2XUMA

Factor inhibiting hif (fih) q239h mutant in complex with zn(ii), nog and asp-substrate peptide (20-mer)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRHSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 106
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2xumA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xumA01
1H2KA 2WA3A 3D8CA 4QU2A 1MZEA 1H2NA 1IZ3A 5JWPA 2YDEA 4NR1A 3KCYA 2Y0IA 4AI8A 4Z1VA 1MZFA 3KCXA 4BIOA 1H2MA 2CGOA 2CGNA 3P3PA 4Z2WA 1YCIA 4B7EA 2W0XA 2YC0A 4JAAA 2XUMA 3OD4A 2WA4A 1H2LA 4B7KA 3P3NA 2ILMA
chains in the Genus database with same CATH superfamily
1KD7A 1ND2B 1V0AA 3ORJA 2YU1A 5LRSA 3URFA 4PJYA 2VG9A 4W4ZA 2Y64A 4LNUB 2VW2A 1U5XA 5JZGC 4Q4X3 4ZHNA 5DUVA 2FMYA 3CCUV 2P5BA 2EZOA 4GT1A 3R65A 4QU1A 1I5YA 1RUG1 2IFRA 1NTZH 1JBCA 3THCA 5FZFA 3AFKA 4YGDA 3OW2U 2ADEA 1A78A 1C8M1 4XFIA 5KXBA 2BVBA 3VBFB 2Y0PA 3DC5A 1W8FA 1JFFB 1OSGA 5A3MA 1HNXO 3PVOA 1PX3A 3ZMVA 3ABKB 3K04A 4E2GA 4DV2O 3SYOA 4IEYA 3E5XA 1POV1 4O9GA 4BQ3A 4R9CA 1MQTB 4X8PA 4YM1A 2WLKA 1B06A 4XXPA 3C3TA 2DBNA 5DDJ2 4PA9A 3EMRA 5BNNC 4X1KA 2YC2A 3KVAA 4UWDA 2QVSB 2SBAA 2G9ZA 1VQ7V 4K35A 4ZS2A 1ALYA 4XUQA 3UESA 4LOSA 1E79G 1ENSA 4LK7A 1Z7S3 4TTGA 4GQ7A 2Y34A 2VXRA 4JGZB 2EJRA 3ZX7A 3WF4A 1MS0A 2OKXA 2HBTA 3RWNA 5LK5A 1XNKA 1WBFA 3SHRA 4IEUA 4ZU4A 2Z79A 5GLZA 2WBKA 3WG1A 2W6JG 1XSRA 4X66B 2QQPA 5DG1A 3BABA 4Q0UA 4UFKA 5ACA1 4WM7B 1O3RA 1EFRG 4A5UB 3X29B 4PIZA 4FVVA 4JC1A 3WG2A 2ZKOA 1WD3A 3PUHA 4BQWA 1W2UA 1KRIA 2FZ1A 5H9RA 1UU6A 3KT4A 3T1YB 3VDAA 2GZWA 4DUZB 1ZNPA 2DVBA 4WBBA 5GZGA 2BU9A 2YYOA 2JRIA 5B3SB 3CMGA 4TSFG 1PGW1 4LFBB 5FUNA 3GWKC 1U97A 3WB1A 1DTOA 5C7GA 1ZYBA 3SH3A 3CS5A 3AL5A 4JGSA 1LOAA 4JI3B 4DR6O 3M1HA 5LEJA 3AKTA 5BY5A 1AI6A 3O7OA 3K5NA 5C3RA 4NAOA 5BMVB 5KXEA 4P9PA 3OPZA 2IJJA 5JZGB 4AR2A 4KG8A 4YW7A 2BTOA 1URXA 1AP6A 4H33A 1LNQA 3VL9A 1AYN1 2P3JA 1VQ8V 4M0NA 3ZMUA 3CC7V 4BU2A 4OI1A 3M3CA 1W04A 4COVA 4Z8BA 1LHUA 1COV3 5ERLA 1OH3A 1NH2D 1PK6C 3FX3A 1NX9A 4Y3OA 5EQUA 2WNUA 1EN5A 1RUJ3 2P2KA 1ZM1A 1GQGA 1G8MA 3KCXA 2W87A 2OX0A 1GQPA 5F2SA 3T4DA 5EPAA 1Y4MA 2XNDG 4XDKA 4PIYA 1FXKA 4LUKA 2PHRA 1AR1B 4CCNA 1TUBB 2AHYA 2A3YA 2BOJA 4Q4Y2 3SJCC 1RUD3 4OULA 4UCOA 5BNNB 3R6SA 1SQBH 4AG4A 2P34A 5GZCA 2WFF3 4O4IB 3FLPA 1YEWA 2Y0OA 1HWYA 2A1XA 3ZPOA 4X88A 4FXKB 3VKOA 1SQPH 2VUDA 2Y69B 3Q8FA 3AYAA 2AZ2A 3L2YA 4OUEA 3RRDA 3JD71 4UYBA 3SYPA 3LQCA 4C1XA 1CIWA 5A3NA 4AILC 5LA6A 3DKWA 5J98B 5TISZ 1UU4A 4P9YA 4QKBA 4XQ4A 2LQTA 1KITA 2PQQA 3QOPA 1RUE2 1Y43B 2JIZG 5LOVA 1V9U3 4HOOA 4FM0A 2BNMA 1HB2A 4IXLA 3NXSA 3AMMA 4WFBV 2E76B 1XNAA 4CSWA 5J1XA 1XQNA 2CTWA 3GZUC 5F39A 5KMGA 2JVDA 1R1ZA 5LASA 2ET7A 1M57C 5A6QA 4Q4W3 1H2SB 2QWOB 4K40A 1IPSA 1QJY2 3ZXEA 1SQGA 4LO6B 2DE0X 1W8NA 3MPPG 3APBA 4UW6A 4FO9A 5FJHA 3W58A 3H3ZA 3NO8A 2PAKA 5LXTB 3K4ZA 4UXNA 3DXUA 5IYBO 2JEUA 3H7YA 3J7NA 2ERFA 4P02B 4O4LB 1AXZA 1UD1A 4QT6A 4N21A 4D3WA 3P6BA 1SLBA 1NTKH 1OC1A 2VZUA 4KWJA 4LMFA 4NHKA 5TSWA 5FJKA 3AVRA 4QM9A 5L3BA 1B35A 2VQUA 4IGQA 2WN3A 5IVCA 1QXJA 2BZDA 3H3UA 4W6XA 4GMP0 4DV1B 2VZ1A 2J1VA 4MUVA 1MZEA 1PNLA 3GZEA 4UCUA 1VP6A 4DK1A 4WM8A 5FXXA 5C4WA 1VARA 3CJHB 5FP7A 1E5SA 1NBMG 2HFEC 2ZX4A 1M4UA 4MXWB 1PNFA 3U11A 1NUKA 5FZDA 3OB8A 4DR4O 3ZFGB 5IJ0B 5LP6C 2G1MA 4LHLA 4QXHA 4DR3B 3CRRA 2E3CA 2QWNB 1CQ9A 4ZPIA 3LNMB 1YQ2A 1KU9A 2EICA 4XJ9A 5H9SA 3DTUB 2WLNA 4LC1A 3OF1A 5HI0A 5L3CA 3WP6A 3ILNA 1Y66A 3GVMA 2LP7A 3HPLC 1QLEC 1VF6A 2YUEA 3WDWA 2P22C 4HZFA 2P3IA 4KNCA 1NJIW 4AI1A 5EZYA 1MSWD 2RS53 2ZMNA 5C71A 3FL7A 5FXVA 4YG3A 4H0LB 4Y5Z0 3C7FA 2XBO3 5KHKA 3ZYIB 1WAZA 1WLCA 2GV9A 2GH2A 1SKVA 1UZWA 3LIGA 1J5EO 5J09A 3LD8A 3GYDA 4IYIA 1LOCA 1LKNA 1OBNA 1OKOA 3PJYA 3S7EA 4DO2A 3TJTA 4YJ2B 1EV13 4IV1C 3TNQA 1H2GA 1ULEA 4LHKA 3VB9A 5CFCC 1SZBA 3AG3C 1J95A 3DYMA 4F6EA 2R0HA 3B77A 2VZTA 4R50A 4GYCB 4JTOA 1QLNA 3WV6A 4F6RB 3ZXGA 4A41A 3ES1A 3W7WA 2ZGNA 1ST8A 1PO13 2QM8A 5BUVA 1GZWA 3D82A 2WDBA 1AR72 1GK9A 2BBAA 4EROA 3K3OA 3SC7X 3ETGA 4OI0A 3RGBA 2X09A 3FB6C 5CB4B 1LHVA 4IIJA 4DUYB 2IC1A 3PUIA 3LUTB 3CXHF 4J42A 2C5DA 1FV2A 2C9KA 3C7HA 3CJIB 1RPOA 2FDGA 4U7OA 4FVMA 2VZRA 5DUUA 1QH7A 2YIBA 4DR2O 2NLJC 2B9ZA 1TA8A 2MEV2 1QOTA 2A79B 1N3OA 4OCTA 1I94O 5LHGA 1LR1A 5FLIA 2ES3A 2Y48A 3JASB 2ZINA 1PGL1 2VUAA 1RMU2 5J2TA 4DV7O 1AXKA 1VEWA 1MZFA 3MICA 1LRHA 1ZAUA 1URFA 3CCJV 3VV1A 2BOCC 3MHSC 5BXXA 4INDA 1WB8A 4K8FA 4XURA 4R4ZA 5H6QA 1DHKB 2JG8C 2ATFA 5FBZA 3F95A 3FHAA 5K9YA 3FUQA 1QLEB 2DQ0A 4A4AA 4CTEA 5H9CA 3PUSA 1N47A 5LBQA 1OFSA 2E32A 2HWC1 2W3JA 5FZ9A 2A73B 4B7KA 1NZCA 1QNMA 3L75H 5IWFA 5FO7B 3HR0A 4WVVA 4TV8B 3UETA 1WLDA 4Q26A 3RZHA 5I8TA 2IXLA 5FLXN 2YI9A 4AQYB 1W6OB 4RHV1 3EO6A 3N9LA 3QF7A 1YCIA 2RS31 3RYCA 3N9NA 2ZDIC 4IV1B 1X8MA 1FFTB 2KB1A 1AX2A 1PIV3 4EE2A 2FDHA 2VAUA 3ZMOA 1O7FA 4WZCA 2WS93 1FMD3 2OWOA 5FZGA 5LBFA 2JDUA 3RJRA 4XZUG 3VBOC 4YPJA 1N33B 1EZVH 4OHYA 3OPWA 1AR93 1TVKB 1OCZB 1ZL8B 1D4M3 4XILA 2Y8KA 3L73H 3NJXA 4RR3A 4B4RA 4GB32 1QDCA 1ENVA 2ADPA 2QQOA 4BB3A 1M4WA 5APAA 3ABMC 5HXMA 2QUOA 2BJSA 2BWAA 3HKBA 3FLRA 3H1MA 4LBLA 1F2NA 2EXHA 3OM3B 1Q8SA 5IE9A 3VBSC 3OUSA 5LYJB 2N05A 1QJZA 2YV8A 4COUA 1WP8A 2YBKA 3N35A 1S0IA 2EIMC 4MVRA 4X6QB 4OPAA 4S2HA 5H9QA 1MEC3 1V9PA 1LOFC 4QE9A 2D6NA 1WA8A 3IFXA 4MHUA 2GDFA 4I4TB 4JKKA 1BQ0A 4O2BB 3KLSA 5H9PA 1MS3A 3BTXA 4QXBA 4AQSA 5K4LA 1E1RG 1HV0A 1POV3 5DAXA 4FCAA 4MLOA 4RQPC 4N8MA 2UYBA 2FHRA 2ZHNA 1ENRA 1QH6A 2WZPP 2BV4A 3GHMA 3CJXA 3OY8B 1VIWB 2K46A 1CESA 3ZFFC 1R3KC 3CRCA 4MOAA 3OYWA 5KA6A 2JG8B 2WQ4A 3DL3A 2O14A 2JG9B 2ARXA 3T2TA 5FAXA 1W0NA 4HT1T 4I0BA 2BOBC 4LWSA 2P4KA 3W7UA 2PFWA 4EWDA 3STZC 4FZ1A 1N33O 5FPZA 4IETA 2YIBD 4PDMA 1RINA 3AK2A 4Q4V1 3ZRSA 1EAH1 2VS0A 1H0BA 5A7WB 4BMBA 3BIWE 3AP6A 1DGWX 3ZXKA 4YM2A 2Q4SA 3VDDA 3OEBA 2IJKA 4NRMA 5IJRA 5ACA3 5T55A 3OTOB 5C3PA 1S72V 4LH7A 4XTMA 1JU3A 5KXDA 1PM4A 3UO2A 3PNAA 2VZSA 4FOVA 2ZMKA 2CTQA 2CDPA 1N1VA 4QQHA 3J7HA 3VOUA 4BQYA 1S0VA 1N32O 1O3TA 3RN4A 3BALA 2GH8A 2OVUA 3AB0A 4XHXA 4CU8A 3P3NA 4E4EA 4XUNA 5GONB 2QQJA 3TNPB 1EN4A 3FHIB 2PMWB 1L0NH 3WUCA 1KBHA 4BAYA 1R092 4YVWB 5LATA 3K4DA 4YARA 3D0SA 5FO8B 3ICXA 1UCXA 2HJDA 3PDQA 3ABMB 4FBFA 5ANNA 1V55B 4W4KA 1N3QA 3POSA 1EPZA 4EB6B 2JK5C 4CP9B 2XMLA 2TEPA 2A7AA 1AYN3 3VBSB 1MMMA 4F3JA 3LAGA 3OUJA 3IAPA 4UV8A 3BRCA 3LFIA 3NAPA 3T2OA 4CDWA 2NZ9A 2EIMB 2Q6AA 1NU1H 2RJZA 2UUCB 4G3YC 1YI7A 3MI8A 3BPSA 1Q8VA 4P14A 2HH9A 2PAMA 3DCQA 1ORQC 2XKOA 3KQRA 4NOTA 2G4IA 2AGSA 2UUBO 1W2BU 2RJ2A 3S6PA 4I0XA 1UY1A 3ABUA 3KSCA 1YTFB 2IW5A 1Y6XA 3MFCA 4DXZA 4F83A 2WLIB 1JI6A 1QGLA 5DAWA 4FIPC 4AE2A 4RQPB 3DXTA 2G19A 4QPIA 5C8WA 5IHRA 4N7IA 4ARYA 1Q8PA 2RCVA 3NW4A 1TGOA 5FK8A 1F23A 4AEMA 5DDJ1 4CP0A 2P1BA 2VNVA 2UWAA 4CUAA 4DR7O 2YPDA 2FDKA 1UY3A 1R3IC 3ZFFB 4RO2A 3U4XA 4GUNA 1I7FA 4DOUA 3CKHA 1UMHA 3ZSJA 3ZN6B 2H6BA 2NPIA 4PA4A 3CB2A 2Q0AA 2QQVA 4QGMA 2GNBA 4LF8B 2ID4A 2WA3A 2VQEO 1FFXA 4KBZA 3JALB 3JD73 2E5LB 4OI4A 1GKFA 4B3RB 3B69A 1VQMV 2G9GA 3E5QA 5B66Z 1D0GA 5FY0A 3MF6A 1HRI3 5I0RA 2E6VA 4UCVA 3CLPA 4HK9A 5FYHA 1GWMA 1CAVA 2Q73A 2ZGUA 2ARHA 1S55A 2ZTNA 2ZHKA 1SESA 3H1WA 3LWCA 3SXWA 3OBRA 2D3PA 4CEWA 2WLLA 4N43A 5IJ9B 4DW0A 3I8TA 1NZIA 3W21A 2JDYA 3HMYA 3I3EA 4TUYB 1DGRA 2JDZA 3SJAC 2ZKNA 1GYKA 4A6SA 3MFAA 4LIUA 4E8DA 3CCRV 4LFCO 5EBWC 1W0KG 3FX7A 3KF3A 5IVYA 3SKVA 1GP5A 3LOBA 2HWE2 4LLFA 2UXCB 4CUGA 5FZOA 1DYKA 3ME2A 4XHBA 2ARCA 4Y33A 2DWRA 2XHKA 2LFRA 4N90A 5FKBA 3Q8CA 4QPWA 3RS6A 2QQKA 4D7TA 2ZE8A 1ROPA 1LEDA 3OBAA 3LDRA 2E7QA 4LR4A 3NV3A 2K2SA 2R062 4XBFA 2QR4A 1B09A 1XHZA 4X1IB 3WW4A 4Z2WA 2QQWA 4Q4Y1 2YGLA 4MHRA 3UL2A 3WHUA 2HWF2 5IVBA 2V7QG 4X62B 4HONA 2X5IC 4NO4A 5DZGA 4LH6A 5FYVA 4AGGA 1GV9A 3Q9OA 1K97A 2O57A 4IEZA 2UUAO 1RUH3 4FPGA 3J8F2 3SH4A 2D6LX 4O65A 2Y6JA 1CPMA 3MW3A 3JXSA 2WLQA 1Q43A 2A3WA 4URTA 3OGCC 3HKCB 1XJAA 1K4DC 2D40A 2PHDA 4X9QA 5IWAO 4R6ZA 4DW1A 4WF9V 3DECA 1QNWA 2JS5A 4IGOA 4I0WB 2ZCWA 5E16A 1O91A 1XREA 1IBMB 2IBZH 1RUE1 4WVMA 1TMF2 2F4PA 5DZEA 4TT3G 3ZLIA 1XC6A 4FAGA 2GU9A 5C9AC 3C3VA 2XLAA 5DAVA 3SYCA 2R042 1M56C 3VBRA 3UYJA 2FL4A 4Q8KA 3UQ8A 1QU7A 1QHTA 3PU8A 2BP6A 3UKTA 3PJQA 2GMMA 2UWBA 1QJY1 2JB8A 2Z5UA 1Q82W 4X8AA 1O4YA 2XJPA 1QVFU 2OIGA 1U0AA 4BZ4A 5LEKA 1JYIA 1G6UA 3K59A 1IBKO 3WW3A 4XETA 3OSDA 3ZXAC 4FP3A 2VOWA 4E2SA 4KHPO 4DR5B 1UO9A 2CGPA 1ZBA3 4QX3A 5EK0A 3GGLA 1VAKA 5FPUA 1CJDA 1GOGA 1AZDA 3HWJA 5HV0A 2DYSC 4CH5A 4LHSA 4ASKA 4AI9A 2GP3A 1OF3A 1GQHA 4BISA 1V6IA 2RDNA 1HXS2 3JCIA 3D3AA 3D36C 3APQA 3VBBA 2NYYA 2VZPA 4YVSC 3I2FA 4RS5A 5ISLA 4HVRA 4LORA 5C5TA 1UX7A 5A32B 3FC0A 5FUIA 2BUKA 3RG0A 5DPNA 3GJAA 4N53B 5B4NA 2JGDA 2RS12 3I56V 4E4HA 4NWWA 3ILRA 1G9AA 4AFMA 3G4SV 1M93A 2VOKA 3ZHVA 2ZABA 1REEA 4C7UA 1CX4A 1FXZA 3OT7A 3MYXA 4K3AA 2BRTA 1NQDA 1JYTA 2BE3A 4H2AA 3ZRXA 4JTNA 2X5IB 1JS9A 1W6PA 2DU0A 4LE4A 1EUUA 1K92A 1QHDA 3CMAV 3RYHB 3I55V 1W05A 5FK7A 2W9XA 5GKAC 2HWC3 1MVQA 4CEYC 1KFUL 5CA0B 1XYOA 1NY72 2RVAA 3IC9A 1QXRA 1AI4A 2VZOA 4MZUA 2GHYA 3LEIA 3OGVA 2B7YA 1R1A2 4DRRA 1G9CA 2C2AA 4Y1UA 4LXLA 2QEXV 1P7BA 1SEFA 2RDQA 2YDEA 4BDVB 5C9AB 2RS33 2ZEXA 4RSUA 4JQRA 3K06A 3LDDA 4N23A 4PDRA 2RNBA 2ZEZA 2Y6LA 1T6BX 1QBZA 2OT5A 5T52A 4NRQA 4YJ3B 5CZKA 5J2UA 1SHWB 3S7IA 3MZHA 1NYWA 4NIIA 2VQAA 2Q7HA 1SLAA 4CH4A 3RYIB 5FPRA 1AR71 1VP7A 2RM23 4MTGA 3JARA 1J3PA 4YNIA 5FZHA 3W20A 1PNKA 4D6TH 2YFZA 2WL1A 2CTVA 1ZTEA 1UKRA 4CU7A 3ABZA 1TME2 1LHOA 1MZ5A 1ULPA 2EF6A 1ULFA 1OCRB 4IGGA 2ZE5A 1EZJA 2PQSA 4YZ2A 2GALA 4PLMA 3NNLA 4C91A 4QIWF 1AVBA 2BCCH 4NXMB 4FQZA 5BNQA 1KDMA 2VL4A 4P5YA 3H8XA 2HEVF 2XGXA 1HQNA 2E9QA 1J59A 1D2SA 2MEV1 4MSVA 4BW9A 3H3LA 3B3QE 1O4ZA 3QNEA 5KX5A 1FNZA 3QO7A 1RMU1 2IXHA 1PVC3 4G9SB 3BTAA 4XF9A 3K46A 4TQFA 4EEQA 2EJ7A 1SFYA 4L99A 3QO8A 1W03A 2GC1A 3VKFC 5FPOA 2ODMA 5C8CC 3VL8A 1U12A 4KQ7A 5JH7B 3HKEA 3ZHSA 4YY3B 4M0HA 4FPKA 3T1LA 3IMNA 1H2MA 4HFSA 3M7AA 3JBG2 3DN7A 5T5LA 1IG3A 2PLV2 4RQFA 2G38A 5JJJB 4MTOA 3AC0A 4I2OA 5B1BC 3UO3A 2VZQA 1O4TA 3AZWA 5KBFA 5A1AA 3N9MA 2WLJA 3ZIWA 2D5HA 2QA4V 1EAH3 4LTAA 1DLLA 3IDAA 2R9RB 3DSQA 1R3JC 2JIJA 2E31A 5CBGA 5EYPA 3RMXA 1H8TB 4YW4A 5D5QA 3OUHA 4A44A 3B09A 4X1YB 1UPIA 3HNMA 4LF9B 4CC5A 1F4NA 2PZSA 2OIEA 4NXMO 5FMCA 5FY1A 3OEEG 4YW2A 4JI4O 2WZR3 1GUIA 3SYQA 3ZHTA 5J7MA 1JYWA 3MV11 4GB31 3OMNB 5ABJA 2OT7A 2JX9A 4UFJA 3SCHA 1CPNA 3A2FA 1GWLA 1JHNA 2FQPA 1F7YA 3I3MA 3KB5A 3H01A 5BNOC 4CS3A 2A0LA 2ZR2A 2L6LA 1PV0A 2VPVA 3SQOA 5FPAA 3Q8AA 2YMZA 5JI9A 3DPRC 2GUZB 1ND2A 1GZ9A 3MIEA 3TETA 1SERA 4CDXB 2YG0A 3LOIA 4LNUA 3CO2A 1DGLA 3B02A 2VC9A 4BQXA 3I2HA 1Z5VA 2Z2SB 5EWSA 3KV4A 5JXIA 1YITV 5AVPA 2JDNA 2AZ5A 3SR2C 3ZSEA 1WMEA 2EIEA 3CRQA 1CX1A 1AX0A 5HXVA 4FM2A 2JE7A 3LPFA 3VBFA 4R9DA 5LBBA 3C7OA 1HDJA 4Z92B 5DDJ3 3OGIB 1JFFA 1FATA 1UAIA 3B93A 3LSQA 3S0MA 2C9AA 4OGQB 1AYM2 2UXBO 5L3GA 4DY3A 4B3NA 3PLQA 1EBOA 3WG7C 1HB1A 3O1TA 2XH6A 3HEIA 1PZ8A 4ZKIA 3AKPA 5FMOL 4C1WA 3A0HZ 1N34O 5SV8A 1SQFA 5F7UA 4JI7O 4DV6B 1UQXA 2HEYF 3POWA 1VRH2 4B29A 1BHBA 2WN2A 5B1BB 1UIJA 3IPVB 2DDUA 3JD0A 4U36A 1X4TA 1Y9QA 2V09A 1N36O 4FPYA 3AKQA 4KH9A 1OUXA 4GH4C 4AK3A 3RBZA 3U4SA 1JVMA 4QX2A 1DBNA 1VF5B 3R4SA 1E5RA 4JGZA 4LFAO 4GKJB 1LOEA 3WZ1A 2YZ4A 1X8EA 2XPJA 1AX1A 2W39A 4Q5OA 4TLFA 4O2AA 5CEHA 4EN6B 3CEIA 1YNAA 2D44A 4ET7A 1R091 4PQ9A 2DCZA 4QPGC 2HHHB 4CU9A 1ZREA 3RPQA 3ZDSA 1H2KA 5LGNA 3AG4C 1UPSA 1N4CA 5FOBB 1GTOA 2Z5WA 2CE4A 4MX3A 5LBCA 4HL0A 3IAYA 1X9PA 5BPXA 4BHPA 3UT5A 2PYLA 5KHGA 3NR7A 1BVP1 2R072 1ND3C 3WCRA 4LUMA 4Y1XA 3DPRB 2P6JA 3ITQA 2RR12 1MNGA 4A6OA 1RUNA 4J1WA 1XNTA 3J9SA 4NKGB 3F2ZA 4H13B 1STMA 4OZXA 4TV9B 2BNNA 1DQ1A 4E9KA 5JZGA 5FMBA 2A9HA 5IYCO 5D1IA 4JI0B 1OMIA 1OI6A 1AROP 1IQDC 4CP2A 4I7ZB 2TUNA 1S2BA 1EPWA 4P2ZA 2Q8DA 4NIAA 3B01A 4LPLA 2JJ2G 2WYSA 3T09A 2EZPA 4OYUA 4AGVA 4B3TO 3CCEV 3BA9A 4J7KA 1OLMA 2KM2A 5CFDC 4OVEA 5CADA 5LY2A 3WSOA 4R9BA 3KG2A 4JI8B 1HQWA 3I2IA 3LIHA 2DCKA 1BBT2 4DUVA 2FMDA 1BXHA 3WG7B 4GWJA 3NVCA 3OMAB 5C5UA 5A1FA 3N4MA 2ZGRA 2DFCA 4XEZA 2ZGOA 4TXWA 1OOPC 3F5TA 1W2OA 4D7YA 1WMFA 3ZRVA 1QEXA 4AXOA 5KAFZ 5FZEA 5FY5A 1IBLO 1L3JA 4NXNO 2GSYA 2QZ3A 4GMP1 1XBFA 5A3OA 4BLIA 2H6CA 2XQXA 1OCCC 4GA9A 1KGYA 3AFGA 2IXKA 3BODA 3WQ7A 2HEPA 2PHXA 1I5PA 4FPCA 3RMYA 4ZS3A 2EBOA 4NJ4A 3OTFA 5A7NA 1ACCA 2BGOA 1J58A 4HK8A 1XL6A 3F7YC 4UW5A 3AG1C 1CPYA 4TLGA 3F5WC 3LNNA 2I45A 2X7RB 3EJKA 1SLIA 4AVBA 4W6WA 5FWEA 4XJ8A 4DY5A 1AR63 1FJGB 2VXJA 3UV9A 3JATA 4YW5A 4BYYA 4DXTA 2YXLA 3AG4B 1FD9A 1UF2C 2O1QA 2XONA 3IKWA 3B8MA 4ARXA 5BNPC 1UZVA 2HWE1 4QNHB 3UKVA 4GKXA 1Y9GA 2Z42A 2EXKA 1ZVFA 4Y4RA 5D2AA 2VMFA 4QB1A 1HW7A 4LBQA 1VQNV 1O9GA 1WUVA 4PD4F 5EIBD 1NXMA 4UBGA 2HLDG 3DC6A 2WQ8A 2OS2A 1QCEA 3CL1A 4AQTA 4Y22A 4X20A 4O4JB 3DYPA 1R6KA 2RHPA 1RUC3 4HETA 4AHCA 1HQLA 2ZHMA 3ZXDA 4CUBA 3NQHA 3AP9A 3GBWA 2F17A 2CUGA 4DNYA 2D98A 1W06A 1XYPA 1ULCA 2R061 3ES4A 2DVGA 1VBC2 2LROA 4UB6Z 1THZA 3HKDB 4CDUC 4M3CA 1RYYA 4XC9A 1TG7A 3RI8A 4I30A 5CIRA 2HWF1 2Y38A 3K9SA 1QF3A 1SPPB 1QR9A 3HNYM 1PK6A 2TNFA 5FYIA 2DQ3A 2XHNA 1YFUA 1MG1A 4IV3B 3JAKA 1CAXB 1I5ZA 1HV1A 5FL7G 5JSPA 3J8F1 5JQGB 4WFHA 3CP1A 4HLTA 4DR1O 3MIDA 3CYOA 4B3SB 1UOGA 4NIDA 1GR3A 1DYPA 2V4AA 3K79A 4AVVA 3ZIAG 2YPJA 4JZ2A 4DXWA 4OFGA 4CDQB 4AVSA 2A75A 3L9JT 4XAEA 3I5DA 2B9VA 5I91A 5IYZB 5IK4A 3VDCA 4EN0A 1OA4A 2YICA 3EVKA 2C26A 2P17A 3RYRA 1YHQV 3TAYA 4PDWC 1K5MC 3VD9A 4JQTA 2MW2B 1C4RA 1XL4A 3TEWA 5CKQA 4EFBA 2ZX1A 2DF7A 2R041 3N9QA 2RMU2 2OQ6A 4K20A 2UURA 1UOFA 3CCLV 4J7ZA 5J9PC 1HJFA 3TEZA 5FREA 1VQKV 3O0XA 4M01A 2RDSA 3VQYA 2ADDA 3JD1A 2BTQA 2QQNA 3N27A 1XNCA 5A3PA 2HWB3 4KUMA 4V2VA 3WNXA 2GTSA 1QKQA 1AR73 3RSJA 4QJFB 4HBNA 3HPNA 4GXLA 4ZXEA 1WJZA 4Q4X2 4F6RA 2ZD9A 2HJFC 1QJU1 5F5QA 3INAA 3M7MX 2ZE6A 1HXS1 5FCCA 3WU2Z 2NNUA 1M5IA 2B46X 4P9GA 3NKTA 2IJIA 1UL9A 4J80A 4FLXA 4FLTA 3ASOC 2DN9A 5IVJA 3NKGA 1YJNV 1FT9A 3AZYA 1BEV2 2JDAA 5L7OC 1G4YB 3LSSA 1GP4A 1XUQA 1P8JA 3AMHA 2XVKA 4XDJA 3MIBA 1NE6A 1Q8OA 4E27A 2RS11 3MGUA 1Q7YW 3GDBA 3K2OA 4X1KB 2CAVA 1Q86W 3VD7A 2LFSA 1K5JA 3WNNA 3AK1A 3ZFEC 1ODNA 1RMU3 2JEXA 4QWNA 4QGNA 4JI1O 3VBUC 1OD3A 5CG9A 1GOHA 5FZ1A 4CE8A 2YY1A 4LBQD 2J22A 5JOZA 4I50A 3I7DA 4UT5A 1XMOB 1AVMA 3GCWA 2VULA 3VLBB 3UT0A 2CWMA 5FIXA 4K8ZA 1H8HG 5LP6A 1B04A 3JASA 4MVSA 4A2UA 1Z7S2 5GALA 5F2WA 5HFLA 5GM0A 4LK6A 5LRRA 4L92A 1R1A1 1FS0G 1CIYA 3NRUA 2KG7A 1PMIA 2OA2A 4IHJA 2F95B 1PX4A 4LO4B 4L2NA 4CH3A 2QQMA 4DV5B 1GOFA 5IDJA 3A8TA 4LNVA 3GM8A 2WT0A 4DPNA 3GHNA 4NUBA 4LF7O 1W0OA 3PUQA 4LF6B 2GMPA 4WVZA 3SGIA 3SNMA 2ZGQA 4TV8A 1HIXA 4BW5A 5I0SA 1SA0B 1C57A 2WT2A 1DIWA 5FQ0A 4H7LA 4V2WA 1POV0 1I9RA 4AZZA 3WINE 1W6QA 1XNDA 1YUDA 1DQ0A 2AENA 4MADA 1FXHA 2K9PA 5JIAA 3CC4V 2V1DA 5CFCA 5LMNB 1TME1 2AW9A 1YHFA 2A6WA 1JODA 5K0UC 1PGSA 1AR82 2W92A 1VBD2 1YQ5A 4JI6O 2I2SA 2WNUB 3AMPA 1W9TA 4HNAA 1ZL8A 3TRSB 5FY9A 3IN9A 3VBHC 2LTNA 3I4IA 2DUQA 5JLVA 1Q8IA 5IT9N 4XFHA 2F4VB 1COV2 1K12A 4QGPA 5L7OB 1FXKB 2DUOA 5IK7A 5T5OA 4Y1ZA 3ZIXA 1RUJ2 1V6OA 4MGIE 1D5AA 1XE0A 2Y26A 1VB2A 3ZFEB 4MS2A 4WCEV 4U2AA 1AL22 1UU5A 2KR2A 2XWBB 2E75B 2FBEA 2AHZA 1RM1C 4I4TA 1TEIA 3RYFB 4YW3A 3ZN4A 2DWEC 1G7YA 2PHUA 4OMCA 4IUGA 3JCUZ 5LA6B 3JBG1 1RUD2 3M3OA 1I3HA 3BU7A 2CH7B 4LO8A 5FP8A 1O3SA 2WFF2 3HN3A 3T30A 5KC5A 2A6VA 4OUSA 5LOVB 3MBWA 3KF5A 1NLSA 4AFCA 4AHYA 3H1KH 3OE7G 5ANQA 2QM4A 2JG8A 4EV0A 2Y0IA 2X8KA 1DQ4A 3T1MA 5ITZA 4R7CA 2VWKA 3Q4HB 1XU1A 4HSJA 1BL8A 1S2EA 2LALA 2Q30A 5IAVA 3PTYA 4WV8A 4UF0A 3FAVB 5F6LB 2QWPB 3BVOA 1F9KA 4U3FH 1SZXA 4CXYA 4U7NA 1VQLV 5EYYA 1BJQA 1GP6A 4JYAB 3HBZA 4Q4W2 1AL0G 4AVCA 1YLLA 1V6MA 4OI2A 5J36A 3ENRA 2ZDIA 1NCQC 3VHOA 3C3SA 2Q1MA 1B35B 1C5HA 1NXD1 4FFBB 2B42B 5FZCA 3NSTA 2JB4A 2DVFA 3QD6A 2ZBJA 4PBPA 5JVDB 5GONA 4I3PA 3MIGA 3VBOA 4ASUG 4UUJC 2P3KA 2A3QA 1WMDA 1PP9H 1VRBA 5K8SA 4B1LA 4XBNA 2PTMA 3WNKA 2H8PC 4CCOA 1XU2A 1IS3A 3GNEA 3T2MA 4LF5B 5DQ0A 4CUCA 3LDKA 2O8OA 5F1RA 3MLJA 3WVJA 4GX0A 2EIJC 1I0HA 3VBSA 1KC8W 1YXWA 5EJZB 1JJ2U 3HD8B 4K9SA 1GO3F 4FPLA 5L3EA 1RUF3 1FAFA 1C1LA 4BK4A 3K4AA 1O6UA 4Q1RA 1G9FA 1LOFA 4ZIBA 5DUWA 5EZYB 4EFEA 1RM1B 5EJ1B 4P9XA 1AYM1 4KG0A 3RZLA 2FD8A 1XDCA 3THPA 1R6TA 3PMEA 2PHTA 5HCBA 3RW0A 1WBLA 2VW0A 5KC6A 2D97A 3GBFA 2WO7A 3P1IA 2Q8OA 4NAMA 4C8DA 4I01A 2WNOA 1VRH1 1MOFA 1OUSA 2WINB 4LIVA 1WP7A 1ZRIA 2J1AA 1ZZ9A 3MW4A 4JYAO 3QBQA 2ZE7A 2ZM6O 2RS52 2VE1A 1XYNA 2EA7A 2VOXA 1W6MB 2XBO2 3K0DA 3CDZB 1H6YA 1HNXB 4ZONA 3RYKA 1FAYA 2IVJA 4D6SA 3WQBA 4DV2B 1OLRA 3R4UA 4TYSA 2OZJA 3ACHA 1XILA 1HW5A 1FYJA 4FPJA 2WLHA 2ZNIA 1YVWA 1SQQH 1NT2B 4FMTA 1KJLA 2XQRA 3B8NA 1RHI3 4SLIA 2QZ2A 3ZXFA 5JR2A 1VIBA 1SFPA 3V65A 3ZR5A 3ZRWA 3ZKYA 5JIUA 1G9BA 4I9QA 3P32A 1SG3A 3VN4A 3U1XA 4AI3A 2ZXQA 2LGWA 1DGRN 4S2DA 1NCQB 3ZYHA 5JXHA 3NJZA 1XHXA 1TZOA 3IZOA 4ASLA 3GCXA 1BMV2 2J1SA 1WCUA 2R071 4WBNB 2RDRA 4H55A 5DN6G 1ENQA 4QX0A 2JDHA 2QDNA 3LE0A 1X59A 1R73A 2XG3A 2RR11 4TUYA 1AJNA 1OKQA 4QXCA 2DV9A 1OT5A 1ASJ2 3BU0A 3LB9A 5M0TA 3ZEDA 2F6BA 2OQ7A 4L0PA 2EVXA 4JV4A 1KS5A 3AJYA 2LO1A 1JJOA 1APNA 4A7YA 4X65O 3CZUA 1P49A 3WD5A 2EIJB 2JDKA 5C3OA 1GNYA 3IM0A 1CD3G 4FTEA 2VTXA 1SF9A 4DR6B 3KZ4C 4MSWC 1KMIZ 1M90W 4K6BA 1O8SA 3TN92 1NAEA 4LBOA 2HWF3 2UXDO 1YJLA 2W1QA 2IVIB 1BBT1 2QQLA 2YBSA 3ZYGA 2HP8A 4JZRA 2X29A 5FYCA 2K1EA 2D6PA 5GJ6A 4ISQA 2B4KA 3ZDVA 5CBHA 4X1IA 2P5OA 3VQXA 5FYBA 2FB5A 5J96B 2C4XA 2J1EA 3RYCB 2VM9A 1AHSA 3T4ZA 1DF0A 1DQ5A 2XLFA 4Y1YA 2IXIA 1ZSPA 3NNGA 2Y69C 1BT8A 1D0HA 5EJ3A 4JF3A 3VUOA 1UOJA 2AXTZ 3BFRA 2A71A 1C8NA 3ALQA 4ES9A 4ZHQA 5AC93 2D6KA 5JCOC 1KS4A 4JI2O 4CA9A 2YFUA 4TN7A 4QKDA 3CX5F 2GMEA 3S3XA 4FLVA 2YXHA 1QJX2 1PIV2 1JHJA 4JVAA 4YGCA 1FMD2 1JOYA 4X8NA 5IFPA 5JDBA 4CS4A 3HKBB 1W9SA 1S77D 5FZBA 3I97A 4E2QA 3A7QA 4G2KA 4DV0B 1EY2A 1OQEA 4QU2A 3EFFK 1EYBA 3E8GA 3WDXA 4P9WA 4HN0A 5A3UA 2DVDA 4D69A 1VMHA 1US3A 1JXNA 4D8MA 4JZGA 1H9PA 1F35A 4OPHA 1NZ6A 1QJU3 4HZ3A 4X64O 2W94A 4KGQA 2WUHA 1V6NA 5HCAA 2P6HA 3A21A 1MEC2 4FPEA 2ZX2A 3H0OA 1VBC1 3JAWB 4AF9A 2W0FC 1VQ5V 1DU3D 3FKSG 1ZBE2 3OYWB 3RFRA 2WWJA 4D6QA 2JENA 1QOSA 2DU1A 2YSUB 4LWSB 4FPFA 4MV2A 3ZFGC 4K0KO 5FZAA 2WWWA 3M70A 4FLUA 4K8XA 3I3BA 2Y6HA 1S0FA 4IE4A 1RP3B 1WB7A 1W8TA 4EZHA 5IVVA 3B7MA 4SBVA 3E22B 3AYEA 2RE9A 4QDRA 5FY7A 4N9HA 4YRDA 4AI2A 4L9BA 4XJWA 1NVPB 2VUCA 2JS3A 3MHHC 1VJ2A 3HIFA 2X5IA 1Y4WA 3HN1A 5FOJB 1IKQA 4DV0O 5A3TA 2A7WA 2RMU1 4JGYC 2PY5A 2YROA 4DR4B 3IWZA 3KGLA 4NHYA 1V6JA 2W1SA 1K3IA 5CA0A 1NLQA 4J41A 1X33A 2CL2A 1WA6X 4QD2A 4ONUA 2CTRA 3ZSKA 2H3OA 3J7MA 5FZ0A 2ETEA 5LWBA 1OQDA 3O1PA 3OCPA 1VBB2 3G6EV 1TE1B 5C9AA 3CPWU 1S0GA 1Z0HA 1R64A 3WLUA 3NAPB 3CCSV 1KXGA 3ZJZA 1SZTA 4Q4X1 3AKSA 5DXDA 1TME3 1J5EB 1F4MA 2VMEA 3Q8BA 2UXNA 2XAQA 2UU9O 4YJ3A 1ZZ8A 4XAAA 1Q5OA 3C90A 1T6GC 4I0XB 3K9AA 5DECA 2JWPA 4IQPA 3FJSA 3SMHA 3PVNA 1WCDJ 2EINB 4OXSA 4NTXA 3O65A 5G05L 4XBQA 1BEV1 2E7TA 3N7LA 2V4VA 4IEWA 3ECQA 3T2PA 2R6QA 2QNKA 2FMLA 1QXPA 3ZYJB 1US2A 3H9AA 4B3MO 2XJTA 3SLIA 3CJIC 1UYZA 1NQTA 1ULDA 4HMZA 1A32A 3WOGA 2EX3A 4AQ2A 1NG0A 2W47A 1JMKC 3G67A 3DXRA 5A70A 1KECA 3D36A 1V6LA 4AHXA 1COWG 3LSDA 4YVSA 1NQJA 1VBE3 4KBBA 1HN1A 2WSVA 3MUZ1 1MA1A 4JKLA 1GNHA 4WFEA 5FPBA 1UWWA 3BAAA 3JBG3 1Y76A 4FPOB 5C6CA 1Z7S1 5EXOA 4Q6GA 1S2KA 2C0ZA 3V0BA 1D2QA 4PLNA 5LY1A 2VBPA 4J9YB 1Y74A 1VMJA 1CAVB 3OG2A 5CVRA 4NPLA 1S1AA 3LA2A 3QACA 5JH7A 1LB2A 4DR2B 1GKBA 4PDVA 4GZRB 3AMNA 4JRAA 1JH5A 4CEWB 1I94B 2XJUA 3L71H 4I09A 4JGYB 4OQ9A 4UVAA 2Z0AA 1HRI2 4DV7B 5C3SA 4CEYA 4AWDA 1QJFA 3ELNA 2VMGA 1XOYA 1S0EA 1XMQO 2PXJA 2B5UA 3OBZA 2HWD3 1W3XA 2WO2A 4COWA 1N1SA 2BFUS 3PMSA 3H50A 3R66A 4CBCA 3GZTB 4P9OA 4NRPA 5FZOB 4YW1A 2R9AA 1WN7A 2VQFO 3EYPA 1UOBA 2PELA 3E2EA 3RDIA 1FPN3 3O1UA 1OCZC 1AR81 2OYZA 4KU8A 4I02A 1VBD1 4QX1A 2WABA 2Y4UA 5L36A 2Q69A 2P4EA 3WDVA 4DQAA 3HQRA 3LKJA 3FBYA 4V1PA 2WZ8A 4DO0A 1JMUB 4IYHA 3LA3A 4A45A 3TGUH 4UCSA 3WG3A 1COV1 5FXZA 1Y3TA 5GLWA 2WLPA 3WEZA 2W2IA 1JW6A 1RUJ1 2EALA 1MS8A 3CRMA 3B5LB 1Y67A 4XXAA 2D3OW 2W95A 4KWKA 3RWRD 5LA2A 5KHHA 1WLEA 1AL21 5HCFA 4XMIA 5C8YB 4ZY9A 1VLNA 4L87A 3W7TA 1E5HA 2ZXWC 2D7FA 4DXSA 4CS2A 1CN1A 1RUD1 4FTBA 3CZJA 1AYM3 3N9PA 2QFEA 2W6IG 2B39A 4LEJA 4IE0A 1Y7BA 2ARAA 2WFF1 4GZ9A 1F4HA 2EAKA 3B94A 1HNZO 1RUH2 3CCMV 1VRH3 2JG9C 1GWKA 2ORZA 4ZU5A 3QO5A 4DMIA 2IJHA 3RYPA 5C8CA 2QWQB 5A6XA 5JPMB 4GX1A 5EC1C 3SPGA 3TBDA 3VGIA 3JD2A 1FXVA 5LBEA 5FYSA 3G7DA 5CNAA 4NIHA 4X89A 4A42A 5F2VO 3B9CA 2MNGA 2EILC 4UXAA 5JVVA 1SCSA 1RVF2 1PL0A 1UMZA 2ADQB 3E5UA 4HKOA 5JWPA 2CDOA 1MS9A 4BIUA 1W2TA 4JV5O 1O8PA 4OUMA 4RGAA 1SQXH 1KD1W 4J1XA 4NPRA 3U10A 1KQRA 1JZ7A 3JUUA 2VCBA 4JDNA 1WW5A 2BERA 3KVBA 3O1MA 4FPHA 4YVWC 5GZDA 3SEPA 1Z2GA 3HR9A 4DUWA 4HANA 2EIKC 3RT3C 2X6BA 1QNYA 3VKLA 2R073 2XVGA 2GP5A 1K42A 1V55C 2RR13 4XCAA 3RI9A 1ZBA2 3ZS8C 3L9DA 3X2QC 5BY1A 1CWPA 2FTKA 4RAIA 1G8WA 5J48A 3ACIA 3NMBA 2ZQMA 4JPRA 5K1PA 3SJQC 5A80A 5BNOA 3SYAA 1Z5WA 1RUG3 5F3GA 1VQOV 4IL6Z 1N32B 2ZACA 4J25A 1R6NA 1O3QA 4OZOA 1XXNA 5JJNB 3DPRA 1C8M3 2IZWA 2R1DA 3OPTA 1AJKA 1JYVA 4RYDA 5GW7A 2VTXJ 3K77A 1NA1A 3AG7A 1PHMA 2Q7GA 1BYHA 3EHKA 3MEPA 3OGJA 2ZXWB 1H1AA 1MACA 2WWSA 3VZOA 5FWJA 2UY9A 2IFWA 2UY8A 3RZJA 4RWUA 2R49A 2RDCA 5GTHZ 4FFIA 4I5SA 2ZX0A 2VWJA 3UKNA 3A4UA 4LKFA 1MS4A 5EZWA 1QOOA 4GJYA 2V72A 2RS51 2UYAA 4PF1A 3B4SA 4AEDC 2QCSB 2BGCA 2XBO1 3KCYA 3LEMA 1OA2A 5JOXA 3I2JA 2UUBB 4O4HA 1UMIA 2AZ0A 2A3XA 1XRUA 4JTCB 1SLCA 4ISRA 1W8HA 1WW7A 5I0TA 2PN5A 2VMCA 1IXBA 4L97A 3VKNA 4CCLA 3O0VA 3IDCB 4XQWA 3KV5A 4CXXA 5J2UB 1ONAA 5B1AB 5I93A 1CP9A 2BYVE 2YEVB 4O7XA 2EILB 1E5IA 1X82A 4DR7B 2WSUA 4S2GA 2EIGA 4GH4A 1CZTA 3NNFA 5EHDA 4XF3A 1SETA 2FYUH 2QTOA 2GC3A 3FB7C 3RJ2X 1VAMA 3MF9A 4GWMA 5F8PA 2VCAA 1YIPA 5BYNA 2VQEB 2W91A 2P3YA 4DINB 2D2CB 2RM22 1PO22 1Q6HA 1LGBA 2PHWA 3H8RA 1XPWA 1SCRA 5A3LA 2QQIA 2EIKB 4YM3A 3VKMA 1LGNA 2CY6A 1QDOA 4YGEA 4QAWA 1A6CA 1ASJ1 2N7GA 3MLLA 4QPGA 3M4FA 5FO9B 4I55A 3WNPA 4GWNA 5C70A 3X2QB 3DV8A 3K5OA 3M3IA 3WQ0A 4JCKA 2JICA 2CGOA 4EKWA 4BCUA 4IE6A 2V4DA 1GN6A 3AKRA 1YQ6A 1ND3A 2A6ZA 5D21A 3IBMA 5FZ6A 3TEYA 3WNMA 2CYFA 1DP0A 3VD5A 3HKEB 5CKMA 4XIOA 4UW4A 1RGSA 3TN91 3O14A 1HR0B 2Q4PA 4MH0E 4IGPA 3JQWA 1W0JG 1H1MA 4LFCB 1PVC2 3T2QA 3WNOA 5LMUO 2FCVA 1L1FA 2WYFA 5F37A 3SITA 4QB2A 3BPZA 1OV9A 2WJSA 3GXUA 5FYYA 2XOMA 5LGUA 3HNBM 3H42B 2L9LA 5J3UA 3T1HO 4P9IA 4MGKE 5BV6A 1VBA2 1YI9A 5FKCA 4Y20B 5CFDA 4NIGA 3RVZA 1H9WA 4AEDB 5EYPB 2QDRA 2DYCA 2GBOA 3AVSA 4ZI7A 2ZEWA 5JSOA 1AF9A 5DABA 4IEVA 1IKPA 2KSDA 2PA7A 2EXJA 3PIGA 4Z07A 1EAH2 1W28A 3M3QA 5A33A 5CN0A 1VF7A 2RMU3 1N0JA 1OOPA 1YQ8A 3FUOA 2DCYA 1W9FA 2KD7A 4JASA 4TWTA 3ZHRA 5ABJB 3KS7A 2JE8A 3BKZA 1QJX1 1QJEA 5KHIA 1PIV1 3D3QA 1J1LA 3CBNA 1K9MW 1FMD1 3USUA 4DEVA 4AHZA 1G9DA 4YZ4A 1VB4A 1FV3A 2H0VA 2B1GA 3C2UA 5F3EA 2UUAB 3ZHQA 3J26N 1AJPA 3VD3A 1NCRC 1SS3A 2WZR2 1K73W 2GN3A 4IL7A 1H8EG 5IVFA 5IWAB 2GNTA 3R0RA 1HNWO 4PIXA 3JSLA 1HR0O 3MV01 5CB7A 2IH1C 1NI8A 3PIJA 3U78A 4W4LA 1NOVA 3AMQA 3HVDA 2B45X 3G80A 4DRXA 2Q8EA 4JDOA 3I49A 5D8AA 2VZVA 3GJBA 1X36A 5BNPA 5IVEA 1MEC1 3I2OA 1BEV3 1GH6A 3CD6V 1KUQA 3KQ4B 1K4CC 1KYOF 2YHJA 3VD4A 2E53A 1DDLA 1UW8A 3L72H 1ZBE1 3ZM8A 1GM7A 2GDSA 3OR7C 4W50A 4OQ8A 2PYJA 3OR6C 1MSDA 5CU1A 4BJ0A 3T4VA 3RVHA 2BTVC 2OTLV 2YC0A 3OD4A 4JX0A 1IBKB 4N53C 5IYDO 3IB3A 1B6QA 3D0JA 2LJ2A 4LKDA 1L7LA 4UI9L 3PU3A 2VNGA 4KHPB 5C93A 3SJBC 2DTYA 1RTVA 4BH9A 3WXPA 5FR3A 2R16A 2QKAA 4CDUA 4XJZA 2JE9A 4MVTA 1ZZCA 5LA9A 2OYQA 4CYDA 1N8RW 5LZ6A 4UVBA 5CA1B 2HJIA 1DLCA 5KUKA 3DEMA 3IIAA 5SV5A 3K57A 3I59A 4LF4O 1RC6A 5FMDA 2N74A 3G6BA 3NJYA 3PVBB 3THDA 2D43A 3NV2A 1IX9A 4O2AB 2YIAA 1L8DA 1CAWA 3UGGA 3LSEA 5H5NA 4BQ4A 4KMQA 4E4DX 3JZVA 4QMAA 4H14A 1UY0A 4QHBA 4JDMA 3SPJA 3OGGA 2LW1A 3V64A 1VALA 2F1MA 5JMOA 3KD4A 2KKWA 5I8YA 1F15A 3SDLA 3E86A 4MGTA 2X6CA 1DCSA 1SDDB 3WB2A 4OMDA 4LCUC 3BTYA 3DUIA 1YSCA 1VBB1 2EAAA 1K5MA 4PDWA 1ZRDA 1LU2A 3UT5B 5IATA 2A70A 3JQXA 1NCRB 1IS6A 1I6XA 4G4FA 4UOJA 4W65A 1TNRA 3J80N 1SA0A 1AR83 1VBD3 3BI3A 5HFMA 4ITCA 3K3NA 5FLJA 2OXBA 2VJXA 4J6GA 2RV9A 5CMUA 1SQ4A 3K51A 1OCRC 1IHMA 2WPDG 3SKJE 1CAUA 2QM7A 2K9ZA 3KKYA 5FTTC 1SRYA 5EBMC 3A0BZ 4EQVA 5AG2A 3JYCA 2ZS6B 1W6NA 1LUVA 3N7JA 1MABG 1DGSA 5FYMA 3BCCH 4BOWA 2O0OA 2VCCA 3K75B 2IUWA 2VBDA 2ENRA 1LAJA 2F93B 1AL23 2ZR3A 1ZRFA 4DYLA 4X66O 4BQ5A 1JZ2A 5JXGA 4Y4YA 2ZNJA 3CU7A 3JD3A 1HP8A 4CVUA 5CYYA 5L7OA 4CZSA 4FJCC 3V0AA 1BMFG 1LR5A 4HKWA 3HJRA 4XOGA 1UXXX 1W0PA 4DZGA 1SQVH 3O1SA 4FTSA 2C24A 2XAJA 1US6A 4ZOLA 3VZNA 3T1YO 4DUZO 3ETPA 1LHWA 5E89A 3ZFEA 2W1UA 3DYOA 4LKSA 4EYUA 1G6NA 1GN4A 2QTWB 3VBUA 4LFBO 3T0AA 1GZCA 1K5QA 3RYFA 1F5JA 3ZPYA 1OPOA 4EN9B 2WQZC 2AGAA 3MHZA 1DF5A 4JI3O 5F5CA 3OOXA 3QG5A 4XMAA 2HR3A 2OCHA 4CCEA 1WLTA 2CH7A 3N3HA 3ZYPA 2OPKA 1HRI1 1E57A 1BHAA 4XJUA 1HRV2 1LENA 1UZYA 1H38A 3H8OA 2XXZA 2D6MA 3JATB 4RHV3 2MHFA 4PBOA 2R70A 4QQOA 2WIIB 3MIFA 5C33A 1H8TC 4FI9A 3AK3A 2Q7EA 3F7VC 1UY2A 1R082 3P3PA 1GLHA 1D4VB 4D0QA 1UNBA 3Q4HA 4QQLA 2GNMA 2LGQA 4LBQB 2Q1ZB 4CP1A 2ET1A 3FAVA 5DM6V 1SBFA 3Q8EA 1AR62 1OXCA 4Y22B 4X20B 4IE5A 2VRZA 1NR7A 1OHFA 5FYZA 4RUEA 4E2LA 2B8MA 1AJQA 4META 2WA4A 5CG8A 3FD9A 4HPKA 2YI8A 2A6XA 4U3JB 3OBTA 4YHHB 3NV1A 4Q27A 3ETQA 3UM7A 4M3CB 4FFBA 3N2GB 5K0UA 2XUMA 2TBVA 4CDXC 1OVPA 3KT1A 5JVDA 3JSNA 4PCRA 1PK6B 3LDBA 4XDOA 1OD5A 1RUC2 5LL6Y 3L2HA 5E8AA 2JD4A 4MXVA 1OQ1A 3JAKB 2CSGA 3QH7A 4JI4B 3MIHA 4NTWA 4BIOA 3KT7A 3AEIA 2PHFA 4FQ4A 1BQPA 1KB9F 3LZZA 3VBHA 2XJSA 5KLVH 2F23A 1W59A 3LPGA 2JKXA 3BOPA 5DAPA 1PD3A 2YC4A 2QJ1A 4DRVA 4Q0SA 2IU0A 3MDSA 1PZ7A 4IT5A 4NHMA 1RUH1 1GFF2 2IXJA 1PNMA 5DN2A 4PI0A 4MYEA 4FFKA 4RGKA 3NNMA 1REDA 2AR6A 5FZLA 4QHZA 3ACLA 5FZ8A 4DEQA 1PPJH 3RZMA 4JAUA 2Z4FA 3HAGA 5JUVA 3ETEA 4Q4V3 3H1JH 4Y1VA 2J7MA 3C7GA 2BTQB 4M4RA 2LRPA 2FCTA 5HBAA 1UX6A 1X9TA 5A7OA 1PZ9A 3JD4A 2VO5A 2XVLA 4RL7A 2ZGKA 2YU2A 1W6MA 4YHHO 1RVF1 4OLLA 1XE8A 5L3FA 3CC2V 3I2KA 2Q5ZA 1XNBA 1H4HA 4OHVA 3B40A 4XFGA 1M57B 2UXBB 3PN1A 2CAUA 4DV1O 3VZJA 4HG6B 4H3WA 1JX9A 2QE3A 1N34B 3FHQA 4JTDB 5FNVA 5LHHA 4JI7B 1HDKA 2HWB2 4AYUA 4AVAA 1CJPA 2RG4A 1BCXA 1N36B 4JHTA 4CCMA 1M9NA 2P06A 1ZBA1 4PHZA 4NE9A 3BHPA 4MW8A 4LBNA 4MGQA 2XTAA 3E6CC 1ASJ3 1U5YA 4DR3O 1A3KA 1W3VA 3ZCCA 1NCQA 4LFAB 3RVYA 1ZUQA 3T1CA 2GAUA 1VAVA 2E63A 4WBNA 5FYUA 3UKMA 3OUIA 3B2EE 4JAVA 3MD0A 4D7SA 2M7WA 3UJOA 4UFMA 1GN2A 3PUAA 3TOJA 4ZKTB 1LU1A 4GLXA 2VBBA 4JRLA 4I50B 2VVDA 3CCQV 1K7DA 5LB6A 3M8LA 3WHTA 3WDTA 3WP4A 1KFXL 4QPYA 3D3IA 3H1YA 1W99A 1CZVA 3TN93 3POBA 5LP6B 1JZ8A 3ILFA 1S0BA 3QLQA 2IM9A 1JYXA 1FOD2 4MTFA 4CPBA 1S5JA 1S4CA 4AAXA 2BQPA 3LF7A 2KG7B 1W2AX 4IHJB 3WY6A 3QVNA 2NR5A 4ATEA 3IDBB 1JTZX 4B1MA 2RJLA 1MQTA 3CCVV 2JGUA 1DZQA 3KV9A 1BE3H 1WA4A 1A34A 3DGTA 4L11A 3ROUA 5FQ0B 1IS4A 1TVGA 1BQZA 4XW3A 3AYDA 1W6QB 4B3TB 1OJHA 2D5FA 2XOKG 3I3QA 4UFZA 1RJ7A 2FDIA 3ZO0B 5JJEB 1LESA 2I74A 1QJX3 4DUYO 5CFCB 2AACA 3AG3B 2PAEA 1KEXA 5BXZA 4DV4B 4AL9A 1JQ0A 5DEDA 1H2LA 3FMGA 4OHZA 4PA6A 4ORFA 1WPXA 3IC7A 4Y24A 1W8WA 1UKGA 3IDEA 4WM7A 4HNAB 4FT8A 3WFVA 2RM21 2IH3C 1PO21 1D2DA 2RQ6A 1IDSA 1IBLB 3W7SA 2LW7A 4JAAA 4NXNB 1K8AW 4J9ZB 2VQ0A 5LA0A 3ZMTA 3TB0A 2R1BA 4P9JA 3I3DA 4J11A 1TQ5A 2WNVC 2WFPA 4QKNA 1M1KW 2XLGA 1W90A 2UWCA 4PF5A 4MGYE 5DAQA 4GD4A 4NPMA 1UYYA 4GX5A 2BW8A 2NMNA 3N7KA 1XE7A 2VVEA 1J83A 5BMVA 1SFNA 4R8HA 1OA3A 3H1LH 4JI5B 4PI2A 4CCKA 1ZBE3 2VNRA 4GWIA 5KR7A 4LP8A 2FDFA 4HVQA 1PVC1 3OGRA 4XZPA 2P6CA 4A7ZA 3W5NA 2BVVA 3EB7A 1OF4A 4HYOA 1JZ3A 4AQYO 4WZFA 2DCJA 1CONA 3JAWA 2FKXA 2OTJV 2WAAA 4Q20A 4FZ0A 3LEKA 4HSLA 1IGOA 2W08A 1UPGA 1YIFA 4IV3C 3N2KB 4Q4Y3 4Z82A 5IUQA 1VBA1 1LULA 3W59A 5LW9A 4Q0PA 5HV4A 5ITZB 1BVVA 1TNFA 4Q0QA 1AI5A 4RD7A 3T4HB 4DV4O 5FPLA 3PTRB 3ZN5A 4MTXA 4ZBMA 2HVJC 5FP4A 4UF0B 1GM8A 3PL0A 3S5QA 4CDQC 1TUBA 1BHGA 2KA3A 1HN0A 1DGWA 1E1QG 1YF2A 4XUPA 5BNNA 4URAA 3E22A 1FYUA 2AEYA 3WW2A 4O4IA 5L19A 1RUE3 2HYXA 4NROA 4CPBD 4K21A 4FAHA 1OFNA 1QQP2 4DB5A 2CK3G 3IJ4A 2ATKC 3CNAA 4DR1B 4DUXA 4FK5C 1VBB3 2WZR1 1NLRA 3VBOB 2ZEYA 1H2NA 4IERA 4K8RB 5F3IA 3N36A 5JCOA 4NTYA 2DCTA 3ASIA 4JI5O 1QJY3 4LA2A 4EWAA 2XHBA 2RMKB 2W0XA 5F3CA 2ZT9B 2JXAA 2ILMA 4H7MA 2FZ2A 1PMJX 1IS5A 5L9VA 4MVUA 1LTEA 1AUYA 2QJVA 1LEMA 2WNVB 3AZZA 1MS1A 3RQ0A 1KP2A 4BWAA 5A2QN 1CXZB 1DG6A 3AZVA 2NM1A 3WDUA 1PM9A 3WP3A 1Q6IA 2Q9LA 3ZXLA 1W9WA 5LXTA 2A6YA 4O4LA 5KHJA 3BEHA 4AEKA 5FFOC 2JIGA 5JOWA 2R0FA 5LK7B 1AB3A 1YI2V 1JYCA 1WGPA 3O1OA 3MO4A 3ZN0A 1EP0A 3VQWA 1XNRB 1I08A 1RUF2 4ICGA 3ACGA 1VQ6V 3HB3B 3OTOO 4R9AA 3EHBB 2HKXA 5FZ4A 4YZ3A 4IESA 4BM8A 1A8MA 3BVCA 3CJHA 4PV1B 1BK0A 2WO3A 2HG5C 3JB4C 4MXWA 2P90A 3K58A 3W7XA 5G04L 1DYOA 3ZFGA 2NQYA 5IJ0A 4BXFA 3K5MA 1W8ZA 1IZ3A 2XL9A 4GULA 3EXUA 1DK1A 1IOAA 4QX7A 2HVKC 1RSOB 1TMF1 3ZRWB 4LBJA 4JI1B 4L8JA 2E74B 1UZ0A 1NH2B 2BSKB 1SBEA 4P9LA 1LECA 4CH6A 4GJZA 3D5OA 1RHI2 1U5IA 1H4GA 2UUCO 4XF4A 2KQXA 1JOPA 3W5MA 1W9YA 4JGYA 2I07B 3CMEV 3E6BA 3S5AA 3E83A 1WZXA 2XWJB 3ZMNA 1UIKA 3NWKA 1O5LA 1P4RA 4XFAA 4N7UA 2Q8CA 1RUI2 1AI7A 2PF4E 2R9IA 3SCGA 4YJ2A 3GBGA 1LOBA 4BLJA 1JOJA 5FZ7A 2H0BA 1Q90D 3GF6A 3HT2A 1XNRO 3RNSA 2F66C 1W2NA 5BR8B 4A7KA 2WRAA 3WG4A 3HT1A 1FPOA 2ZPXA 1NVPD 4ASMB 5FYTA 1F4AA 2WNUC 2QTSA 4LF7B 3ZX6A 3CF6E 3LFMA 4QX5A 5T54A 1YO8A 4WFFA 2WWUA 3WF1A 4H44B 1AR4A 1AR5A 3ML0A 1GBGA 2E7AA 3C8XA 4D6RA 2LUWA 1KP3A 4F4LA 3E97A 3ON7A 3VDBA 4LF8O 3H9VA 1FXKC 3AP4A 2E5LO 3A0KA 3AXDA 2VMIA 5CB4A 2MEV3 4F8AA 1JCHA 4B3RO 1ZRCA 4K1ZA 2DVAA 4C0HA 2A5ZA 3CJIA 2AC1A 2HYKA 4JI6B 3L74H 4LBKA 1ZZ6A 2B5HA 4PJ0Z 1S3JA 2Y33A 4UB8Z 5E1AC 5C8YA 5EFUA 4KWLA 2NP0A 4PA7A 1DZTA 1QU0A 4KI5M 2VOVA 3UNPA 1H1IA 3M8AA 1WNSA 4PT6A 3NL1A 1CR7A 4TZDA 4IEXA 2WR9A 4ZHQB 4LBMA 1RXGA 1NY71 4GALA 3O5SA 3OGSA 3OJBA 2MPFA 4BQ2A 1GAXA 3TXQA 1HRV1 2VOTA 1P7GA 3JU9A 2IWGB 2VUJA 1HLCA 4PELA 5KXCA 1BLZA 2UXCO 5BR8O 3IGAC 5AC92 3K48A 4B08A 1RVF3 2IXCA 4BE3A 1R081 5DZFA 4XUOA 2WAOA 1XI1A 1ZA4A 1NKDA 4K3UA 3E8FA 4XACA 1YDXA 3VZKA 3WF3A 2WNEA 1AR61 2ZMLA 1W6OA 3SPIA 3EQEA 1BZWA 3K08A 1PMHX 4UFLA 5FY8A 2P37A 2BBVA 4IV1A 4Q29A 5A7PA 4GB33 2VD7A 1GNZA 4M00A 1B35C 5GZEA 3ZSMA 3KV6A 4EWEA 1RUOA 3SPCA 3U07A 2ITCC 3DGEA 3CSXA 2VMDA 4X62O 1QJU2 4WM8C 1TVKA 2VECA 4LULA 3PJSK 5C4WC 4JTAB 1RUC1 1QVGU 5DUXA 4WFAV 2VGDA 1VMGA 2W52A 2WC2A 4OHWA 4KFMA 4Z2AA 4J10A 4YSFA 2ITDC 5JOYA 3QTCA 3MAQA 5IK5A 1ULOA 5LYJA 4YGBA 1IBMO 2CHHA 2Q8VA 3ABTA 3AM2A 1WCKA 2VH9A 4I3GA 4MGSA 1VF6C 3HQUA 3E1F1 3OMIB 3POIA 1AXYA 1OHHG 1RIRA 1R3LC 1IQAA 3BOWA 4J7JA 4GKYA 3FZ3A 4NR1A 3CHXA 3WCSA 1DLBA 2YIDA 5H6RA 4O2BA 2ZZQA 1JOBA 5CA3A 2R32A 3U14A 4LQRA 1B3QA 2PLV1 5CAZA 5FZIA 4PQQA 3ETDA 1LJ7A 4N9IA 5IAXA 3OY8A 4EN8B 2JJ1G 2D3RA 4ZXKA 5E79Z 1G1XB 3A22A 4QDSA 2JECA 5L9BA 4LBEC 1JU4A 4HXCA 3BB6A 2N04A 2JG9A 5JMCA 4XIKA 2WLMA 3V56A 1LHNA 5KMGB 3TK1A 4DR5O 3I54A 1L0LH 1L7RA 1FKAO 1M56B 2PHLA 3BIEA 1VPHA 4QGLA 4IDZA 4RQEA 1V9U2 2VR4A 4Q1PA 2P4VA 3T3YA 1D7PM 1NE4A 5A7WA 5LHIA 2X53S 2HWB1 2EULA 1C28A 2FDJA 4AOCA 1HB4A 5CISA 3NNJA 1N1YA 3WQ1A 1FI2A 1C5IA 5EYXA 5EBLC 2YEVA 1PO23 2ZM6B 1R093 3A23A 2ZA9A 4B4PA 1GMGA 1CEZA 1JPXA 4KP4A 1W8OA 1Q3EA 4FFFA 3H7JA 2DUPA 5I8SA 4QHOA 3AP7A 4FLYA 3UCSC 3WDYA 1MPXA 5CKNA 4AGRA 2DYSB 1X50A 3CIHA 5FBJA 3IIIA 1WLWA 4WM8B 3E8HA 2XJQA 5C4WB 4YVWA 3WNLA 5GLUA 3DXRB 3SCFA 4DV3B 4XVHA 4XDQA 4KU7A 4YVSB 3JAMN 4GKKB 2RN9A 2W46A 5K7PA 3JCZA 2ORXA 4XDPA 3ACFA 3WT3A 4B8EA 1WWYA 4QB6A 3VZLA 4L8QA 3ZOIA 1XNQB 1JA8A 4EB6A 3POJA 4CP9A 1SMVA 1RL3A 1Y76B 4FP2A 4Q2FA 2O8QA 1Q56A 3THTA 1PNGA 2L35A 1D5NA 1FOD1 3V0BB 2DYRC 1F51A 1EM1A 3U0ZA 3WP5A 4YIPA 1VBE2 1Y74B 1YC61 4GAZA 4CXWA 3S30A 4A3ZA 3RZZA 4YZ1A 2JDIG 3CRAA 3JB8A 2GC2A 1V54C 1VBA3 5A1LA 4A3XA 2JKBA 2WLIA 1IVSA 2X6AA 1X7NA 3A0NA 5LCWL 1EUTA 2HKOA 4RQPA 1ZLZA 4OHXA 1S0CA 4CEYB 5IT6A 1LGCA 3CWBH 4X65B 5DG2A 4FLWA 1PL4A 5F5AA 4DFSA 3TXSA 5L3DA 5EC2C 1N0NA 2BFUL 3ZFFA 1GZTA 4XF1A 4QDQA 3GWOA 4Y20A 1VQ9V 4GMP3 3ZN6A 3KHBA 3I2DA 4AEDA 4AEJA 1OPMA 2UXDB 3ZXJA 3ZKUA 1IPKA 1RITA 2ZJCA 2BGPA 4XF0A 1YZBA 4JYYA 4S2FA 3UGHA 2J42A 4KWUA 2LM3A 4M4PA 1H6XA 3JALA 1EV12 2X10A 4RR3C 4IW3A 5H2FZ 2PI4A 2HWD2 4TSVA 3K5LA 1GZWB 4DV3O 4FFGA 3ZYFA 5AFEA 4GKKO 2AYHA 3M99B 1WCSA 4H37A 5FZMA 2IU3A 2VQTA 2HEWF 1HKDA 2YXYA 4F7ZA 1XNQO 1ZWIC 3VHPA 2KXLA 4LLOA 1I5XA 1FPN2 4IIJB 1GICA 1UY4A 4PA3A 5AVAA 1PO12 4XFFA 4XFCA 2D6OX 5IJ9A 3T08A 2HWE3 3VQVA 2VU9A 1ZZBA 3RWKX 1NA1C 4JI2B 4E4SA 3KZIZ 3FWEA 4YY3O 1IXMA 3MPBA 4QKFA 4TOIA 1XQ8A 2J1TA 4D94A 2DJVA 3IT8A 3THOA 3O1RA 1K33A 2Z3YA 2ZGMA 5T50A 5J2TB 3QH6A 1UN1A 3ZMZA 2NN8A 3DF0A 4EJRA 2QSAA 4AFBA 2HLEA 5T5PA 3KWVA 1XBLA 3ZBHA 3AX4A 5K1XA 3FB8C 2PUSA 2R063 5IYYA 2J1RA 3VHRA 1IPJA 1NR1A 1XSQA 2YS8A 2DYRB 4IEPA 3LA7A 1JYNA 1JZ5A 4Q8LA 1GRJA 3OFNG 4R4XA 2LS6A 5C8CB 1QMJA 2Y6GA 1V70A 2XL7A 4X64B 4YLZA 5FRAA 2WO1A 1JUHA 1NTMH 5BZBA 1V54B 1Z78A 4C0BA 4LF9O 3J8F3 1W8UA 2VW1A 2WZEA 3FYEB 2ZGLA 3R05A 2ZGSA 3VDDC 3ATGA 2JDMA 3FLTA 4DK0A 5E1RA 2NLRA 2VTFA 4MVOA 5FZKA 2YB7A 2XASA 4LHNA 2CTPA 3ZMSA 5A6ZA 2DFBA 3AG2C 5CA1A 4NHXA 1TMF3 3BTZA 2PYTA 4AW7A 3APOA 4XYXA 1QQP1 5CBLA 3ASNC 4QX8A 4K0KB 2DOSA 1LCLA 2R043 3J7LA 1K45A 2BPA2 3HKCA 3BA8A 1J1TA 1YTFD 2XAHA 4R52A 4RR3B 1ENXA 4FM1A 1K5SA 1P84F 4LKEA 5B2GB 1OVSA 4FXGB 2WS92 1YFYA 4FPPA 2XUEA 3R4DB 5JPNB 4KXRA 1YFWA 1SC5B 3J7AU 1AR92 2XT9A 2P67A 2XDVA 1K3EA 5BNOB 4COZA 1J84A 4RGGA 1WMXA 1D4M2 3NAPC 4CDWC 2CU5A 3I2GA 1NCRA 1K34A 4YG0A 3ZSLA 5F9TA 3FYIB 5FLHA 4BR6A 1YQCA 2UXXA 1S0JA 4YW6A 4ATFA 1WA8B 1WKYA 4LITA 3IMMA 4RA0A 1NA1B 3MDPA 3L70H 2Y6KA 4CRQA 2XKPA 5B4XA 4QE7A 2CWSA 2EINC 3USSA 2ZIOA 1HXS3 1LUWA 1RUG2 4DV6O 4QPIC 1JZ6A 1G86A 4XCBA 2VNOA 1C8M2 2QGNA 3WW1A 1RPRA 1PVXA 3ZN1A 1RUF1 5E88A 2XJRA 1N1TA 1SBDA 1PKXA 2RS13 3TEXA 3OD0A 3FB5C 5IFTA 2C1FA 3HOBA 3UGFA 2Q0OC 4AI0A 2D3SA 1DFQA 1UXZA 2UU9B 1QY4A 2WT1A 1CVNA 1L7QA 4FSJA 4O4HB 4GKJO 4YWAA 4QQPA 5A32A 4XABA 2ZZJA 2UU8A 1SLLA 5FP3A 3D8CA 4Y5SA 4N53A 4O61A 1GANA 2J1UA 1WCQA 4R8CA 1DF4A 3HQXA 2CNAA 3VDDB 3BY6A 4Y5TA 1GN3A 2HHHO 4B3MB 1IURA 2MK3A 4FOWA 2VMHA 3FBMA 4NWVA 1BGYH 3LSUA 1BK1A 2E33A 3WF0A 4GH4B 5D5PA 4P5HA 1CGPA 3AG2B 1R1A3 2R72A 1HRV3 1U96A 5A6YA 4CEWC 1Q81W 3ZYBA 2GN7A 1UYPA 4N43C 3VZMA 1VE0A 3RYHA 2ZKLA 3ASNB 3LEGA 1RHI1 1RB8G 3CE2A 5L73A 5ACA2 4NVPA 3D4KA 1N3PA 2ZHLA 1R083 2VY0A 3ZYRA 3GZAA 4ES8A 5JCTA 4AFAA 4LE3A 1UZZA 3POFA 4IEQA 3KHCA 2Q5TA 4JI0O 5E6HA 1RUI1 4QPGB 4I55B 3AZXA 1J3RA 1LODA 5F5IA 3ZVXA 4DXRA 1PGW2 3AL6A 5D8AC 1T5EA 1ZZ7A 3B9IA 1WD4A 4GCZA 5B1NA 3TCUA 4IEOA 2R7EB 4CDWB 4XBLA 1ND3B 5CA6A 5EP9A 2C6SA 1YWKA 1KJRA 1LNSA 5IW0A 3BYWA 3O0WA 4JI8O 2V5DA 1ZRRA 4XDLA 2JD9A 1O9HA 3S3WA 3RYIA 4XJAA 1XMQB 1AYN2 1GMMA 3G6JB 2QQUA 4JHZA 4U3JA 3OUFA 3AYCA 2WKKA 1I1EA 4QPIB 3OEHG 2ZOEB 4AHWA 3O9OA 3NJVA 3ABLC 4QQ2A 4UW3A 4IE7A 2VQFB 4UFIA 3N2GA 2DBIA 1TAEA 1KDKA 4PLOA 3K03A 4W6YA 3SISA 5CFDB 3AK0A 4BA6A 1HX6A 1O5UA 1WW6A 3DKQA 2QE7G 4G27B 1SDWA 4ZZ8A 4BWOA 4ZI7B 2PGGA 2XR4A 2GC0A 2E51A 1C3HA 2QKCA 4KL1A 1FFXB 1OZ0A 5A33B 4UV9A 1BCCH 2DMXA 1ODMA 1Q8QA 2JDPA 2YXSA 5KWRA 3W9AA 1OOPB 2PLV3 2XB6C 1IG0A 1MS5A 2JJ6A 1FJGO 5IY5C 4MVZA 5FPVA 3E35A 1DQ6A 2BEOA 3USUB 2A06H 2AEZA 3VBRC 4E8CA 1OCCB 3ZR6A 4FFHA 2NN4A 4YM0A 3JD72 2Q68A 5A7QA 4K7JA 3VHNA 5AC91 1REFA 1DZRA 4AFDA 2WLLB 1YFXA 4N43B 4BIFA 5JXJA 1NKGA 5FV3A 3MLKA 1H8VA 2Y4TA 5EV7A 1HJGA 3AG1B 2OUJA 4P08A 5AFBA 1VQ4V 2P7TC 3C7EA 4P30A 1MR5A 4QXKA 3H1HH 1HNZB 2YBPA 2SLIA 4DRXB 1C1FA 5JAXA 1UJWB 3U75A 3AXEA 2CV6A 2OIIA 3MW2A 4RN5A 5D8AB 2RJKA 3POEA 5CBFA 5FDBA 5BNPB 1H8TA 1UYXA 1AJOA 4YFWA 4ZZ5A 4AQ6A 5HCHA 4FLZA 3BGAA 4X1YA 1RXFA 1OURA 2BWCA 4QPKA 4AVTA 2OZ6A 2K0GA 4NN0A 2R30A 5FP9A 4RS5C 1GM9A 1VR3A 1EN6A 4NB5A 1RJ8A 5J37A 4B3SO 1YJ9V 5LGTA 2ZAAA 3SH5A 1OLQA 1V00A 1JUIA 3GB7C 2GNDA 3PURA 4JV5B 3FN9A 3E8BA 3FFZA 3BCWA 3ABLB 4YZ5A 4YIOA 1KKDA 2G9FA 1YJKA 4CDUB 2GUZA 4CDXA 4GX2A 2E26A 1UFIA 2W1WA 3WX5A 1FOD3 5FPXA 4EN7B 1OH4A 3ZHUA 4MGZE 3I59B 2B9UA 1FX5A 1ZX5A 4UCRA 2AH2A 4BXSV 3TYJA 3KMHA 3E6DA 4TWKA 2BOIA 5C3QA 1CAWB 1POQA 2OCCC 5GZFA 4JKMA 4I0AA 3WB0A 1S5LZ 2BDRA 4FOQA 1VMFA 3FE5A 3WR0A 4WVMB 4XUTA 1J3QA 4G28B 5DMYA 4UCTA 5EIYB 5IY5B 1YJWV 5IK8A 5L9RA 2W5FA 1YYNA 3LGRA 3VBRB 4PDWB 1K5MB 2B1IA 2AUYA 3J4UH 1TUEB 3J81N 1MZ6A 3OAAG 4NHLA 2OW4A 1NT0A 1CZSA 1HB3A 5FMOS 4O9EA 4EZ4A 3D6EA 1OCOC 1V9U1 4MW3A 2F43G 3CXCU 2V5YA 1MVEA 3IPVA 5B1AC 1Q6UA 3U37A 4MVQA 2Z69A 3LDCA 4Q4W1 3RZGA 1H30A 4QM8A 3T0BA 5T5JA 3SEEA 1GU3A 2Q67A 1A8DA 1CAUB 1F5FA 2HBUA 2AREA 1GSLA 4JYBA 4UVCA 5A3WA 5F32A 3UK9A 1QQCA 1W6NB 4LA3A 1F8VA 3WUDA 4TQDA 4CCJA 4BIZA 4DS0A 3KGZA 3N7MA 3LCPA 4GIQA 4RS5B 3T0DA 1XMOO 1XOUA 5KAIZ 3M2MA 4ABMA 3MUY1 4NYKA 1V6KA 2NMOA 2V73A 4K1YA 3ASOB 5FUPA 4CU6A 3BN6A 2JGDB 2D93A 3V0AB 4CCCA 3OEAA 1KQSU 5JR7B 2XJVA 3P5BA 1JZ4A 4COYA 3A0RA 3O1VA 1OLME 2ZCEA 4RFT0 4M3CF 4ZOLB 3IAQA 4RUFA 3G71V 4XTPA 2X05A 3CEWA 4Z1MG 2ZGPA 1FNYA 4MG2A 3VBUB 4LJHA 1VBE1 4DV5O 1W6PB 4XE9A 4TV9A 3S57A 5FZ3A 1WW4A 4XPVA 2X0LA 4XFBA 1QIQA 4LF6O 5T3NA 4LO5B 1PGL2 2DW4A 1T2XA 5FXWA 5HPOA 1BBT3 2OCCB 4UFHA 2YUAA 1PM7A 3UJQA 1M06G 2Y60A 5LA1A 3HBKA 4B7EA 2ZAHA 3POGA 1DQ2A 2QWRB 3LDEA 4CCDA 3B00A 1O59A 4LO7A 2QBXA 3P30A 2ARBA 3N2KA 1XB9A 2BNOA 5A7SA 2WSSG 4B4QA 3RZKA 1JR9A 2HWC2 2JEMA 3WF2A 5LMNO 4OX9B 4BMEA 1AP5A 1AILA 2QDOA 3AJZA 4WFGA 2DURA 4PDLA 3BUCA 1QQP3 4MO3M 1OCOB 1EV11 5LMUB 4RHV2 4YXWG 2HWD1 3O12A 4UAPA 5ABJC 1RFYA 2RS32 2LW8A 3NV4A 3JARB 3T1HB 4HPKB 2CAZC 3PVEA 2F4VO 2Y6FA 4BQ1A 3H1IH 2XAFA 4X6RB 2VCMA 3E89A 1FPN1 4AI8A 1YIJV 2F4LA 5A9GA 4FOYA 4HKLA 4YFZA 1PO11 4UBHA 1ND2C 1BMV1 5K0UB 4Q0VA 4JYCA 3K0GA 4MVMA 5GLTA 2ZIMA 4I9WA 2FCUA 5I0DA 5JI7A 4MT8A 1SLTA 3TWIA 4RFRB 1R1BA 4LOTA 3ST7A 1BS3A 3KM5A 3VBHB 2W68A 2H94A 4QPJA 3EBRA 4BPZA 4P00B 1JN2P 4C90A 5KX5B 1VQPV 3STLC 1S0DA 5KUMA 4M3CE 1W39A 2WNVA 3VBFC 1XEQA 4HVOA 2VZ3A 5I0UA 5JSRA 1QR8A 2DWDC 2GTAA 1VBC3 4LR3A 1YRZA 3ABKC 5B5EZ 2EXIA 2CDYA 4Z1VA 1U5ZA 4OX9O 3SPHA 1HNWB 2CGNA 4O4JA 5B1OA 1MQTC 4HN1A 3EXAA 4XQDA 2ZGTA 4WVWA 2Q1FA 2M6YA 4W8JA 1KKCA 1Y9MA 1ULGA 1ZA7A 3AP5A 1S76D 5GLVA 4CZZA 3N9OA 2OUHA 2XAGA 4BK5A 2OPWA 3H8UA 4YG6A 3QCWA 3HKDA 2DTWA 2VVFA 1ZX3A 2GSMB 4LT5A 1SPPA 2ETNA 4Y26A 2WAMA 4NMIA 4JGZC 5FY4A 4IV3A 5EIBC 2YGMA 1CAXA 2QKSA 4ZU7A 5JQGA 3CQOA 4YYOA 1NS1A 2EIDA 4Q4V2 3PHMA 1BKZA 4WM7C 1WPBA 4DIQA 5FNVB 3POYA 1SACA 4CDQA 1S5HC 3K3WA 4CC6A 5GTIZ 5IYZA 1RSOA 3GALA 2EIBA 2WS91 4AAPA 5B3SC 5KA5A 1F31A 2PI5A 4LF5O 1YXBA 4E4ZA 4KGGA 5F6KA 4HAMA 1RUI3 2BSKA 3M3EA 2QKDA 3KCCA 1BSMA 1BZKA 4LF4B 1AR91 2ZX3A 1LOGA 3FFQA 1D4M1 1QWRA
chains in the Genus database with same CATH topology
3SCHA 1CPNA 1KD7A 1ND2B 1JOJA 1JHNA 1AR81 2OYZA 4KU8A 4I02A 1VBD1 5LRSA 2FQPA 3URFA 2H0BA 4PJYA 2VG9A 3GF6A 3HT2A 3KB5A 5BNOC 2VW2A 3RNSA 1U5XA 5JZGC 5L36A 4Q4X3 4A7KA 3WG4A 5DUVA 2FMYA 3HT1A 3WDVA 2VPVA 2ZPXA 4DQAA 4ASMB 2YMZA 5JI9A 3LKJA 3DPRC 2WNUC 3FBYA 4V1PA 3LA3A 1ND2A 1GZ9A 3CF6E 3MIEA 3WG3A 4QX5A 1RUG1 4CDXB 5T54A 1YO8A 2IFRA 1JBCA 1COV1 1Y3TA 3LOIA 3AFKA 4YGDA 5GLWA 3CO2A 1GBGA 1A78A 4M23A 1DGLA 2E7AA 1C8M1 2LUWA 2WLPA 4XFIA 5KXBA 2BVBA 3B02A 1JW6A 1RUJ1 2EALA 1MS8A 3VBFB 3E97A 3B5LB 4XXAA 4KWKA 2Z2SB 5EWSA 3AP4A 1OSGA 5KHHA 3A0KA 3AXDA 5A3MA 2VMIA 1AL21 2MEV3 3PVOA 5AVPA 4F8AA 5HCFA 4XMIA 2AZ5A 4E2GA 3ZSEA 1WMEA 1VLNA 4IEYA 1ZRCA 3E5XA 4K1ZA 1POV1 2DVAA 4C0HA 2A5ZA 4O9GA 1AX0A 2D7FA 5HXVA 4R9CA 2JE7A 3VBFA 4R9DA 1MQTB 1CN1A 3CJIA 2HYKA 4X8PA 4YM1A 4Z92B 1RUD1 4FTBA 5DDJ3 1FATA 1JR7A 4LBKA 4XXPA 1ZZ6A 1AYM3 2B5HA 2QFEA 1UAIA 2B39A 3B93A 4LEJA 1Y7BA 5EFUA 5DDJ2 3S0MA 2WFF1 4KWLA 2C9AA 2NP0A 1AYM2 5BNNC 1DZTA 1QU0A 2VOVA 2EAKA 4B3NA 3PLQA 4DY3A 3B94A 5J92A 2XH6A 1H1IA 2QVSB 1RUH2 2SBAA 1PZ8A 3AKPA 1VRH3 5FMOL 2JG9C 1ALYA 3NL1A 4C1WA 1CR7A 1ENSA 4IEXA 5SV8A 1Z7S3 4ZU5A 4TZDA 4GQ7A 2HEYF 3POWA 1VRH2 4B29A 2VXRA 4LBMA 4DMIA 1UIJA 3IPVB 4JGZB 3ZX7A 3RYPA 5C8CA 1NY71 1MS0A 3RWNA 4CWDA 4GALA 5LK5A 1XNKA 4U36A 1Y9QA 2V09A 5JPMB 4FPYA 3VGIA 1WBFA 3AKQA 3O5SA 4IEUA 4KH9A 4ZU4A 3SHRA 3TBDA 3OJBA 2MPFA 2Z79A 5GLZA 3WG1A 4OJ8A 1HRV1 2QQPA 4GH4C 5DG1A 4AK3A 4Q0UA 3JU9A 3G7DA 5CNAA 2IWGB 5ACA1 2VUJA 4WM7B 1DBNA 1HLCA 1O3RA 5KXCA 3X29B 4PIZA 3R4SA 4FVVA 4JC1A 4JGZA 3WG2A 1WD3A 3B9CA 2WBPA 2MNGA 5AC92 3K48A 1LOEA 1W2UA 3WZ1A 1KRIA 1RVF3 2YZ4A 2FZ1A 2IXCA 5H9RA 1X8EA 4BE3A 1R081 1UU6A 5DZFA 2XPJA 1AX1A 2W39A 3KT4A 4TLFA 4UXAA 2GZWA 5JVVA 1SCSA 1ZNPA 1RVF2 2DVBA 1UMZA 4WBBA 4EN6B 5GZGA 2YYOA 3E5UA 1ZA4A 4HKOA 4K3UA 5JWPA 3VZKA 1PGW1 1YNAA 2D44A 1MS9A 2WNEA 1AR61 2ZMLA 1R091 4PQ9A 1W6OA 4OUMA 4RGAA 2DCZA 3EQEA 4QPGC 1BZWA 4J1XA 4NPRA 3U10A 1ZREA 1KQRA 3JUUA 3RPQA 1OIKA 1ZYBA 3SH3A 2P37A 1H2KA 3ZDSA 4JDNA 2BBVA 1LOAA 1UPSA 4IV1A 4Q29A 1WW5A 4GB33 3M1HA 5FOBB 4FPHA 5LEJA 1GNZA 2Z5WA 4M00A 4YVWC 5GZDA 3AKTA 5BY5A 1B35C 3HR9A 3O7OA 4MX3A 5GZEA 4HANA 4HL0A 3ZSMA 1QNYA 5BPXA 3VKLA 2R073 4EWEA 4BHPA 1RUOA 5KXEA 3OPZA 5JZGB 3U07A 5KHGA 4KG8A 1BVP1 2XVGA 1URXA 2R072 1ND3C 2RR13 3RI9A 1ZBA2 3WCRA 4LUMA 4Y1XA 3VL9A 1QJU2 3DPRB