2XUMA

Factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRHSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 106
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2xumA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xumA01
1MZFA 4QU2A 3P3PA 2YDEA 1H2LA 4B7KA 4JAAA 4BIOA 2Y0IA 1H2MA 2YC0A 2CGOA 2WA4A 1MZEA 2ILMA 3P3NA 1H2KA 4B7EA 3KCXA 1IZ3A 4Z1VA 1H2NA 4NR1A 3D8CA 3KCYA 5JWPA 2CGNA 2XUMA 2WA3A 2W0XA 3OD4A 4Z2WA 4AI8A 1YCIA
chains in the Genus database with same CATH superfamily
2A70A 3TOJA 1H8TB 1DF5A 2VCMA 4FP3A 3G67A 4S2HA 4UOJA 4LF4B 1CPNA 4L11A 3IC7A 5FWEA 1OV9A 5L9BA 2D3RA 3OOXA 1EN6A 1BMFG 3M70A 1QXJA 1XOYA 4E4ZA 2ETNA 2ZEWA 4NRQA 5GLZA 3TETA 2P6JA 5H6QA 2LP7A 1WW4A 1OQDA 3VKNA 3APQA 2EXIA 2PA7A 1N36O 1RVF1 3I2KA 3S7EA 1SETA 2E74B 2JVDA 5FZ8A 4XF1A 3VHOA 1J1TA 4AI8A 4MT8A 5LA6B 4V2VA 4M4RA 4XJ9A 4FZ1A 3GDBA 3GHMA 2VJXA 1UKRA 2VL4A 1SERA 2QM4A 1ZZBA 4ZI7A 3LQCA 4C7UA 1H2KA 4NJ4A 1AR63 1W6OB 3USUB 4ZU7A 1ODNA 3PTRB 1O3TA 3CJIC 2OIGA 4UB8Z 4QWNA 4V1PA 1QR8A 4M3CE 2DWRA 4K6BA 4ZU4A 4Y20A 3H1IH 3QO5A 3BGAA 2EIJC 2VS0A 2Y26A 3N9MA 1VLNA 4LR4A 4YHHB 2RMU1 3AL6A 4S2DA 3ES1A 2HWE1 4KWJA 2OZ6A 1ROPA 1K8AW 2WS93 5LASA 1R64A 1TGOA 2QCSB 4YVSB 4KP4A 5A3WA 3KMHA 4AYUA 1HNXO 4XW3A 4NKGB 1K5MB 2A6YA 3OR6C 4ZY9A 3KCXA 4GT1A 3GJBA 2ZGLA 1GO3F 3SH4A 4EN9B 2AC1A 3ZYJB 1SC5B 1NCRB 4XF9A 3ABUA 4YZ3A 5B1BC 1HDJA 5A2QN 4Q4W3 2XVGA 1SA0A 1LULA 1KUQA 2I07B 1AR4A 4BZ4A 4I0XB 2ARCA 2QE3A 2JS5A 2QJVA 2BV4A 1CIYA 3BRCA 2LUWA 3OBRA 3RJRA 4OHYA 3ZXGA 4EKWA 5FZ4A 5CFDA 4RWUA 3H1MA 2MHFA 5B5EZ 4LBNA 2ZHMA 4DRRA 3JBG1 4RA0A 1DZRA 3VBFC 5DUVA 3JAWA 4XILA 2BBVA 1VBC1 2SBAA 5A3NA 1POQA 4RL7A 4CEYB 4QPGB 4XFCA 4YM2A 2KG7B 3GM8A 2WFF1 4N53C 1VF5B 4QMAA 4D6RA 2IJKA 2DFBA 1S0JA 2UU8A 3AZVA 4HSJA 2XASA 3N9QA 2W95A 1OHFA 3VDDB 3AL5A 1X33A 4W6XA 4PA4A 2WZR1 1SDDB 5JMOA 4BA6A 1C4RA 4JAUA 1FOD2 2RHPA 1NKGA 1LOAA 2B1GA 1K5MC 3K9AA 2BOJA 1CAVA 3LDKA 2R062 4CUBA 4XOGA 4X8PA 2CDPA 5KAIZ 4L99A 4LE4A 4EZHA 1VAMA 1P8JA 4FOWA 2Y69C 3SYOA 4Z1VA 4Z92B 3ZS8C 1MS3A 1GKFA 3AC0A 1D0HA 3ZRWB 2ZJCA 5FZHA 1QJX2 2SLIA 4M01A 4QU2A 2WINB 5HBAA 4LOTA 1R73A 3S7IA 1UFIA 1BEV2 4XBFA 3T1LA 3VL9A 2QQOA 3O0XA 4NHXA 1RUE1 1GMMA 4GX5A 3AG1B 2IH3C 2WT1A 4K8FA 3SEPA 2FZ2A 5FZLA 2D5FA 1SQGA 2PAEA 3ZXLA 2C0ZA 2RS31 1KU9A 3ZXEA 5IYCO 1XL6A 1A8MA 3JAMN 3WCSA 1LHWA 1UJWB 3IFXA 4QNHB 3GALA 4DR2B 1W0KG 2FMLA 4DXWA 3CXCU 5ERLA 5FYTA 5JUVA 2D97A 3CCRV 1C8NA 1GWLA 4ES9A 1N0NA 2ZHNA 4AGGA 4MGIE 2QBXA 1I9RA 2X10A 3VBUA 1NXD1 3THTA 1Q6UA 1G9DA 4QQLA 3VV1A 4MS2A 1ZYBA 2RDCA 3MPBA 2HVJC 2W6IG 1NT2B 1R6KA 4TWKA 4DYLA 2YC2A 2HWE3 3ZFGA 4A3ZA 2ARBA 4K40A 2HWE2 1VQOV 5IWAO 5FLJA 2ZX2A 2Q7EA 2MEV1 3NJYA 1HNWO 3SH5A 4J9YB 4BK4A 4CZSA 1W6OA 1LAJA 4DR1B 4Z2AA 4XXPA 5BNNA 1D4M2 4JGZB 1FAFA 2BGOA 1QBZA 4JQRA 4IT5A 4U7NA 1QOTA 3ZHVA 1K7DA 2VCBA 3OEAA 4GALA 3ACFA 4PF1A 4COWA 5BY1A 4MUVA 5FZKA 3DYOA 3PL0A 3CJIB 3ZDVA 3CXHF 2WLHA 1AILA 5F5AA 3DPRC 1AJPA 4J7ZA 3HKEB 3ETPA 1DLLA 1L0LH 3IIAA 1K5MA 1D2DA 1ZBA1 5IVEA 4WFGA 1FJGO 5L3FA 2GC3A 1I94B 5CIRA 5IT9N 3APBA 1GNHA 2JG9C 1KS4A 2FB5A 4AQ2A 4OQ9A 1NH2B 5HI0A 5B1AC 4IHJB 3VLBB 1D5AA 1YTFD 1MS1A 4TV8A 1B3QA 3M99B 1RB8G 3CJHB 1H1IA 2XJSA 3FL7A 4XUOA 5LMUO 2YI9A 3ABLB 4WM7A 3NV2A 2JDKA 3THOA 3I59A 5FR3A 1V9U2 4NWVA 2QWNB 2ZEZA 3AP4A 1DBNA 1AR1B 2UU9O 4HMZA 3VD7A 1H8TC 5AC93 4BU2A 4D94A 3E8BA 5BNQA 5K8SA 3ETQA 3DPRA 3U07A 3LPFA 3E22A 4X64B 5LY2A 2GN3A 2CK3G 5CVRA 4FPJA 4H2AA 5C8CC 2Z4FA 2QWQB 2EALA 1W04A 4LBOA 3FMGA 4UFLA 4Y1ZA 1LECA 3OGCC 5A7WA 2CDYA 1ZL8A 3ABMC 2UUAO 4XYXA 3SGIA 4FFIA 3TJTA 1XNCA 3L9DA 5CA0B 1NE4A 1NXMA 1W28A 3MICA 1XREA 4Q5OA 5FBJA 1WWYA 1CN1A 2YGLA 4QHOA 4P9JA 5EYXA 3OAAG 2Q68A 4TQDA 4X8NA 1NCRA 4ASMB 1OPMA 3CX5F 3DYMA 5FP3A 3AK1A 5FNVB 1W9WA 1AROP 3S5AA 4LTAA 3HD8B 4DUWA 3J7LA 1OJHA 2XJVA 3WF0A 1LR5A 4LHNA 1N32B 3UQ8A 1NQTA 1NYWA 3ZN6B 1FPOA 2BNOA 2MK3A 1TQ5A 2WLIB 3JCUZ 5IATA 5FY5A 3S30A 5ABJA 4BH9A 3IAYA 4TZDA 4JI6B 3B40A 5JQGB 1IS4A 3DKWA 3ZFGB 3PNAA 3AKPA 4LF7O 5LMNB 1ND3B 2VOKA 1CESA 4AZZA 3WV6A 4RUFA 3USUA 1A32A 2BOIA 2FBEA 1QJY2 5A7SA 4AQSA 3T2OA 3AYCA 1OF4A 2QWPB 2J7MA 2NN8A 5C3RA 3RYFA 2PI4A 1KKDA 2HWF2 1PL4A 4CCEA 3A2FA 2ODMA 3HEIA 4J1WA 4NIHA 2LALA 4CRQA 5KHKA 3LSDA 2ID4A 3ZN1A 2P4KA 4PBOA 1Y9MA 1AP5A 3GZUC 4RQPA 1H1AA 2YS8A 2GUZA 1RUE3 4B08A 4F6EA 1H4GA 4L87A 1Q8QA 4G2KA 1Q8VA 3O1TA 3M1HA 3PIGA 1O91A 2BWCA 1VAVA 5IK7A 3AMPA 5L3CA 2BNMA 1DZTA 3TRSB 1XYPA 3I2IA 3E5UA 3SQOA 1LOEA 4XJ8A 5A33A 4GKKB 4AHZA 4LIUA 3ZFEB 4H7MA 4Z07A 2Y64A 2FMDA 3VDCA 3RZGA 3WNLA 5C8CA 3POFA 3M2MA 1QJU1 3POIA 1S4CA 1NVPB 1OCZB 4PCRA 4LXLA 3CRCA 1H38A 1JU3A 4MSVA 1RMU2 2XONA 3H0OA 1NX9A 3GHNA 2TBVA 3L75H 3HVDA 3KWVA 1EBOA 3CU7A 4M3CF 1TMF3 2HWB1 3GCWA 2DN9A 3DTUB 4P9XA 3D3QA 4F8AA 1DHKB 2CNAA 4L92A 3O7OA 4QM9A 4DXTA 1GQHA 5CBLA 3C3SA 3BI3A 2FDKA 3T3YA 4HYOA 4P9YA 1QLNA 1WCQA 1KXGA 1QDCA 3HMYA 5LHIA 4NPRA 3H3UA 1W2BU 5L9VA 3CRRA 4UW3A 3BN6A 5FZCA 4G28B 1JOJA 4X1KB 5F6KA 4AAPA 1S0CA 2TUNA 4CEYA 1FYJA 2PMWB 4IIJB 4GWJA 1PO13 5ACA3 4FXGB 4PIZA 1XL4A 4O9EA 4UFHA 5D5QA 3OEHG 5JXJA 4PI0A 3T4HB 2VVFA 1JYCA 2QDOA 1KQSU 3AJZA 4EJRA 3MV11 5JOZA 4XFIA 2J1VA 1YIPA 3KT1A 1BZKA 5EC2C 1VBE1 4EV0A 3K0GA 2K0GA 3B94A 1VBB1 1NS1A 1UMZA 1VE0A 1E5SA 2DCKA 1CAXA 3HKDA 4QDSA 1PP9H 2RS51 2XUMA 4YJ3B 1GSLA 1H0BA 1OHHG 1R1ZA 2O0OA 4ZPIA 1VB2A 1FV2A 4UB6Z 4OGQB 4G9SB 4BQ1A 3CCLV 5BNNB 1KP2A 1YSCA 4DV2O 1CAUA 5LK5A 4IV1C 1EAH3 1R3LC 5JWPA 4URAA 3ZXAC 2BOCC 1BMV1 5I91A 3NWKA 1VJ2A 1KD7A 2VZPA 1QR9A 3CCMV 1KGYA 3ZIWA 1ZZCA 2Y69B 1DIWA 4R4XA 3D8CA 2R32A 1F9KA 1ZA4A 4UXNA 2NM1A 2JIZG 3ZKUA 4YRDA 2ATKC 4LBEC 4H37A 3VBUB 1QJY1 2WBKA 1SHWB 4COZA 4DW0A 3M4FA 4CCCA 1XNBA 3IDAA 1EUTA 1Q56A 2YPDA 2ET1A 2RDRA 1ENVA 2IU3A 5EYYA 4DEVA 5CAZA 1W0JG 1O59A 3JAWB 5JXIA 4FTEA 3O65A 4FFGA 3LZZA 1JZ2A 2Y0PA 3CO2A 4J80A 2GV9A 5CA1B 2IXHA 2NN4A 3WB0A 1GN2A 1FFTB 1YI7A 5IVFA 5DXDA 1RVF2 1WP8A 3E8HA 5FOJB 1W8ZA 3IPVB 3L2HA 1VRH2 3KVBA 1H30A 2OCCB 1COWG 5JH7A 4QB1A 2QE7G 3T1HB 1XC6A 1HNZO 2WN3A 4PLMA 2X7RB 1LESA 3I97A 1RUJ3 4B3TB 1PMJX 2NPIA 5A32A 2XLGA 3VKMA 3H8OA 1REFA 2ITCC 4CEYC 2VUDA 4HKLA 2VXJA 3UGFA 3BABA 3EB7A 1GBGA 4LWSB 1ENRA 1W2NA 5DDJ2 4NR1A 1K34A 1VQPV 5FP7A 3SHRA 1EV13 1RUC3 2PXJA 5I8SA 3TXQA 1U12A 5DABA 4LWSA 4YFZA 2Q67A 3BCWA 1BE3H 2GC0A 2EBOA 2HVKC 3O9OA 1OKQA 1ZBE3 2Y4TA 1UZWA 3KCCA 2J1TA 3VDDA 2ATFA 3GF6A 1JMUB 2HFEC 2D7FA 3B93A 1VB4A 2XAFA 4DUXA 3MF6A 3WR0A 5LZ6A 1FPN1 1Q8OA 1PGL2 4FPYA 2WNVB 4BISA 3H3LA 1GNYA 1XU1A 5CA1A 2GH2A 5E8AA 2RM21 1HXS2 4O7XA 5IE9A 3K48A 3ZIXA 3O1RA 2W6JG 1JUHA 3KV4A 2UUBB 3AMHA 5BYNA 3Q9OA 1Q7YW 4E4SA 3K51A 4XEZA 1EUUA 4TSVA 4CPBD 1JYTA 1WPBA 1WD4A 4GA9A 5LA0A 2VUJA 1O4TA 4EEQA 4UBGA 3LNNA 1FT9A 1JCHA 2YPJA 5C3QA 1OVSA 1N1VA 4DV7O 1OA4A 2Q1ZB 1UY1A 1QQP3 4AR2A 3GBFA 4HVQA 3ZHTA 1JZ5A 1SQFA 1DGWX 3K3OA 1ZRRA 5FCCA 2GP3A 1H2LA 3DC6A 2R49A 3VZKA 2WDBA 4JAVA 4DK1A 1BL8A 4F6RA 2XPJA 3K79A 4TV9A 3ZXKA 1J84A 5B1NA 1FD9A 3BAAA 5J98B 1CGPA 3FB7C 2UXXA 1W3VA 1L7LA 1OLRA 4WFHA 1CZSA 4LJHA 2ZHLA 4XJAA 3VD3A 5FP9A 3WNOA 1IS3A 2ZEXA 2F66C 3PLQA 1V9U1 1IDSA 2IJJA 2DWDC 3ZHUA 1OH3A 2AGAA 1LODA 3WDTA 2FCTA 5H5NA 5JJJB 2Y6JA 1HN1A 4AEMA 1D5NA 3WG7B 5IVJA 1GOGA 5F2SA 4JCKA 1QWRA 4HZ3A 1COV2 3PVOA 3LFMA 4EE2A 1BSMA 1AI7A 3FFQA 2DVAA 3K57A 3S5QA 3BALA 3KZ4C 5EIBD 3JATA 4CUCA 2HLDG 4P14A 1RUF1 1ZLZA 3ME2A 1VIWB 2A3QA 2CGNA 3LKJA 3ELNA 1BK0A 1JA8A 2IXKA 2ZIMA 1V54C 3SCHA 1ZVFA 1TME1 2H0VA 4Q0VA 1VEWA 4FOVA 3OYWB 1X82A 1H2NA 2F4LA 1XNTA 4O65A 2P67A 3CYOA 1V55C 3E6BA 1DP0A 1R092 3WW4A 1P84F 2UURA 4QD2A 3VHNA 3LIHA 2CAZC 3V56A 4E2GA 4MZUA 1QNMA 3ZFEC 1SQBH 3IMNA 1XXNA 3B8NA 2K46A 4YGEA 3NO8A 1FXZA 3ZEDA 3VBHA 1IPKA 5T5LA 1BQ0A 4FOYA 2MEV2 3Q8CA 4A44A 4XURA 1O4ZA 4P2ZA 3LEMA 3JBG2 1D2QA 4UAPA 1S5HC 4GKJO 2YEVB 4UCUA 3CJHA 2E7QA 1RUNA 1QQP1 3WP6A 2J22A 4LHLA 2V1DA 5JIAA 4P30A 1HRV3 3SJCC 4YVWC 1V6JA 4MGTA 5BMVB 1AB3A 4YNIA 2PN5A 2K9PA 4Q27A 1C5IA 2Y38A 1NG0A 4X20B 2ZE6A 1JI6A 2VPVA 4QQOA 4GMP3 5T54A 2P4VA 4PDRA 2VZOA 1YHFA 1RUI1 3IBMA 3DXRA 3NV3A 3EVKA 4BIUA 4D6QA 5IT6A 1EN4A 2QQLA 5JCOC 1TVGA 2W52A 3CBNA 3FHQA 4K3AA 2XJPA 2DDUA 4AOCA 3KS7A 1R082 3HPNA 2DWEC 2XVLA 4QXKA 5B3SB 4KL1A 1OURA 2YFZA 2ITDC 1ZBA2 5TISZ 2PGGA 4KMQA 3BOWA 1N3PA 1RL3A 4QXCA 1YNAA 2NMNA 4IERA 2ERFA 1LEDA 1VP7A 4IGOA 3W7UA 4UW4A 1ND2C 2DURA 4TUYA 3I56V 1NT0A 4XTMA 1RP3B 4BXFA 3U10A 5M0TA 1OZ0A 5A6XA 1AYN1 1NLSA 1N1SA 2JDUA 4HANA 2IJHA 2VQEB 4FLXA 5SV5A 4A3XA 1I94O 2V4DA 2N04A 3BYWA 2EINB 4DV5B 2QQJA 1PGW2 1AR93 3ZN6A 1DTOA 3B77A 3DC5A 4UBHA 4JI3O 3O14A 1EFRG 1ZZ9A 3SMHA 4CSWA 1UW8A 2D6MA 4P9IA 2HKXA 4QB2A 5D5PA 4YY3B 1EPWA 1V6IA 4Q4W2 5LATA 3ASIA 2Y6FA 1ZX3A 2Y0IA 2PYLA 3OYWA 3ZXJA 2A6VA 2HG5C 2EIMB 4BWAA 2YHJA 2VQFB 4QHBA 3UKNA 4Y1XA 2G38A 2CDOA 3AG2B 1YJWV 5F1RA 3RVHA 5LXTB 1A6CA 3HNYM 4HN0A 2J1AA 5T3NA 4S2FA 1XHXA 1XB9A 1F4NA 5A3OA 2LTNA 5FLXN 2UWAA 2WL1A 4QM8A 1DDLA 4GKJB 3GJAA 2WLQA 1FFXA 3UKMA 3T09A 2A9HA 4FLYA 4IL7A 1R3KC 4UV9A 4ZBMA 3U4SA 3T08A 1YHQV 3CMAV 1Q81W 3LSSA 1EM1A 2W68A 1FXKC 4TV9B 3FYEB 5K9YA 4MVMA 2FDIA 4FM0A 3POYA 3JCZA 2L35A 2O57A 4CCNA 4Y1UA 2ZKOA 5HCHA 4LO8A 1Y66A 3O12A 2GZWA 3AG1C 5IY5B 5KWRA 3JAKA 1XYOA 2QJ1A 1M1KW 5C7GA 4LUKA 3DSQA 1F35A 4N43B 5CG9A 3VDAA 4FOQA 1QJEA 1AZDA 4ZKTB 4NXMO 1VBC3 1THZA 3MGUA 1RPOA 2YFUA 2RJZA 2LO1A 5FWJA 1F51A 2IFRA 4TYSA 4P5YA 4Z82A 2C9KA 5FY8A 1IG0A 4XBLA 1ZBE2 1S77D 5F39A 3I7DA 3OPTA 3K06A 2EJRA 2WZR3 4H33A 3WFVA 2JEUA 3GB7C 4AF9A 2O8OA 2GDSA 5J09A 1RHI3 4O61A 4XFGA 2UXBO 4IV3A 1Y74B 4A7ZA 3PVEA 2EILC 4JI7B 2VM9A 4J6GA 4Y5TA 5GONA 2B1IA 2TNFA 1VQKV 1BHAA 5D21A 4K1ZA 1EZJA 3BU7A 4JI4B 2ZXQA 1XYNA 1W06A 2OCCC 4XXAA 2IC1A 4Q8LA 5JAXA 1O9HA 2WSUA 3L70H 4GZ9A 4UCVA 1RUG2 2XKPA 4ET7A 1UD1A 1I5XA 3OBZA 3FJSA 3SR2C 5BNOB 3CEIA 3W7XA 4AGVA 3HNMA 1AI5A 1IXMA 4J7KA 1E79G 5HXVA 4COYA 5C71A 5BY5A 2ZS6B 1ASJ2 4EROA 2VMEA 1POV0 3KHBA 4CBCA 1N36B 4LF6O 1WBLA 4NAMA 4O2BB 1UY3A 4QPGA 4QPWA 2K2SA 2OWOA 1UY0A 2EIDA 5EYPB 3RQ0A 3K5MA 3ZM8A 5A6ZA 1NA1A 1OUSA 4YVSC 4BAYA 5FZDA 3KG2A 3W7WA 5FYZA 1OXCA 3JUUA 4RQFA 4CA9A 3OUHA 2RS11 1YJNV 5G05L 5IAVA 1W8NA 2DQ0A 4K21A 2CTVA 3NNJA 2CH7B 1RTVA 3AFGA 5IJRA 3O0WA 5A1LA 4JI5O 1PNMA 5E1RA 1DQ2A 3OGJA 1UZZA 4J41A 1GU3A 5KXCA 1ZZ8A 2VZQA 5LHHA 1GK9A 1ZREA 2MW2B 5I0SA 4X1KA 2AR6A 4N8MA 3MW3A 2PQQA 1SACA 1KBHA 1H2GA 1IKQA 1W6NA 2XBO1 3H7JA 1AR91 3THDA 1C8M3 3E2EA 3ATGA 2R72A 3SCFA 2CGPA 4Y1YA 1AR72 3JARB 2RDNA 3O1MA 3RNSA 3CZJA 1JYXA 1PVC1 5I8YA 3MAQA 3KGZA 1VALA 4ZIBA 5H9RA 4YG6A 3WNXA 3OY8A 4P08A 3GCXA 3UNPA 3SYCA 4JI7O 4JV5O 1UYZA 2ZX3A 4KGQA 2GN7A 4FLTA 4UFJA 3FUQA 4X20A 4LIVA 2JJ6A 2LW8A 2WLJA 5D2AA 4I7ZB 1PPJH 1TUEB 1LHUA 5FYMA 1K5JA 4IEYA 1GOHA 3FBYA 4FFHA 3DGTA 2Y6LA 1I3HA 1GQPA 3ZRSA 3W7SA 3FD9A 4CXXA 5FZAA 1QJX1 3UT5B 3IB3A 1LR1A 1JYWA 2ZNIA 3CZUA 1BT8A 1K92A 3I2DA 3NQHA 3JD71 4DV4B 4QX5A 2Y60A 1F31A 2R30A 5F8PA 4I55A 1G9AA 2X6BA 3N27A 5DAQA 1LHOA 5HV4A 4YVWB 4K8ZA 3LAGA 2W92A 4AFCA 1FPN2 2E7TA 1VRH3 5EZYA 3TK1A 2RS32 2F1MA 1OC1A 1WB7A 4HVRA 2P1BA 2Q1MA 4W6WA 1BS3A 1OOPB 3FWEA 3H1JH 3JSNA 1DQ1A 5FZ3A 4ORFA 4GQ7A 5LA1A 4OMCA 1OF3A 2KA3A 1O3QA 3ICXA 1QMJA 5FZIA 3FB5C 4CDUC 2NR5A 4QX7A 5KMGA 1XBFA 2YIBA 3O1SA 2Y4UA 3RZKA 3J81N 4XACA 4HVOA 3WG4A 5SV8A 3C7FA 4DUVA 3D82A 4NHKA 4ITCA 5I0RA 1PZ9A 1D4M3 4LA3A 2LGQA 1W2OA 5GKAC 2VTFA 2NP0A 4WM7C 3VGIA 1C8M1 2NNUA 4RYDA 1SQVH 2WLLB 1MABG 5KLVH 4H7LA 2QWRB 2OUJA 4RO2A 5ABJB 1YEWA 2VNVA 1ND3C 2QQPA 4I2OA 1FXHA 5FUNA 5DG1A 1S76D 1XE7A 4R52A 4MGQA 3S3XA 5IYZB 3KT7A 4WM8B 5I0DA 1T5EA 2ADEA 5LL6Y 3IDBB 1HN0A 4OLLA 3OD0A 5GZEA 2ZM6B 4YM3A 1QLEC 2QEXV 4M0NA 4CH6A 1W6PB 4CDXA 1HRV1 2XUEA 2VNGA 1R3IC 1D2SA 1ULFA 4LFAO 4QDQA 4NAOA 3LSQA 2OPWA 1BQPA 1UU4A 1LGNA 3SJQC 2WFPA 3O1PA 5DN2A 3V0AB 4YW1A 5F5CA 2VNRA 4AFBA 4XZUG 2HJIA 3ABKC 5IYDO 1ND3A 4EQVA 5C3OA 5DAWA 5CN0A 2QQWA 4R9BA 4YM1A 3VBBA 2WT0A 5GLVA 1PIV2 3O1OA 3U0ZA 3AZYA 4GJYA 2LQTA 4RHV2 3UETA 4DR6B 1SPPA 2WNVA 4ATFA 3MUZ1 4BQ3A 4Q0SA 1M4UA 1MACA 2VO5A 4DR4O 4P9GA 4UVCA 1PNGA 3VBFA 1US6A 2XLFA 4R9AA 4ES8A 1PNFA 3D5OA 4YZ5A 1FNYA 1D0GA 4C1WA 2HWB3 1BQZA 3M7AA 2VBPA 2X6CA 3UESA 4KH9A 3WQ0A 3OEBA 1PX3A 4AW7A 4I30A 2PUSA 1HJGA 2N7GA 1VIBA 4RQEA 4IEUA 4L2NA 4EFBA 2FCUA 4C91A 4GX0A 1G7YA 3IPVA 1ZSPA 3TCUA 2ZIOA 1Y6XA 2AEYA 2OT5A 1UKGA 5LRRA 5A6QA 4PDLA 3FKSG 1VBE2 5CFCC 2WAMA 4D7TA 2EVXA 5BXXA 5FZOB 4WVMA 1FS0G 2P90A 4GIQA 4IETA 1UIKA 2CUGA 2WQ8A 2D98A 3EO6A 3K03A 1ULDA 1YFWA 4NIIA 4WBBA 4JGSA 1HRI3 2R16A 3LOIA 3WHTA 4OPAA 2DYRC 1GP4A 5ANNA 2ZX1A 3WG3A 4AFDA 1YQ8A 3PTYA 1H8HG 1O7FA 3H8UA 1W8WA 4FIPC 1G4YB 1UIJA 4JGZC 1S0GA 4DR6O 4KWKA 4EN8B 3AG3C 4XPVA 2ZMNA 3WB2A 4DR1O 1REDA 2ZM6O 2PHFA 4G4FA 1GN3A 1AYN3 4MW8A 4DV3B 1MOFA 1GKBA 3LGRA 5DPNA 1Y4MA 2A71A 2VWKA 3ZRXA 4WFAV 1BCXA 3MF9A 4XC9A 5J2UA 3WEZA 2CL2A 5B4NA 2VOVA 4NN0A 1GRJA 2HEYF 3MIGA 2IH1C 4BQ5A 3NRUA 3B69A 2A0LA 5CNAA 1T2XA 2FYUH 5LEKA 5LMNO 5C3PA 2C9AA 2BSKA 3DCQA 3WVJA 3VBUC 2NYYA 3IKWA 4CDWB 2IFWA 5FZFA 4SBVA 2RS52 3ZYGA 4DXRA 3WP3A 1WJZA 2QQUA 5H6RA 1KFXL 1AYM3 2QVSB 1O5LA 1IS5A 2WZEA 2WNUC 1SA0B 5GONB 2ZA9A 3QCWA 1U5XA 4IE0A 2DQ3A 3RYIB 3OTOO 1GP6A 4GD4A 4MG2A 1US2A 4XUQA 3KSCA 4KG0A 1MVQA 3SC7X 3T1YO 3AK0A 3P6BA 1AX1A 4TOIA 4AHYA 5BNNC 4D6TH 2QQIA 5CKQA 4XF4A 1K4CC 3VZMA 2X5IB 4YYOA 1RPRA 2P22C 5JLVA 4XJZA 4K0KO 2ZE8A 2BQPA 1ORQC 4YZ4A 1Q43A 4PJ0Z 1LJ7A 4C8DA 2B8MA 4DV2B 5DZFA 3K5LA 2H6CA 3CLPA 1S0DA 5CB7A 5CFCA 2WO1A 1ZTEA 3AKQA 2IXJA 4N43A 1YO8A 1YLLA 3W9AA 3C8XA 2F4PA 3G6JB 2JG9A 1DGWA 2OPKA 3WG1A 4DPNA 1VQ7V 1VBD1 2NLJC 5A6YA 3AP9A 1W59A 2VY0A 4J42A 3F5WC 2FCVA 4PDMA 3AX4A 4O4LA 3GZTB 1HXS1 4CP9A 1ZZ6A 2VOXA 3VBRA 1QXPA 4JI8B 4UF0A 4D6SA 1JQ0A 4MTFA 3NV1A 1K5SA 4FK5C 1MPXA 2XQRA 1NCQC 5LY1A 2WNOA 4MW3A 5KX5A 4KU8A 1GZCA 3LE0A 3J8F2 2WIIB 3VBFB 4AEKA 5DAPA 5IFPA 4GX1A 5EQUA 5CU1A 1EY2A 3VQYA 4UCOA 4MOAA 4R50A 3WDYA 3WOGA 1RXFA 3I55V 5A33B 1RMU3 2P3JA 1GR3A 5FPZA 1WCSA 1IBKO 2R7EB 4DR5O 1IBLO 4U3JA 1LUWA 1X7NA 1PVC2 1NI8A 2ZEYA 1V9U3 4LH7A 4DV0O 2WLPA 1LOFA 1VP6A 2WUHA 3ZMZA 3WQ7A 4B3SB 1S2BA 3VOUA 3VD5A 4RQPB 5JXHA 3FHIB 1RUC2 5EFUA 4GAZA 1SPPB 3POSA 1UXXX 4OI4A 3SJAC 3AYDA 3J7HA 3RJ2X 2XJRA 4KNCA 2IXLA 1Z78A 2J1UA 2QSAA 3PMSA 3N7MA 4GMP1 4RUEA 5DM6V 3NNGA 2VW0A 3LSUA 1FMD3 4XE9A 4IGPA 3ACLA 2RE9A 1PVC3 2H3OA 2VZRA 1LGBA 3GBGA 1KS5A 2F17A 5DG2A 1H1MA 4PA9A 4HBNA 1YJ9V 4HFSA 2RR11 1PL0A 5EZWA 2WYSA 2QR4A 2OS2A 3LF7A 1ZM1A 3ZFGC 1AYM1 5LBFA 1HDKA 4Q2FA 4RR3C 1XEQA 3MZHA 5A3LA 1SZXA 5AG2A 1QJFA 1TMF1 2QKDA 5HXMA 5APAA 3OBAA 4ASLA 1RHI2 3HKBB 4FCAA 4X6RB 1AX0A 5DDJ1 2WFF2 4CUAA 2VC9A 1A8DA 3MW2A 2GH8A 2HKOA 3SJBC 2PHDA 2QZ2A 4ZI7B 1ZAUA 3JB8A 1YQ5A 2WO3A 2ZOEB 4JYAO 3IJ4A 5K4LA 4GB31 1NR7A 4D3WA 1PO11 3N35A 1NR1A 4WM8C 1ZZ7A 4I50A 4I9QA 3S6PA 2PHWA 2BDRA 5DEDA 3MO4A 1OCCB 1W6QB 3UKVA 4I5SA 4WVZA 2V5DA 2P17A 4IYIA 3NJZA 2Q69A 1JJ2U 1ULPA 1K3IA 4DR5B 3UV9A 5IFTA 1I5PA 3MIEA 3I2OA 4MGKE 4I0AA 1ALYA 4M00A 4YGDA 3ZYFA 4WM7B 4AHCA 3OGVA 3JD0A 2BYVE 3IAPA 2OW4A 3AVRA 3ABTA 4QB6A 1YYNA 3OFNG 2QM7A 1SLTA 4KBZA 4CDUB 3FAVB 2XHKA 4CZZA 3IZOA 4YWAA 1MZFA 1TG7A 2F6BA 3X29B 3KGLA 3IMMA 4M0HA 3E22B 3S3WA 4O4IB 1UL9A 2R063 3NAPC 4JKKA 3EJKA 3EHBB 2C6SA 2W39A 1J3RA 4FPPA 1FOD3 5GLWA 1JW6A 4Z1MG 2WQ4A 2NZ9A 2WT2A 1U0AA 1MR5A 2BTVC 4I50B 2JWPA 5KC5A 2EAAA 1AYN2 3W58A 1C1LA 4CDQB 1ZRFA 3UL2A 3MHHC 5BNPA 1PGW1 5CMUA 1W8HA 4Y24A 4PD4F 2ZQMA 4IEZA 3JARA 5EJ3A 2YC4A 3ZMOA 2J42A 3SNMA 2BBAA 2WO2A 1OA3A 3WXPA 4LPLA 2ZXWC 3VBHC 4FPHA 3RG0A 3ZKYA 2DVGA 3GVMA 4YW3A 3I2GA 1RGSA 1GTOA 2XJTA 2QDNA 1C28A 4X1IB 5L3EA 1QY4A 5FXWA 2KSDA 2E5LB 2VECA 4AVSA 3RBZA 3AJYA 3BCCH 3ORJA 4GWIA 1PZ7A 4L9BA 4AVCA 3N36A 1DQ0A 2UYAA 3UGGA 1RIRA 4ISRA 2RCVA 5FY1A 1KD1W 5FZBA 4BJ0A 3AMNA 4FPGA 4GLXA 2ORXA 1M90W 2Y0OA 5J2TA 2Y6KA 4LBLA 2XR4A 4D69A 4META 1A34A 3KM5A 4GWMA 2A7AA 2R0FA 2BSKB 5EYPA 4MLOA 4XMIA 4CU6A 4B3SO 1KQRA 5JCOA 1NAEA 3P30A 1W2AX 1AX2A 4QKNA 3G6EV 2A6ZA 3TB0A 5BR8O 4FZ0A 4DV0B 2A06H 4DV7B 4TLFA 5JJNB 4OI1A 3TXSA 1QF3A 2IZWA 3B02A 5FY4A 1GQGA 1AR92 4GUNA 3BVOA 3KV6A 2P4EA 1M93A 1AR71 3FX7A 5FP4A 2VZUA 2FDHA 1JMKC 2FHRA 3C7HA 1VBA2 5FYCA 3CCVV 1JZ3A 2XBO2 3I3QA 3PUIA 1UCXA 4HLTA 5LGNA 1NH2D 4FPLA 2R061 4HPKA 1HQLA 4Q29A 4GB33 4JDOA 2DYCA 1L7RA 4DK0A 3NAPA 3NKGA 5EK0A 3FLPA 1FOD1 1RUOA 3UYJA 4QX3A 3VBRB 4IEOA 1JHJA 4QDRA 3DL3A 3RN4A 4Q4Y1 2AZ0A 4YLZA 5JVDB 1VBD2 1AR5A 4QPIB 4MTGA 3ZSJA 3NNFA 4JI6O 3U78A 4DV1O 3H3ZA 4AGRA 3GXUA 1RUI2 2JD4A 4S2GA 3ZPOA 1I7FA 3JCIA 4K7JA 4W65A 2LS6A 1LOGA 4DR3O 1QOSA 1YJKA 2D3SA 4UF0B 4NROA 3JU9A 3BPZA 3TEXA 2EXJA 3VDDC 2LROA 4V2WA 4JKMA 4X1YB 4XMAA 2X0LA 4K3UA 5A7NA 1Q90D 2O1QA 2QQVA 1HP8A 4N53B 4CP1A 1Z0HA 1IBKB 2E33A 4ISQA 3VKFC 3HQRA 5LEJA 4RGAA 3RWNA 1MA1A 5AVAA 3V0BA 3ZX6A 1OI6A 4FSJA 1RHI1 2VTXJ 3FN9A 5EBLC 2BVVA 2JD9A 4LF4O 1DQ5A 1N1TA 1YDXA 2IJIA 4Y5Z0 4B1LA 2ADDA 4JI3B 1PM7A 2V09A 2YU2A 5DUUA 1KEXA 3VBOB 1XPWA 3O1UA 3FC0A 4E2QA 4CDWC 4G3YC 5JH7B 1XNDA 1FMD2 1TZOA 5D1IA 4ZZ8A 2UXDB 5KXEA 1KFUL 2XB6C 2RJ2A 5F6LB 3DGEA 5G04L 4ATEA 3HPLC 1F5FA 1UMHA 4IE4A 4CH5A 1FFXB 1NCQA 1SLIA 2PHTA 2VMCA 4MO3M 3I2FA 4Y22A 5GM0A 4QAWA 2EAKA 4XQWA 4JZRA 1Y74A 2RV9A 4B3NA 1RUD1 1W0OA 1WMEA 1DQ4A 3VBSA 1K9MW 4N90A 3N9LA 4LKSA 2YUEA 5LBQA 3KQ4B 3G7DA 3EFFK 4UFKA 2JIJA 3JXSA 4LLOA 2BRTA 3D6EA 1WCKA 4QPIA 1VQNV 2JE7A 4K20A 2M6YA 1I0HA 4BIZA 4NWWA 4YVSA 5D8AC 1R1A3 2D5HA 3KKYA 1YQ6A 2RR12 2Q30A 5FQ0B 2GMPA 5KHJA 5FJHA 5HPOA 3TNPB 2VQFO 1XSRA 2Y48A 1Y7BA 2WWUA 1Y76A 3P1IA 3LDBA 5L73A 3LNMB 3JD3A 3GZEA 5IAXA 2B9ZA 2WNUB 4DR7O 4MH0E 2IM9A 4LFCB 2Q8EA 3H8RA 4FTBA 4P9LA 4J10A 1V0AA 3VHPA 1E5IA 1XNAA 4LP8A 5BR8B 3R4SA 2AYHA 3U4XA 2PF4E 4CP0A 2R071 1PZ8A 4JASA 3HKDB 5IDJA 1LOBA 3CCUV 3W7TA 4LNUA 4WV8A 3T2MA 3JD4A 1TA8A 5CBFA 3N9PA 4XETA 3CPWU 5JZGC 2DCZA 3POBA 1N47A 3WQ1A 3UGHA 4DXZA 1LRHA 1SQXH 2VG9A 4GXLA 1SZBA 5F2WA 4CYDA 2D6NA 3UO2A 5EXOA 3ZFEA 4TWTA 3M3QA 4LCUC 1C3HA 4CCLA 1YRZA 3U75A 1LU2A 1QNWA 5K0UB 2A3WA 1J95A 2R043 4L8JA 4Q4W1 1F23A 1S2EA 4HPKB 1URXA 2D93A 4NMIA 1ZX5A 3D3AA 2B5HA 1G8MA 3MW4A 4EWAA 3IC9A 1UOBA 4XCAA 4B3MB 1ND2B 3CMGA 4DO2A 5C9AC 4WBNB 1UU6A 2D2CB 5KHHA 5CA3A 4AVAA 4NPMA 1E57A 2JDAA 5LOVA 2DCJA 1TME2 4QE7A 3ENRA 1DFQA 2QNKA 1IPJA 1AR73 3ILFA 2JECA 2OUHA 2OVUA 4WVWA 4F3JA 1WB8A 1AR83 2YC0A 1UY2A 1V00A 4O4HB 5IW0A 5IYZA 1JUIA 4WM8A 3BEHA 3J80N 5FZEA 2G4IA 3U37A 2DW4A 2WRAA 2JKBA 4AEDC 2Q0OC 1WW7A 2W91A 1ZRDA 1BJQA 4OPHA 1RXGA 4X1IA 1H2MA 3RMXA 3B4SA 2YXYA 4JHTA 4TLGA 3AP7A 2UWCA 3SYAA 4W8JA 2Q7GA 1XMQO 3ZSEA 1CIWA 3WUDA 1W9TA 2WWJA 1AJKA 4NTWA 1SBEA 1KMIZ 4JTAB 3JZVA 1U5ZA 4Q4V1 3J7AU 5GLTA 5FFOC 3VBHB 4MTOA 2WS92 4YJ3A 3RI8A 4SLIA 4WZCA 1H6XA 4YW7A 2LRPA 3Q4HA 2VBBA 1S2KA 3PUAA 1SRYA 3T0BA 1W9FA 2WPDG 4CEWB 4H44B 4K8XA 1XMOB 3IM0A 5L3BA 3J7NA 3MLJA 4C0HA 4LO7A 1SCSA 5ISLA 1LGCA 1G86A 3L72H 1YC61 1X9TA 1UQXA 3TN92 3ZSMA 5B4XA 5A1FA 1UAIA 2ORZA 3K3WA 5JZGA 1V55B 1RC6A 3MFCA 3TEZA 2QFEA 3K4DA 4FLZA 2EXKA 5JJEB 1GOFA 3SKJE 4N9HA 5IJ9A 1HQNA 1ODMA 3ILRA 3M7MX 3POEA 5FPAA 2JX9A 1GWMA 1W39A 4Y5SA 5F3CA 2MPFA 1PKXA 1E5RA 1OOPC 1OFNA 5LWBA 2H6BA 1P7BA 3APOA 3BTYA 2HR3A 2GSYA 4Q0UA 1BBT3 1LHVA 1EV11 1VF6A 1PM9A 2IXCA 3I8TA 4CCOA 4JI8O 4OHZA 2JGDA 2XJUA 1W03A 4LH6A 2R073 2L6LA 5FXVA 2W9XA 5FK7A 5KXBA 2BE3A 4F4LA 5CBGA 3K0DA 3DN7A 2ZT9B 2CU5A 4UCTA 4NXNB 1DYPA 3AK3A 4C0BA 5E16A 1W8TA 3T4DA 2ZGKA 3LB9A 2CAVA 5FLHA 4LR3A 1G6UA 4Q1RA 3ROUA 1UOFA 2KXLA 1X50A 2K1EA 3MLKA 4YFWA 1M9NA 5H9SA 4OULA 2HJFC 4ICGA 5K1PA 3CE2A 2PAKA 4R4ZA 1Q5OA 2ZGPA 1ZNPA 1AI4A 1BBT2 2E31A 1QU7A 3THPA 1K42A 4XUTA 3EMRA 1TE1B 4LLFA 3OUSA 1A3KA 2VMFA 3SPCA 1ULEA 5FTTC 3CJIA 2VQAA 3KZIZ 3N9OA 1W6MB 3T30A 4TV8B 1I5ZA 5IUQA 4FQZA 2D3OW 3ZLIA 1X4TA 4O4JA 1POV1 1UOJA 4OZXA 4IXLA 3HN1A 4BMEA 5KXDA 4DB5A 1STMA 4IDZA 2ES3A 3U11A 3VZOA 1SLBA 5H9PA 4GCZA 1UPIA 2X05A 4EYUA 3B7MA 5FO7B 1NQJA 4IGGA 3BA9A 4IW3A 4HK9A 2VCCA 5IYYA 3SPHA 3RZMA 5HFLA 5JOXA 4AILC 3HIFA 5TSWA 5LCWL 2E3CA 1P49A 1LU1A 2VVDA 4AEJA 1Y3TA 4JGZA 5A70A 3BOPA 4FPKA 1GM9A 2KKWA 3TNQA 3I49A 4B7EA 1AR61 2WNVC 1BBT1 1NOVA 4INDA 3T0AA 3C2UA 2WNEA 3VBOA 5DN6G 5CFDC 3SPIA 3K5NA 4B3MO 5I0UA 2JDIG 1RUF3 2IU0A 1H4HA 4B3RB 5BNOC 2Y6GA 1WMFA 1AVMA 4GJZA 3RZLA 3SXWA 1B35C 1CVNA 5LMUB 4QPGC 4N53A 2GALA 2DYSB 4X89A 1O8SA 1WD3A 3ZPYA 1BEV1 2PLV2 3K04A 5FYBA 1WMDA 3IDCB 3OUIA 4UYBA 1SZTA 1NZ6A 4LE3A 3B3QE 1F7YA 1QCEA 1WP7A 4DFSA 4X62O 1Y9QA 4AFMA 2FDGA 2WNUA 2PQSA 1CX1A 2JG8A 3CIHA 2A6XA 2DV9A 4W4ZA 2VQEO 1LNSA 2O8QA 1CR7A 2FL4A 1HR0O 5IJ0A 5F5IA 2PHXA 5LHGA 4DV5O 5FK8A 1GNZA 4OVEA 3LA3A 5C33A 4QPIC 3DXTA 1FXKA 1US3A 4H14A 2F95B 3CHXA 2RS33 4LORA 3LDDA 4MSWC 4LHKA 1UZYA 5GW7A 3QG5A 5HCFA 2ZGMA 2GAUA 1EAH1 4R6ZA 1VQ9V 3ZYPA 1FI2A 2RM22 2BUKA 4PELA 5LA6A 4XFHA 1LOCA 4WFFA 3QNEA 2ZGRA 2XTAA 1MZ5A 1EPZA 4M3CA 1H6YA 4QPYA 4QE9A 2VMDA 3HQUA 1CZVA 2YU1A 4NE9A 2HH9A 3RWKX 4DQAA 4AG4A 2QUOA 5J2TB 3RZZA 1AXZA 1CAWB 2PELA 5F5QA 5IHRA 1HW7A 3GYDA 1UX6A 1JBCA 4CCMA 1T6BX 1YQ2A 1DF4A 4Y33A 4BHPA 3K59A 3NJVA 2B4KA 5T52A 3SCGA 2VULA 5F3IA 1W99A 2XXZA 3MUY1 4UW5A 2Z2SB 3FLTA 1PO23 2OCHA 2HJDA 5IVBA 3WF2A 4BLIA 1POV3 2HWC2 2DOSA 2XHBA 1CXZB 4DEQA 3ZFFB 3LPGA 3HJRA 3STZC 4JYYA 2ZE7A 1XU2A 2EILB 3AK2A 1EZVH 1U96A 3AKSA 2G1MA 2FDFA 5E88A 2XL7A 3T1YB 1BCCH 3OJBA 2FD8A 3B9IA 3CRAA 5FMBA 4GWNA 4LF9O 4Q4X1 2VQUA 2W46A 4BMBA 3LA7A 5EJ1B 1WLDA 3OPZA 4QU1A 1CAXB 3TN93 4IUGA 1MEC2 4XDQA 4MVOA 2JDNA 4H3WA 1RUJ1 5C5TA 4U36A 5C8YB 3N2GB 1GLHA 3E1F1 1ENSA 1W9YA 5FPRA 3RGBA 1Z7S1 3VQXA 2OZJA 2UXBB 4AE2A 4ARXA 1XQNA 5C9AA 1WNSA 4JZGA 2UXCB 3JQWA 2X8KA 1YF2A 2W0XA 4XQDA 2OKXA 4LT5A 2EIJB 2RMKB 4CS2A 1Q6IA 2PYJA 2B45X 5CKNA 1IURA 1RUG3 3MFAA 1UYYA 2DUOA 2JG8C 4CVUA 2WWWA 3E6DA 4ZZ5A 5C4WC 4TUYB 4DMIA 1NY72 2EINC 3OSDA 2LGWA 4GZRB 1V6KA 1S0IA 2V4VA 3OMIB 4Y20B 2E63A 4DXSA 1MNGA 4DV3O 3E8GA 3P3NA 1AF9A 3R4UA 1N34O 4QGNA 1D4M1 5FYSA 3B5LB 1XNQB 2RDQA 2JXAA 3EYPA 4CU8A 4R8HA 1W3XA 2ZNJA 4C90A 1J59A 4KQ7A 4Q6GA 1R1A1 3RYPA 4BIOA 3AXEA 3AFKA 2VMGA 4LO4B 3ASNB 4D7YA 2JDZA 2VE1A 1AJOA 5AC92 4FT8A 1YIJV 4A7KA 4N21A 4A6SA 1Z5WA 4DR3B 4DRVA 2HWD1 4MYEA 4MXWB 1JZ4A 3E89A 3SITA 2RMU3 1CQ9A 2CTQA 4GB32 3BU0A 1LTEA 4F6RB 4PBPA 3KF3A 1KJRA 4GH4C 2HWF1 4OX9O 3MBWA 1K97A 3OD4A 3ITQA 5IVCA 4DOUA 5LXTA 1RITA 3R05A 4KHPB 1EN5A 4BB3A 2X09A 4I4TA 3A0BZ 4EFEA 3E5QA 2WWSA 2DJVA 3UK9A 2PAMA 2PFWA 1IS6A 4BOWA 3B8MA 5LA2A 3CRMA 3ETDA 4HK8A 4HG6B 1WLWA 3MV01 5CZKA 3OT7A 4FLVA 2E7AA 4JI2B 2QGNA 3LEGA 3VQVA 5H9CA 2RS13 3HT1A 2YEVA 2OQ6A 2GU9A 4OYUA 2I74A 3AYEA 4XUPA 1L1FA 4QHZA 1K5QA 1FXVA 5FZ6A 2Q0AA 1CZTA 4QX8A 4QXBA 1JX9A 5FREA 5FZ1A 3ZMNA 1JH5A 3UJOA 2BERA 1TNFA 1XJAA 4LBQA 1S1AA 4Q0QA 2YIAA 5KUKA 3QD6A 1RUG1 1M56B 3ZMSA 5E6HA 1OD3A 4JHZA 4BWOA 3TAYA 4CDXB 4UCRA 4BW9A 3ZYBA 2N05A 3EHKA 2BJSA 2DMXA 1GH6A 4I3GA 2I45A 5C8CB 3A23A 3RYRA 5KAFZ 3I3BA 3A7QA 1MS5A 4B3TO 3WF3A 3WG7C 4EB6A 4COVA 3H1WA 1NKDA 1X59A 3Q8AA 1OLME 3CJXA 1IKPA 3K77A 1GN4A 3PURA 1PK6A 4JV5B 2UXDO 2L9LA 3VD4A 1IQDC 2CAUA 3TEWA 2YICA 4X64O 4J9ZB 3GNEA 3UCSC 3STLC 4DUZB 3BHPA 2ZGQA 4AVVA 4RS5B 4KBBA 4PA3A 4QGMA 4F7ZA 5E89A 2QKCA 1YI9A 1OQEA 4Q4V3 1RFYA 5LOVB 4AEDB 4LFCO 1XNRO 4RQPC 4CPBA 4JI0O 4KUMA 4NTXA 3D4KA 3IIIA 5GZCA 3VN4A 2WLLA 1TME3 1PO21 2BFUS 3WCRA 5KMGB 3QBQA 5AFEA 1J3PA 4TQFA 1VRH1 5B1AB 4PDWC 1HLCA 2EIGA 4R7CA 3USSA 1MS9A 3RYKA 2KM2A 1Q8PA 1YFXA 1IX9A 2A79B 3OGIB 1DQ6A 4PIXA 4AHXA 1U5YA 3L9JT 4ZOLA 2DTYA 5F3EA 5EZYB 2GTAA 5IK4A 1OBNA 1FATA 3AKTA 1BHBA 5A1AA 1HQWA 3SISA 2ZTNA 2Q8OA 4BQWA 3AG7A 4LQRA 1F2NA 4OHWA 3L71H 2D6OX 2D44A 2MEV3 2AEZA 2R072 2RS12 5FQ0A 1FKAO 2GNMA 5CISA 2JENA 3BKZA 5T5OA 1NBMG 2WA4A 1AVBA 1QH6A 2GC1A 2YV8A 1ZA7A 4MV2A 3SPGA 1SESA 3G71V 2P6HA 5BZBA 5AFBA 2ZDIA 5F9TA 5L3GA 1COV1 2ARAA 2Z5WA 1S5JA 3AZXA 4KGGA 3PMEA 3WD5A 4IV1A 2UU9B 1MS8A 1URFA 1SEFA 1F4AA 2ZABA 2Z42A 5T5JA 3OGGA 1GP5A 4CC5A 1F8VA 1KECA 1HRV2 4EN6B 1W0PA 2FQPA 4UXAA 2VTXA 1TEIA 4NHMA 4X66O 4YJ2B 3IDEA 5GZDA 5F7UA 2VNOA 3EXAA 5T50A 2J1SA 1D4VB 3WB1A 2EZOA 4CXYA 4LNUB 4HL0A 2BGPA 2TEPA 3WZ1A 1IPSA 1FAYA 4B7KA 5DZGA 1LKNA 2HYXA 2BVBA 4GMP0 2ADPA 3SH3A 1BGYH 2W1QA 2QTSA 2XNDG 3T2PA 4O2BA 2HWF3 1HB4A 2WC2A 4MGYE 1G9BA 1VMJA 5CA6A 1TUBB 1VAKA 1FMD1 2VZVA 4E2LA 1K12A 4I0WB 2OXBA 1MS0A 1JOYA 4PQ9A 1QJZA 4QX0A 4XUNA 5GZGA 1SDWA 1RUE2 3MI8A 3VD9A 4YW4A 5FPUA 4CDWA 4FI9A 1O4YA 4CTEA 1KDKA 1YJLA 1JODA 2JDPA 4YW2A 3T1MA 5FBZA 1Q6HA 4LKFA 4FQ4A 1VQMV 3H1HH 3F5TA 1GV9A 4IE5A 3AB0A 4YZ2A 4CH4A 5CB4A 3ZHQA 3B9CA 3I2HA 3C3VA 4BM8A 1ZBA3 3ZSLA 1TNRA 1QJY3 3TYJA 4ARYA 3WDVA 1MZEA 2P34A 5C70A 1BVVA 4AI0A 1W9SA 3VB9A 1WA6X 2VCAA 4JI4O 3OUJA 5FL7G 2M7WA 4FPEA 4JAAA 4MVTA 1FPN3 1QKQA 2VZSA 2HWC1 4DR2O 1XNRB 3JALB 3E6CC 1N33O 1AL21 2WAOA 1MSWD 3BTAA 4IQPA 4U7OA 1S0VA 1RM1B 3O1VA 1CJDA 4MXVA 1C1FA 3BVCA 3QVNA 1JXNA 2R9RB 5GTIZ 1ZRCA 2YIBD 3RZHA 1ENQA 2E51A 3WDUA 3OPWA 4CCKA 3RYIA 2G9FA 5IYBO 2WA3A 1QOOA 1WPXA 4IV3B 3ZRVA 1QH7A 4JYBA 2W5FA 5DAVA 4RR3A 4OXSA 3M8AA 4GULA 1X9PA 2YB7A 2JE9A 3PUQA 4CCDA 4PF5A 3C90A 4WZFA 4HONA 3JALA 1CAWA 2AZ5A 2XL9A 5ACA2 2ZMKA 2A7WA 2XGXA 4Q20A 2NMOA 4J1XA 2VU9A 3JD1A 4AQ6A 1IGOA 3T1CA 1PHMA 2UY8A 3LD8A 5FKBA 3WF1A 4FJCC 1DYKA 2C4XA 4Q4Y2 4MVSA 1LENA 1E5HA 1Q86W 2KD7A 4LF5B 3P5BA 4IEQA 3N7JA 4GKXA 5JSRA 4PDVA 4HSLA 1LNQA 5E79Z 5DDJ3 3ABZA 4XDPA 1VMFA 2MNGA 4ZOLB 3E83A 5LYJA 1ZL8B 4QXHA 1OD5A 2GSMB 1OVPA 4Z8BA 3RRDA 5KBFA 4CEWA 1GZTA 2BEOA 3CDZB 4IEPA 3DXUA 4XAAA 1N33B 3JQXA 3ZJZA 1Q3EA 1HV0A 1NZIA 4WFBV 1TVKA 4JTDB 2AHYA 5I8TA 3NNLA 3FFZA 4GH4A 5FMOL 3WW1A 2EF6A 1HB1A 2Q5ZA 2CTWA 1M06G 1VQ4V 1OMIA 4JI0B 1V6NA 2WN2A 3TWIA 1FNZA 1HKDA 5IK8A 4RHV1 4RS5C 5JIUA 1Y9GA 1LHNA 3IAQA 2A6WA 5LP6A 5FAXA 4OMDA 4B3RO 2B7YA 2ZGSA 4XHXA 2JDHA 5A9GA 2QA4V 1OPOA 2YDEA 4XZPA 2YUAA 3JD2A 2QKAA 2PLV3 5EC1C 4J11A 4O4HA 2VW2A 5FZMA 3W59A 5ANQA 1W0NA 2XT9A 1R1A2 2Z0AA 2YXLA 4TT3G 3VHRA 2GNDA 5BNPC 1AR62 5FNVA 4YSFA 1FYUA 1LB2A 1SQQH 2P6CA 2VZTA 3H42B 2W87A 4JZ2A 4DNYA 1M56C 4OHXA 1J3QA 1UYXA 3E97A 3WU2Z 2N74A 4RS5A 3VKOA 4AVBA 4UFZA 1VBB3 3CB2A 3SKVA 2VQ0A 2ZCEA 2AACA 5BV6A 1AHSA 1YXWA 1WW6A 1GUIA 3QACA 4ABMA 1PK6B 2H94A 1UMIA 2EIBA 4AFAA 5J7MA 3CKHA 2AUYA 3VQWA 1BVP1 5FDBA 1QJX3 4XTPA 2O14A 3PVNA 4EB6B 3NAPB 1VBA1 3PUSA 3JD73 2BU9A 2QDRA 4NHYA 3AP6A 4P9WA 2PHUA 4LBMA 5CKMA 3ASOB 3GBWA 1HNZB 2XJQA 2JGUA 3M3OA 2CGOA 1RMU1 2EA7A 4LITA 4BW5A 5FXZA 1OKOA 3ZFFA 1PGL1 1DZQA 2LFSA 2P3KA 2RJLA 3WNKA 4Q4Y3 4OUMA 2CTRA 2QZ3A 1ST8A 5FPVA 3RMYA 4AEDA 2PY5A 5LK7B 3T1HO 2WLIA 1JHNA 4CEWC 4MXWA 2R042 2ZMLA 5GTHZ 4O2AB 5GJ6A 2UUCB 1V70A 4PHZA 1OCCC 3G6BA 2E5LO 5LBBA 1W6NB 5FJKA 4FFBB 4FO9A 3FLRA 3GGLA 3HT2A 1H9WA 1VBD3 4E4HA 3ASOC 5LGUA 3N7KA 3HB3B 3S0MA 2QWOB 1I5YA 4BDVB 3H1LH 3I3EA 3ASNC 4FPOB 3F7YC 2E26A 1CD3G 2E76B 4LEJA 4IEXA 2W0FC 4QIWF 4COUA 2BWAA 2XWJB 5JVVA 2XBO3 4ZKIA 3EQEA 5A7WB 3ZXFA 3OF1A 1JYIA 1T6GC 5B1OA 1N3QA 5FYIA 3LOBA 5H9QA 3A0RA 1EV12 1TAEA 2WZPP 4CXWA 1RJ8A 2P37A 2D6KA 4N7UA 4FAGA 5C9AB 1K33A 4FLWA 3RDIA 2JG8B 4GYCB 2W08A 4K8RB 1UYPA 4YIPA 2GNBA 5FYVA 1N1YA 5FZGA 2VR4A 4TN7A 2P5BA 1YUDA 4BQXA 3NL1A 4U3JB 1RUD3 2ZDIC 4DR4B 3J26N 3ABMB 3ACHA 1VF6C 3CP1A 3OUFA 4CCJA 2VBDA 2Q5TA 5JZGB 1LCLA 1JJOA 5GZFA 1PX4A 1ENXA 4AI9A 3SYPA 1N34B 4GH4B 3KB5A 3ZHSA 2VQTA 5DMYA 1UXZA 3IT8A 2JIGA 1ULOA 2XOMA 2ZGOA 1Y76B 3SLIA 4ZS3A 4URTA 3O0VA 5CYYA 3Q8EA 4ASKA 4XIKA 1DCSA 2RNBA 1JU4A 1OH4A 3N2GA 4PI2A 4DUYO 2E9QA 4JGYC 2VZ1A 1WA8A 5C3SA 1BXHA 5JPMB 3WHUA 2EIEA 4QX2A 4CP9B 3ZFFC 2ZGUA 1DU3D 2V7QG 3VZNA 5JI9A 1IBLB 1KJLA 3D3IA 2WJSA 2KR2A 4LFBB 2AENA 1ZRIA 4EWEA 4PLNA 5J3UA 2JG9B 1XQ8A 4I01A 3URFA 5IWAB 1UX7A 2R1BA 3JSLA 4NYKA 5BPXA 1PGSA 4A5UB 2WSVA 4ONUA 3T4VA 3VBSC 2WZ8A 5BNOA 2JEXA 3WDWA 4HZFA 3L73H 3A0HZ 4OX9B 3KV5A 1R6TA 2HLEA 3K4AA 5C4WB 4LF9B 4LKEA 1W2UA 3AG4C 3GZAA 3H9AA 4OZOA 4DW1A 1DYOA 2W2IA 1R6NA 4CU7A 1ONAA 4DV4O 2HHHB 3J4UH 2VWJA 4OUSA 3WUCA 3BIWE 3CNAA 3MPPG 4DY3A 4B8EA 3AYAA 5DZEA 5L3DA 1UN1A 5K1XA 1BKZA 5LGTA 3D36A 3QO8A 4X65B 4IV3C 1S0FA 2XH6A 3M3IA 4H55A 2WO7A 5FPBA 4UVBA 3HQXA 1KB9F 5KA5A 3QH6A 1IG3A 1JYNA 2X53S 3PDQA 4LF7B 5CB4B 1AI6A 2XDVA 2XAQA 2JS3A 4LMFA 1RM1C 2XAJA 3DF0A 1Z7S2 3N9NA 3BTZA 1WGPA 1NQDA 1PMHX 1ZUQA 2V5YA 3KCYA 2HBTA 3BY6A 2XAHA 5BXZA 1KRIA 4O4LB 5H2FZ 5FZOA 1VRBA 3DUIA 4QKDA 5KA6A 3VBOC 1J1LA 3FB6C 1SBFA 2VAUA 3RW0A 3BTXA 2BTQA 4W6YA 4E4EA 4ZHNA 1OLMA 1COV3 1TUBA 5JOYA 4JI2O 3LSEA 4JDMA 1BZWA 3NR7A 4N23A 2W1WA 4FVMA 4DINB 2YBSA 2DYSC 2C1FA 5A3MA 1QQCA 1HB3A 4IIJA 2Q7HA 1UO9A 4K35A 3KD4A 2KQXA 4NIDA 3J8F1 4A42A 5CFDB 1UF2C 3ST7A 3VZLA 3HWJA 4GKYA 2Y8KA 3ZYHA 1VQ8V 4XDJA 2A73B 5C93A 4OCTA 1ASJ3 3SYQA 2LW7A 2UWBA 4EWDA 1DGRA 1AR82 1G8WA 4W50A 2DVFA 2GTSA 2Z3YA 4HNAB 2HEVF 3OMNB 3E5XA 3AM2A 2ZGTA 3V64A 2BGCA 4XABA 3X2QB 4U2AA 2QQKA 2G9ZA 5LB6A 2EXHA 3LCPA 3D0SA 1SFYA 2BTQB 2JJ2G 1XUQA 3OR7C 5JR2A 2XWBB 3W5MA 3RT3C 4AI2A 4DRXA 1W05A 3H8XA 2GUZB 5EBWC 3OM3B 4X1YA 1V9PA 1SLAA 1RUH1 3UT0A 1OCOB 3VKLA 2ZAHA 3FAVA 4Q0PA 3ILNA 1H2SB 4KXRA 3SPJA 3E35A 1NY71 5JMCA 2DYRB 5FO8B 1JFFB 1HJFA 2XOKG 3CCEV 2ZINA 1WLTA 2PHLA 2F43G 4FFBA 2W47A 5LP6C 2DVBA 4E27A 2RJKA 4JI1B 3OMAB 1XNKA 4QKFA 2JICA 5C4WA 3AEIA 4CP2A 2B5UA 4MVUA 4LK6A 2W1SA 3L74H 5LW9A 1QLEB 2C26A 4JTOA 5LRSA 1SS3A 2HBUA 3A8TA 5J9PC 1PO22 2DU0A 2DVDA 5C5UA 1DGSA 1NE6A 3WY6A 3RYFB 4AI3A 1NCRC 3RYHA 2P3IA 4ZONA 3ZYRA 5D8AA 1J5EB 4O2AA 2F93B 2HYKA 4PQQA 2KG7A 5EP9A 4M4PA 1XSQA 4O4IA 3MYXA 4HOOA 1QQP2 2ZXWB 5FOBB 5IJ9B 2DBNA 3Q8BA 4A45A 3B01A 1NTZH 1CJPA 5FY7A 4QPJA 1CEZA 2CY6A 1J58A 5A7OA 2ZE5A 4LFBO 4JC1A 1DLBA 2ZKNA 4I0XA 4H13B 3KVAA 3NMBA 4NUBA 3C7GA 1L7QA 2B39A 2ARHA 3HKCA 5FZ7A 2RS53 5FPOA 1CPMA 1JOBA 4Y4RA 4PT6A 3ZDSA 1JPXA 2YI8A 4RAIA 1R081 1WCUA 4AL9A 4QGLA 5CG8A 2ZZJA 4NXMB 2VGDA 5JOWA 1H8VA 4AQTA 1RUH2 2GBOA 2P7TC 3ZYIB 4BCUA 3AVSA 1G1XB 1WLCA 4NTYA 3T0DA 4UWDA 3A21A 4PIYA 1AL0G 1UPGA 4YXWG 3JB4C 3NXSA 1QU0A 4A41A 1KITA 3FBMA 2R6QA 1J83A 4DV1B 4MVZA 4JX0A 4FFKA 4P02B 3POWA 1CP9A 1O3RA 1NVPD 1XNQO 1N0JA 2GMMA 1OSGA 4JYCA 3RVYA 4WVVA 3OGRA 1MSDA 2LJ2A 3RYHB 4XF0A 4NXNO 1W8FA 3WW3A 2VVEA 3ZMVA 3ZMTA 5JQGA 3H1YA 5EHDA 3OTFA 3LDCA 3EXUA 5I93A 3BUCA 2CHHA 2QM8A 2XMLA 2ZR3A 2C24A 3NV4A 1BYHA 4CDXC 2E75B 5EJZB 3ZO0B 4DY5A 5A3TA 5KC6A 4JVAA 4EN7B 2I2SA 5IK5A 2D6PA 2YROA 2PYTA 4AK3A 5ITZB 5B2GB 1E1QG 2CH7A 1HRI2 3W5NA 2PLV1 5FYHA 4Q8KA 2C5DA 4PA7A 5FIXA 1PD3A 4JV4A 4K0KB 1RSOA 3DKQA 3WG2A 1IXBA 1NA1B 1QVGU 3FZ3A 1VQ5V 2ZKLA 1EP0A 3HKCB 5LP6B 3LA2A 2VMHA 2H0BA 4HETA 2Q8DA 4R9DA 1M5IA 2Q8VA 2Q9LA 2ZHKA 1YIFA 4B29A 2EULA 5GLUA 1H8EG 4JPRA 1U5IA 1VMGA 5K0UA 3JASB 3HKBA 2UXCO 2X29A 1KC8W 3ZOIA 1VBC2 2ADQB 1ASJ1 4CU9A 4D0QA 3QLQA 4WBNA 1LEMA 2XQXA 1M4WA 2Z79A 5L7OB 1Q8SA 1AR81 3U14A 2PHRA 4JKLA 1SMVA 2VOTA 3N7LA 2GMEA 4I3PA 4XDLA 4NIAA 1SLCA 2R70A 3V0BB 4NRMA 3A22A 4DV6B 2OA2A 1JFFA 5A80A 2E53A 4JF3A 1GWKA 4XFFA 3F2ZA 5A32B 1OOPA 3BFRA 2YXHA 2Q4PA 3MIDA 1HW5A 2XAGA 1O6UA 2GDFA 1QIQA 2VD7A 2IW5A 2YBKA 1XMQB 4UFMA 1XHZA 4X8AA 3HOBA 1C5HA 1QNYA 5KR7A 2C2AA 4BXSV 3ZMUA 4XQ4A 3HNBM 1R093 3WP5A 3AZWA 2R041 1VR3A 3KHCA 3UM7A 3J7MA 5J37A 1AP6A 3HKEA 4I55B 5BUVA 2JK5C 3CC2V 2YXSA 1GAXA 1RUC1 4JTCB 3KQRA 2ZR2A 1W6QA 1YCIA 2VMIA 5IWFA 4XFAA 4AXOA 2EIKB 1H9PA 3I54A 3RYCB 4P9PA 3KV9A 1X36A 4Y22B 1MMMA 4P9OA 4KWLA 2UXNA 1QHDA 1L8DA 3DPRB 4LF6B 2FDJA 3ZRWA 1O8PA 1V6OA 2ZX0A 4FP2A 4W4KA 2PI5A 4Y1VA 3CS5A 1Z5VA 4K9SA 1HNWB 2GHYA 3AP5A 3QO7A 3TGUH 5J2UB 2OTJV 1TMF2 4XBQA 1MS4A 3D36C 1QJU2 2JB8A 5EWSA 2RVAA 4WFEA 1SBDA 1KYOF 4AI1A 4ASUG 2YIDA 4PDWA 4UUJC 5IJ0B 2IVIB 1VQLV 1PM4A 2BCCH 1FJGB 4RGKA 3FHAA 3WP4A 1YXBA 3X2QC 4J7JA 1HRI1 3M3EA 3UKTA 2OYQA 1BLZA 2JRIA 3JAKB 4UT5A 3K4ZA 3NVCA 1NTMH 1B06A 2Q4SA 3C7OA 1UOGA 4OFGA 3OEEG 2WS91 2J1RA 3T4ZA 2OIIA 1RUD2 1UNBA 1JZ7A 1P7GA 5E1AC 2ZX4A 1A78A 4ZHQA 3PN1A 3CL1A 3KT4A 1GM7A 3MDSA 3R4DB 1ZWIC 4LNVA 3LEIA 2VRZA 4AWDA 4E4DX 1HIXA 2RG4A 5IVYA 1BHGA 3CC7V 3HR9A 3ZN5A 4QX1A 4BIFA 1MVEA 2BFUL 3MHZA 2EZPA 4NO4A 2UUCO 3ZIAG 2B42B 3PU3A 4RN5A 1WZXA 5IVVA 5C8WA 4HT1T 2GP5A 5A3UA 5D8AB 4IEWA 4XIOA 1KKCA 3N4MA 1Z7S3 3ACIA 1PV0A 1S0BA 4RHV3 5FKCA 3BB6A 1JTZX 2JJ1G 4CH3A 3ZXDA 2P06A 3B2EE 3LFIA 1MQTB 4A7YA 1B35A 3K75B 4L0PA 1D7PM 2WFF3 1XILA 4BR6A 4E2SA 1N32O 1WLEA 2EIMC 2OTLV 4FTSA 5JXGA 3VBRC 2R9AA 4E9KA 5FPLA 5KX5B 4BQ2A 1S5LZ 4B1MA 1W2TA 4CE8A 4TTGA 2AH2A 3CCQV 3A0KA 1F4MA 3RI9A 3K46A 4KI5M 1GM8A 1X8MA 3W21A 3FUOA 3M8LA 3NJXA 1WKYA 4UFIA 4JRAA 5L9RA 4PV1B 2F4VO 4YZ1A 4N43C 1DK1A 3K2OA 4IL6Z 1V6MA 5FZ0A 3OCPA 4YM0A 1IBMB 2XHNA 3FX3A 4Y26A 5EV7A 2CV6A 5DQ0A 5J96B 3AG3B 3PIJA 1QGLA 1U97A 2CYFA 2IUWA 3PJYA 4FBFA 1SF9A 1HB2A 1KP3A 2WAAA 5L36A 5EIYB 1JZ6A 5CFCB 3FB8C 1B35B 4Q1PA 4Y3OA 4D8MA 3LUTB 2BPA2 3PVBB 5J1XA 3ZCCA 4JYAB 3JASA 4Y4YA 5B1BB 2ZCWA 3AZZA 2V72A 3IWZA 4UW6A 2D6LX 5FUIA 2DCTA 3CF6E 4MHRA 4NB5A 5LBEA 4WCEV 2ARXA 2LW1A 3POJA 5HCBA 4JGYB 1WW5A 1OCRC 5BMVA 3AG2C 4Q4V2 3BODA 5FY0A 2FTKA 4A6OA 1I6XA 2QTWB 1GZ9A 5HV0A 1LOFC 2G9GA 5JSOA 4MGSA 5JDBA 2RR13 1CONA 3GWOA 2IVJA 3C7EA 2WQZC 2WR9A 4GKKO 3CQOA 4HKOA 1JYVA 1JVMA 3R66A 4KWUA 4HAMA 1K73W 3ZN4A 3THCA 1G9FA 4D7SA 1HV1A 1ULGA 4LHSA 2WLMA 1ZBE1 5T5PA 2R0HA 1ACCA 3J9SA 3MIBA 1EAH2 2AGSA 3Q4HB 1OLQA 1XI1A 3VUOA 1XBLA 2EJ7A 1SQ4A 2ILMA 2P2KA 1AJNA 4UCSA 4DV6O 3EBRA 1Q8IA 1GZWB 3ACGA 3E86A 1QVFU 1DGRN 2RM23 4PLOA 3MHSC 1L3JA 4YG0A 2F23A 4BLJA 1PK6C 3ABKB 2WZR2 2XKOA 1BEV3 1H8TA 1XDCA 1K4DC 2JDMA 4G27B 2YZ4A 3QF7A 2QKSA 3LEKA 4BK5A 2JGDB 4HKWA 3DXRB 5KUMA 4TSFG 4FPFA 1B04A 1SCRA 1PNLA 3ETEA 2ZGNA 3LDEA 3SDLA 2RQ6A 1IHMA 2AZ2A 1AXYA 1JR9A 2RDSA 3H7YA 3I59B 3W20A 3OTOB 3OB8A 1GICA 2DUQA 1RINA 4BYYA 4DS0A 3WNPA 1VBA3 1GFF2 4U3FH 3L2YA 2WLKA 1WCDJ 3N3HA 2NQYA 1ND2A 2XLAA 1Z2GA 3T2QA 4NIGA 2YMZA 1F4HA 1W90A 2Y34A 5FYYA 1YVWA 3HN3A 2W3JA 1B6QA 3PHMA 4XVHA 4RGGA 2BZDA 2IWGB 2JKXA 1XMOO 4QGPA 3N2KA 3MEPA 2D3PA 2HP8A 1C57A 5F2VO 2K9ZA 4E8CA 1KDMA 5DUXA 2ZZQA 1RSOB 4QKBA 1BK1A 1PO12 1WAZA 1YITV 4CDQC 3V65A 1AYM2 2AHZA 1YWKA 3NW4A 4LOSA 3ABLC 4N7IA 2F4VB 4C1XA 3VDBA 2GC2A 4NPLA 4X62B 3OW2U 5LA9A 3MIHA 3K9SA 2A5ZA 2ZBJA 1HR0B 5HCAA 3ES4A 3MIFA 4QQPA 5KHIA 3VL8A 2DU1A 1RUF2 1PIV1 3OGSA 2HEWF 4P5HA 4FM1A 4RR3B 3U1XA 4DO0A 3MDPA 4KG8A 4LC1A 3A0NA 1YQCA 4OI0A 4UI9L 3OY8B 4DIQA 3WX5A 1JOPA 1BMV2 1S72V 4UVAA 1M57C 4QQ2A 4YW5A 5JPNB 2A3XA 2IBZH 5FMOS 4JDNA 1WMXA 3WLUA 2Z69A 2AW9A 1V54B 1MQTA 4XDKA 1SFPA 5GALA 2KB1A 5HFMA 3MD0A 1W8UA 2X5IA 4BE3A 4IESA 2DF7A 5BNPB 2YSUB 4ZS2A 2A3YA 1DGLA 3OE7G 4LK7A 5AC91 4I02A 4QJFB 3H01A 3I4IA 1AUYA 4LBQB 2WLNA 1YI2V 2CWMA 4L97A 1RVF3 1AL22 2BW8A 3I2JA 4NOTA 4GX2A 4O9GA 3P3PA 2QTOA 2WABA 2DFCA 5F3GA 1FX5A 1TVKB 4I4TB 3Q8FA 4ZXKA 1PMIA 4DR7B 1EYBA 4LF8O 5FLIA 4XCBA 4JTNA 1QDOA 3JATB 4B4PA 3UT5A 3N2KB 2H8PC 3WW2A 4YARA 4DRXB 5FZ9A 4NVPA 1RUI3 2CTPA 2OIEA 2FKXA 4LFAB 5FRAA 4BQ4A 1HX6A 3K5OA 4DZGA 4MTXA 2Y33A 1VPHA 1CAVB 1WBFA 4FVVA 2PTMA 1GANA 1XRUA 3I5DA 4M3CB 3E8FA 2HWB2 3ZR6A 2OYZA 5J36A 4IHJA 3J8F3 1R091 2UUBO 2BNNA 1OCOC 4YY3O 4AQYB 3CEWA 4RSUA 4BQYA 4MHUA 4PA6A 3OBTA 5FUPA 2JEMA 4YG3A 4B4QA 4RFRB 3INAA 5FO9B 3K08A 3H9VA 1O3SA 2WKKA 4ZXEA 1DF0A 2NLRA 4N9IA 2B9UA 3JYCA 4XBNA 2R9IA 1OQ1A 1VBE3 1CPYA 1AJQA 4LO6B 5LBCA 1N8RW 3D0JA 5AVPA 3MLLA 4ZU5A 1O9GA 3I3MA 4MX3A 1OT5A 3JBG3 3JD72 5DUWA 3RYCA 4A2UA 5LYJB 3BA8A 2JE8A 5CEHA 2VOWA 4IE7A 3LWCA 1R3JC 1B09A 1VMHA 1REEA 3NNMA 3WDXA 1VF7A 2WYFA 1MQTC 2GNTA 1OCRB 4ZHQB 4YJ2A 1K3EA 1OUXA 3M3CA 5FPXA 1LUVA 5JVDA 2YG0A 4YGCA 1VBB2 4LA2A 5JI7A 1F5JA 2X5IC 1UZ0A 1MZ6A 2OT7A 3IN9A 2E32A 3UO3A 1UPSA 4HNAA 1WA8B 3G80A 2DBIA 3BPSA 2Q8CA 5J48A 4JGYA 2VZ3A 3LIGA 4UV8A 4JQTA 4LULA 4OUEA 3CWBH 5C6CA 3NKTA 2LFRA 1PIV3 4XF3A 4LBQD 2Q1FA 4FMTA 4R8CA 2QQNA 2UUAB 1G6NA 3K58A 2Z5UA 3BIEA 4I09A 3TEYA 3F7VC 4JRLA 1DLCA 2UY9A 4FLUA 2ZD9A 4MVQA 4F83A 1Q82W 5T55A 2IXIA 4WF9V 2W94A 1WUVA 1NCQB 2ETEA 3RFRA 1QHTA 1UY4A 3DYPA 1XE0A 3R0RA 1SQPH 5FXXA 1AXKA 4X6QB 3FYIB 5FY9A 2B9VA 3AKRA 4LO5B 1SFNA 1CX4A 2CWSA 3F95A 1QEXA 1APNA 3UJQA 1C8M2 2VUCA 1E1RG 2DUPA 1R1BA 2G19A 3R65A 1RYYA 1NLQA 1DG6A 1G9CA 2BOBC 2YY1A 3CC4V 4MGZE 2VXRA 2FMYA 1SLLA 5A3PA 4QPKA 2D43A 2OX0A 4LBKA 1WN7A 4L8QA 5ACA1 3AG4B 1YFUA 1QXRA 5I0TA 1CAUB 1FV3A 3ZN0A 1YFYA 4QT6A 2UYBA 2JB4A 3VBSB 2EICA 4LKDA 4X88A 2R1DA 4I9WA 1R083 1XE8A 1W6MA 1V6LA 1MEC3 2ZAAA 1OCZC 4IV1B 4PDWB 5IY5C 3ECQA 3AMMA 1VARA 5DAXA 5FYUA 2EIKC 3FE5A 2J1EA 1PVXA 1FXKB 1S0EA 1X8EA 4YPJA 3WNMA 2A75A 2ET7A 1HNXB 3I3DA 1JN2P 1RUH3 4KU7A 4E8DA 2BP6A 4OHVA 3RS6A 1F15A 1JZ8A 3ZBHA 4KFMA 4DUZO 4XAEA 3RWRD 3DV8A 2RMU2 3H50A 3QOPA 4X66B 4HN1A 1Y67A 4FXKB 4YGBA 1YTFB 5K7PA 4FPCA 1L0NH 4YIOA 2XG3A 4OQ8A 3ZHRA 1VQ6V 2Y6HA 2CE4A 1NJIW 1S55A 2OQ7A 4B4RA 3SEEA 3PUHA 4YHHO 3WSOA 1IZ3A 1UZVA 4LBJA 5CADA 3P32A 4CS3A 2ZACA 3KF5A 5FP8A 5JR7B 2FZ1A 3WF4A 2BTOA 2HEPA 4CDUA 2VH9A 1I1EA 5EBMC 3AMQA 1N3OA 5L19A 3LDRA 4AAXA 3RPQA 4MADA 4H0LB 2LM3A 4IEVA 2A1XA 4A4AA 2RN9A 4Z2WA 4AHWA 3ETGA 3GWKC 2JDYA 2HHHO 4LF5O 2YYOA 3ZSKA 2P5OA 4PJYA 4EN0A 5DECA 3WINE 1GYKA 5F32A 1W6PA 4YW6A 2VUAA 4W4LA 2AREA 3TN91 3B09A 4CC6A 3WNNA 4QQHA 1Y43B 1IVSA 2QQMA 5ITZA 1NZCA 4X65O 1NA1C 1IQAA 4NRPA 2ZPXA 3TBDA 4AQYO 4LF8B 1IBMO 3PJSK 1OFSA 2Q73A 2DCYA 3CCJV 4FFFA 3WQBA 3S57A 4OI2A 1OA2A 3ZR5A 1UU5A 2E6VA 4IYHA 2W1UA 2AXTZ 1RUJ2 2YBPA 5JCTA 3POGA 1CWPA 1MEC1 4WVMB 2DTWA 5B3SC 3CCSV 1AL23 3C3TA 4XJUA 2DE0X 4DUYB 3CRQA 4Q26A 4CUGA 1K45A 1GZWA 2B46X 4O4JB 4TXWA 1P4RA 1GMGA 5EPAA 4CDQA 2Q6AA 4FAHA 4KHPO 3NSTA 1ULCA 4BPZA 1RJ7A 3HBKA 2ENRA 1YZBA 1HWYA 3H1KH 5L7OC 3IGAC 1QJU3 4I0BA 3ZVXA 5CBHA 1M57B 1JS9A 1N4CA 2PZSA 1WA4A 3T2TA 4IE6A 1SKVA 4J25A 3KLSA 5FMCA 2XVKA 3CMEV 3RZJA 3DEMA 2WSSG 2X6AA 5B66Z 5C8YA 3ALQA 3HBZA 4AVTA 1W8OA 3OG2A 4P00B 3R6SA 3CSXA 4RFT0 3A4UA 1NU1H 1NLRA 5JSPA 1MG1A 4JI1O 5EIBC 3B00A 2EX3A 1O5UA 4K1YA 4EZ4A 3DECA 5F37A 4YVWA 3QH7A 5FMDA 5FV3A 4XHBA 1NTKH 2HWC3 3PJQA 3HAGA 1PNKA 1S3JA 3K3NA 2VW1A 3V0AA 5L7OA 1XOUA 2D40A 4R9CA 5KHGA 1UWWA 4MVRA 4LUMA 3ZX7A 2V73A 3HR0A 4HXCA 4IGQA 3ML0A 1J5EO 4Q4X3 4FM2A 3CD6V 4NHLA 3PU8A 1NUKA 1Y4WA 3AXDA 3O5SA 2P3YA 4X9QA 4RD7A 4Q4X2 5A7QA 2HWD3 3G4SV 5ABJC 2YGMA 2V4AA 5K0UC 2HWD2 4XFBA 3QTCA 4XDOA 5CA0A 3VZJA 3ON7A 3WT3A 1I08A 5A7PA 2CSGA 1SG3A 1HXS3 1IOAA 1GN6A 3RVZA 4CS4A 3RSJA 4JI5B 4XJWA
chains in the Genus database with same CATH topology
2A70A 2CTVA 3TOJA 2PAKA 1H8TB 2XWBB 1RTVA 4FP3A 3AFGA 4AI2A 3O0WA 4R4ZA 4S2HA 1Q5OA 2ZGPA 1ZNPA 1BBT2 1CPNA 4L11A 5E1RA 3THPA 1SLAA 1DQ2A 1RUH1 2D3RA 3OGJA 1UZZA 1TE1B 3VKLA 5KXCA 4LLFA 2ZAHA 1ZZ8A 3M70A 1QXJA 4Q0PA 3ILNA 4E4ZA 1ZREA 5GLZA 1A3KA 1NY71 1ULEA 5I0SA 5JMCA 5FTTC 2AR6A 5FO8B 1WW4A 1OQDA 3MW3A 3VKNA 2PQQA 2EXIA 1WLTA 2PA7A 2PHLA 3CJIA 1SACA 1RVF1 2VQAA 1IKQA 1W6NA 3S7EA 2XBO1 1W6MB 2DVBA 4E27A 3H7JA 1AR91 4XF1A 2RJKA 1I5ZA 3VHOA 5IUQA 1C8M3 1J1TA 4FQZA 1XNKA 3ATGA 4AI8A 2JICA 4XJ9A 3SCFA 2CGPA 3GHMA 5C4WA 4Y1YA 1POV1 1UKRA 1AR72 4CP2A 3RNSA 1DRYA 1ZZBA 4OZXA 4IXLA 3HN1A 1H2KA 1PVC1 5I8YA 1AR63 1W6OB 4JTOA 3USUB 4BMEA 4ZU7A 1O3TA 5LRSA 5KXDA 4DB5A 3CJIC 1VALA 3KGZA 5H9RA 1PO22 4V1PA 4YG6A 3OY8A 2ES3A 2DU0A 2DWRA 4K6BA 4M3CE 3U11A 3WNXA 4ZU4A 4Y20A 2DVDA 3VZOA 1NE6A 1OIJC 1SLBA 3WY6A 5H9PA 4AI3A 1NCRC 1UPIA 2P3IA 2Y26A 2ZX3A 1VLNA 4KGQA 2GN7A 3B7MA 3ZYRA 4LR4A 5D8AA 5FO7B 2RMU1 4S2DA 3FUQA 3ES1A 1NQJA 2JJ6A 2HWE1 4KWJA 2OZ6A 4HK9A 2WS93 2HYKA 1LHUA 2QCSB 5JOXA 3HIFA 4YVSB 5TSWA 4IEYA 3FBYA 3DGTA 3MYXA 1I3HA 1QQP2 1LU1A 2VVDA 4AEJA 3KMHA 4AYUA 1QJX1 1OIJA 1Y3TA 4JGZA 4XW3A 3BOPA 5FOBB 4FPKA 1K5MB 1DS1A 2A6YA 3I2DA 3TNQA 4B7EA 3KCXA 3JD71 1AR61 3B01A 1CJPA 2WNVC 1BBT1 2ZGLA 1NOVA 4INDA 4QX5A 3C2UA 1F31A 2WNEA 2R30A 3VBOA 3SH4A 1G9AA 5CFDC 4EN9B 2CY6A 1J58A 1LHOA 3ZYJB 4YVWB 1NCRB 4XF9A 4JC1A 3LAGA 2ZKNA 4YZ3A 4AFCA 1FPN2 2E7TA 5I0UA 4Q4W3 1VRH3 2XVGA 1RUF3 2RS32 1LULA 2B39A 2I07B 1H4HA 4BZ4A 5BNOC 2RS53 4HVRA 1WMFA 2QE3A 2QJVA 3SXWA 1B35C 1CPMA 1CVNA 2Q1MA 3ZDSA 4W6WA 4QPGC 4N53A 1R081 2LUWA 2GALA 3FWEA 1OOPB 3OBRA 4QGLA 3RJRA 3ZXGA 4OHYA 5CFDA 5CG8A 1WD3A 3ZPYA 2ZZJA 1BEV1 2PLV2 5JOWA 2VGDA 3H1MA 1DQ1A 1H8VA 4AQTA 2MHFA 4LBNA 1WMDA 3IDCB 4ORFA 1RUH2 2ZHMA 4GQ7A 4DRRA 3ZYIB 3JBG1 4RA0A 1DZRA 3R1JA 3VBFC 4BCUA 5DUVA 4XILA 1WLCA 2BBVA 2KA3A 1O3QA 4LE3A 1VBC1 1QMJA 3B3QE 2SBAA 4RL7A 4CEYB 4QPGB 4XFCA 4M2GA 4YM2A 2WFF1 4PIYA 4N53C 1AL0G 4CDUC 4DFSA 4QMAA 1Y9QA 4AFMA 3JB4C 2DFBA 1S0JA 2UU8A 1QU0A 2WNUA 3AZVA 4HSJA 4HVOA 1KITA 3FBMA 3WG4A 2R6QA 5SV8A 3VDDB 1OHFA 4W6XA 1X33A 2JG8A 3D82A 2WZR1 4NHKA 4ITCA 3POWA 2A6XA 1O3RA 4BA6A 1C4RA 2DV9A 2GMMA 1OSGA 5I0RA 2O8QA 1CR7A 1FOD2 1PZ9A 4WVVA 2PHXA 1D4M3 2RHPA 4LA3A 1LOAA 1GNZA 5GKAC 1K5MC 4OVEA 3LA3A 1CAVA 5C33A 2NP0A 4XF0A 4WM7C 3VGIA 1C8M1 1JR7A 4BHGA 3WW3A