;  3TCU A;  2IJK A;  1H8H G;  5H9C A;  2EZP A;  2XOK G;  5KUM A;  3CXC U;  4FJC C;  3RVY A;  4RQE A;  1PNL A;  5DN6 G;  4HZ3 A;  1THZ A;  4P2Z A;  2JJ1 G;  3OMI B;  2YEV A;  3JD1 A;  1J95 A;  1CEZ A;  4PDR A;  1VQ9 V;  2EIM B;  2Z3Y A;  3OM3 B;  2XND G;  1F51 A;  4I5S A;  3F7Y C;  4RO2 A;  2GHY A;  1VQ5 V;  4CBC A;  1GTO A;  2EJR A;  3FB8 C;  3HB3 B;  1DLB A;  2DQ3 A;  2WWW A;  1G4Y B;  1FFT B;  1AI5 A;  4LCU C;  3WFV A;  1QLN A;  4N21 A;  2MK3 A;  1YJW V;  2LP7 A;  4H37 A;  4CZZ A;  2QA4 V;  1V55 C;  1MSW D;  1ORQ C;  1YJN V;  1PD3 A;  1AR1 B;  1XL4 A;  5L3E A;  1VQP V;  3ABL C;  2A0L A;  4JYB A;  5E1A C;  2EIK B;  4N23 A;  2PI4 A;  1M90 W;  4WFH A;  3CCL V;  3E8G A;  1M56 C;  4R50 A;  4FK5 C;  1YTF B;  3ZRW A;  2AHZ A;  3ASN B;  3K04 A;  3SPI A;  5L3G A;  2ZR2 A;  4Q20 A;  3X2Q B;  1KP3 A;  4MSW C;  3OR6 C;  1K3E A;  4QE9 A;  1OCO C;  2P67 A;  2IW5 A;  3ABK B;  3E8B A;  2DYR B;  4KP4 A;  3E83 A;  1OCZ B;  4UV8 A;  4MVO A;  2YEV B;  2EZO A;  3EFF K;  2D3O W;  2QKS A;  4JTA B;  1Q86 W;  1SZT A;  2XAS A;  1S77 D;  2XAF A;  4MT8 A;  3ZRW B;  2Q68 A;  4BW5 A;  3D3I A;  4MW8 A;  5H6Q A;  3CD6 V;  1K5S A;  3K03 A;  2R9I A;  3STL C;  1VQ7 V;  3SPG A;  1NKD A;  2XAJ A;  4JPR A;  3E35 A;  1KP2 A;  4R6Z A;  1DTO A;  5EBL C;  1VQK V;  3R65 A;  3SPJ A;  3P32 A;  3ML0 A;  3SPH A;  3SYQ A;  4JTD B;  4XDL A;  1BHA A;  1S72 V;  1YSC A;  4WFE A;  1GKF A;  4KFM A;  1OCO B;  1OZ0 A;  4FMT A;  3STZ C;  1AJN A;  2WLJ A;  2Q67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...