4J9YB

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
89
Chain Sequence
b'GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
publication title Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/calcium binding
total genus 35
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2013-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4j9yB00
4LP8A 2YEVA 2W0FC 1JVMA 1R3IC 3SPHA 2Q69A 3SPCA 4DXWA 3FB6C 5CBGA 2X6AA 4PA7A 5KUKA 4MSWC 1LNQA 1XL4A 3SYOA 3RBZA 4MVMA 2HVJC 3OR6C 4X88A 4R7CA 4XDKA 5EBLC 2NLJC 3FB5C 3RVYA 5EBMC 3BEHA 5E1AC 3LDEA 3SYQA 2A9HA 1KKDA 2A0LA 2JK5C 4MVZA 2BOBC 3IGAC 2HFEC 3F7VC 2WLKA 4MVRA 4RUEA 4GX5A 2OCCC 1ZWIC 2AHYA 4PDMA 2KB1A 3ZRSA 1J95A 4ZBMA 4HYOA 1G4YB 4MW3A 4R50A 3T2MA 4XDLA 1M56C 2P7TC 2EIJC 3AG4C 2WLIB 3F7YC 4G27B 1R3KC 2BOCC 4R8CA 3AG2C 5B1AC 2ZD9A 3SPGA 2A79B 4LBEC 3T4DA 3ZJZA 1R3LC 3ABKC 2WLLA 5EC1C 4QNHB 3E89A 1OCRC 5J9PC 1XL6A 3K04A 4P9OA 3X2QC 2ITDC 4MTGA 2K1EA 2WLHA 3OUFA 1V55C 3FB8C 2Q68A 4CBCA 2HVKC 2WLJA 5B1BC 4WFFA 2DYSC 4TWKA 3RVZA 3WG7C 4X89A 2EIKC 3K0GA 3T1CA 2DYRC 5KUMA 3E8FA 1K4CC 1R3JC 2WLMA 3LDCA 4OXSA 4PDLA 2H8PC 4JTAB 4MVSA 4PA4A 2HJFC 5IY5C 2Y69C 4BW5A 2WLNA 2R9RB 3AG3C 3LDDA 1V54C 4H37A 3T4ZA 2DWDC 4GX1A 4PDRA 3ABMC 1OCCC 3OUSA 3UM7A 3E8BA 3LNMB 3STLC 3K0DA 3ASNC 3KG2A 2WLLB 4PA3A 3UKMA 4QE9A 3JYCA 4I9WA 3E86A 2AHZA 3OR7C 5BZBA 2X6BA 4RAIA 3SYPA 1QLEC 3E8HA 2EILC 2Q6AA 4QE7A 2ITCC 4GX0A 4PA6A 5CBHA 2QKSA 4MVQA 5B3SC 1M57C 4RO2A 3IFXA 2EIMC 2Q67A 3K08A 4HZ3A 4MS2A 4P30A 2QTOA 4JTCB 1K4DC 3RW0A 4P2ZA 4MVUA 2WLIA 3K06A 4WFEA 4LCUC 4EKWA 3FB7C 3TETA 4XDJA 3SJQC 3E83A 3STZC 4G28B 3K03A 4KFMA 3HPLC 2IH1C 2ZXWC 3ASOC 4RUFA 4WFHA 3SPJA 2ATKC 4J9YB 3F5WC 5EK0A 3SPIA 4P9PA 2HG5C 1OCZC 4J9ZB 4R6ZA 2DWEC 3OGCC 3GB7C 3E8GA 3VOUA 1BL8A 3PJSK 4MVOA 3TCUA 3SYAA 5EBWC 4PDVA 3ABLC 4JTDB 5EC2C 5CBFA 4GX2A 3AG1C 4MTOA 4X8AA 4WFGA 1P7BA 2X6CA 2IH3C 4MTFA 3R65A 4UUJC 4H33A 4PA9A 4F4LA 2EINC 3LUTB 4MW8A 1OCOC 3EFFK 1ORQC 1S5HC 3SYCA
chains in the Genus database with same CATH superfamily
2ETNA 3UO2A 3CD6V 2GUZA 5LA6A 4PA7A 4YIOA 3ASOB 4MSWC 1S77D 3NXSA 4GKJB 3RVYA 2UXNA 5EBMC 2A0LA 5JVDA 3CCMV 2VS0A 3F7VC 1FS0G 3ETDA 3SJBC 2EINB 4LFBB 2AHYA 5BR8B 1IBMO 1K5SA 2EBOA 1HR0B 1AR4A 1DGSA 3S3WA 4F6EA 3T1YO 1WLEA 4R8CA 5K1XA 4I55A 4JYAO 4JV5O 2V4DA 1VEWA 3ZS8C 5DECA 3OUFA 5KHIA 1M1KW 1AP5A 3QG5A 2DYSC 5IT9N 2IM9A 3K0GA 3T1CA 1Q6IA 4PDLA 1W2BU 5EIBC 4X65O 5H6QA 4FLYA 2PF4E 3KG2A 4PA3A 1N0JA 1XNQO 3OMIB 3HKBA 3OR7C 5LHIA 5LMUB 4IT5A 2EILC 2Q6AA 2ITCC 4ZI7A 4I5SA 1G8MA 4RO2A 4LNUB 1DK1A 1KP2A 2P6JA 3S3XA 4Z1MG 2NR5A 3HB3B 1AR5A 2WLIA 4BWAA 2F93B 5JJEB 4IL6Z 4G28B 2PTMA 1FFTB 2IH1C 2ZXWC 1YZBA 4DUZO 4J7ZA 3E8GA 2ZNJA 3KCYA 5CA0A 5FL7G 1GTOA 3R65A 1Y74A 3AG7A 4UFZA 2P22C 4E2LA 1J5EB 4UVBA 3TGUH 4BIOA 2XOKG 5LMNO 4DXWA 5FPRA 4JF3A 1TAEA 1QR8A 2UUAO 1XL4A 3F5TA 4N23A 1Y67A 3AEIA 1XOUA 2D3OW 1CXZB 1K97A 3M7MX 2HKOA 4D7SA 3K5MA 3HKDA 4ZOLA 3CE2A 5LGTA 4W4LA 2EJRA 1SZTA 1HW7A 4DR3O 1MMMA 4NTWA 2E3CA 4RQEA 3X2QC 2IU3A 1JPXA 4TWKA 3WG7C 4X89A 3RYFB 4LFCB 4JI4O 1IURA 2B9ZA 1M90W 5B5EZ 2ZDIC 5B66Z 1MZFA 1R6TA 3ZRVA 3CJHA 2PYJA 1YHQV 2QWOB 3BRCA 1K5QA 1WA8B 3G67A 1XMOO 1P84F 5H6RA 1JX9A 2GSMB 2B1GA 3JYCA 4UV8A 5LHGA 2W6IG 4U3JA 5L3EA 2P4KA 4CH6A 2XAQA 5LHHA 3ZEDA 1RSOB 5KA6A 4TV9B 3ASNB 3SPIA 4O2AB 1OCZC 4X20A 2UXCB 1Q3EA 1JJOA 4O4HA 1TUBB 3TXSA 4BR6A 1AB3A 4MW8A 1SQBH 5CN0A 4ZHQB 4N21A 3TK1A 1UJWB 1VF7A 4HBNA 1EFRG 1FXKC 4DW0A 2C2AA 2VWKA 3BY6A 2YUAA 1Q81W 2Q4PA 4I7ZB 2ARHA 4ICGA 1LR1A 5JH7A 2JJ1G 2JK5C 2R70A 2QWQB 1ZAUA 2YSUB 4F6RA 2ZIMA 1QNMA 1G4YB 3T2MA 4JI5O 2OCHA 3B77A 2EIJC 3IJ4A 2QJ1A 2GUZB 5LA6B 1RPRA 3QO5A 2YC0A 2ITDC 5F2VO 3U0ZA 4DV6O 2WLJA 2JRIA 5JVDB 1Q86W 1O9GA 2CH7A 1Q43A 5C8YA 4LF8B 3KKYA 2RQ6A 1OCCB 3AG3C 5B1AB 4YHHO 4JI1O 4I55B 1UPGA 4UCRA 3UKMA 1HNXB 2CK3G 5BZBA 1T5EA 3OTOB 1MNGA 1A32A 1QCEA 2HJDA 5FNVA 2ADPA 1GN2A 4D6TH 4NYKA 2VQFO 1YIJV 4Q20A 3ASOC 4IHJA 4CH4A 4J9YB 1UFIA 1VQOV 3OM3B 1QLEB 3HKBB 4KP4A 3P3NA 3GVMA 2KQXA 2EINC 2KG7A 2V1DA 4AHCA 5DM6V 3I5DA 2W0FC 3WB0A 3SPHA 1XHZA 5CBGA 4L87A 2Q7EA 3ABTA 1WAZA 2QKAA 2GV9A 3RBZA 5CA1A 3UQ8A 4K8XA 4JAAA 1HWYA 2WA4A 5GW7A 3CS5A 3CHXA 4RUEA 1XNRO 4DV4O 5KHHA 1R6NA 1JR9A 4J10A 1MSDA 1HNWB 1RFYA 5LYJA 1Y74B 2G38A 1YCIA 2XTAA 4OX9O 1US6A 2NN4A 4DR4B 4JASA 1RPOA 3F7YC 4DV7O 2PZSA 4LWSA 1ENVA 1H2MA 4TT3G 3H1JH 4LR3A 2EZOA 1DF5A 2JJ2G 2M6YA 1YSCA 2YIBD 4OXSA 3HKDB 3CCQV 4ZOLB 5LXTA 2MK3A 2PI4A 4I4TA 1PP9H 1NKDA 3SJAC 3FAVA 4BAYA 4EFBA 3I55V 1WPBA 1ROPA 2AHZA 3HKCA 2X6BA 4OPHA 1FAFA 4QE7A 2FKXA 2DYRB 4LFAO 2CTRA 4MVQA 2AZ2A 1H2LA 1NVPD 3VQWA 3JARB 4P30A 4JTCB 3TJTA 4DYLA 5KX5B 1JA8A 1NZ6A 3FYEB 4YXWG 3CJHB 5IYCO 3HPLC 1FJGO 4DK1A 2HG5C 3H1LH 1EN4A 5K1PA 4JI2O 4JAVA 3TXQA 3TCUA 3U10A 2Q0OC 4ABMA 1QLNA 2X6CA 5J2UA 5B3SB 1Q82W 5KLVH 4U3JB 3RYIA 4O4LA 1K7DA 5EYPB 1S5HC 1QVGU 4GKJO 3G6BA 2ZE5A 3CCJV 2AZ0A 3RT3C 2OWOA 1GAXA 4LFBO 5BR8O 4X20B 4LC1A 2JDIG 1HR0O 1K8AW 4PHZA 5IYZB 4QJFB 4EFEA 5C93A 2P67A 3L73H 1OV9A 1YVWA 4O4HB 2Y4UA 1N8RW 3UO3A 5LP6A 1FYJA 4NTYA 1FFXA 2IW5A 1OHHG 3K58A 2BOCC 2UUCB 2ZNIA 2ZD9A 3SPGA 2UUBB 3QNEA 4LBEC 5A9GA 3MHSC 3T4DA 1MABG 1R3LC 3DXRB 3H1IH 1AVMA 1I5XA 2IBZH 2A7WA 3JAKA 5JH7B 4FLVA 4FM2A 4GKKB 3JSNA 4NXMB 2WLMA 3JASA 2JGDB 3CC4V 2ZQMA 3D36C 1KYOF 4PA4A 1QHTA 5BXZA 3DGEA 5LMUO 1AI4A 3T4ZA 4PDRA 2LQTA 5TISZ 5IJ0A 3JAWA 3ASNC 2ZT9B 2W6JG 2CTWA 1P4RA 2P4VA 3ZMTA 1VQ9V 2CTQA 4CZZA 4CS2A 1XREA 3H1HH 1EBOA 3DC5A 3ZN1A 4I0XB 1K3EA 4EKWA 3ZMVA 1ZLZA 1SQFA 1GKFA 2JVDA 2B5UA 1XDCA 3SPJA 3W7SA 4J9ZB 1BSMA 1BZKA 1J5EO 1B06A 1OJHA 1P7BA 3UT5A 2EIMB 4KUMA 3W7WA 1BS3A 3EFFK 3GWKC 1Y4MA 2E5LB 5FNVB 4DK0A 2YEVA 4CS3A 2LP7A 5L3CA 3FB6C 2EULA 4IHJB 5JCOA 4WFBV 3NR7A 4B3TB 3ABLB 3CRCA 4UCSA 3LDEA 3LNNA 3ZHQA 3FKSG 2F66C 3JD1A 2KG7B 3ZCCA 4JPRA 3ZMUA 3QTCA 3HR0A 4DR7B 5B1AC 1IXBA 3CXCU 3L70H 4LFCO 3QVNA 1AP6A 1V55B 5BMVB 4PELA 1F4MA 2EIKB 2QWPB 4TSFG 4WFFA 2QTSA 2OCCB 3C3SA 2UXDB 1KUQA 5LYJB 5IY5B 4EEQA 2LW7A 4MVSA 3IC9A 2BE3A 1AI5A 1NR1A 1BE3H 2Y69C 1AJNA 4TV8A 2QR4A 3L72H 3STLC 3VBBA 1JCHA 4QGPA 3MHHC 1FXVA 1P49A 1QLEC 5JJJB 4BW9A 1NH2B 1I7FA 2F95B 4FM1A 2BCCH 3IFXA 2YI9A 3B40A 5LXTB 4GUNA 4I4TB 4XDJA 1GH6A 2UXCO 3STZC 2XNDG 4KFMA 1AJQA 2XAGA 3C90A 3FAVB 3E35A 5KA5A 1BL8A 2CTPA 4PDVA 3CCSV 2CUGA 3AG1C 4X8AA 1MA1A 4RQFA 4W4KA 2IH3C 1OZ0A 3W7XA 4B7KA 2DQ3A 2Q7HA 1D2DA 3ZRWA 4DV2B 2BSKB 3J80N 1JVMA 3M8AA 3ML0A 4PJ0Z 5KUKA 4JI8B 2XAFA 4DV3B 1GM8A 3FB5C 3BEHA 3OGIB 3CEIA 4MVZA 5J2UB 2RJZA 1QBZA 3RYIB 3ZRSA 2OIEA 5DEDA 1YTFB 4DW1A 4UXNA 4JZ2A 4X1YA 5CMUA 3CSXA 2CGOA 2WA3A 2JGUA 4FFBA 4JAUA 1BQ0A 3T1HB 1KQSU 3K57A 4LF8O 2UU9B 4RWUA 4DO2A 2P5OA 2ZKOA 5L3BA 3JD4A 4FZ0A 2DYRC 5KHJA 1HP8A 3LDCA 4NKGB 1X59A 3WB1A 2PGGA 1HNXO 2XT9A 1FFXB 1SERA 1JOYA 1HDJA 1L0LH 1XQ8A 1VIBA 4LF4B 3OTOO 1W0JG 3R66A 2XASA 1F51A 3BA8A 5LL6Y 2JEUA 3VQVA 4I50A 5DN6G 2QE7G 5B1BB 3JAKB 3G6EV 2QWRB 5L3DA 4PA6A 5B3SC 4KL1A 3SR2C 3RYHA 3K9SA 3JASB 1VQ8V 2PYLA 1XMQB 4A5UB 1ZTEA 1V54B 4GCZA 4Z2WA 3CRAA 1SQVH 4RUFA 2N04A 5IJ0B 1YI2V 2QDOA 3J7AU 3LSUA 3CCVV 3EHBB 3N2KA 2OTLV 4WFGA 1YITV 1M57B 1N0NA 5GTHZ 3K79A 1I5YA 1B6QA 1EN6A 3CCEV 3JD0A 4EB6A 3CXHF 4MVMA 1HNWO 4X88A 3OEHG 5EIBD 5E1AC 4CH3A 4DR4O 5D5PA 2A06H 2Y0IA 3W7TA 1QVFU 2YI8A 3AK2A 3UT5B 4GX5A 1VMGA 1GN4A 4YJ3A 3H9VA 4CC5A 5CA3A 1VQ6V 3KZIZ 2ZIOA 5JWPA 2DMXA 4X1IA 2QSAA 3ZJZA 3U11A 3ICXA 3E89A 2DJVA 3CC7V 2VQEB 2WLHA 4NR1A 4HNAA 3APQA 4OGQB 1R3JC 1SS3A 3CC2V 2RDCA 4GZRB 1VF6C 4O2BA 3LDDA 4H37A 5H9CA 2LGQA 3UM7A 2X7RB 4AI8A 5KAFZ 2RCVA 4JI6B 2R9IA 2FL4A 3MAQA 1SQPH 1QQCA 3FFQA 2EIMC 1H2NA 3RW0A 1FXKA 2H3OA 3P32A 2YIBA 3CX5F 3ABMB 4TV8B 1H2KA 4B3MB 3ZHUA 1MOFA 3OAAG 5EK0A 4R6ZA 3FX7A 3VOUA 3ZMSA 3ABLC 2ZINA 4MTOA 1HNZB 3JD2A 5JJNB 4H33A 1WB8A 1U97A 1BGYH 3SYCA 1AROP 2DN9A 1U96A 4JYYA 3ZBHA 5D5QA 2OTJV 1IVSA 2HVJC 1H8HG 3OR6C 1PNLA 2QM7A 1WNSA 2UXBB 2UUCO 2OCCC 1YF2A 3MDSA 4ZI7B 2LFRA 2UUBO 3W7UA 2N05A 3ZRWB 4XDLA 1NTZH 1EM1A 2WLIB 4G27B 1QU7A 1XI1A 4DV5B 4B3RB 4GKKO 1Y66A 2F23A 1NTKH 4NXMO 5JQGA 1BHBA 3P3PA 3G4SV 4DR2B 5GONA 2DYSB 4DR6B 2HVKC 5CA0B 1VQMV 3OEEG 3QO7A 4LF9B 1PL4A 1F4NA 2QM4A 1IBKB 1N34B 3BABA 5GTIZ 2HJFC 3A8TA 2ZM6O 3BPZA 4FLZA 4X1YB 2FMLA 1KD1W 1EZVH 2LW1A 2YXYA 1IX9A 1OCRB 2GBOA 4FFBB 4LF7B 3MD0A 3H1KH 2EILB 3E8HA 4NXNB 3CMAV 2QEXV 2IJJA 3CMEV 2ZE8A 4QPKA 1K73W 2Q8VA 2HP8A 2LO1A 4AQYB 5LBQA 2ZXWB 5FPOA 1YEWA 3B8MA 4JI3B 3F5WC 4B7EA 3GB7C 1Y76A 2E5LO 2YXLA 4I50B 1VQ5V 2YS8A 1FXHA 2QM8A 3JCUZ 3HKEA 3RYHB 2B1IA 3OMAB 3THOA 4B3TO 4B3SB 1Q6UA 5J2TA 3CB2A 4IYHA 2VWJA 4XDKA 5EBLC 3JALA 3N2KB 3CCLV 2ADQB 3IGAC 4ASUG 2HFEC 4DR7O 2WLKA 3JD3A 2KB1A 1OCOB 3L9DA 4HYOA 5KAIZ 4J42A 2M7WA 4DV1B 5KMGA 1DF4A 2WAMA 3VQYA 2A79B 1I08A 4FIPC 1KC8W 4EB6B 2XUMA 2UXDO 4QNHB 3X2QB 2WLLA 3ZRXA 2F43G 2ZCEA 3H01A 2ZE7A 4DUYB 4X62B 1VQ7V 2HHHB 5B1BC 1F23A 5LGUA 1WN7A 2Q7GA 1N33B 3ZN0A 2H8PC 4YJ3B 2Z5UA 4GYCB 4PI2A 1V54C 4LF5B 1KP3A 1S3JA 3E8BA 3ABKB 3BHPA 1N32B 1Y6XA 2L6LA 2PY5A 1S5JA 4HNAB 1EN5A 2XAHA 4MT8A 1M57C 1S5LZ 4F6RB 4WFEA 1I94B 4O2BB 2YXHA 3SJQC 4I9QA 1JQ0A 1OCZB 1R1BA 4WFHA 1Z5WA 4OPAA 1XILA 1SQXH 1YJWV 3K3WA 1PKXA 5IYDO 3ZIAG 4MVOA 4DV2O 2ZM6B 3IC7A 1G1XB 4FFKA 4F4LA 4JI8O 2EX3A 4DV3O 2CH7B 5C8YB 3GWOA 1W59A 1TVKA 2X6AA 5KHGA 1ZX3A 3SDLA 5CB4A 3AK3A 2Z3YA 4H13B 4IIJA 4YIPA 3BFRA 3ZX6A 2CDYA 4YY3B 4MVRA 1H38A 1NR7A 4FLXA 3T1HO 1R3KC 3CP1A 1NVPB 4TV9A 2UU9O 4O2AA 4WCEV 4GLXA 1Q6HA 2K1EA 3FB8C 2DQ0A 1H2SB 2Q68A 3D8CA 4JI7O 2GDSA 4LF6B 4K0KB 1PD3A 3K5LA 4LF4O 2DE0X 4FM0A 1Q90D 1M56B 4DV0O 4BW5A 4QIWF 1L0NH 2Y0PA 3ABMC 1OCCC 1K33A 4KHPB 2HEPA 2Z0AA 5AG2A 5JQGB 5CA1B 5LOVA 4FVMA 1NTMH 5GONB 3OMNB 4QPJA 1XMQO 1ZSPA 3DTUB 1KKCA 4FJCC 1VQPV 3BVOA 1YXBA 3FB7C 3SGIA 1XEQA 2FTKA 4LWSB 4P9PA 1M9NA 2DWEC 4X1KA 3VQXA 2WPDG 4YJ2A 2CGNA 3SYAA 5ITZA 4WBNA 4MTFA 1AR1B 3LUTB 2FB5A 4U3FH 5B1OA 3BCCH 1R3IC 2HLDG 1GM7A 3K5OA 1GK9A 3AK1A 1R6KA 4FLWA 2JIZG 2QGNA 1YJ9V 1Y76B 3K9AA 1TUEB 3SYQA 2A9HA 3HKCB 4UVAA 4DR1B 2ZE6A 1ZWIC 4PDMA 1YJNV 3HKEB 4Z1VA 2WWWA 4O4IA 3M99B 2PUSA 2VQEO 4X64B 1K9MW 1SKVA 2R72A 5J2TB 1JJ2U 3WB2A 4JI0B 3QO8A 1F7YA 5LGNA 1OCRC 3A0HZ 2EZPA 3EVKA 1Q7YW 3JALB 4O4JA 1VF5B 4FK5C 2O57A 4ZIBA 5IWAB 4O4LB 2RN9A 2E74B 4HAMA 4JI6O 3AG4B 1SA0A 3AG2B 5KMGB 2DWDC 2ZR3A 1THZA 3OUSA 2WLLB 5HFLA 2E75B 3KCXA 2Q73A 3E86A 4X66B 4PD4F 1GM9A 1VQNV 3CCRV 5KHKA 4GX0A 1SC5B 5CBHA 4B3MO 3CCUV 3E2EA 5LP6B 1M5IA 2XAJA 2F4VB 4JI7B 1HNZO 4E4EA 2YICA 1X4TA 2CAZC 4IGGA 3OGCC 4DV0B 2BTQA 4JTDB 3RGBA 1IBLB 1LUWA 5CBFA 1GO3F 1FKAO 2P06A 2KSDA 1OCOC 5H5NA 1N36O 2DOSA 4KXRA 2Q69A 3SPCA 1EZJA 4TUYA 3RFRA 2DW4A 2UXBO 3JATA 4K35A 2GTAA 3EXAA 3JAWB 1Z5VA 2NLJC 1WP7A 4DR5O 3B09A 4U7OA 1CPYA 2BOBC 3N2GA 5IDJA 3N27A 4DV5O 3JARA 4B3RO 1H2GA 1J95A 4ZBMA 4MW3A 4R50A 5KX5A 1VARA 1ZL8A 1R73A 1O9HA 4DR2O 1PL0A 1TVKB 4DR6O 5FLXN 1IBMB 1JFFA 4LF9O 5CB4B 3ZHVA 1IDSA 1I0HA 3ABKC 5EC1C 4IIJB 4C7UA 1IBKO 1E79G 3O65A 4MTGA 1N34O 3T1YB 2Q9LA 4JYAB 1NBMG 3O9OA 4JV5B 3E8FA 1K4CC 1SRYA 5EYPA 3OTFA 3BAAA 1CP9A 4LF7O 2ZDIA 5IJ9A 2ILMA 2YEVB 2JS5A 3WFVA 1MG1A 4NXNO 4TQDA 3B4SA 3LNMB 3K0DA 4FPPA 1N4CA 4X65B 4UCOA 1VQLV 4UB8Z 2VRZA 4Q6GA 4G2KA 5IYZA 1S76D 2Y4TA 3E22A 4AQYO 1PPJH 4WF9V 4FZ1A 1SF9A 1TA8A 4J7KA 2AXTZ 2Q67A 4JI3O 1XNQB 1WP8A 2QA4V 2QKCA 1K4DC 4MVUA 4DRXA 3OD4A 3FD9A 1L1FA 2YIAA 3DXRA 4J7JA 5LOVB 5EBWC 2RNBA 3Q4HA 2LFSA 4XBFA 4B3SO 4GX2A 4CS4A 1PNKA 1KBHA 1P7GA 3ZHRA 1Q5OA 4K3AA 3L75H 4PA9A 2JGDA 4DUZB 1SETA 4H0LB 2KKWA 2ODMA 3BA9A 4J80A 3RYCA 5A2QN 3SYOA 4X1KB 1IZ3A 4R7CA 1GMGA 5LMNB 4YJ2B 3D3IA 2LJ2A 1RM1B 1B04A 5ITZB 4WBNB 4GT1A 3OFNG 4DV1O 2UUAB 5IE9A 4I0XA 1VF6A 5EZYA 3K59A 3A0RA 1M56C 2UXXA 4B08A 4DUYO 4X62O 2NNUA 2HHHO 4BIZA 4UVCA 1N33O 1N36B 4TQFA 1XL6A 3JSLA 4P9OA 1BHAA 1BMFG 1V55C 4CBCA 1BT8A 4DR3B 2D2CB 3RVZA 2EIKC 4LF5O 2E76B 4WFAV 1AJPA 1H8EG 4PI0A 1N32O 2Y69B 4O4IB 5IY5C 4DR5B 5HFMA 4GX1A 4JI4B 4D7TA 4NB5A 1WJZA 1KU9A 1KMIZ 1E1RG 4O4JB 1I94O 5IYBO 2N74A 2QKSA 3L74H 1XMOB 1K92A 3K08A 4MS2A 2QTOA 1VP7A 2GTSA 4JYCA 3K5NA 1SA0B 1AI6A 3ZMZA 3K03A 3D3QA 1S0VA 5BMVA 1GRJA 3G71V 4UB6Z 3AG1B 2JEXA 3PJSK 4FLUA 2Y48A 5EC2C 3WU2Z 3B8NA 2IU0A 2Q5ZA 2ZR2A 1QR9A 1FD9A 1URFA 3UCSC 3LSQA 1W0KG 4BIUA 3CYOA 1S72V 1KECA 3SJCC 1YDXA 1RP3B 3DC6A 3PN1A 2XHBA 4K8ZA 1L8DA 2RMKB 2OT5A 1PM9A 4YY3O 3JAMN 1LNQA 3CRQA 2OIGA 1GN3A 5E79Z 1WB7A 2CE4A 3JCZA 2BTQB 4JGSA 1NT2B 2X0LA 4NTXA 1IXMA 2A3QA 3ETEA 1SZXA 3OW2U 1Q8IA 2P7TC 3AG4C 3CPWU 4TUYB 2OYQA 3AG2C 3CWBH 3JATB 4LF6O 4IYIA 4K0KO 4NVPA 1K34A 2HR3A 4JI5B 1NU1H 1FPOA 2H94A 3N2GB 1G6UA 4LNUA 4KHPO 2BSKA 2BTOA 4DV6B 3OE7G 4L8JA 5LP6C 1ZL8B 2LGWA 2R9AA 1AI7A 1BCCH 2WLNA 4TOIA 2R9RB 2EJ7A 3CRRA 1JFFB 5H2FZ 1SQQH 4QE9A 4CC6A 4I9WA 4YHHB 4JI1B 1B3QA 3WG7B 4ZKIA 1NJIW 4MTXA 1MSWD 1VQKV 4HZ3A 1ZUQA 3FYIB 4X9QA 5IJ9B 4P2ZA 3A2FA 3ETQA 4LCUC 1GN6A 3E83A 1DLBA 3LSSA 2ATKC 4X1IB 1Z2GA 4PV1B 2FYUH 3RN4A 1SQGA 2Q0AA 3E22B 2VQFB 2JS3A 2P90A 2V7QG 3C3TA 4UCTA 4LH7A 4UUJC 4J41A 1DTOA 4H44B 2AW9A 1PNMA 4UCVA 1SESA 1NQTA 4LP8A 4DRXB 3B2EE 2W0XA 3J81N 4DR1O 2MW2B 1XUQA 1NH2D 3CRMA 1CEZA 1E1QG 3Q4HB 5B1NA 1KKDA 1V9PA 4X64O 5BY1A 3RYFA 1MZEA 1M4UA 4JI0O 4FMTA 3ABUA 2IJKA 1FXKB 5L3GA 1XNRB 4DV4B 3I56V 1KB9F 4AILC 3RYCB 1XBLA 1WA8A 2QWNB 2GHYA 3ZHTA 5J9PC 5IWAO 4OX9B 5JCOC 3K04A 2IJIA 4DV7B 1LUVA 2YDEA 4FLTA 3DSQA 1NI8A 4LH6A 1JMKC 5KUMA 2WSSG 3D36A 4JYBA 4JTAB 5EZYB 3QF7A 1D5AA 2EIJB 1M93A 1RSOA 4X66O 2IJHA 1AILA 4CH5A 3ETGA 3IAYA 4RAIA 3SYPA 1YTFD 2F4VO 3APOA 1TUBA 1PV0A 3OT7A 3L71H 3RWRD 1NS1A 2YIDA 4J11A 4ZHQA 4UV9A 3K06A 3AG3B 3TETA 1COWG 3A0BZ 1IBLO 4LFAB 1BQZA 3ZHSA 2F1MA 4U7NA 2AGAA 2L35A 2PI5A 1XHXA 3G80A 1RM1C 1VQ4V 1FJGB 4JZGA 1D5NA 5L3FA 3P30A 1TGOA 4UCUA 1ORQC 4JI2B 1WPXA 2K9PA
chains in the Genus database with same CATH topology
2Q69A 3SPCA 1EZJA 3CCJV 3CD6V 2DW4A 4PA7A 3ASOB 4MSWC 2OTJV 1S77D 3NXSA 2HVJC 1H8HG 4LC1A 2JDIG 3OR6C 3RVYA 1PNLA 2QM7A 2NLJC 2UXNA 5EBMC 1K8AW 4QJFB 4U7OA 1CPYA 2A0LA 5C93A 2BOBC 2P67A 3CCMV 3F7VC 1FS0G 2OCCC 3ETDA 2EINB 5IDJA 2AHYA 1N8RW 2LFRA 1H2GA 1J95A 4ZBMA 3W7UA 4MW3A 1K5SA 2EBOA 4R50A 3ZRWB 4XDLA 2IW5A 1OHHG 1R73A 2WLIB 4G27B 1WLEA 1PL0A 2BOCC 4R8CA 2ZD9A 3SPGA 3QNEA 4LBEC 1Y66A 3MHSC 3T4DA 1MABG 1R3LC 3ABKC 5EC1C 1BHBA 1I5XA 1E79G 4MTGA 3G4SV 3OUFA 2DYSB 2HVKC 1M1KW 2DYSC 1NBMG 1VQMV 3OEEG 3QO7A 3K0GA 3T1CA 3E8FA 1K4CC 1SRYA 2WLMA 1F4NA 4PDLA 1W2BU 3CC4V 1CP9A 2ZQMA 5H6QA 2ZDIA 4PA4A 2HJFC 3DGEA 2YEVB 1AI4A 3WFVA 1KD1W 3T4ZA 1MG1A 4PDRA 3LNMB 3K0DA 4FPPA 1OCRB 3ASNC 3KG2A 4PA3A 2W6JG 3MD0A 3OMIB 1VQLV 1P4RA 1S76D 4G2KA 2EILB 3OR7C 5LHIA 3ZMTA 3E8HA 2EILC 2Q6AA 4WF9V 3CMAV 1VQ9V 2ITCC 4CZZA 2QEXV 4I5SA 1G8MA 2IJJA 3CMEV 4RO2A 2Q67A 4QPKA 1K73W 1EBOA 2QA4V 1K4DC 1KP2A 2P6JA 4Z1MG 3ZN1A 3HB3B 1K3EA 4EKWA 4MVUA 2WLIA 3ZMVA 5LBQA 2ZXWB 1L1FA 4G28B 3B8MA 1FFTB 1GKFA 2B5UA 2IH1C 2ZXWC 3SPJA 3F5WC 3W7SA 4J9ZB 3GB7C 3E8GA 5EBWC 4XBFA 1VQ5V 2LFSA 1FXHA 4GX2A 5FL7G 1GTOA 1PNKA 1P7BA 2QM8A 2EIMB 4KUMA 3R65A 4PA9A 3W7WA 3EFFK 2B1IA 1Y4MA 3OMAB 4E2LA 1SETA 4UVBA 2YEVA 2LP7A 2XOKG 5L3CA 4DXWA 3FB6C 4JF3A 1QR8A 1XL4A 4WFBV 3SYOA 4N23A 3AEIA 4R7CA 4XDKA 1GMGA 3ABLB 5EBLC 2D3OW 3D3IA 1RM1B 3LDEA 1K97A 4GT1A 4ASUG 3IGAC 3CCLV 2HFEC 3OFNG 2WLKA 3FKSG 3JD1A 2HKOA 3JD3A 2KB1A 1OCOB 4HYOA 3ZCCA 3A0RA 4JPRA 5LGTA 1M56C 2EJRA 3ZMUA 1SZTA 2M7WA 2UXXA 2NNUA 1DF4A 2WAMA 5B1AC 3CXCU 2A79B 4BIZA 4FIPC 1KC8W 4QNHB 4UVCA 2WLLA 3X2QB 3ZRXA 1V55B 1XL6A 4RQEA 4P9OA 2F43G 3X2QC 1BHAA 4PELA 1F4MA 1BMFG 1V55C 2IU3A 3H01A 4CBCA 1VQ7V 2EIKB 4TSFG 4WFFA 5B1BC 1F23A 1JPXA 2OCCB 4TWKA 3RVZA 4X89A 3WG7C 2EIKC 5LGUA 4WFAV 1AJPA 1H8EG 3ZN0A 2H8PC 1M90W 5IY5B 2Y69B 2Z5UA 4MVSA 1AI5A 2ZDIC 5IY5C 1NR1A 2Y69C 1AJNA 3ZRVA 1V54C 5HFMA 1KP3A 4GX1A 1YHQV 1S3JA 3E8BA 1K5QA 3ABKB 3STLC 3VBBA 1JCHA 5H6RA 3MHHC 1JX9A 1FXVA 2GSMB 2B1GA 3JYCA 4UV8A 1E1RG 1QLEC 5IYBO 5LHGA 1NH2B 2XAHA 2W6IG 5L3EA 2QKSA 4MT8A 1M57C 3IFXA 1K92A 3K08A 2XAQA 4MS2A 2QTOA 5LHHA 4JYCA 4WFEA 1AI6A 4XDJA 3SJQC 5KA6A 3STZC 2XNDG 3ZMZA 1JQ0A 3K03A 1OCZB 4KFMA 1S0VA 4WFHA 3ASNB 1AJQA 2XAGA 3SPIA 1OCZC 1YJWV 3K3WA 3G71V 1PKXA 3E35A 3ZIAG 5KA5A 1BL8A 2JEXA 3AG1B 3PJSK 4MVOA 5IYDO 4PDVA 2Y48A 5EC2C 3CCSV 3B8NA 2IU0A 3AG1C 2ZR2A 4X8AA 4RQFA 2IH3C 1OZ0A 3IC7A 1QR9A 3W7XA 4F4LA 2DQ3A 3LSQA 1W0KG 4MW8A 4BIUA 3ZRWA 5CN0A 3CYOA 4N21A 1S72V 1KECA 3TK1A 1JVMA 1UJWB 3ML0A 3GWOA 1EFRG 1FXKC 2X6AA 2OT5A 2C2AA 5KUKA 3BY6A 1LNQA 2XAFA 1Q81W 1GM8A 2Z3YA 3FB5C 3BEHA 3JCZA 2JJ1G 2JK5C 4JGSA 4MVZA 4MVRA 2YSUB 1H38A 1QBZA 2X0LA 1NR7A 3ZRSA 1IXMA 1G4YB 3T2MA 1YTFB 3ETEA 4UXNA 3OW2U 2P7TC 3B77A 2EIJC 3AG4C 3CPWU 1R3KC 3CP1A 1NVPB 3AG2C 5CMUA 1RPRA 3QO5A 4WCEV 1K34A 4JAUA 2HR3A 1KQSU 2ITDC 2K1EA 3FB8C 2DQ0A 2Q68A 2WLJA 4DO2A 1Q86W 5L3BA 3JD4A 2H94A 2DYRC 1PD3A 3LDCA 3OE7G 1M56B 1SERA 1AI7A 2WLNA 1OCCB 4QIWF 2R9RB 3AG3C 5B1AB 4BW5A 1JOYA 3ABMC 1OCCC 1K33A 1W0JG 2XASA 1F51A 3UKMA 2JEUA 4QE9A 2CK3G 4I9WA 5BZBA 5DN6G 2QE7G 5B1BB 3OMNB 4QPJA 3G6EV 3WG7B 5L3DA 4ZKIA 1NJIW 4MTXA 1MSWD 4PA6A 1VQKV 3DTUB 5B3SC 1QCEA 4HZ3A 1VQ8V 3FYIB 4FJCC 1VQPV 4P2ZA 4LCUC 3FB7C 1V54B 4GCZA 3E83A 1YIJV 1DLBA 3LSSA 2FTKA 4Q20A 3ASOC 4RUFA 2ATKC 4J9YB 1YI2V 4P9PA 1VQOV 3OM3B 1M9NA 2DWEC 2WPDG 3SYAA 1QLEB 3CCVV 3EHBB 4KP4A 2P90A 2V7QG 2OTLV 4WFGA 1YITV 1M57B 4MTFA 1AR1B 4UUJC 1DTOA 2EINC 3LUTB 1PNMA 5B1OA 1SESA 2V1DA 3K79A 5DM6V 1NQTA 4LP8A 2W0FC 1R3IC 2HLDG 1GM7A 3SPHA 1I5YA 5CBGA 1B6QA 1GK9A 4L87A 3ABTA 3JD0A 3CCEV 1R6KA 2JIZG 1YJ9V 1NH2D 3RBZA 4MVMA 1CEZA 1HWYA 3OEHG 4X88A 1E1QG 5E1AC 3K9AA 1TUEB 3SYQA 5B1NA 5GW7A 2A9HA 3W7TA 1KKDA 4UVAA 1QVFU 4RUEA 4GX5A 1R6NA 1ZWIC 4PDMA 1YJNV 2WWWA 4FMTA 3ABUA 2IJKA 3M99B 4JASA 5CA3A 1VQ6V 1FXKB 1RPOA 3F7YC 5L3GA 1K9MW 3I56V 1JJ2U 1ENVA 4TT3G 3ZJZA 3QO8A 5LGNA 2GHYA 2EZOA 1OCRC 1DF5A 3E89A 5J9PC 2EZPA 3K04A 3CC7V 1Q7YW 2WLHA 2IJIA 2JJ2G 1YSCA 4FK5C 5KUMA 1R3JC 4OXSA 3CCQV 2WSSG 3D36A 4JYBA 3CC2V 2MK3A 4HAMA 4JTAB 2PI4A 2EIJB 3AG4B 3AG2B 3LDDA 4H37A 5H9CA 2DWDC 1NKDA 2ZR3A 2IJHA 1THZA 3OUSA 3UM7A 2X7RB 2WLLB 4BAYA 3I55V 2R9IA 5HFLA 3ETGA 3E86A 1ROPA 2AHZA 2X6BA 4RAIA 3SYPA 1YTFD 1GM9A 4QE7A 1VQNV 3CCRV 2DYRB 4GX0A 5CBHA 4MVQA 1NVPD 3CCUV 2EIMC 3E2EA 4P30A 4JTCB 3RW0A 4UV9A 1FXKA 3K06A 2XAJA 3FYEB 3AG3B 3P32A 3TETA 1COWG 3ABMB 4YXWG 5IYCO 3HPLC 1MOFA 3OAAG 5EK0A 2HG5C 4R6ZA 4U7NA 3OGCC 3VOUA 4JAVA 3ZMSA 3TCUA 2PI5A 3ABLC 4JTDB 5CBFA 4MTOA 1RM1C 1VQ4V 1GO3F 1QLNA 3JD2A 2X6CA 5B3SB 1Q82W 5L3FA 3P30A 4H33A 1K7DA 1OCOC 1ORQC 1S5HC 1WPXA 3SYCA 1QVGU 1AROP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LP8 A;  2YEV A;  2W0F C;  1JVM A;  1R3I C;  3SPH A;  2Q69 A;  3SPC A;  4DXW A;  3FB6 C;  5CBG A;  2X6A A;  4PA7 A;  5KUK A;  4MSW C;  1LNQ A;  1XL4 A;  3SYO A;  3RBZ A;  4MVM A;  2HVJ C;  3OR6 C;  4X88 A;  4R7C A;  4XDK A;  5EBL C;  2NLJ C;  3FB5 C;  3RVY A;  5EBM C;  3BEH A;  5E1A C;  3LDE A;  3SYQ A;  2A9H A;  1KKD A;  2A0L A;  2JK5 C;  4MVZ A;  2BOB C;  3IGA C;  2HFE C;  3F7V C;  2WLK A;  4MVR A;  4RUE A;  4GX5 A;  2OCC C;  1ZWI C;  2AHY A;  4PDM A;  2KB1 A;  3ZRS A;  1J95 A;  4ZBM A;  4HYO A;  1G4Y B;  4MW3 A;  4R50 A;  3T2M A;  4XDL A;  1M56 C;  2P7T C;  2EIJ C;  3AG4 C;  2WLI B;  3F7Y C;  4G27 B;  1R3K C;  2BOC C;  4R8C A;  3AG2 C;  5B1A C;  2ZD9 A;  3SPG A;  2A79 B;  4LBE C;  3T4D A;  3ZJZ A;  1R3L C;  3ABK C;  2WLL A;  5EC1 C;  4QNH B;  3E89 A;  1OCR C;  5J9P C;  1XL6 A;  3K04 A;  4P9O A;  3X2Q C;  2ITD C;  4MTG A;  2K1E A;  2WLH A;  3OUF A;  1V55 C;  3FB8 C;  2Q68 A;  4CBC A;  2HVK C;  2WLJ A;  5B1B C;  4WFF A;  2DYS C;  4TWK A;  3RVZ A;  3WG7 C;  4X89 A;  2EIK C;  3K0G A;  3T1C A;  2DYR C;  5KUM A;  3E8F A;  1K4C C;  1R3J C;  2WLM A;  3LDC A;  4OXS A;  4PDL A;  2H8P C;  4JTA B;  4MVS A;  4PA4 A;  2HJF C;  5IY5 C;  2Y69 C;  4BW5 A;  2WLN A;  2R9R B;  3AG3 C;  3LDD A;  1V54 C;  4H37 A;  3T4Z A;  2DWD C;  4GX1 A;  4PDR A;  3ABM C;  1OCC C;  3OUS A;  3UM7 A;  3E8B A;  3LNM B;  3STL C;  3K0D A;  3ASN C;  3KG2 A;  2WLL B;  4PA3 A;  3UKM A;  4QE9 A;  3JYC A;  4I9W A;  3E86 A;  2AHZ A;  3OR7 C;  5BZB A;  2X6B A;  4RAI A;  3SYP A;  1QLE C;  3E8H A;  2EIL C;  2Q6A A;  4QE7 A;  2ITC C;  4GX0 A;  4PA6 A;  5CBH A;  2QKS A;  4MVQ A;  5B3S C;  1M57 C;  4RO2 A;  3IFX A;  2EIM C;  2Q67 A;  3K08 A;  4HZ3 A;  4MS2 A;  4P30 A;  2QTO A;  4JTC B;  1K4D C;  3RW0 A;  4P2Z A;  4MVU A;  2WLI A;  3K06 A;  4WFE A;  4LCU C;  4EKW A;  3FB7 C;  3TET A;  4XDJ A;  3SJQ C;  3E83 A;  3STZ C;  4G28 B;  3K03 A;  4KFM A;  3HPL C;  2IH1 C;  2ZXW C;  3ASO C;  4RUF A;  4WFH A;  3SPJ A;  2ATK C;  4J9Y B;  3F5W C;  5EK0 A;  3SPI A;  4P9P A;  2HG5 C;  1OCZ C;  4J9Z B;  4R6Z A;  2DWE C;  3OGC C;  3GB7 C;  3E8G A;  3VOU A;  1BL8 A;  3PJS K;  4MVO A;  3TCU A;  3SYA A;  5EBW C;  4PDV A;  3ABL C;  4JTD B;  5EC2 C;  5CBF A;  4GX2 A;  3AG1 C;  4MTO A;  4X8A A;  4WFG A;  1P7B A;  2X6C A;  2IH3 C;  4MTF A;  3R65 A;  4UUJ C;  4H33 A;  4PA9 A;  4F4L A;  2EIN C;  3LUT B;  4MW8 A;  1OCO C;  3EFF K;  1ORQ C;  1S5H C;  3SYC A; 
#chains in the Genus database with same CATH topology
 2ETN A;  3UO2 A;  3CD6 V;  2GUZ A;  5LA6 A;  4PA7 A;  4YIO A;  3ASO B;  4MSW C;  1S77 D;  3NXS A;  4GKJ B;  3RVY A;  2UXN A;  5EBM C;  2A0L A;  5JVD A;  3CCM V;  2VS0 A;  3F7V C;  1FS0 G;  3ETD A;  3SJB C;  2EIN B;  4LFB B;  2AHY A;  5BR8 B;  1IBM O;  1K5S A;  2EBO A;  1HR0 B;  1AR4 A;  1DGS A;  3S3W A;  4F6E A;  3T1Y O;  1WLE A;  4R8C A;  5K1X A;  4I55 A;  4JYA O;  4JV5 O;  2V4D A;  1VEW A;  3ZS8 C;  5DEC A;  3OUF A;  5KHI A;  1M1K W;  1AP5 A;  3QG5 A;  2DYS C;  5IT9 N;  2IM9 A;  3K0G A;  3T1C A;  1Q6I A;  4PDL A;  1W2B U;  5EIB C;  4X65 O;  5H6Q A;  4FLY A;  2PF4 E;  3KG2 A;  4PA3 A;  1N0J A;  1XNQ O;  3OMI B;  3HKB A;  3OR7 C;  5LHI A;  5LMU B;  4IT5 A;  2EIL C;  2Q6A A;  2ITC C;  4ZI7 A;  4I5S A;  1G8M A;  4RO2 A;  4LNU B;  1DK1 A;  1KP2 A;  2P6J A;  3S3X A;  4Z1M G;  2NR5 A;  3HB3 B;  1AR5 A;  2WLI A;  4BWA A;  2F93 B;  5JJE B;  4IL6 Z;  4G28 B;  2PTM A;  1FFT B;  2IH1 C;  2ZXW C;  1YZB A;  4DUZ O;  4J7Z A;  3E8G A;  2ZNJ A;  3KCY A;  5CA0 A;  5FL7 G;  1GTO A;  3R65 A;  1Y74 A;  3AG7 A;  4UFZ A;  2P22 C;  4E2L A;  1J5E B;  4UVB A;  3TGU H;  4BIO A;  2XOK G;  5LMN O;  4DXW A;  5FPR A;  4JF3 A;  1TAE A;  1QR8 A;  2UUA O;  1XL4 A;  3F5T A;  4N23 A;  1Y67 A;  3AEI A;  1XOU A;  2D3O W;  1CXZ B;  1K97 A;  3M7M X;  2HKO A;  4D7S A;  3K5M A;  3HKD A;  4ZOL A;  3CE2 A;  5LGT A;  4W4L A;  2EJR A;  1SZT A;  1HW7 A;  4DR3 O;  1MMM A;  4NTW A;  2E3C A;  4RQE A;  3X2Q C;  2IU3 A;  1JPX A;  4TWK A;  3WG7 C;  4X89 A;  3RYF B;  4LFC B;  4JI4 O;  1IUR A;  2B9Z A;  1M90 W;  5B5E Z;  2ZDI C;  5B66 Z;  1MZF A;  1R6T A;  3ZRV A;  3CJH A;  2PYJ A;  1YHQ V;  2QWO B;  3BRC A;  1K5Q A;  1WA8 B;  3G67 A;  1XMO O;  1P84 F;  5H6R A;  1JX9 A;  2GSM B;  2B1G A;  3JYC A;  4UV8 A;  5LHG A;  2W6I G;  4U3J A;  5L3E A;  2P4K A;  4CH6 A;  2XAQ A;  5LHH A;  3ZED A;  1RSO B;  5KA6 A;  4TV9 B;  3ASN B;  3SPI A;  4O2A B;  1OCZ C;  4X20 A;  2UXC B;  1Q3E A;  1JJO A;  4O4H A;  1TUB B;  3TXS A;  4BR6 A;  1AB3 A;  4MW8 A;  1SQB H;  5CN0 A;  4ZHQ B;  4N21 A;  3TK1 A;  1UJW B;  1VF7 A;  4HBN A;  1EFR G;  1FXK C;  4DW0 A;  2C2A A;  2VWK A;  3BY6 A;  2YUA A;  1Q81 W;  2Q4P A;  4I7Z B;  2ARH A;  4ICG A;  1LR1 A;  5JH7 A;  2JJ1 G;  2JK5 C;  2R70 A;  2QWQ B;  1ZAU A;  2YSU B;  4F6R A;  2ZIM A;  1QNM A;  1G4Y B;  3T2M A;  4JI5 O;  2OCH A;  3B77 A;  2EIJ C;  3IJ4 A;  2QJ1 A;  2GUZ B;  5LA6 B;  1RPR A;  3QO5 A;  2YC0 A;  2ITD C;  5F2V O;  3U0Z A;  4DV6 O;  2WLJ A;  2JRI A;  5JVD B;  1Q86 W;  1O9G A;  2CH7 A;  1Q43 A;  5C8Y A;  4LF8 B;  3KKY A;  2RQ6 A;  1OCC B;  3AG3 C;  5B1A B;  4YHH O;  4JI1 O;  4I55 B;  1UPG A;  4UCR A;  3UKM A;  1HNX B;  2CK3 G;  5BZB A;  1T5E A;  3OTO B;  1MNG A;  1A32 A;  1QCE A;  2HJD A;  5FNV A;  2ADP A;  1GN2 A;  4D6T H;  4NYK A;  2VQF O;  1YIJ V;  4Q20 A;  3ASO C;  4IHJ A;  4CH4 A;  4J9Y B;  1UFI A;  1VQO V;  3OM3 B;  1QLE B;  3HKB B;  4KP4 A;  3P3N A;  3GVM A;  2KQX A;  2EIN C;  2KG7 A;  2V1D A;  4AHC A;  5DM6 V;  3I5D A;  2W0F C;  3WB0 A;  3SPH A;  1XHZ A;  5CBG A;  4L87 A;  2Q7E A;  3ABT A;  1WAZ A;  2QKA A;  2GV9 A;  3RBZ A;  5CA1 A;  3UQ8 A;  4K8X A;  4JAA A;  1HWY A;  2WA4 A;  5GW7 A;  3CS5 A;  3CHX A;  4RUE A;  1XNR O;  4DV4 O;  5KHH A;  1R6N A;  1JR9 A;  4J10 A;  1MSD A;  1HNW B;  1RFY A;  5LYJ A;  1Y74 B;  2G38 A;  1YCI A;  2XTA A;  4OX9 O;  1US6 A;  2NN4 A;  4DR4 B;  4JAS A;  1RPO A;  3F7Y C;  4DV7 O;  2PZS A;  4LWS A;  1ENV A;  1H2M A;  4TT3 G;  3H1J H;  4LR3 A;  2EZO A;  1DF5 A;  2JJ2 G;  2M6Y A;  1YSC A;  2YIB D;  4OXS A;  3HKD B;  3CCQ V;  4ZOL B;  5LXT A;  2MK3 A;  2PI4 A;  4I4T A;  1PP9 H;  1NKD A;  3SJA C;  3FAV A;  4BAY A;  4EFB A;  3I55 V;  1WPB A;  1ROP A;  2AHZ A;  3HKC A;  2X6B A;  4OPH A;  1FAF A;  4QE7 A;  2FKX A;  2DYR B;  4LFA O;  2CTR A;  4MVQ A;  2AZ2 A;  1H2L A;  1NVP D;  3VQW A;  3JAR B;  4P30 A;  4JTC B;  3TJT A;  4DYL A;  5KX5 B;  1JA8 A;  1NZ6 A;  3FYE B;  4YXW G;  3CJH B;  5IYC O;  3HPL C;  1FJG O;  4DK1 A;  2HG5 C;  3H1L H;  1EN4 A;  5K1P A;  4JI2 O;  4JAV A;  3TXQ A;  3TCU A;  3U10 A;  2Q0O C;  4ABM A;  1QLN A;  2X6C A;  5J2U A;  5B3S B;  1Q82 W;  5KLV H;  4U3J B;  3RYI A;  4O4L A;  1K7D A;  5EYP B;  1S5H C;  1QVG U;  4GKJ O;  3G6B A;  2ZE5 A;  3CCJ V;  2AZ0 A;  3RT3 C;  2OWO A;  1GAX A;  4LFB O;  5BR8 O;  4X20 B;  4LC1 A;  2JDI G;  1HR0 O;  1K8A W;  4PHZ A;  5IYZ B;  4QJF B;  4EFE A;  5C93 A;  2P67 A;  3L73 H;  1OV9 A;  1YVW A;  4O4H B;  2Y4U A;  1N8R W;  3UO3 A;  5LP6 A;  1FYJ A;  4NTY A;  1FFX A;  2IW5 A;  1OHH G;  3K58 A;  2BOC C;  2UUC B;  2ZNI A;  2ZD9 A;  3SPG A;  2UUB B;  3QNE A;  4LBE C;  5A9G A;  3MHS C;  3T4D A;  1MAB G;  1R3L C;  3DXR B;  3H1I H;  1AVM A;  1I5X A;  2IBZ H;  2A7W A;  3JAK A;  5JH7 B;  4FLV A;  4FM2 A;  4GKK B;  3JSN A;  4NXM B;  2WLM A;  3JAS A;  2JGD B;  3CC4 V;  2ZQM A;  3D36 C;  1KYO F;  4PA4 A;  1QHT A;  5BXZ A;  3DGE A;  5LMU O;  1AI4 A;  3T4Z A;  4PDR A;  2LQT A;  5TIS Z;  5IJ0 A;  3JAW A;  3ASN C;  2ZT9 B;  2W6J G;  2CTW A;  1P4R A;  2P4V A;  3ZMT A;  1VQ9 V;  2CTQ A;  4CZZ A;  4CS2 A;  1XRE A;  3H1H H;  1EBO A;  3DC5 A;  3ZN1 A;  4I0X B;  1K3E A;  4EKW A;  3ZMV A;  1ZLZ A;  1SQF A;  1GKF A;  2JVD A;  2B5U A;  1XDC A;  3SPJ A;  3W7S A;  4J9Z B;  1BSM A;  1BZK A;  1J5E O;  1B06 A;  1OJH A;  1P7B A;  3UT5 A;  2EIM B;  4KUM A;  3W7W A;  1BS3 A;  3EFF K;  3GWK C;  1Y4M A;  2E5L B;  5FNV B;  4DK0 A;  2YEV A;  4CS3 A;  2LP7 A;  5L3C A;  3FB6 C;  2EUL A;  4IHJ B;  5JCO A;  4WFB V;  3NR7 A;  4B3T B;  3ABL B;  3CRC A;  4UCS A;  3LDE A;  3LNN A;  3ZHQ A;  3FKS G;  2F66 C;  3JD1 A;  2KG7 B;  3ZCC A;  4JPR A;  3ZMU A;  3QTC A;  3HR0 A;  4DR7 B;  5B1A C;  1IXB A;  3CXC U;  3L70 H;  4LFC O;  3QVN A;  1AP6 A;  1V55 B;  5BMV B;  4PEL A;  1F4M A;  2EIK B;  2QWP B;  4TSF G;  4WFF A;  2QTS A;  2OCC B;  3C3S A;  2UXD B;  1KUQ A;  5LYJ B;  5IY5 B;  4EEQ A;  2LW7 A;  4MVS A;  3IC9 A;  2BE3 A;  1AI5 A;  1NR1 A;  1BE3 H;  2Y69 C;  1AJN A;  4TV8 A;  2QR4 A;  3L72 H;  3STL C;  3VBB A;  1JCH A;  4QGP A;  3MHH C;  1FXV A;  1P49 A;  1QLE C;  5JJJ B;  4BW9 A;  1NH2 B;  1I7F A;  2F95 B;  4FM1 A;  2BCC H;  3IFX A;  2YI9 A;  3B40 A;  5LXT B;  4GUN A;  4I4T B;  4XDJ A;  1GH6 A;  2UXC O;  3STZ C;  2XND G;  4KFM A;  1AJQ A;  2XAG A;  3C90 A;  3FAV B;  3E35 A;  5KA5 A;  1BL8 A;  2CTP A;  4PDV A;  3CCS V;  2CUG A;  3AG1 C;  4X8A A;  1MA1 A;  4RQF A;  4W4K A;  2IH3 C;  1OZ0 A;  3W7X A;  4B7K A;  2DQ3 A;  2Q7H A;  1D2D A;  3ZRW A;  4DV2 B;  2BSK B;  3J80 N;  1JVM A;  3M8A A;  3ML0 A;  4PJ0 Z;  5KUK A;  4JI8 B;  2XAF A;  4DV3 B;  1GM8 A;  3FB5 C;  3BEH A;  3OGI B;  3CEI A;  4MVZ A;  5J2U B;  2RJZ A;  1QBZ A;  3RYI B;  3ZRS A;  2OIE A;  5DED A;  1YTF B;  4DW1 A;  4UXN A;  4JZ2 A;  4X1Y A;  5CMU A;  3CSX A;  2CGO A;  2WA3 A;  2JGU A;  4FFB A;  4JAU A;  1BQ0 A;  3T1H B;  1KQS U;  3K57 A;  4LF8 O;  2UU9 B;  4RWU A;  4DO2 A;  2P5O A;  2ZKO A;  5L3B A;  3JD4 A;  4FZ0 A;  2DYR C;  5KHJ A;  1HP8 A;  3LDC A;  4NKG B;  1X59 A;  3WB1 A;  2PGG A;  1HNX O;  2XT9 A;  1FFX B;  1SER A;  1JOY A;  1HDJ A;  1L0L H;  1XQ8 A;  1VIB A;  4LF4 B;  3OTO O;  1W0J G;  3R66 A;  2XAS A;  1F51 A;  3BA8 A;  5LL6 Y;  2JEU A;  3VQV A;  4I50 A;  5DN6 G;  2QE7 G;  5B1B B;  3JAK B;  3G6E V;  2QWR B;  5L3D A;  4PA6 A;  5B3S C;  4KL1 A;  3SR2 C;  3RYH A;  3K9S A;  3JAS B;  1VQ8 V;  2PYL A;  1XMQ B;  4A5U B;  1ZTE A;  1V54 B;  4GCZ A;  4Z2W A;  3CRA A;  1SQV H;  4RUF A;  2N04 A;  5IJ0 B;  1YI2 V;  2QDO A;  3J7A U;  3LSU A;  3CCV V;  3EHB B;  3N2K A;  2OTL V;  4WFG A;  1YIT V;  1M57 B;  1N0N A;  5GTH Z;  3K79 A;  1I5Y A;  1B6Q A;  1EN6 A;  3CCE V;  3JD0 A;  4EB6 A;  3CXH F;  4MVM A;  1HNW O;  4X88 A;  3OEH G;  5EIB D;  5E1A C;  4CH3 A;  4DR4 O;  5D5P A;  2A06 H;  2Y0I A;  3W7T A;  1QVF U;  2YI8 A;  3AK2 A;  3UT5 B;  4GX5 A;  1VMG A;  1GN4 A;  4YJ3 A;  3H9V A;  4CC5 A;  5CA3 A;  1VQ6 V;  3KZI Z;  2ZIO A;  5JWP A;  2DMX A;  4X1I A;  2QSA A;  3ZJZ A;  3U11 A;  3ICX A;  3E89 A;  2DJV A;  3CC7 V;  2VQE B;  2WLH A;  4NR1 A;  4HNA A;  3APQ A;  4OGQ B;  1R3J C;  1SS3 A;  3CC2 V;  2RDC A;  4GZR B;  1VF6 C;  4O2B A;  3LDD A;  4H37 A;  5H9C A;  2LGQ A;  3UM7 A;  2X7R B;  4AI8 A;  5KAF Z;  2RCV A;  4JI6 B;  2R9I A;  2FL4 A;  3MAQ A;  1SQP H;  1QQC A;  3FFQ A;  2EIM C;  1H2N A;  3RW0 A;  1FXK A;  2H3O A;  3P32 A;  2YIB A;  3CX5 F;  3ABM B;  4TV8 B;  1H2K A;  4B3M B;  3ZHU A;  1MOF A;  3OAA G;  5EK0 A;  4R6Z A;  3FX7 A;  3VOU A;  3ZMS A;  3ABL C;  2ZIN A;  4MTO A;  1HNZ B;  3JD2 A;  5JJN B;  4H33 A;  1WB8 A;  1U97 A;  1BGY H;  3SYC A;  1ARO P;  2DN9 A;  1U96 A;  4JYY A;  3ZBH A;  5D5Q A;  2OTJ V;  1IVS A;  2HVJ C;  1H8H G;  3OR6 C;  1PNL A;  2QM7 A;  1WNS A;  2UXB B;  2UUC O;  2OCC C;  1YF2 A;  3MDS A;  4ZI7 B;  2LFR A;  2UUB O;  3W7U A;  2N05 A;  3ZRW B;  4XDL A;  1NTZ H;  1EM1 A;  2WLI B;  4G27 B;  1QU7 A;  1XI1 A;  4DV5 B;  4B3R B;  4GKK O;  1Y66 A;  2F23 A;  1NTK H;  4NXM O;  5JQG A;  1BHB A;  3P3P A;  3G4S V;  4DR2 B;  5GON A;  2DYS B;  4DR6 B;  2HVK C;  5CA0 B;  1VQM V;  3OEE G;  3QO7 A;  4LF9 B;  1PL4 A;  1F4N A;  2QM4 A;  1IBK B;  1N34 B;  3BAB A;  5GTI Z;  2HJF C;  3A8T A;  2ZM6 O;  3BPZ A;  4FLZ A;  4X1Y B;  2FML A;  1KD1 W;  1EZV H;  2LW1 A;  2YXY A;  1IX9 A;  1OCR B;  2GBO A;  4FFB B;  4LF7 B;  3MD0 A;  3H1K H;  2EIL B;  3E8H A;  4NXN B;  3CMA V;  2QEX V;  2IJJ A;  3CME V;  2ZE8 A;  4QPK A;  1K73 W;  2Q8V A;  2HP8 A;  2LO1 A;  4AQY B;  5LBQ A;  2ZXW B;  5FPO A;  1YEW A;  3B8M A;  4JI3 B;  3F5W C;  4B7E A;  3GB7 C;  1Y76 A;  2E5L O;  2YXL A;  4I50 B;  1VQ5 V;  2YS8 A;  1FXH A;  2QM8 A;  3JCU Z;  3HKE A;  3RYH B;  2B1I A;  3OMA B;  3THO A;  4B3T O;  4B3S B;  1Q6U A;  5J2T A;  3CB2 A;  4IYH A;  2VWJ A;  4XDK A;  5EBL C;  3JAL A;  3N2K B;  3CCL V;  2ADQ B;  3IGA C;  4ASU G;  2HFE C;  4DR7 O;  2WLK A;  3JD3 A;  2KB1 A;  1OCO B;  3L9D A;  4HYO A;  5KAI Z;  4J42 A;  2M7W A;  4DV1 B;  5KMG A;  1DF4 A;  2WAM A;  3VQY A;  2A79 B;  1I08 A;  4FIP C;  1KC8 W;  4EB6 B;  2XUM A;  2UXD O;  4QNH B;  3X2Q B;  2WLL A;  3ZRX A;  2F43 G;  2ZCE A;  3H01 A;  2ZE7 A;  4DUY B;  4X62 B;  1VQ7 V;  2HHH B;  5B1B C;  1F23 A;  5LGU A;  1WN7 A;  2Q7G A;  1N33 B;  3ZN0 A;  2H8P C;  4YJ3 B;  2Z5U A;  4GYC B;  4PI2 A;  1V54 C;  4LF5 B;  1KP3 A;  1S3J A;  3E8B A;  3ABK B;  3BHP A;  1N32 B;  1Y6X A;  2L6L A;  2PY5 A;  1S5J A;  4HNA B;  1EN5 A;  2XAH A;  4MT8 A;  1M57 C;  1S5L Z;  4F6R B;  4WFE A;  1I94 B;  4O2B B;  2YXH A;  3SJQ C;  4I9Q A;  1JQ0 A;  1OCZ B;  1R1B A;  4WFH A;  1Z5W A;  4OPA A;  1XIL A;  1SQX H;  1YJW V;  3K3W A;  1PKX A;  5IYD O;  3ZIA G;  4MVO A;  4DV2 O;  2ZM6 B;  3IC7 A;  1G1X B;  4FFK A;  4F4L A;  4JI8 O;  2EX3 A;  4DV3 O;  2CH7 B;  5C8Y B;  3GWO A;  1W59 A;  1TVK A;  2X6A A;  5KHG A;  1ZX3 A;  3SDL A;  5CB4 A;  3AK3 A;  2Z3Y A;  4H13 B;  4IIJ A;  4YIP A;  3BFR A;  3ZX6 A;  2CDY A;  4YY3 B;  4MVR A;  1H38 A;  1NR7 A;  4FLX A;  3T1H O;  1R3K C;  3CP1 A;  1NVP B;  4TV9 A;  2UU9 O;  4O2A A;  4WCE V;  4GLX A;  1Q6H A;  2K1E A;  3FB8 C;  2DQ0 A;  1H2S B;  2Q68 A;  3D8C A;  4JI7 O;  2GDS A;  4LF6 B;  4K0K B;  1PD3 A;  3K5L A;  4LF4 O;  2DE0 X;  4FM0 A;  1Q90 D;  1M56 B;  4DV0 O;  4BW5 A;  4QIW F;  1L0N H;  2Y0P A;  3ABM C;  1OCC C;  1K33 A;  4KHP B;  2HEP A;  2Z0A A;  5AG2 A;  5JQG B;  5CA1 B;  5LOV A;  4FVM A;  1NTM H;  5GON B;  3OMN B;  4QPJ A;  1XMQ O;  1ZSP A;  3DTU B;  1KKC A;  4FJC C;  1VQP V;  3BVO A;  1YXB A;  3FB7 C;  3SGI A;  1XEQ A;  2FTK A;  4LWS B;  4P9P A;  1M9N A;  2DWE C;  4X1K A;  3VQX A;  2WPD G;  4YJ2 A;  2CGN A;  3SYA A;  5ITZ A;  4WBN A;  4MTF A;  1AR1 B;  3LUT B;  2FB5 A;  4U3F H;  5B1O A;  3BCC H;  1R3I C;  2HLD G;  1GM7 A;  3K5O A;  1GK9 A;  3AK1 A;  1R6K A;  4FLW A;  2JIZ G;  2QGN A;  1YJ9 V;  1Y76 B;  3K9A A;  1TUE B;  3SYQ A;  2A9H A;  3HKC B;  4UVA A;  4DR1 B;  2ZE6 A;  1ZWI C;  4PDM A;  1YJN V;  3HKE B;  4Z1V A;  2WWW A;  4O4I A;  3M99 B;  2PUS A;  2VQE O;  4X64 B;  1K9M W;  1SKV A;  2R72 A;  5J2T B;  1JJ2 U;  3WB2 A;  4JI0 B;  3QO8 A;  1F7Y A;  5LGN A;  1OCR C;  3A0H Z;  2EZP A;  3EVK A;  1Q7Y W;  3JAL B;  4O4J A;  1VF5 B;  4FK5 C;  2O57 A;  4ZIB A;  5IWA B;  4O4L B;  2RN9 A;  2E74 B;  4HAM A;  4JI6 O;  3AG4 B;  1SA0 A;  3AG2 B;  5KMG B;  2DWD C;  2ZR3 A;  1THZ A;  3OUS A;  2WLL B;  5HFL A;  2E75 B;  3KCX A;  2Q73 A;  3E86 A;  4X66 B;  4PD4 F;  1GM9 A;  1VQN V;  3CCR V;  5KHK A;  4GX0 A;  1SC5 B;  5CBH A;  4B3M O;  3CCU V;  3E2E A;  5LP6 B;  1M5I A;  2XAJ A;  2F4V B;  4JI7 B;  1HNZ O;  4E4E A;  2YIC A;  1X4T A;  2CAZ C;  4IGG A;  3OGC C;  4DV0 B;  2BTQ A;  4JTD B;  3RGB A;  1IBL B;  1LUW A;  5CBF A;  1GO3 F;  1FKA O;  2P06 A;  2KSD A;  1OCO C;  5H5N A;  1N36 O;  2DOS A;  4KXR A;  2Q69 A;  3SPC A;  1EZJ A;  4TUY A;  3RFR A;  2DW4 A;  2UXB O;  3JAT A;  4K35 A;  2GTA A;  3EXA A;  3JAW B;  1Z5V A;  2NLJ C;  1WP7 A;  4DR5 O;  3B09 A;  4U7O A;  1CPY A;  2BOB C;  3N2G A;  5IDJ A;  3N27 A;  4DV5 O;  3JAR A;  4B3R O;  1H2G A;  1J95 A;  4ZBM A;  4MW3 A;  4R50 A;  5KX5 A;  1VAR A;  1ZL8 A;  1R73 A;  1O9H A;  4DR2 O;  1PL0 A;  1TVK B;  4DR6 O;  5FLX N;  1IBM B;  1JFF A;  4LF9 O;  5CB4 B;  3ZHV A;  1IDS A;  1I0H A;  3ABK C;  5EC1 C;  4IIJ B;  4C7U A;  1IBK O;  1E79 G;  3O65 A;  4MTG A;  1N34 O;  3T1Y B;  2Q9L A;  4JYA B;  1NBM G;  3O9O A;  4JV5 B;  3E8F A;  1K4C C;  1SRY A;  5EYP A;  3OTF A;  3BAA A;  1CP9 A;  4LF7 O;  2ZDI A;  5IJ9 A;  2ILM A;  2YEV B;  2JS5 A;  3WFV A;  1MG1 A;  4NXN O;  4TQD A;  3B4S A;  3LNM B;  3K0D A;  4FPP A;  1N4C A;  4X65 B;  4UCO A;  1VQL V;  4UB8 Z;  2VRZ A;  4Q6G A;  4G2K A;  5IYZ A;  1S76 D;  2Y4T A;  3E22 A;  4AQY O;  1PPJ H;  4WF9 V;  4FZ1 A;  1SF9 A;  1TA8 A;  4J7K A;  2AXT Z;  2Q67 A;  4JI3 O;  1XNQ B;  1WP8 A;  2QA4 V;  2QKC A;  1K4D C;  4MVU A;  4DRX A;  3OD4 A;  3FD9 A;  1L1F A;  2YIA A;  3DXR A;  4J7J A;  5LOV B;  5EBW C;  2RNB A;  3Q4H A;  2LFS A;  4XBF A;  4B3S O;  4GX2 A;  4CS4 A;  1PNK A;  1KBH A;  1P7G A;  3ZHR A;  1Q5O A;  4K3A A;  3L75 H;  4PA9 A;  2JGD A;  4DUZ B;  1SET A;  4H0L B;  2KKW A;  2ODM A;  3BA9 A;  4J80 A;  3RYC A;  5A2Q N;  3SYO A;  4X1K B;  1IZ3 A;  4R7C A;  1GMG A;  5LMN B;  4YJ2 B;  3D3I A;  2LJ2 A;  1RM1 B;  1B04 A;  5ITZ B;  4WBN B;  4GT1 A;  3OFN G;  4DV1 O;  2UUA B;  5IE9 A;  4I0X A;  1VF6 A;  5EZY A;  3K59 A;  3A0R A;  1M56 C;  2UXX A;  4B08 A;  4DUY O;  4X62 O;  2NNU A;  2HHH O;  4BIZ A;  4UVC A;  1N33 O;  1N36 B;  4TQF A;  1XL6 A;  3JSL A;  4P9O A;  1BHA A;  1BMF G;  1V55 C;  4CBC A;  1BT8 A;  4DR3 B;  2D2C B;  3RVZ A;  2EIK C;  4LF5 O;  2E76 B;  4WFA V;  1AJP A;  1H8E G;  4PI0 A;  1N32 O;  2Y69 B;  4O4I B;  5IY5 C;  4DR5 B;  5HFM A;  4GX1 A;  4JI4 B;  4D7T A;  4NB5 A;  1WJZ A;  1KU9 A;  1KMI Z;  1E1R G;  4O4J B;  1I94 O;  5IYB O;  2N74 A;  2QKS A;  3L74 H;  1XMO B;  1K92 A;  3K08 A;  4MS2 A;  2QTO A;  1VP7 A;  2GTS A;  4JYC A;  3K5N A;  1SA0 B;  1AI6 A;  3ZMZ A;  3K03 A;  3D3Q A;  1S0V A;  5BMV A;  1GRJ A;  3G71 V;  4UB6 Z;  3AG1 B;  2JEX A;  3PJS K;  4FLU A;  2Y48 A;  5EC2 C;  3WU2 Z;  3B8N A;  2IU0 A;  2Q5Z A;  2ZR2 A;  1QR9 A;  1FD9 A;  1URF A;  3UCS C;  3LSQ A;  1W0K G;  4BIU A;  3CYO A;  1S72 V;  1KEC A;  3SJC C;  1YDX A;  1RP3 B;  3DC6 A;  3PN1 A;  2XHB A;  4K8Z A;  1L8D A;  2RMK B;  2OT5 A;  1PM9 A;  4YY3 O;  3JAM N;  1LNQ A;  3CRQ A;  2OIG A;  1GN3 A;  5E79 Z;  1WB7 A;  2CE4 A;  3JCZ A;  2BTQ B;  4JGS A;  1NT2 B;  2X0L A;  4NTX A;  1IXM A;  2A3Q A;  3ETE A;  1SZX A;  3OW2 U;  1Q8I A;  2P7T C;  3AG4 C;  3CPW U;  4TUY B;  2OYQ A;  3AG2 C;  3CWB H;  3JAT B;  4LF6 O;  4IYI A;  4K0K O;  4NVP A;  1K34 A;  2HR3 A;  4JI5 B;  1NU1 H;  1FPO A;  2H94 A;  3N2G B;  1G6U A;  4LNU A;  4KHP O;  2BSK A;  2BTO A;  4DV6 B;  3OE7 G;  4L8J A;  5LP6 C;  1ZL8 B;  2LGW A;  2R9A A;  1AI7 A;  1BCC H;  2WLN A;  4TOI A;  2R9R B;  2EJ7 A;  3CRR A;  1JFF B;  5H2F Z;  1SQQ H;  4QE9 A;  4CC6 A;  4I9W A;  4YHH B;  4JI1 B;  1B3Q A;  3WG7 B;  4ZKI A;  1NJI W;  4MTX A;  1MSW D;  1VQK V;  4HZ3 A;  1ZUQ A;  3FYI B;  4X9Q A;  5IJ9 B;  4P2Z A;  3A2F A;  3ETQ A;  4LCU C;  1GN6 A;  3E83 A;  1DLB A;  3LSS A;  2ATK C;  4X1I B;  1Z2G A;  4PV1 B;  2FYU H;  3RN4 A;  1SQG A;  2Q0A A;  3E22 B;  2VQF B;  2JS3 A;  2P90 A;  2V7Q G;  3C3T A;  4UCT A;  4LH7 A;  4UUJ C;  4J41 A;  1DTO A;  4H44 B;  2AW9 A;  1PNM A;  4UCV A;  1SES A;  1NQT A;  4LP8 A;  4DRX B;  3B2E E;  2W0X A;  3J81 N;  4DR1 O;  2MW2 B;  1XUQ A;  1NH2 D;  3CRM A;  1CEZ A;  1E1Q G;  3Q4H B;  5B1N A;  1KKD A;  1V9P A;  4X64 O;  5BY1 A;  3RYF A;  1MZE A;  1M4U A;  4JI0 O;  4FMT A;  3ABU A;  2IJK A;  1FXK B;  5L3G A;  1XNR B;  4DV4 B;  3I56 V;  1KB9 F;  4AIL C;  3RYC B;  1XBL A;  1WA8 A;  2QWN B;  2GHY A;  3ZHT A;  5J9P C;  5IWA O;  4OX9 B;  5JCO C;  3K04 A;  2IJI A;  4DV7 B;  1LUV A;  2YDE A;  4FLT A;  3DSQ A;  1NI8 A;  4LH6 A;  1JMK C;  5KUM A;  2WSS G;  3D36 A;  4JYB A;  4JTA B;  5EZY B;  3QF7 A;  1D5A A;  2EIJ B;  1M93 A;  1RSO A;  4X66 O;  2IJH A;  1AIL A;  4CH5 A;  3ETG A;  3IAY A;  4RAI A;  3SYP A;  1YTF D;  2F4V O;  3APO A;  1TUB A;  1PV0 A;  3OT7 A;  3L71 H;  3RWR D;  1NS1 A;  2YID A;  4J11 A;  4ZHQ A;  4UV9 A;  3K06 A;  3AG3 B;  3TET A;  1COW G;  3A0B Z;  1IBL O;  4LFA B;  1BQZ A;  3ZHS A;  2F1M A;  4U7N A;  2AGA A;  2L35 A;  2PI5 A;  1XHX A;  3G80 A;  1RM1 C;  1VQ4 V;  1FJG B;  4JZG A;  1D5N A;  5L3F A;  3P30 A;  1TGO A;  4UCU A;  1ORQ C;  4JI2 B;  1WPX A;  2K9P A; 
#chains in the Genus database with same CATH homology
 2Q69 A;  3SPC A;  1EZJ A;  3CCJ V;  3CD6 V;  2DW4 A;  4PA7 A;  3ASO B;  4MSW C;  2OTJ V;  1S77 D;  3NXS A;  2HVJ C;  1H8H G;  4LC1 A;  2JDI G;  3OR6 C;  3RVY A;  1PNL A;  2QM7 A;  2NLJ C;  2UXN A;  5EBM C;  1K8A W;  4QJF B;  4U7O A;  1CPY A;  2A0L A;  5C93 A;  2BOB C;  2P67 A;  3CCM V;  3F7V C;  1FS0 G;  2OCC C;  3ETD A;  2EIN B;  5IDJ A;  2AHY A;  1N8R W;  2LFR A;  1H2G A;  1J95 A;  4ZBM A;  3W7U A;  4MW3 A;  1K5S A;  2EBO A;  4R50 A;  3ZRW B;  4XDL A;  2IW5 A;  1OHH G;  1R73 A;  2WLI B;  4G27 B;  1WLE A;  1PL0 A;  2BOC C;  4R8C A;  2ZD9 A;  3SPG A;  3QNE A;  4LBE C;  1Y66 A;  3MHS C;  3T4D A;  1MAB G;  1R3L C;  3ABK C;  5EC1 C;  1BHB A;  1I5X A;  1E79 G;  4MTG A;  3G4S V;  3OUF A;  2DYS B;  2HVK C;  1M1K W;  2DYS C;  1NBM G;  1VQM V;  3OEE G;  3QO7 A;  3K0G A;  3T1C A;  3E8F A;  1K4C C;  1SRY A;  2WLM A;  1F4N A;  4PDL A;  1W2B U;  3CC4 V;  1CP9 A;  2ZQM A;  5H6Q A;  2ZDI A;  4PA4 A;  2HJF C;  3DGE A;  2YEV B;  1AI4 A;  3WFV A;  1KD1 W;  3T4Z A;  1MG1 A;  4PDR A;  3LNM B;  3K0D A;  4FPP A;  1OCR B;  3ASN C;  3KG2 A;  4PA3 A;  2W6J G;  3MD0 A;  3OMI B;  1VQL V;  1P4R A;  1S76 D;  4G2K A;  2EIL B;  3OR7 C;  5LHI A;  3ZMT A;  3E8H A;  2EIL C;  2Q6A A;  4WF9 V;  3CMA V;  1VQ9 V;  2ITC C;  4CZZ A;  2QEX V;  4I5S A;  1G8M A;  2IJJ A;  3CME V;  4RO2 A;  2Q67 A;  4QPK A;  1K73 W;  1EBO A;  2QA4 V;  1K4D C;  1KP2 A;  2P6J A;  4Z1M G;  3ZN1 A;  3HB3 B;  1K3E A;  4EKW A;  4MVU A;  2WLI A;  3ZMV A;  5LBQ A;  2ZXW B;  1L1F A;  4G28 B;  3B8M A;  1FFT B;  1GKF A;  2B5U A;  2IH1 C;  2ZXW C;  3SPJ A;  3F5W C;  3W7S A;  4J9Z B;  3GB7 C;  3E8G A;  5EBW C;  4XBF A;  1VQ5 V;  2LFS A;  1FXH A;  4GX2 A;  5FL7 G;  1GTO A;  1PNK A;  1P7B A;  2QM8 A;  2EIM B;  4KUM A;  3R65 A;  4PA9 A;  3W7W A;  3EFF K;  2B1I A;  1Y4M A;  3OMA B;  4E2L A;  1SET A;  4UVB A;  2YEV A;  2LP7 A;  2XOK G;  5L3C A;  4DXW A;  3FB6 C;  4JF3 A;  1QR8 A;  1XL4 A;  4WFB V;  3SYO A;  4N23 A;  3AEI A;  4R7C A;  4XDK A;  1GMG A;  3ABL B;  5EBL C;  2D3O W;  3D3I A;  1RM1 B;  3LDE A;  1K97 A;  4GT1 A;  4ASU G;  3IGA C;  3CCL V;  2HFE C;  3OFN G;  2WLK A;  3FKS G;  3JD1 A;  2HKO A;  3JD3 A;  2KB1 A;  1OCO B;  4HYO A;  3ZCC A;  3A0R A;  4JPR A;  5LGT A;  1M56 C;  2EJR A;  3ZMU A;  1SZT A;  2M7W A;  2UXX A;  2NNU A;  1DF4 A;  2WAM A;  5B1A C;  3CXC U;  2A79 B;  4BIZ A;  4FIP C;  1KC8 W;  4QNH B;  4UVC A;  2WLL A;  3X2Q B;  3ZRX A;  1V55 B;  1XL6 A;  4RQE A;  4P9O A;  2F43 G;  3X2Q C;  1BHA A;  4PEL A;  1F4M A;  1BMF G;  1V55 C;  2IU3 A;  3H01 A;  4CBC A;  1VQ7 V;  2EIK B;  4TSF G;  4WFF A;  5B1B C;  1F23 A;  1JPX A;  2OCC B;  4TWK A;  3RVZ A;  4X89 A;  3WG7 C;  2EIK C;  5LGU A;  4WFA V;  1AJP A;  1H8E G;  3ZN0 A;  2H8P C;  1M90 W;  5IY5 B;  2Y69 B;  2Z5U A;  4MVS A;  1AI5 A;  2ZDI C;  5IY5 C;  1NR1 A;  2Y69 C;  1AJN A;  3ZRV A;  1V54 C;  5HFM A;  1KP3 A;  4GX1 A;  1YHQ V;  1S3J A;  3E8B A;  1K5Q A;  3ABK B;  3STL C;  3VBB A;  1JCH A;  5H6R A;  3MHH C;  1JX9 A;  1FXV A;  2GSM B;  2B1G A;  3JYC A;  4UV8 A;  1E1R G;  1QLE C;  5IYB O;  5LHG A;  1NH2 B;  2XAH A;  2W6I G;  5L3E A;  2QKS A;  4MT8 A;  1M57 C;  3IFX A;  1K92 A;  3K08 A;  2XAQ A;  4MS2 A;  2QTO A;  5LHH A;  4JYC A;  4WFE A;  1AI6 A;  4XDJ A;  3SJQ C;  5KA6 A;  3STZ C;  2XND G;  3ZMZ A;  1JQ0 A;  3K03 A;  1OCZ B;  4KFM A;  1S0V A;  4WFH A;  3ASN B;  1AJQ A;  2XAG A;  3SPI A;  1OCZ C;  1YJW V;  3K3W A;  3G71 V;  1PKX A;  3E35 A;  3ZIA G;  5KA5 A;  1BL8 A;  2JEX A;  3AG1 B;  3PJS K;  4MVO A;  5IYD O;  4PDV A;  2Y48 A;  5EC2 C;  3CCS V;  3B8N A;  2IU0 A;  3AG1 C;  2ZR2 A;  4X8A A;  4RQF A;  2IH3 C;  1OZ0 A;  3IC7 A;  1QR9 A;  3W7X A;  4F4L A;  2DQ3 A;  3LSQ A;  1W0K G;  4MW8 A;  4BIU A;  3ZRW A;  5CN0 A;  3CYO A;  4N21 A;  1S72 V;  1KEC A;  3TK1 A;  1JVM A;  1UJW B;  3ML0 A;  3GWO A;  1EFR G;  1FXK C;  2X6A A;  2OT5 A;  2C2A A;  5KUK A;  3BY6 A;  1LNQ A;  2XAF A;  1Q81 W;  1GM8 A;  2Z3Y A;  3FB5 C;  3BEH A;  3JCZ A;  2JJ1 G;  2JK5 C;  4JGS A;  4MVZ A;  4MVR A;  2YSU B;  1H38 A;  1QBZ A;  2X0L A;  1NR7 A;  3ZRS A;  1IXM A;  1G4Y B;  3T2M A;  1YTF B;  3ETE A;  4UXN A;  3OW2 U;  2P7T C;  3B77 A;  2EIJ C;  3AG4 C;  3CPW U;  1R3K C;  3CP1 A;  1NVP B;  3AG2 C;  5CMU A;  1RPR A;  3QO5 A;  4WCE V;  1K34 A;  4JAU A;  2HR3 A;  1KQS U;  2ITD C;  2K1E A;  3FB8 C;  2DQ0 A;  2Q68 A;  2WLJ A;  4DO2 A;  1Q86 W;  5L3B A;  3JD4 A;  2H94 A;  2DYR C;  1PD3 A;  3LDC A;  3OE7 G;  1M56 B;  1SER A;  1AI7 A;  2WLN A;  1OCC B;  4QIW F;  2R9R B;  3AG3 C;  5B1A B;  4BW5 A;  1JOY A;  3ABM C;  1OCC C;  1K33 A;  1W0J G;  2XAS A;  1F51 A;  3UKM A;  2JEU A;  4QE9 A;  2CK3 G;  4I9W A;  5BZB A;  5DN6 G;  2QE7 G;  5B1B B;  3OMN B;  4QPJ A;  3G6E V;  3WG7 B;  5L3D A;  4ZKI A;  1NJI W;  4MTX A;  1MSW D;  4PA6 A;  1VQK V;  3DTU B;  5B3S C;  1QCE A;  4HZ3 A;  1VQ8 V;  3FYI B;  4FJC C;  1VQP V;  4P2Z A;  4LCU C;  3FB7 C;  1V54 B;  4GCZ A;  3E83 A;  1YIJ V;  1DLB A;  3LSS A;  2FTK A;  4Q20 A;  3ASO C;  4RUF A;  2ATK C;  4J9Y B;  1YI2 V;  4P9P A;  1VQO V;  3OM3 B;  1M9N A;  2DWE C;  2WPD G;  3SYA A;  1QLE B;  3CCV V;  3EHB B;  4KP4 A;  2P90 A;  2V7Q G;  2OTL V;  4WFG A;  1YIT V;  1M57 B;  4MTF A;  1AR1 B;  4UUJ C;  1DTO A;  2EIN C;  3LUT B;  1PNM A;  5B1O A;  1SES A;  2V1D A;  3K79 A;  5DM6 V;  1NQT A;  4LP8 A;  2W0F C;  1R3I C;  2HLD G;  1GM7 A;  3SPH A;  1I5Y A;  5CBG A;  1B6Q A;  1GK9 A;  4L87 A;  3ABT A;  3JD0 A;  3CCE V;  1R6K A;  2JIZ G;  1YJ9 V;  1NH2 D;  3RBZ A;  4MVM A;  1CEZ A;  1HWY A;  3OEH G;  4X88 A;  1E1Q G;  5E1A C;  3K9A A;  1TUE B;  3SYQ A;  5B1N A;  5GW7 A;  2A9H A;  3W7T A;  1KKD A;  4UVA A;  1QVF U;  4RUE A;  4GX5 A;  1R6N A;  1ZWI C;  4PDM A;  1YJN V;  2WWW A;  4FMT A;  3ABU A;  2IJK A;  3M99 B;  4JAS A;  5CA3 A;  1VQ6 V;  1FXK B;  1RPO A;  3F7Y C;  5L3G A;  1K9M W;  3I56 V;  1JJ2 U;  1ENV A;  4TT3 G;  3ZJZ A;  3QO8 A;  5LGN A;  2GHY A;  2EZO A;  1OCR C;  1DF5 A;  3E89 A;  5J9P C;  2EZP A;  3K04 A;  3CC7 V;  1Q7Y W;  2WLH A;  2IJI A;  2JJ2 G;  1YSC A;  4FK5 C;  5KUM A;  1R3J C;  4OXS A;  3CCQ V;  2WSS G;  3D36 A;  4JYB A;  3CC2 V;  2MK3 A;  4HAM A;  4JTA B;  2PI4 A;  2EIJ B;  3AG4 B;  3AG2 B;  3LDD A;  4H37 A;  5H9C A;  2DWD C;  1NKD A;  2ZR3 A;  2IJH A;  1THZ A;  3OUS A;  3UM7 A;  2X7R B;  2WLL B;  4BAY A;  3I55 V;  2R9I A;  5HFL A;  3ETG A;  3E86 A;  1ROP A;  2AHZ A;  2X6B A;  4RAI A;  3SYP A;  1YTF D;  1GM9 A;  4QE7 A;  1VQN V;  3CCR V;  2DYR B;  4GX0 A;  5CBH A;  4MVQ A;  1NVP D;  3CCU V;  2EIM C;  3E2E A;  4P30 A;  4JTC B;  3RW0 A;  4UV9 A;  1FXK A;  3K06 A;  2XAJ A;  3FYE B;  3AG3 B;  3P32 A;  3TET A;  1COW G;  3ABM B;  4YXW G;  5IYC O;  3HPL C;  1MOF A;  3OAA G;  5EK0 A;  2HG5 C;  4R6Z A;  4U7N A;  3OGC C;  3VOU A;  4JAV A;  3ZMS A;  3TCU A;  2PI5 A;  3ABL C;  4JTD B;  5CBF A;  4MTO A;  1RM1 C;  1VQ4 V;  1GO3 F;  1QLN A;  3JD2 A;  2X6C A;  5B3S B;  1Q82 W;  5L3F A;  3P30 A;  4H33 A;  1K7D A;  1OCO C;  1ORQ C;  1S5H C;  1WPX A;  3SYC A;  1QVG U;  1ARO P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...