5H2FZ

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
62
structure length
62
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 25
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5h2fZ00
5E79Z 1S5LZ 5B66Z 2AXTZ 4IL6Z 3A0HZ 3A0BZ 5KAFZ 3JCUZ 5H2FZ 3WU2Z 5GTHZ 5TISZ 5GTIZ 4UB8Z 4UB6Z 5B5EZ 5KAIZ 3KZIZ 4PJ0Z
chains in the Genus database with same CATH superfamily
1XEQA 3SJQC 4HAMA 1IBKB 2ZQMA 3CRCA 4WCEV 4DUZB 3BY6A 4X89A 3ZN1A 1D5AA 3CCMV 2DYSC 1P49A 1OZ0A 2A06H 2AHZA 4X8AA 3OTOB 1SQQH 4AI8A 2CH7A 2DJVA 3QG5A 1FS0G 1XUQA 1UJWB 4DR4B 1I5YA 2Q7GA 2Y0IA 2DMXA 2WLLA 3JAMN 4IHJB 4ZKIA 1K5QA 2EJ7A 1FD9A 4RWUA 4DV0B 5LL6Y 1BZKA 4X1KA 4FVMA 4X66B 1UPGA 4CS3A 4I4TB 1TA8A 1ZSPA 3DSQA 3G6EV 5EYPA 3CE2A 3CX5F 2GV9A 3B8MA 4MVQA 4DW1A 3T2MA 4JYAB 3JD0A 1PNMA 4GCZA 4R50A 3RYHA 3FYEB 2K1EA 2FB5A 1OCRC 2UUBB 1W59A 2CH7B 4JTAB 1G4YB 1TAEA 3UQ8A 4N23A 2VRZA 4B3SO 2WLLB 4PA7A 1GN4A 2QKCA 1BGYH 3ABLB 4LWSA 5L3CA 4U3FH 4H37A 4H44B 3CRQA 4ICGA 3JD1A 2HHHO 1MZEA 2HR3A 4X1KB 1R3LC 4WFBV 1HR0B 2BTOA 1EZJA 1I0HA 3CCRV 5J2TA 4B3MB 5EYPB 3N27A 4AQYB 2FYUH 5EIBC 3UKMA 4JI3B 3RYHB 2YC0A 2UXCO 3I56V 3KKYA 1WNSA 4I7ZB 4PDRA 5JJNB 3JD2A 1ENVA 5CMUA 3SPJA 3DXRB 5EK0A 3ABKB 5FNVA 3D3IA 2WLHA 5HFLA 4U7NA 2IJJA 3AG4B 2P6JA 4LFBB 3CRMA 2P90A 4LWSB 4MT8A 1GRJA 4UCVA 1H2LA 1M57B 2P67A 3H1JH 2IU3A 5B5EZ 3K3WA 2QA4V 1VP7A 1V55B 4OGQB 2UXBB 2QR4A 1R1BA 4DR6O 1MABG 5J2TB 1W0KG 2LFSA 2LGWA 1N36B 1K4DC 4DV3O 2GTSA 4TSFG 2LFRA 3ZMVA 1FXHA 3E2EA 3E35A 4FFBA 4DV5B 3B09A 3CP1A 1L8DA 1L0NH 1JPXA 5BXZA 1S5LZ 3SDLA 5FNVB 3GWKC 4XBFA 1HNXO 4FFKA 1AR4A 1N0JA 5H2FZ 5FL7G 3SYQA 4JI2O 1IX9A 4DRXA 1BL8A 5GONA 3F5WC 4DV6B 4LF4O 4JZ2A 2FKXA 1NR7A 3IC9A 2A7WA 4MVMA 4UCOA 2OIEA 3OR6C 1Q8IA 3TXSA 3A0BZ 4FFBB 5KUKA 5JQGA 2BE3A 3W7SA 5TISZ 1GTOA 4JI8O 3JAKA 1NVPD 5BY1A 1IVSA 2FTKA 3T1HO 2ITCC 3FB6C 2RN9A 3ZMZA 3ASNB 3AG2C 5FPRA 3ZHQA 1IBKO 4DUZO 4DR2B 2WSSG 4DRXB 4LFAB 5GONB 2YI9A 1MZFA 3CSXA 3OE7G 2YIAA 4B3RB 3OTOO 2F43G 3CCUV 1Y76A 2Y48A 4DR4O 2YDEA 3N2KA 4PHZA 5JQGB 4WFAV 4BIZA 2AHYA 2XUMA 2P06A 5JCOA 4CBCA 1WB7A 3MHSC 2F95B 1AJNA 1T5EA 1AP6A 3JAKB 4FLWA 2LO1A 4FLUA 4UCTA 4DV0O 3OGIB 4X66O 4LF9B 4QPKA 3SGIA 3RFRA 4FZ0A 1NTKH 5EIBD 1F4MA 1N34B 4FPPA 3SR2C 1YVWA 1F23A 3ZRVA 3G71V 5DM6V 2UUBO 2QJ1A 1Q82W 1Y76B 2AW9A 4CH6A 1KD1W 2WPDG 2EX3A 1SQVH 2Q68A 3N2KB 4GKKB 1QNMA 4K35A 3L70H 3RT3C 1H2NA 3H01A 1YI2V 1W0JG 3Q4HA 1VEWA 4YXWG 2VWJA 1HR0O 2UUAB 4BR6A 2OT5A 5CB4A 3K0GA 4NTWA 2EIKB 1QBZA 3TXQA 4B3MO 1Q5OA 4AQYO 2ZDIA 3APQA 2X7RB 4JI3O 1G8MA 4JGSA 1CP9A 1J5EB 4A5UB 5CA0A 4PI0A 3ZEDA 1KU9A 2PY5A 1WA8A 1AROP 1YTFB 1Y74A 1NBMG 1AB3A 1BHBA 1K7DA 4EFBA 4TQFA 2NN4A 3LNMB 4LFBO 3GVMA 4YY3B 1Z2GA 1P4RA 3ZRWA 3SPIA 3Q4HB 4QPJA 1BQZA 1JOYA 1H8EG 1K5SA 3O65A 5B3SB 1GKFA 4DUYB 2UXBO 5IJ0A 4JV5B 4ZOLA 5CB4B 3AK2A 3QO7A 5F2VO 1R3KC 1R3JC 2EINC 2EIJB 2B1GA 2Q7EA 3ZBHA 1THZA 2Q0OC 1N36O 1COWG 1CEZA 3CRRA 3KG2A 3ZHVA 3QTCA 1TUEB 3ASOB 1MSWD 4JAUA 2PZSA 5LMUB 4DV5O 1Y66A 4DV1B 5CA0B 3ZMTA 5C8YA 3B40A 2YXHA 1WA8B 4OPHA 4HYOA 1Y74B 2XASA 1K4CC 1LUVA 5EBMC 1XI1A 3CB2A 5KHHA 1ORQC 2DWEC 1B3QA 1URFA 1KB9F 3ZRWB 2QGNA 1SKVA 3FX7A 5IJ0B 5B1OA 4UVBA 4ZOLB 3RN4A 4K3AA 4DV6O 2QWRB 1IDSA 2XAJA 4G27B 3CEIA 3CJHA 4MTGA 5IJ9A 2GBOA 1VQOV 3ZCCA 3I55V 2YIBA 1AJQA 1GMGA 1NH2D 3MAQA 5C8YB 2QTOA 1K9MW 2Z0AA 4FM2A 3X2QC 5D5PA 2H8PC 1R73A 2ILMA 3H1LH 3ZHRA 4D6TH 3K06A 3C3TA 4ZHQA 1H2SB 1UFIA 1Q6UA 3A0HZ 3CCSV 1NJIW 1VQ6V 2JS5A 4X62B 2OIGA 2M6YA 4O4HA 4CC5A 1OCOC 3DC5A 4DR2O 2WLKA 2RQ6A 1SQXH 1ZAUA 4LFAO 3L72H 3K57A 4DV7B 3OT7A 1EN4A 2F93B 5IDJA 4B3RO 2E76B 4F4LA 5A2QN 3CJHB 3RW0A 5IJ9B 2OTLV 4HBNA 3CC2V 4RUFA 1FXKA 3AG1B 1G1XB 2CTWA 4D7TA 3E8GA 2V7QG 2VWKA 3J7AU 4KXRA 5L3FA 3L75H 3K5LA 1NI8A 2Y0PA 4ZHQB 4RUEA 4LF9O 1FPOA 4JAVA 1IZ3A 4DR5B 4O4HB 1N34O 1QR9A 1Q90D 4DR6B 4LC1A 1S0VA 4ABMA 4GUNA 1K34A 1QLEB 1XQ8A 4WFEA 4FLZA 3SYAA 5DECA 2O57A 4MVRA 2A79B 2E5LB 3BA8A 4NR1A 5JH7A 3IFXA 4TWKA 5EZYA 3SPHA 2Q4PA 4BAYA 4GKKO 1HP8A 3KZIZ 3NR7A 1FXKB 3BA9A 2LGQA 3G4SV 1AP5A 5C93A 2JJ2G 1OV9A 1VQ5V 2UXXA 1XBLA 2XOKG 1JVMA 1VF6A 1PNKA 2UUAO 4JI4O 3CRAA 2EIMC 3ZMSA 1GK9A 4XDLA 3ZJZA 4WF9V 2ZIOA 1DK1A 2Q67A 2CGOA 3ZN0A 2ZR2A 1J5EO 3U11A 4IYIA 4BWAA 2R9RB 1RPOA 2Y4TA 3OUFA 3AEIA 4JI0O 4UFZA 4UV8A 5JH7B 4LF7B 4GX0A 5EZYB 2G38A 3ABMB 3SYPA 4D7SA 3OW2U 3ZHUA 4YY3O 4L87A 5LP6A 5JJJB 4J7JA 3H1IH 2QE7G 1PKXA 4BW5A 4Z2WA 4H0LB 4DUYO 3D3QA 1P84F 4JV5O 3ZRXA 1LNQA 4KFMA 5B1AB 1ZUQA 3CXCU 1VMGA 5LMUO 4DV1O 1GO3F 4BIUA 2LP7A 3SPCA 3CYOA 1XL4A 3U0ZA 3UO2A 4K0KB 3EXAA 5GW7A 2RNBA 4ZIBA 1MG1A 2A3QA 3WU2Z 5LP6B 1HW7A 2YS8A 4KP4A 4TV9B 2JEXA 3EVKA 5IY5B 1TUBA 3ABUA 5LYJA 2P22C 3ABLC 4JYYA 1D2DA 4DR7B 3GWOA 1OCCB 4GX1A 3KCYA 1H8HG 3CWBH 1GN2A 1BCCH 3JATA 1X4TA 4JYBA 4EKWA 3FB5C 1PM9A 2JVDA 1PL0A 2HG5C 4X1YA 3ETGA 1M93A 3T4DA 3BAAA 1F51A 3FYIB 5FPOA 2QDOA 1K8AW 4DR3B 2EZOA 3U10A 2E75B 3BHPA 1EN6A 4FMTA 2QWNB 4J42A 5IE9A 4X62O 3ABKC 1TUBB 1ZLZA 5LYJB 1U96A 3AG4C 2DW4A 5B1BB 4DV7O 5KUMA 3JATB 3WB1A 3WB0A 4ASUG 4CH5A 2CE4A 1V55C 2W0FC 1QCEA 2OTJV 4EB6A 3K5NA 1WJZA 4C7UA 3JCZA 1XDCA 3B2EE 4X1YB 1HNZB 1EM1A 5LMNB 5LHIA 2NNUA 4UCRA 2XAHA 3K5MA 2A0LA 3HKCA 3QO5A 4JF3A 4NTXA 4DR5O 4Z1MG 4J80A 2LW1A 4KUMA 3SJCC 1K3EA 4NXNB 2Q5ZA 2VQEB 1N32B 3L71H 4L8JA 4U7OA 5FLXN 2A9HA 1VF7A 3F5TA 4DV2B 5GTIZ 3DC6A 4EB6B 2E5LO 3J81N 4PDVA 2QM8A 3ZX6A 1VQ8V 5K1PA 4J10A 1PL4A 3MDSA 1XNRB 2ADPA 3PJSK 4QNHB 3JCUZ 3VQYA 3HKCB 3KCXA 1JQ0A 1P7BA 2ZKOA 4JTDB 2P5OA 4JASA 4X64B 3O9OA 1W2BU 2HVJC 4EEQA 3ASNC 5ITZA 1YIJV 1VQPV 1NU1H 3ICXA 4Z1VA 4DO2A 3M8AA 4LF7O 5H9CA 2YUAA 4UV9A 1E1QG 3STLC 1WB8A 2MW2B 3IAYA 4FZ1A 4UVCA 4QGPA 2LJ2A 4TT3G 5BMVA 1GM7A 2H94A 1CPYA 1RM1B 2P7TC 1X59A 1YEWA 1SQGA 3FAVA 4FM0A 5KA5A 3T4ZA 1HDJA 2Q69A 3CMAV 3OGCC 5ITZB 4B7KA 3T1YB 5IYZA 3SJAC 3D36A 4J41A 3RYFA 2W6IG 2Y4UA 2Q7HA 5CA1A 1B04A 2KSDA 3B77A 5JWPA 1S72V 1V54B 4LF6B 4N21A 4K0KO 1SRYA 4X1IA 1KECA 3OMAB 2QWPB 4I9QA 4PDMA 4UB8Z 1AI4A 5BMVB 4DR7O 1KKDA 1Y4MA 2ZR3A 3FAVB 3AG2B 4X20A 4O2AA 4FM1A 4O4IA 3DGEA 4MW8A 1H2GA 1VARA 2EIKC 5IYZB 1I7FA 1R3IC 2Y69C 5L3BA 3RYFB 1DTOA 4UVAA 2JDIG 1G6UA 3ZIAG 5CA1B 5BR8B 2JGDA 3ETDA 4PI2A 1WP8A 3RYCA 2PF4E 3BVOA 1AJPA 3CD6V 3TGUH 4DR3O 4PELA 3JAWA 2RJZA 4X1IB 1FFXA 4JI4B 5LOVA 4NKGB 5CA3A 3RVYA 2JRIA 5D5QA 1VQKV 1N0NA 2KQXA 4X20B 2IJIA 4O2AB 5B3SC 1S76D 4O4IB 4JI5B 4RQEA 1H2KA 1ZL8A 2EIJC 2PTMA 2ZDIC 3G6BA 3L73H 4JI0B 1NS1A 1HNZO 5KHKA 5LMNO 3ASOC 4MVOA 2JGDB 2DOSA 3IGAC 3RYCB 1WPBA 3UO3A 1BE3H 2EILB 5LGNA 1U97A 2DQ0A 3JAWB 1FFXB 2XAGA 2GTAA 2N74A 4GX5A 5LOVB 4NXNO 2XNDG 2AZ0A 3W7UA 1I5XA 1XMQB 1F7YA 1XHXA 4UXNA 2VQEO 1M90W 2QKAA 4YIPA 1N32O 4WBNA 4NB5A 4DV4B 1SQPH 3HKDA 5DEDA 4DV2O 1VQMV 1SESA 3THOA 1ZL8B 3SJBC 3K59A 1IBMB 4B3TB 3WG7B 1O9HA 4MVSA 4LP8A 2QTSA 1ROPA 2OCCC 4YIOA 1XNRO 3HKEA 4FIPC 3RVZA 5K1XA 1SZXA 3BRCA 1R6TA 1ZWIC 4DW0A 3E83A 2KKWA 1OJHA 4LNUA 4X64O 2VS0A 2GDSA 2B1IA 2ATKC 4QE7A 1DF4A 3K08A 2ARHA 3HKBA 1HNWB 1QLNA 2K9PA 4WBNB 3FB7C 1PPJH 2EINB 3HKDB 4YJ3A 2F66C 2MK3A 1RPRA 2F1MA 2CUGA 3E8HA 3AG3B 1XREA 4P9OA 3MD0A 4FLTA 3HKEB 3QVNA 3UT5A 4X65B 3J80N 1H2MA 1M4UA 2R70A 3AG1C 3SYOA 5KAFZ 2YSUB 3N2GA 3A2FA 3NXSA 2XT9A 4LNUB 2WWWA 3STZC 2HEPA 4K8ZA 3I5DA 1AR5A 1S3JA 3IC7A 1FYJA 3HKBB 4NVPA 3P32A 3T1YO 1R6KA 2R72A 4I55A 4Q6GA 5LHHA 5IWAB 4YJ3B 1HWYA 2XAFA 1WN7A 1QLEC 3BPZA 1GH6A 1YTFD 1EBOA 1YXBA 4RQFA 1E79G 4LF6O 3R66A 1LUWA 4HZ3A 2ZD9A 4CZZA 1F4NA 1K92A 3DTUB 3UT5B 1VIBA 4MTXA 3JSNA 3PN1A 2DQ3A 3N2GB 1EN5A 5IYDO 2X0LA 3FFQA 1TVKA 3FD9A 3K9AA 2YICA 1YZBA 1I94B 4IGGA 4GLXA 2OCHA 5GTHZ 1S5JA 4Q20A 4I55B 3L9DA 3G67A 3ZS8C 4J11A 1BSMA 5BR8O 4YHHB 5KAIZ 1NTZH 2HFEC 2CAZC 4PV1B 5E1AC 5J2UA 4NXMB 3HB3B 1M56C 2PYJA 2XAQA 5JVDA 3LDDA 3ABMC 1Q7YW 4XDKA 1JCHA 4LH6A 3UCSC 4P9PA 2ZXWC 2CTQA 4UB6Z 4WFHA 1K73W 1TVKB 2FMLA 1VF6C 2IJHA 2X6AA 3W7XA 4JI5O 2BTQA 4IYHA 3QNEA 4DK1A 1SQFA 2E3CA 5B1AC 1YSCA 1MMMA 1J95A 1JJ2U 2LW7A 2V1DA 4MW3A 4B08A 5CBFA 1GM8A 1V9PA 3CHXA 1DLBA 2XHBA 4CH3A 2WLIA 1XILA 5J2UB 3P3NA 1E1RG 3ZHTA 2ZINA 5JVDB 2JK5C 2DYRB 1IURA 1R6NA 1OCZB 5LA6A 2Q9LA 1WP7A 3OMIB 2X6CA 1US6A 1DGSA 4X88A 1N33B 3M7MX 3H1HH 3CCQV 3OM3B 1PV0A 1IXMA 1XMQO 1Y6XA 4PD4F 5LP6C 4GYCB 3P30A 4LF8B 3RWRD 4RO2A 1SZTA 5CN0A 3OD4A 1OCCC 4DV4O 2OWOA 2BTQB 4E4EA 3K03A 4B7EA 1PD3A 3F7VC 1YJNV 2Q6AA 1KUQA 1IBMO 2YIBD 4B3TO 2V4DA 1S5HC 3E22A 3BFRA 1NTMH 3VBBA 1NT2B 2WLNA 2P4VA 5KHJA 4TOIA 1YDXA 1YJWV 2WLIB 2W0XA 2GHYA 2Q73A 4PA3A 3SPGA 5LA6B 2VQFB 5H5NA 3A0RA 1TGOA 1XHZA 4LBEC 4JI7B 3M99B 2WLMA 5KA6A 3QF7A 2AXTZ 4O4JA 1EFRG 1Q6IA 5LXTA 3RYIA 2CGNA 1HNWO 1KKCA 4X9QA 1XNQB 3CCVV 3RBZA 2PI5A 4F6EA 3CMEV 3K58A 5B1BC 4DR1B 1BS3A 5EBWC 1MA1A 2DYSB 1FAFA 2WAMA 3H1KH 3E22B 1PNLA 4GKJB 1GAXA 3BABA 4X65O 1AI6A 4LFCB 2HP8A 3JD4A 5LGTA 2JIZG 4TUYA 1XL6A 3VQVA 2ZT9B 1ZX3A 3DXRA 4R6ZA 2B5UA 1M57C 2GSMB 4O4JB 1NVPB 2RCVA 5LXTB 3RYIB 4CS2A 1YITV 3SYCA 4WFFA 2E74B 1MOFA 2RMKB 1I08A 2PYLA 4IL6Z 4CH4A 5IWAO 1Q81W 4KHPB 1YF2A 4W4LA 5LHGA 2DE0X 2CK3G 1OCRB 1RSOA 4AHCA 2ZE5A 4NTYA 3K79A 2ZM6B 4P2ZA 3CCJV 2CTPA 4H13B 4PDLA 2BOCC 2PGGA 3LNNA 3TJTA 2UXNA 3MHHC 5E79Z 3FB8C 4TUYB 4TQDA 4IT5A 1SERA 2OYQA 2BSKA 2ZNJA 4MSWC 4K8XA 1N4CA 1FFTB 3JD3A 1I94O 1EZVH 3OMNB 3RGBA 1JR9A 1P7GA 3G80A 3C3SA 3F7YC 4YHHO 2Q0AA 2B9ZA 2QWQB 1WPXA 1AR1B 3AG7A 4NXMO 5EBLC 1RSOB 1XMOB 1FKAO 1WAZA 1Y67A 1AI5A 2QEXV 2YXYA 3P3PA 4MTFA 1M5IA 3C90A 1QR8A 1XOUA 4R8CA 3WB2A 1SS3A 4E2LA 2IH1C 2Q8VA 2L6LA 2BSKB 4QJFB 2BOBC 4G2KA 1S77D 2ZE8A 1RM1C 3OEEG 2UUCB 2IW5A 1O9GA 2FL4A 2X6BA 4H33A 4LCUC 3ZRSA 3TETA 3LSQA 4MTOA 4UCUA 4G28B 1D5NA 4J9YB 3BEHA 1BMFG 3QO8A 3A8TA 3APOA 1V54C 4J9ZB 4P30A 4IIJA 1N33O 2HJDA 2ETNA 3E86A 3L74H 4LF8O 1NKDA 3OUSA 1IBLB 5KHIA 1PP9H 4I9WA 4QE9A 4PA4A 3H9VA 2F23A 4JI6B 4LH7A 2BCCH 1B06A 1RFYA 3OAAG 5EC2C 2IBZH 3TCUA 4EFEA 4U3JA 2AGAA 3D36C 1M9NA 4DXWA 2DWDC 2P4KA 5H6QA 3CC4V 4OX9B 4JTCB 3K5OA 2QSAA 4BW9A 1JJOA 5JCOC 4LF5B 1GM9A 3ML0A 3JALA 2F4VB 4QIWF 4W4KA 2D2CB 2VQFO 4IIJB 4JI7O 1QU7A 1WLEA 3LSSA 3R65A 3CPWU 2ZNIA 1XNQO 4UUJC 1SQBH 4DR1O 1KMIZ 3IJ4A 5L3EA 2IM9A 5KMGA 1YCIA 4U3JB 2DN9A 1IXBA 3JSLA 4GKJO 2PUSA 4JPRA 4JYAO 2GUZA 3K0DA 1KYOF 3B8NA 1Z5VA 5H6RA 4LFCO 2LQTA 1NH2B 4GT1A 2CDYA 3JALB 2EILC 4JYCA 4DYLA 1FJGB 4YJ2A 2UXDB 3GB7C 3VQWA 1GN6A 2CTRA 3K9SA 4PJ0Z 4XDJA 5IT9N 3E8BA 2D3OW 4HNAA 2RDCA 5L3DA 4KHPO 4KL1A 1BHAA 5J9PC 5KMGB 5HFMA 2Y69B 1VQ9V 5KX5A 2UU9B 4JZGA 2ZM6O 1CXZB 2GUZB 1BT8A 2HLDG 1SETA 3WG7C 1AI7A 2EULA 3ETQA 4CC6A 1BQ0A 1JFFA 5EC1C 2YI8A 2QM4A 4YJ2B 2L35A 2QWOB 3S3WA 3VQXA 3BCCH 4GZRB 4UCSA 3W7TA 4TV8A 1OHHG 4JI1B 2N04A 4HNAB 4CS4A 1SF9A 1QQCA 4OPAA 4RAIA 3EFFK 2YIDA 1N8RW 3OEHG 1NZ6A 1M1KW 1JX9A 2Z5UA 2M7WA 3ZMUA 1XMOO 5KX5B 2ITDC 4OXSA 1VQ4V 3JARA 2ZE7A 2H3OA 3LSUA 1KBHA 3AK3A 4NYKA 1H38A 3CC7V 3AG3C 1JFFB 4J7KA 1NR1A 2ZIMA 3AK1A 1QVGU 4FK5C 3ABTA 5B66Z 1Q43A 5LGUA 4JAAA 2Z3YA 1YHQV 3CCEV 2YEVA 3WFVA 1QVFU 4TV8B 4F6RA 3TK1A 2ZE6A 2NLJC 2JS3A 2UUCO 4R7CA 5LBQA 3FKSG 5A9GA 1Q6HA 4MS2A 3ZHSA 2NR5A 1KP3A 2WA4A 1VQNV 4I50A 3JARB 4MVUA 4O2BA 4I5SA 3LDEA 2W6JG 2KB1A 2OCCB 3OR7C 3JYCA 1VQ7V 2JGUA 4B3SB 1IBLO 1K97A 1Q86W 1JA8A 4WFGA 2YEVB 2YXLA 5IYCO 4F6RB 2HHHB 1ZTEA 2JJ1G 3T1CA 1KQSU 4JI6O 1A32A 3E8FA 1DF5A 3K04A 1K33A 4MVZA 5IYBO 4OX9O 1KP2A 5BZBA 2R9AA 1QHTA 2QM7A 4I50B 1L1FA 3X2QB 2HJFC 2HKOA 3D8CA 2UXCB 4O2BB 4LF5O 2F4VO 2C2AA 1FXKC 1SA0A 2QKSA 4PA9A 4DK0A 4I0XA 4GX2A 4BIOA 1OCOB 3LDCA 1GN3A 1B6QA 2EJRA 2KG7A 2XTAA 1KC8W 1L0LH 3LUTB 1NQTA 4O4LA 2JEUA 1RP3B 2IU0A 3E89A 1AVMA 4DV3B 5B1NA 1MNGA 1AILA 3JASA 5JJEB 1MSDA 2PI4A 3ETEA 3CXHF 5AG2A 1FJGO 3CCLV 3HR0A 2UXDO 1SA0B 4FLVA 2DYRC 3CS5A 4ZBMA 1OCZC 4I0XB 4ZI7A 2AZ2A 2HVKC 1HNXB 2IJKA 1LR1A 1JMKC 2KG7B 3OFNG 1FXVA 4O4LB 4FLXA 1YJ9V 4JI2B 2WA3A 3OTFA 5DN6G 4LF4B 3VOUA 5KLVH 2EZPA 2UU9O 1Q3EA 3UM7A 2WLJA 2ADQB 2ZCEA 3JASB 1M56B 2EBOA 2N05A 3W7WA 4LR3A 4AILC 5KHGA 4FJCC 3B4SA 4J7ZA 2IH3C 3EHBB 4IHJA 5IY5C 4JI8B 4PA6A 1VQLV 2ODMA 1SC5B 4ZI7B 2EIMB 3HPLC 1VF5B 3S3XA 5CBGA 1Z5WA 4JI1O 2R9IA 4FLYA 4TV9A 2ZXWB 3T1HB 5CBHA 4I4TA 5L3GA
chains in the Genus database with same CATH topology
5E79Z 1S5LZ 5B66Z 2AXTZ 4IL6Z 3A0HZ 3A0BZ 5KAFZ 3JCUZ 5H2FZ 3WU2Z 5GTHZ 5TISZ 5GTIZ 4UB8Z 4UB6Z 5B5EZ 5KAIZ 3KZIZ 4PJ0Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 Z;  1S5L Z;  5B66 Z;  2AXT Z;  4IL6 Z;  3A0H Z;  3A0B Z;  5KAF Z;  3JCU Z;  5H2F Z;  3WU2 Z;  5GTH Z;  5TIS Z;  5GTI Z;  4UB8 Z;  4UB6 Z;  5B5E Z;  5KAI Z;  3KZI Z;  4PJ0 Z; 
#chains in the Genus database with same CATH topology
 1XEQ A;  3SJQ C;  4HAM A;  1IBK B;  2ZQM A;  3CRC A;  4WCE V;  4DUZ B;  3BY6 A;  4X89 A;  3ZN1 A;  1D5A A;  3CCM V;  2DYS C;  1P49 A;  1OZ0 A;  2A06 H;  2AHZ A;  4X8A A;  3OTO B;  1SQQ H;  4AI8 A;  2CH7 A;  2DJV A;  3QG5 A;  1FS0 G;  1XUQ A;  1UJW B;  4DR4 B;  1I5Y A;  2Q7G A;  2Y0I A;  2DMX A;  2WLL A;  3JAM N;  4IHJ B;  4ZKI A;  1K5Q A;  2EJ7 A;  1FD9 A;  4RWU A;  4DV0 B;  5LL6 Y;  1BZK A;  4X1K A;  4FVM A;  4X66 B;  1UPG A;  4CS3 A;  4I4T B;  1TA8 A;  1ZSP A;  3DSQ A;  3G6E V;  5EYP A;  3CE2 A;  3CX5 F;  2GV9 A;  3B8M A;  4MVQ A;  4DW1 A;  3T2M A;  4JYA B;  3JD0 A;  1PNM A;  4GCZ A;  4R50 A;  3RYH A;  3FYE B;  2K1E A;  2FB5 A;  1OCR C;  2UUB B;  1W59 A;  2CH7 B;  4JTA B;  1G4Y B;  1TAE A;  3UQ8 A;  4N23 A;  2VRZ A;  4B3S O;  2WLL B;  4PA7 A;  1GN4 A;  2QKC A;  1BGY H;  3ABL B;  4LWS A;  5L3C A;  4U3F H;  4H37 A;  4H44 B;  3CRQ A;  4ICG A;  3JD1 A;  2HHH O;  1MZE A;  2HR3 A;  4X1K B;  1R3L C;  4WFB V;  1HR0 B;  2BTO A;  1EZJ A;  1I0H A;  3CCR V;  5J2T A;  4B3M B;  5EYP B;  3N27 A;  4AQY B;  2FYU H;  5EIB C;  3UKM A;  4JI3 B;  3RYH B;  2YC0 A;  2UXC O;  3I56 V;  3KKY A;  1WNS A;  4I7Z B;  4PDR A;  5JJN B;  3JD2 A;  1ENV A;  5CMU A;  3SPJ A;  3DXR B;  5EK0 A;  3ABK B;  5FNV A;  3D3I A;  2WLH A;  5HFL A;  4U7N A;  2IJJ A;  3AG4 B;  2P6J A;  4LFB B;  3CRM A;  2P90 A;  4LWS B;  4MT8 A;  1GRJ A;  4UCV A;  1H2L A;  1M57 B;  2P67 A;  3H1J H;  2IU3 A;  5B5E Z;  3K3W A;  2QA4 V;  1VP7 A;  1V55 B;  4OGQ B;  2UXB B;  2QR4 A;  1R1B A;  4DR6 O;  1MAB G;  5J2T B;  1W0K G;  2LFS A;  2LGW A;  1N36 B;  1K4D C;  4DV3 O;  2GTS A;  4TSF G;  2LFR A;  3ZMV A;  1FXH A;  3E2E A;  3E35 A;  4FFB A;  4DV5 B;  3B09 A;  3CP1 A;  1L8D A;  1L0N H;  1JPX A;  5BXZ A;  1S5L Z;  3SDL A;  5FNV B;  3GWK C;  4XBF A;  1HNX O;  4FFK A;  1AR4 A;  1N0J A;  5H2F Z;  5FL7 G;  3SYQ A;  4JI2 O;  1IX9 A;  4DRX A;  1BL8 A;  5GON A;  3F5W C;  4DV6 B;  4LF4 O;  4JZ2 A;  2FKX A;  1NR7 A;  3IC9 A;  2A7W A;  4MVM A;  4UCO A;  2OIE A;  3OR6 C;  1Q8I A;  3TXS A;  3A0B Z;  4FFB B;  5KUK A;  5JQG A;  2BE3 A;  3W7S A;  5TIS Z;  1GTO A;  4JI8 O;  3JAK A;  1NVP D;  5BY1 A;  1IVS A;  2FTK A;  3T1H O;  2ITC C;  3FB6 C;  2RN9 A;  3ZMZ A;  3ASN B;  3AG2 C;  5FPR A;  3ZHQ A;  1IBK O;  4DUZ O;  4DR2 B;  2WSS G;  4DRX B;  4LFA B;  5GON B;  2YI9 A;  1MZF A;  3CSX A;  3OE7 G;  2YIA A;  4B3R B;  3OTO O;  2F43 G;  3CCU V;  1Y76 A;  2Y48 A;  4DR4 O;  2YDE A;  3N2K A;  4PHZ A;  5JQG B;  4WFA V;  4BIZ A;  2AHY A;  2XUM A;  2P06 A;  5JCO A;  4CBC A;  1WB7 A;  3MHS C;  2F95 B;  1AJN A;  1T5E A;  1AP6 A;  3JAK B;  4FLW A;  2LO1 A;  4FLU A;  4UCT A;  4DV0 O;  3OGI B;  4X66 O;  4LF9 B;  4QPK A;  3SGI A;  3RFR A;  4FZ0 A;  1NTK H;  5EIB D;  1F4M A;  1N34 B;  4FPP A;  3SR2 C;  1YVW A;  1F23 A;  3ZRV A;  3G71 V;  5DM6 V;  2UUB O;  2QJ1 A;  1Q82 W;  1Y76 B;  2AW9 A;  4CH6 A;  1KD1 W;  2WPD G;  2EX3 A;  1SQV H;  2Q68 A;  3N2K B;  4GKK B;  1QNM A;  4K35 A;  3L70 H;  3RT3 C;  1H2N A;  3H01 A;  1YI2 V;  1W0J G;  3Q4H A;  1VEW A;  4YXW G;  2VWJ A;  1HR0 O;  2UUA B;  4BR6 A;  2OT5 A;  5CB4 A;  3K0G A;  4NTW A;  2EIK B;  1QBZ A;  3TXQ A;  4B3M O;  1Q5O A;  4AQY O;  2ZDI A;  3APQ A;  2X7R B;  4JI3 O;  1G8M A;  4JGS A;  1CP9 A;  1J5E B;  4A5U B;  5CA0 A;  4PI0 A;  3ZED A;  1KU9 A;  2PY5 A;  1WA8 A;  1ARO P;  1YTF B;  1Y74 A;  1NBM G;  1AB3 A;  1BHB A;  1K7D A;  4EFB A;  4TQF A;  2NN4 A;  3LNM B;  4LFB O;  3GVM A;  4YY3 B;  1Z2G A;  1P4R A;  3ZRW A;  3SPI A;  3Q4H B;  4QPJ A;  1BQZ A;  1JOY A;  1H8E G;  1K5S A;  3O65 A;  5B3S B;  1GKF A;  4DUY B;  2UXB O;  5IJ0 A;  4JV5 B;  4ZOL A;  5CB4 B;  3AK2 A;  3QO7 A;  5F2V O;  1R3K C;  1R3J C;  2EIN C;  2EIJ B;  2B1G A;  2Q7E A;  3ZBH A;  1THZ A;  2Q0O C;  1N36 O;  1COW G;  1CEZ A;  3CRR A;  3KG2 A;  3ZHV A;  3QTC A;  1TUE B;  3ASO B;  1MSW D;  4JAU A;  2PZS A;  5LMU B;  4DV5 O;  1Y66 A;  4DV1 B;  5CA0 B;  3ZMT A;  5C8Y A;  3B40 A;  2YXH A;  1WA8 B;  4OPH A;  4HYO A;  1Y74 B;  2XAS A;  1K4C C;  1LUV A;  5EBM C;  1XI1 A;  3CB2 A;  5KHH A;  1ORQ C;  2DWE C;  1B3Q A;  1URF A;  1KB9 F;  3ZRW B;  2QGN A;  1SKV A;  3FX7 A;  5IJ0 B;  5B1O A;  4UVB A;  4ZOL B;  3RN4 A;  4K3A A;  4DV6 O;  2QWR B;  1IDS A;  2XAJ A;  4G27 B;  3CEI A;  3CJH A;  4MTG A;  5IJ9 A;  2GBO A;  1VQO V;  3ZCC A;  3I55 V;  2YIB A;  1AJQ A;  1GMG A;  1NH2 D;  3MAQ A;  5C8Y B;  2QTO A;  1K9M W;  2Z0A A;  4FM2 A;  3X2Q C;  5D5P A;  2H8P C;  1R73 A;  2ILM A;  3H1L H;  3ZHR A;  4D6T H;  3K06 A;  3C3T A;  4ZHQ A;  1H2S B;  1UFI A;  1Q6U A;  3A0H Z;  3CCS V;  1NJI W;  1VQ6 V;  2JS5 A;  4X62 B;  2OIG A;  2M6Y A;  4O4H A;  4CC5 A;  1OCO C;  3DC5 A;  4DR2 O;  2WLK A;  2RQ6 A;  1SQX H;  1ZAU A;  4LFA O;  3L72 H;  3K57 A;  4DV7 B;  3OT7 A;  1EN4 A;  2F93 B;  5IDJ A;  4B3R O;  2E76 B;  4F4L A;  5A2Q N;  3CJH B;  3RW0 A;  5IJ9 B;  2OTL V;  4HBN A;  3CC2 V;  4RUF A;  1FXK A;  3AG1 B;  1G1X B;  2CTW A;  4D7T A;  3E8G A;  2V7Q G;  2VWK A;  3J7A U;  4KXR A;  5L3F A;  3L75 H;  3K5L A;  1NI8 A;  2Y0P A;  4ZHQ B;  4RUE A;  4LF9 O;  1FPO A;  4JAV A;  1IZ3 A;  4DR5 B;  4O4H B;  1N34 O;  1QR9 A;  1Q90 D;  4DR6 B;  4LC1 A;  1S0V A;  4ABM A;  4GUN A;  1K34 A;  1QLE B;  1XQ8 A;  4WFE A;  4FLZ A;  3SYA A;  5DEC A;  2O57 A;  4MVR A;  2A79 B;  2E5L B;  3BA8 A;  4NR1 A;  5JH7 A;  3IFX A;  4TWK A;  5EZY A;  3SPH A;  2Q4P A;  4BAY A;  4GKK O;  1HP8 A;  3KZI Z;  3NR7 A;  1FXK B;  3BA9 A;  2LGQ A;  3G4S V;  1AP5 A;  5C93 A;  2JJ2 G;  1OV9 A;  1VQ5 V;  2UXX A;  1XBL A;  2XOK G;  1JVM A;  1VF6 A;  1PNK A;  2UUA O;  4JI4 O;  3CRA A;  2EIM C;  3ZMS A;  1GK9 A;  4XDL A;  3ZJZ A;  4WF9 V;  2ZIO A;  1DK1 A;  2Q67 A;  2CGO A;  3ZN0 A;  2ZR2 A;  1J5E O;  3U11 A;  4IYI A;  4BWA A;  2R9R B;  1RPO A;  2Y4T A;  3OUF A;  3AEI A;  4JI0 O;  4UFZ A;  4UV8 A;  5JH7 B;  4LF7 B;  4GX0 A;  5EZY B;  2G38 A;  3ABM B;  3SYP A;  4D7S A;  3OW2 U;  3ZHU A;  4YY3 O;  4L87 A;  5LP6 A;  5JJJ B;  4J7J A;  3H1I H;  2QE7 G;  1PKX A;  4BW5 A;  4Z2W A;  4H0L B;  4DUY O;  3D3Q A;  1P84 F;  4JV5 O;  3ZRX A;  1LNQ A;  4KFM A;  5B1A B;  1ZUQ A;  3CXC U;  1VMG A;  5LMU O;  4DV1 O;  1GO3 F;  4BIU A;  2LP7 A;  3SPC A;  3CYO A;  1XL4 A;  3U0Z A;  3UO2 A;  4K0K B;  3EXA A;  5GW7 A;  2RNB A;  4ZIB A;  1MG1 A;  2A3Q A;  3WU2 Z;  5LP6 B;  1HW7 A;  2YS8 A;  4KP4 A;  4TV9 B;  2JEX A;  3EVK A;  5IY5 B;  1TUB A;  3ABU A;  5LYJ A;  2P22 C;  3ABL C;  4JYY A;  1D2D A;  4DR7 B;  3GWO A;  1OCC B;  4GX1 A;  3KCY A;  1H8H G;  3CWB H;  1GN2 A;  1BCC H;  3JAT A;  1X4T A;  4JYB A;  4EKW A;  3FB5 C;  1PM9 A;  2JVD A;  1PL0 A;  2HG5 C;  4X1Y A;  3ETG A;  1M93 A;  3T4D A;  3BAA A;  1F51 A;  3FYI B;  5FPO A;  2QDO A;  1K8A W;  4DR3 B;  2EZO A;  3U10 A;  2E75 B;  3BHP A;  1EN6 A;  4FMT A;  2QWN B;  4J42 A;  5IE9 A;  4X62 O;  3ABK C;  1TUB B;  1ZLZ A;  5LYJ B;  1U96 A;  3AG4 C;  2DW4 A;  5B1B B;  4DV7 O;  5KUM A;  3JAT B;  3WB1 A;  3WB0 A;  4ASU G;  4CH5 A;  2CE4 A;  1V55 C;  2W0F C;  1QCE A;  2OTJ V;  4EB6 A;  3K5N A;  1WJZ A;  4C7U A;  3JCZ A;  1XDC A;  3B2E E;  4X1Y B;  1HNZ B;  1EM1 A;  5LMN B;  5LHI A;  2NNU A;  4UCR A;  2XAH A;  3K5M A;  2A0L A;  3HKC A;  3QO5 A;  4JF3 A;  4NTX A;  4DR5 O;  4Z1M G;  4J80 A;  2LW1 A;  4KUM A;  3SJC C;  1K3E A;  4NXN B;  2Q5Z A;  2VQE B;  1N32 B;  3L71 H;  4L8J A;  4U7O A;  5FLX N;  2A9H A;  1VF7 A;  3F5T A;  4DV2 B;  5GTI Z;  3DC6 A;  4EB6 B;  2E5L O;  3J81 N;  4PDV A;  2QM8 A;  3ZX6 A;  1VQ8 V;  5K1P A;  4J10 A;  1PL4 A;  3MDS A;  1XNR B;  2ADP A;  3PJS K;  4QNH B;  3JCU Z;  3VQY A;  3HKC B;  3KCX A;  1JQ0 A;  1P7B A;  2ZKO A;  4JTD B;  2P5O A;  4JAS A;  4X64 B;  3O9O A;  1W2B U;  2HVJ C;  4EEQ A;  3ASN C;  5ITZ A;  1YIJ V;  1VQP V;  1NU1 H;  3ICX A;  4Z1V A;  4DO2 A;  3M8A A;  4LF7 O;  5H9C A;  2YUA A;  4UV9 A;  1E1Q G;  3STL C;  1WB8 A;  2MW2 B;  3IAY A;  4FZ1 A;  4UVC A;  4QGP A;  2LJ2 A;  4TT3 G;  5BMV A;  1GM7 A;  2H94 A;  1CPY A;  1RM1 B;  2P7T C;  1X59 A;  1YEW A;  1SQG A;  3FAV A;  4FM0 A;  5KA5 A;  3T4Z A;  1HDJ A;  2Q69 A;  3CMA V;  3OGC C;  5ITZ B;  4B7K A;  3T1Y B;  5IYZ A;  3SJA C;  3D36 A;  4J41 A;  3RYF A;  2W6I G;  2Y4U A;  2Q7H A;  5CA1 A;  1B04 A;  2KSD A;  3B77 A;  5JWP A;  1S72 V;  1V54 B;  4LF6 B;  4N21 A;  4K0K O;  1SRY A;  4X1I A;  1KEC A;  3OMA B;  2QWP B;  4I9Q A;  4PDM A;  4UB8 Z;  1AI4 A;  5BMV B;  4DR7 O;  1KKD A;  1Y4M A;  2ZR3 A;  3FAV B;  3AG2 B;  4X20 A;  4O2A A;  4FM1 A;  4O4I A;  3DGE A;  4MW8 A;  1H2G A;  1VAR A;  2EIK C;  5IYZ B;  1I7F A;  1R3I C;  2Y69 C;  5L3B A;  3RYF B;  1DTO A;  4UVA A;  2JDI G;  1G6U A;  3ZIA G;  5CA1 B;  5BR8 B;  2JGD A;  3ETD A;  4PI2 A;  1WP8 A;  3RYC A;  2PF4 E;  3BVO A;  1AJP A;  3CD6 V;  3TGU H;  4DR3 O;  4PEL A;  3JAW A;  2RJZ A;  4X1I B;  1FFX A;  4JI4 B;  5LOV A;  4NKG B;  5CA3 A;  3RVY A;  2JRI A;  5D5Q A;  1VQK V;  1N0N A;  2KQX A;  4X20 B;  2IJI A;  4O2A B;  5B3S C;  1S76 D;  4O4I B;  4JI5 B;  4RQE A;  1H2K A;  1ZL8 A;  2EIJ C;  2PTM A;  2ZDI C;  3G6B A;  3L73 H;  4JI0 B;  1NS1 A;  1HNZ O;  5KHK A;  5LMN O;  3ASO C;  4MVO A;  2JGD B;  2DOS A;  3IGA C;  3RYC B;  1WPB A;  3UO3 A;  1BE3 H;  2EIL B;  5LGN A;  1U97 A;  2DQ0 A;  3JAW B;  1FFX B;  2XAG A;  2GTA A;  2N74 A;  4GX5 A;  5LOV B;  4NXN O;  2XND G;  2AZ0 A;  3W7U A;  1I5X A;  1XMQ B;  1F7Y A;  1XHX A;  4UXN A;  2VQE O;  1M90 W;  2QKA A;  4YIP A;  1N32 O;  4WBN A;  4NB5 A;  4DV4 B;  1SQP H;  3HKD A;  5DED A;  4DV2 O;  1VQM V;  1SES A;  3THO A;  1ZL8 B;  3SJB C;  3K59 A;  1IBM B;  4B3T B;  3WG7 B;  1O9H A;  4MVS A;  4LP8 A;  2QTS A;  1ROP A;  2OCC C;  4YIO A;  1XNR O;  3HKE A;  4FIP C;  3RVZ A;  5K1X A;  1SZX A;  3BRC A;  1R6T A;  1ZWI C;  4DW0 A;  3E83 A;  2KKW A;  1OJH A;  4LNU A;  4X64 O;  2VS0 A;  2GDS A;  2B1I A;  2ATK C;  4QE7 A;  1DF4 A;  3K08 A;  2ARH A;  3HKB A;  1HNW B;  1QLN A;  2K9P A;  4WBN B;  3FB7 C;  1PPJ H;  2EIN B;  3HKD B;  4YJ3 A;  2F66 C;  2MK3 A;  1RPR A;  2F1M A;  2CUG A;  3E8H A;  3AG3 B;  1XRE A;  4P9O A;  3MD0 A;  4FLT A;  3HKE B;  3QVN A;  3UT5 A;  4X65 B;  3J80 N;  1H2M A;  1M4U A;  2R70 A;  3AG1 C;  3SYO A;  5KAF Z;  2YSU B;  3N2G A;  3A2F A;  3NXS A;  2XT9 A;  4LNU B;  2WWW A;  3STZ C;  2HEP A;  4K8Z A;  3I5D A;  1AR5 A;  1S3J A;  3IC7 A;  1FYJ A;  3HKB B;  4NVP A;  3P32 A;  3T1Y O;  1R6K A;  2R72 A;  4I55 A;  4Q6G A;  5LHH A;  5IWA B;  4YJ3 B;  1HWY A;  2XAF A;  1WN7 A;  1QLE C;  3BPZ A;  1GH6 A;  1YTF D;  1EBO A;  1YXB A;  4RQF A;  1E79 G;  4LF6 O;  3R66 A;  1LUW A;  4HZ3 A;  2ZD9 A;  4CZZ A;  1F4N A;  1K92 A;  3DTU B;  3UT5 B;  1VIB A;  4MTX A;  3JSN A;  3PN1 A;  2DQ3 A;  3N2G B;  1EN5 A;  5IYD O;  2X0L A;  3FFQ A;  1TVK A;  3FD9 A;  3K9A A;  2YIC A;  1YZB A;  1I94 B;  4IGG A;  4GLX A;  2OCH A;  5GTH Z;  1S5J A;  4Q20 A;  4I55 B;  3L9D A;  3G67 A;  3ZS8 C;  4J11 A;  1BSM A;  5BR8 O;  4YHH B;  5KAI Z;  1NTZ H;  2HFE C;  2CAZ C;  4PV1 B;  5E1A C;  5J2U A;  4NXM B;  3HB3 B;  1M56 C;  2PYJ A;  2XAQ A;  5JVD A;  3LDD A;  3ABM C;  1Q7Y W;  4XDK A;  1JCH A;  4LH6 A;  3UCS C;  4P9P A;  2ZXW C;  2CTQ A;  4UB6 Z;  4WFH A;  1K73 W;  1TVK B;  2FML A;  1VF6 C;  2IJH A;  2X6A A;  3W7X A;  4JI5 O;  2BTQ A;  4IYH A;  3QNE A;  4DK1 A;  1SQF A;  2E3C A;  5B1A C;  1YSC A;  1MMM A;  1J95 A;  1JJ2 U;  2LW7 A;  2V1D A;  4MW3 A;  4B08 A;  5CBF A;  1GM8 A;  1V9P A;  3CHX A;  1DLB A;  2XHB A;  4CH3 A;  2WLI A;  1XIL A;  5J2U B;  3P3N A;  1E1R G;  3ZHT A;  2ZIN A;  5JVD B;  2JK5 C;  2DYR B;  1IUR A;  1R6N A;  1OCZ B;  5LA6 A;  2Q9L A;  1WP7 A;  3OMI B;  2X6C A;  1US6 A;  1DGS A;  4X88 A;  1N33 B;  3M7M X;  3H1H H;  3CCQ V;  3OM3 B;  1PV0 A;  1IXM A;  1XMQ O;  1Y6X A;  4PD4 F;  5LP6 C;  4GYC B;  3P30 A;  4LF8 B;  3RWR D;  4RO2 A;  1SZT A;  5CN0 A;  3OD4 A;  1OCC C;  4DV4 O;  2OWO A;  2BTQ B;  4E4E A;  3K03 A;  4B7E A;  1PD3 A;  3F7V C;  1YJN V;  2Q6A A;  1KUQ A;  1IBM O;  2YIB D;  4B3T O;  2V4D A;  1S5H C;  3E22 A;  3BFR A;  1NTM H;  3VBB A;  1NT2 B;  2WLN A;  2P4V A;  5KHJ A;  4TOI A;  1YDX A;  1YJW V;  2WLI B;  2W0X A;  2GHY A;  2Q73 A;  4PA3 A;  3SPG A;  5LA6 B;  2VQF B;  5H5N A;  3A0R A;  1TGO A;  1XHZ A;  4LBE C;  4JI7 B;  3M99 B;  2WLM A;  5KA6 A;  3QF7 A;  2AXT Z;  4O4J A;  1EFR G;  1Q6I A;  5LXT A;  3RYI A;  2CGN A;  1HNW O;  1KKC A;  4X9Q A;  1XNQ B;  3CCV V;  3RBZ A;  2PI5 A;  4F6E A;  3CME V;  3K58 A;  5B1B C;  4DR1 B;  1BS3 A;  5EBW C;  1MA1 A;  2DYS B;  1FAF A;  2WAM A;  3H1K H;  3E22 B;  1PNL A;  4GKJ B;  1GAX A;  3BAB A;  4X65 O;  1AI6 A;  4LFC B;  2HP8 A;  3JD4 A;  5LGT A;  2JIZ G;  4TUY A;  1XL6 A;  3VQV A;  2ZT9 B;  1ZX3 A;  3DXR A;  4R6Z A;  2B5U A;  1M57 C;  2GSM B;  4O4J B;  1NVP B;  2RCV A;  5LXT B;  3RYI B;  4CS2 A;  1YIT V;  3SYC A;  4WFF A;  2E74 B;  1MOF A;  2RMK B;  1I08 A;  2PYL A;  4IL6 Z;  4CH4 A;  5IWA O;  1Q81 W;  4KHP B;  1YF2 A;  4W4L A;  5LHG A;  2DE0 X;  2CK3 G;  1OCR B;  1RSO A;  4AHC A;  2ZE5 A;  4NTY A;  3K79 A;  2ZM6 B;  4P2Z A;  3CCJ V;  2CTP A;  4H13 B;  4PDL A;  2BOC C;  2PGG A;  3LNN A;  3TJT A;  2UXN A;  3MHH C;  5E79 Z;  3FB8 C;  4TUY B;  4TQD A;  4IT5 A;  1SER A;  2OYQ A;  2BSK A;  2ZNJ A;  4MSW C;  4K8X A;  1N4C A;  1FFT B;  3JD3 A;  1I94 O;  1EZV H;  3OMN B;  3RGB A;  1JR9 A;  1P7G A;  3G80 A;  3C3S A;  3F7Y C;  4YHH O;  2Q0A A;  2B9Z A;  2QWQ B;  1WPX A;  1AR1 B;  3AG7 A;  4NXM O;  5EBL C;  1RSO B;  1XMO B;  1FKA O;  1WAZ A;  1Y67 A;  1AI5 A;  2QEX V;  2YXY A;  3P3P A;  4MTF A;  1M5I A;  3C90 A;  1QR8 A;  1XOU A;  4R8C A;  3WB2 A;  1SS3 A;  4E2L A;  2IH1 C;  2Q8V A;  2L6L A;  2BSK B;  4QJF B;  2BOB C;  4G2K A;  1S77 D;  2ZE8 A;  1RM1 C;  3OEE G;  2UUC B;  2IW5 A;  1O9G A;  2FL4 A;  2X6B A;  4H33 A;  4LCU C;  3ZRS A;  3TET A;  3LSQ A;  4MTO A;  4UCU A;  4G28 B;  1D5N A;  4J9Y B;  3BEH A;  1BMF G;  3QO8 A;  3A8T A;  3APO A;  1V54 C;  4J9Z B;  4P30 A;  4IIJ A;  1N33 O;  2HJD A;  2ETN A;  3E86 A;  3L74 H;  4LF8 O;  1NKD A;  3OUS A;  1IBL B;  5KHI A;  1PP9 H;  4I9W A;  4QE9 A;  4PA4 A;  3H9V A;  2F23 A;  4JI6 B;  4LH7 A;  2BCC H;  1B06 A;  1RFY A;  3OAA G;  5EC2 C;  2IBZ H;  3TCU A;  4EFE A;  4U3J A;  2AGA A;  3D36 C;  1M9N A;  4DXW A;  2DWD C;  2P4K A;  5H6Q A;  3CC4 V;  4OX9 B;  4JTC B;  3K5O A;  2QSA A;  4BW9 A;  1JJO A;  5JCO C;  4LF5 B;  1GM9 A;  3ML0 A;  3JAL A;  2F4V B;  4QIW F;  4W4K A;  2D2C B;  2VQF O;  4IIJ B;  4JI7 O;  1QU7 A;  1WLE A;  3LSS A;  3R65 A;  3CPW U;  2ZNI A;  1XNQ O;  4UUJ C;  1SQB H;  4DR1 O;  1KMI Z;  3IJ4 A;  5L3E A;  2IM9 A;  5KMG A;  1YCI A;  4U3J B;  2DN9 A;  1IXB A;  3JSL A;  4GKJ O;  2PUS A;  4JPR A;  4JYA O;  2GUZ A;  3K0D A;  1KYO F;  3B8N A;  1Z5V A;  5H6R A;  4LFC O;  2LQT A;  1NH2 B;  4GT1 A;  2CDY A;  3JAL B;  2EIL C;  4JYC A;  4DYL A;  1FJG B;  4YJ2 A;  2UXD B;  3GB7 C;  3VQW A;  1GN6 A;  2CTR A;  3K9S A;  4PJ0 Z;  4XDJ A;  5IT9 N;  3E8B A;  2D3O W;  4HNA A;  2RDC A;  5L3D A;  4KHP O;  4KL1 A;  1BHA A;  5J9P C;  5KMG B;  5HFM A;  2Y69 B;  1VQ9 V;  5KX5 A;  2UU9 B;  4JZG A;  2ZM6 O;  1CXZ B;  2GUZ B;  1BT8 A;  2HLD G;  1SET A;  3WG7 C;  1AI7 A;  2EUL A;  3ETQ A;  4CC6 A;  1BQ0 A;  1JFF A;  5EC1 C;  2YI8 A;  2QM4 A;  4YJ2 B;  2L35 A;  2QWO B;  3S3W A;  3VQX A;  3BCC H;  4GZR B;  4UCS A;  3W7T A;  4TV8 A;  1OHH G;  4JI1 B;  2N04 A;  4HNA B;  4CS4 A;  1SF9 A;  1QQC A;  4OPA A;  4RAI A;  3EFF K;  2YID A;  1N8R W;  3OEH G;  1NZ6 A;  1M1K W;  1JX9 A;  2Z5U A;  2M7W A;  3ZMU A;  1XMO O;  5KX5 B;  2ITD C;  4OXS A;  1VQ4 V;  3JAR A;  2ZE7 A;  2H3O A;  3LSU A;  1KBH A;  3AK3 A;  4NYK A;  1H38 A;  3CC7 V;  3AG3 C;  1JFF B;  4J7K A;  1NR1 A;  2ZIM A;  3AK1 A;  1QVG U;  4FK5 C;  3ABT A;  5B66 Z;  1Q43 A;  5LGU A;  4JAA A;  2Z3Y A;  1YHQ V;  3CCE V;  2YEV A;  3WFV A;  1QVF U;  4TV8 B;  4F6R A;  3TK1 A;  2ZE6 A;  2NLJ C;  2JS3 A;  2UUC O;  4R7C A;  5LBQ A;  3FKS G;  5A9G A;  1Q6H A;  4MS2 A;  3ZHS A;  2NR5 A;  1KP3 A;  2WA4 A;  1VQN V;  4I50 A;  3JAR B;  4MVU A;  4O2B A;  4I5S A;  3LDE A;  2W6J G;  2KB1 A;  2OCC B;  3OR7 C;  3JYC A;  1VQ7 V;  2JGU A;  4B3S B;  1IBL O;  1K97 A;  1Q86 W;  1JA8 A;  4WFG A;  2YEV B;  2YXL A;  5IYC O;  4F6R B;  2HHH B;  1ZTE A;  2JJ1 G;  3T1C A;  1KQS U;  4JI6 O;  1A32 A;  3E8F A;  1DF5 A;  3K04 A;  1K33 A;  4MVZ A;  5IYB O;  4OX9 O;  1KP2 A;  5BZB A;  2R9A A;  1QHT A;  2QM7 A;  4I50 B;  1L1F A;  3X2Q B;  2HJF C;  2HKO A;  3D8C A;  2UXC B;  4O2B B;  4LF5 O;  2F4V O;  2C2A A;  1FXK C;  1SA0 A;  2QKS A;  4PA9 A;  4DK0 A;  4I0X A;  4GX2 A;  4BIO A;  1OCO B;  3LDC A;  1GN3 A;  1B6Q A;  2EJR A;  2KG7 A;  2XTA A;  1KC8 W;  1L0L H;  3LUT B;  1NQT A;  4O4L A;  2JEU A;  1RP3 B;  2IU0 A;  3E89 A;  1AVM A;  4DV3 B;  5B1N A;  1MNG A;  1AIL A;  3JAS A;  5JJE B;  1MSD A;  2PI4 A;  3ETE A;  3CXH F;  5AG2 A;  1FJG O;  3CCL V;  3HR0 A;  2UXD O;  1SA0 B;  4FLV A;  2DYR C;  3CS5 A;  4ZBM A;  1OCZ C;  4I0X B;  4ZI7 A;  2AZ2 A;  2HVK C;  1HNX B;  2IJK A;  1LR1 A;  1JMK C;  2KG7 B;  3OFN G;  1FXV A;  4O4L B;  4FLX A;  1YJ9 V;  4JI2 B;  2WA3 A;  3OTF A;  5DN6 G;  4LF4 B;  3VOU A;  5KLV H;  2EZP A;  2UU9 O;  1Q3E A;  3UM7 A;  2WLJ A;  2ADQ B;  2ZCE A;  3JAS B;  1M56 B;  2EBO A;  2N05 A;  3W7W A;  4LR3 A;  4AIL C;  5KHG A;  4FJC C;  3B4S A;  4J7Z A;  2IH3 C;  3EHB B;  4IHJ A;  5IY5 C;  4JI8 B;  4PA6 A;  1VQL V;  2ODM A;  1SC5 B;  4ZI7 B;  2EIM B;  3HPL C;  1VF5 B;  3S3X A;  5CBG A;  1Z5W A;  4JI1 O;  2R9I A;  4FLY A;  4TV9 A;  2ZXW B;  3T1H B;  5CBH A;  4I4T A;  5L3G A; 
#chains in the Genus database with same CATH homology
 5E79 Z;  1S5L Z;  5B66 Z;  2AXT Z;  4IL6 Z;  3A0H Z;  3A0B Z;  5KAF Z;  3JCU Z;  5H2F Z;  3WU2 Z;  5GTH Z;  5TIS Z;  5GTI Z;  4UB8 Z;  4UB6 Z;  5B5E Z;  5KAI Z;  3KZI Z;  4PJ0 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...