4J9YB

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
89
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
publication title Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/calcium binding
total genus 35
structure length 89
sequence length 97
ec nomenclature
pdb deposition date 2013-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4j9yB00
4PA6A 1P7BA 4XDLA 4WFHA 1JVMA 2Y69C 3SYOA 3K0DA 4RAIA 2R9RB 3RVZA 3K04A 4PA7A 1K4CC 2Q67A 3E8HA 4GX5A 3IGAC 5B1AC 2W0FC 4MW8A 5KUMA 3AG4C 3T2MA 4BW5A 1XL4A 2KB1A 3ABKC 2Q6AA 1ZWIC 2ITCC 3OR7C 4MSWC 4PA4A 4MVOA 2A79B 1LNQA 2QTOA 2ZXWC 4J9ZB 2X6BA 2HVJC 1M57C 1G4YB 5BZBA 2Q69A 4MVRA 3SYCA 4LP8A 3OR6C 3HPLC 4GX1A 4WFEA 1OCRC 2HFEC 2WLJA 1R3IC 3T1CA 2K1EA 3PJSK 5B1BC 1R3JC 3ASNC 2HG5C 5EBMC 3F7VC 4JTCB 2JK5C 4G27B 4RUFA 2P7TC 3FB8C 2BOBC 5CBHA 1R3KC 4OXSA 3RVYA 3E8FA 2HJFC 4I9WA 5EBWC 3SYAA 1XL6A 5EBLC 4F4LA 4X8AA 3K08A 4ZBMA 2DYRC 3TETA 4H37A 4R6ZA 3SPJA 3KG2A 1V54C 3R65A 4MTOA 4MTFA 4PA9A 4JTAB 4PA3A 3K06A 5CBGA 2EINC 4QE9A 3SPIA 2ATKC 4P9PA 4J9YB 4RO2A 4XDKA 3FB5C 3SYPA 4UUJC 3ASOC 3STLC 3STZC 4R7CA 1BL8A 2A9HA 2ZD9A 4MVSA 3T4DA 2A0LA 3LDDA 4G28B 4MW3A 2WLNA 5J9PC 4PDLA 3UM7A 5KUKA 3VOUA 3LDCA 3TCUA 3WG7C 2X6CA 2QKSA 5EC1C 4MVMA 2WLHA 2WLIB 2NLJC 4WFFA 4RUEA 4XDJA 1KKDA 2WLIA 1K4DC 2IH1C 4LBEC 2OCCC 3E8GA 3SYQA 1M56C 3AG1C 3F7YC 3ABLC 3E83A 3SJQC 2EIMC 3JYCA 4MVUA 3SPCA 3T4ZA 3K03A 3K0GA 3OUFA 3E8BA 3BEHA 2DWEC 5IY5C 4QNHB 4P30A 4MTGA 3SPGA 5EC2C 3SPHA 4PDRA 4R50A 1ORQC 3OGCC 4P9OA 3OUSA 1J95A 4R8CA 3AG2C 4WFGA 4EKWA 2EIJC 2HVKC 3ZRSA 3LDEA 4HYOA 3RBZA 2BOCC 3AG3C 4H33A 3IFXA 4HZ3A 1QLEC 2WLKA 1OCZC 4MS2A 4QE7A 4KFMA 3FB7C 3UKMA 3ZJZA 2X6AA 4LCUC 1S5HC 5CBFA 4PDVA 4X88A 2Q68A 4GX0A 4TWKA 1V55C 4X89A 2AHYA 2AHZA 2IH3C 2DWDC 3X2QC 2WLLB 3F5WC 3LUTB 3RW0A 2DYSC 2ITDC 5E1AC 2WLLA 3EFFK 3E89A 1R3LC 3FB6C 2EILC 2WLMA 4GX2A 4P2ZA 4CBCA 5EK0A 3E86A 4JTDB 3GB7C 4MVQA 5B3SC 2YEVA 4MVZA 4DXWA 3LNMB 3ABMC 1OCCC 1OCOC 2H8PC 4PDMA 2EIKC
chains in the Genus database with same CATH superfamily
4RAIA 1ZX3A 3IGAC 4CH3A 5F2VO 1XHZA 3CCEV 1PNLA 4O2BA 4J9ZB 4LFAB 1VQNV 1S0VA 3L75H 2OWOA 1ZUQA 3CHXA 4B3TB 2AZ2A 5DECA 2K1EA 4JZ2A 1N34B 3K58A 2MW2B 4LFCO 2EIMB 4TV9B 3K3WA 3ZBHA 1N36B 5IYCO 1HNXB 1GKFA 4YJ3B 3Q4HB 3J81N 5KHKA 5LOVA 4UCVA 3WFVA 3QF7A 2K9PA 2XAFA 5LA6A 3TXSA 2VQFB 4F6RA 5IYZB 4DR1O 3VBBA 3GWKC 4BIZA 1H8EG 3IAYA 1B6QA 5J9PC 2EIMC 3K03A 4DV1O 1E79G 3TXQA 1LUVA 1OCCB 4R8CA 3ZHTA 3ZRSA 3G67A 2VS0A 2YC0A 4NXNB 1K8AW 1FXKB 3OTOO 3FB7C 2CTWA 2Y4UA 2GTAA 2A06H 1IURA 4K8XA 1XBLA 1YXBA 2AHZA 3M8AA 4JYBA 1NQTA 1GTOA 5KHHA 4DR3O 2RJZA 5L3FA 3ZCCA 4JTDB 1NH2D 2YEVB 3L72H 5CA1A 4NYKA 3CPWU 2QDOA 1OCCC 3FFQA 4EFBA 3HKBA 2OIEA 2UUBB 1MSWD 4NXMB 3SYOA 5L3CA 2PTMA 3RVZA 4E4EA 1FJGO 1FXKC 3CP1A 1PL4A 1XEQA 5LHGA 1Z5VA 3ZMZA 1WN7A 2VWJA 1O9HA 4DV5B 2YXYA 1XNQO 4LR3A 5B1BB 4GX1A 3SJAC 1SZXA 2HFEC 3CS5A 4J41A 4DRXA 4TOIA 2UUCO 3QO5A 3U10A 4ZOLA 4JI8O 2EJRA 2HJFC 2RN9A 3SDLA 1E1QG 4QJFB 3ZEDA 1Q81W 1N4CA 2EIJB 1CPYA 1VEWA 1PPJH 1L1FA 3K06A 3ZN0A 2ZNJA 4RO2A 2XTAA 5JCOC 4CH5A 4JI7O 3VQYA 1A32A 3FYIB 3K9SA 1HNWO 3OEHG 4J7KA 1U97A 2IH1C 2LW7A 4GKKO 1MG1A 4X65O 1I5XA 3E8BA 4I4TA 3S3WA 4JV5O 1ZAUA 1OCOB 3LSSA 2UXCO 4DR2B 1QLEB 2EIJC 3JD1A 1JPXA 4B3MO 3FYEB 3HB3B 5L3DA 5LXTA 1XMQO 4LCUC 3ZHVA 3MD0A 4DW1A 2Q68A 2A7WA 3LNNA 2Y0IA 1H2KA 1BZKA 2XOKG 5BMVB 4J80A 4GZRB 1XQ8A 3F5WC 1IBLB 4KHPO 1Y76A 1R3LC 3HKCA 2EILC 2WLMA 2N04A 5B3SB 3H01A 3ZRWA 1SA0A 4WBNA 4NB5A 5LGNA 4N21A 1OCOC 5CA0A 3ZX6A 1EFRG 2YUAA 4DV4B 3O9OA 4DV6B 1YSCA 2B1GA 2QM7A 5IYDO 1GO3F 2YIBD 2P4KA 1S5JA 2PZSA 1IBKO 1N33O 1DLBA 5H6RA 5K1PA 4JYAO 1VQOV 1SESA 2FMLA 2ZNIA 3UCSC 4AI8A 2ZE8A 1W59A 2OCCB 5JJNB 3JD3A 4DK1A 1FFTB 3B40A 4TQDA 1QNMA 1SQPH 3B8MA 5CBHA 2GUZB 1SKVA 3E8FA 1AJPA 1MZFA 2YIBA 4B7KA 1P49A 3EXAA 1WPXA 3TETA 2M7WA 4R6ZA 3SPJA 4O4JB 2R9AA 3AG3B 4YJ2A 3E22A 2E5LO 5CB4A 1EM1A 1H2LA 4J9YB 4JASA 4X1KB 4U3JA 2OIGA 1SQXH 3UT5A 1KKDA 3FAVA 1VQ5V 4FFBB 3BVOA 4KUMA 2YXLA 2WA4A 4H13B 4RUEA 2UXNA 2WLIA 1BQ0A 4DUZB 2OCCC 4NTYA 3A0HZ 5AG2A 2GTSA 3SPCA 2QKAA 2IW5A 2ZE5A 3DC6A 3JD2A 5DEDA 1F51A 5EC2C 1IXBA 3ZMTA 4Z1MG 3T1YB 4KP4A 1GN2A 4JI3O 3AG3C 4H33A 2ZM6B 3CJHA 3UQ8A 1K92A 5BR8B 3ABKB 5KLVH 4U7NA 1IBMB 1WPBA 1I5YA 3JD4A 3QTCA 1FYJA 3CCUV 5JVDA 4LF5O 3BHPA 1PD3A 2XHBA 3ZMSA 2DN9A 1Y74B 1ZTEA 5LMUB 4DR4B 3K5MA 1SQFA 5B1AB 2BTQB 1TVKB 1BE3H 3AK1A 1F4MA 4N23A 1ENVA 1WB8A 3PN1A 1NJIW 3BPZA 2RMKB 3ABKC 1FS0G 2ITCC 3JCUZ 3ZHSA 1M57C 3P30A 4FJCC 2JJ1G 3W7TA 5GTHZ 2IU3A 2WLJA 1YZBA 1WP7A 2PYJA 4LFCB 4DYLA 3CRCA 3E35A 5BY1A 3NXSA 4TV9A 3N2KB 1GM7A 4YJ3A 4I0XB 3Q4HA 5L3EA 3H1IH 3R65A 5KX5B 4JTAB 2HHHO 2CH7B 2YIDA 3STLC 4DR1B 1AI6A 1JX9A 3VOUA 5IYZA 1QHTA 4ICGA 4ABMA 4F6EA 2Q9LA 3SYQA 4FVMA 4DV1B 5FNVA 5B66Z 2WPDG 1RP3B 2Q0OC 5EZYB 4H44B 4DV7O 3QO8A 3RYCB 1R73A 4R50A 3N2GB 1S72V 2HVKC 2Y69B 5IYBO 3RWRD 2V1DA 3OTOB 3AG7A 4MS2A 1FXKA 4A5UB 1Z2GA 5IWAO 2UUAO 2ZE7A 4GX0A 3I5DA 2WLLB 1XUQA 2X0LA 1VQKV 3GB7C 1MSDA 5JJEB 2JJ2G 1BQZA 2YEVA 1CEZA 4ZHQB 2FYUH 2QA4V 1YTFB 4RQFA 2C2AA 4FZ0A 4UV8A 1JA8A 1M4UA 2Y69C 2R9RB 1SQGA 4B3RO 3E8HA 4GX5A 1QCEA 4PA4A 4ZKIA 4D7SA 4MVOA 1BT8A 1XNQB 4YIPA 4BAYA 5B5EZ 3KKYA 1VQLV 3D36C 3BABA 4MVRA 2DE0X 1SERA 3CWBH 4JF3A 2XAGA 2UUCB 4CS4A 1QLNA 2HG5C 2P90A 1K9MW 1GK9A 3KCYA 1R3KC 5EBWC 4X64O 1KU9A 1PV0A 2RCVA 4BIUA 3ZS8C 4MTOA 1KQSU 1WJZA 1AROP 4QE9A 3RGBA 1GN4A 2XT9A 1GM9A 2WA3A 4JI7B 1THZA 1HNWB 4KXRA 1NT2B 2D3OW 1Q6HA 4GKKB 4X65B 4PI0A 1KC8W 1H2MA 3AG1C 3UO2A 3JAWB 4LC1A 4MVUA 4JV5B 1WB7A 1I08A 3TGUH 2UXCB 5CN0A 1VIBA 3AG2C 4B3MB 3L70H 4UFZA 1XMQB 3D3QA 1GH6A 3AG4B 4IYIA 1WP8A 1VMGA 2CTPA 5JH7B 4QGPA 4FLWA 4KHPB 5BMVA 2DWDC 2LW1A 3E89A 3FB6C 1HR0B 4GUNA 5EK0A 4YY3O 2QWRB 3E86A 1IDSA 1YJWV 3CRMA 3VQVA 2P6JA 4MVZA 1AB3A 1Q90D 2H8PC 2YI9A 4WFHA 2P4VA 3QG5A 4OX9O 2IJHA 3AG4C 3CC7V 2DYRB 1VF6C 4BWAA 1IBKB 5C8YB 1N33B 4HAMA 4IT5A 1SRYA 4JYAB 2AXTZ 2CTRA 3SYCA 4LF4O 4W4KA 4X62O 3OR6C 4WFEA 3T1CA 5D5PA 4Q20A 1L0NH 2EJ7A 5H2FZ 5BXZA 4LWSB 2P7TC 1N32O 1PM9A 2UXXA 4OXSA 2GUZA 4FK5C 2YDEA 1XL6A 3OFNG 2DYRC 3WB2A 2E5LB 4H37A 2PYLA 1WLEA 1QQCA 4O4JA 5LGTA 1Q86W 5LL6Y 2YICA 4X1KA 1J5EO 1M9NA 4MVSA 1NTZH 3DGEA 4JAUA 1V55B 4FFBA 4FLVA 3WG7C 1FFXB 2JRIA 1HW7A 5EIBC 1EBOA 2Q7HA 1IX9A 3K57A 3SJQC 1N0NA 3OTFA 1G8MA 2R70A 3BEHA 4J7ZA 3OW2U 2QM8A 4QNHB 1VQ6V 5DM6V 2JEUA 1SC5B 2VQEO 1H8HG 1YVWA 2ZDIC 4JI3B 4EEQA 2Q4PA 2P22C 1XDCA 1EN4A 2NNUA 3SJBC 4O4IB 4FMTA 4OPAA 4UVBA 1S5HC 2D2CB 2H3OA 3G80A 1Y67A 1V55C 4X89A 1Y66A 1DF4A 1Q8IA 4JYYA 1OCRB 4LF5B 1Y6XA 2BCCH 2ZT9B 3GWOA 3HR0A 1Y74A 3WB0A 2BTQA 1TVKA 3W7XA 3CC2V 1XL4A 2CK3G 1EZJA 2Q6AA 1ZWIC 4PELA 2ZR3A 5GONB 3HKDB 2WAMA 1LNQA 4K35A 4C7UA 1MZEA 3C3SA 1AI4A 4JI6O 4H0LB 5B1NA 1OCRC 3CCSV 2NR5A 3ASNC 2DQ0A 2PI4A 4CH4A 4BR6A 1Q43A 1LUWA 4X1IB 1DK1A 2ARHA 2DQ3A 1NVPB 3N2KA 3DC5A 2B5UA 4I0XA 2HHHB 1GMGA 4MTFA 2XAJA 4O4HB 5CBGA 5KX5A 2CH7A 2BE3A 4NR1A 4Z2WA 2A0LA 3DSQA 3I55V 1Q5OA 2X6CA 4MVMA 4FM2A 1K4DC 2LJ2A 4DV7B 1YI2V 3ETQA 4P30A 4FFKA 5EZYA 3B4SA 3RYCA 2EIKB 1KBHA 1XHXA 3N2GA 1YTFD 2JIZG 4GYCB 4HZ3A 1OCZC 5IJ9B 1OZ0A 5IWAB 2UUAB 3D3IA 3U0ZA 2HJDA 2EILB 4DK0A 1NU1H 3JASB 1BS3A 3RW0A 4JAVA 2WLLA 2XNDG 3EFFK 2QWNB 2UXDO 2CGOA 2NN4A 4UB8Z 4D7TA 4ZHQA 5A2QN 4LF8O 2ZIMA 2EIKC 1QVGU 1P7BA 4DV3O 4B3RB 1G1XB 4AHCA 4DUYO 3H1HH 5KUMA 2UXBO 4UB6Z 3T2MA 2VWKA 3GVMA 3JCZA 2Y48A 5GW7A 3TK1A 1ZLZA 2Q7EA 3RYIB 1HR0O 2L35A 1BSMA 5IJ0B 2QWOB 2JS5A 1PL0A 5KMGB 1AJQA 5FPRA 5KA6A 1E1RG 4X64B 3H9VA 3THOA 2DOSA 4JZGA 4ASUG 3KG2A 3SJCC 2EINC 1JOYA 5LHIA 2ADQB 5LBQA 3ZHQA 2RNBA 1OV9A 3TCUA 1L0LH 2B9ZA 3X2QB 2HKOA 2KSDA 2F4VO 3BA8A 1M56C 2F95B 1YITV 4IL6Z 3IC9A 3JAWA 5LYJB 2QKCA 1RSOA 1R1BA 4LF9O 4FLXA 1NS1A 1K3EA 3JD0A 4PV1B 4IYHA 5FLXN 4P9OA 3OUSA 5LMNO 3LDEA 3P32A 1YJNV 2BSKB 5LHHA 3QNEA 2WLKA 4QE7A 2AGAA 1VF6A 1B3QA 2W6JG 4PDVA 1YF2A 4TWKA 5JH7A 4AQYO 4BW9A 3D8CA 3IJ4A 1HNZO 3X2QC 4CC6A 1G6UA 1AR4A 4YY3B 3ZHUA 1US6A 5JQGB 3CCMV 2JEXA 3G6BA 3C3TA 2XAQA 3WU2Z 4OX9B 1M5IA 1I94O 1TAEA 1M57B 1MMMA 1V54B 3BRCA 1FXVA 5C8YA 1NTKH 4LF4B 2LFRA 2LGQA 4X62B 4U7OA 1IXMA 1W0KG 2QEXV 2HLDG 3JARB 2Q5ZA 1R3JC 3SR2C 1WA8B 3JATB 4J11A 4X66O 3JAMN 1D5NA 1N32B 3C90A 2OYQA 4JPRA 2Q0AA 4LWSA 1GN6A 1KKCA 2KG7B 1M93A 4QPJA 3K9AA 1NTMH 3CXHF 4B3SO 2XASA 4E2LA 3EHBB 1V54C 4Q6GA 4FLZA 3ETEA 2Y4TA 1J5EB 4UUJC 5K1XA 3OM3B 2GSMB 4R7CA 1X59A 3T4DA 2OTJV 2GV9A 3LDDA 4MW3A 2HEPA 3UM7A 1XNRO 2OT5A 1FFXA 2ZIOA 3KCXA 4LBEC 1KMIZ 3ZHRA 2ZCEA 2Q8VA 2GHYA 2VQEB 3ICXA 3B77A 1AP6A 4CS3A 1J95A 3RBZA 1NBMG 2F1MA 3J80N 4UCRA 2O57A 4O4IA 1XMOO 2W6IG 4HNAB 4JI2O 4IHJB 4RQEA 2CTQA 4NTXA 3BY6A 5E1AC 4LF7O 1DGSA 1HWYA 1VQPV 1NH2B 1TUBB 5KHGA 2QR4A 1VARA 3S3XA 4K0KO 4ZOLB 5HFMA 1WNSA 4K3AA 4EFEA 1S77D 2H94A 4PA7A 2W0FC 4IGGA 1JMKC 3WB1A 1NVPD 1BHBA 1S5LZ 4FLYA 4J42A 4MSWC 3AK3A 5GONA 2ZXWC 3HKDA 4JI6B 5BZBA 2KQXA 1HDJA 1QVFU 3W7UA 1H2GA 1M90W 1O9GA 1JJOA 4YHHB 2E75B 4X1IA 2Y0PA 1TUEB 2AW9A 1GM8A 3A0BZ 4HBNA 3OAAG 2EZOA 3F5TA 4GT1A 5JWPA 5DN6G 4UCTA 4GKJO 4LH6A 3J7AU 4PHZA 1XREA 2YI8A 5JCOA 5L3GA 3OGIB 4O4HA 3SYPA 2P67A 4FLTA 1KECA 1V9PA 2WLNA 4TQFA 1SETA 2MK3A 3HKEB 2BTOA 3AG1B 3CB2A 4TV8B 2NLJC 4DW0A 1R6NA 5KHIA 3ZRWB 1AR5A 3AG2B 3SPGA 2M6YA 4WFGA 1D2DA 1F7YA 3LSQA 1BMFG 2BOCC 3IFXA 1P4RA 4D6TH 2JDIG 1RM1B 4O4LB 4Z1VA 5IJ9A 4DR7O 4RWUA 2QM4A 4I50B 2UXDB 3JASA 3JALB 4J7JA 4GX2A 4DR6O 1EN5A 4JI5O 2GBOA 1LR1A 4LF8B 2YIAA 2E74B 4DV3B 1Q3EA 2ILMA 2Z0AA 4DUYB 1F23A 1OJHA 4UV9A 1JQ0A 1AP5A 1JVMA 2UXBB 2HP8A 3ABUA 1RM1C 3M7MX 4PJ0Z 3CEIA 3OR7C 2A79B 4I55B 5D5QA 2HVJC 3G4SV 1PNMA 3RYIA 4LP8A 4ZI7B 3NR7A 1H2NA 3K5OA 5IJ0A 4UCOA 1Q6IA 3N27A 5KMGA 4JI0O 4JYCA 3CD6V 1K5QA 1NR7A 2IJJA 3RVYA 3CCLV 4DO2A 5EBLC 1GN3A 2WSSG 4PA9A 4UXNA 2ATKC 4P9PA 3MHSC 5KAFZ 3WG7B 1P84F 5LP6B 5FL7G 1X4TA 3OEEG 2F4VB 1BHAA 3JAKB 1ZL8B 2E3CA 2DYSB 2N05A 1SQVH 3E83A 4LF9B 4L87A 4LF6O 3K0GA 1MOFA 5LYJA 3CRQA 1DF5A 4PI2A 2DWEC 4J10A 5LMNB 3ZMVA 4EKWA 3FD9A 3VQWA 2V4DA 2BSKA 2GDSA 4WFAV 2JGUA 2IJIA 2FKXA 4AQYB 1HNZB 5LP6C 3A8TA 4UCUA 2DYSC 1VQMV 4P2ZA 4LFBO 5JQGA 3OMAB 2R72A 1JFFB 4JI1O 2ZINA 3CRAA 3ABMC 1VF7A 1KYOF 4PDMA 3RYHB 3CMEV 1I94B 1K4CC 3RT3C 4BW5A 1KD1W 2JVDA 5E79Z 3DXRB 2FTKA 1AR1B 3FX7A 4MTXA 2X6BA 2YXHA 1MA1A 3ASNB 1QR9A 1R3IC 4CS2A 3JARA 4X66B 1WA8A 3JATA 4LNUB 4JTCB 2Z5UA 1QU7A 4G27B 1B06A 1PP9H 2BOBC 2JGDB 1K7DA 1YDXA 5KHJA 3K5LA 3RFRA 5FNVB 2KG7A 2IJKA 1B04A 1URFA 4B3SB 1RPOA 3K08A 4ZBMA 2ODMA 1JR9A 2EZPA 2Z3YA 4PA3A 3TJTA 5ITZB 2YSUB 4O2AB 4XDKA 4L8JA 3STZC 2Q7GA 1XNRB 1AI7A 2A9HA 2ZD9A 2UU9O 3ETDA 3MHHC 4PDLA 1IVSA 2PY5A 2WLHA 1D5AA 3E8GA 4YHHO 3JYCA 3OUFA 4MT8A 3ZIAG 3QVNA 4DR5B 4BIOA 2QE7G 2PGGA 5EYPB 3MDSA 1OCZB 1S3JA 4HYOA 1UPGA 4X20B 1XMOB 3UKMA 4JI2B 4HNAA 4IHJA 4LF7B 3K79A 3LUTB 2RDCA 1MNGA 5LGUA 3A0RA 4CBCA 2DW4A 4IIJB 1TUBA 1DTOA 4K0KB 4EB6B 4PA6A 4TUYB 3BCCH 4DV2O 4QPKA 3AK2A 1W0JG 2KB1A 1XOUA 1KP2A 3D36A 1G4YB 4JAAA 1QR8A 1COWG 3JSLA 3PJSK 5B1BC 3P3NA 5EBMC 3K5NA 4DV0O 2JK5C 3ABLB 2ZQMA 1UJWB 4GKJB 5H9CA 2EINB 1KP3A 3AEIA 3QO7A 1AVMA 2V7QG 2F23A 3SPIA 3ZRVA 2LP7A 3L71H 3OMIB 4NKGB 3ZRXA 2E76B 1Q7YW 2P06A 5CMUA 1SZTA 3LDCA 1M56B 2WWWA 3HKEA 5B1OA 1U96A 4TV8A 3OMNB 3ZMUA 3CSXA 3F7YC 3ABLC 1VQ4V 5J2TB 1FPOA 5IE9A 1TGOA 3CE2A 5J2UB 5TISZ 2G38A 1ORQC 4TSFG 1YHQV 1QLEC 1KB9F 4JI4O 4O4LA 4DR7B 1FXHA 1GRJA 5CBFA 4X88A 5H5NA 4YXWG 4DR6B 4I50A 3L9DA 4U3FH 3JALA 4UCSA 4JI5B 4X1YB 2ZR2A 1S76D 3LSUA 3OE7G 2KKWA 1ROPA 1FKAO 5B3SC 1VQ8V 3RYFB 2XAHA 3T1HO 4YIOA 5C93A 1OHHG 4B08A 4XDLA 3K0DA 2QWPB 1K73W 1SQQH 3G71V 3ZN1A 2EX3A 4FLUA 5KA5A 3ETGA 4WFBV 4O2BB 3MAQA 4LH7A 5HFLA 2QWQB 4I55A 3CCVV 2HR3A 3ABTA 5L3BA 4LFAO 3L73H 3HPLC 4XBFA 3UO3A 4ZI7A 1XILA 3BFRA 4B3TO 1AILA 4JI0B 5EIBD 1JCHA 1N34O 5JJJB 2ZE6A 4FIPC 1AI5A 3APOA 2QGNA 1VQ7V 1N36O 1HNXO 4G2KA 2Q73A 4F4LA 4X8AA 5GTIZ 2XUMA 1WAZA 4KL1A 1SF9A 3FKSG 1FAFA 1UFIA 1IZ3A 5LOVB 2CDYA 1NI8A 3K59A 4NTWA 3A2FA 2PF4E 3SGIA 1CP9A 1EZVH 5LA6B 4F6RB 1Q82W 2FL4A 4WCEV 1ZSPA 4FPPA 5LP6A 2VQFO 4WFFA 3JAKA 1ZL8A 2DJVA 4LF6B 2QTSA 4CH6A 3T4ZA 2ZDIA 1W2BU 2ADPA 1N8RW 3P3PA 3OGCC 1VF5B 2QSAA 1SQBH 3BAAA 3H1LH 4ZIBA 4NXNO 2PI5A 5CA3A 2W0XA 3VQXA 3OD4A 2ITDC 4LFBB 2P5OA 1QBZA 3L74H 5CA1B 4JI1B 4DR5O 1Z5WA 3CYOA 3LNMB 3I56V 2N74A 1JFFA 3HKBB 1T5EA 2F43G 3CCJV 2UUBO 3RYHA 4NXMO 2CUGA 3K04A 5B1AC 4MW8A 1HP8A 2R9IA 4QIWF 2ZXWB 3ML0A 3DXRA 2QTOA 2VRZA 4GLXA 2Q69A 4DV5O 5H6QA 1I7FA 2EULA 4DRXB 3CC4V 3BA9A 4GCZA 4UVCA 3F7VC 4LNUA 4RUFA 3FB8C 3EVKA 2JGDA 3B09A 1NR1A 3R66A 3SYAA 1SS3A 4AILC 3IC7A 3CCQV 1VQ9V 2F66C 2LQTA 3B2EE 2DMXA 1CXZB 5ITZA 4O2AA 1K33A 1YJ9V 2UU9B 4G28B 1M1KW 2FB5A 2QKSA 2YS8A 5EC1C 2CGNA 4JGSA 4DR3B 4CZZA 2F93B 4I4TB 4I7ZB 1I0HA 4MTGA 1R6KA 4CC5A 3O65A 5EYPA 3RN4A 4DR2O 5LXTB 1YCIA 2LFSA 4X20A 2X7RB 1TA8A 1FJGB 4WF9V 5FPOA 1K97A 3JSNA 2IH3C 2ETNA 1Y76B 2CAZC 3HKCB 1IBLO 2OCHA 3CXCU 1SA0B 4WBNB 2LO1A 1BCCH 2CE4A 4OGQB 3G6EV 4IIJA 1EN6A 3W7SA 3B8NA 4I5SA 5CA0B 4EB6A 2OTLV 2QJ1A 4JI8B 4DV2B 4DV4O 4TUYA 4DV6O 2Q67A 3U11A 1BGYH 4FM0A 3APQA 2JS3A 1P7GA 2IU0A 3CCRV 3E2EA 1H38A 3ASOB 1H2SB 4TT3G 4FZ1A 4X9QA 1KUQA 1NZ6A 4DV0B 3OT7A 4UVAA 3CMAV 3CX5F 1VP7A 3CRRA 1MABG 4I9WA 5IY5B 1RFYA 1RSOB 3W7WA 4NVPA 1XI1A 3KZIZ 4YJ2B 5IT9N 3E22B 1NKDA 5CB4B 1K34A 4U3JB 2A3QA 5A9GA 3FB5C 4PD4F 1YEWA 3ASOC 3UT5B 3FAVB 1BL8A 1K5SA 2AZ0A 5KUKA 2PUSA 4OPHA 1JJ2U 4B7EA 1FD9A 2WLIB 4XDJA 4DUZO 1RPRA 5J2TA 1AJNA 5IY5C 5J2UA 1Y4MA 3SPHA 2ZKOA 1F4NA 4PDRA 4W4LA 1L8DA 2B1IA 3T1YO 3M99B 1R6TA 4JI4B 3CJHB 2IBZH 4I9QA 2LGWA 4KFMA 3ZJZA 4FM1A 2X6AA 2ZM6O 3DTUB 1Q6UA 5BR8O 2EBOA 1N0JA 2AHYA 1PKXA 1IBMO 2IM9A 3H1KH 4K8ZA 5JVDB 5KAIZ 1GAXA 1PNKA 2L6LA 4X1YA 3ABMB 3T1HB 5IDJA 4DXWA 3H1JH 3RYFA 1YIJV 4MVQA 5LMUO 4DR4O 2RQ6A
chains in the Genus database with same CATH topology
4PA6A 4UV8A 2Y69C 4RAIA 2R9RB 4QPKA 3E8HA 4GX5A 3IGAC 1W0JG 1QCEA 2KB1A 1M57B 1KP2A 1V54B 4PA4A 3CCEV 1FXVA 1PNLA 3D36A 4ZKIA 4MVOA 4BAYA 4J9ZB 1VQNV 1S0VA 2LFRA 1VQLV 1G4YB 4MVRA 4U7OA 1SERA 1QR8A 1IXMA 1W0KG 4JF3A 2QEXV 1COWG 2HLDG 2K1EA 2XAGA 3PJSK 5B1BC 1R3JC 1QLNA 2HG5C 2P90A 5EBMC 1K9MW 1GK9A 2JK5C 3ABLB 2ZQMA 4JPRA 2EIMB 1R3KC 3K3WA 5IYCO 4QPJA 1GKFA 3K9AA 5EBWC 1UJWB 5H9CA 2EINB 2XASA 4E2LA 4BIUA 1KP3A 3EHBB 1V54C 1S76D 3AEIA 4MTOA 1KQSU 3QO7A 3ETEA 1AROP 4QE9A 2V7QG 3SPIA 3WFVA 3ZRVA 4UUJC 2LP7A 1GM9A 3OM3B 2GSMB 3OMIB 2XAFA 4R7CA 1THZA 3ZRXA 3T4DA 2OTJV 3LDDA 1Q7YW 4MW3A 5CMUA 3UM7A 2D3OW 1SZTA 3LDCA 3VBBA 1M56B 2OT5A 2WWWA 5B1OA 3OMNB 4LBEC 4BIZA 3ZMUA 1KC8W 1H8EG 3AG1C 3ABLC 3F7YC 4LC1A 1B6QA 1VQ4V 5J9PC 2EIMC 4MVUA 3K03A 1E79G 2GHYA 1OCCB 5CN0A 3B77A 1ORQC 1J95A 4R8CA 3AG2C 3ZRSA 4TSFG 1YHQV 3RBZA 1NBMG 3AG4B 1QLEC 1K8AW 1FXKB 3FB7C 1FXHA 5CBFA 2W6IG 4X88A 4YXWG 2AHZA 4RQEA 4JYBA 2DWDC 1NQTA 1GTOA 3BY6A 5E1AC 3E89A 3FB6C 5L3FA 2ZR2A 5EK0A 1HWYA 3OE7G 3ZCCA 3E86A 4JTDB 1VQPV 1NH2D 1NH2B 2YEVB 1ROPA 1YJWV 5B3SC 2P6JA 1VQ8V 4MVZA 3CPWU 2XAHA 1OCCC 2H8PC 5C93A 1OHHG 1MSWD 5HFMA 4XDLA 4WFHA 3SYOA 3K0DA 5L3CA 1S77D 3RVZA 2H94A 4PA7A 2IJHA 2W0FC 1K73W 3G71V 3AG4C 3CC7V 3ZN1A 1FXKC 1NVPD 3CP1A 2DYRB 1BHBA 5KA5A 3ETGA 4WFBV 5LHGA 4MSWC 4HAMA 3ZMZA 1SRYA 2ZXWC 5HFLA 3CCVV 2HR3A 5BZBA 3ABTA 5L3BA 3SYCA 3OR6C 3HPLC 4GX1A 4WFEA 5B1BB 4XBFA 2HFEC 3T1CA 1QVFU 3W7UA 1H2GA 4Q20A 1M90W 3QO5A 1JCHA 2P7TC 2UXXA 2EJRA 4OXSA 4FIPC 1TUEB 1AI5A 2HJFC 1GM8A 1E1QG 4QJFB 1VQ7V 4FK5C 3OAAG 4G2KA 1XL6A 2EZOA 1Q81W 4F4LA 4GT1A 3OFNG 4X8AA 5DN6G 2EIJB 1CPYA 2DYRC 1L1FA 3FKSG 4H37A 1WLEA 3K06A 5L3GA 5LGTA 3ZN0A 1Q86W 4RO2A 3SYPA 1CP9A 2P67A 1KECA 1M9NA 4MVSA 1Q82W 4WCEV 3DGEA 4JAUA 2WLNA 1V55B 4FPPA 1SETA 2MK3A 3FYIB 3WG7C 3AG1B 3OEHG 4WFFA 2NLJC 1EBOA 2IH1C 1MG1A 3SJQC 1R6NA 3T4ZA 1I5XA 3E8BA 1G8MA 3ZRWB 3BEHA 3AG2B 3OW2U 2QM8A 2ZDIA 4QNHB 1W2BU 1VQ6V 5DM6V 2JEUA 1OCOB 3LSSA 3SPGA 1N8RW 1H8HG 3OGCC 2ZDIC 4WFGA 1QLEB 2EIJC 3JD1A 3LSQA 1JPXA 1BMFG 2BOCC 2NNUA 3IFXA 3FYEB 1P4RA 3HB3B 5L3DA 2JDIG 4FMTA 1RM1B 4LCUC 2PI5A 4UVBA 1S5HC 3MD0A 2Q68A 2XOKG 1V55C 4X89A 5CA3A 1Y66A 1DF4A 3F5WC 2ITDC 1OCRB 1R3LC 4GX2A 2EILC 2WLMA 5B3SB 3H01A 3ZRWA 1QBZA 3GWOA 5LGNA 3CYOA 3LNMB 3I56V 4N21A 1OCOC 1EFRG 1F23A 2F43G 4UV9A 1JQ0A 1JVMA 1YSCA 3CCJV 2B1GA 3W7XA 3K04A 2QM7A 5IYDO 5B1AC 3ABUA 4MW8A 2R9IA 1GO3F 4QIWF 2ZXWB 1XL4A 2CK3G 1RM1C 3CC2V 3ML0A 1EZJA 2Q6AA 1ZWIC 4PELA 2ZR3A 3OR7C 2A79B 2WAMA 1LNQA 2QTOA 1DLBA 2HVJC 5H6RA 3G4SV 2Q69A 1PNMA 1AI4A 5H6QA 1VQOV 1SESA 4LP8A 5B1NA 1OCRC 3CCSV 3CC4V 3ASNC 2DQ0A 2PI4A 4GCZA 2OCCB 4UVCA 3F7VC 3JD3A 4JYCA 4RUFA 1FFTB 3FB8C 3CD6V 5CBHA 1K5QA 1NR7A 2IJJA 3B8MA 3RVYA 3E8FA 1AJPA 2DQ3A 1NVPB 1NR1A 3CCLV 3SYAA 4DO2A 5EBLC 3IC7A 2B5UA 1WPXA 3TETA 3CCQV 1VQ9V 2M7WA 4R6ZA 2WSSG 1GMGA 4MTFA 3SPJA 3AG3B 2XAJA 4PA9A 5CBGA 4UXNA 2ATKC 4P9PA 4J9YB 3MHSC 4JASA 1K33A 3WG7B 1YJ9V 2A0LA 1VQ5V 4G28B 1KKDA 5FL7G 3OEEG 1M1KW 4KUMA 3I55V 1BHAA 2X6CA 2QKSA 5EC1C 4MVMA 2DYSB 4RUEA 2UXNA 2WLIA 4JGSA 1K4DC 2OCCC 4CZZA 3E83A 3SPCA 4L87A 3K0GA 1YI2V 1MOFA 2IW5A 1DF5A 3JD2A 2DWEC 4P30A 4MTGA 1F51A 5EC2C 1R6KA 3ZMTA 2EIKB 3ZMVA 4Z1MG 4EKWA 4KP4A 1YTFD 2JIZG 3AG3C 4H33A 4HZ3A 2LFSA 1OCZC 2X7RB 1OZ0A 1K92A 3ABKB 4WFAV 4WF9V 2IJIA 4U7NA 3D3IA 1K97A 2EILB 1I5YA 2IH3C 3JD4A 3RW0A 4JAVA 2DYSC 1VQMV 2WLLA 2XNDG 3EFFK 4P2ZA 3CXCU 3CCUV 3G6EV 1PD3A 3OMAB 3ZMSA 3W7SA 3B8NA 3ABMC 4I5SA 2OTLV 4PDMA 5B1AB 2EIKC 1QVGU 1P7BA 3CMEV 1F4MA 4N23A 1ENVA 1K4CC 2Q67A 5KUMA 4BW5A 1NJIW 1KD1W 3T2MA 2FTKA 3ABKC 2IU0A 3CCRV 1FS0G 2ITCC 3E2EA 1AR1B 4MTXA 3JCZA 2Y48A 5GW7A 2X6BA 3TK1A 1M57C 1H38A 3P30A 3ASOB 4FJCC 2JJ1G 4TT3G 3W7TA 3ASNB 2IU3A 1QR9A 2WLJA 1R3IC 1PL0A 1AJQA 4JTCB 2Z5UA 4G27B 4UVAA 3E35A 3CMAV 5KA6A 2BOBC 3NXSA 1K7DA 1E1RG 1MABG 2IJKA 4I9WA 5IY5B 3W7WA 1GM7A 1RPOA 3K08A 4ZBMA 5L3EA 4ASUG 2EZPA 3KG2A 2Z3YA 1NKDA 3R65A 4JTAB 4PA3A 2EINC 1K34A 2YSUB 1JOYA 4XDKA 3FB5C 5LHIA 3ASOC 3STLC 3STZC 5LBQA 1BL8A 1AI7A 2A9HA 1K5SA 1AI6A 2ZD9A 3ETDA 3MHHC 4PDLA 5KUKA 1JX9A 3VOUA 3TCUA 3X2QB 1JJ2U 2HKOA 2WLHA 2WLIB 4XDJA 3SYQA 3E8GA 1M56C 1YITV 3JYCA 1RPRA 3OUFA 4MT8A 2WPDG 3ZIAG 1AJNA 1K3EA 3JD0A 5IY5C 3QO8A 1Y4MA 3SPHA 2QE7G 1F4NA 1R73A 4P9OA 4PDRA 4R50A 3OUSA 1OCZB 1S72V 2HVKC 2Y69B 5IYBO 3LDEA 3P32A 1S3JA 2B1IA 4HYOA 2V1DA 1YJNV 3M99B 5LHHA 3QNEA 2WLKA 4MS2A 4QE7A 4KFMA 3ZJZA 3UKMA 1FXKA 2X6AA 2W6JG 3DTUB 4PDVA 2EBOA 4GX0A 4TWKA 2AHYA 1PKXA 3X2QC 3K79A 2WLLB 3LUTB 5LGUA 3A0RA 4CBCA 1PNKA 2X0LA 3ABMB 2DW4A 1VQKV 3GB7C 3CCMV 2JJ2G 2YEVA 2JEXA 1DTOA 5IDJA 4DXWA 1CEZA 1YIJV 2QA4V 1YTFB 4RQFA 2C2AA 4MVQA 2XAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA6 A;  1P7B A;  4XDL A;  4WFH A;  1JVM A;  2Y69 C;  3SYO A;  3K0D A;  4RAI A;  2R9R B;  3RVZ A;  3K04 A;  4PA7 A;  1K4C C;  2Q67 A;  3E8H A;  4GX5 A;  3IGA C;  5B1A C;  2W0F C;  4MW8 A;  5KUM A;  3AG4 C;  3T2M A;  4BW5 A;  1XL4 A;  2KB1 A;  3ABK C;  2Q6A A;  1ZWI C;  2ITC C;  3OR7 C;  4MSW C;  4PA4 A;  4MVO A;  2A79 B;  1LNQ A;  2QTO A;  2ZXW C;  4J9Z B;  2X6B A;  2HVJ C;  1M57 C;  1G4Y B;  5BZB A;  2Q69 A;  4MVR A;  3SYC A;  4LP8 A;  3OR6 C;  3HPL C;  4GX1 A;  4WFE A;  1OCR C;  2HFE C;  2WLJ A;  1R3I C;  3T1C A;  2K1E A;  3PJS K;  5B1B C;  1R3J C;  3ASN C;  2HG5 C;  5EBM C;  3F7V C;  4JTC B;  2JK5 C;  4G27 B;  4RUF A;  2P7T C;  3FB8 C;  2BOB C;  5CBH A;  1R3K C;  4OXS A;  3RVY A;  3E8F A;  2HJF C;  4I9W A;  5EBW C;  3SYA A;  1XL6 A;  5EBL C;  4F4L A;  4X8A A;  3K08 A;  4ZBM A;  2DYR C;  3TET A;  4H37 A;  4R6Z A;  3SPJ A;  3KG2 A;  1V54 C;  3R65 A;  4MTO A;  4MTF A;  4PA9 A;  4JTA B;  4PA3 A;  3K06 A;  5CBG A;  2EIN C;  4QE9 A;  3SPI A;  2ATK C;  4P9P A;  4J9Y B;  4RO2 A;  4XDK A;  3FB5 C;  3SYP A;  4UUJ C;  3ASO C;  3STL C;  3STZ C;  4R7C A;  1BL8 A;  2A9H A;  2ZD9 A;  4MVS A;  3T4D A;  2A0L A;  3LDD A;  4G28 B;  4MW3 A;  2WLN A;  5J9P C;  4PDL A;  3UM7 A;  5KUK A;  3VOU A;  3LDC A;  3TCU A;  3WG7 C;  2X6C A;  2QKS A;  5EC1 C;  4MVM A;  2WLH A;  2WLI B;  2NLJ C;  4WFF A;  4RUE A;  4XDJ A;  1KKD A;  2WLI A;  1K4D C;  2IH1 C;  4LBE C;  2OCC C;  3E8G A;  3SYQ A;  1M56 C;  3AG1 C;  3F7Y C;  3ABL C;  3E83 A;  3SJQ C;  2EIM C;  3JYC A;  4MVU A;  3SPC A;  3T4Z A;  3K03 A;  3K0G A;  3OUF A;  3E8B A;  3BEH A;  2DWE C;  5IY5 C;  4QNH B;  4P30 A;  4MTG A;  3SPG A;  5EC2 C;  3SPH A;  4PDR A;  4R50 A;  1ORQ C;  3OGC C;  4P9O A;  3OUS A;  1J95 A;  4R8C A;  3AG2 C;  4WFG A;  4EKW A;  2EIJ C;  2HVK C;  3ZRS A;  3LDE A;  4HYO A;  3RBZ A;  2BOC C;  3AG3 C;  4H33 A;  3IFX A;  4HZ3 A;  1QLE C;  2WLK A;  1OCZ C;  4MS2 A;  4QE7 A;  4KFM A;  3FB7 C;  3UKM A;  3ZJZ A;  2X6A A;  4LCU C;  1S5H C;  5CBF A;  4PDV A;  4X88 A;  2Q68 A;  4GX0 A;  4TWK A;  1V55 C;  4X89 A;  2AHY A;  2AHZ A;  2IH3 C;  2DWD C;  3X2Q C;  2WLL B;  3F5W C;  3LUT B;  3RW0 A;  2DYS C;  2ITD C;  5E1A C;  2WLL A;  3EFF K;  3E89 A;  1R3L C;  3FB6 C;  2EIL C;  2WLM A;  4GX2 A;  4P2Z A;  4CBC A;  5EK0 A;  3E86 A;  4JTD B;  3GB7 C;  4MVQ A;  5B3S C;  2YEV A;  4MVZ A;  4DXW A;  3LNM B;  3ABM C;  1OCC C;  1OCO C;  2H8P C;  4PDM A;  2EIK C; 
#chains in the Genus database with same CATH topology
 4RAI A;  1ZX3 A;  3IGA C;  4CH3 A;  5F2V O;  1XHZ A;  3CCE V;  1PNL A;  4O2B A;  4J9Z B;  4LFA B;  1VQN V;  1S0V A;  3L75 H;  2OWO A;  1ZUQ A;  3CHX A;  4B3T B;  2AZ2 A;  5DEC A;  2K1E A;  4JZ2 A;  1N34 B;  3K58 A;  2MW2 B;  4LFC O;  2EIM B;  4TV9 B;  3K3W A;  3ZBH A;  1N36 B;  5IYC O;  1HNX B;  1GKF A;  4YJ3 B;  3Q4H B;  3J81 N;  5KHK A;  5LOV A;  4UCV A;  3WFV A;  3QF7 A;  2K9P A;  2XAF A;  5LA6 A;  3TXS A;  2VQF B;  4F6R A;  5IYZ B;  4DR1 O;  3VBB A;  3GWK C;  4BIZ A;  1H8E G;  3IAY A;  1B6Q A;  5J9P C;  2EIM C;  3K03 A;  4DV1 O;  1E79 G;  3TXQ A;  1LUV A;  1OCC B;  4R8C A;  3ZHT A;  3ZRS A;  3G67 A;  2VS0 A;  2YC0 A;  4NXN B;  1K8A W;  1FXK B;  3OTO O;  3FB7 C;  2CTW A;  2Y4U A;  2GTA A;  2A06 H;  1IUR A;  4K8X A;  1XBL A;  1YXB A;  2AHZ A;  3M8A A;  4JYB A;  1NQT A;  1GTO A;  5KHH A;  4DR3 O;  2RJZ A;  5L3F A;  3ZCC A;  4JTD B;  1NH2 D;  2YEV B;  3L72 H;  5CA1 A;  4NYK A;  3CPW U;  2QDO A;  1OCC C;  3FFQ A;  4EFB A;  3HKB A;  2OIE A;  2UUB B;  1MSW D;  4NXM B;  3SYO A;  5L3C A;  2PTM A;  3RVZ A;  4E4E A;  1FJG O;  1FXK C;  3CP1 A;  1PL4 A;  1XEQ A;  5LHG A;  1Z5V A;  3ZMZ A;  1WN7 A;  2VWJ A;  1O9H A;  4DV5 B;  2YXY A;  1XNQ O;  4LR3 A;  5B1B B;  4GX1 A;  3SJA C;  1SZX A;  2HFE C;  3CS5 A;  4J41 A;  4DRX A;  4TOI A;  2UUC O;  3QO5 A;  3U10 A;  4ZOL A;  4JI8 O;  2EJR A;  2HJF C;  2RN9 A;  3SDL A;  1E1Q G;  4QJF B;  3ZED A;  1Q81 W;  1N4C A;  2EIJ B;  1CPY A;  1VEW A;  1PPJ H;  1L1F A;  3K06 A;  3ZN0 A;  2ZNJ A;  4RO2 A;  2XTA A;  5JCO C;  4CH5 A;  4JI7 O;  3VQY A;  1A32 A;  3FYI B;  3K9S A;  1HNW O;  3OEH G;  4J7K A;  1U97 A;  2IH1 C;  2LW7 A;  4GKK O;  1MG1 A;  4X65 O;  1I5X A;  3E8B A;  4I4T A;  3S3W A;  4JV5 O;  1ZAU A;  1OCO B;  3LSS A;  2UXC O;  4DR2 B;  1QLE B;  2EIJ C;  3JD1 A;  1JPX A;  4B3M O;  3FYE B;  3HB3 B;  5L3D A;  5LXT A;  1XMQ O;  4LCU C;  3ZHV A;  3MD0 A;  4DW1 A;  2Q68 A;  2A7W A;  3LNN A;  2Y0I A;  1H2K A;  1BZK A;  2XOK G;  5BMV B;  4J80 A;  4GZR B;  1XQ8 A;  3F5W C;  1IBL B;  4KHP O;  1Y76 A;  1R3L C;  3HKC A;  2EIL C;  2WLM A;  2N04 A;  5B3S B;  3H01 A;  3ZRW A;  1SA0 A;  4WBN A;  4NB5 A;  5LGN A;  4N21 A;  1OCO C;  5CA0 A;  3ZX6 A;  1EFR G;  2YUA A;  4DV4 B;  3O9O A;  4DV6 B;  1YSC A;  2B1G A;  2QM7 A;  5IYD O;  1GO3 F;  2YIB D;  2P4K A;  1S5J A;  2PZS A;  1IBK O;  1N33 O;  1DLB A;  5H6R A;  5K1P A;  4JYA O;  1VQO V;  1SES A;  2FML A;  2ZNI A;  3UCS C;  4AI8 A;  2ZE8 A;  1W59 A;  2OCC B;  5JJN B;  3JD3 A;  4DK1 A;  1FFT B;  3B40 A;  4TQD A;  1QNM A;  1SQP H;  3B8M A;  5CBH A;  2GUZ B;  1SKV A;  3E8F A;  1AJP A;  1MZF A;  2YIB A;  4B7K A;  1P49 A;  3EXA A;  1WPX A;  3TET A;  2M7W A;  4R6Z A;  3SPJ A;  4O4J B;  2R9A A;  3AG3 B;  4YJ2 A;  3E22 A;  2E5L O;  5CB4 A;  1EM1 A;  1H2L A;  4J9Y B;  4JAS A;  4X1K B;  4U3J A;  2OIG A;  1SQX H;  3UT5 A;  1KKD A;  3FAV A;  1VQ5 V;  4FFB B;  3BVO A;  4KUM A;  2YXL A;  2WA4 A;  4H13 B;  4RUE A;  2UXN A;  2WLI A;  1BQ0 A;  4DUZ B;  2OCC C;  4NTY A;  3A0H Z;  5AG2 A;  2GTS A;  3SPC A;  2QKA A;  2IW5 A;  2ZE5 A;  3DC6 A;  3JD2 A;  5DED A;  1F51 A;  5EC2 C;  1IXB A;  3ZMT A;  4Z1M G;  3T1Y B;  4KP4 A;  1GN2 A;  4JI3 O;  3AG3 C;  4H33 A;  2ZM6 B;  3CJH A;  3UQ8 A;  1K92 A;  5BR8 B;  3ABK B;  5KLV H;  4U7N A;  1IBM B;  1WPB A;  1I5Y A;  3JD4 A;  3QTC A;  1FYJ A;  3CCU V;  5JVD A;  4LF5 O;  3BHP A;  1PD3 A;  2XHB A;  3ZMS A;  2DN9 A;  1Y74 B;  1ZTE A;  5LMU B;  4DR4 B;  3K5M A;  1SQF A;  5B1A B;  2BTQ B;  1TVK B;  1BE3 H;  3AK1 A;  1F4M A;  4N23 A;  1ENV A;  1WB8 A;  3PN1 A;  1NJI W;  3BPZ A;  2RMK B;  3ABK C;  1FS0 G;  2ITC C;  3JCU Z;  3ZHS A;  1M57 C;  3P30 A;  4FJC C;  2JJ1 G;  3W7T A;  5GTH Z;  2IU3 A;  2WLJ A;  1YZB A;  1WP7 A;  2PYJ A;  4LFC B;  4DYL A;  3CRC A;  3E35 A;  5BY1 A;  3NXS A;  4TV9 A;  3N2K B;  1GM7 A;  4YJ3 A;  4I0X B;  3Q4H A;  5L3E A;  3H1I H;  3R65 A;  5KX5 B;  4JTA B;  2HHH O;  2CH7 B;  2YID A;  3STL C;  4DR1 B;  1AI6 A;  1JX9 A;  3VOU A;  5IYZ A;  1QHT A;  4ICG A;  4ABM A;  4F6E A;  2Q9L A;  3SYQ A;  4FVM A;  4DV1 B;  5FNV A;  5B66 Z;  2WPD G;  1RP3 B;  2Q0O C;  5EZY B;  4H44 B;  4DV7 O;  3QO8 A;  3RYC B;  1R73 A;  4R50 A;  3N2G B;  1S72 V;  2HVK C;  2Y69 B;  5IYB O;  3RWR D;  2V1D A;  3OTO B;  3AG7 A;  4MS2 A;  1FXK A;  4A5U B;  1Z2G A;  5IWA O;  2UUA O;  2ZE7 A;  4GX0 A;  3I5D A;  2WLL B;  1XUQ A;  2X0L A;  1VQK V;  3GB7 C;  1MSD A;  5JJE B;  2JJ2 G;  1BQZ A;  2YEV A;  1CEZ A;  4ZHQ B;  2FYU H;  2QA4 V;  1YTF B;  4RQF A;  2C2A A;  4FZ0 A;  4UV8 A;  1JA8 A;  1M4U A;  2Y69 C;  2R9R B;  1SQG A;  4B3R O;  3E8H A;  4GX5 A;  1QCE A;  4PA4 A;  4ZKI A;  4D7S A;  4MVO A;  1BT8 A;  1XNQ B;  4YIP A;  4BAY A;  5B5E Z;  3KKY A;  1VQL V;  3D36 C;  3BAB A;  4MVR A;  2DE0 X;  1SER A;  3CWB H;  4JF3 A;  2XAG A;  2UUC B;  4CS4 A;  1QLN A;  2HG5 C;  2P90 A;  1K9M W;  1GK9 A;  3KCY A;  1R3K C;  5EBW C;  4X64 O;  1KU9 A;  1PV0 A;  2RCV A;  4BIU A;  3ZS8 C;  4MTO A;  1KQS U;  1WJZ A;  1ARO P;  4QE9 A;  3RGB A;  1GN4 A;  2XT9 A;  1GM9 A;  2WA3 A;  4JI7 B;  1THZ A;  1HNW B;  4KXR A;  1NT2 B;  2D3O W;  1Q6H A;  4GKK B;  4X65 B;  4PI0 A;  1KC8 W;  1H2M A;  3AG1 C;  3UO2 A;  3JAW B;  4LC1 A;  4MVU A;  4JV5 B;  1WB7 A;  1I08 A;  3TGU H;  2UXC B;  5CN0 A;  1VIB A;  3AG2 C;  4B3M B;  3L70 H;  4UFZ A;  1XMQ B;  3D3Q A;  1GH6 A;  3AG4 B;  4IYI A;  1WP8 A;  1VMG A;  2CTP A;  5JH7 B;  4QGP A;  4FLW A;  4KHP B;  5BMV A;  2DWD C;  2LW1 A;  3E89 A;  3FB6 C;  1HR0 B;  4GUN A;  5EK0 A;  4YY3 O;  2QWR B;  3E86 A;  1IDS A;  1YJW V;  3CRM A;  3VQV A;  2P6J A;  4MVZ A;  1AB3 A;  1Q90 D;  2H8P C;  2YI9 A;  4WFH A;  2P4V A;  3QG5 A;  4OX9 O;  2IJH A;  3AG4 C;  3CC7 V;  2DYR B;  1VF6 C;  4BWA A;  1IBK B;  5C8Y B;  1N33 B;  4HAM A;  4IT5 A;  1SRY A;  4JYA B;  2AXT Z;  2CTR A;  3SYC A;  4LF4 O;  4W4K A;  4X62 O;  3OR6 C;  4WFE A;  3T1C A;  5D5P A;  4Q20 A;  1L0N H;  2EJ7 A;  5H2F Z;  5BXZ A;  4LWS B;  2P7T C;  1N32 O;  1PM9 A;  2UXX A;  4OXS A;  2GUZ A;  4FK5 C;  2YDE A;  1XL6 A;  3OFN G;  2DYR C;  3WB2 A;  2E5L B;  4H37 A;  2PYL A;  1WLE A;  1QQC A;  4O4J A;  5LGT A;  1Q86 W;  5LL6 Y;  2YIC A;  4X1K A;  1J5E O;  1M9N A;  4MVS A;  1NTZ H;  3DGE A;  4JAU A;  1V55 B;  4FFB A;  4FLV A;  3WG7 C;  1FFX B;  2JRI A;  1HW7 A;  5EIB C;  1EBO A;  2Q7H A;  1IX9 A;  3K57 A;  3SJQ C;  1N0N A;  3OTF A;  1G8M A;  2R70 A;  3BEH A;  4J7Z A;  3OW2 U;  2QM8 A;  4QNH B;  1VQ6 V;  5DM6 V;  2JEU A;  1SC5 B;  2VQE O;  1H8H G;  1YVW A;  2ZDI C;  4JI3 B;  4EEQ A;  2Q4P A;  2P22 C;  1XDC A;  1EN4 A;  2NNU A;  3SJB C;  4O4I B;  4FMT A;  4OPA A;  4UVB A;  1S5H C;  2D2C B;  2H3O A;  3G80 A;  1Y67 A;  1V55 C;  4X89 A;  1Y66 A;  1DF4 A;  1Q8I A;  4JYY A;  1OCR B;  4LF5 B;  1Y6X A;  2BCC H;  2ZT9 B;  3GWO A;  3HR0 A;  1Y74 A;  3WB0 A;  2BTQ A;  1TVK A;  3W7X A;  3CC2 V;  1XL4 A;  2CK3 G;  1EZJ A;  2Q6A A;  1ZWI C;  4PEL A;  2ZR3 A;  5GON B;  3HKD B;  2WAM A;  1LNQ A;  4K35 A;  4C7U A;  1MZE A;  3C3S A;  1AI4 A;  4JI6 O;  4H0L B;  5B1N A;  1OCR C;  3CCS V;  2NR5 A;  3ASN C;  2DQ0 A;  2PI4 A;  4CH4 A;  4BR6 A;  1Q43 A;  1LUW A;  4X1I B;  1DK1 A;  2ARH A;  2DQ3 A;  1NVP B;  3N2K A;  3DC5 A;  2B5U A;  4I0X A;  2HHH B;  1GMG A;  4MTF A;  2XAJ A;  4O4H B;  5CBG A;  5KX5 A;  2CH7 A;  2BE3 A;  4NR1 A;  4Z2W A;  2A0L A;  3DSQ A;  3I55 V;  1Q5O A;  2X6C A;  4MVM A;  4FM2 A;  1K4D C;  2LJ2 A;  4DV7 B;  1YI2 V;  3ETQ A;  4P30 A;  4FFK A;  5EZY A;  3B4S A;  3RYC A;  2EIK B;  1KBH A;  1XHX A;  3N2G A;  1YTF D;  2JIZ G;  4GYC B;  4HZ3 A;  1OCZ C;  5IJ9 B;  1OZ0 A;  5IWA B;  2UUA B;  3D3I A;  3U0Z A;  2HJD A;  2EIL B;  4DK0 A;  1NU1 H;  3JAS B;  1BS3 A;  3RW0 A;  4JAV A;  2WLL A;  2XND G;  3EFF K;  2QWN B;  2UXD O;  2CGO A;  2NN4 A;  4UB8 Z;  4D7T A;  4ZHQ A;  5A2Q N;  4LF8 O;  2ZIM A;  2EIK C;  1QVG U;  1P7B A;  4DV3 O;  4B3R B;  1G1X B;  4AHC A;  4DUY O;  3H1H H;  5KUM A;  2UXB O;  4UB6 Z;  3T2M A;  2VWK A;  3GVM A;  3JCZ A;  2Y48 A;  5GW7 A;  3TK1 A;  1ZLZ A;  2Q7E A;  3RYI B;  1HR0 O;  2L35 A;  1BSM A;  5IJ0 B;  2QWO B;  2JS5 A;  1PL0 A;  5KMG B;  1AJQ A;  5FPR A;  5KA6 A;  1E1R G;  4X64 B;  3H9V A;  3THO A;  2DOS A;  4JZG A;  4ASU G;  3KG2 A;  3SJC C;  2EIN C;  1JOY A;  5LHI A;  2ADQ B;  5LBQ A;  3ZHQ A;  2RNB A;  1OV9 A;  3TCU A;  1L0L H;  2B9Z A;  3X2Q B;  2HKO A;  2KSD A;  2F4V O;  3BA8 A;  1M56 C;  2F95 B;  1YIT V;  4IL6 Z;  3IC9 A;  3JAW A;  5LYJ B;  2QKC A;  1RSO A;  1R1B A;  4LF9 O;  4FLX A;  1NS1 A;  1K3E A;  3JD0 A;  4PV1 B;  4IYH A;  5FLX N;  4P9O A;  3OUS A;  5LMN O;  3LDE A;  3P32 A;  1YJN V;  2BSK B;  5LHH A;  3QNE A;  2WLK A;  4QE7 A;  2AGA A;  1VF6 A;  1B3Q A;  2W6J G;  4PDV A;  1YF2 A;  4TWK A;  5JH7 A;  4AQY O;  4BW9 A;  3D8C A;  3IJ4 A;  1HNZ O;  3X2Q C;  4CC6 A;  1G6U A;  1AR4 A;  4YY3 B;  3ZHU A;  1US6 A;  5JQG B;  3CCM V;  2JEX A;  3G6B A;  3C3T A;  2XAQ A;  3WU2 Z;  4OX9 B;  1M5I A;  1I94 O;  1TAE A;  1M57 B;  1MMM A;  1V54 B;  3BRC A;  1FXV A;  5C8Y A;  1NTK H;  4LF4 B;  2LFR A;  2LGQ A;  4X62 B;  4U7O A;  1IXM A;  1W0K G;  2QEX V;  2HLD G;  3JAR B;  2Q5Z A;  1R3J C;  3SR2 C;  1WA8 B;  3JAT B;  4J11 A;  4X66 O;  3JAM N;  1D5N A;  1N32 B;  3C90 A;  2OYQ A;  4JPR A;  2Q0A A;  4LWS A;  1GN6 A;  1KKC A;  2KG7 B;  1M93 A;  4QPJ A;  3K9A A;  1NTM H;  3CXH F;  4B3S O;  2XAS A;  4E2L A;  3EHB B;  1V54 C;  4Q6G A;  4FLZ A;  3ETE A;  2Y4T A;  1J5E B;  4UUJ C;  5K1X A;  3OM3 B;  2GSM B;  4R7C A;  1X59 A;  3T4D A;  2OTJ V;  2GV9 A;  3LDD A;  4MW3 A;  2HEP A;  3UM7 A;  1XNR O;  2OT5 A;  1FFX A;  2ZIO A;  3KCX A;  4LBE C;  1KMI Z;  3ZHR A;  2ZCE A;  2Q8V A;  2GHY A;  2VQE B;  3ICX A;  3B77 A;  1AP6 A;  4CS3 A;  1J95 A;  3RBZ A;  1NBM G;  2F1M A;  3J80 N;  4UCR A;  2O57 A;  4O4I A;  1XMO O;  2W6I G;  4HNA B;  4JI2 O;  4IHJ B;  4RQE A;  2CTQ A;  4NTX A;  3BY6 A;  5E1A C;  4LF7 O;  1DGS A;  1HWY A;  1VQP V;  1NH2 B;  1TUB B;  5KHG A;  2QR4 A;  1VAR A;  3S3X A;  4K0K O;  4ZOL B;  5HFM A;  1WNS A;  4K3A A;  4EFE A;  1S77 D;  2H94 A;  4PA7 A;  2W0F C;  4IGG A;  1JMK C;  3WB1 A;  1NVP D;  1BHB A;  1S5L Z;  4FLY A;  4J42 A;  4MSW C;  3AK3 A;  5GON A;  2ZXW C;  3HKD A;  4JI6 B;  5BZB A;  2KQX A;  1HDJ A;  1QVF U;  3W7U A;  1H2G A;  1M90 W;  1O9G A;  1JJO A;  4YHH B;  2E75 B;  4X1I A;  2Y0P A;  1TUE B;  2AW9 A;  1GM8 A;  3A0B Z;  4HBN A;  3OAA G;  2EZO A;  3F5T A;  4GT1 A;  5JWP A;  5DN6 G;  4UCT A;  4GKJ O;  4LH6 A;  3J7A U;  4PHZ A;  1XRE A;  2YI8 A;  5JCO A;  5L3G A;  3OGI B;  4O4H A;  3SYP A;  2P67 A;  4FLT A;  1KEC A;  1V9P A;  2WLN A;  4TQF A;  1SET A;  2MK3 A;  3HKE B;  2BTO A;  3AG1 B;  3CB2 A;  4TV8 B;  2NLJ C;  4DW0 A;  1R6N A;  5KHI A;  3ZRW B;  1AR5 A;  3AG2 B;  3SPG A;  2M6Y A;  4WFG A;  1D2D A;  1F7Y A;  3LSQ A;  1BMF G;  2BOC C;  3IFX A;  1P4R A;  4D6T H;  2JDI G;  1RM1 B;  4O4L B;  4Z1V A;  5IJ9 A;  4DR7 O;  4RWU A;  2QM4 A;  4I50 B;  2UXD B;  3JAS A;  3JAL B;  4J7J A;  4GX2 A;  4DR6 O;  1EN5 A;  4JI5 O;  2GBO A;  1LR1 A;  4LF8 B;  2YIA A;  2E74 B;  4DV3 B;  1Q3E A;  2ILM A;  2Z0A A;  4DUY B;  1F23 A;  1OJH A;  4UV9 A;  1JQ0 A;  1AP5 A;  1JVM A;  2UXB B;  2HP8 A;  3ABU A;  1RM1 C;  3M7M X;  4PJ0 Z;  3CEI A;  3OR7 C;  2A79 B;  4I55 B;  5D5Q A;  2HVJ C;  3G4S V;  1PNM A;  3RYI A;  4LP8 A;  4ZI7 B;  3NR7 A;  1H2N A;  3K5O A;  5IJ0 A;  4UCO A;  1Q6I A;  3N27 A;  5KMG A;  4JI0 O;  4JYC A;  3CD6 V;  1K5Q A;  1NR7 A;  2IJJ A;  3RVY A;  3CCL V;  4DO2 A;  5EBL C;  1GN3 A;  2WSS G;  4PA9 A;  4UXN A;  2ATK C;  4P9P A;  3MHS C;  5KAF Z;  3WG7 B;  1P84 F;  5LP6 B;  5FL7 G;  1X4T A;  3OEE G;  2F4V B;  1BHA A;  3JAK B;  1ZL8 B;  2E3C A;  2DYS B;  2N05 A;  1SQV H;  3E83 A;  4LF9 B;  4L87 A;  4LF6 O;  3K0G A;  1MOF A;  5LYJ A;  3CRQ A;  1DF5 A;  4PI2 A;  2DWE C;  4J10 A;  5LMN B;  3ZMV A;  4EKW A;  3FD9 A;  3VQW A;  2V4D A;  2BSK A;  2GDS A;  4WFA V;  2JGU A;  2IJI A;  2FKX A;  4AQY B;  1HNZ B;  5LP6 C;  3A8T A;  4UCU A;  2DYS C;  1VQM V;  4P2Z A;  4LFB O;  5JQG A;  3OMA B;  2R72 A;  1JFF B;  4JI1 O;  2ZIN A;  3CRA A;  3ABM C;  1VF7 A;  1KYO F;  4PDM A;  3RYH B;  3CME V;  1I94 B;  1K4C C;  3RT3 C;  4BW5 A;  1KD1 W;  2JVD A;  5E79 Z;  3DXR B;  2FTK A;  1AR1 B;  3FX7 A;  4MTX A;  2X6B A;  2YXH A;  1MA1 A;  3ASN B;  1QR9 A;  1R3I C;  4CS2 A;  3JAR A;  4X66 B;  1WA8 A;  3JAT A;  4LNU B;  4JTC B;  2Z5U A;  1QU7 A;  4G27 B;  1B06 A;  1PP9 H;  2BOB C;  2JGD B;  1K7D A;  1YDX A;  5KHJ A;  3K5L A;  3RFR A;  5FNV B;  2KG7 A;  2IJK A;  1B04 A;  1URF A;  4B3S B;  1RPO A;  3K08 A;  4ZBM A;  2ODM A;  1JR9 A;  2EZP A;  2Z3Y A;  4PA3 A;  3TJT A;  5ITZ B;  2YSU B;  4O2A B;  4XDK A;  4L8J A;  3STZ C;  2Q7G A;  1XNR B;  1AI7 A;  2A9H A;  2ZD9 A;  2UU9 O;  3ETD A;  3MHH C;  4PDL A;  1IVS A;  2PY5 A;  2WLH A;  1D5A A;  3E8G A;  4YHH O;  3JYC A;  3OUF A;  4MT8 A;  3ZIA G;  3QVN A;  4DR5 B;  4BIO A;  2QE7 G;  2PGG A;  5EYP B;  3MDS A;  1OCZ B;  1S3J A;  4HYO A;  1UPG A;  4X20 B;  1XMO B;  3UKM A;  4JI2 B;  4HNA A;  4IHJ A;  4LF7 B;  3K79 A;  3LUT B;  2RDC A;  1MNG A;  5LGU A;  3A0R A;  4CBC A;  2DW4 A;  4IIJ B;  1TUB A;  1DTO A;  4K0K B;  4EB6 B;  4PA6 A;  4TUY B;  3BCC H;  4DV2 O;  4QPK A;  3AK2 A;  1W0J G;  2KB1 A;  1XOU A;  1KP2 A;  3D36 A;  1G4Y B;  4JAA A;  1QR8 A;  1COW G;  3JSL A;  3PJS K;  5B1B C;  3P3N A;  5EBM C;  3K5N A;  4DV0 O;  2JK5 C;  3ABL B;  2ZQM A;  1UJW B;  4GKJ B;  5H9C A;  2EIN B;  1KP3 A;  3AEI A;  3QO7 A;  1AVM A;  2V7Q G;  2F23 A;  3SPI A;  3ZRV A;  2LP7 A;  3L71 H;  3OMI B;  4NKG B;  3ZRX A;  2E76 B;  1Q7Y W;  2P06 A;  5CMU A;  1SZT A;  3LDC A;  1M56 B;  2WWW A;  3HKE A;  5B1O A;  1U96 A;  4TV8 A;  3OMN B;  3ZMU A;  3CSX A;  3F7Y C;  3ABL C;  1VQ4 V;  5J2T B;  1FPO A;  5IE9 A;  1TGO A;  3CE2 A;  5J2U B;  5TIS Z;  2G38 A;  1ORQ C;  4TSF G;  1YHQ V;  1QLE C;  1KB9 F;  4JI4 O;  4O4L A;  4DR7 B;  1FXH A;  1GRJ A;  5CBF A;  4X88 A;  5H5N A;  4YXW G;  4DR6 B;  4I50 A;  3L9D A;  4U3F H;  3JAL A;  4UCS A;  4JI5 B;  4X1Y B;  2ZR2 A;  1S76 D;  3LSU A;  3OE7 G;  2KKW A;  1ROP A;  1FKA O;  5B3S C;  1VQ8 V;  3RYF B;  2XAH A;  3T1H O;  4YIO A;  5C93 A;  1OHH G;  4B08 A;  4XDL A;  3K0D A;  2QWP B;  1K73 W;  1SQQ H;  3G71 V;  3ZN1 A;  2EX3 A;  4FLU A;  5KA5 A;  3ETG A;  4WFB V;  4O2B B;  3MAQ A;  4LH7 A;  5HFL A;  2QWQ B;  4I55 A;  3CCV V;  2HR3 A;  3ABT A;  5L3B A;  4LFA O;  3L73 H;  3HPL C;  4XBF A;  3UO3 A;  4ZI7 A;  1XIL A;  3BFR A;  4B3T O;  1AIL A;  4JI0 B;  5EIB D;  1JCH A;  1N34 O;  5JJJ B;  2ZE6 A;  4FIP C;  1AI5 A;  3APO A;  2QGN A;  1VQ7 V;  1N36 O;  1HNX O;  4G2K A;  2Q73 A;  4F4L A;  4X8A A;  5GTI Z;  2XUM A;  1WAZ A;  4KL1 A;  1SF9 A;  3FKS G;  1FAF A;  1UFI A;  1IZ3 A;  5LOV B;  2CDY A;  1NI8 A;  3K59 A;  4NTW A;  3A2F A;  2PF4 E;  3SGI A;  1CP9 A;  1EZV H;  5LA6 B;  4F6R B;  1Q82 W;  2FL4 A;  4WCE V;  1ZSP A;  4FPP A;  5LP6 A;  2VQF O;  4WFF A;  3JAK A;  1ZL8 A;  2DJV A;  4LF6 B;  2QTS A;  4CH6 A;  3T4Z A;  2ZDI A;  1W2B U;  2ADP A;  1N8R W;  3P3P A;  3OGC C;  1VF5 B;  2QSA A;  1SQB H;  3BAA A;  3H1L H;  4ZIB A;  4NXN O;  2PI5 A;  5CA3 A;  2W0X A;  3VQX A;  3OD4 A;  2ITD C;  4LFB B;  2P5O A;  1QBZ A;  3L74 H;  5CA1 B;  4JI1 B;  4DR5 O;  1Z5W A;  3CYO A;  3LNM B;  3I56 V;  2N74 A;  1JFF A;  3HKB B;  1T5E A;  2F43 G;  3CCJ V;  2UUB O;  3RYH A;  4NXM O;  2CUG A;  3K04 A;  5B1A C;  4MW8 A;  1HP8 A;  2R9I A;  4QIW F;  2ZXW B;  3ML0 A;  3DXR A;  2QTO A;  2VRZ A;  4GLX A;  2Q69 A;  4DV5 O;  5H6Q A;  1I7F A;  2EUL A;  4DRX B;  3CC4 V;  3BA9 A;  4GCZ A;  4UVC A;  3F7V C;  4LNU A;  4RUF A;  3FB8 C;  3EVK A;  2JGD A;  3B09 A;  1NR1 A;  3R66 A;  3SYA A;  1SS3 A;  4AIL C;  3IC7 A;  3CCQ V;  1VQ9 V;  2F66 C;  2LQT A;  3B2E E;  2DMX A;  1CXZ B;  5ITZ A;  4O2A A;  1K33 A;  1YJ9 V;  2UU9 B;  4G28 B;  1M1K W;  2FB5 A;  2QKS A;  2YS8 A;  5EC1 C;  2CGN A;  4JGS A;  4DR3 B;  4CZZ A;  2F93 B;  4I4T B;  4I7Z B;  1I0H A;  4MTG A;  1R6K A;  4CC5 A;  3O65 A;  5EYP A;  3RN4 A;  4DR2 O;  5LXT B;  1YCI A;  2LFS A;  4X20 A;  2X7R B;  1TA8 A;  1FJG B;  4WF9 V;  5FPO A;  1K97 A;  3JSN A;  2IH3 C;  2ETN A;  1Y76 B;  2CAZ C;  3HKC B;  1IBL O;  2OCH A;  3CXC U;  1SA0 B;  4WBN B;  2LO1 A;  1BCC H;  2CE4 A;  4OGQ B;  3G6E V;  4IIJ A;  1EN6 A;  3W7S A;  3B8N A;  4I5S A;  5CA0 B;  4EB6 A;  2OTL V;  2QJ1 A;  4JI8 B;  4DV2 B;  4DV4 O;  4TUY A;  4DV6 O;  2Q67 A;  3U11 A;  1BGY H;  4FM0 A;  3APQ A;  2JS3 A;  1P7G A;  2IU0 A;  3CCR V;  3E2E A;  1H38 A;  3ASO B;  1H2S B;  4TT3 G;  4FZ1 A;  4X9Q A;  1KUQ A;  1NZ6 A;  4DV0 B;  3OT7 A;  4UVA A;  3CMA V;  3CX5 F;  1VP7 A;  3CRR A;  1MAB G;  4I9W A;  5IY5 B;  1RFY A;  1RSO B;  3W7W A;  4NVP A;  1XI1 A;  3KZI Z;  4YJ2 B;  5IT9 N;  3E22 B;  1NKD A;  5CB4 B;  1K34 A;  4U3J B;  2A3Q A;  5A9G A;  3FB5 C;  4PD4 F;  1YEW A;  3ASO C;  3UT5 B;  3FAV B;  1BL8 A;  1K5S A;  2AZ0 A;  5KUK A;  2PUS A;  4OPH A;  1JJ2 U;  4B7E A;  1FD9 A;  2WLI B;  4XDJ A;  4DUZ O;  1RPR A;  5J2T A;  1AJN A;  5IY5 C;  5J2U A;  1Y4M A;  3SPH A;  2ZKO A;  1F4N A;  4PDR A;  4W4L A;  1L8D A;  2B1I A;  3T1Y O;  3M99 B;  1R6T A;  4JI4 B;  3CJH B;  2IBZ H;  4I9Q A;  2LGW A;  4KFM A;  3ZJZ A;  4FM1 A;  2X6A A;  2ZM6 O;  3DTU B;  1Q6U A;  5BR8 O;  2EBO A;  1N0J A;  2AHY A;  1PKX A;  1IBM O;  2IM9 A;  3H1K H;  4K8Z A;  5JVD B;  5KAI Z;  1GAX A;  1PNK A;  2L6L A;  4X1Y A;  3ABM B;  3T1H B;  5IDJ A;  4DXW A;  3H1J H;  3RYF A;  1YIJ V;  4MVQ A;  5LMU O;  4DR4 O;  2RQ6 A; 
#chains in the Genus database with same CATH homology
 4PA6 A;  4UV8 A;  2Y69 C;  4RAI A;  2R9R B;  4QPK A;  3E8H A;  4GX5 A;  3IGA C;  1W0J G;  1QCE A;  2KB1 A;  1M57 B;  1KP2 A;  1V54 B;  4PA4 A;  3CCE V;  1FXV A;  1PNL A;  3D36 A;  4ZKI A;  4MVO A;  4BAY A;  4J9Z B;  1VQN V;  1S0V A;  2LFR A;  1VQL V;  1G4Y B;  4MVR A;  4U7O A;  1SER A;  1QR8 A;  1IXM A;  1W0K G;  4JF3 A;  2QEX V;  1COW G;  2HLD G;  2K1E A;  2XAG A;  3PJS K;  5B1B C;  1R3J C;  1QLN A;  2HG5 C;  2P90 A;  5EBM C;  1K9M W;  1GK9 A;  2JK5 C;  3ABL B;  2ZQM A;  4JPR A;  2EIM B;  1R3K C;  3K3W A;  5IYC O;  4QPJ A;  1GKF A;  3K9A A;  5EBW C;  1UJW B;  5H9C A;  2EIN B;  2XAS A;  4E2L A;  4BIU A;  1KP3 A;  3EHB B;  1V54 C;  1S76 D;  3AEI A;  4MTO A;  1KQS U;  3QO7 A;  3ETE A;  1ARO P;  4QE9 A;  2V7Q G;  3SPI A;  3WFV A;  3ZRV A;  4UUJ C;  2LP7 A;  1GM9 A;  3OM3 B;  2GSM B;  3OMI B;  2XAF A;  4R7C A;  1THZ A;  3ZRX A;  3T4D A;  2OTJ V;  3LDD A;  1Q7Y W;  4MW3 A;  5CMU A;  3UM7 A;  2D3O W;  1SZT A;  3LDC A;  3VBB A;  1M56 B;  2OT5 A;  2WWW A;  5B1O A;  3OMN B;  4LBE C;  4BIZ A;  3ZMU A;  1KC8 W;  1H8E G;  3AG1 C;  3ABL C;  3F7Y C;  4LC1 A;  1B6Q A;  1VQ4 V;  5J9P C;  2EIM C;  4MVU A;  3K03 A;  1E79 G;  2GHY A;  1OCC B;  5CN0 A;  3B77 A;  1ORQ C;  1J95 A;  4R8C A;  3AG2 C;  3ZRS A;  4TSF G;  1YHQ V;  3RBZ A;  1NBM G;  3AG4 B;  1QLE C;  1K8A W;  1FXK B;  3FB7 C;  1FXH A;  5CBF A;  2W6I G;  4X88 A;  4YXW G;  2AHZ A;  4RQE A;  4JYB A;  2DWD C;  1NQT A;  1GTO A;  3BY6 A;  5E1A C;  3E89 A;  3FB6 C;  5L3F A;  2ZR2 A;  5EK0 A;  1HWY A;  3OE7 G;  3ZCC A;  3E86 A;  4JTD B;  1VQP V;  1NH2 D;  1NH2 B;  2YEV B;  1ROP A;  1YJW V;  5B3S C;  2P6J A;  1VQ8 V;  4MVZ A;  3CPW U;  2XAH A;  1OCC C;  2H8P C;  5C93 A;  1OHH G;  1MSW D;  5HFM A;  4XDL A;  4WFH A;  3SYO A;  3K0D A;  5L3C A;  1S77 D;  3RVZ A;  2H94 A;  4PA7 A;  2IJH A;  2W0F C;  1K73 W;  3G71 V;  3AG4 C;  3CC7 V;  3ZN1 A;  1FXK C;  1NVP D;  3CP1 A;  2DYR B;  1BHB A;  5KA5 A;  3ETG A;  4WFB V;  5LHG A;  4MSW C;  4HAM A;  3ZMZ A;  1SRY A;  2ZXW C;  5HFL A;  3CCV V;  2HR3 A;  5BZB A;  3ABT A;  5L3B A;  3SYC A;  3OR6 C;  3HPL C;  4GX1 A;  4WFE A;  5B1B B;  4XBF A;  2HFE C;  3T1C A;  1QVF U;  3W7U A;  1H2G A;  4Q20 A;  1M90 W;  3QO5 A;  1JCH A;  2P7T C;  2UXX A;  2EJR A;  4OXS A;  4FIP C;  1TUE B;  1AI5 A;  2HJF C;  1GM8 A;  1E1Q G;  4QJF B;  1VQ7 V;  4FK5 C;  3OAA G;  4G2K A;  1XL6 A;  2EZO A;  1Q81 W;  4F4L A;  4GT1 A;  3OFN G;  4X8A A;  5DN6 G;  2EIJ B;  1CPY A;  2DYR C;  1L1F A;  3FKS G;  4H37 A;  1WLE A;  3K06 A;  5L3G A;  5LGT A;  3ZN0 A;  1Q86 W;  4RO2 A;  3SYP A;  1CP9 A;  2P67 A;  1KEC A;  1M9N A;  4MVS A;  1Q82 W;  4WCE V;  3DGE A;  4JAU A;  2WLN A;  1V55 B;  4FPP A;  1SET A;  2MK3 A;  3FYI B;  3WG7 C;  3AG1 B;  3OEH G;  4WFF A;  2NLJ C;  1EBO A;  2IH1 C;  1MG1 A;  3SJQ C;  1R6N A;  3T4Z A;  1I5X A;  3E8B A;  1G8M A;  3ZRW B;  3BEH A;  3AG2 B;  3OW2 U;  2QM8 A;  2ZDI A;  4QNH B;  1W2B U;  1VQ6 V;  5DM6 V;  2JEU A;  1OCO B;  3LSS A;  3SPG A;  1N8R W;  1H8H G;  3OGC C;  2ZDI C;  4WFG A;  1QLE B;  2EIJ C;  3JD1 A;  3LSQ A;  1JPX A;  1BMF G;  2BOC C;  2NNU A;  3IFX A;  3FYE B;  1P4R A;  3HB3 B;  5L3D A;  2JDI G;  4FMT A;  1RM1 B;  4LCU C;  2PI5 A;  4UVB A;  1S5H C;  3MD0 A;  2Q68 A;  2XOK G;  1V55 C;  4X89 A;  5CA3 A;  1Y66 A;  1DF4 A;  3F5W C;  2ITD C;  1OCR B;  1R3L C;  4GX2 A;  2EIL C;  2WLM A;  5B3S B;  3H01 A;  3ZRW A;  1QBZ A;  3GWO A;  5LGN A;  3CYO A;  3LNM B;  3I56 V;  4N21 A;  1OCO C;  1EFR G;  1F23 A;  2F43 G;  4UV9 A;  1JQ0 A;  1JVM A;  1YSC A;  3CCJ V;  2B1G A;  3W7X A;  3K04 A;  2QM7 A;  5IYD O;  5B1A C;  3ABU A;  4MW8 A;  2R9I A;  1GO3 F;  4QIW F;  2ZXW B;  1XL4 A;  2CK3 G;  1RM1 C;  3CC2 V;  3ML0 A;  1EZJ A;  2Q6A A;  1ZWI C;  4PEL A;  2ZR3 A;  3OR7 C;  2A79 B;  2WAM A;  1LNQ A;  2QTO A;  1DLB A;  2HVJ C;  5H6R A;  3G4S V;  2Q69 A;  1PNM A;  1AI4 A;  5H6Q A;  1VQO V;  1SES A;  4LP8 A;  5B1N A;  1OCR C;  3CCS V;  3CC4 V;  3ASN C;  2DQ0 A;  2PI4 A;  4GCZ A;  2OCC B;  4UVC A;  3F7V C;  3JD3 A;  4JYC A;  4RUF A;  1FFT B;  3FB8 C;  3CD6 V;  5CBH A;  1K5Q A;  1NR7 A;  2IJJ A;  3B8M A;  3RVY A;  3E8F A;  1AJP A;  2DQ3 A;  1NVP B;  1NR1 A;  3CCL V;  3SYA A;  4DO2 A;  5EBL C;  3IC7 A;  2B5U A;  1WPX A;  3TET A;  3CCQ V;  1VQ9 V;  2M7W A;  4R6Z A;  2WSS G;  1GMG A;  4MTF A;  3SPJ A;  3AG3 B;  2XAJ A;  4PA9 A;  5CBG A;  4UXN A;  2ATK C;  4P9P A;  4J9Y B;  3MHS C;  4JAS A;  1K33 A;  3WG7 B;  1YJ9 V;  2A0L A;  1VQ5 V;  4G28 B;  1KKD A;  5FL7 G;  3OEE G;  1M1K W;  4KUM A;  3I55 V;  1BHA A;  2X6C A;  2QKS A;  5EC1 C;  4MVM A;  2DYS B;  4RUE A;  2UXN A;  2WLI A;  4JGS A;  1K4D C;  2OCC C;  4CZZ A;  3E83 A;  3SPC A;  4L87 A;  3K0G A;  1YI2 V;  1MOF A;  2IW5 A;  1DF5 A;  3JD2 A;  2DWE C;  4P30 A;  4MTG A;  1F51 A;  5EC2 C;  1R6K A;  3ZMT A;  2EIK B;  3ZMV A;  4Z1M G;  4EKW A;  4KP4 A;  1YTF D;  2JIZ G;  3AG3 C;  4H33 A;  4HZ3 A;  2LFS A;  1OCZ C;  2X7R B;  1OZ0 A;  1K92 A;  3ABK B;  4WFA V;  4WF9 V;  2IJI A;  4U7N A;  3D3I A;  1K97 A;  2EIL B;  1I5Y A;  2IH3 C;  3JD4 A;  3RW0 A;  4JAV A;  2DYS C;  1VQM V;  2WLL A;  2XND G;  3EFF K;  4P2Z A;  3CXC U;  3CCU V;  3G6E V;  1PD3 A;  3OMA B;  3ZMS A;  3W7S A;  3B8N A;  3ABM C;  4I5S A;  2OTL V;  4PDM A;  5B1A B;  2EIK C;  1QVG U;  1P7B A;  3CME V;  1F4M A;  4N23 A;  1ENV A;  1K4C C;  2Q67 A;  5KUM A;  4BW5 A;  1NJI W;  1KD1 W;  3T2M A;  2FTK A;  3ABK C;  2IU0 A;  3CCR V;  1FS0 G;  2ITC C;  3E2E A;  1AR1 B;  4MTX A;  3JCZ A;  2Y48 A;  5GW7 A;  2X6B A;  3TK1 A;  1M57 C;  1H38 A;  3P30 A;  3ASO B;  4FJC C;  2JJ1 G;  4TT3 G;  3W7T A;  3ASN B;  2IU3 A;  1QR9 A;  2WLJ A;  1R3I C;  1PL0 A;  1AJQ A;  4JTC B;  2Z5U A;  4G27 B;  4UVA A;  3E35 A;  3CMA V;  5KA6 A;  2BOB C;  3NXS A;  1K7D A;  1E1R G;  1MAB G;  2IJK A;  4I9W A;  5IY5 B;  3W7W A;  1GM7 A;  1RPO A;  3K08 A;  4ZBM A;  5L3E A;  4ASU G;  2EZP A;  3KG2 A;  2Z3Y A;  1NKD A;  3R65 A;  4JTA B;  4PA3 A;  2EIN C;  1K34 A;  2YSU B;  1JOY A;  4XDK A;  3FB5 C;  5LHI A;  3ASO C;  3STL C;  3STZ C;  5LBQ A;  1BL8 A;  1AI7 A;  2A9H A;  1K5S A;  1AI6 A;  2ZD9 A;  3ETD A;  3MHH C;  4PDL A;  5KUK A;  1JX9 A;  3VOU A;  3TCU A;  3X2Q B;  1JJ2 U;  2HKO A;  2WLH A;  2WLI B;  4XDJ A;  3SYQ A;  3E8G A;  1M56 C;  1YIT V;  3JYC A;  1RPR A;  3OUF A;  4MT8 A;  2WPD G;  3ZIA G;  1AJN A;  1K3E A;  3JD0 A;  5IY5 C;  3QO8 A;  1Y4M A;  3SPH A;  2QE7 G;  1F4N A;  1R73 A;  4P9O A;  4PDR A;  4R50 A;  3OUS A;  1OCZ B;  1S72 V;  2HVK C;  2Y69 B;  5IYB O;  3LDE A;  3P32 A;  1S3J A;  2B1I A;  4HYO A;  2V1D A;  1YJN V;  3M99 B;  5LHH A;  3QNE A;  2WLK A;  4MS2 A;  4QE7 A;  4KFM A;  3ZJZ A;  3UKM A;  1FXK A;  2X6A A;  2W6J G;  3DTU B;  4PDV A;  2EBO A;  4GX0 A;  4TWK A;  2AHY A;  1PKX A;  3X2Q C;  3K79 A;  2WLL B;  3LUT B;  5LGU A;  3A0R A;  4CBC A;  1PNK A;  2X0L A;  3ABM B;  2DW4 A;  1VQK V;  3GB7 C;  3CCM V;  2JJ2 G;  2YEV A;  2JEX A;  1DTO A;  5IDJ A;  4DXW A;  1CEZ A;  1YIJ V;  2QA4 V;  1YTF B;  4RQF A;  2C2A A;  4MVQ A;  2XAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...