5H2FZ

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
total genus 25
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5h2fZ00
3KZIZ 3A0HZ 3A0BZ 5GTHZ 4UB8Z 3JCUZ 5B5EZ 5E79Z 5B66Z 4IL6Z 5TISZ 1S5LZ 5KAFZ 4UB6Z 2AXTZ 5KAIZ 5H2FZ 3WU2Z 5GTIZ 4PJ0Z
chains in the Genus database with same CATH superfamily
3U11A 2E5LB 1N33B 2ZINA 2HFEC 1I08A 2YICA 1GM8A 2N74A 2Q68A 1VQ4V 4XDKA 3CCMV 5IYBO 1DK1A 4I0XB 3M7MX 2NNUA 1GTOA 4DR2O 1FXKA 1E1QG 3CSXA 1NU1H 5AG2A 4AILC 4UCTA 1KP3A 3K06A 2EULA 1V55C 4K3AA 4G28B 2P90A 1YI2V 3STLC 2QTOA 2QWRB 1BS3A 4YJ2B 1G1XB 4NXNO 4MW3A 3PJSK 4GUNA 1PP9H 5CA1A 1Q5OA 2Y4UA 2UU9O 3BPZA 3WG7C 1SERA 1CPYA 2F66C 2X6BA 2QDOA 2ARHA 3L75H 3A0RA 2Y4TA 3VQYA 1X4TA 2ZT9B 4OX9B 3H01A 4WFGA 3SPGA 1XILA 5E1AC 1K8AW 2Q7EA 4BIOA 2AZ2A 4I50B 4BIZA 4DV5B 5JH7B 1AI4A 3CC4V 4J9YB 3LSUA 3QNEA 4JTCB 3FB8C 5JJEB 1JA8A 2OIEA 2HP8A 3B2EE 1AP5A 2EIJB 3K5OA 4HYOA 4A5UB 4KP4A 2QWOB 3UO3A 4DV1B 4NTWA 2AHZA 3UM7A 2EZOA 1YJ9V 4X64O 2IJIA 1AR4A 5B1AB 4JTAB 1IDSA 3H9VA 3OFNG 4F6RB 1VQNV 1IURA 2CAZC 1Y6XA 1YF2A 5L3CA 1RPOA 4B3TB 3M8AA 2YC0A 1H2LA 4FLYA 1HNWO 4HNAB 4TUYB 1MOFA 1YSCA 1K7DA 1VQOV 2JJ2G 1XNQO 1WJZA 3SYPA 1QQCA 2Q7HA 1IBLO 2RQ6A 1SC5B 1JFFA 1H2SB 5GONB 1R3LC 4FVMA 3HKDA 1EZJA 5EC1C 2Q9LA 1VQ7V 3JAWB 4TSFG 5C8YB 3KZIZ 4FFKA 4H13B 1GM7A 4FM2A 4B08A 1LNQA 5HFLA 3E2EA 3R66A 1MABG 3ZRXA 1TVKB 3ABKB 1FJGB 5LMUB 2WLIB 1I0HA 1YVWA 2QJ1A 2QSAA 4DR5B 3VQVA 2DWEC 3K58A 4QGPA 1YEWA 4DR6O 2O57A 1FFTB 3SPIA 5LA6A 5BZBA 2GV9A 3BEHA 5D5PA 3GWOA 4LFBB 2EIMC 3T1CA 3ABLC 4JI2B 3J7AU 1KMIZ 1DF5A 4DW1A 2YEVA 1EM1A 4JASA 2Q6AA 2UXBB 4EFBA 4LF9B 3P3NA 1FXHA 4MVUA 5D5QA 4DV2B 1S0VA 4JV5B 1AI6A 1J5EB 4LFCO 3JCUZ 1AB3A 4JI7O 5CA3A 2VRZA 2R70A 2KSDA 2FTKA 3CP1A 4L87A 3UQ8A 3K0GA 1R6KA 1FYJA 4LP8A 4I9QA 4DR4O 1SS3A 3BHPA 1PL4A 4QPKA 2V7QG 1Q43A 2M6YA 1TUEB 4H33A 4B3SO 2IU3A 4GX2A 3K08A 3BRCA 1K34A 4MSWC 4X89A 4X65O 3T4DA 2UUBO 1CEZA 2YI8A 4GKKB 4B3MB 4JI1O 2WLNA 5KAIZ 4L8JA 4I9WA 1IX9A 3QF7A 3CPWU 3T1HO 1IBKB 4ZOLB 1XNRO 3K03A 5L3BA 2Y48A 5DM6V 1AROP 2QM4A 1N34B 3ZRWB 2Q8VA 1GN3A 1U96A 2NLJC 4O4HB 4GLXA 2EJ7A 3CJHA 3ZS8C 1OCZC 3THOA 2UUCO 1M56C 3ML0A 1NBMG 4LFAO 1VF5B 3JCZA 3SJAC 4PDLA 1VQ5V 3R65A 3E86A 2FKXA 2W6JG 1VQ6V 3STZC 1MZFA 1G6UA 1SZXA 3HKBB 5KHJA 3CCEV 1BMFG 4F6EA 2WLJA 3OM3B 5LMNO 3QO5A 2N05A 1NKDA 4FLUA 5EIBD 1YDXA 4DUZB 4TT3G 2ILMA 2JGDB 1VF6A 3BA9A 3RYCB 2PI5A 5IJ9A 4YHHB 1F23A 1XHXA 2V1DA 1KECA 4K0KO 2GBOA 3D36A 3LDEA 4DR7B 4I5SA 1BZKA 1HR0B 3MHHC 4WCEV 3AG3C 5FL7G 4WFEA 3JD3A 4AI8A 3JYCA 4AHCA 1ZTEA 1WLEA 2LW7A 5B1OA 1DLBA 2VWKA 2XAGA 4PI0A 2JIZG 3LDDA 1XL6A 2WSSG 3OTOO 3JD2A 3QTCA 1FXKB 3W7UA 3L70H 1NR1A 4ABMA 3FAVA 3ZHRA 4FFBA 3VQWA 3C3TA 1EFRG 3C90A 4MTOA 1VP7A 5LGUA 1K92A 4LNUA 3M99B 4MVMA 5H6RA 3OW2U 2IJKA 2VS0A 1MNGA 3J80N 5CA1B 1XOUA 2E76B 4PA6A 2ZKOA 2ZNJA 5LYJA 4C7UA 2R9AA 1CP9A 2QTSA 1M5IA 2CGOA 2DQ3A 3A2FA 3CCLV 1V55B 5H5NA 1NH2B 3JALB 1QCEA 1RM1B 2R72A 1XMQB 1AILA 4X1KB 2Z5UA 3VOUA 3S3XA 5B1NA 3WG7B 4U7NA 4JI3O 4J41A 4LF7B 4W4LA 4TV8A 2DJVA 1ZWIC 4ASUG 1IZ3A 3DC6A 1VIBA 1H2KA 2MK3A 3DXRA 5DEDA 2LFSA 3FD9A 3N2KA 4K8XA 2XAJA 4JF3A 3TCUA 4LBEC 1TUBB 2P4VA 3ABMC 1XHZA 3K57A 3CB2A 2B5UA 4I4TA 1M57B 2BOBC 5A2QN 2QKCA 3B8MA 2OCCC 5L3GA 3KKYA 2EJRA 2VWJA 4J11A 3UCSC 1GN4A 1B6QA 4Z1VA 4J10A 1PNLA 2PGGA 3AK3A 4LF5B 4QNHB 2QM7A 5KAFZ 3TXQA 4UB6Z 2D2CB 5ITZA 1JJOA 4UFZA 1JFFB 2PI4A 3OMIB 4EKWA 5H9CA 4W4KA 4GX5A 5EC2C 5JJJB 2HHHO 4UCUA 4TWKA 4YJ3A 4YY3B 4JTDB 3RVZA 2JK5C 2IU0A 1N36B 3EFFK 4PELA 4PA9A 3E8FA 3CRAA 2LGQA 2Q0OC 5CB4A 3ZCCA 1SKVA 1THZA 5BR8O 3H1LH 1SF9A 3GWKC 4QE7A 1MSWD 2ZE7A 1NZ6A 1S5JA 3ZN1A 4B3RO 5LA6B 4FM1A 1OCRC 1T5EA 3OEEG 4DR2B 1VQ9V 4KL1A 2P7TC 2Q69A 3ZMZA 1NQTA 3D8CA 4GT1A 4LWSA 2Q73A 4R6ZA 5EBWC 2WWWA 3LSSA 1BL8A 2YEVB 2DOSA 1P4RA 5EBLC 5LGNA 1L8DA 4NXNB 2BTOA 2UU9B 1S5LZ 1WA8A 4NVPA 4FJCC 4P30A 2WAMA 1QR8A 2EIMB 3Q4HA 3B40A 4GKJO 1AJNA 4WF9V 2P67A 3UO2A 3K59A 2Q67A 5EYPA 2Q4PA 2Y69B 4WFFA 4XDLA 3E83A 4PA7A 2WLLA 4J80A 1HNZO 4UCVA 4JI6B 1L1FA 4JPRA 3G80A 5KA6A 4X8AA 5LXTA 1W0JG 2R9IA 3EVKA 3I56V 3CCUV 1EN6A 1K5SA 2JRIA 4KFMA 5K1PA 1VF7A 2DYRB 2K9PA 3AG4B 4X62O 1SRYA 2G38A 1IVSA 2ZIMA 1QLNA 4X1YA 1XI1A 4X64B 4H0LB 4AQYO 3CJHB 2B1GA 3AG2C 1L0NH 5J2TA 4JI0B 4JYYA 4JAAA 5HFMA 1G8MA 1WN7A 1HNWB 1OJHA 4FZ0A 3UT5A 2KKWA 4N23A 4RQFA 4MTFA 3AG7A 1OCOB 1I5YA 5EZYA 1XNQB 2A9HA 5CBFA 4FLTA 2CH7A 4DV6O 2Q0AA 1IBLB 4Z2WA 1YTFD 1OCZB 3CCJV 1H8EG 3ZHUA 2RNBA 4RUEA 1IXBA 2EINB 4O2BA 4NTYA 1QR9A 1KKCA 3B77A 1B04A 3L9DA 1JMKC 3ZHSA 1UPGA 3S3WA 1H8HG 2CTPA 2HJFC 2HLDG 5CMUA 3GB7C 3O9OA 3W7XA 4LF8O 4BWAA 3K04A 3JASA 2GDSA 4LF4O 1H38A 1P49A 1SA0A 1IBMO 3MD0A 1JPXA 1E1RG 5EIBC 5J2UA 2OYQA 1Q7YW 4DR6B 2IJHA 2OTLV 3K5NA 4IIJA 3JAKA 3E8BA 3FKSG 4YIPA 2ZR2A 1GMGA 1SQXH 2BSKA 4DV4O 1PNKA 4ZIBA 2ZIOA 2GTSA 2W0FC 2OIGA 2JEUA 1S3JA 1H2NA 3N27A 4YXWG 3WU2Z 5LOVA 3T4ZA 2QE7G 5IY5C 3ZBHA 4O2AA 3FAVB 5KX5A 4FFBB 5IYZA 4RQEA 5LP6C 5LL6Y 1P7GA 1K4CC 1AI5A 1R3KC 4LC1A 3AG3B 4LNUB 1NI8A 2A06H 3H1HH 4DR3O 4LFCB 1VQ8V 4PD4F 4JI7B 3OTFA 1YZBA 2XNDG 5IDJA 5LYJB 1FFXA 2JS5A 4E4EA 2DYSC 3OD4A 2WLMA 1OCCB 5IE9A 5JCOC 1XMOO 3SPHA 1MG1A 2B9ZA 1SQGA 2EIKB 1MMMA 4G27B 2F43G 2LW1A 1VMGA 2X6AA 5B5EZ 3IGAC 3TETA 1M4UA 1WB8A 1NTZH 3SJCC 4TQDA 5JQGA 4X65B 4X1IB 4CH5A 2UUBB 1TGOA 3CX5F 4JI1B 4DK0A 1FKAO 4MVZA 4TV8B 1IXMA 3ASOC 5BXZA 2PZSA 3D3IA 3EXAA 5B1BB 3T1HB 3DXRB 1BHBA 3QVNA 3E35A 1DGSA 5F2VO 3TK1A 4JI8B 3N2KB 1YTFB 3IC9A 3ZN0A 5B3SC 4ZKIA 4K35A 5H2FZ 1KQSU 4I4TB 4CC5A 2UUCB 4JI4O 1NTMH 5H6QA 1PL0A 2A3QA 4LFAB 2BOCC 4B7EA 1Y66A 3CC7V 3APOA 3OGCC 4CS2A 4LCUC 1R6NA 4E2LA 1YCIA 3U0ZA 4P9OA 2ZE6A 3RYFB 2JGUA 3CYOA 5LMNB 5ITZB 1OHHG 2CTWA 4JI5O 3LSQA 1O9GA 4R8CA 2OCCB 1W2BU 3BFRA 2A0LA 2PUSA 4HBNA 4WBNB 1MSDA 1YXBA 1FS0G 2ZR3A 2ADPA 3JARA 3ASNB 5FPOA 2QM8A 5TISZ 4YJ3B 5KHGA 1RFYA 3SJBC 3ZHVA 3VQXA 1Y74A 2ZXWC 2F4VB 4K0KB 3E8HA 3BCCH 3RYIA 5FNVA 5BY1A 4X9QA 3WFVA 5IYDO 4OPHA 3TGUH 5BMVA 4JAVA 4DUYO 4Q20A 5CB4B 2R9RB 1AR5A 4KHPO 5LMUO 3U10A 1V54B 1NH2D 2V4DA 3ABTA 3SDLA 3AG1B 1ROPA 3OTOB 2K1EA 2XASA 5LHHA 4MTXA 4I0XA 2VQEB 5EK0A 2FL4A 4LH7A 4JI2O 5JVDA 2X6CA 1WA8B 3F7YC 4J7JA 3FB7C 3Q4HB 5K1XA 1M93A 5KUMA 1VQKV 3ETGA 1YIJV 2RN9A 4DR1O 1S76D 1NT2B 3G4SV 5LBQA 4DV7B 1N32O 3X2QB 3JD4A 2UXDO 2YIBA 4X88A 2KG7A 3I5DA 3RFRA 2WLHA 2EIJC 1BT8A 3CCQV 4JI3B 2W0XA 1CXZB 1Q3EA 2JDIG 2UXCO 2LFRA 1PKXA 2GTAA 1YJNV 2ZDIC 4JYAO 1O9HA 3FB6C 1QLEB 5JH7A 5KA5A 1L0LH 3E8GA 4UUJC 5B1AC 2IW5A 3CMEV 2QR4A 4NKGB 4QJFB 1BQ0A 3CRMA 3JSNA 4MTGA 2JEXA 4EEQA 4FPPA 5IWAO 2YUAA 2XOKG 2YIAA 3F5WC 1F4MA 1GH6A 4H37A 5J2TB 3RN4A 3D3QA 2LJ2A 3CC2V 3H1JH 3SGIA 3UT5B 1BCCH 1R1BA 1KUQA 1EN4A 4WFBV 1I94O 1VEWA 3JD0A 5EZYB 4NXMO 5A9GA 4KXRA 2CH7B 4TUYA 4R50A 1Q6IA 2P22C 2L35A 3W7WA 4DYLA 3SYAA 2OWOA 3K5LA 4O2BB 2AW9A 3FX7A 2HHHB 3ABKC 1XUQA 1OV9A 4J42A 4HZ3A 3N2GA 3TXSA 2B1IA 4EB6A 1XL4A 3JAWA 3JATA 3HPLC 4O4LA 3JASB 3G71V 4RAIA 1HDJA 1V9PA 1NR7A 3RYHA 1SA0B 4XDJA 5BR8B 3EHBB 2ZM6O 4PA4A 3OUSA 2OT5A 2W6IG 1TA8A 5J2UB 4DO2A 1B06A 1NJIW 4IIJB 3JAKB 2BSKB 1SESA 4RUFA 1H2GA 3JAMN 2YI9A 4UV9A 1K73W 4O2AB 5KHIA 5KX5B 3G6EV 5IYZB 2VQFO 3ZIAG 2Y0IA 4NTXA 1I7FA 1KC8W 3NR7A 2ZD9A 4DXWA 4MW8A 4Q6GA 4UCSA 4UVAA 1AR1B 1X59A 3CCVV 1U97A 1GN2A 2UXNA 3HKDB 1FFXB 4FM0A 4GKJB 2LO1A 3ZMTA 1XREA 1VQPV 2BCCH 2LGWA 1SQVH 1PPJH 2X0LA 2HG5C 3T1YO 2D3OW 4DV3O 4IHJA 4LF6O 2DQ0A 2X7RB 5JQGB 1HNZB 1HNXO 2QWNB 3CEIA 4ZI7A 1KU9A 1ZUQA 2A7WA 3LDCA 1F51A 2QA4V 4CS4A 1ZAUA 1UFIA 3FYIB 4UV8A 2KB1A 3SJQC 4DV0O 1Z5VA 4X62B 3K3WA 3L74H 2YSUB 3RVYA 4FLXA 2HR3A 1PD3A 5L3EA 1SQFA 2N04A 3AEIA 4IT5A 4AQYB 2ETNA 2UUAO 1N8RW 2YXHA 4ZOLA 2IJJA 3K9SA 1EBOA 3ASOB 5LGTA 1K97A 2QEXV 3ETEA 1M90W 1I5XA 2YDEA 4FLVA 3ABLB 3CS5A 4DV6B 2ZQMA 3ETQA 2BTQA 3TJTA 3BABA 4K8ZA 1DTOA 2CTRA 1F7YA 2CDYA 1B3QA 4GYCB 3ZEDA 5JJNB 5KUKA 4X66O 3JARB 4OGQB 1JOYA 1COWG 1N0NA 4H44B 3IC7A 1Y74B 4D7TA 4LF8B 2JGDA 4U7OA 4YIOA 5FNVB 3RYIB 4LF4B 3E89A 5BMVB 2Q5ZA 1TAEA 4BAYA 1IBMB 1K33A 3FB5C 3OUFA 2UXXA 5B66Z 4IL6Z 1LUVA 4PV1B 1FXKC 2QWPB 1JVMA 4FZ1A 4UVCA 3C3SA 1YITV 1KBHA 1RSOA 1VQMV 2F95B 2RMKB 4DV4B 4MS2A 3OGIB 3MDSA 4ZBMA 1ZLZA 1D2DA 4LR3A 2HEPA 1XEQA 2PTMA 2RDCA 1NS1A 2DMXA 4MVQA 1Q90D 1YHQV 4DR3B 4ICGA 2NN4A 1GKFA 5JVDB 3CCRV 4R7CA 5J9PC 3RWRD 1M56B 1EZVH 3ICXA 4RO2A 1RM1C 2XAQA 1QU7A 1Y76A 3AK2A 1XMOB 2IH1C 4N21A 3G67A 4X20A 5IJ9B 5LHIA 2OCHA 3OEHG 3P32A 2KG7B 1WAZA 4PDRA 3CWBH 5CBHA 3JALA 1Q86W 4UCRA 4OPAA 4X1KA 5KMGA 2QGNA 1US6A 3ABUA 1BQZA 3NXSA 4TV9A 4JZGA 2DW4A 4JI6O 4O4IA 1M57C 3T2MA 4BW9A 1PM9A 2AGAA 2LP7A 3ZMVA 1GAXA 3LUTB 2E5LO 1N33O 1PNMA 4PDMA 3DGEA 3B4SA 1P84F 2H8PC 3CXHF 4JI4B 1Y4MA 2H94A 4O4JA 2DN9A 1ENVA 3OE7G 4U3JA 3RW0A 5DECA 3SYCA 2AZ0A 1Q6HA 1TUBA 2WA4A 3HB3B 1Q6UA 2DE0X 3JD1A 3OMNB 5FPRA 2ZE8A 5IJ0A 3MHSC 3KCYA 5L3FA 2CK3G 3LNNA 4J9ZB 1P7BA 1G4YB 4JI0O 1NVPB 2P4KA 2EILC 2NR5A 4JI5B 4JGSA 5LP6A 2Y0PA 1F4NA 1WPBA 4DR4B 3RBZA 2ODMA 4B3SB 1FPOA 3KG2A 1VARA 4JAUA 1JQ0A 1ZL8A 2DWDC 3BA8A 5KHHA 1GK9A 3N2GB 4CC6A 4OX9O 3E22A 1WPXA 4WFHA 4EB6B 1VQLV 1GN6A 4WFAV 4B7KA 3JATB 1SQQH 3AK1A 2EBOA 4O4LB 2CUGA 3HKEA 5JCOA 4DUYB 1ZX3A 4DV5O 3RYHB 4DK1A 5E79Z 5CA0A 2HVKC 1WP8A 4UCOA 4PA3A 1XNRB 1Q82W 4KHPB 1MZEA 2PYLA 3OMAB 4NB5A 4QIWF 1K3EA 3CHXA 3QO7A 1AP6A 3DTUB 4UXNA 3W7TA 1XQ8A 2CTQA 4DV1O 2IM9A 4CBCA 2YIDA 4ZHQA 1JJ2U 4MVSA 3OT7A 2JS3A 3P3PA 1KD1W 1EN5A 4MT8A 4LH6A 3JSLA 2ITDC 4B3TO 4PI2A 3ABMB 1SQPH 2ATKC 2HKOA 1WNSA 2Y69C 3H1KH 1AI7A 5GW7A 3J81N 3RGBA 1SQBH 3ZMUA 1MA1A 1K9MW 4DR1B 3MAQA 4Z1MG 3K0DA 1QNMA 3FYEB 1KB9F 1N32B 2F1MA 2UXDB 4IHJB 4I55A 1ORQC 2GSMB 4F4LA 1AJPA 2DYRC 4MVRA 4ZI7B 2MW2B 3AG4C 2UXCB 3A0HZ 4JYBA 2RCVA 2C2AA 4JYAB 2CE4A 3H1IH 4DRXA 3HKCA 1BGYH 2GUZA 1FJGO 1GRJA 4DW0A 2AXTZ 2IBZH 2P6JA 2ZE5A 4PDVA 4DR5O 3K79A 1S77D 2WPDG 1N0JA 4CH3A 4LWSB 4JI8O 4NYKA 3ZX6A 5IWAB 5IT9N 1RP3B 1OCOC 4LFBO 1UJWB 4FLWA 1Y67A 1OCRB 1BHAA 1I94B 3OR6C 2UXBO 4PHZA 3CRQA 3WB2A 4LF9O 2EINC 4YJ2A 4CS3A 4NXMB 4DV2O 4JV5O 1VF6C 4TQFA 1J5EO 1LUWA 3A0BZ 2BTQB 2XT9A 5EYPB 1W59A 3L71H 5EBMC 2QWQB 3O65A 3D36C 2ZCEA 5JWPA 2WLLB 1R73A 1QVGU 3CE2A 1PV0A 1RPRA 2JJ1G 2OTJV 2HJDA 1J95A 5LXTB 4I50A 3SR2C 1R3IC 5DN6G 1BSMA 1QBZA 3K5MA 2F4VO 4GKKO 2ZM6B 4B3MO 1R3JC 2YS8A 2WLKA 1WP7A 1HWYA 4X1YB 2M7WA 1RSOB 2YXYA 1IBKO 3CMAV 4JZ2A 2Q7GA 2BE3A 2Z3YA 3DC5A 1QVFU 1BE3H 2ZDIA 3OAAG 1N34O 2HVJC 4GCZA 2FB5A 3DSQA 2VQFB 4UVBA 1HW7A 2JVDA 3CCSV 3ZHQA 3K9AA 3P30A 5C93A 4P9PA 4F6RA 2F23A 2LQTA 1OCCC 3BAAA 4D6TH 4OXSA 3SYQA 3SPCA 2VQEO 2EIKC 4HNAA 3IFXA 2ZNIA 3ZRSA 3AG2B 1N4CA 2WA3A 1Y76B 1URFA 3B8NA 4X20B 5GONA 5LHGA 1K5QA 4J7KA 3T1YB 4DUZO 4DV3B 3ZMSA 4LF6B 5L3DA 3RT3C 2H3OA 5C8YA 2E74B 3APQA 1HNXB 3BY6A 4MVOA 4RWUA 5B1BC 4YHHO 4DV7O 2E3CA 3GVMA 3VBBA 1R6TA 5KMGB 1GO3F 4BW5A 4X1IA 1TVKA 5FLXN 4DR7O 1Z5WA 3CRRA 4TV9B 1GM9A 2WLIA 1HR0O 1JR9A 4DV0B 4B3RB 4O4IB 4QPJA 5CN0A 3L73H 3ZRVA 5GTIZ 4KUMA 4CH4A 4FK5C 3BVOA 5LOVB 3IAYA 2A79B 2UUAB 1LR1A 5GTHZ 4J7ZA 3WB1A 4O4JB 2XUMA 1Q8IA 4I7ZB 4U3JB 4EFEA 3L72H 2Z0AA 3ZJZA 2PY5A 3CD6V 2YXLA 1NTKH 2EZPA 1AJQA 3CRCA 1FAFA 1SETA 4TOIA 1KYOF 5IJ0B 4FLZA 4U3FH 3B09A 3QG5A 1XBLA 4BR6A 3W7SA 1ZSPA 4HAMA 5IY5B 1D5NA 1D5AA 3PN1A 2XTAA 3ASNC 2XAHA 3SPJA 5LP6B 3RYFA 2XAFA 4FMTA 5KLVH 4BIUA 1Z2GA 2GHYA 4G2KA 2KQXA 3OR7C 1KP2A 4X66B 2PYJA 1FXVA 2QKAA 1ZL8B 4GX1A 1WB7A 3E22B 4WBNA 3LNMB 4QE9A 1XMQO 2E75B 2EILB 2DYSB 3FFQA 1Q81W 4CZZA 3UKMA 2P5OA 3A8TA 3HKEB 2ITCC 1V54C 1M1KW 2ADQB 4LF7O 3AG1C 5CA0B 4CH6A 1H2MA 1QHTA 4IGGA 2XHBA 2AHYA 2P06A 4GZRB 3F7VC 3IJ4A 1YJWV 2YIBD 3QO8A 2QKSA 2L6LA 1OZ0A 3ZRWA 4ZHQB 5IYCO 3WB0A 4O4HA 3I55V 1HP8A 1W0KG 3KCXA 1KKDA 4JYCA 2EX3A 4NR1A 5CBGA 1E79G 4D7SA 5B3SB 2FMLA 1A32A 1XDCA 4FIPC 4LF5O 3X2QC 3HKBA 4UB8Z 4P2ZA 2CGNA 1S5HC 2RJZA 1SZTA 1S72V 3F5TA 3HR0A 1DF4A 3G6BA 2PF4E 4IYHA 4I55B 1FD9A 3RYCA 1QLEC 3ZHTA 3ETDA 5KHKA 4IYIA 2IH3C 4YY3O 2FYUH 1JX9A 1N36O 1NVPD 1JCHA 3CXCU 4DRXB 3HKCB 2F93B 4GX0A 2GUZB 4XBFA 3SYOA 1K4DC 2ZXWB 4PJ0Z 1AVMA 1M9NA
chains in the Genus database with same CATH topology
3KZIZ 3A0HZ 3A0BZ 5GTHZ 4UB8Z 3JCUZ 5B5EZ 5E79Z 5B66Z 4IL6Z 5TISZ 1S5LZ 5KAFZ 4UB6Z 2AXTZ 5KAIZ 5H2FZ 3WU2Z 5GTIZ 4PJ0Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI Z;  3A0H Z;  3A0B Z;  5GTH Z;  4UB8 Z;  3JCU Z;  5B5E Z;  5E79 Z;  5B66 Z;  4IL6 Z;  5TIS Z;  1S5L Z;  5KAF Z;  4UB6 Z;  2AXT Z;  5KAI Z;  5H2F Z;  3WU2 Z;  5GTI Z;  4PJ0 Z; 
#chains in the Genus database with same CATH topology
 3U11 A;  2E5L B;  1N33 B;  2ZIN A;  2HFE C;  1I08 A;  2YIC A;  1GM8 A;  2N74 A;  2Q68 A;  1VQ4 V;  4XDK A;  3CCM V;  5IYB O;  1DK1 A;  4I0X B;  3M7M X;  2NNU A;  1GTO A;  4DR2 O;  1FXK A;  1E1Q G;  3CSX A;  1NU1 H;  5AG2 A;  4AIL C;  4UCT A;  1KP3 A;  3K06 A;  2EUL A;  1V55 C;  4K3A A;  4G28 B;  2P90 A;  1YI2 V;  3STL C;  2QTO A;  2QWR B;  1BS3 A;  4YJ2 B;  1G1X B;  4NXN O;  4MW3 A;  3PJS K;  4GUN A;  1PP9 H;  5CA1 A;  1Q5O A;  2Y4U A;  2UU9 O;  3BPZ A;  3WG7 C;  1SER A;  1CPY A;  2F66 C;  2X6B A;  2QDO A;  2ARH A;  3L75 H;  3A0R A;  2Y4T A;  3VQY A;  1X4T A;  2ZT9 B;  4OX9 B;  3H01 A;  4WFG A;  3SPG A;  1XIL A;  5E1A C;  1K8A W;  2Q7E A;  4BIO A;  2AZ2 A;  4I50 B;  4BIZ A;  4DV5 B;  5JH7 B;  1AI4 A;  3CC4 V;  4J9Y B;  3LSU A;  3QNE A;  4JTC B;  3FB8 C;  5JJE B;  1JA8 A;  2OIE A;  2HP8 A;  3B2E E;  1AP5 A;  2EIJ B;  3K5O A;  4HYO A;  4A5U B;  4KP4 A;  2QWO B;  3UO3 A;  4DV1 B;  4NTW A;  2AHZ A;  3UM7 A;  2EZO A;  1YJ9 V;  4X64 O;  2IJI A;  1AR4 A;  5B1A B;  4JTA B;  1IDS A;  3H9V A;  3OFN G;  4F6R B;  1VQN V;  1IUR A;  2CAZ C;  1Y6X A;  1YF2 A;  5L3C A;  1RPO A;  4B3T B;  3M8A A;  2YC0 A;  1H2L A;  4FLY A;  1HNW O;  4HNA B;  4TUY B;  1MOF A;  1YSC A;  1K7D A;  1VQO V;  2JJ2 G;  1XNQ O;  1WJZ A;  3SYP A;  1QQC A;  2Q7H A;  1IBL O;  2RQ6 A;  1SC5 B;  1JFF A;  1H2S B;  5GON B;  1R3L C;  4FVM A;  3HKD A;  1EZJ A;  5EC1 C;  2Q9L A;  1VQ7 V;  3JAW B;  4TSF G;  5C8Y B;  3KZI Z;  4FFK A;  4H13 B;  1GM7 A;  4FM2 A;  4B08 A;  1LNQ A;  5HFL A;  3E2E A;  3R66 A;  1MAB G;  3ZRX A;  1TVK B;  3ABK B;  1FJG B;  5LMU B;  2WLI B;  1I0H A;  1YVW A;  2QJ1 A;  2QSA A;  4DR5 B;  3VQV A;  2DWE C;  3K58 A;  4QGP A;  1YEW A;  4DR6 O;  2O57 A;  1FFT B;  3SPI A;  5LA6 A;  5BZB A;  2GV9 A;  3BEH A;  5D5P A;  3GWO A;  4LFB B;  2EIM C;  3T1C A;  3ABL C;  4JI2 B;  3J7A U;  1KMI Z;  1DF5 A;  4DW1 A;  2YEV A;  1EM1 A;  4JAS A;  2Q6A A;  2UXB B;  4EFB A;  4LF9 B;  3P3N A;  1FXH A;  4MVU A;  5D5Q A;  4DV2 B;  1S0V A;  4JV5 B;  1AI6 A;  1J5E B;  4LFC O;  3JCU Z;  1AB3 A;  4JI7 O;  5CA3 A;  2VRZ A;  2R70 A;  2KSD A;  2FTK A;  3CP1 A;  4L87 A;  3UQ8 A;  3K0G A;  1R6K A;  1FYJ A;  4LP8 A;  4I9Q A;  4DR4 O;  1SS3 A;  3BHP A;  1PL4 A;  4QPK A;  2V7Q G;  1Q43 A;  2M6Y A;  1TUE B;  4H33 A;  4B3S O;  2IU3 A;  4GX2 A;  3K08 A;  3BRC A;  1K34 A;  4MSW C;  4X89 A;  4X65 O;  3T4D A;  2UUB O;  1CEZ A;  2YI8 A;  4GKK B;  4B3M B;  4JI1 O;  2WLN A;  5KAI Z;  4L8J A;  4I9W A;  1IX9 A;  3QF7 A;  3CPW U;  3T1H O;  1IBK B;  4ZOL B;  1XNR O;  3K03 A;  5L3B A;  2Y48 A;  5DM6 V;  1ARO P;  2QM4 A;  1N34 B;  3ZRW B;  2Q8V A;  1GN3 A;  1U96 A;  2NLJ C;  4O4H B;  4GLX A;  2EJ7 A;  3CJH A;  3ZS8 C;  1OCZ C;  3THO A;  2UUC O;  1M56 C;  3ML0 A;  1NBM G;  4LFA O;  1VF5 B;  3JCZ A;  3SJA C;  4PDL A;  1VQ5 V;  3R65 A;  3E86 A;  2FKX A;  2W6J G;  1VQ6 V;  3STZ C;  1MZF A;  1G6U A;  1SZX A;  3HKB B;  5KHJ A;  3CCE V;  1BMF G;  4F6E A;  2WLJ A;  3OM3 B;  5LMN O;  3QO5 A;  2N05 A;  1NKD A;  4FLU A;  5EIB D;  1YDX A;  4DUZ B;  4TT3 G;  2ILM A;  2JGD B;  1VF6 A;  3BA9 A;  3RYC B;  2PI5 A;  5IJ9 A;  4YHH B;  1F23 A;  1XHX A;  2V1D A;  1KEC A;  4K0K O;  2GBO A;  3D36 A;  3LDE A;  4DR7 B;  4I5S A;  1BZK A;  1HR0 B;  3MHH C;  4WCE V;  3AG3 C;  5FL7 G;  4WFE A;  3JD3 A;  4AI8 A;  3JYC A;  4AHC A;  1ZTE A;  1WLE A;  2LW7 A;  5B1O A;  1DLB A;  2VWK A;  2XAG A;  4PI0 A;  2JIZ G;  3LDD A;  1XL6 A;  2WSS G;  3OTO O;  3JD2 A;  3QTC A;  1FXK B;  3W7U A;  3L70 H;  1NR1 A;  4ABM A;  3FAV A;  3ZHR A;  4FFB A;  3VQW A;  3C3T A;  1EFR G;  3C90 A;  4MTO A;  1VP7 A;  5LGU A;  1K92 A;  4LNU A;  3M99 B;  4MVM A;  5H6R A;  3OW2 U;  2IJK A;  2VS0 A;  1MNG A;  3J80 N;  5CA1 B;  1XOU A;  2E76 B;  4PA6 A;  2ZKO A;  2ZNJ A;  5LYJ A;  4C7U A;  2R9A A;  1CP9 A;  2QTS A;  1M5I A;  2CGO A;  2DQ3 A;  3A2F A;  3CCL V;  1V55 B;  5H5N A;  1NH2 B;  3JAL B;  1QCE A;  1RM1 B;  2R72 A;  1XMQ B;  1AIL A;  4X1K B;  2Z5U A;  3VOU A;  3S3X A;  5B1N A;  3WG7 B;  4U7N A;  4JI3 O;  4J41 A;  4LF7 B;  4W4L A;  4TV8 A;  2DJV A;  1ZWI C;  4ASU G;  1IZ3 A;  3DC6 A;  1VIB A;  1H2K A;  2MK3 A;  3DXR A;  5DED A;  2LFS A;  3FD9 A;  3N2K A;  4K8X A;  2XAJ A;  4JF3 A;  3TCU A;  4LBE C;  1TUB B;  2P4V A;  3ABM C;  1XHZ A;  3K57 A;  3CB2 A;  2B5U A;  4I4T A;  1M57 B;  2BOB C;  5A2Q N;  2QKC A;  3B8M A;  2OCC C;  5L3G A;  3KKY A;  2EJR A;  2VWJ A;  4J11 A;  3UCS C;  1GN4 A;  1B6Q A;  4Z1V A;  4J10 A;  1PNL A;  2PGG A;  3AK3 A;  4LF5 B;  4QNH B;  2QM7 A;  5KAF Z;  3TXQ A;  4UB6 Z;  2D2C B;  5ITZ A;  1JJO A;  4UFZ A;  1JFF B;  2PI4 A;  3OMI B;  4EKW A;  5H9C A;  4W4K A;  4GX5 A;  5EC2 C;  5JJJ B;  2HHH O;  4UCU A;  4TWK A;  4YJ3 A;  4YY3 B;  4JTD B;  3RVZ A;  2JK5 C;  2IU0 A;  1N36 B;  3EFF K;  4PEL A;  4PA9 A;  3E8F A;  3CRA A;  2LGQ A;  2Q0O C;  5CB4 A;  3ZCC A;  1SKV A;  1THZ A;  5BR8 O;  3H1L H;  1SF9 A;  3GWK C;  4QE7 A;  1MSW D;  2ZE7 A;  1NZ6 A;  1S5J A;  3ZN1 A;  4B3R O;  5LA6 B;  4FM1 A;  1OCR C;  1T5E A;  3OEE G;  4DR2 B;  1VQ9 V;  4KL1 A;  2P7T C;  2Q69 A;  3ZMZ A;  1NQT A;  3D8C A;  4GT1 A;  4LWS A;  2Q73 A;  4R6Z A;  5EBW C;  2WWW A;  3LSS A;  1BL8 A;  2YEV B;  2DOS A;  1P4R A;  5EBL C;  5LGN A;  1L8D A;  4NXN B;  2BTO A;  2UU9 B;  1S5L Z;  1WA8 A;  4NVP A;  4FJC C;  4P30 A;  2WAM A;  1QR8 A;  2EIM B;  3Q4H A;  3B40 A;  4GKJ O;  1AJN A;  4WF9 V;  2P67 A;  3UO2 A;  3K59 A;  2Q67 A;  5EYP A;  2Q4P A;  2Y69 B;  4WFF A;  4XDL A;  3E83 A;  4PA7 A;  2WLL A;  4J80 A;  1HNZ O;  4UCV A;  4JI6 B;  1L1F A;  4JPR A;  3G80 A;  5KA6 A;  4X8A A;  5LXT A;  1W0J G;  2R9I A;  3EVK A;  3I56 V;  3CCU V;  1EN6 A;  1K5S A;  2JRI A;  4KFM A;  5K1P A;  1VF7 A;  2DYR B;  2K9P A;  3AG4 B;  4X62 O;  1SRY A;  2G38 A;  1IVS A;  2ZIM A;  1QLN A;  4X1Y A;  1XI1 A;  4X64 B;  4H0L B;  4AQY O;  3CJH B;  2B1G A;  3AG2 C;  1L0N H;  5J2T A;  4JI0 B;  4JYY A;  4JAA A;  5HFM A;  1G8M A;  1WN7 A;  1HNW B;  1OJH A;  4FZ0 A;  3UT5 A;  2KKW A;  4N23 A;  4RQF A;  4MTF A;  3AG7 A;  1OCO B;  1I5Y A;  5EZY A;  1XNQ B;  2A9H A;  5CBF A;  4FLT A;  2CH7 A;  4DV6 O;  2Q0A A;  1IBL B;  4Z2W A;  1YTF D;  1OCZ B;  3CCJ V;  1H8E G;  3ZHU A;  2RNB A;  4RUE A;  1IXB A;  2EIN B;  4O2B A;  4NTY A;  1QR9 A;  1KKC A;  3B77 A;  1B04 A;  3L9D A;  1JMK C;  3ZHS A;  1UPG A;  3S3W A;  1H8H G;  2CTP A;  2HJF C;  2HLD G;  5CMU A;  3GB7 C;  3O9O A;  3W7X A;  4LF8 O;  4BWA A;  3K04 A;  3JAS A;  2GDS A;  4LF4 O;  1H38 A;  1P49 A;  1SA0 A;  1IBM O;  3MD0 A;  1JPX A;  1E1R G;  5EIB C;  5J2U A;  2OYQ A;  1Q7Y W;  4DR6 B;  2IJH A;  2OTL V;  3K5N A;  4IIJ A;  3JAK A;  3E8B A;  3FKS G;  4YIP A;  2ZR2 A;  1GMG A;  1SQX H;  2BSK A;  4DV4 O;  1PNK A;  4ZIB A;  2ZIO A;  2GTS A;  2W0F C;  2OIG A;  2JEU A;  1S3J A;  1H2N A;  3N27 A;  4YXW G;  3WU2 Z;  5LOV A;  3T4Z A;  2QE7 G;  5IY5 C;  3ZBH A;  4O2A A;  3FAV B;  5KX5 A;  4FFB B;  5IYZ A;  4RQE A;  5LP6 C;  5LL6 Y;  1P7G A;  1K4C C;  1AI5 A;  1R3K C;  4LC1 A;  3AG3 B;  4LNU B;  1NI8 A;  2A06 H;  3H1H H;  4DR3 O;  4LFC B;  1VQ8 V;  4PD4 F;  4JI7 B;  3OTF A;  1YZB A;  2XND G;  5IDJ A;  5LYJ B;  1FFX A;  2JS5 A;  4E4E A;  2DYS C;  3OD4 A;  2WLM A;  1OCC B;  5IE9 A;  5JCO C;  1XMO O;  3SPH A;  1MG1 A;  2B9Z A;  1SQG A;  2EIK B;  1MMM A;  4G27 B;  2F43 G;  2LW1 A;  1VMG A;  2X6A A;  5B5E Z;  3IGA C;  3TET A;  1M4U A;  1WB8 A;  1NTZ H;  3SJC C;  4TQD A;  5JQG A;  4X65 B;  4X1I B;  4CH5 A;  2UUB B;  1TGO A;  3CX5 F;  4JI1 B;  4DK0 A;  1FKA O;  4MVZ A;  4TV8 B;  1IXM A;  3ASO C;  5BXZ A;  2PZS A;  3D3I A;  3EXA A;  5B1B B;  3T1H B;  3DXR B;  1BHB A;  3QVN A;  3E35 A;  1DGS A;  5F2V O;  3TK1 A;  4JI8 B;  3N2K B;  1YTF B;  3IC9 A;  3ZN0 A;  5B3S C;  4ZKI A;  4K35 A;  5H2F Z;  1KQS U;  4I4T B;  4CC5 A;  2UUC B;  4JI4 O;  1NTM H;  5H6Q A;  1PL0 A;  2A3Q A;  4LFA B;  2BOC C;  4B7E A;  1Y66 A;  3CC7 V;  3APO A;  3OGC C;  4CS2 A;  4LCU C;  1R6N A;  4E2L A;  1YCI A;  3U0Z A;  4P9O A;  2ZE6 A;  3RYF B;  2JGU A;  3CYO A;  5LMN B;  5ITZ B;  1OHH G;  2CTW A;  4JI5 O;  3LSQ A;  1O9G A;  4R8C A;  2OCC B;  1W2B U;  3BFR A;  2A0L A;  2PUS A;  4HBN A;  4WBN B;  1MSD A;  1YXB A;  1FS0 G;  2ZR3 A;  2ADP A;  3JAR A;  3ASN B;  5FPO A;  2QM8 A;  5TIS Z;  4YJ3 B;  5KHG A;  1RFY A;  3SJB C;  3ZHV A;  3VQX A;  1Y74 A;  2ZXW C;  2F4V B;  4K0K B;  3E8H A;  3BCC H;  3RYI A;  5FNV A;  5BY1 A;  4X9Q A;  3WFV A;  5IYD O;  4OPH A;  3TGU H;  5BMV A;  4JAV A;  4DUY O;  4Q20 A;  5CB4 B;  2R9R B;  1AR5 A;  4KHP O;  5LMU O;  3U10 A;  1V54 B;  1NH2 D;  2V4D A;  3ABT A;  3SDL A;  3AG1 B;  1ROP A;  3OTO B;  2K1E A;  2XAS A;  5LHH A;  4MTX A;  4I0X A;  2VQE B;  5EK0 A;  2FL4 A;  4LH7 A;  4JI2 O;  5JVD A;  2X6C A;  1WA8 B;  3F7Y C;  4J7J A;  3FB7 C;  3Q4H B;  5K1X A;  1M93 A;  5KUM A;  1VQK V;  3ETG A;  1YIJ V;  2RN9 A;  4DR1 O;  1S76 D;  1NT2 B;  3G4S V;  5LBQ A;  4DV7 B;  1N32 O;  3X2Q B;  3JD4 A;  2UXD O;  2YIB A;  4X88 A;  2KG7 A;  3I5D A;  3RFR A;  2WLH A;  2EIJ C;  1BT8 A;  3CCQ V;  4JI3 B;  2W0X A;  1CXZ B;  1Q3E A;  2JDI G;  2UXC O;  2LFR A;  1PKX A;  2GTA A;  1YJN V;  2ZDI C;  4JYA O;  1O9H A;  3FB6 C;  1QLE B;  5JH7 A;  5KA5 A;  1L0L H;  3E8G A;  4UUJ C;  5B1A C;  2IW5 A;  3CME V;  2QR4 A;  4NKG B;  4QJF B;  1BQ0 A;  3CRM A;  3JSN A;  4MTG A;  2JEX A;  4EEQ A;  4FPP A;  5IWA O;  2YUA A;  2XOK G;  2YIA A;  3F5W C;  1F4M A;  1GH6 A;  4H37 A;  5J2T B;  3RN4 A;  3D3Q A;  2LJ2 A;  3CC2 V;  3H1J H;  3SGI A;  3UT5 B;  1BCC H;  1R1B A;  1KUQ A;  1EN4 A;  4WFB V;  1I94 O;  1VEW A;  3JD0 A;  5EZY B;  4NXM O;  5A9G A;  4KXR A;  2CH7 B;  4TUY A;  4R50 A;  1Q6I A;  2P22 C;  2L35 A;  3W7W A;  4DYL A;  3SYA A;  2OWO A;  3K5L A;  4O2B B;  2AW9 A;  3FX7 A;  2HHH B;  3ABK C;  1XUQ A;  1OV9 A;  4J42 A;  4HZ3 A;  3N2G A;  3TXS A;  2B1I A;  4EB6 A;  1XL4 A;  3JAW A;  3JAT A;  3HPL C;  4O4L A;  3JAS B;  3G71 V;  4RAI A;  1HDJ A;  1V9P A;  1NR7 A;  3RYH A;  1SA0 B;  4XDJ A;  5BR8 B;  3EHB B;  2ZM6 O;  4PA4 A;  3OUS A;  2OT5 A;  2W6I G;  1TA8 A;  5J2U B;  4DO2 A;  1B06 A;  1NJI W;  4IIJ B;  3JAK B;  2BSK B;  1SES A;  4RUF A;  1H2G A;  3JAM N;  2YI9 A;  4UV9 A;  1K73 W;  4O2A B;  5KHI A;  5KX5 B;  3G6E V;  5IYZ B;  2VQF O;  3ZIA G;  2Y0I A;  4NTX A;  1I7F A;  1KC8 W;  3NR7 A;  2ZD9 A;  4DXW A;  4MW8 A;  4Q6G A;  4UCS A;  4UVA A;  1AR1 B;  1X59 A;  3CCV V;  1U97 A;  1GN2 A;  2UXN A;  3HKD B;  1FFX B;  4FM0 A;  4GKJ B;  2LO1 A;  3ZMT A;  1XRE A;  1VQP V;  2BCC H;  2LGW A;  1SQV H;  1PPJ H;  2X0L A;  2HG5 C;  3T1Y O;  2D3O W;  4DV3 O;  4IHJ A;  4LF6 O;  2DQ0 A;  2X7R B;  5JQG B;  1HNZ B;  1HNX O;  2QWN B;  3CEI A;  4ZI7 A;  1KU9 A;  1ZUQ A;  2A7W A;  3LDC A;  1F51 A;  2QA4 V;  4CS4 A;  1ZAU A;  1UFI A;  3FYI B;  4UV8 A;  2KB1 A;  3SJQ C;  4DV0 O;  1Z5V A;  4X62 B;  3K3W A;  3L74 H;  2YSU B;  3RVY A;  4FLX A;  2HR3 A;  1PD3 A;  5L3E A;  1SQF A;  2N04 A;  3AEI A;  4IT5 A;  4AQY B;  2ETN A;  2UUA O;  1N8R W;  2YXH A;  4ZOL A;  2IJJ A;  3K9S A;  1EBO A;  3ASO B;  5LGT A;  1K97 A;  2QEX V;  3ETE A;  1M90 W;  1I5X A;  2YDE A;  4FLV A;  3ABL B;  3CS5 A;  4DV6 B;  2ZQM A;  3ETQ A;  2BTQ A;  3TJT A;  3BAB A;  4K8Z A;  1DTO A;  2CTR A;  1F7Y A;  2CDY A;  1B3Q A;  4GYC B;  3ZED A;  5JJN B;  5KUK A;  4X66 O;  3JAR B;  4OGQ B;  1JOY A;  1COW G;  1N0N A;  4H44 B;  3IC7 A;  1Y74 B;  4D7T A;  4LF8 B;  2JGD A;  4U7O A;  4YIO A;  5FNV B;  3RYI B;  4LF4 B;  3E89 A;  5BMV B;  2Q5Z A;  1TAE A;  4BAY A;  1IBM B;  1K33 A;  3FB5 C;  3OUF A;  2UXX A;  5B66 Z;  4IL6 Z;  1LUV A;  4PV1 B;  1FXK C;  2QWP B;  1JVM A;  4FZ1 A;  4UVC A;  3C3S A;  1YIT V;  1KBH A;  1RSO A;  1VQM V;  2F95 B;  2RMK B;  4DV4 B;  4MS2 A;  3OGI B;  3MDS A;  4ZBM A;  1ZLZ A;  1D2D A;  4LR3 A;  2HEP A;  1XEQ A;  2PTM A;  2RDC A;  1NS1 A;  2DMX A;  4MVQ A;  1Q90 D;  1YHQ V;  4DR3 B;  4ICG A;  2NN4 A;  1GKF A;  5JVD B;  3CCR V;  4R7C A;  5J9P C;  3RWR D;  1M56 B;  1EZV H;  3ICX A;  4RO2 A;  1RM1 C;  2XAQ A;  1QU7 A;  1Y76 A;  3AK2 A;  1XMO B;  2IH1 C;  4N21 A;  3G67 A;  4X20 A;  5IJ9 B;  5LHI A;  2OCH A;  3OEH G;  3P32 A;  2KG7 B;  1WAZ A;  4PDR A;  3CWB H;  5CBH A;  3JAL A;  1Q86 W;  4UCR A;  4OPA A;  4X1K A;  5KMG A;  2QGN A;  1US6 A;  3ABU A;  1BQZ A;  3NXS A;  4TV9 A;  4JZG A;  2DW4 A;  4JI6 O;  4O4I A;  1M57 C;  3T2M A;  4BW9 A;  1PM9 A;  2AGA A;  2LP7 A;  3ZMV A;  1GAX A;  3LUT B;  2E5L O;  1N33 O;  1PNM A;  4PDM A;  3DGE A;  3B4S A;  1P84 F;  2H8P C;  3CXH F;  4JI4 B;  1Y4M A;  2H94 A;  4O4J A;  2DN9 A;  1ENV A;  3OE7 G;  4U3J A;  3RW0 A;  5DEC A;  3SYC A;  2AZ0 A;  1Q6H A;  1TUB A;  2WA4 A;  3HB3 B;  1Q6U A;  2DE0 X;  3JD1 A;  3OMN B;  5FPR A;  2ZE8 A;  5IJ0 A;  3MHS C;  3KCY A;  5L3F A;  2CK3 G;  3LNN A;  4J9Z B;  1P7B A;  1G4Y B;  4JI0 O;  1NVP B;  2P4K A;  2EIL C;  2NR5 A;  4JI5 B;  4JGS A;  5LP6 A;  2Y0P A;  1F4N A;  1WPB A;  4DR4 B;  3RBZ A;  2ODM A;  4B3S B;  1FPO A;  3KG2 A;  1VAR A;  4JAU A;  1JQ0 A;  1ZL8 A;  2DWD C;  3BA8 A;  5KHH A;  1GK9 A;  3N2G B;  4CC6 A;  4OX9 O;  3E22 A;  1WPX A;  4WFH A;  4EB6 B;  1VQL V;  1GN6 A;  4WFA V;  4B7K A;  3JAT B;  1SQQ H;  3AK1 A;  2EBO A;  4O4L B;  2CUG A;  3HKE A;  5JCO A;  4DUY B;  1ZX3 A;  4DV5 O;  3RYH B;  4DK1 A;  5E79 Z;  5CA0 A;  2HVK C;  1WP8 A;  4UCO A;  4PA3 A;  1XNR B;  1Q82 W;  4KHP B;  1MZE A;  2PYL A;  3OMA B;  4NB5 A;  4QIW F;  1K3E A;  3CHX A;  3QO7 A;  1AP6 A;  3DTU B;  4UXN A;  3W7T A;  1XQ8 A;  2CTQ A;  4DV1 O;  2IM9 A;  4CBC A;  2YID A;  4ZHQ A;  1JJ2 U;  4MVS A;  3OT7 A;  2JS3 A;  3P3P A;  1KD1 W;  1EN5 A;  4MT8 A;  4LH6 A;  3JSL A;  2ITD C;  4B3T O;  4PI2 A;  3ABM B;  1SQP H;  2ATK C;  2HKO A;  1WNS A;  2Y69 C;  3H1K H;  1AI7 A;  5GW7 A;  3J81 N;  3RGB A;  1SQB H;  3ZMU A;  1MA1 A;  1K9M W;  4DR1 B;  3MAQ A;  4Z1M G;  3K0D A;  1QNM A;  3FYE B;  1KB9 F;  1N32 B;  2F1M A;  2UXD B;  4IHJ B;  4I55 A;  1ORQ C;  2GSM B;  4F4L A;  1AJP A;  2DYR C;  4MVR A;  4ZI7 B;  2MW2 B;  3AG4 C;  2UXC B;  3A0H Z;  4JYB A;  2RCV A;  2C2A A;  4JYA B;  2CE4 A;  3H1I H;  4DRX A;  3HKC A;  1BGY H;  2GUZ A;  1FJG O;  1GRJ A;  4DW0 A;  2AXT Z;  2IBZ H;  2P6J A;  2ZE5 A;  4PDV A;  4DR5 O;  3K79 A;  1S77 D;  2WPD G;  1N0J A;  4CH3 A;  4LWS B;  4JI8 O;  4NYK A;  3ZX6 A;  5IWA B;  5IT9 N;  1RP3 B;  1OCO C;  4LFB O;  1UJW B;  4FLW A;  1Y67 A;  1OCR B;  1BHA A;  1I94 B;  3OR6 C;  2UXB O;  4PHZ A;  3CRQ A;  3WB2 A;  4LF9 O;  2EIN C;  4YJ2 A;  4CS3 A;  4NXM B;  4DV2 O;  4JV5 O;  1VF6 C;  4TQF A;  1J5E O;  1LUW A;  3A0B Z;  2BTQ B;  2XT9 A;  5EYP B;  1W59 A;  3L71 H;  5EBM C;  2QWQ B;  3O65 A;  3D36 C;  2ZCE A;  5JWP A;  2WLL B;  1R73 A;  1QVG U;  3CE2 A;  1PV0 A;  1RPR A;  2JJ1 G;  2OTJ V;  2HJD A;  1J95 A;  5LXT B;  4I50 A;  3SR2 C;  1R3I C;  5DN6 G;  1BSM A;  1QBZ A;  3K5M A;  2F4V O;  4GKK O;  2ZM6 B;  4B3M O;  1R3J C;  2YS8 A;  2WLK A;  1WP7 A;  1HWY A;  4X1Y B;  2M7W A;  1RSO B;  2YXY A;  1IBK O;  3CMA V;  4JZ2 A;  2Q7G A;  2BE3 A;  2Z3Y A;  3DC5 A;  1QVF U;  1BE3 H;  2ZDI A;  3OAA G;  1N34 O;  2HVJ C;  4GCZ A;  2FB5 A;  3DSQ A;  2VQF B;  4UVB A;  1HW7 A;  2JVD A;  3CCS V;  3ZHQ A;  3K9A A;  3P30 A;  5C93 A;  4P9P A;  4F6R A;  2F23 A;  2LQT A;  1OCC C;  3BAA A;  4D6T H;  4OXS A;  3SYQ A;  3SPC A;  2VQE O;  2EIK C;  4HNA A;  3IFX A;  2ZNI A;  3ZRS A;  3AG2 B;  1N4C A;  2WA3 A;  1Y76 B;  1URF A;  3B8N A;  4X20 B;  5GON A;  5LHG A;  1K5Q A;  4J7K A;  3T1Y B;  4DUZ O;  4DV3 B;  3ZMS A;  4LF6 B;  5L3D A;  3RT3 C;  2H3O A;  5C8Y A;  2E74 B;  3APQ A;  1HNX B;  3BY6 A;  4MVO A;  4RWU A;  5B1B C;  4YHH O;  4DV7 O;  2E3C A;  3GVM A;  3VBB A;  1R6T A;  5KMG B;  1GO3 F;  4BW5 A;  4X1I A;  1TVK A;  5FLX N;  4DR7 O;  1Z5W A;  3CRR A;  4TV9 B;  1GM9 A;  2WLI A;  1HR0 O;  1JR9 A;  4DV0 B;  4B3R B;  4O4I B;  4QPJ A;  5CN0 A;  3L73 H;  3ZRV A;  5GTI Z;  4KUM A;  4CH4 A;  4FK5 C;  3BVO A;  5LOV B;  3IAY A;  2A79 B;  2UUA B;  1LR1 A;  5GTH Z;  4J7Z A;  3WB1 A;  4O4J B;  2XUM A;  1Q8I A;  4I7Z B;  4U3J B;  4EFE A;  3L72 H;  2Z0A A;  3ZJZ A;  2PY5 A;  3CD6 V;  2YXL A;  1NTK H;  2EZP A;  1AJQ A;  3CRC A;  1FAF A;  1SET A;  4TOI A;  1KYO F;  5IJ0 B;  4FLZ A;  4U3F H;  3B09 A;  3QG5 A;  1XBL A;  4BR6 A;  3W7S A;  1ZSP A;  4HAM A;  5IY5 B;  1D5N A;  1D5A A;  3PN1 A;  2XTA A;  3ASN C;  2XAH A;  3SPJ A;  5LP6 B;  3RYF A;  2XAF A;  4FMT A;  5KLV H;  4BIU A;  1Z2G A;  2GHY A;  4G2K A;  2KQX A;  3OR7 C;  1KP2 A;  4X66 B;  2PYJ A;  1FXV A;  2QKA A;  1ZL8 B;  4GX1 A;  1WB7 A;  3E22 B;  4WBN A;  3LNM B;  4QE9 A;  1XMQ O;  2E75 B;  2EIL B;  2DYS B;  3FFQ A;  1Q81 W;  4CZZ A;  3UKM A;  2P5O A;  3A8T A;  3HKE B;  2ITC C;  1V54 C;  1M1K W;  2ADQ B;  4LF7 O;  3AG1 C;  5CA0 B;  4CH6 A;  1H2M A;  1QHT A;  4IGG A;  2XHB A;  2AHY A;  2P06 A;  4GZR B;  3F7V C;  3IJ4 A;  1YJW V;  2YIB D;  3QO8 A;  2QKS A;  2L6L A;  1OZ0 A;  3ZRW A;  4ZHQ B;  5IYC O;  3WB0 A;  4O4H A;  3I55 V;  1HP8 A;  1W0K G;  3KCX A;  1KKD A;  4JYC A;  2EX3 A;  4NR1 A;  5CBG A;  1E79 G;  4D7S A;  5B3S B;  2FML A;  1A32 A;  1XDC A;  4FIP C;  4LF5 O;  3X2Q C;  3HKB A;  4UB8 Z;  4P2Z A;  2CGN A;  1S5H C;  2RJZ A;  1SZT A;  1S72 V;  3F5T A;  3HR0 A;  1DF4 A;  3G6B A;  2PF4 E;  4IYH A;  4I55 B;  1FD9 A;  3RYC A;  1QLE C;  3ZHT A;  3ETD A;  5KHK A;  4IYI A;  2IH3 C;  4YY3 O;  2FYU H;  1JX9 A;  1N36 O;  1NVP D;  1JCH A;  3CXC U;  4DRX B;  3HKC B;  2F93 B;  4GX0 A;  2GUZ B;  4XBF A;  3SYO A;  1K4D C;  2ZXW B;  4PJ0 Z;  1AVM A;  1M9N A; 
#chains in the Genus database with same CATH homology
 3KZI Z;  3A0H Z;  3A0B Z;  5GTH Z;  4UB8 Z;  3JCU Z;  5B5E Z;  5E79 Z;  5B66 Z;  4IL6 Z;  5TIS Z;  1S5L Z;  5KAF Z;  4UB6 Z;  2AXT Z;  5KAI Z;  5H2F Z;  3WU2 Z;  5GTI Z;  4PJ0 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...