2KG7B

Structure and features of the complex formed by the tuberculosis virulence factors rv0287 and rv0288
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
SMSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the M. tuberculosis EsxG-EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Uncharacterized protein esxG (PE family protein)
total genus 23
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2kg7B00
2AZ2A 4LWSA 2AZ0A 3O9OA 3Q4HA 3FD9A 2VS0A 1WA8B 3G80A 3GWKC 3GVMA 4ABMA 1WA8A 3TXQA 3OGIB 3Q4HB 2KG7B 4I0XA 3FAVA 2DE0X 4LWSB 2B9ZA 3ZBHA 2KG7A 4GZRB 4I0XB 3FAVB 2VRZA 3TXSA 3HR0A
chains in the Genus database with same CATH superfamily
4JTDB 4LFCB 4DUZO 2WSSG 3DXRB 4J9ZB 3RYIA 1UJWB 5B5EZ 2YIAA 2QSAA 1FFTB 5B1AC 3L75H 4DV2O 1YEWA 1KP3A 3D36A 5BY1A 2KG7B 1EM1A 4L87A 3LSSA 3BRCA 2AXTZ 1BE3H 3AG3B 4PJ0Z 3QF7A 5LP6A 4NR1A 3VBBA 4XDLA 3B77A 1THZA 4ZI7B 1K7DA 3K0DA 3LDCA 3E83A 5LMUB 2AHZA 1IXBA 3G6EV 1SQPH 2EZPA 4OPHA 1NJIW 1VQMV 2WPDG 1HNXO 1YIJV 1HDJA 4DRXA 1AI4A 2E74B 5EC2C 3CC4V 1VQ7V 1NR1A 3DSQA 4JI8O 1SQQH 2HVKC 4LFAO 3AK2A 3C3TA 1TA8A 2RQ6A 3AG7A 1IBMO 3AEIA 1DGSA 3UT5B 1R3LC 4X1KB 1Q8IA 4TWKA 2ZE6A 3DC6A 1R3JC 1TVKA 5HFMA 3KCXA 5LOVA 4GKKB 3OTOB 3HB3B 1AJPA 1KD1W 1N34O 2JS5A 4FPPA 3VOUA 1V55B 2ZNJA 3ZN1A 3X2QC 5L3BA 4JI2B 4QPKA 3FYEB 1YF2A 4O4IA 4JV5B 4DYLA 3W7UA 3RN4A 4RAIA 3N27A 2EJRA 2HG5C 3BY6A 3ZHTA 1J5EO 2CTPA 4EFBA 1AI7A 5EYPB 2E5LB 1A32A 1WP8A 1RPRA 3ABLB 1SETA 3TCUA 2ZR2A 1GN2A 3W7TA 2P06A 2DQ0A 1GKFA 3SPGA 5L3FA 2FTKA 3N2KA 2UXCO 1YSCA 3THOA 3BPZA 4F6EA 5FNVB 2WA4A 3AK3A 1B3QA 1IURA 1F4MA 1XREA 2OCCB 3ABMC 3KZIZ 2UXXA 4B3RB 1QR8A 4JI8B 3SYAA 2HHHB 1D5NA 1EFRG 1F23A 1V54B 4TUYB 1K4DC 4MT8A 4ZBMA 4UVAA 2DYSB 1K92A 2RJZA 2IH3C 2FYUH 3P30A 4IL6Z 1KMIZ 5L3GA 1SQFA 1PNKA 3IGAC 4LF5O 1W0KG 1KKDA 2YXHA 4BIUA 2GTAA 5TISZ 3QO7A 2UXBB 4DR4O 3R66A 4I4TA 3JATA 1Z2GA 1KB9F 2Q68A 3G6BA 3LDDA 5KHKA 1JCHA 4CS3A 4A5UB 3AG3C 5B66Z 5K1PA 1Q86W 2HKOA 1U96A 3IAYA 1R3IC 4FM0A 4UCRA 2N05A 5J2UA 1VQPV 1IX9A 1ZWIC 5B1AB 1OCOB 4MTGA 2EIMC 4AQYB 1Y67A 1VQ9V 2A3QA 2BCCH 4WFFA 4JGSA 1Q6HA 3TK1A 1YDXA 4MW8A 1SQXH 3B8NA 5LHGA 2AW9A 3Q4HB 2QWPB 1IBLB 4OPAA 3CXCU 4I9WA 4JTAB 2F43G 4LF9O 4W4LA 3W7SA 3OMNB 3ABLC 2Q67A 2AZ0A 2FMLA 1I5XA 2YIDA 3H1JH 3JSNA 1XMQO 3HKEA 5IYDO 1L0NH 1VF6C 2WLIB 1HWYA 2WWWA 5BR8O 2E5LO 4DK1A 4L8JA 1RSOB 3D36C 1SQGA 5LA6B 2C2AA 2BSKA 3CXHF 4ASUG 2EIJC 4FLYA 1N36O 2RCVA 4PA4A 1CXZB 1CEZA 1YZBA 2XAQA 4LCUC 1XOUA 2EIJB 2ETNA 3BVOA 2Q7EA 2QKCA 5HFLA 2QTSA 1FXKB 4U7OA 2DYRB 3CB2A 4O4LA 1GAXA 1BSMA 5KUKA 5JQGB 5IYBO 2ITDC 4K8ZA 1YITV 2DYRC 3LSQA 3SPJA 4FFBB 4QE7A 4YIOA 2CH7B 2JGDB 4QNHB 4IIJB 3M8AA 3NXSA 4JI6B 4C7UA 4FLUA 3U11A 2NR5A 1V9PA 3CCVV 4GKJO 1GK9A 1AR5A 3U0ZA 3T1YB 4I0XB 1J5EB 2UXBO 4O2BA 2Q0AA 1VQ4V 4UFZA 3OFNG 5KAIZ 2HR3A 4NTXA 4ZKIA 4R8CA 4ZOLA 5EZYB 3ZHUA 2YIBD 4JASA 3JD2A 5KA6A 3J80N 1I08A 3ZRWA 1L8DA 3BABA 3FB7C 3MHHC 3ZEDA 4PDRA 5KLVH 4NXNB 3IC7A 3ZX6A 2CDYA 3G67A 1AILA 2WLJA 4XBFA 1KBHA 3JASA 1H8EG 4LFAB 4IHJA 2X6CA 1XEQA 5IDJA 3TGUH 1Q3EA 3H1IH 1AB3A 3L9DA 2B5UA 3ZHRA 4FZ1A 1XNQB 3HKBA 1SQVH 2YEVA 3E35A 4X89A 5EBLC 3UKMA 5KUMA 3T2MA 4MVOA 1QLEB 3UCSC 2MK3A 2B1GA 3JAWB 2CUGA 4PELA 1QLNA 4XDJA 2P4VA 2LP7A 4TV8B 1OCCC 2EBOA 2PUSA 1FPOA 3OR6C 3WG7C 1COWG 4F4LA 2WAMA 2Q6AA 4O2AA 4FK5C 2KG7A 1E1RG 1OCCB 3E86A 3RYFA 2WLLB 4J7KA 1U97A 3CRRA 4LF7B 4KHPB 4D7TA 2HLDG 1GTOA 2XNDG 3PN1A 3HKDA 4I9QA 5H5NA 3ABTA 5BMVB 4X65B 1MSDA 1Q6IA 4LP8A 2EILB 4TOIA 4DK0A 1H8HG 4WFHA 5H6QA 2DWEC 5LXTB 3HR0A 1BGYH 3AG2B 4X88A 1NKDA 1VEWA 2EULA 4MTOA 5FPRA 1EZVH 3IFXA 1K8AW 2QKAA 1B04A 3UT5A 2AHYA 3RYHA 4U3JA 1Y4MA 1FXVA 4B7KA 1SESA 1PM9A 1B06A 1PNMA 3VQWA 2OIGA 3RYIB 5GONB 1M57B 3K59A 5EIBD 1Q90D 3WFVA 2D2CB 3ASNB 4B3TB 1URFA 2YEVB 1TGOA 4DR7O 4BW9A 1O9GA 3DXRA 5AG2A 4CS2A 1NH2B 4J42A 4J10A 4PD4F 4UB6Z 3VQXA 1R3KC 2BOCC 3CJHA 3JARA 4O4JB 1XHZA 1Y66A 4W4KA 4X64B 3AG2C 1JVMA 3D3IA 1EN6A 2LGWA 2GV9A 4WFGA 1GM8A 1K4CC 4O4HB 2PI5A 5H6RA 1AJQA 4JPRA 4ICGA 3ZHQA 1N34B 2H8PC 4ZOLB 2EILC 3L74H 1PPJH 3B09A 4WFEA 3OE7G 1VQOV 3SDLA 2YSUB 3CC2V 3J81N 2F4VB 1WPBA 1GRJA 1WA8A 4XDKA 5BXZA 1SRYA 2FKXA 2N04A 4YJ3A 1OJHA 1PV0A 3DGEA 4X8AA 3FB8C 1JJOA 5EC1C 1LNQA 5B3SB 1QBZA 1ZUQA 3ASNC 1VF5B 4MVZA 3QVNA 3TXQA 2Q4PA 4PI2A 5CA1B 1HNWO 3AG1B 4FFKA 4DW0A 4ZHQB 2JK5C 5GW7A 1OCZC 2NLJC 4LFCO 4NKGB 1N32O 4RUEA 1JFFB 1IVSA 3VQVA 4P9PA 3OTFA 3JD4A 3RYFB 3BEHA 5LP6C 4MVSA 4QGPA 1JPXA 2P90A 1H38A 3U10A 1XMOO 1BZKA 2Y4TA 4K3AA 3E22A 1NQTA 4LF8B 3LNNA 1AI5A 4NXMB 1QNMA 4Q6GA 1LR1A 1XDCA 2ZDIC 1VQ6V 2QTOA 3K06A 4X1IB 4NXNO 2YIBA 4GX2A 3ETQA 3QO5A 1N33B 2LFRA 5JVDA 4JYBA 2YS8A 4UCUA 1T5EA 1N33O 1YJ9V 3JATB 2WLHA 4DV3B 2ZXWB 2LFSA 1KC8W 3UO2A 3ABUA 3NR7A 3ZMSA 1VQ8V 3K58A 5A9GA 3T4ZA 1Z5VA 4B7EA 2ZE5A 1VF6A 2EINB 2HJFC 1AI6A 1KKCA 3FB6C 1WN7A 1CP9A 2P22C 4J7ZA 5C8YA 4AILC 4BR6A 4CH6A 4LF8O 4B08A 5JH7A 3G71V 3STLC 3SGIA 4J9YB 4DUYB 3O65A 3CMAV 3QG5A 1KU9A 2YICA 2QE7G 2B1IA 4HNAB 2UU9B 5GTHZ 5EBMC 5JJJB 4YHHB 4TT3G 3A0HZ 4DV7O 1GM9A 1GH6A 4EEQA 3O9OA 4JI3O 3E22B 1DLBA 3JCZA 4B3SO 1TUBB 4QPJA 4JYAO 1DTOA 2Y0PA 3B40A 4CC5A 1AROP 2IU0A 3JAKA 3LSUA 3ZCCA 2Q0OC 2CAZC 4LF9B 2GSMB 4JTCB 4GX1A 2CGNA 4TV9B 1LUVA 1GM7A 1FKAO 4CS4A 4OXSA 4JV5O 3APQA 3OM3B 1I94B 3M7MX 1K33A 4IHJB 1MA1A 5E1AC 3CRMA 1DK1A 1W2BU 2EZOA 5IY5C 1Q81W 4YJ2B 2F1MA 1FXKA 5B1OA 1DF4A 4ZIBA 1P7GA 3FFQA 4MVRA 4YXWG 1ZSPA 1HNXB 4IGGA 2UU9O 2IBZH 2Q73A 4AI8A 3L72H 5JH7B 4Z1VA 2KSDA 1RFYA 4FM1A 2P6JA 2LGQA 4G27B 1KP2A 4RO2A 2R72A 1YJWV 1MZFA 1NR7A 4JAUA 3EHBB 1ZAUA 2HVJC 1RM1B 4X64O 3ZS8C 4O2AB 2X0LA 4UVCA 1ZTEA 1W59A 5EZYA 2PZSA 4LR3A 1WP7A 2F23A 5A2QN 3HKCA 3B2EE 3IJ4A 4I50A 2BTQB 5DECA 3OR7C 4DR3O 4DR6B 4GZRB 5ITZA 2QGNA 5LXTA 5LYJB 1OCRB 4YY3B 3WB2A 1XI1A 3OUSA 2N74A 3K9SA 2UXDO 1IDSA 3JASB 4I7ZB 1XNRB 2A9HA 4MVMA 4TV9A 2ZIMA 4LH7A 1MMMA 1FS0G 4JI4O 1QVFU 1VP7A 2GDSA 1SS3A 2Y69C 3HKBB 1Y6XA 2X6BA 4MW3A 2XAJA 3OMAB 1LUWA 1QHTA 2JVDA 4B3RO 2DWDC 2ADQB 2VS0A 4FZ0A 1GN6A 3D8CA 4EB6A 2P4KA 5DN6G 1V55C 1E1QG 1IXMA 3JD1A 1R6KA 2P67A 3CX5F 1FXKC 2Z0AA 3ZMZA 5IYZB 3RVZA 2LW7A 1BL8A 3A0BZ 1N32B 4H44B 5FNVA 5JCOC 1H2NA 4PA6A 5IJ0A 3ZIAG 5L3DA 3ICXA 1PP9H 3OMIB 2V1DA 2XUMA 4O4HA 3CC7V 5IJ9B 3RYCA 3BFRA 4TUYA 4FJCC 5BMVA 4PHZA 1K97A 1XQ8A 1SQBH 3K79A 2Z3YA 1OCOC 2HP8A 3F5WC 3T4DA 4UCVA 1ROPA 2XASA 4DUYO 2Q69A 5LMNO 3IC9A 1AJNA 3JALA 1BQ0A 2D3OW 5JJNB 1R73A 2V7QG 1OCRC 1CPYA 1JA8A 2OT5A 1IBKB 3K0GA 3K04A 1NTKH 4CH3A 2ZINA 2G38A 5D5QA 3AG4C 5CN0A 2PYJA 1BHBA 1XUQA 4UV8A 2X6AA 2VQFB 1SZTA 1SERA 3AG4B 4FLVA 2BOBC 2XTAA 4DV4O 3T1CA 2X7RB 3CJHB 5J2UB 4JYAB 1KECA 4Q20A 1HP8A 4D7SA 3H1HH 2CGOA 2DE0X 4BAYA 2JGUA 1BMFG 3OUFA 2CK3G 1NH2D 4DR4B 2Y4UA 5CA0A 3OEHG 1K73W 4BIZA 3CRAA 1QU7A 5E79Z 5LL6Y 3BA9A 1S5JA 2MW2B 4NXMO 3GWOA 2ODMA 2ZM6O 2PF4E 1IZ3A 3T1HB 1Q6UA 3WB1A 4LWSB 1SKVA 3S3XA 4F6RB 4DR7B 1FFXB 2ZXWC 1FJGB 2AGAA 2H94A 3K5NA 4OX9O 1GN3A 2W6IG 4H13B 4KL1A 1M9NA 1Y74B 4FLTA 1WA8B 4DV6B 1BS3A 4OX9B 2CTRA 1OHHG 2Y48A 4X9QA 3CCUV 3JALB 1WNSA 1SA0A 4JAAA 3UO3A 4YIPA 4R7CA 3OW2U 4FVMA 2ZCEA 4UCOA 4PA3A 3SJAC 3SR2C 5GTIZ 2VQEB 5LHIA 2QWRB 2RDCA 4YJ3B 1NTMH 1D5AA 4KP4A 2QKSA 3ZN0A 4RQFA 5KHIA 3BA8A 2VQEO 4I5SA 3GVMA 4ABMA 1RP3B 1SF9A 1HR0B 3K5MA 2QA4V 3RGBA 2DYSC 4FLZA 2UUBB 4LF4O 1AP6A 3JAMN 3FX7A 2EX3A 1I5YA 2YXLA 1M57C 5C8YB 2FL4A 4GCZA 4GUNA 3Q4HA 3UQ8A 2CE4A 2A06H 4AQYO 2PI4A 4DV7B 5J9PC 1P7BA 3TETA 1X59A 3WU2Z 2ARHA 3EXAA 1G6UA 1QLEC 3JYCA 4WFBV 3K5LA 4J41A 2R9IA 4F6RA 2DJVA 4MVUA 3G4SV 1PL4A 3CCLV 2EIMB 1S72V 3RT3C 1P49A 4DW1A 1JR9A 3L70H 3CP1A 1K3EA 3ZMUA 2OYQA 4NB5A 1KUQA 4LBEC 3F7VC 1XMQB 2CTWA 1TAEA 3JD3A 3CRQA 2XAHA 5EBWC 3KG2A 2VWJA 4BWAA 4YHHO 3TJTA 2GBOA 2F66C 3OAAG 3ZBHA 1XBLA 4LFBB 5B1NA 3LUTB 4RQEA 4DV5O 4MTXA 1AR1B 2OWOA 4JI5B 1XHXA 1S5LZ 3F5TA 5LHHA 4HNAA 3K57A 2W0FC 3GWKC 5KA5A 4AHCA 3CCEV 2WLLA 1TUEB 1FXHA 4NYKA 2IU3A 5J2TA 1YHQV 4X20A 5LGUA 5BZBA 4PI0A 1I94O 5IWAO 4LWSA 1KYOF 4DR6O 2XT9A 2ILMA 3LDEA 4DRXB 3WB0A 4PDVA 1RPOA 4JYCA 4GX5A 5JWPA 1ENVA 1YTFB 2M6YA 2JEXA 4WCEV 3PJSK 4Z2WA 4DR2B 1WLEA 3APOA 4DV0O 4K0KB 3JAKB 2A79B 1M90W 2M7WA 3ASOB 4TSFG 1M4UA 4H37A 1M56B 2QDOA 2UUCO 3KCYA 4U3JB 1BQZA 3W7WA 4O4IB 4I4TB 2IJJA 2UUAB 3CYOA 1QQCA 4U3FH 1S0VA 4CBCA 2R9RB 2Z5UA 1IBMB 4JI5O 5B1BC 3E8GA 1Y76B 1N8RW 4DUZB 2ZT9B 4E2LA 5LBQA 3CEIA 3JSLA 4KUMA 3SYOA 4K8XA 2P5OA 2F95B 4O4JA 3EVKA 2OCCC 3RFRA 1K9MW 4TQFA 2ZR3A 5LGNA 4MSWC 1XILA 3H9VA 1MNGA 1NTZH 4JI0B 3E8BA 2Q7GA 2ZKOA 1J95A 5DM6V 1M5IA 2E3CA 4H33A 4YY3O 2IJIA 5KX5B 3C90A 5KMGA 3SJQC 2ZM6B 4PA7A 1WJZA 4DV0B 4K0KO 3X2QB 3OT7A 2IW5A 3CS5A 2LQTA 4HZ3A 5EIBC 1TUBA 1NI8A 4X66B 3CCQV 1DF5A 3I56V 4MTFA 4UV9A 3DC5A 4J80A 1ZX3A 4I50B 3OGIB 5B1BB 1NBMG 1H2LA 2A7WA 1BT8A 2OCHA 4B3MO 4IT5A 2F93B 1NT2B 5K1XA 1MG1A 1R6TA 3FB5C 4IYHA 4JI3B 3N2GA 4I55A 3QTCA 5JJEB 1MOFA 1ZL8B 4R6ZA 1YXBA 3P32A 5GONA 3RWRD 3K9AA 1VIBA 5CBFA 1QVGU 1G1XB 2YXYA 1N4CA 3ABKB 1XNQO 2ATKC 1EZJA 1S77D 2OTLV 1G8MA 3EFFK 1G4YB 2V4DA 2UUBO 4LF4B 4LNUA 4ZHQA 5DEDA 1HR0O 5LMUO 1Q5OA 2WLKA 4J7JA 1YVWA 1ZLZA 3FAVA 3ML0A 1JFFA 3A8TA 2CH7A 4K35A 2YI9A 2W6JG 3D3QA 4QE9A 3CWBH 5IJ0B 2IM9A 5IYZA 4P2ZA 4JF3A 1NZ6A 2AZ2A 3ZJZA 3E2EA 3CD6V 1GMGA 3RYCB 4O2BB 4E4EA 1US6A 1NVPB 1VARA 3KKYA 2ADPA 4LF6B 1YTFD 3OTOO 3ASOC 2XHBA 2VRZA 3ETDA 4FMTA 4UUJC 1I0HA 1H2KA 2GHYA 5EK0A 1VQKV 3QNEA 2ZE7A 2L35A 1Q43A 5C93A 1RSOA 3I5DA 3E8FA 1Q82W 4GKKO 3WG7B 1WPXA 4JI7O 1Y74A 4DR3B 3N2GB 4I55B 2DW4A 2O57A 1ORQC 5H2FZ 3CCJV 3F7YC 1EBOA 4QIWF 4WF9V 2YDEA 5KHGA 1PD3A 4JI1O 3ETEA 4EB6B 1Y76A 3SYCA 5BR8B 3OD4A 4RUFA 2GTSA 2LJ2A 3CCRV 2PGGA 2UUCB 3K03A 4LNUB 5CBGA 1VQNV 5CA0B 4TV8A 2JDIG 4DV3O 3E89A 1EN4A 4NTYA 2R70A 5IYCO 3SJCC 1W0JG 4DV6O 3R65A 4U7NA 4ZI7A 4JZGA 2ZE8A 3BAAA 3CHXA 5IJ9A 3JD0A 4G28B 2QWNB 5CB4A 3MHSC 1IBLO 1NS1A 3P3PA 2HHHO 1FFXA 2DOSA 2YC0A 3S3WA 2K1EA 1YJNV 2QJ1A 3A2FA 1GO3F 1S3JA 1PKXA 4JI7B 3C3SA 3ZRWB 4BW5A 1SZXA 1WB7A 4UCTA 1TVKB 4GYCB 2NN4A 3RVYA 2LO1A 4PDMA 1XNRO 2ITCC 1R1BA 2ZIOA 4HBNA 4DR2O 2QM4A 3T1HO 3H1KH 3DTUB 2Y0IA 5LMNB 1N36B 4X1YB 2Q5ZA 1VF7A 4OGQB 1R6NA 1O9HA 1M93A 4DR5B 1N0JA 2YI8A 4YJ2A 3UM7A 1JQ0A 4WFAV 4FLWA 2QWQB 2DN9A 1F51A 1WB8A 1VQLV 4DO2A 1NU1H 1M1KW 5EYPA 2VQFO 1EN5A 3JARB 4DV2B 2QM8A 5CMUA 2CTQA 4GX0A 3CRCA 4KFMA 2BE3A 3CE2A 1S5HC 2QM7A 1B6QA 5CA3A 4HAMA 2GUZA 1D2DA 3ZMVA 1I7FA 3L71H 4BIOA 3ABKC 4PDLA 1XMOB 3CPWU 2JEUA 5CB4B 1E79G 3LNMB 1HNZO 2HFEC 4R50A 3RBZA 4KXRA 4X1KA 4JI4B 2DMXA 1YI2V 2LW1A 2BTQA 4NVPA 1SA0B 4HYOA 1KQSU 4LFBO 1OCZB 2E75B 3ETGA 1P4RA 2JRIA 2RN9A 5LYJA 5IY5B 1NVPD 2B9ZA 4CC6A 3MAQA 1MABG 3M99B 2PY5A 4LF6O 4X65O 1K34A 4MS2A 1F4NA 3ZRVA 3H01A 4Z1MG 2VWKA 3GB7C 3FD9A 5KHHA 2JIZG 5L3CA 5H9CA 1XL4A 3HPLC 3SYPA 1L1FA 4LH6A 3SJBC 5KHJA 1UPGA 2ZD9A 5IT9N 3J7AU 1P84F 4EKWA 3K08A 4H0LB 3ZRXA 5FL7G 3N2KB 1RM1C 4P30A 3ZHVA 2UXDB 2Q7HA 4CH4A 5JQGA 4J11A 2EINC 4FIPC 1VQ5V 1HNZB 4X62B 2WLNA 3OEEG 3ZMTA 1Q7YW 1QCEA 4EFEA 2ZNIA 2UXCB 3CCMV 1H2SB 2GUZB 2EJ7A 2DQ3A 4X20B 1V54C 1FJGO 1FAFA 5KX5A 5KAFZ 3HKCB 4B3MB 3OGCC 4DR5O 3AG1C 4MVQA 4D6TH 2WLIA 3K5OA 2HJDA 4WBNB 5ITZB 3A0RA 3QO8A 2BSKB 4DR1O 1S76D 4UXNA 3BCCH 5FPOA 4CH5A 2OIEA 3CCSV 4JI0O 4X1YA 1FD9A 4JI2O 3I55V 1K5QA 2EIKB 4O4LB 1ZL8A 4GKJB 3B8MA 1M56C 2XAGA 2XOKG 4B3TO 4X62O 2F4VO 5CA1A 4N21A 4FFBA 2WA3A 1JMKC 5LGTA 1AP5A 2P7TC 2KKWA 2R9AA 1X4TA 2ZQMA 2EIKC 4TQDA 5J2TB 3L73H 3E8HA 1PL0A 1PNLA 1K5SA 2RNBA 5KMGB 3FYIB 4GT1A 2QEXV 5F2VO 3SYQA 3FAVB 4B3SB 4DV5B 4FLXA 2IJKA 2IJHA 4DV4B 2Y69B 1MSWD 1QR9A 4CZZA 3SPIA 1HNWB 2L6LA 3HKEB 3CMEV 3G80A 1AR4A 1BCCH 2JJ2G 3STZC 3P3NA 1JX9A 4LF5B 1L0LH 2XAFA 5LA6A 5IE9A 5CBHA 2K9PA 2NNUA 4X1IA 1SC5B 3ZHSA 4JI6O 2WLMA 3W7XA 2H3OA 3BHPA 2FB5A 5JVDB 2BTOA 2Q8VA 5JCOA 3T1YO 1BHAA 4DXWA 5B3SC 1MZEA 4LC1A 5L3EA 4UB8Z 1F7YA 2UXNA 1XL6A 4DV1B 3B4SA 3K3WA 2Q9LA 3ABMB 3MDSA 4G2KA 1N0NA 2E76B 4RWUA 2JGDA 4IIJA 4LF7O 2PYLA 2JS3A 4KHPO 3VQYA 4JAVA 4IYIA 3JAWA 3ZRSA 2UUAO 4UVBA 5LP6B 2YUAA 3CSXA 4I0XA 4PA9A 1VMGA 4NTWA 4DR1B 1H2GA 1OV9A 3H1LH 1UFIA 1YCIA 1FYJA 2QR4A 4UCSA 3RW0A 3AK1A 3SPHA 1HW7A 2PTMA 2W0XA 5IWAB 2ZDIA 3FKSG 4PV1B 1Z5WA 3HKDB 2A0LA 4X66O 4QJFB 4DV1O 4N23A 4JI1B 3JCUZ 2RMKB 3SPCA 4WBNA 2IH1C 2QWOB 5D5PA 1AVMA 4JZ2A 5LOVB 1JOYA 2KB1A 1H2MA 3MD0A 4JYYA 4P9OA 2KQXA 1IBKO 1GN4A 2HEPA 1WAZA 2OTJV 5FLXN 1JJ2U 4GLXA 2JJ1G 3TXSA 3RYHB 4FM2A 1OZ0A
chains in the Genus database with same CATH topology
2AZ2A 4LWSA 2AZ0A 3O9OA 3Q4HA 3FD9A 2VS0A 1WA8B 3G80A 3GWKC 3GVMA 4ABMA 1WA8A 3TXQA 3OGIB 3Q4HB 2KG7B 4I0XA 3FAVA 2DE0X 4LWSB 2B9ZA 3ZBHA 2KG7A 4GZRB 4I0XB 3FAVB 2VRZA 3TXSA 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ2 A;  4LWS A;  2AZ0 A;  3O9O A;  3Q4H A;  3FD9 A;  2VS0 A;  1WA8 B;  3G80 A;  3GWK C;  3GVM A;  4ABM A;  1WA8 A;  3TXQ A;  3OGI B;  3Q4H B;  2KG7 B;  4I0X A;  3FAV A;  2DE0 X;  4LWS B;  2B9Z A;  3ZBH A;  2KG7 A;  4GZR B;  4I0X B;  3FAV B;  2VRZ A;  3TXS A;  3HR0 A; 
#chains in the Genus database with same CATH topology
 4JTD B;  4LFC B;  4DUZ O;  2WSS G;  3DXR B;  4J9Z B;  3RYI A;  1UJW B;  5B5E Z;  2YIA A;  2QSA A;  1FFT B;  5B1A C;  3L75 H;  4DV2 O;  1YEW A;  1KP3 A;  3D36 A;  5BY1 A;  2KG7 B;  1EM1 A;  4L87 A;  3LSS A;  3BRC A;  2AXT Z;  1BE3 H;  3AG3 B;  4PJ0 Z;  3QF7 A;  5LP6 A;  4NR1 A;  3VBB A;  4XDL A;  3B77 A;  1THZ A;  4ZI7 B;  1K7D A;  3K0D A;  3LDC A;  3E83 A;  5LMU B;  2AHZ A;  1IXB A;  3G6E V;  1SQP H;  2EZP A;  4OPH A;  1NJI W;  1VQM V;  2WPD G;  1HNX O;  1YIJ V;  1HDJ A;  4DRX A;  1AI4 A;  2E74 B;  5EC2 C;  3CC4 V;  1VQ7 V;  1NR1 A;  3DSQ A;  4JI8 O;  1SQQ H;  2HVK C;  4LFA O;  3AK2 A;  3C3T A;  1TA8 A;  2RQ6 A;  3AG7 A;  1IBM O;  3AEI A;  1DGS A;  3UT5 B;  1R3L C;  4X1K B;  1Q8I A;  4TWK A;  2ZE6 A;  3DC6 A;  1R3J C;  1TVK A;  5HFM A;  3KCX A;  5LOV A;  4GKK B;  3OTO B;  3HB3 B;  1AJP A;  1KD1 W;  1N34 O;  2JS5 A;  4FPP A;  3VOU A;  1V55 B;  2ZNJ A;  3ZN1 A;  3X2Q C;  5L3B A;  4JI2 B;  4QPK A;  3FYE B;  1YF2 A;  4O4I A;  4JV5 B;  4DYL A;  3W7U A;  3RN4 A;  4RAI A;  3N27 A;  2EJR A;  2HG5 C;  3BY6 A;  3ZHT A;  1J5E O;  2CTP A;  4EFB A;  1AI7 A;  5EYP B;  2E5L B;  1A32 A;  1WP8 A;  1RPR A;  3ABL B;  1SET A;  3TCU A;  2ZR2 A;  1GN2 A;  3W7T A;  2P06 A;  2DQ0 A;  1GKF A;  3SPG A;  5L3F A;  2FTK A;  3N2K A;  2UXC O;  1YSC A;  3THO A;  3BPZ A;  4F6E A;  5FNV B;  2WA4 A;  3AK3 A;  1B3Q A;  1IUR A;  1F4M A;  1XRE A;  2OCC B;  3ABM C;  3KZI Z;  2UXX A;  4B3R B;  1QR8 A;  4JI8 B;  3SYA A;  2HHH B;  1D5N A;  1EFR G;  1F23 A;  1V54 B;  4TUY B;  1K4D C;  4MT8 A;  4ZBM A;  4UVA A;  2DYS B;  1K92 A;  2RJZ A;  2IH3 C;  2FYU H;  3P30 A;  4IL6 Z;  1KMI Z;  5L3G A;  1SQF A;  1PNK A;  3IGA C;  4LF5 O;  1W0K G;  1KKD A;  2YXH A;  4BIU A;  2GTA A;  5TIS Z;  3QO7 A;  2UXB B;  4DR4 O;  3R66 A;  4I4T A;  3JAT A;  1Z2G A;  1KB9 F;  2Q68 A;  3G6B A;  3LDD A;  5KHK A;  1JCH A;  4CS3 A;  4A5U B;  3AG3 C;  5B66 Z;  5K1P A;  1Q86 W;  2HKO A;  1U96 A;  3IAY A;  1R3I C;  4FM0 A;  4UCR A;  2N05 A;  5J2U A;  1VQP V;  1IX9 A;  1ZWI C;  5B1A B;  1OCO B;  4MTG A;  2EIM C;  4AQY B;  1Y67 A;  1VQ9 V;  2A3Q A;  2BCC H;  4WFF A;  4JGS A;  1Q6H A;  3TK1 A;  1YDX A;  4MW8 A;  1SQX H;  3B8N A;  5LHG A;  2AW9 A;  3Q4H B;  2QWP B;  1IBL B;  4OPA A;  3CXC U;  4I9W A;  4JTA B;  2F43 G;  4LF9 O;  4W4L A;  3W7S A;  3OMN B;  3ABL C;  2Q67 A;  2AZ0 A;  2FML A;  1I5X A;  2YID A;  3H1J H;  3JSN A;  1XMQ O;  3HKE A;  5IYD O;  1L0N H;  1VF6 C;  2WLI B;  1HWY A;  2WWW A;  5BR8 O;  2E5L O;  4DK1 A;  4L8J A;  1RSO B;  3D36 C;  1SQG A;  5LA6 B;  2C2A A;  2BSK A;  3CXH F;  4ASU G;  2EIJ C;  4FLY A;  1N36 O;  2RCV A;  4PA4 A;  1CXZ B;  1CEZ A;  1YZB A;  2XAQ A;  4LCU C;  1XOU A;  2EIJ B;  2ETN A;  3BVO A;  2Q7E A;  2QKC A;  5HFL A;  2QTS A;  1FXK B;  4U7O A;  2DYR B;  3CB2 A;  4O4L A;  1GAX A;  1BSM A;  5KUK A;  5JQG B;  5IYB O;  2ITD C;  4K8Z A;  1YIT V;  2DYR C;  3LSQ A;  3SPJ A;  4FFB B;  4QE7 A;  4YIO A;  2CH7 B;  2JGD B;  4QNH B;  4IIJ B;  3M8A A;  3NXS A;  4JI6 B;  4C7U A;  4FLU A;  3U11 A;  2NR5 A;  1V9P A;  3CCV V;  4GKJ O;  1GK9 A;  1AR5 A;  3U0Z A;  3T1Y B;  4I0X B;  1J5E B;  2UXB O;  4O2B A;  2Q0A A;  1VQ4 V;  4UFZ A;  3OFN G;  5KAI Z;  2HR3 A;  4NTX A;  4ZKI A;  4R8C A;  4ZOL A;  5EZY B;  3ZHU A;  2YIB D;  4JAS A;  3JD2 A;  5KA6 A;  3J80 N;  1I08 A;  3ZRW A;  1L8D A;  3BAB A;  3FB7 C;  3MHH C;  3ZED A;  4PDR A;  5KLV H;  4NXN B;  3IC7 A;  3ZX6 A;  2CDY A;  3G67 A;  1AIL A;  2WLJ A;  4XBF A;  1KBH A;  3JAS A;  1H8E G;  4LFA B;  4IHJ A;  2X6C A;  1XEQ A;  5IDJ A;  3TGU H;  1Q3E A;  3H1I H;  1AB3 A;  3L9D A;  2B5U A;  3ZHR A;  4FZ1 A;  1XNQ B;  3HKB A;  1SQV H;  2YEV A;  3E35 A;  4X89 A;  5EBL C;  3UKM A;  5KUM A;  3T2M A;  4MVO A;  1QLE B;  3UCS C;  2MK3 A;  2B1G A;  3JAW B;  2CUG A;  4PEL A;  1QLN A;  4XDJ A;  2P4V A;  2LP7 A;  4TV8 B;  1OCC C;  2EBO A;  2PUS A;  1FPO A;  3OR6 C;  3WG7 C;  1COW G;  4F4L A;  2WAM A;  2Q6A A;  4O2A A;  4FK5 C;  2KG7 A;  1E1R G;  1OCC B;  3E86 A;  3RYF A;  2WLL B;  4J7K A;  1U97 A;  3CRR A;  4LF7 B;  4KHP B;  4D7T A;  2HLD G;  1GTO A;  2XND G;  3PN1 A;  3HKD A;  4I9Q A;  5H5N A;  3ABT A;  5BMV B;  4X65 B;  1MSD A;  1Q6I A;  4LP8 A;  2EIL B;  4TOI A;  4DK0 A;  1H8H G;  4WFH A;  5H6Q A;  2DWE C;  5LXT B;  3HR0 A;  1BGY H;  3AG2 B;  4X88 A;  1NKD A;  1VEW A;  2EUL A;  4MTO A;  5FPR A;  1EZV H;  3IFX A;  1K8A W;  2QKA A;  1B04 A;  3UT5 A;  2AHY A;  3RYH A;  4U3J A;  1Y4M A;  1FXV A;  4B7K A;  1SES A;  1PM9 A;  1B06 A;  1PNM A;  3VQW A;  2OIG A;  3RYI B;  5GON B;  1M57 B;  3K59 A;  5EIB D;  1Q90 D;  3WFV A;  2D2C B;  3ASN B;  4B3T B;  1URF A;  2YEV B;  1TGO A;  4DR7 O;  4BW9 A;  1O9G A;  3DXR A;  5AG2 A;  4CS2 A;  1NH2 B;  4J42 A;  4J10 A;  4PD4 F;  4UB6 Z;  3VQX A;  1R3K C;  2BOC C;  3CJH A;  3JAR A;  4O4J B;  1XHZ A;  1Y66 A;  4W4K A;  4X64 B;  3AG2 C;  1JVM A;  3D3I A;  1EN6 A;  2LGW A;  2GV9 A;  4WFG A;  1GM8 A;  1K4C C;  4O4H B;  2PI5 A;  5H6R A;  1AJQ A;  4JPR A;  4ICG A;  3ZHQ A;  1N34 B;  2H8P C;  4ZOL B;  2EIL C;  3L74 H;  1PPJ H;  3B09 A;  4WFE A;  3OE7 G;  1VQO V;  3SDL A;  2YSU B;  3CC2 V;  3J81 N;  2F4V B;  1WPB A;  1GRJ A;  1WA8 A;  4XDK A;  5BXZ A;  1SRY A;  2FKX A;  2N04 A;  4YJ3 A;  1OJH A;  1PV0 A;  3DGE A;  4X8A A;  3FB8 C;  1JJO A;  5EC1 C;  1LNQ A;  5B3S B;  1QBZ A;  1ZUQ A;  3ASN C;  1VF5 B;  4MVZ A;  3QVN A;  3TXQ A;  2Q4P A;  4PI2 A;  5CA1 B;  1HNW O;  3AG1 B;  4FFK A;  4DW0 A;  4ZHQ B;  2JK5 C;  5GW7 A;  1OCZ C;  2NLJ C;  4LFC O;  4NKG B;  1N32 O;  4RUE A;  1JFF B;  1IVS A;  3VQV A;  4P9P A;  3OTF A;  3JD4 A;  3RYF B;  3BEH A;  5LP6 C;  4MVS A;  4QGP A;  1JPX A;  2P90 A;  1H38 A;  3U10 A;  1XMO O;  1BZK A;  2Y4T A;  4K3A A;  3E22 A;  1NQT A;  4LF8 B;  3LNN A;  1AI5 A;  4NXM B;  1QNM A;  4Q6G A;  1LR1 A;  1XDC A;  2ZDI C;  1VQ6 V;  2QTO A;  3K06 A;  4X1I B;  4NXN O;  2YIB A;  4GX2 A;  3ETQ A;  3QO5 A;  1N33 B;  2LFR A;  5JVD A;  4JYB A;  2YS8 A;  4UCU A;  1T5E A;  1N33 O;  1YJ9 V;  3JAT B;  2WLH A;  4DV3 B;  2ZXW B;  2LFS A;  1KC8 W;  3UO2 A;  3ABU A;  3NR7 A;  3ZMS A;  1VQ8 V;  3K58 A;  5A9G A;  3T4Z A;  1Z5V A;  4B7E A;  2ZE5 A;  1VF6 A;  2EIN B;  2HJF C;  1AI6 A;  1KKC A;  3FB6 C;  1WN7 A;  1CP9 A;  2P22 C;  4J7Z A;  5C8Y A;  4AIL C;  4BR6 A;  4CH6 A;  4LF8 O;  4B08 A;  5JH7 A;  3G71 V;  3STL C;  3SGI A;  4J9Y B;  4DUY B;  3O65 A;  3CMA V;  3QG5 A;  1KU9 A;  2YIC A;  2QE7 G;  2B1I A;  4HNA B;  2UU9 B;  5GTH Z;  5EBM C;  5JJJ B;  4YHH B;  4TT3 G;  3A0H Z;  4DV7 O;  1GM9 A;  1GH6 A;  4EEQ A;  3O9O A;  4JI3 O;  3E22 B;  1DLB A;  3JCZ A;  4B3S O;  1TUB B;  4QPJ A;  4JYA O;  1DTO A;  2Y0P A;  3B40 A;  4CC5 A;  1ARO P;  2IU0 A;  3JAK A;  3LSU A;  3ZCC A;  2Q0O C;  2CAZ C;  4LF9 B;  2GSM B;  4JTC B;  4GX1 A;  2CGN A;  4TV9 B;  1LUV A;  1GM7 A;  1FKA O;  4CS4 A;  4OXS A;  4JV5 O;  3APQ A;  3OM3 B;  1I94 B;  3M7M X;  1K33 A;  4IHJ B;  1MA1 A;  5E1A C;  3CRM A;  1DK1 A;  1W2B U;  2EZO A;  5IY5 C;  1Q81 W;  4YJ2 B;  2F1M A;  1FXK A;  5B1O A;  1DF4 A;  4ZIB A;  1P7G A;  3FFQ A;  4MVR A;  4YXW G;  1ZSP A;  1HNX B;  4IGG A;  2UU9 O;  2IBZ H;  2Q73 A;  4AI8 A;  3L72 H;  5JH7 B;  4Z1V A;  2KSD A;  1RFY A;  4FM1 A;  2P6J A;  2LGQ A;  4G27 B;  1KP2 A;  4RO2 A;  2R72 A;  1YJW V;  1MZF A;  1NR7 A;  4JAU A;  3EHB B;  1ZAU A;  2HVJ C;  1RM1 B;  4X64 O;  3ZS8 C;  4O2A B;  2X0L A;  4UVC A;  1ZTE A;  1W59 A;  5EZY A;  2PZS A;  4LR3 A;  1WP7 A;  2F23 A;  5A2Q N;  3HKC A;  3B2E E;  3IJ4 A;  4I50 A;  2BTQ B;  5DEC A;  3OR7 C;  4DR3 O;  4DR6 B;  4GZR B;  5ITZ A;  2QGN A;  5LXT A;  5LYJ B;  1OCR B;  4YY3 B;  3WB2 A;  1XI1 A;  3OUS A;  2N74 A;  3K9S A;  2UXD O;  1IDS A;  3JAS B;  4I7Z B;  1XNR B;  2A9H A;  4MVM A;  4TV9 A;  2ZIM A;  4LH7 A;  1MMM A;  1FS0 G;  4JI4 O;  1QVF U;  1VP7 A;  2GDS A;  1SS3 A;  2Y69 C;  3HKB B;  1Y6X A;  2X6B A;  4MW3 A;  2XAJ A;  3OMA B;  1LUW A;  1QHT A;  2JVD A;  4B3R O;  2DWD C;  2ADQ B;  2VS0 A;  4FZ0 A;  1GN6 A;  3D8C A;  4EB6 A;  2P4K A;  5DN6 G;  1V55 C;  1E1Q G;  1IXM A;  3JD1 A;  1R6K A;  2P67 A;  3CX5 F;  1FXK C;  2Z0A A;  3ZMZ A;  5IYZ B;  3RVZ A;  2LW7 A;  1BL8 A;  3A0B Z;  1N32 B;  4H44 B;  5FNV A;  5JCO C;  1H2N A;  4PA6 A;  5IJ0 A;  3ZIA G;  5L3D A;  3ICX A;  1PP9 H;  3OMI B;  2V1D A;  2XUM A;  4O4H A;  3CC7 V;  5IJ9 B;  3RYC A;  3BFR A;  4TUY A;  4FJC C;  5BMV A;  4PHZ A;  1K97 A;  1XQ8 A;  1SQB H;  3K79 A;  2Z3Y A;  1OCO C;  2HP8 A;  3F5W C;  3T4D A;  4UCV A;  1ROP A;  2XAS A;  4DUY O;  2Q69 A;  5LMN O;  3IC9 A;  1AJN A;  3JAL A;  1BQ0 A;  2D3O W;  5JJN B;  1R73 A;  2V7Q G;  1OCR C;  1CPY A;  1JA8 A;  2OT5 A;  1IBK B;  3K0G A;  3K04 A;  1NTK H;  4CH3 A;  2ZIN A;  2G38 A;  5D5Q A;  3AG4 C;  5CN0 A;  2PYJ A;  1BHB A;  1XUQ A;  4UV8 A;  2X6A A;  2VQF B;  1SZT A;  1SER A;  3AG4 B;  4FLV A;  2BOB C;  2XTA A;  4DV4 O;  3T1C A;  2X7R B;  3CJH B;  5J2U B;  4JYA B;  1KEC A;  4Q20 A;  1HP8 A;  4D7S A;  3H1H H;  2CGO A;  2DE0 X;  4BAY A;  2JGU A;  1BMF G;  3OUF A;  2CK3 G;  1NH2 D;  4DR4 B;  2Y4U A;  5CA0 A;  3OEH G;  1K73 W;  4BIZ A;  3CRA A;  1QU7 A;  5E79 Z;  5LL6 Y;  3BA9 A;  1S5J A;  2MW2 B;  4NXM O;  3GWO A;  2ODM A;  2ZM6 O;  2PF4 E;  1IZ3 A;  3T1H B;  1Q6U A;  3WB1 A;  4LWS B;  1SKV A;  3S3X A;  4F6R B;  4DR7 B;  1FFX B;  2ZXW C;  1FJG B;  2AGA A;  2H94 A;  3K5N A;  4OX9 O;  1GN3 A;  2W6I G;  4H13 B;  4KL1 A;  1M9N A;  1Y74 B;  4FLT A;  1WA8 B;  4DV6 B;  1BS3 A;  4OX9 B;  2CTR A;  1OHH G;  2Y48 A;  4X9Q A;  3CCU V;  3JAL B;  1WNS A;  1SA0 A;  4JAA A;  3UO3 A;  4YIP A;  4R7C A;  3OW2 U;  4FVM A;  2ZCE A;  4UCO A;  4PA3 A;  3SJA C;  3SR2 C;  5GTI Z;  2VQE B;  5LHI A;  2QWR B;  2RDC A;  4YJ3 B;  1NTM H;  1D5A A;  4KP4 A;  2QKS A;  3ZN0 A;  4RQF A;  5KHI A;  3BA8 A;  2VQE O;  4I5S A;  3GVM A;  4ABM A;  1RP3 B;  1SF9 A;  1HR0 B;  3K5M A;  2QA4 V;  3RGB A;  2DYS C;  4FLZ A;  2UUB B;  4LF4 O;  1AP6 A;  3JAM N;  3FX7 A;  2EX3 A;  1I5Y A;  2YXL A;  1M57 C;  5C8Y B;  2FL4 A;  4GCZ A;  4GUN A;  3Q4H A;  3UQ8 A;  2CE4 A;  2A06 H;  4AQY O;  2PI4 A;  4DV7 B;  5J9P C;  1P7B A;  3TET A;  1X59 A;  3WU2 Z;  2ARH A;  3EXA A;  1G6U A;  1QLE C;  3JYC A;  4WFB V;  3K5L A;  4J41 A;  2R9I A;  4F6R A;  2DJV A;  4MVU A;  3G4S V;  1PL4 A;  3CCL V;  2EIM B;  1S72 V;  3RT3 C;  1P49 A;  4DW1 A;  1JR9 A;  3L70 H;  3CP1 A;  1K3E A;  3ZMU A;  2OYQ A;  4NB5 A;  1KUQ A;  4LBE C;  3F7V C;  1XMQ B;  2CTW A;  1TAE A;  3JD3 A;  3CRQ A;  2XAH A;  5EBW C;  3KG2 A;  2VWJ A;  4BWA A;  4YHH O;  3TJT A;  2GBO A;  2F66 C;  3OAA G;  3ZBH A;  1XBL A;  4LFB B;  5B1N A;  3LUT B;  4RQE A;  4DV5 O;  4MTX A;  1AR1 B;  2OWO A;  4JI5 B;  1XHX A;  1S5L Z;  3F5T A;  5LHH A;  4HNA A;  3K57 A;  2W0F C;  3GWK C;  5KA5 A;  4AHC A;  3CCE V;  2WLL A;  1TUE B;  1FXH A;  4NYK A;  2IU3 A;  5J2T A;  1YHQ V;  4X20 A;  5LGU A;  5BZB A;  4PI0 A;  1I94 O;  5IWA O;  4LWS A;  1KYO F;  4DR6 O;  2XT9 A;  2ILM A;  3LDE A;  4DRX B;  3WB0 A;  4PDV A;  1RPO A;  4JYC A;  4GX5 A;  5JWP A;  1ENV A;  1YTF B;  2M6Y A;  2JEX A;  4WCE V;  3PJS K;  4Z2W A;  4DR2 B;  1WLE A;  3APO A;  4DV0 O;  4K0K B;  3JAK B;  2A79 B;  1M90 W;  2M7W A;  3ASO B;  4TSF G;  1M4U A;  4H37 A;  1M56 B;  2QDO A;  2UUC O;  3KCY A;  4U3J B;  1BQZ A;  3W7W A;  4O4I B;  4I4T B;  2IJJ A;  2UUA B;  3CYO A;  1QQC A;  4U3F H;  1S0V A;  4CBC A;  2R9R B;  2Z5U A;  1IBM B;  4JI5 O;  5B1B C;  3E8G A;  1Y76 B;  1N8R W;  4DUZ B;  2ZT9 B;  4E2L A;  5LBQ A;  3CEI A;  3JSL A;  4KUM A;  3SYO A;  4K8X A;  2P5O A;  2F95 B;  4O4J A;  3EVK A;  2OCC C;  3RFR A;  1K9M W;  4TQF A;  2ZR3 A;  5LGN A;  4MSW C;  1XIL A;  3H9V A;  1MNG A;  1NTZ H;  4JI0 B;  3E8B A;  2Q7G A;  2ZKO A;  1J95 A;  5DM6 V;  1M5I A;  2E3C A;  4H33 A;  4YY3 O;  2IJI A;  5KX5 B;  3C90 A;  5KMG A;  3SJQ C;  2ZM6 B;  4PA7 A;  1WJZ A;  4DV0 B;  4K0K O;  3X2Q B;  3OT7 A;  2IW5 A;  3CS5 A;  2LQT A;  4HZ3 A;  5EIB C;  1TUB A;  1NI8 A;  4X66 B;  3CCQ V;  1DF5 A;  3I56 V;  4MTF A;  4UV9 A;  3DC5 A;  4J80 A;  1ZX3 A;  4I50 B;  3OGI B;  5B1B B;  1NBM G;  1H2L A;  2A7W A;  1BT8 A;  2OCH A;  4B3M O;  4IT5 A;  2F93 B;  1NT2 B;  5K1X A;  1MG1 A;  1R6T A;  3FB5 C;  4IYH A;  4JI3 B;  3N2G A;  4I55 A;  3QTC A;  5JJE B;  1MOF A;  1ZL8 B;  4R6Z A;  1YXB A;  3P32 A;  5GON A;  3RWR D;  3K9A A;  1VIB A;  5CBF A;  1QVG U;  1G1X B;  2YXY A;  1N4C A;  3ABK B;  1XNQ O;  2ATK C;  1EZJ A;  1S77 D;  2OTL V;  1G8M A;  3EFF K;  1G4Y B;  2V4D A;  2UUB O;  4LF4 B;  4LNU A;  4ZHQ A;  5DED A;  1HR0 O;  5LMU O;  1Q5O A;  2WLK A;  4J7J A;  1YVW A;  1ZLZ A;  3FAV A;  3ML0 A;  1JFF A;  3A8T A;  2CH7 A;  4K35 A;  2YI9 A;  2W6J G;  3D3Q A;  4QE9 A;  3CWB H;  5IJ0 B;  2IM9 A;  5IYZ A;  4P2Z A;  4JF3 A;  1NZ6 A;  2AZ2 A;  3ZJZ A;  3E2E A;  3CD6 V;  1GMG A;  3RYC B;  4O2B B;  4E4E A;  1US6 A;  1NVP B;  1VAR A;  3KKY A;  2ADP A;  4LF6 B;  1YTF D;  3OTO O;  3ASO C;  2XHB A;  2VRZ A;  3ETD A;  4FMT A;  4UUJ C;  1I0H A;  1H2K A;  2GHY A;  5EK0 A;  1VQK V;  3QNE A;  2ZE7 A;  2L35 A;  1Q43 A;  5C93 A;  1RSO A;  3I5D A;  3E8F A;  1Q82 W;  4GKK O;  3WG7 B;  1WPX A;  4JI7 O;  1Y74 A;  4DR3 B;  3N2G B;  4I55 B;  2DW4 A;  2O57 A;  1ORQ C;  5H2F Z;  3CCJ V;  3F7Y C;  1EBO A;  4QIW F;  4WF9 V;  2YDE A;  5KHG A;  1PD3 A;  4JI1 O;  3ETE A;  4EB6 B;  1Y76 A;  3SYC A;  5BR8 B;  3OD4 A;  4RUF A;  2GTS A;  2LJ2 A;  3CCR V;  2PGG A;  2UUC B;  3K03 A;  4LNU B;  5CBG A;  1VQN V;  5CA0 B;  4TV8 A;  2JDI G;  4DV3 O;  3E89 A;  1EN4 A;  4NTY A;  2R70 A;  5IYC O;  3SJC C;  1W0J G;  4DV6 O;  3R65 A;  4U7N A;  4ZI7 A;  4JZG A;  2ZE8 A;  3BAA A;  3CHX A;  5IJ9 A;  3JD0 A;  4G28 B;  2QWN B;  5CB4 A;  3MHS C;  1IBL O;  1NS1 A;  3P3P A;  2HHH O;  1FFX A;  2DOS A;  2YC0 A;  3S3W A;  2K1E A;  1YJN V;  2QJ1 A;  3A2F A;  1GO3 F;  1S3J A;  1PKX A;  4JI7 B;  3C3S A;  3ZRW B;  4BW5 A;  1SZX A;  1WB7 A;  4UCT A;  1TVK B;  4GYC B;  2NN4 A;  3RVY A;  2LO1 A;  4PDM A;  1XNR O;  2ITC C;  1R1B A;  2ZIO A;  4HBN A;  4DR2 O;  2QM4 A;  3T1H O;  3H1K H;  3DTU B;  2Y0I A;  5LMN B;  1N36 B;  4X1Y B;  2Q5Z A;  1VF7 A;  4OGQ B;  1R6N A;  1O9H A;  1M93 A;  4DR5 B;  1N0J A;  2YI8 A;  4YJ2 A;  3UM7 A;  1JQ0 A;  4WFA V;  4FLW A;  2QWQ B;  2DN9 A;  1F51 A;  1WB8 A;  1VQL V;  4DO2 A;  1NU1 H;  1M1K W;  5EYP A;  2VQF O;  1EN5 A;  3JAR B;  4DV2 B;  2QM8 A;  5CMU A;  2CTQ A;  4GX0 A;  3CRC A;  4KFM A;  2BE3 A;  3CE2 A;  1S5H C;  2QM7 A;  1B6Q A;  5CA3 A;  4HAM A;  2GUZ A;  1D2D A;  3ZMV A;  1I7F A;  3L71 H;  4BIO A;  3ABK C;  4PDL A;  1XMO B;  3CPW U;  2JEU A;  5CB4 B;  1E79 G;  3LNM B;  1HNZ O;  2HFE C;  4R50 A;  3RBZ A;  4KXR A;  4X1K A;  4JI4 B;  2DMX A;  1YI2 V;  2LW1 A;  2BTQ A;  4NVP A;  1SA0 B;  4HYO A;  1KQS U;  4LFB O;  1OCZ B;  2E75 B;  3ETG A;  1P4R A;  2JRI A;  2RN9 A;  5LYJ A;  5IY5 B;  1NVP D;  2B9Z A;  4CC6 A;  3MAQ A;  1MAB G;  3M99 B;  2PY5 A;  4LF6 O;  4X65 O;  1K34 A;  4MS2 A;  1F4N A;  3ZRV A;  3H01 A;  4Z1M G;  2VWK A;  3GB7 C;  3FD9 A;  5KHH A;  2JIZ G;  5L3C A;  5H9C A;  1XL4 A;  3HPL C;  3SYP A;  1L1F A;  4LH6 A;  3SJB C;  5KHJ A;  1UPG A;  2ZD9 A;  5IT9 N;  3J7A U;  1P84 F;  4EKW A;  3K08 A;  4H0L B;  3ZRX A;  5FL7 G;  3N2K B;  1RM1 C;  4P30 A;  3ZHV A;  2UXD B;  2Q7H A;  4CH4 A;  5JQG A;  4J11 A;  2EIN C;  4FIP C;  1VQ5 V;  1HNZ B;  4X62 B;  2WLN A;  3OEE G;  3ZMT A;  1Q7Y W;  1QCE A;  4EFE A;  2ZNI A;  2UXC B;  3CCM V;  1H2S B;  2GUZ B;  2EJ7 A;  2DQ3 A;  4X20 B;  1V54 C;  1FJG O;  1FAF A;  5KX5 A;  5KAF Z;  3HKC B;  4B3M B;  3OGC C;  4DR5 O;  3AG1 C;  4MVQ A;  4D6T H;  2WLI A;  3K5O A;  2HJD A;  4WBN B;  5ITZ B;  3A0R A;  3QO8 A;  2BSK B;  4DR1 O;  1S76 D;  4UXN A;  3BCC H;  5FPO A;  4CH5 A;  2OIE A;  3CCS V;  4JI0 O;  4X1Y A;  1FD9 A;  4JI2 O;  3I55 V;  1K5Q A;  2EIK B;  4O4L B;  1ZL8 A;  4GKJ B;  3B8M A;  1M56 C;  2XAG A;  2XOK G;  4B3T O;  4X62 O;  2F4V O;  5CA1 A;  4N21 A;  4FFB A;  2WA3 A;  1JMK C;  5LGT A;  1AP5 A;  2P7T C;  2KKW A;  2R9A A;  1X4T A;  2ZQM A;  2EIK C;  4TQD A;  5J2T B;  3L73 H;  3E8H A;  1PL0 A;  1PNL A;  1K5S A;  2RNB A;  5KMG B;  3FYI B;  4GT1 A;  2QEX V;  5F2V O;  3SYQ A;  3FAV B;  4B3S B;  4DV5 B;  4FLX A;  2IJK A;  2IJH A;  4DV4 B;  2Y69 B;  1MSW D;  1QR9 A;  4CZZ A;  3SPI A;  1HNW B;  2L6L A;  3HKE B;  3CME V;  3G80 A;  1AR4 A;  1BCC H;  2JJ2 G;  3STZ C;  3P3N A;  1JX9 A;  4LF5 B;  1L0L H;  2XAF A;  5LA6 A;  5IE9 A;  5CBH A;  2K9P A;  2NNU A;  4X1I A;  1SC5 B;  3ZHS A;  4JI6 O;  2WLM A;  3W7X A;  2H3O A;  3BHP A;  2FB5 A;  5JVD B;  2BTO A;  2Q8V A;  5JCO A;  3T1Y O;  1BHA A;  4DXW A;  5B3S C;  1MZE A;  4LC1 A;  5L3E A;  4UB8 Z;  1F7Y A;  2UXN A;  1XL6 A;  4DV1 B;  3B4S A;  3K3W A;  2Q9L A;  3ABM B;  3MDS A;  4G2K A;  1N0N A;  2E76 B;  4RWU A;  2JGD A;  4IIJ A;  4LF7 O;  2PYL A;  2JS3 A;  4KHP O;  3VQY A;  4JAV A;  4IYI A;  3JAW A;  3ZRS A;  2UUA O;  4UVB A;  5LP6 B;  2YUA A;  3CSX A;  4I0X A;  4PA9 A;  1VMG A;  4NTW A;  4DR1 B;  1H2G A;  1OV9 A;  3H1L H;  1UFI A;  1YCI A;  1FYJ A;  2QR4 A;  4UCS A;  3RW0 A;  3AK1 A;  3SPH A;  1HW7 A;  2PTM A;  2W0X A;  5IWA B;  2ZDI A;  3FKS G;  4PV1 B;  1Z5W A;  3HKD B;  2A0L A;  4X66 O;  4QJF B;  4DV1 O;  4N23 A;  4JI1 B;  3JCU Z;  2RMK B;  3SPC A;  4WBN A;  2IH1 C;  2QWO B;  5D5P A;  1AVM A;  4JZ2 A;  5LOV B;  1JOY A;  2KB1 A;  1H2M A;  3MD0 A;  4JYY A;  4P9O A;  2KQX A;  1IBK O;  1GN4 A;  2HEP A;  1WAZ A;  2OTJ V;  5FLX N;  1JJ2 U;  4GLX A;  2JJ1 G;  3TXS A;  3RYH B;  4FM2 A;  1OZ0 A; 
#chains in the Genus database with same CATH homology
 2AZ2 A;  4LWS A;  2AZ0 A;  3O9O A;  3Q4H A;  3FD9 A;  2VS0 A;  1WA8 B;  3G80 A;  3GWK C;  3GVM A;  4ABM A;  1WA8 A;  3TXQ A;  3OGI B;  3Q4H B;  2KG7 B;  4I0X A;  3FAV A;  2DE0 X;  4LWS B;  2B9Z A;  3ZBH A;  2KG7 A;  4GZR B;  4I0X B;  3FAV B;  2VRZ A;  3TXS A;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...