2KG7B

Structure and features of the complex formed by the tuberculosis virulence factors rv0287 and rv0288
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
b'SMSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein esxG (PE family protein)
publication title Solution structure of the M. tuberculosis EsxG-EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 23
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2kg7B00
2VRZA 3FD9A 3GWKC 3O9OA 3ZBHA 4ABMA 2AZ2A 3OGIB 3HR0A 4GZRB 3TXSA 2DE0X 1WA8B 2VS0A 3FAVB 1WA8A 4I0XB 2KG7B 3FAVA 4LWSB 2AZ0A 2KG7A 4I0XA 3TXQA 4LWSA 3G80A 3Q4HB 2B9ZA 3Q4HA 3GVMA
chains in the Genus database with same CATH superfamily
1EZVH 2Q6AA 2CH7B 4MVSA 4RUEA 1JR9A 1IBLO 1OV9A 1AR5A 2XAJA 4OGQB 1ZTEA 4OXSA 4JI1B 3M8AA 2YI9A 2WA4A 1QHTA 4FJCC 2UXXA 2AZ0A 4UFZA 2XNDG 1MOFA 3D8CA 5DEDA 2Q0OC 2NN4A 2Q7EA 3CCEV 2B1IA 2ZD9A 3OMAB 4KFMA 4DV6O 1P7BA 4ZOLA 1Q43A 2Q0AA 4WF9V 4DV0B 3JCUZ 5B1BB 1H2LA 4UCUA 1QNMA 2VWJA 5IE9A 3QTCA 5JH7A 5KX5B 4TUYA 2HKOA 5BXZA 3FYEB 4X65B 1WB7A 3WG7C 5LOVA 5CA0B 1KP2A 5HFLA 2VRZA 1OJHA 2HP8A 2UUAB 1K5QA 4XDKA 5LGUA 3N2GB 2Y4TA 4LFAO 3NR7A 4B7KA 3DGEA 5CBHA 2ZE5A 1YTFB 4DW0A 1AI6A 1Y4MA 5CBFA 1IXBA 1FFXB 3G6EV 1W59A 2YUAA 4MVOA 3H1IH 4Z1MG 2HHHO 4DV4B 4FLUA 4JI5O 2NR5A 5LHHA 4QNHB 1SA0B 4DRXB 1I94O 3SPCA 4AHCA 3QNEA 4DW1A 5LP6A 2ODMA 4MW8A 4PHZA 1N36O 2RQ6A 4IYHA 2BOCC 3E8GA 1VQ5V 3K5OA 1M56B 2KKWA 1US6A 3G4SV 1XNQO 2V7QG 5LMUO 3OM3B 1K4CC 3OEEG 1CEZA 5EIBC 4CS4A 4JI4B 2Q68A 2DJVA 2GUZA 4BR6A 2WLLA 2HJFC 4EB6A 3U0ZA 4YJ3A 4TSFG 5BR8O 3B8MA 4U3JB 4X9QA 4O4IA 3RYCA 4X62O 5IT9N 3L72H 3ETEA 2CDYA 5EBWC 3F5TA 3B40A 4LBEC 3SR2C 1HR0B 2FL4A 5D5QA 3CRCA 5CBGA 1X4TA 4O4LB 3JATA 1WPXA 4UUJC 4DYLA 4YIOA 4OX9O 3A0RA 5H9CA 1GRJA 1BS3A 4BIOA 4HNAB 1KKDA 3CRQA 4MS2A 3STZC 1DTOA 3ZJZA 1SQQH 4DO2A 3AG1C 2HJDA 5JQGB 3OR7C 2ZXWB 1OCZB 1N34B 3JAWB 2OCCC 4FM1A 2CGOA 4KP4A 4JV5O 3APQA 1IBMO 2Y69C 5B3SC 3OR6C 2YIBD 1K4DC 2HG5C 1F4MA 3C3TA 5A9GA 3ASOC 4FLWA 3L73H 1W0KG 4MT8A 4CS2A 2XOKG 4GT1A 1F23A 2CH7A 2DYRB 2A3QA 4P2ZA 4K0KB 1N33B 4I55A 1FD9A 2UXCO 4F4LA 2F4VO 1FJGO 3OFNG 2EIKC 2DW4A 5L3GA 2PI4A 1QQCA 2DMXA 2Q8VA 3AG2B 1XMQO 4HAMA 3BFRA 2BTQB 5H6RA 4MTFA 4HZ3A 2ZKOA 1HNXB 2XAFA 3FB7C 4ASUG 2CTWA 4I9QA 1YDXA 3FB8C 4WFAV 3WU2Z 2GDSA 1Y76B 3A8TA 1YF2A 2Q5ZA 4MVQA 3G67A 1TA8A 1H2MA 1YJ9V 5L3CA 2Q69A 4DR7O 4IT5A 4NXMO 1KECA 2B5UA 3CCQV 5KX5A 3B2EE 1EFRG 3JCZA 2IU3A 4KUMA 1NZ6A 1PM9A 4B3RB 1HNZB 4JGSA 1GM9A 5CA0A 1AVMA 1YCIA 2W0FC 3BAAA 1Q7YW 4F6RB 3KCYA 4GUNA 2JEXA 4ABMA 3DSQA 2BTOA 3L75H 3SJQC 1DF5A 2F66C 4GLXA 3B4SA 4RQEA 1G6UA 1IDSA 2IBZH 1YXBA 2Q9LA 3W7XA 2BE3A 2ZDIC 1FFXA 3ZMUA 2C2AA 4Q6GA 4DV3B 2OWOA 2OTJV 5LYJB 3H1JH 3IGAC 2QKSA 1MSDA 3BY6A 4KHPO 1SA0A 1MZEA 3BCCH 2X7RB 1PPJH 3E35A 1BQZA 5F2VO 1FFTB 1JQ0A 2XUMA 2ZM6O 4AQYO 4GKJO 1U96A 2QR4A 4N21A 3E22A 3P3PA 2E5LO 1NQTA 5AG2A 1Q6UA 2EJ7A 3QO8A 1SQXH 2B9ZA 3T1HO 2Q7GA 3K04A 4YJ2B 5IJ9B 1TVKB 3AG1B 5JWPA 3AG3C 3K5MA 3E86A 4YHHB 3D3QA 3OTOB 2Y0IA 4UB8Z 3T2MA 4I4TB 4U3JA 5E79Z 1JFFB 4LWSA 4JI6O 2YDEA 3UT5B 1K92A 1XOUA 3ASOB 2ZR3A 3AK3A 2Z3YA 2HEPA 3X2QB 1VQ7V 5KUMA 4X1YA 3T4DA 1XI1A 1G1XB 2NLJC 4DR2B 5LHIA 1XMOB 2VS0A 5IY5B 2HVKC 2EIKB 1WP8A 3TETA 3JALA 2YXYA 4DUZO 1D5NA 4JYYA 2M7WA 1VIBA 5JQGA 1PV0A 3JARA 1R3KC 1VARA 1S76D 2ZCEA 3JAWA 5IWAB 4XDLA 3AG4C 3ZRSA 2GSMB 2PI5A 4DR4O 4TWKA 3FAVB 3FB6C 1AJPA 3ZIAG 2WPDG 3ML0A 4X1IA 3B09A 1X59A 1G8MA 2YXHA 3K58A 2Q4PA 5FLXN 3RYFA 1N32B 1AB3A 4FFKA 4TV9B 3JD1A 1SZXA 3ZHRA 3LDEA 2XAHA 1Q90D 3FB5C 5EZYB 3K59A 3ZN1A 4XDJA 3A0BZ 4MVZA 1BMFG 4O4JB 5FNVB 2IH1C 2ZQMA 5B1NA 2PYJA 4B3TO 3Q4HB 4JI1O 1MZFA 3UO3A 4LF9O 1OCOB 5LGTA 1BE3H 2QA4V 3VQWA 4UV9A 3CWBH 1OHHG 3ZEDA 4DV0O 3ABKB 3AEIA 1XEQA 4QE9A 3BVOA 1ZLZA 1NVPD 2K1EA 3WB1A 4J9ZB 4F6RA 3VQVA 5KHKA 2HLDG 1NJIW 2Q7HA 4X65O 3K57A 2QWPB 2QSAA 2Y0PA 1IVSA 3ZX6A 2QTSA 3E8HA 1P7GA 1WA8B 3SJBC 2UUAO 3RW0A 4K8XA 4TQDA 2E3CA 3BRCA 5LYJA 2G38A 3D36A 1M90W 4NTYA 4L8JA 2P22C 3RWRD 4UVAA 1D5AA 4RUFA 4WFBV 1QU7A 5B1BC 2YXLA 3ZBHA 2H94A 2WA3A 2YI8A 3H9VA 5IJ0A 3OAAG 3CMEV 2P06A 3CCJV 4RO2A 4H33A 5IYZB 1ROPA 2XAGA 5LXTB 3RYIB 1HNWB 3W7SA 2XT9A 3T1CA 1IBKB 3VBBA 3CPWU 4JZ2A 4PI0A 3IAYA 4YJ2A 5IJ9A 1TVKA 1PNMA 2ZIMA 1YZBA 3GB7C 4PJ0Z 4LFBB 3RBZA 2QE7G 4EEQA 4GYCB 2YC0A 3A0HZ 3RVYA 3AG4B 2HR3A 4I4TA 3EVKA 4OPAA 1AR1B 3THOA 1WAZA 4JI4O 3R66A 1JFFA 4D6TH 4LF6B 1I0HA 1NVPB 4Q20A 1IZ3A 3U11A 3UT5A 3OTFA 3EFFK 5C93A 4DR1O 1VQ8V 3O9OA 3SJAC 2F43G 1HR0O 1VQ4V 2UXDB 1Q6HA 1D2DA 4QE7A 1M56C 5GTHZ 4PD4F 5C8YB 4PA6A 1SQPH 2ARHA 4O4HB 4FLTA 1SF9A 4O2BB 4LF5B 1AJQA 1RFYA 5H5NA 5JCOC 3GVMA 3IJ4A 2F23A 4IHJA 1EN6A 2JVDA 3LUTB 2V1DA 3A2FA 1EN4A 1KUQA 4UCSA 1XUQA 4GZRB 2MW2B 1ZUQA 2QJ1A 1VQKV 3FX7A 3TXSA 4JAAA 3FAVA 1N34O 2JEUA 5BMVB 1XBLA 2Q67A 2UUCB 1VF7A 3SYCA 3SGIA 2N04A 3J80N 1J5EB 1N8RW 4DV7B 1A32A 1KD1W 4WFFA 5LBQA 3CS5A 3SYQA 1CPYA 1W0JG 2QKCA 3PN1A 1GM7A 4FLZA 4IYIA 4TV8B 5EZYA 4DV5O 3OT7A 5JJNB 2WLKA 3OE7G 3B77A 1WLEA 4K0KO 1PD3A 1N33O 2DWDC 3ABLB 1VQ9V 4PA7A 5FNVA 3G6BA 4O4JA 3S3XA 2ZDIA 5B5EZ 5DECA 2ZXWC 1VMGA 1OCZC 4X64B 5K1XA 1GM8A 2KQXA 3K0DA 1NR1A 4G27B 2UUBO 1HNXO 3CX5F 1Q8IA 1NTKH 3CE2A 3B8NA 1K34A 1VQLV 3CD6V 1JPXA 4X1KB 3OD4A 1KYOF 2DYRC 1V55B 5CN0A 3TGUH 4LC1A 4DV2B 3CYOA 4YY3B 3HKCB 3E8BA 4U7NA 5LMNB 2RCVA 4B3RO 1IXMA 1UFIA 1HNZO 2WWWA 3AG2C 3CP1A 4DUYO 1WA8A 3K5LA 5B1AB 2LO1A 2QGNA 1Q3EA 2WLIB 1Y74B 1Q82W 3HKEA 1XHXA 3DXRB 2P4KA 2P6JA 4DV3O 4NTWA 4JYAB 1TUBA 2V4DA 4NVPA 3L9DA 2QWRB 4UCOA 5GTIZ 3JD4A 5E1AC 4JI8B 5LXTA 5A2QN 3RYIA 3JAKA 4ZIBA 3HKDB 2EULA 1H2GA 4B3MB 1TGOA 4QIWF 4X8AA 1COWG 2UXBB 3F7YC 4LCUC 4LH6A 3JSNA 1Q6IA 3HR0A 1JJ2U 2Z0AA 3QVNA 3SPGA 3I55V 3D36C 4MSWC 3M99B 3G71V 2OIEA 4YHHO 3OTOO 3P30A 3K06A 2YSUB 1N0NA 4CH5A 5TISZ 4BW5A 4UV8A 3P3NA 3WFVA 3JD2A 4LF4B 3LNNA 1VQOV 3CCUV 1BSMA 4JTAB 3WB0A 4FVMA 1SC5B 2EINC 3K0GA 5KHGA 5C8YA 4J80A 5HFMA 1LUWA 1N0JA 3C3SA 4O4HA 1ZSPA 4DR2O 4O2BA 1ZX3A 3OMIB 1XMOO 2DWEC 1M1KW 1U97A 2IM9A 1S5JA 4ZHQB 5FPOA 4DXWA 4PDVA 4W4KA 1E79G 3ZCCA 4JASA 3ABTA 2OYQA 3OGIB 5J2TA 4LFCB 3LNMB 1F7YA 2O57A 2P90A 3K5NA 1VF6A 4G2KA 5ITZA 4FZ0A 3MD0A 4A5UB 1QR8A 5LL6Y 1TUEB 2JGDB 4LF7B 4I0XA 3TXQA 4PDLA 3RFRA 4EFBA 4R8CA 2FKXA 5IWAO 1I08A 3SYOA 3X2QC 4PDMA 4UVBA 3ETDA 3SPIA 3CJHB 2QM4A 2N05A 5IY5C 2R72A 5KAIZ 1N32O 3TCUA 1IBLB 4JZGA 3CCSV 2AHZA 3WB2A 4GCZA 1VQNV 1I5YA 5EYPB 1PNLA 1S3JA 2CE4A 4MTOA 3ASNB 2ZE7A 1RM1B 2WSSG 3KG2A 5KHIA 2P4VA 4J7ZA 2AXTZ 4CS3A 1MSWD 2RN9A 4QPKA 4X1KA 1SQGA 1YI2V 1FXVA 3ZHSA 5KHJA 1SESA 3IFXA 3SPHA 4QPJA 2F93B 3N2GA 2CTPA 2JS3A 1P4RA 1PNKA 2IJJA 4WCEV 3VQXA 4LFAB 2F95B 1DF4A 4FM2A 4DV1B 4FLVA 2A9HA 2QWOB 1Y74A 2ITCC 2DN9A 4DK0A 1L8DA 1QR9A 1NKDA 1SS3A 2A79B 4DRXA 3O65A 3DXRA 4J9YB 5J2UB 3ABMC 1P49A 3CCMV 2AHYA 2R9IA 1OCOC 1R3IC 1H8EG 3J7AU 3ZMVA 2IJKA 1Q86W 2F1MA 3ABKC 1GN6A 4CC6A 1R73A 3I56V 4J11A 2EINB 2QKAA 4TQFA 1O9HA 3MHSC 1GMGA 3PJSK 4IIJB 1K97A 2QTOA 4R6ZA 5JCOA 1M4UA 1NI8A 1IURA 3QO5A 4GX2A 2XTAA 3RT3C 2YEVB 3E8FA 5LMUB 4JI2O 2OCHA 1IBKO 5EC1C 2LP7A 2BOBC 4O2AB 2YICA 1EZJA 4H0LB 4FLYA 2Z5UA 4LFBO 4DR5B 5EBMC 1KMIZ 1M57B 1SETA 2FTKA 3ZS8C 4O4LA 3ZMTA 2LW7A 4LF6O 4BIZA 3ZMZA 1V54B 4X66B 1JOYA 3JAMN 2L35A 3MHHC 1RPRA 4WFGA 1OZ0A 3CRRA 4AILC 2W6JG 4HNAA 4I7ZB 2UXDO 2R70A 2ILMA 3JASB 3ZRWB 1BQ0A 4LF5O 1JVMA 5H6QA 1R6NA 4LNUB 3JD0A 3RYHB 3VOUA 2JGDA 1M9NA 2NNUA 1KKCA 3ZMSA 1ENVA 1Z5VA 3TK1A 4LP8A 2PUSA 4I9WA 3HKBB 1UPGA 2P7TC 2R9AA 2EIMB 5L3DA 1W2BU 2CUGA 1GN2A 3W7TA 3JYCA 2W0XA 1YITV 2K9PA 2ZT9B 3CJHA 4MVMA 4J7JA 1RP3B 1QBZA 2QM8A 1J5EO 4DV7O 4UXNA 4C7UA 1WP7A 1NH2D 2JGUA 1K33A 4UCTA 2F4VB 1V9PA 2BTQA 1LNQA 3OEHG 4FMTA 4DR6B 3ETGA 2X6CA 1IX9A 1M5IA 2N74A 1VF6C 3AK1A 2RJZA 4H44B 1B3QA 1R6KA 3K79A 1Y76A 3ABMB 4JAVA 4X64O 4JPRA 2PZSA 4MVRA 2DOSA 3SYAA 1URFA 1KU9A 1DK1A 1VQPV 1XHZA 4BIUA 3CC2V 2VQFB 4N23A 4IL6Z 4RQFA 1FKAO 4ZI7B 2LGQA 3BA8A 4UB6Z 2E74B 3ABLC 4TUYB 2YIBA 5D5PA 4R50A 4K8ZA 4DV2O 4YY3O 5LOVB 5LMNO 1H38A 5JJJB 3SJCC 3ICXA 5GW7A 4CH3A 1QVGU 5K1PA 3TJTA 5J2UA 4DV4O 1K5SA 3SYPA 1B04A 1WPBA 2E76B 3CEIA 3K9AA 2EIJB 4PDRA 1H2NA 1V55C 2JIZG 5IDJA 2A0LA 2D3OW 4JYAO 2OTLV 1Q5OA 1K9MW 1Z2GA 4Z2WA 2DYSB 4IIJA 1WJZA 4GKKB 4JI8O 1SZTA 2HFEC 3LSUA 5LP6B 5DM6V 1KP3A 2GHYA 3JD3A 5B1AC 4B3MO 1L0NH 4ICGA 2UXBO 4RWUA 4UCVA 4PV1B 4CBCA 4O2AA 5EBLC 3KZIZ 3OUFA 1RPOA 4IGGA 2P5OA 3W7UA 3RGBA 4GX5A 1R1BA 4CH4A 1PKXA 3CCRV 4JI6B 1MABG 2QM7A 2VQEB 1PL4A 3ZHUA 2WLLB 4YJ3B 1YEWA 1L1FA 3BEHA 1MG1A 4NXNB 3RYCB 4TOIA 2PGGA 1YVWA 1K3EA 4X88A 4JI3B 1YJNV 1ZAUA 1G4YB 3ZRWA 1L0LH 1FAFA 4X20B 4PI2A 1XL4A 2YIAA 3CCVV 1S5LZ 1JMKC 4JI0B 2QDOA 4LNUA 1Z5WA 1BGYH 1H2SB 4LFCO 1SERA 3SDLA 3HKBA 5IYDO 4LF7O 2X6BA 2EZOA 3OMNB 4PA3A 4TV9A 3F7VC 4ZKIA 1HW7A 1F51A 2Q73A 4WBNB 2XASA 4H37A 2LQTA 2ZINA 1GKFA 4LF8B 4J10A 1VP7A 2BCCH 3Q4HA 2UXNA 5KA6A 1AROP 4I55B 4BAYA 5BZBA 4B3TB 5IYBO 3CHXA 4FM0A 4PA9A 2PY5A 2CAZC 2QWNB 2Y48A 1H8HG 4B3SB 2W6IG 4LF9B 4D7SA 4NKGB 2CTRA 3ETQA 3JSLA 1QLNA 4P30A 4YXWG 1OCRB 5FPRA 1K73W 2ETNA 5FL7G 4GX1A 4ZI7A 3H1LH 5L3BA 3IC9A 1FXKB 4FZ1A 3T1YB 3MDSA 3AK2A 2IJIA 1HWYA 4XBFA 3GWOA 3OUSA 3LSQA 5KMGB 3KCXA 4I50B 1AJNA 3ASNC 5L3EA 4PELA 2MK3A 2R9RB 3LDCA 1RM1C 1DLBA 4DV1O 1PP9H 2JJ1G 2ZNIA 1GH6A 3CCLV 1H2KA 2PF4E 5IYZA 4FLXA 3CSXA 4JAUA 1HP8A 1NT2B 4J7KA 1QVFU 1GTOA 2UU9B 4DR3B 5GONB 1F4NA 5KA5A 1VF5B 1K8AW 1JCHA 2DQ0A 2LGWA 3UM7A 4YIPA 4QJFB 3UO2A 1NBMG 1KQSU 4JI7B 3E22B 1SQVH 3UKMA 3CXHF 4FK5C 1GK9A 3CRAA 1XNRB 1GN4A 3KKYA 4U3FH 2EILC 2IJHA 2WLMA 3AG7A 2QEXV 4G28B 2AW9A 4DR5O 1FXHA 5KHHA 4EFEA 4DR1B 5JVDB 2L6LA 5L3FA 2KB1A 1I7FA 4LWSB 1R3LC 2WLJA 2IW5A 3S3WA 2LJ2A 3I5DA 4X66O 2LW1A 5CA1B 4CC5A 2H3OA 1QLEB 3OGCC 4X1YB 3T4ZA 1VQMV 4X20A 3F5WC 1AI4A 4J41A 5CB4B 3LSSA 2JJ2G 3OW2U 3L71H 1CXZB 3DC6A 3CB2A 2JDIG 3JALB 5BMVA 1ORQC 1AP5A 1M57C 2ZR2A 1FS0G 1KB9F 3BPZA 3MAQA 2PTMA 3JARB 4FFBB 1V54C 1NR7A 4L87A 3E2EA 3J81N 5EIBD 4LR3A 3C90A 4WBNA 1OCCC 4TV8A 5KLVH 1KC8W 4X1IB 5IYCO 2M6YA 1BL8A 3LDDA 2EBOA 2A7WA 4X89A 3FFQA 1S72V 3RYFB 1I5XA 1JX9A 2LFSA 1SQFA 4MW3A 4FPPA 3WG7B 4DV5B 2AGAA 4DR6O 1GN3A 4UVCA 1YHQV 4DV6B 3UCSC 2UUBB 3K9SA 2EIMC 4OPHA 2EZPA 4LH7A 3DC5A 1NTZH 5KAFZ 3HKCA 4TT3G 3CMAV 2D2CB 4MTGA 1FXKA 2VQFO 4JF3A 2FYUH 1EM1A 2KG7B 2CTQA 5CA3A 1GO3F 1BZKA 3G80A 5B66Z 3M7MX 5KMGA 3N2KB 2EX3A 4I50A 2WLIA 4DUYB 3H1KH 2WLNA 1GAXA 2HHHB 3QG5A 5EC2C 4JI5B 5JJEB 2QWQB 2ZNJA 2EILB 1ZL8B 1RSOB 1SQBH 1QCEA 1I94B 3D3IA 2CK3G 2EJRA 2ZE6A 3L70H 1N4CA 1E1RG 3IC7A 4PA4A 2JRIA 3HKDA 3VQYA 1AI7A 1K7DA 1N36B 2WLHA 1UJWB 5GONA 5IJ0B 2HVJC 4CZZA 1XNQB 1HNWO 4JYCA 5LA6B 4EKWA 3DTUB 4GKKO 1TAEA 1WNSA 2XHBA 1AI5A 1S5HC 2BSKB 5BR8B 1NU1H 1KBHA 5LGNA 4WFHA 4X62B 4KXRA 1Y6XA 3ABUA 4HBNA 4RAIA 5J9PC 5BY1A 2OCCB 2EIJC 4U7OA 1VQ6V 5JVDA 5DN6G 4MVUA 3CC7V 1XREA 2GTSA 2IH3C 2VQEO 1OCCB 2X6AA 2Y69B 3QO7A 5B3SB 4OX9B 2GTAA 2DYSC 4UCRA 5CA1A 4NXNO 3FD9A 1HDJA 4ZHQA 5LP6C 2OIGA 1Y66A 1WN7A 3L74H 3BA9A 1MA1A 2CGNA 4JYBA 4JI3O 5CB4A 2FB5A 1MNGA 2IU0A 1JA8A 4BW9A 4HYOA 3K3WA 1S0VA 4JI0O 4E4EA 4JTDB 4NR1A 4IHJB 4JV5B 1IBMB 2RNBA 1NS1A 1XL6A 3K08A 1AILA 4FFBA 3ZHTA 2UUCO 1CP9A 1R6TA 4R7CA 2VWKA 2Y4UA 4P9PA 2DE0X 3E89A 1BHAA 3R65A 2OT5A 1Q81W 4F6EA 2UXCB 4P9OA 1FJGB 4J42A 5EYPA 1XILA 3W7WA 1XDCA 1XMQB 4GX0A 1AP6A 1R3JC 4LF8O 2XAQA 2A06H 1E1QG 1EN5A 1B06A 3H1HH 5EK0A 2YS8A 3K03A 4K3AA 1WB8A 3UQ8A 4DR7B 2JS5A 4NXMB 3GWKC 3BABA 3H01A 2ITDC 4B3SO 2RDCA 4ZOLB 2E75B 2PYLA 4H13B 3RN4A 1LUVA 1LR1A 4AI8A 5JH7B 2KG7A 4E2LA 2JK5C 4B08A 3EHBB 3HB3B 3CRMA 1AR4A 1NTMH 5CMUA 3N2KA 5B1OA 3T1YO 2LFRA 4D7TA 3AG3B 1PL0A 1ZL8A 1RSOA 4KHPB 4W4LA 2X0LA 1NH2B 4I5SA 2GBOA 1FPOA 4Z1VA 3ZN0A 5H2FZ 3HKEB 2ZM6B 1OCRC 3HPLC 3BHPA 3ZHVA 1XQ8A 3CXCU 4AQYB 4GKJB 5LHGA 1EBOA 3SPJA 2H8PC 2E5LB 4JTCB 1FXKC 2B1GA 3RVZA 4BWAA 1TUBB 2UU9O 3T1HB 2DQ3A 2YEVA 4NTXA 2RMKB 5LA6A 4DR3O 2P67A 4FIPC 3JAKB 3QF7A 4JI2B 2BSKA 2ZIOA 2ZE8A 4JI7O 3EXAA 3NXSA 2AZ2A 2GUZB 4EB6B 2WAMA 2GV9A 1JJOA 4NB5A 1Y67A 1XNRO 3ZHQA 4O4IB 1S77D 2ADPA 4LF4O 2ADQB 2ATKC 1J95A 1BT8A 2FMLA 4WFEA 3N27A 3JASA 4CH6A 1SRYA 5KUKA 3JATB 1YSCA 1THZA 4DUZB 1VEWA 1M93A 3P32A 2KSDA 1P84F 3ZRXA 3RYHA 4DK1A 1DGSA 1BHBA 3E83A 4DR4B 1BCCH 5J2TB 3FKSG 3FYIB 3STLC 1ZWIC 5ITZB 4QGPA 3ZRVA 4MTXA 3APOA 4KL1A 1YJWV 1T5EA 1SKVA 3U10A 1YIJV 4I0XB 1B6QA 1YTFD 3CC4V 1FYJA 2YIDA 1O9GA 4ZBMA 4K35A 4NYKA 4B7EA 1QLEC 1MMMA
chains in the Genus database with same CATH topology
2VRZA 3FD9A 3GWKC 3O9OA 3ZBHA 4ABMA 2AZ2A 3OGIB 3HR0A 4GZRB 3TXSA 2DE0X 1WA8B 2VS0A 3FAVB 1WA8A 4I0XB 2KG7B 3FAVA 4LWSB 2AZ0A 2KG7A 4I0XA 3TXQA 4LWSA 3G80A 3Q4HB 2B9ZA 3Q4HA 3GVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRZ A;  3FD9 A;  3GWK C;  3O9O A;  3ZBH A;  4ABM A;  2AZ2 A;  3OGI B;  3HR0 A;  4GZR B;  3TXS A;  2DE0 X;  1WA8 B;  2VS0 A;  3FAV B;  1WA8 A;  4I0X B;  2KG7 B;  3FAV A;  4LWS B;  2AZ0 A;  2KG7 A;  4I0X A;  3TXQ A;  4LWS A;  3G80 A;  3Q4H B;  2B9Z A;  3Q4H A;  3GVM A; 
#chains in the Genus database with same CATH topology
 1EZV H;  2Q6A A;  2CH7 B;  4MVS A;  4RUE A;  1JR9 A;  1IBL O;  1OV9 A;  1AR5 A;  2XAJ A;  4OGQ B;  1ZTE A;  4OXS A;  4JI1 B;  3M8A A;  2YI9 A;  2WA4 A;  1QHT A;  4FJC C;  2UXX A;  2AZ0 A;  4UFZ A;  2XND G;  1MOF A;  3D8C A;  5DED A;  2Q0O C;  2NN4 A;  2Q7E A;  3CCE V;  2B1I A;  2ZD9 A;  3OMA B;  4KFM A;  4DV6 O;  1P7B A;  4ZOL A;  1Q43 A;  2Q0A A;  4WF9 V;  4DV0 B;  3JCU Z;  5B1B B;  1H2L A;  4UCU A;  1QNM A;  2VWJ A;  5IE9 A;  3QTC A;  5JH7 A;  5KX5 B;  4TUY A;  2HKO A;  5BXZ A;  3FYE B;  4X65 B;  1WB7 A;  3WG7 C;  5LOV A;  5CA0 B;  1KP2 A;  5HFL A;  2VRZ A;  1OJH A;  2HP8 A;  2UUA B;  1K5Q A;  4XDK A;  5LGU A;  3N2G B;  2Y4T A;  4LFA O;  3NR7 A;  4B7K A;  3DGE A;  5CBH A;  2ZE5 A;  1YTF B;  4DW0 A;  1AI6 A;  1Y4M A;  5CBF A;  1IXB A;  1FFX B;  3G6E V;  1W59 A;  2YUA A;  4MVO A;  3H1I H;  4Z1M G;  2HHH O;  4DV4 B;  4FLU A;  4JI5 O;  2NR5 A;  5LHH A;  4QNH B;  1SA0 B;  4DRX B;  1I94 O;  3SPC A;  4AHC A;  3QNE A;  4DW1 A;  5LP6 A;  2ODM A;  4MW8 A;  4PHZ A;  1N36 O;  2RQ6 A;  4IYH A;  2BOC C;  3E8G A;  1VQ5 V;  3K5O A;  1M56 B;  2KKW A;  1US6 A;  3G4S V;  1XNQ O;  2V7Q G;  5LMU O;  3OM3 B;  1K4C C;  3OEE G;  1CEZ A;  5EIB C;  4CS4 A;  4JI4 B;  2Q68 A;  2DJV A;  2GUZ A;  4BR6 A;  2WLL A;  2HJF C;  4EB6 A;  3U0Z A;  4YJ3 A;  4TSF G;  5BR8 O;  3B8M A;  4U3J B;  4X9Q A;  4O4I A;  3RYC A;  4X62 O;  5IT9 N;  3L72 H;  3ETE A;  2CDY A;  5EBW C;  3F5T A;  3B40 A;  4LBE C;  3SR2 C;  1HR0 B;  2FL4 A;  5D5Q A;  3CRC A;  5CBG A;  1X4T A;  4O4L B;  3JAT A;  1WPX A;  4UUJ C;  4DYL A;  4YIO A;  4OX9 O;  3A0R A;  5H9C A;  1GRJ A;  1BS3 A;  4BIO A;  4HNA B;  1KKD A;  3CRQ A;  4MS2 A;  3STZ C;  1DTO A;  3ZJZ A;  1SQQ H;  4DO2 A;  3AG1 C;  2HJD A;  5JQG B;  3OR7 C;  2ZXW B;  1OCZ B;  1N34 B;  3JAW B;  2OCC C;  4FM1 A;  2CGO A;  4KP4 A;  4JV5 O;  3APQ A;  1IBM O;  2Y69 C;  5B3S C;  3OR6 C;  2YIB D;  1K4D C;  2HG5 C;  1F4M A;  3C3T A;  5A9G A;  3ASO C;  4FLW A;  3L73 H;  1W0K G;  4MT8 A;  4CS2 A;  2XOK G;  4GT1 A;  1F23 A;  2CH7 A;  2DYR B;  2A3Q A;  4P2Z A;  4K0K B;  1N33 B;  4I55 A;  1FD9 A;  2UXC O;  4F4L A;  2F4V O;  1FJG O;  3OFN G;  2EIK C;  2DW4 A;  5L3G A;  2PI4 A;  1QQC A;  2DMX A;  2Q8V A;  3AG2 B;  1XMQ O;  4HAM A;  3BFR A;  2BTQ B;  5H6R A;  4MTF A;  4HZ3 A;  2ZKO A;  1HNX B;  2XAF A;  3FB7 C;  4ASU G;  2CTW A;  4I9Q A;  1YDX A;  3FB8 C;  4WFA V;  3WU2 Z;  2GDS A;  1Y76 B;  3A8T A;  1YF2 A;  2Q5Z A;  4MVQ A;  3G67 A;  1TA8 A;  1H2M A;  1YJ9 V;  5L3C A;  2Q69 A;  4DR7 O;  4IT5 A;  4NXM O;  1KEC A;  2B5U A;  3CCQ V;  5KX5 A;  3B2E E;  1EFR G;  3JCZ A;  2IU3 A;  4KUM A;  1NZ6 A;  1PM9 A;  4B3R B;  1HNZ B;  4JGS A;  1GM9 A;  5CA0 A;  1AVM A;  1YCI A;  2W0F C;  3BAA A;  1Q7Y W;  4F6R B;  3KCY A;  4GUN A;  2JEX A;  4ABM A;  3DSQ A;  2BTO A;  3L75 H;  3SJQ C;  1DF5 A;  2F66 C;  4GLX A;  3B4S A;  4RQE A;  1G6U A;  1IDS A;  2IBZ H;  1YXB A;  2Q9L A;  3W7X A;  2BE3 A;  2ZDI C;  1FFX A;  3ZMU A;  2C2A A;  4Q6G A;  4DV3 B;  2OWO A;  2OTJ V;  5LYJ B;  3H1J H;  3IGA C;  2QKS A;  1MSD A;  3BY6 A;  4KHP O;  1SA0 A;  1MZE A;  3BCC H;  2X7R B;  1PPJ H;  3E35 A;  1BQZ A;  5F2V O;  1FFT B;  1JQ0 A;  2XUM A;  2ZM6 O;  4AQY O;  4GKJ O;  1U96 A;  2QR4 A;  4N21 A;  3E22 A;  3P3P A;  2E5L O;  1NQT A;  5AG2 A;  1Q6U A;  2EJ7 A;  3QO8 A;  1SQX H;  2B9Z A;  3T1H O;  2Q7G A;  3K04 A;  4YJ2 B;  5IJ9 B;  1TVK B;  3AG1 B;  5JWP A;  3AG3 C;  3K5M A;  3E86 A;  4YHH B;  3D3Q A;  3OTO B;  2Y0I A;  4UB8 Z;  3T2M A;  4I4T B;  4U3J A;  5E79 Z;  1JFF B;  4LWS A;  4JI6 O;  2YDE A;  3UT5 B;  1K92 A;  1XOU A;  3ASO B;  2ZR3 A;  3AK3 A;  2Z3Y A;  2HEP A;  3X2Q B;  1VQ7 V;  5KUM A;  4X1Y A;  3T4D A;  1XI1 A;  1G1X B;  2NLJ C;  4DR2 B;  5LHI A;  1XMO B;  2VS0 A;  5IY5 B;  2HVK C;  2EIK B;  1WP8 A;  3TET A;  3JAL A;  2YXY A;  4DUZ O;  1D5N A;  4JYY A;  2M7W A;  1VIB A;  5JQG A;  1PV0 A;  3JAR A;  1R3K C;  1VAR A;  1S76 D;  2ZCE A;  3JAW A;  5IWA B;  4XDL A;  3AG4 C;  3ZRS A;  2GSM B;  2PI5 A;  4DR4 O;  4TWK A;  3FAV B;  3FB6 C;  1AJP A;  3ZIA G;  2WPD G;  3ML0 A;  4X1I A;  3B09 A;  1X59 A;  1G8M A;  2YXH A;  3K58 A;  2Q4P A;  5FLX N;  3RYF A;  1N32 B;  1AB3 A;  4FFK A;  4TV9 B;  3JD1 A;  1SZX A;  3ZHR A;  3LDE A;  2XAH A;  1Q90 D;  3FB5 C;  5EZY B;  3K59 A;  3ZN1 A;  4XDJ A;  3A0B Z;  4MVZ A;  1BMF G;  4O4J B;  5FNV B;  2IH1 C;  2ZQM A;  5B1N A;  2PYJ A;  4B3T O;  3Q4H B;  4JI1 O;  1MZF A;  3UO3 A;  4LF9 O;  1OCO B;  5LGT A;  1BE3 H;  2QA4 V;  3VQW A;  4UV9 A;  3CWB H;  1OHH G;  3ZED A;  4DV0 O;  3ABK B;  3AEI A;  1XEQ A;  4QE9 A;  3BVO A;  1ZLZ A;  1NVP D;  2K1E A;  3WB1 A;  4J9Z B;  4F6R A;  3VQV A;  5KHK A;  2HLD G;  1NJI W;  2Q7H A;  4X65 O;  3K57 A;  2QWP B;  2QSA A;  2Y0P A;  1IVS A;  3ZX6 A;  2QTS A;  3E8H A;  1P7G A;  1WA8 B;  3SJB C;  2UUA O;  3RW0 A;  4K8X A;  4TQD A;  2E3C A;  3BRC A;  5LYJ A;  2G38 A;  3D36 A;  1M90 W;  4NTY A;  4L8J A;  2P22 C;  3RWR D;  4UVA A;  1D5A A;  4RUF A;  4WFB V;  1QU7 A;  5B1B C;  2YXL A;  3ZBH A;  2H94 A;  2WA3 A;  2YI8 A;  3H9V A;  5IJ0 A;  3OAA G;  3CME V;  2P06 A;  3CCJ V;  4RO2 A;  4H33 A;  5IYZ B;  1ROP A;  2XAG A;  5LXT B;  3RYI B;  1HNW B;  3W7S A;  2XT9 A;  3T1C A;  1IBK B;  3VBB A;  3CPW U;  4JZ2 A;  4PI0 A;  3IAY A;  4YJ2 A;  5IJ9 A;  1TVK A;  1PNM A;  2ZIM A;  1YZB A;  3GB7 C;  4PJ0 Z;  4LFB B;  3RBZ A;  2QE7 G;  4EEQ A;  4GYC B;  2YC0 A;  3A0H Z;  3RVY A;  3AG4 B;  2HR3 A;  4I4T A;  3EVK A;  4OPA A;  1AR1 B;  3THO A;  1WAZ A;  4JI4 O;  3R66 A;  1JFF A;  4D6T H;  4LF6 B;  1I0H A;  1NVP B;  4Q20 A;  1IZ3 A;  3U11 A;  3UT5 A;  3OTF A;  3EFF K;  5C93 A;  4DR1 O;  1VQ8 V;  3O9O A;  3SJA C;  2F43 G;  1HR0 O;  1VQ4 V;  2UXD B;  1Q6H A;  1D2D A;  4QE7 A;  1M56 C;  5GTH Z;  4PD4 F;  5C8Y B;  4PA6 A;  1SQP H;  2ARH A;  4O4H B;  4FLT A;  1SF9 A;  4O2B B;  4LF5 B;  1AJQ A;  1RFY A;  5H5N A;  5JCO C;  3GVM A;  3IJ4 A;  2F23 A;  4IHJ A;  1EN6 A;  2JVD A;  3LUT B;  2V1D A;  3A2F A;  1EN4 A;  1KUQ A;  4UCS A;  1XUQ A;  4GZR B;  2MW2 B;  1ZUQ A;  2QJ1 A;  1VQK V;  3FX7 A;  3TXS A;  4JAA A;  3FAV A;  1N34 O;  2JEU A;  5BMV B;  1XBL A;  2Q67 A;  2UUC B;  1VF7 A;  3SYC A;  3SGI A;  2N04 A;  3J80 N;  1J5E B;  1N8R W;  4DV7 B;  1A32 A;  1KD1 W;  4WFF A;  5LBQ A;  3CS5 A;  3SYQ A;  1CPY A;  1W0J G;  2QKC A;  3PN1 A;  1GM7 A;  4FLZ A;  4IYI A;  4TV8 B;  5EZY A;  4DV5 O;  3OT7 A;  5JJN B;  2WLK A;  3OE7 G;  3B77 A;  1WLE A;  4K0K O;  1PD3 A;  1N33 O;  2DWD C;  3ABL B;  1VQ9 V;  4PA7 A;  5FNV A;  3G6B A;  4O4J A;  3S3X A;  2ZDI A;  5B5E Z;  5DEC A;  2ZXW C;  1VMG A;  1OCZ C;  4X64 B;  5K1X A;  1GM8 A;  2KQX A;  3K0D A;  1NR1 A;  4G27 B;  2UUB O;  1HNX O;  3CX5 F;  1Q8I A;  1NTK H;  3CE2 A;  3B8N A;  1K34 A;  1VQL V;  3CD6 V;  1JPX A;  4X1K B;  3OD4 A;  1KYO F;  2DYR C;  1V55 B;  5CN0 A;  3TGU H;  4LC1 A;  4DV2 B;  3CYO A;  4YY3 B;  3HKC B;  3E8B A;  4U7N A;  5LMN B;  2RCV A;  4B3R O;  1IXM A;  1UFI A;  1HNZ O;  2WWW A;  3AG2 C;  3CP1 A;  4DUY O;  1WA8 A;  3K5L A;  5B1A B;  2LO1 A;  2QGN A;  1Q3E A;  2WLI B;  1Y74 B;  1Q82 W;  3HKE A;  1XHX A;  3DXR B;  2P4K A;  2P6J A;  4DV3 O;  4NTW A;  4JYA B;  1TUB A;  2V4D A;  4NVP A;  3L9D A;  2QWR B;  4UCO A;  5GTI Z;  3JD4 A;  5E1A C;  4JI8 B;  5LXT A;  5A2Q N;  3RYI A;  3JAK A;  4ZIB A;  3HKD B;  2EUL A;  1H2G A;  4B3M B;  1TGO A;  4QIW F;  4X8A A;  1COW G;  2UXB B;  3F7Y C;  4LCU C;  4LH6 A;  3JSN A;  1Q6I A;  3HR0 A;  1JJ2 U;  2Z0A A;  3QVN A;  3SPG A;  3I55 V;  3D36 C;  4MSW C;  3M99 B;  3G71 V;  2OIE A;  4YHH O;  3OTO O;  3P30 A;  3K06 A;  2YSU B;  1N0N A;  4CH5 A;  5TIS Z;  4BW5 A;  4UV8 A;  3P3N A;  3WFV A;  3JD2 A;  4LF4 B;  3LNN A;  1VQO V;  3CCU V;  1BSM A;  4JTA B;  3WB0 A;  4FVM A;  1SC5 B;  2EIN C;  3K0G A;  5KHG A;  5C8Y A;  4J80 A;  5HFM A;  1LUW A;  1N0J A;  3C3S A;  4O4H A;  1ZSP A;  4DR2 O;  4O2B A;  1ZX3 A;  3OMI B;  1XMO O;  2DWE C;  1M1K W;  1U97 A;  2IM9 A;  1S5J A;  4ZHQ B;  5FPO A;  4DXW A;  4PDV A;  4W4K A;  1E79 G;  3ZCC A;  4JAS A;  3ABT A;  2OYQ A;  3OGI B;  5J2T A;  4LFC B;  3LNM B;  1F7Y A;  2O57 A;  2P90 A;  3K5N A;  1VF6 A;  4G2K A;  5ITZ A;  4FZ0 A;  3MD0 A;  4A5U B;  1QR8 A;  5LL6 Y;  1TUE B;  2JGD B;  4LF7 B;  4I0X A;  3TXQ A;  4PDL A;  3RFR A;  4EFB A;  4R8C A;  2FKX A;  5IWA O;  1I08 A;  3SYO A;  3X2Q C;  4PDM A;  4UVB A;  3ETD A;  3SPI A;  3CJH B;  2QM4 A;  2N05 A;  5IY5 C;  2R72 A;  5KAI Z;  1N32 O;  3TCU A;  1IBL B;  4JZG A;  3CCS V;  2AHZ A;  3WB2 A;  4GCZ A;  1VQN V;  1I5Y A;  5EYP B;  1PNL A;  1S3J A;  2CE4 A;  4MTO A;  3ASN B;  2ZE7 A;  1RM1 B;  2WSS G;  3KG2 A;  5KHI A;  2P4V A;  4J7Z A;  2AXT Z;  4CS3 A;  1MSW D;  2RN9 A;  4QPK A;  4X1K A;  1SQG A;  1YI2 V;  1FXV A;  3ZHS A;  5KHJ A;  1SES A;  3IFX A;  3SPH A;  4QPJ A;  2F93 B;  3N2G A;  2CTP A;  2JS3 A;  1P4R A;  1PNK A;  2IJJ A;  4WCE V;  3VQX A;  4LFA B;  2F95 B;  1DF4 A;  4FM2 A;  4DV1 B;  4FLV A;  2A9H A;  2QWO B;  1Y74 A;  2ITC C;  2DN9 A;  4DK0 A;  1L8D A;  1QR9 A;  1NKD A;  1SS3 A;  2A79 B;  4DRX A;  3O65 A;  3DXR A;  4J9Y B;  5J2U B;  3ABM C;  1P49 A;  3CCM V;  2AHY A;  2R9I A;  1OCO C;  1R3I C;  1H8E G;  3J7A U;  3ZMV A;  2IJK A;  1Q86 W;  2F1M A;  3ABK C;  1GN6 A;  4CC6 A;  1R73 A;  3I56 V;  4J11 A;  2EIN B;  2QKA A;  4TQF A;  1O9H A;  3MHS C;  1GMG A;  3PJS K;  4IIJ B;  1K97 A;  2QTO A;  4R6Z A;  5JCO A;  1M4U A;  1NI8 A;  1IUR A;  3QO5 A;  4GX2 A;  2XTA A;  3RT3 C;  2YEV B;  3E8F A;  5LMU B;  4JI2 O;  2OCH A;  1IBK O;  5EC1 C;  2LP7 A;  2BOB C;  4O2A B;  2YIC A;  1EZJ A;  4H0L B;  4FLY A;  2Z5U A;  4LFB O;  4DR5 B;  5EBM C;  1KMI Z;  1M57 B;  1SET A;  2FTK A;  3ZS8 C;  4O4L A;  3ZMT A;  2LW7 A;  4LF6 O;  4BIZ A;  3ZMZ A;  1V54 B;  4X66 B;  1JOY A;  3JAM N;  2L35 A;  3MHH C;  1RPR A;  4WFG A;  1OZ0 A;  3CRR A;  4AIL C;  2W6J G;  4HNA A;  4I7Z B;  2UXD O;  2R70 A;  2ILM A;  3JAS B;  3ZRW B;  1BQ0 A;  4LF5 O;  1JVM A;  5H6Q A;  1R6N A;  4LNU B;  3JD0 A;  3RYH B;  3VOU A;  2JGD A;  1M9N A;  2NNU A;  1KKC A;  3ZMS A;  1ENV A;  1Z5V A;  3TK1 A;  4LP8 A;  2PUS A;  4I9W A;  3HKB B;  1UPG A;  2P7T C;  2R9A A;  2EIM B;  5L3D A;  1W2B U;  2CUG A;  1GN2 A;  3W7T A;  3JYC A;  2W0X A;  1YIT V;  2K9P A;  2ZT9 B;  3CJH A;  4MVM A;  4J7J A;  1RP3 B;  1QBZ A;  2QM8 A;  1J5E O;  4DV7 O;  4UXN A;  4C7U A;  1WP7 A;  1NH2 D;  2JGU A;  1K33 A;  4UCT A;  2F4V B;  1V9P A;  2BTQ A;  1LNQ A;  3OEH G;  4FMT A;  4DR6 B;  3ETG A;  2X6C A;  1IX9 A;  1M5I A;  2N74 A;  1VF6 C;  3AK1 A;  2RJZ A;  4H44 B;  1B3Q A;  1R6K A;  3K79 A;  1Y76 A;  3ABM B;  4JAV A;  4X64 O;  4JPR A;  2PZS A;  4MVR A;  2DOS A;  3SYA A;  1URF A;  1KU9 A;  1DK1 A;  1VQP V;  1XHZ A;  4BIU A;  3CC2 V;  2VQF B;  4N23 A;  4IL6 Z;  4RQF A;  1FKA O;  4ZI7 B;  2LGQ A;  3BA8 A;  4UB6 Z;  2E74 B;  3ABL C;  4TUY B;  2YIB A;  5D5P A;  4R50 A;  4K8Z A;  4DV2 O;  4YY3 O;  5LOV B;  5LMN O;  1H38 A;  5JJJ B;  3SJC C;  3ICX A;  5GW7 A;  4CH3 A;  1QVG U;  5K1P A;  3TJT A;  5J2U A;  4DV4 O;  1K5S A;  3SYP A;  1B04 A;  1WPB A;  2E76 B;  3CEI A;  3K9A A;  2EIJ B;  4PDR A;  1H2N A;  1V55 C;  2JIZ G;  5IDJ A;  2A0L A;  2D3O W;  4JYA O;  2OTL V;  1Q5O A;  1K9M W;  1Z2G A;  4Z2W A;  2DYS B;  4IIJ A;  1WJZ A;  4GKK B;  4JI8 O;  1SZT A;  2HFE C;  3LSU A;  5LP6 B;  5DM6 V;  1KP3 A;  2GHY A;  3JD3 A;  5B1A C;  4B3M O;  1L0N H;  4ICG A;  2UXB O;  4RWU A;  4UCV A;  4PV1 B;  4CBC A;  4O2A A;  5EBL C;  3KZI Z;  3OUF A;  1RPO A;  4IGG A;  2P5O A;  3W7U A;  3RGB A;  4GX5 A;  1R1B A;  4CH4 A;  1PKX A;  3CCR V;  4JI6 B;  1MAB G;  2QM7 A;  2VQE B;  1PL4 A;  3ZHU A;  2WLL B;  4YJ3 B;  1YEW A;  1L1F A;  3BEH A;  1MG1 A;  4NXN B;  3RYC B;  4TOI A;  2PGG A;  1YVW A;  1K3E A;  4X88 A;  4JI3 B;  1YJN V;  1ZAU A;  1G4Y B;  3ZRW A;  1L0L H;  1FAF A;  4X20 B;  4PI2 A;  1XL4 A;  2YIA A;  3CCV V;  1S5L Z;  1JMK C;  4JI0 B;  2QDO A;  4LNU A;  1Z5W A;  1BGY H;  1H2S B;  4LFC O;  1SER A;  3SDL A;  3HKB A;  5IYD O;  4LF7 O;  2X6B A;  2EZO A;  3OMN B;  4PA3 A;  4TV9 A;  3F7V C;  4ZKI A;  1HW7 A;  1F51 A;  2Q73 A;  4WBN B;  2XAS A;  4H37 A;  2LQT A;  2ZIN A;  1GKF A;  4LF8 B;  4J10 A;  1VP7 A;  2BCC H;  3Q4H A;  2UXN A;  5KA6 A;  1ARO P;  4I55 B;  4BAY A;  5BZB A;  4B3T B;  5IYB O;  3CHX A;  4FM0 A;  4PA9 A;  2PY5 A;  2CAZ C;  2QWN B;  2Y48 A;  1H8H G;  4B3S B;  2W6I G;  4LF9 B;  4D7S A;  4NKG B;  2CTR A;  3ETQ A;  3JSL A;  1QLN A;  4P30 A;  4YXW G;  1OCR B;  5FPR A;  1K73 W;  2ETN A;  5FL7 G;  4GX1 A;  4ZI7 A;  3H1L H;  5L3B A;  3IC9 A;  1FXK B;  4FZ1 A;  3T1Y B;  3MDS A;  3AK2 A;  2IJI A;  1HWY A;  4XBF A;  3GWO A;  3OUS A;  3LSQ A;  5KMG B;  3KCX A;  4I50 B;  1AJN A;  3ASN C;  5L3E A;  4PEL A;  2MK3 A;  2R9R B;  3LDC A;  1RM1 C;  1DLB A;  4DV1 O;  1PP9 H;  2JJ1 G;  2ZNI A;  1GH6 A;  3CCL V;  1H2K A;  2PF4 E;  5IYZ A;  4FLX A;  3CSX A;  4JAU A;  1HP8 A;  1NT2 B;  4J7K A;  1QVF U;  1GTO A;  2UU9 B;  4DR3 B;  5GON B;  1F4N A;  5KA5 A;  1VF5 B;  1K8A W;  1JCH A;  2DQ0 A;  2LGW A;  3UM7 A;  4YIP A;  4QJF B;  3UO2 A;  1NBM G;  1KQS U;  4JI7 B;  3E22 B;  1SQV H;  3UKM A;  3CXH F;  4FK5 C;  1GK9 A;  3CRA A;  1XNR B;  1GN4 A;  3KKY A;  4U3F H;  2EIL C;  2IJH A;  2WLM A;  3AG7 A;  2QEX V;  4G28 B;  2AW9 A;  4DR5 O;  1FXH A;  5KHH A;  4EFE A;  4DR1 B;  5JVD B;  2L6L A;  5L3F A;  2KB1 A;  1I7F A;  4LWS B;  1R3L C;  2WLJ A;  2IW5 A;  3S3W A;  2LJ2 A;  3I5D A;  4X66 O;  2LW1 A;  5CA1 B;  4CC5 A;  2H3O A;  1QLE B;  3OGC C;  4X1Y B;  3T4Z A;  1VQM V;  4X20 A;  3F5W C;  1AI4 A;  4J41 A;  5CB4 B;  3LSS A;  2JJ2 G;  3OW2 U;  3L71 H;  1CXZ B;  3DC6 A;  3CB2 A;  2JDI G;  3JAL B;  5BMV A;  1ORQ C;  1AP5 A;  1M57 C;  2ZR2 A;  1FS0 G;  1KB9 F;  3BPZ A;  3MAQ A;  2PTM A;  3JAR B;  4FFB B;  1V54 C;  1NR7 A;  4L87 A;  3E2E A;  3J81 N;  5EIB D;  4LR3 A;  3C90 A;  4WBN A;  1OCC C;  4TV8 A;  5KLV H;  1KC8 W;  4X1I B;  5IYC O;  2M6Y A;  1BL8 A;  3LDD A;  2EBO A;  2A7W A;  4X89 A;  3FFQ A;  1S72 V;  3RYF B;  1I5X A;  1JX9 A;  2LFS A;  1SQF A;  4MW3 A;  4FPP A;  3WG7 B;  4DV5 B;  2AGA A;  4DR6 O;  1GN3 A;  4UVC A;  1YHQ V;  4DV6 B;  3UCS C;  2UUB B;  3K9S A;  2EIM C;  4OPH A;  2EZP A;  4LH7 A;  3DC5 A;  1NTZ H;  5KAF Z;  3HKC A;  4TT3 G;  3CMA V;  2D2C B;  4MTG A;  1FXK A;  2VQF O;  4JF3 A;  2FYU H;  1EM1 A;  2KG7 B;  2CTQ A;  5CA3 A;  1GO3 F;  1BZK A;  3G80 A;  5B66 Z;  3M7M X;  5KMG A;  3N2K B;  2EX3 A;  4I50 A;  2WLI A;  4DUY B;  3H1K H;  2WLN A;  1GAX A;  2HHH B;  3QG5 A;  5EC2 C;  4JI5 B;  5JJE B;  2QWQ B;  2ZNJ A;  2EIL B;  1ZL8 B;  1RSO B;  1SQB H;  1QCE A;  1I94 B;  3D3I A;  2CK3 G;  2EJR A;  2ZE6 A;  3L70 H;  1N4C A;  1E1R G;  3IC7 A;  4PA4 A;  2JRI A;  3HKD A;  3VQY A;  1AI7 A;  1K7D A;  1N36 B;  2WLH A;  1UJW B;  5GON A;  5IJ0 B;  2HVJ C;  4CZZ A;  1XNQ B;  1HNW O;  4JYC A;  5LA6 B;  4EKW A;  3DTU B;  4GKK O;  1TAE A;  1WNS A;  2XHB A;  1AI5 A;  1S5H C;  2BSK B;  5BR8 B;  1NU1 H;  1KBH A;  5LGN A;  4WFH A;  4X62 B;  4KXR A;  1Y6X A;  3ABU A;  4HBN A;  4RAI A;  5J9P C;  5BY1 A;  2OCC B;  2EIJ C;  4U7O A;  1VQ6 V;  5JVD A;  5DN6 G;  4MVU A;  3CC7 V;  1XRE A;  2GTS A;  2IH3 C;  2VQE O;  1OCC B;  2X6A A;  2Y69 B;  3QO7 A;  5B3S B;  4OX9 B;  2GTA A;  2DYS C;  4UCR A;  5CA1 A;  4NXN O;  3FD9 A;  1HDJ A;  4ZHQ A;  5LP6 C;  2OIG A;  1Y66 A;  1WN7 A;  3L74 H;  3BA9 A;  1MA1 A;  2CGN A;  4JYB A;  4JI3 O;  5CB4 A;  2FB5 A;  1MNG A;  2IU0 A;  1JA8 A;  4BW9 A;  4HYO A;  3K3W A;  1S0V A;  4JI0 O;  4E4E A;  4JTD B;  4NR1 A;  4IHJ B;  4JV5 B;  1IBM B;  2RNB A;  1NS1 A;  1XL6 A;  3K08 A;  1AIL A;  4FFB A;  3ZHT A;  2UUC O;  1CP9 A;  1R6T A;  4R7C A;  2VWK A;  2Y4U A;  4P9P A;  2DE0 X;  3E89 A;  1BHA A;  3R65 A;  2OT5 A;  1Q81 W;  4F6E A;  2UXC B;  4P9O A;  1FJG B;  4J42 A;  5EYP A;  1XIL A;  3W7W A;  1XDC A;  1XMQ B;  4GX0 A;  1AP6 A;  1R3J C;  4LF8 O;  2XAQ A;  2A06 H;  1E1Q G;  1EN5 A;  1B06 A;  3H1H H;  5EK0 A;  2YS8 A;  3K03 A;  4K3A A;  1WB8 A;  3UQ8 A;  4DR7 B;  2JS5 A;  4NXM B;  3GWK C;  3BAB A;  3H01 A;  2ITD C;  4B3S O;  2RDC A;  4ZOL B;  2E75 B;  2PYL A;  4H13 B;  3RN4 A;  1LUV A;  1LR1 A;  4AI8 A;  5JH7 B;  2KG7 A;  4E2L A;  2JK5 C;  4B08 A;  3EHB B;  3HB3 B;  3CRM A;  1AR4 A;  1NTM H;  5CMU A;  3N2K A;  5B1O A;  3T1Y O;  2LFR A;  4D7T A;  3AG3 B;  1PL0 A;  1ZL8 A;  1RSO A;  4KHP B;  4W4L A;  2X0L A;  1NH2 B;  4I5S A;  2GBO A;  1FPO A;  4Z1V A;  3ZN0 A;  5H2F Z;  3HKE B;  2ZM6 B;  1OCR C;  3HPL C;  3BHP A;  3ZHV A;  1XQ8 A;  3CXC U;  4AQY B;  4GKJ B;  5LHG A;  1EBO A;  3SPJ A;  2H8P C;  2E5L B;  4JTC B;  1FXK C;  2B1G A;  3RVZ A;  4BWA A;  1TUB B;  2UU9 O;  3T1H B;  2DQ3 A;  2YEV A;  4NTX A;  2RMK B;  5LA6 A;  4DR3 O;  2P67 A;  4FIP C;  3JAK B;  3QF7 A;  4JI2 B;  2BSK A;  2ZIO A;  2ZE8 A;  4JI7 O;  3EXA A;  3NXS A;  2AZ2 A;  2GUZ B;  4EB6 B;  2WAM A;  2GV9 A;  1JJO A;  4NB5 A;  1Y67 A;  1XNR O;  3ZHQ A;  4O4I B;  1S77 D;  2ADP A;  4LF4 O;  2ADQ B;  2ATK C;  1J95 A;  1BT8 A;  2FML A;  4WFE A;  3N27 A;  3JAS A;  4CH6 A;  1SRY A;  5KUK A;  3JAT B;  1YSC A;  1THZ A;  4DUZ B;  1VEW A;  1M93 A;  3P32 A;  2KSD A;  1P84 F;  3ZRX A;  3RYH A;  4DK1 A;  1DGS A;  1BHB A;  3E83 A;  4DR4 B;  1BCC H;  5J2T B;  3FKS G;  3FYI B;  3STL C;  1ZWI C;  5ITZ B;  4QGP A;  3ZRV A;  4MTX A;  3APO A;  4KL1 A;  1YJW V;  1T5E A;  1SKV A;  3U10 A;  1YIJ V;  4I0X B;  1B6Q A;  1YTF D;  3CC4 V;  1FYJ A;  2YID A;  1O9G A;  4ZBM A;  4K35 A;  4NYK A;  4B7E A;  1QLE C;  1MMM A; 
#chains in the Genus database with same CATH homology
 2VRZ A;  3FD9 A;  3GWK C;  3O9O A;  3ZBH A;  4ABM A;  2AZ2 A;  3OGI B;  3HR0 A;  4GZR B;  3TXS A;  2DE0 X;  1WA8 B;  2VS0 A;  3FAV B;  1WA8 A;  4I0X B;  2KG7 B;  3FAV A;  4LWS B;  2AZ0 A;  2KG7 A;  4I0X A;  3TXQ A;  4LWS A;  3G80 A;  3Q4H B;  2B9Z A;  3Q4H A;  3GVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...