2XUMA

Factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRHSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 106
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2xumA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xumA01
2YDEA 4NR1A 5JWPA 2CGOA 3D8CA 1IZ3A 3P3PA 2ILMA 1H2KA 3KCXA 2XUMA 3KCYA 4B7EA 4AI8A 3P3NA 1H2LA 2WA4A 2CGNA 3OD4A 2YC0A 4BIOA 2Y0IA 2WA3A 1H2MA 4JAAA 4Z1VA 2W0XA 4QU2A 1MZFA 4B7KA 1YCIA 4Z2WA 1H2NA 1MZEA
chains in the Genus database with same CATH superfamily
1KD7A 3V0AA 4CPBA 3HQRA 3CWBH 4ORFA 5I8TA 2WWWA 4M4PA 4XZUG 4KMQA 4Q4X1 3K3OA 4EN6B 1JU4A 1JA8A 2JECA 5LASA 4P9WA 1XQNA 3LD8A 3BOPA 5FYHA 3Q9OA 4JI3O 5LMNB 5JSPA 1TQ5A 1WP8A 2B5UA 1UW8A 2IVIB 3ETGA 5FXXA 3STZC 4PHZA 2KQXA 5FP9A 2CSGA 4AFDA 5CA1A 3WG2A 1KU9A 1NYWA 2A3QA 2X53S 4BAYA 1COV1 2FZ2A 3ASNB 4ASUG 1PK6A 4LF8B 4JI6O 4JV5B 2R042 1NZ6A 4XAEA 5BPXA 5HXVA 4NHXA 3P32A 4BISA 3ZN4A 3ZRXA 1F31A 3I2OA 1QXPA 1OCZB 1I94B 4ASLA 2C9KA 3TWIA 2ITDC 3C7HA 5T3NA 3LDRA 3K2OA 3OY8A 5KHIA 3TEZA 3VL8A 2JENA 4Q0QA 3RRDA 2XAFA 1PL0A 3ZR6A 1C28A 4CEYC 1CJPA 1ZVFA 1SF9A 1MVEA 3VHOA 4XUNA 1MS9A 5T5JA 3M3EA 3CC7V 4PCRA 2J1RA 3A22A 4Q4Y2 2B1IA 3ABKB 3T3YA 1SRYA 2ZGTA 3C7GA 1JYIA 3K06A 1O5LA 3I59B 2WLHA 5DUVA 1NLSA 4RS5B 2DVBA 2RS33 1TME2 3RWNA 3THOA 4B4QA 3A0HZ 3AM2A 5LHGA 4NWWA 4BB3A 1WA8B 2HEVF 3SEPA 1VMGA 1FMD2 4X66B 2VZQA 2DFCA 4PBOA 2QM8A 3KLSA 3R4UA 2D7FA 1QJZA 4QPKA 2HKOA 2C5DA 2WLMA 5CFCC 1GQPA 4PDWA 5LA6A 2ORZA 4BQ5A 4F8AA 1HXS3 5FDBA 5DM6V 1TMF2 5EXOA 3VHRA 1YTFB 5KAIZ 1W99A 2BTQB 3EFFK 4TSFG 4LLFA 2RMKB 1M57B 4YIOA 1WA4A 5AG2A 3WW1A 1UN1A 1DQ0A 4YLZA 2BFUL 4N53A 1S5LZ 3X29B 4QWNA 5KLVH 5JMOA 1SBFA 1W2OA 4KWLA 2ZHLA 1ZBE1 2EIMC 4Q4X2 1BBT1 1I5XA 4JGZA 2ARBA 4KU7A 3VDDC 1TA8A 4CDQA 4DXSA 1P4RA 3FLPA 4YFWA 3AXEA 4LE4A 3ZIAG 4IV1A 5A1LA 2WQ8A 2CE4A 2JD4A 1M4UA 5KC6A 5L19A 1COV2 2FHRA 2BYVE 2CTPA 4X88A 1W9FA 4O4HA 4CRQA 2WL1A 3K08A 3SJBC 4UCRA 2VPVA 5LP6C 2R0FA 3DXRB 3PJYA 4NXNO 1K5SA 4N7UA 1GAXA 2WNVA 4AK3A 4BLIA 1MOFA 2XT9A 3UQ8A 5FY4A 4XHXA 2R16A 4R7CA 1JTZX 2VULA 5FJHA 1HP8A 2DVDA 3LDEA 1SZBA 1MS3A 2GN7A 4FMTA 4LHNA 4FOVA 2HWC3 2F1MA 3J7LA 3IJ4A 5C6CA 4KG8A 5I0SA 4GKKB 5C3SA 3H8OA 3ZN1A 3H1MA 5FYSA 2B4KA 4FOYA 3SITA 1PGW2 2FB5A 4D3WA 5KR7A 4BMBA 3PUSA 4DPNA 4N8MA 2PN5A 1ORQC 5T55A 1YLLA 2IH1C 4O61A 5FNVA 2JD9A 4AVBA 3IC7A 2Z79A 3VBHC 2RS13 5FV3A 4CDWA 5FPXA 1K34A 5IK7A 1EV13 4LO6B 5BV6A 3GHNA 4HOOA 2EINB 2BU9A 4U3JB 3N2GA 2DWDC 2A6WA 2EIJC 1CR7A 2Q67A 1HLCA 1GTOA 2GNTA 3VZKA 2YG0A 1OD3A 2PYLA 3NAPB 4N43B 1RMU3 4KI5M 4TUYA 5CAZA 4QB6A 2UXXA 1N36O 4NB5A 2XKPA 5L3EA 1SQFA 4LQRA 2P06A 3B02A 4MGZE 4RA0A 5ACA3 1A32A 3FX7A 3LUTB 3CXCU 1N1YA 1IS5A 2DE0X 1ULCA 5BNOB 5CBLA 1EPZA 1G9DA 3ZHRA 1ZBE2 2XUEA 4YVSB 4YM1A 4CA9A 2WIIB 1W8UA 4MGYE 1OA3A 4EN7B 4QX0A 3W5NA 4CH6A 3WG7B 3L75H 2CU5A 2BGPA 4CCMA 5BMVA 3LDKA 2W46A 4LHSA 3N9QA 1NLRA 4YZ4A 2ZE5A 4CUCA 4WVVA 4QQ2A 3OSDA 1AL21 1PO22 1Y4MA 4P9GA 5C33A 1GZ9A 4BJ0A 4I01A 4X62O 3URFA 4QPWA 3KMHA 4BXFA 4PBPA 4ATEA 2WJSA 2LGWA 1G9AA 4LFCO 4ZKIA 5FY1A 3OTOB 4L8JA 2P4VA 2WS92 2JDIG 1G9FA 4AFCA 2QTSA 3WEZA 5IJRA 1RUD3 5CG9A 3B4SA 3OPZA 1VP6A 1DQ2A 1BCCH 1OUXA 1OLMA 2CAZC 3OUJA 4IGGA 2WT1A 3DXTA 2ITCC 3J7MA 4P02B 1Y6XA 2OCCB 4CEYA 4FPPA 4AFBA 1X82A 1WLWA 2UWBA 3GGLA 4DZGA 4QPYA 1ZBA2 2WLIA 5T5LA 1OT5A 4B3NA 4JTDB 3RWRD 4CXWA 3NJYA 2BNOA 5EWSA 3WDVA 2YICA 1KKCA 1D2DA 4JI0B 2QZ3A 4DQAA 3L73H 4IYHA 5IE9A 3D3IA 2VUJA 1VLNA 5FZ8A 2OTLV 2Q30A 4QX8A 4IV3A 4UF0A 5F6LB 1UY2A 4ZU4A 2A6VA 2AGAA 4FZ0A 3PLQA 5BNQA 5CFCA 2WZEA 3ZN0A 2UUBB 2XWBB 2JG9B 3NQHA 1TGOA 3CCJV 3I2KA 5LZ6A 1F4NA 5IYZB 3ZBHA 3VUOA 3OBAA 1MABG 2Z3YA 1FT9A 2UU9B 1G4YB 1URXA 1V6OA 3BPZA 1GM8A 2ZA9A 1UO9A 4TWTA 5LEKA 4DRRA 4L99A 4M3CA 4OLLA 3AVRA 4UCVA 1HQLA 1TUBA 2BUKA 4LWSB 2JG8C 2RDQA 5FK8A 4EEQA 4KFMA 4QKFA 5EYPA 4XQWA 4XE9A 2RS31 2WYFA 3ASIA 1XUQA 1VBB3 5EJZB 4PDMA 3P3NA 1N34B 3PNAA 1KS5A 2A0LA 2WLJA 1EZVH 2Q0OC 2R1BA 5JJJB 3VDDA 3E1F1 1XJAA 4X64B 1Q8QA 1VBC1 2J1EA 4DB5A 2V73A 5DDJ3 5L3GA 2VOVA 4FLYA 5LL6Y 2A1XA 5GKAC 1AL22 2ZKOA 1W0PA 4LC1A 4LO5B 2PI5A 4QJFB 1HXS1 2IU3A 4J41A 1BMV1 3OB8A 5FR3A 1VQ5V 3AYAA 3UGGA 4A5UB 4RUEA 3VD4A 3ZFGC 5LP6A 3MAQA 3AG1C 2YUAA 1IHMA 3E8HA 4I3GA 2GMEA 3P3PA 4LH7A 1V00A 2JJ6A 2K9PA 3I54A 3AP7A 2MK3A 2J7MA 3HOBA 1QHTA 1FAFA 1JHNA 2HWB3 5DEDA 1K7DA 3OE7G 4OPAA 5HCHA 4R4ZA 4B7EA 1ZTEA 3ZRVA 5B1OA 4Y4YA 4ICGA 2X0LA 1W06A 4XVHA 5GALA 1UL9A 2VOTA 3H1YA 1EY2A 3N9MA 5A7SA 4EFEA 2ENRA 4BE3A 4D7YA 2QQPA 3OEBA 3THTA 5F5AA 2DYSB 1W05A 3LSQA 1CP9A 1GBGA 4CZZA 2EAKA 3ATGA 3VBHA 5I8YA 1OMIA 5KBFA 5KA5A 1K97A 5JCTA 3K5MA 3T1YO 4XQDA 3R4SA 4DUZB 1DFQA 4IE6A 1UYYA 3CC4V 1XMQB 3ORJA 1RPRA 1O4TA 3GWKC 4LITA 4GJYA 2RDSA 3W58A 3I2DA 2VMFA 2V1DA 4LKSA 1YFXA 4TV8B 4GZRB 2TNFA 3IPVB 5JIAA 5C8YA 4LK6A 3ZSKA 2Y38A 1QNYA 2ZAHA 3N36A 3OTOO 5LK7B 2Y69C 1R3KC 1PMIA 1BQ0A 4XPVA 3UYJA 5F5CA 4LP8A 2WFF3 1J95A 4E2SA 3AMPA 2BZDA 1QKQA 5E88A 3HIFA 5K1XA 2ZINA 2RS32 4B3SO 5BUVA 3WB1A 3POWA 4LBQD 2MNGA 1WPXA 1YDXA 1ZM1A 3VBSC 1FATA 2Y33A 1NT0A 4QNHB 3KCXA 3OR6C 1VBC2 2GU9A 4Q0SA 5EIYB 2W08A 3L9JT 5CYYA 1BK0A 3K46A 5TISZ 1EV11 5H9RA 3LCPA 4JI0O 3MDSA 3BCWA 3MW3A 2IXLA 4OI0A 4AI3A 2UUAO 3PURA 4ABMA 1HXS2 1YJWV 1BMV2 4AI2A 3O7OA 5C8WA 3ABLB 3BFRA 1JZ5A 2Y0OA 5FQ0B 1DGLA 1RMU1 5F3CA 4MGKE 3RYIA 1K3IA 3JARB 4NRPA 3DKWA 3VD9A 3SKVA 1BZWA 4JX0A 1IQAA 2UUBO 4Z07A 5ACA1 5JH7B 3LFMA 2BSKB 4K40A 3ZIXA 2CAVA 4XUTA 2ADQB 3HQUA 3T2OA 2OT7A 1N0NA 3Q8AA 4QD2A 4QHBA 5FZDA 4PI0A 3JCUZ 3KF3A 2LM3A 4QKDA 3OUSA 2J22A 2DBNA 5T5PA 3FBYA 4HPKB 4XF0A 2OQ6A 3CCEV 3O12A 1CX1A 1PMJX 2E74B 4DR2B 3VD5A 2ZX1A 1RITA 2A9HA 5A32B 4WZCA 3VQYA 2QDRA 3G71V 4XXAA 2RJ2A 4QX3A 3CMAV 5FZ4A 1YIJV 2VQFO 3GHMA 1R091 4RFRB 3WHTA 2Q8DA 4R8CA 2F43G 3CMEV 4E8DA 1A34A 2GAUA 5FO8B 2W1UA 5EYXA 4A7ZA 4X64O 1JZ3A 5HV0A 1DLLA 4TZDA 4ZY9A 3U14A 3GBWA 3RGBA 2NLRA 3ZRWB 4LA2A 5CIRA 3C8XA 4WVMA 5FL7G 5FPBA 2DQ3A 4HBNA 3ZVXA 1JFFA 1LOFA 3ZFFC 1NCQC 4CU9A 3VKMA 4DK1A 2Q7EA 4AW7A 5T52A 1EN6A 2WNUC 5FPUA 1AI5A 3AFKA 3POYA 2Y6KA 3TN93 4EJRA 4YHHO 1AJNA 1ULPA 2VCCA 1AZDA 3PJSK 1HX6A 1JUHA 1QQP3 5C4WC 1AYM1 4QKNA 4O2AA 1SLTA 4OMDA 1VBA3 1GMMA 2RS12 5FP7A 1GK9A 5JI9A 3MIFA 4AEKA 1EV12 2OPKA 4Q4W1 1NQJA 2Q4PA 4M00A 3ACFA 4AAPA 5CB4B 3NVCA 3HWJA 4OI1A 3ZFGA 5IATA 1RMU2 1CAWA 2QWPB 2JGDA 1FXKC 4AWDA 1QBZA 4PLOA 3T1MA 4J7KA 2E26A 1NOVA 1YQ8A 1U5YA 1TVKB 5ACA2 4GWNA 3STLC 4LTAA 2XHNA 5L3DA 2IFWA 3KVAA 1R1ZA 4QT6A 1X50A 2P3YA 3P6BA 2C24A 1Q5OA 3J8F3 2VUAA 4FTEA 1VBB1 3POJA 3WW2A 1Q82W 4LF6B 4N23A 1TZOA 3T08A 1ODNA 1W0NA 2VE1A 2OIGA 5BZBA 1R081 1BVVA 2EIKC 2ZXWB 1ASJ3 3ENRA 1FPN3 5DDJ1 1M5IA 1H1IA 4Z82A 2Q73A 3HKCB 2C2AA 1WMFA 1ZZ9A 1ZZ7A 1JYCA 5ITZB 5BNNB 4JZGA 3AX4A 4CVUA 1R092 1AI7A 3I3DA 4X65B 4D8MA 3LOBA 5A3OA 2XUMA 4LNUB 4LT5A 5EZYB 1Y66A 1EAH3 2VNRA 1RUD2 1S76D 4UWDA 4X8PA 2JICA 2LALA 4META 2NMNA 2OZJA 4XJ8A 1XE0A 5JDBA 3LQCA 3K75B 1VRBA 2Z2SB 4MUVA 3I56V 3ZLIA 1BLZA 2CL2A 4JHTA 2G9FA 1N1VA 1DGSA 1CAVA 2FDFA 1YC61 1Y76B 4FAGA 4FM2A 1W8FA 2DWRA 3M4FA 4IE5A 1K12A 4XQ4A 4RYDA 1W0OA 1RB8G 1UJWB 4PA6A 2YC0A 1RVF3 4YGBA 3RZHA 4PLMA 4RWUA 1JZ8A 3CD6V 2QJVA 4QPGB 2QE7G 3VBSA 2P22C 1PX3A 2ZGKA 3KF5A 2DN9A 2OXBA 3H3UA 2FDKA 5FBJA 2RJZA 4CH5A 5FXWA 2GNMA 5K0UB 3OGSA 1GWKA 4RGGA 5A7NA 5L9RA 5LXTB 1SQGA 4QDRA 4JAAA 1VBE3 3SR2C 4QQPA 3WV6A 5FWEA 4XCAA 5HBAA 4NTYA 3K4ZA 3KT1A 4LA3A 3DUIA 4UCOA 1DTOA 2C6SA 3LA3A 1C5HA 5DZFA 4JHZA 4B3TO 4NHMA 3BHPA 1K5MC 2PAEA 3SNMA 5CFDC 3EXAA 1FYJA 1Z5WA 4E2QA 3O1PA 3CRMA 1OCCB 4FSJA 3BY6A 3VN4A 1W04A 4BIOA 1VBB2 3LGRA 2Y6LA 1I1EA 1B35C 3JCIA 1Q8SA 4JI8B 2QSAA 2QWOB 2QQNA 2OS2A 5DDJ2 5CB7A 4NYKA 4A42A 1YIFA 2HH9A 4M0HA 1US6A 4GH4C 2M7WA 1N1TA 1QWRA 1Z0HA 4WFHA 1NT2B 4C7UA 5DQ0A 4YY3O 3TXSA 3TNQA 5B3SC 5GZEA 5FP8A 2Q0AA 3CDZB 3A21A 4DV3O 1D2QA 1REEA 2XHBA 4CDXB 4LKEA 2BCCH 2FZ1A 1G8MA 4XFAA 1Y3TA 3PUIA 3ZFFA 4YW6A 3D4KA 3LEKA 1NCQA 2HWB2 4LR4A 2ZX0A 4DNYA 2ZGUA 3HKEA 2EX3A 3AP4A 1KFUL 1OBNA 2WNUA 2A79B 4GX2A 4NOTA 1KQSU 4BQXA 3DPRB 1ZZBA 1XNTA 2NQYA 1RUG3 2VVDA 1SFNA 1OI6A 5C4WA 4K35A 4HNAA 5IK8A 4OYUA 3ZXLA 3T2MA 1AR1B 1JH5A 4XF4A 3ZHQA 4IE7A 3ZN5A 2DVFA 1AR73 1DHKB 3C3VA 3RI8A 3RPQA 4LF6O 3ASOC 4RD7A 4O4JB 2W47A 2NR5A 3NKGA 1NVPD 4Y3OA 1AR83 4FQ4A 1N3OA 2JB8A 4B4PA 4LNVA 1VQPV 1IBMO 3WB0A 1UOFA 2F4VB 1F51A 5JCOC 5FMOL 5LA9A 4OUSA 1IKQA 3BTZA 1FXKA 4P9XA 1K4DC 1OCRB 3PMSA 4G3YC 3WDWA 1XRUA 4NTWA 5EJ1B 2FCVA 1AXZA 3K51A 1NA1C 4FFFA 4SBVA 1SCSA 2I74A 4JGYB 2J1VA 2J1AA 5FYBA 1VQLV 2OW4A 3MIGA 4TV9B 2ZMLA 1G1XB 4DUXA 1F4AA 1FYUA 5CA6A 1POV3 1QQP1 2PLV3 4GQ7A 5CN0A 2AR6A 2PMWB 1YVWA 3R4DB 2VQEB 4Q0PA 3NJVA 5FYUA 1C5IA 3UESA 3NW4A 1EZJA 4CP9B 3OEAA 4QX7A 1JQ0A 4K20A 4NXMB 1RUNA 3SYQA 2WKKA 1VBA1 2Z5UA 2GC1A 2W2IA 5EPAA 3OYWB 2R1DA 2VQAA 4OI4A 4FP3A 1ZA4A 1Y74B 1BGYH 3ZYJB 2VQUA 3H3ZA 5HFMA 3UETA 2WINB 3BAAA 1N33O 3RZZA 5JVDB 5TSWA 1OCZC 2ORXA 3RYFA 5IVBA 4OPHA 3VQVA 3CU7A 4Z1VA 1F7YA 2O8QA 1HJFA 5F2WA 1W90A 2VM9A 3S3WA 2XONA 2EXJA 2IXHA 1A8DA 2GN3A 5FMBA 1UX7A 3DF0A 4JAUA 4A2UA 4ASMB 1BVP1 1SQXH 3W7WA 2O57A 3MIBA 4UFKA 5JVVA 3M1HA 3FUQA 4R50A 2YBPA 4YZ3A 1V6JA 5E1AC 4AHWA 1KB9F 3N9PA 4HT1T 1EP0A 2W1QA 5L9BA 4IESA 2VS0A 4QU2A 5LATA 4FPFA 3X2QB 4B08A 4Y22B 1CEZA 4JI2B 4A44A 3CC2V 5FLHA 2KR2A 5KX5A 2NN8A 2TBVA 3NV3A 2PELA 1GQHA 4AOCA 1AR4A 4Q4V3 4MVOA 4KQ7A 3NMBA 3FB8C 1WCDJ 2WWUA 4NJ4A 1SQPH 2EULA 5EC2C 5F6KA 1O4YA 1EAH1 1VAMA 1J3PA 2W3JA 3VKFC 4GCZA 3VBUA 2HFEC 3D36C 3PJQA 1YQ5A 2VZTA 2ET7A 3QF7A 1S4CA 1U5XA 3M3CA 3SGIA 1KRIA 3TEXA 3DV8A 3RWKX 2ZE6A 3OW2U 5FJKA 3ZOIA 3DYMA 3S57A 1WKYA 3WNLA 1RHI3 2RR13 2AEZA 5EJ3A 2YXYA 4CH4A 4H44B 1S0CA 3TN92 2XHKA 2ODMA 3RYHA 1GN3A 4IIJB 3GJBA 2CDPA 4XDOA 4DR6B 1K5MA 1QQP2 3LSEA 5CFDA 1RVF1 1KYOF 2DBIA 1P49A 4TT3G 1PHMA 3TNPB 2YI8A 2OPWA 4LULA 3J80N 3EHBB 1VBA2 1B35A 1O4ZA 3MYXA 1UIJA 1V0AA 3HD8B 4I7ZB 1V54B 4JQTA 4LF7O 4K8XA 2N74A 2DOSA 5F1RA 2C9AA 4DINB 2PA7A 1W6NB 2WQ4A 4EFBA 4GH4A 1DP0A 4DR7O 2QZ2A 2XLGA 4XJAA 4U7NA 4QDQA 3J4UH 2QTWB 4Q8KA 2ZDIC 1H8TC 1URFA 2WDBA 1W8TA 4XBNA 1LGCA 4F3JA 1VBE1 2OYZA 2B9VA 4TTGA 1LB2A 2GC2A 4L0PA 3T2PA 1M93A 1YTFD 1OF3A 4UOJA 1FOD1 3ABZA 4LE3A 3M7AA 1W6OB 5CA0B 1RPOA 1QCEA 3O0XA 1OZ0A 5GLZA 3ZHTA 3RYKA 2HHHB 1REFA 1AJQA 1H4GA 2VZSA 4LBOA 1NJIW 3APBA 2ZT9B 1O8SA 3M2MA 1CZVA 4DK0A 3ZM8A 2W95A 3ZFEC 2IC1A 3ZXKA 1PP9H 3GJAA 1Z7S3 4KXRA 4QXHA 1RUF3 4AQYB 3I2FA 4IDZA 2WZR3 1GM9A 1ASJ2 1FPN2 2MW2B 5AC91 4N7IA 3USUA 3WW3A 4F7ZA 3JALA 1XU2A 2VQEO 1KBHA 4R8HA 5A6QA 4DW1A 2KXLA 2RMU3 5KMGA 3IKWA 5EFUA 4J25A 1EAH2 4UCSA 4DR3O 3AL5A 3WP6A 3OJBA 1OOPB 2OIEA 3WB2A 4WFFA 4N43C 5A7WB 1UPGA 3HKBB 3OOXA 1C4RA 2XWJB 3A4UA 5JCOA 4E27A 3QG5A 5LYJB 5FK7A 4NPRA 4YARA 3H1IH 2DURA 1GSLA 1HRI3 1NA1A 3RZMA 2RS53 3HJRA 2WLQA 3TAYA 1TEIA 4KG0A 4IGOA 1AXYA 4YVSC 5GLUA 2W1WA 4NIIA 1RUG1 3D5OA 3CJIB 1RVF2 1OJHA 3NXSA 4MVSA 3WG7C 2Q1ZB 4Y5Z0 2KM2A 5J2TB 1I5ZA 4AGRA 3K04A 1UIKA 1O9HA 1HNWB 2YU1A 3C3TA 1C1LA 3IMMA 5HXMA 1AR71 2Y6HA 1RGSA 3IDBB 3HT1A 3U4SA 2P7TC 2HBUA 4FFKA 1NQTA 4OHVA 4XILA 4AGGA 1ENXA 1PO13 2UWCA 2GHYA 1VAKA 3JBG3 3K9AA 1VE0A 5H2FZ 4WV8A 4I0BA 1LOEA 1VBE2 4MSVA 2AACA 1JU3A 4YW3A 3ZR5A 3N4MA 5LOVB 4JI5B 5KXBA 2JRIA 2LTNA 2HBTA 4IT5A 2XOKG 4QPJA 5GONA 1L7QA 1UCXA 2OQ7A 1RUE3 3MPBA 1WZXA 1WN7A 5L3BA 4A6OA 3B77A 2AUYA 3ZYBA 3KG2A 4CDUC 1RUH1 3T1HB 4DV7O 2CTRA 2DQ0A 3VD7A 2FMLA 3JXSA 5LY2A 1GYKA 2YEVB 2ZACA 3HNMA 2XAJA 5JPMB 1JYXA 2LJ2A 3DSQA 2D3SA 4JDOA 3IAPA 2G38A 4DR6O 4RGAA 2IU0A 4CZSA 4DR1B 4LOSA 4LBKA 1RL3A 1DQ6A 4OX9O 4KBBA 1UMIA 2HWD3 2KKWA 2EILC 3PVEA 2VWKA 5CADA 3TRSB 3VBRB 2DW4A 3QLQA 3LIHA 5IWFA 5FZOB 4OHYA 3D36A 3H1WA 5DG2A 1CIYA 1FD9A 3HB3B 1HDKA 2WRAA 2BTQA 5EIBC 3K5LA 3AP9A 2ZR3A 4OUEA 2ZKNA 5GLVA 1JVMA 3KT4A 1PIV3 1XNAA 2KB1A 3K0GA 4X8AA 4AGVA 2ZXQA 5JXJA 2GTAA 1H2SB 2IJHA 2W68A 4W4ZA 2JK5C 3WDXA 2FCUA 3VBOB 3UT5A 2YXHA 1RUG2 3KHCA 3A0KA 4U3FH 4YJ3A 2HHHO 3SYAA 2RNBA 1JOPA 3BB6A 4DV2B 1K9MW 2PQQA 2X29A 4LIUA 4MZUA 2JE9A 3FUOA 2E9QA 3FB5C 1I7FA 3E6DA 1H2KA 2QA4V 4CSWA 1AR72 3OY8B 3WP5A 4IEUA 2DCYA 5KUKA 2AZ0A 3W59A 4AHYA 4FK5C 1NE4A 3FHQA 5AVAA 4AQYO 2VNOA 2JDMA 5LMUO 1AR82 1MACA 3KV6A 1N3PA 3DXRA 5JOZA 1GZTA 4EWEA 2ZDIA 2B8MA 1H8TA 3FFQA 5IK5A 1PL4A 3VL9A 2ARCA 5KWRA 1LENA 4JGSA 1NG0A 3CCQV 5A6YA 1D4M1 1I5PA 5EIBD 5ANQA 1RHI1 2RR11 2YI9A 4QX2A 4MTGA 4L8QA 2E5LO 3WDYA 2RCVA 3MPPG 3T2TA 3VZMA 3WDUA 3IDCB 3AG2B 2VTXA 4KH9A 2XTAA 4C0HA 4XFGA 2JDPA 4A7YA 2ZGPA 4FPEA 1K3EA 4XIKA 1H9WA 1HRV1 1LULA 5JQGB 4LF9B 3ZFEA 2WR9A 3IMNA 4AYUA 3WLUA 4BW9A 4Z92B 3JZVA 4PDWB 5A1AA 1H1MA 5LA6B 5IDJA 2OTJV 1DU3D 2RJKA 4Y1XA 1H6XA 2DCJA 4PQQA 2NNUA 3ETDA 3PVOA 5EC1C 4K8RB 1G86A 3UCSC 1YEWA 1RIRA 3K58A 3T2QA 2YC4A 2JJ2G 2NPIA 4JVAA 4U3JA 3SPGA 4CYDA 2YFUA 1ZRRA 2Z4FA 2OCHA 3FAVB 3GZAA 3DCQA 1SESA 1VQ8V 4FP2A 5HPOA 1BYHA 1ZSPA 5EP9A 1NZCA 5IHRA 5A7QA 4KHPO 1SC5B 4UT5A 2P5OA 1B3QA 2JDAA 1MQTC 5EQUA 1DK1A 3FL7A 5FXVA 5A6ZA 3AZVA 4YG0A 2QKSA 3WUDA 1SBDA 1W3XA 4CDQB 1WCUA 2OZ6A 1FFXA 3CRRA 3IBMA 4I4TB 4TQDA 1Q7YW 2VECA 5JR7B 5GLTA 2OWOA 2VXJA 2Q68A 2G1MA 1YFWA 3PUAA 1EYBA 1Z7S1 1OCOB 1RUF1 1XSQA 1T6GC 2PHLA 1WLEA 1J59A 4MVRA 3J81N 2HWF3 2BDRA 4I50B 2WZR1 4IXLA 4PQ9A 1HNZO 4X1YA 4HVQA 3CEWA 1FXHA 2WNVB 3WF3A 3T1HO 4X6RB 1WNSA 4XJ9A 2RMU1 4I9WA 2ZEWA 3W7UA 1IBKO 4TXWA 1M9NA 2DUPA 2D3OW 5JOWA 2XH6A 1VF7A 4H33A 4AILC 3N9OA 3ZMNA 1O3RA 3CRQA 3ZHVA 4GX0A 4XW3A 1BQPA 3ZO0B 2EZOA 4MVUA 2BWCA 1BHGA 4DR1O 1MZFA 4XTMA 1TG7A 4FPOB 4YZ1A 3S3XA 4YRDA 2R071 1OFSA 2UYAA 3J26N 4GX5A 1D4M2 1HRI1 1S0DA 5HCFA 3ZYPA 4WM8C 1RHI2 2RR12 5DAVA 2P4EA 1Y43B 5LEJA 5K8SA 3R6SA 1XEQA 4YYOA 4O2BB 3AZXA 4DV5O 4K6BA 4FLVA 1YRZA 1OV9A 3HPLC 4CDUA 2QCSB 1PV0A 1JJOA 4CDWB 4NVPA 1NE6A 3RJ2X 1W2NA 4ZS3A 5IT6A 1BJQA 4ONUA 2VVFA 3CE2A 1P7BA 5J09A 3E83A 5A3PA 4JRAA 2QWQB 2BJSA 4JQRA 1WW4A 3JASA 1SS3A 1CPYA 4AQSA 4RHV1 2FTKA 3GB7C 2AH2A 4QE9A 3VQWA 4BIUA 1N32B 3POIA 1I3HA 1PO11 4DV2O 3J7NA 3JBG1 1GN2A 2XJQA 1MMMA 3WVJA 3E89A 4UXAA 4RFT0 5IYZA 5T50A 3CS5A 1DLCA 5C8CB 3EHKA 2BTOA 3AKQA 3JD71 4MX3A 4O4LA 3K3NA 2YHJA 1JW6A 5IYCO 1F8VA 1GWLA 1FX5A 1XILA 4MTOA 2R49A 2E7QA 3JQXA 3JB8A 2UXDO 5KAFZ 3T0BA 3IWZA 1NH2B 4BWAA 1M4WA 1Y9GA 2UXCB 1AX0A 3AEIA 3VBFC 3RJRA 2Q4SA 4I0AA 3PMEA 1HR0O 1PGL2 4A4AA 1JX9A 5LA0A 2VZRA 2NLJC 1Z7S2 1RUF2 3MFAA 4GD4A 1KD1W 5F3GA 5FZAA 2ADDA 4OHWA 2WZR2 1UKGA 4OXSA 2VBPA 3B9CA 1HN1A 4W6WA 2E76B 1ODMA 3GYDA 2QQMA 4JI3B 2HWD1 4KP4A 1CWPA 2G9GA 4RL7A 2GNDA 2RMU2 4FTSA 1LHNA 1ZZCA 2RVAA 2QKAA 4CEWB 3TETA 4FFBA 4HONA 1ZBE3 5CG8A 3SHRA 2BV4A 2WSUA 4Q8LA 1KJRA 1BBT3 3O1MA 3T1CA 4FCAA 2WLIB 2A7WA 1QJY3 1AP5A 5FZ1A 3NL1A 1GO3F 3QH7A 1VRH3 2R072 5FYVA 3EJKA 2KD7A 2ZX3A 5FZMA 1PIV1 3T4DA 1HRI2 3QACA 2LUWA 3GDBA 5A9GA 2WLLB 4UFZA 2WO2A 2HYXA 2RS52 1SPPB 5D21A 5FZCA 4K0KO 5LK5A 4JF3A 1VF5B 2V4VA 4IV3B 4HK8A 1O3SA 4UF0B 5EYYA 3ZXFA 5FTTC 4GKJO 1HNXB 3WF2A 4RQEA 2CK3G 4UW4A 1QNMA 4PJYA 3MO4A 2C1FA 5A3LA 3DXUA 1OH4A 3QBQA 1E5HA 2TEPA 1YJNV 2ZXWC 1K45A 5FPAA 3RT3C 2R30A 1F5JA 3LEIA 5KHHA 1PD3A 2HYKA 1KQRA 1R6TA 3I49A 1VMFA 2QQWA 4ZIBA 4Q0VA 2HVKC 1PO12 1D4VB 2P6JA 3LSSA 2ZAAA 3JBG2 4A41A 4AI9A 2D6KA 2Y64A 3LNMB 4LBEC 2PAKA 2ZGQA 4TV8A 4NROA 3IPVA 5EYPB 5KHKA 1QHDA 5JAXA 1FV2A 3JD72 2VO5A 3RMYA 1GN4A 2VCBA 4QHOA 5F3IA 2AREA 3CMGA 3AL6A 1MZEA 3J7HA 3ILFA 4NHLA 3AYCA 1UXXX 1MQTA 4X89A 1AB3A 2JIJA 1QVFU 3E2EA 5FPLA 1GZWA 1J1LA 5FY5A 3F5WC 3UM7A 2R32A 1K33A 4K9SA 2HG5C 4RO2A 2R7EB 2ET1A 4J7JA 2R063 5DUXA 4FXGB 5F9TA 3PTRB 4GX1A 1SFYA 4QPGC 3VLBB 3VB9A 2PQSA 3T30A 3UGFA 4BXSV 5GZGA 1D7PM 4XBQA 2RN9A 5LP6B 4X1KA 4HLTA 2YGLA 1GNZA 2EJRA 4R9AA 2HWD2 5K0UC 5FPVA 4OHXA 3B7MA 4FOWA 2GUZB 2WFPA 1DGWA 4WFBV 2EIDA 3B8MA 2WNOA 2YIBD 1NCRB 2ATKC 4I5SA 1VALA 1DZRA 4R9DA 4QX5A 4DV0O 1JZ6A 2PI4A 3P30A 1HDJA 1LUVA 2ID4A 1LR1A 3JD3A 3SJQC 5I93A 5H6RA 2VG9A 3MLLA 2ZPXA 4LBMA 2RDNA 4QGLA 3WQ7A 2VGDA 1PIV2 4EN0A 2BSKA 1ZRFA 1IURA 4WM8A 3DEMA 1AL23 5D2AA 3VDBA 1JCHA 4WFEA 4JI4O 4P9LA 5C3RA 2GH2A 2QM4A 4H14A 1OCCC 1OKQA 5IFPA 5J36A 2IJJA 1HQNA 3VBHB 2M6YA 3E97A 2HWF1 3ZXGA 3HBZA 4WBNB 3I55V 5JOXA 4W6XA 2VZVA 3TJTA 1LOGA 4HPKA 4BM8A 2FD8A 4S2GA 1OPOA 3RI9A 2QGNA 2ARXA 2PF4E 2GC3A 1VF6C 2L9LA 1YIPA 1G6NA 1H8EG 5DZGA 4XZPA 3JYCA 1PZ7A 1CN1A 5C8YB 3PL0A 4OZXA 2AGSA 1I0HA 4SLIA 5A3WA 5JMCA 5GLWA 4UW6A 5FUPA 5CNAA 2VCMA 1OUSA 2BE3A 2X8KA 4JI1B 4CDXC 4UI9L 4BU2A 4LH6A 2DMXA 1W6QA 1XHXA 1B09A 1QU0A 1H4HA 2V5YA 1M56C 5F5IA 5KA6A 3AMHA 4XFHA 3RYCB 2FDJA 1LOAA 4LHLA 2QUOA 5CU1A 5D8AB 2VTXJ 1G8WA 1N36B 2ZGRA 3IFXA 1LGNA 3PIGA 3H1JH 3VBFA 5IW0A 3BU7A 2VC9A 2OYQA 1W2TA 3WXPA 4WFGA 1OFNA 2LW1A 1XE8A 2YZ4A 4CCDA 1RUC3 4FJCC 1VJ2A 5FCCA 1VQ6V 1I6XA 3WNNA 2CWSA 3JAKB 3AJYA 3WSOA 1IQDC 1XYOA 4K1ZA 1XNRO 2WSSG 2IZWA 4GJZA 1HNXO 4O65A 2OX0A 5J2UB 4R9CA 1BL8A 4GB33 3TGUH 4QX1A 1UZYA 5L36A 2F66C 3ABUA 1U96A 4R52A 5CB4A 1GP4A 4O7XA 3QNEA 3MV01 1D0HA 4AFAA 3ZSEA 5FLIA 2DU0A 1CPMA 4X62B 2DU1A 4CS3A 2G4IA 5GZDA 5I0RA 3N7KA 4MHUA 2P90A 1OCRC 3Q8FA 3GWOA 4INDA 4LFCB 4E4SA 2ARHA 2XVGA 1K73W 4H3WA 5JR2A 2DYCA 1F5FA 3ZX7A 3G6EV 1VBC3 4JGYC 3QH6A 1TVKA 2XAQA 3F7YC 4OCTA 4BQYA 2XL9A 2L35A 3LDCA 4B4RA 1Q56A 1ZZ8A 2JB4A 2NZ9A 2VOXA 3C3SA 1AVMA 1V6IA 2HWF2 3I5DA 3L74H 3CZJA 2WA4A 1W6PB 3KWVA 3WFVA 2A75A 1AP6A 1DZTA 3MEPA 3OCPA 2P67A 4JYYA 2EXHA 5LY1A 3HKCA 3PHMA 4IL7A 3ZDSA 3AMQA 3P5BA 3JD0A 1A3KA 4WVMB 4QPIC 4KL1A 1Z2GA 2PYJA 4X9QA 1W8ZA 4O9GA 3U75A 3VV1A 2ZKLA 3OM3B 1CXZB 4LHKA 2QQJA 1WW7A 2B9UA 3MICA 2B45X 1QJY1 4UUJC 2WQZC 2CGPA 1VRH1 4IUGA 2XAGA 2A5ZA 3EB7A 4J7ZA 5IAVA 1QR9A 1SLLA 2XPJA 1O6UA 3ZYIB 1Y9QA 5B1NA 4IEQA 3WW4A 2EIBA 2YU2A 1GZCA 4EWDA 3FX3A 3H1HH 1DQ1A 1VQMV 5FPZA 1HB3A 4DEVA 3L2YA 3UKMA 1LUWA 5G05L 1OH3A 3S5QA 2HJIA 1DZQA 3WP3A 3X2QC 1DCSA 4MXWB 1C8M3 3WNMA 2VQ0A 1AYN3 4QU1A 1BZKA 3BVCA 2W6JG 2E6VA 3WG4A 4QPGA 1H1AA 1WUVA 4FQZA 3L9DA 1CAUA 3I8TA 2W0XA 3ZFGB 4PLNA 1CAWB 3AG1B 2JGDB 4XMIA 1LKNA 5K0UA 3UO2A 4BQWA 1QJX1 3S0MA 3Q8BA 3FYEB 3ZX6A 5F3EA 2K2SA 2A70A 3UKTA 5F7UA 3PVNA 3E8BA 2OIIA 5M0TA 2W39A 1XL4A 3ZJZA 4NN0A 4LFAO 3ABMB 2CNAA 2GBOA 4FPGA 2R0HA 3SC7X 5BXZA 4Q5OA 1YHQV 5EBWC 3SEEA 1KMIZ 2QNKA 4JI1O 4P9JA 4YM0A 3M8LA 3IDAA 4FZ1A 3JD1A 1OKOA 5A3NA 2RJLA 1IXBA 5FZ9A 1KXGA 4CP2A 1RYYA 4BQ1A 2VJXA 4YXWG 3VBBA 1UKRA 2R061 4XC9A 2CDYA 3AFGA 4MLOA 4XJZA 1I08A 3CJHB 5F2VO 3OR7C 5CBFA 1SQBH 2Q8OA 3LE0A 2GMMA 5IVYA 4GKXA 1VP7A 3FBMA 2ZIOA 1V54C 4AEDB 2QTOA 2ZJCA 1SZTA 4W65A 1EFRG 4FIPC 1VF6A 4NAMA 3OPWA 4W6YA 2QR4A 3UV9A 2VD7A 2WUHA 4DXTA 3SCHA 4AL9A 4UCUA 3K5NA 2RDRA 1JHJA 2P17A 3DYPA 3ABTA 5EHDA 5C3QA 4XUOA 2LW8A 1XNQB 4LBLA 3K5OA 3CPWU 3W20A 1K5QA 1BBT2 1CAVB 2GZWA 1QJY2 1JYTA 3KV9A 2XMLA 4LPLA 2O1QA 4CDXA 1JOJA 3ZKUA 1YXBA 1VRH2 5DMYA 2UUCO 3T1YB 4CCLA 4XMAA 1KS4A 4DXWA 4YVWB 5C3PA 2PGGA 2A3YA 3AJZA 3U0ZA 2BPA2 3WCRA 3CRCA 4MVMA 2P2KA 5A7OA 3ME2A 1R093 3VBSB 4FBFA 1UU4A 2VZOA 2AHZA 3PUQA 3LEMA 2HEWF 2YS8A 4HXCA 4CUBA 1FJGB 4AHCA 2WBKA 2WAOA 1G7YA 4MW3A 4P14A 3AP5A 3S30A 1U97A 4HL0A 3SLIA 4AF9A 1QEXA 4I55B 1ZRCA 2WSVA 4JI7B 4B3SB 1GICA 1D5AA 4XDLA 1QDOA 1RUI3 2UXNA 1YQ6A 3DN7A 3OF1A 2VXRA 4JZ2A 2AENA 2JDUA 2WAAA 1JMKC 4O4JA 4NPLA 1ZWIC 3AZWA 1VQKV 4H7LA 5LRRA 1QJX2 4OULA 1SLAA 5JWPA 5T54A 3A2FA 2VUDA 2VMGA 2EXIA 2A3WA 2XDVA 3JAMN 1L3JA 1DF4A 2OT5A 1AYM3 1QLEC 3CCRV 2UUAB 1K4CC 5LA1A 5FKBA 5B1AB 4OZOA 5A3MA 2V4DA 2XGXA 1H2GA 1VIWB 4JGYA 4ZHQA 4J9YB 5DAXA 2HEYF 1FXZA 4CXYA 4Q4W3 2GP3A 1SMVA 2ZABA 1Q6HA 1LHOA 2P3JA 2IWGB 1RUC1 1MA1A 5DN6G 1W6MB 2R062 4BQ2A 1SERA 1YJLA 1ZRDA 3FB6C 1GOGA 1LOBA 2ADEA 2XB6C 1KGYA 5BNPC 4JYBA 2HLDG 3OYWA 2P5BA 1V9U1 1W3VA 3U1XA 5CISA 2R70A 1Y74A 1WCKA 4GB31 2L6LA 3BGAA 2DV9A 5L7OC 1R6KA 4Y1UA 3KQ4B 1BQZA 5EZWA 1N47A 1DLBA 4QPIA 3JATB 1QXJA 4QQHA 5B4XA 2HJFC 5ISLA 2GH8A 3ACLA 2QQOA 2Q9LA 2DTWA 3ZFFB 1LEDA 1NCQB 4X6QB 1Y9MA 1J5EO 1UY0A 5FLJA 2VQFB 1AJOA 4D6QA 1AX2A 3EO6A 1RFYA 2ZIMA 1R083 1HB1A 1RM1B 1JODA 1UD1A 5C4WB 3FFZA 4HNAB 2E3CA 2ZHKA 3SJAC 4ZOLA 1YO8A 1SKVA 4ZONA 1JBCA 3B00A 4TN7A 5FZEA 3WY6A 1BXHA 1YUDA 5BYNA 2N05A 4QIWF 2ZQMA 4RN5A 1Q90D 4JTAB 3ZCCA 1HN0A 4OVEA 2A71A 4BR6A 1V6NA 3GXUA 5IJ0B 1VEWA 4B3MO 3AK1A 3V56A 3KS7A 4YHHB 4YWAA 3LKJA 4C1XA 3CKHA 3UK9A 5AVPA 3IIAA 3MDPA 5C93A 4XACA 1XE7A 2VU9A 2QWRB 2PHRA 3VKNA 3D0SA 4BCUA 5E6HA 2JXAA 1MS4A 1NTZH 3OD0A 3ZSMA 5DXDA 1FXKB 3VBRC 3IAYA 3APQA 1DGRA 4DV4O 2F4PA 1O91A 2YYOA 5ANNA 3RBZA 1APNA 4XFFA 4Q29A 5IY5B 3DC6A 3LSUA 3WINE 5I0DA 3I2IA 4XF9A 2XLAA 4RAIA 4IEXA 4I2OA 1KJLA 3TBDA 5LHHA 1IPKA 3CF6E 3E6BA 1JZ4A 3OGRA 5G04L 1XU1A 3FHAA 5CKQA 1COWG 1YHFA 3MGUA 2BNMA 4Y20A 1XNQO 1XNDA 1LODA 2A6ZA 4LO8A 3D3QA 5EBLC 3QO7A 3SDLA 1W9YA 3CRAA 2HVJC 3ZPOA 3KHBA 3VBOC 3R0RA 3THDA 4LF4B 2YB7A 2EIKB 3EVKA 1UAIA 2JGUA 1PM9A 5FY8A 3POFA 5SV8A 1C8M1 1LU1A 4BIFA 1CAXA 1AYN1 1RUC2 1ZX3A 1G9CA 3SQOA 1AJKA 4LR3A 2XR4A 3QVNA 4UFIA 1VMJA 2XVKA 3RYFB 1G9BA 4Q1PA 1WPBA 4JYAO 4HSJA 1W6NA 1FJGO 2H6BA 4GB32 2XG3A 5FP4A 5AFEA 3FD9A 4KWKA 1WMDA 1S72V 3MIEA 4IEOA 2YIDA 1DGRN 1AR63 3PUHA 2LO1A 4BPZA 1V9PA 4JI7O 2D44A 4Y1YA 1O3TA 4IEYA 4ZI7A 1TVGA 2A7AA 1LR5A 1Z5VA 1IDSA 4CPBD 1W6OA 5CA0A 4JCKA 4DO0A 3BPSA 2XQXA 3C7FA 2IXCA 2F17A 1HIXA 4OUMA 2X5IC 3AG2C 3I97A 1S2KA 3CX5F 2D6NA 4R4XA 5KX5B 3AKTA 2A06H 4ES8A 4UW3A 2PYTA 1T5EA 3ZMTA 3SH3A 4XURA 4KUMA 3SPCA 2ZE7A 2WYSA 2LFRA 4GZ9A 4QAWA 3VBUB 1JOYA 4N90A 3R05A 1Z78A 1V6LA 2QBXA 5FZ0A 3UO3A 2Y8KA 4DR4B 4B3RB 3AKPA 4I0WB 2K46A 5LBEA 4A3ZA 5C9AC 2B1GA 2CH7A 3OGCC 3IM0A 2YY1A 5LRSA 5IYYA 4DUVA 1LAJA 3BODA 3ZHSA 3AKSA 4EN9B 4XTPA 1NKDA 1WMXA 4ARYA 1P7GA 3WR0A 3SCGA 5A7WA 2VZ3A 1IBLO 1ULGA 2H94A 1H6YA 1XHZA 2XJRA 1OQEA 1OLRA 4RR3C 1UZZA 4DYLA 2JJ1G 3RVZA 5CFDB 1GFF2 3OUHA 4JC1A 3Q4HB 4CTEA 5B2GB 1S3JA 4BYYA 1S2BA 2JS3A 4KU8A 2W92A 4COYA 1DF5A 4P9IA 4JASA 1OCOC 4FPCA 1RSOB 3PIJA 1W9WA 3BTAA 4B3TB 1C8M2 1PNLA 1NVPB 1AYN2 1H2LA 3MHHC 2WNVC 4C8DA 2FDIA 5BNPA 2Q7HA 2JIGA 2YPJA 1RUI1 3MZHA 4XFCA 5B3SB 4AI0A 2CDOA 3VZLA 2XOMA 2SLIA 1SA0A 5L7OA 1ULFA 2JG8A 1US2A 3CZUA 4LIVA 4X20A 2KG7A 4D0QA 4COZA 4IL6Z 1BK1A 2MPFA 3H1LH 3CXHF 3E8FA 5F8PA 4B1MA 4EZ4A 4YY3B 1ENRA 1OLQA 4H0LB 1XBFA 2SBAA 1PVXA 1RXFA 1WLDA 3QCWA 2ZGNA 5BXXA 1NKGA 5L73A 1IS6A 4WVZA 4MO3M 4DV3B 3JCZA 4H2AA 4BZ4A 4J1XA 1N8RW 4BH9A 2QDOA 2WNEA 3V64A 3WNPA 3VKLA 5JSOA 2GDFA 3MUZ1 1GKFA 3CB2A 2VQTA 4MT8A 3USUB 4JV4A 2BVVA 4TWKA 3ZHUA 1OURA 1MZ5A 2D6OX 1NI8A 3M3IA 1EUTA 5KMGB 4C0BA 4Y33A 1CJDA 1WBFA 5FFOC 3ZEDA 4WF9V 1TMF1 4DV1O 4LF4O 3ML0A 2UWAA 2WLKA 2LP7A 4GUNA 3WCSA 5IUQA 3D6EA 1S0VA 5A7PA 3NNGA 2QQUA 1QDCA 5A3TA 2IFRA 5JJEB 4XAAA 4XUQA 3VBRA 2CTQA 1XYNA 4QB2A 1STMA 4BDVB 5FZOA 1UMHA 1W03A 1BT8A 4XOGA 1JN2P 1NA1B 4LBQA 2H0VA 2AZ2A 2WPDG 1ACCA 5C8CC 4CU7A 2VZPA 1FPOA 3B40A 1QJFA 2W5FA 1AR91 1YXWA 4L97A 1V55C 4AVVA 4I0XA 2K1EA 4CCCA 1J1TA 1CZTA 1CGPA 1IBMB 1XOYA 4EKWA 2Q6AA 3LOIA 1CZSA 1MS0A 3ZYRA 1L0LH 4RQPC 3CSXA 5IWAO 1VARA 4LFBO 2ADPA 4DRXB 2B7YA 5LBFA 4LUKA 3ZXAC 5J7MA 2BVBA 3VBOA 2VRZA 2HWE1 5B4NA 3BRCA 2CWMA 4F83A 3CBNA 2VH9A 1RJ7A 1C8NA 2BEOA 1SBEA 1UU5A 1PMHX 2KSDA 3UJOA 4Y24A 1YZBA 4NO4A 1KP3A 3MLJA 4HZ3A 2DYRC 2ETNA 1EN5A 4OGQB 4WCEV 3RMXA 1OHFA 4M01A 1RUI2 2D97A 2DCZA 2UY9A 3N3HA 4Y5SA 4CEWC 4LJHA 2VMIA 2FCTA 3F7VC 1E5IA 4DXRA 4IHJB 1FXVA 4YNIA 1F35A 5GONB 1QLNA 1BCXA 3G6BA 4DR4O 1AYM2 5FZLA 1UWWA 4B3RO 3G80A 1N33B 4XDJA 5IVEA 3OEEG 4EZHA 3LPGA 5LW9A 1X33A 3F95A 1PGW1 1NBMG 5E89A 2Q8CA 4U7OA 4HKWA 2I2SA 3NNLA 3J7AU 1HKDA 4QDSA 4IV3C 2QQKA 4CH3A 2X5IA 3TK1A 4XXPA 4WVWA 1KITA 4Q4W2 1P84F 1NH2D 1ZNPA 4QXKA 4DOUA 4XUPA 4IERA 5JQGA 1DYOA 1UZVA 4QQLA 1F15A 2CV6A 3WG1A 2ZOEB 3OMNB 5A1FA 4Z2WA 4ZXKA 1ND2C 4C90A 1ENSA 4GAZA 4BOWA 4YGEA 1S2EA 1FOD3 3BU0A 4XDPA 1UY1A 1U5ZA 4QQOA 4YM2A 2VBBA 3H9AA 3B94A 1TNRA 4BQ4A 1BEV3 4COWA 1F2NA 2Y26A 4PIYA 5CBHA 3VD3A 1FFTB 4MOAA 2FL4A 5FY0A 3T1LA 1PNGA 4PV1B 4XF1A 1QNWA 4WM7C 4DMIA 5C9AA 1AR61 1FI2A 3EMRA 3I7DA 5K1PA 4ASKA 3RNSA 4J9ZB 1UYXA 1S55A 1JZ2A 5BY1A 1RINA 4LO4B 2DDUA 3FAVA 3HKDA 2Y34A 5DABA 4OMCA 5E16A 5I0UA 3AK3A 3HN1A 5GM0A 4RR3A 1R082 3UT5B 1AR92 3NV2A 3RYRA 5F32A 3C7OA 4YJ3B 3HQXA 5AC93 1RXGA 4GMP1 4AR2A 1LHWA 3O1VA 2Q1FA 4UW5A 2RHPA 2AC1A 1ENVA 4TQFA 1X8EA 1FNZA 4DR5O 4I4TA 2VMHA 2FMYA 3WQ1A 2HWE2 4MG2A 3WDTA 1PO21 3IGAC 4PDLA 5EK0A 1D2SA 3PVBB 3K3WA 2EA7A 4CCOA 4YZ5A 4I50A 3GZUC 4Y4RA 1LGBA 3AK2A 2WS91 2DCTA 4WZFA 3PDQA 2D6LX 2Q8EA 3VDAA 4I9QA 1H8TB 3VZNA 4DEQA 2H6CA 3VHPA 2QQVA 4D6SA 3C2UA 3ETEA 1NCRC 3AMNA 1FV3A 1JJ2U 4BW5A 5GJ6A 3ACGA 4HN0A 1YFYA 5JPNB 4LF7B 4B29A 4UB8Z 2EXKA 2EJ7A 3W9AA 1UY3A 2A6YA 4D94A 1ZBA1 3MI8A 3NV1A 2GDSA 5FO9B 4DR7B 1HW7A 3TOJA 1OF4A 4D6RA 1DGWX 4NRMA 1N4CA 2IW5A 3V0BA 3ZFEB 4DV6O 2ZZJA 4NRQA 4P9OA 4O4IA 1NLQA 2VTFA 1X7NA 4IEWA 3AG4C 4O2BA 5J37A 4AEJA 3I2JA 5FIXA 4UXNA 1XNBA 2JDHA 5LMNO 5LA2A 4AVCA 3ZS8C 3LA2A 4FPHA 2E75B 3UL2A 2VWJA 1GRJA 2X10A 3A0NA 5FZ3A 1AVBA 4AVAA 1V6KA 4X1IB 4LF8O 4B1LA 1GH6A 4JV5O 4NIGA 2E33A 1J58A 2YUEA 2X09A 1TUEB 1W8WA 4IGPA 1IKPA 1AR62 1NTKH 1I94O 1RUH3 3WX5A 1GP6A 5IJ9A 2D5FA 2RV9A 4ISQA 2E7TA 5C8CA 4A3XA 1FFXB 3OTFA 2YXLA 2ATFA 4PD4F 3U4XA 4DR3B 3ASNC 4UVAA 5J3UA 5D8AC 4JRLA 4JZRA 2YSUB 4F6EA 2ZMKA 1WCQA 3H1KH 2JDNA 4X1YB 4RQPA 1SQQH 2YXSA 5SV5A 2PHXA 3U07A 3ICXA 1GNYA 1W39A 5A33A 3FYIB 3OFNG 1RP3B 2AYHA 4CBCA 3MIDA 4YJ2A 1AJPA 3HT2A 1E1RG 1S0BA 3BVOA 3FB7C 4L2NA 4J6GA 5FAXA 4EB6A 4X66O 3GCXA 1S0IA 1PKXA 2D98A 1G6UA 1XC6A 1QU7A 3MIHA 3ABKC 5FYTA 2BOCC 1QR8A 4CU8A 4FVVA 3A0RA 3N9LA 3U10A 4CEWA 3NV4A 2Y4TA 1U0AA 4RS5C 1IS3A 2NP0A 4HVRA 1WB8A 3A7QA 3M70A 4GIQA 1Q81W 1QH7A 3QOPA 3E5XA 4CDUB 4CC5A 4AI8A 2R9AA 2JKBA 2MEV3 2WLLA 4QB1A 3FZ3A 3L71H 1SPPA 1L1FA 4G9SB 3KT7A 4FAHA 2EZPA 4K3UA 5CEHA 1SLIA 2W6IG 4QE7A 1GUIA 3JD4A 4QGPA 2D2CB 3JASB 4FI9A 5JJNB 2JE8A 4DUWA 5IT9N 1M57C 3MF9A 4I09A 3ZN6A 3RW0A 3OGGA 2EILB 3QD6A 4G27B 1ZL8B 4DV7B 1PVC3 1XNCA 1ND2A 2CGOA 1Q6IA 1D4M3 1Q3EA 1E57A 2VUCA 3RSJA 1PPJH 5HCAA 1YQCA 5CKMA 3VOUA 1WAZA 2D40A 1Y4WA 3SPJA 3N9NA 1LOFC 2E53A 4O4LB 4G2KA 5FKCA 4WM7A 1MSDA 3IB3A 4OX9B 1HRV3 3KV5A 4V2WA 1BKZA 2GC0A 1XMOB 1B06A 3BN6A 1OA4A 2VCAA 5D5PA 3JAWB 3WNXA 2ZHNA 3RZKA 4UYBA 4PIZA 5H9PA 2BFUS 3O65A 4GKKO 4NUBA 3U37A 4YW1A 1UZWA 1GKBA 2WLPA 1IGOA 1YNAA 3JU9A 3HMYA 1SFPA 1EN4A 3KCYA 2JVDA 1ZAUA 2LS6A 5FZ6A 4PA3A 1JS9A 4E4DX 4FFBB 3OUFA 2Y0PA 3H0OA 3MHZA 1SETA 1ONAA 1MS1A 1ND3B 3ACIA 2JIZG 1BEV1 2FYUH 1TAEA 1LEMA 4UFLA 2HKXA 5T5OA 2FMDA 4YPJA 3BIEA 1JI6A 2GUZA 3PU8A 1NCRA 1IPSA 3ZKYA 5ERLA 5K9YA 3N35A 4TYSA 1VQ9V 4XFIA 5B1BB 4BIZA 4LBJA 3V65A 2XNDG 5J96B 5LMUB 3ABMC 3HR0A 2Y6FA 4AEMA 5KHGA 4LF5B 3WP4A 4XJUA 4F6RA 4NKGB 1OVSA 3WQBA 4RSUA 2EINC 1UZ0A 2IVJA 2XJPA 4OQ8A 1X9TA 4OI2A 1IS4A 3EYPA 4ARXA 3T0AA 3O0WA 4FPYA 1JR9A 3NAPC 2WC2A 3TCUA 4WBNA 1NR7A 2E5LB 3O1OA 3GBGA 3T09A 1X9PA 4AEDC 3ETQA 5LGNA 1NS1A 2R073 4MGSA 2IXKA 5ABJB 3IC9A 1WP7A 4V2VA 2WA3A 1MG1A 4OQ9A 4YSFA 3MLKA 5H9SA 3WUCA 4J80A 5BNOC 2ZNIA 2D93A 4LKDA 1XSRA 1UPIA 3K77A 1IG3A 4TOIA 3E22B 4A45A 5JZGB 4CP0A 3H3LA 3POGA 2C26A 2V09A 4FM0A 2HWC1 1MQTB 3I3MA 4KBZA 2LFSA 1GZWB 3K4AA 1T6BX 1Q6UA 4YGCA 5FZFA 4N9IA 3N2KB 4YVWC 5CA3A 2YBKA 2ZCWA 1ULEA 4CCJA 1ULDA 4IE4A 2G9ZA 1VBD3 2QDNA 1KDMA 1YI7A 3RYCA 5D8AA 1OQDA 2DF7A 1LECA 3RYPA 2BNNA 3KSCA 4RHV3 4E4HA 2DUQA 3LEGA 2JKXA 2A3XA 1OPMA 3B9IA 4UFMA 3INAA 4X1KB 4KHPB 2RS11 2LRPA 2EF6A 3IZOA 3SMHA 5FYCA 4HFSA 3LAGA 5FPRA 4FXKB 5LB6A 3JAKA 3UJQA 4CC6A 2OCCC 4E4ZA 1FOD2 3GVMA 1H38A 3JD73 1BEV2 3K0DA 4GLXA 5J2UA 5APAA 2V4AA 2G19A 4L11A 1AI6A 4LMFA 1HNZB 2P4KA 2BWAA 2BOBC 2VBDA 3BTXA 1LOCA 5K7PA 1EUUA 1AF9A 2WWSA 4PF5A 1XPWA 1HW5A 3I59A 4P2ZA 1RUOA 3OMIB 4Q0UA 3AP6A 4RS5A 4WM8B 1IBKB 5FY9A 4IETA 5KXCA 1NXD1 1U5IA 1Q8IA 2IUWA 4N21A 5B1AC 3HNYM 2UU9O 2VNGA 1WA8A 4EYUA 4L92A 5JXHA 1XQ8A 3FHIB 5AC92 1I9RA 2VZUA 2BTVC 1YI2V 1GP5A 4NTXA 1WW6A 1VR3A 2B5HA 1XBLA 1UYPA 2YROA 2JG9C 4Q20A 2CUGA 1XMOO 3BA9A 3B93A 1KKDA 3ITQA 3POBA 4Y1ZA 4P00B 4D6TH 2EICA 2VOKA 4YM3A 2XVLA 2BBVA 3I3EA 1RUJ3 4E4EA 3KZ4C 3O14A 2H3OA 3V0AB 1N34O 4GMP0 1W6PA 1KECA 2K9ZA 3FE5A 4DV5B 2RM23 5KC5A 3BKZA 1QMJA 4IQPA 1RUD1 1YFUA 2BERA 3G7DA 2HR3A 3FN9A 2QQIA 1PZ8A 1W9TA 5FZHA 2W0FC 1W6QB 5CA1B 2Z42A 1ZZ6A 3KZIZ 3AC0A 2ILMA 4G4FA 2EIEA 4XJWA 1PK6B 2HWC2 5CBGA 3MBWA 4FLUA 4QXCA 1RM1C 1R64A 3VBFB 3RS6A 4PDRA 5E79Z 2Y60A 1TNFA 1UOBA 2MEV1 5FYYA 2Q5ZA 2GNBA 4CCEA 5FMCA 4W50A 3NRUA 2ZGOA 1H8VA 4XABA 1R3JC 1CPNA 1X36A 4YW5A 4LF5O 1LHUA 3ILNA 2UXDB 4MV2A 4MXWA 2E63A 1KFXL 4J42A 1WMEA 2FBEA 3ZXJA 5C71A 1PVC1 1C57A 5FZBA 5JI7A 4Y26A 3CCSV 1QIQA 1QOTA 3D3AA 1HR0B 3EQEA 2I07B 4NE9A 3L2HA 4LK7A 2D6PA 2UU8A 4QGNA 4UFHA 5JXIA 1YYNA 1XYPA 3O5SA 3ZIWA 2JX9A 3LZZA 3VDCA 1RUH2 4DUZO 5IY5C 1Q8PA 1PNMA 4Q26A 1UFIA 4IEVA 5LGUA 5L3FA 1XMQO 1IZ3A 2E31A 4MH0E 3E6CC 2DYSC 3VZOA 1UX6A 1CD3G 4PDVA 1R1A3 3NO8A 4DUYB 4UB6Z 5L3CA 2BRTA 4LLOA 3UGHA 2R72A 2XL7A 4BMEA 5FYIA 4N53B 4LEJA 4S2FA 4AQTA 3WNKA 2MHFA 1WJZA 4K0KB 3NAPA 3CJHA 4N43A 3ZXDA 3T4VA 1NX9A 1I5YA 5DPNA 5FYZA 3ELNA 3FLTA 4TSVA 4AEDA 4GKJB 2D3PA 3RQ0A 2P37A 4JGZB 4FLXA 4NIAA 4XFBA 3K4DA 5BNOA 2P1BA 1VQ4V 1VQ7V 2BBAA 5J9PC 4IV1B 4PI2A 4YVSA 2WT2A 2HWB1 4CS4A 2P3IA 5F5QA 4Y5TA 3HR9A 3LFIA 1J3RA 1W2AX 4UV8A 4O4HB 1ZRIA 3NNJA 4MGQA 2ETEA 3DYOA 3D8CA 3ACHA 2XAHA 3I3QA 1F9KA 3WZ1A 4XCBA 4XETA 2R6QA 4H55A 5BR8B 4YVWA 1PGSA 2MEV2 1KUQA 1RC6A 1QVGU 2WT0A 3E5UA 1OXCA 2W1SA 5JXGA 3UKVA 2PFWA 2A73B 2OVUA 1CAUB 2YC2A 1YSCA 3ABLC 2Y0IA 1EM1A 3POEA 3ZMZA 5FY7A 2EBOA 1THZA 4DIQA 4CXXA 4YG6A 1W9SA 3THCA 3VBUC 3ZSJA 1VAVA 1PVC2 1XI1A 3TEWA 4DR2O 5IYBO 4I55A 3OD4A 5FREA 4URAA 1W8NA 4I3PA 2JDZA 4B7KA 3ZSLA 3ST7A 1QJU3 5FNVB 1QH6A 1YITV 1WBLA 2VY0A 1XOUA 2BW8A 1UNBA 3AG3B 3M3QA 1HRV2 4BWOA 4EROA 4ITCA 2WFF1 3H7JA 4Z2AA 3WF4A 1R1BA 3N2GB 2YMZA 4YGDA 2IJIA 1VBD1 4DV0B 4HK9A 4MVTA 3L70H 3ZPYA 2D43A 5GZCA 2HJDA 1KDKA 2UYBA 2GV9A 4TUYB 1GU3A 1LJ7A 3T4ZA 1CX4A 3G4SV 3CJXA 4GYCB 1W0KG 1Y67A 2FDHA 1B04A 3OEHG 4DXZA 3H8XA 2JG9A 4XDKA 2ZX4A 1EBOA 4RGKA 4XYXA 3LWCA 1SEFA 2X6CA 1MEC3 1W6MA 4JKMA 4JI4B 2DTYA 1S0JA 5DECA 2QE3A 1H2NA 3RDIA 2F6BA 5HI0A 5FP3A 5KXDA 3N27A 3NWKA 3KGLA 1JOBA 3KD4A 4MVQA 3WU2Z 4ZHNA 3OMAB 5BMVB 2YGMA 4LWSA 3K03A 4H7MA 3JATA 2ZX2A 2BGOA 5C3OA 3OUIA 1M56B 3CEIA 3VKOA 2W87A 3MW2A 4M3CF 2PUSA 2P3KA 1BMFG 1WA6X 1US3A 1HWYA 4UBGA 5FPOA 4NAOA 5IVJA 4FPLA 1A78A 3HPNA 3F2ZA 5B66Z 1IG0A 2XJTA 2F93B 1LNSA 3U78A 1O9GA 4J11A 3D0JA 4CEYB 3G67A 1H30A 3ZMSA 3CCUV 2QWNB 4COVA 4DS0A 4MHRA 4YZ2A 2Y4UA 5KHJA 1VQNV 4IGQA 1RUJ1 1ZYBA 4DUYO 5J98B 3ZMVA 4YIPA 2VMCA 4GT1A 5IJ0A 2RM21 3OPTA 3GCWA 1GM7A 1F23A 2XASA 5FZIA 4KGQA 3E8GA 1PZ9A 3GZEA 2ZEXA 3AG7A 3W7TA 4GULA 5FRAA 5LBBA 5DUWA 2OUJA 1JMUB 4FLWA 3KKYA 4X65O 4AI1A 3MHSC 1XNRB 1PM4A 3H8UA 2VMEA 3GF6A 3KM5A 1K42A 4AE2A 3MV11 4ZHQB 5H9QA 4FLZA 4JTNA 3TN91 2ZMNA 3EBRA 4KWUA 5F39A 1CONA 5CFCB 4ET7A 4NIDA 2WFF2 4TLGA 2IBZH 3TXQA 1WW5A 3CCMV 1UOJA 1VBD2 3N7JA 4FVMA 4R6ZA 5BNNC 3RZLA 3WT3A 4CCNA 5L9VA 2WZPP 4H37A 4RHV2 3WD5A 2J1SA 1AUYA 1C1FA 2BQPA 1OVPA 2EIGA 1QJX3 2NM1A 1H2MA 2JEUA 4H13B 2W94A 4M3CB 4WFAV 5BR8O 1XREA 1QOOA 3H9VA 1TUBB 2PHFA 3IT8A 4YW2A 4IE0A 2QKCA 1R6NA 4L87A 4QPIB 2PHTA 3I2HA 2V72A 2WAMA 2XLFA 2EIMB 1YCIA 3CYOA 3WF1A 1IXMA 1NR1A 3OAAG 1QQCA 5H6QA 2GALA 3VDDB 1H0BA 1W0JG 1JYVA 1XNKA 4DFSA 1AHSA 2VOWA 2IXJA 2ZGMA 1MNGA 1VQOV 4FLTA 4ZOLB 3QTCA 1YQ2A 3ZYFA 4N9HA 3A8TA 3DTUB 5FOBB 4URTA 1KP2A 1N1SA 4FTBA 4C1WA 3N7LA 3SKJE 1R1A1 2XXZA 5DUUA 1ZLZA 1VMHA 3J8F1 3KB5A 5CKNA 4HKOA 1T2XA 2JDKA 3LF7A 1DYPA 3LNNA 1ASJ1 2YBSA 5I0TA 1FPN1 3NSTA 4OFGA 2YV8A 1FNYA 4GWMA 3BI3A 4G28B 5KXEA 1MZ6A 4LXLA 5FQ0A 3SPIA 3FMGA 1RUJ2 3JD2A 1KEXA 4BLJA 2RDCA 1XB9A 3C90A 3DGTA 3JARA 3ECQA 4MSWC 2RM22 5HV4A 3RFRA 5HCBA 1SQVH 5F37A 4JI8O 3GNEA 1W8HA 3F5TA 2X6AA 4YW7A 5D1IA 1HB2A 2HLEA 5JH7A 4ATFA 1K8AW 1R73A 4K8FA 4KWJA 3HN3A 1J83A 1ZA7A 2EVXA 5FXZA 3LIGA 2RG4A 1WLCA 3MD0A 4ZZ5A 4FOQA 3WOGA 4Y20B 3PN1A 2WO3A 2Z5WA 1REDA 2AW9A 2P34A 3T0DA 3JQWA 3OGIB 2QM7A 2DFBA 1YJKA 3VQXA 2AEYA 3B5LB 3ES4A 2ZEZA 3UKNA 2UURA 5A80A 3CP1A 1K5JA 5A32A 2XJSA 2EIJB 1CAXB 4HG6B 3Q4HA 5IK4A 1GOFA 4AVTA 2XQRA 3ROUA 3H8RA 2BP6A 5B5EZ 2YIAA 4LFAB 3APOA 3BYWA 4GWIA 4GALA 1NU1H 4MVZA 1HB4A 3LSDA 3I4IA 3KGZA 1OSGA 1RSOA 3FWEA 1VB2A 3ALQA 3MW4A 4AVSA 3U11A 3ZRWA 4NHKA 3WHUA 5KUMA 1S5HC 1NTMH 3CO2A 3ILRA 2JWPA 1DF0A 1E5SA 3WNOA 2CYFA 1LTEA 1IPJA 2C4XA 3DECA 4ZI7B 2D3RA 1H9PA 3UNPA 1JPXA 1GQGA 1QJU1 5FO7B 1GN6A 4JAVA 3JB4C 4CU6A 4HKLA 3DPRC 3USSA 4U36A 5JSRA 4UCTA 1U12A 1O5UA 5FUNA 2DUOA 3OT7A 4U2AA 2F4VO 3I2GA 1LHVA 2ZM6B 1ROPA 2VR4A 4FT8A 4NWVA 4YG3A 4EE2A 5JOYA 1R1A2 5CZKA 4FFHA 1WD4A 3J8F2 2GTSA 5FOJB 1V9U3 3SXWA 1GOHA 3E5QA 3B01A 3RYIB 4FPKA 1GNHA 2Y6GA 2NYYA 5JUVA 2UUCB 4BQ3A 1VIBA 3SYCA 2UXBB 4JTCB 1SZXA 3ZYGA 3T4HB 5IYDO 1MEC1 4JYCA 4HANA 1N0JA 1QJEA 1NAEA 4L9BA 4NXMO 4PF1A 3Q8EA 2CH7B 3HNBM 3BTYA 2B9ZA 1SLCA 3S7IA 4BK5A 1NUKA 4ZZ8A 4FFGA 1M1KW 1A8MA 2QKDA 4FO9A 1YWKA 4LOTA 3K79A 1QLEB 1O3QA 2JEMA 4Q27A 2AXTZ 2KA3A 2ZD9A 5BY5A 3AMMA 4NIHA 1K92A 4CUGA 2YFZA 4RQFA 1LRHA 3HVDA 1QF3A 2OKXA 2J1TA 5FMOS 3BUCA 3TB0A 4B8EA 2PHWA 2QQLA 2YIBA 1CESA 5ITZA 5BNNA 5DZEA 2GSMB 4GKYA 2LROA 2CTVA 3VHNA 4DRXA 4LNUA 4UV9A 5BNPB 1JFFB 4MGIE 5EZYA 1M06G 2ZEYA 1Q8VA 4R9BA 3P1IA 1OHHG 1WLTA 2IH3C 1SA0B 5I91A 5L7OB 2W52A 1VB4A 2JG8B 4PA4A 1AR81 4JI2O 2IXIA 3THPA 2Q69A 4X20B 3BIWE 4E2LA 2KG7B 4WBBA 3H42B 3GM8A 4P5YA 4DY3A 1X4TA 4K8ZA 5CMUA 4O2AB 1DG6A 5I8SA 3HEIA 3H50A 1Y76A 2I45A 4LBNA 2QEXV 4ES9A 1QJU2 1PM7A 1LNQA 4DW0A 1XDCA 2WLNA 4F4LA 4IHJA 1MR5A 4HETA 1BS3A 3DL3A 4PELA 4M0NA 3AK0A 2NMOA 1QXRA 4IW3A 3RVHA 4JPRA 5J48A 3J9SA 1POV1 3PTYA 2PLV1 1MVQA 1S1AA 3OGVA 2JDYA 4IEZA 1DDLA 5DAWA 2XKOA 1X59A 1OD5A 2ZGLA 4QGMA 1UY4A 2CHHA 5FZGA 4A7KA 4P9YA 1J5EB 2GSYA 2C0ZA 2BOJA 3W7XA 3C7EA 5A6XA 4NHYA 3CHXA 4JDMA 4DRVA 1VPHA 1SDWA 2BGCA 3ZDVA 4W8JA 5LXTA 1MEC2 2W9XA 4HMZA 4W4LA 3NJZA 3VZJA 4EN8B 2XBO3 4JDNA 3SISA 1QGLA 3SYOA 4LBQB 4ISRA 3ZXEA 1Q8OA 1SDDB 4HN1A 2VAUA 4B3MB 1SACA 5E1RA 3AXDA 5F2SA 3CLPA 4I0XB 1OC1A 2VW2A 1CIWA 4E8CA 1W8OA 1AX1A 1LCLA 4Q2FA 4AZZA 2NN4A 1ZX5A 3PU3A 1DYKA 3SH4A 4QHZA 3OBRA 3M8AA 4ZS2A 3W7SA 5HFLA 4DV4B 3SJCC 5AFBA 2F23A 3B2EE 3Q8CA 3ON7A 2OUHA 3JUUA 2ZM6O 1S0FA 4HYOA 2H0BA 5DAQA 4NPMA 3RG0A 5EV7A 2E32A 1B6QA 4Q4V1 5CVRA 1JXNA 2ES3A 5JLVA 2Y69B 3BEHA 4QM9A 3SPHA 2ZS6B 3O1TA 3CCLV 4Y1VA 3S5AA 1FKAO 1BE3H 1ND3C 2WWJA 1UYZA 2UXBO 1LU2A 4ZU7A 3FC0A 1JUIA 4XIOA 3GBFA 2H8PC 3E86A 2ERFA 4GWJA 1NY71 5EBMC 4FPJA 2VMDA 1HQWA 1GMGA 5D5QA 2VVEA 2XJVA 4QKBA 3KV4A 5E8AA 3DPRA 5B1BC 4JYAB 4P5HA 3OBTA 5JIUA 5FZ7A 2R043 3LDBA 4ZPIA 2X5IB 4GA9A 3K48A 4K7JA 2PLV2 1H8HG 4XBFA 1JZ7A 1XXNA 4QXBA 3OGJA 3KVBA 2R9RB 5A70A 3B8NA 1DBNA 3FJSA 5IVVA 2EALA 1JYNA 1N3QA 1SLBA 3LDDA 1L0NH 3ZMOA 3GALA 1IOAA 3QO8A 2VNVA 1OOPC 4KGGA 1BHBA 3NR7A 4Q4Y3 1QY4A 5FZKA 4D7SA 1AR5A 3L72H 3DKQA 4OHZA 1UPSA 4M4RA 2X7RB 2ZR2A 5FLXN 1RJ8A 5ABJC 5C9AB 1E1QG 4QM8A 1HNWO 1GLHA 1IVSA 2IM9A 1SQ4A 1E79G 4I02A 1WGPA 4X1IA 1TME3 2VW1A 5GTIZ 4PT6A 3NKTA 3HKDB 3OBZA 3E35A 4TV9A 3RZJA 5JZGC 3S6PA 4RR3B 4XF3A 4ZKTB 1BSMA 3DC5A 2N04A 2GMPA 2A6XA 3CJIC 1FMD3 4EV0A 3A23A 4P9PA 2J42A 1AI4A 4MTFA 4Z1MG 3AVSA 2HEPA 1LESA 2Y6JA 4CP9A 2JE7A 5IAXA 1UF2C 3RZGA 1AROP 5FMDA 3SCFA 1AXKA 5IVCA 1C3HA 4JI5O 1PGL1 3MF6A 1TMF3 4J1WA 1IBLB 1L7LA 3ETPA 4MXVA 1A6CA 2W91A 3IAQA 3R65A 2ZBJA 1NQDA 5FWJA 4MTXA 2PHDA 1J3QA 5JVDA 1ST8A 4AFMA 4UVCA 2Z0AA 2ZCEA 1J84A 4ZXEA 3AB0A 5A3UA 4MGTA 4Q4V2 4AAXA 1R3IC 2VW0A 4IYIA 4P08A 5IFTA 3WG3A 3O1UA 3HKEB 4JKLA 4C91A 1L8DA 2WNUB 2QJ1A 3LB9A 4V1PA 4K3AA 1AR93 1JYWA 4Q4X3 5C7GA 2ZTNA 3H01A 1WCSA 1KC8W 3B09A 4PJ0Z 4YFZA 1Y7BA 4UBHA 1NY72 4IEPA 4W4KA 4X8NA 3V0BB 2CGNA 3ZYHA 4PA9A 4DO2A 1R3LC 3NJXA 2HWE3 2RQ6A 2FKXA 2B39A 4AQ6A 1YF2A 3TYJA 2RS51 1COV3 3KQRA 4O4IB 1O7FA 2E51A 3I3BA 4Y22A 1DQ4A 1UMZA 2O8OA 2DWEC 4COUA 2DVGA 1UXZA 3M3OA 3BALA 5DN2A 2ARAA 5GTHZ 3D82A 1OA2A 1OLME 2Q8VA 3BABA 3AZYA 2R9IA 2XJUA 4LO7A 1ULOA 2Z69A 1YJ9V 1ENQA 4GXLA 3AYEA 4P30A 1UU6A 4S2HA 1W28A 3MUY1 5LGTA 3A0BZ 1SCRA 4LCUC 1V6MA 4MW8A 5H9CA 3VGIA 2X6BA 2WABA 1AILA 1ZL8A 3ES1A 1WB7A 1YI9A 5IJ9B 2ZGSA 1HV1A 4MS2A 2ZNJA 2LGQA 4XHBA 5IVFA 1W2BU 1PNKA 3WF0A 4AG4A 5LCWL 1IX9A 4IIJA 4DV1B 2TUNA 4AQ2A 2J1UA 3MFCA 1V55B 3M7MX 1PK6C 4K1YA 1RUE1 4BHPA 5C5TA 4FFIA 1GR3A 1O59A 2DJVA 3TEYA 4HVOA 1S5JA 2CTWA 1Q43A 1L7RA 4RQPB 4MADA 4I30A 2Q5TA 5A33B 1V9U2 1ZUQA 4QMAA 1F4MA 3JAWA 2WO1A 3LPFA 4YJ2B 1ALYA 3RVYA 3NNFA 5C5UA 5J1XA 2D6MA 1S0GA 2P6HA 1BHAA 4AXOA 4M3CE 1CQ9A 2DYRB 3JSLA 4EB6B 3GZTB 2VZ1A 1SHWB 1DQ5A 1AL0G 4LF9O 1F4HA 2YPDA 3FKSG 2O14A 1WD3A 1W2UA 5IWAB 2XBO1 4LFBB 4HSLA 4K21A 1X8MA 1ND3A 2DCKA 3OG2A 2P6CA 4JI6B 1OQ1A 1UQXA 1POQA 4Q1RA 4XDQA 1PNFA 1E5RA 4GMP3 3K57A 1O8PA 4RUFA 2GP5A 2EAAA 4E2GA 2Y48A 2YDEA 2AHYA 2JEXA 4FM1A 4LKFA 2V7QG 3H7YA 3O0VA 1RTVA 5FUIA 2HP8A 2WN2A 4PA7A 1PO23 2PTMA 4BK4A 1GV9A 4PDWC 3AKRA 5FBZA 4J10A 1PX4A 2CAUA 1UOGA 4D69A 4LORA 2Q7GA 3RN4A 4S2DA 4A6SA 2IJKA 4JTOA 2BOIA 2WS93 3IIIA 4XBLA 4CP1A 1HV0A 4O9EA 3LA7A 1D5NA 5LBCA 3ZN6B 4DY5A 1GANA 1V70A 1W59A 3EXUA 4HZFA 1FS0G 3CQOA 2OA2A 1ND2B 4N53C 2LW7A 2Q1MA 2PHUA 4YW4A 2ZE8A 1WWYA 1OOPA 2WN3A 1P8JA 4D7TA 3BCCH 3HKBA 5FYMA 4UVBA 1ZBA3 5LWBA 3RYHB 3AYDA 3B3QE 3HBKA 1S0EA 3ZRSA 2B42B 1K5MB 5LYJA 4WM7B 5ABJA 3CIHA 2FDGA 5K4LA 3DGEA 2PZSA 4JGZC 4NR1A 4UFJA 5GW7A 3SYPA 1FAYA 1DIWA 1D0GA 5DAPA 3K59A 1Q86W 4CDQC 3FLRA 3G6JB 1B35B 1EPWA 4IV1C 5H5NA 5C70A 2QFEA 3E22A 5JZGA 1GWMA 3UT0A 3CJIA 4EQVA 2LQTA 1RUE2 2R041 3KCCA 2RE9A 4GH4B 4XEZA 3O1SA 5J2TA 3BOWA 3JSNA 3IN9A 3N2KA 3QO5A 2QVSB 1XL6A 1QOSA 3ZMUA 3R66A 2PY5A 2WZ8A 4AHXA 4ZBMA 3POSA 1MSWD 4JKKA 2AZ5A 3K9SA 2V5DA 3W21A 4HAMA 1POV0 3B69A 4Z8BA 4Q4Y1 1NZIA 4CUAA 3W5MA 2ZHMA 2N7GA 4ZU5A 2PXJA 4KNCA 5DG1A 2UY8A 5LBQA 1ZREA 4PIXA 2D5HA 3CL1A 2XBO2 4DR5B 4Q6GA 3SH5A 5LOVA 2VL4A 3HAGA 4EWAA 1TME1 2E7AA 1M90W 4E9KA 3S7EA 2PAMA 1N32O 2F4LA 4CS2A 1FMD1 4NMIA 4NXNB 4CE8A 2CY6A 2DVAA 3JALB 4F6RB 3AG3C 4CDWC 1MS8A 4LUMA 2YEVA 4CCKA 2K0GA 3ASOB 3M99B 3WQ0A 3AG4B 3BA8A 3CCVV 3N7MA 3CNAA 3O9OA 4BA6A 2JS5A 4AHZA 3AZZA 5LHIA 2F95B 2WO7A 1NXMA 4UAPA 2B46X 2UXCO 2ZZQA 3NNMA 2X05A 1S77D 5A2QN 1TE1B 4DV6B 3O1RA 2O0OA 2FQPA 1MPXA 1HJGA 4TLFA 5GZFA 4MYEA 1SG3A 1CVNA 3IDEA 1MS5A
chains in the Genus database with same CATH topology
1KD7A 1LHOA 3V0AA 1K5MA 2P3JA 2IWGB 1RUC1 1QQP2 3LSEA 3NAPA 5CFDA 4ORFA 4N43A 1RVF1 3ZXDA 5I8TA 1W6MB 2R062 4Q4X1 4EN6B 1YJLA 1ZRDA 2JECA 1PHMA 3TNPB 4P9WA 1XQNA 3ELNA 3FLTA 1LOBA 3BOPA 4TSVA 2XB6C 4AEDA 5BNPC 3Q9OA 3OYWA 5JSPA 2D3PA 1TQ5A 1V9U1 3RQ0A 4C5WA 2P37A 4JGZB 1UW8A 4LULA 1VBA2 1B35A 1O4ZA 4BGMA 3MYXA 1UIJA 3HD8B 4AFDA 4XFBA 1WCKA 3WG2A 4GB31 5BNOA 2DV9A 5F1RA 5L7OC 4Y1UA 1NYWA 2C9AA 4DINB 2PA7A 1W6NB 2X53S 1COV1 2WQ4A 2FZ2A 5EZWA 1N47A 4IV1B 4YVSA 2WT2A 4QPIA 4GH4A 1PK6A 2QZ2A 2XLGA 4XJAA 1QXJA 2HWB1 2R042 4QQHA 2P3IA 2GH8A 3ACLA 3ZFFB 2DTWA 5F5QA 5BPXA 1LEDA 1NCQB 4X6QB 3HR9A 3J4UH 5HXVA 1J3RA 5FLJA 4Q8KA 3ZN4A 2ETEA 3D8CA 1F31A 1H8TC 1QXPA 1AJOA 1F9KA 3WZ1A 4XBNA 1LGCA 4F3JA 1AX2A 4ASLA 1VBE1 3EO6A 2OYZA 4XETA 3TWIA 2R6QA 1LB2A 2GC2A 4H55A 5T3NA 3OY8A 5KHIA 1R083 4YVWA 1PGSA 2JENA 3VL8A 4Q0QA 1FOD1 3RRDA 2MEV2 1RC6A 4LE3A 3M7AA 1W6OB 1UD1A 5C4WB 3FFZA 1C28A 3O0XA 4CEYC 2ZHKA 1CJPA 2WT0A 3E5UA 1ZVFA 5GLZA 1MVEA 3VHOA 3RYKA 1REFA 3PVJA 1MS9A 5T5JA 1YO8A 3UKVA 3M3EA 1JBCA 2PFWA 1H4GA 3B00A 2A73B 2OVUA 1CAUB 4PCRA 4LBOA 4Q4Y2 2Y0IA 3APBA 3WY6A 1BXHA 1YUDA 5BYNA 3M2MA 2ZGTA 4OVEA 2A71A 4YG6A 3ZFEC 2IC1A 3ZXKA 1JYIA 1V6NA 3VBUC 1O5LA 3I59B 5DUVA 3ZSJA 1VAVA 3V56A 1NLSA 1PVC2 1Z7S3 3KS7A 4RS5B 2DVBA 1RUF3 3LKJA 2RS33 4C1XA 1TME2 3OD4A 3UK9A 3RWNA 2WZR3 5FREA 5AVPA 3IIAA 4B4QA 3MDPA 1ASJ2 3AM2A 4I3PA 1FPN2 4NWWA 1XE7A 2JDZA 5AC91 4B7KA 4N7IA 3USUA 2VU9A 2HEVF 3WW3A 2PHRA 3ZSLA 3ST7A 3D0SA 3VKNA 4BCUA 4F7ZA 1XU2A 2JXAA 1FMD2 1MS4A 3OD0A 3ZSMA 4R8HA 5DXDA 1QJU3 2DFCA 4PBOA 3VBRC 2KXLA 3KLSA 2RMU3 3R4UA 2D7FA 1QH6A 1WBLA 1DGRA 2F4PA 2VY0A 1QJZA 3IKWA 1O91A 2BW8A 2YYOA 2C5DA 1APNA 3M3QA 1HRV2 4XFFA 5CFCC 5EFUA 1VZ4A 1EAH2 4BWOA 2WBQA 4Q29A 4PDWA 3WP6A 4EROA 3OJBA 3WINE 4ITCA 1HXS3 1OOPB 2WFF1 4F8AA 3H7JA 5FDBA 4N43C 4M2IA 4XF9A 1TMF2 2XLAA 2YMZA 4YGDA 4IEXA 4I2OA 5EXOA 1VBD1 3VHRA 1C4RA 1KJLA 2XWJB 3TBDA 1IPKA 3CF6E 4HK9A 3E6BA 3A4UA 4E27A 2OG7A 4MVTA 3ZPYA 2D43A 5GZCA 1KDKA 1XU1A 2UYBA 4NPRA 3MGUA 1YHFA 4LLFA 2BNMA 4Y20A 4YARA 1WA4A 1XNDA 1LJ7A 1LODA 1CX4A 2DURA 1GSLA 2A6ZA 4LO8A 1DRTA 1HRI3 3CJXA 3WW1A 1UN1A 1DQ0A 1NA1A 4YLZA 2BFUL 4N53A 3VBOC 2RS53 3R0RA 2WLQA 4DXZA 3X29B 3TAYA 2JG9A 1TEIA 4KG0A 2ZX4A 1AXYA 4BHFA 4XYXA 1UAIA 3LWCA 1SEFA 4YVSC 5GLUA 1MEC3 1SBFA 1W6MA 5SV8A 1RUG1 1C8M1 1LU1A 4BIFA 4KWLA