4J9YB

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
89
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/calcium binding
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 35
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2013-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4j9yB00
3IFXA 2WLLA 1OCRC 3E8GA 3SPIA 2WLMA 2HFEC 4UUJC 2HJFC 3BEHA 3TCUA 3E89A 4EKWA 4HYOA 3AG3C 4OXSA 3ABMC 3SYQA 5IY5C 5J9PC 2IH1C 4PDVA 3SPGA 1P7BA 3AG2C 3FB8C 4J9YB 2Q69A 2A0LA 3VOUA 5EBLC 1JVMA 3SPJA 2H8PC 3OR6C 3FB6C 4TWKA 4MW3A 2K1EA 1OCCC 1ZWIC 4XDLA 3ABLC 2BOBC 2AHZA 3K0DA 3RW0A 3SYPA 2HVJC 4WFEA 3TETA 4PA4A 4RAIA 1LNQA 2HG5C 4H37A 4LBEC 4MVRA 4MSWC 4XDKA 2JK5C 4MVZA 3STLC 4LP8A 3E83A 2R9RB 3ASNC 2EIKC 3R65A 3T4DA 2WLIB 4H33A 2QKSA 4GX0A 3X2QC 5EBWC 5CBHA 3ASOC 4QE7A 5CBGA 5B1AC 2P7TC 2ZD9A 4HZ3A 3F7VC 4BW5A 4RUEA 1BL8A 2ZXWC 3RVYA 3ZJZA 2DWDC 2ITCC 4I9WA 3SYAA 3T1CA 2Q6AA 2X6BA 3T4ZA 3E86A 3E8HA 3LNMB 3SYOA 2NLJC 2DWEC 4CBCA 4PA3A 3OGCC 2HVKC 1S5HC 2A9HA 5EC2C 2OCCC 3IGAC 4KFMA 4MVMA 1V55C 1OCOC 5B3SC 1R3IC 1G4YB 3LDEA 4RO2A 1V54C 1M57C 2IH3C 5B1BC 2W0FC 1KKDA 3K04A 2EIMC 4MVOA 3LDDA 4X89A 4X88A 3EFFK 4XDJA 1K4DC 5EK0A 4MW8A 3FB7C 3F5WC 2BOCC 2Q67A 4F4LA 1R3KC 4R6ZA 2DYRC 4MVQA 4P2ZA 4P30A 4MS2A 4G28B 5EC1C 3T2MA 4GX5A 3KG2A 2Q68A 3OUFA 4PA9A 3E8BA 4PDRA 1M56C 2ATKC 3GB7C 5E1AC 4JTDB 2X6AA 2EINC 1K4CC 4PA7A 3E8FA 4P9PA 3OR7C 4LCUC 3WG7C 5BZBA 3UKMA 3K03A 4WFGA 1J95A 3LDCA 5CBFA 1ORQC 2YEVA 1XL4A 4R7CA 4MVSA 5EBMC 5KUKA 3SPCA 3SPHA 1R3JC 2ITDC 3K08A 4R50A 3F7YC 2WLIA 2WLNA 2Y69C 3STZC 2EIJC 5KUMA 3RVZA 3AG4C 4ZBMA 4G27B 2DYSC 2X6CA 3AG1C 4P9OA 4PA6A 4WFHA 3OUSA 1OCZC 4WFFA 1XL6A 4MTGA 4PDLA 3PJSK 3FB5C 4JTAB 2KB1A 4PDMA 4R8CA 2WLJA 1R3LC 4JTCB 4DXWA 2A79B 4QNHB 4GX2A 4J9ZB 3ZRSA 4GX1A 2WLLB 3K06A 3SJQC 2WLKA 3ABKC 2AHYA 1QLEC 4MTOA 3JYCA 2QTOA 3K0GA 4QE9A 4MTFA 4X8AA 3UM7A 4RUFA 3LUTB 3RBZA 2WLHA 4MVUA 2EILC 3HPLC 3SYCA
chains in the Genus database with same CATH superfamily
1IDSA 3JSLA 1HWYA 2HJFC 1SETA 2JGDB 4H13B 5J9PC 4EFEA 1SZXA 1N0NA 3D36C 1N34B 2Q69A 4NVPA 3TXQA 3K9AA 1ZWIC 2Q7HA 4GT1A 4UCVA 1Z2GA 3OEHG 4LBEC 4H37A 3UT5B 4I50A 1XNQB 2OCCB 4X1IB 3R65A 2JIZG 4BIZA 2QM7A 5CBGA 5B1AC 1RM1C 4RUEA 2DE0X 3FKSG 2CGOA 3OGCC 1N33O 5J2TA 2B5UA 1HNWB 2YDEA 3G6EV 3LDEA 1XEQA 2JGDA 3HKDA 4MTXA 4MVOA 2LFSA 1EN5A 3EFFK 5EZYB 2FL4A 4X64O 3BA8A 5LGUA 3T1HO 5L3DA 2Z5UA 2JJ2G 5L3CA 2M6YA 2G38A 2A7WA 3UCSC 2DJVA 1SQQH 1BCCH 4FMTA 2MW2B 4UCUA 1URFA 1NJIW 4LFCB 3DXRA 3AG4C 2PY5A 1XDCA 1IBKO 1XMOB 3VBBA 4PA6A 4ZIBA 4FFKA 5IJ9A 1OCRB 1FXKA 4AQYB 1S5LZ 2ZE6A 1XMOO 4QE9A 3JD2A 1MSDA 2Y0IA 3LUTB 4JI4O 3RYIA 4YIOA 4DUYO 4Z1VA 3B09A 4JPRA 2ZKOA 4O4IA 4DR4B 3ABUA 5IYCO 2VQFO 4B3RO 1SQPH 3NR7A 1RP3B 2K1EA 5J2UB 4IL6Z 3B40A 4DV1B 4I4TB 5LP6B 4IHJB 5CB4B 3SDLA 4BWAA 4UFZA 4QE7A 4B3RB 2ZD9A 1BL8A 1BQ0A 1UPGA 3GWKC 2OTJV 2ITCC 3SYAA 3G80A 5IE9A 2W6JG 5B5EZ 4U3FH 1OCOC 5IYZA 5HFLA 4RO2A 2IH3C 3MHSC 2P90A 1L0LH 3JATB 3FB7C 3TJTA 2B1IA 3Q4HB 1S0VA 4KXRA 3K5MA 4J80A 3CCRV 4O2AA 5CMUA 4ZOLB 2OT5A 4TV9B 1S77D 5CN0A 3JAKB 2N04A 5CA3A 2DYSB 5IWAO 3ABTA 1NVPD 1RSOB 5BZBA 3FX7A 5BMVA 3SPCA 4B3MO 1GH6A 3ZRVA 5B66Z 2WLIA 5IDJA 4UCSA 4X62O 3DC6A 5FNVB 4U3JA 5LXTA 2PI4A 5B3SB 1N4CA 5IJ0B 3CC7V 1UFIA 4AI8A 3UQ8A 4O4HB 4ZI7B 1F51A 5C8YB 3KZIZ 1QLNA 4JI8O 2W6IG 2LW1A 1N8RW 2FB5A 5GTIZ 5LHGA 3FYEB 2P22C 2R9IA 2DOSA 3ZMVA 4I55B 1M1KW 3L70H 3W7TA 4E4EA 3AG3C 5IY5C 3SPGA 3ZN0A 1P7BA 3AG2C 2ZQMA 1W2BU 2QTSA 1E1RG 2WWWA 3AG1B 3OEEG 1GM7A 4KHPO 2YC0A 3OTFA 5B1NA 1FXKC 1OJHA 4MVZA 1S3JA 4LP8A 1YXBA 1VARA 3T4DA 1P4RA 1TUBB 3BAAA 3ZHQA 1JOYA 2DW4A 4D7TA 2P7TC 4LF4B 1A32A 3E8HA 2WPDG 1EBOA 2P6JA 2HVKC 1AI5A 4DW0A 2LFRA 2QE7G 3S3WA 3X2QB 1NI8A 3ASOB 3QO7A 4O4IB 3SJAC 3MDSA 5LMNB 1QCEA 5ITZB 4Q20A 2CUGA 2BOCC 1NBMG 4DV7B 2BSKA 1HNZB 2UXBB 2DN9A 1FXVA 1CPYA 1GRJA 5JCOA 2Q73A 3LSUA 1MABG 2ATKC 1THZA 2WSSG 1XNRO 4LH7A 2PF4E 3IC7A 1FJGO 4N21A 3N2KA 3J80N 2DQ0A 2FTKA 1GMGA 4DK1A 3PJSK 4CH6A 3PN1A 4GKKB 4TV8B 4JTCB 1F4MA 2IBZH 2IJKA 1KC8W 1SKVA 4DV0O 3BCCH 3ZRSA 4JI0O 1B06A 3K0GA 3A8TA 2PTMA 2L6LA 2ZCEA 4JV5O 2ZE5A 3IFXA 2RQ6A 5H6QA 3ZCCA 5LGNA 2A0LA 5EBLC 5LOVB 3AEIA 2H8PC 4TWKA 2GDSA 1WP7A 4PHZA 2N05A 1AJQA 1FKAO 1AILA 1DK1A 4DRXB 1HW7A 4JYAB 3JASA 1VQ4V 1ZL8B 3H1KH 5GTHZ 4NR1A 2V7QG 1AROP 5KMGA 1GTOA 4FFBA 1KKDA 1GO3F 4LWSA 3H01A 2E5LO 3M8AA 3KKYA 2DMXA 3H1HH 2IJJA 1NQTA 4IT5A 2Q67A 4CS4A 2GTSA 3OE7G 3MHHC 1Z5VA 5JCOC 1WLEA 1JMKC 2CH7A 4GYCB 4Q6GA 3D3QA 4TV8A 1AP6A 1Q90D 2YEVA 3WB2A 3SGIA 4R7CA 1QU7A 2PUSA 1R3JC 3H1IH 5LP6A 4PELA 4P9OA 4OPAA 4HBNA 2YEVB 3APOA 2F4VB 5KLVH 2KB1A 4R8CA 1NVPB 2WLJA 1AR5A 1Q6UA 4MT8A 1YJWV 3CCMV 1BGYH 4U7OA 2GHYA 1IZ3A 5KHHA 1H2GA 3RYHB 1VF6C 4GX1A 4FK5C 3ICXA 3SJQC 5IYBO 4MTOA 1ZX3A 2YIDA 2ZINA 2EILC 3ABLB 1K73W 3CXHF 1YITV 2QKAA 3U0ZA 2GSMB 2IH1C 1XMQO 3ETEA 4OGQB 5D5QA 1H2LA 5H5NA 2XOKG 4UXNA 3U10A 2ZE7A 4DR5O 2IW5A 4UB8Z 3CCJV 1EN4A 4OX9O 4WFEA 4NXMO 4RAIA 3W7WA 4QIWF 1R1BA 1VQNV 1KU9A 3CB2A 3CS5A 1N32O 2EIMB 1YDXA 1Y67A 5LMUO 3ZJZA 3T1CA 1G1XB 4ZKIA 2KG7A 4LFBO 2ZE8A 2EIJB 4X62B 2PI5A 1VP7A 4J41A 2QGNA 1GM9A 2EIKB 2EZPA 5BR8O 2W0FC 4CH3A 4FJCC 4UB6Z 4MW8A 1O9GA 4LF5B 1KKCA 4FLZA 1R3KC 4J10A 1HP8A 3W7SA 3T2MA 4ZI7A 1FXHA 1I7FA 4PA9A 5BR8B 3CC4V 1M56C 1Y66A 5E1AC 2NR5A 2X6AA 4B3SO 3S3XA 3H1JH 4N23A 5IT9N 2QJ1A 3LDCA 5EBMC 2IU0A 3SPHA 3B8NA 3CC2V 2WLNA 3ZS8C 2VS0A 2Q0OC 4OPHA 1ZAUA 3FAVB 1OCOB 3ABKB 1FAFA 3ZMTA 1S5JA 3CCEV 1HR0B 1AR4A 4YJ2B 1JX9A 1XQ8A 4DV5B 2XAHA 2UXXA 1HR0O 1LUVA 5JWPA 3CWBH 1WPBA 4NTWA 2CAZC 3SYQA 2XAGA 4JZGA 1YIJV 2M7WA 4JI1O 3K5NA 3CPWU 3AK1A 2RNBA 3BFRA 4LH6A 1FFTB 3L75H 5JQGA 5IYDO 1R73A 5LL6Y 3D8CA 2QDOA 4CH5A 3ZEDA 2P67A 1XHXA 3EHBB 3I55V 3O65A 3ABMB 2EINB 2OYQA 1K33A 4ZHQB 2UUCB 3E35A 2XASA 4WF9V 2R9AA 1VQMV 2ZXWC 1YTFD 2QA4V 1FD9A 2JGUA 1Q82W 1R3IC 2D3OW 4KL1A 2Y4TA 1VMGA 2YI8A 4X89A 1NR1A 4X88A 3AG3B 5IY5B 3A0RA 4XDJA 3SJCC 3RYFB 2YIBD 4X1KA 4JI2B 5LYJA 3RT3C 2VQFB 1E79G 4MVQA 1WB7A 1WJZA 4BIUA 3RYHA 4JI6B 4H0LB 1FXKB 4GX5A 1I5XA 2UUAO 2ZIOA 1G6UA 4UCRA 1ROPA 3ZN1A 1DF5A 1VQ8V 5FPOA 4JI2O 3HKBA 1DF4A 4R50A 4U3JB 3F7YC 3DXRB 3K58A 2Y69C 1VQOV 3ETQA 3ZMUA 2UUAB 2VWKA 3OUSA 4MTGA 2IJHA 4YIPA 2PGGA 2WAMA 3DGEA 3E2EA 4GUNA 2ETNA 2A79B 3RYCB 2P06A 4TUYB 4DYLA 2R72A 4O2BA 4FZ1A 3T1HB 4JYAO 4I55A 4MTFA 5AG2A 3A2FA 2WLMA 2PYLA 4YJ2A 3A0BZ 2UUBB 3RYCA 1U97A 1KMIZ 1O9HA 1ZL8A 5KX5B 2MK3A 2JEXA 4NXMB 2AZ0A 5IJ0A 1OHHG 2UXNA 2XTAA 3FAVA 2F23A 2V1DA 3K5LA 3N2KB 1AR1B 1DTOA 3ZX6A 4DV3B 1F4NA 1GN6A 3CEIA 3M7MX 4EB6B 3R66A 5KX5A 2X6BA 1U96A 4B7EA 3SYOA 2FYUH 4PA3A 5L3FA 1X4TA 1SQBH 3IGAC 1MMMA 4W4LA 4DR4O 3N2GB 1K4DC 1TVKB 3LSSA 4B08A 4WFAV 4KP4A 1IX9A 3F5WC 4LFAB 2LGQA 3AK3A 3M99B 3O9OA 4P30A 1VQ7V 3KG2A 2BTQB 4DR7B 3P3NA 1VEWA 3GWOA 2Q8VA 1BHAA 3K79A 1LUWA 1Y76A 3QVNA 1CXZB 2Q4PA 5JVDB 1BS3A 1GN4A 1GKFA 1WA8B 2ADQB 2JJ1G 3JD0A 2QWPB 4LF4O 1QNMA 4FLUA 1EZJA 4LFCO 2IJIA 4FPPA 1PD3A 1WA8A 2RCVA 1YJNV 4OX9B 4GLXA 1H2SB 5JQGB 3HR0A 2UXDB 3ASNB 4PD4F 4DXWA 1BT8A 2ZR3A 1H38A 2IU3A 4X65B 1K3EA 4XBFA 2O57A 3QO8A 5EIBD 1YI2V 3CXCU 1QLEC 1HNZO 2QTOA 3SR2C 5IWAB 1P84F 2WLHA 4JASA 1HDJA 1SS3A 5CA0B 1R6TA 4I7ZB 1K5QA 3E89A 5LP6C 1YJ9V 3FB8C 2E75B 4X66O 5H6RA 4BIOA 4XDLA 2AHZA 4EB6A 3ZRXA 1H2KA 4UCOA 2XAQA 4PA4A 2JK5C 2X7RB 2R9RB 1COWG 1HNXO 4GKKO 4HZ3A 4LF7B 5BMVB 2DWDC 3VQXA 1SA0A 3VQYA 2DWEC 4DR2B 3B2EE 5JJJB 3FYIB 4JI0B 4KFMA 2EILB 1I08A 1N36O 1JPXA 1W0JG 4LF6B 3MAQA 3L74H 2CTWA 1IBMO 1OV9A 1AP5A 4X1YA 3N2GA 3P3PA 3QNEA 4CC5A 2JS3A 2HEPA 4R6ZA 4JI6O 3K5OA 3HKDB 4JAAA 4MS2A 1GK9A 4DV4O 1N36B 4J7JA 4ICGA 2DQ3A 3HKCA 3GB7C 4EFBA 2QWQB 5HFMA 5B1OA 5KAIZ 4K3AA 3K03A 5FL7G 4FLVA 1VQPV 4MVSA 1SRYA 1XUQA 1Z5WA 3JD1A 2C2AA 2EIJC 1UJWB 3I5DA 3VQVA 1I0HA 1QVFU 2X6CA 1OCZC 1NKDA 5C93A 2GV9A 2CGNA 1RSOA 3T1YB 2CE4A 1F7YA 1B6QA 2LO1A 2BTOA 2E5LB 4RQFA 4ZOLA 1EM1A 2CK3G 2GBOA 2GTAA 4FM1A 3AG2B 3K06A 4DV6B 1Q81W 1KD1W 3OMNB 4RUFA 2QWNB 4C7UA 1Q86W 2UXCB 2Z0AA 1PNKA 2QEXV 3L73H 2P4KA 5B1BB 2QKCA 1XNRB 2HFEC 3QO5A 1IURA 1MG1A 3WB0A 4DV6O 2KG7B 2Q9LA 1P49A 3ZBHA 2BOBC 2B1GA 3SYPA 4WCEV 4MVRA 2YS8A 1SQGA 2UU9B 1Y4MA 2QWOB 4H33A 1NS1A 4GX0A 3X2QC 3ASOC 4DV3O 2OWOA 4DV0B 2HHHB 1RPOA 1QHTA 3JSNA 2W0XA 1CEZA 1KUQA 2VWJA 3G71V 4CBCA 4FZ0A 1WN7A 1VIBA 4EEQA 2BTQA 2OTLV 3CCLV 4DV2O 1JA8A 1Y74B 1GN3A 5EYPB 1B04A 5KHIA 5F2VO 2XT9A 5BY1A 1WPXA 4AHCA 1K9MW 2XNDG 1WB8A 3N27A 4JYBA 2QM4A 4A5UB 1V54B 2JVDA 5IJ9B 3CCSV 2AZ2A 3B8MA 4JTDB 4K0KO 2EINC 1S76D 1K5SA 3WG7C 3H1LH 1L0NH 4JZ2A 4BAYA 4DR1B 5BXZA 4ZHQA 4YHHB 4IGGA 3IC9A 3UO3A 1GAXA 4NXNB 4G27B 3CSXA 1EN6A 3OFNG 2UUCO 1D5NA 2FKXA 4DUYB 1WP8A 4UVBA 4B7KA 4YHHO 2YXLA 4TQDA 1IBKB 2F95B 2L35A 3Q4HA 3L9DA 4LF5O 1XOUA 1J5EB 4Z1MG 2YIBA 4DV1O 1M57B 4O2BB 4B3SB 1L1FA 5J2TB 1X59A 1VF5B 4NTXA 2H3OA 3SPJA 3FB6C 1SA0B 3RW0A 1LNQA 4NTYA 3CJHA 5FNVA 1M4UA 4JYYA 2WLIB 5CBHA 5EBWC 1RFYA 1YTFB 4LF8O 2N74A 3CYOA 2Q6AA 3G6BA 2HKOA 1EFRG 4TT3G 1PPJH 1S5HC 3ZIAG 2A9HA 2YSUB 2A06H 3ML0A 3GVMA 3E22A 1JR9A 2UXDO 3CD6V 1DLBA 3K59A 1R6KA 4F6RB 4RWUA 4DV4B 5IYZB 2Q0AA 4IIJB 1TGOA 4J11A 1KP2A 3SJBC 2IM9A 1TUBA 3CRQA 4X66B 3RVZA 3CRCA 1K7DA 2NNUA 3JD4A 1OZ0A 5J2UA 2OIEA 2PYJA 3EVKA 5LBQA 1NR7A 2QSAA 4JI7B 1W0KG 1YCIA 4F6EA 1PNLA 3C3TA 4JI3B 2OCHA 1JFFA 2VRZA 1NTKH 2UXCO 4LWSB 5KA5A 1YZBA 4WFBV 1AJPA 1GN2A 4FM0A 3B77A 5LA6B 3QG5A 1KQSU 2WA4A 1M90W 4MW3A 2JS5A 4I0XA 3JASB 2VQEO 2H94A 4DRXA 1T5EA 2JEUA 5DEDA 1LR1A 3ASNC 2EIKC 1JJ2U 1NH2D 1N32B 1SESA 3ZHUA 1QLEB 2CTPA 3WU2Z 5LOVA 3JAMN 2CTRA 3CRRA 4K35A 2OCCC 4MVMA 4J42A 5KHJA 1B3QA 3JALB 1RM1B 1Q5OA 2RJZA 5EK0A 1SERA 3BA9A 1XILA 3F5TA 4O4LA 5FPRA 2UUBO 4ASUG 1NTZH 4FFBB 2Q7EA 4WBNB 4PDRA 5L3EA 1Q3EA 1K4CC 5LMNO 3E8FA 2B9ZA 3OR7C 4O4HA 3UKMA 4WFGA 5FLXN 1MZFA 2CDYA 5LXTB 2ITDC 4W4KA 3NXSA 2Y0PA 3ZMSA 4X1IA 1OCCB 2ARHA 4I50B 4YXWG 1IXBA 4GKJO 4LC1A 5GONA 3KCYA 4JV5B 1BSMA 2Q5ZA 4GX2A 4D6TH 3K9SA 3JCZA 3CX5F 4LF9B 2EJRA 3AG4B 1VQ9V 2WLLB 3W7UA 1TA8A 1XBLA 1W59A 3D3IA 1ZLZA 3ZMZA 1ZTEA 3U11A 3RYFA 1H8HG 1XREA 4PI2A 4JI4B 3TK1A 2AW9A 1AB3A 1OCRC 1AI4A 3E8GA 4BW9A 4EKWA 4OXSA 3ABMC 4IYHA 3I56V 1NT2B 1JJOA 1XHZA 1OCZB 3K0DA 1AJNA 2Q7GA 3HB3B 3BHPA 1M93A 3JCUZ 3VQWA 3FD9A 1MSWD 2ZR2A 4BW5A 5DN6G 4HAMA 3RVYA 3OAAG 3E86A 1G8MA 3L72H 4IIJA 4NXNO 1V55C 1VF6A 4X20B 1V9PA 5B1BC 1XI1A 3RWRD 1RPRA 3ZRWB 4ABMA 1QR8A 1VQKV 4JYCA 2ADPA 3AK2A 1TVKA 4YY3B 3EXAA 3IJ4A 2DYRC 2RMKB 4JI5B 1D2DA 2R70A 4TOIA 5JJNB 4H44B 5K1XA 1J5EO 2BCCH 4JGSA 1JQ0A 2F4VO 2EZOA 1KB9F 4BR6A 5CBFA 2HLDG 1XL4A 5KUKA 4QGPA 2KKWA 5A2QN 3K08A 2EX3A 4JI5O 3A0HZ 4LF7O 5KHGA 4GCZA 2ZNIA 2FMLA 2DYSC 2Y4UA 4Z2WA 3FFQA 2KSDA 4UVAA 1DGSA 3ETGA 2OIGA 1YEWA 2RN9A 4LF6O 2XUMA 1QR9A 4TV9A 3TXSA 4WBNA 1XMQB 4UCTA 1MZEA 1WNSA 1WAZA 4JAVA 5EIBC 2HJDA 4TQFA 4D7SA 4RQEA 2ZM6B 1S72V 1Q7YW 1IBLB 4MVUA 2F93B 2HR3A 5CA1B 4PJ0Z 3JATA 2PZSA 1AVMA 2ZT9B 2ZIMA 4JAUA 4X9QA 1Y6XA 3TCUA 1SC5B 5DM6V 3H9VA 3HKEA 2JRIA 1AI7A 4KUMA 4DR6O 1YSCA 1NU1H 4LFBB 1PL0A 3TETA 2HG5C 3DSQA 1MOFA 3OGIB 2GUZB 2QKSA 3BVOA 4DR1O 4FLXA 4LNUB 5DECA 1D5AA 2CTQA 3LNMB 5L3GA 4FVMA 3CMEV 5EC2C 1M57C 3K04A 4K8XA 1NTMH 1VQ5V 2F66C 3RYIB 2YUAA 4QJFB 4DK0A 1NH2B 3CRMA 5CA0A 4FLWA 4DV7O 1JFFB 5JH7A 5LHHA 1AI6A 1FFXA 4YJ3B 4UV9A 4JI7O 5KA6A 1Y74A 5EC1C 2YXHA 2Q68A 3OUFA 1JCHA 3E8BA 3MD0A 2E3CA 1YHQV 1XNQO 1VQLV 2ODMA 5L3BA 1K97A 4CC6A 4K8ZA 4IHJA 5KUMA 5CB4A 2GUZA 4ZBMA 4GKJB 2VQEB 2Y48A 4KHPB 4PDLA 3OD4A 1FS0G 3RGBA 4FIPC 1BMFG 4PDMA 4DV2B 1Y76B 1HNWO 3CCVV 1I94O 1R3LC 1IBMB 4I9QA 5B1AB 2P5OA 1Q8IA 1FFXB 2WLKA 3OM3B 4YJ3A 3UM7A 2F43G 3J7AU 5JH7B 3CHXA 2QR4A 3BPZA 1IXMA 3LSQA 5EZYA 1I94B 4I5SA 1I5YA 1PNMA 2V4DA 3BEHA 4UUJC 1SQXH 2EULA 4J7ZA 5C8YA 4PDVA 2LGWA 4J9YB 3WB1A 1H8EG 3OR6C 1QVGU 1KECA 1GM8A 1H2MA 2EBOA 3CJHB 1HNXB 4JI1B 1K8AW 4B3MB 3UT5A 3QF7A 4DW1A 1M5IA 1US6A 3T4ZA 1FJGB 1E1QG 3ZHRA 3P30A 1P7GA 4J7KA 4O4JB 3C3SA 4DR3B 3RFRA 5D5PA 5CA1A 4UV8A 1N34O 2E74B 4JI3O 4P2ZA 1MNGA 2ILMA 2HP8A 4L87A 4TUYA 3OMIB 2NN4A 1TAEA 1PL4A 3ZHSA 1SF9A 5E79Z 1NZ6A 4JF3A 1KP3A 1YF2A 4FM2A 1H2NA 2QWRB 4I4TA 3HKBB 2ZDIA 2ZNJA 4QPKA 3ZHTA 2A3QA 2EJ7A 3FB5C 4I0XB 4JTAB 4DUZO 3J81N 1PM9A 4QNHB 4X64B 4J9ZB 4G2KA 2YXYA 2ZM6O 5LYJB 3JAWB 2AHYA 2XAFA 4X8AA 2BSKB 2LJ2A 2D2CB 4X1KB 3ZHVA 1MA1A 2K9PA 3RBZA 1IBLO 4K0KB 4DUZB 2JDIG 1TUEB 3CCUV 2WLLA 3RN4A 4NYKA 3TGUH 4CH4A 4HNAB 4HYOA 4X20A 4QPJA 2UXBO 4FLTA 3QTCA 3VOUA 5LHIA 4DR6B 1N0JA 1JVMA 4YY3O 2LW7A 2LQTA 5H9CA 5GONB 1OCCC 1BE3H 3ABLC 2HVJC 3JARA 4XDKA 1SQFA 2YI9A 3LNNA 4UVCA 3STLC 2UU9O 3OT7A 5JVDA 3JARB 2HHHO 1Q6HA 1VF7A 2F1MA 5GW7A 5JJEB 3HKEB 4JI8B 1N33B 5B3SC 1Q43A 1V54C 4TSFG 4CS3A 2XHBA 2EIMC 3BY6A 4B3TB 3WG7B 3IAYA 1M9NA 1KBHA 1ZUQA 3OTOO 4NB5A 4F4LA 1FPOA 2ZDIC 4O4JA 3OMAB 3JALA 3CCQV 4G28B 1BHBA 3APQA 5KMGB 3G4SV 1Q6IA 1SQVH 4PV1B 5K1PA 4B3TO 4PA7A 4P9PA 3DTUB 1EZVH 3JD3A 3CE2A 2KQXA 1F23A 4LF8B 4LNUA 4LFAO 3OTOB 3STZC 1VQ6V 1M56B 3AG1C 4DR7O 1V55B 3B4SA 1XL6A 3CRAA 1SZTA 3L71H 2RDCA 3JAKA 3K3WA 5LA6A 1BQZA 1FYJA 4O2AB 2DYRB 5LMUB 4AQYO 2AGAA 3ABKC 4O4LB 3JYCA 4X1YB 4L8JA 1PKXA 3SYCA 4CS2A 3D36A 1ENVA 3SPIA 4X65O 1KYOF 3BABA 4AILC 2Z3YA 1R6NA 1QQCA 3DC5A 2QM8A 3CMAV 4MSWC 2WA3A 4FLYA 3E83A 3ETDA 4NKGB 4DO2A 1BZKA 3F7VC 3P32A 3KCXA 2LP7A 4I9WA 4CZZA 5KHKA 2NLJC 3OW2U 4LF9O 4LR3A 3THOA 5KAFZ 3BRCA 1K34A 4IYIA 1G4YB 4F6RA 3LDDA 2ZXWB 2XAJA 3CP1A 5ITZA 4GZRB 4DR2O 2YICA 3JAWA 3ZRWA 4PI0A 5EYPA 4E2LA 3W7XA 1PV0A 1CP9A 2YIAA 4DV5O 1L8DA 1IVSA 4LCUC 3T1YO 1J95A 1ORQC 2BE3A 1ZSPA 2AXTZ 4DR5B 2P4VA 1K92A 4WFHA 4WFFA 5A9GA 3C90A 1YVWA 3K57A 4DR3O 4U7NA 3AG7A 5LGTA 2CH7B 1PP9H 2X0LA 3HKCB 3G67A 2Y69B 3UO2A 5H2FZ 2E76B 4HNAA 1QBZA 5TISZ 3WFVA 3HPLC 3E22B
chains in the Genus database with same CATH topology
5B1BB 1HWYA 2HFEC 2GSMB 2HJFC 1SETA 3QO5A 4JAUA 3TCUA 5DM6V 5J9PC 2IH1C 3ETEA 1MG1A 4KUMA 1AI7A 2Q69A 3K9AA 1YSCA 2XOKG 4UXNA 1ZWIC 2IW5A 1PL0A 2BOBC 2B1GA 4GT1A 3SYPA 3CCJV 4WFEA 3TETA 4WCEV 4RAIA 2HG5C 3OEHG 4H37A 4LBEC 4MVRA 3W7WA 1MOFA 4QIWF 1VQNV 2OCCB 3R65A 1Y4MA 4H33A 2QKSA 4GX0A 3X2QC 2JIZG 2EIMB 3ASOC 2QM7A 4BIZA 5B1AC 5CBGA 1RM1C 1RPOA 4RUEA 3FKSG 3ZJZA 3T1CA 1CEZA 4ZKIA 3G71V 4CBCA 3LNMB 5L3GA 2EIJB 3OGCC 2PI5A 3CMEV 5EC2C 2B5UA 2OTLV 3CCLV 1GM9A 2EIKB 2EZPA 3LDEA 3G6EV 1M57C 4MTXA 2W0FC 3K04A 4MVOA 4FJCC 2LFSA 1VQ5V 3EFFK 4QJFB 1NH2B 4MW8A 5LHHA 1WPXA 1AI6A 1R3KC 5LGUA 1K9MW 2XNDG 4UV9A 5L3DA 2Z5UA 2JJ2G 4JYBA 5KA6A 3W7SA 5EC1C 3T2MA 1V54B 1FXHA 2Q68A 3OUFA 1JCHA 3E8BA 3MD0A 4PA9A 1M56C 5L3CA 1Y66A 3CC4V 3CCSV 5E1AC 3B8MA 4JTDB 2X6AA 2EINC 1S76D 1K5SA 4N23A 1YHQV 3WG7C 1VQLV 3LDCA 4FMTA 5EBMC 2IU0A 4BAYA 1NJIW 3SPHA 3B8NA 3CC2V 2WLNA 5L3BA 1K97A 5KUMA 3AG4C 4ZBMA 4G27B 3VBBA 4PA6A 1OCOB 3ABKB 2Y48A 4PDLA 3ZMTA 1FS0G 3OFNG 4FIPC 1BMFG 4PDMA 3CCVV 3CCEV 1R3LC 4UVBA 1OCRB 5B1AB 1FXKA 3OM3B 2WLKA 3UM7A 2F43G 4QE9A 1JX9A 3JD2A 3LUTB 4Z1MG 1IXMA 3LSQA 2XAHA 2UXXA 4JPRA 1M57B 4I5SA 1I5YA 1PNMA 4UUJC 3BEHA 1L1FA 3SYQA 2XAGA 3ABUA 2M7WA 4PDVA 5IYCO 3CPWU 1YIJV 4J9YB 1FFTB 3SPJA 1H8EG 3OR6C 3FB6C 1QVGU 5IYDO 1R73A 2K1EA 3RW0A 1KECA 1LNQA 2P67A 1GM8A 3EHBB 3I55V 3ABMB 2EINB 2EBOA 2WLIB 1K33A 5CBHA 5EBWC 1K8AW 4QE7A 3E35A 2XASA 2ZD9A 1YTFB 4WF9V 1VQMV 1BL8A 2ZXWC 1YTFD 2QA4V 2OTJV 2ITCC 3SYAA 3CYOA 2Q6AA 2HKOA 3T4ZA 1EFRG 4TT3G 1E1QG 1S5HC 2W6JG 3ZIAG 2A9HA 1Q82W 3P30A 1OCOC 1R3IC 2YSUB 5HFLA 4RO2A 2IH3C 2D3OW 3ML0A 4X89A 3MHSC 2P90A 1NR1A 4X88A 3AG3B 5IY5B 3A0RA 4XDJA 4UV8A 3FB7C 3CD6V 1DLBA 2B1IA 1S0VA 1R6KA 1E79G 4MVQA 4P2ZA 3CCRV 4BIUA 5CMUA 2OT5A 1S77D 1FXKB 4GX5A 5CN0A 1I5XA 5CA3A 4L87A 2DYSB 3ABTA 3OMIB 1NVPD 5BZBA 1ROPA 3ZN1A 1DF5A 1VQ8V 1KP2A 3SPCA 1DF4A 3ZRVA 4R50A 3F7YC 2WLIA 4JF3A 1KP3A 5IDJA 2Y69C 1VQOV 3RVZA 3ZMUA 1K7DA 2PI4A 2ZDIA 3OUSA 5B3SB 4QPKA 4MTGA 2IJHA 2NNUA 3JD4A 1OZ0A 3CC7V 3FB5C 2WAMA 4JTAB 3DGEA 3E2EA 2A79B 4QNHB 4J9ZB 4G2KA 1F51A 5LBQA 1NR7A 1QLNA 1W0KG 2W6IG 1PNLA 2AHYA 2XAFA 4X8AA 1N8RW 4MTFA 3RBZA 5LHGA 3FYEB 2R9IA 5KA5A 3ZMVA 2JDIG 4WFBV 1TUEB 1M1KW 1AJPA 2WLLA 3CCUV 3W7TA 2WLMA 3B77A 4HYOA 3AG3C 5IY5C 1KQSU 3SPGA 3ZN0A 4QPJA 1P7BA 3AG2C 3VOUA 5LHIA 2ZQMA 1W2BU 1JVMA 5H9CA 1M90W 4MW3A 2MK3A 1E1RG 1OCCC 2WWWA 3AG1B 3OEEG 3ABLC 1GM7A 2JEXA 2H94A 2HVJC 1OHHG 2UXNA 1FXKC 4UVCA 4XDKA 5B1NA 4MVZA 1S3JA 2JEUA 3STLC 4LP8A 2V1DA 3ASNC 2EIKC 1P4RA 3T4DA 1JJ2U 1NH2D 1JOYA 1AR1B 2DW4A 2P7TC 1DTOA 1SESA 1F4NA 2X6BA 3E8HA 3SYOA 2WPDG 1EBOA 1QLEB 2P6JA 4PA3A 5L3FA 5GW7A 2HVKC 1AI5A 2LFRA 2QE7G 2OCCC 3IGAC 4MVMA 5B3SC 4TSFG 1V54C 3X2QB 2EIMC 3ASOB 3QO7A 3BY6A 1RM1B 1SERA 1K4DC 1QCEA 5EK0A 4WFAV 3LSSA 4Q20A 4KP4A 3F5WC 2BOCC 3WG7B 1M9NA 1NBMG 4F4LA 2ZDIC 4ASUG 1FXVA 1CPYA 3M99B 3OMAB 4P30A 3CCQV 4G28B 1VQ7V 3KG2A 1BHBA 4PDRA 5L3EA 1MABG 2ATKC 1THZA 3G4SV 3GWOA 2WSSG 1K4CC 3K79A 1BHAA 4PA7A 3E8FA 4P9PA 3DTUB 3OR7C 3JD3A 3UKMA 4WFGA 1F23A 3IC7A 1GKFA 3JD0A 2ITDC 2JJ1G 4N21A 3STZC 3NXSA 3ZMSA 1VQ6V 1EZJA 2DQ0A 1M56B 2IJIA 4FPPA 1OCCB 1PD3A 3AG1C 4YXWG 1V55B 2FTKA 1GMGA 1XL6A 1YJNV 3PJSK 4LC1A 3ASNB 4JTCB 1SZTA 4DXWA 1F4MA 4GX2A 2ZR3A 2IJKA 3JCZA 1KC8W 1H38A 2IU3A 3K3WA 1K3EA 4XBFA 2EJRA 3AG4B 1VQ9V 2DYRB 3ZRSA 3QO8A 2WLLB 3W7UA 1YI2V 3CXCU 3ABKC 1QLEC 3D3IA 3JYCA 2QTOA 3K0GA 3ZMZA 1H8HG 2WLHA 4JASA 1PKXA 3TK1A 3SYCA 3IFXA 1OCRC 3D36A 5H6QA 1AI4A 1ENVA 3E8GA 1K5QA 3SPIA 4EKWA 3E89A 1K73W 4OXSA 1YJ9V 3ABMC 3ZCCA 3FB8C 5LGNA 2A0LA 3I56V 5EBLC 3AEIA 5H6RA 2Z3YA 2H8PC 4TWKA 1R6NA 4XDLA 1OCZB 2AHZA 3K0DA 3ZRXA 2QM8A 1AJNA 3CMAV 2XAQA 4PA4A 4MSWC 2JK5C 3HB3B 2X7RB 3E83A 3ETDA 2R9RB 1COWG 4DO2A 1AJQA 1MSWD 4HZ3A 2ZR2A 3F7VC 3P32A 4BW5A 5DN6G 4HAMA 3RVYA 2DWDC 2LP7A 4I9WA 3OAAG 4CZZA 1VQ4V 3E86A 2NLJC 2DWEC 1G8MA 3OW2U 2V7QG 1AROP 3FYIB 4KFMA 2EILB 1V55C 1GTOA 1K34A 1G4YB 5B1BC 1KKDA 1JPXA 1GO3F 1RPRA 1W0JG 3LDDA 3ZRWB 2ZXWB 1QR8A 3H01A 1VQKV 2XAJA 4JYCA 2IJJA 1NQTA 3CP1A 3QNEA 2Q67A 4R6ZA 3ZRWA 2DYRC 4E2LA 3W7XA 3OE7G 4MS2A 1GK9A 3MHHC 2DQ3A 1CP9A 1WLEA 4JGSA 3GB7C 5HFMA 1JQ0A 2EZOA 4LCUC 5B1OA 3K03A 1J95A 5CBFA 2HLDG 1ORQC 2YEVA 1XL4A 5FL7G 1VQPV 4R7CA 4MVSA 5KUKA 1SRYA 1R3JC 3K08A 3JD1A 2C2AA 2EIJC 4GCZA 1UJWB 1K92A 4PELA 2DYSC 1QVFU 2X6CA 4P9OA 4WFHA 4WFFA 1OCZC 4UVAA 2YEVB 1NKDA 3ETGA 5C93A 2KB1A 4R8CA 1NVPB 2WLJA 4U7NA 5LGTA 4MT8A 1YJWV 1B6QA 2X0LA 3CCMV 4U7OA 2GHYA 2Y69B 1QR9A 1H2GA 4RQFA 2CK3G 4GX1A 3AG2B 4FK5C 3K06A 3SJQC 5IYBO 4JAVA 4RQEA 1Q81W 1QBZA 4MTOA 1KD1W 3WFVA 1S72V 1Q7YW 3OMNB 4RUFA 4MVUA 2EILC 2HR3A 3ABLB 3HPLC 1Q86W 1PNKA 2QEXV 1YITV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFX A;  2WLL A;  1OCR C;  3E8G A;  3SPI A;  2WLM A;  2HFE C;  4UUJ C;  2HJF C;  3BEH A;  3TCU A;  3E89 A;  4EKW A;  4HYO A;  3AG3 C;  4OXS A;  3ABM C;  3SYQ A;  5IY5 C;  5J9P C;  2IH1 C;  4PDV A;  3SPG A;  1P7B A;  3AG2 C;  3FB8 C;  4J9Y B;  2Q69 A;  2A0L A;  3VOU A;  5EBL C;  1JVM A;  3SPJ A;  2H8P C;  3OR6 C;  3FB6 C;  4TWK A;  4MW3 A;  2K1E A;  1OCC C;  1ZWI C;  4XDL A;  3ABL C;  2BOB C;  2AHZ A;  3K0D A;  3RW0 A;  3SYP A;  2HVJ C;  4WFE A;  3TET A;  4PA4 A;  4RAI A;  1LNQ A;  2HG5 C;  4H37 A;  4LBE C;  4MVR A;  4MSW C;  4XDK A;  2JK5 C;  4MVZ A;  3STL C;  4LP8 A;  3E83 A;  2R9R B;  3ASN C;  2EIK C;  3R65 A;  3T4D A;  2WLI B;  4H33 A;  2QKS A;  4GX0 A;  3X2Q C;  5EBW C;  5CBH A;  3ASO C;  4QE7 A;  5CBG A;  5B1A C;  2P7T C;  2ZD9 A;  4HZ3 A;  3F7V C;  4BW5 A;  4RUE A;  1BL8 A;  2ZXW C;  3RVY A;  3ZJZ A;  2DWD C;  2ITC C;  4I9W A;  3SYA A;  3T1C A;  2Q6A A;  2X6B A;  3T4Z A;  3E86 A;  3E8H A;  3LNM B;  3SYO A;  2NLJ C;  2DWE C;  4CBC A;  4PA3 A;  3OGC C;  2HVK C;  1S5H C;  2A9H A;  5EC2 C;  2OCC C;  3IGA C;  4KFM A;  4MVM A;  1V55 C;  1OCO C;  5B3S C;  1R3I C;  1G4Y B;  3LDE A;  4RO2 A;  1V54 C;  1M57 C;  2IH3 C;  5B1B C;  2W0F C;  1KKD A;  3K04 A;  2EIM C;  4MVO A;  3LDD A;  4X89 A;  4X88 A;  3EFF K;  4XDJ A;  1K4D C;  5EK0 A;  4MW8 A;  3FB7 C;  3F5W C;  2BOC C;  2Q67 A;  4F4L A;  1R3K C;  4R6Z A;  2DYR C;  4MVQ A;  4P2Z A;  4P30 A;  4MS2 A;  4G28 B;  5EC1 C;  3T2M A;  4GX5 A;  3KG2 A;  2Q68 A;  3OUF A;  4PA9 A;  3E8B A;  4PDR A;  1M56 C;  2ATK C;  3GB7 C;  5E1A C;  4JTD B;  2X6A A;  2EIN C;  1K4C C;  4PA7 A;  3E8F A;  4P9P A;  3OR7 C;  4LCU C;  3WG7 C;  5BZB A;  3UKM A;  3K03 A;  4WFG A;  1J95 A;  3LDC A;  5CBF A;  1ORQ C;  2YEV A;  1XL4 A;  4R7C A;  4MVS A;  5EBM C;  5KUK A;  3SPC A;  3SPH A;  1R3J C;  2ITD C;  3K08 A;  4R50 A;  3F7Y C;  2WLI A;  2WLN A;  2Y69 C;  3STZ C;  2EIJ C;  5KUM A;  3RVZ A;  3AG4 C;  4ZBM A;  4G27 B;  2DYS C;  2X6C A;  3AG1 C;  4P9O A;  4PA6 A;  4WFH A;  3OUS A;  1OCZ C;  4WFF A;  1XL6 A;  4MTG A;  4PDL A;  3PJS K;  3FB5 C;  4JTA B;  2KB1 A;  4PDM A;  4R8C A;  2WLJ A;  1R3L C;  4JTC B;  4DXW A;  2A79 B;  4QNH B;  4GX2 A;  4J9Z B;  3ZRS A;  4GX1 A;  2WLL B;  3K06 A;  3SJQ C;  2WLK A;  3ABK C;  2AHY A;  1QLE C;  4MTO A;  3JYC A;  2QTO A;  3K0G A;  4QE9 A;  4MTF A;  4X8A A;  3UM7 A;  4RUF A;  3LUT B;  3RBZ A;  2WLH A;  4MVU A;  2EIL C;  3HPL C;  3SYC A; 
#chains in the Genus database with same CATH topology
 1IDS A;  3JSL A;  1HWY A;  2HJF C;  1SET A;  2JGD B;  4H13 B;  5J9P C;  4EFE A;  1SZX A;  1N0N A;  3D36 C;  1N34 B;  2Q69 A;  4NVP A;  3TXQ A;  3K9A A;  1ZWI C;  2Q7H A;  4GT1 A;  4UCV A;  1Z2G A;  3OEH G;  4LBE C;  4H37 A;  3UT5 B;  4I50 A;  1XNQ B;  2OCC B;  4X1I B;  3R65 A;  2JIZ G;  4BIZ A;  2QM7 A;  5CBG A;  5B1A C;  1RM1 C;  4RUE A;  2DE0 X;  3FKS G;  2CGO A;  3OGC C;  1N33 O;  5J2T A;  2B5U A;  1HNW B;  2YDE A;  3G6E V;  3LDE A;  1XEQ A;  2JGD A;  3HKD A;  4MTX A;  4MVO A;  2LFS A;  1EN5 A;  3EFF K;  5EZY B;  2FL4 A;  4X64 O;  3BA8 A;  5LGU A;  3T1H O;  5L3D A;  2Z5U A;  2JJ2 G;  5L3C A;  2M6Y A;  2G38 A;  2A7W A;  3UCS C;  2DJV A;  1SQQ H;  1BCC H;  4FMT A;  2MW2 B;  4UCU A;  1URF A;  1NJI W;  4LFC B;  3DXR A;  3AG4 C;  2PY5 A;  1XDC A;  1IBK O;  1XMO B;  3VBB A;  4PA6 A;  4ZIB A;  4FFK A;  5IJ9 A;  1OCR B;  1FXK A;  4AQY B;  1S5L Z;  2ZE6 A;  1XMO O;  4QE9 A;  3JD2 A;  1MSD A;  2Y0I A;  3LUT B;  4JI4 O;  3RYI A;  4YIO A;  4DUY O;  4Z1V A;  3B09 A;  4JPR A;  2ZKO A;  4O4I A;  4DR4 B;  3ABU A;  5IYC O;  2VQF O;  4B3R O;  1SQP H;  3NR7 A;  1RP3 B;  2K1E A;  5J2U B;  4IL6 Z;  3B40 A;  4DV1 B;  4I4T B;  5LP6 B;  4IHJ B;  5CB4 B;  3SDL A;  4BWA A;  4UFZ A;  4QE7 A;  4B3R B;  2ZD9 A;  1BL8 A;  1BQ0 A;  1UPG A;  3GWK C;  2OTJ V;  2ITC C;  3SYA A;  3G80 A;  5IE9 A;  2W6J G;  5B5E Z;  4U3F H;  1OCO C;  5IYZ A;  5HFL A;  4RO2 A;  2IH3 C;  3MHS C;  2P90 A;  1L0L H;  3JAT B;  3FB7 C;  3TJT A;  2B1I A;  3Q4H B;  1S0V A;  4KXR A;  3K5M A;  4J80 A;  3CCR V;  4O2A A;  5CMU A;  4ZOL B;  2OT5 A;  4TV9 B;  1S77 D;  5CN0 A;  3JAK B;  2N04 A;  5CA3 A;  2DYS B;  5IWA O;  3ABT A;  1NVP D;  1RSO B;  5BZB A;  3FX7 A;  5BMV A;  3SPC A;  4B3M O;  1GH6 A;  3ZRV A;  5B66 Z;  2WLI A;  5IDJ A;  4UCS A;  4X62 O;  3DC6 A;  5FNV B;  4U3J A;  5LXT A;  2PI4 A;  5B3S B;  1N4C A;  5IJ0 B;  3CC7 V;  1UFI A;  4AI8 A;  3UQ8 A;  4O4H B;  4ZI7 B;  1F51 A;  5C8Y B;  3KZI Z;  1QLN A;  4JI8 O;  2W6I G;  2LW1 A;  1N8R W;  2FB5 A;  5GTI Z;  5LHG A;  3FYE B;  2P22 C;  2R9I A;  2DOS A;  3ZMV A;  4I55 B;  1M1K W;  3L70 H;  3W7T A;  4E4E A;  3AG3 C;  5IY5 C;  3SPG A;  3ZN0 A;  1P7B A;  3AG2 C;  2ZQM A;  1W2B U;  2QTS A;  1E1R G;  2WWW A;  3AG1 B;  3OEE G;  1GM7 A;  4KHP O;  2YC0 A;  3OTF A;  5B1N A;  1FXK C;  1OJH A;  4MVZ A;  1S3J A;  4LP8 A;  1YXB A;  1VAR A;  3T4D A;  1P4R A;  1TUB B;  3BAA A;  3ZHQ A;  1JOY A;  2DW4 A;  4D7T A;  2P7T C;  4LF4 B;  1A32 A;  3E8H A;  2WPD G;  1EBO A;  2P6J A;  2HVK C;  1AI5 A;  4DW0 A;  2LFR A;  2QE7 G;  3S3W A;  3X2Q B;  1NI8 A;  3ASO B;  3QO7 A;  4O4I B;  3SJA C;  3MDS A;  5LMN B;  1QCE A;  5ITZ B;  4Q20 A;  2CUG A;  2BOC C;  1NBM G;  4DV7 B;  2BSK A;  1HNZ B;  2UXB B;  2DN9 A;  1FXV A;  1CPY A;  1GRJ A;  5JCO A;  2Q73 A;  3LSU A;  1MAB G;  2ATK C;  1THZ A;  2WSS G;  1XNR O;  4LH7 A;  2PF4 E;  3IC7 A;  1FJG O;  4N21 A;  3N2K A;  3J80 N;  2DQ0 A;  2FTK A;  1GMG A;  4DK1 A;  3PJS K;  4CH6 A;  3PN1 A;  4GKK B;  4TV8 B;  4JTC B;  1F4M A;  2IBZ H;  2IJK A;  1KC8 W;  1SKV A;  4DV0 O;  3BCC H;  3ZRS A;  4JI0 O;  1B06 A;  3K0G A;  3A8T A;  2PTM A;  2L6L A;  2ZCE A;  4JV5 O;  2ZE5 A;  3IFX A;  2RQ6 A;  5H6Q A;  3ZCC A;  5LGN A;  2A0L A;  5EBL C;  5LOV B;  3AEI A;  2H8P C;  4TWK A;  2GDS A;  1WP7 A;  4PHZ A;  2N05 A;  1AJQ A;  1FKA O;  1AIL A;  1DK1 A;  4DRX B;  1HW7 A;  4JYA B;  3JAS A;  1VQ4 V;  1ZL8 B;  3H1K H;  5GTH Z;  4NR1 A;  2V7Q G;  1ARO P;  5KMG A;  1GTO A;  4FFB A;  1KKD A;  1GO3 F;  4LWS A;  3H01 A;  2E5L O;  3M8A A;  3KKY A;  2DMX A;  3H1H H;  2IJJ A;  1NQT A;  4IT5 A;  2Q67 A;  4CS4 A;  2GTS A;  3OE7 G;  3MHH C;  1Z5V A;  5JCO C;  1WLE A;  1JMK C;  2CH7 A;  4GYC B;  4Q6G A;  3D3Q A;  4TV8 A;  1AP6 A;  1Q90 D;  2YEV A;  3WB2 A;  3SGI A;  4R7C A;  1QU7 A;  2PUS A;  1R3J C;  3H1I H;  5LP6 A;  4PEL A;  4P9O A;  4OPA A;  4HBN A;  2YEV B;  3APO A;  2F4V B;  5KLV H;  2KB1 A;  4R8C A;  1NVP B;  2WLJ A;  1AR5 A;  1Q6U A;  4MT8 A;  1YJW V;  3CCM V;  1BGY H;  4U7O A;  2GHY A;  1IZ3 A;  5KHH A;  1H2G A;  3RYH B;  1VF6 C;  4GX1 A;  4FK5 C;  3ICX A;  3SJQ C;  5IYB O;  4MTO A;  1ZX3 A;  2YID A;  2ZIN A;  2EIL C;  3ABL B;  1K73 W;  3CXH F;  1YIT V;  2QKA A;  3U0Z A;  2GSM B;  2IH1 C;  1XMQ O;  3ETE A;  4OGQ B;  5D5Q A;  1H2L A;  5H5N A;  2XOK G;  4UXN A;  3U10 A;  2ZE7 A;  4DR5 O;  2IW5 A;  4UB8 Z;  3CCJ V;  1EN4 A;  4OX9 O;  4WFE A;  4NXM O;  4RAI A;  3W7W A;  4QIW F;  1R1B A;  1VQN V;  1KU9 A;  3CB2 A;  3CS5 A;  1N32 O;  2EIM B;  1YDX A;  1Y67 A;  5LMU O;  3ZJZ A;  3T1C A;  1G1X B;  4ZKI A;  2KG7 A;  4LFB O;  2ZE8 A;  2EIJ B;  4X62 B;  2PI5 A;  1VP7 A;  4J41 A;  2QGN A;  1GM9 A;  2EIK B;  2EZP A;  5BR8 O;  2W0F C;  4CH3 A;  4FJC C;  4UB6 Z;  4MW8 A;  1O9G A;  4LF5 B;  1KKC A;  4FLZ A;  1R3K C;  4J10 A;  1HP8 A;  3W7S A;  3T2M A;  4ZI7 A;  1FXH A;  1I7F A;  4PA9 A;  5BR8 B;  3CC4 V;  1M56 C;  1Y66 A;  5E1A C;  2NR5 A;  2X6A A;  4B3S O;  3S3X A;  3H1J H;  4N23 A;  5IT9 N;  2QJ1 A;  3LDC A;  5EBM C;  2IU0 A;  3SPH A;  3B8N A;  3CC2 V;  2WLN A;  3ZS8 C;  2VS0 A;  2Q0O C;  4OPH A;  1ZAU A;  3FAV B;  1OCO B;  3ABK B;  1FAF A;  3ZMT A;  1S5J A;  3CCE V;  1HR0 B;  1AR4 A;  4YJ2 B;  1JX9 A;  1XQ8 A;  4DV5 B;  2XAH A;  2UXX A;  1HR0 O;  1LUV A;  5JWP A;  3CWB H;  1WPB A;  4NTW A;  2CAZ C;  3SYQ A;  2XAG A;  4JZG A;  1YIJ V;  2M7W A;  4JI1 O;  3K5N A;  3CPW U;  3AK1 A;  2RNB A;  3BFR A;  4LH6 A;  1FFT B;  3L75 H;  5JQG A;  5IYD O;  1R73 A;  5LL6 Y;  3D8C A;  2QDO A;  4CH5 A;  3ZED A;  2P67 A;  1XHX A;  3EHB B;  3I55 V;  3O65 A;  3ABM B;  2EIN B;  2OYQ A;  1K33 A;  4ZHQ B;  2UUC B;  3E35 A;  2XAS A;  4WF9 V;  2R9A A;  1VQM V;  2ZXW C;  1YTF D;  2QA4 V;  1FD9 A;  2JGU A;  1Q82 W;  1R3I C;  2D3O W;  4KL1 A;  2Y4T A;  1VMG A;  2YI8 A;  4X89 A;  1NR1 A;  4X88 A;  3AG3 B;  5IY5 B;  3A0R A;  4XDJ A;  3SJC C;  3RYF B;  2YIB D;  4X1K A;  4JI2 B;  5LYJ A;  3RT3 C;  2VQF B;  1E79 G;  4MVQ A;  1WB7 A;  1WJZ A;  4BIU A;  3RYH A;  4JI6 B;  4H0L B;  1FXK B;  4GX5 A;  1I5X A;  2UUA O;  2ZIO A;  1G6U A;  4UCR A;  1ROP A;  3ZN1 A;  1DF5 A;  1VQ8 V;  5FPO A;  4JI2 O;  3HKB A;  1DF4 A;  4R50 A;  4U3J B;  3F7Y C;  3DXR B;  3K58 A;  2Y69 C;  1VQO V;  3ETQ A;  3ZMU A;  2UUA B;  2VWK A;  3OUS A;  4MTG A;  2IJH A;  4YIP A;  2PGG A;  2WAM A;  3DGE A;  3E2E A;  4GUN A;  2ETN A;  2A79 B;  3RYC B;  2P06 A;  4TUY B;  4DYL A;  2R72 A;  4O2B A;  4FZ1 A;  3T1H B;  4JYA O;  4I55 A;  4MTF A;  5AG2 A;  3A2F A;  2WLM A;  2PYL A;  4YJ2 A;  3A0B Z;  2UUB B;  3RYC A;  1U97 A;  1KMI Z;  1O9H A;  1ZL8 A;  5KX5 B;  2MK3 A;  2JEX A;  4NXM B;  2AZ0 A;  5IJ0 A;  1OHH G;  2UXN A;  2XTA A;  3FAV A;  2F23 A;  2V1D A;  3K5L A;  3N2K B;  1AR1 B;  1DTO A;  3ZX6 A;  4DV3 B;  1F4N A;  1GN6 A;  3CEI A;  3M7M X;  4EB6 B;  3R66 A;  5KX5 A;  2X6B A;  1U96 A;  4B7E A;  3SYO A;  2FYU H;  4PA3 A;  5L3F A;  1X4T A;  1SQB H;  3IGA C;  1MMM A;  4W4L A;  4DR4 O;  3N2G B;  1K4D C;  1TVK B;  3LSS A;  4B08 A;  4WFA V;  4KP4 A;  1IX9 A;  3F5W C;  4LFA B;  2LGQ A;  3AK3 A;  3M99 B;  3O9O A;  4P30 A;  1VQ7 V;  3KG2 A;  2BTQ B;  4DR7 B;  3P3N A;  1VEW A;  3GWO A;  2Q8V A;  1BHA A;  3K79 A;  1LUW A;  1Y76 A;  3QVN A;  1CXZ B;  2Q4P A;  5JVD B;  1BS3 A;  1GN4 A;  1GKF A;  1WA8 B;  2ADQ B;  2JJ1 G;  3JD0 A;  2QWP B;  4LF4 O;  1QNM A;  4FLU A;  1EZJ A;  4LFC O;  2IJI A;  4FPP A;  1PD3 A;  1WA8 A;  2RCV A;  1YJN V;  4OX9 B;  4GLX A;  1H2S B;  5JQG B;  3HR0 A;  2UXD B;  3ASN B;  4PD4 F;  4DXW A;  1BT8 A;  2ZR3 A;  1H38 A;  2IU3 A;  4X65 B;  1K3E A;  4XBF A;  2O57 A;  3QO8 A;  5EIB D;  1YI2 V;  3CXC U;  1QLE C;  1HNZ O;  2QTO A;  3SR2 C;  5IWA B;  1P84 F;  2WLH A;  4JAS A;  1HDJ A;  1SS3 A;  5CA0 B;  1R6T A;  4I7Z B;  1K5Q A;  3E89 A;  5LP6 C;  1YJ9 V;  3FB8 C;  2E75 B;  4X66 O;  5H6R A;  4BIO A;  4XDL A;  2AHZ A;  4EB6 A;  3ZRX A;  1H2K A;  4UCO A;  2XAQ A;  4PA4 A;  2JK5 C;  2X7R B;  2R9R B;  1COW G;  1HNX O;  4GKK O;  4HZ3 A;  4LF7 B;  5BMV B;  2DWD C;  3VQX A;  1SA0 A;  3VQY A;  2DWE C;  4DR2 B;  3B2E E;  5JJJ B;  3FYI B;  4JI0 B;  4KFM A;  2EIL B;  1I08 A;  1N36 O;  1JPX A;  1W0J G;  4LF6 B;  3MAQ A;  3L74 H;  2CTW A;  1IBM O;  1OV9 A;  1AP5 A;  4X1Y A;  3N2G A;  3P3P A;  3QNE A;  4CC5 A;  2JS3 A;  2HEP A;  4R6Z A;  4JI6 O;  3K5O A;  3HKD B;  4JAA A;  4MS2 A;  1GK9 A;  4DV4 O;  1N36 B;  4J7J A;  4ICG A;  2DQ3 A;  3HKC A;  3GB7 C;  4EFB A;  2QWQ B;  5HFM A;  5B1O A;  5KAI Z;  4K3A A;  3K03 A;  5FL7 G;  4FLV A;  1VQP V;  4MVS A;  1SRY A;  1XUQ A;  1Z5W A;  3JD1 A;  2C2A A;  2EIJ C;  1UJW B;  3I5D A;  3VQV A;  1I0H A;  1QVF U;  2X6C A;  1OCZ C;  1NKD A;  5C93 A;  2GV9 A;  2CGN A;  1RSO A;  3T1Y B;  2CE4 A;  1F7Y A;  1B6Q A;  2LO1 A;  2BTO A;  2E5L B;  4RQF A;  4ZOL A;  1EM1 A;  2CK3 G;  2GBO A;  2GTA A;  4FM1 A;  3AG2 B;  3K06 A;  4DV6 B;  1Q81 W;  1KD1 W;  3OMN B;  4RUF A;  2QWN B;  4C7U A;  1Q86 W;  2UXC B;  2Z0A A;  1PNK A;  2QEX V;  3L73 H;  2P4K A;  5B1B B;  2QKC A;  1XNR B;  2HFE C;  3QO5 A;  1IUR A;  1MG1 A;  3WB0 A;  4DV6 O;  2KG7 B;  2Q9L A;  1P49 A;  3ZBH A;  2BOB C;  2B1G A;  3SYP A;  4WCE V;  4MVR A;  2YS8 A;  1SQG A;  2UU9 B;  1Y4M A;  2QWO B;  4H33 A;  1NS1 A;  4GX0 A;  3X2Q C;  3ASO C;  4DV3 O;  2OWO A;  4DV0 B;  2HHH B;  1RPO A;  1QHT A;  3JSN A;  2W0X A;  1CEZ A;  1KUQ A;  2VWJ A;  3G71 V;  4CBC A;  4FZ0 A;  1WN7 A;  1VIB A;  4EEQ A;  2BTQ A;  2OTL V;  3CCL V;  4DV2 O;  1JA8 A;  1Y74 B;  1GN3 A;  5EYP B;  1B04 A;  5KHI A;  5F2V O;  2XT9 A;  5BY1 A;  1WPX A;  4AHC A;  1K9M W;  2XND G;  1WB8 A;  3N27 A;  4JYB A;  2QM4 A;  4A5U B;  1V54 B;  2JVD A;  5IJ9 B;  3CCS V;  2AZ2 A;  3B8M A;  4JTD B;  4K0K O;  2EIN C;  1S76 D;  1K5S A;  3WG7 C;  3H1L H;  1L0N H;  4JZ2 A;  4BAY A;  4DR1 B;  5BXZ A;  4ZHQ A;  4YHH B;  4IGG A;  3IC9 A;  3UO3 A;  1GAX A;  4NXN B;  4G27 B;  3CSX A;  1EN6 A;  3OFN G;  2UUC O;  1D5N A;  2FKX A;  4DUY B;  1WP8 A;  4UVB A;  4B7K A;  4YHH O;  2YXL A;  4TQD A;  1IBK B;  2F95 B;  2L35 A;  3Q4H A;  3L9D A;  4LF5 O;  1XOU A;  1J5E B;  4Z1M G;  2YIB A;  4DV1 O;  1M57 B;  4O2B B;  4B3S B;  1L1F A;  5J2T B;  1X59 A;  1VF5 B;  4NTX A;  2H3O A;  3SPJ A;  3FB6 C;  1SA0 B;  3RW0 A;  1LNQ A;  4NTY A;  3CJH A;  5FNV A;  1M4U A;  4JYY A;  2WLI B;  5CBH A;  5EBW C;  1RFY A;  1YTF B;  4LF8 O;  2N74 A;  3CYO A;  2Q6A A;  3G6B A;  2HKO A;  1EFR G;  4TT3 G;  1PPJ H;  1S5H C;  3ZIA G;  2A9H A;  2YSU B;  2A06 H;  3ML0 A;  3GVM A;  3E22 A;  1JR9 A;  2UXD O;  3CD6 V;  1DLB A;  3K59 A;  1R6K A;  4F6R B;  4RWU A;  4DV4 B;  5IYZ B;  2Q0A A;  4IIJ B;  1TGO A;  4J11 A;  1KP2 A;  3SJB C;  2IM9 A;  1TUB A;  3CRQ A;  4X66 B;  3RVZ A;  3CRC A;  1K7D A;  2NNU A;  3JD4 A;  1OZ0 A;  5J2U A;  2OIE A;  2PYJ A;  3EVK A;  5LBQ A;  1NR7 A;  2QSA A;  4JI7 B;  1W0K G;  1YCI A;  4F6E A;  1PNL A;  3C3T A;  4JI3 B;  2OCH A;  1JFF A;  2VRZ A;  1NTK H;  2UXC O;  4LWS B;  5KA5 A;  1YZB A;  4WFB V;  1AJP A;  1GN2 A;  4FM0 A;  3B77 A;  5LA6 B;  3QG5 A;  1KQS U;  2WA4 A;  1M90 W;  4MW3 A;  2JS5 A;  4I0X A;  3JAS B;  2VQE O;  2H94 A;  4DRX A;  1T5E A;  2JEU A;  5DED A;  1LR1 A;  3ASN C;  2EIK C;  1JJ2 U;  1NH2 D;  1N32 B;  1SES A;  3ZHU A;  1QLE B;  2CTP A;  3WU2 Z;  5LOV A;  3JAM N;  2CTR A;  3CRR A;  4K35 A;  2OCC C;  4MVM A;  4J42 A;  5KHJ A;  1B3Q A;  3JAL B;  1RM1 B;  1Q5O A;  2RJZ A;  5EK0 A;  1SER A;  3BA9 A;  1XIL A;  3F5T A;  4O4L A;  5FPR A;  2UUB O;  4ASU G;  1NTZ H;  4FFB B;  2Q7E A;  4WBN B;  4PDR A;  5L3E A;  1Q3E A;  1K4C C;  5LMN O;  3E8F A;  2B9Z A;  3OR7 C;  4O4H A;  3UKM A;  4WFG A;  5FLX N;  1MZF A;  2CDY A;  5LXT B;  2ITD C;  4W4K A;  3NXS A;  2Y0P A;  3ZMS A;  4X1I A;  1OCC B;  2ARH A;  4I50 B;  4YXW G;  1IXB A;  4GKJ O;  4LC1 A;  5GON A;  3KCY A;  4JV5 B;  1BSM A;  2Q5Z A;  4GX2 A;  4D6T H;  3K9S A;  3JCZ A;  3CX5 F;  4LF9 B;  2EJR A;  3AG4 B;  1VQ9 V;  2WLL B;  3W7U A;  1TA8 A;  1XBL A;  1W59 A;  3D3I A;  1ZLZ A;  3ZMZ A;  1ZTE A;  3U11 A;  3RYF A;  1H8H G;  1XRE A;  4PI2 A;  4JI4 B;  3TK1 A;  2AW9 A;  1AB3 A;  1OCR C;  1AI4 A;  3E8G A;  4BW9 A;  4EKW A;  4OXS A;  3ABM C;  4IYH A;  3I56 V;  1NT2 B;  1JJO A;  1XHZ A;  1OCZ B;  3K0D A;  1AJN A;  2Q7G A;  3HB3 B;  3BHP A;  1M93 A;  3JCU Z;  3VQW A;  3FD9 A;  1MSW D;  2ZR2 A;  4BW5 A;  5DN6 G;  4HAM A;  3RVY A;  3OAA G;  3E86 A;  1G8M A;  3L72 H;  4IIJ A;  4NXN O;  1V55 C;  1VF6 A;  4X20 B;  1V9P A;  5B1B C;  1XI1 A;  3RWR D;  1RPR A;  3ZRW B;  4ABM A;  1QR8 A;  1VQK V;  4JYC A;  2ADP A;  3AK2 A;  1TVK A;  4YY3 B;  3EXA A;  3IJ4 A;  2DYR C;  2RMK B;  4JI5 B;  1D2D A;  2R70 A;  4TOI A;  5JJN B;  4H44 B;  5K1X A;  1J5E O;  2BCC H;  4JGS A;  1JQ0 A;  2F4V O;  2EZO A;  1KB9 F;  4BR6 A;  5CBF A;  2HLD G;  1XL4 A;  5KUK A;  4QGP A;  2KKW A;  5A2Q N;  3K08 A;  2EX3 A;  4JI5 O;  3A0H Z;  4LF7 O;  5KHG A;  4GCZ A;  2ZNI A;  2FML A;  2DYS C;  2Y4U A;  4Z2W A;  3FFQ A;  2KSD A;  4UVA A;  1DGS A;  3ETG A;  2OIG A;  1YEW A;  2RN9 A;  4LF6 O;  2XUM A;  1QR9 A;  4TV9 A;  3TXS A;  4WBN A;  1XMQ B;  4UCT A;  1MZE A;  1WNS A;  1WAZ A;  4JAV A;  5EIB C;  2HJD A;  4TQF A;  4D7S A;  4RQE A;  2ZM6 B;  1S72 V;  1Q7Y W;  1IBL B;  4MVU A;  2F93 B;  2HR3 A;  5CA1 B;  4PJ0 Z;  3JAT A;  2PZS A;  1AVM A;  2ZT9 B;  2ZIM A;  4JAU A;  4X9Q A;  1Y6X A;  3TCU A;  1SC5 B;  5DM6 V;  3H9V A;  3HKE A;  2JRI A;  1AI7 A;  4KUM A;  4DR6 O;  1YSC A;  1NU1 H;  4LFB B;  1PL0 A;  3TET A;  2HG5 C;  3DSQ A;  1MOF A;  3OGI B;  2GUZ B;  2QKS A;  3BVO A;  4DR1 O;  4FLX A;  4LNU B;  5DEC A;  1D5A A;  2CTQ A;  3LNM B;  5L3G A;  4FVM A;  3CME V;  5EC2 C;  1M57 C;  3K04 A;  4K8X A;  1NTM H;  1VQ5 V;  2F66 C;  3RYI B;  2YUA A;  4QJF B;  4DK0 A;  1NH2 B;  3CRM A;  5CA0 A;  4FLW A;  4DV7 O;  1JFF B;  5JH7 A;  5LHH A;  1AI6 A;  1FFX A;  4YJ3 B;  4UV9 A;  4JI7 O;  5KA6 A;  1Y74 A;  5EC1 C;  2YXH A;  2Q68 A;  3OUF A;  1JCH A;  3E8B A;  3MD0 A;  2E3C A;  1YHQ V;  1XNQ O;  1VQL V;  2ODM A;  5L3B A;  1K97 A;  4CC6 A;  4K8Z A;  4IHJ A;  5KUM A;  5CB4 A;  2GUZ A;  4ZBM A;  4GKJ B;  2VQE B;  2Y48 A;  4KHP B;  4PDL A;  3OD4 A;  1FS0 G;  3RGB A;  4FIP C;  1BMF G;  4PDM A;  4DV2 B;  1Y76 B;  1HNW O;  3CCV V;  1I94 O;  1R3L C;  1IBM B;  4I9Q A;  5B1A B;  2P5O A;  1Q8I A;  1FFX B;  2WLK A;  3OM3 B;  4YJ3 A;  3UM7 A;  2F43 G;  3J7A U;  5JH7 B;  3CHX A;  2QR4 A;  3BPZ A;  1IXM A;  3LSQ A;  5EZY A;  1I94 B;  4I5S A;  1I5Y A;  1PNM A;  2V4D A;  3BEH A;  4UUJ C;  1SQX H;  2EUL A;  4J7Z A;  5C8Y A;  4PDV A;  2LGW A;  4J9Y B;  3WB1 A;  1H8E G;  3OR6 C;  1QVG U;  1KEC A;  1GM8 A;  1H2M A;  2EBO A;  3CJH B;  1HNX B;  4JI1 B;  1K8A W;  4B3M B;  3UT5 A;  3QF7 A;  4DW1 A;  1M5I A;  1US6 A;  3T4Z A;  1FJG B;  1E1Q G;  3ZHR A;  3P30 A;  1P7G A;  4J7K A;  4O4J B;  3C3S A;  4DR3 B;  3RFR A;  5D5P A;  5CA1 A;  4UV8 A;  1N34 O;  2E74 B;  4JI3 O;  4P2Z A;  1MNG A;  2ILM A;  2HP8 A;  4L87 A;  4TUY A;  3OMI B;  2NN4 A;  1TAE A;  1PL4 A;  3ZHS A;  1SF9 A;  5E79 Z;  1NZ6 A;  4JF3 A;  1KP3 A;  1YF2 A;  4FM2 A;  1H2N A;  2QWR B;  4I4T A;  3HKB B;  2ZDI A;  2ZNJ A;  4QPK A;  3ZHT A;  2A3Q A;  2EJ7 A;  3FB5 C;  4I0X B;  4JTA B;  4DUZ O;  3J81 N;  1PM9 A;  4QNH B;  4X64 B;  4J9Z B;  4G2K A;  2YXY A;  2ZM6 O;  5LYJ B;  3JAW B;  2AHY A;  2XAF A;  4X8A A;  2BSK B;  2LJ2 A;  2D2C B;  4X1K B;  3ZHV A;  1MA1 A;  2K9P A;  3RBZ A;  1IBL O;  4K0K B;  4DUZ B;  2JDI G;  1TUE B;  3CCU V;  2WLL A;  3RN4 A;  4NYK A;  3TGU H;  4CH4 A;  4HNA B;  4HYO A;  4X20 A;  4QPJ A;  2UXB O;  4FLT A;  3QTC A;  3VOU A;  5LHI A;  4DR6 B;  1N0J A;  1JVM A;  4YY3 O;  2LW7 A;  2LQT A;  5H9C A;  5GON B;  1OCC C;  1BE3 H;  3ABL C;  2HVJ C;  3JAR A;  4XDK A;  1SQF A;  2YI9 A;  3LNN A;  4UVC A;  3STL C;  2UU9 O;  3OT7 A;  5JVD A;  3JAR B;  2HHH O;  1Q6H A;  1VF7 A;  2F1M A;  5GW7 A;  5JJE B;  3HKE B;  4JI8 B;  1N33 B;  5B3S C;  1Q43 A;  1V54 C;  4TSF G;  4CS3 A;  2XHB A;  2EIM C;  3BY6 A;  4B3T B;  3WG7 B;  3IAY A;  1M9N A;  1KBH A;  1ZUQ A;  3OTO O;  4NB5 A;  4F4L A;  1FPO A;  2ZDI C;  4O4J A;  3OMA B;  3JAL A;  3CCQ V;  4G28 B;  1BHB A;  3APQ A;  5KMG B;  3G4S V;  1Q6I A;  1SQV H;  4PV1 B;  5K1P A;  4B3T O;  4PA7 A;  4P9P A;  3DTU B;  1EZV H;  3JD3 A;  3CE2 A;  2KQX A;  1F23 A;  4LF8 B;  4LNU A;  4LFA O;  3OTO B;  3STZ C;  1VQ6 V;  1M56 B;  3AG1 C;  4DR7 O;  1V55 B;  3B4S A;  1XL6 A;  3CRA A;  1SZT A;  3L71 H;  2RDC A;  3JAK A;  3K3W A;  5LA6 A;  1BQZ A;  1FYJ A;  4O2A B;  2DYR B;  5LMU B;  4AQY O;  2AGA A;  3ABK C;  4O4L B;  3JYC A;  4X1Y B;  4L8J A;  1PKX A;  3SYC A;  4CS2 A;  3D36 A;  1ENV A;  3SPI A;  4X65 O;  1KYO F;  3BAB A;  4AIL C;  2Z3Y A;  1R6N A;  1QQC A;  3DC5 A;  2QM8 A;  3CMA V;  4MSW C;  2WA3 A;  4FLY A;  3E83 A;  3ETD A;  4NKG B;  4DO2 A;  1BZK A;  3F7V C;  3P32 A;  3KCX A;  2LP7 A;  4I9W A;  4CZZ A;  5KHK A;  2NLJ C;  3OW2 U;  4LF9 O;  4LR3 A;  3THO A;  5KAF Z;  3BRC A;  1K34 A;  4IYI A;  1G4Y B;  4F6R A;  3LDD A;  2ZXW B;  2XAJ A;  3CP1 A;  5ITZ A;  4GZR B;  4DR2 O;  2YIC A;  3JAW A;  3ZRW A;  4PI0 A;  5EYP A;  4E2L A;  3W7X A;  1PV0 A;  1CP9 A;  2YIA A;  4DV5 O;  1L8D A;  1IVS A;  4LCU C;  3T1Y O;  1J95 A;  1ORQ C;  2BE3 A;  1ZSP A;  2AXT Z;  4DR5 B;  2P4V A;  1K92 A;  4WFH A;  4WFF A;  5A9G A;  3C90 A;  1YVW A;  3K57 A;  4DR3 O;  4U7N A;  3AG7 A;  5LGT A;  2CH7 B;  1PP9 H;  2X0L A;  3HKC B;  3G67 A;  2Y69 B;  3UO2 A;  5H2F Z;  2E76 B;  4HNA A;  1QBZ A;  5TIS Z;  3WFV A;  3HPL C;  3E22 B; 
#chains in the Genus database with same CATH homology
 5B1B B;  1HWY A;  2HFE C;  2GSM B;  2HJF C;  1SET A;  3QO5 A;  4JAU A;  3TCU A;  5DM6 V;  5J9P C;  2IH1 C;  3ETE A;  1MG1 A;  4KUM A;  1AI7 A;  2Q69 A;  3K9A A;  1YSC A;  2XOK G;  4UXN A;  1ZWI C;  2IW5 A;  1PL0 A;  2BOB C;  2B1G A;  4GT1 A;  3SYP A;  3CCJ V;  4WFE A;  3TET A;  4WCE V;  4RAI A;  2HG5 C;  3OEH G;  4H37 A;  4LBE C;  4MVR A;  3W7W A;  1MOF A;  4QIW F;  1VQN V;  2OCC B;  3R65 A;  1Y4M A;  4H33 A;  2QKS A;  4GX0 A;  3X2Q C;  2JIZ G;  2EIM B;  3ASO C;  2QM7 A;  4BIZ A;  5B1A C;  5CBG A;  1RM1 C;  1RPO A;  4RUE A;  3FKS G;  3ZJZ A;  3T1C A;  1CEZ A;  4ZKI A;  3G71 V;  4CBC A;  3LNM B;  5L3G A;  2EIJ B;  3OGC C;  2PI5 A;  3CME V;  5EC2 C;  2B5U A;  2OTL V;  3CCL V;  1GM9 A;  2EIK B;  2EZP A;  3LDE A;  3G6E V;  1M57 C;  4MTX A;  2W0F C;  3K04 A;  4MVO A;  4FJC C;  2LFS A;  1VQ5 V;  3EFF K;  4QJF B;  1NH2 B;  4MW8 A;  5LHH A;  1WPX A;  1AI6 A;  1R3K C;  5LGU A;  1K9M W;  2XND G;  4UV9 A;  5L3D A;  2Z5U A;  2JJ2 G;  4JYB A;  5KA6 A;  3W7S A;  5EC1 C;  3T2M A;  1V54 B;  1FXH A;  2Q68 A;  3OUF A;  1JCH A;  3E8B A;  3MD0 A;  4PA9 A;  1M56 C;  5L3C A;  1Y66 A;  3CC4 V;  3CCS V;  5E1A C;  3B8M A;  4JTD B;  2X6A A;  2EIN C;  1S76 D;  1K5S A;  4N23 A;  1YHQ V;  3WG7 C;  1VQL V;  3LDC A;  4FMT A;  5EBM C;  2IU0 A;  4BAY A;  1NJI W;  3SPH A;  3B8N A;  3CC2 V;  2WLN A;  5L3B A;  1K97 A;  5KUM A;  3AG4 C;  4ZBM A;  4G27 B;  3VBB A;  4PA6 A;  1OCO B;  3ABK B;  2Y48 A;  4PDL A;  3ZMT A;  1FS0 G;  3OFN G;  4FIP C;  1BMF G;  4PDM A;  3CCV V;  3CCE V;  1R3L C;  4UVB A;  1OCR B;  5B1A B;  1FXK A;  3OM3 B;  2WLK A;  3UM7 A;  2F43 G;  4QE9 A;  1JX9 A;  3JD2 A;  3LUT B;  4Z1M G;  1IXM A;  3LSQ A;  2XAH A;  2UXX A;  4JPR A;  1M57 B;  4I5S A;  1I5Y A;  1PNM A;  4UUJ C;  3BEH A;  1L1F A;  3SYQ A;  2XAG A;  3ABU A;  2M7W A;  4PDV A;  5IYC O;  3CPW U;  1YIJ V;  4J9Y B;  1FFT B;  3SPJ A;  1H8E G;  3OR6 C;  3FB6 C;  1QVG U;  5IYD O;  1R73 A;  2K1E A;  3RW0 A;  1KEC A;  1LNQ A;  2P67 A;  1GM8 A;  3EHB B;  3I55 V;  3ABM B;  2EIN B;  2EBO A;  2WLI B;  1K33 A;  5CBH A;  5EBW C;  1K8A W;  4QE7 A;  3E35 A;  2XAS A;  2ZD9 A;  1YTF B;  4WF9 V;  1VQM V;  1BL8 A;  2ZXW C;  1YTF D;  2QA4 V;  2OTJ V;  2ITC C;  3SYA A;  3CYO A;  2Q6A A;  2HKO A;  3T4Z A;  1EFR G;  4TT3 G;  1E1Q G;  1S5H C;  2W6J G;  3ZIA G;  2A9H A;  1Q82 W;  3P30 A;  1OCO C;  1R3I C;  2YSU B;  5HFL A;  4RO2 A;  2IH3 C;  2D3O W;  3ML0 A;  4X89 A;  3MHS C;  2P90 A;  1NR1 A;  4X88 A;  3AG3 B;  5IY5 B;  3A0R A;  4XDJ A;  4UV8 A;  3FB7 C;  3CD6 V;  1DLB A;  2B1I A;  1S0V A;  1R6K A;  1E79 G;  4MVQ A;  4P2Z A;  3CCR V;  4BIU A;  5CMU A;  2OT5 A;  1S77 D;  1FXK B;  4GX5 A;  5CN0 A;  1I5X A;  5CA3 A;  4L87 A;  2DYS B;  3ABT A;  3OMI B;  1NVP D;  5BZB A;  1ROP A;  3ZN1 A;  1DF5 A;  1VQ8 V;  1KP2 A;  3SPC A;  1DF4 A;  3ZRV A;  4R50 A;  3F7Y C;  2WLI A;  4JF3 A;  1KP3 A;  5IDJ A;  2Y69 C;  1VQO V;  3RVZ A;  3ZMU A;  1K7D A;  2PI4 A;  2ZDI A;  3OUS A;  5B3S B;  4QPK A;  4MTG A;  2IJH A;  2NNU A;  3JD4 A;  1OZ0 A;  3CC7 V;  3FB5 C;  2WAM A;  4JTA B;  3DGE A;  3E2E A;  2A79 B;  4QNH B;  4J9Z B;  4G2K A;  1F51 A;  5LBQ A;  1NR7 A;  1QLN A;  1W0K G;  2W6I G;  1PNL A;  2AHY A;  2XAF A;  4X8A A;  1N8R W;  4MTF A;  3RBZ A;  5LHG A;  3FYE B;  2R9I A;  5KA5 A;  3ZMV A;  2JDI G;  4WFB V;  1TUE B;  1M1K W;  1AJP A;  2WLL A;  3CCU V;  3W7T A;  2WLM A;  3B77 A;  4HYO A;  3AG3 C;  5IY5 C;  1KQS U;  3SPG A;  3ZN0 A;  4QPJ A;  1P7B A;  3AG2 C;  3VOU A;  5LHI A;  2ZQM A;  1W2B U;  1JVM A;  5H9C A;  1M90 W;  4MW3 A;  2MK3 A;  1E1R G;  1OCC C;  2WWW A;  3AG1 B;  3OEE G;  3ABL C;  1GM7 A;  2JEX A;  2H94 A;  2HVJ C;  1OHH G;  2UXN A;  1FXK C;  4UVC A;  4XDK A;  5B1N A;  4MVZ A;  1S3J A;  2JEU A;  3STL C;  4LP8 A;  2V1D A;  3ASN C;  2EIK C;  1P4R A;  3T4D A;  1JJ2 U;  1NH2 D;  1JOY A;  1AR1 B;  2DW4 A;  2P7T C;  1DTO A;  1SES A;  1F4N A;  2X6B A;  3E8H A;  3SYO A;  2WPD G;  1EBO A;  1QLE B;  2P6J A;  4PA3 A;  5L3F A;  5GW7 A;  2HVK C;  1AI5 A;  2LFR A;  2QE7 G;  2OCC C;  3IGA C;  4MVM A;  5B3S C;  4TSF G;  1V54 C;  3X2Q B;  2EIM C;  3ASO B;  3QO7 A;  3BY6 A;  1RM1 B;  1SER A;  1K4D C;  1QCE A;  5EK0 A;  4WFA V;  3LSS A;  4Q20 A;  4KP4 A;  3F5W C;  2BOC C;  3WG7 B;  1M9N A;  1NBM G;  4F4L A;  2ZDI C;  4ASU G;  1FXV A;  1CPY A;  3M99 B;  3OMA B;  4P30 A;  3CCQ V;  4G28 B;  1VQ7 V;  3KG2 A;  1BHB A;  4PDR A;  5L3E A;  1MAB G;  2ATK C;  1THZ A;  3G4S V;  3GWO A;  2WSS G;  1K4C C;  3K79 A;  1BHA A;  4PA7 A;  3E8F A;  4P9P A;  3DTU B;  3OR7 C;  3JD3 A;  3UKM A;  4WFG A;  1F23 A;  3IC7 A;  1GKF A;  3JD0 A;  2ITD C;  2JJ1 G;  4N21 A;  3STZ C;  3NXS A;  3ZMS A;  1VQ6 V;  1EZJ A;  2DQ0 A;  1M56 B;  2IJI A;  4FPP A;  1OCC B;  1PD3 A;  3AG1 C;  4YXW G;  1V55 B;  2FTK A;  1GMG A;  1XL6 A;  1YJN V;  3PJS K;  4LC1 A;  3ASN B;  4JTC B;  1SZT A;  4DXW A;  1F4M A;  4GX2 A;  2ZR3 A;  2IJK A;  3JCZ A;  1KC8 W;  1H38 A;  2IU3 A;  3K3W A;  1K3E A;  4XBF A;  2EJR A;  3AG4 B;  1VQ9 V;  2DYR B;  3ZRS A;  3QO8 A;  2WLL B;  3W7U A;  1YI2 V;  3CXC U;  3ABK C;  1QLE C;  3D3I A;  3JYC A;  2QTO A;  3K0G A;  3ZMZ A;  1H8H G;  2WLH A;  4JAS A;  1PKX A;  3TK1 A;  3SYC A;  3IFX A;  1OCR C;  3D36 A;  5H6Q A;  1AI4 A;  1ENV A;  3E8G A;  1K5Q A;  3SPI A;  4EKW A;  3E89 A;  1K73 W;  4OXS A;  1YJ9 V;  3ABM C;  3ZCC A;  3FB8 C;  5LGN A;  2A0L A;  3I56 V;  5EBL C;  3AEI A;  5H6R A;  2Z3Y A;  2H8P C;  4TWK A;  1R6N A;  4XDL A;  1OCZ B;  2AHZ A;  3K0D A;  3ZRX A;  2QM8 A;  1AJN A;  3CMA V;  2XAQ A;  4PA4 A;  4MSW C;  2JK5 C;  3HB3 B;  2X7R B;  3E83 A;  3ETD A;  2R9R B;  1COW G;  4DO2 A;  1AJQ A;  1MSW D;  4HZ3 A;  2ZR2 A;  3F7V C;  3P32 A;  4BW5 A;  5DN6 G;  4HAM A;  3RVY A;  2DWD C;  2LP7 A;  4I9W A;  3OAA G;  4CZZ A;  1VQ4 V;  3E86 A;  2NLJ C;  2DWE C;  1G8M A;  3OW2 U;  2V7Q G;  1ARO P;  3FYI B;  4KFM A;  2EIL B;  1V55 C;  1GTO A;  1K34 A;  1G4Y B;  5B1B C;  1KKD A;  1JPX A;  1GO3 F;  1RPR A;  1W0J G;  3LDD A;  3ZRW B;  2ZXW B;  1QR8 A;  3H01 A;  1VQK V;  2XAJ A;  4JYC A;  2IJJ A;  1NQT A;  3CP1 A;  3QNE A;  2Q67 A;  4R6Z A;  3ZRW A;  2DYR C;  4E2L A;  3W7X A;  3OE7 G;  4MS2 A;  1GK9 A;  3MHH C;  2DQ3 A;  1CP9 A;  1WLE A;  4JGS A;  3GB7 C;  5HFM A;  1JQ0 A;  2EZO A;  4LCU C;  5B1O A;  3K03 A;  1J95 A;  5CBF A;  2HLD G;  1ORQ C;  2YEV A;  1XL4 A;  5FL7 G;  1VQP V;  4R7C A;  4MVS A;  5KUK A;  1SRY A;  1R3J C;  3K08 A;  3JD1 A;  2C2A A;  2EIJ C;  4GCZ A;  1UJW B;  1K92 A;  4PEL A;  2DYS C;  1QVF U;  2X6C A;  4P9O A;  4WFH A;  4WFF A;  1OCZ C;  4UVA A;  2YEV B;  1NKD A;  3ETG A;  5C93 A;  2KB1 A;  4R8C A;  1NVP B;  2WLJ A;  4U7N A;  5LGT A;  4MT8 A;  1YJW V;  1B6Q A;  2X0L A;  3CCM V;  4U7O A;  2GHY A;  2Y69 B;  1QR9 A;  1H2G A;  4RQF A;  2CK3 G;  4GX1 A;  3AG2 B;  4FK5 C;  3K06 A;  3SJQ C;  5IYB O;  4JAV A;  4RQE A;  1Q81 W;  1QBZ A;  4MTO A;  1KD1 W;  3WFV A;  1S72 V;  1Q7Y W;  3OMN B;  4RUF A;  4MVU A;  2EIL C;  2HR3 A;  3ABL B;  3HPL C;  1Q86 W;  1PNK A;  2QEX V;  1YIT V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...