2XUMA

Factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
b'MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRHSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 106
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2xumA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xumA01
3KCXA 3KCYA 4NR1A 2CGOA 4JAAA 1MZEA 2WA4A 4Z2WA 5JWPA 1IZ3A 3OD4A 4QU2A 2WA3A 1H2KA 4B7KA 2W0XA 1H2NA 1H2LA 2YC0A 3P3PA 1H2MA 4B7EA 2Y0IA 1MZFA 4BIOA 4Z1VA 4AI8A 1YCIA 2ILMA 2XUMA 3P3NA 2YDEA 2CGNA 3D8CA
chains in the Genus database with same CATH superfamily
5GW7A 2JIZG 5I0TA 2ZXWC 4FVMA 1QH6A 3TN92 3KS7A 4GWJA 3E89A 4HKOA 4H0LB 3S0MA 2NLJC 4UXNA 1PX3A 4GWMA 3ABLC 1R3JC 4Y26A 1IURA 1J5EB 2LJ2A 4GZRB 2EBOA 4RAIA 2JG9C 1PNFA 1IS3A 3PUHA 3OGJA 1YI2V 3IIAA 1N0NA 3FHIB 3SCGA 2JECA 3IGAC 1KGYA 2A79B 4EN6B 1FJGB 4ZHNA 1WWYA 5KAIZ 2CHHA 3JALA 2GSMB 1G6NA 1EZJA 1XI1A 1NLSA 2VMCA 1MEC3 5KR7A 4DW1A 1UF2C 1S3JA 2GV9A 3CF6E 1THZA 2TBVA 3ZMSA 3L74H 2VQTA 1ZRFA 1MS9A 2VXRA 1K5MA 4F3JA 5LA6A 5F3GA 1S77D 5LASA 4LF6O 2EIKC 4Z1VA 5FZAA 1N33B 4EN0A 3O0WA 1SA0B 4QU1A 3VBFB 1YWKA 4X6RB 3LSUA 3BHPA 1CIWA 1E5IA 2PYTA 4YVWB 1CAUA 1JYVA 2O14A 4XMIA 3A23A 5JXGA 1FXKB 1UU6A 4ORFA 3QO8A 3WP5A 3C7FA 4IGQA 1NKDA 3TEYA 4LJHA 3ABMC 1RMU1 2YIDA 2Z42A 1W8TA 2FL4A 4LOTA 1XHZA 5IY5B 1V54B 1DK1A 1M9NA 4BQ5A 4LNVA 5JCTA 2J7MA 2PHRA 3OD4A 1UMIA 2BNMA 5L3CA 5FYMA 2LFSA 3GWKC 1YFUA 1UU5A 1EN5A 5CISA 2B5UA 3CLPA 3T4DA 1WGPA 1GNHA 3VHPA 4O61A 1XSRA 5DZGA 5I91A 1OOPC 3H3LA 5A3PA 3E22B 2ARBA 2IXHA 5FZEA 4IEZA 5HCFA 4AZZA 1PGW1 4CPBA 4DXRA 3ZRVA 4CU6A 5DM6V 4KWKA 5GLWA 3LKJA 1POV1 2D3SA 3N7LA 4IV1A 1M57C 5BMVA 3ZRWA 2WBKA 4HSJA 4Y4RA 1XC6A 3WFVA 1RUF1 4HYOA 1ULCA 3RI8A 2JDKA 3L71H 1VQ6V 3HAGA 1OV9A 4KWUA 3H8UA 5FMCA 1BCCH 1ZRDA 1EN6A 2PAEA 1AR81 2VMEA 4HL0A 1URXA 1VQKV 2BNOA 1GQGA 4O65A 2R49A 3S7EA 5EK0A 1HRV3 3ZDSA 1P7GA 2XOMA 4OI4A 5CB7A 5AC91 4TUYA 4QPKA 2IW5A 3B01A 4LFCB 2FMYA 5J2UA 4OHZA 3WB2A 2EX3A 1YQ2A 3WB1A 3QH6A 2Q8VA 4RR3C 5DZFA 2PHWA 1DLBA 1LAJA 3H0OA 4QE9A 1V6OA 2IH3C 1DGRN 2ZGSA 5FO9B 4DR3O 2EIJB 1QNWA 3DXUA 3E6BA 2E31A 4Q8KA 4JI4O 2VOWA 5GLUA 1UIKA 4XUQA 3FLRA 4ZU7A 4Y1YA 3E6CC 1JZ6A 1AJNA 1CZTA 4RQPC 2X0LA 1TAEA 4I9WA 4L8JA 1RUE1 1SG3A 3G80A 1ENVA 1VQ4V 4GD4A 4LIUA 4AHWA 2GP3A 1W8UA 1RUD3 4COYA 2DJVA 4JX0A 4GUNA 4Q4W1 5F39A 1P8JA 4NXMO 1B35B 3O7OA 4XJUA 1OQEA 2MEV2 4BR6A 4IE0A 3WUCA 1BBT3 3KV5A 4AOCA 2IXJA 3RYPA 2VOXA 5C8YB 1RTVA 2ET7A 2HLDG 1NVPB 4GKKB 1OUXA 3OUIA 1GZWA 1CJDA 4A2UA 3SPIA 1SQXH 4EYUA 2Q7HA 3OTOO 2PHXA 1HNWB 4JYYA 3VDDB 3JD4A 2RS32 3MLKA 2E26A 4UT5A 4QKDA 3KZIZ 2ZE8A 4LBJA 3H3ZA 5LXTA 4MVOA 4IEOA 4XJWA 4QAWA 1DDLA 1OA2A 5L7OB 1QVGU 4X1YA 4AR2A 5T52A 2VBDA 1KU9A 1X9TA 4G3YC 1AR61 1PM9A 2QTOA 3H1MA 3L75H 4MTFA 4JZRA 2IUWA 1A6CA 4Q4X1 4PF5A 4ZY9A 2E7TA 1N1SA 3MBWA 4UF0B 4CH5A 1YJKA 3HKEA 1AXZA 1D4M1 3CSXA 5EWSA 1NQDA 2Z2SB 1VE0A 4YFZA 4HK9A 3SYAA 5KXDA 5FQ0A 1K5JA 5GONB 4LKSA 2VW0A 4I0WB 4LHLA 3I49A 5FO8B 4IYHA 4HOOA 2RJ2A 1LUVA 2QQKA 4QXBA 5L3DA 2RJLA 3G6EV 4QQOA 4MGYE 5LB6A 4K35A 4COZA 1NQTA 4EKWA 5A7WB 3AYCA 3F5WC 2OUHA 4PBPA 4Y33A 3T2MA 1AI6A 1UO9A 4TXWA 2RDRA 3AKRA 1WD3A 3ES4A 2ADPA 4GX1A 2E53A 5T5PA 1G9BA 1PO23 3OGRA 4ZU5A 2WSSG 5F2VO 3CJIA 3DPRC 1WZXA 3I59B 5JR2A 3RZZA 3CBNA 2ZACA 3ZOIA 1SLLA 1NCQC 3LEMA 3JD2A 1N3PA 1K3IA 4I7ZB 2DYRC 4ASKA 2LS6A 2R6QA 4W6WA 2QVSB 4YJ3B 3W58A 5EPAA 4LFBO 4EFBA 1XNQO 3BIWE 3HMYA 2HVJC 4HPKA 1O9HA 2ZGRA 4GH4C 2Q0OC 3UO3A 2A7AA 3FC0A 1JOPA 2CAUA 1LUWA 2B9ZA 2GUZA 5CIRA 3PU8A 3CDZB 2W2IA 1LU1A 1IHMA 2BEOA 5FK7A 1Q81W 2ZIMA 1WJZA 4HLTA 1N36O 2WO1A 5KHKA 2D97A 1F35A 4A45A 1SZBA 5FPRA 5FP4A 4P5HA 4JKKA 1J83A 1G4YB 1Z78A 2JDAA 3WNXA 1P4RA 4IE4A 3UNPA 5A2QN 2LUWA 4NPLA 5T55A 5JXHA 2YSUB 4IIJA 2RNBA 4CDXC 4P9JA 4JI5O 1AYM3 3PNAA 3VQXA 4YVSA 1GZ9A 3JD1A 1COV2 1E5SA 1GU3A 3GBWA 1R1A2 4YIPA 3E22A 1N3QA 3ACLA 3MFAA 2WT2A 1G8WA 1T6GC 1HB1A 1RUG2 1WA4A 1LULA 1V6JA 4QPGC 1PD3A 4DR6B 1N4CA 1H8TA 2RCVA 5CBHA 4AAPA 2ORXA 4UW5A 1HNXO 4FMTA 5F3EA 3SKJE 1YHQV 1Z5VA 3QACA 1X36A 2QQNA 3CS5A 1ZBE2 4BHPA 4IGGA 4HG6B 1OVPA 4RUEA 1QLEC 1DZRA 1EUUA 1OCOB 2VMGA 3ZO0B 3CCSV 1G9AA 3K2OA 3WD5A 3EQEA 4CEWB 4FI9A 1NLRA 1EV11 1UZZA 3HR0A 1S2EA 4FPCA 4Q0SA 1Z7S1 2XBO2 3HD8B 2XG3A 4UW3A 2PN5A 2MPFA 3GB7C 1LOEA 4Q4V2 1ASJ1 1WMFA 4LBOA 3CEWA 5ABJA 1YCIA 5C6CA 1SESA 2SBAA 1WD4A 4O4LB 4EWEA 5A32A 3ZYIB 2AREA 2XB6C 5EBMC 4HMZA 1CAXB 2G9FA 4J7KA 2Q0AA 3X29B 3ZYPA 1HNWO 1FOD3 2YC2A 2QA4V 2AH2A 5H6RA 2YROA 5CA1A 5I8YA 3DC5A 1BL8A 3K3WA 4FOVA 4CUGA 1DGSA 4Y22B 3VBOA 4WZCA 2XHBA 1LR1A 2L35A 1WAZA 2MEV1 5FY4A 4X8AA 3DGTA 5EC1C 4OPHA 5GLZA 1B35A 5FRAA 5B2GB 4GX0A 2EIGA 4DMIA 2BNNA 3ZVXA 2HBUA 4DV3B 3OYWB 2ZJCA 3KVAA 3WDWA 5JJEB 3MDSA 1HNZB 3WW4A 4HK8A 1CONA 2RS31 4ISQA 3L9DA 4HVQA 2ZXQA 3E35A 1IKQA 1HB4A 1VQ9V 3VDDA 1OCZC 5C8CC 2XWJB 1QJFA 4JRLA 5KUMA 2ZHKA 3PTYA 3N4MA 4LF8B 5AG2A 1AR92 4JCKA 4O4HB 3CE2A 1NAEA 5L7OA 2WNUB 5BV6A 2CWMA 1XMOB 3B5LB 5I0RA 3ZHRA 2BCCH 4Y1UA 5LBFA 3IAPA 1JZ3A 2W68A 4GQ7A 1G7YA 2RS52 2CAZC 2OT5A 4B4PA 5JPMB 4NJ4A 1BVP1 3GHNA 1SPPA 5F5CA 3V64A 1R6NA 4MH0E 2Q4PA 3AM2A 3ZYJB 1V9U3 5EQUA 1RITA 2VG9A 2VNGA 2Q4SA 2ADQB 1SC5B 3N27A 2DVDA 3IJ4A 1PIV1 2PYJA 1YIPA 2GMMA 5A33B 4CCLA 2PYLA 1JI6A 3JQWA 2YDEA 1DZQA 3LE0A 1DQ4A 4E9KA 1ZZCA 4K1YA 3OGVA 2FCVA 5EZYB 4IE6A 5KXBA 1PNLA 3JD3A 1DYOA 4H7MA 2YZ4A 5H9QA 4N9HA 4UXAA 3OBTA 3VBSB 2EZOA 2VTXJ 5CADA 4I3PA 4OZOA 3GALA 1PMJX 2CTRA 3T2PA 3A0KA 1HW5A 5F32A 5EC2C 4NHMA 4BE3A 2GNDA 3IDEA 5J98B 1JA8A 3IMNA 2Y6LA 1AL23 4J25A 1YQCA 2JKXA 1OLME 3DECA 2AUYA 3HBKA 3N2GB 1QXPA 4BIZA 4PBOA 5FJKA 2A5ZA 4DY3A 5LCWL 1RVF3 1ZA7A 1WPXA 1CN1A 3IKWA 2JIJA 1GM7A 2PLV2 5DXDA 2X5IC 3MD0A 3UKNA 4BA6A 1JJ2U 1FXHA 2CV6A 1NY71 2QQUA 3SYPA 4ISRA 4P14A 3MF6A 1NCRB 5DAWA 5B66Z 3FN9A 2D5FA 1NA1A 1QDOA 4JHZA 4M3CA 3RZLA 4KQ7A 3QD6A 1BMV2 3GZTB 5H5NA 2ZIOA 4RQFA 1WP8A 1UXZA 2CTPA 2JICA 2FCUA 4FFHA 5APAA 3RJRA 2EILB 4CDUA 2PAKA 2G1MA 1PVXA 3M2MA 3WCSA 4I0XB 3KGZA 1JPXA 5BNNA 3OPWA 1AROP 2ETNA 3THCA 1TMF1 2D6LX 4PQ9A 5F8PA 3WW1A 5HCAA 3WP3A 4Q26A 1SLTA 4EB6B 3IN9A 4TQFA 3FMGA 1C28A 1W0KG 2YV8A 1TNFA 4LBEC 1X8MA 2EXHA 4E4HA 2YICA 1MG1A 1OT5A 5A7OA 1PPJH 4IERA 3D6EA 3OR6C 4QT6A 3M7MX 1L7QA 4XE9A 1RUG1 3OCPA 3SC7X 2PUSA 2CTQA 2A75A 1QLNA 4XFIA 5FPOA 5K0UC 4LFAO 4DFSA 1BE3H 4PA7A 1RUNA 3SJBC 2Q73A 5FK8A 4LK6A 3PDQA 3AG4B 1VQ5V 2OTLV 1BZKA 2E9QA 3VBHC 4GJYA 1BYHA 4ZS2A 1VBA2 4JGSA 2QDOA 5HI0A 3UJQA 4BZ4A 4BK5A 1XDCA 2X6CA 3S5AA 5FZOB 2D3RA 5C3RA 2VQUA 3CRRA 4QPWA 4QX0A 4YHHB 1C8M1 4NHLA 2I07B 3LDRA 2FMDA 3OUJA 2HVKC 2JXAA 1Z0HA 5A1AA 1F9KA 4M0HA 2LW8A 4NHKA 3VHOA 2JEMA 2UWBA 4HETA 4FOYA 1JUHA 4Q4V1 3FBMA 2VZ3A 1LESA 3AFKA 1GOGA 2BVVA 3ZPOA 1GKBA 2JDUA 5A9GA 3UGGA 3WU2Z 2YBPA 4O4LA 4JGZA 3Q8EA 5H9RA 1FXVA 4X62B 2SLIA 5IVEA 3BI3A 3T2QA 4J80A 3M3OA 4QX2A 2OPWA 2R061 4FPFA 1K7DA 4KU8A 3LDEA 4BMEA 2VTXA 4MT8A 5LGUA 1KD1W 3H1WA 3N7KA 1VF6C 1BJQA 3POSA 3THPA 3K08A 4AQ2A 2OCCC 1XQNA 4UCTA 4LF8O 2HWC3 4IV3C 4AI3A 2WABA 4XFGA 4RFRB 4LUKA 1GO3F 2B1IA 1PO12 2BVBA 4Q0PA 2KD7A 1SLAA 1XMOO 1OSGA 1JFFA 5LOVA 5CAZA 3ZFGB 2AENA 2VS0A 2EXIA 5I8SA 3M1HA 2RHPA 5SV5A 4MZUA 4FAHA 4HKWA 4CCCA 3MPBA 1VBC2 2R073 3T1CA 1SQ4A 3H50A 4CA9A 5KA6A 4BJ0A 5A6ZA 5A6YA 1A34A 4XBQA 1CJPA 3FUQA 3NSTA 1ZZ7A 2QQLA 3EXUA 2IFRA 1PGL2 3RW0A 1HLCA 1KRIA 4ABMA 5FPAA 4MGSA 4QPYA 4OZXA 2ATKC 2W0XA 4BIFA 4BIOA 1YZBA 5A3NA 3USUB 2IZWA 4O4HA 5C4WA 1HR0B 2VZ1A 4META 5IYZB 2RS51 4LIVA 4XF3A 3S7IA 5JAXA 4BXFA 4DV4B 3V0AB 2Q1FA 3TXQA 5CFDC 4DR5B 4RQEA 4EROA 3JZVA 1W9FA 1NH2B 4UVBA 2HHHB 1WLDA 4YZ1A 3WNOA 5IE9A 2R1DA 2ZBJA 1S5JA 3FKSG 1RP3B 5FKCA 4N23A 1N32B 1QY4A 1ND3B 1PZ9A 1QQP3 1YTFB 3K06A 1S0BA 2F17A 1GZTA 4C8DA 1AZDA 2ZGTA 1VBE1 3ZN5A 3L72H 5A33A 2EAKA 2QKAA 3SYQA 2W1SA 4E2SA 1SFYA 2P3KA 5HXVA 1LOFC 2UWAA 3ZKYA 1I5XA 4Q0UA 2OZJA 3TK1A 4JYBA 5KHIA 5CMUA 2XHNA 4DEQA 4N43B 1NT2B 1W3VA 1QHTA 2JD4A 3W5MA 4YXWG 2B7YA 3VBSA 4D7SA 4FPKA 3LDCA 5F37A 3LWCA 4Y5Z0 3H1HH 1M56B 5IT9N 4AGRA 1X50A 3SPGA 1N34O 2LROA 5FAXA 3IWZA 1RJ7A 4YM0A 1FMD2 5JSRA 3M3CA 2WWWA 1UMHA 5IYDO 4PJYA 1YNAA 3ASOC 1ULOA 1WW7A 3AKPA 2HJIA 1BGYH 2B9UA 4CEYC 3N2GA 5LK5A 4FFFA 1YI7A 5LA1A 4NTWA 3ZFEA 2P2KA 4R6ZA 2BBVA 1XNBA 1RUH1 4AK3A 3GF6A 3KWVA 3T2OA 4SBVA 3AZVA 2H94A 1IPSA 1BMV1 5K7PA 1LNQA 1AJKA 1DQ2A 4N7UA 3OE7G 5ANNA 2VOTA 4FVVA 2MHFA 1UZWA 3K0GA 1FV2A 1WMXA 1Q8OA 5FP8A 2E7QA 3K3NA 4XJZA 4G27B 1VEWA 2I74A 3B3QE 4PI0A 3JAMN 3K4AA 2QWRB 3AK1A 3BABA 3S57A 5ITZB 3QLQA 1UY1A 4LP8A 4UVCA 4TV8A 5DN6G 3TEZA 4Y20B 1TUBA 1YXBA 1IBMB 4EB6A 5DN2A 5JOXA 4FFBB 4I9QA 5LHHA 4W4LA 1S0FA 1UD1A 4IQPA 1JQ0A 5A70A 4HT1T 2Y6GA 4JPRA 3IM0A 5F6LB 4WFHA 4IEWA 3QF7A 2ZT9B 4BWAA 4N8MA 1JZ7A 4J9ZB 3ZDVA 5L3EA 1WW5A 1VBA1 2E7AA 1CAWA 4Y1XA 3E5QA 2ZM6B 1K97A 1LENA 1JYCA 5FR3A 4XETA 1FD9A 3MIFA 1ZUQA 1C8NA 4CS2A 4DV1O 4JI1B 4G28B 5JIAA 2WQZC 1S72V 2UUAB 1NE4A 4X62O 5FZOA 4HVOA 3TGUH 4PDWA 4AEKA 3WDYA 4ATFA 1SRYA 1SDWA 3R05A 2GMPA 4MVTA 1H1AA 4GWNA 5GM0A 1UYPA 2W39A 2JENA 5BNOC 1K45A 3CX5F 2E51A 1Q56A 3G67A 4KHPB 5KAFZ 4PIYA 3HKBB 2OYZA 2VZUA 3N9MA 3RYRA 4DK1A 1JYXA 5D8AC 4XXPA 2G9ZA 5TISZ 2WAMA 4FTBA 2EINB 4KI5M 1IZ3A 4FTEA 2OA2A 4FAGA 4JGYC 3HR9A 5A7NA 1QDCA 2DU0A 1LRHA 1GR3A 3B69A 4P9PA 1VJ2A 4UV9A 1KQRA 5JSPA 1BEV1 1MS3A 1W8NA 1XILA 2FKXA 4JTNA 3NRUA 2KB1A 4Y1ZA 3NNMA 3B93A 5L19A 3GJAA 5FYHA 1GK9A 1PNMA 1UJWB 1VF7A 3SXWA 2V4DA 3TXSA 4OUSA 2YB7A 5H2FZ 4GALA 4NPMA 1VBC1 5JZGB 1GOFA 2WN2A 2Y4TA 1AI7A 4XQDA 4DV4O 2JIGA 1JZ5A 3UKVA 2NQYA 2ZD9A 4DR5O 2NM1A 4YGBA 1MQTC 3N36A 2A0LA 1PGL1 3ABZA 4XTPA 3K5NA 3CC4V 2WQ8A 4YY3B 5L36A 3FE5A 3OEAA 4JAAA 4MTXA 3ASNC 3LFMA 2ZGMA 3ABUA 4Q5OA 4B1LA 3W59A 4TQDA 4FPGA 2BOBC 2TEPA 4RN5A 2IVIB 4JHTA 3AYEA 1B3QA 2XPJA 5LYJB 2ZA9A 4Q8LA 3X2QB 1NUKA 3AJYA 1OFNA 3O12A 2VNOA 2C2AA 3AG3C 5AFEA 1GLHA 4IEQA 2A7WA 1UPIA 3OMIB 3WINE 2WO3A 2FHRA 3KCYA 1JXNA 4D6QA 1QBZA 2RDCA 2BGOA 4L92A 4GJZA 4HKLA 1O5LA 4LKEA 2YI8A 1ND3A 1KECA 3HQXA 4LLFA 2HWE3 1VLNA 3J26N 3F7VC 1AP6A 2D6MA 1GN3A 2GH2A 3ZSEA 2ENRA 5D5PA 3E5UA 3APBA 1OKQA 3OOXA 4QM8A 4C7UA 4R50A 2LM3A 4QXCA 4N43A 4YWAA 3K9SA 1J59A 1XL6A 5EV7A 3RMYA 2ATFA 5FUNA 5LA9A 2Q5ZA 2XVGA 3PUAA 1DGWX 3O65A 4K3UA 4DRXB 1ALYA 1RUJ3 1W2NA 4B1MA 3BU0A 2WLPA 4UVAA 3SPCA 2F66C 3S30A 4NIHA 1TZOA 1B06A 2P3IA 4YZ4A 2JG8B 3CQOA 1IQAA 5FYBA 4RL7A 3GVMA 5F3IA 4YW1A 5IVCA 4F83A 2VMFA 1I5ZA 1Y76A 1Y9GA 1G9FA 2FCTA 2YFZA 1XNKA 1HXS3 2VD7A 3HIFA 2UXBB 4NHXA 4ZHQA 4YZ5A 4JI8B 1SQFA 1CX4A 3BALA 1XE8A 4AYUA 1ND2A 4QMAA 5CFCA 1TQ5A 2P37A 5DPNA 3OEEG 1OFSA 4A44A 1SACA 5LMUB 2ZE7A 5ITZA 4UB8Z 1OCCB 1TVKA 2RS12 4MO3M 3O1MA 3J7NA 4E27A 2ZMLA 5GZFA 1JYNA 1BHAA 1BQPA 2WLIB 4YG6A 2UUBB 1AX2A 1NX9A 1ZSPA 2DYSC 2BBAA 1IOAA 5LMNB 3JD72 2PXJA 2F23A 2WSUA 4FPLA 3ZRXA 1FPN2 1I5PA 1P7BA 3ZPYA 2Y64A 2WS93 2D6PA 1HV1A 2JD9A 2ZGOA 5F5AA 1MEC1 2VH9A 3NVCA 5CBFA 3FFQA 3WF0A 4U36A 4X1IA 5GZGA 2XUMA 1DQ1A 1FFXB 1K5MC 1DGWA 1D2QA 4MGKE 1NR7A 5K1XA 1R1ZA 3ENRA 3BCWA 1IBKO 2ZGLA 3N9QA 4AI0A 5LW9A 3HWJA 4UBHA 5CB4A 3LDBA 5K4LA 1AXYA 2HH9A 5EZWA 2PF4E 2VOKA 2CYFA 3FFZA 4LTAA 1U5IA 3ICXA 1WCQA 3VKMA 1K42A 1S0CA 1F23A 3G71V 4CDWC 2AGAA 4HONA 1GMGA 2XLFA 1DLCA 1S0EA 5IAVA 3F5TA 2C26A 1W6NB 4DR2B 4YW4A 3MHZA 2ZX4A 3I3EA 4B3MB 3BA9A 4GB33 3VBRB 3WNMA 4FLVA 4B4RA 5FZ1A 1QU7A 3NO8A 4U7OA 4ASLA 2ZR3A 2ARHA 4NOTA 1WCUA 2ZXWB 1YJNV 3JASA 1R64A 2XH6A 3FJSA 4JQRA 1IQDC 1MS5A 3CC7V 1H1MA 3H1IH 5CU1A 4OPAA 4DXZA 2GC1A 1STMA 3MLJA 5IVBA 1JZ8A 3ABLB 1JW6A 5J96B 2OUJA 2P90A 4IV1C 1QR8A 1K73W 3OJBA 1EAH2 4NRMA 1JOYA 4BCUA 2RMU2 5FZBA 2WZR3 4JASA 2JG9B 5F5QA 4IW3A 1VR3A 3AJZA 4M00A 2P4VA 3ALQA 3WF1A 3BIEA 5JZGA 5KHGA 3LEGA 4HN0A 1HRV1 4QHZA 4LEJA 1QOTA 1O4YA 2ZMKA 4DO0A 3WF4A 2VZOA 2DCZA 3ZSJA 3TBDA 3W5NA 3AEIA 4I01A 5B1OA 3WG3A 3POGA 1K92A 5ACA3 1MS4A 5EXOA 1YFYA 1VAMA 2A1XA 4J1WA 2EIKB 2QE7G 1OXCA 1RPRA 4FK5C 2VVDA 2G38A 4AAXA 1GNYA 4FFGA 1V0AA 1F4MA 3IZOA 1YYNA 2QWNB 1S0JA 1OBNA 1NTMH 1FOD2 2IJIA 3CRMA 4IL7A 2VUCA 4LQRA 4ZZ5A 1H9PA 5FYIA 4MS2A 1RUD1 1OLMA 2HWB3 4MVZA 1SKVA 3ABMB 4LF4O 3F95A 1VQOV 1MNGA 1BMFG 1BBT1 1POQA 1SLBA 4NO4A 2XAGA 2GBOA 2QM7A 1R092 1TVGA 1UKRA 1DQ5A 1HJFA 3B4SA 2HWD3 2Q1ZB 4N53A 2IXKA 3E86A 2WFF2 1VB2A 5EJ3A 2EULA 1RJ8A 3PU3A 3GM8A 5CNAA 4DPNA 4K8FA 1OOPB 1ZBA3 2VAUA 3URFA 2ZDIC 4NRPA 4FOQA 3AP9A 1POV0 1W2UA 4BOWA 1XJAA 4OI0A 3NJYA 2GDFA 3PIGA 3H7JA 1M57B 4AEDA 2UURA 3DV8A 5DDJ2 3KT7A 3K5LA 5FMOS 1F4NA 5EIBC 4JTAB 2JG8A 5L9RA 1VQ8V 1Y4MA 5IJ0B 1F15A 5B1NA 1FYUA 4QQ2A 1W9SA 1VBB3 3ZS8C 5BR8O 5G05L 2ET1A 3ZHUA 4BWOA 4PA3A 3KT1A 5J2TB 5FWEA 1A32A 5JH7B 4NPRA 1RSOA 4AHYA 1AXKA 2K9PA 3HKDA 1VPHA 1Q8SA 1XNRB 4RR3B 3ZYBA 3FB6C 4COWA 1AR5A 2WLIA 2Q5TA 3FX3A 3PL0A 4AW7A 3RVHA 1VMGA 4OUMA 1FPN1 3T1MA 1Y67A 2KSDA 4OFGA 2ARCA 1YLLA 3L2HA 2GDSA 4YYOA 1PO21 4ZPIA 1NT0A 4RHV2 2DVBA 2PA7A 3I2DA 4RQPB 3WSOA 4D7TA 3CJIC 2DFBA 4DR4B 3AMMA 3UL2A 1FXZA 1I9RA 3ZIXA 4BXSV 4IHJA 3ZXAC 2EA7A 3ZLIA 1GWKA 2ZGPA 3NW4A 5GZDA 2RDQA 2CY6A 3WR0A 2BTVC 2C5DA 5GTIZ 4CSWA 1FFXA 2E5LB 2OW4A 4F7ZA 2XDVA 2W6JG 1RUC3 4QB1A 3NAPA 3N2KB 3AZZA 2VL4A 2VUJA 2D3OW 1FV3A 4I50B 4BQ4A 2XJVA 1LOCA 2W47A 1TME3 3SH5A 1VMHA 4CH3A 3CO2A 2YGMA 4LBNA 4DW0A 1S55A 2DOSA 2ZHMA 2W6IG 1K8AW 4XCAA 4LHSA 3WNLA 1VRH3 2PMWB 3U10A 4E4ZA 4OGQB 4XUTA 1OMIA 4GYCB 4GT1A 4E2QA 5DG2A 3RNSA 1AYM1 1ENRA 3HN3A 2XQRA 5LP6A 4LF7B 1VAKA 3VD5A 2ORZA 1OURA 4Y24A 4YVSC 3K46A 4MW8A 4LR3A 1V6KA 2RR13 5FO7B 1OI6A 4DUXA 1HJGA 4BQYA 2Y6HA 3KGLA 1GP4A 4AGGA 3DC6A 3FB5C 3O1RA 3CCRV 2WWJA 3AP4A 4QGNA 3A0NA 3KG2A 4ZKTB 2VO5A 3RWKX 1H8TC 5K8SA 3D8CA 4QDSA 2JJ6A 5E1RA 4O4JB 4UYBA 1HRI2 2ZZJA 3SEEA 2JG9A 2V1DA 5FMBA 3I2KA 4MXVA 3RYCB 1O9GA 1JR9A 5FZGA 1RHI3 3CJXA 2JE9A 3AMQA 1GM9A 1KITA 3VZLA 3AK2A 1C1LA 4NB5A 1RUI3 3DPRB 4W50A 2P22C 3UT5B 3GCWA 3ZXFA 3NMBA 1NCQB 5I0UA 4ZIBA 2VZTA 1J1TA 2NP0A 1CPMA 2EIBA 2WUHA 2GHYA 1G9CA 3ZCCA 3POBA 4Y3OA 2FDHA 4O2AB 1YSCA 3PUSA 2DYRB 1SS3A 4UWDA 4A5UB 4LF5B 3KSCA 4KG0A 2IU0A 5LBQA 5ABJC 5KXEA 4PA4A 4AQTA 1QIQA 4NYKA 1D4VB 4OVEA 3WF2A 2K46A 3WQ7A 3MGUA 4L8QA 1FOD1 2R70A 2W0FC 2RQ6A 4XDKA 1XMQB 2AHYA 4B7KA 1UWWA 4K7JA 1OKOA 1W6PA 3RYIA 3NQHA 5LATA 5CG9A 1JMKC 4CUAA 1VQMV 3KB5A 2ES3A 4AHXA 5FY1A 1AJPA 3LGRA 2EICA 4FLWA 3VBOC 3S5QA 3WZ1A 3SGIA 5BXXA 5IJ9B 1R091 4W6XA 4QGPA 3POEA 1JOBA 1RMU3 4CZSA 3VQVA 1MS8A 2WL1A 2UXXA 4CDXB 2JGDB 2A06H 1ZX5A 2R072 4HFSA 4EEQA 4BM8A 5HXMA 5FYCA 1H6YA 1JJOA 4W65A 4P9IA 4BIUA 1M5IA 3TRSB 2D93A 3AVSA 4HZ3A 4HVRA 1JODA 2ZEXA 4EN7B 1AR4A 2V5YA 1WBLA 4FP2A 4DRRA 3BTXA 5C93A 4QPGB 2JJ1G 3HVDA 1K3EA 3GBFA 2JGUA 2CGPA 1FI2A 1F4HA 1O91A 5CBGA 5DDJ1 4JI2B 5L7OC 5FZ3A 4QJFB 1KMIZ 1UX7A 1LHVA 2DVGA 1POV3 1Y9QA 2BGCA 3VB9A 1JOJA 4MOAA 4BH9A 1QLEB 5IJ0A 4WVMA 2R043 5LRRA 2HYXA 1UY0A 1NJIW 2QZ2A 2EIDA 1V9U1 1RUF3 3ACGA 5FYYA 5EHDA 2UYBA 5FWJA 4CTEA 3ON7A 2LGQA 1YIJV 1QQP2 2VRZA 4DR4O 3ECQA 2P7TC 3JARB 2NR5A 2V7QG 4NROA 3ASIA 3ME2A 1DHKB 3I3BA 5E16A 1BHBA 2RM22 2JWPA 3GZEA 2AC1A 2LW1A 3LAGA 3PIJA 2JKBA 3T0AA 4CE8A 4YW3A 2Y0OA 3M3EA 2ZINA 3Q8BA 2E5LO 3MYXA 1W04A 2LGWA 2ZE5A 5A7PA 1RFYA 3HOBA 3TCUA 2VQFO 5FP7A 2ZCEA 1N1YA 1JHJA 5KBFA 3RVYA 3POIA 1J58A 4KBZA 5LHIA 4KGGA 3BODA 5JR7B 1Q82W 2WLMA 3VLBB 3ZM8A 3RT3C 1YQ8A 3FYIB 1KD7A 5F9TA 1EPWA 3VD4A 5J48A 4UFLA 1FPOA 1PZ8A 1RVF1 4XUPA 1LU2A 3Q9OA 4DUYO 1W3XA 1FAFA 1YQ6A 3JXSA 1NVPD 4XIKA 4RD7A 4Q4W3 3B8MA 1OA4A 1XHXA 3VOUA 1NA1C 3ZR6A 3CCVV 4AE2A 4LF6B 4R8CA 3AKTA 1UY3A 2PHDA 2HLEA 3L2YA 4MW3A 2PI4A 1QNYA 3AK0A 1OCZB 5C8CB 1QR9A 1KJLA 3E5XA 1HV0A 4CDUC 3NWKA 1F4AA 2WAAA 4JI3O 4PA9A 2Q8DA 1IX9A 4SLIA 4WFAV 5BNNC 2QQIA 4AEMA 3O1OA 2K1EA 3IIIA 5GLVA 1C57A 1PGW2 5C8WA 4QB6A 5FY9A 3VQYA 2DWDC 2C6SA 2PGGA 2HP8A 1H2NA 1AR63 1KKCA 4K40A 1UZVA 3CC2V 2EJRA 4X65O 5FY8A 4WM8A 2ERFA 3MIGA 5JI9A 3VBBA 3CRCA 2GNTA 3WX5A 1PVC3 2WT0A 1JH5A 3WW2A 5JCOA 4NE9A 1I5YA 3VD3A 1EUTA 5JOWA 2Y34A 3NL1A 3TN93 2NPIA 2Z69A 4Q0QA 2FDKA 3M4FA 5FIXA 5FDBA 1YIFA 1XNDA 2WWUA 4ZBMA 3K77A 1W06A 1QF3A 1J95A 2GC2A 4O2BB 4YFWA 4LF5O 1K33A 4O4JA 2BWAA 2C9AA 4FPYA 4W4ZA 2KA3A 4JDNA 1ENSA 2R32A 1M06G 2W3JA 4TV9B 3IT8A 2LO1A 3WNNA 2V72A 5C71A 2CDPA 2ZE6A 3FLTA 4ZKIA 2RN9A 5JOYA 2ZEZA 4RO2A 2DFCA 4B7EA 3LOBA 4QGLA 4ZU4A 4JTCB 4H2AA 3SQOA 2ILMA 4LE3A 1XQ8A 2ZNIA 4X66B 1WB8A 4CXYA 1NCQA 3U37A 3LDKA 3LB9A 4RSUA 4V2VA 4S2HA 4O2AA 3R6SA 2X5IB 3IDAA 1ZL8A 3SHRA 3SEPA 1GQPA 2QQPA 3OGCC 4JGZC 1Y6XA 1D5NA 4U3JB 4DR3B 2ZHNA 2NMNA 1I3HA 5T5JA 4JI4B 4MGTA 2BV4A 3ILRA 4IE5A 2RDNA 4Q6GA 2A3QA 2HWC1 2UU9O 1OD5A 3BKZA 3OB8A 1GICA 4IYIA 5B5EZ 1EFRG 2Y33A 2MNGA 3FLPA 1MOFA 3U78A 5DABA 5IJ9A 2HKXA 1Q8IA 2R071 4CBCA 4NXMB 1WMDA 1OA3A 2A3XA 1SETA 3C90A 3W7SA 5FNVA 5KMGB 4FLTA 1X33A 4FXKB 2QUOA 1SBDA 2PFWA 3PVEA 3OFNG 5JVVA 4Q4X2 1Y74B 4CH4A 3OPZA 1D4M2 4BYYA 1W90A 1WP7A 4DV0O 1WCSA 2IWGB 5FZ7A 4L9BA 2XGXA 5K0UB 4XPVA 4NIAA 3DXTA 1VAVA 4Z2AA 3N9NA 1NZ6A 1RXFA 3TJTA 4WM7C 2WR9A 1W9TA 4P9XA 4O4IB 5C4WC 5EIYB 3B40A 3HNMA 3WHTA 1PM4A 2VE1A 1W6OB 2VQ0A 5A6XA 4B3TO 2UU8A 2AXTZ 5KX5B 3E83A 4R8HA 4A7KA 2WQ4A 2J22A 3HQUA 4CU7A 3A8TA 1UQXA 1XRUA 1QQP1 3W7UA 3H8XA 1QU0A 5FFOC 4KGQA 2X7RB 5CA0B 2A6WA 2VW1A 2CSGA 2ZR2A 4J10A 2RM21 2GN7A 4GA9A 2WLNA 2HWE2 4TT3G 4DV5O 4WVVA 3E2EA 5T50A 2L9LA 5EYYA 4HNAA 1WUVA 2XAHA 4A7YA 4QQLA 3KHBA 1YVWA 4TWKA 4YGDA 1XU1A 3M70A 1UKGA 1M93A 1XPWA 2XJRA 1JYIA 4NUBA 1W39A 4MYEA 4EN8B 4D94A 4MGQA 3IPVA 1PMHX 1IG3A 2XAQA 2QE3A 3HB3B 2J1UA 2RJKA 2OCCB 5I0DA 2BSKB 1VBD2 5BNQA 4IV3B 4MLOA 4UFHA 1IGOA 1UNBA 5BXZA 1D2SA 2BTQA 3OAAG 2D6KA 2VMIA 3HKCA 4GAZA 3CCJV 3ZFEC 5IK5A 1QKQA 2Q6AA 2MEV3 3MHSC 4YM3A 4LO5B 1W8HA 1Y7BA 4AILC 5JVDB 1HXS2 4LFBB 1XNQB 1ORQC 3I2GA 1MSWD 1R3IC 1ONAA 2B8MA 4E4EA 1YJWV 1HQNA 2D6NA 4IXLA 5HPOA 3KT4A 1WA8A 4AVVA 1UOFA 1FS0G 1KC8W 1PHMA 1AX1A 5C8CA 1VQPV 3BVOA 1W8OA 1N36B 3DF0A 5CEHA 3SJQC 1WLWA 5FV3A 3JAWA 3ML0A 1SQBH 3CHXA 1XE7A 5CN0A 2ZX3A 1VIBA 3OBRA 3ZJZA 5CFDB 4E2GA 2ITCC 3R4UA 2C9KA 1NXMA 3KHCA 4JI5B 5KHHA 2VGDA 1S2KA 3QO5A 2GP5A 1XYPA 3NXSA 2B4KA 3N7MA 5C3SA 2ZX0A 4R4ZA 2VY0A 4X66O 4JAUA 1W6QB 1AP5A 3T08A 2WJSA 5A7QA 3C2UA 3WP6A 2DCYA 5F1RA 1EY2A 2OS2A 3Q8FA 3FAVB 1EV12 3A0RA 3VBUA 5IATA 1GP6A 2FDGA 1RUOA 1Z7S2 4CXXA 1HNXB 3O9OA 1TG7A 1GBGA 2ZGKA 5LY1A 4I4TB 1G9DA 4MGZE 1ASJ2 5JPNB 4CP0A 4F4LA 4FLUA 4WBBA 1REDA 4PDWC 1YITV 4MVRA 3BGAA 3T30A 4MADA 3OUFA 2HJFC 4UB6Z 2JS5A 2R9IA 3W20A 3ASOB 4F6RB 2DBIA 3ZMTA 1DCSA 4DV2B 4LBKA 2OPKA 2WAOA 4CEYB 1L7RA 2OWOA 4DR7O 1EP0A 3OM3B 4CP9A 4DY5A 2UY8A 4PLOA 5K1PA 3JCIA 4YJ2A 3FL7A 2VR4A 2H0BA 1UIJA 3I4IA 3K4DA 1OCRC 1YEWA 1MVEA 5EYPB 2HG5C 5J9PC 3ZSMA 1XUQA 3APQA 1OQ1A 4O9GA 4O9EA 3OUSA 2HYKA 5JJJB 2WNEA 4KH9A 3T1HO 4B8EA 3ZX6A 4H37A 3WG4A 4IEYA 5LBCA 1L0NH 1YC61 1QOOA 1UX6A 4GMP3 4XVHA 5FPZA 1NOVA 3WG1A 1S2BA 4LBQB 1S0DA 1US3A 3N35A 3WDXA 3ABKC 1JS9A 1COV3 5C9AA 1WA6X 1LCLA 4I55A 3WLUA 1LGNA 1RB8G 4DIQA 5BZBA 1R1A3 4K8ZA 3SDLA 3UT0A 5ACA2 2LALA 1MS0A 3GHMA 3S3XA 4XDLA 4AQSA 2QCSB 2YS8A 1HP8A 1K12A 2I45A 5IK8A 1QJU3 1ACCA 2BFUL 4O4IA 3VZNA 1PIV2 5D21A 2CDOA 2QWQB 3H01A 4K1ZA 3D36C 1W6OA 2WSVA 3MF9A 1ZBE3 2W9XA 1I08A 1F7YA 4KMQA 3ZYHA 1AI5A 2HWB2 1LGBA 4UFIA 4DUZB 4D6RA 2VMHA 5FP3A 2JE8A 2HWE1 1DLLA 5T5OA 3LIHA 5CA0A 1ND3C 5E88A 5BNOB 1GKFA 1DGRA 1FNYA 1N1VA 5IT6A 3LA7A 2XBO3 3LSEA 1DF5A 3I7DA 3UGHA 2N74A 2PI5A 3L9JT 4D0QA 2ZAAA 4Q4V3 5D8AB 1WPBA 2F4VB 2WZEA 3O14A 3I55V 2F43G 4G4FA 4P9YA 4EE2A 3HT2A 3CZUA 1H38A 1T6BX 2JS3A 2UWCA 1LHNA 3ZFFC 4OCTA 3GDBA 2Z5UA 4MTGA 4UCSA 1ZBA2 4AXOA 4GX5A 1NY72 1YJ9V 1SA0A 3VBFA 4NHYA 4OYUA 2ZABA 1QOSA 2Y48A 2WLLB 1QJEA 2JDHA 1AR73 2CH7B 4YVWA 1VBD1 1NR1A 1XE0A 1RC6A 1VF6A 1ROPA 1L1FA 4HANA 4UW6A 1FXKA 4S2GA 4IV3A 1E57A 2VZPA 5T54A 2N7GA 3J7MA 3D3QA 1HXS1 4XAEA 2BQPA 1ULGA 4PF1A 4Q4Y2 1TMF2 2X6AA 3WUDA 2ZGNA 3C7HA 3POYA 4OHWA 4XQ4A 2Y0IA 3P30A 4L97A 1GV9A 2EAAA 1MQTB 4COUA 3U07A 3DYPA 1ND2C 5CFCC 1PK6C 1YQ5A 3JBG2 2Q7GA 2QWOB 3KM5A 4B3NA 5I93A 3CEIA 4ARXA 5IYCO 3ASNB 1HKDA 1CP9A 3OF1A 3T2TA 4LOSA 4UUJC 3HJRA 2ZQMA 2RJZA 4PV1B 2VCAA 5TSWA 1AR93 1W8FA 4YW7A 1X9PA 2K0GA 3WB0A 1J84A 2WS91 4CU8A 2Q8CA 1NH2D 3I3MA 5IK4A 4BQ3A 3AG3B 4UBGA 5FJHA 3I5DA 4CRQA 3UV9A 3BA8A 4ZI7B 5A1FA 3AZWA 1YTFD 2D7FA 2YIAA 5L3BA 2OXBA 3BN6A 3ES1A 3C3TA 3T4VA 5EBWC 2FD8A 1DF4A 1C8M2 1H8VA 2D44A 1V9PA 4DV2O 4LNUB 3BTAA 3IB3A 4AF9A 1E5RA 1NKGA 3UYJA 1O59A 3FHQA 1K5SA 4LFAB 1GSLA 4WBNB 2A6ZA 3OMNB 4UW4A 3CNAA 1UXXX 1H30A 5GJ6A 2DWRA 4QX5A 3NR7A 4MX3A 5C5UA 5FZ8A 1KBHA 3MW3A 1U5XA 3HEIA 1YFWA 1LEDA 3RN4A 5CBLA 1C4RA 3VD7A 1D7PM 2P3JA 3N9OA 4I2OA 3KD4A 4XJ9A 1AB3A 2BUKA 4K0KO 2FDFA 4F6RA 1AILA 2R062 3MW4A 4X64O 1NQJA 2CK3G 3AP5A 2CNAA 1M4UA 2YPJA 2PAMA 4GB31 2XTAA 4JTOA 3RSJA 3B8NA 4A3ZA 1G8MA 4JDOA 3ZN6B 3AYDA 5C33A 2PLV3 4NWVA 4XILA 1IDSA 3K4ZA 4MHRA 5DMYA 1R73A 4AFAA 4LPLA 4BMBA 3SR2C 5C8YA 1M90W 4ARYA 1HDJA 2V5DA 2KR2A 1HW7A 2P34A 5EP9A 4IGPA 5JDBA 3THDA 4XJAA 3K58A 4PDLA 1AHSA 2LRPA 4FPHA 3ZXLA 3PHMA 5DAVA 4S2DA 2DYSB 2XXZA 3T4ZA 1TGOA 3QVNA 4RGKA 3MFCA 4MGIE 5CA3A 2FMLA 1GNZA 3IC9A 1RHI2 3RYKA 2HR3A 3KCXA 2HWF3 4LBQA 1RUI2 2X29A 5JWPA 1QJX3 3ZXJA 4W4KA 4DUZO 3JALB 4UF0A 1J1LA 3SPJA 2XUEA 5ACA1 1BT8A 3P5BA 3CU7A 1AUYA 1LJ7A 4KFMA 5GONA 1KKDA 4N21A 3ZYGA 1K5MB 1ST8A 5LA6B 4QQHA 2DU1A 3QO7A 1LOBA 2F4VO 3AMPA 1OHFA 2Q69A 3PVBB 1LOAA 3U75A 4LCUC 1VBE2 2R7EB 3EFFK 1CAUB 1TNRA 1URFA 5A7WA 4Y1VA 2HWB1 2WA4A 1UU4A 2E33A 3DEMA 1Y43B 4P9GA 4CDQC 3RG0A 5FPLA 2O8OA 2BW8A 1KEXA 1IBLO 3A0BZ 2H0VA 2QWPB 4CDWB 3AKQA 1UFIA 4BQ1A 5FKBA 2R1BA 2HWD1 2EIMC 1VQ7V 4AFBA 2D6OX 4LA2A 3I59A 1PKXA 1LHWA 1O8SA 3TB0A 4WVWA 2ARAA 4JRAA 4N53C 2E63A 3PVNA 4FIPC 3T1YO 2LW7A 3GBGA 2X6BA 5D8AA 4AL9A 1SQGA 2YMZA 4QX7A 1DU3D 1ZBA1 5FOBB 4MV2A 4YJ3A 1PX4A 1AX0A 2F93B 1QEXA 4INDA 2QBXA 1GP5A 2GU9A 2FZ2A 4K21A 2YUAA 3CXHF 1XOYA 2Y6KA 1RUH2 1AYN2 1NXD1 1H2SB 1BXHA 4XACA 1N1TA 4CXWA 2R16A 2CH7A 3CZJA 3LIGA 2CDYA 4FM1A 5JSOA 4IV1B 1N34B 4QGMA 2IM9A 2DTWA 2EZPA 3ZRWB 3SITA 4AEDC 1W0PA 3K3OA 4QXHA 1VBB1 1PO13 4JKLA 3DN7A 3STLC 4Q4Y1 1RIRA 5HCHA 4FLYA 3IFXA 1KQSU 3VQWA 1DTOA 5SV8A 1AVMA 2RMKB 1W0OA 3JBG1 3ZSKA 2TUNA 4BDVB 2P5BA 2B1GA 1SQQH 2WO2A 3Q8CA 5KC6A 1BQ0A 2VZSA 2DF7A 2XL9A 5C5TA 5J2UB 3O0VA 1H6XA 4FM0A 3HN1A 1SBFA 2DCTA 2TNFA 3LSQA 5GKAC 1F5JA 2WC2A 1SQPH 1OF3A 3N7JA 3B2EE 5L3GA 4MVSA 3LSDA 4ITCA 1Y9MA 1O8PA 2AW9A 1FNZA 3AG7A 4MVQA 4P02B 4BAYA 4LULA 2F4PA 3BB6A 2OYQA 2P67A 1XNCA 4JF3A 3EXAA 3WG2A 3NV1A 4CEWA 1Q3EA 3MZHA 1LR5A 3H9VA 4WZFA 2OQ6A 4FPPA 1I94O 4C91A 1UPSA 4RS5C 2DE0X 3VDAA 2FDIA 1RUC1 3AX4A 4G9SB 3WEZA 1GZWB 1EM1A 3BAAA 4NVPA 4DUWA 3RGBA 3NAPC 4DUVA 3CCQV 1TME1 3WDVA 5D1IA 1V55C 4XBLA 5ANQA 4ES8A 3CL1A 1AR1B 4DV1B 4DXSA 4X6QB 2GC3A 3OTFA 4JV5O 4XIOA 3H1LH 5LXTB 3J8F2 2OIGA 1GWMA 2QGNA 1CAXA 5A3UA 5IVFA 3E1F1 3EHKA 1FMD3 3O1SA 3NV4A 5FZKA 5T5LA 3ZMNA 5BNPC 3KQ4B 5B1BC 1BEV2 1CIYA 2F4LA 4Y22A 5LP6C 4IETA 5CZKA 2RR11 1HX6A 3PUQA 3HKEB 4NTXA 1JZ2A 4IL6Z 1WW4A 3K51A 2G4IA 1OUSA 5LHGA 1NU1H 1UOJA 4WF9V 4JI6O 4NWWA 2UXDO 2WFPA 4J7JA 3FYEB 3UCSC 5A1LA 3OGGA 5FXVA 4RUFA 3OYWA 5ISLA 3OD0A 2WNVC 2PY5A 5IUQA 3B77A 2GC0A 2XLGA 2IFWA 1VARA 4GIQA 3K5MA 5LK7B 4QQPA 4OQ8A 2Z79A 1FFTB 4QX1A 2Q67A 5JJNB 4Z8BA 2Z3YA 3CKHA 3ZXDA 5LBEA 2VNRA 3H1JH 4ZXEA 3WT3A 1W2AX 1RHI1 1I6XA 3WHUA 1RUI1 5FL7G 2WNUA 4QD2A 2QJVA 2WLHA 2RV9A 3SMHA 3H1YA 1LOGA 3H8RA 3J7LA 1K34A 3CJIB 2HEWF 3I2IA 4TTGA 5LWBA 4LHNA 2LFRA 2V4AA 1RM1C 4YM1A 4XXAA 1Y4WA 3IBMA 3E8BA 3ST7A 1YI9A 2EF6A 1UAIA 3WP4A 4OHXA 5FZDA 4HPKB 4J42A 3JU9A 1KS4A 5CKNA 4LO7A 4IUGA 3JB4C 2GUZB 1NTZH 1KP2A 5C3PA 1APNA 1S0GA 3N9PA 5EZYA 4DYLA 4EZHA 4XF0A 3MHHC 2BDRA 3QBQA 3THOA 3ETEA 1GOHA 4B29A 4CDWA 1V6IA 5GALA 3VD9A 3VKLA 1BK1A 3USSA 2QNKA 2YBKA 5JLVA 4IIJB 2IJHA 3CB2A 2C1FA 3GYDA 1SEFA 1GTOA 1C3HA 4YVSB 3J7HA 2QQVA 4UFJA 1UMZA 3UESA 1AYN1 4JZ2A 3CP1A 1NCRA 3D0JA 4QPIC 4D6SA 1Q6HA 4JYAB 1DQ6A 1Q43A 4LH6A 1H8TB 1CWPA 2KG7B 3GCXA 2UUCO 4N90A 3P6BA 4CS4A 1XYNA 2WLQA 2R041 4GXLA 4Z92B 2PQQA 4I0XA 1Z2GA 2R9AA 3SJAC 1HIXA 1UOGA 2W5FA 5FZHA 3BYWA 1A8MA 4CU9A 4QXKA 3U1XA 4YARA 1MEC2 1ZLZA 4K3AA 2JDPA 5ABJB 1XU2A 3DKQA 5A32B 2YU1A 4P2ZA 4IE7A 1UPGA 2DUQA 4DV6B 1JVMA 3MDPA 2CWSA 2A3YA 1CQ9A 3WG7B 4YSFA 2Q8OA 1NG0A 4IEVA 1CGPA 5HFMA 4L0PA 5DUXA 3OGSA 4FQ4A 5CA1B 1DF0A 1SLCA 2BGPA 3FBYA 3J9SA 3ROUA 2YEVB 2VBBA 3VBOB 3JCZA 3MIHA 4RYDA 4H14A 3ZMOA 4LORA 4W6YA 1B09A 1SCRA 3K0DA 5FZFA 4PELA 3JQXA 4FXGB 1Q8VA 4AWDA 3N3HA 5DECA 4AHZA 5BUVA 1AJQA 2XJSA 3D3AA 4K8RB 1HWYA 1RXGA 2B9VA 1IBKB 4UCVA 4ZOLB 2OIIA 4YM2A 3EB7A 1ZRIA 5M0TA 5FLXN 3J8F1 2ZDIA 2J1RA 4U2AA 2ZNJA 4L87A 3PUIA 3K57A 4D3WA 1F8VA 3HPLC 4BLJA 3BEHA 3RWNA 4U7NA 1QJY3 2C0ZA 4K20A 4DNYA 4YRDA 1J5EO 1WKYA 5FPBA 3O1UA 4TOIA 1BKZA 2BWCA 2RVAA 5E79Z 3AG2B 3P1IA 1RYYA 1SPPB 1R3KC 1PVC1 2ZOEB 3EYPA 1UCXA 4WM8C 2WYFA 2IXCA 3ZFGA 2OTJV 1XOUA 2VXJA 3HNBM 4N9IA 3TN91 2WRAA 5DUWA 4HZFA 5JCOC 4QWNA 1FJGO 4P08A 1SFPA 1V6MA 2ZZQA 1HRV2 3KLSA 5C70A 2YIBA 3U14A 5FXWA 1B04A 3KV6A 1V70A 1JTZX 2FQPA 5EBLC 1KUQA 1VP6A 4KNCA 2HKOA 2RS13 4PQQA 4FBFA 3CXCU 4CC5A 1D2DA 4P30A 1CEZA 3NV3A 3H3UA 1N33O 1FAYA 1QNMA 5IAXA 3USUA 1VRBA 3JD73 1P84F 4QKNA 4ASMB 1TEIA 1FPN3 4XOGA 5IYZA 4WVZA 1QVFU 3LOIA 2J1EA 5HCBA 5BY5A 5JQGB 3I8TA 4FLXA 1H0BA 3V0AA 3ACHA 1U5YA 2NN4A 5LZ6A 1A3KA 1MA1A 1H8HG 3G7DA 4QE7A 3ABTA 5FBZA 4JVAA 1F31A 2VCCA 1RUD2 4F6EA 4BQXA 3MV11 3D3IA 2PHFA 3WOGA 4C1XA 2JB8A 2PQSA 1O7FA 3OEBA 4PI2A 4E8CA 2NNUA 1NA1B 1BBT2 4M3CB 1KS5A 1O3SA 1DIWA 3VN4A 5KWRA 1UW8A 2IU3A 1HB3A 3TWIA 4JAVA 1XBLA 1MR5A 3BUCA 4AGVA 4X1KB 2ADDA 4ICGA 3CCMV 4JYCA 1BZWA 2W91A 4CDUB 2LQTA 3I2FA 4UCOA 4JV4A 2WO7A 4OMDA 3DSQA 4JYAO 2JEUA 5L9VA 1DG6A 3RI9A 5BNNB 4HXCA 1NBMG 3KKYA 5J3UA 4LF4B 1XL4A 2ODMA 1P49A 1LHOA 2K9ZA 5B4NA 1VIWB 2QKDA 3W21A 4XYXA 1O4TA 4CS3A 2P3YA 3LFIA 3CMEV 1B6QA 1XBFA 1HN1A 3JUUA 5LGTA 5LA2A 3O1TA 2NLRA 2RDSA 1OPOA 2M7WA 3M3QA 1NZCA 4Z1MG 4DRVA 5AVPA 3RRDA 1SHWB 2RG4A 5LBBA 3LA3A 4MSVA 5F2SA 3LPGA 2BYVE 3LEIA 1JYTA 4LFCO 1ZYBA 3WQBA 2KG7A 3IMMA 1QJU2 2DVFA 3ZXGA 4LKDA 1W2OA 1EAH3 4HAMA 2D40A 2RMU3 5CYYA 4LK7A 4KWJA 5IYYA 1ZVFA 5FP9A 4DV6O 3PTRB 3L70H 4Y20A 2YHJA 2Y69C 1OH4A 2P4EA 5FZ6A 3BPSA 1J3RA 2YXLA 5GZEA 4Q0VA 3UQ8A 5BR8B 4CVUA 3AXEA 4FFBA 2LP7A 3QCWA 2OKXA 3I2HA 3BY6A 3QNEA 5H9CA 1PO22 3AC0A 3PJQA 2VVFA 5HV4A 4IEPA 4KP4A 5H9PA 4AVCA 5JUVA 2DN9A 3VUOA 1Q90D 3NNLA 4LKFA 4KU7A 1ZAUA 3TYJA 3B02A 4XFAA 3AMHA 2XHKA 4A7ZA 4JGZB 1L8DA 2UXCB 3I54A 1MACA 2XMLA 4GKKO 4BW5A 2VWKA 4NIDA 5E6HA 4BB3A 1X59A 1S1AA 1DYPA 4CCDA 2QFEA 3LQCA 1MZFA 1V6LA 2ZGUA 1WBFA 4NMIA 3OGIB 1AR72 4XURA 3FZ3A 3RDIA 2OQ7A 3ZN1A 2ETEA 3B7MA 5FMDA 2YEVA 5B4XA 1H2KA 2AEYA 3VDCA 4XBFA 2W08A 3R0RA 4QHBA 2ZX1A 3ACIA 1V00A 2OZ6A 1JFFB 5F5IA 1IXBA 5LOVB 2AEZA 1WCDJ 3ZMUA 1R093 1YHFA 3WF3A 2WFF3 1H8EG 4OLLA 1GZCA 3HKBA 3P3PA 1XSQA 1AYM2 5FCCA 1ZZ8A 4JI0B 4ZOLA 1I0HA 5FREA 3OW2U 4Z07A 4KBBA 4ZZ8A 1DQ0A 3IAQA 1Y3TA 1G1XB 4XUOA 2MK3A 2C4XA 4X88A 2WLJA 3WQ1A 2IXLA 5FPUA 4WM7B 2GTAA 2A9HA 2QTSA 5C4WB 4KWLA 4LBMA 1JZ4A 1W03A 3AP6A 3JSNA 1XNTA 5JMOA 2R0FA 1S0VA 3SH3A 5B1AC 5DDJ3 2WT1A 3CPWU 4LF9B 3CWBH 1TE1B 3RPQA 1PP9H 2IJJA 3CCUV 1BCXA 4EN9B 2QDNA 2VZRA 4LE4A 3STZC 3NNJA 4YGEA 3EHBB 2OIEA 4XZPA 2BRTA 4XFBA 1O4ZA 4YGCA 4JZGA 1ZZBA 5B3SC 4JI7B 2YFUA 2B5HA 3JB8A 3MW2A 3JSLA 2PZSA 3DXRB 1U96A 1W99A 3VBUC 1LKNA 3PURA 4R7CA 2DUOA 4UCUA 4Y5TA 2QR4A 3PJSK 2WZ8A 5LEJA 1GQHA 2E75B 4XAAA 2H6CA 2QQOA 4BU2A 4Q1RA 3O1VA 5LYJA 3H42B 4RHV3 3AG1C 4CCEA 5JQGA 2XL7A 3M7AA 3C3SA 2XAJA 3SNMA 3UKMA 5C3OA 3K5OA 1JCHA 2DMXA 1YF2A 3MIDA 2DWEC 4AQ6A 3U4SA 4K6BA 1W05A 3ZFEB 4ES9A 5KC5A 1L7LA 4L99A 3K59A 1KYOF 3OT7A 3K03A 2WINB 5FY7A 1IPJA 1AI4A 1JX9A 3BPZA 3C7OA 5FBJA 3W7XA 4X1KA 4OX9B 3SCFA 1ZTEA 2QM4A 1H2LA 5LA0A 4TV8B 1QWRA 3M8LA 3JAKB 3GZUC 4GWIA 1DYKA 4PA6A 2ZTNA 2BERA 4DR6O 2DDUA 1TUBB 1R3LC 4GMP1 4ZS3A 3QG5A 4EV0A 4LO4B 2HJDA 4M3CF 4DRXA 4JTDB 3HBZA 4JQTA 2E32A 2HWF2 1NS1A 1COV1 2LTNA 1QJX2 5FXZA 4CCMA 2EVXA 3Q4HB 4X89A 1LHUA 1M1KW 2DVAA 3OPTA 3E8GA 5EJ1B 1Q7YW 1R1A1 3THTA 1AL0G 1Q5OA 5C9AC 1V9U2 1EN4A 2XWBB 4FJCC 2ZS6B 1O3QA 1QJU1 3E6DA 3DYMA 4M01A 1MZ6A 4BPZA 5FYVA 4FFIA 1JU4A 4X9QA 1CAWB 1CZVA 3ETDA 3KF5A 1OPMA 3M3IA 3WCRA 1HRI3 2R72A 5IVYA 1ZBE1 4WFEA 2ARXA 1EYBA 2ZX2A 1K5QA 2ZAHA 4GKJB 2UXCO 3BVCA 2DCJA 4CP2A 3I3DA 2DCKA 2NN8A 1U97A 4PDWB 2CE4A 4RGGA 4LWSB 3A21A 3UKTA 2L6LA 3K79A 2E76B 2Y38A 4AG4A 4AI9A 2DUPA 4BQ2A 1W59A 2A6XA 2XBO1 4TWTA 2B42B 1W6MB 2G19A 4XZUG 1AL22 4X20B 3KMHA 5K9YA 5ERLA 4E8DA 4IEUA 1MSDA 3JCUZ 4DQAA 3ZBHA 1RVF2 3T0BA 3BFRA 4KG8A 4RGAA 4H3WA 4DV3O 3HQRA 4PDMA 5CKMA 2DTYA 4IGOA 2M6YA 1OCRB 2O8QA 2DQ0A 1AR71 1HNZO 4JI0O 1CD3G 2CU5A 3VBFC 2VQFB 4YG0A 2DW4A 5FZ4A 3DL3A 4YVWC 4L2NA 5EFUA 1SZTA 3KF3A 4H7LA 3I2JA 2AACA 1FXKC 3FHAA 3WQ0A 1R083 1VMFA 2Y60A 3LNMB 2B39A 4DUYB 4XHBA 4GLXA 1C5HA 2VZVA 3ZSLA 1L3JA 1QH7A 5FLIA 1W2BU 2JDZA 5IY5C 3OUHA 1V54C 4C90A 3CMGA 2FZ1A 4LF9O 3SLIA 1G86A 3AXDA 2Z4FA 1W6NA 3ILFA 3ABKB 4TSVA 1SBEA 3R4SA 4R9DA 2J1TA 1OF4A 1T2XA 3D82A 1GAXA 1XNAA 5IWFA 2XKOA 3VBRA 3TEXA 3PVOA 5J7MA 1ZRRA 4AEJA 3CMAV 1AR91 3A22A 4JI7O 3CRAA 5FZ0A 3IDBB 3ZX7A 1ZRCA 2VCMA 4PD4F 2W94A 2QZ3A 4JI3B 4WM7A 4TZDA 1KP3A 1XB9A 4S2FA 4XDPA 1SFNA 4QDQA 5GZCA 1M4WA 4P9LA 2GALA 4WCEV 3GGLA 1VF5B 3TNQA 3VL9A 3I56V 5LRSA 4B08A 2QDRA 2V73A 2HFEC 4PJ0Z 4PIXA 4AFCA 3T3YA 4X65B 1HQLA 3FD9A 2D3PA 5C3QA 4UAPA 3P32A 3A7QA 1C5IA 4K8XA 4O7XA 5H9SA 2WKKA 2A6YA 4PDRA 5AVAA 2RM23 4OULA 3DXRA 3H7YA 5H6QA 3BTYA 2EALA 1D5AA 1GN4A 1H4GA 5IYBO 4Z82A 4BK4A 1N0JA 1GANA 3ZFFB 4P9OA 1GWLA 2DURA 2PHUA 5I8TA 2Q1MA 4FZ0A 4M0NA 4GH4B 2PHTA 2H8PC 2EIJC 2UXNA 4DV7B 1SF9A 1YUDA 4AQYB 1HB2A 4OX9O 4OQ9A 2OT7A 4D7YA 3W9AA 5IVVA 2J1SA 2WPDG 1OLRA 5A3WA 3SISA 2PLV1 2HWC2 1NLQA 2VZQA 4WFGA 1BK0A 3SPHA 1Y76B 3CCLV 1KFUL 1B35C 4LO6B 1CR7A 3UETA 2QJ1A 4ZHQB 4KL1A 2ZCWA 1W2TA 1S0IA 1HQWA 1ND2B 4I30A 1PK6B 5CFCB 2XVLA 1A8DA 3S3WA 1Y66A 4FQZA 3RMXA 2PELA 4J1XA 1OOPA 4E4SA 2Q7EA 5JXJA 3VDDC 1TVKB 2UU9B 1GH6A 3JAKA 5L73A 3D0SA 3INAA 3ZHQA 3U0ZA 4C0BA 2HWF1 2YC0A 5FZCA 1PZ7A 1QJX1 3TOJA 4GKJO 1E1RG 1QQCA 2BZDA 1KJRA 1VQLV 1Q6UA 4YHHO 2YG0A 4WV8A 3Q4HA 3OEHG 1AJOA 1DGLA 1CPYA 5KA5A 4YLZA 2H3OA 4XUNA 2XJTA 3ATGA 4X1IB 3RJ2X 3QTCA 4L11A 4C1WA 3H1KH 2DV9A 4E4DX 2P4KA 3RYHB 4DV0B 5J2TA 1W8WA 2AGSA 2XR4A 1AR83 1OJHA 2KXLA 1WB7A 5JH7A 3OBZA 1MMMA 3M8AA 5AC93 5CB4B 5EJZB 4RR3A 4D69A 5FUPA 1BVVA 4MSWC 3RZGA 4A41A 4H13B 5BY1A 4B3TB 4EZ4A 1DBNA 4N7IA 4FO9A 5KXCA 4LWSA 3NKTA 4R4XA 2UY9A 1T5EA 1WLCA 4J11A 3A2FA 3WNKA 3LCPA 1AL21 4RQPA 4X8PA 1W6MA 2VNVA 3DUIA 4CUCA 2DYCA 4MHUA 3RBZA 2W95A 4G2KA 4X20A 2XOKG 1VALA 4DV5B 3FB8C 1RUE3 1LTEA 3ZEDA 3BRCA 3ZN0A 3T0DA 2BU9A 4YW6A 5DAQA 4Y4YA 3POJA 3VV1A 4D6TH 2QSAA 2GN3A 1ZREA 4FM2A 3JASB 2P17A 1J3QA 3AK3A 2XJUA 1R6TA 4UCRA 5HFLA 2PTMA 3E8FA 3N2KA 1W9YA 2QQMA 3GJBA 3NV2A 4I50A 1PO11 3F7YC 4I0BA 3OY8B 4LUMA 2DBNA 5DQ0A 3K04A 4LT5A 4FCAA 2W46A 4XFHA 3ZYFA 4XF1A 1JU3A 3UJOA 2QKSA 1HR0O 4LBQD 1GUIA 1EBOA 2W52A 3SYCA 2VECA 1F51A 1IS6A 5IW0A 4MG2A 3OR7C 1GYKA 4XDQA 1DFQA 3DKWA 3C7GA 5FYTA 3SKVA 1IS4A 4QKFA 5BYNA 2HHHO 5DUUA 1YO8A 4LC1A 5J1XA 3C3VA 4Q4X3 1N32O 1D4M3 4OMCA 4DB5A 3BU7A 4XF9A 2F1MA 2X10A 4J6GA 3CRQA 3O0XA 1LODA 2A3WA 3J7AU 4XFCA 3D36A 3B00A 4CCKA 1SDDB 5I0SA 4YZ3A 1O6UA 4GX2A 4CDQB 4AHCA 3R66A 3PMEA 4DV7O 2XT9A 3RYCA 4AQYO 2E74B 1OCOC 1BHGA 4KXRA 1OC1A 5CVRA 2YY1A 2EIMB 4CEWC 1WLEA 4MXWB 5C7GA 3DPRA 5IHRA 4PIZA 3PLQA 3UT5A 2Q68A 5IDJA 4N53B 2EXKA 3NNFA 5FYZA 5IK7A 1CVNA 4CH6A 3MIEA 1PNGA 1PL4A 5DAXA 4NKGB 4QPJA 5A7SA 3ZFFA 1BQZA 4EWDA 4GH4A 4YIOA 1CXZB 3Q8AA 1FMD1 3BTZA 1IPKA 2R0HA 2O57A 3ZKUA 3ZMZA 4R9AA 2B45X 3ZMVA 4EFEA 1SCSA 4TN7A 2XASA 3IAYA 4AEDB 5GTHZ 1QXRA 1QJY2 4ET7A 1VBD3 2R9RB 2IJKA 5JOZA 5AFBA 4ZXKA 2CUGA 1IBMO 2WDBA 3R4DB 4I5SA 3WVJA 4DR7B 4PT6A 2KQXA 5CA6A 2VVEA 5A3MA 2YYOA 3S6PA 4YW5A 2D43A 1JMUB 4CDXA 2JGDA 2WIIB 4FPJA 4NRQA 1TA8A 1PK6A 2QTWB 1XXNA 3ZIWA 1RSOB 4PHZA 4XCBA 1ENXA 2VQEB 3HKDB 3HT1A 5T3NA 3SJCC 2F6BA 5FOJB 1HDKA 4F8AA 2H6BA 2XONA 4PLNA 2K2SA 2NYYA 4QPGA 4Q27A 1UY2A 3T1HB 1Q86W 2ZM6O 2QQJA 4XJ8A 3VBHB 2FBEA 2AZ5A 1R6KA 2WNUC 3HNYM 4JI1O 1ZM1A 4QX3A 2UUAO 5F3CA 3ZR5A 1ENQA 5IJRA 1XREA 4IHJB 1OVSA 2VTFA 1FKAO 4FOWA 4OHYA 4RFT0 3BOWA 2CGNA 4MVMA 5F2WA 4NR1A 4JC1A 3RYHA 4WFBV 4RS5B 4KHPO 3JARA 1EV13 2JE7A 4FPEA 3DGEA 3NKGA 4KUMA 2BJSA 4COVA 3KQRA 2VPVA 1Z7S3 3NAPB 1V55B 2VQAA 2KKWA 2VM9A 2V4VA 3WXPA 1ASJ3 3D5OA 5IWAB 1JBCA 5LL6Y 2WA3A 3VBSC 4P5YA 3VZMA 1DP0A 4M4PA 3J80N 3K9AA 4NIGA 2RE9A 5IFPA 2XJQA 1LECA 2V09A 1RUJ2 3V56A 5BNPB 1ZZ9A 5B1BB 4CZZA 4XW3A 5LEKA 5LP6B 2J42A 2OCHA 1IKPA 2AYHA 1N3OA 2BPA2 1ODMA 4Q20A 4URAA 3G6BA 2D2CB 2ITDC 4A6SA 3CYOA 4XF4A 3W7TA 3ZHVA 3RVZA 3K75B 3APOA 2N04A 1NCRC 2KM2A 2WNVB 3VZKA 4BISA 5J09A 4A6OA 3BOPA 4YY3O 2E6VA 3VKNA 2HEPA 2ADEA 3IC7A 3KCCA 2EILC 1REFA 2RS33 3OY8A 1W8ZA 3POWA 5F6KA 2YGLA 1ZZ6A 3EBRA 2ZKNA 4UFMA 2G9GA 4B4QA 4RWUA 2EJ7A 2F95B 5L9BA 4QM9A 2VOVA 3ZXEA 5KLVH 2CTVA 4HN1A 4LMFA 1UZ0A 3BCCH 1QCEA 4UOJA 2BTOA 2WS92 3MLLA 1PMIA 2A6VA 5A3LA 3ORJA 4R9BA 4OUEA 1LB2A 2P6CA 3LEKA 1RM1B 3VDBA 3PJYA 4R9CA 5FMOL 3J81N 4UFKA 5A80A 1RGSA 3EJKA 1H2MA 4URTA 3FX7A 2Q30A 5L3FA 2WLKA 2JVDA 1PIV3 3I2OA 4O2BA 3AG4C 3FUOA 4I09A 1E1QG 2HBTA 1W6PB 3QOPA 3O5SA 3RYIB 3ZYRA 4CDQA 1J3PA 3TNPB 3JYCA 4UI9L 3C7EA 2P6JA 2Y6JA 3UO2A 4Q2FA 2FDJA 2IH1C 1WCKA 4IEXA 3KZ4C 3W7WA 4TV9A 3NNGA 4LO8A 4C0HA 1QGLA 4P9WA 2OX0A 2QQWA 4MXWA 4D8MA 2X05A 2D98A 3DYOA 2CAVA 4CCNA 1KDKA 3F2ZA 2IBZH 1MZEA 2GH8A 1ULEA 4Z2WA 1DZTA 5KHJA 3CJHB 3A0HZ 4QU2A 4GB32 2X5IA 1W28A 4CPBD 2UXBO 4QPIB 1R1BA 4ZONA 4TLFA 4JI8O 3ZHTA 4GZ9A 4CP1A 4U3JA 4DO2A 1QJY1 2VQEO 2A70A 3RYFB 3UM7A 5LMUO 3ZXKA 4K0KB 3ZRSA 2UUBO 4X64B 2WZR2 5IFTA 4XHXA 4WVMB 4I3GA 1PL0A 5LMNO 2VMDA 2I2SA 2HEVF 1IXMA 5FTTC 3V0BB 1TMF3 4Q4Y3 3ZFGC 3RFRA 4A3XA 2YC4A 4JKMA 3P3NA 1GN6A 2XVKA 1ODNA 3PN1A 3I3QA 4AVBA 5KMGA 1X8EA 4GCZA 3JBG3 5DEDA 1NZIA 4OI2A 4OHVA 2RS11 1XYOA 4TSFG 3WV6A 4XMAA 1Y74A 4B3SB 4GULA 1UN1A 4J41A 1HN0A 4I0AA 4QDRA 4HSLA 5K0UA 3I97A 3WW3A 1RUG3 3JD71 4IESA 4QIWF 3T09A 3GWOA 1WW6A 2J1VA 1PV0A 2VWJA 5IVJA 5FLHA 3VBHA 1YFXA 2VU9A 2NZ9A 1PGSA 3LNNA 5IWAO 1LGCA 3TETA 5KX5A 3AFGA 3IDCB 1LNSA 1ULFA 1SERA 4UV8A 2XQXA 4JDMA 3VZOA 2WWSA 4LHKA 3ZIAG 1H1IA 2JB4A 3AKSA 1K4CC 1C8M3 4DK0A 3VHRA 3HPNA 1U12A 1X4TA 1ZA4A 4RS5A 4YW2A 1FATA 1KXGA 1N8RW 1TUEB 4IT5A 1VP7A 4NAOA 2HWD2 3AL6A 4DR2O 4A4AA 2JRIA 4B3MO 1QJZA 3VGIA 4UFZA 3SH4A 2XNDG 4MTOA 2WN3A 3L73H 2GZWA 5DZEA 5FZIA 3VHNA 2J1AA 2GTSA 2X09A 4TLGA 4N43C 1NYWA 4PLMA 4JGYB 3LD8A 3RS6A 2ZEYA 4M4RA 1IBLB 1RUJ1 5LGNA 1YDXA 2VUAA 1M56C 5EIBD 1KB9F 3OSDA 2W92A 3DCQA 1VMJA 4YZ2A 1SMVA 3RZJA 2NMOA 1W9WA 5BNPA 2R063 1Q6IA 2BSKA 4MVUA 3WDUA 2Q8EA 3VKFC 3T1YB 2JDMA 3AZYA 4WM8B 2QEXV 2VUDA 3MUZ1 1VBB2 3TAYA 2AZ2A 3MI8A 2YIBD 4DINB 2BFUS 5JVDA 3G6JB 4YPJA 4LBLA 2WNVA 1EPZA 3CD6V 4AVTA 5DAPA 3ETQA 3JATB 3LSSA 2PHLA 2P1BA 4FLZA 2BOCC 1OQDA 1EAH1 4WFFA 2RMU1 2GAUA 2JJ2G 2Q9LA 2AHZA 3MIBA 4FP3A 1RPOA 1GN2A 3ZHSA 2IXIA 1ZWIC 4CC6A 1G6UA 1NE6A 3E8HA 4P00B 4EQVA 1OLQA 5F7UA 1MABG 2Y0PA 2O0OA 3ELNA 1OHHG 5FZ9A 3UGFA 4NTYA 4B3RB 4E2LA 2O1QA 1ULPA 2RS53 4ATEA 1RL3A 1YJLA 2B46X 4BLIA 2GMEA 1C1FA 5CFDA 1E5HA 3T4HB 5E89A 1CPNA 1CAVB 4LITA 1FT9A 1US2A 2W1WA 4Q1PA 1ZL8B 3ZN4A 4LA3A 3K48A 4TYSA 5A6QA 1S5LZ 1PM7A 4FPOB 4DR1B 1W6QA 3G4SV 3GZAA 1X7NA 5JMCA 3FAVA 3H8OA 5JXIA 1SLIA 3VL8A 3FWEA 4LH7A 1KDMA 1LOFA 4QKBA 1VBE3 1K9MW 3WG7C 4I02A 4NAMA 3OG2A 4QHOA 5FPXA 1RUC2 2A73B 1BS3A 4AI8A 4I4TA 3H9AA 4V1PA 5DG1A 3AP7A 1TME2 1CZSA 2EIEA 5J37A 1MZ5A 1UYYA 1IVSA 1R082 4GKYA 5CKQA 2W87A 4DOUA 1A78A 2ZGQA 5BPXA 5HV0A 1O3RA 1E79G 4QX8A 2VBPA 3R65A 2VULA 2P5OA 2WFF1 1VRH2 4XABA 4FFKA 4BW9A 4FT8A 2IVJA 3RZHA 1AF9A 1S5HC 1I94B 4CEYA 5FNVB 1V6NA 1UZYA 1D0HA 2BOJA 5D5QA 3OBAA 2WZPP 3CJHA 1OD3A 3B94A 5FUIA 4LXLA 3VZJA 3KVBA 3MPPG 2MW2B 1UL9A 2RR12 2YXSA 2UYAA 1VB4A 4QPIA 4U3FH 1COWG 2EINC 4XC9A 1RUH3 1AYN3 4OI1A 4NXNB 3WDTA 1WNSA 2C24A 1FX5A 5EYPA 5FYSA 4JV5B 3T1LA 2QKCA 2YXHA 3EMRA 4AFMA 3RYFA 2ZMNA 4XQWA 4B3SO 1XNRO 4Q29A 1UOBA 1N47A 2WZR1 4W8JA 1CESA 3AL5A 2XKPA 2QM8A 1AVBA 4XBNA 5J36A 1UY4A 2E3CA 1BLZA 1F5FA 3KV9A 2Y69B 3AG2C 3VKOA 2BOIA 1JUIA 4BQWA 2ID4A 3SYOA 4CCJA 5HBAA 3EO6A 4DS0A 3V0BA 4XDJA 5JZGC 4JI6B 4AVAA 1OZ0A 2UXDB 4PCRA 1UYXA 3RZMA 2N05A 2ZHLA 3MV01 1IG0A 4EWAA 2Y8KA 3LZZA 2BE3A 4HNAB 2ZKOA 2Y26A 2XAFA 4DEVA 3ETGA 2P6HA 1MPXA 2A71A 2FTKA 3GNEA 1SQVH 2VW2A 3POFA 4RHV1 3FB7C 4FSJA 3ILNA 2WNOA 4CUBA 3IPVB 3LA2A 1BSMA 3AZXA 1Z5WA 2JEXA 1VBA3 1EZVH 3NJXA 4YNIA 3X2QC 2YBSA 3MICA 3JD0A 1ZNPA 3DTUB 1JHNA 5CG8A 1QMJA 4Y5SA 1Q8PA 2BTQB 3WNPA 2AZ0A 2GSYA 5FLJA 1RINA 4XDOA 2ZPXA 2DQ3A 3HKCB 2Y6FA 3B09A 1U0AA 3RZKA 2Y4UA 2W1QA 1W0JG 5BNOA 3J4UH 1RMU2 3LUTB 4LF7O 3D4KA 4J7ZA 2XJPA 2YPDA 3CCEV 1XEQA 5LY2A 1WLTA 2ZEWA 3MEPA 1X82A 1JN2P 2ZKLA 3MUY1 5KUKA 2BP6A 1WA8B 4DZGA 4PDVA 3MAQA 2W1UA 1OH3A 3MO4A 4V2WA 5FZMA 1GM8A 4ASUG 1SZXA 1REEA 4ONUA 1CX1A 3B9IA 5EYXA 2FYUH 2P06A 4R52A 3KV4A 1MS1A 4JGYA 3E97A 4M3CE 3M99B 2X53S 4X8NA 3J8F3 1US6A 2JDYA 2OVUA 2YUEA 2YXYA 3U11A 1YRZA 1O3TA 2WLLA 5FZLA 1QHDA 4H33A 3JAWB 4K9SA 3EVKA 1H2GA 5B1AB 4EJRA 1BEV3 2IC1A 5BMVB 3LDDA 1LEMA 3PMSA 4AVSA 2JG8C 2X8KA 4H44B 2VC9A 4NN0A 2R30A 3LF7A 4GKXA 2R042 1H9WA 2CTWA 3OMAB 5G04L 1RUF2 1PNKA 2HEYF 1YXWA 4FTSA 3AB0A 4B3RO 4A42A 1H4HA 4IDZA 4CYDA 1VBC3 4OXSA 5FXXA 5B3SB 1MQTA 2VCBA 4XEZA 4AI1A 3JATA 1AR82 2JX9A 1L0LH 3RWRD 1HRI1 1I7FA 2CGOA 3VBUB 4TUYB 4AI2A 1VQNV 3O1PA 2AR6A 1JYWA 3NJZA 5AC92 2Z5WA 2UUCB 4NIIA 2GNMA 1W0NA 4DR1O 1OCCC 1ULDA 1NTKH 1S4CA 1Q8QA 5FPVA 3ETPA 3GXUA 2XLAA 1XMQO 2D5HA 3AG1B 1D0GA 1S76D 4RA0A 3U4XA 4XFFA 5E1AC 5D2AA 1O5UA 3CIHA 1KFXL 4FZ1A 5JI7A 3ACFA 3ITQA 1GFF2 1NI8A 3LPFA 2Z0AA 2YI9A 4ZI7A 4LLOA 1CAVA 1UYZA 1RUE2 1GMMA 2EXJA 1WN7A 4CP9B 4MUVA 3WY6A 4YJ2B 1WMEA 1I1EA 4Q4W2 1MVQA 1ZX3A 4LNUA 4DXTA 5DUVA 1FYJA 3RQ0A 2JDNA 3V65A 3SCHA 1K4DC 2GNBA 4WBNA 3AVRA 4HBNA 4QNHB 3TEWA 2JK5C 5JIUA 5A3TA 4AFDA 2VJXA 2WYSA 5FY5A 1R081 2YU2A 4NXNO 5FYUA 1IS5A 5GLTA 2JDIG 3C8XA 4GMP0 4YG3A 4XTMA 3A4UA 3UK9A 2FB5A 3N9LA 1QXJA 1VRH1 3NJVA 4JI2O 4J9YB 4X1YB 1U5ZA 3QH7A 5E8AA 4QB2A 4DXWA 1F2NA 4LR4A 1AR62 3AYAA 3AMNA 2CL2A 3ZN6A 5FY0A 5C9AB 3VBRC 4H55A 5A3OA 4I55B 1GRJA 4CCOA 3B9CA 5FQ0B 1PVC2 3OTOB
chains in the Genus database with same CATH topology
1CX4A 1PK6C 3BALA 3PVOA 5CFCC 5J7MA 1XE8A 4AYUA 3JBG2 5I0TA 1ZRRA 1ND2A 3KM5A 4QMAA 4AEJA 4B3NA 5CFCA 5I93A 1TQ5A 1QH6A 1AR91 1HKDA 2P37A 3TN92 3KS7A 3OF1A 3T2TA 3IDBB 3ZX7A 1ZRCA 4HKOA 1OFSA 5HSXA 2QZ3A 1SACA 3S0MA 4WM7A 4TZDA 4S2FA 5TSWA 1AR93 4GWMA 2RS12 1SFNA 5GZCA 4E27A 2ZMLA 4Y26A 5GZFA 1BQPA 4YG6A 1M4WA 4P9LA 2GALA 2K0GA 3TNQA 1AX2A 3VL9A 2WS91 5LRSA 2JG9C 1IOAA 2QDRA 3JD72 2V73A 1PNFA 1IS3A 2WSUA 4FPLA 5IK4A 1FPN2 4UBGA 3ZPYA 4PIXA 3OGJA 4CRQA 2WS93 3UV9A 4AFCA 3IIAA 2D6PA 1HV1A 1HQLA 3FHIB 3SCGA 3AZWA 2ZGOA 2D7FA 2JECA 2D3PA 1MEC1 2VH9A 1C5IA 3NVCA 4EN6B 3ES1A 5H9SA 4BGMA 3FFQA 2WKKA 2A6YA 1C8M2 4U36A 1H8VA 5AVAA 1G6NA 5GZGA 2D44A 1NLSA 2XUMA 3BTAA 2RM23 1DQ1A 4AF9A 1MEC3 4OULA 1UF2C 3H7YA 3CF6E 2TBVA 1GSLA 2EALA 1K5MC 1DGWA 2A6ZA 1H4GA 1D2QA 4UW4A 3CNAA 4Z82A 1ZRFA 1MS9A 2VXRA 4MGKE 1K5MA 1R1ZA 4F3JA 3ENRA 1H30A 1GANA 3BCWA 5GJ6A 3ZFFB 2DURA 2PHUA 2ZGLA 5I8TA 4AI0A 2DWRA 4Z1VA 2Q1MA 3HWJA 4M0NA 4GH4B 4UBHA 3O0WA 4QX5A 2Q4AA 3VBFB 4EN0A 2PHTA 4MX3A 1YWKA 4X6RB 1YUDA 1CIWA 2PYTA 4YVWB 1AXYA 3MS5A 1CAUA 3MW3A 5EZWA 2VOKA 2CYFA 3FFZA 4XMIA 1U5XA 1YFWA 1LEDA 4LTAA 5CBLA 1C4RA 1U5IA 3VKMA 2P3JA 4I2OA 1UU6A 1S0CA 3KD4A 4XJ9A 4D7YA 4ORFA 3W9AA 3WP5A 4CDWC 2BUKA 1OLRA 2R062 2XLFA 3MW4A 1RMU1 1S0EA 3SISA 2PLV1 2HWC2 2Z42A 1NQJA 3AP5A 2CNAA 2YPJA 2PAMA 4GB31 4LNVA 4JTOA 3RSJA 5JCTA 1W6NB 2PHRA 3OD4A 4JDOA 1KFUL 3ZN6B 2BNMA 1B35C 4LO6B 3AYDA 1CR7A 5C33A 2PLV3 4YW4A 4NWVA 4XILA 2ZX4A 1OIJB 3VBRB 4GB33 2ZCWA 4KL1A 1YFUA 4B4RA 4AFAA 1S0IA 1HQWA 3NO8A 1UU5A 1ND2B 4ASLA 4I30A 1PK6B 4BMBA 2XVLA 5CFCB 3CLPA 4NOTA 1WGPA 1GNHA 1A8DA 3VHPA 5DZGA 5I91A 2XH6A 4FQZA 3RMXA 1OOPC 2PELA 3FJSA 4JQRA 1MS5A 4J1XA 2ARBA 1H1MA 1OOPA 2IXHA 2P34A 3N6WA 4E4SA 5CU1A 5JDBA 3VDDC 4DXZA 2GC1A 4IEZA 5HCFA 1PGW1 3MLJA 5L73A 3D0SA 4XJAA 3INAA 1AHSA 1JW6A 4FPHA 4KWKA 5J96B 2OUJA 3ZXLA 3PHMA 5GLWA 4IV1C 3U0ZA 3LKJA 1POV1 3OJBA 2D3SA 1EAH2 3N7LA 4C0BA 4BCUA 4S2DA 2RMU2 4IV1A 2HWF1 2WZR3 2YC0A 4HSJA 1PZ7A 2JG9B 3MFCA 4MGIE 1QJX1 3TOJA 1GNZA 5F5QA 1RUF1 1VR3A 3AJZA 1RHI2 4M00A 3ALQA 1ULCA 3RYKA 1KJRA 3KCXA 3RI8A 2HWF3 5JZGA 5KHGA 3HAGA 4LBQA 1RUI2 4HN0A 4WV8A 2X29A 5JWPA 3H8UA 1AJOA 1HRV1 1QJX3 1DGLA 4LEJA 3ZXJA 1QOTA 4YLZA 1O4YA 2ZMKA 1ZRDA 2XJTA 2PAEA 1AR81 1J1LA 3ATGA 4HL0A 3RJ2X 1URXA 5ACA1 2BNOA 1GQGA 2R49A 4L11A 3S7EA 4C1WA 1HRV3 3CU7A