4J9YB

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
89
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/calcium binding
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 35
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2013-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4j9yB00
3AG1C 3RW0A 2P7TC 4XDLA 3RBZA 4OXSA 1XL6A 2ITCC 4XDKA 2ZXWC 2IH1C 5EC2C 5EBWC 2WLJA 2ITDC 4J9ZB 2Q68A 4MW8A 4PDRA 3UKMA 4MTGA 2BOCC 4MVSA 3TETA 3SPHA 4WFFA 3BEHA 3ABLC 3F7YC 4QE9A 3SPIA 4P2ZA 4P30A 1G4YB 1R3IC 4MW3A 4H37A 5EBMC 5KUKA 3OR6C 2EINC 2DYRC 2ATKC 3X2QC 2NLJC 3SJQC 3F7VC 2H8PC 4HZ3A 5J9PC 4MVRA 4PA4A 4MS2A 3E89A 4WFGA 4X8AA 2W0FC 2WLIB 2EILC 2WLNA 3K0GA 3RVZA 3WG7C 3ASOC 2Q6AA 4RO2A 1BL8A 4LCUC 2X6AA 5B3SC 4HYOA 2EIKC 4TWKA 3E8GA 3HPLC 4I9WA 4MVOA 4RUEA 2IH3C 3KG2A 5EBLC 2JK5C 5B1AC 3E8FA 2A9HA 1OCOC 2QTOA 2AHZA 3SPCA 4R8CA 1ZWIC 3TCUA 1J95A 4MSWC 4PDVA 1OCZC 4PA6A 5CBFA 1JVMA 2KB1A 4GX2A 4GX0A 3E8BA 4JTCB 2A79B 4R7CA 4BW5A 2WLLA 3OR7C 3AG3C 2AHYA 3LUTB 4P9OA 3VOUA 1ORQC 4EKWA 3RVYA 4PDLA 2X6CA 3SYCA 4GX1A 3ZJZA 4RUFA 1K4DC 4ZBMA 4MVZA 2A0LA 3E8HA 3SYPA 3FB8C 4UUJC 3K04A 2WLMA 3T4DA 4QE7A 3SYQA 4RAIA 4P9PA 3K06A 3STZC 4J9YB 4PA9A 4PDMA 3STLC 4X89A 3IFXA 2YEVA 2DYSC 3LDEA 3T1CA 1M56C 2HVJC 2WLIA 4R50A 2QKSA 3K08A 4MVMA 3EFFK 3FB6C 3FB7C 3AG2C 4WFHA 2BOBC 4MTFA 2DWEC 3E83A 2R9RB 4LBEC 5KUMA 5CBHA 3JYCA 3SYOA 3OGCC 1K4CC 2Q67A 5CBGA 1XL4A 3UM7A 3OUSA 4DXWA 3LDDA 3ABMC 1P7BA 4WFEA 4MVQA 3SYAA 2DWDC 2ZD9A 1R3KC 2WLKA 3ASNC 4GX5A 3ZRSA 4LP8A 1R3LC 4F4LA 4JTAB 4MVUA 1OCRC 2WLHA 4CBCA 2HJFC 4MTOA 4R6ZA 1OCCC 4X88A 1KKDA 3T4ZA 3T2MA 4H33A 2Y69C 3LNMB 4PA7A 5BZBA 3SPJA 1V54C 2HVKC 3IGAC 5EK0A 2EIMC 3R65A 4G28B 3E86A 3PJSK 3GB7C 4PA3A 2K1EA 3ABKC 2WLLB 2OCCC 1M57C 1R3JC 1V55C 4KFMA 4XDJA 5EC1C 3FB5C 3SPGA 3K0DA 2X6BA 5E1AC 1S5HC 3AG4C 4G27B 1LNQA 2HFEC 3LDCA 3OUFA 3F5WC 1QLEC 4JTDB 5B1BC 4QNHB 3K03A 2EIJC 5IY5C 2HG5C 2Q69A
chains in the Genus database with same CATH superfamily
1OCZB 3CCRV 4CS2A 3OAAG 2ZE8A 4B3SO 2ZR2A 1QNMA 2XNDG 1V9PA 5B1AB 1Q86W 5LGNA 3SJQC 2F93B 3G80A 3L9DA 4JYBA 4X9QA 1KYOF 1XMQB 4B3TB 4LF5O 3QO7A 4J11A 3BHPA 3BY6A 3A0BZ 3KG2A 1Y74A 4LWSB 1P4RA 4UVAA 4BIZA 4D6TH 4AQYB 1GMGA 3ABLB 5LMNO 3W7SA 1YJWV 3RYIB 1HNZO 1WNSA 2CTQA 1EZJA 3ZHUA 2YEVB 3ZBHA 2D3OW 4FLXA 3CCEV 3AG3C 2PI5A 1GN6A 4UCVA 1VQ4V 4EFEA 1V55B 1Q6IA 3BAAA 5GTHZ 2ETNA 5B1BB 2Y48A 1S0VA 3ZHSA 2OTLV 3AEIA 1PL0A 2RDCA 3CE2A 3FFQA 2WLIA 2QKSA 3RT3C 4LF6O 2ZDIA 4FLUA 1H2MA 3A2FA 5L3CA 2DWDC 1BZKA 4MTXA 1S5LZ 2XTAA 3TXSA 2F66C 5L3GA 1YJNV 3D36A 2WLHA 1K5QA 1CPYA 1F4NA 5BXZA 2Q7GA 5IYBO 3GWKC 4K3AA 3RYFA 2HVKC 4YJ3A 2WWWA 1VP7A 3QNEA 4X20B 2Q73A 4KFMA 4B3MB 3LSUA 1M57B 3T1HO 3J81N 4DK0A 1N32O 2Z3YA 3LUTB 2EIJC 5JH7A 1B6QA 2MW2B 1AJQA 2PYLA 4KHPO 3OEEG 1FXKC 1Q6HA 3G6EV 4I0XA 1G4YB 4W4LA 1Y66A 4J42A 1CXZB 5J9PC 1VQKV 1EZVH 4DR6B 2QTSA 3WG7C 4RO2A 5B1OA 2YXLA 1MSDA 2JJ1G 4JI7O 4GKKO 1Z2GA 4JI6O 3JAWB 5EBLC 5KAFZ 1JJOA 1JCHA 4R8CA 1HNZB 3CCQV 3CCUV 1URFA 3G67A 1IBKO 2UXDB 1N33B 4ASUG 3OMIB 3T1HB 3OR7C 4P9OA 1YTFB 5LMNB 4YXWG 4WCEV 1ORQC 2QGNA 4DRXA 3ZRVA 2ADPA 3ZJZA 4WFAV 4LNUA 3FB8C 4UUJC 3STZC 1DF5A 1W2BU 1SZTA 1DTOA 5FLXN 1FJGB 1M56C 2IU0A 2EILB 4LFAO 2Q8VA 1IXMA 3C3SA 3FX7A 4MTFA 1AI7A 2CE4A 5LA6B 4DV0O 3CP1A 4X64O 1VMGA 5CBGA 3ZIAG 3U10A 1WAZA 4DXWA 3JD3A 2JS3A 4FFBB 3CD6V 3N2GB 4UFZA 5L3FA 2B5UA 3E35A 1BMFG 1R3JC 4IIJB 4BWAA 5E1AC 1S5HC 3CJHA 5H6RA 3JASA 1XBLA 4DUZB 1BGYH 1P84F 3K03A 1I94O 2V1DA 1ZLZA 2WPDG 2YIDA 2ZT9B 2QJ1A 3OTOB 3CPWU 1HR0O 1MA1A 4JF3A 2JVDA 4JI2O 1NR7A 1BE3H 1R3IC 4EEQA 1KP2A 4H37A 4WBNA 4YJ3B 1O9GA 5H2FZ 1PD3A 4CS3A 4DV6O 1EFRG 1H2GA 3F7VC 4MVRA 1AR4A 1XI1A 2M7WA 2XAJA 2GDSA 1VF5B 3J7AU 5JCOA 1PV0A 4KXRA 1S76D 2G38A 3ETEA 5LBQA 2GSMB 1GH6A 2Q7EA 4JI6B 2QKCA 1TUBB 2QWRB 5LHIA 2L6LA 4FLVA 3JD0A 4DR1O 4X66O 1F7YA 4B08A 4KHPB 3ZS8C 1FFTB 2LFRA 3SYCA 4RUFA 5IE9A 2PZSA 3UT5B 5IJ0B 1QBZA 4TQFA 5LHHA 3L73H 1DF4A 4R50A 3K08A 3RWRD 3EFFK 4DV3B 3U11A 2Y0IA 1WA8B 3ETQA 3DTUB 1IBMB 4JI5O 4IHJB 4NXMB 2ZIOA 1Q7YW 3JD1A 1R3KC 1GRJA 1NTZH 1ZL8A 2LGQA 3E2EA 4CBCA 1GAXA 1WA8A 3KCXA 3LNMB 1VQPV 4G28B 2XOKG 4PD4F 2VQFB 5EZYA 5FPOA 1AP6A 4QIWF 3VQYA 5CA1A 3OE7G 3SPGA 4ICGA 3CSXA 4JAVA 4DV7B 2UXBO 3ETDA 1R1BA 5J2TA 4O4JB 1KP3A 4FJCC 4OXSA 3MD0A 4D7TA 1T5EA 2CH7B 2ITDC 2YXHA 2CGOA 2Q9LA 1UFIA 4JAAA 5B5EZ 2B9ZA 5EBMC 1N0JA 1WPBA 1N34B 1AI4A 1US6A 2Q0AA 2Z0AA 4Z1VA 5KHGA 4DV0B 4ZOLB 1IBLO 4DR2B 1OCOB 2H8PC 4FPPA 3RFRA 2AZ2A 2WLIB 3K0GA 1Q6UA 3IC9A 1BL8A 4DV5B 1XMOB 4UCSA 2X6AA 3VBBA 1AR5A 2WSSG 2ZE6A 4G2KA 4MVOA 1KU9A 2LP7A 2IH3C 5LA6A 4OX9O 1MOFA 3BPZA 1ZWIC 4OX9B 1RFYA 2AGAA 3C90A 4LF8B 5CMUA 1N33O 3DSQA 2FB5A 1VQ5V 3LSSA 4YIOA 2KB1A 4LF5B 2A79B 1MABG 2X7RB 4EKWA 2NN4A 1RPOA 1QCEA 2P22C 1YVWA 1GO3F 3JASB 2HEPA 4JI8B 3K04A 4UCRA 5A9GA 2E5LO 3N2GA 4P9PA 1FAFA 3STLC 1BSMA 2XHBA 4X89A 2EX3A 1NKDA 4GZRB 3UO3A 1JJ2U 4DR2O 1PPJH 3AG2C 4LBEC 2N05A 3K79A 2XAFA 3JAWA 4DV4B 1SQXH 2RJZA 3ASOB 4JYCA 4B7KA 3SYAA 5CB4A 1I08A 1WN7A 2Z5UA 4CS4A 1QLNA 1LUWA 4MVUA 3I55V 3G71V 2OWOA 1YCIA 3T4ZA 1HNXB 2E74B 2N74A 1V54C 1AROP 1NZ6A 3JCZA 5EC1C 5LOVA 1EN6A 2QM8A 3ETGA 4DYLA 5B66Z 1XL6A 3D3IA 4I7ZB 1E79G 5EC2C 2WLJA 1QR9A 1X4TA 1COWG 4DV4O 5KUKA 2VQEB 2EINC 2DYRC 4O2BB 2F4VB 5LGUA 3CRCA 2KSDA 3ZMVA 1XDCA 3TGUH 3ZCCA 3E89A 1WLEA 4LFBB 3ABMB 3K9AA 3E8GA 5IYCO 5A2QN 4FFKA 5LYJA 4E2LA 3E8FA 2CTWA 2BCCH 1YI2V 2QM4A 2YXYA 3J80N 4GUNA 2EULA 1N0NA 3BABA 3QVNA 4DR4O 2EJ7A 1SC5B 4B7EA 3RYCA 2W6IG 1TAEA 1QHTA 2ILMA 1MZEA 4GYCB 1BHAA 4J9YB 4PA9A 1VQ9V 1FKAO 3P32A 3ABKB 4B3RO 1RM1C 3K5NA 3N2KB 4NXMO 4K0KB 2Q67A 5JVDB 2LW7A 1NVPD 2OTJV 2CGNA 1YSCA 1K7DA 4JI7B 1M5IA 2R9IA 1WP8A 4DR6O 2QEXV 3E86A 1BQ0A 5IJ0A 1KQSU 3B8NA 2JJ2G 4W4KA 4PV1B 4X1IB 3ZHTA 1HDJA 1MNGA 3RYHA 3LDCA 2QWNB 4JTDB 1KUQA 2H94A 2HG5C 1M9NA 2KG7A 5C8YA 1E1QG 4BW9A 3C3TA 1A32A 5EBWC 1B06A 2RCVA 4X1YB 3BRCA 1NT2B 4MVSA 4DV3O 3CCLV 4J41A 1Y74B 4FLTA 1TUBA 3N27A 5JQGA 5H6QA 3QTCA 4K35A 1M56B 1K3EA 4LF6B 2UUCB 3P3NA 2DW4A 4MT8A 3G6BA 1DK1A 4PI2A 4DV1O 2ZNIA 1AI5A 5LL6Y 3OMNB 2BTQA 5KLVH 1F4MA 1B3QA 3OTFA 1B04A 1L0NH 2PY5A 2EJRA 4F6RB 1TGOA 3R66A 4ZIBA 1P49A 1AI6A 4JYAB 4O4IA 4CH4A 5DN6G 4FM0A 4NYKA 1GKFA 3K5MA 3NXSA 4KP4A 5IYZA 4YHHB 4RAIA 4DR7B 1AP5A 1F51A 2YIBD 4CH5A 1YDXA 5K1XA 4H0LB 1N36O 4LH7A 2A06H 2AZ0A 3AK3A 4UCTA 2L35A 3ZN1A 5LMUO 1M93A 4GCZA 3WFVA 3LDDA 1P7BA 3ASNC 5B3SB 1PP9H 3W7XA 1R3LC 4N21A 1OCCC 5K1PA 1HWYA 2PI4A 4UXNA 4TV8B 1QR8A 3CEIA 4EFBA 2FTKA 3QG5A 3ABKC 2WA3A 3KZIZ 1GM7A 5LOVB 2VRZA 3RYIA 2YICA 4LNUB 3H9VA 4DO2A 2CTRA 3RBZA 2GTSA 1U96A 4YIPA 1ZSPA 4P30A 3M8AA 3HR0A 2OT5A 1J5EO 3X2QC 1VQ6V 4K0KO 2M6YA 2P4VA 1XNQO 3ZRWA 1OCCB 4TQDA 4X8AA 3OW2U 1HP8A 1XHZA 4LF8O 4O2AA 1SZXA 3ASNB 5B3SC 4DUYB 3HKEA 4LC1A 3HPLC 2PGGA 3IJ4A 4RUEA 2ZE5A 4H44B 3K58A 2EBOA 3S3WA 4HNAA 2AHZA 3JSLA 3JATA 1JA8A 2DYRB 2KG7B 2JGDA 1IBKB 1JVMA 1NQTA 4R7CA 5C8YB 3MHSC 3K3WA 4L8JA 3TJTA 2WA4A 4FM1A 1VQ8V 4BIUA 5J2UB 2NNUA 3SYQA 1SETA 4Q6GA 2DYSC 4B3SB 1NU1H 3CMEV 2HVJC 1YHQV 5EIBC 3FB7C 4XBFA 3SJCC 1R73A 2DWEC 2PTMA 2R9RB 2Y0PA 2EINB 1N36B 3OGCC 1I5YA 4ZI7A 4X65O 4DR3O 3EHBB 4K8ZA 2F1MA 2Q7HA 4O4LA 2QA4V 3I56V 3MAQA 5F2VO 1D2DA 1P7GA 4IT5A 5EK0A 3GVMA 2EZPA 5D5PA 3DXRB 1XUQA 3HKCB 3ICXA 5BR8O 5DM6V 2HFEC 1L8DA 5CBHA 2EZOA 2LW1A 3K57A 1JOYA 1VF7A 3OTOO 4ZKIA 4U3FH 3JAKA 2IH1C 1CP9A 4JGSA 4PDRA 2IJIA 2ZCEA 1JPXA 4DR4B 3ZMTA 1BT8A 2GBOA 1HNWB 3CS5A 3F7YC 3DC5A 4JI4B 4MW3A 3JD2A 3SJAC 3CMAV 4QJFB 2BSKB 5GONB 5IT9N 3MDSA 4PA4A 5KMGB 3CCMV 4I50B 1AR1B 5H9CA 1W59A 4CH6A 4FFBA 3EVKA 1H2KA 4TWKA 4UVCA 1OHHG 5JJEB 4Z2WA 1SKVA 1OCOC 2V4DA 1DLBA 4DV2B 2JIZG 4MSWC 4X66B 1K92A 1KECA 1R6NA 3E8BA 4JTCB 4FIPC 2WLLA 4UCUA 3A0HZ 3FAVA 5FL7G 3RVYA 3L72H 3DC6A 1VQNV 1IURA 4JYYA 1FD9A 2QWQB 1K4DC 3K5OA 3ZHQA 1XNRB 1H2LA 3SYPA 3OGIB 1YTFD 1SESA 4I4TA 4PDMA 5TISZ 1Y76A 4JI0B 1ZTEA 3P3PA 2P67A 4Q20A 1M4UA 4JI1O 3SYOA 3JARA 2DQ3A 4MVQA 3PN1A 4GX5A 4F4LA 3CWBH 3RN4A 2E75B 4I50A 1KKDA 4I4TB 2VS0A 4O4HB 5GONA 2CTPA 1VIBA 2DYSB 3W7UA 2K1EA 1V55C 3ZHVA 3FB5C 3ML0A 3WU2Z 2FMLA 3AG3B 3A0RA 5IYZB 2HHHB 4K8XA 3RGBA 4DR1B 3SDLA 4NXNO 1LR1A 4DR5B 4U3JA 3ZN0A 1SS3A 2ZM6O 2K9PA 1G8MA 1JR9A 3NR7A 1OCRB 4WFFA 1FXKA 1MMMA 4B3RB 1PNLA 5L3DA 3OR6C 3CRRA 4LFCO 4HZ3A 5DEDA 4O4LB 2Q6AA 5KA6A 4LCUC 3IC7A 1IXBA 4JI4O 2IJHA 4ZOLA 3X2QB 5EYPA 1RM1B 2QSAA 3IAYA 2CDYA 4UB8Z 1Q5OA 1S5JA 2QDOA 3CX5F 3U0ZA 2JDIG 3O65A 4DV2O 5KHHA 3WB0A 4YHHO 4NTXA 2A7WA 3DXRA 1XHXA 1I94B 4ZHQA 5D5QA 1NR1A 2QE7G 1EBOA 3CYOA 5DECA 5FNVA 2ZM6B 3H01A 3E22A 3IFXA 1THZA 2UXBB 1FFXB 2B1IA 3OUSA 3ABMC 4TV9A 2WLKA 4R6ZA 3B09A 4H33A 2ZQMA 3L70H 1SA0A 1QU7A 3JAKB 2UU9O 4YJ2B 3JALB 4JASA 1HNXO 2QKAA 3K0DA 1K34A 5CN0A 5ITZA 4MS2A 2Q69A 1XNRO 3UQ8A 1HW7A 4DR5O 3HKCA 2ITCC 4XDKA 4J9ZB 3Q4HA 3HB3B 4MW8A 2YI9A 2UXCO 2BOCC 2ODMA 5JJJB 4HAMA 2YC0A 4O2AB 3H1IH 4DR7O 4JZGA 1VARA 1XEQA 2BSKA 1JX9A 3APQA 2EILC 3B4SA 3ASOC 3G4SV 3B40A 1K33A 4I9WA 1H2NA 3FYIB 1SQVH 3AG2B 4OPAA 3SR2C 4RQFA 4ABMA 2P06A 4DV1B 2GTAA 3QO8A 4PA6A 1QLEB 2X0LA 3T1YB 1N4CA 3CJHB 3T1YO 2BE3A 2GUZB 3H1LH 1E1RG 3ZMSA 2UXXA 1N32B 1R6TA 2EIJB 3CB2A 5KAIZ 3JATB 3CHXA 3K06A 1W0KG 3BVOA 5L3EA 2YSUB 3T1CA 4JAUA 2C2AA 1J5EB 3APOA 1QQCA 4FLYA 4PHZA 4O4HA 1I5XA 5KUMA 2RN9A 1PL4A 3OFNG 5LMUB 1SF9A 3ZMZA 3MHHC 4LP8A 3D36C 2QM7A 1MZFA 2HJFC 3ABTA 5KX5B 4ZHQB 5BZBA 3GWOA 2WAMA 1O9HA 1NTMH 3QO5A 4TSFG 2YUAA 1TVKA 1R6KA 1M57C 3ZEDA 4O4IB 2X6BA 2E5LB 1RSOA 4X1KB 1XREA 3OUFA 1YZBA 5B1BC 2OCCB 4DRXB 1KC8W 5KX5A 5LP6C 1KBHA 1WPXA 4XDLA 4FM2A 3CXHF 4JI5B 2GUZA 1TVKB 3RYHB 3H1JH 4X1IA 5CB4B 3TETA 3SPHA 1VF6A 3ABUA 2ZE7A 3VQWA 5JJNB 4UB6Z 1IBMO 4GKJB 4KUMA 4E4EA 4QPJA 4IL6Z 1WP7A 1RP3B 2NR5A 3LSQA 2JEXA 3RVZA 3W7WA 3L74H 4HYOA 1YF2A 2UXDO 5LXTA 1JFFA 4X65B 4PJ0Z 4DV5O 1XMOO 4PI0A 2QTOA 1SQGA 4FLZA 1FYJA 1YIJV 4JYAO 2YS8A 4FZ0A 2Y4TA 2O57A 4YY3B 3QF7A 2AHYA 1I7FA 5JH7B 1I0HA 2DQ0A 2N04A 4DV7O 4NXNB 2HLDG 4ZBMA 3E8HA 2VWJA 3T4DA 2GV9A 3UO2A 4RQEA 1BHBA 5E79Z 2BTQB 2F43G 1V54B 5GW7A 4NB5A 3WB1A 3JSNA 2F4VO 4H13B 3FD9A 4NTWA 1HNWO 1K4CC 1DGSA 3OD4A 1Z5VA 4NVPA 1WB7A 4AI8A 4HBNA 4JTAB 4U7OA 4DUZO 2CH7A 1SRYA 2Y4UA 1XNQB 3SPJA 3BA9A 1KB9F 5J2TB 3Q4HB 2B1GA 1FXKB 2IJJA 2DOSA 4XDJA 2IBZH 2KKWA 2E76B 3F5WC 4QNHB 3BA8A 3AG1C 3A8TA 2LGWA 4JI8O 3DGEA 2ZXWC 1NBMG 3FKSG 5H5NA 3BCCH 4PELA 1OZ0A 2HR3A 1NS1A 3TK1A 1K97A 2ATKC 4HNAB 1ROPA 4JI1B 2IJKA 1QVGU 1K73W 1Q8IA 3I5DA 1OJHA 3JAMN 1JQ0A 2H3OA 1EN4A 4KL1A 5KHIA 2EIKC 2UUCO 1NI8A 4B3TO 2AW9A 3N2KA 1M90W 5CA0A 4C7UA 4AQYO 2LQTA 2CAZC 4Z1MG 1Y67A 3AG4B 2P90A 3VOUA 2IU3A 1Y4MA 3H1KH 1ZX3A 2ARHA 4FVMA 3SJBC 4D7SA 4MVZA 3P30A 3CC4V 1F23A 4J7JA 1SQBH 5IJ9A 3AG7A 3D8CA 3LDEA 2ZINA 4CC6A 4CH3A 4JV5B 3O9OA 4WFHA 5EYPB 3SGIA 3W7TA 3HKBB 1XILA 4WBNB 1XL4A 3WG7B 4QPKA 3ZRSA 1BS3A 4DR3B 1H38A 3ZRXA 4RWUA 4MTOA 4WF9V 4B3MO 4AILC 3IGAC 4JZ2A 2HP8A 2P6JA 5IDJA 5BR8B 2OYQA 1GN4A 4I5SA 2FYUH 2QWOB 4TV8A 3THOA 2V7QG 2ZNJA 3UKMA 1YJ9V 3ZX6A 4MTGA 1Q43A 3BEHA 2LFSA 1H8EG 2PYJA 5EIBD 2EIMB 2UUAB 1Z5WA 3JARB 2ZR3A 2ADQB 4GKKB 4DW1A 1PM9A 4WFGA 1EN5A 1CEZA 2W6JG 1FXHA 2HJDA 5HFLA 3OMAB 1Q81W 5BY1A 2CK3G 4IYHA 5KHJA 3LNNA 5KMGA 2JK5C 1X59A 4IYIA 2D2CB 5IY5B 1IZ3A 3K5LA 4PDVA 4UV8A 3JCUZ 2KQXA 4F6RA 1H2SB 2VWKA 3L75H 1YITV 2X6CA 4GX1A 1VEWA 4YJ2A 2A0LA 1FS0G 1SERA 4QE7A 2P4KA 1Y6XA 2Q0OC 4GT1A 4MVMA 1W0JG 2XAGA 2E3CA 1IBLB 2YI8A 4DUYO 1ZAUA 4I0XB 3HKEB 1D5AA 2JEUA 2XAHA 4EB6B 1N34O 4A5UB 3CCVV 5IYDO 2LJ2A 2P5OA 3VQXA 3T2MA 2Y69C 4PA7A 1OV9A 2UUBB 4O4JA 4IGGA 4PA3A 1QVFU 2OCCC 5FNVB 1VQMV 3AG4C 4LF9O 5BMVA 5IY5C 4U7NA 4JV5O 4X62O 3FYEB 5LP6A 3CXCU 4J7ZA 1L1FA 2OIEA 2RQ6A 2Q68A 3CRAA 1VF6C 4QE9A 1NH2D 4FMTA 3F5TA 5GTIZ 4ZI7B 1ZL8B 4TOIA 4JPRA 3M99B 4JI0O 2WLNA 4NR1A 1S72V 3CCJV 4LF7B 2A3QA 1K8AW 2JRIA 1VQ7V 2QWPB 5IWAB 1D5NA 1GK9A 2OCHA 4J7KA 3M7MX 5LGTA 5CBFA 4FK5C 5CA1B 1GM9A 3K9SA 4GX0A 4BW5A 4LF9B 3B8MA 3CCSV 5FPRA 4I55B 4IIJA 2DN9A 2IM9A 4PDLA 4X62B 1XQ8A 2FL4A 1K5SA 1SA0B 4L87A 2UUAO 4LWSA 1FPOA 5LXTB 5C93A 4OPHA 5KHKA 3H1HH 1U97A 4GLXA 1YEWA 2PUSA 1VQOV 2VQEO 4GKJO 3OM3B 2Y69B 2IW5A 1SQFA 2ZDIC 1NJIW 4F6EA 2OIGA 1AILA 2ZD9A 1L0LH 2Q4PA 1MG1A 3E22B 2Q5ZA 1XMQO 3UT5A 3UCSC 1MSWD 1TA8A 2UU9B 3VQVA 3B2EE 1RSOB 4X1KA 3GB7C 1GTOA 4TT3G 1YXBA 2JGUA 3CC2V 2BTOA 4I55A 3RW0A 3JD4A 1AJNA 1IDSA 1KKCA 2EIKB 1IVSA 4X64B 4I9QA 2YDEA 3ABLC 3BFRA 3AK1A 3SPIA 2MK3A 1NH2B 1WJZA 2RNBA 4LFAB 5CA3A 3KKYA 1AJPA 3HKBA 4CZZA 4TUYA 2W0FC 4J80A 1AB3A 3HKDA 3L71H 4BAYA 1PNKA 4LFBO 3CRMA 1BCCH 1ZUQA 4LR3A 5B1AC 2GHYA 2A9HA 4N23A 2YIAA 3SPCA 4AHCA 5IJ9B 4LF7O 1OCZC 1M1KW 5AG2A 1PNMA 5IWAO 1KMIZ 1GM8A 2CUGA 5B1NA 2ZIMA 1KD1W 4UCOA 5ITZB 4JI2B 2PF4E 3CC7V 3K59A 3ZHRA 1FXVA 2LO1A 3JALA 2YEVA 3S3XA 5CA0B 1S77D 1ENVA 3FB6C 4LFCB 2XAQA 2QR4A 2F23A 3KCYA 1JFFB 3JYCA 1N8RW 3UM7A 4TV9B 4WFEA 1G1XB 4IHJA 3AK2A 4JI3O 3TXQA 4LF4O 1OCRC 3ZRWB 2DJVA 1AVMA 4FLWA 5LHGA 2VQFO 1S3JA 1JMKC 1Q3EA 3FAVB 3R65A 4WFBV 4X1YA 2WLLB 2AXTZ 5L3BA 1LNQA 5EZYB 2R9AA 2DMXA 1FJGO 1QLEC 2XASA 4BIOA 3RYCB 2XUMA 2P7TC 3RYFB 1RPRA 4X20A 1H8HG 1K9MW 4QGPA 5KA5A 4OGQB 4P2ZA 4UV9A 2RMKB 5JVDA 3EXAA 1VQLV 2NLJC 2UXNA 1FFXA 1WB8A 1SQQH 3WB2A 1IX9A 1XOUA 4LH6A 5JCOC 3OT7A 4J10A 1LUVA 4NKGB 4YY3O 2YIBA 5LP6B 2HHHO 1GN2A 3TCUA 1GN3A 5BMVB 3D3QA 1J95A 1PKXA 2W0XA 4GX2A 1NTKH 1SQPH 3B77A 2ZXWB 2HKOA 2F95B 1EM1A 4U3JB 2UXCB 3AG1B 2FKXA 3ZMUA 2WLMA 1UPGA 2JS5A 1HR0B 2R72A 5JWPA 4EB6A 4DW0A 4TUYB 4DV6B 2ZKOA 5LYJB 2BOBC 3HKDB 3OEHG 1BQZA 3CRQA 3E83A 1UJWB 4O2BA 1Q82W 4NTYA 1NVPB 4LF4B 2R70A 1Q90D 2DE0X 1G6UA 5JQGB 4X88A 5J2UA 4FZ1A 5HFMA 4CC5A 1Y76B 4JI3B 2EIMC 4DK1A 3PJSK 2XT9A 1TUEB 4BR6A 4G27B 2JGDB 2UUBO 4UVBA
chains in the Genus database with same CATH topology
2V7QG 3ZN0A 1XL6A 3D3IA 1E79G 1G8MA 5EC2C 1OCZB 3UKMA 2WLJA 1QR9A 1YJ9V 3CCRV 4MTGA 1COWG 1OCRB 4WFFA 3BEHA 3OAAG 1FXKA 2LFSA 1H8EG 2ZR2A 1PNLA 2XNDG 5L3DA 5KUKA 2EIMB 5B1AB 3OR6C 2EINC 2DYRC 1Q86W 5LGNA 5LGUA 3SJQC 2ZR3A 3ZMVA 4HZ3A 3ZCCA 3E89A 4WFGA 1CEZA 1WLEA 2W6JG 3ABMB 2Q6AA 4JYBA 5KA6A 1FXHA 4LCUC 3IC7A 3K9AA 2IJHA 3E8GA 3OMAB 3QO7A 5HFLA 5IYCO 1Q81W 2CK3G 3X2QB 1RM1B 3BY6A 3KG2A 2JK5C 1P4RA 4UVAA 3E8FA 4E2LA 4BIZA 5IY5B 1GMGA 3ABLB 3W7SA 2JDIG 1YI2V 1YJWV 4PDVA 1EZJA 2YEVB 4UV8A 2D3OW 2PI5A 3CCEV 3AG3C 1VQ4V 1V55B 1YITV 2X6CA 1NR1A 2QE7G 4GX1A 2A0LA 1FS0G 2W6IG 1EBOA 1SERA 3CYOA 3H01A 5B1BB 4QE7A 1BHAA 2Y48A 1S0VA 4J9YB 4PA9A 2OTLV 1VQ9V 4GT1A 3AEIA 1PL0A 3IFXA 3P32A 1THZA 3ABKB 2WLIA 2QKSA 4MVMA 1W0JG 2B1IA 2XAGA 1RM1C 2ZDIA 2Q67A 3OUSA 2XAHA 2JEUA 3ABMC 5L3CA 1NVPD 2DWDC 3CCVV 2OTJV 2WLKA 4MTXA 5L3GA 1YJNV 1YSCA 3D36A 1K7DA 2WLHA 5IYDO 4R6ZA 2R9IA 1K5QA 1CPYA 1F4NA 3T2MA 5IYBO 4H33A 2Y69C 2ZQMA 2QEXV 4PA7A 2HVKC 2WWWA 3E86A 3QNEA 4PA3A 1QVFU 1KQSU 3B8NA 4JASA 2JJ2G 2OCCC 4KFMA 1M57B 1VQMV 3K0DA 3AG4C 1K34A 3LDCA 5CN0A 4JTDB 2Z3YA 3LUTB 2H94A 2EIJC 2HG5C 4MS2A 4U7NA 2Q69A 1M9NA 5IY5C 3FYEB 3CXCU 1B6QA 1E1QG 1L1FA 2ITCC 4XDKA 5EBWC 4J9ZB 2Q68A 3HB3B 1AJQA 4MW8A 2BOCC 4MVSA 3OEEG 1FXKC 3G6EV 4HAMA 4QE9A 1NH2D 1G4YB 4FMTA 3CCLV 1Y66A 1JX9A 5J9PC 1VQKV 4JPRA 3M99B 5H6QA 2WLNA 2EILC 1S72V 3CCJV 3WG7C 3ASOC 4RO2A 3G4SV 5B1OA 1K8AW 1VQ7V 2JJ1G 1K33A 1M56B 1K3EA 4I9WA 3FYIB 1GK9A 3AG2B 2DW4A 4MT8A 5EBLC 4RQFA 1AI5A 1JCHA 4R8CA 3OMNB 3CCQV 3CCUV 1F4MA 5LGTA 3QO8A 4PA6A 2EJRA 1QLEB 4FK5C 5CBFA 2X0LA 1GM9A 4GX0A 4ASUG 3OMIB 1AI6A 3B8MA 3OR7C 4P9OA 4BW5A 1YTFB 4YXWG 3CCSV 4WCEV 1ORQC 5DN6G 4PDLA 1E1RG 3ZMSA 3ZRVA 1K5SA 2UXXA 4L87A 3ZJZA 4WFAV 2EIJB 1GKFA 3FB8C 4UUJC 3NXSA 4KP4A 5C93A 4RAIA 3K06A 1W0KG 3STZC 5L3EA 1F51A 1DF5A 1W2BU 1SZTA 2YSUB 1DTOA 3T1CA 1M56C 4JAUA 2IU0A 2C2AA 2EILB 1IXMA 1VQOV 4MTFA 3ZN1A 1AI7A 1I5XA 3OM3B 2Y69B 3CP1A 4GCZA 2IW5A 3OFNG 5KUMA 3WFVA 2ZDIC 1NJIW 5CBGA 3ZIAG 4DXWA 3LDDA 1P7BA 3JD3A 3ZMZA 3MHHC 2ZD9A 3ASNC 5B3SB 3CD6V 4LP8A 3W7XA 1R3LC 1MG1A 2QM7A 4N21A 2HJFC 1OCCC 1HWYA 2PI4A 1MSWD 4UXNA 3ABTA 1QR8A 5BZBA 3GWOA 2WAMA 5L3FA 2FTKA 2B5UA 3E35A 1BMFG 3GB7C 1GTOA 3ABKC 3QO5A 4TSFG 4TT3G 1R6KA 1M57C 1GM7A 1R3JC 2X6BA 5E1AC 1S5HC 5H6RA 3OUFA 3CC2V 5B1BC 2OCCB 3K03A 4DO2A 1KC8W 2V1DA 3RW0A 2WPDG 3JD4A 1WPXA 4XDLA 1AJNA 3RBZA 3CPWU 2EIKB 4JF3A 3TETA 3SPHA 3ABLC 1NR7A 3SPIA 2MK3A 3ABUA 1R3IC 4P30A 1KP2A 4H37A 1NH2B 2OT5A 3X2QC 1PD3A 5CA3A 1VQ6V 4KUMA 1AJPA 1EFRG 1H2GA 3F7VC 4QPJA 4MVRA 2M7WA 2XAJA 4CZZA 3ZRWA 1OCCB 3LSQA 2W0FC 4X8AA 3OW2U 2JEXA 3RVZA 3W7WA 4BAYA 1PNKA 3ASNB 5B3SC 4HYOA 1S76D 3ETEA 5LBQA 4LC1A 3HPLC 2GSMB 4RUEA 5B1AC 2GHYA 2A9HA 4N23A 2EBOA 2QTOA 2AHZA 3SPCA 5LHIA 2DYRB 1YIJV 3JD0A 1OCZC 1M1KW 1JVMA 1PNMA 1NQTA 1GM8A 4R7CA 5B1NA 2AHYA 2DQ0A 1FFTB 3MHSC 1KD1W 3K3WA 2LFRA 3SYCA 2HLDG 4RUFA 4ZBMA 3CC7V 1VQ8V 4BIUA 3E8HA 1FXVA 2NNUA 3SYQA 3T4DA 1SETA 4RQEA 1BHBA 1QBZA 2F43G 2YEVA 2DYSC 5LHHA 1V54B 3CMEV 5GW7A 1DF4A 1S77D 2HVJC 4R50A 1YHQV 3K08A 1ENVA 3EFFK 3FB6C 2XAQA 3FB7C 4XBFA 1R73A 2DWEC 3DTUB 2R9RB 2EINB 3JYCA 3OGCC 1K4CC 1N8RW 3UM7A 1I5YA 1Q7YW 4WFEA 3JD1A 1R3KC 3EHBB 4JTAB 1OCRC 3E2EA 4CBCA 4U7OA 3ZRWB 3I56V 2QA4V 1SRYA 3LNMB 5LHGA 3SPJA 1VQPV 5EK0A 2EZPA 1S3JA 3R65A 4G28B 2XOKG 4WFBV 4QIWF 2B1GA 1FXKB 2IJJA 2WLLB 4XDJA 3OE7G 3SPGA 5L3BA 1LNQA 5DM6V 2HFEC 3F5WC 1QLEC 4QNHB 2XASA 4JAVA 5CBHA 2EZOA 3AG1C 2P7TC 1JOYA 3ETDA 4ZKIA 1KP3A 3DGEA 4FJCC 4OXSA 3MD0A 2ZXWC 2IH1C 1CP9A 1NBMG 3FKSG 1RPRA 2ITDC 4JGSA 4PDRA 2IJIA 1H8HG 1JPXA 3ZMTA 4PELA 1K9MW 3F7YC 5KA5A 1OZ0A 4P2ZA 2HR3A 4MW3A 4UV9A 3JD2A 5EBMC 1AI4A 1VQLV 3CMAV 1K97A 2ATKC 3TK1A 2NLJC 2UXNA 4QJFB 1ROPA 2IJKA 1QVGU 1OCOB 2H8PC 1K73W 4FPPA 4PA4A 3CCMV 2WLIB 3K0GA 1AR1B 5H9CA 1JQ0A 1BL8A 2X6AA 3VBBA 2EIKC 4TWKA 2WSSG 4UVCA 4G2KA 4MVOA 1OHHG 2LP7A 2IH3C 1M90W 1OCOC 1MOFA 1DLBA 1ZWIC 3TCUA 1J95A 1PKXA 2JIZG 4MSWC 5CMUA 1K92A 1VQ5V 4Z1MG 1KECA 1R6NA 2KB1A 3LSSA 4GX2A 3E8BA 4JTCB 2A79B 1MABG 4FIPC 2WLLA 2X7RB 3AG4B 2P90A 3VOUA 2IU3A 3B77A 1Y4MA 2ZXWB 2HKOA 4EKWA 5FL7G 3RVYA 1RPOA 1QCEA 1VQNV 1K4DC 3AG1B 1GO3F 4MVZA 3P30A 3SYPA 3ZMUA 3K04A 2WLMA 1YTFD 3CC4V 1F23A 4P9PA 1SESA 4PDMA 3STLC 4X89A 1NKDA 3LDEA 1JJ2U 4WFHA 3AG2C 2BOBC 3OEHG 2P67A 3E83A 1UJWB 3W7TA 4LBEC 4Q20A 3K79A 3SYOA 2XAFA 1XL4A 1Q82W 3ASOB 2DQ3A 4JYCA 4QPKA 3WG7B 4MVQA 3SYAA 4GX5A 3ZRSA 1NVPB 1H38A 3ZRXA 2Z5UA 4F4LA 1QLNA 4MVUA 3I55V 3G71V 4MTOA 4X88A 1KKDA 4WF9V 3T4ZA 5HFMA 1V54C 3IGAC 2DYSB 2EIMC 3W7UA 3PJSK 1AROP 2K1EA 1TUEB 2P6JA 1V55C 3JCZA 5EC1C 3FB5C 5IDJA 3ML0A 2QM8A 3AG3B 4G27B 4I5SA 3A0RA 3ETGA 4UVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG1 C;  3RW0 A;  2P7T C;  4XDL A;  3RBZ A;  4OXS A;  1XL6 A;  2ITC C;  4XDK A;  2ZXW C;  2IH1 C;  5EC2 C;  5EBW C;  2WLJ A;  2ITD C;  4J9Z B;  2Q68 A;  4MW8 A;  4PDR A;  3UKM A;  4MTG A;  2BOC C;  4MVS A;  3TET A;  3SPH A;  4WFF A;  3BEH A;  3ABL C;  3F7Y C;  4QE9 A;  3SPI A;  4P2Z A;  4P30 A;  1G4Y B;  1R3I C;  4MW3 A;  4H37 A;  5EBM C;  5KUK A;  3OR6 C;  2EIN C;  2DYR C;  2ATK C;  3X2Q C;  2NLJ C;  3SJQ C;  3F7V C;  2H8P C;  4HZ3 A;  5J9P C;  4MVR A;  4PA4 A;  4MS2 A;  3E89 A;  4WFG A;  4X8A A;  2W0F C;  2WLI B;  2EIL C;  2WLN A;  3K0G A;  3RVZ A;  3WG7 C;  3ASO C;  2Q6A A;  4RO2 A;  1BL8 A;  4LCU C;  2X6A A;  5B3S C;  4HYO A;  2EIK C;  4TWK A;  3E8G A;  3HPL C;  4I9W A;  4MVO A;  4RUE A;  2IH3 C;  3KG2 A;  5EBL C;  2JK5 C;  5B1A C;  3E8F A;  2A9H A;  1OCO C;  2QTO A;  2AHZ A;  3SPC A;  4R8C A;  1ZWI C;  3TCU A;  1J95 A;  4MSW C;  4PDV A;  1OCZ C;  4PA6 A;  5CBF A;  1JVM A;  2KB1 A;  4GX2 A;  4GX0 A;  3E8B A;  4JTC B;  2A79 B;  4R7C A;  4BW5 A;  2WLL A;  3OR7 C;  3AG3 C;  2AHY A;  3LUT B;  4P9O A;  3VOU A;  1ORQ C;  4EKW A;  3RVY A;  4PDL A;  2X6C A;  3SYC A;  4GX1 A;  3ZJZ A;  4RUF A;  1K4D C;  4ZBM A;  4MVZ A;  2A0L A;  3E8H A;  3SYP A;  3FB8 C;  4UUJ C;  3K04 A;  2WLM A;  3T4D A;  4QE7 A;  3SYQ A;  4RAI A;  4P9P A;  3K06 A;  3STZ C;  4J9Y B;  4PA9 A;  4PDM A;  3STL C;  4X89 A;  3IFX A;  2YEV A;  2DYS C;  3LDE A;  3T1C A;  1M56 C;  2HVJ C;  2WLI A;  4R50 A;  2QKS A;  3K08 A;  4MVM A;  3EFF K;  3FB6 C;  3FB7 C;  3AG2 C;  4WFH A;  2BOB C;  4MTF A;  2DWE C;  3E83 A;  2R9R B;  4LBE C;  5KUM A;  5CBH A;  3JYC A;  3SYO A;  3OGC C;  1K4C C;  2Q67 A;  5CBG A;  1XL4 A;  3UM7 A;  3OUS A;  4DXW A;  3LDD A;  3ABM C;  1P7B A;  4WFE A;  4MVQ A;  3SYA A;  2DWD C;  2ZD9 A;  1R3K C;  2WLK A;  3ASN C;  4GX5 A;  3ZRS A;  4LP8 A;  1R3L C;  4F4L A;  4JTA B;  4MVU A;  1OCR C;  2WLH A;  4CBC A;  2HJF C;  4MTO A;  4R6Z A;  1OCC C;  4X88 A;  1KKD A;  3T4Z A;  3T2M A;  4H33 A;  2Y69 C;  3LNM B;  4PA7 A;  5BZB A;  3SPJ A;  1V54 C;  2HVK C;  3IGA C;  5EK0 A;  2EIM C;  3R65 A;  4G28 B;  3E86 A;  3PJS K;  3GB7 C;  4PA3 A;  2K1E A;  3ABK C;  2WLL B;  2OCC C;  1M57 C;  1R3J C;  1V55 C;  4KFM A;  4XDJ A;  5EC1 C;  3FB5 C;  3SPG A;  3K0D A;  2X6B A;  5E1A C;  1S5H C;  3AG4 C;  4G27 B;  1LNQ A;  2HFE C;  3LDC A;  3OUF A;  3F5W C;  1QLE C;  4JTD B;  5B1B C;  4QNH B;  3K03 A;  2EIJ C;  5IY5 C;  2HG5 C;  2Q69 A; 
#chains in the Genus database with same CATH topology
 1OCZ B;  3CCR V;  4CS2 A;  3OAA G;  2ZE8 A;  4B3S O;  2ZR2 A;  1QNM A;  2XND G;  1V9P A;  5B1A B;  1Q86 W;  5LGN A;  3SJQ C;  2F93 B;  3G80 A;  3L9D A;  4JYB A;  4X9Q A;  1KYO F;  1XMQ B;  4B3T B;  4LF5 O;  3QO7 A;  4J11 A;  3BHP A;  3BY6 A;  3A0B Z;  3KG2 A;  1Y74 A;  4LWS B;  1P4R A;  4UVA A;  4BIZ A;  4D6T H;  4AQY B;  1GMG A;  3ABL B;  5LMN O;  3W7S A;  1YJW V;  3RYI B;  1HNZ O;  1WNS A;  2CTQ A;  1EZJ A;  3ZHU A;  2YEV B;  3ZBH A;  2D3O W;  4FLX A;  3CCE V;  3AG3 C;  2PI5 A;  1GN6 A;  4UCV A;  1VQ4 V;  4EFE A;  1V55 B;  1Q6I A;  3BAA A;  5GTH Z;  2ETN A;  5B1B B;  2Y48 A;  1S0V A;  3ZHS A;  2OTL V;  3AEI A;  1PL0 A;  2RDC A;  3CE2 A;  3FFQ A;  2WLI A;  2QKS A;  3RT3 C;  4LF6 O;  2ZDI A;  4FLU A;  1H2M A;  3A2F A;  5L3C A;  2DWD C;  1BZK A;  4MTX A;  1S5L Z;  2XTA A;  3TXS A;  2F66 C;  5L3G A;  1YJN V;  3D36 A;  2WLH A;  1K5Q A;  1CPY A;  1F4N A;  5BXZ A;  2Q7G A;  5IYB O;  3GWK C;  4K3A A;  3RYF A;  2HVK C;  4YJ3 A;  2WWW A;  1VP7 A;  3QNE A;  4X20 B;  2Q73 A;  4KFM A;  4B3M B;  3LSU A;  1M57 B;  3T1H O;  3J81 N;  4DK0 A;  1N32 O;  2Z3Y A;  3LUT B;  2EIJ C;  5JH7 A;  1B6Q A;  2MW2 B;  1AJQ A;  2PYL A;  4KHP O;  3OEE G;  1FXK C;  1Q6H A;  3G6E V;  4I0X A;  1G4Y B;  4W4L A;  1Y66 A;  4J42 A;  1CXZ B;  5J9P C;  1VQK V;  1EZV H;  4DR6 B;  2QTS A;  3WG7 C;  4RO2 A;  5B1O A;  2YXL A;  1MSD A;  2JJ1 G;  4JI7 O;  4GKK O;  1Z2G A;  4JI6 O;  3JAW B;  5EBL C;  5KAF Z;  1JJO A;  1JCH A;  4R8C A;  1HNZ B;  3CCQ V;  3CCU V;  1URF A;  3G67 A;  1IBK O;  2UXD B;  1N33 B;  4ASU G;  3OMI B;  3T1H B;  3OR7 C;  4P9O A;  1YTF B;  5LMN B;  4YXW G;  4WCE V;  1ORQ C;  2QGN A;  4DRX A;  3ZRV A;  2ADP A;  3ZJZ A;  4WFA V;  4LNU A;  3FB8 C;  4UUJ C;  3STZ C;  1DF5 A;  1W2B U;  1SZT A;  1DTO A;  5FLX N;  1FJG B;  1M56 C;  2IU0 A;  2EIL B;  4LFA O;  2Q8V A;  1IXM A;  3C3S A;  3FX7 A;  4MTF A;  1AI7 A;  2CE4 A;  5LA6 B;  4DV0 O;  3CP1 A;  4X64 O;  1VMG A;  5CBG A;  3ZIA G;  3U10 A;  1WAZ A;  4DXW A;  3JD3 A;  2JS3 A;  4FFB B;  3CD6 V;  3N2G B;  4UFZ A;  5L3F A;  2B5U A;  3E35 A;  1BMF G;  1R3J C;  4IIJ B;  4BWA A;  5E1A C;  1S5H C;  3CJH A;  5H6R A;  3JAS A;  1XBL A;  4DUZ B;  1BGY H;  1P84 F;  3K03 A;  1I94 O;  2V1D A;  1ZLZ A;  2WPD G;  2YID A;  2ZT9 B;  2QJ1 A;  3OTO B;  3CPW U;  1HR0 O;  1MA1 A;  4JF3 A;  2JVD A;  4JI2 O;  1NR7 A;  1BE3 H;  1R3I C;  4EEQ A;  1KP2 A;  4H37 A;  4WBN A;  4YJ3 B;  1O9G A;  5H2F Z;  1PD3 A;  4CS3 A;  4DV6 O;  1EFR G;  1H2G A;  3F7V C;  4MVR A;  1AR4 A;  1XI1 A;  2M7W A;  2XAJ A;  2GDS A;  1VF5 B;  3J7A U;  5JCO A;  1PV0 A;  4KXR A;  1S76 D;  2G38 A;  3ETE A;  5LBQ A;  2GSM B;  1GH6 A;  2Q7E A;  4JI6 B;  2QKC A;  1TUB B;  2QWR B;  5LHI A;  2L6L A;  4FLV A;  3JD0 A;  4DR1 O;  4X66 O;  1F7Y A;  4B08 A;  4KHP B;  3ZS8 C;  1FFT B;  2LFR A;  3SYC A;  4RUF A;  5IE9 A;  2PZS A;  3UT5 B;  5IJ0 B;  1QBZ A;  4TQF A;  5LHH A;  3L73 H;  1DF4 A;  4R50 A;  3K08 A;  3RWR D;  3EFF K;  4DV3 B;  3U11 A;  2Y0I A;  1WA8 B;  3ETQ A;  3DTU B;  1IBM B;  4JI5 O;  4IHJ B;  4NXM B;  2ZIO A;  1Q7Y W;  3JD1 A;  1R3K C;  1GRJ A;  1NTZ H;  1ZL8 A;  2LGQ A;  3E2E A;  4CBC A;  1GAX A;  1WA8 A;  3KCX A;  3LNM B;  1VQP V;  4G28 B;  2XOK G;  4PD4 F;  2VQF B;  5EZY A;  5FPO A;  1AP6 A;  4QIW F;  3VQY A;  5CA1 A;  3OE7 G;  3SPG A;  4ICG A;  3CSX A;  4JAV A;  4DV7 B;  2UXB O;  3ETD A;  1R1B A;  5J2T A;  4O4J B;  1KP3 A;  4FJC C;  4OXS A;  3MD0 A;  4D7T A;  1T5E A;  2CH7 B;  2ITD C;  2YXH A;  2CGO A;  2Q9L A;  1UFI A;  4JAA A;  5B5E Z;  2B9Z A;  5EBM C;  1N0J A;  1WPB A;  1N34 B;  1AI4 A;  1US6 A;  2Q0A A;  2Z0A A;  4Z1V A;  5KHG A;  4DV0 B;  4ZOL B;  1IBL O;  4DR2 B;  1OCO B;  2H8P C;  4FPP A;  3RFR A;  2AZ2 A;  2WLI B;  3K0G A;  1Q6U A;  3IC9 A;  1BL8 A;  4DV5 B;  1XMO B;  4UCS A;  2X6A A;  3VBB A;  1AR5 A;  2WSS G;  2ZE6 A;  4G2K A;  4MVO A;  1KU9 A;  2LP7 A;  2IH3 C;  5LA6 A;  4OX9 O;  1MOF A;  3BPZ A;  1ZWI C;  4OX9 B;  1RFY A;  2AGA A;  3C90 A;  4LF8 B;  5CMU A;  1N33 O;  3DSQ A;  2FB5 A;  1VQ5 V;  3LSS A;  4YIO A;  2KB1 A;  4LF5 B;  2A79 B;  1MAB G;  2X7R B;  4EKW A;  2NN4 A;  1RPO A;  1QCE A;  2P22 C;  1YVW A;  1GO3 F;  3JAS B;  2HEP A;  4JI8 B;  3K04 A;  4UCR A;  5A9G A;  2E5L O;  3N2G A;  4P9P A;  1FAF A;  3STL C;  1BSM A;  2XHB A;  4X89 A;  2EX3 A;  1NKD A;  4GZR B;  3UO3 A;  1JJ2 U;  4DR2 O;  1PPJ H;  3AG2 C;  4LBE C;  2N05 A;  3K79 A;  2XAF A;  3JAW A;  4DV4 B;  1SQX H;  2RJZ A;  3ASO B;  4JYC A;  4B7K A;  3SYA A;  5CB4 A;  1I08 A;  1WN7 A;  2Z5U A;  4CS4 A;  1QLN A;  1LUW A;  4MVU A;  3I55 V;  3G71 V;  2OWO A;  1YCI A;  3T4Z A;  1HNX B;  2E74 B;  2N74 A;  1V54 C;  1ARO P;  1NZ6 A;  3JCZ A;  5EC1 C;  5LOV A;  1EN6 A;  2QM8 A;  3ETG A;  4DYL A;  5B66 Z;  1XL6 A;  3D3I A;  4I7Z B;  1E79 G;  5EC2 C;  2WLJ A;  1QR9 A;  1X4T A;  1COW G;  4DV4 O;  5KUK A;  2VQE B;  2EIN C;  2DYR C;  4O2B B;  2F4V B;  5LGU A;  3CRC A;  2KSD A;  3ZMV A;  1XDC A;  3TGU H;  3ZCC A;  3E89 A;  1WLE A;  4LFB B;  3ABM B;  3K9A A;  3E8G A;  5IYC O;  5A2Q N;  4FFK A;  5LYJ A;  4E2L A;  3E8F A;  2CTW A;  2BCC H;  1YI2 V;  2QM4 A;  2YXY A;  3J80 N;  4GUN A;  2EUL A;  1N0N A;  3BAB A;  3QVN A;  4DR4 O;  2EJ7 A;  1SC5 B;  4B7E A;  3RYC A;  2W6I G;  1TAE A;  1QHT A;  2ILM A;  1MZE A;  4GYC B;  1BHA A;  4J9Y B;  4PA9 A;  1VQ9 V;  1FKA O;  3P32 A;  3ABK B;  4B3R O;  1RM1 C;  3K5N A;  3N2K B;  4NXM O;  4K0K B;  2Q67 A;  5JVD B;  2LW7 A;  1NVP D;  2OTJ V;  2CGN A;  1YSC A;  1K7D A;  4JI7 B;  1M5I A;  2R9I A;  1WP8 A;  4DR6 O;  2QEX V;  3E86 A;  1BQ0 A;  5IJ0 A;  1KQS U;  3B8N A;  2JJ2 G;  4W4K A;  4PV1 B;  4X1I B;  3ZHT A;  1HDJ A;  1MNG A;  3RYH A;  3LDC A;  2QWN B;  4JTD B;  1KUQ A;  2H94 A;  2HG5 C;  1M9N A;  2KG7 A;  5C8Y A;  1E1Q G;  4BW9 A;  3C3T A;  1A32 A;  5EBW C;  1B06 A;  2RCV A;  4X1Y B;  3BRC A;  1NT2 B;  4MVS A;  4DV3 O;  3CCL V;  4J41 A;  1Y74 B;  4FLT A;  1TUB A;  3N27 A;  5JQG A;  5H6Q A;  3QTC A;  4K35 A;  1M56 B;  1K3E A;  4LF6 B;  2UUC B;  3P3N A;  2DW4 A;  4MT8 A;  3G6B A;  1DK1 A;  4PI2 A;  4DV1 O;  2ZNI A;  1AI5 A;  5LL6 Y;  3OMN B;  2BTQ A;  5KLV H;  1F4M A;  1B3Q A;  3OTF A;  1B04 A;  1L0N H;  2PY5 A;  2EJR A;  4F6R B;  1TGO A;  3R66 A;  4ZIB A;  1P49 A;  1AI6 A;  4JYA B;  4O4I A;  4CH4 A;  5DN6 G;  4FM0 A;  4NYK A;  1GKF A;  3K5M A;  3NXS A;  4KP4 A;  5IYZ A;  4YHH B;  4RAI A;  4DR7 B;  1AP5 A;  1F51 A;  2YIB D;  4CH5 A;  1YDX A;  5K1X A;  4H0L B;  1N36 O;  4LH7 A;  2A06 H;  2AZ0 A;  3AK3 A;  4UCT A;  2L35 A;  3ZN1 A;  5LMU O;  1M93 A;  4GCZ A;  3WFV A;  3LDD A;  1P7B A;  3ASN C;  5B3S B;  1PP9 H;  3W7X A;  1R3L C;  4N21 A;  1OCC C;  5K1P A;  1HWY A;  2PI4 A;  4UXN A;  4TV8 B;  1QR8 A;  3CEI A;  4EFB A;  2FTK A;  3QG5 A;  3ABK C;  2WA3 A;  3KZI Z;  1GM7 A;  5LOV B;  2VRZ A;  3RYI A;  2YIC A;  4LNU B;  3H9V A;  4DO2 A;  2CTR A;  3RBZ A;  2GTS A;  1U96 A;  4YIP A;  1ZSP A;  4P30 A;  3M8A A;  3HR0 A;  2OT5 A;  1J5E O;  3X2Q C;  1VQ6 V;  4K0K O;  2M6Y A;  2P4V A;  1XNQ O;  3ZRW A;  1OCC B;  4TQD A;  4X8A A;  3OW2 U;  1HP8 A;  1XHZ A;  4LF8 O;  4O2A A;  1SZX A;  3ASN B;  5B3S C;  4DUY B;  3HKE A;  4LC1 A;  3HPL C;  2PGG A;  3IJ4 A;  4RUE A;  2ZE5 A;  4H44 B;  3K58 A;  2EBO A;  3S3W A;  4HNA A;  2AHZ A;  3JSL A;  3JAT A;  1JA8 A;  2DYR B;  2KG7 B;  2JGD A;  1IBK B;  1JVM A;  1NQT A;  4R7C A;  5C8Y B;  3MHS C;  3K3W A;  4L8J A;  3TJT A;  2WA4 A;  4FM1 A;  1VQ8 V;  4BIU A;  5J2U B;  2NNU A;  3SYQ A;  1SET A;  4Q6G A;  2DYS C;  4B3S B;  1NU1 H;  3CME V;  2HVJ C;  1YHQ V;  5EIB C;  3FB7 C;  4XBF A;  3SJC C;  1R73 A;  2DWE C;  2PTM A;  2R9R B;  2Y0P A;  2EIN B;  1N36 B;  3OGC C;  1I5Y A;  4ZI7 A;  4X65 O;  4DR3 O;  3EHB B;  4K8Z A;  2F1M A;  2Q7H A;  4O4L A;  2QA4 V;  3I56 V;  3MAQ A;  5F2V O;  1D2D A;  1P7G A;  4IT5 A;  5EK0 A;  3GVM A;  2EZP A;  5D5P A;  3DXR B;  1XUQ A;  3HKC B;  3ICX A;  5BR8 O;  5DM6 V;  2HFE C;  1L8D A;  5CBH A;  2EZO A;  2LW1 A;  3K57 A;  1JOY A;  1VF7 A;  3OTO O;  4ZKI A;  4U3F H;  3JAK A;  2IH1 C;  1CP9 A;  4JGS A;  4PDR A;  2IJI A;  2ZCE A;  1JPX A;  4DR4 B;  3ZMT A;  1BT8 A;  2GBO A;  1HNW B;  3CS5 A;  3F7Y C;  3DC5 A;  4JI4 B;  4MW3 A;  3JD2 A;  3SJA C;  3CMA V;  4QJF B;  2BSK B;  5GON B;  5IT9 N;  3MDS A;  4PA4 A;  5KMG B;  3CCM V;  4I50 B;  1AR1 B;  5H9C A;  1W59 A;  4CH6 A;  4FFB A;  3EVK A;  1H2K A;  4TWK A;  4UVC A;  1OHH G;  5JJE B;  4Z2W A;  1SKV A;  1OCO C;  2V4D A;  1DLB A;  4DV2 B;  2JIZ G;  4MSW C;  4X66 B;  1K92 A;  1KEC A;  1R6N A;  3E8B A;  4JTC B;  4FIP C;  2WLL A;  4UCU A;  3A0H Z;  3FAV A;  5FL7 G;  3RVY A;  3L72 H;  3DC6 A;  1VQN V;  1IUR A;  4JYY A;  1FD9 A;  2QWQ B;  1K4D C;  3K5O A;  3ZHQ A;  1XNR B;  1H2L A;  3SYP A;  3OGI B;  1YTF D;  1SES A;  4I4T A;  4PDM A;  5TIS Z;  1Y76 A;  4JI0 B;  1ZTE A;  3P3P A;  2P67 A;  4Q20 A;  1M4U A;  4JI1 O;  3SYO A;  3JAR A;  2DQ3 A;  4MVQ A;  3PN1 A;  4GX5 A;  4F4L A;  3CWB H;  3RN4 A;  2E75 B;  4I50 A;  1KKD A;  4I4T B;  2VS0 A;  4O4H B;  5GON A;  2CTP A;  1VIB A;  2DYS B;  3W7U A;  2K1E A;  1V55 C;  3ZHV A;  3FB5 C;  3ML0 A;  3WU2 Z;  2FML A;  3AG3 B;  3A0R A;  5IYZ B;  2HHH B;  4K8X A;  3RGB A;  4DR1 B;  3SDL A;  4NXN O;  1LR1 A;  4DR5 B;  4U3J A;  3ZN0 A;  1SS3 A;  2ZM6 O;  2K9P A;  1G8M A;  1JR9 A;  3NR7 A;  1OCR B;  4WFF A;  1FXK A;  1MMM A;  4B3R B;  1PNL A;  5L3D A;  3OR6 C;  3CRR A;  4LFC O;  4HZ3 A;  5DED A;  4O4L B;  2Q6A A;  5KA6 A;  4LCU C;  3IC7 A;  1IXB A;  4JI4 O;  2IJH A;  4ZOL A;  3X2Q B;  5EYP A;  1RM1 B;  2QSA A;  3IAY A;  2CDY A;  4UB8 Z;  1Q5O A;  1S5J A;  2QDO A;  3CX5 F;  3U0Z A;  2JDI G;  3O65 A;  4DV2 O;  5KHH A;  3WB0 A;  4YHH O;  4NTX A;  2A7W A;  3DXR A;  1XHX A;  1I94 B;  4ZHQ A;  5D5Q A;  1NR1 A;  2QE7 G;  1EBO A;  3CYO A;  5DEC A;  5FNV A;  2ZM6 B;  3H01 A;  3E22 A;  3IFX A;  1THZ A;  2UXB B;  1FFX B;  2B1I A;  3OUS A;  3ABM C;  4TV9 A;  2WLK A;  4R6Z A;  3B09 A;  4H33 A;  2ZQM A;  3L70 H;  1SA0 A;  1QU7 A;  3JAK B;  2UU9 O;  4YJ2 B;  3JAL B;  4JAS A;  1HNX O;  2QKA A;  3K0D A;  1K34 A;  5CN0 A;  5ITZ A;  4MS2 A;  2Q69 A;  1XNR O;  3UQ8 A;  1HW7 A;  4DR5 O;  3HKC A;  2ITC C;  4XDK A;  4J9Z B;  3Q4H A;  3HB3 B;  4MW8 A;  2YI9 A;  2UXC O;  2BOC C;  2ODM A;  5JJJ B;  4HAM A;  2YC0 A;  4O2A B;  3H1I H;  4DR7 O;  4JZG A;  1VAR A;  1XEQ A;  2BSK A;  1JX9 A;  3APQ A;  2EIL C;  3B4S A;  3ASO C;  3G4S V;  3B40 A;  1K33 A;  4I9W A;  1H2N A;  3FYI B;  1SQV H;  3AG2 B;  4OPA A;  3SR2 C;  4RQF A;  4ABM A;  2P06 A;  4DV1 B;  2GTA A;  3QO8 A;  4PA6 A;  1QLE B;  2X0L A;  3T1Y B;  1N4C A;  3CJH B;  3T1Y O;  2BE3 A;  2GUZ B;  3H1L H;  1E1R G;  3ZMS A;  2UXX A;  1N32 B;  1R6T A;  2EIJ B;  3CB2 A;  5KAI Z;  3JAT B;  3CHX A;  3K06 A;  1W0K G;  3BVO A;  5L3E A;  2YSU B;  3T1C A;  4JAU A;  2C2A A;  1J5E B;  3APO A;  1QQC A;  4FLY A;  4PHZ A;  4O4H A;  1I5X A;  5KUM A;  2RN9 A;  1PL4 A;  3OFN G;  5LMU B;  1SF9 A;  3ZMZ A;  3MHH C;  4LP8 A;  3D36 C;  2QM7 A;  1MZF A;  2HJF C;  3ABT A;  5KX5 B;  4ZHQ B;  5BZB A;  3GWO A;  2WAM A;  1O9H A;  1NTM H;  3QO5 A;  4TSF G;  2YUA A;  1TVK A;  1R6K A;  1M57 C;  3ZED A;  4O4I B;  2X6B A;  2E5L B;  1RSO A;  4X1K B;  1XRE A;  3OUF A;  1YZB A;  5B1B C;  2OCC B;  4DRX B;  1KC8 W;  5KX5 A;  5LP6 C;  1KBH A;  1WPX A;  4XDL A;  4FM2 A;  3CXH F;  4JI5 B;  2GUZ A;  1TVK B;  3RYH B;  3H1J H;  4X1I A;  5CB4 B;  3TET A;  3SPH A;  1VF6 A;  3ABU A;  2ZE7 A;  3VQW A;  5JJN B;  4UB6 Z;  1IBM O;  4GKJ B;  4KUM A;  4E4E A;  4QPJ A;  4IL6 Z;  1WP7 A;  1RP3 B;  2NR5 A;  3LSQ A;  2JEX A;  3RVZ A;  3W7W A;  3L74 H;  4HYO A;  1YF2 A;  2UXD O;  5LXT A;  1JFF A;  4X65 B;  4PJ0 Z;  4DV5 O;  1XMO O;  4PI0 A;  2QTO A;  1SQG A;  4FLZ A;  1FYJ A;  1YIJ V;  4JYA O;  2YS8 A;  4FZ0 A;  2Y4T A;  2O57 A;  4YY3 B;  3QF7 A;  2AHY A;  1I7F A;  5JH7 B;  1I0H A;  2DQ0 A;  2N04 A;  4DV7 O;  4NXN B;  2HLD G;  4ZBM A;  3E8H A;  2VWJ A;  3T4D A;  2GV9 A;  3UO2 A;  4RQE A;  1BHB A;  5E79 Z;  2BTQ B;  2F43 G;  1V54 B;  5GW7 A;  4NB5 A;  3WB1 A;  3JSN A;  2F4V O;  4H13 B;  3FD9 A;  4NTW A;  1HNW O;  1K4C C;  1DGS A;  3OD4 A;  1Z5V A;  4NVP A;  1WB7 A;  4AI8 A;  4HBN A;  4JTA B;  4U7O A;  4DUZ O;  2CH7 A;  1SRY A;  2Y4U A;  1XNQ B;  3SPJ A;  3BA9 A;  1KB9 F;  5J2T B;  3Q4H B;  2B1G A;  1FXK B;  2IJJ A;  2DOS A;  4XDJ A;  2IBZ H;  2KKW A;  2E76 B;  3F5W C;  4QNH B;  3BA8 A;  3AG1 C;  3A8T A;  2LGW A;  4JI8 O;  3DGE A;  2ZXW C;  1NBM G;  3FKS G;  5H5N A;  3BCC H;  4PEL A;  1OZ0 A;  2HR3 A;  1NS1 A;  3TK1 A;  1K97 A;  2ATK C;  4HNA B;  1ROP A;  4JI1 B;  2IJK A;  1QVG U;  1K73 W;  1Q8I A;  3I5D A;  1OJH A;  3JAM N;  1JQ0 A;  2H3O A;  1EN4 A;  4KL1 A;  5KHI A;  2EIK C;  2UUC O;  1NI8 A;  4B3T O;  2AW9 A;  3N2K A;  1M90 W;  5CA0 A;  4C7U A;  4AQY O;  2LQT A;  2CAZ C;  4Z1M G;  1Y67 A;  3AG4 B;  2P90 A;  3VOU A;  2IU3 A;  1Y4M A;  3H1K H;  1ZX3 A;  2ARH A;  4FVM A;  3SJB C;  4D7S A;  4MVZ A;  3P30 A;  3CC4 V;  1F23 A;  4J7J A;  1SQB H;  5IJ9 A;  3AG7 A;  3D8C A;  3LDE A;  2ZIN A;  4CC6 A;  4CH3 A;  4JV5 B;  3O9O A;  4WFH A;  5EYP B;  3SGI A;  3W7T A;  3HKB B;  1XIL A;  4WBN B;  1XL4 A;  3WG7 B;  4QPK A;  3ZRS A;  1BS3 A;  4DR3 B;  1H38 A;  3ZRX A;  4RWU A;  4MTO A;  4WF9 V;  4B3M O;  4AIL C;  3IGA C;  4JZ2 A;  2HP8 A;  2P6J A;  5IDJ A;  5BR8 B;  2OYQ A;  1GN4 A;  4I5S A;  2FYU H;  2QWO B;  4TV8 A;  3THO A;  2V7Q G;  2ZNJ A;  3UKM A;  1YJ9 V;  3ZX6 A;  4MTG A;  1Q43 A;  3BEH A;  2LFS A;  1H8E G;  2PYJ A;  5EIB D;  2EIM B;  2UUA B;  1Z5W A;  3JAR B;  2ZR3 A;  2ADQ B;  4GKK B;  4DW1 A;  1PM9 A;  4WFG A;  1EN5 A;  1CEZ A;  2W6J G;  1FXH A;  2HJD A;  5HFL A;  3OMA B;  1Q81 W;  5BY1 A;  2CK3 G;  4IYH A;  5KHJ A;  3LNN A;  5KMG A;  2JK5 C;  1X59 A;  4IYI A;  2D2C B;  5IY5 B;  1IZ3 A;  3K5L A;  4PDV A;  4UV8 A;  3JCU Z;  2KQX A;  4F6R A;  1H2S B;  2VWK A;  3L75 H;  1YIT V;  2X6C A;  4GX1 A;  1VEW A;  4YJ2 A;  2A0L A;  1FS0 G;  1SER A;  4QE7 A;  2P4K A;  1Y6X A;  2Q0O C;  4GT1 A;  4MVM A;  1W0J G;  2XAG A;  2E3C A;  1IBL B;  2YI8 A;  4DUY O;  1ZAU A;  4I0X B;  3HKE B;  1D5A A;  2JEU A;  2XAH A;  4EB6 B;  1N34 O;  4A5U B;  3CCV V;  5IYD O;  2LJ2 A;  2P5O A;  3VQX A;  3T2M A;  2Y69 C;  4PA7 A;  1OV9 A;  2UUB B;  4O4J A;  4IGG A;  4PA3 A;  1QVF U;  2OCC C;  5FNV B;  1VQM V;  3AG4 C;  4LF9 O;  5BMV A;  5IY5 C;  4U7N A;  4JV5 O;  4X62 O;  3FYE B;  5LP6 A;  3CXC U;  4J7Z A;  1L1F A;  2OIE A;  2RQ6 A;  2Q68 A;  3CRA A;  1VF6 C;  4QE9 A;  1NH2 D;  4FMT A;  3F5T A;  5GTI Z;  4ZI7 B;  1ZL8 B;  4TOI A;  4JPR A;  3M99 B;  4JI0 O;  2WLN A;  4NR1 A;  1S72 V;  3CCJ V;  4LF7 B;  2A3Q A;  1K8A W;  2JRI A;  1VQ7 V;  2QWP B;  5IWA B;  1D5N A;  1GK9 A;  2OCH A;  4J7K A;  3M7M X;  5LGT A;  5CBF A;  4FK5 C;  5CA1 B;  1GM9 A;  3K9S A;  4GX0 A;  4BW5 A;  4LF9 B;  3B8M A;  3CCS V;  5FPR A;  4I55 B;  4IIJ A;  2DN9 A;  2IM9 A;  4PDL A;  4X62 B;  1XQ8 A;  2FL4 A;  1K5S A;  1SA0 B;  4L87 A;  2UUA O;  4LWS A;  1FPO A;  5LXT B;  5C93 A;  4OPH A;  5KHK A;  3H1H H;  1U97 A;  4GLX A;  1YEW A;  2PUS A;  1VQO V;  2VQE O;  4GKJ O;  3OM3 B;  2Y69 B;  2IW5 A;  1SQF A;  2ZDI C;  1NJI W;  4F6E A;  2OIG A;  1AIL A;  2ZD9 A;  1L0L H;  2Q4P A;  1MG1 A;  3E22 B;  2Q5Z A;  1XMQ O;  3UT5 A;  3UCS C;  1MSW D;  1TA8 A;  2UU9 B;  3VQV A;  3B2E E;  1RSO B;  4X1K A;  3GB7 C;  1GTO A;  4TT3 G;  1YXB A;  2JGU A;  3CC2 V;  2BTO A;  4I55 A;  3RW0 A;  3JD4 A;  1AJN A;  1IDS A;  1KKC A;  2EIK B;  1IVS A;  4X64 B;  4I9Q A;  2YDE A;  3ABL C;  3BFR A;  3AK1 A;  3SPI A;  2MK3 A;  1NH2 B;  1WJZ A;  2RNB A;  4LFA B;  5CA3 A;  3KKY A;  1AJP A;  3HKB A;  4CZZ A;  4TUY A;  2W0F C;  4J80 A;  1AB3 A;  3HKD A;  3L71 H;  4BAY A;  1PNK A;  4LFB O;  3CRM A;  1BCC H;  1ZUQ A;  4LR3 A;  5B1A C;  2GHY A;  2A9H A;  4N23 A;  2YIA A;  3SPC A;  4AHC A;  5IJ9 B;  4LF7 O;  1OCZ C;  1M1K W;  5AG2 A;  1PNM A;  5IWA O;  1KMI Z;  1GM8 A;  2CUG A;  5B1N A;  2ZIM A;  1KD1 W;  4UCO A;  5ITZ B;  4JI2 B;  2PF4 E;  3CC7 V;  3K59 A;  3ZHR A;  1FXV A;  2LO1 A;  3JAL A;  2YEV A;  3S3X A;  5CA0 B;  1S77 D;  1ENV A;  3FB6 C;  4LFC B;  2XAQ A;  2QR4 A;  2F23 A;  3KCY A;  1JFF B;  3JYC A;  1N8R W;  3UM7 A;  4TV9 B;  4WFE A;  1G1X B;  4IHJ A;  3AK2 A;  4JI3 O;  3TXQ A;  4LF4 O;  1OCR C;  3ZRW B;  2DJV A;  1AVM A;  4FLW A;  5LHG A;  2VQF O;  1S3J A;  1JMK C;  1Q3E A;  3FAV B;  3R65 A;  4WFB V;  4X1Y A;  2WLL B;  2AXT Z;  5L3B A;  1LNQ A;  5EZY B;  2R9A A;  2DMX A;  1FJG O;  1QLE C;  2XAS A;  4BIO A;  3RYC B;  2XUM A;  2P7T C;  3RYF B;  1RPR A;  4X20 A;  1H8H G;  1K9M W;  4QGP A;  5KA5 A;  4OGQ B;  4P2Z A;  4UV9 A;  2RMK B;  5JVD A;  3EXA A;  1VQL V;  2NLJ C;  2UXN A;  1FFX A;  1WB8 A;  1SQQ H;  3WB2 A;  1IX9 A;  1XOU A;  4LH6 A;  5JCO C;  3OT7 A;  4J10 A;  1LUV A;  4NKG B;  4YY3 O;  2YIB A;  5LP6 B;  2HHH O;  1GN2 A;  3TCU A;  1GN3 A;  5BMV B;  3D3Q A;  1J95 A;  1PKX A;  2W0X A;  4GX2 A;  1NTK H;  1SQP H;  3B77 A;  2ZXW B;  2HKO A;  2F95 B;  1EM1 A;  4U3J B;  2UXC B;  3AG1 B;  2FKX A;  3ZMU A;  2WLM A;  1UPG A;  2JS5 A;  1HR0 B;  2R72 A;  5JWP A;  4EB6 A;  4DW0 A;  4TUY B;  4DV6 B;  2ZKO A;  5LYJ B;  2BOB C;  3HKD B;  3OEH G;  1BQZ A;  3CRQ A;  3E83 A;  1UJW B;  4O2B A;  1Q82 W;  4NTY A;  1NVP B;  4LF4 B;  2R70 A;  1Q90 D;  2DE0 X;  1G6U A;  5JQG B;  4X88 A;  5J2U A;  4FZ1 A;  5HFM A;  4CC5 A;  1Y76 B;  4JI3 B;  2EIM C;  4DK1 A;  3PJS K;  2XT9 A;  1TUE B;  4BR6 A;  4G27 B;  2JGD B;  2UUB O;  4UVB A; 
#chains in the Genus database with same CATH homology
 2V7Q G;  3ZN0 A;  1XL6 A;  3D3I A;  1E79 G;  1G8M A;  5EC2 C;  1OCZ B;  3UKM A;  2WLJ A;  1QR9 A;  1YJ9 V;  3CCR V;  4MTG A;  1COW G;  1OCR B;  4WFF A;  3BEH A;  3OAA G;  1FXK A;  2LFS A;  1H8E G;  2ZR2 A;  1PNL A;  2XND G;  5L3D A;  5KUK A;  2EIM B;  5B1A B;  3OR6 C;  2EIN C;  2DYR C;  1Q86 W;  5LGN A;  5LGU A;  3SJQ C;  2ZR3 A;  3ZMV A;  4HZ3 A;  3ZCC A;  3E89 A;  4WFG A;  1CEZ A;  1WLE A;  2W6J G;  3ABM B;  2Q6A A;  4JYB A;  5KA6 A;  1FXH A;  4LCU C;  3IC7 A;  3K9A A;  2IJH A;  3E8G A;  3OMA B;  3QO7 A;  5HFL A;  5IYC O;  1Q81 W;  2CK3 G;  3X2Q B;  1RM1 B;  3BY6 A;  3KG2 A;  2JK5 C;  1P4R A;  4UVA A;  3E8F A;  4E2L A;  4BIZ A;  5IY5 B;  1GMG A;  3ABL B;  3W7S A;  2JDI G;  1YI2 V;  1YJW V;  4PDV A;  1EZJ A;  2YEV B;  4UV8 A;  2D3O W;  2PI5 A;  3CCE V;  3AG3 C;  1VQ4 V;  1V55 B;  1YIT V;  2X6C A;  1NR1 A;  2QE7 G;  4GX1 A;  2A0L A;  1FS0 G;  2W6I G;  1EBO A;  1SER A;  3CYO A;  3H01 A;  5B1B B;  4QE7 A;  1BHA A;  2Y48 A;  1S0V A;  4J9Y B;  4PA9 A;  2OTL V;  1VQ9 V;  4GT1 A;  3AEI A;  1PL0 A;  3IFX A;  3P32 A;  1THZ A;  3ABK B;  2WLI A;  2QKS A;  4MVM A;  1W0J G;  2B1I A;  2XAG A;  1RM1 C;  2ZDI A;  2Q67 A;  3OUS A;  2XAH A;  2JEU A;  3ABM C;  5L3C A;  1NVP D;  2DWD C;  3CCV V;  2OTJ V;  2WLK A;  4MTX A;  5L3G A;  1YJN V;  1YSC A;  3D36 A;  1K7D A;  2WLH A;  5IYD O;  4R6Z A;  2R9I A;  1K5Q A;  1CPY A;  1F4N A;  3T2M A;  5IYB O;  4H33 A;  2Y69 C;  2ZQM A;  2QEX V;  4PA7 A;  2HVK C;  2WWW A;  3E86 A;  3QNE A;  4PA3 A;  1QVF U;  1KQS U;  3B8N A;  4JAS A;  2JJ2 G;  2OCC C;  4KFM A;  1M57 B;  1VQM V;  3K0D A;  3AG4 C;  1K34 A;  3LDC A;  5CN0 A;  4JTD B;  2Z3Y A;  3LUT B;  2H94 A;  2EIJ C;  2HG5 C;  4MS2 A;  4U7N A;  2Q69 A;  1M9N A;  5IY5 C;  3FYE B;  3CXC U;  1B6Q A;  1E1Q G;  1L1F A;  2ITC C;  4XDK A;  5EBW C;  4J9Z B;  2Q68 A;  3HB3 B;  1AJQ A;  4MW8 A;  2BOC C;  4MVS A;  3OEE G;  1FXK C;  3G6E V;  4HAM A;  4QE9 A;  1NH2 D;  1G4Y B;  4FMT A;  3CCL V;  1Y66 A;  1JX9 A;  5J9P C;  1VQK V;  4JPR A;  3M99 B;  5H6Q A;  2WLN A;  2EIL C;  1S72 V;  3CCJ V;  3WG7 C;  3ASO C;  4RO2 A;  3G4S V;  5B1O A;  1K8A W;  1VQ7 V;  2JJ1 G;  1K33 A;  1M56 B;  1K3E A;  4I9W A;  3FYI B;  1GK9 A;  3AG2 B;  2DW4 A;  4MT8 A;  5EBL C;  4RQF A;  1AI5 A;  1JCH A;  4R8C A;  3OMN B;  3CCQ V;  3CCU V;  1F4M A;  5LGT A;  3QO8 A;  4PA6 A;  2EJR A;  1QLE B;  4FK5 C;  5CBF A;  2X0L A;  1GM9 A;  4GX0 A;  4ASU G;  3OMI B;  1AI6 A;  3B8M A;  3OR7 C;  4P9O A;  4BW5 A;  1YTF B;  4YXW G;  3CCS V;  4WCE V;  1ORQ C;  5DN6 G;  4PDL A;  1E1R G;  3ZMS A;  3ZRV A;  1K5S A;  2UXX A;  4L87 A;  3ZJZ A;  4WFA V;  2EIJ B;  1GKF A;  3FB8 C;  4UUJ C;  3NXS A;  4KP4 A;  5C93 A;  4RAI A;  3K06 A;  1W0K G;  3STZ C;  5L3E A;  1F51 A;  1DF5 A;  1W2B U;  1SZT A;  2YSU B;  1DTO A;  3T1C A;  1M56 C;  4JAU A;  2IU0 A;  2C2A A;  2EIL B;  1IXM A;  1VQO V;  4MTF A;  3ZN1 A;  1AI7 A;  1I5X A;  3OM3 B;  2Y69 B;  3CP1 A;  4GCZ A;  2IW5 A;  3OFN G;  5KUM A;  3WFV A;  2ZDI C;  1NJI W;  5CBG A;  3ZIA G;  4DXW A;  3LDD A;  1P7B A;  3JD3 A;  3ZMZ A;  3MHH C;  2ZD9 A;  3ASN C;  5B3S B;  3CD6 V;  4LP8 A;  3W7X A;  1R3L C;  1MG1 A;  2QM7 A;  4N21 A;  2HJF C;  1OCC C;  1HWY A;  2PI4 A;  1MSW D;  4UXN A;  3ABT A;  1QR8 A;  5BZB A;  3GWO A;  2WAM A;  5L3F A;  2FTK A;  2B5U A;  3E35 A;  1BMF G;  3GB7 C;  1GTO A;  3ABK C;  3QO5 A;  4TSF G;  4TT3 G;  1R6K A;  1M57 C;  1GM7 A;  1R3J C;  2X6B A;  5E1A C;  1S5H C;  5H6R A;  3OUF A;  3CC2 V;  5B1B C;  2OCC B;  3K03 A;  4DO2 A;  1KC8 W;  2V1D A;  3RW0 A;  2WPD G;  3JD4 A;  1WPX A;  4XDL A;  1AJN A;  3RBZ A;  3CPW U;  2EIK B;  4JF3 A;  3TET A;  3SPH A;  3ABL C;  1NR7 A;  3SPI A;  2MK3 A;  3ABU A;  1R3I C;  4P30 A;  1KP2 A;  4H37 A;  1NH2 B;  2OT5 A;  3X2Q C;  1PD3 A;  5CA3 A;  1VQ6 V;  4KUM A;  1AJP A;  1EFR G;  1H2G A;  3F7V C;  4QPJ A;  4MVR A;  2M7W A;  2XAJ A;  4CZZ A;  3ZRW A;  1OCC B;  3LSQ A;  2W0F C;  4X8A A;  3OW2 U;  2JEX A;  3RVZ A;  3W7W A;  4BAY A;  1PNK A;  3ASN B;  5B3S C;  4HYO A;  1S76 D;  3ETE A;  5LBQ A;  4LC1 A;  3HPL C;  2GSM B;  4RUE A;  5B1A C;  2GHY A;  2A9H A;  4N23 A;  2EBO A;  2QTO A;  2AHZ A;  3SPC A;  5LHI A;  2DYR B;  1YIJ V;  3JD0 A;  1OCZ C;  1M1K W;  1JVM A;  1PNM A;  1NQT A;  1GM8 A;  4R7C A;  5B1N A;  2AHY A;  2DQ0 A;  1FFT B;  3MHS C;  1KD1 W;  3K3W A;  2LFR A;  3SYC A;  2HLD G;  4RUF A;  4ZBM A;  3CC7 V;  1VQ8 V;  4BIU A;  3E8H A;  1FXV A;  2NNU A;  3SYQ A;  3T4D A;  1SET A;  4RQE A;  1BHB A;  1QBZ A;  2F43 G;  2YEV A;  2DYS C;  5LHH A;  1V54 B;  3CME V;  5GW7 A;  1DF4 A;  1S77 D;  2HVJ C;  4R50 A;  1YHQ V;  3K08 A;  1ENV A;  3EFF K;  3FB6 C;  2XAQ A;  3FB7 C;  4XBF A;  1R73 A;  2DWE C;  3DTU B;  2R9R B;  2EIN B;  3JYC A;  3OGC C;  1K4C C;  1N8R W;  3UM7 A;  1I5Y A;  1Q7Y W;  4WFE A;  3JD1 A;  1R3K C;  3EHB B;  4JTA B;  1OCR C;  3E2E A;  4CBC A;  4U7O A;  3ZRW B;  3I56 V;  2QA4 V;  1SRY A;  3LNM B;  5LHG A;  3SPJ A;  1VQP V;  5EK0 A;  2EZP A;  1S3J A;  3R65 A;  4G28 B;  2XOK G;  4WFB V;  4QIW F;  2B1G A;  1FXK B;  2IJJ A;  2WLL B;  4XDJ A;  3OE7 G;  3SPG A;  5L3B A;  1LNQ A;  5DM6 V;  2HFE C;  3F5W C;  1QLE C;  4QNH B;  2XAS A;  4JAV A;  5CBH A;  2EZO A;  3AG1 C;  2P7T C;  1JOY A;  3ETD A;  4ZKI A;  1KP3 A;  3DGE A;  4FJC C;  4OXS A;  3MD0 A;  2ZXW C;  2IH1 C;  1CP9 A;  1NBM G;  3FKS G;  1RPR A;  2ITD C;  4JGS A;  4PDR A;  2IJI A;  1H8H G;  1JPX A;  3ZMT A;  4PEL A;  1K9M W;  3F7Y C;  5KA5 A;  1OZ0 A;  4P2Z A;  2HR3 A;  4MW3 A;  4UV9 A;  3JD2 A;  5EBM C;  1AI4 A;  1VQL V;  3CMA V;  1K97 A;  2ATK C;  3TK1 A;  2NLJ C;  2UXN A;  4QJF B;  1ROP A;  2IJK A;  1QVG U;  1OCO B;  2H8P C;  1K73 W;  4FPP A;  4PA4 A;  3CCM V;  2WLI B;  3K0G A;  1AR1 B;  5H9C A;  1JQ0 A;  1BL8 A;  2X6A A;  3VBB A;  2EIK C;  4TWK A;  2WSS G;  4UVC A;  4G2K A;  4MVO A;  1OHH G;  2LP7 A;  2IH3 C;  1M90 W;  1OCO C;  1MOF A;  1DLB A;  1ZWI C;  3TCU A;  1J95 A;  1PKX A;  2JIZ G;  4MSW C;  5CMU A;  1K92 A;  1VQ5 V;  4Z1M G;  1KEC A;  1R6N A;  2KB1 A;  3LSS A;  4GX2 A;  3E8B A;  4JTC B;  2A79 B;  1MAB G;  4FIP C;  2WLL A;  2X7R B;  3AG4 B;  2P90 A;  3VOU A;  2IU3 A;  3B77 A;  1Y4M A;  2ZXW B;  2HKO A;  4EKW A;  5FL7 G;  3RVY A;  1RPO A;  1QCE A;  1VQN V;  1K4D C;  3AG1 B;  1GO3 F;  4MVZ A;  3P30 A;  3SYP A;  3ZMU A;  3K04 A;  2WLM A;  1YTF D;  3CC4 V;  1F23 A;  4P9P A;  1SES A;  4PDM A;  3STL C;  4X89 A;  1NKD A;  3LDE A;  1JJ2 U;  4WFH A;  3AG2 C;  2BOB C;  3OEH G;  2P67 A;  3E83 A;  1UJW B;  3W7T A;  4LBE C;  4Q20 A;  3K79 A;  3SYO A;  2XAF A;  1XL4 A;  1Q82 W;  3ASO B;  2DQ3 A;  4JYC A;  4QPK A;  3WG7 B;  4MVQ A;  3SYA A;  4GX5 A;  3ZRS A;  1NVP B;  1H38 A;  3ZRX A;  2Z5U A;  4F4L A;  1QLN A;  4MVU A;  3I55 V;  3G71 V;  4MTO A;  4X88 A;  1KKD A;  4WF9 V;  3T4Z A;  5HFM A;  1V54 C;  3IGA C;  2DYS B;  2EIM C;  3W7U A;  3PJS K;  1ARO P;  2K1E A;  1TUE B;  2P6J A;  1V55 C;  3JCZ A;  5EC1 C;  3FB5 C;  5IDJ A;  3ML0 A;  2QM8 A;  3AG3 B;  4G27 B;  4I5S A;  3A0R A;  3ETG A;  4UVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...