2XUMA

Factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRHSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2xumA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xumA01
2YDEA 4AI8A 1MZFA 2WA3A 2W0XA 3OD4A 1YCIA 2ILMA 1H2NA 2CGNA 4B7KA 5JWPA 4JAAA 4QU2A 2Y0IA 3KCYA 2YC0A 1IZ3A 3D8CA 3P3NA 4BIOA 2WA4A 4NR1A 1H2LA 3P3PA 1H2KA 4Z2WA 4Z1VA 1MZEA 2XUMA 4B7EA 1H2MA 2CGOA 3KCXA
chains in the Genus database with same CATH superfamily
1GUIA 2DCJA 1S5HC 3KGZA 1E5IA 3NV2A 4QGLA 3LDRA 2BYVE 5EBWC 2RJ2A 5IJRA 1PL4A 3IBMA 2W47A 2P2KA 1XSRA 2DYSB 2CUGA 3MICA 4UB6Z 1QLNA 3QTCA 1XNAA 3OGCC 2OKXA 1F8VA 1OPOA 2A6ZA 2DVGA 4NIIA 1V9U2 4B3MO 4O4IB 2RS53 2DE0X 3L75H 3OBTA 4HKOA 1IDSA 1OVSA 3I7DA 2VTFA 1KGYA 2XR4A 4XBNA 5J37A 3RJ2X 4XE9A 5FWJA 5C8YB 1W39A 2ZJCA 3K3OA 2JD9A 3TEWA 1AR62 1B35B 2ETEA 3K04A 1POV3 2Y38A 2BWAA 5EQUA 3QD6A 2G4IA 4XILA 1Z2GA 3MW3A 3PURA 1IHMA 1HNZB 5C4WC 4NR1A 4OPAA 3ME2A 5DECA 1VRH3 5FOBB 3N27A 2VW1A 5IHRA 5FAXA 4B1LA 1MSDA 3VBSC 4LBQB 1J1LA 4GB31 1J3QA 4MVOA 5LK7B 4UXAA 1PZ9A 4B3TO 2WLJA 4LPLA 1FATA 4CS3A 4OYUA 1Y7BA 1SPPB 3HEIA 2VVEA 4C90A 4WM8B 5JXJA 2W6IG 5D2AA 1AL0G 3OB8A 3WF2A 4DUXA 4M4RA 3ACLA 3VKOA 1NKGA 2GDSA 1RUJ1 4A6OA 3AP9A 2XLGA 3D4KA 4JZGA 3I4IA 4Q8KA 5E8AA 1Q81W 1ST8A 4YVWA 3D8CA 2B7YA 1PVC2 3E1F1 4QXCA 2BW8A 5FZ8A 3WQBA 2C9AA 3PTRB 2YIBA 4KHPB 4EEQA 1PV0A 4QE7A 3CB2A 1SACA 1NY72 4EN7B 1OKOA 3ZHUA 1JTZX 2VY0A 5CN0A 5D1IA 4L11A 4Y20A 3QOPA 3QO8A 5JOWA 1K4CC 3BIEA 2L6LA 2P7TC 4ZU7A 1VR3A 3HBKA 5BV6A 4QKDA 2D43A 3LEMA 1IGOA 3VBRA 1OPMA 4JV4A 3WDYA 1LECA 2EAKA 3PIGA 3I3EA 4JTCB 1IBKO 1ULDA 3AFGA 1TMF3 1DF4A 2VQFO 3C2UA 1VALA 2A75A 1VLNA 1LGCA 3H3LA 2UUBB 2X29A 3WP6A 3JAKB 2QQIA 1N3QA 2PHDA 4IXLA 3BABA 3ICXA 2IH3C 1AYN2 2BNOA 4XACA 2QBXA 4DPNA 4UVCA 2OT7A 1FS0G 5K8SA 5H5NA 4U3JA 3LUTB 2ZAAA 4P9WA 1YQCA 5KX5B 5F37A 3WW4A 3S5QA 1AL22 1GM9A 2E5LB 2ILMA 1QXRA 3QH6A 3U11A 5GKAC 3RG0A 1VQ7V 2ZX0A 5F9TA 1NLRA 2EIKB 1GV9A 4FZ1A 3VBSB 5DUUA 4KH9A 2X6AA 3CPWU 4YZ2A 5JXHA 1RHI2 2AW9A 5AFBA 1LNQA 3JBG1 3JSNA 2HJIA 4OLLA 4AVBA 4O4IA 2ZHKA 3UT5B 4ZHQB 3RZKA 3PUIA 2XBO1 1U96A 4IEQA 1ND3B 2E53A 5FYBA 2E51A 4WFBV 3I2JA 3CRCA 2E32A 3CJIC 5C5UA 3INAA 1SCRA 4JI3B 3AP4A 4O9EA 4H55A 3BGAA 2WS91 3M3CA 4NN0A 4LF7B 2R1DA 3ZYRA 2GSYA 3POSA 1ND2B 2A3QA 4B4RA 2MEV3 4CUCA 1IBLB 1A8MA 1BQPA 5JI7A 3VDAA 4Q0VA 3ILNA 2ADQB 2RN9A 1AYM3 2PELA 4GA9A 3T4HB 3PUAA 4WFGA 1K5SA 4BXFA 1DQ0A 3L74H 2XASA 3WU2Z 1PZ7A 4Y22A 5A7QA 4QDRA 4COVA 4PI2A 4WM8A 1JYTA 4F8AA 2NYYA 1JMKC 3I59B 3EYPA 2UXBB 1LHOA 3B69A 4WCEV 3CIHA 3C3SA 1ZL8B 2AHZA 3FC0A 1G9AA 2C5DA 4LHNA 1JI6A 4CEWB 1DP0A 1FPOA 3GBGA 2VNRA 1URFA 2ZMKA 1ZRCA 4YW2A 3PUSA 4QX5A 3WSOA 1SG3A 1GZTA 3MI8A 4Y1VA 4B4QA 4XFBA 3PU8A 1UKGA 3FBYA 4MVUA 5FPOA 1J5EB 4JI0B 2RS51 5FYYA 1S0FA 1S2EA 2XXZA 4XDPA 4XVHA 5JCOA 5LWBA 3ZMTA 4AQYO 1K5JA 3T2TA 1O4TA 1O9HA 4DV4B 3WT3A 2QE3A 3PJQA 3A0BZ 1OUSA 5BNOB 2SLIA 1JMUB 4Q4X3 4HOOA 1LHVA 2QQVA 3E83A 5J7MA 3L2HA 3ASNC 1U5YA 1VBE3 1POV1 3ZCCA 1T2XA 4I0AA 3JAKA 4B7EA 3RQ0A 3ZMZA 1FXVA 4X8NA 1X33A 4XIKA 1GYKA 2JG9C 1WBFA 1G9CA 4GX2A 1HJGA 1VRH1 2ZEWA 1H8HG 1NZ6A 1ULOA 4INDA 4I9WA 4OQ9A 1OA2A 3HIFA 4Q4W2 3VBUA 2JKBA 1FNYA 1OURA 2NZ9A 4JRAA 5KX5A 4QPGC 4CSWA 3OEEG 2E33A 1YHFA 4LBMA 2HYKA 3D0JA 5KXCA 1W8NA 3KT1A 3A0NA 4CCOA 5LYJB 3LDDA 4XETA 1FFXB 5A70A 3JALB 1D2DA 3LSEA 5CFCC 5F7UA 4ISRA 3SJCC 1LEDA 2VNVA 4X1KA 1HNXO 3WP3A 3VBOC 2ZDIC 4K1YA 1QF3A 1IURA 3QLQA 3IPVA 2AGAA 4UV8A 1J84A 3H1YA 4AI2A 3FB8C 4QPIB 3UT5A 2YI8A 4NHXA 2YMZA 1G8WA 1HV0A 2UXNA 1DZRA 1RJ7A 1WZXA 1IS4A 2QTSA 1BK1A 3JUUA 4LMFA 4TQDA 1DLCA 4CU7A 4EYUA 2BWCA 1FJGO 4CCCA 3Q8EA 2HWE2 2UY8A 5L73A 2Q8CA 2WN2A 5GZFA 5FLJA 1WA8B 1WLCA 4QDQA 1OA3A 1ZBE3 2ADDA 2A79B 3K0DA 2KSDA 2RM22 1KFXL 1LKNA 2V73A 2ZTNA 1TMF1 4DR1O 4AVSA 4AAXA 2ZEXA 1WCKA 2EA7A 4W4KA 2QQUA 1RMU2 3PNAA 4HVQA 2XPJA 3IM0A 4LNUA 3RI9A 3KZIZ 1CD3G 4FQ4A 3SR2C 5LMUB 1T6BX 2ZQMA 3IC7A 2ARHA 3O1MA 1GP5A 2YYOA 2FCTA 4FVMA 3SYQA 2X0LA 5HCBA 2V4VA 2EULA 3N7JA 1WCUA 1UX7A 5F2WA 2GBOA 1X36A 2GDFA 3CMEV 2WSSG 3AKRA 4BQ1A 3HAGA 4BM8A 5M0TA 3T1YO 3T2PA 1GM7A 1ZYBA 1L0NH 2VBDA 2QKDA 2VULA 2JG9B 1NKDA 5CAZA 3TN93 3LB9A 4K40A 2J1SA 2QWRB 4R9AA 2BVBA 3DGTA 4K8RB 1KD1W 1OQ1A 3ZXDA 3JD3A 1COV2 4MZUA 3OMNB 4DV1B 4BLIA 3LPGA 1I5ZA 4X62O 1MS1A 3ALQA 4YIPA 3A22A 1LOBA 4HT1T 4I0XB 4JYAO 2EIBA 3B40A 4TT3G 4NPMA 4QX7A 3CJHB 2XKPA 1NE6A 1GAXA 2PMWB 3N7LA 1RUF3 5L3DA 4YNIA 4DR4O 2UU9O 2H94A 1UPIA 1W2OA 3A21A 5JH7A 4LF9O 4LOSA 3B09A 4DZGA 5FRAA 2FMYA 2WT1A 1XMOO 5JQGB 4B3RO 1H30A 5KAFZ 4CDXA 2D5HA 1Q82W 4DR2B 2ZMNA 2B9ZA 4MG2A 2Q0OC 1XSQA 5LK5A 1JUIA 2XAJA 1MS4A 1REFA 5I0UA 5T3NA 2P6JA 4KNCA 1TVKA 1W6PB 3AMPA 2MEV1 1LU2A 4FM2A 1RUE2 1F4AA 2Q6AA 4DV3O 5C5TA 4KWKA 2PI4A 2WLHA 4A41A 4MGQA 1AYM1 4YARA 4KU7A 2ZHMA 3H8RA 3H8XA 1W6QA 3MD0A 2Y6FA 4FPYA 5FMBA 3MEPA 4RUEA 4FXGB 1SQBH 2RDNA 1NLQA 3I8TA 5JSRA 5ACA3 1CAWA 3LKJA 2GC0A 4DV5O 3HT1A 3M70A 1SZTA 3PHMA 2ITCC 1HLCA 2P3KA 2R9RB 1SLBA 2JDUA 5FWEA 3JQXA 1IQDC 3N9OA 3MZHA 5F5IA 1W2UA 3OAAG 4OQ8A 2VTXJ 2PHRA 1TME3 4F6RA 3T30A 1UL9A 4P00B 4XTPA 3UQ8A 1W3XA 1SF9A 4QPIA 3WOGA 2RVAA 1DGRN 4K8FA 3CC4V 5D21A 2FZ1A 1RTVA 3PMEA 3E35A 5FZ0A 1Y4MA 3VBRC 5IYYA 3LSSA 4N43B 2ZIMA 3SHRA 1QEXA 1PMIA 1WA8A 2VTXA 1W28A 1OCOB 4IEYA 4QXBA 4Q4X1 1CZTA 3VZMA 1XE8A 3NV3A 1VBE1 3AJZA 4AHWA 4QX1A 4AEDB 4NWVA 1QJFA 2EXKA 5FXXA 3V0AA 1T5EA 1GQPA 5C93A 4Q26A 4XAEA 4JTDB 4DRXB 4QU2A 3VHRA 2HWB3 1EUUA 1HR0B 3LIHA 4LBQD 5H6QA 3N2GB 3SITA 3POWA 1VP6A 2DVBA 2JEUA 1RP3B 1Z5VA 3WDWA 1PNKA 1N1VA 3PLQA 1J83A 4XMAA 2GHYA 1W9FA 1XEQA 4MLOA 2HWF2 1RPOA 3RZHA 5AC93 3LDCA 1GQGA 4D6QA 1HRI3 1S0GA 4CXXA 1XNRO 3QBQA 1F31A 3RNSA 1FMD3 2WZPP 1NCRB 5IWFA 1PHMA 1EFRG 1PO13 2IJIA 3WQ1A 1BBT2 2AENA 2D44A 4U3FH 4W8JA 2WAOA 2B5HA 2Q8OA 1XREA 5F2SA 2CHHA 3J8F3 2F4LA 4BZ4A 2MHFA 2BBAA 4PA3A 3LWCA 1U5ZA 1D5NA 3T1LA 1ASJ3 3KVBA 3AG1C 2IW5A 4FM1A 5CEHA 3CMGA 3ZYJB 3TXQA 4Q4V3 4R50A 2JDIG 4HN0A 3FL7A 4S2HA 3M3EA 5CZKA 2YDEA 2A3XA 4KWLA 2L9LA 1HB4A 5JQGA 2DYRC 3KQ4B 4K8XA 3TEXA 3U10A 3ZFFB 1GKBA 2ZIOA 1PX3A 1ZBE1 3UJQA 4BQ2A 4IETA 1BQ0A 4DR5O 3AL5A 4LKDA 3SMHA 4WVMB 3M8LA 2BDRA 2XLAA 1AI5A 1WUVA 5IJ0A 2CV6A 3CL1A 3FHQA 1YYNA 4AZZA 5H6RA 3FYEB 1PO23 3GBWA 3MDPA 2PLV2 1DLBA 3AYAA 4Y26A 2NNUA 1VQKV 3HKBA 1PK6C 5K1XA 5L9RA 3ZRWB 4XUOA 2LW8A 5T50A 2XG3A 3O14A 3N2KB 2GNDA 1Q6UA 2DU0A 1H0BA 2QWQB 2X09A 3FLTA 3AVRA 3HPLC 4LULA 3SH3A 2Y64A 3P5BA 5LW9A 4JI6B 4QGPA 2FDIA 2EIJB 2XTAA 4FXKB 3WXPA 2Q5TA 5T55A 3TN91 4NHMA 2JE7A 4RR3B 3POBA 4XBQA 4YFWA 4YW5A 1V0AA 2ZINA 2XWBB 4NIGA 3K06A 2JEXA 3FN9A 1UJWB 5JVDA 4ES9A 1W05A 4LF4B 3OJBA 2DTWA 1RUI3 4L8QA 4LIVA 2QQWA 3HKCB 5FZAA 3P30A 5IFPA 5FZ1A 3ZRSA 4XJZA 3ZPYA 2WN3A 5CIRA 1O3RA 4O4JB 1NR7A 3FB6C 1DYPA 5LA1A 2FDKA 1IPJA 1Q8QA 2HKXA 4I3GA 5BNNB 1Q43A 2V4DA 1OBNA 2TEPA 1N32O 1KXGA 4N23A 1RUF1 3LOIA 3EB7A 1ZZBA 1AX2A 2YICA 2BQPA 4A3ZA 4GYCB 4YW4A 3K5LA 4UXNA 1H2MA 1R082 1OLRA 2WYFA 4QGNA 1BYHA 1Y74B 2WO3A 3F7YC 4AEDA 1MQTA 2A3WA 1QQCA 5FLXN 3NNMA 2C1FA 4H7MA 2ZGLA 2EX3A 1FX5A 3THTA 4DRXA 1W8WA 4XMIA 4PD4F 2BV4A 3DUIA 2QJ1A 5IK5A 2ET1A 2BPA2 4IIJB 1OLME 4Z2AA 4NAMA 1APNA 5J2TB 2IM9A 2HKOA 3M7AA 1R1BA 4JI7B 1DLLA 1XQ8A 3GXUA 1RUNA 3USSA 4X20B 5I8YA 4DO2A 1NR1A 4LO6B 5A9GA 1CEZA 3BEHA 5JZGC 3ZFGA 5DEDA 4UB8Z 5ACA1 4P9YA 5C8WA 1UZVA 1KKCA 3U0ZA 4AQTA 4JI8B 2Q4SA 3HNYM 1NCRA 4TYSA 3AM2A 1LHNA 3S0MA 1W0JG 3MPPG 3ITQA 2JJ1G 4C1WA 1GOFA 3SH4A 1JXNA 1CAUB 3WNMA 4FT8A 1UZZA 2ET7A 3ZHVA 1GMMA 4NTYA 1MZ6A 3RVZA 2R043 1Y3TA 2PQQA 4LFAO 4LE3A 2IUWA 4IESA 4H37A 2QQOA 5EYPB 2VMCA 3VDCA 4BOWA 1GOHA 1SRYA 2ZNIA 1UN1A 2AACA 3BTAA 3MFAA 3AKQA 4HVOA 4OUSA 1MSWD 3ZXKA 3F2ZA 2EVXA 5FUNA 3ZFFA 1WLWA 2ZHNA 2OIIA 2F23A 1I9RA 5A80A 2FD8A 3H42B 1IXBA 5L3EA 2ORXA 3WHUA 2NP0A 4QNHB 1YZBA 2BOIA 4J11A 4NPRA 1W6OB 1JYWA 2GH2A 1RUH2 2VCCA 1HB2A 5LOVA 5L3BA 1KDKA 5DUVA 4CDWC 2HWB1 2QE7G 4JF3A 2G9FA 2DUPA 4HLTA 5C9AB 2E9QA 1Q56A 3WW3A 4DV2B 1AR73 1SFPA 2W08A 2FQPA 1V6NA 1W8OA 5AC91 1NZIA 1HRI1 3VBBA 2YXLA 4YW6A 1VQ8V 3TEZA 3APQA 1FMD1 4JHTA 4UFIA 1MZ5A 5D8AA 2K9PA 2I2SA 2IH1C 1F35A 1NA1C 1PO11 2WQZC 2QQPA 2VQ0A 3WNOA 1UNBA 4RHV2 1DGWX 2OCHA 3T4DA 5IDJA 3GJAA 3PDQA 3J8F1 1XYPA 4CCDA 3MFCA 2ZE5A 4IEWA 4P5HA 3KT7A 1F9KA 5FKBA 1YTFB 1ASJ1 2G9GA 4YM0A 1EN5A 3LA2A 3IZOA 2CTRA 4YPJA 3TNPB 3ZSLA 1QJY2 2P3IA 3K03A 4QT6A 4Q4V1 1XUQA 3MUY1 4N53B 4AW7A 3WNKA 4CDXC 2QNKA 4LFBB 1TEIA 1SLIA 2ARXA 1RUC3 4FPOB 2XVKA 5CMUA 4LF5O 1PMHX 1VF7A 4MSWC 4GWIA 4CXYA 3ENRA 5IT9N 1ZZ7A 4KXRA 4XJ9A 4IE7A 1BGYH 1AB3A 3FUQA 2ZGSA 2JG8B 3EVKA 2I07B 4LF6O 3ACHA 4YWAA 2WWJA 4Y5TA 1YJKA 1NVPB 1IKPA 1H38A 4L87A 4XPVA 1PO21 4KG0A 4IIJA 3RT3C 3CEWA 4JZ2A 2VUDA 1B3QA 3BCWA 2WR9A 3UNPA 4OUEA 5BUVA 3OSDA 1CX4A 5ABJA 2WLPA 5FMOL 3OTOO 5L3GA 1QBZA 1C4RA 4K3AA 2J1AA 4CDWB 1XYOA 4EE2A 1JZ6A 2JEMA 4GH4C 5A3UA 1CAUA 2VD7A 3AG2B 4C1XA 2DN9A 3RYKA 3H3ZA 4Q29A 2LALA 2ENRA 4XDLA 1RUI1 5CISA 1XC6A 3X2QC 1GP4A 4L9BA 1Y43B 4UW5A 1JA8A 4FZ0A 4PQ9A 2AHYA 4FTBA 1OOPA 3CHXA 2JDPA 3TWIA 4PCRA 3WG7B 1NA1B 4XABA 4WVWA 4BIFA 4MVQA 2ATKC 5IVYA 2HBTA 5C8CB 3DKQA 3EMRA 2WLQA 4CE8A 1D5AA 1V6OA 4JC1A 1YRZA 3RYHA 1LUWA 1S0CA 4AAPA 4GUNA 3RYIA 3P32A 4XAAA 1V9U3 5DN2A 2OIEA 2HJFC 2IVJA 3H1WA 1W6MA 3DC6A 2ZGPA 3DYMA 5J2UA 1RXGA 5EPAA 1WAZA 2JDAA 3IB3A 2VUCA 4OMDA 1YNAA 2VWJA 2BP6A 5JR7B 4I9QA 1HXS3 4FFBB 1FKAO 2VWKA 2UXCB 1R3JC 1WA6X 1AR63 4TLFA 3U75A 4PA6A 3O65A 2WLIB 1YQ5A 5C9AA 2VC9A 4JTAB 1Y67A 3ZDVA 1QDOA 1YJ9V 1ULPA 1OHFA 4BIZA 2A7AA 3HR0A 1US3A 4QX0A 5B1AC 5ITZA 4CEYB 3CCUV 4UFJA 5E79Z 3FLPA 2YZ4A 2VMDA 5KAIZ 5KUMA 3F5WC 2BNNA 3WVJA 3NXSA 5HBAA 1QJU2 1YEWA 1D4M1 4TWKA 3K3WA 2R041 1RUG2 3IC9A 4G3YC 1G86A 4LR4A 3U14A 2C9KA 1PVC3 2VGDA 4BB3A 4B7KA 4N53A 4GMP3 4GH4B 2RNBA 2OCCC 3WHTA 1NZCA 2XL9A 1G9DA 5EHDA 4NIDA 2OUHA 3VQYA 1ENVA 4OX9O 1BK0A 1PGW2 2E76B 4YLZA 1XMQO 1VBB2 2P5OA 3OD4A 5A3WA 2E3CA 2IFRA 4UW6A 3W7TA 1ZREA 1UFIA 1EBOA 4ZU5A 3RYRA 2PAMA 3K58A 2JG8A 4E4ZA 2XT9A 3ZM8A 2W92A 4BXSV 1GM8A 5A7OA 1S3JA 5T5PA 5A33A 5SV8A 1V54B 3AL6A 2DFBA 1XXNA 4ZI7A 5JJJB 4DK0A 2AYHA 3ABLC 1AR71 3NW4A 1W03A 1E79G 1HDJA 1W8UA 4B3SO 3VL9A 5A6ZA 5C70A 3I55V 1L3JA 2DBIA 5EBLC 1N33B 3JAWB 1UXZA 4FCAA 3CRQA 3ZFEB 3M2MA 2VOTA 5IJ9A 4AI0A 3GZTB 4OI0A 4N7UA 3P6BA 4E4HA 2YU1A 4FK5C 3MLKA 1AL23 2ODMA 1MEC2 4OI4A 2O8OA 4DUZO 4MSVA 3ZIAG 3S30A 4LF8O 1HB3A 4YZ5A 4RFT0 4BHPA 1W0OA 1EN6A 3T0AA 2Y26A 1I3HA 1ZRRA 4XJ8A 1REEA 1C57A 3UETA 2A71A 1PPJH 3SYOA 1SEFA 4C91A 3WZ1A 1RL3A 4YW3A 5C7GA 1PIV3 1S0VA 1I7FA 3K77A 1O59A 4B3MB 4RA0A 2BTVC 5ISLA 3LFMA 3I3BA 3K79A 1RUC1 1MQTC 4QM8A 3WF4A 2OXBA 3STLC 1EV12 5CFDA 2XOKG 3RI8A 1ULEA 1QOOA 5T54A 1OV9A 1MVQA 5DN6G 4D7TA 5IW0A 1CWPA 2WLIA 3LEIA 1UYYA 5JJNB 4RWUA 2ZX4A 4TN7A 4YZ1A 5A32B 4YVSB 4DR7O 3ZLIA 4OUMA 5CYYA 2WFF2 3J7LA 4M01A 3VV1A 1QHTA 1LENA 1QNYA 5IVFA 3ZFGC 1A6CA 4JI4O 2LS6A 2R49A 3GHMA 3B8MA 4QD2A 1RXFA 1WNSA 1AI4A 4L92A 5BMVB 3B00A 4PDLA 1GWKA 2VOWA 2FDJA 4B3TB 4MYEA 4U2AA 5L7OC 2GUZB 5DXDA 1UY0A 1OSGA 4B1MA 1LHUA 4O7XA 4OI2A 3VBHA 3EXUA 3MHSC 2RS32 3BVOA 4IE0A 1H9WA 4UOJA 1IBMO 3JYCA 1M1KW 4P14A 1K12A 2BZDA 4M3CE 4C0HA 2HH9A 3Q4HB 1V55B 1FAFA 5I8SA 2R16A 4XIOA 5IY5C 2Q8VA 4QKBA 5CU1A 4TQFA 1LOFC 2Q7HA 3GJBA 1RINA 1A78A 5F1RA 1IXMA 1QXJA 4JYBA 5K1PA 1V9U1 1LOCA 2P3JA 1H2KA 4FTEA 4J25A 3ZN5A 1VQ6V 4ITCA 5H9PA 4MTGA 4RGAA 2E7QA 2BTOA 5EIYB 4CPBA 3X29B 2CDPA 3RDIA 2HHHO 1H8VA 5BR8O 4GKYA 1SHWB 2ZM6B 4ZIBA 1HXS1 2ARAA 4QGMA 2Y34A 1AR61 4P9IA 1MG1A 2P3YA 2RDCA 3ZYFA 4CH4A 5FYSA 2SBAA 1VARA 4X89A 4FP3A 1AJOA 5A3MA 3DCQA 5IVEA 1VMFA 2YB7A 4MXVA 4M3CF 5D8AC 3JAWA 1CN1A 1NTKH 2UU8A 5IYZA 2ZCEA 4NTXA 1AXYA 4WVZA 4QPJA 5JWPA 3BUCA 2GTSA 4Q4W3 4FFGA 1CAXA 2X53S 4RYDA 5KWRA 3UKTA 2Q7GA 4LLFA 3J7MA 3ACFA 2JKXA 2FB5A 3ZN6B 1NXMA 1I0HA 2FBEA 4YJ2A 3E97A 1CQ9A 4ATEA 2ZGNA 3BIWE 1C5IA 4FPFA 1N34O 1KECA 1KS4A 1PVC1 1XDCA 1PMJX 4GJZA 1V6JA 4LO5B 2BOJA 2NLRA 3R05A 4ATFA 5L7OB 1RM1C 3MBWA 4IYHA 3RW0A 1REDA 1G7YA 1HRV3 4BE3A 1XRUA 5EJ3A 4KMQA 2CAUA 3CQOA 5A3NA 1EZVH 2HWC3 1YHQV 3BB6A 2TBVA 1XL6A 3QACA 3ABTA 4K0KB 1NT2B 2R72A 1W8FA 5EV7A 1IS6A 2GU9A 4NXMB 2DF7A 4IV1C 3Q8BA 1YVWA 2DWRA 3G4SV 5A3OA 1RJ8A 3POEA 4I3PA 4FOQA 3C8XA 1JYIA 5A3PA 1AP6A 1S55A 5IY5B 5GZGA 4OFGA 4XDKA 2P17A 4PDMA 2RJKA 4EFEA 3Q8AA 1GN6A 4WBBA 3D5OA 3KV5A 2RM23 5KHIA 2K46A 2LGWA 4A4AA 2UUAO 2BRTA 3ZYIB 3T2QA 1RMU3 2H8PC 4NUBA 4QAWA 2F93B 4YHHB 3MAQA 2B8MA 2IXHA 5ABJC 5LASA 3OTFA 4FPLA 4Q2FA 5CB4B 4AI8A 3NWKA 2LW7A 2NQYA 1SMVA 3K0GA 4MTOA 4K7JA 4H7LA 5BMVA 1JOJA 4MUVA 1WGPA 5EWSA 3ZMOA 2ZABA 2GTAA 5LY1A 2GUZA 3BKZA 3E5XA 1ODNA 1RUD2 1I5XA 4JTOA 1QLEC 3MIHA 1K3EA 2V5YA 1XU1A 5TSWA 5AVPA 2QQNA 3ABZA 4XFAA 3POGA 1AL21 2IXKA 1FFTB 1YUDA 3WR0A 4GX0A 1YTFD 1JPXA 2R9IA 3AXDA 4XQWA 2NMNA 3K08A 3CC7V 3N4MA 2VXJA 3AJYA 4IV3A 1OCZC 3PIJA 1C5HA 1QJX3 2WT0A 2ITDC 3B94A 2Y6GA 2VCAA 4Y33A 2Q8EA 1PIV1 3RWRD 4M4PA 3RYCB 5DPNA 2NMOA 3K9AA 4O4LA 4E2QA 5LBBA 3KHBA 4Q20A 1H1AA 2W0XA 2LP7A 1ZZ8A 2ZBJA 4I50A 2CL2A 1YXBA 1F7YA 3MIDA 3DTUB 1I5PA 1UZYA 3CWBH 3D82A 1K92A 2HEPA 2XJQA 5IUQA 1NVPD 3CCQV 4UFLA 4CH5A 2R7EB 2YXHA 4AVTA 4YM3A 1K5QA 4XURA 3MO4A 5FMCA 3QH7A 2R1BA 3C7EA 1X9PA 5IAXA 1X59A 1RUE3 1A3KA 1X50A 4HFSA 3NJZA 1GR3A 3HWJA 5BYNA 4XFHA 1IVSA 4CP9B 2X5IA 3B8NA 4PV1B 1QR9A 3A2FA 2OQ6A 2WZ8A 4IYIA 4RAIA 2GC2A 1K5MA 5FZGA 4XBLA 4GAZA 1W2NA 3JZVA 5JOZA 4LE4A 3DXTA 4KQ7A 4OHWA 2WS92 4I55A 5C6CA 3D3IA 3O9OA 4I0BA 3ZIXA 5T5LA 4XUNA 3WDVA 4HPKA 3F95A 2D3RA 5FO7B 5F3CA 2RMU2 2UUBO 4F4LA 4A5UB 3WY6A 1GZWA 4GLXA 5LBFA 1PM7A 3TAYA 4KBBA 4Y1YA 1UZ0A 5FPUA 1Q8OA 1JOYA 2ZS6B 5EP9A 3GB7C 3HKDA 2BE3A 2V72A 5FZKA 4XUTA 3SH5A 4X8PA 2GP5A 1OCZB 4JGZC 5LCWL 4EZ4A 3USUB 1QY4A 5GALA 4DXTA 2X6CA 3JSLA 1OC1A 2ZX2A 5HCAA 1GICA 4QDSA 2WNUB 2E5LO 4DR1B 3LSQA 4A42A 5GLWA 4RQEA 4AWDA 2P37A 4FTSA 3VZLA 4J1XA 3GWOA 5D5PA 1ALYA 3DXRB 3DEMA 4J80A 4CCNA 2VZOA 4CUBA 1HQWA 5FFOC 4QM9A 1SLTA 3BN6A 4HAMA 4YXWG 4GKJO 1SS3A 4DFSA 2Q5ZA 4S2GA 3ZBHA 1H8TB 1XPWA 4E27A 2B1GA 2VUAA 2C26A 4Q4W1 3WCRA 1ENXA 1PM9A 1RSOB 2HWF3 1VAKA 4EV0A 1NUKA 4HNAB 2PXJA 1C8NA 1U12A 4LKFA 4CU9A 5LHGA 2PGGA 3NVCA 5HFMA 1GWMA 2H6BA 4MV2A 1BBT3 3AG4C 1GTOA 3VN4A 4NHLA 4TOIA 2CH7B 2QWPB 1ZRDA 1DIWA 5FOJB 4FLUA 3ZPOA 3PTYA 4LF7O 4X62B 1IZ3A 4XFCA 1AUYA 4LBEC 2ZD9A 2K2SA 1HRV1 4JYAB 5EBMC 1IBLO 2GAUA 3SQOA 4EKWA 4YFZA 3LSDA 3ZXGA 2HWC1 3NJXA 4LHSA 3KMHA 5LRSA 4IUGA 3WNPA 3D3QA 4AQ6A 2DUQA 4PDVA 1AHSA 3KF5A 4CZSA 2UU9B 3SCFA 1E1QG 1S77D 3HNBM 4N90A 4LF9B 4LFCB 1FXKA 3IWZA 1XMOB 3H1JH 4EWAA 4BMEA 4Z1MG 2CWMA 4NB5A 4B3RB 3QG5A 2OW4A 3CCEV 2FDHA 2P6CA 3K46A 1D4VB 4QPYA 4OPHA 1EAH2 1JYCA 2UXBO 5FYTA 5GONA 1HW7A 2QQMA 2ZA9A 1JYVA 2A5ZA 3IAQA 3N9PA 1ZX3A 2RM21 1OVPA 2JK5C 1UIKA 3B2EE 3UCSC 1BEV2 1RMU1 4E8CA 1H8EG 3I56V 4DXWA 5FZOA 4JI2O 2YBSA 3HVDA 3SGIA 1SBFA 4XEZA 3H9VA 1R1A3 3AP6A 2PLV3 3HPNA 2BFUL 3WG1A 3CSXA 1JCHA 4WFAV 4JYCA 2F1MA 1J5EO 3VBHC 5B3SC 2JDMA 3B3QE 4QPKA 3SEEA 1SFNA 2EJ7A 4H13B 2J7MA 5EJZB 2VNOA 4AI1A 2OPKA 4HKLA 1AXZA 4LR3A 2G9ZA 4CDUC 3EHKA 2PHTA 3VBFA 3H1KH 4I0WB 1YJLA 2J1UA 4X1IA 4YM2A 1YQ2A 4N9IA 3T1MA 1QJX1 3GGLA 4Q4Y2 4LUMA 1H2GA 1QH6A 4OULA 2BU9A 4XYXA 1OD3A 5FJHA 1EYBA 1QJEA 3HQXA 5D5QA 5GM0A 3KLSA 1YI2V 2P1BA 4BQ4A 4ET7A 1W2AX 2F95B 4CA9A 3RJRA 3ZN0A 4BK4A 1QU0A 5H9RA 2YS8A 4LBJA 3BTZA 2IBZH 2XHKA 3KM5A 5DAQA 1VIBA 2PN5A 4G4FA 1S5LZ 3EO6A 1HIXA 1B06A 1ENQA 1Y76A 2AR6A 3AG3B 4P9XA 4XC9A 2BOBC 3DPRB 1HN0A 1BMV1 1R083 4RL7A 4LBNA 2NPIA 4XFIA 4LH7A 4TUYA 1ZRFA 3EFFK 2XUMA 1OF3A 4DUVA 1ZX5A 1YIPA 1OFSA 5JOYA 3NQHA 3AMHA 2KXLA 1YCIA 4AFBA 4PQQA 4YY3O 1DZQA 4S2DA 1RUE1 4QB2A 4BWAA 5KA5A 2WNOA 1IS5A 1PKXA 3VQWA 2WNEA 5J48A 3NR7A 3WB0A 3W7XA 1H8TA 5FY8A 5BNPB 2GH8A 3N9NA 3PVNA 4BPZA 1ZRIA 2E74B 1LULA 1W6NB 3SXWA 3VLBB 5LBEA 3WCSA 1LCLA 2IXIA 3OMAB 2K9ZA 1W2BU 4CCKA 2FHRA 1NQDA 1M57B 4YW7A 2GMPA 4J42A 3FFQA 1DG6A 4K3UA 3CX5F 3MUZ1 1WW4A 5IVBA 3ZKYA 1IX9A 2R063 3QO7A 3WP5A 5FPVA 4KI5M 4HSLA 5JXIA 4Q8LA 3HKEA 1VBA2 5FY1A 4PDWA 5FP8A 1I94B 1RVF3 2YEVB 2MEV2 3ZVXA 4H3WA 1DFQA 2AGSA 3D0SA 4GMP0 1OLMA 4BISA 1WMDA 5KMGA 3FAVB 1AYM2 1UPGA 3R0RA 1WMXA 4LIUA 4I01A 5ANQA 4GWNA 3SYAA 4W6WA 2VXRA 4UUJC 5KA6A 1FD9A 5FNVA 2A1XA 2XAGA 2DQ3A 1HNWB 3MGUA 3LEKA 2CSGA 2CGPA 2RE9A 4DR5B 5A7SA 1LAJA 3BPSA 4CXWA 3FFZA 3BCCH 5J36A 4YRDA 2NLJC 1JVMA 4CCLA 3TNQA 1UOBA 2LGQA 3L70H 3IIAA 4X8AA 2AEYA 3ZDSA 5AVAA 2XAFA 2JDKA 2WJSA 2D93A 2UWAA 3UV9A 1GRJA 3UGFA 1L7LA 3AP5A 2XQXA 1MMMA 2N04A 2EF6A 1O5UA 4WM7B 3IDBB 3PVEA 3SLIA 3U37A 3PVBB 4GZRB 2D3OW 1FV2A 4JDOA 4NE9A 1WW6A 1ZLZA 2D2CB 2WL1A 4LNVA 1O5LA 4FJCC 2BSKB 4IV3C 4Q4X2 2AC1A 2DJVA 1BBT1 1VBE2 4FFIA 4RHV3 4JGYB 2KA3A 5CNAA 4LQRA 5FZ7A 1Y9MA 3QCWA 4BYYA 3JD0A 4X65O 2Y8KA 3SJQC 3KD4A 2QTOA 2JWPA 3VKMA 4GWMA 1SERA 4JV5B 4F7ZA 3R4SA 1QJY3 2FL4A 3JARB 4O4HB 1TQ5A 1Z0HA 2OYZA 3IIIA 1BCCH 1ZUQA 5IVVA 3IMMA 3WF0A 3ETDA 1CPMA 2QKSA 2JGDB 2JS5A 1VRBA 1GBGA 5H9CA 1VBC1 1CXZB 5KBFA 2VZPA 1BSMA 4CS4A 2RCVA 1XJAA 2JVDA 1EUTA 1SKVA 2KQXA 4QU1A 1BXHA 2MW2B 2JDNA 2DDUA 2W0FC 3ZHTA 1ORQC 2X5IC 2MPFA 2XB6C 4DV6B 4P30A 1K7DA 1R1A1 4N7IA 1N36O 2PLV1 3FBMA 1B6QA 5BNPA 4DMIA 4DR3O 1UU5A 1UY3A 1BZWA 4N9HA 4KUMA 2VZ3A 1W6NA 3K3NA 5DZGA 4WFEA 2D6MA 4J6GA 4LWSA 4D7SA 3LZZA 5F39A 2ZGMA 4XBFA 4V2VA 1LOAA 2LW1A 1AR1B 4P02B 3POFA 4MH0E 4HG6B 1UY1A 4AEJA 1SBEA 4DEQA 3O7OA 3G7DA 3WB1A 2W5FA 5KC6A 2ZE6A 4YJ3A 4IGGA 1I08A 5B1OA 2YEVA 3WDUA 2ZKNA 4EQVA 4MVTA 4N21A 4DV7O 1F15A 1WB7A 4CCMA 4MXWB 3E22A 5CBFA 1NCQA 1O8SA 2UURA 4A6SA 3LDEA 1JJOA 4JI5B 4JI1B 1SLCA 1JZ8A 1HR0O 4QPWA 5C33A 1D2SA 3H7YA 3WD5A 4R52A 3HBZA 3ILRA 1WW5A 3OEBA 3NMBA 2RS13 1XNTA 2WNVA 3HQRA 3RZMA 1HKDA 2X10A 5FYVA 4Z82A 2LTNA 2PHXA 5IE9A 5FY9A 1AR83 1CVNA 5FZLA 1O3TA 2Z2SB 3SISA 5LATA 1R081 5LP6C 5FY0A 3D3AA 5C4WB 4A7KA 1Q8IA 1LNSA 3BODA 3IMNA 1VAVA 1DZTA 3LNNA 4RQPC 4RGKA 3O1VA 5F8PA 2R072 2KM2A 1H2SB 4W65A 1M06G 1AF9A 3OCPA 4R7CA 1OI6A 3BU0A 2FMLA 3K5NA 1HV1A 1N1SA 3WNXA 1MS9A 1SLAA 3KF3A 1DDLA 2WYSA 4A3XA 4IEOA 2D6NA 2CAVA 1NQTA 5K0UC 1RUF2 4K35A 3NKTA 4E4EA 1UD1A 5EZYB 2V09A 4AL9A 1JH5A 2A6WA 4H0LB 4COYA 3CXHF 4LA2A 4D7YA 4JVAA 3GBFA 5DAPA 2HWD3 3UT0A 5C8YA 2BSKA 3T4ZA 4YGCA 2UXDB 3I2IA 1B35A 2UWBA 2R061 2IWGB 3DECA 4JGYA 1QJU3 5IYCO 2YG0A 1NLSA 1YJNV 3H9AA 4HMZA 2WC2A 2B45X 4UFMA 1CJPA 2IFWA 1XOUA 1FOD2 1RVF1 4IGOA 1VJ2A 4JDNA 2EXHA 3MIBA 1WMEA 1WBLA 2WSUA 4PF5A 5F5AA 3JCIA 1UO9A 4PLMA 4NTWA 5L3FA 1J58A 4X1YB 1HB1A 1XYNA 3JARA 4O4HA 5CG8A 4UFZA 4FI9A 4LBQA 1FXKC 1WD3A 1TUEB 3HNMA 2ZZJA 4E9KA 4JKMA 1AJNA 2R6QA 1MZEA 1SPPA 2C4XA 3POYA 2ETNA 5JUVA 1MS8A 3UKMA 3K48A 1R3IC 2DBNA 1W90A 1GZ9A 3OGVA 4JI6O 4LF5B 4IE5A 1CPNA 3MHHC 1JUHA 4MO3M 3SJBC 2YIDA 4AI3A 3NSTA 1FYUA 4CDQC 2F6BA 3B01A 4E2GA 4AHYA 2QWOB 4A7ZA 4NRPA 1SQ4A 4E2LA 2R9AA 4CZZA 4LK6A 3IGAC 1B04A 3LIGA 3N7MA 4DY3A 3OFNG 2B5UA 4MHUA 5E1AC 3QNEA 2VPVA 1UPSA 2CNAA 4KG8A 4D6TH 1K34A 4M3CB 5DMYA 4BMBA 4X64O 1W9YA 4BQWA 1P7BA 3UK9A 1LTEA 3HQUA 3HB3B 1E5RA 3RMYA 3TJTA 3UM7A 2PAEA 1K42A 2YUAA 3VBFC 4LH6A 1CZSA 5LA6B 3FYIB 2EALA 2ZGKA 4AGRA 1XOYA 4PA7A 3PL0A 3K57A 1SESA 3C7GA 3VDDC 3E89A 3THPA 2F66C 3ABMC 3RZZA 1VQ4V 2I45A 2WIIB 4FOWA 4RHV1 1XNKA 4IEZA 5FYUA 2WZEA 4P9LA 1VBD2 1Z7S2 2F4VB 2DURA 3VOUA 4H2AA 2HWB2 3AK0A 3CJIB 4MVRA 2A6XA 5ANNA 1UU4A 4M00A 4MGTA 2XNDG 4FP2A 4MTXA 1ULGA 3W7WA 1QIQA 4NVPA 2GC1A 1NX9A 2QVSB 2WLLB 5FJKA 2C6SA 1YSCA 2BBVA 2WZR2 3JB8A 1HRI2 4I4TB 4DV0O 2P22C 1GNYA 1FMD2 3NAPC 1FXHA 5FUIA 1EV13 1K4DC 3FX7A 1AVBA 3IT8A 5BY5A 3VBSA 3O1TA 5J98B 4UF0B 2O14A 2VW0A 4AFAA 5E6HA 2VZQA 3R65A 2B39A 2VNGA 4A45A 4D8MA 1QQP3 5AG2A 4Z2WA 3O1OA 4ZHQA 1Q8VA 2WFF3 4CDQB 2QCSB 2DCKA 3E5UA 1O3QA 1MZFA 2J22A 4Q4V2 1QXPA 1M90W 4Y24A 1ND3A 1U0AA 4BIUA 3N9QA 3HMYA 3OYWB 1SFYA 2QM4A 1KEXA 4LTAA 3T1HO 4E2SA 3S57A 2P06A 2DCYA 2XQRA 4MGSA 4H14A 2Q68A 5A3TA 2E7AA 4DW1A 4TTGA 2Q7EA 4FAGA 4UCTA 3GZEA 5HCHA 2EIEA 4ZXEA 5CA1B 1WA4A 2KG7B 3Q9OA 2HR3A 1YJWV 1OKQA 1V9PA 2XOMA 4XZPA 2LFSA 4L8JA 5E88A 1ND2A 2RS33 1JX9A 3ETEA 4FLYA 4NRMA 4GX5A 1PO22 2OTLV 1N3PA 5DAVA 3O0VA 1JZ4A 4IERA 1R093 3F7VC 3OGRA 3VDDB 2OTJV 1WCSA 4RS5C 2W2IA 4TWTA 3VZJA 5I93A 4OX9B 4DV2O 3ASNB 5A6YA 1V6LA 2RS11 1ZVFA 2PZSA 5IVCA 3ORJA 1O8PA 1AR81 3I59A 1OZ0A 3DL3A 5CBHA 1NOVA 4K8ZA 2GALA 1ZL8A 4OHYA 3W7SA 4CTEA 5EK0A 1VB2A 3KV6A 4CEWA 4WZFA 5H9QA 3POJA 3LCPA 3T09A 2Y48A 5LXTB 2PY5A 1RUI2 2XHNA 4NOTA 2BGCA 4WBNB 1IPSA 4P2ZA 1SQGA 1H4GA 4URAA 1FYJA 3J7AU 3VD5A 4QPGB 2RJLA 3NAPB 4M3CA 3NRUA 3W5NA 3PUHA 4XF1A 4R6ZA 2WQ4A 1U5IA 2X6BA 5FZBA 1YFWA 3U4SA 4MT8A 3ABKC 2YXSA 3OBRA 1P4RA 5CFCB 1XILA 4MGYE 4X88A 4LFBO 2HWD1 3OY8B 2YGMA 3VBOB 5BNOA 2XJPA 4Z07A 4Y1XA 3GF6A 1CONA 5LGNA 4PJ0Z 2PHLA 3HN1A 3OD0A 1TGOA 3ZS8C 1QJU1 4HZFA 5FV3A 1VP7A 3SNMA 2YSUB 2WSVA 3CJIA 3KV4A 3CRAA 5L9BA 4KWJA 2LQTA 1WN7A 2AZ2A 4RUFA 4MGIE 1K45A 3K4AA 5E16A 1F2NA 1PGW1 1AILA 3ILFA 4EB6B 1FT9A 4FM0A 1YFXA 4EWDA 2OQ7A 5FZMA 1S2BA 1BVP1 2VH9A 4YVWC 2A6YA 1LHWA 4QIWF 2OVUA 5LYJA 5IWAB 4FLZA 1FFXA 4JHZA 4RS5B 3T0DA 3JALA 1HW5A 1D4M2 1M9NA 3WV6A 3K5MA 2W1SA 2VS0A 1JN2P 2R042 1NAEA 2GMEA 4WZCA 5A7WB 3OPZA 4CBCA 1JW6A 4IL7A 2KKWA 4GX1A 4DR7B 3URFA 3P1IA 1KITA 3BYWA 2X8KA 4SBVA 5GJ6A 4JI4B 3BALA 4JAAA 4X9QA 4KL1A 4GWJA 2VW2A 5LHHA 5F3IA 2BNMA 1ONAA 3WQ0A 4TZDA 2ZGUA 2QGNA 1DBNA 1GANA 1QJZA 5EC2C 4HONA 2KR2A 3ECQA 1W9TA 3JAMN 4HXCA 2KG7A 1YDXA 4GALA 5F6LB 1UX6A 4XUQA 1RUD3 1ZBA2 1C8M2 1JU3A 4B08A 3NJVA 3WNNA 1KDMA 2DV9A 2XJUA 4DRRA 1NCQC 1IBMB 3G6EV 3ZO0B 4I5SA 4D6SA 4W6YA 2ZOEB 3ASOC 3TYJA 3E6BA 5A6XA 2EIGA 1HDKA 1W0NA 1YLLA 5FP7A 5GZEA 1WJZA 2WNVC 2XAHA 1AR72 3PVOA 5DG1A 4PLOA 2HVJC 3FKSG 5IATA 3ZXLA 3IDAA 3CZUA 5ERLA 3H8OA 3N9LA 4LK7A 2JG9A 4KGQA 4UVBA 5FZFA 4DUYO 1Z78A 3MHZA 1ZZCA 3WDXA 1EV11 1SQVH 4Y1ZA 3MF6A 1K97A 1G6UA 2DYSC 2C24A 3KKYA 4PIXA 5LXTA 4PT6A 4NROA 2OUJA 4AFCA 4FLWA 3HD8B 1US6A 5EJ1B 1QQP1 4YYOA 3F5TA 4QPGA 1CIWA 1CIYA 3SPIA 2UXXA 1FPN2 4UBHA 1H4HA 4I0XA 2Y4UA 1BVVA 1JZ7A 2Z79A 3L73H 4JASA 4H44B 2GSMB 3BOPA 4YVWB 3CJHA 1E57A 5K9YA 2W46A 2Y6LA 3CRMA 2LROA 3PJYA 4UCOA 3DC5A 3C7FA 5CFCA 4LO8A 1SQQH 4LO4B 3MV11 4QX2A 1B35C 1DCSA 3SJAC 2XH6A 3OY8A 4OI1A 2Y6HA 3VBOA 1UOJA 5DABA 3KG2A 1UU6A 4KU8A 2BTQB 4DINB 1GFF2 1Q8PA 1UIJA 2VMEA 4YGDA 4X66O 1EZJA 3W21A 1URXA 2QZ3A 2XJSA 4MVMA 2VR4A 1F4HA 1W6PA 1XE0A 3I2KA 3GDBA 2RS31 4YM1A 3VBRB 5CVRA 3BAAA 5FQ0B 2R0HA 2IU0A 1MVEA 2CWSA 1R091 1S72V 1UMIA 4NXNO 1XU2A 3I5DA 4D6RA 2RMU3 1AXKA 4WM8C 3JD72 5T5OA 3HN3A 3ZIWA 1SC5B 3AP7A 3BVCA 1R6NA 1N33O 2UUCB 1MOFA 2YV8A 5JI9A 5JR2A 5JVVA 4JPRA 5FLIA 5CKNA 4DR6O 5LRRA 1S0DA 1Q6HA 3RWNA 2RHPA 2CGOA 2VQEB 1Z5WA 5A7WA 5IK8A 2G38A 2UUAB 3JASB 4DS0A 2JDYA 3HOBA 1XI1A 2IJHA 2RR12 2Z0AA 4NKGB 2Q1ZB 4QQPA 1W04A 3L72H 2JE9A 5JCOC 5FREA 3ZRVA 1NH2B 4N43A 4QHBA 3KS7A 2CK3G 4GKXA 2GMMA 3OEHG 5FIXA 4FPKA 1XNQO 1N4CA 2GNTA 5FZ4A 2JXAA 3SYPA 4XUPA 1BZKA 4NPLA 2FDGA 2IVIB 4ES8A 2VBPA 3AG1B 1YIFA 1HX6A 3LF7A 5DAXA 1LB2A 4BCUA 4YGEA 1PX4A 4QXHA 1QNWA 5LA0A 5LGUA 4HL0A 1HXS2 3R6SA 5FPXA 1UZWA 3BFRA 3MIGA 4D94A 5B1NA 4NIAA 3ZMUA 2H0VA 1U5XA 2DYRB 4XDOA 3N2GA 5DDJ3 3VBUC 3LQCA 1OQDA 4QHZA 2WDBA 2B9UA 1XE7A 3IAPA 3NV4A 2JJ6A 1F23A 4COUA 1V00A 1MS5A 2EIKC 3OEAA 5LMNO 3VUOA 3WB2A 4KP4A 3KT4A 4QQOA 2YY1A 3JD1A 2VQUA 3CF6E 2N05A 1VMGA 3G80A 4LBOA 2JECA 4HBNA 4Y22B 1PK6B 3NNLA 1I1EA 3AMMA 5EZWA 3CBNA 2ZGOA 1XL4A 3GCXA 5JXGA 1VF5B 4R4XA 2JDZA 3JD2A 1J3RA 1EAH3 1TME1 3TETA 3KHCA 4MHRA 2QDRA 2ORZA 2XJTA 1GU3A 1ND3C 1BEV3 2VMIA 1WWYA 4QX3A 1IOAA 1OH3A 2AZ5A 4LO7A 4UFHA 4C8DA 4WF9V 3DYOA 3MV01 4Y5Z0 4QJFB 2XJVA 4BQYA 2ZGRA 1GN3A 3ZR6A 1X82A 4XCAA 4Q27A 1EPWA 2BTQA 3A0RA 4FMTA 4P9GA 2OS2A 4FPEA 1KQRA 4B3NA 2PUSA 3U4XA 2B46X 4WVMA 1ND2C 4UI9L 1VQNV 1RUD1 3HR9A 4PLNA 2P4VA 1ZZ6A 2YFZA 5FY7A 2D7FA 1R3KC 4QQHA 4GCZA 2CDYA 2LFRA 1IG0A 1AZDA 5FQ0A 2ZM6O 2FTKA 3IDCB 4UCSA 2ZKOA 4CS2A 2N7GA 2JS3A 2DVFA 1H2NA 5E89A 3ZRWA 4Q4Y3 3JB4C 1M93A 3K5OA 3MLJA 3N2KA 3R4UA 1OCRC 5FZCA 4LITA 2ZNJA 4QHOA 2VZSA 1VB4A 3Q8CA 4P08A 2Y0IA 3TCUA 4RR3A 4CEWC 2P4EA 1DGRA 3THOA 2P4KA 4GD4A 3CDZB 3VBUB 4X6RB 4P9OA 1LOEA 1QHDA 4WFHA 1OH4A 2QQLA 3ATGA 2R30A 2CTPA 2VMHA 3HKCA 1O4ZA 5FUPA 4CRQA 1NTZH 4UT5A 3JASA 1EY2A 2WABA 5JZGB 4C7UA 3B5LB 4O4JA 4HANA 3TOJA 1ENRA 5JSPA 1LGNA 2A3YA 3G6BA 1XNBA 4LKSA 2CTQA 5BNNA 3AK3A 2W1QA 3A0HZ 1ZNPA 4Q0QA 2FCUA 4TV9B 4X1KB 3OUIA 2PYLA 1PIV2 5BNOC 1P84F 4GKJB 3IPVB 4G2KA 4O61A 4MADA 1K3IA 4K0KO 1PGL2 2IJKA 5FMOS 5HI0A 3H1MA 4NXMO 1Y74A 4Q0UA 1J95A 3O1RA 1SLLA 1S0JA 1NYWA 1H6YA 3AX4A 5I0SA 2Z3YA 1QKQA 1KRIA 1RUOA 4ZKIA 4XDQA 2XL7A 3OOXA 2CAZC 5J2TA 1SDWA 2QQJA 1VBA3 5BZBA 4TSFG 1AR92 4RN5A 4X20A 2RMU1 1OLQA 4YHHO 4LNUB 5H2FZ 5J09A 1RPRA 5A2QN 3QO5A 4LOTA 3T3YA 3LSUA 2D97A 2F17A 2ZEZA 3FD9A 3GVMA 5GZCA 3DSQA 1AJKA 5LBQA 2LO1A 2BOCC 1BLZA 3ZJZA 2ZMLA 1PK6A 3OR6C 2EJRA 4XHXA 2G19A 3RN4A 5HV4A 2QM7A 4QPIC 1OCRB 1QOSA 3BA8A 1LU1A 2OYQA 4MGZE 3TB0A 5JIUA 5EYPA 3TEYA 4AFDA 1WLEA 4CP2A 4JI2B 1OQEA 1ZM1A 3ACIA 3H01A 1PNGA 5KHHA 3SDLA 4XJAA 3J26N 1RGSA 2GN7A 4NRQA 3ZSMA 5JDBA 3ACGA 1W0PA 2Y4TA 2Y69C 2TUNA 4JKKA 3VHOA 5CB7A 2DFCA 5JH7B 2QWNB 1W6OA 3KZ4C 2ZXWC 2ATFA 3OGJA 4U7OA 1R6KA 1NXD1 4CVUA 1D0HA 4CDXB 3G67A 2OWOA 2EAAA 4I02A 4KWUA 3JU9A 3B4SA 3Q8FA 2PA7A 3THCA 5DDJ1 4AQ2A 3UKVA 2CDOA 1GP6A 2VM9A 2P34A 1TVKB 3RYPA 1YF2A 3VZKA 4JKLA 5J96B 4O65A 1V6KA 4PA4A 5FPBA 2DYCA 1W6QB 2W94A 1S1AA 4CCJA 5I91A 3D36A 1W0KG 4HYOA 2YUEA 4OCTA 3ZXFA 2R0FA 3OUFA 5IVJA 1B09A 1WCDJ 2NN8A 4TXWA 1CAWB 2VVDA 3C7HA 3TGUH 1CPYA 4Z8BA 1VEWA 1EAH1 3PMSA 5JZGA 4AOCA 5F3GA 3JATB 1BHGA 4GKKO 5KXEA 4R8HA 3JCZA 4PIYA 1BEV1 4QKNA 1OJHA 4YY3B 2CGNA 1N3OA 2ZE7A 4R9BA 4TV9A 1MS0A 3CCMV 5FYIA 4F6RB 1MR5A 2GZWA 4M0NA 1HRV2 2W68A 1QGLA 1W2TA 3FLRA 2HWC2 3RRDA 3X2QB 1P8JA 1CP9A 2HEYF 2V1DA 1AI7A 3E8GA 3FB7C 3M4FA 2HLDG 2KB1A 2WO2A 3E86A 4IGQA 4EWEA 2IC1A 3ES4A 4IEVA 1JYXA 1L8DA 1A32A 5FL7G 2P67A 1YWKA 3E5QA 5CADA 4K1ZA 4IE4A 3VKNA 3OF1A 1JHNA 3K51A 2V4AA 1QH7A 4GULA 4Q4Y1 3S3WA 2AEZA 2WWUA 3V0AB 2EXIA 1ZZ9A 2Y69B 3WF1A 4J7KA 3L9JT 2FCVA 3H7JA 2ZXWB 2YI9A 3L71H 3AG7A 2PHFA 1AYN3 4CDWA 1LODA 5F32A 4GZ9A 4FAHA 2YU2A 4DUWA 5LBCA 3M8AA 2QR4A 3SCHA 4UYBA 2YC0A 4LC1A 2E26A 2EXJA 1H6XA 1S2KA 2KD7A 4LHKA 2YBKA 1RC6A 2PYJA 1CESA 5B1AB 5KUKA 1THZA 3TRSB 1QU7A 3B9IA 4N43C 1VE0A 3I2OA 3RZLA 1NA1A 2BUKA 3M7MX 1QJX2 2R073 2LUWA 1TAEA 2YIBD 1SCSA 4PELA 1RHI3 1OCOC 1HQNA 5C8CA 4MTFA 2XVLA 4Y4RA 1SZXA 3THDA 4O9GA 4YIOA 5FP4A 4UCRA 1YI7A 1ZA4A 3BI3A 4AEDC 2F43G 4RFRB 1TA8A 4E4DX 5CA3A 1I6XA 1SBDA 2AXTZ 3CZJA 1EM1A 4FFHA 3LPFA 4LFCO 1V70A 2OCCB 3OMIB 1BS3A 3FMGA 4FFBA 1P49A 2XVGA 1BMV2 4FFFA 2J42A 3MF9A 2QKCA 2HEWF 3UO2A 2VL4A 5C71A 5FDBA 2QDOA 1VBA1 2D6OX 5IJ0B 1VMJA 3POIA 5IAVA 2HEVF 1FOD3 2JB8A 3MPBA 2O8QA 4X65B 1PM4A 5CA0B 2WO1A 5GLZA 2FDFA 1FV3A 1NCRC 4DO0A 4UWDA 1LR1A 4FLVA 4CEYA 4V2WA 2WLNA 3HKBB 4FVVA 1TUBB 1DYOA 4B29A 4CCEA 2WT2A 3AYDA 1LEMA 5JPMB 3LA3A 1H2LA 1PP9H 1Y6XA 3ABLB 3OR7C 3JATA 2LM3A 5A7NA 1ACCA 4AVAA 3K75B 1WLDA 3KVAA 4MW3A 1GLHA 4DOUA 3RYFB 5JVDB 3BHPA 2HLEA 4GH4A 5CBGA 1A34A 4D69A 5FCCA 1GZCA 2VCBA 1DGWA 1NH2D 4L99A 1N36B 3AC0A 3ZFFC 1K8AW 3BPZA 4DR3B 4OZOA 2D98A 4L0PA 3ML0A 1E1RG 2Z69A 1ZWIC 2XKOA 1R6TA 3K2OA 2H3OA 3IFXA 2VG9A 2JX9A 3GHNA 1GN4A 3KCXA 3E2EA 1E5SA 5LA9A 4WVVA 2AREA 1CGPA 1ZSPA 2IU3A 3IJ4A 4ZXKA 3ZYGA 3I3MA 1YO8A 4ZU4A 4V1PA 2UWCA 1IBKB 4TV8B 5A3LA 3OT7A 4YG6A 2VQFB 5AFEA 1H9PA 4TSVA 3T08A 1MQTB 3ES1A 4ZS3A 1BJQA 1WP8A 3G6JB 1VBD3 1Z7S3 3BRCA 4QQLA 5GLUA 4OZXA 4DV7B 3WG3A 4DEVA 2EIJC 5C3PA 2EILC 4RR3C 2R32A 2H0BA 5K7PA 1WW7A 2HBUA 3FWEA 3ZFEA 2JJ2G 1V6MA 4JX0A 2VAUA 2UYBA 4ZZ5A 2WZR3 5F5CA 4J41A 3DN7A 3ZFGB 5EIBC 2EZPA 5DZFA 1RB8G 3FJSA 4LT5A 4DYLA 2OZ6A 2VZUA 5BNNC 4GJYA 3ZHQA 4AK3A 1BT8A 1UYPA 5FXWA 1J3PA 3VDBA 3EQEA 4JQRA 1NS1A 3AKPA 4AF9A 5GW7A 4I2OA 5HCFA 5GTHZ 1KYOF 4GMP1 4J10A 1I94O 3FHIB 1NY71 3LD8A 2P90A 2ZHLA 2NN4A 4ICGA 4RD7A 2WAAA 4XF9A 4IHJB 2VQAA 2WPDG 5F3EA 2M6YA 1UKRA 1SQFA 1R3LC 1XBFA 2PTMA 1K33A 1RIRA 3FX3A 4GB32 4LBKA 1O91A 3VGIA 3ZYBA 3OUHA 2HWE3 2JICA 2VOKA 1VBC2 2J1VA 1HNWO 4FPHA 5FO8B 1C1FA 5FPRA 1RUJ2 4WV8A 1KB9F 3E8BA 5A32A 1EP0A 1Q86W 4YVSA 5B66Z 3O5SA 3OGGA 5FYMA 1DHKB 3CEIA 2HFEC 4PBOA 1N47A 3L9DA 3ETPA 5JOXA 1GQHA 3CP1A 5JIAA 3TBDA 5CA0A 3GALA 1CAVB 5DG2A 1R1A2 5LOVB 1KP3A 4YGBA 3QF7A 2J1TA 4CP0A 1GOGA 5FYCA 4AGVA 2IXCA 1YQ8A 2WLMA 1TUBA 1AYN1 3M3IA 3WNLA 5I0RA 2VRZA 3RBZA 2PHWA 1XQNA 4LUKA 3QVNA 3OW2U 1AJPA 4LXLA 1SZBA 2TNFA 4XF4A 2E75B 4FPPA 3M1HA 2ZX3A 2EILB 4BDVB 2ADPA 1JZ2A 5D8AB 1Q7YW 1OOPC 4ASUG 2RG4A 4ZKTB 3HT2A 3SPJA 2E7TA 2JDHA 3SYCA 3VD4A 3Q4HA 5GLVA 3RYFA 1R64A 1H1MA 1COV3 1UF2C 5FK7A 4S2FA 2ID4A 1GWLA 2R071 1RHI1 2X7RB 4Y3OA 2N74A 2L35A 1NBMG 4W4LA 1HNZO 2Q0AA 2EICA 4X64B 4W4ZA 4JV5O 3O12A 3B93A 1OHHG 3H0OA 1DQ1A 2VO5A 1W9WA 1PGSA 5JLVA 3N3HA 2DOSA 2WFPA 4BLJA 3GM8A 4AQYB 4I7ZB 3H1LH 4LJHA 2Q73A 1N0NA 5KC5A 4XFFA 2WWWA 1RM1B 2Z42A 2J1EA 4GXLA 5C9AC 4H33A 2QJVA 3H8UA 4TV8A 4SLIA 2F4PA 4K6BA 1XNCA 4UW3A 3I2HA 4YG0A 3OPTA 2YGLA 1X8MA 5FY4A 1HN1A 3ROUA 4IV1B 1FOD1 1POV0 3SPCA 4DV6O 1VAMA 3STZC 4KHPO 1W8HA 3JBG2 2ZAHA 3TK1A 3D6EA 1DQ4A 3D36C 3J7HA 4R8CA 2V7QG 4LHLA 1L1FA 1SQPH 1W9SA 4GQ7A 1Q5OA 2XBO2 1IQAA 1US2A 2NR5A 1KJLA 5L9VA 4OHXA 4DV0B 3ZN6A 5CKQA 2W6JG 2JD4A 5KHKA 2RV9A 3ZMNA 2J1RA 1O7FA 5ABJB 3V0BB 4CYDA 3SKVA 1VQOV 3C90A 1AI6A 2D6PA 5EYXA 1ZTEA 2R062 2HYXA 2WUHA 4N53C 4I09A 1LR5A 1D4M3 5G04L 5FYHA 1BQZA 4KFMA 1HNXB 2PHUA 2CTVA 4Q0SA 5L7OA 3CJXA 1RVF2 1LJ7A 4UCUA 4AQSA 4IHJA 1QLEB 5IK7A 1VF6A 1S0IA 2Z4FA 3N35A 4F6EA 4EROA 1S0BA 1Q3EA 4JI1O 4JI5O 1OOPB 3M99B 3ZSKA 2JG8C 5FPZA 3AZXA 3T1HB 1G9FA 2AZ0A 1FJGB 3U78A 2VZTA 1RFYA 2DVAA 2ZACA 3RYHB 4NJ4A 2JGUA 3EXAA 3RPQA 3WLUA 4IEPA 3RYIB 4L2NA 4N8MA 4LEJA 2YC4A 1LOFA 1PVXA 3PUQA 4HVRA 3N36A 1POQA 3U07A 1ULCA 1W6MB 1ZBA3 1C8M3 5J2UB 1ULFA 1S0EA 5GLTA 1ZAUA 1N8RW 3T2OA 3V64A 5JMCA 1VBD1 1CAVA 2CTWA 1Z7S1 4XFGA 4BQXA 4ZPIA 1IPKA 4QB1A 5CB4A 1AROP 4W6XA 3UESA 1O3SA 4BQ3A 4G28B 2W1UA 1YIJV 1F4NA 3W9AA 1W8TA 3VD7A 3LA7A 4P9JA 1N0JA 5SV5A 2JIGA 4YG3A 3CRRA 2QSAA 5JJEB 2EZOA 4Q5OA 4RGGA 3AG2C 1ODMA 3WINE 4J7JA 2RS52 3NV1A 4ZONA 4BJ0A 2WZR1 4A7YA 3OUJA 3T1YB 3AKTA 1LESA 3LE0A 2ZPXA 5ITZB 3W58A 4DRVA 4CUGA 1GH6A 3AVSA 2XHBA 4IEXA 4JI3O 2UXDO 4AG4A 3WG7C 1A8DA 1UYXA 4XTMA 5C8CC 2WWSA 4OHZA 5LY2A 3FHAA 4DXSA 5TISZ 2D5FA 2IXJA 4IDZA 5FLHA 3P3PA 2PAKA 3V56A 1DTOA 3RYCA 1FPN3 4PDRA 2D40A 3WFVA 3UO3A 1WPXA 2WRAA 1VRH2 2PYTA 5T5JA 2BFUS 4Q1PA 1OF4A 5CFDC 4XW3A 4MW8A 3H50A 3KQRA 4DR4B 4Z92B 4QE9A 5GZDA 4FPGA 2EINC 4DNYA 1GK9A 2ES3A 2XUEA 3WW1A 3I54A 2HWE1 1JOPA 1Q6IA 4JYYA 5DQ0A 3JD4A 2VOVA 5HFLA 1EPZA 3AK2A 3ZYPA 2YHJA 3ELNA 1W59A 4IV1A 1TZOA 4DXZA 2DW4A 2W1WA 4CEYC 2ZZQA 1LUVA 3ZHSA 3ON7A 3B7MA 1MABG 4DV3B 1R1ZA 1BCXA 4JGZB 1WCQA 4CP9A 5A33B 3B02A 2Q69A 3RSJA 5L36A 4JQTA 3VD9A 3UYJA 3H1HH 5EXOA 5B2GB 3OGIB 1AR4A 4ZI7B 3IDEA 3JD73 3WUDA 1NJIW 4PIZA 4JI0O 4F83A 1WB8A 1FNZA 2QUOA 4DV5B 4XXAA 3ZKUA 2YROA 3ZHRA 3V0BA 1D7PM 4QQ2A 2K1EA 4CC6A 3LGRA 4DV4O 1N1YA 5IJ9B 1TMF2 4BW9A 2B9VA 4BK5A 1COV1 3GNEA 4UV9A 1L0LH 3J80N 3K59A 4ISQA 1UW8A 2ZEYA 3VKLA 1S5JA 4C0BA 2F4VO 2UY9A 1TNFA 3AXEA 2RR13 1X7NA 4IW3A 5A7PA 2OIGA 4XQDA 4XF3A 4LORA 1ENSA 4IE6A 2A0LA 4XZUG 1S4CA 3AG4B 3UGGA 4ARXA 2RS12 5I0DA 3USUA 5LB6A 3S3XA 1G9BA 2VQTA 2CY6A 1DQ5A 1V54C 1AR82 1QOTA 5FY5A 4AHZA 2H6CA 2XWJB 1HP8A 2PI5A 2WNUA 1G8MA 1F5JA 3AYEA 1LRHA 5CFDB 2HG5C 4F3JA 4MOAA 1JQ0A 5KHJA 3ABUA 1SDDB 3DXRA 2JB4A 5BXXA 5A6QA 2O0OA 2EINB 4EFBA 1VMHA 2W87A 3T4VA 3ZFEC 4XOGA 1YI9A 3ZXJA 2WAMA 2NM1A 4XQ4A 4JRLA 3M3OA 3MLLA 3MDSA 4UAPA 4JCKA 5LL6Y 4DY5A 1RSOA 4URTA 2A7WA 1KBHA 5EC1C 2RMKB 1XNRB 3DKWA 5J9PC 3E6CC 4OGQB 4HNAA 1KMIZ 3ZN1A 2HWD2 3T1CA 2YFUA 5JMOA 1Y9QA 4DUYB 4DK1A 2ERFA 4CH6A 1S76D 1V6IA 4HK9A 2ZKLA 4NWWA 2CH7A 5FR3A 3BOWA 2DTYA 3I97A 3SPHA 1X8EA 4QWNA 4BWOA 1MACA 4D3WA 4NYKA 4HKWA 1AP5A 3VBHB 4EN8B 4DB5A 5B3SB 2Y0PA 4RQFA 4IQPA 1DGLA 4K9SA 2DMXA 5LMUO 2D6LX 3RZGA 3L2YA 4AEMA 1VPHA 5FZ3A 3RGBA 1NG0A 4FO9A 5JPNB 4AGGA 4CDUB 2MK3A 3KB5A 2JRIA 2A6VA 3VKFC 2QZ2A 3CC2V 3DF0A 1CJDA 3CCSV 2VMGA 4YVSC 4WFFA 1G6NA 3VB9A 3IN9A 3AFKA 5K4LA 1Y66A 4X66B 3JXSA 5FKCA 1JS9A 5KXDA 3R4DB 1Q90D 1AJQA 1ZBA1 1C8M1 5APAA 4MGKE 4COZA 2BCCH 5C3QA 4FFKA 4NIHA 4O2AB 1O4YA 5FBJA 4JGZA 2QQKA 3W20A 3FE5A 4DV1O 1RUH3 3CE2A 3JCUZ 3J4UH 4NXNB 1F5FA 3PJSK 4XXPA 3ZX6A 3W59A 3AKSA 4AILC 5A1AA 3CKHA 3WF3A 3PN1A 1JHJA 4CH3A 2HWF1 1KP2A 3M3QA 4LKEA 3IKWA 4AVCA 5IYZB 2JE8A 2RQ6A 5FBZA 3KV9A 1V55C 4D0QA 5LEJA 4DR6B 2JIZG 4DR2O 4UBGA 1CAXB 2WBKA 5B4XA 2W52A 2LRPA 4YZ4A 3BU7A 1YQ6A 3ZYHA 5KXBA 3VD3A 4YJ2B 3IAYA 3AMNA 1FPN1 3SKJE 3I2DA 1PNFA 1I5YA 3KWVA 1N32B 3B9CA 1NE4A 2WINB 1PL0A 1UOGA 4AR2A 2XGXA 3AZYA 4OMCA 4Y5SA 1XNQB 3WQ7A 1JFFB 3RVHA 3DPRA 3FB5C 3K4ZA 1Y4WA 2VCMA 2O1QA 1PD3A 3EBRA 3WW2A 3KCCA 1UMHA 5FXVA 3CNAA 3OGSA 1OCCC 2DQ0A 5CBLA 3ETGA 5IWAO 3MIFA 1TG7A 4AYUA 4ZS2A 4ZBMA 2XLFA 2YXYA 1WLTA 4E8DA 4NMIA 4FIPC 1YITV 5FYZA 1NTMH 1QQP2 1MPXA 3CMAV 5L3CA 2Q9LA 3CU7A 4FLXA 4UVAA 1AR93 1HWYA 1GNZA 3O1SA 4CU6A 1K73W 1K5MC 5A1LA 3VQVA 5JSOA 5IYBO 3JD71 3LNMB 4XDJA 4BIOA 1XB9A 3NO8A 3OG2A 4EN0A 2RJZA 4A44A 2ARBA 1JOBA 2OA2A 4FPJA 2W3JA 2OT5A 5LMNB 4QB6A 1OFNA 2BERA 2GNMA 1CX1A 3S5AA 2ZT9B 1ZBE2 2DCTA 2EIDA 5B5EZ 1JBCA 1VF6C 5FZ9A 4BQ5A 1P7GA 4LFAB 5FP9A 5EIBD 2YPDA 1XBLA 4AHCA 3C7OA 1R092 1W8ZA 2E6VA 2RR11 3FAVA 5B4NA 2Z5UA 2VZRA 4LBLA 3E6DA 1IG3A 4CDUA 3LEGA 2ZGQA 1DQ2A 4ARYA 2IZWA 4IV3B 1IKQA 5BNQA 2DVDA 1BL8A 5BXZA 2Y6JA 1SETA 4BR6A 1VQPV 5HV0A 3ZX7A 3T0BA 5FZDA 5C3OA 3GZUC 2ARCA 4Q6GA 1KKDA 1RYYA 4O4LB 5J3UA 4U7NA 1KJRA 4EN6B 1EN4A 5KR7A 1LGBA 3DGEA 4PF1A 2PQSA 2ZCWA 3TN92 4DQAA 3ZOIA 3VZNA 4PI0A 4I50B 4O2AA 1GNHA 4QXKA 3U1XA 1M4UA 1TVGA 4HSJA 1YC61 1M56C 3G71V 5DZEA 4FQZA 3WX5A 2WO7A 5LHIA 1G1XB 2Y0OA 2YC2A 3ZSJA 3SC7X 3NNJA 1OCCB 1X4TA 4WM7A 3GCWA 4EN9B 4JDMA 3A4UA 3WUCA 2DCZA 3B77A 3I3QA 2Z5WA 2EBOA 3O0XA 2WLKA 3ZR5A 3ASIA 5IYDO 4JAVA 3KGLA 3K9SA 2X5IB 3A8TA 4QKFA 4U36A 3V65A 2W91A 4K21A 4HN1A 3ZMSA 2C2AA 4J7ZA 1WPBA 5KHGA 1ZA7A 1NU1H 5FP3A 1OT5A 1KS5A 1W99A 2QTWB 1K5MB 2PF4E 4ABMA 4META 4J9ZB 2ZX1A 2Y33A 1UXXX 1PNMA 1AX0A 2E63A 4OXSA 3DXUA 1RUG3 3WG2A 4I55B 3CXCU 3MYXA 2VE1A 3J7NA 1VQMV 5EFUA 1M5IA 4HPKB 3CLPA 2OZJA 4TLGA 4NHYA 1GZWB 2QA4V 1JFFA 2GC3A 2JGDA 4FOVA 3ST7A 1VBB3 5ACA2 4LLOA 4E4SA 2ZGTA 4AE2A 2D3SA 5F5QA 1WMFA 4W50A 1QVGU 3ZN4A 1QR8A 2UUCO 1UQXA 3HKDB 3OPWA 3BY6A 5DUWA 2VZ1A 2DU1A 4LF6B 1KFUL 1KUQA 2AH2A 4LF4O 1TME2 2VQEO 1RUH1 4B4PA 4Q0PA 1C28A 4NAOA 2O57A 1GMGA 1JU4A 2XAQA 5LP6B 4AHXA 2BGOA 3O1PA 3C3VA 3AB0A 5C3RA 4RQPB 4QX8A 4MVSA 1DGSA 4AI9A 3OTOB 1M56B 5FO9B 3KCYA 4MX3A 1FI2A 5BPXA 3LOBA 1FAYA 1BKZA 4YW1A 2A9HA 4HZ3A 1HQLA 5FPAA 4ZY9A 5T52A 3BTYA 1KU9A 1QWRA 2DUOA 3I2FA 4IL6Z 4Q1RA 4M0HA 3CCJV 5K0UB 1MEC3 5FMDA 1QVFU 4BU2A 3VHNA 2QM8A 2BEOA 4LP8A 3C3TA 1NT0A 4MXWA 5DAWA 3FUOA 2A70A 1WKYA 1L7RA 1QJY1 3UGHA 4JI7O 5I0TA 1MA1A 2VVFA 4CP1A 4CUAA 4CC5A 2WNUC 1E5HA 2XJRA 2BJSA 5DM6V 5AC92 1AX1A 4A2UA 2P6HA 3ZMVA 5C4WA 1CR7A 4JI8O 1PGL1 1UAIA 4B8EA 1BHAA 3CCRV 4OVEA 3AZZA 1PO12 1RITA 5FZEA 3JQWA 1FXKB 5FZHA 3BA9A 1OXCA 3J8F2 3AYCA 4IGPA 2G1MA 1QNMA 3GYDA 1H8TC 5GONB 4JGSA 5E1RA 2IJJA 2WA4A 1ASJ2 1AR91 2VZVA 3KSCA 4ASKA 5FZOB 1SA0B 4LA3A 4J9YB 3N9MA 5EZYA 2P5BA 1YXWA 3TXSA 3WEZA 4AXOA 4I30A 4MVZA 2JIJA 2ZXQA 5B1BC 4O2BB 2CE4A 1DYKA 5GTIZ 4PDWC 2QDNA 3K4DA 3E8FA 1UYZA 5A1FA 4JAUA 2MNGA 3SEPA 1UWWA 4GIQA 5FPLA 4GKKB 4YZ3A 5G05L 5KLVH 3DYPA 4DXRA 4BA6A 3RFRA 3I49A 5FXZA 5F2VO 3RMXA 3VHPA 3VBFB 3H3UA 4X1YA 1DQ6A 4G27B 4X1IB 5LZ6A 2OX0A 3W5MA 3CCLV 2B1IA 2EIMC 2PFWA 2Q67A 3ABMB 2UYAA 3AZWA 5CA6A 1J59A 1MS3A 2FZ2A 1XMQB 3MIEA 2M7WA 1VQ5V 1Q8SA 1YFYA 5HXMA 2XDVA 3NNFA 5FK8A 3OBZA 3NNGA 2FYUH 1BHBA 2GNBA 5IK4A 2HVKC 1F4MA 2Y6KA 4KGGA 3SCGA 1Y76B 2DWDC 3PU3A 3RZJA 1JZ5A 1UCXA 1L7QA 4FOYA 2CU5A 1JZ3A 4TUYB 4AEKA 4BW5A 2W39A 2FMDA 4UCVA 5LP6A 2QEXV 4ZOLB 1AR5A 2LJ2A 1DF0A 4OHVA 3RVYA 1YFUA 3S7EA 2W9XA 1OUXA 4ASMB 3EHBB 1K9MW 4ONUA 1NQJA 2X05A 1X9TA 1JYNA 1Y9GA 4NHKA 1W3VA 2VU9A 2VUJA 4RQPA 1AVMA 4B3SB 5HXVA 1COWG 3OBAA 1M4WA 3S6PA 3AZVA 4FLTA 1QDCA 1XNDA 3LFIA 5L19A 5LA6A 4YSFA 1OMIA 3WG4A 3CYOA 1DK1A 2BGPA 1KC8W 4XJWA 3A23A 5K0UA 2YPJA 2JENA 2QKAA 1IS3A 3UL2A 4MS2A 3ETQA 4DUZB 3RWKX 4LF8B 1RUG1 1CZVA 5B1BB 2VOXA 2ZR2A 1D0GA 5DDJ2 3HKEB 2WKKA 3HJRA 4AVVA 4PDWB 2YBPA 3AG3C 2WLLA 4K20A 3S7IA 5LGTA 3DPRC 4PJYA 1DF5A 2GV9A 2E31A 5FZ6A 4ORFA 1QMJA 4FSJA 4I4TA 5C3SA 1VBB1 2Q30A 5KMGB 1R73A 1HJFA 4P9PA 4RSUA 2XMLA 1ROPA 3ZXEA 3RS6A 4GB33 1U97A 3FZ3A 1G4YB 1DU3D 4R4ZA 2XONA 4CPBD 2D6KA 4UF0A 3R66A 4JTNA 2EIMB 1KD7A 5FNVB 1VBC3 1D2QA 4COWA 1RUJ3 5BNPC 4HETA 1C3HA 2ZR3A 1XHZA 4ASLA 1GKFA 4DW0A 2V5DA 1H1IA 1BMFG 2CYFA 3LDBA 4X6QB 1MNGA 4CDQA 1SA0A 1M57C 2B42B 3OYWA 1J1TA 1PNLA 4XHBA 4P5YA 4Z1VA 2FKXA 2Q4PA 3UKNA 4O2BA 1O6UA 1NI8A 4LCUC 3NL1A 1KQSU 3N7KA 2I74A 4NO4A 3OUSA 5CA1A 1UY2A 2ADEA 3SPGA 2DWEC 4L97A 2IXLA 3LAGA 3ZEDA 1MEC1 3VZOA 3ABKB 1OD5A 1VIWB 3OE7G 1WP7A 3NJYA 5I8TA 5IFTA 2BVVA 3AMQA 3WDTA 4R9CA 3MW4A 1BE3H 2UXCO 2A73B 2Q8DA 3VDDA 4PBPA 5BY1A 4DIQA 3MW2A 3GWKC 5FTTC 3CD6V 4FBFA 1C1LA 5CG9A 1QCEA 3CS5A 1VQ9V 1JR9A 3VQXA 5JCTA 4QMAA 3ZRXA 4ZHNA 4PA9A 2YIAA 5F6KA 1UMZA 1UY4A 5DUXA 2VBBA 5FZIA 4EJRA 2C0ZA 2Q1MA 1TNRA 1F51A 3J9SA 3LDKA 3BTXA 2Y60A 2HHHB 3WP4A 3UJOA 5BR8B 1FXZA 4UFKA 1OA4A 3NKGA 4WBNA 3T2MA 2Q1FA 2AUYA 4Y4YA 3J81N 3A0KA 1STMA 4UW4A 2ZE8A 4WM7C 4AFMA 4ZOLA 3NAPA 4ZZ8A 4FPCA 5CKMA 3DV8A 3ZSEA 2WFF1 3I2GA 4CU8A 1O9GA 1UOFA 4HK8A 3JBG3 4R9DA 5LEKA 4GT1A 4RO2A 4G9SB 3VL8A 3AEIA 1JJ2U 2K0GA 2WA3A 2ZDIA 2VECA 2WQ8A 2A06H 2R70A 4JGYC 5LA2A 4J1WA 2XBO3 4Y20B 1RUC2 2GN3A 4Y1UA 2HP8A 5H9SA 3E8HA 4PHZA 4LWSB 4XJUA 3A7QA 5IT6A 5HPOA 2VJXA 3H1IH 2GP3A 4XCBA 3CO2A 3CCVV 1PZ8A 2D3PA 1GO3F 3GZAA 1SQXH 2QFEA 2OPWA 1N1TA 2WS93 3APOA 2W95A 1N34B 3OM3B 4XF0A 3EJKA 4YJ3B 1T6GC 1VQLV 1JODA 3O0WA 1LOGA 4JZRA 3ZXAC 4BH9A 5EYYA 2B4KA 2HJDA 2RDRA 2RDSA 4EB6A 1TE1B 1XHXA 3E22B 1NCQB 3O1UA 1W06A 3ASOB 4BAYA 2VMFA 3W7UA 1GN2A 1WD4A 3APBA 4RS5A 5J1XA 5JAXA 2WNVB 4EZHA 2RDQA 4IT5A 3P3NA 1GSLA 4U3JB 3AK1A 4KBZA 3I3DA 4IEUA
chains in the Genus database with same CATH topology
2VW0A 1PGW2 4AFAA 4BHIA 3B93A 4YLZA 2DCJA 3H0OA 1DQ1A 1VBB2 1PGSA 3KGZA 5JLVA 3N3HA 3OD4A 3NV2A 2B39A 2WFPA 4QGLA 2VNGA 2IFRA 4BLJA 2BYVE 1QQP3 5KC5A 4UW6A 5HSXA 1ZREA 4Z2WA 4XFFA 2Z42A 3IBMA 4ZU5A 3RYRA 2PAMA 1Q8VA 2P2KA 2WFF3 4GXLA 5C9AC 2QJVA 3H8UA 4SLIA 2JG8A 4CDQB 2QCSB 2DCKA 2F4PA 3E5UA 3MICA 4K6BA 4E4ZA 1O3QA 1MZFA 1XNCA 4Q4V2 1QXPA 4UW3A 1F8VA 1OPOA 4Y24A 1ND3A 2A6ZA 2DVGA 1U0AA 3HMYA 1V9U2 3OYWB 1SFYA 4YG0A 4LTAA 5T5PA 2YGLA 5A33A 1X8MA 4E2SA 2RS53 3EATX 3ROUA 5SV8A 4IV1B 2DCYA 1FOD1 1POV0 4H14A 2DFBA 3OBTA 1VAMA 2E7AA 4HKOA 4FAGA 3JBG2 3I7DA 1XXNA 2ZAHA 2AYHA 3D6EA 4XBNA 5J37A 3RJ2X 1WA4A 3Q9OA 1AR71 1DQ4A 4XE9A 1W39A 2ZJCA 3NW4A 4LHLA 1OKQA 4XZPA 3VL9A 1AR62 4GQ7A 1B35B 5E88A 2ETEA 1ND2A 1Q5OA 1L3JA 2XBO2 1IQAA 2RS33 1KJLA 1POV3 4FCAA 4OHXA 1PO22 2Y38A 3ZN6A 2BWAA 1N3PA 3M2MA 3ZFEB 3O0VA 3QD6A 4IERA 2G4IA 2JD4A 5KHKA 1R093 4XILA 3MW3A 3ZMNA 1O7FA 5ABJB 4AI0A 3GZTB 4OI0A 4N7UA 3V0BB 4CYDA 1IHMA 3VDDB 5C4WC 1WCSA 4RS5C 4TWTA 3VZJA 4NR1A 2D6PA 5EYXA 5I93A 2R062 3ME2A 1VRH3 3MLKA 5FOBB 4N53C 1AL23 2VW1A 1MEC2 1V6LA 5FAXA 4I09A 4OI4A 2RS11 1LR5A 2O8OA 3VBSC 1D4M3 4MSVA 1ZVFA 4LBQB 3S30A 4YZ5A 1J1LA 4RFT0 4BHPA 4GB31 1J3QA 1W0OA 2PHUA 4Q0SA 2CTVA 5LK7B 5L7OA 2Y26A 1AR81 1I3HA 1RVF2 3CJXA 3I59A 4UXAA 1LJ7A 1PZ9A 1ZRRA 4XJ8A 1REEA 1FATA 1C57A 3DL3A 1Y7BA 2A71A 4AQSA 1NOVA 5IK7A 4C90A 2VVEA 1S0IA 1SEFA 4C91A 4WM8B 2GALA 3N35A 3WZ1A 1AL0G 4M2IA 4OHYA 3ACLA 1RL3A 4YW3A 3VKOA 4EROA 1RUJ1 1PIV3 1S0BA 3AP9A 2XLGA 3D4KA 1Q3EA 1VB2A 4CTEA 1OOPB 4CEWA 4WZFA 5H9QA 3I4IA 3ZSKA 2JG8C 5FPZA 3LCPA 3AZXA 1RUI2 4RA0A 4Q8KA 2BTVC 4NOTA 5E8AA 1G9FA 2BGCA 4YVWA 3D8CA 2B7YA 1PVC2 1RUC1 1H4GA 1MQTC 4QM8A 2DVAA 2ZACA 2BW8A 3RPQA 3WLUA 4QPGB 4IEPA 2C9AA 4L2NA 1EV12 2RJLA 4LEJA 3NAPB 1SACA 4M3CA 4EN7B 1NY72 1LOFA 1PVXA 5CFDA 4HVRA 4XF1A 3N36A 3U07A 3RI8A 1ULEA 1QOOA 1ULCA 1JTZX 5T54A 2WQ4A 1MVQA 1U5IA 1W6MB 2VY0A 1YFWA 1ZBA3 1C8M3 1ULFA 4D7TA 2YXSA 5D1IA 1S0EA 3OBRA 4L11A 4Y20A 3QOPA 5GLTA 5CFCB 4MGYE 5JOWA 2ZX4A 4YZ1A 3V64A 5JMCA 5A32B 1VBD1 1CAVA 2HWD1 1Z7S1 4YVSB 4XFGA 4ZU7A 1IPKA 2YGMA 1VR3A 3OY8B 3VBOB 4OUMA 5BNOA 2XJPA 5BV6A 2WFF2 4Z07A 4Y1XA 4M01A 2D43A 3GF6A 4W6XA 3VV1A 1QNYA 1LENA 1O3SA 1CONA 3ZFGC 3HN1A 2PHLA 1A6CA 1IGOA 3W9AA 3OD0A 2R49A 3VBRA 1OPMA 1OTJA 3LA7A 4P9JA 4JV4A 3GHMA 3WDYA 1QJU1 5SV5A 1LECA 2EAKA 4YG3A