2XUMA

Factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRHSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 106
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2xumA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xumA01
2WA3A 3OD4A 3KCYA 4JAAA 4BIOA 4B7KA 2CGNA 3P3PA 1YCIA 4Z1VA 1IZ3A 4B7EA 2YC0A 4AI8A 5JWPA 1MZFA 1H2KA 2YDEA 2Y0IA 1H2NA 2WA4A 1MZEA 2XUMA 3D8CA 3P3NA 2CGOA 4NR1A 4Z2WA 1H2LA 3KCXA 2W0XA 1H2MA 4QU2A 2ILMA
chains in the Genus database with same CATH superfamily
1JOBA 3R05A 4BJ0A 1VQMV 3B5LB 2XL7A 3RWNA 3S0MA 4JI8O 1QMJA 2VMGA 4ZI7A 2BQPA 4GWJA 4HNAB 4I30A 3CBNA 1WB7A 2YXYA 1CPYA 2XJVA 5GZCA 1TMF3 1RIRA 4XF0A 4JAAA 2NMOA 1RMU3 2RS11 2FBEA 1SBEA 1H2KA 5F6LB 1W8NA 4FQ4A 2DUOA 3AKPA 4QQHA 3UJQA 2H6CA 4YM0A 4FI9A 1ZRDA 3N2GB 3LA3A 5FFOC 3M3CA 3OUFA 1VARA 5FUPA 2WWSA 5DUWA 1SLLA 4QKBA 4FIPC 3D82A 4YVWA 2EBOA 2RS53 4XDJA 2HWD3 4FFKA 3ABLC 5KMGB 2ZDIC 3E5XA 1S72V 3NKTA 1GQHA 1G8WA 1K5MB 3L9JT 3FHAA 3BA8A 3LCPA 1DZQA 1OHHG 1HWYA 4YZ4A 5FMCA 1UZWA 2RG4A 1AI7A 2AZ2A 1LHVA 2JECA 3ZSMA 3ROUA 3R0RA 4UW6A 1U96A 4TT3G 4N9IA 3BTXA 4I9WA 5FY9A 2VZ3A 2HVKC 3NL1A 2BJSA 3OGGA 1LECA 3AJYA 3FC0A 3BVCA 4P9XA 3RYHB 2D7FA 1K33A 2W3JA 4OXSA 1GBGA 2X09A 2QKDA 2Q73A 4OHYA 4PLMA 1Y66A 3NO8A 2F4VB 4EFBA 4BDVB 4QX5A 1YIFA 3LSEA 2ATKC 3E83A 3CB2A 1TG7A 1OUXA 3AZXA 2VOVA 4WZFA 3THCA 4CDWB 5DN2A 3W5MA 3ZYFA 2YYOA 4HANA 1RUG3 4LFCO 4ZOLB 1AXYA 3GNEA 1D5NA 3SPCA 1RMU1 4JI1O 1VQOV 3QF7A 3ITQA 5FZAA 1AR73 2ZJCA 5FDBA 3CJIC 1JU4A 4XHXA 5EFUA 4W6WA 4CPBA 1VBE2 4XJAA 5IWFA 5KA5A 1Y6XA 2WQ4A 4CXYA 4XXPA 5FAXA 4TOIA 3VOUA 4LBQA 3ZFEA 4KHPB 4IEVA 5LHGA 5JXIA 5HCFA 1EBOA 5DAPA 5FZLA 1X59A 4B3TB 3MICA 3W59A 1LCLA 5HXMA 3FBYA 1BZKA 3LPFA 2PHRA 3CD6V 2ZM6B 1H1AA 1YO8A 4BWAA 2GHYA 1IKPA 4OUEA 1RUH3 1JVMA 4ZKIA 4WBBA 2ZX3A 1XI1A 1BHBA 4DV5B 3OR7C 1C8NA 1G8MA 4D0QA 4HZFA 4EN9B 2Y38A 3AP6A 4Y4YA 2YBSA 2Q8EA 2ORZA 2ZE6A 1ZL8A 3BUCA 2QKCA 1PIV1 4LHNA 5A7PA 5A3OA 3MD0A 4PHZA 2HEYF 5B4XA 1RTVA 4OYUA 1AP5A 3Q8CA 3A0KA 3G6BA 5KXBA 1QHDA 1S3JA 4R4XA 1BT8A 3K59A 3QLQA 4DV3O 4UAPA 5E6HA 1OCCB 5IYYA 1NTZH 1NE6A 3ZRVA 3HKCA 3P1IA 4AGVA 4DR7O 2JICA 1ASJ2 3PUQA 5FPUA 1VQ7V 5LYJB 3HNYM 5KWRA 1QXPA 1QJFA 1ND2C 3AZWA 4Q6GA 1ZZCA 1W9FA 2EXHA 5I0DA 3A0HZ 3SYPA 4ZZ8A 4D7SA 1H2MA 2WAOA 5G04L 4LMFA 4IGOA 2E51A 5SV8A 4QB2A 5BR8B 4UXNA 2ZDIA 1J3PA 3NJZA 4LBLA 3VV1A 5A70A 5BY1A 4JTCB 1D0GA 3JAMN 5JJEB 1SQ4A 1RITA 2XGXA 1K34A 1F4AA 1OXCA 4P9WA 5J9PC 5EV7A 2UY8A 3ML0A 2JDNA 3SEEA 1PGL2 2VMHA 4R8CA 1Q86W 4CDUC 1H0BA 3V65A 5IK8A 2Y34A 4BMBA 2Z2SB 2ITCC 3DYMA 1MOFA 1W2BU 3JBG1 1HRV1 4JI0B 5LY1A 4DUVA 4NOTA 4XZPA 1W2TA 2F4PA 2YIBA 2BTQB 5F3IA 2JKXA 3LEKA 2QM4A 1NXMA 1O9HA 4CUAA 1E5HA 2G1MA 1YQ2A 2YI8A 3B8NA 1ZREA 2F4VO 1Z7S3 4BQ4A 4FAHA 3PIGA 1JCHA 5BNPA 1IHMA 4LO5B 3ZN1A 1VPHA 1RUC3 1DK1A 4GKJO 2IBZH 1YXWA 3T0AA 3RI8A 3ZRWB 3APBA 3E8BA 4DV6O 1BQ0A 3SGIA 2J1SA 5H9CA 2RDCA 1AROP 2YIBD 4YVWC 2E7TA 2Y60A 1UKRA 2FMYA 4S2HA 4RO2A 3G6JB 4EN7B 4A41A 3OPZA 1MS4A 1GANA 2P4EA 3VDDC 4EQVA 1C8M2 2W6JG 4BW9A 1TUEB 1RP3B 3MDPA 3VZOA 2ZGOA 4XJ9A 3K3NA 4FPFA 2FZ1A 2EXJA 5IFPA 3C7HA 3C7FA 3ORJA 1E5RA 3KZIZ 1M57C 5LMUO 4XDQA 2DVBA 4GMP1 5HBAA 1VQ6V 5LA2A 1RXGA 4COWA 3NJVA 1GP5A 4WVZA 1ND3A 4NRQA 3N36A 4CDUB 1OLMA 4Q4W1 1VBD2 1BEV3 4MLOA 3WQ0A 1Q81W 4DRRA 3MYXA 4MXWB 1T5EA 2OIEA 4HXCA 4AVCA 3J4UH 2YB7A 3OBAA 1GP6A 4C7UA 5F5AA 5GTIZ 2NM1A 3IC7A 4BQ2A 1S4CA 4I09A 3OGIB 2JDAA 3POSA 1MR5A 4QM8A 4COVA 4IV1C 1DQ6A 1UCXA 3SPJA 3WP5A 2LW1A 1YQ6A 4F3JA 2YUEA 3USUA 2YHJA 3VB9A 3ZFFA 4GZ9A 3L9DA 1DGRA 2E33A 2PHDA 1DFQA 2IXLA 2A06H 4MGSA 1JBCA 1PL0A 4IT5A 2PHTA 4TWTA 1YHQV 4UW3A 3PMEA 3TK1A 2JDUA 2LRPA 4OCTA 2ZX1A 1RUD2 3TN92 1GMGA 4J42A 3QH7A 4FZ0A 4FK5C 2VMEA 2QQMA 2Y6HA 4BAYA 2XKPA 5JJNB 1OKQA 2V5YA 2WFPA 5LXTB 1A78A 1CAVA 2XVLA 2DDUA 1O6UA 2PYJA 3ILNA 3X2QC 1GOGA 4GZRB 2DVDA 5C5TA 2VZRA 3WEZA 4DR3B 5JPNB 5EBLC 3LSDA 3PHMA 2B9UA 4E4EA 1XU2A 2IU3A 5K0UB 4XFAA 4SLIA 5FP8A 1R6TA 1TME1 2D6OX 3O1VA 4KQ7A 4CCMA 5CIRA 5H6QA 5BNOC 3CQOA 4DXTA 2A9HA 3ACIA 5IUQA 4FM0A 5FPZA 1HN1A 1DQ5A 2E6VA 5JZGC 2EIGA 4K20A 3WF1A 2QWOB 1NS1A 4A6SA 1YCIA 1IBKO 1FPOA 5ANNA 1VBA2 3KT1A 2PELA 4BIUA 3CJIA 1G9BA 1D7PM 4BLIA 1AXZA 4RWUA 1FNYA 4PF5A 3TWIA 1Q8OA 1FV3A 1NLSA 2YU2A 3X2QB 5FZ4A 1CONA 3K77A 4MZUA 4QE7A 1TAEA 3L72H 1QJX1 3LA2A 4A42A 1UN1A 5JOYA 2LP7A 4NROA 2EILB 2QKAA 4PDWA 3TN91 4UV8A 5BNNB 4UWDA 5JIUA 1D2DA 4RS5B 1RUI2 1K97A 1GNHA 2KSDA 3NV2A 2Y6FA 1XEQA 2DWRA 1ND2B 4LBNA 3BPSA 5C6CA 1F5JA 5CB4A 2D6MA 1Y74B 2ARCA 4D7TA 4QX8A 1R6KA 1NBMG 1M56B 4LLFA 2TBVA 4R7CA 3CYOA 2DWEC 1SLAA 4Q29A 4K8RB 3GWKC 3JZVA 4B3NA 1WN7A 1ZBE2 1EUUA 2JWPA 2WS92 4NHXA 1UPSA 2EINB 1KS4A 4Q4Y3 4YFZA 2WLJA 3ZN4A 1HXS3 1NKGA 4FQZA 3UO3A 5LBCA 1OQDA 1FT9A 5LL6Y 1C28A 1MEC3 4IQPA 3RW0A 1W2UA 1PO12 2DUQA 2UYAA 4XFBA 2ARBA 1FXKB 3HWJA 4FSJA 1A8DA 3MLJA 2L6LA 4Y22A 2A3QA 1KQRA 1YQ8A 5LATA 3F7VC 2XASA 2ZNJA 1LOBA 1FPN2 1GWMA 3SJQC 3LKJA 1AJPA 4Q26A 1OF3A 4IEZA 1VBB3 4QPIC 2BWAA 2UWCA 1OH4A 3VKNA 1ULFA 4W50A 3ZFEB 2PAMA 2XJTA 4JTOA 5GLUA 2DFCA 1YQ5A 1REFA 3M8LA 5IVBA 3JAWA 3ABKB 3GDBA 4XQDA 2CDYA 4P2ZA 1RHI3 2FKXA 1H8HG 4AXOA 4Y20B 1VRH3 2C6SA 1L8DA 2IM9A 3CDZB 1RVF2 2Y6JA 1W2AX 1DLBA 1CN1A 5FYTA 2QDOA 1APNA 3AMQA 3FL7A 3L2YA 3ST7A 4PDWB 4QDQA 1QJU3 1V55B 5LGNA 2MHFA 1MEC2 2WLKA 5E89A 2RR12 4F83A 1RUD1 1PD3A 5JH7B 2W1SA 3FHQA 2EIKB 4NIHA 1JHJA 2JG8B 4QJFB 1SCRA 4Y24A 3MUZ1 1NQJA 1Q3EA 2ENRA 2ZAHA 5JI9A 2BEOA 1RM1C 2JVDA 4JC1A 4FPCA 1UZVA 1HIXA 4XUTA 2VPVA 2QR4A 5FP9A 2JG9B 4AVTA 3HKBB 5E1RA 1BKZA 5AVPA 3VBHB 4J1WA 2VOWA 2C24A 4UFMA 5T55A 3H42B 2WNVB 4LF4B 4D6SA 4AI0A 3ZSEA 5CEHA 1HN0A 3MEPA 2OKXA 2WSVA 2PHUA 1WB8A 1V6NA 3RGBA 3WDVA 1ZRIA 5DDJ3 5CBGA 2J1AA 2WWWA 1JN2P 4WF9V 1UNBA 3DTUB 3SKJE 3S3XA 3KM5A 5I91A 3DXUA 5C4WA 1F4MA 5LASA 4ZXEA 2VVEA 3K03A 1RUOA 3RVZA 2QTWB 4IDZA 3OUIA 1AL21 3U37A 2YS8A 1OFSA 2RS52 4NPLA 4EWDA 1VBA1 1ZZ6A 5HCBA 1RM1B 4Z92B 1WLEA 4E4SA 2WAAA 2GDSA 1XYPA 1W05A 4MV2A 4UF0B 5JWPA 3WHTA 2R072 1S2KA 2A6WA 5EWSA 3WG3A 3CCLV 2Y48A 5BMVA 1BHGA 1RUF3 2J1RA 2VOTA 3RWKX 2HLDG 4YWAA 5IT6A 4XQWA 4CA9A 4CRQA 1UAIA 1FYUA 5TISZ 3W7SA 5KX5B 2LGQA 4AQYB 1O8PA 2GNTA 4WFAV 2HHHO 5J37A 1GAXA 1R1A1 4MUVA 1RVF1 2P3YA 3SH5A 2HWC2 4LF9O 1DBNA 2FZ2A 4XTMA 5L9RA 1US2A 2BBAA 3LNMB 5LRRA 3KQ4B 2EJRA 4X8AA 4M00A 1O91A 1YXBA 4DRXA 3OG2A 3WX5A 2JDHA 4GKXA 1OOPA 1K9MW 3T0DA 2UXDO 2XHBA 2GN7A 5TSWA 1Z78A 4CDQB 4CCNA 5CFDA 1PPJH 2WIIB 4XBNA 3AMPA 1VB4A 1UOBA 4YM2A 3JSNA 1LRHA 4TLFA 4QMAA 1W0PA 1LEDA 3MF9A 4LULA 5AC91 3OD0A 2ZEZA 1F51A 1W06A 4Q5OA 2A79B 1H8EG 2CTVA 1UXZA 2X05A 4JASA 2KM2A 3N7JA 5EBWC 4L0PA 3CCJV 4KGQA 3C2UA 1WD4A 5IK5A 2YICA 4I5SA 1N3QA 4Y1ZA 2XR4A 3ZSJA 3MPBA 4E4HA 2PXJA 2UUBO 4WFFA 2QSAA 1OOPC 4A6OA 3OEEG 2V1DA 3VQXA 4I55B 4LOTA 1R3KC 3CF6E 5A1LA 4IHJB 3GBWA 1VBD1 4XDKA 1IPSA 2CE4A 2WC2A 5FLHA 3OMIB 1I3HA 4QX2A 3IC9A 2WS91 4GQ7A 5FZKA 1PGL1 3I2GA 1PK6A 2Y8KA 1OPOA 3ZHSA 2EULA 3QO7A 3ZM8A 3BB6A 3HQUA 1V6MA 3AG4B 2OA2A 2BE3A 1J3QA 3ABLB 2ZX4A 2ITDC 2BZDA 2JENA 3GZUC 2YUAA 1ZVFA 4DUZB 3IM0A 5FPXA 2Z0AA 1W8TA 1QJU2 2OVUA 3FUQA 3AC0A 1N32O 1VAMA 5GZDA 2WABA 2JEMA 2I2SA 1C8M3 2IWGB 2HJFC 2P34A 2OCCC 3CRMA 3HBZA 5KXCA 5JJJB 4XTPA 3ZR6A 2B39A 1N1VA 4JDNA 4W65A 4TTGA 4D3WA 5L9BA 1AR61 4Z1VA 4DO0A 4QB1A 3TOJA 2HWB1 1ZX3A 3ZYGA 3T2QA 5CN0A 3ZN6B 4F6RB 3KHBA 1B09A 1R1A2 2RJKA 5LOVA 4Y26A 3SQOA 3ECQA 1S0FA 1SHWB 3JCUZ 3KG2A 4TWKA 1XNBA 5FO9B 3B69A 4GH4C 1W6MA 2YC4A 2PAEA 2IVIB 4LBMA 1Y9QA 2PQSA 3POIA 2QTSA 4CC6A 1DZRA 4ZKTB 2Z5UA 2CDOA 1XNDA 1MZEA 1H8TB 2ZKNA 1KP2A 4OI2A 1BVVA 3K58A 1WW6A 4GX0A 4MO3M 2ZMNA 3O7OA 4EZHA 2GDFA 3GF6A 3IJ4A 2CSGA 3KGZA 4NJ4A 1BZWA 4RSUA 3PTYA 4RFRB 4KXRA 1KITA 3CC4V 3OJBA 1WJZA 2OYZA 5JCOA 1H2SB 1SZBA 5HCAA 1GOFA 3AG2C 4R50A 3ZS8C 4ZU4A 2FQPA 4OI0A 2GH8A 3LAGA 4JV4A 3BN6A 3BOWA 1WGPA 4CZSA 1BMV2 4DV5O 2WO3A 5C8CC 2ADPA 4KL1A 1XL6A 3K3WA 2R061 4LF6O 2I07B 2E26A 4RGKA 3N7KA 2CH7A 2JD9A 4YW6A 2JXAA 4LBOA 2JEUA 1HQLA 2D3PA 4MYEA 5KXDA 3I49A 2W1UA 2A3YA 1JYWA 1MACA 4Y5Z0 4P9OA 4AGRA 2NLRA 3WW2A 2ODMA 3GM8A 1YUDA 3MIEA 4XUPA 1VBA3 5CNAA 2YXLA 4L8QA 4JYAO 1JMKC 3QACA 4KI5M 2YFUA 1NYWA 1J84A 1AL23 1SLBA 4X88A 5FPAA 5FMDA 1SG3A 2ZIOA 4QXHA 3AG3B 2GBOA 1ULPA 3JD2A 3ZXJA 1GQPA 4O4IB 2GU9A 5ACA2 4AE2A 5EYYA 2PN5A 4RHV2 2A73B 4NO4A 3P30A 2DWDC 4K8XA 3K0GA 4V1PA 3U07A 1HNZB 1W8UA 1XRUA 3R65A 2F93B 3KZ4C 1VBE1 4H3WA 3HN3A 1U12A 1JYNA 1UWWA 3JASB 1H1MA 4O7XA 4J11A 1QH6A 2EIDA 2NLJC 3I2HA 3KHCA 3NJYA 4I0AA 3T2MA 4B7KA 2R062 3FLTA 3ZXFA 5K1XA 2VQAA 3RYPA 1FJGO 4YPJA 4LWSB 4FXKB 1F2NA 2IVJA 2WO2A 5EYPA 1RUD3 2DU1A 3U14A 2YZ4A 2JJ6A 5J98B 1I7FA 4E2LA 3KVAA 3VKFC 2XXZA 2ZZJA 3ZVXA 2BBVA 4DOUA 5LRSA 2R6QA 1BSMA 1GM8A 2YIDA 4AEDB 2ZD9A 1TZOA 4XAEA 2JE7A 1DGWX 2XG3A 3POFA 3POEA 4YVWB 1HJGA 5JCTA 5DABA 4FLTA 4ZZ5A 2UXCB 4Z2AA 2RVAA 5DAQA 4NHKA 3S5AA 3MW4A 1JOJA 3FX7A 5C8YA 2R9IA 5J2TB 1QVGU 4GB31 4HT1T 1T6BX 1SC5B 1VBD3 3T4DA 2EIMB 3ZHTA 3MV11 2IJKA 1WCSA 3VBFA 4BQXA 1GU3A 1PVC1 4IIJA 4YW4A 4LF8O 4MG2A 2BSKA 5EXOA 1DTOA 5IYBO 1R081 4CZZA 2ZNIA 4H7LA 2AACA 2VGDA 2RJZA 5HV4A 3B02A 4OUMA 3NAPC 4MVRA 3MIDA 1GSLA 3BABA 5H2FZ 1W3VA 2XAJA 5D5PA 1H6YA 3MPPG 3IIAA 4YY3O 5FZGA 3ETGA 3ZSKA 4XUQA 5IJ9A 4J6GA 2V4VA 4ISRA 5DECA 2YGLA 1W03A 1RJ8A 4JRAA 2YSUB 2P37A 3U1XA 4AFAA 1JR9A 1H2NA 1PX3A 1IXBA 1VMGA 3C7GA 4UFLA 3S7IA 1O59A 3ZSLA 4DEVA 5EJ1B 2W94A 4K0KO 1FI2A 1OCOC 2ET1A 4R9DA 2QEXV 4A7KA 3OM3B 4DW0A 4X65B 4GMP0 4PA3A 1BBT3 3HJRA 4C0BA 4K9SA 1AR63 5BNQA 2GMPA 2RJLA 2EXKA 4G27B 3VDBA 1EYBA 2DCZA 1LOEA 3RS6A 2WYFA 2WZR2 2NQYA 1RYYA 4JGZA 3SJAC 4M4PA 4B3SO 3U78A 4JI4O 4N8MA 2HEVF 1TME3 5CFCA 3M3OA 2QGNA 1CX4A 4ZY9A 2GNDA 1CPMA 1JU3A 4BHPA 1TMF2 1YLLA 1G9DA 4AR2A 1EFRG 1K45A 3I3EA 2X5IB 1PKXA 1FFTB 3TEZA 2FB5A 4UCRA 4LE3A 1LU2A 1QJY1 1IXMA 1N3PA 5FQ0B 1PMHX 1Q8VA 4Y5SA 5H9SA 4WVWA 3CC2V 3LNNA 2UU8A 3DEMA 4MVMA 2GAUA 3LE0A 1RXFA 1WPXA 2BTVC 1VIWB 3T4ZA 3HPNA 1RJ7A 2NYYA 4PI2A 3VHPA 3JYCA 4YGBA 1KKDA 4JQTA 3W21A 5T5OA 1SESA 3N27A 5F5IA 5I8YA 2ZXWC 4CSWA 4R8HA 3K4DA 2OT7A 1F4HA 2EXIA 2R073 2YMZA 3WCSA 4O61A 4OZOA 5FO8B 2C4XA 4O65A 5EHDA 4ZXKA 3VGIA 1OCOB 1GZWB 1QXJA 4B3TO 5T5JA 4XDOA 1WNSA 5A33B 3ABTA 4GKYA 1QJY3 5IVCA 1B35C 2X5IC 4XBFA 2OW4A 2HJDA 1L0LH 5ITZA 3UKTA 4IV3B 3M7MX 4AFMA 1UF2C 5ISLA 4RQFA 4BIFA 2CTRA 3DF0A 1JZ4A 3M1HA 2Q6AA 1XL4A 4PQ9A 1E1QG 1XSRA 3WR0A 3S30A 4MGQA 5GONA 2UU9O 1OQ1A 1IQAA 1V6KA 3O0XA 1PVC3 4EJRA 2ZMKA 3WF3A 1A32A 5F39A 1N4CA 5FZBA 1P4RA 4XDLA 1DU3D 2ZMLA 1Y9MA 4ZS2A 1P84F 4UCTA 5KHGA 3ZDSA 3RG0A 2PF4E 4XFFA 4AG4A 5JXHA 5JVDA 5CA0A 1YSCA 4HN0A 3J7LA 1QIQA 2YPDA 1VQNV 1CIWA 2ZE7A 4X1KB 4JI5O 3M8AA 1VP7A 2WZEA 1HDJA 4X66B 4E8CA 2HWB2 4M3CF 3N9OA 1K4CC 2GN3A 1I9RA 2QNKA 2QJ1A 5DMYA 5I0RA 5C93A 1XHXA 1NT2B 3K06A 1NLRA 5J2UA 2JJ1G 4GWNA 4DV6B 1XE7A 1D4M3 4WBNB 2LALA 1YF2A 3UGHA 2DYSC 1SA0B 4EN6B 1ZZBA 4XJWA 3A7QA 4UVAA 4QNHB 2CL2A 2DYCA 2OT5A 4BIZA 4QQPA 4CCJA 4JYYA 2K0GA 4FLZA 2CTWA 2QQLA 4WFEA 3IIIA 3AYEA 4IL6Z 2XAGA 5B3SB 2Q1ZB 2WLLB 1HQNA 1OHFA 4CEWB 4XQ4A 3RSJA 1W9TA 4QX7A 1HXS2 2GNMA 2Z5WA 3I3MA 2QCSB 2JG8C 1LR1A 5CG8A 1X50A 4MVQA 4BXFA 3WFVA 4UCSA 3ACLA 1R083 4BYYA 1JZ5A 4X8PA 2OUJA 4G4FA 2WFF2 2P6CA 3QOPA 4GMP3 5FWEA 1AR5A 4CEYA 4AYUA 4LBQD 1C3HA 3K48A 2PZSA 4EROA 1FOD2 3JD3A 5E79Z 1ZRFA 3USUB 1CPNA 1SCSA 3B00A 3DN7A 3OUSA 1NTKH 3OGVA 1KD7A 1N0NA 1UL9A 3A2FA 5GZFA 1VRH1 1RMU2 5FXWA 4XACA 3MHSC 1W0JG 5JR7B 2EIBA 5A3TA 5IJ9B 1YFWA 2WLQA 3E97A 3OPWA 5LA0A 3J7MA 1JYTA 1W2NA 3N35A 4AQ6A 5LA6B 1FXZA 2DYSB 3AKRA 3N9LA 1BK0A 2JEXA 3CJHB 1LHWA 3D3AA 3PJYA 3N2GA 4YLZA 1VQ9V 3WDTA 3G4SV 4JZGA 4NIIA 2R043 4XFGA 4Q0SA 2Q4SA 2GUZA 2HH9A 1ND2A 4PDRA 3VKMA 3LEGA 3VBOA 1UW8A 2DJVA 5HV0A 3O1TA 2HKOA 1LKNA 4YG3A 3TEXA 4GULA 1FFXA 5BY5A 4R4ZA 3AK2A 3N9NA 5LHHA 4Z82A 2ZHMA 2X7RB 2JB8A 3DPRA 2VW0A 3VN4A 3GXUA 1V6JA 4XXAA 3JD1A 1YEWA 3ZYPA 4AFDA 3CL1A 4MSWC 4K40A 1IVSA 4GT1A 3STZC 1S0GA 4GKKO 2ZCWA 3RYCB 2JKBA 1QLEC 2YPJA 3M70A 4Q2FA 5IW0A 4MTFA 4LORA 4CUBA 1HP8A 1AR1B 1TVGA 3OPTA 2YBKA 3DECA 4CP1A 3HB3B 4P9GA 1RUJ2 1X4TA 1LHUA 4WCEV 4UB8Z 1SDDB 1AYM1 2R0HA 3T1HO 2CGOA 4NKGB 4B4RA 4RFT0 1NX9A 3N7MA 4K1ZA 4YG0A 2A1XA 4F7ZA 1NA1B 3RZKA 4I4TA 2CGNA 1W2OA 2E75B 1RSOA 1R093 4LF9B 3UO2A 3FB7C 1KC8W 4W4KA 2WPDG 3IT8A 5B4NA 1J83A 3NNMA 4UYBA 4CU7A 4AI3A 2N05A 5KHHA 2NR5A 3OBZA 2BNNA 1NXD1 2ZABA 1LUVA 2BUKA 2PHFA 1DF5A 2WT0A 2XBO2 1PHMA 4MH0E 4WFBV 3B77A 2KKWA 4G9SB 3RT3C 2OX0A 3GJAA 2WDBA 3T1MA 2VZTA 1YFUA 4OVEA 3SPIA 5C9AB 2Q7GA 5CBFA 1XOYA 5C8YB 3AG1B 1W0KG 2PFWA 4HL0A 3JSLA 2VO5A 1TE1B 2WN3A 2A7WA 4LHKA 4LA2A 4LF8B 1NY72 1GZ9A 3ZIAG 4KP4A 1F35A 4WM7C 3U4SA 1N34O 4M3CA 1XQNA 4AEJA 3AG2B 4URTA 2VUAA 3DPRC 4WFHA 2B8MA 5F32A 1AI5A 5EPAA 2BVBA 3THOA 1OF4A 4Q1PA 3OOXA 4NXMB 4LBKA 1WPBA 5KC6A 3FMGA 2RM22 3JCZA 2P2KA 3JBG3 2VOKA 5LA6A 4YM3A 2XPJA 4P9PA 4Z07A 1RUC1 4DUZO 3FX3A 3K9SA 2ZKLA 2RS13 2LW8A 3THPA 3R4DB 1DF0A 4JF3A 2VQFB 2DE0X 3GALA 1C5IA 1QJY2 1ORQC 2WLPA 3K5LA 3RZGA 4LIUA 2QWRB 4CDWC 3MW3A 4X1IA 3C8XA 4M3CB 1I94O 2EIEA 2R30A 5BYNA 5FZOA 3VHRA 2ADDA 1IBMB 3L75H 2QQVA 5FZIA 5FYYA 4YARA 3A0NA 5FMBA 2YG0A 3ZDVA 5IYCO 5FJHA 1KD1W 4Q4X2 1NR7A 1TMF1 3OR6C 1H2LA 4PA6A 4AI2A 3KF5A 1KJRA 2MEV3 4JGZC 1AP6A 3V56A 1AXKA 4JI0O 2Q7EA 3IPVB 3SJBC 1VQLV 5FKCA 1VBC2 3P5BA 1SA0A 3CJXA 2VMCA 1SLCA 4LK6A 1X7NA 5CVRA 3SEPA 4L9BA 2A5ZA 3K79A 3H1JH 1KU9A 5CMUA 1RC6A 4AW7A 1COWG 2E5LO 2KQXA 1NCRA 4EN8B 1E79G 1VBB1 2OYQA 2LTNA 1GN3A 3H8RA 1ZA7A 3ZFGA 3JU9A 5H6RA 2IJHA 3ILRA 1RHI1 4XUNA 1O3QA 4XUOA 1IX9A 1M9NA 4OHVA 1SFPA 3OEBA 1MA1A 3HEIA 2D5FA 2XH6A 3TAYA 1Y43B 3E89A 1RUJ3 1WUVA 4J10A 4W8JA 5C3PA 5FZ3A 1W90A 4X62B 2ARAA 4QHZA 3CIHA 3JASA 1JZ3A 1EAH1 1ZRRA 4LUMA 1UY3A 5AFBA 1JS9A 2P6HA 3HKDB 3RJ2X 2XL9A 5IK7A 5C8WA 3ZFGB 2VNVA 4UBGA 1MG1A 4DR4B 2P4KA 1XNRB 5A9GA 3NNFA 1HW5A 4UFJA 2VY0A 2OIIA 1ZBA2 2HWD1 3I54A 2ZGTA 3CZJA 1XOUA 2CWMA 3IAPA 3DC6A 4ZHNA 1UY0A 3ACFA 1WW4A 1ZZ9A 2QKSA 2BGOA 2WUHA 2H0VA 3HKEA 4RQPA 4NPRA 2D6KA 1LGBA 4LF5O 1HB2A 3WNPA 2P67A 4UB6Z 5B1NA 4A4AA 4CVUA 1S0BA 2ET7A 2QQNA 2P22C 2GZWA 5JMOA 1GZWA 4HN1A 3TN93 4OULA 5GLZA 3WF2A 3KLSA 4Q0QA 3AYAA 2R9RB 3KD4A 1K42A 1D2QA 1F9KA 2GTAA 4WZCA 1I08A 4CH3A 3J8F2 1YRZA 3AK3A 1W6NB 1HNXO 2UUCO 3QBQA 1NI8A 3WNXA 1MSDA 2XJPA 3UK9A 1Y4WA 1UPGA 5IY5B 4JTNA 5H9QA 4O2AB 3MF6A 3CNAA 4H44B 1FXKA 4WM7B 4AI1A 2Y26A 2R32A 1MNGA 2UXNA 5JXGA 4JYCA 3POYA 5AC92 3A23A 4BQYA 1XUQA 4QX1A 4AL9A 2ZGRA 3LGRA 3KV5A 2JIZG 4J1XA 4OX9B 2VXRA 4B3MB 1VF7A 2W0FC 4Y4RA 1BYHA 5A32A 3B01A 5IE9A 5B1AC 1QDOA 2ZXQA 5ABJC 3ZCCA 3WXPA 4JGYC 3IGAC 4JI1B 3LEIA 5EYXA 1TVKB 1FX5A 1QOOA 5IJ0A 1T6GC 4TQDA 1LHOA 2WN2A 3K5NA 4AQYO 3VQWA 4XDPA 5IK4A 3ZYRA 4MGZE 2CK3G 3U10A 4FVVA 3E8HA 1BVP1 3ZX6A 1J5EB 4I50B 2PAKA 4XYXA 4ZHQB 4BLJA 1YC61 2I74A 1GQGA 5DDJ1 1O4TA 1JOPA 1OURA 2GC2A 4NHYA 4JI5B 2HVJC 1BMV1 5CB4B 4J9YB 3I2IA 5GZGA 3I2FA 2HEPA 1NZCA 1JTZX 1XXNA 1RUC2 1XMOO 2W2IA 1PMJX 1TEIA 4QX0A 1IBKB 5FNVB 5FZCA 1VF6A 4K8FA 4HBNA 5C3QA 4L2NA 2EIKC 4AGGA 2OWOA 1XBLA 4CE8A 4DV1B 4YIOA 1YI9A 4G2KA 3AX4A 5LWBA 1BHAA 3I55V 3CRRA 2EVXA 2B5HA 4E2GA 1S2EA 2XJUA 4Q4W3 3WU2Z 2QE3A 1OCRC 1GN6A 2X10A 2XWBB 2EF6A 2NN8A 1JFFA 4LCUC 1ACCA 3N2KA 1AR71 2ZBJA 4KBBA 1VE0A 5F1RA 1NT0A 2Y69C 5DUXA 1V54B 1F15A 2D44A 4FLUA 4GH4B 3RVYA 2RE9A 3HKBA 4X65O 3WP3A 2D43A 3ZMVA 2JE8A 5C70A 3KMHA 1EM1A 2FHRA 3ZFFC 4L8JA 2HYKA 3ZN5A 3FFZA 4NIAA 2MK3A 3TETA 1I5YA 1GNZA 3VBFB 3GZAA 4C8DA 3A21A 1BL8A 2KD7A 1U5ZA 1QNYA 1UOFA 3QG5A 4P9LA 2LUWA 3I3BA 3RZLA 2D6NA 4V2WA 4NTXA 3D36C 1NCQA 1UU5A 4PCRA 4DR7B 3LD8A 3V64A 4IEYA 4I9QA 1SKVA 1KUQA 3HKEB 5B5EZ 1KP3A 3DV8A 4YGEA 2C9KA 2Z79A 4FXGB 4NE9A 4KUMA 1MS3A 2IJIA 4JDMA 4LF5B 2D6LX 2ZHNA 5LMUB 4IETA 2DURA 2SLIA 3RI9A 2JJ2G 2Y33A 3I4IA 4FAGA 1AUYA 4QPGA 1IBLO 5F3GA 3DSQA 3DL3A 5FPRA 5FP3A 4Z8BA 5A3NA 5L3GA 1WP7A 5LEKA 3NAPB 5FWJA 2LFSA 2OPKA 3J26N 3CC7V 4C90A 2UU9B 2ZKOA 1EZVH 4DK0A 4MTXA 4FOWA 1HRV3 4X8NA 1S0JA 1VMJA 5JZGB 1QOSA 1J1TA 4YZ1A 3Q8EA 4BW5A 3L70H 2P06A 2YGMA 2VBDA 2E3CA 4Y1YA 5C3RA 2WR9A 5FYVA 2M6YA 1AVBA 2XVGA 5CKQA 3VLBB 4P02B 5JQGA 5B1BC 4PIYA 4IYIA 5H5NA 1VMFA 4RQPB 2OQ6A 2ZTNA 2UWAA 5JOZA 1TNRA 3UV9A 4FPJA 4CXXA 2JG8A 2B46X 2I45A 2OIGA 1YTFD 1RUH2 1W28A 5M0TA 2RM23 4I0XA 4GIQA 3ZRWA 5GTHZ 3PUSA 4AVSA 1M93A 5AVAA 1K4DC 5JXJA 4NTWA 4GWIA 5C7GA 2WWUA 1R64A 2WBKA 1N34B 4PBPA 3BEHA 1LOAA 4AVAA 4A7YA 4NAMA 3WSOA 5IJ0B 2RV9A 5KAFZ 4NXMO 2RM21 2VC9A 3WVJA 4FFIA 3H7YA 1FXHA 5CZKA 3G7DA 4KG0A 1IOAA 2Y69B 1YJLA 2WNUB 2JDKA 4E2QA 1K92A 5GZEA 3VZNA 4I7ZB 1FAFA 3IN9A 2BOJA 1EN6A 4XC9A 3PVEA 1RPOA 1SQVH 4FM2A 2Q8OA 1RINA 3LDDA 1AX1A 3NNLA 3KS7A 5A6QA 1ASJ1 2W46A 1US6A 2LROA 3PVBB 5CA3A 2A3WA 4GUNA 3DXTA 3D3QA 1PO13 1VRH2 4DIQA 3ZMUA 4AAPA 4N21A 1IBLB 3B2EE 4JYAB 1JUHA 4EYUA 3LA7A 3SCHA 4OMDA 2VUJA 5L3CA 4PDWC 4Q0PA 3WLUA 5DUUA 4DV4B 1VQ8V 1W3XA 3ZHRA 3EMRA 4DUYB 4DR6O 1EV11 1CAVB 1UYPA 4DXSA 3MGUA 5KLVH 2DUPA 4ARXA 3M7AA 5IYZB 3WW1A 3O9OA 3D5OA 1MSWD 1W04A 5FZEA 3CMAV 1FKAO 3ATGA 2Q8DA 2A6ZA 3CJHA 4DS0A 1HV0A 1RFYA 4NTYA 1ALYA 5F3EA 2ZGNA 5L3DA 1NCRC 3TXQA 1S0IA 4OI4A 2CU5A 3RNSA 1UXXX 4LF7B 3E86A 5LMNB 5FP7A 2BCCH 2PUSA 1W6OA 2YXHA 5LK5A 1SQBH 2VQ0A 4KBZA 4ZI7B 3ETQA 4YFWA 4NB5A 4IL7A 4I3GA 3K04A 4L11A 3U4XA 3CEIA 3TCUA 5ANQA 4E4DX 5DQ0A 2H94A 1QQP3 4NIDA 2UWBA 4CCEA 3T1YB 4YHHB 4U3JB 1D2SA 1RUE3 2W0XA 4YY3B 3UYJA 2D93A 1MS1A 2PTMA 4JI3B 2JDYA 5IVFA 4QKNA 4L92A 4DXRA 3PJSK 1QQP1 1POV1 3DGEA 3JAKB 2O1QA 5A1FA 3PVOA 5FYMA 3ZXGA 3WDWA 2BOBC 5C9AA 5IY5C 1FXKC 2IJJA 3MUY1 1S5HC 2Q1MA 2DBNA 1O3TA 3T1CA 4DY3A 3ASOB 2ZGKA 2X5IA 4X6RB 1UZZA 2Q5ZA 1R73A 3TXSA 4RQEA 2ZGQA 3POWA 3OFNG 2Q5TA 1JODA 3WD5A 4F8AA 4MGTA 2VH9A 3KV6A 4JKMA 4M0NA 1NE4A 2CDPA 3RWRD 3NMBA 1K7DA 1LGNA 4HVRA 2UXCO 2L35A 2WFF1 3LQCA 3UESA 1AR92 2WZR3 4B7EA 3L2HA 2W47A 3BPZA 4FTBA 2GSMB 1RUNA 5EC1C 2IW5A 3RRDA 4Y1VA 4I2OA 4XMAA 5LB6A 1K5JA 4C91A 4CDXB 5DPNA 1O4YA 3GB7C 2ZAAA 5A32B 1EUTA 1BBT2 3T09A 4FPGA 2C5DA 5A1AA 1SACA 5KHIA 1LTEA 2BP6A 2OQ7A 1KB9F 1GH6A 3I97A 2DCKA 3VBUA 4J41A 2V4AA 1S77D 3IAYA 3OSDA 4JDOA 2J22A 3NRUA 1SQGA 2WRAA 1G4YB 2DFBA 4JPRA 4DXWA 2EA7A 1XU1A 3ASOC 2G4IA 1K5MA 3AK1A 3I59B 3KV9A 2CY6A 5FZDA 1C4RA 4DFSA 3K4ZA 1V9PA 4PJ0Z 4N43C 3J8F1 3WQ1A 4JI7O 4DV7O 1V54C 1VF6C 2VS0A 3DPRB 3TYJA 1FV2A 4MADA 5J48A 3SR2C 3JCIA 3DCQA 5EC2C 1S5JA 5KA6A 4EZ4A 2FTKA 5L9VA 4E27A 2RR13 4FCAA 2NNUA 3F2ZA 3I3DA 5L7OB 2XUMA 4PELA 2YBPA 3BY6A 4K3AA 3JD73 4RS5A 4OPHA 4BR6A 3WT3A 1DYPA 4X64B 4OPAA 1QU0A 2Y0PA 1GICA 2ZGSA 1V6IA 1NKDA 3BCCH 2AEYA 3WG7B 3AKTA 3H3ZA 3HBKA 1R6NA 1XNTA 2J1EA 3KT4A 3IMNA 5C33A 4O9EA 2P5OA 3IKWA 2BPA2 3VD5A 4DW1A 3C7EA 4CP9B 2Y64A 5FY5A 4FZ1A 1L3JA 3BYWA 3S5QA 4IUGA 3ZLIA 2V7QG 2XLFA 2WNUA 4PIXA 4XCBA 5KXEA 1V55C 3ZMTA 3ZPYA 4HZ3A 2XQRA 3UGGA 3CWBH 1SLTA 1B06A 3RBZA 2PI5A 2FMDA 4P30A 4R6ZA 4R9CA 1ODNA 3NXSA 3ETDA 3HT1A 5CG9A 4QPJA 2QZ3A 2UXXA 1LEMA 3U75A 4UV9A 4HKOA 1N36B 4YJ3A 1UKGA 4X66O 3BVOA 3NKGA 3HIFA 2W1WA 4LNUB 4JI2O 3B8MA 1VR3A 4N43A 3MIBA 2LM3A 3CRCA 5FUNA 1Y74A 1Y76B 4C1WA 1LOFA 1VALA 5LBBA 2HBTA 1KMIZ 5T3NA 3LSUA 2BNMA 3ZEDA 2WNUC 4J7JA 1U5IA 4CCDA 3OEHG 4N53B 1YI2V 1XYOA 1QXRA 5L3FA 3WG2A 4U3FH 3WW4A 3OBRA 4RL7A 3IPVA 2O14A 2RCVA 2F17A 1ASJ3 3FYEB 3K5MA 3NV3A 3TEYA 1JQ0A 2YIAA 4IGPA 3GZEA 1JXNA 2AZ5A 1X9TA 4FFGA 4Q8KA 2Q30A 5LP6A 1PVC2 3AYDA 4NUBA 2K9PA 1HB1A 5FLJA 2BU9A 2CWSA 3M3EA 5B1OA 3OGRA 1MS9A 1HNWB 1MS0A 4ZPIA 1IS3A 1CZVA 3VD4A 4ES9A 3CRQA 1DP0A 2IXHA 1I6XA 4AILC 1KFUL 3ZMZA 1IZ3A 1UMZA 2HWC1 2JDPA 3C7OA 2VNRA 5IYDO 4U3JA 4YZ3A 3LDEA 1CAWB 4JV5B 3PUIA 4N53C 3FAVA 1POV0 1GOHA 1ZL8B 3BIEA 2ZM6O 3SH4A 2GNBA 4XE9A 2PHWA 3W5NA 4DR4O 2EAAA 1QLEB 4QPYA 5FYHA 2VWKA 1XNQB 1TGOA 3QVNA 1YYNA 1P8JA 3ZPOA 2A7AA 2HWC3 2QM7A 1SEFA 5K7PA 1FS0G 2RQ6A 3H50A 1H4HA 3O14A 4OUSA 4JCKA 1PNKA 5J1XA 2WA3A 1E5IA 5C71A 2YFZA 4YGDA 5A6ZA 1N36O 4XJZA 5BMVB 4RUFA 1WMDA 1XILA 1QCEA 4PDVA 4GLXA 1QQP2 2A3XA 1B35A 1HB4A 2AR6A 5FL7G 4UCUA 3W7XA 1JA8A 3WUCA 3KWVA 2DQ0A 1I5PA 4COZA 4K1YA 5H9RA 2HWF1 4XJ8A 4B4PA 1XC6A 1FMD1 2WO7A 3T1LA 3CZUA 4MTOA 1I5XA 1AL0G 2C9AA 4CCCA 4IE6A 2UUCB 2WQ8A 5F9TA 2W87A 3I5DA 5LEJA 5A3WA 1LODA 4XJUA 3ABUA 4DR1B 5C8CB 2W91A 3A22A 3H1HH 3POJA 3QTCA 1ENRA 4AHXA 1X33A 3KGLA 5IWAB 1RUH1 3BI3A 5D8AA 1WLDA 3ZN6A 1WA8B 4TV9B 4MXVA 4W6YA 2VECA 4DV4O 4CS2A 5FO7B 3Q4HB 4QDSA 2WLMA 4CDUA 5J09A 2FL4A 3I59A 4HK9A 2KA3A 5FNVA 3PN1A 2P5BA 2O8QA 1ROPA 1CD3G 1V0AA 5GLWA 3IWZA 1C5HA 3SYQA 4HPKA 2X6AA 3LOBA 1CAUA 4LC1A 4DR6B 1UIJA 2UUAB 2TEPA 3E5QA 4FMTA 1W9YA 4JI3O 4URAA 2VVDA 3B09A 3EXUA 3ZIXA 4EWEA 3QCWA 4ZOLA 1OQEA 3VD3A 3JALB 2Q7HA 3MFCA 4LUKA 4E9KA 4UI9L 2DQ3A 2IXJA 3ELNA 2P3IA 3TEWA 5F7UA 3OW2U 3OTOO 1VQ4V 4NRMA 3ZJZA 1BGYH 3VQYA 5FZ6A 5J2UB 2YI9A 2Y6LA 2Y4TA 1JHNA 1DZTA 3FLRA 2AEZA 1AB3A 3E6DA 4WM8B 2K9ZA 1ZBA1 2HWD2 1OFNA 4H13B 1HRV2 4S2GA 2VMDA 3VBOC 5CKNA 4LF6B 1PO21 4CDQA 3IDBB 1FPN3 5KAIZ 3CU7A 3ZO0B 5FZFA 5FZOB 3ZMOA 2QQUA 3B3QE 5I0SA 4EB6B 4HVQA 1JI6A 1GRJA 3V0AB 2OXBA 5KMGA 2AHZA 4WM8A 5K4LA 4IIJB 4L87A 4EKWA 4LHSA 4HYOA 1N3OA 1V9U2 5CA6A 3RYFB 3NNGA 3SC7X 4K8ZA 3ZFEC 4A44A 4ZS3A 4DRXB 3LF7A 1I94B 3SYAA 5DZGA 3DGTA 3N7LA 3W7UA 5LGUA 4FPOB 5F3CA 1GFF2 1OVPA 1FXVA 4DV2B 4ATEA 4D7YA 4BIOA 2VTFA 3LEMA 5FOBB 2WLNA 4B3RB 3NV1A 4CH4A 2RJ2A 3ES4A 4M0HA 4A3ZA 2DTYA 4HKLA 1ENVA 1Q43A 5L3EA 2Y0OA 1PNGA 4NPMA 4CEYC 4RR3B 1O3RA 3H1WA 3CRAA 1R3JC 1HR0B 1RUI3 4N23A 4ASKA 4AZZA 1PK6C 2E5LB 4BWOA 1NR1A 4WM8C 1R3LC 2J1VA 5D8AC 1OCZB 2JDZA 1CWPA 4H0LB 4FBFA 5F5QA 3CX5F 1BK1A 1VBE3 1YJNV 2VZVA 4XOGA 2ZQMA 3E8GA 4HONA 4LFAO 2R071 2ZPXA 3ME2A 1O5UA 4NHLA 4LO6B 3OTOB 3LDCA 1LNQA 1VQPV 5FXVA 1F23A 2WT1A 3CO2A 1YFXA 4CDXC 1ZLZA 1QJZA 1ZWIC 5FZ9A 5J36A 5LY2A 2AW9A 5DUVA 2BTQA 4PIZA 3R6SA 1C57A 1G1XB 3VL9A 2P7TC 5HXVA 3GWOA 1JZ7A 1MS8A 2VR4A 3HNMA 1QNMA 1WA8A 4E2SA 1VP6A 1H38A 2ZGUA 5IJRA 5I8TA 1Q82W 4Y1UA 2K1EA 5C9AC 1UQXA 5DAWA 2MNGA 5C5UA 4LKDA 5IAVA 3H7JA 4MVZA 1JMUB 4UXAA 4IE0A 4UFZA 1POV3 1COV3 1LU1A 4IEPA 4CTEA 3H9VA 1KRIA 1RUJ1 4GXLA 3LB9A 1Q90D 2CGPA 4MT8A 2WT2A 3G67A 3BTZA 4DUXA 1W6QB 1RVF3 4L99A 5A6YA 5FMOS 3RYKA 4QKFA 4XFIA 4AEKA 2E53A 2XAQA 3SJCC 5L7OA 1AYM2 5DZEA 4FO9A 4LA3A 1VIBA 1PMIA 1X8MA 3ASNC 1SPPA 1U5YA 1NCQC 2EICA 4FOQA 2B5UA 2R72A 4CP2A 3AKSA 1O5LA 1VBB2 1OD5A 1W8WA 4DR2O 3O1RA 1Q8QA 1S76D 3JD4A 2FYUH 1OMIA 3ES1A 4BK4A 4YJ2B 5CU1A 4YW7A 3K4AA 2IXIA 3GZTB 4FFFA 3RPQA 3ZFGC 2C26A 1MQTC 5KHJA 3M3QA 1YIJV 3F5WC 1NU1H 4B3MO 4IEXA 1GLHA 4CCKA 1H9PA 1V70A 1WA6X 4FP2A 5B1BB 3E6BA 2IU0A 3RZHA 3WF0A 1GKBA 4U7OA 1S1AA 4R9BA 3OMAB 1H30A 1IS5A 3T0BA 4I01A 3THTA 4X1YB 3AMMA 1SBFA 4QT6A 4LKSA 3AVSA 4BM8A 1GWLA 2N04A 5ABJA 5LGTA 3T1YO 3UKMA 2ZGMA 1URXA 1N32B 4FPEA 5FPVA 3UM7A 4GB33 5JSOA 1U0AA 1SQFA 1GMMA 1LNSA 1W6QA 2JGDA 2R9AA 1DF4A 1DQ4A 3H1MA 1OJHA 3OE7G 2LS6A 2B1GA 1ZM1A 1I5ZA 1RPRA 3AG1C 3E35A 5EZYB 1F8VA 4UFIA 5JQGB 3K0DA 4XABA 4LWSA 3GCWA 2FDJA 3E22B 4O4JB 4JI2B 2AC1A 3ZXKA 4IV3C 5ACA3 4QAWA 4OX9O 2OCHA 3LDRA 2JS5A 4QXCA 4QIWF 5LA1A 5CA0B 1L7QA 1EAH2 2XQXA 4WVVA 4Y1XA 4GKJB 1HKDA 2W08A 3WQBA 3K5OA 2QFEA 4CCOA 2ZGLA 5EIYB 4UOJA 3MIGA 4LF7O 4Y3OA 4BU2A 2QJVA 1EN5A 4DR2B 4XBQA 4FOYA 1ZUQA 3MW2A 3EFFK 4LR3A 4J7KA 4NVPA 3KKYA 4QQ2A 3VDCA 5HPOA 4JRLA 5F2WA 2JS3A 3OD4A 2C2AA 5FY8A 1CESA 2NMNA 3SLIA 3H1IH 5APAA 4FPLA 5I0UA 4COUA 3MV01 4KWUA 1AYN3 4LEJA 3VD9A 1EY2A 1K73W 2GP5A 3J9SA 1HXS1 5FXXA 1AR83 2RMU3 1AR4A 2ZCEA 2EILC 1JZ8A 4BE3A 2OCCB 1WKYA 4OHXA 2F1MA 1G9FA 1WLTA 1VQ5V 2LFRA 1M4WA 4O4LB 2XAHA 5FXZA 1W6PB 1CAXB 2DCYA 4Q4X3 1WW5A 1DGRN 1J1LA 1WCUA 1OI6A 2SBAA 4AHZA 2JX9A 3P6BA 4FLVA 4O4HA 4DV1O 4Y5TA 5BXXA 3KB5A 1SS3A 2JE9A 1FJGB 1U97A 4OMCA 1XNAA 3V0AA 1V9U3 5B66Z 1UO9A 1K8AW 1IDSA 4CS3A 4TUYB 1AX2A 2B42B 3EVKA 3T2TA 1OLME 2HG5C 4YVSC 1QWRA 5FYBA 3FKSG 4V2VA 4FVMA 1FYJA 3I2DA 5CB7A 4AI8A 1XPWA 5BNNC 4U7NA 1YITV 3PVNA 3OAAG 2AZ0A 1HJFA 4BQWA 1M57B 4QPWA 4JAUA 5C4WC 3CCVV 2VW2A 2YXSA 1FOD3 4UW4A 2BSKB 3ASNB 4PT6A 2XJQA 2MW2B 1IG0A 3KVBA 1JYIA 2FDKA 2D2CB 1QF3A 3UT0A 1BQPA 5FBZA 4CCLA 5FBJA 3HT2A 2BFUS 1Q8SA 2QA4V 5KX5A 3O12A 3K3OA 3MHZA 1R091 4HLTA 1NA1C 2VZQA 1VAKA 2VZSA 3D8CA 1SETA 3B9CA 3USSA 1WAZA 4LXLA 2YC2A 1Y4MA 1KDMA 3ABZA 3JD0A 1FATA 3BIWE 1W6MB 2NN4A 1Y9GA 3H8OA 5CBLA 4HSJA 4WBNA 3VBUC 3WW3A 4TV8A 2XDVA 1JOYA 3VKOA 3OBTA 1KDKA 2DN9A 2NPIA 3WF4A 3RYHA 1O4ZA 1WW7A 2PHLA 4LBJA 4LT5A 2W39A 1Y76A 1ZAUA 4ORFA 4WV8A 2AXTZ 3FB6C 1OUSA 4XHBA 3OT7A 4J7ZA 3ABMB 5FY4A 5FYZA 3LWCA 3O0VA 4X64O 4MS2A 2P6JA 3NWKA 2PQQA 4EN0A 3GBFA 2Q1FA 1NLQA 1GV9A 3IDAA 1XNCA 1NH2D 2DVGA 1JW6A 2VQEB 4XFHA 2CUGA 1IS6A 4QU2A 2H6BA 3AXDA 4QGLA 2R0FA 2RMKB 1AR82 3O65A 2QVSB 1PGW2 4CYDA 3HVDA 5T52A 3EQEA 2QQJA 4FPPA 2QDNA 4Q4V3 1UMHA 3OYWA 3Q8FA 4CEWC 1AR91 4AQ2A 2XONA 2EZOA 3HR0A 5FR3A 1YJ9V 1PX4A 2HEWF 2DBIA 3UT5A 5FLIA 3B9IA 3BRCA 1LJ7A 2CTPA 3MZHA 2VQTA 5AFEA 4K6BA 5GONB 2XLAA 3OUHA 5FUIA 1UZYA 2UUBB 2XBO1 3PTRB 1AHSA 1NUKA 1BBT1 1TVKA 2GV9A 2W1QA 4DR5B 4XFCA 3L71H 2QWQB 2VTXJ 1Q8IA 4BOWA 4IERA 4Q20A 2X6BA 1ZNPA 4IYHA 3HR9A 4Q1RA 4F4LA 3EHBB 3HQRA 5LMNO 2H3OA 1NY71 5BUVA 4ITCA 4W4LA 1JYVA 3JATB 4LQRA 3QNEA 4ZBMA 3V0BB 1KQSU 3S6PA 1UYXA 4FTEA 4DUYO 1UD1A 1R1BA 2DCTA 4XVHA 3WHUA 3E2EA 5LHIA 1IPKA 4COYA 4LFBB 4P9JA 5FY7A 4WVMA 5KC5A 3K9AA 1BXHA 1Y3TA 2XHNA 2RHPA 2DU0A 4Q0VA 4QQLA 4JGSA 3WB1A 4Y22B 3H3UA 2WNVC 1QR8A 4ASMB 2DYRB 2A71A 5FPLA 1ONAA 1UJWB 2QQPA 3BTAA 4YW1A 2RDNA 3RZJA 4I0WB 1TUBB 1GP4A 3VL8A 3JD71 1H8TC 3SCGA 4JX0A 1OZ0A 1Z2GA 5JOXA 1C1FA 5B1AB 1CVNA 5EZWA 1L0NH 3OGSA 4LP8A 1PL4A 5LP6B 3AG3C 4UVCA 2A6XA 4D69A 2N7GA 1URFA 4B1MA 3SPGA 5FZMA 1XE0A 5FK7A 5I0TA 2WYSA 4GB32 2VUDA 4CEWA 3H1KH 2BGCA 3X29B 3I56V 1BS3A 1GNYA 5CA1B 1ZSPA 1BCXA 1OBNA 3INAA 4O4LA 1IGOA 4CDQC 4JYBA 1EAH3 2ADEA 4N43B 3RMYA 4IHJA 2QQOA 5IAXA 4P00B 4UT5A 2YU1A 2JK5C 1DLLA 5FZ7A 3ZHQA 4QU1A 4F6RA 1LOFC 2AUYA 2KG7B 1ZZ8A 1KBHA 3LIHA 3SH3A 4QPKA 3IDCB 4HFSA 2DVAA 3WQ7A 3C3SA 3DXRA 3BGAA 3AFKA 1GYKA 5BPXA 1XDCA 1UOGA 1OC1A 1O9GA 4LNVA 3H1LH 1MABG 2K46A 3MLKA 5HFLA 1LUWA 2WLIA 2MEV1 4DPNA 2M7WA 4GCZA 2CHHA 1MZFA 2GP3A 3BFRA 4PV1B 2X53S 2PLV1 4CH6A 1W59A 4MGIE 3RYCA 3VBFC 1PZ7A 3WDYA 5JPMB 5LCWL 1QQCA 3GCXA 2LO1A 4BB3A 3KCCA 4X1KA 3QO8A 3DXRB 3Q4HA 1MZ6A 1RHI2 2VBPA 4X20B 1L1FA 3VQVA 4QPGB 3RFRA 1QBZA 1NVPD 4GYCB 1EZJA 1REEA 3KV4A 4IGQA 4DK1A 2XTAA 3A4UA 1XE8A 2KB1A 3IMMA 2VAUA 1XNRO 3ZN0A 4WFGA 4KWJA 2IXCA 1UU6A 3U0ZA 1G86A 2WINB 2UY9A 1AZDA 4X1YA 1W0NA 5AG2A 5AC93 1D4M1 1NAEA 1R1ZA 4B4QA 2B9ZA 2Z42A 3CMGA 1UU4A 3CMEV 5EJZB 1WZXA 4P9YA 1COV2 1DLCA 4Q4Y2 4YG6A 2AYHA 3O0WA 1OT5A 5FREA 5KBFA 1K5SA 3OYWB 2RNBA 2D98A 2VMFA 2WZPP 3HPLC 3NR7A 4DV7B 3GHNA 4EEQA 3ALQA 4DYLA 5DG1A 4LOSA 1P7BA 4QHOA 5EYPB 5FYSA 4DV2O 3CE2A 2LGWA 4OI1A 3ABKC 4YRDA 4OLLA 3ICXA 1J3RA 3AK0A 3FJSA 5A7SA 2D3SA 4WM7A 3IFXA 1NA1A 5C4WB 2UXBO 4PQQA 3FZ3A 1K5MC 4GJZA 4I0BA 4KMQA 2R041 5IATA 5FK8A 1JJ2U 1GM9A 3AZZA 3BAAA 3ZHVA 2CAUA 3TNQA 4AAXA 3D0JA 3J7NA 4LR4A 3HD8B 2WAMA 3OY8A 4JI7B 4LFBO 2WNOA 2ZEWA 2BGPA 3OCPA 1JUIA 4I3PA 1A34A 1CZTA 4YSFA 2VCMA 2OTJV 1ULDA 4QX3A 4R9AA 3WY6A 1Z7S2 4JGZB 3PLQA 1AR93 4CDXA 1QHTA 5LZ6A 4NR1A 1EP0A 2J42A 3QO5A 3P32A 4B29A 2Q8CA 4KHPO 3ZXLA 1NH2B 4P14A 3I8TA 1QGLA 5FJKA 1CAUB 2FD8A 2E63A 2VE1A 4RGGA 1YI7A 3JAKA 1D4VB 3VBOB 2CV6A 1TUBA 2GUZB 4KFMA 4YW3A 4RR3C 4FPHA 4JI6O 1DGWA 4KU8A 4P9IA 1IG3A 2R7EB 3VDDA 1O7FA 1BMFG 2XVKA 1QJU1 2EALA 4X9QA 1CIYA 1ENQA 1OKOA 3CP1A 4TV9A 3U11A 3LDBA 3VBSB 5FPOA 1KECA 4B3SB 2TUNA 1I1EA 5B3SC 1VLNA 4A5UB 3AEIA 3WDUA 2FDIA 2V4DA 5J96B 2BOIA 3KCXA 2MEV2 1W8HA 1YDXA 4P5HA 3HOBA 1QR9A 2VZUA 2WL1A 2ETEA 3JBG2 4XURA 3CXCU 4UFHA 3ZR5A 2Y6KA 2P1BA 2E32A 4DNYA 3PNAA 1M4UA 4LO8A 3G80A 2YEVA 2B9VA 4H37A 4S2DA 1G7YA 4GKKB 5BNPC 1AF9A 4LF4O 3FBMA 4LHLA 5D5QA 3PURA 1WBLA 3R4UA 4XF1A 1S0DA 5EIBD 3Q8AA 3KT7A 1S0VA 2G9ZA 1HW7A 4UUJC 4IV3A 3MFAA 5J2TA 5I8SA 3HN1A 1SQPH 5B2GB 3ON7A 3RYRA 4GA9A 3T1HB 4HG6B 2HYXA 5FYUA 3IB3A 4N9HA 2E7AA 4FLXA 4YZ2A 2PI4A 4H14A 1AJNA 1NOVA 1W9WA 3FWEA 1AYM3 1PVXA 2WWJA 3UETA 3T30A 4JV5O 3VBRC 4PBOA 3H01A 1M06G 2BRTA 5FY1A 4QE9A 1UY4A 3VUOA 3NW4A 2AHYA 2IFWA 3CJIB 4KH9A 2FDFA 2V72A 2FMLA 1BEV2 1F4NA 5GKAC 4QHBA 2ARHA 2RS33 4LFCB 1N1YA 3VBSA 1UY2A 4LE4A 4FFBA 2P90A 2ERFA 4AEMA 1PNLA 1M90W 1VRBA 4LIVA 3EHKA 4N7UA 4CEYB 4OHZA 4O9GA 5IHRA 4IE4A 1R092 1W6PA 2RMU1 3VBHA 4DXZA 3S3WA 5JMCA 5BNOB 3ZOIA 4JTAB 3RYIA 1N33O 4AVBA 3TB0A 3MIHA 3TBDA 2P3JA 3UKVA 1QOTA 1G6UA 5ABJB 2DCJA 4CBCA 5FZ0A 2R063 1POQA 4HVOA 2H0BA 1NZIA 1M1KW 3O1UA 3N3HA 4B8EA 2K2SA 5LA9A 3DC5A 3AB0A 3IBMA 3FD9A 3ZYIB 4JKKA 2WZ8A 1HX6A 2Z3YA 1OCRB 3PMSA 5G05L 4XZUG 5KHKA 1MVQA 4LITA 2W68A 1XJAA 4PDLA 4E4ZA 3OGCC 2EAKA 5FIXA 4NAOA 2CH7B 3OB8A 3D6EA 5EP9A 4P08A 4IEOA 2WJSA 4LNUA 3ZXEA 4YJ3B 1D5AA 4Q4V1 5GLVA 4LBEC 1VBC3 4QM9A 5BV6A 1T2XA 3ZXDA 2A6VA 3LPGA 3WCRA 2Z4FA 4JKLA 4YW2A 4KU7A 4XAAA 4NWVA 1SZXA 2Y0IA 5FZ8A 1W6OB 2FCUA 1N0JA 3M2MA 4AHWA 1KYOF 4RYDA 4WVMB 5DXDA 2R70A 3VZMA 1PGW1 4BH9A 3TGUH 3OUJA 3CEWA 4JHZA 1W0OA 1QJX3 2BV4A 3VBSC 2YROA 2QWPB 2E74B 1W6NA 2VMIA 1B35B 2VU9A 2UUAO 3CS5A 1YIPA 2VXJA 1CX1A 1JYCA 2OS2A 2VWJA 3PU3A 1NVPB 3URFA 1U5XA 2XLGA 2AH2A 1CJPA 4LKEA 5DDJ2 2VZ1A 1UOJA 2RS12 4X62O 2WSUA 1SRYA 1SERA 1ENXA 4IEQA 3WOGA 3WB2A 3RYFA 3AYCA 2YDEA 1PP9H 1OPMA 4Q27A 4K0KB 4PF1A 5JLVA 5BNPB 1V6OA 4QPIB 4DV3B 1R1A3 1ULCA 1RUG1 5JR2A 4NIGA 2IZWA 2F95B 2EIJB 4MOAA 5IVYA 5CISA 4LFAB 4LK7A 1MQTA 1Y7BA 3FLPA 4EE2A 4Q4W2 3N2KB 2XUEA 3AXEA 4RA0A 1RUF1 2PLV2 2G38A 3O1SA 2HKXA 5IT9N 2VRZA 2VVFA 3BALA 3AVRA 1GTOA 4YXWG 3THDA 1TNFA 1VAVA 4JI8B 4NXNB 2RS31 5J7MA 2HR3A 1HR0O 4UW5A 4HETA 4B3RO 3VZKA 5CAZA 1HRI2 4CP0A 1PO23 4AEDC 1HRI3 1EPZA 1NQDA 3I7DA 4E8DA 4FLWA 5EK0A 3VBBA 3EXAA 4G3YC 4Q4Y1 1LOGA 4PI0A 2OPWA 2W95A 2XJRA 1V9U1 1UFIA 1ENSA 1SDWA 3P3PA 5CBHA 4CDWA 3PUAA 4YZ5A 2GC0A 1J95A 2ADQB 4IW3A 3K08A 3AP7A 1H1IA 2HWE1 5A7WA 2AGSA 1BQZA 2HFEC 2BTOA 2ZS6B 4XETA 3F95A 3TRSB 3RQ0A 3SDLA 4ZU7A 2HP8A 1KKCA 1J5EO 3PJQA 5BNOA 2O57A 1XNKA 5FOJB 5CFDB 4HNAA 2E31A 3AL5A 1TQ5A 2J7MA 5JSPA 2VUCA 3ZYJB 2Q68A 2XHKA 5JZGA 3OEAA 1MQTB 1VBC1 1V00A 1H4GA 3LZZA 3W58A 4CU8A 3CSXA 2QQKA 1YJWV 2XJSA 3AP5A 4X1IB 3RZMA 3AKQA 4QGNA 5D2AA 1S2BA 3N9PA 3AL6A 3V0BA 1UY1A 3EYPA 5HI0A 4OZXA 2YV8A 5JVVA 4TSFG 4CU9A 2R1BA 4BISA 4HOOA 4MXWA 1GWKA 1ULOA 1OH3A 4AOCA 2WS93 4GX5A 4D6QA 1NCQB 4YYOA 5DZFA 5L7OC 1PIV3 3K46A 3MI8A 3J81N 1ZBE3 1YTFB 3E8FA 4AF9A 2ZA9A 4CXWA 4TN7A 1JH5A 1K5QA 5CFDC 1BCCH 1UX7A 2X8KA 1PGSA 2ZE8A 5LBQA 3T4HB 3HKCB 4JZ2A 4AEDA 1CGPA 5A3LA 3Q9OA 4QD2A 2G9FA 5IWAO 1XMQO 1XREA 1PIV2 2ES3A 1LULA 1H8TA 1NTMH 1I0HA 3RZZA 5T50A 3POBA 1UPIA 3AFGA 1W99A 1YWKA 3FAVB 4TZDA 1Z7S1 1G6NA 3OGJA 4LJHA 5J3UA 1DYKA 5D21A 2F66C 2LW7A 1MPXA 3A0BZ 3SISA 3HQXA 1LOCA 4DR5O 3PUHA 4ARYA 5LP6C 3POGA 3N4MA 2XOKG 2VJXA 3WNMA 2PGGA 2BDRA 2P3KA 3VKLA 5E88A 2XMLA 4Z1MG 3A8TA 4RUEA 3H8UA 2WFF3 3SHRA 3AP4A 2VCCA 4PDMA 2X29A 4OFGA 4TQFA 2WQZC 2CYFA 4QGPA 1LB2A 2A0LA 3R4SA 2W52A 4NWWA 2DTWA 2DF7A 1ODMA 2WO1A 4DRVA 1FAYA 3WB0A 3VBUB 1EN4A 3LIGA 5IDJA 3K2OA 2BNOA 5HFMA 2OUHA 1FFXB 2DW4A 3GGLA 1THZA 4J25A 2PYLA 1A8MA 2DV9A 4U36A 2J1UA 3HAGA 1CJDA 4RAIA 4M4RA 1N47A 3TNPB 4BXSV 3UQ8A 3SPHA 3TJTA 1DHKB 5T5PA 1N8RW 4BCUA 2BOCC 2ZEXA 4HKWA 4QPGC 5IVJA 1R3IC 2OTLV 1DG6A 1FPN1 1GUIA 4HPKB 4I50A 1J59A 1QU7A 4Q4X1 4FFBB 4KWKA 2RS51 4NYKA 2IC1A 2Q8VA 3NNJA 5A7OA 1DQ0A 1B04A 1YFYA 1MMMA 3A0RA 5K8SA 3VD7A 1XBFA 2HWF3 2QM8A 3AG4C 1WCKA 3AP9A 5E1AC 1GN2A 2QE7G 2VD7A 2VL4A 2GC1A 4BK5A 3CCEV 1AR81 4BQ1A 2B45X 3I2OA 4DV0O 2Y6GA 4MVTA 1BLZA 1VEWA 1S55A 3CCQV 3JARB 4DMIA 1P7GA 1F5FA 2ZOEB 4CPBD 3SXWA 1CAWA 5IVEA 1XHZA 3JATA 2FDHA 5LK7B 3NVCA 3ETEA 1QH7A 4OQ8A 1BE3H 4OGQB 4IXLA 5A2QN 2G9GA 4O2BA 3APQA 2HWF2 1W8FA 3OF1A 1QJX2 2IH3C 2JIJA 2AENA 5I93A 1ZYBA 3UJOA 3ZYHA 2ZX2A 5F8PA 1C8M1 2RN9A 4META 3ZX7A 1E5SA 3GJBA 2CAVA 5FCCA 3MIFA 1SPPB 1OCZC 1OLQA 3JUUA 1QEXA 3H9AA 5GALA 4PLNA 4QDRA 3CLPA 2HWB3 2EIMC 3JD72 3FB8C 2GALA 1UYYA 5FZ1A 3L74H 5BR8O 3OMNB 3JB8A 4JZRA 2PA7A 2XBO3 2XT9A 2VG9A 5CFCB 2A70A 2PLV3 4BQ5A 3WG7C 4MVOA 2RMU2 2R49A 2B7YA 5LOVB 3AMNA 2NZ9A 2P4VA 3ZIWA 5JAXA 3BKZA 2BW8A 1UIKA 4XF9A 2ETNA 3T3YA 2UYBA 4C1XA 3B93A 1GZTA 3KSCA 4NMIA 1DDLA 3WZ1A 1HNXB 4RQPC 3LSQA 1TME2 3C3TA 5C3OA 1DCSA 3ZRXA 4KGGA 3VDDB 3HKDA 4DO2A 5KUMA 4K35A 4JVAA 3SITA 4B1LA 2IUWA 2JIGA 4QPIA 2HWE3 1IQDC 3E5UA 4YNIA 2BYVE 1NCRB 1NJIW 1OVSA 5ERLA 5A6XA 4LLOA 1WP8A 4LTAA 1OOPB 4KG8A 2ZEYA 5LXTA 1LGCA 2IFRA 4F6EA 4DB5A 2ZACA 3JQXA 3O1PA 4DV0B 2RS32 5ITZB 1QLNA 2Q67A 3T08A 4YHHO 4C0HA 3ZRSA 3LFMA 2QQIA 2DYRC 5LYJA 4Q8LA 4LO4B 3CPWU 4MHRA 4BQ3A 4QGMA 2YEVB 2CAZC 1AYN1 5KR7A 1K3EA 3FN9A 1LENA 1SQQH 1RGSA 5L19A 3JB4C 1YNAA 2QUOA 4XF4A 3NJXA 2F6BA 4FOVA 1X36A 3DYPA 5IFTA 4UBHA 3BU0A 3GVMA 3K57A 1Q56A 1ZZ7A 4XF3A 3F5TA 2VNOA 2NP0A 2VOXA 2YY1A 2FCTA 1C1LA 2RDQA 4AHCA 1FMD2 1JZ6A 5FLXN 2E7QA 3GHMA 3IZOA 4A45A 2WLHA 1NQTA 4O2BB 1ULGA 2ZE5A 3C3VA 1GO3F 2QWNB 3LOIA 3NV4A 2DOSA 4HK8A 3APOA 1E1RG 1AR72 2D40A 1US3A 3VZLA 3WINE 3IAQA 4AFBA 2OZ6A 2HBUA 2HJIA 3MHHC 2KXLA 2Q4PA 5LBEA 4S2FA 5DAXA 2IXKA 3R66A 1F31A 4O4HB 3PIJA 4MHUA 3FFQA 1OLRA 1CZSA 1AR62 1HLCA 3H3LA 5GW7A 2EZPA 4NN0A 3RMXA 5ACA1 4TUYA 3CXHF 2Q0OC 2F43G 1W8OA 2P17A 3SYOA 3PU8A 5DG2A 4MGKE 4N53A 1OSGA 1N1TA 2JD4A 1XYNA 1BJQA 1PV0A 3ZBHA 2FCVA 3M3IA 4UFKA 1MS5A 3MO4A 2J1TA 5GLTA 1QY4A 2XB6C 3H8XA 2JG9C 2YC0A 3DKQA 3T2PA 1HV1A 1FMD3 4O4IA 1RUG2 3RJRA 1F7YA 1MVEA 3D4KA 3J7AU 1PZ8A 2ZT9B 1SBDA 4ONUA 2AREA 4HMZA 1AX0A 2WKKA 4ET7A 3VHOA 2E9QA 4I55A 2D3OW 4M01A 1H8VA 2MPFA 3EB7A 2CTQA 4A2UA 1W8ZA 4LH7A 1N33B 1GM7A 3VDAA 1TA8A 4PA4A 2HLEA 4D6TH 3IDEA 1JYXA 3S57A 3O5SA 3G71V 1DQ2A 4TLGA 1RSOB 1WLCA 4D94A 4XEZA 3I2KA 1ULEA 3ZYBA 5JUVA 4ES8A 2JB4A 3KQRA 4YVSB 2N74A 2ZHKA 3BA9A 1WA4A 1S0EA 4X89A 1HDKA 3VBRB 2PYTA 1E57A 2QZ2A 2JG9A 5K0UA 1GZCA 4CP9A 3KF3A 4PD4F 5JDBA 4LPLA 2VTXA 3I3QA 1SFYA 4DZGA 4IE7A 5JVDB 4IV1A 5FMOL 4NRPA 4ASUG 2ILMA 5FP4A 4RHV3 3W20A 3MDSA 3FUOA 2B1IA 4FJCC 2GH2A 2VCAA 1UMIA 4EWAA 1OA4A 1DQ1A 3UKNA 5EZYA 2KR2A 4AFCA 4J80A 1MEC1 5F2SA 4U2AA 1HB3A 4X6QB 4Z2WA 4PA9A 1COV1 1Q8PA 1PNFA 1ZRCA 4IGGA 5H9PA 3SNMA 4XW3A 5A33A 4AK3A 1PM9A 3WG1A 4IEUA 2EJ7A 4P5YA 4GWMA 5T54A 1QKQA 1W9SA 2V73A 5IVVA 4I02A 1ZA4A 5JI7A 2OZJA 1KXGA 1RUE1 1DGLA 3CKHA 4H7MA 1WLWA 4IEWA 2RDSA 2XAFA 2QTOA 1ST8A 2X6CA 2ZGPA 2O8OA 2ORXA 4Y33A 3M99B 4FTSA 1ZBA3 3WNOA 1DGSA 5FV3A 3EJKA 3CHXA 3FB5C 2O0OA 4MSVA 3ZFFB 4RS5C 1NG0A 1GN4A 1X82A 1X8EA 4YGCA 4W6XA 3VZJA 5E8AA 3DUIA 1HQWA 4XPVA 1LESA 3AMHA 5DAVA 4HSLA 4FFHA 4EB6A 1KEXA 1AL22 1J58A 1AILA 1REDA 5EBMC 3VBRA 1EV12 1WMXA 4SBVA 1VB2A 3BTYA 1M56C 3NQHA 2ZIMA 4YW5A 3NSTA 3JQWA 2ZXWB 1R082 1PK6B 3UGFA 5JCOC 4QXBA 2JDMA 1WD3A 3GYDA 4Q4V2 4YIPA 4MW3A 5EIBC 3N9MA 1M5IA 2ZHLA 1WMFA 5CKMA 5EQUA 3VBHC 3H0OA 5A80A 1FNZA 3FHIB 5A3PA 2CNAA 1OCCC 3CCUV 4XMIA 3MAQA 2G19A 1AI6A 2WLLA 1V6LA 2W9XA 1RUI1 2VQEO 3MBWA 4JGYB 4W4ZA 4GH4A 2VULA 2GC3A 3OY8B 1CQ9A 2VQFO 2GSYA 1B3QA 1D4M2 4FPKA 1ZTEA 1KS5A 4D6RA 2R1DA 4QKDA 4LH6A 1RL3A 1SMVA 4XBLA 1AVMA 4H55A 3UL2A 2EIJC 4IE5A 5L36A 5K1PA 4I4TB 3ILFA 4R52A 2ZX0A 1IBMO 3SKVA 4MVSA 5A3UA 2BERA 5KUKA 2GMMA 4BZ4A 1O8SA 4AHYA 3ZKYA 3B40A 3LUTB 1XSQA 2QQWA 1A6CA 1OA3A 1YJKA 1G9CA 4GAZA 5FRAA 1UX6A 2W5FA 1PZ9A 2D97A 1H2GA 2D5HA 1CEZA 4AI9A 2JDIG 5L3BA 4CC5A 2VZOA 4GX2A 1OV9A 3B4SA 2Q69A 1W39A 5D8AB 3VHNA 2WA4A 3WP6A 1G9AA 4TYSA 1AI4A 1GK9A 3PDQA 5JOWA 4PJYA 4CS4A 1N1SA 4RR3A 1K3IA 2QDRA 4ZHQA 5FKBA 4QXKA 3E1F1 1O3SA 5LW9A 1WCQA 3OTFA 5FYIA 2ZR2A 4JI6B 1YHFA 3D36A 4DEQA 4LKFA 1WWYA 1K12A 2QBXA 5DM6V 3N9QA 3Q8BA 2TNFA 1Q7YW 4FP3A 1PNMA 4IV1B 4A7ZA 5K0UC 3O1OA 3ASIA 1WBFA 3LFIA 2B4KA 3AZVA 1S0CA 3QD6A 3B94A 5BNNA 1OD3A 3M4FA 1Y67A 2DMXA 5T5LA 4RN5A 2V5DA 4HAMA 5A7QA 3UCSC 4PLOA 3WDXA 2VQUA 1YZBA 4MTGA 1HRI1 4YM1A 3BCWA 4ZIBA 4O2AA 2BVVA 3D0SA 2RR11 3DYOA 5F2VO 4OQ9A 1RUF2 4NHMA 5GJ6A 3FYIB 3HMYA 2XKOA 4BPZA 3E6CC 1XMQB 4QWNA 3G6EV 1JX9A 1SFNA 3BU7A 1L7RA 4K3UA 4YJ2A 2EINC 4KWLA 2F4LA 2VM9A 4ISQA 3ACGA 3GBGA 2WLIB 4N7IA 4TXWA 2VCBA 5A7WB 5K9YA 4GALA 3T2OA 3J8F3 1WCDJ 2WSSG 5FQ0A 1VF5B 4DR3O 4O4JA 3F7YC 2ATFA 1ND3B 1H6XA 4RGAA 1VQKV 4DY5A 4RHV1 3RDIA 1Z5WA 5CA1A 4MX3A 3B7MA 2D6PA 3H1YA 1STMA 3AG7A 3ETPA 2KG7A 4MVUA 1EPWA 3STLC 2VBBA 2W6IG 4BA6A 3UT5B 3ZHUA 2GMEA 2RDRA 3RVHA 3T4VA 1SF9A 3CCMV 1YQCA 4I0XB 5C3SA 2PMWB 4JTDB 3ACHA 4GD4A 3JAWB 1ZX5A 3P3NA 2A75A 3W9AA 3HNBM 3SMHA 5A3MA 2UURA 5EJ3A 1QJEA 3C90A 3WG4A 1LR5A 1IS4A 3AZYA 2HWE2 4FT8A 2H8PC 1CP9A 2C1FA 2PHXA 4JI4B 3BHPA 5DEDA 4ABMA 1QNWA 3DKWA 3NAPA 5A7NA 4XCAA 1YVWA 3PL0A 5DN6G 4CH5A 4QQOA 4PA7A 4FLYA 5HCHA 4FPYA 4AVVA 5LBFA 4H33A 3WNKA 2Q9LA 1RUE2 1Q6IA 5FTTC 1Q6UA 3AJZA 2F23A 2V09A 3UNPA 4B08A 3W7WA 3D3IA 1FD9A 2EX3A 1ND3C 5C8CA 4DUWA 1XQ8A 1SLIA 3ZKUA 3J80N 4IESA 1P49A 4MW8A 1HNWO 5CADA 4RD7A 2R042 4D8MA 4FM1A 4EFEA 3FE5A 5CYYA 4GJYA 4ATFA 4TV8B 4Q0UA 2JGDB 3EBRA 1FOD1 1VJ2A 2VNGA 4JAVA 5JIAA 1JJOA 2L9LA 1UZ0A 2D3RA 5L73A 2JRIA 4CU6A 1DIWA 1IURA 2Z69A 1XMOB 1PM7A 1AJKA 5IYZA 5SV5A 5F37A 4CUGA 3I2JA 4UF0A 2XOMA 5F5CA 4AQTA 1S5LZ 2BWCA 5BXZA 4BMEA 4XILA 2Y4UA 2Q0AA 4J9ZB 1SQXH 3ABMC 1L7LA 1Q6HA 1XNQO 1QVFU 1UYZA 4ASLA 2UXBB 3JXSA 3BOPA 3JALA 4X20A 4UVBA 4DQAA 2XNDG 4H2AA 4EV0A 2WNEA 4CUCA 4INDA 5E16A 3SCFA 4A3XA 3JARA 1B6QA 2ZR3A 1BEV1 1LHNA 4KNCA 1GKFA 5CFCC 2WNVA 1JPXA 1JFFB 2FDGA 4ICGA 2XWJB 1RB8G 4LO7A 3ZMNA 2BFUL 3RN4A 1NZ6A 1Q5OA 3LSSA 2WZR1 1QDCA 1CXZB 5FPBA 2ARXA 4JQRA 3L73H 4UCVA 1WMEA 3MLLA 2LQTA 4NXNO 5FY0A 3WNLA 1VMHA 4QB6A 1AYN2 5D1IA 4YVSA 4LBQB 2ZINA 1IKQA 4TSVA 3J7HA 1CAXA 2JGUA 1OA2A 2R16A 1PO22 5F6KA 4JGYA 3K75B 4M3CE 4L97A 4DR1O 2A6YA 5JH7A 4MGYE 4AWDA 2PY5A 2ZZQA 3S7EA 1PO11 3WV6A 3ZXAC 2W92A 2UXDB 3WP4A 1A3KA 3K51A 1EV13 4ZONA 1KGYA 2DVFA 3QH6A 4UCOA 4K21A 1Z5VA 2C0ZA 3LDKA 4AQSA 3AM2A 1DYOA 4XIKA 4OHWA 1CR7A 2VW1A 2E76B 2ID4A 1HNZO 3CCSV 4JHTA 5BZBA 1IPJA 5JSRA 2AGAA 5GM0A 2LJ2A 4G28B 2HHHB 4Y20A 4GX1A 2IH1C 1H9WA 3O1MA 4N90A 2X0LA 3KCYA 1Z0HA 3RYIB 3W7TA 1XB9A 1SZTA 1D0HA 1KJLA 3ZMSA 3WUDA 3ENRA 1ZBE1 1KFXL 1GR3A 4ZU5A 2GTSA 4XIOA 1X9PA 1PM4A 1MZ5A 3E22A 5FZHA 4DINB 3WNNA 1LAJA 3EO6A 1JZ2A 3CCRV 3SYCA 2VZPA 1AJOA 4K7JA 3BODA 1AJQA 5FYCA
chains in the Genus database with same CATH topology
4WVMB 5DXDA 3R05A 4XE9A 2PHWA 3B5LB 3VZMA 2EAAA 2EXIA 2R073 2XL7A 4QPYA 3RWNA 3S0MA 1PGW1 2YMZA 1NX4A 3WCSA 1GY9A 1QMJA 2VMGA 4BH9A 1YYNA 5FO8B 2BQPA 2A7AA 4CWDA 2HWC3 1SEFA 3CEWA 5K7PA 1W0OA 1QJX3 4I30A 3VBSC 4ZXKA 3VGIA 2XJVA 2YROA 1GZWB 3H50A 1H4HA 3O14A 4OUSA 5GZCA 1TMF3 4JCKA 1W6NA 1QXJA 1RIRA 2VMIA 1B35B 4XF0A 2VU9A 2WA3A 5T5JA 4JAAA 1YIPA 2NMOA 1JYCA 1RMU3 5A33B 4YGDA 4GKYA 2RS11 2FBEA 1QJY3 1SBEA 4XJZA 1B35C 3URFA 2X5IC 1H2KA 5F6LB 1U5XA 2XLGA 2AH2A 3EATX 1WMDA 4FQ4A 1CJPA 1QQP2 2DUOA 2OW4A 3AKPA 4QQHA 5DDJ2 2A3XA 2RS12 3UJQA 1B35A 2H6CA 4YM0A 2WSUA 2AR6A 3UKTA 4IV3B 1ZRDA 1ENXA 3LA3A 4IEQA 4AFMA 3WOGA 3WUCA 1UF2C 4BIFA 4COZA 4K1YA 5H9RA 5FFOC 2HWF1 3DF0A 3M3CA 4XJ8A 4B4PA 1FMD1 3M1HA 3T1LA 3AYCA 2WWSA 4PQ9A 2YDEA 5DUWA 1OPMA 1AL0G 3WR0A 3S30A 1SLLA 4Q27A 3D82A 4YVWA 2C9AA 5JLVA 1OQ1A 1IQAA 1V6KA 2RS53 5BNPB 5F9TA 2HWD3 3O0XA 1V6OA 4QPIB 1PVC3 1R1A3 1ULCA 1RUG1 5LEJA 3E5XA 4EJRA 1LODA 2ZMKA 2IZWA 3NKTA 1GQHA 4XJUA 1G8WA 1K5MB 5C8CB 1DU3D 2ZMLA 3L9JT 3LCPA 1ENRA 4AHXA 1X33A 5KHGA 3ZDSA 3KGLA 1MQTA 1RUH1 1DZQA 3RG0A 1Y7BA 3FLPA 4YZ4A 4XFFA 5D8AA 1WLDA 3ZN6A 4AG4A 4Q4W2 3AXEA 4RA0A 1RUF1 4MXVA 4W6YA 2VECA 2PLV2 4HN0A 1LHVA 2JECA 3ZSMA 3ROUA 1CIWA 5FO7B 3R0RA 2HKXA 4UW6A 4CDUA 5J09A 3I59A 4HK9A 2KA3A 4N9IA 2VVFA 3BALA 3NL1A 2O8QA 1CD3G 5GLWA 2HWB2 3OGGA 4M3CF 1TNFA 3IWZA 2GN3A 1VAVA 1I9RA 2QNKA 1LECA 3AJYA 3FC0A 2RS31 1C5HA 4P9XA 2D7FA 5J7MA 5I0RA 4HPKA 4UW5A 1NLRA 3LOBA 1GBGA 2QKDA 4HETA 1CAUA 3VZKA 1HRI2 5CAZA 4CP0A 1PO23 4OHYA 1UIJA 4PLMA 4GWNA 4AEDC 1XE7A 1D4M3 1HRI3 3NO8A 1EPZA 1NQDA 5HSXA 2LALA 2TEPA 3E5QA 3I7DA 4QX5A 1YIFA 3LSEA 4G3YC 4Q4Y1 2VVDA 4EN6B 1ZZBA 1LOGA 4XJWA 2XJRA 3EXUA 1V9U1 3ZIXA 4EWEA 1ENSA 3AZXA 2VOVA 1SDWA 3QCWA 1OQEA 4WZFA 4CDWB 3P3PA 2YYOA 3MFCA 4M2CA 2CL2A 2DYCA 4HANA 4LUKA 4CDWA 1RUG3 1AXYA 4E9KA 4YZ5A 3GNEA 4QQPA 2GC0A 1RMU1 2IXJA 3ELNA 2K0GA 2P3IA 1AR73 2ZJCA 5FDBA 3AYEA 3CJIC 3AP7A 2Q1ZB 1H1IA 4XHXA 5EFUA 4W6WA 1HQNA 1VBE2 2HWE1 4XJAA 1OHFA 4CEWB 2WQ4A 4XQ4A 3RSJA 4XXPA 2AGSA 5FAXA 1HXS2 2GNMA 2Z5WA 4LBQA 3ZFEA 2QCSB 4IEVA 2JG8C 2ZS6B 4FFAA 1JHNA 4XETA 5CG8A 1DZTA 3FLRA 5HCFA 3TRSB 3RQ0A 1X50A 4ZU7A 3E6DA 3MICA 4WM8B 2K9ZA 3W59A 1LCLA 3ACLA 1ZBA1 2HWD2 1R083 3PJQA 3FBYA 5BNOA 1OFNA 4BYYA 1HRV2 4S2GA 4X8PA 2PHRA 3VBOC 2OUJA 4G4FA 1XNKA 2WFF2 1PO21 3QOPA 4GMP3 1H1AA 5FOJB