2XUMA

Factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRHSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 106
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2xumA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xumA01
2XUMA 2YDEA 1H2NA 3KCYA 3P3PA 2WA3A 3P3NA 4Z1VA 2WA4A 3KCXA 4Z2WA 4AI8A 3OD4A 1IZ3A 2ILMA 3D8CA 2W0XA 1H2MA 1MZEA 2CGOA 1H2KA 4QU2A 1MZFA 4B7KA 5JWPA 1H2LA 2CGNA 1YCIA 2Y0IA 2YC0A 4NR1A 4B7EA 4BIOA 4JAAA
chains in the Genus database with same CATH superfamily
1VQPV 2PN5A 3ETDA 2R16A 2WO2A 3BTAA 3BKZA 2L35A 1RVF1 2VQEB 2OZ6A 1QXJA 3O12A 5FZ3A 4XF3A 5J3UA 2LW1A 5B1AC 4QPGC 1I5ZA 2WBKA 1NLSA 5FXZA 4YVWA 3WUDA 2CWSA 5LZ6A 3KKYA 1L7LA 2YSUB 2HJIA 1O7FA 2C6SA 4LP8A 3PJYA 3OEEG 3CEIA 5BUVA 3FLPA 4CP1A 1W9SA 3OG2A 3NWKA 4NXNB 1UWWA 3O1RA 2PTMA 3ABKC 2AZ0A 4R9BA 1M56C 1RUJ1 1MACA 2H0VA 2Y64A 5ACA2 1SQXH 2YXHA 1HIXA 4XUQA 3CRQA 1LTEA 4YW6A 1JJOA 2LGWA 3H9VA 4G27B 2YG0A 4BIFA 4H0LB 2BFUS 1ULDA 1WBFA 2Y6JA 5T55A 3AZYA 1TUBB 2R061 1DQ1A 4MZUA 2XMLA 1X8MA 3B8MA 1AR82 4GKJO 3KCXA 4YGBA 4UFKA 5JR7B 3PVNA 2VRZA 5A7OA 2YXYA 1VQ4V 3K5LA 1QNWA 4K8ZA 4LUMA 4MUVA 4CP0A 2XQRA 1YCIA 5DZGA 1V6IA 2OCHA 2DYCA 5IE9A 4XF4A 2DQ0A 5F6LB 1KD1W 4M0HA 1RUNA 3BI3A 3L75H 1M4UA 3TJTA 4Q4X3 3ZYGA 1GM8A 1Y3TA 5FO7B 1ZRRA 5L3GA 1YFYA 2P90A 1NZCA 4B3TB 3WF4A 1DZTA 5FZ0A 2BTOA 5C3RA 1XNQO 2JJ1G 3EYPA 3SCGA 3N9OA 4IIJA 3VBRC 1OOPB 1RUD1 2UU9B 4DV2O 3APOA 4XIKA 3GZAA 1H8HG 4UI9L 2WAAA 1UO9A 4HNAB 3WG4A 4CDWC 1DGWA 3F5TA 4BMEA 2VJXA 2JIZG 2BTVC 1RUI3 4W4LA 3FWEA 1ZZ8A 1Q81W 1F5FA 3PMEA 1AR83 2B5UA 2W94A 2VUJA 1EV12 1YEWA 4D94A 2BVVA 1URFA 1FATA 4DW0A 4I0WB 1W3VA 2ITCC 2W6JG 1JZ6A 3I97A 1EV11 2UWCA 5A7WA 1DGWX 4CUGA 5J1XA 5LXTA 1S2BA 1O6UA 1G9CA 1US2A 4QDQA 5CA0A 1GU3A 2LP7A 4TZDA 3HKCB 1FAYA 5CBGA 3SR2C 3THDA 3RBZA 3ETPA 4IXLA 5T5JA 2OVUA 3AYDA 1PM7A 1G4YB 3ILRA 2VTXA 3WQ1A 2IW5A 2QQWA 2EA7A 1VBD1 2HBUA 3VBRB 5GZDA 4X1YB 3LDBA 4LHKA 1U0AA 2IUWA 3CRMA 1GWLA 4I2OA 4I01A 2XLGA 4CCCA 3ZSJA 3D0SA 5H9CA 4E2QA 2WFF2 1OSGA 5FP7A 3ASOB 3W20A 5B4NA 4EJRA 2VMEA 4CDQA 3NV3A 2VE1A 1ASJ2 1R1A2 2VVEA 2JKBA 2Q1ZB 1MEC3 3J7MA 1RUH1 2KXLA 1ENRA 3D6EA 5FIXA 1CGPA 4JGSA 3MLLA 3HKEA 3AMMA 4A6OA 2JWPA 1TEIA 1WAZA 1Q8PA 3S5QA 1OQDA 1VBB3 2D6KA 2KB1A 2XGXA 3A4UA 5FY0A 1VF6C 3CWBH 1H8VA 2WWJA 2VVFA 5CA0B 2UYAA 4R7CA 1BLZA 3MIEA 1ULEA 4DV7O 4DUYB 5IJ9B 3WDTA 5H2FZ 3QH7A 1W06A 2ARXA 2V4DA 4QX2A 4FQZA 3ZHTA 1T2XA 2RS51 1GN4A 4XBLA 3AVRA 3D3IA 2QR4A 4CH5A 2ZR2A 3FUQA 2WJSA 5TSWA 1QR9A 4DUVA 4MVZA 2NLJC 4L2NA 2YC0A 2J7MA 4LA2A 2VOWA 2OWOA 1DQ6A 5F5QA 1GNZA 4Y5SA 4QQLA 3D5OA 1HWYA 3TNPB 2XBO2 1TUEB 4HKLA 3PN1A 5J37A 1X9TA 1I5XA 1QCEA 3I2FA 1UQXA 4OQ8A 3RZLA 4XUTA 1H2GA 4CDXC 3WDXA 1K92A 1G9BA 2AGAA 5BNOA 4MXWA 2X29A 3WNPA 1WB8A 4WFEA 2P1BA 3VD4A 1LODA 4DXWA 2X10A 3IAQA 2QJ1A 4AWDA 1FS0G 1S0GA 4K1YA 4QQHA 2WZR3 4KG8A 1S5LZ 4Z1VA 5FZLA 1BK1A 3U0ZA 2GC0A 1RMU3 3RWKX 4Q8KA 4E4SA 2P7TC 4BQ4A 5JJJB 2B9UA 3ON7A 4FVVA 5F39A 5DQ0A 2Q7EA 5H9QA 2GMPA 1VE0A 4UCUA 4PJYA 2AGSA 2PI5A 3ZKUA 2HWF1 2HWE2 3NKGA 3VBOA 2YBPA 4U3JA 3MW4A 4FFGA 2Y6HA 4NWVA 1WA8B 4HKOA 4PDRA 1HW7A 1YJLA 5CADA 1Z5WA 1NTMH 3ZFEA 4CC6A 1XNCA 3MIHA 1HRI3 5LW9A 2ORXA 2ZM6B 4RA0A 5FY1A 4C90A 4O4IB 3O1UA 4QIWF 3VOUA 2Q8DA 4GX1A 4DRXB 5LK7B 3LIGA 3FHAA 1FXZA 2BGCA 2Y0OA 1OZ0A 1E5HA 3N9LA 4Y1YA 5ITZB 4QXCA 1CAUB 4YGDA 5C8CB 1AYN2 5IVJA 2Y6KA 4LKEA 3E8HA 3CCUV 2K9ZA 3ABTA 3CHXA 1FXKC 3UJQA 1S0FA 4ZOLB 1WCQA 1SDDB 4P30A 1S5JA 3BIWE 4BR6A 3KD4A 4NXMB 1W2AX 2VAUA 1GBGA 2ZDIA 4BIOA 4PLNA 4AGRA 4ZU7A 4XPVA 1VBC3 3JATA 5BY1A 3KCYA 2W6IG 4A7KA 2X6BA 2R043 3U11A 5JOWA 2HWC3 1LOGA 2V5YA 3POIA 1N32O 2ARHA 3GF6A 2VOXA 4I4TA 4UFJA 2VMDA 3PUQA 5A3OA 5JSPA 1QLNA 1KJLA 2XL9A 2X5IB 4XF1A 4KBBA 1YQ6A 5GALA 5DMYA 4JTDB 2MEV2 1JTZX 4ITCA 3I49A 1TMF3 2DVFA 5FBZA 1O9GA 3DSQA 4XDLA 3DV8A 5FZ1A 1QVFU 3U07A 1VR3A 1YYNA 3POYA 1TQ5A 2D7FA 5DG1A 2RJLA 5LA2A 1OKQA 4JF3A 3WDWA 1VEWA 4CU8A 1XRUA 1CPMA 1OCZC 1ZZBA 2YGLA 3T3YA 4ZS3A 2ZINA 3KF3A 4LO4B 4LBJA 3VHPA 4WZCA 5FLIA 3NJVA 2WA4A 4E2SA 4NB5A 3EHKA 5I0DA 5D8AC 1W0NA 2UYBA 4OLLA 1DYPA 3RJRA 1OV9A 5KA5A 3K3OA 1ASJ3 3B93A 1DQ0A 3CZUA 4AVBA 2E6VA 4UFHA 1AJPA 1DHKB 2XQXA 4GX2A 5JCOA 4I9WA 3ZHVA 1CAVA 1ALYA 3MDSA 3HR0A 5FK7A 3M3OA 4PIZA 1F2NA 5FL7G 2RHPA 2JDUA 1W9TA 1LOAA 4BH9A 4UW4A 2C1FA 4CDWA 2WDBA 1W2UA 1G6UA 3RDIA 3VBUA 3DYMA 1MOFA 1GH6A 3VGIA 1PX3A 4I0AA 1S72V 1VBC1 4W6XA 3W58A 1VBA2 2CV6A 2V73A 2B42B 3OUIA 4F4LA 1O9HA 4FPKA 1S2EA 5FPAA 5I8SA 1HLCA 5JVVA 2GMMA 1LGCA 4K8FA 5I91A 2LQTA 1NA1C 3Q8AA 1S0EA 3ASNB 1XJAA 2X09A 3GBFA 1AL23 2GUZA 3VZLA 2PHUA 4W65A 4IYHA 4QNHB 3NNGA 5FY8A 2Y69C 4OPHA 3IKWA 2VMCA 4JRLA 4J80A 1OCZB 2E76B 2F17A 1RC6A 1AR72 1OA2A 1Q56A 5FQ0B 2JDZA 4DXRA 5KXCA 4P9GA 5FPLA 4C1WA 4META 3M8LA 5DECA 5LASA 3ES4A 5KXBA 3L74H 5G04L 3LPGA 1W6PB 4NIHA 3G71V 3MV01 1IKPA 4JI7B 1OCRB 3I56V 1S0IA 3ZCCA 5JH7B 4YJ2A 3QCWA 5AC93 1WP8A 1IBLO 4LF7B 4Q4W2 1SLLA 2A0LA 4IYIA 5JMOA 2YZ4A 1TVKB 1WJZA 4NRQA 3A21A 1VQKV 1MPXA 2NP0A 2YUEA 1L3JA 3RG0A 4NTWA 2AZ5A 1H2LA 3QACA 3DC5A 4XDJA 3RYIB 3ZYBA 1XBFA 1UKGA 1O4ZA 4FI9A 1AHSA 1JHJA 5C4WC 4A3ZA 3ETGA 4D7YA 4X1KA 3BU0A 1PZ9A 2ZGSA 3FUOA 4AVCA 1Q8OA 4UV9A 1REEA 1PGW2 3NJXA 1RHI2 1NA1B 1VBE3 5HV0A 2MHFA 3AZWA 2V5DA 3CX5F 1RJ7A 2KSDA 2XPJA 2XTAA 2QCSB 1PP9H 2RG4A 4EQVA 1A34A 1DF5A 2W91A 3RVHA 4NE9A 3LOBA 1XNRO 1P7GA 1MS0A 4WF9V 2DBNA 5CA6A 4BQXA 1PGL1 1EN4A 1EN5A 3E6DA 4LF6B 1LHUA 4YVWB 1ONAA 5FJHA 3JBG1 1XE7A 4GMP0 3BYWA 3OUSA 1HV0A 5FZGA 1SACA 2Y4TA 4DR1B 3SNMA 4YZ1A 1ZREA 1AR93 5I0TA 5FWEA 1PL4A 1PZ7A 2OTLV 1PGL2 4WVWA 1FPN3 4KG0A 4W6WA 1RITA 1CR7A 3WHUA 5GTIZ 1NE6A 4LTAA 5EYPB 3VBSA 1QJU1 1WW6A 1NX9A 3S30A 1XNAA 2JEUA 4QX3A 3WP6A 3J26N 4M3CF 1FD9A 4P5HA 3ZN6A 3B9IA 2P17A 4DV5O 4GB31 1W9YA 4CYDA 1AYM2 1GZWA 2FDGA 2PAMA 3L2YA 2GBOA 3J8F3 1LNQA 2PELA 3OY8A 5EJZB 5E88A 3E2EA 1IS3A 1IG3A 3VQXA 2ZE7A 4ISRA 1S76D 2AH2A 3VDCA 3P1IA 3IJ4A 4NKGB 5EHDA 3WHTA 3OD4A 4OHVA 4X1KB 4NXMO 2KG7B 2WFF1 2J1TA 4C1XA 1HB1A 1BEV3 1RTVA 4W50A 3VZNA 5FZFA 5FZIA 1W8NA 4FLTA 4L99A 1MS4A 5CYYA 4FOQA 2HWF2 4U3FH 1JHNA 4JCKA 2IXJA 4FOVA 2WFPA 5FYCA 5K4LA 3MIBA 3Q4HA 3ZFEC 2BUKA 2RV9A 2WT0A 1HV1A 2QQIA 4JX0A 3ZFFA 4PA4A 3OGCC 3DXUA 1WZXA 5BXXA 1QJFA 1HRV1 3NAPC 4DR6O 3GNEA 5B1BC 4XXAA 3T1MA 2FDJA 2D6PA 1XOYA 1G9AA 4UCOA 2WNVB 1N0NA 1D5NA 5E89A 2VNGA 1R091 2AHYA 4TT3G 1X7NA 4D8MA 1SFYA 4JYBA 4GWIA 1XDCA 5J2TB 5FY9A 2ZTNA 4Q4Y3 2BSKA 3I54A 2WNEA 1HJGA 5F3IA 1VBE1 4QPIB 1Z5VA 3DUIA 3PUIA 4XUNA 2Y38A 4XABA 1ENSA 4J11A 2M6YA 4UW3A 1ULCA 2Y34A 3UKVA 4IEQA 3KWVA 1NH2B 4AILC 2YC2A 2X6CA 1E1RG 5FZKA 3CYOA 3TN91 5G05L 5KHJA 2WLKA 5L3CA 4CDUC 3BODA 1QJZA 1VQOV 4XIOA 2HWC2 2C9AA 2WNUA 3V64A 1Y4MA 1HN0A 1Z0HA 1PO22 4OX9B 3BEHA 3EJKA 4NTXA 4P9PA 1EPZA 5AC91 2G38A 3MYXA 4EN6B 2BOJA 4WFAV 5LMNO 1FX5A 5FLHA 1ZX3A 2R073 4AQ2A 4RQEA 3VBOB 4A41A 3IWZA 4BPZA 3ZFEB 2QUOA 1ZA4A 3ZMVA 3AKQA 4F6RB 4FFIA 4DUZB 2FYUH 1O8SA 4XJZA 2RDNA 5AC92 3I4IA 3E97A 1HB4A 3JD73 3E6BA 2YEVA 1K5SA 4Q4Y2 1WCUA 3LFMA 4LBOA 1SQQH 4BWAA 3I3QA 3NW4A 3OD0A 5B1AB 5CU1A 1PO23 1IBKB 2IU0A 2WYSA 5EQUA 5F3EA 4XBQA 1BSMA 4PV1B 1IGOA 4FLXA 5FTTC 2FTKA 1VRH2 1KKDA 4FOYA 4QPGB 3CSXA 3G4SV 2ZXWC 5JCOC 4UT5A 3ZFFB 1PKXA 5GLVA 5CA3A 1UX6A 5GZGA 4ET7A 1S0DA 1MG1A 5LWBA 4DR2O 5B5EZ 1AR73 3LNMB 4Y33A 5JCTA 3RZKA 4PDLA 3SJCC 3M3QA 1MS1A 2YS8A 4PBPA 1GWMA 4LO7A 3VBRA 4YZ3A 2GP5A 4YYOA 4AEMA 4TQDA 1UY3A 3LWCA 3M4FA 4N23A 4JI3B 4JYYA 3CRCA 1SBFA 1F7YA 3K3NA 2JEXA 4FM2A 4EWEA 4E2LA 2TBVA 1B35B 4IHJA 5FMOS 5FNVB 3OPTA 2BNOA 2JE7A 4FK5C 4IEWA 4JI5O 3KV4A 2VL4A 5HPOA 4Q5OA 1POV1 1GQHA 1AP6A 1YJWV 2NZ9A 4HN0A 3B3QE 1H9WA 1US3A 3BFRA 5C9AB 3HT1A 3CEWA 2ARCA 3CCRV 3WQ0A 1VBA1 4LNUB 1T6GC 4E4ZA 3HNBM 3WCRA 2YYOA 4YW7A 1AROP 2Z4FA 3ZRVA 3DEMA 3KV6A 3ZDSA 4GAZA 2QKCA 3GZUC 1Q5OA 4BWOA 3OEHG 2DFBA 2FBEA 3TEYA 1OOPC 1J3QA 2CE4A 2YB7A 5D1IA 4LC1A 4MVUA 2MPFA 2XUMA 3LPFA 2MEV3 3CJXA 4Q26A 1N4CA 1MEC2 1EZVH 1RVF3 3UKTA 4LHLA 3ACIA 2P3KA 3OY8B 2BZDA 3U4SA 1GR3A 3ZS8C 5FO9B 1QH7A 4X8AA 4U36A 2JJ6A 2WT2A 1GWKA 4B08A 1QR8A 4O2AA 4FOWA 1TMF1 3BOPA 2IU3A 4CCNA 1XYNA 3LZZA 1FYJA 3B01A 3L72H 5KAFZ 1FFXA 4GMP3 1BQPA 1QJY2 1CAXA 2ZHMA 4NIDA 4LR3A 1B09A 4XFIA 2PHTA 2ATFA 2UY8A 2V09A 3UETA 2WIIB 2W9XA 1LOCA 1ZZ9A 5C3QA 1W8FA 3AFKA 5JQGB 3SYPA 5FYYA 1OVPA 4E4HA 3HB3B 4E4DX 1ZBE1 1S3JA 5D2AA 1URXA 1FI2A 2W47A 4TLGA 3TETA 2HWD1 4W4ZA 4EB6A 1AVBA 1XHXA 2BWCA 5C9AC 1MQTC 2DE0X 2WUHA 1BGYH 3BRCA 3UT5B 1L7QA 2HWB2 3F2ZA 2R72A 4MTFA 1RUH2 3O0WA 1BQZA 1KFXL 1RUE1 2N04A 2P34A 3PLQA 2ZACA 1UU4A 1CIYA 5IW0A 4PA9A 2B4KA 2PXJA 5B3SB 5FNVA 5FKCA 3WW4A 1EBOA 1TA8A 3URFA 4Q4W3 1Z7S1 4QAWA 4AI8A 1W6MB 1DBNA 1RHI1 3H1IH 2B9ZA 1KDMA 5JQGA 4FP2A 3ACLA 4XQDA 3AXEA 3G6BA 3WB1A 1NCRB 3CBNA 3GHNA 4NIGA 2VCCA 3ZXEA 3WINE 1FOD3 2YUAA 2VMIA 3VBSC 1SESA 2W1WA 3RRDA 3ETQA 4COZA 2R9AA 5FZ6A 3Q8EA 2A1XA 4YW3A 3ZN4A 1YIPA 2NR5A 1GN2A 2ZX3A 3H1KH 4XF0A 2EINC 4B3SB 1N47A 4Q6GA 5KHKA 3KHBA 4ZS2A 1ZLZA 3SDLA 2B9VA 4ZOLA 4LUKA 2VWJA 3MLKA 4FPLA 4X6RB 4JKMA 3IMNA 2DYRC 2QE7G 3N2GB 2FMYA 2YMZA 2BDRA 4MYEA 1UZYA 2NMOA 1VBD2 1IHMA 1P8JA 2WZR2 2FDHA 2RJKA 2XNDG 3STZC 1Y7BA 3MDPA 2K46A 5A1FA 2DCTA 1GZ9A 3CPWU 1TZOA 4XJUA 1NBMG 4CEYC 2GNTA 4GZRB 3ABUA 1YITV 2DFCA 4P08A 5GLZA 2CAVA 2DWRA 4HG6B 4PI2A 3WNNA 3ETEA 1OH3A 1KB9F 2ZGLA 1KQSU 3CXCU 4Y4YA 3M3IA 2XWJB 2XBO3 2X5IC 2GV9A 1L1FA 5A32B 3QO7A 4P9OA 4N53C 4AVSA 3OBRA 4FAHA 1I08A 5JXIA 3N9QA 3TYJA 2ET7A 3K46A 3KT4A 1ENXA 4WFBV 5IJRA 3HQRA 4JC1A 3ROUA 3GZEA 1LESA 5FYBA 4Z92B 4EZHA 4QX5A 2W1SA 4IEVA 5SV5A 1WN7A 3H3ZA 1Q7YW 1WLDA 5E1RA 1VARA 4DV6O 1KU9A 3E89A 2RJZA 5LA6B 2C5DA 1WLEA 3OGVA 3ZFGB 4CVUA 5C3SA 3HMYA 4Q4V3 3DGEA 4J7ZA 2NYYA 3FBYA 1W2TA 2LFRA 5EJ3A 1GLHA 4BAYA 3R05A 2ORZA 2QEXV 1W2NA 2VBBA 4XUOA 5ANNA 3L9DA 2RDCA 3MI8A 2VXRA 5IYCO 1WW7A 4QX0A 4BOWA 3LEKA 4QT6A 1QMJA 3BU7A 1GAXA 4FPJA 1OI6A 4IQPA 2Y69B 5BPXA 1PIV2 4LBKA 4Q4V1 3OGJA 3PURA 1H9PA 5A9GA 5DUUA 4HNAA 3J4UH 5A7WB 3K2OA 1QJU3 3E22B 3FC0A 2JG8A 5IAXA 2IFRA 2XAHA 1KUQA 2ZM6O 2R063 3OUHA 2W39A 2L9LA 2GNDA 3RQ0A 4DO0A 5FYVA 5T5LA 2QQKA 1UMZA 2VZ1A 4YW5A 5AVPA 5KX5A 4CCKA 4NRPA 4JI5B 2ATKC 3ZLIA 2OTJV 4XBNA 2WO1A 3A23A 2G9GA 1ULPA 4KUMA 3FX3A 5IDJA 1WKYA 1X36A 3KZIZ 3DPRB 4QU2A 3S5AA 1EUTA 2Z0AA 4OGQB 3ZN1A 3USSA 3VZKA 1DF0A 1LOFC 2W5FA 3RT3C 1R081 2YBSA 1WW4A 3K0GA 1NR1A 1I94O 5D8AA 2YBKA 5GONA 5IYZA 3TNQA 2AREA 2JGDA 2O1QA 1V00A 4TLFA 1QXPA 1FV2A 3Q8BA 2JDYA 2R32A 1NI8A 3HT2A 4IE0A 3ILFA 2OT7A 2E75B 2CYFA 4FPOB 5J2UA 4L97A 2OQ6A 2V4VA 5EC1C 4JGYC 4AFMA 4UFIA 4D7SA 2DU1A 3O9OA 1XHZA 3ZPYA 1UKRA 4MH0E 1UL9A 4QGLA 3IMMA 3HQXA 4AI1A 4CH3A 1DP0A 3VHOA 4AG4A 2P4VA 1VRBA 1OQ1A 2R062 2A75A 5IJ9A 2LROA 1LGBA 1FAFA 5BR8O 3N2KA 4Q0PA 2HWC1 1PNGA 3V0AA 5DZEA 1UOGA 2VPVA 1ZAUA 3VBBA 3KVAA 1OOPA 1X82A 1NJIW 1IPKA 5K1XA 3I3DA 3B4SA 1SRYA 2J1RA 2ZHKA 3ZRWB 4LK7A 1RUC3 3FN9A 2PHXA 2RMU3 1BQ0A 4UCSA 2H8PC 3JU9A 4DR4B 2ZIOA 2O57A 1F31A 1JH5A 2EIJC 5BNNC 4LFCO 2CDPA 1EZJA 2JGDB 1RSOA 4WVMB 5H6RA 4MGIE 1XNBA 3K3WA 1EYBA 1JCHA 2EICA 2LRPA 2OZJA 1R73A 3T2TA 4UF0A 4LO8A 4JDOA 3JASB 1JFFB 3IAYA 2RVAA 2DVAA 5FMDA 4BISA 2JD4A 5CFCB 3T2MA 2P37A 4LCUC 1N33O 1CAWA 3BN6A 3P3PA 4Q4W1 3EQEA 4TYSA 2K9PA 5L3BA 1Q82W 4JGZA 3FHIB 3T1YB 4TWTA 1NZ6A 3D8CA 2XAQA 5F5AA 4BDVB 3OGRA 4JGYB 5FUIA 1KC8W 1SHWB 4R6ZA 3J7NA 2J1VA 1UOFA 5FV3A 1REFA 1U97A 2DF7A 3M3EA 4NRMA 4I5SA 2DN9A 1PMIA 4I50B 4XACA 1QDOA 4LIUA 4UF0B 1E79G 5GLUA 1GZWB 4H33A 2Q8VA 2AACA 2DCYA 2YXLA 2WLIA 5B1BB 3AK0A 5EBMC 3SPJA 4RS5A 3I3EA 1QJX1 4M01A 3BTYA 4KHPB 1XBLA 1ND3A 2ETEA 3HNMA 3THPA 1G7YA 3C3VA 2DBIA 2PQSA 3WV6A 5LBEA 3OBTA 3T4HB 1QBZA 2DV9A 3JBG2 3I8TA 1Q43A 3HN1A 2ITDC 4H7LA 1RMU1 3UO3A 4GIQA 4WVMA 1OVSA 1GANA 1OLME 5FZ8A 2YFZA 1K5JA 1Y4WA 4TWKA 1GSLA 2EXIA 4LBNA 1OCRC 4QM8A 1WMDA 5JXHA 1CESA 1F35A 2WPDG 5DUXA 1E57A 2JENA 4EZ4A 5CFCA 4QDSA 1I94B 2Q8OA 1ZM1A 5FFOC 2FKXA 1VPHA 3AZVA 3B02A 4DMIA 4NYKA 5CFDC 3E86A 4LKSA 2WLJA 4J25A 3K4ZA 3G67A 5FXWA 5CN0A 2UWAA 2MK3A 3T4DA 3ZXFA 1LEDA 2WZPP 1RYYA 1JBCA 4IW3A 1SEFA 1QQP3 4NMIA 1QHDA 3KS7A 4IGGA 4BW9A 1HQNA 3C8XA 4IE4A 4FVMA 3ZX7A 2VWKA 2A70A 2XVGA 1SQFA 2Q7HA 1VQ6V 4Y1UA 4A2UA 3UYJA 2RM23 2ZAAA 1HRV3 1KKCA 4BHPA 2W68A 4IL6Z 4JVAA 4MO3M 4IV1C 1WCKA 1TME2 1ZZ7A 4LPLA 1I5YA 5IWAO 2X5IA 2ZGQA 3RYRA 4YW1A 4C7UA 4N53A 1NCRA 1H30A 2WWSA 4Q1PA 5GW7A 3PVBB 3MLJA 1AJNA 2BQPA 2GTAA 4QPGA 1YLLA 4DUWA 4YVWC 4QHBA 3JYCA 2AXTZ 3N9NA 1HRV2 2OUJA 1JN2P 3DC6A 4G9SB 1Q86W 2QJVA 1XL6A 4F7ZA 4QPJA 4CTEA 2BCCH 1J83A 3O1OA 1F23A 2XASA 4MTOA 2EIMC 2XWBB 5IK8A 4UB6Z 2VXJA 1QJU2 3E8GA 3HR9A 1BVVA 4DV1O 1WMFA 4R8HA 3NJZA 3ZN5A 3B7MA 3R4UA 2FZ1A 3GZTB 1CQ9A 4LF5O 4RWUA 4WV8A 4OI4A 1H2NA 3FYIB 2NLRA 1WA6X 2WLHA 1RL3A 3DKWA 3IDEA 3EO6A 3B9CA 1SFPA 4AQSA 3WG7C 1UMIA 4M0NA 2UUAO 3KGLA 3FB5C 5FPUA 4RHV1 3IGAC 3BPZA 5KUKA 3WCSA 1SG3A 4MTGA 2RS11 5IVEA 1LHOA 3K5MA 1J3RA 2RM21 1ZRIA 4NPLA 1FFTB 5ITZA 4ZZ8A 3QBQA 1PK6C 2DWDC 1EV13 5CFDB 1D2DA 3O7OA 3WDUA 2J1EA 3T0DA 2ZQMA 1WPXA 4EFBA 1CJDA 5DZFA 2HJFC 1C57A 2EILC 1G8WA 2QQNA 1F4NA 2IJIA 1OF4A 1W8UA 1JOBA 4RHV3 4N9HA 4PDWC 1KEXA 3WF0A 4HT1T 3HKDB 2EIKB 1GN6A 1K34A 3QNEA 4FZ1A 3VD9A 4EN9B 3NKTA 5LRRA 1JI6A 1TVKA 5H9SA 5IVFA 1QU7A 3P32A 5FZCA 1R3IC 1N3PA 1CPNA 2NM1A 4HZFA 1VIBA 5F1RA 4KH9A 3J8F2 4CDUB 4QPIA 5F2VO 2QQOA 4FCAA 2VH9A 4NROA 5DPNA 2HEPA 2JX9A 4DV0B 5L9BA 3S7IA 4BK5A 3LDKA 4RQPA 3KLSA 4B3MB 4GLXA 1BYHA 1P7BA 4JQRA 2X7RB 1VQMV 3BAAA 4ZXKA 5LY1A 4EE2A 3ZN0A 2VZUA 1WMEA 3ZXDA 1UY0A 4DR5O 1K3IA 3VKMA 4B1MA 2Z69A 4KWLA 4B29A 2YIBD 5LMNB 5IK7A 3PVOA 2LTNA 2R70A 3CCEV 4FTEA 2A3YA 1W0JG 2E5LB 2WYFA 1XI1A 4Y1VA 3RZGA 2VNRA 2IJKA 2B7YA 3ZYJB 3DXTA 4WVZA 5BXZA 1VMFA 3LEMA 4RYDA 1N8RW 1GP5A 4MG2A 3OOXA 3AKSA 3SCFA 3Q8FA 3WVJA 2IM9A 3O1SA 1UOBA 3NQHA 1W05A 5L7OC 3LSDA 2EIBA 4MV2A 2OYZA 1GKBA 3AP6A 2ERFA 2MW2B 3RPQA 4Q1RA 1DLCA 1MQTB 3D0JA 2JE8A 3LA2A 3ZDVA 1XILA 5A3NA 3TXQA 3SKVA 2UU9O 5FZMA 2VNOA 3ZM8A 5FREA 4JI4B 4P9IA 4WM8A 4XTPA 1EAH3 4CUCA 2OIGA 4LJHA 1C5HA 4U7OA 1XOUA 2DDUA 2OKXA 4DEQA 5CNAA 4CXYA 4Q0QA 3SYQA 3SEPA 3LEIA 4YM2A 4F6RA 1CAVB 1GN3A 4JGZC 2VOVA 4B4PA 1JXNA 4CZZA 4UBHA 2CK3G 3NMBA 2TUNA 4OHZA 3A22A 1M4WA 5FQ0A 2D2CB 3CMGA 4YM3A 2ZMKA 5FCCA 3J80N 3A0KA 4UYBA 1SZBA 4TN7A 3HN3A 1SQ4A 3WNKA 3WR0A 1XYOA 1UIKA 3D3QA 4DS0A 1U12A 4YJ2B 5L7OB 3N7JA 4RS5C 1DQ5A 3ZHSA 1G1XB 1LGNA 4BQ5A 1SPPA 4DXZA 2D5FA 2QQJA 2BBAA 2P4KA 4DY3A 1OCOB 4JI7O 4MVQA 4DR4O 1UCXA 4XVHA 4ZPIA 3FB6C 4I3GA 2XL7A 4ASKA 2PYLA 1VQ8V 3WP4A 2D3RA 4QE7A 1QDCA 3EHBB 1W39A 2Y8KA 1SZXA 3C7FA 1JYTA 1AL21 2DTWA 2WO3A 5FO8B 3JQWA 1BCXA 1CAUA 4B4QA 4GX5A 1JUIA 3BPSA 1W8TA 4ES9A 2VZQA 4XAEA 1LENA 4N43B 2ZNIA 5L73A 3E6CC 3NNJA 5HCBA 3U37A 1DGRA 1PO11 1RUI2 5BNOC 4MOAA 4HFSA 4GWNA 4HSJA 4F8AA 5B3SC 3FHQA 4KNCA 4ASMB 4B7EA 1CZVA 5I8TA 1RUJ3 5IYYA 4XF9A 4QPKA 1A8DA 2WQ8A 3VL8A 5FYUA 1UJWB 4MVMA 5CIRA 4QMAA 1W6OA 5FP8A 4Y20B 5FYSA 3ZXLA 2VMGA 5F2WA 1M5IA 2PA7A 4EB6B 2Y26A 1X4TA 2D93A 3J7AU 2PFWA 2AEZA 5CKMA 2VGDA 1UFIA 3LDEA 4XETA 1H4HA 2IXCA 1UW8A 4CU7A 1A78A 3DPRC 5BYNA 2HWB1 4QX1A 2UXXA 3K4DA 4LA3A 4MVSA 3E1F1 4PIYA 1GRJA 3C7OA 2GH2A 5T52A 1MZ5A 2ZS6B 4DOUA 2P3YA 2RQ6A 4ZKIA 3OF1A 3RJ2X 2PAKA 2WZEA 1BCCH 1I7FA 2XAJA 3KCCA 4XDQA 1FXKA 3X2QB 1AI6A 2HWB3 3GDBA 2P5BA 3JALB 5I0UA 4RFT0 2JVDA 2VQAA 4XZPA 2WLPA 3E5QA 4MTXA 2PAEA 3KZ4C 1K5MB 2ZKNA 2VZRA 5JZGB 5KHIA 5FZDA 2ZMLA 1VAKA 5FY5A 4IEZA 1AUYA 4TV8A 3ZPOA 4K1ZA 1W8WA 1R3LC 2HG5C 5FZAA 2R9RB 4FTSA 1K97A 3UT0A 1QJY3 4WM8B 1ZTEA 1FXVA 3N7KA 1APNA 3OMNB 1R6NA 3LF7A 3ABMB 5JPNB 1W0KG 5J2TA 1V54B 2XKPA 1DYKA 5IYBO 1NQDA 4KQ7A 3NL1A 1YHFA 2Q73A 1I5PA 5A3TA 3HEIA 3BHPA 5EIBD 3FZ3A 4K3AA 2W95A 2F6BA 1F8VA 2P67A 5CAZA 5FZHA 3PL0A 4XOGA 3EB7A 4D6QA 1HNZO 2FB5A 4NPRA 2C26A 1SA0B 3K04A 3DECA 2PZSA 1W6PA 1T5EA 4QQ2A 3B77A 4QXKA 4R9AA 2HWF3 3GALA 5FY7A 2UUCB 4U2AA 2VTXJ 4DV1B 5FKBA 2UUBB 3J8F1 1YXWA 4RQPC 4CA9A 1QHTA 2FCTA 2WWWA 1DDLA 1VRH3 1UYZA 1N34O 5LGNA 1K8AW 5JZGC 3POFA 3TRSB 4Y1ZA 1W2BU 4BK4A 4RN5A 1D0GA 3RYIA 2VG9A 3RNSA 2H6BA 4LE3A 1IZ3A 3SH5A 3M7MX 4FXGB 1UZWA 3N9MA 3VBUB 3FKSG 3POEA 2Y4UA 1H8TA 1ENQA 4JYAO 3H01A 5IY5B 3K03A 3ZMOA 5JLVA 1HNWO 5FMBA 1NA1A 4K7JA 4PQQA 4U7NA 3OR7C 1VBE2 3H1WA 1N36O 4AEDA 3ICXA 4N90A 3A0HZ 3UKMA 4LULA 1D7PM 3OUFA 1W04A 4P9LA 2OA2A 4HOOA 1M57C 2PHRA 1M06G 1WA4A 1RUC2 5CMUA 2VQTA 1AJOA 1SPPB 3AKTA 1O5UA 2PLV2 1B04A 4WM8C 1WWYA 1VMHA 4K20A 2E74B 3T2QA 4UWDA 4FJCC 1NAEA 4PDVA 1XMOB 4KBZA 4EEQA 3WT3A 1ZRCA 1E5RA 4CCJA 1HR0B 4X62O 5J9PC 2PLV1 2PY5A 4RL7A 3ST7A 5ACA3 2QTOA 1RVF2 5F7UA 4Z8BA 1AL0G 3POSA 3C7EA 1XREA 5A33A 4X20A 1GYKA 3BVCA 3GBWA 5JH7A 2O8QA 4IV3C 2OW4A 2CNAA 3BALA 4LXLA 4YRDA 5BMVA 2HYKA 2NNUA 2J22A 4LOSA 2D3PA 4X1IB 1IS5A 3I2IA 3CMEV 2F4VO 4UFZA 3KV5A 4LH7A 3LEGA 2BYVE 5HXVA 1FOD1 3MUY1 2XJQA 1W6NB 5JJEB 2Q30A 4PLOA 1KRIA 3WF2A 1WB7A 1BE3H 5JVDB 5KAIZ 2P5OA 1QY4A 1U96A 5E16A 4MVTA 1W0PA 2VZ3A 1L8DA 4FPEA 3QF7A 3GM8A 3VKFC 5L19A 1Q3EA 3FE5A 4CZSA 2IWGB 1DGRN 3GB7C 1COV2 3PVEA 1NVPD 4WM7C 3M8AA 4BYYA 2OQ7A 3ZFGA 2BNNA 3OE7G 1YTFD 2XJUA 1D2SA 4B1LA 3UJOA 3W7UA 2CHHA 4I9QA 1VQ7V 1UU5A 2DCKA 3K58A 1KP2A 1UY1A 1HNXO 4LFAB 4FQ4A 2EIJB 3OAAG 2ILMA 4CS2A 4DYLA 4LHSA 3RMXA 1UNBA 3JAWA 1AR81 4K8RB 3UT5A 2O0OA 4X1IA 4MVOA 2PHFA 4HK8A 2LW7A 2DOSA 1YZBA 5T3NA 4IV3B 1RXFA 5T5PA 1G86A 2XAGA 3IBMA 1X50A 5IUQA 5D21A 3WNOA 2IBZH 2QDOA 1HNWB 5ABJB 4J1XA 3WG7B 3JAKA 1R6KA 2A06H 3JSLA 5L9VA 1W8ZA 4XFHA 5CFCC 3SISA 1R6TA 1XNRB 3OPZA 4LF5B 5LEJA 4JKKA 4DZGA 2B46X 3MD0A 2JDAA 1QQP2 5FXXA 5C8YA 1BKZA 3T0BA 2AR6A 3MIFA 1SA0A 4J6GA 3AKRA 5FPXA 2PQQA 2WS93 4K0KO 2QQLA 3ZYIB 1CP9A 3CJHB 1E1QG 1E5IA 4Y4RA 5IVCA 4HBNA 1H0BA 2P3JA 3KB5A 5FJKA 2WLNA 1VF5B 4YJ3A 3HAGA 1YWKA 4IEUA 3DPRA 3VQYA 4FO9A 1YVWA 3AFGA 4IV1A 5LGUA 2CL2A 2CDYA 2IJJA 3E22A 4JAVA 3TEZA 4I4TB 4MGKE 1PGW1 3T08A 1Y74B 4XAAA 1Z2GA 2ZCWA 3KGZA 3WG2A 4CUBA 1PVC2 4WFHA 2WS91 1VALA 4IEXA 2AC1A 3JCUZ 4X66B 1W90A 2YU2A 2ODMA 2ZXWB 1H8TB 5KWRA 2VULA 1OKOA 4MXWB 5A1AA 1SERA 3TK1A 2ZCEA 2BNMA 5FYTA 4GD4A 4X62B 3WW3A 3PHMA 4MVRA 1RHI3 4HZ3A 4QE9A 1XPWA 1ULFA 4FP3A 2V4AA 1JOYA 4AVTA 4OHWA 1AR71 4CE8A 5FRAA 2Q5ZA 4XFAA 3VZJA 5A3LA 3POBA 1TUBA 1TE1B 2DVGA 1RUOA 2VCBA 1IKQA 3AZZA 4RGKA 1AXKA 1O4YA 1ULOA 3OYWB 3JAWB 1D5AA 2QBXA 2QZ2A 4E4EA 4MXVA 2ZEZA 1XMQO 1CPYA 3L2HA 4FPFA 5M0TA 4DR6B 4PA3A 1OBNA 2GUZB 4RSUA 2VQUA 1T6BX 4DV4B 4HK9A 3ZYFA 1AXZA 3JQXA 4GB32 4J1WA 5ABJC 2EIDA 4KWKA 1U5IA 3UK9A 4YPJA 2Q5TA 4UB8Z 2VUDA 3SKJE 3WOGA 3E83A 2BGPA 4KWJA 2UXNA 4P02B 4IE6A 3I59A 1NR7A 5FK8A 3UM7A 3CJIC 1PK6A 3SJAC 5IHRA 1DIWA 2R6QA 3F5WC 4FM1A 4MHRA 5J36A 4UCRA 4UVAA 2XHKA 4H13B 1OPOA 1VB2A 3VBHB 3WB0A 4LORA 1YQ5A 4PIXA 4DINB 3O14A 4K21A 1H8EG 3N9PA 4DV6B 2FQPA 1UXZA 4AAPA 4PDWA 4P00B 1JOPA 2CWMA 1XC6A 1O8PA 1QOOA 1W0OA 1LUVA 1GOFA 4INDA 1GM9A 4CP9B 2GALA 4AFCA 1VAVA 1YTFB 2VZSA 2ZX1A 4G3YC 4YW2A 3ZJZA 3M1HA 2XJSA 2PYTA 3AYCA 3I59B 5GZCA 1IDSA 1I6XA 5FUPA 4LBEC 1LR1A 1YFXA 3U75A 2BOIA 2HEYF 1IVSA 1QGLA 1NXMA 1KECA 2KR2A 3FAVB 1H8TC 1KFUL 2GAUA 5E8AA 5IVYA 4P2ZA 4MT8A 1YI9A 4GKJB 4LH6A 4EV0A 3PUHA 4TQFA 4RS5B 3LSEA 2EIKC 5A7SA 5LP6A 1VQNV 5E6HA 2JG9B 4Q8LA 4PBOA 4RAIA 2Q68A 5FOJB 1RPRA 5FZEA 3EXUA 1KITA 1B6QA 2WNUB 4E2GA 1TAEA 5IWAB 2GC2A 2HLDG 4WFFA 2J1AA 4X88A 3VDDC 4LNVA 3APQA 3FB8C 4UW5A 4DR2B 4ATEA 4DR7O 1HNZB 2R042 4P9YA 4GH4A 1W8OA 1RB8G 4B4RA 2Q67A 2Y6FA 4YHHO 1CX4A 3JD1A 3QO8A 1OH4A 1JZ7A 2YHJA 3VBSB 3S0MA 1RIRA 4JI3O 1N32B 1NXD1 2XLAA 4ATFA 3RN4A 5IVBA 1PO21 4HSLA 4YZ5A 4RO2A 4HN1A 4QB2A 2JICA 1CVNA 1S1AA 3L9JT 5CBHA 3JB8A 1VBD3 1SDWA 1IBMO 1E5SA 2GMEA 2VZVA 2ZZQA 1VP6A 5IWFA 2FHRA 3N2GA 4B7KA 2UUAB 4A3XA 1STMA 3H1LH 3FFQA 3MPPG 2JS5A 3A2FA 2VVDA 5BR8B 1AR91 1MQTA 3PJQA 5C9AA 1WPBA 2D43A 1NLQA 5I93A 1LAJA 4XEZA 3N27A 4R50A 3CCLV 4Y3OA 3C7HA 3JBG3 4L87A 1LCLA 1GICA 4IESA 3MIDA 1CJPA 2ID4A 5ACA1 2A5ZA 3AYAA 4NPMA 1B35C 4ZXEA 3VDDB 4LE4A 3SEEA 4Y20A 5DEDA 4XYXA 3UL2A 2C24A 3WSOA 4Z2AA 2VO5A 1IG0A 3MHHC 4WM7A 3RZJA 4IGOA 3AL6A 2JE9A 1IS6A 1LKNA 2W3JA 4M3CA 4IEYA 4F3JA 2OPKA 4XZUG 4YSFA 4NHYA 2XR4A 5JSRA 3WP5A 3QTCA 3CXHF 5IFPA 1NCQC 3BABA 3O1VA 4NAOA 4QGNA 1L0LH 2HWE3 4XMIA 3QG5A 3HNYM 4YZ4A 1UZ0A 4HVOA 3PIJA 1V70A 3GVMA 2DQ3A 1K4CC 1UPSA 2N05A 2UU8A 1DZRA 2CDOA 3TCUA 4GKXA 4OZXA 2BFUL 3SC7X 1ZL8A 2DUQA 2JDIG 4DV7B 1NYWA 3CNAA 1AILA 1BZKA 5FPZA 2SBAA 3FYEB 1GZCA 4XFCA 4BQ2A 4MW8A 2JIGA 2RS33 3O65A 1MVQA 1S4CA 4EN8B 2DYSC 2CTWA 1TMF2 2DCJA 3SJBC 2R30A 5KC5A 3PJSK 5FYZA 2H0BA 2FD8A 1C8NA 3JD0A 1ULGA 2OT5A 4TTGA 3HQUA 4DRVA 5CG8A 2H3OA 3TWIA 1MS5A 4LKFA 1YJNV 4QPWA 3NO8A 4NHMA 1F5JA 4NIIA 1ZRFA 2F23A 3K77A 4R4ZA 1WNSA 5EWSA 4AHXA 1IX9A 2W92A 3WW2A 1RFYA 4XJ9A 1I9RA 3MZHA 3ORJA 1VBC2 4IETA 3ZVXA 4HPKA 3VZMA 1AR62 4ISQA 5T5OA 1F9KA 2ZX0A 4MGSA 1MS9A 4S2FA 1QH6A 1NVPB 2CU5A 1ZZCA 1VF7A 2UXCO 1Q90D 5IT6A 2EINB 4FIPC 2OIIA 1MS3A 5LYJB 2D6LX 4DR3B 3RYHA 4OHXA 2M7WA 4DEVA 1EN6A 3R66A 2N74A 2HH9A 4F6EA 3FB7C 3ZYRA 1JR9A 3AG2B 4CUAA 4LT5A 3UGHA 3AK2A 4E27A 2UUBO 4DB5A 5AG2A 1PO13 4O2BB 1NT2B 3CKHA 1SMVA 3MGUA 1N34B 2PHDA 3LDRA 1C8M2 4DW1A 2DYSB 1OLRA 1BXHA 4QD2A 2BJSA 2BBVA 4BQWA 5DUWA 1ODMA 1HP8A 2HLEA 3FAVA 3I3BA 2QWQB 3QVNA 1COWG 2HBTA 2QGNA 5F3GA 3RYFA 2Y33A 4EWAA 4AOCA 1FYUA 1UZZA 5CISA 3M7AA 1NLRA 3T1CA 4JTNA 5DAPA 2QWNB 1X59A 3DYPA 1MZFA 4XFFA 5JJNB 4CCDA 5C5TA 1YI7A 3NXSA 4YY3B 4NXNO 3WNMA 4IL7A 1OC1A 3JD72 4DV5B 2EBOA 1IOAA 2VQFO 4Q0UA 5BNNB 1J3PA 2BW8A 1C1FA 4CEWC 2OX0A 1RSOB 3KG2A 1O3RA 4C91A 4ABMA 2YPJA 4ORFA 1LOFA 1ZBA2 3THCA 1V6LA 1ZZ6A 5A3UA 3HVDA 3CRAA 1NH2D 4PA6A 1MSDA 3RW0A 2WC2A 2HP8A 3VLBB 1KGYA 1KQRA 1POV3 2DU0A 2N7GA 1JZ3A 1HXS3 5LATA 2PGGA 1QOTA 1XSRA 2VCMA 5J96B 5H6QA 1ZBA1 3BB6A 4IGPA 3T0AA 4AI2A 4N7UA 1RXGA 5EZYB 3I2KA 4JTCB 3MBWA 3OYWA 2QQUA 4PLMA 5F2SA 5IAVA 5LP6C 4C8DA 5SV8A 4TOIA 1AF9A 2ZE5A 3THOA 3VHRA 1POQA 3CQOA 1UXXX 2QQVA 5CBFA 3HKEB 1HX6A 1DK1A 2ZGKA 2ZJCA 2WFF3 2JG8B 3GJAA 2RM22 2AEYA 2JIJA 4I7ZB 3HKBB 4DR3O 5CZKA 3H1JH 2ZEYA 3DTUB 4AFDA 1XXNA 2QDRA 1V54C 2CSGA 2GZWA 2ZR3A 3AP7A 2AYHA 1JZ2A 4GH4C 2JB8A 2F95B 3MHZA 5HBAA 4ZKTB 4JV4A 1L0NH 2V1DA 3QH6A 1RUC1 1XU2A 2XJTA 1JYNA 3KSCA 4QGPA 4D6TH 1O59A 4CCMA 5DAWA 3TBDA 4JKLA 3TGUH 1A8MA 2F93B 1SZTA 2HKOA 5B4XA 1G9FA 4AR2A 3VDBA 2GP3A 2A9HA 2RDRA 4DR5B 5EBLC 3S6PA 1KXGA 2EULA 1SQGA 3H9AA 3S57A 1M56B 4OULA 1AR63 5IK4A 2F1MA 1MR5A 3WZ1A 4IV3A 2XDVA 4YW4A 4XE9A 4O4HB 4N8MA 3WEZA 5LL6Y 2BWAA 4EWDA 3GXUA 4GKKO 5HCFA 4QQPA 3LFIA 3VBUC 2LUWA 4XBFA 1FKAO 1BS3A 1IXMA 4KP4A 4A42A 1ND2C 3WXPA 4W4KA 5I0RA 5KHGA 3S3WA 3SITA 2UY9A 1R082 1RUG3 1V6KA 1NU1H 1OA4A 1CX1A 1VF6A 4X8NA 2CGPA 3H50A 4PCRA 4XDOA 1VBB1 4NJ4A 2A3QA 5DN2A 3ZIAG 2WLQA 4O2AB 3SH3A 3QO5A 1GQPA 5B1OA 1M57B 1PM9A 4O4HA 1COV1 3AG3B 1VJ2A 5IYDO 5FP3A 2A6VA 2W0XA 4J9ZB 1XNQB 2W87A 5K9YA 5AFEA 1NTKH 2VY0A 3CP1A 3ML0A 1PVXA 1DYOA 3IPVB 1BMV1 1CZTA 4BM8A 5GLWA 1HRI1 3SPHA 4N21A 2JJ2G 1MEC1 5J09A 3WD5A 2ZOEB 2WNOA 1VRH1 2FDKA 4H55A 4Q2FA 3CU7A 4M00A 4CDWB 4JV5O 5DM6V 1A32A 3K75B 1W6NA 1NOVA 3N36A 5DAVA 1YFUA 4ZHQB 5A7NA 1GM7A 1ZA7A 2ADQB 4GX0A 3CIHA 4JI2O 3PMSA 5AFBA 1H6XA 3U4XA 1KS5A 2RMKB 5FMOL 5CA1A 4OHYA 1Q6UA 5C4WA 1RUE3 3U14A 3K0DA 1Y76A 4LWSB 3O0VA 3NSTA 2ZBJA 1QXRA 3B8NA 1R1A3 2XJRA 4OI2A 2ZKLA 1SETA 1BHGA 2XG3A 1SCSA 5KX5B 3MFCA 3U10A 4TV8B 1XL4A 2R1DA 2WRAA 2EX3A 3ZBHA 4LLOA 3UGFA 1OHHG 1YRZA 2RDSA 2OS2A 3HBKA 2LGQA 1AZDA 2ZD9A 5BV6A 4LFAO 1YSCA 4M3CB 3C7GA 2ZGPA 3EVKA 3QLQA 2IZWA 1NZIA 2BSKB 3OW2U 1UY4A 1UIJA 2X05A 4N53B 3RWRD 3SYAA 1R3KC 1COV3 2EVXA 4XHBA 2LFSA 4P9XA 4CCEA 5A6ZA 3ECQA 3A0BZ 4KGGA 1RUD2 2XVKA 3ZSMA 5A3WA 1RM1C 3T09A 3JD2A 3POWA 1DTOA 4J9YB 2EJ7A 4QX7A 3D36C 4QHOA 1QOSA 4LLFA 3ZYHA 2KKWA 4Z2WA 2P6JA 4AFAA 2ZABA 1RUD3 4ZHQA 1IXBA 1MZ6A 1H1IA 1QIQA 3AG3C 5A3PA 4DUXA 4GALA 2F4LA 4XFBA 1W9FA 4LBQD 4K0KB 3HBZA 3ASOC 4KFMA 4JRAA 3W5NA 5IATA 2FZ2A 4A44A 4YZ2A 1OF3A 1W8HA 3JATB 3ZRSA 3M70A 3WF3A 2Y6GA 5KA6A 5KBFA 1XEQA 1HQWA 3FJSA 3G7DA 4FFKA 2OCCB 3LDCA 4H2AA 4XJ8A 4LOTA 5JIUA 2QA4V 3INAA 2ZKOA 5FZOB 2GC3A 5DABA 2BTQB 5I0SA 3WDVA 5DDJ2 4P9JA 2JG9A 1Y9QA 4IE5A 5KMGB 3LSUA 1DG6A 4GZ9A 3K9AA 3JB4C 4OPAA 2P6HA 1U5YA 2B1GA 3VQWA 4P5YA 5T54A 2OIEA 4PI0A 4JI8B 2OYQA 4DFSA 3HKBA 2I2SA 1F4AA 3R6SA 4EN0A 2ZGMA 4NR1A 1WCSA 4CSWA 2QWOB 1F15A 2AZ2A 2EZPA 3I2DA 3I2OA 1RP3B 3RYHB 2Z2SB 5ANQA 3NAPA 3P5BA 1CWPA 4UVBA 1NY71 1FPN1 4UBGA 4J42A 3WNLA 4MGQA 5ISLA 4QPIC 5LA0A 4CH4A 1LEMA 1Y43B 2W0FC 3IDBB 4Y22B 1NT0A 2HKXA 5AVAA 1LOBA 3GHMA 1DGSA 3Q9OA 3ZOIA 2WS92 1YI2V 3TB0A 4AL9A 1XMQB 4H14A 2L6LA 4O9EA 5JVDA 3ZMNA 4ASLA 4XCAA 5IJ0B 3UESA 4JTAB 3ZN6B 4RR3C 1X8EA 3ZHQA 4N9IA 2GTSA 1O3SA 4L9BA 1IBMB 5FZBA 3TXSA 4DIQA 5KHHA 2GNBA 3H42B 4I3PA 2HR3A 2NQYA 2GSMB 4COWA 4FLYA 2FDIA 4FLZA 2O8OA 2QTSA 3FMGA 5KXDA 3JCZA 4BQ3A 1CEZA 3KQ4B 2VZPA 5L7OA 1RUF3 1S0BA 2W1QA 4IDZA 1J5EO 3I2JA 3AC0A 2WZR1 3JARB 3BVOA 2BOBC 3JXSA 5FPVA 1R1ZA 1BHBA 4HAMA 3Q4HB 4JQTA 3VDDA 3CC7V 3VBHC 1NCQB 1UYYA 5BNPB 3D3AA 2E9QA 1SLTA 5FYHA 3AMQA 3H7YA 5FYMA 2JD9A 1R083 2WNVA 3ATGA 1VQ5V 2LO1A 5BY5A 4IEPA 2VOTA 1PPJH 4RHV2 4MHUA 1Y67A 1S5HC 2ZAHA 5FZ9A 5LBFA 1CONA 2W1UA 1KJRA 2CUGA 4MSWC 1ND3B 4O61A 3EMRA 4PT6A 4TV9B 1U5ZA 2QM4A 4H44B 2RS53 2E53A 4R52A 4CDQB 2ZIMA 2FCVA 2EALA 3IN9A 3MFAA 5FWJA 3PUSA 5H9PA 4BJ0A 1AI5A 5LA1A 1HKDA 1N1VA 3T1HB 1TNRA 3JAKB 2UXBB 2VW1A 4JI4O 1QLEB 3JZVA 1K3EA 3OGIB 1C1LA 3AK1A 3ZMSA 2WO7A 2FCUA 1W6OB 5EIYB 1W3XA 2WT1A 2D44A 4O4JA 4HONA 4JASA 4OVEA 1RUH3 1H1AA 1RPOA 2JS3A 2XHBA 3CCSV 5HI0A 1R092 1LU1A 2R9IA 1PIV1 2IXKA 4MW3A 2FMDA 2A71A 1YUDA 4UFMA 1FJGO 5BMVB 4AEJA 1JQ0A 4CXXA 4XURA 4FPGA 3D4KA 5LA9A 4DV0O 1UAIA 3K51A 4DV3O 2D6MA 4JGZB 4KU7A 2WAMA 1HDJA 4RD7A 1V55B 4ZY9A 1NKGA 2IC1A 2WINB 4M3CE 5DN6G 2R071 5FP9A 2RS31 4PHZA 4BXSV 4XW3A 3LSSA 1NCQA 1AI4A 5BNPA 2WZ8A 3AG4B 2VS0A 4BMBA 1MABG 3JSNA 3S3XA 1P4RA 1JYXA 4XXPA 3E8FA 1I3HA 3J9SA 4XCBA 1I1EA 4QGMA 4QB1A 2Q0AA 3HD8B 4ES8A 2CGNA 4LBQA 1XU1A 2HWE1 5FPBA 4GA9A 4Z1MG 4PA7A 1SBDA 4COUA 1J5EB 5C8WA 1CAWB 2XLFA 1SQBH 3JCIA 3H0OA 3B00A 1YC61 5LBQA 5LGTA 4I0XA 3A8TA 5A6YA 3VKOA 1L7RA 5IT9N 4OMCA 2ADDA 5APAA 3K5NA 1JYWA 4URTA 2EXHA 5K0UB 4KMQA 3MW3A 1N3QA 3ZRXA 4FM0A 5F6KA 4PQ9A 3WU2Z 3WW1A 4YG0A 1V6NA 1X9PA 2PHLA 2ZEXA 3AMNA 4DXTA 4A7ZA 2FDFA 4R9DA 5D5QA 3ABZA 2J1SA 5EV7A 3VUOA 4UXNA 1RUJ2 2KQXA 4ZHNA 3N7MA 2W46A 4JDMA 4AYUA 2J1UA 5EBWC 4YY3O 3MHSC 1OCCC 3LNNA 1GKFA 1OXCA 3LE0A 2XAFA 3RSJA 2VQ0A 4QKNA 1CXZB 4OUMA 3K06A 4RQPB 1P84F 1BMFG 1M9NA 3MF9A 2GC1A 4X89A 3W7WA 2DURA 4NIAA 4TXWA 2WLLA 4GJYA 1SS3A 1OA3A 5CBLA 1R64A 4NTYA 1JYCA 5K7PA 1RJ8A 1QU0A 3G6JB 3O1MA 1PHMA 5EIBC 2JKXA 4DNYA 1C5IA 1EFRG 2KG7A 1Z7S3 1EP0A 3FLRA 4DK0A 4JI2B 3AG1C 1PIV3 4IUGA 3H1MA 2YDEA 1ZRDA 4CCLA 4CDUA 3PU3A 3DN7A 2KM2A 4L8JA 4XMAA 1TGOA 2ARAA 4JI0O 3DF0A 4N43A 2BRTA 3ENRA 1JYVA 1H6YA 3BTZA 4HMZA 1WCDJ 1NQTA 1AR4A 2VCAA 4X65B 2FL4A 3PUAA 4COVA 3SYOA 4YXWG 3T4ZA 1V6JA 5LHGA 1QQCA 3V0BA 4AEDB 1OQEA 1JU3A 1WUVA 1AX2A 1QNMA 3RYCA 3FL7A 2NPIA 3OEAA 4LNUA 1UYPA 3V56A 1F4HA 1JU4A 4YVSA 1YJKA 1MS8A 1NS1A 1Q6IA 3X2QC 3EBRA 2J42A 5T50A 1LJ7A 4OUSA 1QJY1 4P14A 1RINA 5JSOA 4CU9A 1RUE2 1K33A 4CU6A 4I02A 3I5DA 3RI8A 4CEWA 2QWPB 1JUHA 4DV3B 2RMU2 4ONUA 5FMCA 4AZZA 3STLC 3SH4A 1PM4A 3GJBA 4X64B 5JPMB 3V0BB 2PYJA 3RYKA 2AUYA 5JZGA 2CTQA 1FXKB 2Z42A 4OX9O 2JB4A 3W7SA 1Y6XA 3POJA 4GYCB 4OFGA 4AI9A 4NVPA 3AJYA 1NKDA 4CCOA 4JHTA 1LHNA 2VC9A 5HCAA 3B69A 2ENRA 3ZMZA 3HPLC 2VZOA 5DDJ3 1O91A 3AJZA 1CZSA 1R3JC 3RZZA 5FAXA 1F51A 2XH6A 4ZU4A 3POGA 2WSSG 4B3TO 2E26A 3LGRA 5DAQA 5CB7A 1SFNA 3QD6A 4QKFA 1OFNA 3UQ8A 2QDNA 1N1YA 1KD7A 4AEDC 1WLWA 3ZRWA 1IBLB 3ACFA 3WQ7A 4S2GA 4CS3A 2YEVB 3NJYA 3ZYPA 2BEOA 4YFZA 3K59A 4AHZA 2EZOA 2DTYA 3C3SA 1GMGA 4FPPA 2QM7A 3SJQC 4FAGA 1RUG2 2UXCB 3F7YC 3RI9A 3P6BA 5A32A 2RN9A 3RGBA 4CC5A 2ZZJA 2GHYA 2IXHA 2WNVC 4Y22A 3O5SA 2ZHNA 4FT8A 4XQWA 3ZO0B 3FBMA 2X0LA 3GCXA 1A6CA 5EJ1B 5JMCA 5LP6B 2E51A 5D8AB 5IFTA 1FNYA 4EROA 1DU3D 3O1TA 3RYPA 5JDBA 2QKSA 5IJ0A 5E1AC 3OPWA 2OUHA 3R65A 4QKBA 1W28A 2OXBA 4QKDA 2A6WA 1TNFA 4L0PA 4MLOA 1D4M3 4AHYA 3Q8CA 1ZBE3 1EAH1 2QZ3A 1HXS2 1M90W 5J2UB 5K8SA 2ETNA 2Z5UA 1YJ9V 1VIWB 3MIGA 3NV4A 1GFF2 3IAPA 4FFBB 3K57A 1BK0A 4TUYB 2RR13 1PMHX 1ZYBA 2BPA2 4DO2A 4G4FA 3ZKYA 4ZONA 1K9MW 2VBPA 4FPHA 3WP3A 2EAKA 1EUUA 2A6XA 4DY5A 1XMOO 1ND2A 5GJ6A 3USUA 3KQRA 3KF5A 1D2QA 1SLIA 2WSUA 3ZX6A 3R4SA 4WBNB 2HVJC 1SLAA 2WA3A 4J7KA 2K1EA 4QWNA 4BB3A 1AYN1 3LQCA 4IV1B 4NHLA 4Y5Z0 4BLIA 4EKWA 1Q6HA 1M1KW 3VD3A 2Q0OC 2XKOA 3GCWA 2A79B 1UYXA 2YROA 4ICGA 3HKCA 1DQ4A 1PNMA 2K2SA 1VAMA 1AYM1 4KU8A 1MVEA 2GH8A 3J81N 4NOTA 2VECA 2ZA9A 1G6NA 3K4AA 4TV9A 1BBT1 2KD7A 4K9SA 3VBFB 1SQPH 4I09A 4JZGA 5GONB 4NUBA 3TAYA 4D3WA 4P9WA 3UCSC 2GDSA 1DZQA 2RR11 4JZRA 4Q4V2 3FFZA 4AGGA 1XB9A 1W6QA 1O3QA 4HKWA 4AQ6A 2QNKA 4YG3A 5DG2A 1QJX3 3OMIB 5EPAA 1VBA3 5BNOB 1UY2A 1Q8SA 1N36B 2VBDA 4YGEA 4LF4B 3AL5A 5KLVH 3ZSKA 1YF2A 4DQAA 4BIUA 3ZXGA 2TNFA 3IFXA 3CCQV 2IVJA 4K40A 4FBFA 1BT8A 4DXSA 3MPBA 5CKQA 4KL1A 4AQYB 2WKKA 4KXRA 4EYUA 2B5HA 4KHPO 2HYXA 1ND2B 1UPGA 3MF6A 1H2MA 2RDQA 4LQRA 2F66C 1JS9A 2YPDA 4ARYA 1HDKA 1TVGA 1O4TA 4XTMA 1HR0O 3AB0A 5BZBA 1DF4A 3UNPA 5I8YA 3OB8A 4ZIBA 3CRRA 1O3TA 4ZBMA 3MV11 1HW5A 3ME2A 3OT7A 2LJ2A 4Y26A 1SLCA 1G8MA 4GUNA 1ODNA 1N3OA 4GT1A 4BXFA 3PU8A 2E3CA 4LF9O 3SCHA 1YQCA 1HRI2 2PF4E 1KMIZ 3VBFA 3LDDA 3N4MA 5A70A 4LWSA 2GNMA 5EYXA 2R072 4DUZO 4L92A 4AHWA 5B2GB 4HLTA 4HPKB 2Q8CA 3ZXJA 4YIPA 3KV9A 1Y66A 1WD4A 3CJHA 1AB3A 5CFDA 4CP2A 2NN8A 3JUUA 4BCUA 4YWAA 2C9KA 3CC2V 2Y0PA 4BLJA 4MX3A 4X66O 1WLCA 3EFFK 4FSJA 3ABMC 4JI1B 3G80A 2H6CA 5HV4A 1QNYA 1R093 2QE3A 1GUIA 4IE7A 1KDKA 5DDJ1 3PTRB 2ADEA 3ZMTA 1ACCA 4YJ3B 4O2BA 5C8YB 1S77D 4FPYA 4HVQA 3KMHA 3WG1A 4Z82A 1W59A 5A2QN 1NCRC 3PTYA 1Y9MA 3RZHA 1WMXA 4FLUA 1ZBE2 5EYYA 4YGCA 4LIVA 1R1BA 4RFRB 3K08A 4MSVA 4OI1A 4Y24A 2A73B 4X6QB 5LYJA 5C93A 2RE9A 2WLLB 2CTVA 3JASA 5C33A 5J7MA 3E5XA 3OBAA 2CH7A 3M3CA 4PJ0Z 4K8XA 5LRSA 1AJQA 2XOKG 4IIJB 4Q20A 3C90A 2XONA 1RMU2 1AR61 5A6QA 2C0ZA 3UV9A 4LBLA 1UMHA 3WG3A 3VB9A 2XXZA 4RR3A 4A4AA 4JGYA 4RQFA 1YO8A 3OMAB 3PDQA 4QM9A 4V1PA 1PVC1 4D6SA 4J10A 1GP6A 2EXKA 2OCCC 4GCZA 1QJX2 1HB2A 2XHNA 3AP9A 3ILNA 2Y48A 4UCVA 5IY5C 1X33A 1TME3 4FFBA 4A5UB 4UFLA 3ELNA 5KMGA 1Z7S2 1G9DA 4E9KA 1XQ8A 2WQ4A 2LS6A 4K3UA 4I55A 1KYOF 2WL1A 4QDRA 4LITA 4UV8A 3SLIA 3LB9A 1PMJX 1PO12 5HCHA 1W9WA 3CF6E 1J59A 4H37A 2D3SA 1AXYA 5F5IA 5JXJA 3VDAA 3NV2A 3M2MA 1YHQV 5F5CA 3TOJA 3VBHA 1QJEA 5GZFA 3P30A 5BNNA 2HEWF 1AI7A 3A0RA 1GQGA 1NY72 3HIFA 3F7VC 3CB2A 5C7GA 1PK6B 3CC4V 4JHZA 4R4XA 5L9RA 2VW0A 2PMWB 1SLBA 3W7TA 3HJRA 2B1IA 3J7HA 3WFVA 3CZJA 4SBVA 5JOXA 2JDPA 3HWJA 2E32A 2RNBA 3LA7A 3TEWA 1MA1A 4PD4F 4X1YA 4XQ4A 1OUXA 2DUPA 4ZI7B 5F32A 3NNFA 3JAMN 3IZOA 3KHCA 3K79A 3K5OA 2R0HA 1VP7A 3NR7A 3IPVA 1THZA 4LFBO 3BIEA 1AP5A 3ABLB 3E5UA 1ASJ1 1AX0A 3UKNA 5HXMA 4N7IA 2WR9A 4GWMA 2E31A 2DWEC 2PI4A 1DLBA 4GJZA 4YHHB 4JI6O 4B8EA 1OUSA 1RGSA 4MGTA 3CS5A 4LF7O 2VQFB 1Y9GA 4XDPA 2PUSA 4YNIA 2A7WA 1LULA 4I55B 4XILA 1MSWD 4JI8O 1W6MA 5A7PA 5JUVA 3H8UA 5C4WB 4LO6B 1V6MA 4JI1O 4EN7B 2JDHA 1Q8QA 1ND3C 2VUAA 1M93A 2QVSB 2YXSA 3HPNA 4CXWA 5C70A 3IC7A 1GV9A 5A6XA 3SPGA 3I2GA 2RS12 1NE4A 3HKDA 4B3NA 3DXRB 5JAXA 3ZSLA 2AW9A 1UZVA 1D4M2 2VUCA 5FZ4A 3WY6A 1FMD3 3BGAA 2I74A 2UURA 5LMUO 3O1PA 2R041 1SKVA 2YC4A 3X29B 1IQAA 3B09A 1OCCB 5DAXA 4LF6O 1ZUQA 4HXCA 5IK5A 4AI0A 4HETA 3W9AA 3T2OA 2V72A 1KBHA 3OFNG 4DK1A 3G6EV 2G9FA 3OGGA 4RUEA 2HHHO 4YFWA 2G1MA 2ZGUA 4R9CA 2P6CA 1FMD1 1TG7A 4SLIA 5KXEA 4L8QA 3IDAA 1YIFA 4J7JA 1ST8A 2BVBA 4AW7A 2ES3A 3ACHA 4XHXA 5EXOA 3RYCB 4LF8O 2D6OX 2HWD3 3NV1A 3LAGA 4JI0B 4RGGA 4W6YA 3TEXA 4DR7B 1NQJA 3RFRA 3DYOA 3BCWA 4PF5A 1GOHA 2Q1FA 1UX7A 2D3OW 2ZEWA 1YFWA 4YM1A 5TISZ 1FT9A 4WZFA 4OCTA 1FOD2 3SHRA 4QU1A 3JD4A 1YQ2A 1AR1B 4PELA 4DRRA 2BE3A 2DMXA 3SXWA 5GZEA 2IFWA 2ZGRA 4XJAA 2ZGOA 4I30A 4CP9A 1YQ8A 3RZMA 2CAZC 3IDCB 4LR4A 4QJFB 5EC2C 3AEIA 4AI3A 3TN93 3OR6C 1K5MA 2WABA 4JV5B 3VKNA 1K12A 4FPCA 5C8CA 2MEV1 2PLV3 4AFBA 3M99B 4QXBA 3FX7A 5L3FA 5KUMA 5A3MA 1HJFA 2DCZA 4JI6B 4FMTA 2EIMB 3RMYA 4CPBD 2E63A 3MUZ1 2B8MA 4BW5A 3ACGA 2WAOA 4GXLA 1JA8A 2RCVA 3K9SA 4Q4Y1 4AHCA 5J48A 3H3LA 5F3CA 2HJDA 3JALA 5E79Z 4D6RA 5JWPA 1JVMA 1AX1A 5FDBA 1D4VB 2NMNA 3J7LA 3LKJA 4Q0VA 3WF1A 3VZOA 1J95A 3R0RA 4K35A 2D5HA 4NO4A 3WLUA 3FD9A 4CBCA 5F37A 5GM0A 1BJQA 5A7QA 4N43C 2B45X 5K0UC 4QPYA 5F9TA 3RWNA 1NG0A 3WNXA 3OBZA 3I3MA 5JI7A 4COYA 4JYAB 2BP6A 1XQNA 1J84A 4GH4B 2R1BA 1V6OA 3H1HH 5FLXN 1ZNPA 1H38A 4KWUA 2VMFA 2MNGA 1FXHA 2G19A 4B3SO 1H2SB 1JOJA 4AQTA 2Q4SA 3ZFFC 1N1TA 3AKPA 1CD3G 3CCMV 1VMJA 3OGSA 2YFUA 4D69A 2I45A 1OLQA 4LF9B 1LHWA 3ZHRA 1DQ2A 1GOGA 1UN1A 4CPBA 2ZNJA 2Q7GA 4YM0A 4UVCA 2W08A 4G28B 2P2KA 4AK3A 3OTOO 5JOZA 4UCTA 5LMUB 2WQZC 5FOBB 4LF8B 3CO2A 4O7XA 1JX9A 1PD3A 3AG2C 2FMLA 3AG1B 4AEKA 5GKAC 3WB2A 1LECA 1PVC3 1BHAA 1WBLA 1K7DA 2O14A 3VN4A 5JOYA 1YNAA 5JIAA 2HHHB 3USUB 5JR2A 2Y0IA 3NAPB 4X9QA 2ZGTA 4AE2A 4A7YA 5LHIA 2BV4A 1IS4A 1EM1A 3DCQA 2EJRA 4S2HA 3LA3A 4JYCA 4RUFA 1DFQA 4AF9A 1VQLV 2WNUC 1VMGA 5F8PA 4OQ9A 4OMDA 3AXDA 4URAA 2QTWB 3N35A 1LR5A 2A3XA 4HL0A 1QQP1 2YICA 3T1YO 4DRXA 3HOBA 2OPWA 2IJHA 2EAAA 3GWKC 2ZPXA 3H3UA 4BZ4A 4X64O 2JDKA 4HVRA 2WSVA 2ZXQA 4LHNA 5LB6A 4MGZE 4WCEV 1Q8IA 1D0HA 4M4PA 2ZHLA 3BA9A 2AENA 2XJPA 1QKQA 4PDMA 2YIBA 3SYCA 5FPOA 5LXTB 2V7QG 1RUI1 3AM2A 3A7QA 4GMP1 3D82A 3V0AB 1WLTA 3ASIA 5CB4A 1H1MA 4JPRA 1SC5B 5EZYA 3U1XA 4BU2A 4QB6A 1ROPA 5L36A 4Q4X1 5CKNA 2VMHA 4LBMA 4DR1O 3MW2A 1XSQA 1K5QA 2JGUA 2VTFA 4XC9A 1QWRA 4UOJA 4A6SA 2Q9LA 2JK5C 3AP4A 1KS4A 2A3WA 1DGLA 3E35A 5EP9A 4S2DA 2JXAA 5GTHZ 1PNKA 4X20B 3CCVV 2VR4A 1OFSA 3AG7A 3U78A 4QXHA 4M4RA 1W2OA 1FPN2 1CAXB 1CIWA 1OCOC 1R1A1 3QOPA 2F4PA 1JZ4A 1ZL8B 2IH3C 3LUTB 1K42A 2E7AA 3LD8A 3ZEDA 2Q4PA 1J58A 4NHKA 1BVP1 2D97A 4LEJA 4O65A 3RS6A 2Z3YA 1ORQC 2B39A 3W59A 4HYOA 5A1LA 4ASUG 3CDZB 2EILB 5H9RA 4NN0A 1JODA 4GB33 1LNSA 3AP5A 3P3NA 4XFGA 1HN1A 1OT5A 1IPSA 5B1NA 2VW2A 2P4EA 3AZXA 4CH6A 1IPJA 2BERA 5CB4B 2GSYA 1SCRA 4YARA 2HVKC 4MADA 1WW5A 1DLLA 1PGSA 1RM1B 5LY2A 3ZIWA 1RUG1 2WLIB 4F83A 2ZGNA 3N7LA 5A80A 5EYPA 2DVBA 3L70H 4XJWA 2D40A 1BZWA 4DUYO 1FFXB 2Q69A 4JAAA 1GNYA 4O4JB 2F4VB 4QX8A 2R7EB 3ES1A 1BBT2 4OZOA 2XBO1 3W5MA 3IM0A 1OURA 5CG9A 2IXLA 4DPNA 2JDMA 1OMIA 5EK0A 1C4RA 2QWRB 1HXS1 2JDNA 1Z78A 5FXVA 4UW6A 5IYZB 1BBT3 1WD3A 4A45A 2A7AA 3ZXAC 1AR5A 4LK6A 1FV3A 3AMPA 1HNXB 4FFFA 5LEKA 1GK9A 4IT5A 2JRIA 1MMMA 1EAH2 3ZXKA 4LFCB 1V0AA 3T2PA 3BUCA 5HFLA 3H7JA 3GYDA 2BTQA 4B3RB 4IERA 3ZR6A 4O4LA 4WBNA 3LCPA 5LBCA 1FMD2 3APBA 2LM3A 4BA6A 1N1SA 1HB3A 2QM8A 1A3KA 1WGPA 2ZT9B 2ZMNA 4CDXB 5FP4A 2VD7A 2DVDA 2QQMA 1SQVH 4JAUA 3T1LA 1AR92 3NRUA 5FZ7A 1N33B 5LBBA 3B2EE 4L11A 3AMHA 5JXGA 1C3HA 1W6QB 2G9ZA 4PF1A 3ZFGC 2VQEO 1ZX5A 2EXJA 4UUJC 5BNQA 4O4IA 1XE8A 2CH7B 1K5MC 3WUCA 1GO3F 4U3JB 5C3PA 3D36A 5C8CC 3VHNA 2TEPA 3BTXA 1WA8A 4GKKB 1UOJA 1OD5A 1YXBA 2P3IA 2UWBA 1D4M1 4EFEA 4JTOA 3DL3A 5DXDA 1VQ9V 3A0NA 4JZ2A 2D6NA 2CTPA 3W7XA 4C0BA 3B40A 1IBKO 4MGYE 3VBFC 5KR7A 1F4MA 1KP3A 4CDXA 2E33A 3CMAV 1OHFA 1VBB2 2D98A 1YIJV 2XB6C 1OPMA 4AQYO 1S0VA 1LU2A 4H7MA 2W52A 1W03A 4Q27A 2GDFA 1J1LA 1CN1A 4BQ1A 4OXSA 1J1TA 3VQVA 3SPCA 1BMV2 4QHZA 4H3WA 1I0HA 1AJKA 3OTOB 1Q8VA 2CTRA 3B94A 4MS2A 5DUVA 2QSAA 2VM9A 4KI5M 2BGOA 3C3TA 2JG9C 5FPRA 5HFMA 1XNKA 4FLWA 1S0CA 2E7TA 1ENVA 1XNDA 4CEYA 4RR3B 5FR3A 3SGIA 4XUPA 1POV0 1WP7A 4LO5B 5CA1B 2BU9A 1XUQA 4NAMA 4G2KA 1JMUB 2PHWA 4BQYA 2ZE6A 4FZ0A 1NTZH 3W21A 5LK5A 2UXDO 4WBBA 2Y60A 4FLVA 1PL0A 4BIZA 4E8DA 5FY4A 4JDNA 2X6AA 2GN3A 2KA3A 1C28A 2F43G 1K45A 3ZIXA 3S7EA 3OCPA 5LA6A 3RVZA 2Q1MA 3O0XA 3R4DB 3IIIA 3OEBA 3LSQA 2K0GA 1B3QA 4CRQA 1PNLA 3OJBA 3OSDA 1S2KA 3ABLC 4NHXA 3IIAA 1JJ2U 2ZDIC 2I07B 2SLIA 4CEYB 3RYFB 2P22C 2JEMA 3MAQA 2DW4A 1AYN3 4LF4O 2Z5WA 3WX5A 2W2IA 4DV4O 2ET1A 4OUEA 4X65O 1OLMA 1PX4A 4AXOA 1UPIA 3BOWA 3N2KB 3T4VA 2DYRB 3KM5A 4WVVA 3C2UA 1FPOA 5FYIA 5C71A 1AL22 2RS13 3CJIB 1SF9A 4IEOA 5LOVB 5CVRA 2DJVA 5FZOA 1AVMA 2E7QA 4KGQA 3H8XA 2YI8A 1BEV2 3ZSEA 2UUCO 2JG8C 3ITQA 3SMHA 2BOCC 1NUKA 2XUEA 5FBJA 1V9U1 3RVYA 2P06A 1B06A 4GKYA 5KC6A 1XE0A 2CGOA 4V2WA 3DKQA 2R49A 3NNLA 4R8CA 3I2HA 2XT9A 4PDWB 1MNGA 1U5XA 1BEV1 4Q0SA 3E8BA 5LCWL 3FLTA 4IGQA 1V9U2 1HQLA 3CCJV 3T30A 4LKDA 2QKAA 3B5LB 3OUJA 1IURA 2EIEA 5CEHA 2ADPA 4K6BA 3ASNC 3WQBA 1ZSPA 5GLTA 4FFHA 2XVLA 3CE2A 2RMU1 1JFFA 1UF2C 2YI9A 1OJHA 4UAPA 3CLPA 2X8KA 4GULA 3EXAA 3JD71 3GGLA 2JECA 2G4IA 3CD6V 2WLMA 3ALQA 5A33B 3WDYA 3NNMA 1XYPA 5FLJA 4YLZA 1DCSA 4I50A 1JW6A 2YGMA 4I0BA 2ZX4A 1GZTA 2GN7A 4W8JA 2LW8A 1LB2A 3N3HA 4Q4X2 3KVBA 2GU9A 2HWD2 4D7TA 4ARXA 1UU6A 4WM7B 2R0FA 2C2AA 4AAXA 3ZHUA 4TSFG 1V9PA 3JARA 5EFUA 5H5NA 2EIGA 3H8RA 3AG4C 1EY2A 3VD7A 5J98B 1O5LA 3JD3A 2EF6A 4CS4A 5B66Z 4LMFA 4XDKA 2WN2A 1VB4A 1BL8A 4J41A 3PIGA 3GBGA 4C0HA 2Y6LA 3L71H 2NN4A 4AGVA 2RS52 5LHHA 4V2VA 1C8M1 2YIAA 3K48A 1PV0A 3UO2A 1JZ5A 1C8M3 4O9GA 3KT1A 4WFGA 4OYUA 3IT8A 2CY6A 4TUYA 3I55V 3UGGA 5D5PA 4ZU5A 4Q29A 2QKDA 3VL9A 3T1HO 3SPIA 5BNPC 4LFBB 1S55A 2WWUA 3AK3A 1S0JA 5C3OA 2RJ2A 3LOIA 2IH1C 2C4XA 5EZWA 3CL1A 3GWOA 5K1PA 4FXKB 4ZI7A 5C6CA 2YU1A 4AVVA 1AYM3 1EPWA 3OM3B 1QLEC 4IHJB 3IC9A 1P49A 4BE3A 5L3DA 2LALA 1RUF2 3BA8A 1REDA 2YV8A 1UD1A 1N0JA 2AHZA 2VZTA 1FJGB 1TME1 1IQDC 4GWJA 1MZEA 2A6YA 5C5UA 3DGTA 2X53S 5FUNA 5L3EA 4YG6A 4CDQC 3IB3A 1OD3A 1GMMA 3I7DA 1RUF1 2A6ZA 3AYEA 3AVSA 2QFEA 3ZMUA 2VU9A 2ZE8A 1B35A 3H8OA 4QQOA 4YVSB 2WN3A 1LRHA 2DUOA 2QQPA 3MICA 2CAUA 2VNVA 1LHVA 3L73H 2HFEC 4HANA 3ZR5A 1K73W 3AX4A 4ZZ5A 1K4DC 2IXIA 3KT7A 4Y5TA 1V9U3 1W99A 4CEWB 1PNFA 3MO4A 1JMKC 2H94A 3F95A 4TSVA 5IVVA 1H4GA 1LUWA 1LOEA 1H2KA 1FNZA 4D0QA 3DXRA 2UXDB 3LIHA 4LBQB 3THTA 3SQOA 4GQ7A 1PZ8A 4UXAA 1V55C 1ZBA3 5LOVA 1ZVFA 1GNHA 1GP4A 2UXBO 4YIOA 1XNTA 4Z07A 1VLNA 2Z79A 3PNAA 1GTOA 2YY1A 1QF3A 4Y1XA 2YIDA 4FTBA 2ZX2A 4E8CA 3BY6A 1ZWIC 3ABKB 3MEPA 4NWWA 3TN92 2Q8EA 4B3MO 2ARBA 2XOMA 3OTFA 4AVAA 3NVCA 4RGAA 5ERLA 4B3RO 4OI0A 3VV1A 5ABJA 4I0XB 3VD5A 1SBEA 1QEXA 2RS32 4DV2B 1JYIA 1JPXA 1US6A 3H1YA 3VKLA 1Y74A 4O4LB 5JI9A 2VOKA 5K0UA 2IVIB 2RR12 3V65A 1YDXA 1QVGU 4X8PA 1Y76B 3CJIA 3BCCH 2Q6AA 1JZ8A 2E5LO 2HEVF 4YVSC 3VBOC 2XJVA
chains in the Genus database with same CATH topology
2PN5A 3MPBA 2R16A 4KL1A 2WKKA 2B5HA 2GMEA 3USSA 3VZKA 2ZZQA 3BTAA 1VP6A 1DF0A 1LOFC 1RVF1 2FHRA 1ND2B 2OZ6A 1R081 1WW4A 1QXJA 3O12A 1JR7A 3MF6A 1H2MA 5D8AA 4B7KA 4XF3A 2OG5A 4A3XA 5J3UA 3TNQA 2AREA 3FFQA 3MPPG 1HDKA 2O1QA 4QPGC 1I5ZA 2VVDA 1NLSA 1V00A 4YVWA 1AR91 1MQTA 3PJQA 5C9AA 3WUDA 2D43A 1O4TA 4XTMA 4TLFA 1QXPA 3AB0A 1FV2A 2CWSA 4M2GA 5I93A 2R32A 4XEZA 3HT2A 3ILFA 2HJIA 3JBG3 1LCLA 1O7FA 1GICA 5I8YA 4IESA 3MIDA 1CJPA 3PJYA 5BUVA 2CYFA 4FPOB 1O3TA 5ACA1 3FLPA 1HW5A 4L97A 4CP1A 3ME2A 2A5ZA 3AYAA 4JGYC 4Y26A 1B35C 4AFMA 3NWKA 3VDDB 1SLCA 4LE4A 4Y20A 4XYXA 4D7SA 2DU1A 3UL2A 2PTMA 1N3OA 3ZPYA 4WM7A 4R9BA 1UKRA 4MH0E 1UL9A 4QGLA 1RUJ1 3HQXA 4AI1A 1MACA 2H0VA 3SCHA 3VHOA 4AG4A 2JE9A 1OQ1A 2R062 2A75A 5ACA2 1IS6A 1LKNA 1HRI2 1LGBA 1HIXA 4M3CA 3VBFA 1LTEA 3N4MA 4IEYA 4F3JA 2GNMA 2OPKA 5EYXA 4Q0PA 2HWC1 2R072 4YSFA 4L92A 1PNGA 3V0AA 5JSRA 3WP5A 4AHWA 5DZEA 4BIFA 2BFUS 1ULDA 1NCQC 1WBFA 2VPVA 5T55A 3AZYA 2R061 5B2GB 1DQ1A 4MZUA 4QGNA 1OOPA 1X82A 1X8MA 4HLTA 4HPKB 2HWE3 1IPKA 4XMIA 4YZ4A 3ZXJA 4HVOA 1V70A 2ZHKA 1AR82 1UPSA 1RUC3 2PHXA 1WD4A 2RMU3 2UU8A 3KCXA 4YGBA 1DZRA 4OZXA 4GKXA 2BFUL 3PVNA 3JU9A 5JR7B 5CFDA 2NN8A 4CP2A 3JUUA 1F31A 1JH5A 2DUQA 5BNNC 1QNWA 4BCUA 4LUMA 4MUVA 4CP0A 1NYWA 3CNAA 4WVMB 1YCIA 5DZGA 5FPZA 4MGIE 2SBAA 1XNBA 1V6IA 1EYBA 1GZCA 4XFCA 4BLJA 4MX3A 2DYCA 4YLMX 4XF4A 1WLCA 2RS33 2OZJA 4FSJA 5F6LB 3T2TA 1MVQA 4LO8A 2H6CA 4EN8B 4JDOA 4M0HA 1TMF2 2DCJA 1RUNA 2R30A 5KC5A 1QNYA 1R093 2H0BA 1C8NA 2QE3A 2DVAA 1ULGA 1KDKA 5DDJ1 4Q4X3 4C8RA 3ZYGA 2JD4A 5CFCB 4DRVA 2P37A 5CG8A 3TWIA 1CAWA 1MS5A 1Y3TA 5FO7B 1ZRRA 3P3PA 4FPYA 4Q4W1 3EQEA 4TYSA 3NO8A 4NHMA 1F5JA 1YFYA 4JGZA 1ZRFA 4HVQA 3FHIB 3KMHA 4TWTA 4R4ZA 1NZCA 3WG1A 4Z82A 3SWTA 5EWSA 3D8CA 1DZTA 1OIJC 1NCRC 3PTYA 4JGYB 4AHXA 3WW2A 4XJ9A 1I9RA 1ZBE2 3MZHA 5EYYA 1VBC2 4IETA 4YGCA 4MSVA 3SCGA 4OI1A 3ZVXA 1REFA 4Y0EA 3VBRC 2DF7A 4Y24A 2A73B 1OOPB 4HPKA 1RUD1 5HSXA 4X6QB 3M3EA 3VZMA 4XIKA 3GZAA 1AR62 2RE9A 1PMIA 4ISQA 5T5OA 1F9KA 2ZX0A 1MS9A 3WG4A 4S2FA 1QH6A 4CDWC 2CTVA 5C33A 5J7MA 3E5XA 1QDOA 1ZZCA 1DGWA 5GLUA 3M3CA 1GZWB 4BMEA 5LRSA 5IT6A 2DCYA 3AK0A 2BTVC 1RUI3 2OIIA 1MS3A 2D6LX 4RS5A 1QJX1 1AR61 1RMU2 4OHXA 3FWEA 2C0ZA 4M01A 3UV9A 4LBLA 1ZZ8A 3WG3A 1ND3A 1F5FA 2ETEA 3PMEA 3THPA 1AR83 1G7YA 3C3VA 4RR3A 3WV6A 3ZYRA 4JGYA 2VUJA 1YO8A 1EV12 3OBTA 4LT5A