4J9YB

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
89
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/calcium binding
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 35
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2013-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4j9yB00
3F5WC 4HYOA 5CBFA 2EIMC 1J95A 3E8BA 3WG7C 2X6AA 4PDVA 1JVMA 4LBEC 1M57C 4H33A 2ATKC 2EIJC 4XDKA 4MVMA 3TCUA 3EFFK 3K0DA 5E1AC 2ZXWC 3AG4C 3R65A 2H8PC 2Q68A 4RUFA 2IH3C 4CBCA 4MW8A 3SPCA 3ZRSA 4OXSA 3T4DA 4PA7A 4QE7A 3ABKC 3OGCC 5BZBA 2ZD9A 3E83A 4R7CA 5KUMA 2W0FC 4HZ3A 1ZWIC 4P30A 3LDDA 3K04A 4P9PA 5EC2C 3RW0A 2WLIB 3LNMB 3SPGA 2QKSA 4KFMA 2DWEC 4X88A 4PA6A 3AG3C 3FB5C 3X2QC 2ITCC 2WLKA 4F4LA 3K06A 1R3IC 4PDMA 4QNHB 2WLJA 3E8FA 3LDEA 4R6ZA 2ITDC 4MVRA 4RUEA 5B1AC 5KUKA 4G27B 4J9YB 3FB6C 3AG2C 2KB1A 3SPHA 4MTGA 4TWKA 3UM7A 5B3SC 2WLNA 3F7VC 3K03A 3JYCA 4G28B 3K08A 4MW3A 3ASNC 3STZC 4BW5A 4P2ZA 4I9WA 4PDLA 4WFGA 4P9OA 1R3KC 3OR7C 3OUFA 3ZJZA 2R9RB 2WLMA 3E89A 3FB7C 1M56C 4MVOA 3AG1C 3FB8C 5EK0A 2WLLA 3E86A 4WFFA 5EBWC 2WLIA 3KG2A 4ZBMA 4PA9A 2YEVA 4R8CA 3K0GA 3RVZA 4UUJC 1G4YB 1QLEC 2EINC 3T1CA 4MSWC 5J9PC 3GB7C 2A79B 2QTOA 3IGAC 4QE9A 4JTAB 1XL4A 1V55C 4MVUA 3T2MA 3BEHA 2JK5C 3HPLC 2X6CA 3F7YC 4XDJA 2Q67A 4GX2A 4GX5A 2IH1C 3IFXA 3SJQC 3STLC 4LCUC 3LDCA 2AHYA 1OCZC 3RBZA 2HG5C 4MVZA 4RAIA 4MTOA 3SYPA 1OCRC 2AHZA 2NLJC 1P7BA 3TETA 1K4DC 3PJSK 4H37A 3SYQA 4RO2A 1XL6A 3VOUA 3OR6C 3OUSA 4JTCB 1R3LC 2P7TC 2A9HA 3SPIA 4PA4A 5CBHA 2WLHA 3RVYA 5IY5C 2OCCC 4PA3A 1S5HC 5EBLC 4MVSA 2HVKC 2X6BA 5EC1C 2DYSC 4X89A 4EKWA 4MVQA 1BL8A 2EIKC 2BOBC 3ASOC 2HVJC 1V54C 4WFHA 5EBMC 4LP8A 1OCOC 2DWDC 3LUTB 5B1BC 1LNQA 4GX0A 2BOCC 1KKDA 2DYRC 1OCCC 2Y69C 4JTDB 3UKMA 4XDLA 2A0LA 2HJFC 2HFEC 3SYCA 2EILC 3SYOA 3ABLC 4X8AA 3T4ZA 1K4CC 2K1EA 2WLLB 4J9ZB 4MS2A 4R50A 3SYAA 1ORQC 3ABMC 3E8GA 5CBGA 3E8HA 2Q6AA 3SPJA 4GX1A 4WFEA 4DXWA 4MTFA 2Q69A 4PDRA 1R3JC
chains in the Genus database with same CATH superfamily
3F5WC 1NU1H 4JI5O 2F93B 3VQYA 1NTKH 2DJVA 3SJBC 4ZKIA 1QHTA 3OTOO 1MZEA 1YVWA 4CBCA 3U0ZA 1M5IA 4CH3A 1RP3B 4DV0O 1IBKO 1R73A 4ZHQA 2PGGA 1PNMA 4UXNA 3LNMB 4NVPA 4IT5A 1SESA 5JVDA 3ZMSA 4O2AB 3B8NA 4I50B 4I55B 3E8FA 5DN6G 4LF7B 4LF7O 3AK1A 3G71V 4FVMA 1M90W 1XMQO 2YIBA 4ICGA 5EIBC 3K08A 1XMOB 2HJDA 4RQEA 1JPXA 1VP7A 1F23A 4H0LB 2XHBA 5AG2A 3L9DA 5E79Z 1GO3F 1HR0B 1WA8B 3C90A 1GN2A 4NB5A 3CRMA 2VWJA 5LA6B 4HNAA 1CPYA 5LHGA 1TAEA 1H2KA 3E35A 1ZL8A 3SYQA 4JAVA 2DYSB 1COWG 3D36A 1JJOA 2YIBD 1M4UA 3DXRA 1SQQH 4U3JA 4H13B 4EKWA 4N23A 2ODMA 2BOBC 2NN4A 3OFNG 3UCSC 5FNVB 1FXVA 4JI7B 3CP1A 1Q6HA 2QTSA 1RFYA 1YSCA 4DUYB 3G6BA 4CC5A 4EB6B 5EYPB 4HYOA 1N4CA 3PN1A 1JCHA 3JARA 1BZKA 2ZXWC 3P3NA 2H3OA 2VQFO 2W0FC 3RW0A 1K8AW 1XNRO 2OYQA 1IBMO 3FB5C 3RFRA 1IBMB 4TQDA 4YJ2A 4DYLA 1NVPB 3KZIZ 3CJHB 5BMVB 3CHXA 1XOUA 1VQOV 4JV5B 1RM1B 2BSKB 4JI3B 3AG2C 1GKFA 5IWAO 1MA1A 4FPPA 5B5EZ 2IBZH 1L8DA 1K9MW 4W4KA 4I9WA 2IM9A 1R3KC 4AHCA 2CTRA 1TVKA 2AXTZ 1I94B 1H2NA 3K5MA 3J80N 4PA9A 4LF6B 1VF7A 3CX5F 3QO7A 1VF6A 3S3WA 1K34A 1Q8IA 4X64O 2ZE6A 3CSXA 3CRAA 3BA8A 4QGPA 3OT7A 4LCUC 1VQMV 3X2QB 3CCSV 1CXZB 5LHIA 3K5OA 4X66B 3JAWB 1R3LC 2XAFA 4X1KA 1WLEA 1TGOA 4YXWG 3UT5B 2PYLA 4JI0B 3JASA 3FYIB 4I50A 1JFFA 1W2BU 4NKGB 3WFVA 2YXHA 1ZX3A 5L3GA 2BSKA 3E2EA 2X0LA 4LFBO 4XDLA 2HJFC 1AP6A 2EINB 5KMGA 3FAVB 4YIPA 3DC5A 4MS2A 3JSNA 2VQEO 4UVBA 3SPJA 4WFEA 2JEUA 5IYCO 1NI8A 2CH7B 1VMGA 1L1FA 4E4EA 1VQPV 2ETNA 2JGDB 4JI1B 2HEPA 4DRXA 1M57C 3ETDA 4MVMA 2IJIA 3RT3C 1XHXA 1KD1W 2B1IA 2ADPA 2R72A 2VS0A 3WB0A 1VQ4V 1EN6A 4QE7A 5BZBA 2ZM6O 2CTPA 2W6IG 2ZDIA 1U96A 2Q9LA 2JIZG 4JYBA 2WLJA 4DK0A 2F4VO 4R6ZA 2VRZA 4RUEA 4A5UB 3JD0A 2JJ1G 2QGNA 1BE3H 4FFBA 4B3TB 2WLNA 4W4LA 4B3RB 4WFGA 4BIUA 2ZR3A 2Z5UA 1IXMA 3JALA 2UXBO 3UQ8A 1Y74A 2M6YA 5F2VO 2GBOA 2ZE5A 2YIDA 1S77D 1BHBA 4J7ZA 2YXYA 2X6CA 3SJQC 5EZYA 2O57A 4JYYA 4O4HA 2FYUH 1OCRC 2EULA 2FB5A 2FL4A 2UU9O 1ZSPA 5D5QA 3HKEA 4MVSA 1KYOF 1Q6UA 1R6KA 3CPWU 1XNQB 1HNXB 4UVCA 2LQTA 1X4TA 2Y0PA 1JOYA 1QNMA 1XBLA 2HFEC 3SYCA 1RSOB 3TXSA 4B3TO 4GT1A 5C8YB 3SYAA 4DR2B 3W7XA 3HB3B 1YTFD 3QTCA 3GWOA 2K9PA 1Y76B 3L70H 2EIMC 3E8BA 1JQ0A 5TISZ 2ZQMA 4GUNA 1SZTA 3K0DA 3AG7A 1PKXA 5E1AC 2MK3A 3CCRV 4J41A 3ZHQA 3ZRWB 1NT2B 1OCRB 1FYJA 4UCRA 3OGCC 3P3PA 2YIAA 4CS2A 3RYIB 2R70A 4LF8B 4UB8Z 4YHHO 2YS8A 1YJNV 2LW1A 5LOVB 4G27B 4K0KB 1OJHA 1YXBA 1TUBB 2AW9A 2JVDA 3CE2A 2OTLV 4IIJB 4LR3A 3B09A 4CH6A 5LMUB 3OMAB 3T1YB 3R66A 2IJKA 3A0RA 3FB8C 2WLLA 4U3FH 4Z2WA 2QWPB 3D3IA 2WPDG 4DR4O 3H1JH 2KG7A 1EZVH 4DRXB 5CB4A 1XMQB 4O4LB 3TGUH 3LDCA 5LYJB 4AQYO 2JGDA 3ZMTA 4QJFB 4B3MO 2XUMA 2F43G 2P7TC 5KMGB 4X64B 3ZRVA 1VQ8V 2PI4A 3LUTB 2B9ZA 1LNQA 3CCUV 1NR1A 2ARHA 1F4MA 4DO2A 3DGEA 3HKDB 1QLEB 4YJ2B 2EILC 3RWRD 5IYDO 1LUWA 2LGQA 2QSAA 3JAMN 3ZHVA 2XAGA 2CTQA 2P90A 1YITV 2CAZC 5ITZB 1YZBA 2FTKA 3WG7C 2YC0A 1XNQO 4LBEC 4H33A 1AI6A 2JDIG 1DGSA 1W59A 2H8PC 1W0JG 2UU9B 4LF4O 1LUVA 2DMXA 2F95B 2HHHO 1HWYA 1VQ6V 3E83A 1N0JA 5KUMA 4P30A 5HFLA 5EC2C 2QM8A 4KFMA 3CCLV 4UCVA 1K3EA 4JYAB 1NH2B 3B2EE 1SA0B 3H1HH 3LDEA 5EIBD 1Y74B 2P5OA 1IBLB 4BW9A 4JI2B 4EFEA 4LFAB 4BW5A 4P2ZA 3JAKA 4JI7O 1S5JA 3OR7C 3OUFA 3ZJZA 1Z2GA 3D3QA 1I08A 3E86A 3G4SV 4LFCB 4I0XA 3WB1A 4FM1A 2QM4A 5IJ9B 5JWPA 3KCYA 5IE9A 2BTOA 3GB7C 4CS4A 4NTWA 1FS0G 3AG1B 3BFRA 3T2MA 3T1HB 3BEHA 4DR3B 5JQGB 5LXTB 1SERA 3IFXA 3JARB 1AB3A 1OCZC 2HG5C 4RAIA 3OD4A 3DSQA 1N8RW 2NLJC 5KA6A 5CN0A 4EEQA 1NTMH 3SJCC 1MSWD 3ZBHA 1NTZH 3BCCH 2RNBA 3AK2A 3W7UA 3AG3B 5GTIZ 1B04A 4Q20A 4YJ3A 5LL6Y 1KQSU 4E2LA 4MT8A 4JI3O 3OMIB 4DV1O 3SYOA 2GUZB 2OIEA 3E8HA 1AR1B 1Q3EA 3CXHF 5H2FZ 1R3JC 1M57B 3ETEA 3QG5A 4JF3A 3CCJV 2KQXA 3DC6A 4GZRB 4NXNB 2EZPA 3JASB 3TCUA 3N27A 4J10A 3B4SA 4OGQB 4O2AA 3JD4A 3ABKC 3G80A 2A3QA 5L3BA 1WA8A 3JCUZ 4LNUB 4CH5A 5IYZA 2UUAB 1ZWIC 3CCEV 1VQLV 4QPJA 1XEQA 3LSQA 4PA6A 4G2KA 3AG3C 2WLKA 3K06A 2IJJA 1OV9A 4MVRA 3ABMB 1Y67A 3FB6C 1BQZA 4CZZA 4F6RA 4U7OA 2LFSA 1N34O 5B1NA 1KMIZ 1L0LH 2KSDA 4PDLA 4I9QA 4X66O 2WLMA 1JX9A 3ZMUA 5EK0A 2QKCA 3BABA 5DECA 5K1XA 5KX5A 5H6QA 3T1CA 4JAUA 3OE7G 4TQFA 4B3SO 1WB7A 4FMTA 5JH7A 3ICXA 2Q67A 4I5SA 1IVSA 4KP4A 4JI4B 3HKCB 5LP6A 3SYPA 2YEVB 4GKKO 3PJSK 3BVOA 3UO3A 3VOUA 3OW2U 2E75B 5GONA 3RVYA 1FPOA 4UVAA 1BCCH 2P4KA 4JGSA 3U10A 1BL8A 4WFHA 2HVJC 5DM6V 4RWUA 4CC6A 2CE4A 1PD3A 2XTAA 3ZMVA 3UKMA 1VIBA 3ZN1A 1BGYH 1AP5A 3RN4A 4TUYA 5FL7G 5L3EA 1VARA 1AROP 3JAKB 3ZHRA 4DV7O 4IIJA 2EX3A 2UXXA 3AK3A 3CRQA 1MOFA 2DQ3A 3JATB 1MSDA 3P32A 2Q68A 1DLBA 4GCZA 4LFBB 4K3AA 2ZCEA 4R7CA 4WBNA 5JJEB 3LDDA 3K3WA 4B3RO 3WU2Z 1FJGO 2AZ0A 4YY3O 1CEZA 3JD1A 1VQNV 3CD6V 1Q90D 3CEIA 4YY3B 2XAJA 2HHHB 5LMNB 1GN4A 4LFAO 2CK3G 3A0BZ 2X7RB 4TV8B 3NXSA 4DR6B 1QR9A 2E5LO 5H9CA 4ZBMA 3K9AA 3CCMV 1YDXA 2L35A 3RVZA 4LF6O 3A0HZ 1S3JA 4TV9B 4DR1O 4FFKA 2A79B 4LF9O 1PV0A 5JQGA 5B1OA 4UCSA 4ZI7B 2RQ6A 3UT5A 1DF4A 4DK1A 1K5QA 3P30A 1FFXA 1PL0A 2JJ2G 4DR5B 3ABUA 2QE7G 2UXDB 1AR5A 2HVKC 2Q73A 3MHSC 4YJ3B 2LW7A 3ASOC 4JI0O 2XAHA 3OEEG 3FKSG 1V54B 1PL4A 4FLTA 1OHHG 2QWOB 1P84F 1FXHA 5KHKA 3ABLC 1NH2D 4NXNO 3HKDA 2Q69A 4HAMA 1A32A 3MD0A 4O4HB 5KAFZ 1YF2A 1AI7A 3K5NA 2EIJC 5GW7A 2IH3C 4DV1B 4D7SA 3ZCCA 1GM8A 2V7QG 1KUQA 3JAWA 4GKJB 3K04A 2ZE8A 2QWNB 4J80A 3M7MX 4UCUA 4TUYB 4PDMA 5CA1B 5KHGA 3G67A 2QR4A 4B7KA 3UM7A 3F7VC 3W7TA 1E79G 4DV5B 2ILMA 4FZ1A 2R9RB 4MVOA 1Y4MA 2JEXA 3QNEA 2Y48A 2WLIA 5B1AB 4AILC 2YEVA 4JYCA 5LHHA 3L74H 1K5SA 5LXTA 5LP6C 1XL4A 1N33B 1V55C 3RYFB 3ZMZA 1PM9A 4XDJA 3LNNA 1U97A 4X1IB 2AHYA 3AEIA 3ETGA 4DR1B 2XAQA 2F23A 3M99B 1XL6A 3AG4B 2E5LB 3I5DA 4JPRA 5CBHA 5LBQA 2WSSG 1XUQA 4IL6Z 5DEDA 5EC1C 4X9QA 4C7UA 1NQTA 1VQKV 2D2CB 3O65A 2DYRC 4B7EA 2Y69C 2CGOA 2IW5A 4K35A 4FJCC 5IY5B 4ZOLA 4PHZA 2Z3YA 5FLXN 1H8EG 3CCVV 5KLVH 1ENVA 2PI5A 4GX1A 1FJGB 4JI8O 2EZOA 2LJ2A 4JV5O 1J95A 3J81N 3HKBA 3JCZA 1T5EA 1V55B 2PZSA 3ZRWA 3R65A 1EN4A 4OXSA 4I55A 1ZLZA 1SC5B 3VQXA 1IURA 2WA4A 4X65B 4FLYA 4HZ3A 1TVKB 1G8MA 4P9PA 1RPOA 2DWEC 2VQEB 1SKVA 1Y66A 1XMOO 2DQ0A 5FPOA 1MZFA 2ITDC 1QLNA 3THOA 2Q7GA 4TV9A 3CXCU 3H01A 1JMKC 3A8TA 1UJWB 2UXNA 2HP8A 2YSUB 3CRRA 4R8CA 4QPKA 1XI1A 2G38A 4PELA 5CA3A 1HW7A 1M56B 4HNAB 4DV2O 4U3JB 3HPLC 4JI5B 4NYKA 1B06A 4CH4A 2HKOA 4H37A 1H38A 1ZL8B 1Q5OA 5KHHA 1I94O 4U7NA 1NS1A 2A9HA 1YJWV 2VWKA 2WLHA 1EM1A 1SQFA 4OX9O 4X20B 3RYCB 2OIGA 1TUBA 2EIKC 4IHJB 1V54C 5BMVA 3G6EV 5CA1A 2A06H 2Q7EA 5JH7B 2ZIMA 5IJ9A 5KX5B 1TUEB 4ASUG 2LP7A 4NTXA 5CA0B 5BY1A 1NR7A 1AR4A 3CC7V 2RCVA 2P67A 1YTFB 3HR0A 1JVMA 1KKCA 3B77A 3K5LA 1I5YA 2Q8VA 2WWWA 3OEHG 3CJHA 2N05A 1HNWB 1N34B 2Y4TA 3C3SA 2N74A 4H44B 3HKEB 2GTSA 3SPGA 4DR7B 3QVNA 2ITCC 1XNRB 5LYJA 1JA8A 4KHPO 3QO8A 3IC7A 5KUKA 3SGIA 2YUAA 1YHQV 1KP3A 1PNKA 2W0XA 4LF8O 1WAZA 3SPHA 3L75H 3ASNC 4GKJO 4WBNB 4GKKB 5EYPA 4ZHQB 2GUZA 5IWAB 4J42A 4BR6A 4TV8A 2IU0A 1GRJA 2QM7A 2HR3A 1MABG 1J5EB 3IGAC 1NKDA 3RYFA 1AJQA 3I55V 1E1QG 2JK5C 2PUSA 4X1YB 1BSMA 1VQ5V 4Z1VA 3RBZA 1H2LA 4AQYB 2UXCO 1P7BA 4JI6B 5L3DA 2F1MA 3VQWA 3D8CA 5A2QN 4D7TA 4I7ZB 3OTFA 5H5NA 1UFIA 4MTXA 4NXMB 1SZXA 1BMFG 1WP8A 3F5TA 1OCOC 3CWBH 1WB8A 4FLXA 1KECA 1Q7YW 5LA6A 2UUCO 2KKWA 1SETA 1KC8W 4LH7A 4X1KB 1QVGU 3U11A 3N2GA 2JS3A 3RYIA 2B5UA 5IYBO 4DXWA 4MTFA 4PDRA 5KHJA 2E74B 1B6QA 1P4RA 1OCZB 2LGWA 2PY5A 3CC2V 1AI4A 1SQPH 3ZEDA 4O4LA 3BAAA 2ZDIC 1F4NA 2KG7B 4PA7A 1ZUQA 2N04A 3CC4V 4DR6O 3NR7A 1CP9A 3C3TA 1MG1A 1SQGA 1HP8A 1XILA 5JCOC 5CA0A 1SQXH 1PPJH 1HR0O 4UCOA 4L8JA 3ZN0A 2F4VB 3K03A 4UFZA 4K8XA 4DV6B 4X20A 4I0XB 2ZXWB 3ZIAG 2CH7A 3CMAV 3K79A 2AGAA 4LWSB 4B3MB 4JZ2A 2E76B 3HKCA 5LP6B 2ADQB 3CMEV 1FXKB 5J9PC 4JYAO 5IDJA 3IJ4A 1ZTEA 1N36O 1QU7A 1NBMG 4LFCO 5J2UA 4UCTA 3JALB 4JI1O 2FKXA 2DW4A 1K4DC 1N36B 1KB9F 5J2TB 1S72V 4DUZB 2GV9A 1Q82W 3CYOA 3KCXA 1S5HC 2X6BA 2GTAA 4FIPC 5LMUO 1AJPA 3EXAA 4DW0A 4X89A 1F51A 1N0NA 2DYRB 3M8AA 5HFMA 3SR2C 1GK9A 1L0NH 2JGUA 2Z0AA 2JRIA 2B1GA 2P4VA 2C2AA 4DV6O 4X8AA 3T4ZA 1GMGA 1N32B 4O4IA 5CBGA 4FLZA 2DOSA 2Q6AA 2ZIOA 1M1KW 3MHHC 1M93A 4F4LA 5L3CA 1R1BA 3OM3B 5B66Z 3EHBB 3EVKA 1OZ0A 4JI6O 1JJ2U 5D5PA 1FFTB 1S0VA 2NNUA 4LC1A 4TOIA 2Q0OC 4PD4F 1XDCA 1WP7A 3T4DA 4JI8B 3N2KA 3ZX6A 1NJIW 4KXRA 3ML0A 4FLWA 1Q81W 4FM2A 4UV9A 1DF5A 3K57A 1NVPD 4O2BB 2QKSA 4ZIBA 3ASOB 3J7AU 1IX9A 2OT5A 1BT8A 2OCCB 5IT9N 3ABTA 4J9YB 1E1RG 4JZGA 3ABLB 3H1IH 5A9GA 4L87A 1XREA 4CS3A 3H1LH 3ASNB 1O9GA 1EFRG 4P9OA 4DV4B 5GTHZ 3AG1C 3FAVA 3VBBA 1XHZA 2PF4E 4DR7O 4WFFA 5EBWC 2DE0X 2XNDG 1HNWO 4EFBA 1W0KG 1VF6C 1FAFA 2CDYA 1G6UA 4JTAB 2IU3A 1GTOA 1WPBA 1SQBH 3STLC 5K1PA 1YEWA 1Z5VA 1YCIA 4JI4O 4DV4O 1H2MA 1IXBA 1Q86W 3H9VA 1O9HA 5IYZB 4J11A 2UUBO 1AI5A 1FKAO 2EILB 5FPRA 5H6RA 2UXDO 2NR5A 2OCCC 1HNZO 1BHAA 4KUMA 1OCOB 5EBMC 4LP8A 4GYCB 4WF9V 2R9IA 5B1BC 4N21A 4GLXA 1KKDA 1QCEA 4OX9B 1D2DA 4I4TB 2BCCH 3AG2B 3E8GA 1DTOA 2F66C 2X6AA 5C93A 3RGBA 4PDVA 2Y0IA 3K58A 4J7KA 1VF5B 3L72H 2PYJA 1GH6A 3W7SA 4NTYA 2RDCA 4MW8A 5KA5A 1SA0A 1KP2A 1ROPA 5ITZA 1QR8A 1N32O 4I4TA 2V4DA 4DV7B 1YI2V 4LF9B 3KKYA 3X2QC 4RQFA 3RYHB 3D36C 1QVFU 2UUBB 3IC9A 2OTJV 1H2GA 3CB2A 4IHJA 2A7WA 1R6NA 2E3CA 3E22B 2IJHA 3B40A 4LF5O 1QBZA 2ZKOA 5BR8O 1K33A 2ZNJA 5JJNB 2EIJB 3LSUA 4WFAV 3VQVA 1GN6A 3KG2A 1FD9A 4DW1A 4YIOA 1FXKC 4KL1A 2EINC 4AI8A 4Z1MG 1JR9A 2QTOA 1SF9A 2ZINA 3BY6A 1G1XB 3CS5A 1WPXA 2Q7HA 3K59A 2IH1C 2QWQB 3RYHA 2QWRB 1P7GA 4MVZA 1H2SB 2AHZA 5IJ0B 2CTWA 3TETA 2XASA 3OAAG 4JAAA 2ZR2A 3T1HO 4JTCB 1R6TA 1US6A 4UV8A 2ZT9B 2PTMA 4PA3A 2Q5ZA 5LGNA 1VQ7V 5JJJB 2FMLA 3JSLA 1Z5WA 3FX7A 2DWDC 1NZ6A 4GX0A 2BOCC 1K92A 1S76D 1OCCC 4LF5B 5KAIZ 1B3QA 2K1EA 1ORQC 5EZYB 5LGUA 3WB2A 2QA4V 5C8YA 4O4JB 2HLDG 2OCHA 4ZI7A 2ATKC 4XDKA 1WN7A 1QQCA 3EFFK 1D5AA 3AG4C 4RUFA 1Q43A 4PI2A 2AZ2A 1RPRA 1DK1A 1GM9A 4DV0B 1IBKB 5L3FA 3T1YO 1YIJV 3SDLA 2QEXV 2EIKB 4X88A 2OWOA 4NR1A 1LR1A 1R3IC 4BAYA 2LFRA 1H8HG 4TT3G 4QIWF 4NXMO 3A2FA 4EB6A 3IAYA 4B08A 1EZJA 1SS3A 4KHPB 1XQ8A 4J7JA 4B3SB 4HBNA 5FNVA 1PNLA 4LH6A 1FXKA 3F7YC 3TJTA 4GX2A 4DV3B 5CMUA 2EIMB 3Q4HB 3HKBB 4UB6Z 3DXRB 1WJZA 4RO2A 1MMMA 1ZAUA 1GAXA 3ZHSA 2Q4PA 3OGIB 2BE3A 2XT9A 1I7FA 4K8ZA 2DYSC 4IYIA 1F7YA 4JI2O 5B1BB 2GHYA 3ZS8C 4F6EA 2ZM6B 4DUZO 2A0LA 2W6JG 4PJ0Z 4WCEV 1HNXO 4DR3O 5B3SB 5GONB 3CCQV 4J9ZB 2UUAO 3K9SA 4X62O 1AVMA 2YDEA 2DN9A 3Q4HA 3E22A 4IGGA 1TA8A 3FYEB 4X1IA 4WFBV 4LF4B 1IDSA 1GM7A 3SPCA 3L73H 1THZA 4O2BA 2RMKB 2EJ7A 1K73W 4ZOLB 2R9AA 2P06A 5IJ0A 4DV2B 2WLIB 5LMNO 1RSOA 2H94A 2ZE7A 4QNHB 5LOVA 3QO5A 2YI9A 2L6LA 4TWKA 1YJ9V 5B3SC 1VEWA 4G28B 4MW3A 3RYCA 1HNZB 3ETQA 3E89A 4OPHA 4PV1B 1I0HA 3N2GB 3ABKB 2V1DA 2EJRA 3K0GA 3N2KB 1G4YB 1QLEC 3APQA 3W7WA 1IZ3A 2Y69B 1Q6IA 1KU9A 2M7WA 4FK5C 4QE9A 1GN3A 4Q6GA 2P22C 3BRCA 2WAMA 2Q0AA 4F6RB 3I56V 4IYHA 4GX5A 1K7DA 2LO1A 1WNSA 3WG7B 1Y76A 4MTOA 4O4JA 4DR4B 1FFXB 2QKAA 3OR6C 3OTOB 3SPIA 2UUCB 3MDSA 1IBLO 2YI8A 4MVQA 3BA9A 2UXBB 1MNGA 2QDOA 3L71H 1BQ0A 2YXLA 4OPAA 4JTDB 1SQVH 4YHHB 1D5NA 2WLLB 1N33O 3ZHTA 4X65O 4BWAA 4BIZA 4XBFA 3B8MA 4DV3O 5CBFA 1HDJA 2GDSA 2UXCB 2BTQB 3JD2A 5BXZA 4PI0A 3ZRSA 2MW2B 4D6TH 3OMNB 2EBOA 1J5EO 1EBOA 2ZD9A 3DTUB 4FLVA 2QJ1A 1K97A 4LNUA 2WA3A 1P49A 4FM0A 5CB4B 5JCOA 2Y4UA 3JATA 5B1AC 3TK1A 3LSSA 1RM1C 1KBHA 1V9PA 4ABMA 2KB1A 3TXQA 4X62B 1M9NA 4FLUA 3APOA 4MTGA 5LGTA 5KHIA 4DV5O 1X59A 3JYCA 2BTQA 3FD9A 3STZC 1UPGA 4DR5O 2P6JA 3FB7C 1M56C 4TSFG 2CGNA 2CUGA 1BS3A 5J2UB 4K0KO 3JD3A 1PP9H 4O4IB 3O9OA 4UUJC 3ZRXA 2VQFB 4MSWC 3QF7A 4X1YA 1I5XA 2GSMB 3UO2A 1S5LZ 5BR8B 4MVUA 3FFQA 3BHPA 3H1KH 4LWSA 4BIOA 3GVMA 1VQ9V 3ZHUA 5J2TA 4DUYO 1EN5A 2XOKG 3OUSA 3SJAC 4JASA 1AILA 4FFBB 4PA4A 5IY5C 5EBLC 3MAQA 2D3OW 1OCCB 4FZ0A 2YICA 3S3XA 3BPZA 1JFFB 1SRYA 3GWKC 2RN9A 3CRCA 4DR2O 5JVDB 2JS5A 2ZNIA 1K4CC 1AJNA 4R50A 2RJZA 3ABMC 1URFA 1Y6XA
chains in the Genus database with same CATH topology
2EZOA 3F5WC 2FTKA 3WG7C 1J95A 2X6AA 5C93A 4PDVA 3JCZA 4LBEC 4H33A 1AI6A 1V55B 4ZKIA 2JDIG 3ZRWA 3R65A 2H8PC 1W0JG 3W7SA 4CBCA 4MW8A 5KA5A 4OXSA 1KP2A 1ROPA 1HWYA 1VQ6V 1QR8A 3E83A 1R73A 5KUMA 4HZ3A 4P30A 1G8MA 1PNMA 4P9PA 5HFLA 5EC2C 1YI2V 4UXNA 2QM8A 3LNMB 4KFMA 1RPOA 2DWEC 3CCLV 1K3EA 1SESA 3X2QC 4RQFA 1NH2B 3ZMSA 1QVFU 3B8NA 1Y66A 2DQ0A 3E8FA 5DN6G 3LDEA 2ITDC 1QLNA 2OTJV 1H2GA 1R6NA 3G71V 3CXCU 1M90W 2IJHA 3H01A 3K08A 4BW5A 1QBZA 4P2ZA 4RQEA 1K33A 1JPXA 3OR7C 1F23A 3OUFA 3ZJZA 2EIJB 4WFAV 1UJWB 2UXNA 3E86A 3G4SV 3KG2A 2YSUB 4R8CA 1FXKC 1GO3F 4QPKA 2EINC 4Z1MG 4PELA 5CA3A 3GB7C 3BY6A 2QTOA 1FS0G 1M56B 3AG1B 3T2MA 1WPXA 3BEHA 3HPLC 1CPYA 5LHGA 1SERA 2IH1C 3IFXA 1OCZC 2HKOA 2HG5C 4MVZA 4RAIA 1N8RW 2AHZA 2NLJC 3E35A 5KA6A 3TETA 5CN0A 2XASA 4H37A 3OAAG 1H38A 3SYQA 2ZR2A 4JAVA 4JTCB 2DYSB 1MSWD 1COWG 4U7NA 2A9HA 3D36A 4UV8A 1YJWV 2WLHA 3W7UA 4PA3A 5LGNA 3AG3B 1VQ7V 4EKWA 2EIKC 4N23A 2BOBC 1V54C 3OFNG 4Q20A 1KQSU 1FXVA 3G6EV 2DWDC 4E2LA 4GX0A 2BOCC 4MT8A 1K92A 1S76D 1OCCC 3OMIB 1TUEB 4ASUG 3SYOA 3CP1A 2LP7A 2K1EA 1YSCA 1ORQC 1NR7A 3E8HA 1AR1B 1R3JC 3CC7V 1M57B 2P67A 3ETEA 5LGUA 2QA4V 4HYOA 1YTFB 4JF3A 3CCJV 2HLDG 1JCHA 1JVMA 2EZPA 2ATKC 3B77A 4XDKA 3TCUA 1I5YA 3EFFK 2ZXWC 3AG4C 2WWWA 4RUFA 3OEHG 3JD4A 1RPRA 1GM9A 3ABKC 5L3BA 5L3FA 2W0FC 1ZWIC 3CCEV 1YIJV 1VQLV 4QPJA 3RW0A 3SPGA 2QEXV 2EIKB 1K8AW 4X88A 3LSQA 4PA6A 4G2KA 3AG3C 3FB5C 2ITCC 2WLKA 3K06A 1NVPB 1R3IC 2IJJA 4BAYA 2LFRA 1H8HG 1VQOV 4TT3G 3QO8A 3IC7A 4MVRA 5KUKA 1RM1B 1YHQV 1KP3A 3ABMB 3FB6C 3AG2C 4QIWF 1GKFA 1PNKA 4CZZA 4U7OA 3SPHA 2LFSA 4FPPA 5B1NA 1K9MW 3ASNC 4I9WA 4PDLA 1R3KC 2WLMA 1JX9A 3ZMUA 5EK0A 4PA9A 3QO7A 2IU0A 1EZJA 5H6QA 1K34A 2QM7A 2HR3A 3T1CA 4JAUA 3OE7G 1MABG 3IGAC 1NKDA 1PNLA 1AJQA 3I55V 1E1QG 4FMTA 2JK5C 1FXKA 3F7YC 2Q67A 4GX2A 4I5SA 4LCUC 5CMUA 4KP4A 1VQMV 3X2QB 1VQ5V 2EIMB 3RBZA 3CCSV 5LHIA 3SYPA 1P7BA 2YEVB 3PJSK 5L3DA 4RO2A 3OW2U 3VOUA 1R3LC 2XAFA 3RVYA 1WLEA 4UVAA 4MTXA 4YXWG 2DYSC 4JGSA 1BL8A 1BMFG 2HVJC 4WFHA 5DM6V 2GHYA 3FYIB 5B1BB 1OCOC 1W2BU 3WFVA 1KECA 1Q7YW 5L3GA 1PD3A 3E2EA 3ZMVA 2X0LA 3UKMA 3ZN1A 4XDLA 2A0LA 2HJFC 2W6JG 1SETA 4WCEV 1KC8W 2EINB 5B3SB 1QVGU 4J9ZB 5FL7G 4MS2A 5L3EA 4UVBA 5IYBO 2B5UA 1AROP 3SPJA 4DXWA 4WFEA 2JEUA 4MTFA 5IYCO 4PDRA 1B6QA 1P4RA 1L1FA 2UXXA 1OCZB 1VQPV 1MOFA 2DQ3A 3CC2V 1AI4A 1M57C 3ETDA 3FYEB 4MVMA 3P32A 2IJIA 1KD1W 4WFBV 2Q68A 2ZDIC 1GM7A 1DLBA 1F4NA 2B1IA 4GCZA 3SPCA 1THZA 4PA7A 1VQ4V 4QE7A 3CC4V 5BZBA 4R7CA 1K73W 1CP9A 3LDDA 3K3WA 2W6IG 2ZDIA 2WLIB 1MG1A 2H94A 1CEZA 3JD1A 1VQNV 4QNHB 2JIZG 4JYBA 2WLJA 3CD6V 4R6ZA 4RUEA 3ZN0A 3JD0A 2JJ1G 2XAJA 3QO5A 4TWKA 1YJ9V 5B3SC 2WLNA 3K03A 4G28B 4MW3A 2CK3G 3ZIAG 2ZXWB 4WFGA 2X7RB 3CMAV 3NXSA 3K79A 3E89A 4BIUA 1QR9A 2ZR3A 5H9CA 2Z5UA 3ABKB 2V1DA 4ZBMA 3K9AA 1IXMA 3CMEV 2EJRA 3CCMV 3K0GA 3RVZA 1G4YB 1QLEC 3W7WA 1FXKB 1S3JA 5J9PC 2Y69B 2A79B 2M7WA 4FK5C 4QE9A 5IDJA 1S77D 2WAMA 5B1OA 1BHBA 3I56V 2X6CA 4GX5A 1K7DA 3SJQC 1NBMG 1DF4A 3WG7B 4MTOA 1OCRC 1K5QA 3P30A 2DW4A 1K4DC 3OR6C 1S72V 1PL0A 2JJ2G 3SPIA 1Q82W 3CYOA 3ABUA 2QE7G 1S5HC 4MVSA 2HVKC 2X6BA 4FIPC 3CPWU 1AJPA 1R6KA 1F51A 2DYRB 3MHSC 4MVQA 4UVCA 4X89A 5HFMA 3ASOC 2XAHA 1GK9A 3OEEG 3FKSG 1V54B 1OHHG 1JOYA 2B1GA 2C2AA 4JTDB 2HFEC 3SYCA 1FXHA 3ABLC 4X8AA 3T4ZA 2WLLB 1GMGA 4GT1A 3SYAA 3W7XA 3HB3B 5CBGA 4BIZA 1NH2D 1YTFD 2Q6AA 1M1KW 4XBFA 4HAMA 2Q69A 3GWOA 3MHHC 4F4LA 3B8MA 5L3CA 3OM3B 3EHBB 3MD0A 5CBFA 2EIMC 1OZ0A 1JQ0A 3E8BA 1JJ2U 1AI7A 1FFTB 3JD2A 2NNUA 1S0VA 2ZQMA 2EIJC 1SZTA 3K0DA 4LC1A 5E1AC 1PKXA 5GW7A 2MK3A 3CCRV 2IH3C 3ZRWB 3ZRSA 3T4DA 3ZCCA 1OCRB 3OMNB 1NJIW 2EBOA 1GM8A 2V7QG 3OGCC 1EBOA 2ZD9A 3ML0A 3DTUB 1Q81W 3K04A 4UV9A 1DF5A 1NVPD 2QKSA 1K97A 3ASOB 2OT5A 2OCCB 4PDMA 1YJNV 3ABTA 5B1AC 3TK1A 4G27B 3LSSA 4J9YB 1RM1C 1E1RG 2KB1A 3ABLB 1M9NA 2OTLV 4MTGA 5LGTA 4L87A 3UM7A 3F7VC 3ASNB 3JYCA 3STZC 3W7TA 1E79G 1EFRG 3OMAB 2IJKA 4P9OA 3A0RA 2P6JA 2R9RB 3FB7C 4MVOA 1M56C 1Y4MA 2JEXA 2Y48A 3AG1C 3FB8C 3QNEA 2WLLA 4TSFG 4WFFA 5EBWC 2WLIA 3VBBA 3JD3A 5B1AB 2XNDG 2YEVA 3D3IA 4JYCA 4UUJC 5LHHA 3ZRXA 2WPDG 1K5SA 1W0KG 4MSWC 1I5XA 2GSMB 4JTAB 2IU3A 1XL4A 1GTOA 1V55C 4MVUA 3ZMZA 4XDJA 3STLC 3LDCA 2AHYA 3AEIA 3ETGA 2XAQA 1VQ9V 3ZMTA 1Q86W 3M99B 1XL6A 3AG4B 2XOKG 4QJFB 3OUSA 1AI5A 4JASA 2F43G 2P7TC 4JPRA 5CBHA 2EILB 4PA4A 5H6RA 5LBQA 2WSSG 2OCCC 5IY5C 5EBLC 5EC1C 1BHAA 2D3OW 4KUMA 1OCCB 3ZRVA 1OCOB 1NQTA 1VQKV 5EBMC 4LP8A 1VQ8V 4WF9V 2PI4A 2R9IA 3LUTB 4N21A 1LNQA 5B1BC 1SRYA 1KKDA 3CCUV 2DYRC 1NR1A 2Y69C 1QCEA 1F4MA 4DO2A 3DGEA 1QLEB 2EILC 2IW5A 4FJCC 5IY5B 5IYDO 1K4CC 1AJNA 2Z3YA 4R50A 2XAGA 3ABMC 1H8EG 3AG2B 3E8GA 1ENVA 2P90A 3CCVV 1DTOA 4GX1A 1YITV 2PI5A 3CCQV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5W C;  4HYO A;  5CBF A;  2EIM C;  1J95 A;  3E8B A;  3WG7 C;  2X6A A;  4PDV A;  1JVM A;  4LBE C;  1M57 C;  4H33 A;  2ATK C;  2EIJ C;  4XDK A;  4MVM A;  3TCU A;  3EFF K;  3K0D A;  5E1A C;  2ZXW C;  3AG4 C;  3R65 A;  2H8P C;  2Q68 A;  4RUF A;  2IH3 C;  4CBC A;  4MW8 A;  3SPC A;  3ZRS A;  4OXS A;  3T4D A;  4PA7 A;  4QE7 A;  3ABK C;  3OGC C;  5BZB A;  2ZD9 A;  3E83 A;  4R7C A;  5KUM A;  2W0F C;  4HZ3 A;  1ZWI C;  4P30 A;  3LDD A;  3K04 A;  4P9P A;  5EC2 C;  3RW0 A;  2WLI B;  3LNM B;  3SPG A;  2QKS A;  4KFM A;  2DWE C;  4X88 A;  4PA6 A;  3AG3 C;  3FB5 C;  3X2Q C;  2ITC C;  2WLK A;  4F4L A;  3K06 A;  1R3I C;  4PDM A;  4QNH B;  2WLJ A;  3E8F A;  3LDE A;  4R6Z A;  2ITD C;  4MVR A;  4RUE A;  5B1A C;  5KUK A;  4G27 B;  4J9Y B;  3FB6 C;  3AG2 C;  2KB1 A;  3SPH A;  4MTG A;  4TWK A;  3UM7 A;  5B3S C;  2WLN A;  3F7V C;  3K03 A;  3JYC A;  4G28 B;  3K08 A;  4MW3 A;  3ASN C;  3STZ C;  4BW5 A;  4P2Z A;  4I9W A;  4PDL A;  4WFG A;  4P9O A;  1R3K C;  3OR7 C;  3OUF A;  3ZJZ A;  2R9R B;  2WLM A;  3E89 A;  3FB7 C;  1M56 C;  4MVO A;  3AG1 C;  3FB8 C;  5EK0 A;  2WLL A;  3E86 A;  4WFF A;  5EBW C;  2WLI A;  3KG2 A;  4ZBM A;  4PA9 A;  2YEV A;  4R8C A;  3K0G A;  3RVZ A;  4UUJ C;  1G4Y B;  1QLE C;  2EIN C;  3T1C A;  4MSW C;  5J9P C;  3GB7 C;  2A79 B;  2QTO A;  3IGA C;  4QE9 A;  4JTA B;  1XL4 A;  1V55 C;  4MVU A;  3T2M A;  3BEH A;  2JK5 C;  3HPL C;  2X6C A;  3F7Y C;  4XDJ A;  2Q67 A;  4GX2 A;  4GX5 A;  2IH1 C;  3IFX A;  3SJQ C;  3STL C;  4LCU C;  3LDC A;  2AHY A;  1OCZ C;  3RBZ A;  2HG5 C;  4MVZ A;  4RAI A;  4MTO A;  3SYP A;  1OCR C;  2AHZ A;  2NLJ C;  1P7B A;  3TET A;  1K4D C;  3PJS K;  4H37 A;  3SYQ A;  4RO2 A;  1XL6 A;  3VOU A;  3OR6 C;  3OUS A;  4JTC B;  1R3L C;  2P7T C;  2A9H A;  3SPI A;  4PA4 A;  5CBH A;  2WLH A;  3RVY A;  5IY5 C;  2OCC C;  4PA3 A;  1S5H C;  5EBL C;  4MVS A;  2HVK C;  2X6B A;  5EC1 C;  2DYS C;  4X89 A;  4EKW A;  4MVQ A;  1BL8 A;  2EIK C;  2BOB C;  3ASO C;  2HVJ C;  1V54 C;  4WFH A;  5EBM C;  4LP8 A;  1OCO C;  2DWD C;  3LUT B;  5B1B C;  1LNQ A;  4GX0 A;  2BOC C;  1KKD A;  2DYR C;  1OCC C;  2Y69 C;  4JTD B;  3UKM A;  4XDL A;  2A0L A;  2HJF C;  2HFE C;  3SYC A;  2EIL C;  3SYO A;  3ABL C;  4X8A A;  3T4Z A;  1K4C C;  2K1E A;  2WLL B;  4J9Z B;  4MS2 A;  4R50 A;  3SYA A;  1ORQ C;  3ABM C;  3E8G A;  5CBG A;  3E8H A;  2Q6A A;  3SPJ A;  4GX1 A;  4WFE A;  4DXW A;  4MTF A;  2Q69 A;  4PDR A;  1R3J C; 
#chains in the Genus database with same CATH topology
 3F5W C;  1NU1 H;  4JI5 O;  2F93 B;  3VQY A;  1NTK H;  2DJV A;  3SJB C;  4ZKI A;  1QHT A;  3OTO O;  1MZE A;  1YVW A;  4CBC A;  3U0Z A;  1M5I A;  4CH3 A;  1RP3 B;  4DV0 O;  1IBK O;  1R73 A;  4ZHQ A;  2PGG A;  1PNM A;  4UXN A;  3LNM B;  4NVP A;  4IT5 A;  1SES A;  5JVD A;  3ZMS A;  4O2A B;  3B8N A;  4I50 B;  4I55 B;  3E8F A;  5DN6 G;  4LF7 B;  4LF7 O;  3AK1 A;  3G71 V;  4FVM A;  1M90 W;  1XMQ O;  2YIB A;  4ICG A;  5EIB C;  3K08 A;  1XMO B;  2HJD A;  4RQE A;  1JPX A;  1VP7 A;  1F23 A;  4H0L B;  2XHB A;  5AG2 A;  3L9D A;  5E79 Z;  1GO3 F;  1HR0 B;  1WA8 B;  3C90 A;  1GN2 A;  4NB5 A;  3CRM A;  2VWJ A;  5LA6 B;  4HNA A;  1CPY A;  5LHG A;  1TAE A;  1H2K A;  3E35 A;  1ZL8 A;  3SYQ A;  4JAV A;  2DYS B;  1COW G;  3D36 A;  1JJO A;  2YIB D;  1M4U A;  3DXR A;  1SQQ H;  4U3J A;  4H13 B;  4EKW A;  4N23 A;  2ODM A;  2BOB C;  2NN4 A;  3OFN G;  3UCS C;  5FNV B;  1FXV A;  4JI7 B;  3CP1 A;  1Q6H A;  2QTS A;  1RFY A;  1YSC A;  4DUY B;  3G6B A;  4CC5 A;  4EB6 B;  5EYP B;  4HYO A;  1N4C A;  3PN1 A;  1JCH A;  3JAR A;  1BZK A;  2ZXW C;  3P3N A;  2H3O A;  2VQF O;  2W0F C;  3RW0 A;  1K8A W;  1XNR O;  2OYQ A;  1IBM O;  3FB5 C;  3RFR A;  1IBM B;  4TQD A;  4YJ2 A;  4DYL A;  1NVP B;  3KZI Z;  3CJH B;  5BMV B;  3CHX A;  1XOU A;  1VQO V;  4JV5 B;  1RM1 B;  2BSK B;  4JI3 B;  3AG2 C;  1GKF A;  5IWA O;  1MA1 A;  4FPP A;  5B5E Z;  2IBZ H;  1L8D A;  1K9M W;  4W4K A;  4I9W A;  2IM9 A;  1R3K C;  4AHC A;  2CTR A;  1TVK A;  2AXT Z;  1I94 B;  1H2N A;  3K5M A;  3J80 N;  4PA9 A;  4LF6 B;  1VF7 A;  3CX5 F;  3QO7 A;  1VF6 A;  3S3W A;  1K34 A;  1Q8I A;  4X64 O;  2ZE6 A;  3CSX A;  3CRA A;  3BA8 A;  4QGP A;  3OT7 A;  4LCU C;  1VQM V;  3X2Q B;  3CCS V;  1CXZ B;  5LHI A;  3K5O A;  4X66 B;  3JAW B;  1R3L C;  2XAF A;  4X1K A;  1WLE A;  1TGO A;  4YXW G;  3UT5 B;  2PYL A;  4JI0 B;  3JAS A;  3FYI B;  4I50 A;  1JFF A;  1W2B U;  4NKG B;  3WFV A;  2YXH A;  1ZX3 A;  5L3G A;  2BSK A;  3E2E A;  2X0L A;  4LFB O;  4XDL A;  2HJF C;  1AP6 A;  2EIN B;  5KMG A;  3FAV B;  4YIP A;  3DC5 A;  4MS2 A;  3JSN A;  2VQE O;  4UVB A;  3SPJ A;  4WFE A;  2JEU A;  5IYC O;  1NI8 A;  2CH7 B;  1VMG A;  1L1F A;  4E4E A;  1VQP V;  2ETN A;  2JGD B;  4JI1 B;  2HEP A;  4DRX A;  1M57 C;  3ETD A;  4MVM A;  2IJI A;  3RT3 C;  1XHX A;  1KD1 W;  2B1I A;  2ADP A;  2R72 A;  2VS0 A;  3WB0 A;  1VQ4 V;  1EN6 A;  4QE7 A;  5BZB A;  2ZM6 O;  2CTP A;  2W6I G;  2ZDI A;  1U96 A;  2Q9L A;  2JIZ G;  4JYB A;  2WLJ A;  4DK0 A;  2F4V O;  4R6Z A;  2VRZ A;  4RUE A;  4A5U B;  3JD0 A;  2JJ1 G;  2QGN A;  1BE3 H;  4FFB A;  4B3T B;  2WLN A;  4W4L A;  4B3R B;  4WFG A;  4BIU A;  2ZR3 A;  2Z5U A;  1IXM A;  3JAL A;  2UXB O;  3UQ8 A;  1Y74 A;  2M6Y A;  5F2V O;  2GBO A;  2ZE5 A;  2YID A;  1S77 D;  1BHB A;  4J7Z A;  2YXY A;  2X6C A;  3SJQ C;  5EZY A;  2O57 A;  4JYY A;  4O4H A;  2FYU H;  1OCR C;  2EUL A;  2FB5 A;  2FL4 A;  2UU9 O;  1ZSP A;  5D5Q A;  3HKE A;  4MVS A;  1KYO F;  1Q6U A;  1R6K A;  3CPW U;  1XNQ B;  1HNX B;  4UVC A;  2LQT A;  1X4T A;  2Y0P A;  1JOY A;  1QNM A;  1XBL A;  2HFE C;  3SYC A;  1RSO B;  3TXS A;  4B3T O;  4GT1 A;  5C8Y B;  3SYA A;  4DR2 B;  3W7X A;  3HB3 B;  1YTF D;  3QTC A;  3GWO A;  2K9P A;  1Y76 B;  3L70 H;  2EIM C;  3E8B A;  1JQ0 A;  5TIS Z;  2ZQM A;  4GUN A;  1SZT A;  3K0D A;  3AG7 A;  1PKX A;  5E1A C;  2MK3 A;  3CCR V;  4J41 A;  3ZHQ A;  3ZRW B;  1NT2 B;  1OCR B;  1FYJ A;  4UCR A;  3OGC C;  3P3P A;  2YIA A;  4CS2 A;  3RYI B;  2R70 A;  4LF8 B;  4UB8 Z;  4YHH O;  2YS8 A;  1YJN V;  2LW1 A;  5LOV B;  4G27 B;  4K0K B;  1OJH A;  1YXB A;  1TUB B;  2AW9 A;  2JVD A;  3CE2 A;  2OTL V;  4IIJ B;  4LR3 A;  3B09 A;  4CH6 A;  5LMU B;  3OMA B;  3T1Y B;  3R66 A;  2IJK A;  3A0R A;  3FB8 C;  2WLL A;  4U3F H;  4Z2W A;  2QWP B;  3D3I A;  2WPD G;  4DR4 O;  3H1J H;  2KG7 A;  1EZV H;  4DRX B;  5CB4 A;  1XMQ B;  4O4L B;  3TGU H;  3LDC A;  5LYJ B;  4AQY O;  2JGD A;  3ZMT A;  4QJF B;  4B3M O;  2XUM A;  2F43 G;  2P7T C;  5KMG B;  4X64 B;  3ZRV A;  1VQ8 V;  2PI4 A;  3LUT B;  2B9Z A;  1LNQ A;  3CCU V;  1NR1 A;  2ARH A;  1F4M A;  4DO2 A;  3DGE A;  3HKD B;  1QLE B;  4YJ2 B;  2EIL C;  3RWR D;  5IYD O;  1LUW A;  2LGQ A;  2QSA A;  3JAM N;  3ZHV A;  2XAG A;  2CTQ A;  2P90 A;  1YIT V;  2CAZ C;  5ITZ B;  1YZB A;  2FTK A;  3WG7 C;  2YC0 A;  1XNQ O;  4LBE C;  4H33 A;  1AI6 A;  2JDI G;  1DGS A;  1W59 A;  2H8P C;  1W0J G;  2UU9 B;  4LF4 O;  1LUV A;  2DMX A;  2F95 B;  2HHH O;  1HWY A;  1VQ6 V;  3E83 A;  1N0J A;  5KUM A;  4P30 A;  5HFL A;  5EC2 C;  2QM8 A;  4KFM A;  3CCL V;  4UCV A;  1K3E A;  4JYA B;  1NH2 B;  3B2E E;  1SA0 B;  3H1H H;  3LDE A;  5EIB D;  1Y74 B;  2P5O A;  1IBL B;  4BW9 A;  4JI2 B;  4EFE A;  4LFA B;  4BW5 A;  4P2Z A;  3JAK A;  4JI7 O;  1S5J A;  3OR7 C;  3OUF A;  3ZJZ A;  1Z2G A;  3D3Q A;  1I08 A;  3E86 A;  3G4S V;  4LFC B;  4I0X A;  3WB1 A;  4FM1 A;  2QM4 A;  5IJ9 B;  5JWP A;  3KCY A;  5IE9 A;  2BTO A;  3GB7 C;  4CS4 A;  4NTW A;  1FS0 G;  3AG1 B;  3BFR A;  3T2M A;  3T1H B;  3BEH A;  4DR3 B;  5JQG B;  5LXT B;  1SER A;  3IFX A;  3JAR B;  1AB3 A;  1OCZ C;  2HG5 C;  4RAI A;  3OD4 A;  3DSQ A;  1N8R W;  2NLJ C;  5KA6 A;  5CN0 A;  4EEQ A;  1NTM H;  3SJC C;  1MSW D;  3ZBH A;  1NTZ H;  3BCC H;  2RNB A;  3AK2 A;  3W7U A;  3AG3 B;  5GTI Z;  1B04 A;  4Q20 A;  4YJ3 A;  5LL6 Y;  1KQS U;  4E2L A;  4MT8 A;  4JI3 O;  3OMI B;  4DV1 O;  3SYO A;  2GUZ B;  2OIE A;  3E8H A;  1AR1 B;  1Q3E A;  3CXH F;  5H2F Z;  1R3J C;  1M57 B;  3ETE A;  3QG5 A;  4JF3 A;  3CCJ V;  2KQX A;  3DC6 A;  4GZR B;  4NXN B;  2EZP A;  3JAS B;  3TCU A;  3N27 A;  4J10 A;  3B4S A;  4OGQ B;  4O2A A;  3JD4 A;  3ABK C;  3G80 A;  2A3Q A;  5L3B A;  1WA8 A;  3JCU Z;  4LNU B;  4CH5 A;  5IYZ A;  2UUA B;  1ZWI C;  3CCE V;  1VQL V;  4QPJ A;  1XEQ A;  3LSQ A;  4PA6 A;  4G2K A;  3AG3 C;  2WLK A;  3K06 A;  2IJJ A;  1OV9 A;  4MVR A;  3ABM B;  1Y67 A;  3FB6 C;  1BQZ A;  4CZZ A;  4F6R A;  4U7O A;  2LFS A;  1N34 O;  5B1N A;  1KMI Z;  1L0L H;  2KSD A;  4PDL A;  4I9Q A;  4X66 O;  2WLM A;  1JX9 A;  3ZMU A;  5EK0 A;  2QKC A;  3BAB A;  5DEC A;  5K1X A;  5KX5 A;  5H6Q A;  3T1C A;  4JAU A;  3OE7 G;  4TQF A;  4B3S O;  1WB7 A;  4FMT A;  5JH7 A;  3ICX A;  2Q67 A;  4I5S A;  1IVS A;  4KP4 A;  4JI4 B;  3HKC B;  5LP6 A;  3SYP A;  2YEV B;  4GKK O;  3PJS K;  3BVO A;  3UO3 A;  3VOU A;  3OW2 U;  2E75 B;  5GON A;  3RVY A;  1FPO A;  4UVA A;  1BCC H;  2P4K A;  4JGS A;  3U10 A;  1BL8 A;  4WFH A;  2HVJ C;  5DM6 V;  4RWU A;  4CC6 A;  2CE4 A;  1PD3 A;  2XTA A;  3ZMV A;  3UKM A;  1VIB A;  3ZN1 A;  1BGY H;  1AP5 A;  3RN4 A;  4TUY A;  5FL7 G;  5L3E A;  1VAR A;  1ARO P;  3JAK B;  3ZHR A;  4DV7 O;  4IIJ A;  2EX3 A;  2UXX A;  3AK3 A;  3CRQ A;  1MOF A;  2DQ3 A;  3JAT B;  1MSD A;  3P32 A;  2Q68 A;  1DLB A;  4GCZ A;  4LFB B;  4K3A A;  2ZCE A;  4R7C A;  4WBN A;  5JJE B;  3LDD A;  3K3W A;  4B3R O;  3WU2 Z;  1FJG O;  2AZ0 A;  4YY3 O;  1CEZ A;  3JD1 A;  1VQN V;  3CD6 V;  1Q90 D;  3CEI A;  4YY3 B;  2XAJ A;  2HHH B;  5LMN B;  1GN4 A;  4LFA O;  2CK3 G;  3A0B Z;  2X7R B;  4TV8 B;  3NXS A;  4DR6 B;  1QR9 A;  2E5L O;  5H9C A;  4ZBM A;  3K9A A;  3CCM V;  1YDX A;  2L35 A;  3RVZ A;  4LF6 O;  3A0H Z;  1S3J A;  4TV9 B;  4DR1 O;  4FFK A;  2A79 B;  4LF9 O;  1PV0 A;  5JQG A;  5B1O A;  4UCS A;  4ZI7 B;  2RQ6 A;  3UT5 A;  1DF4 A;  4DK1 A;  1K5Q A;  3P30 A;  1FFX A;  1PL0 A;  2JJ2 G;  4DR5 B;  3ABU A;  2QE7 G;  2UXD B;  1AR5 A;  2HVK C;  2Q73 A;  3MHS C;  4YJ3 B;  2LW7 A;  3ASO C;  4JI0 O;  2XAH A;  3OEE G;  3FKS G;  1V54 B;  1PL4 A;  4FLT A;  1OHH G;  2QWO B;  1P84 F;  1FXH A;  5KHK A;  3ABL C;  1NH2 D;  4NXN O;  3HKD A;  2Q69 A;  4HAM A;  1A32 A;  3MD0 A;  4O4H B;  5KAF Z;  1YF2 A;  1AI7 A;  3K5N A;  2EIJ C;  5GW7 A;  2IH3 C;  4DV1 B;  4D7S A;  3ZCC A;  1GM8 A;  2V7Q G;  1KUQ A;  3JAW A;  4GKJ B;  3K04 A;  2ZE8 A;  2QWN B;  4J80 A;  3M7M X;  4UCU A;  4TUY B;  4PDM A;  5CA1 B;  5KHG A;  3G67 A;  2QR4 A;  4B7K A;  3UM7 A;  3F7V C;  3W7T A;  1E79 G;  4DV5 B;  2ILM A;  4FZ1 A;  2R9R B;  4MVO A;  1Y4M A;  2JEX A;  3QNE A;  2Y48 A;  2WLI A;  5B1A B;  4AIL C;  2YEV A;  4JYC A;  5LHH A;  3L74 H;  1K5S A;  5LXT A;  5LP6 C;  1XL4 A;  1N33 B;  1V55 C;  3RYF B;  3ZMZ A;  1PM9 A;  4XDJ A;  3LNN A;  1U97 A;  4X1I B;  2AHY A;  3AEI A;  3ETG A;  4DR1 B;  2XAQ A;  2F23 A;  3M99 B;  1XL6 A;  3AG4 B;  2E5L B;  3I5D A;  4JPR A;  5CBH A;  5LBQ A;  2WSS G;  1XUQ A;  4IL6 Z;  5DED A;  5EC1 C;  4X9Q A;  4C7U A;  1NQT A;  1VQK V;  2D2C B;  3O65 A;  2DYR C;  4B7E A;  2Y69 C;  2CGO A;  2IW5 A;  4K35 A;  4FJC C;  5IY5 B;  4ZOL A;  4PHZ A;  2Z3Y A;  5FLX N;  1H8E G;  3CCV V;  5KLV H;  1ENV A;  2PI5 A;  4GX1 A;  1FJG B;  4JI8 O;  2EZO A;  2LJ2 A;  4JV5 O;  1J95 A;  3J81 N;  3HKB A;  3JCZ A;  1T5E A;  1V55 B;  2PZS A;  3ZRW A;  3R65 A;  1EN4 A;  4OXS A;  4I55 A;  1ZLZ A;  1SC5 B;  3VQX A;  1IUR A;  2WA4 A;  4X65 B;  4FLY A;  4HZ3 A;  1TVK B;  1G8M A;  4P9P A;  1RPO A;  2DWE C;  2VQE B;  1SKV A;  1Y66 A;  1XMO O;  2DQ0 A;  5FPO A;  1MZF A;  2ITD C;  1QLN A;  3THO A;  2Q7G A;  4TV9 A;  3CXC U;  3H01 A;  1JMK C;  3A8T A;  1UJW B;  2UXN A;  2HP8 A;  2YSU B;  3CRR A;  4R8C A;  4QPK A;  1XI1 A;  2G38 A;  4PEL A;  5CA3 A;  1HW7 A;  1M56 B;  4HNA B;  4DV2 O;  4U3J B;  3HPL C;  4JI5 B;  4NYK A;  1B06 A;  4CH4 A;  2HKO A;  4H37 A;  1H38 A;  1ZL8 B;  1Q5O A;  5KHH A;  1I94 O;  4U7N A;  1NS1 A;  2A9H A;  1YJW V;  2VWK A;  2WLH A;  1EM1 A;  1SQF A;  4OX9 O;  4X20 B;  3RYC B;  2OIG A;  1TUB A;  2EIK C;  4IHJ B;  1V54 C;  5BMV A;  3G6E V;  5CA1 A;  2A06 H;  2Q7E A;  5JH7 B;  2ZIM A;  5IJ9 A;  5KX5 B;  1TUE B;  4ASU G;  2LP7 A;  4NTX A;  5CA0 B;  5BY1 A;  1NR7 A;  1AR4 A;  3CC7 V;  2RCV A;  2P67 A;  1YTF B;  3HR0 A;  1JVM A;  1KKC A;  3B77 A;  3K5L A;  1I5Y A;  2Q8V A;  2WWW A;  3OEH G;  3CJH A;  2N05 A;  1HNW B;  1N34 B;  2Y4T A;  3C3S A;  2N74 A;  4H44 B;  3HKE B;  2GTS A;  3SPG A;  4DR7 B;  3QVN A;  2ITC C;  1XNR B;  5LYJ A;  1JA8 A;  4KHP O;  3QO8 A;  3IC7 A;  5KUK A;  3SGI A;  2YUA A;  1YHQ V;  1KP3 A;  1PNK A;  2W0X A;  4LF8 O;  1WAZ A;  3SPH A;  3L75 H;  3ASN C;  4GKJ O;  4WBN B;  4GKK B;  5EYP A;  4ZHQ B;  2GUZ A;  5IWA B;  4J42 A;  4BR6 A;  4TV8 A;  2IU0 A;  1GRJ A;  2QM7 A;  2HR3 A;  1MAB G;  1J5E B;  3IGA C;  1NKD A;  3RYF A;  1AJQ A;  3I55 V;  1E1Q G;  2JK5 C;  2PUS A;  4X1Y B;  1BSM A;  1VQ5 V;  4Z1V A;  3RBZ A;  1H2L A;  4AQY B;  2UXC O;  1P7B A;  4JI6 B;  5L3D A;  2F1M A;  3VQW A;  3D8C A;  5A2Q N;  4D7T A;  4I7Z B;  3OTF A;  5H5N A;  1UFI A;  4MTX A;  4NXM B;  1SZX A;  1BMF G;  1WP8 A;  3F5T A;  1OCO C;  3CWB H;  1WB8 A;  4FLX A;  1KEC A;  1Q7Y W;  5LA6 A;  2UUC O;  2KKW A;  1SET A;  1KC8 W;  4LH7 A;  4X1K B;  1QVG U;  3U11 A;  3N2G A;  2JS3 A;  3RYI A;  2B5U A;  5IYB O;  4DXW A;  4MTF A;  4PDR A;  5KHJ A;  2E74 B;  1B6Q A;  1P4R A;  1OCZ B;  2LGW A;  2PY5 A;  3CC2 V;  1AI4 A;  1SQP H;  3ZED A;  4O4L A;  3BAA A;  2ZDI C;  1F4N A;  2KG7 B;  4PA7 A;  1ZUQ A;  2N04 A;  3CC4 V;  4DR6 O;  3NR7 A;  1CP9 A;  3C3T A;  1MG1 A;  1SQG A;  1HP8 A;  1XIL A;  5JCO C;  5CA0 A;  1SQX H;  1PPJ H;  1HR0 O;  4UCO A;  4L8J A;  3ZN0 A;  2F4V B;  3K03 A;  4UFZ A;  4K8X A;  4DV6 B;  4X20 A;  4I0X B;  2ZXW B;  3ZIA G;  2CH7 A;  3CMA V;  3K79 A;  2AGA A;  4LWS B;  4B3M B;  4JZ2 A;  2E76 B;  3HKC A;  5LP6 B;  2ADQ B;  3CME V;  1FXK B;  5J9P C;  4JYA O;  5IDJ A;  3IJ4 A;  1ZTE A;  1N36 O;  1QU7 A;  1NBM G;  4LFC O;  5J2U A;  4UCT A;  3JAL B;  4JI1 O;  2FKX A;  2DW4 A;  1K4D C;  1N36 B;  1KB9 F;  5J2T B;  1S72 V;  4DUZ B;  2GV9 A;  1Q82 W;  3CYO A;  3KCX A;  1S5H C;  2X6B A;  2GTA A;  4FIP C;  5LMU O;  1AJP A;  3EXA A;  4DW0 A;  4X89 A;  1F51 A;  1N0N A;  2DYR B;  3M8A A;  5HFM A;  3SR2 C;  1GK9 A;  1L0N H;  2JGU A;  2Z0A A;  2JRI A;  2B1G A;  2P4V A;  2C2A A;  4DV6 O;  4X8A A;  3T4Z A;  1GMG A;  1N32 B;  4O4I A;  5CBG A;  4FLZ A;  2DOS A;  2Q6A A;  2ZIO A;  1M1K W;  3MHH C;  1M93 A;  4F4L A;  5L3C A;  1R1B A;  3OM3 B;  5B66 Z;  3EHB B;  3EVK A;  1OZ0 A;  4JI6 O;  1JJ2 U;  5D5P A;  1FFT B;  1S0V A;  2NNU A;  4LC1 A;  4TOI A;  2Q0O C;  4PD4 F;  1XDC A;  1WP7 A;  3T4D A;  4JI8 B;  3N2K A;  3ZX6 A;  1NJI W;  4KXR A;  3ML0 A;  4FLW A;  1Q81 W;  4FM2 A;  4UV9 A;  1DF5 A;  3K57 A;  1NVP D;  4O2B B;  2QKS A;  4ZIB A;  3ASO B;  3J7A U;  1IX9 A;  2OT5 A;  1BT8 A;  2OCC B;  5IT9 N;  3ABT A;  4J9Y B;  1E1R G;  4JZG A;  3ABL B;  3H1I H;  5A9G A;  4L87 A;  1XRE A;  4CS3 A;  3H1L H;  3ASN B;  1O9G A;  1EFR G;  4P9O A;  4DV4 B;  5GTH Z;  3AG1 C;  3FAV A;  3VBB A;  1XHZ A;  2PF4 E;  4DR7 O;  4WFF A;  5EBW C;  2DE0 X;  2XND G;  1HNW O;  4EFB A;  1W0K G;  1VF6 C;  1FAF A;  2CDY A;  1G6U A;  4JTA B;  2IU3 A;  1GTO A;  1WPB A;  1SQB H;  3STL C;  5K1P A;  1YEW A;  1Z5V A;  1YCI A;  4JI4 O;  4DV4 O;  1H2M A;  1IXB A;  1Q86 W;  3H9V A;  1O9H A;  5IYZ B;  4J11 A;  2UUB O;  1AI5 A;  1FKA O;  2EIL B;  5FPR A;  5H6R A;  2UXD O;  2NR5 A;  2OCC C;  1HNZ O;  1BHA A;  4KUM A;  1OCO B;  5EBM C;  4LP8 A;  4GYC B;  4WF9 V;  2R9I A;  5B1B C;  4N21 A;  4GLX A;  1KKD A;  1QCE A;  4OX9 B;  1D2D A;  4I4T B;  2BCC H;  3AG2 B;  3E8G A;  1DTO A;  2F66 C;  2X6A A;  5C93 A;  3RGB A;  4PDV A;  2Y0I A;  3K58 A;  4J7K A;  1VF5 B;  3L72 H;  2PYJ A;  1GH6 A;  3W7S A;  4NTY A;  2RDC A;  4MW8 A;  5KA5 A;  1SA0 A;  1KP2 A;  1ROP A;  5ITZ A;  1QR8 A;  1N32 O;  4I4T A;  2V4D A;  4DV7 B;  1YI2 V;  4LF9 B;  3KKY A;  3X2Q C;  4RQF A;  3RYH B;  3D36 C;  1QVF U;  2UUB B;  3IC9 A;  2OTJ V;  1H2G A;  3CB2 A;  4IHJ A;  2A7W A;  1R6N A;  2E3C A;  3E22 B;  2IJH A;  3B40 A;  4LF5 O;  1QBZ A;  2ZKO A;  5BR8 O;  1K33 A;  2ZNJ A;  5JJN B;  2EIJ B;  3LSU A;  4WFA V;  3VQV A;  1GN6 A;  3KG2 A;  1FD9 A;  4DW1 A;  4YIO A;  1FXK C;  4KL1 A;  2EIN C;  4AI8 A;  4Z1M G;  1JR9 A;  2QTO A;  1SF9 A;  2ZIN A;  3BY6 A;  1G1X B;  3CS5 A;  1WPX A;  2Q7H A;  3K59 A;  2IH1 C;  2QWQ B;  3RYH A;  2QWR B;  1P7G A;  4MVZ A;  1H2S B;  2AHZ A;  5IJ0 B;  2CTW A;  3TET A;  2XAS A;  3OAA G;  4JAA A;  2ZR2 A;  3T1H O;  4JTC B;  1R6T A;  1US6 A;  4UV8 A;  2ZT9 B;  2PTM A;  4PA3 A;  2Q5Z A;  5LGN A;  1VQ7 V;  5JJJ B;  2FML A;  3JSL A;  1Z5W A;  3FX7 A;  2DWD C;  1NZ6 A;  4GX0 A;  2BOC C;  1K92 A;  1S76 D;  1OCC C;  4LF5 B;  5KAI Z;  1B3Q A;  2K1E A;  1ORQ C;  5EZY B;  5LGU A;  3WB2 A;  2QA4 V;  5C8Y A;  4O4J B;  2HLD G;  2OCH A;  4ZI7 A;  2ATK C;  4XDK A;  1WN7 A;  1QQC A;  3EFF K;  1D5A A;  3AG4 C;  4RUF A;  1Q43 A;  4PI2 A;  2AZ2 A;  1RPR A;  1DK1 A;  1GM9 A;  4DV0 B;  1IBK B;  5L3F A;  3T1Y O;  1YIJ V;  3SDL A;  2QEX V;  2EIK B;  4X88 A;  2OWO A;  4NR1 A;  1LR1 A;  1R3I C;  4BAY A;  2LFR A;  1H8H G;  4TT3 G;  4QIW F;  4NXM O;  3A2F A;  4EB6 A;  3IAY A;  4B08 A;  1EZJ A;  1SS3 A;  4KHP B;  1XQ8 A;  4J7J A;  4B3S B;  4HBN A;  5FNV A;  1PNL A;  4LH6 A;  1FXK A;  3F7Y C;  3TJT A;  4GX2 A;  4DV3 B;  5CMU A;  2EIM B;  3Q4H B;  3HKB B;  4UB6 Z;  3DXR B;  1WJZ A;  4RO2 A;  1MMM A;  1ZAU A;  1GAX A;  3ZHS A;  2Q4P A;  3OGI B;  2BE3 A;  2XT9 A;  1I7F A;  4K8Z A;  2DYS C;  4IYI A;  1F7Y A;  4JI2 O;  5B1B B;  2GHY A;  3ZS8 C;  4F6E A;  2ZM6 B;  4DUZ O;  2A0L A;  2W6J G;  4PJ0 Z;  4WCE V;  1HNX O;  4DR3 O;  5B3S B;  5GON B;  3CCQ V;  4J9Z B;  2UUA O;  3K9S A;  4X62 O;  1AVM A;  2YDE A;  2DN9 A;  3Q4H A;  3E22 A;  4IGG A;  1TA8 A;  3FYE B;  4X1I A;  4WFB V;  4LF4 B;  1IDS A;  1GM7 A;  3SPC A;  3L73 H;  1THZ A;  4O2B A;  2RMK B;  2EJ7 A;  1K73 W;  4ZOL B;  2R9A A;  2P06 A;  5IJ0 A;  4DV2 B;  2WLI B;  5LMN O;  1RSO A;  2H94 A;  2ZE7 A;  4QNH B;  5LOV A;  3QO5 A;  2YI9 A;  2L6L A;  4TWK A;  1YJ9 V;  5B3S C;  1VEW A;  4G28 B;  4MW3 A;  3RYC A;  1HNZ B;  3ETQ A;  3E89 A;  4OPH A;  4PV1 B;  1I0H A;  3N2G B;  3ABK B;  2V1D A;  2EJR A;  3K0G A;  3N2K B;  1G4Y B;  1QLE C;  3APQ A;  3W7W A;  1IZ3 A;  2Y69 B;  1Q6I A;  1KU9 A;  2M7W A;  4FK5 C;  4QE9 A;  1GN3 A;  4Q6G A;  2P22 C;  3BRC A;  2WAM A;  2Q0A A;  4F6R B;  3I56 V;  4IYH A;  4GX5 A;  1K7D A;  2LO1 A;  1WNS A;  3WG7 B;  1Y76 A;  4MTO A;  4O4J A;  4DR4 B;  1FFX B;  2QKA A;  3OR6 C;  3OTO B;  3SPI A;  2UUC B;  3MDS A;  1IBL O;  2YI8 A;  4MVQ A;  3BA9 A;  2UXB B;  1MNG A;  2QDO A;  3L71 H;  1BQ0 A;  2YXL A;  4OPA A;  4JTD B;  1SQV H;  4YHH B;  1D5N A;  2WLL B;  1N33 O;  3ZHT A;  4X65 O;  4BWA A;  4BIZ A;  4XBF A;  3B8M A;  4DV3 O;  5CBF A;  1HDJ A;  2GDS A;  2UXC B;  2BTQ B;  3JD2 A;  5BXZ A;  4PI0 A;  3ZRS A;  2MW2 B;  4D6T H;  3OMN B;  2EBO A;  1J5E O;  1EBO A;  2ZD9 A;  3DTU B;  4FLV A;  2QJ1 A;  1K97 A;  4LNU A;  2WA3 A;  1P49 A;  4FM0 A;  5CB4 B;  5JCO A;  2Y4U A;  3JAT A;  5B1A C;  3TK1 A;  3LSS A;  1RM1 C;  1KBH A;  1V9P A;  4ABM A;  2KB1 A;  3TXQ A;  4X62 B;  1M9N A;  4FLU A;  3APO A;  4MTG A;  5LGT A;  5KHI A;  4DV5 O;  1X59 A;  3JYC A;  2BTQ A;  3FD9 A;  3STZ C;  1UPG A;  4DR5 O;  2P6J A;  3FB7 C;  1M56 C;  4TSF G;  2CGN A;  2CUG A;  1BS3 A;  5J2U B;  4K0K O;  3JD3 A;  1PP9 H;  4O4I B;  3O9O A;  4UUJ C;  3ZRX A;  2VQF B;  4MSW C;  3QF7 A;  4X1Y A;  1I5X A;  2GSM B;  3UO2 A;  1S5L Z;  5BR8 B;  4MVU A;  3FFQ A;  3BHP A;  3H1K H;  4LWS A;  4BIO A;  3GVM A;  1VQ9 V;  3ZHU A;  5J2T A;  4DUY O;  1EN5 A;  2XOK G;  3OUS A;  3SJA C;  4JAS A;  1AIL A;  4FFB B;  4PA4 A;  5IY5 C;  5EBL C;  3MAQ A;  2D3O W;  1OCC B;  4FZ0 A;  2YIC A;  3S3X A;  3BPZ A;  1JFF B;  1SRY A;  3GWK C;  2RN9 A;  3CRC A;  4DR2 O;  5JVD B;  2JS5 A;  2ZNI A;  1K4C C;  1AJN A;  4R50 A;  2RJZ A;  3ABM C;  1URF A;  1Y6X A; 
#chains in the Genus database with same CATH homology
 2EZO A;  3F5W C;  2FTK A;  3WG7 C;  1J95 A;  2X6A A;  5C93 A;  4PDV A;  3JCZ A;  4LBE C;  4H33 A;  1AI6 A;  1V55 B;  4ZKI A;  2JDI G;  3ZRW A;  3R65 A;  2H8P C;  1W0J G;  3W7S A;  4CBC A;  4MW8 A;  5KA5 A;  4OXS A;  1KP2 A;  1ROP A;  1HWY A;  1VQ6 V;  1QR8 A;  3E83 A;  1R73 A;  5KUM A;  4HZ3 A;  4P30 A;  1G8M A;  1PNM A;  4P9P A;  5HFL A;  5EC2 C;  1YI2 V;  4UXN A;  2QM8 A;  3LNM B;  4KFM A;  1RPO A;  2DWE C;  3CCL V;  1K3E A;  1SES A;  3X2Q C;  4RQF A;  1NH2 B;  3ZMS A;  1QVF U;  3B8N A;  1Y66 A;  2DQ0 A;  3E8F A;  5DN6 G;  3LDE A;  2ITD C;  1QLN A;  2OTJ V;  1H2G A;  1R6N A;  3G71 V;  3CXC U;  1M90 W;  2IJH A;  3H01 A;  3K08 A;  4BW5 A;  1QBZ A;  4P2Z A;  4RQE A;  1K33 A;  1JPX A;  3OR7 C;  1F23 A;  3OUF A;  3ZJZ A;  2EIJ B;  4WFA V;  1UJW B;  2UXN A;  3E86 A;  3G4S V;  3KG2 A;  2YSU B;  4R8C A;  1FXK C;  1GO3 F;  4QPK A;  2EIN C;  4Z1M G;  4PEL A;  5CA3 A;  3GB7 C;  3BY6 A;  2QTO A;  1FS0 G;  1M56 B;  3AG1 B;  3T2M A;  1WPX A;  3BEH A;  3HPL C;  1CPY A;  5LHG A;  1SER A;  2IH1 C;  3IFX A;  1OCZ C;  2HKO A;  2HG5 C;  4MVZ A;  4RAI A;  1N8R W;  2AHZ A;  2NLJ C;  3E35 A;  5KA6 A;  3TET A;  5CN0 A;  2XAS A;  4H37 A;  3OAA G;  1H38 A;  3SYQ A;  2ZR2 A;  4JAV A;  4JTC B;  2DYS B;  1MSW D;  1COW G;  4U7N A;  2A9H A;  3D36 A;  4UV8 A;  1YJW V;  2WLH A;  3W7U A;  4PA3 A;  5LGN A;  3AG3 B;  1VQ7 V;  4EKW A;  2EIK C;  4N23 A;  2BOB C;  1V54 C;  3OFN G;  4Q20 A;  1KQS U;  1FXV A;  3G6E V;  2DWD C;  4E2L A;  4GX0 A;  2BOC C;  4MT8 A;  1K92 A;  1S76 D;  1OCC C;  3OMI B;  1TUE B;  4ASU G;  3SYO A;  3CP1 A;  2LP7 A;  2K1E A;  1YSC A;  1ORQ C;  1NR7 A;  3E8H A;  1AR1 B;  1R3J C;  3CC7 V;  1M57 B;  2P67 A;  3ETE A;  5LGU A;  2QA4 V;  4HYO A;  1YTF B;  4JF3 A;  3CCJ V;  2HLD G;  1JCH A;  1JVM A;  2EZP A;  2ATK C;  3B77 A;  4XDK A;  3TCU A;  1I5Y A;  3EFF K;  2ZXW C;  3AG4 C;  2WWW A;  4RUF A;  3OEH G;  3JD4 A;  1RPR A;  1GM9 A;  3ABK C;  5L3B A;  5L3F A;  2W0F C;  1ZWI C;  3CCE V;  1YIJ V;  1VQL V;  4QPJ A;  3RW0 A;  3SPG A;  2QEX V;  2EIK B;  1K8A W;  4X88 A;  3LSQ A;  4PA6 A;  4G2K A;  3AG3 C;  3FB5 C;  2ITC C;  2WLK A;  3K06 A;  1NVP B;  1R3I C;  2IJJ A;  4BAY A;  2LFR A;  1H8H G;  1VQO V;  4TT3 G;  3QO8 A;  3IC7 A;  4MVR A;  5KUK A;  1RM1 B;  1YHQ V;  1KP3 A;  3ABM B;  3FB6 C;  3AG2 C;  4QIW F;  1GKF A;  1PNK A;  4CZZ A;  4U7O A;  3SPH A;  2LFS A;  4FPP A;  5B1N A;  1K9M W;  3ASN C;  4I9W A;  4PDL A;  1R3K C;  2WLM A;  1JX9 A;  3ZMU A;  5EK0 A;  4PA9 A;  3QO7 A;  2IU0 A;  1EZJ A;  5H6Q A;  1K34 A;  2QM7 A;  2HR3 A;  3T1C A;  4JAU A;  3OE7 G;  1MAB G;  3IGA C;  1NKD A;  1PNL A;  1AJQ A;  3I55 V;  1E1Q G;  4FMT A;  2JK5 C;  1FXK A;  3F7Y C;  2Q67 A;  4GX2 A;  4I5S A;  4LCU C;  5CMU A;  4KP4 A;  1VQM V;  3X2Q B;  1VQ5 V;  2EIM B;  3RBZ A;  3CCS V;  5LHI A;  3SYP A;  1P7B A;  2YEV B;  3PJS K;  5L3D A;  4RO2 A;  3OW2 U;  3VOU A;  1R3L C;  2XAF A;  3RVY A;  1WLE A;  4UVA A;  4MTX A;  4YXW G;  2DYS C;  4JGS A;  1BL8 A;  1BMF G;  2HVJ C;  4WFH A;  5DM6 V;  2GHY A;  3FYI B;  5B1B B;  1OCO C;  1W2B U;  3WFV A;  1KEC A;  1Q7Y W;  5L3G A;  1PD3 A;  3E2E A;  3ZMV A;  2X0L A;  3UKM A;  3ZN1 A;  4XDL A;  2A0L A;  2HJF C;  2W6J G;  1SET A;  4WCE V;  1KC8 W;  2EIN B;  5B3S B;  1QVG U;  4J9Z B;  5FL7 G;  4MS2 A;  5L3E A;  4UVB A;  5IYB O;  2B5U A;  1ARO P;  3SPJ A;  4DXW A;  4WFE A;  2JEU A;  4MTF A;  5IYC O;  4PDR A;  1B6Q A;  1P4R A;  1L1F A;  2UXX A;  1OCZ B;  1VQP V;  1MOF A;  2DQ3 A;  3CC2 V;  1AI4 A;  1M57 C;  3ETD A;  3FYE B;  4MVM A;  3P32 A;  2IJI A;  1KD1 W;  4WFB V;  2Q68 A;  2ZDI C;  1GM7 A;  1DLB A;  1F4N A;  2B1I A;  4GCZ A;  3SPC A;  1THZ A;  4PA7 A;  1VQ4 V;  4QE7 A;  3CC4 V;  5BZB A;  4R7C A;  1K73 W;  1CP9 A;  3LDD A;  3K3W A;  2W6I G;  2ZDI A;  2WLI B;  1MG1 A;  2H94 A;  1CEZ A;  3JD1 A;  1VQN V;  4QNH B;  2JIZ G;  4JYB A;  2WLJ A;  3CD6 V;  4R6Z A;  4RUE A;  3ZN0 A;  3JD0 A;  2JJ1 G;  2XAJ A;  3QO5 A;  4TWK A;  1YJ9 V;  5B3S C;  2WLN A;  3K03 A;  4G28 B;  4MW3 A;  2CK3 G;  3ZIA G;  2ZXW B;  4WFG A;  2X7R B;  3CMA V;  3NXS A;  3K79 A;  3E89 A;  4BIU A;  1QR9 A;  2ZR3 A;  5H9C A;  2Z5U A;  3ABK B;  2V1D A;  4ZBM A;  3K9A A;  1IXM A;  3CME V;  2EJR A;  3CCM V;  3K0G A;  3RVZ A;  1G4Y B;  1QLE C;  3W7W A;  1FXK B;  1S3J A;  5J9P C;  2Y69 B;  2A79 B;  2M7W A;  4FK5 C;  4QE9 A;  5IDJ A;  1S77 D;  2WAM A;  5B1O A;  1BHB A;  3I56 V;  2X6C A;  4GX5 A;  1K7D A;  3SJQ C;  1NBM G;  1DF4 A;  3WG7 B;  4MTO A;  1OCR C;  1K5Q A;  3P30 A;  2DW4 A;  1K4D C;  3OR6 C;  1S72 V;  1PL0 A;  2JJ2 G;  3SPI A;  1Q82 W;  3CYO A;  3ABU A;  2QE7 G;  1S5H C;  4MVS A;  2HVK C;  2X6B A;  4FIP C;  3CPW U;  1AJP A;  1R6K A;  1F51 A;  2DYR B;  3MHS C;  4MVQ A;  4UVC A;  4X89 A;  5HFM A;  3ASO C;  2XAH A;  1GK9 A;  3OEE G;  3FKS G;  1V54 B;  1OHH G;  1JOY A;  2B1G A;  2C2A A;  4JTD B;  2HFE C;  3SYC A;  1FXH A;  3ABL C;  4X8A A;  3T4Z A;  2WLL B;  1GMG A;  4GT1 A;  3SYA A;  3W7X A;  3HB3 B;  5CBG A;  4BIZ A;  1NH2 D;  1YTF D;  2Q6A A;  1M1K W;  4XBF A;  4HAM A;  2Q69 A;  3GWO A;  3MHH C;  4F4L A;  3B8M A;  5L3C A;  3OM3 B;  3EHB B;  3MD0 A;  5CBF A;  2EIM C;  1OZ0 A;  1JQ0 A;  3E8B A;  1JJ2 U;  1AI7 A;  1FFT B;  3JD2 A;  2NNU A;  1S0V A;  2ZQM A;  2EIJ C;  1SZT A;  3K0D A;  4LC1 A;  5E1A C;  1PKX A;  5GW7 A;  2MK3 A;  3CCR V;  2IH3 C;  3ZRW B;  3ZRS A;  3T4D A;  3ZCC A;  1OCR B;  3OMN B;  1NJI W;  2EBO A;  1GM8 A;  2V7Q G;  3OGC C;  1EBO A;  2ZD9 A;  3ML0 A;  3DTU B;  1Q81 W;  3K04 A;  4UV9 A;  1DF5 A;  1NVP D;  2QKS A;  1K97 A;  3ASO B;  2OT5 A;  2OCC B;  4PDM A;  1YJN V;  3ABT A;  5B1A C;  3TK1 A;  4G27 B;  3LSS A;  4J9Y B;  1RM1 C;  1E1R G;  2KB1 A;  3ABL B;  1M9N A;  2OTL V;  4MTG A;  5LGT A;  4L87 A;  3UM7 A;  3F7V C;  3ASN B;  3JYC A;  3STZ C;  3W7T A;  1E79 G;  1EFR G;  3OMA B;  2IJK A;  4P9O A;  3A0R A;  2P6J A;  2R9R B;  3FB7 C;  4MVO A;  1M56 C;  1Y4M A;  2JEX A;  2Y48 A;  3AG1 C;  3FB8 C;  3QNE A;  2WLL A;  4TSF G;  4WFF A;  5EBW C;  2WLI A;  3VBB A;  3JD3 A;  5B1A B;  2XND G;  2YEV A;  3D3I A;  4JYC A;  4UUJ C;  5LHH A;  3ZRX A;  2WPD G;  1K5S A;  1W0K G;  4MSW C;  1I5X A;  2GSM B;  4JTA B;  2IU3 A;  1XL4 A;  1GTO A;  1V55 C;  4MVU A;  3ZMZ A;  4XDJ A;  3STL C;  3LDC A;  2AHY A;  3AEI A;  3ETG A;  2XAQ A;  1VQ9 V;  3ZMT A;  1Q86 W;  3M99 B;  1XL6 A;  3AG4 B;  2XOK G;  4QJF B;  3OUS A;  1AI5 A;  4JAS A;  2F43 G;  2P7T C;  4JPR A;  5CBH A;  2EIL B;  4PA4 A;  5H6R A;  5LBQ A;  2WSS G;  2OCC C;  5IY5 C;  5EBL C;  5EC1 C;  1BHA A;  2D3O W;  4KUM A;  1OCC B;  3ZRV A;  1OCO B;  1NQT A;  1VQK V;  5EBM C;  4LP8 A;  1VQ8 V;  4WF9 V;  2PI4 A;  2R9I A;  3LUT B;  4N21 A;  1LNQ A;  5B1B C;  1SRY A;  1KKD A;  3CCU V;  2DYR C;  1NR1 A;  2Y69 C;  1QCE A;  1F4M A;  4DO2 A;  3DGE A;  1QLE B;  2EIL C;  2IW5 A;  4FJC C;  5IY5 B;  5IYD O;  1K4C C;  1AJN A;  2Z3Y A;  4R50 A;  2XAG A;  3ABM C;  1H8E G;  3AG2 B;  3E8G A;  1ENV A;  2P90 A;  3CCV V;  1DTO A;  4GX1 A;  1YIT V;  2PI5 A;  3CCQ V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...