2KG7B

Structure and features of the complex formed by the tuberculosis virulence factors rv0287 and rv0288
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
SMSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the M. tuberculosis EsxG-EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Uncharacterized protein esxG (PE family protein)
total genus 23
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2kg7B00
4I0XA 3FD9A 3Q4HA 3Q4HB 2AZ2A 3ZBHA 1WA8B 3HR0A 4ABMA 2KG7A 3FAVB 3G80A 3GVMA 3TXSA 3GWKC 4GZRB 2VS0A 4I0XB 2AZ0A 3TXQA 3O9OA 2B9ZA 3OGIB 4LWSB 2KG7B 4LWSA 2VRZA 1WA8A 3FAVA 2DE0X
chains in the Genus database with same CATH superfamily
3A8TA 2L6LA 5CA0A 4JI6O 1THZA 2H8PC 2LJ2A 1G8MA 3TXSA 3EFFK 1CEZA 4AILC 1I5XA 3EXAA 4I0XB 1K34A 4I55A 4X65B 1GK9A 3ABLB 4MVRA 4ZOLA 1Y76A 4LFAB 1ZAUA 2Y0PA 3RBZA 4B3SO 4KHPO 5JVDA 1DLBA 2Q7GA 4YJ3B 1IDSA 5KX5B 5BMVA 3APQA 3F7YC 1SERA 2ARHA 3IFXA 5L3GA 4FFKA 1R3KC 3LDCA 1KC8W 5JQGA 2R9RB 2QWRB 1JR9A 2WLIA 1OHHG 3L71H 1H2NA 1M56B 1WNSA 2P4KA 4K8ZA 3X2QC 3C90A 4TV8B 2FMLA 4QPJA 3NXSA 1VF5B 3C3SA 3FAVB 2Q68A 1OCRB 1I7FA 2E5LO 2QDOA 1AI5A 2X6CA 1XREA 3HKBA 4TUYB 2OCHA 4J7ZA 2YIAA 1AILA 4LBEC 3JAKB 2D2CB 3ZHRA 1F7YA 3N27A 2DYRB 3CRMA 5KHJA 2PZSA 1NQTA 3OFNG 3HKDA 4YHHO 1Q3EA 4ABMA 3QVNA 4A5UB 1U96A 1K92A 1NU1H 2HVKC 2QKSA 3B40A 1JMKC 2QWOB 4FLTA 4PI2A 4KHPB 2EIJB 5C8YB 1LUVA 1S76D 4PD4F 3AG4B 2M7WA 4DV0O 2W6JG 2F93B 2XASA 4L8JA 2YIBD 5LYJB 5A9GA 3J80N 2RMKB 3E22A 2VQEB 3WU2Z 5LHHA 5B1NA 3AK2A 2XAJA 3RGBA 5EYPA 4O2BA 2FKXA 4TUYA 2YEVA 4LF5B 1R6KA 5FNVA 3FAVA 3H1HH 2UXCB 4QPKA 1H8HG 1EM1A 2GUZA 1WPXA 4O4IA 5B3SC 3AG3C 1SA0B 4ZOLB 2CE4A 2P90A 3G4SV 1P49A 1XNQB 2LP7A 2WLIB 1YITV 1NH2B 1SQGA 1AR4A 1QR9A 1Y67A 5LOVB 3R65A 4J42A 2CGOA 3TXQA 2UXDO 2QWNB 1O9GA 5LOVA 3SPGA 2LGWA 4UCSA 2YI8A 1MG1A 3K9SA 4JI8O 4PDRA 5L3CA 5B5EZ 5BZBA 1Q82W 1G4YB 4JF3A 3GVMA 4LF7O 5LL6Y 4EFEA 1VQ9V 5L3DA 3THOA 1ORQC 4JI1B 4X64O 2HR3A 4QJFB 4XBFA 2Y4TA 1TAEA 1OCOC 5IYZB 2Q9LA 2OT5A 1NKDA 4U7OA 1GN2A 5J2TB 4CZZA 2IJIA 3S3WA 4GLXA 3JD3A 1NR1A 3ML0A 3S3XA 4GKJB 2XTAA 5C93A 3M99B 3CMAV 4PDMA 5FLXN 4JYAB 2IBZH 1NVPD 5J2TA 4PHZA 1Z5WA 4LF6B 4LC1A 1PKXA 4RWUA 2A3QA 5LBQA 1YJWV 3KCXA 2WLMA 3FYIB 4NKGB 2XOKG 1COWG 3LDDA 1Q6HA 3QO7A 4H0LB 5JVDB 1MABG 3SDLA 4X1KA 2IU0A 4UCVA 3UM7A 2E75B 1QR8A 5LMNO 2ZR3A 1QVFU 4DV3O 3RYIA 3E83A 3JARB 2WA4A 4JI3O 4AQYO 3OMNB 2OIEA 3HKEA 1SZXA 5D5PA 3M7MX 4JYYA 4DV2B 5HFMA 3HB3B 3E8FA 1N4CA 1JJOA 4MTOA 5KMGB 5GTHZ 1V54C 4WFBV 2E5LB 2CH7B 1HNXB 5CB4B 5IWAB 4PA4A 1K8AW 4H13B 2EZPA 2Y69C 2X6BA 1XHXA 3CC7V 2EINC 2CTQA 4GX1A 3K59A 3AG1B 2OCCB 2EJRA 3SYOA 2QA4V 1E1QG 3LSUA 1KMIZ 1AI4A 3OTOB 1VQOV 1IXMA 1M57B 4DV7B 3HKDB 1SETA 3LNNA 2ZT9B 1SQBH 4U7NA 2Y4UA 4MVZA 5KHGA 4I4TA 5H5NA 4O4JB 3JAKA 3SYPA 4DV1O 5EC1C 5C8YA 3WB2A 2B9ZA 1FFXB 1XOUA 5IE9A 4MTXA 5B1AB 3RFRA 1GAXA 2A0LA 3RYFA 1HWYA 4LF8B 2N05A 4U3FH 1HNXO 1BQZA 1O9HA 5EIBD 5KUKA 4MTFA 1N32B 4HNAB 2XUMA 1AR1B 4ZI7B 4NVPA 1XMQB 1PD3A 1ZUQA 3P30A 5IY5B 2WWWA 1KECA 2JS5A 4D7SA 5H6QA 1KKCA 3E89A 3F7VC 3J7AU 1MNGA 3JYCA 3TETA 2V7QG 1XI1A 4R7CA 1TUBB 4NXNO 3RN4A 4DR3O 2PF4E 3T4DA 2GHYA 3VQYA 1QLNA 1IBKO 3RYCB 2AGAA 1YCIA 4NR1A 2H3OA 3DXRB 4IGGA 4YXWG 5LA6A 3LNMB 4ZKIA 3UT5A 3HR0A 4JI4O 1P7BA 1NTKH 4CS4A 5IJ9B 1UFIA 1F51A 3OEHG 3J81N 1UPGA 3ETQA 3CHXA 2F43G 1SC5B 2HHHB 2XNDG 5BXZA 4UFZA 1OCZC 4DXWA 1K97A 4KXRA 5DEDA 4ASUG 3CEIA 5LP6B 5CA1A 1R6TA 2A79B 3MHSC 2QM8A 5B1BC 5KAIZ 2X0LA 2DN9A 1QHTA 4X1IB 3APOA 5FL7G 4B3TO 3OM3B 1RP3B 5IJ9A 4TV9A 1ENVA 4I9QA 1URFA 3D3QA 1B04A 3QF7A 4JI6B 4X62B 4WFGA 3SYCA 2DJVA 1BS3A 4HZ3A 3G6BA 3HKCB 4R8CA 4X1YB 3JATB 3T1CA 5LHGA 3CCJV 3GWOA 2OYQA 4LFCB 3JASA 3ZMZA 4P2ZA 4O2AA 4PDVA 3R66A 3RVYA 4X1KB 5LGUA 3I5DA 4X66B 2WLNA 3FB7C 1ROPA 4DV4O 2CGNA 4FLZA 2A9HA 1WAZA 4X1YA 3JCUZ 2HG5C 2ZNIA 1VQNV 5FPOA 2OIGA 2E76B 2N04A 3RT3C 3WB0A 2KSDA 3CCQV 3K03A 4I50A 1V9PA 1BZKA 4CC6A 1ZWIC 3ICXA 3ZBHA 4OPAA 1AP6A 4X89A 1G1XB 2AHZA 4DR4O 1FFXA 1H2LA 3E35A 2ZKOA 2WLLB 1EBOA 1GN4A 1BQ0A 1AROP 1YJNV 3CS5A 3BPZA 3VBBA 5CA1B 4X62O 2Y0IA 3T1HO 1Y74B 4P9PA 4UB6Z 5H6RA 4BW9A 3U0ZA 2GTSA 5KLVH 1YHQV 1JA8A 4B3MB 4P30A 1RFYA 3ABMB 3OTFA 3RYFB 2R70A 2MK3A 4MW3A 1NS1A 4NTWA 2R9IA 5HFLA 2HEPA 1YTFD 1PNLA 2P5OA 3WG7B 4ZIBA 5L3BA 4DV4B 2ETNA 3H9VA 4BIUA 1H8EG 5EK0A 2Q6AA 4CH3A 2WPDG 4X1IA 5JH7B 1HNWB 4YY3B 2YXYA 3H1JH 2UUAB 1NI8A 1L0LH 2DMXA 1P84F 2MW2B 2ODMA 3ASOC 1NJIW 4O4IB 1SRYA 2ZD9A 3OT7A 1GO3F 4JI7O 5A2QN 3ZN1A 1IBKB 3ASNB 3QG5A 3CCUV 3TJTA 3ZCCA 1VQMV 3MAQA 4JPRA 2DQ3A 3A0BZ 1D2DA 2DWDC 3PJSK 3K57A 1P4RA 1Q6UA 1WP7A 2EILB 4CH5A 2NN4A 3JSNA 1S72V 4N21A 4AHCA 2RN9A 4KFMA 1KD1W 2IJKA 4DUYB 5KA5A 1IVSA 3T2MA 4MT8A 5DN6G 4JI2O 3JARA 4JV5O 2WLJA 3F5WC 3JD4A 4FLUA 2AXTZ 4EEQA 4GYCB 4LNUB 2EZOA 3E8GA 3X2QB 1GN6A 4AQYB 1WJZA 1MZEA 1KKDA 3CCEV 4RUEA 3ABKB 1GN3A 4LWSA 4H37A 3SJCC 5IYBO 4DR1O 1YF2A 2KKWA 4JI0B 3FD9A 3E8BA 1OV9A 1BHAA 1J5EO 4B3SB 1K33A 3W7TA 2QR4A 3CX5F 5E1AC 4F6RA 3K06A 2LFSA 2F95B 4JASA 3OEEG 4J11A 4X65O 2B1IA 1NH2D 3G71V 1P7GA 2OWOA 1S5LZ 3KCYA 3CXHF 2AW9A 3ZMVA 1IBMB 3ETGA 5KX5A 2EX3A 2FB5A 3ABMC 2ZCEA 2P6JA 3CRCA 5TISZ 4G2KA 3ZMSA 4FPPA 1Y76B 2CTPA 1XNRB 1QVGU 1TVKB 3ZN0A 2IU3A 4FFBA 3C3TA 3CJHA 2PYLA 4JTAB 4LFBO 3DC6A 1D5AA 4JZ2A 3BABA 4MVMA 3L75H 3L72H 2BTOA 5ITZB 3E22B 2KG7B 2E74B 3ABUA 2ZM6O 1TGOA 3STLC 4JTCB 3JALB 1SA0A 3SPJA 1VQ7V 5EC2C 3TGUH 3MDSA 3K0GA 5FPRA 4X8AA 1M4UA 4LF9B 2UU9B 5B1BB 3SYQA 1MSWD 1KYOF 1KB9F 1JVMA 2P67A 3N2GB 2G38A 3SJBC 4TSFG 3ABLC 4NXNB 4IIJB 4J7JA 3CPWU 2H94A 1DF4A 1GM9A 4PJ0Z 4D6TH 1R3JC 1M1KW 1Y6XA 2DYSC 1JX9A 5IT9N 3K5LA 3E2EA 2NR5A 1A32A 2Q69A 1Q86W 3ETDA 5JJJB 4DV0B 1NR7A 4IIJA 2JVDA 1N0NA 3AG2B 4MVQA 4O4HA 2ZNJA 1E1RG 4DYLA 2GV9A 2W0FC 4YY3O 4TQFA 1DF5A 3ZHVA 1AP5A 5EZYB 1IXBA 2JGDA 2P7TC 2ZE6A 4O4HB 1VEWA 3AK1A 3OGCC 3K5OA 1Q90D 1BSMA 2P4VA 3OUSA 1H38A 4UCOA 3Q4HA 3JALA 3K08A 1TA8A 1L0NH 1LR1A 1YSCA 2ITCC 1N32O 3W7XA 5H9CA 2ZM6B 2BSKB 4H33A 2IH3C 1QLEC 1VARA 5K1PA 1HW7A 3OMAB 5BR8O 4GX5A 3VQVA 1HR0B 4GKKB 4FLWA 1B3QA 5CA3A 2PI5A 3ZIAG 4DO2A 4BIOA 5GTIZ 1Q8IA 3T1YO 2ZXWC 4ZHQA 4DUYO 1JOYA 2Q7HA 4PELA 2JK5C 4FZ1A 1VIBA 5CMUA 4JI8B 1M5IA 2CTRA 3CP1A 4G28B 4I9WA 2QWQB 1YXBA 1Z5VA 1U97A 4D7TA 4J10A 2RCVA 2ZR2A 4J9YB 2ILMA 4LR3A 3UO3A 4FVMA 1KP3A 2CTWA 2L35A 4OX9O 3K5NA 4CS2A 4WFFA 3ABTA 2PY5A 4F6RB 1QQCA 2DYSB 1K3EA 1CP9A 2IJJA 2YSUB 4MSWC 1EN5A 1AJPA 1WA8A 4U3JA 5EBWC 3K5MA 1KP2A 1XNQO 5CA0B 2IH1C 2BSKA 3F5TA 1PM9A 4O4LB 1N33B 3B77A 3WFVA 5JWPA 3D36C 4EB6B 4MTGA 3JD1A 3CE2A 2Z5UA 4I7ZB 4DV2O 4X88A 5EBMC 2P22C 4IHJB 2JGDB 4DR5O 4NXMB 4B7EA 1SQQH 4WBNA 1N34B 2EIMB 1H2KA 1VF7A 5LMNB 4MS2A 3ZHTA 4OGQB 3OR6C 2UXNA 3TK1A 4OPHA 4Z2WA 2EJ7A 2VWKA 2JIZG 4O2AB 4CS3A 4DW1A 3JASB 2Q0AA 4LFAO 4MVSA 1IX9A 1PL0A 2WLHA 3FB6C 4I0XA 4I55B 1VMGA 3ABKC 3AG1C 3DSQA 2EIJC 5KUMA 1S3JA 3CCSV 4DUZO 3HKCA 4JAAA 3JAMN 2QEXV 1KQSU 4DRXB 2VWJA 4DV1B 3N2KA 2JDIG 1ZTEA 3A0RA 4LF6O 1US6A 5ITZA 1EZJA 1B6QA 1W59A 4YJ2A 2N74A 4EKWA 2E3CA 2FYUH 4CH6A 2QKAA 3FB8C 3G80A 4UVAA 4J7KA 3P3NA 2R9AA 4QIWF 5DM6V 4LF4O 1BE3H 1FKAO 4PA6A 3K79A 2UUCB 1BGYH 3CCLV 4YIPA 3ZMUA 1OCCB 4UB8Z 4Q6GA 2YI9A 1S0VA 4DR7O 2LO1A 3UT5B 4HYOA 5IY5C 1Z2GA 2EIKC 3JAWB 4WCEV 1ZX3A 4X20B 1YIJV 1L1FA 2ATKC 3I56V 1FXKA 5J9PC 5L3FA 2Q67A 1XMQO 1X4TA 2ZQMA 1EN6A 4K0KB 4I50B 2UXBB 5GW7A 3WG7C 5L3EA 1TUBA 3T1YB 4BW5A 3CC2V 1Y74A 2YS8A 2AZ0A 3OTOO 2GDSA 4GUNA 4LF5O 2JJ2G 2CDYA 4LF4B 2DYRC 2AZ2A 3AG2C 2F23A 4W4KA 3ZRWA 4QNHB 3B4SA 4LH7A 1SESA 2XAGA 3D3IA 2ZIOA 4UVBA 3RYHB 3OUFA 4UCRA 1YI2V 1VP7A 2NLJC 3JATA 4DR2B 2GTAA 2WAMA 2UXDB 4X20A 2DE0X 4LF8O 5BY1A 2BOBC 4UCUA 2X7RB 3RYHA 4LF7B 2YDEA 4PV1B 4LP8A 1Q7YW 3UKMA 5EBLC 4R6ZA 4IYHA 4BIZA 5LGNA 1F4MA 1K9MW 4LFCO 3RWRD 4KUMA 4Z1VA 5KHIA 1MA1A 4U3JB 1WA8B 4RAIA 4DR5B 4NXMO 4HNAA 4MW8A 4IL6Z 1TUEB 3K04A 4EFBA 1PL4A 4F4LA 4KP4A 1K4DC 4NTYA 4J80A 1JFFB 1I94B 5B3SB 1JCHA 1PPJH 3K0DA 4LF9O 3CRRA 2EIKB 4UVCA 2RNBA 2D3OW 3B09A 1GM7A 1NZ6A 1AR5A 1NTZH 2F4VB 4O4JA 3ZS8C 4DV5B 2UUBO 3UQ8A 1KBHA 2WA3A 3CCVV 1X59A 3BY6A 2VS0A 2W6IG 3QO8A 5LP6C 3D36A 3TCUA 3WB1A 1K5SA 3OAAG 1CPYA 1NVPB 4NB5A 1EN4A 1XQ8A 5B1AC 2ZE7A 1OZ0A 3DTUB 1SQVH 4PDLA 4LFBB 1VQ4V 3DXRA 1V55B 4ZI7A 5H2FZ 4KL1A 2V1DA 1FPOA 3FYEB 3DGEA 3LUTB 5IWAO 1YZBA 4DRXA 3T1HB 4DK1A 3Q4HB 3JD0A 3U11A 4JI5B 1AJNA 1OCCC 4UXNA 5DECA 3HKEB 2BOCC 2QM4A 1XMOB 3RYIB 1VQ5V 2F4VO 4PA3A 4DR7B 3O9OA 2ZDIA 3OGIB 1FFTB 1M56C 4GX0A 3DC5A 5GONA 1YVWA 4LCUC 1GMGA 4LH6A 1XBLA 3BHPA 3W7SA 1BT8A 4DV6B 3UCSC 3ASNC 2W0XA 3BRCA 2UUAO 4PA9A 3SPHA 3JAWA 4WBNB 1PV0A 1I08A 1NT2B 4ICGA 4GCZA 4B3RB 2Q4PA 4YJ2B 4RO2A 3CRAA 1YTFB 1MMMA 1K5QA 3VOUA 2KG7A 4GT1A 2XAFA 1K4CC 2Z0AA 4JI2B 1RSOA 5KMGA 2XHBA 4FIPC 1ZSPA 4GX2A 1YDXA 1IZ3A 3AG4C 3P3PA 5IYZA 3G67A 3LDEA 1PNKA 4JYCA 1S5HC 3ZHUA 4JI1O 2LW1A 1GRJA 3ZHQA 1XMOO 2QKCA 3BVOA 1TVKA 4JI0O 3G6EV 2IJHA 3B8MA 3H1IH 4G27B 3CSXA 4DR3B 1DK1A 3STZC 2DQ0A 1Q6IA 3E8HA 3N2KB 1VQ6V 3GWKC 1M57C 2CH7A 3RVZA 4I5SA 2GSMB 5LA6B 3T4ZA 5IDJA 3CRQA 2Y69B 2UXCO 2A06H 2BCCH 1YEWA 1W0JG 4NTXA 3QO5A 1Q5OA 1R3IC 3BEHA 2QJ1A 4FLVA 1SQFA 3OW2U 2BTQB 2ZE8A 2C2AA 3O65A 4PI0A 4FFBB 2UXXA 1HDJA 1BMFG 4FM0A 3ZX6A 3GB7C 1IBLO 1WP8A 1R3LC 4ZHQB 1K7DA 1J5EB 1OCZB 2QE7G 2AHYA 2Q0OC 3P32A 2F66C 1IURA 1IBMO 1M9NA 5GONB 2CK3G 2OTJV 1HNZO 1FXHA 5IJ0B 4WFEA 1SQPH 2ZE5A 3ZMTA 5KHKA 3KG2A 2HKOA 4QGPA 4CC5A 1SQXH 2Q73A 3W7WA 2Q7EA 4RQEA 5LMUB 1AI6A 4LNUA 3K58A 3AEIA 2EULA 4Q20A 4O4LA 1E79G 1N34O 5KAFZ 2BTQA 4GKJO 5F2VO 1QLEB 5EIBC 2LQTA 2JRIA 4TWKA 4WFHA 4XDJA 4YJ3A 2LFRA 1ZLZA 1R1BA 3CD6V 4L87A 3OD4A 1QU7A 1QNMA 1R73A 2QTSA 2NNUA 1RM1B 2IM9A 3L73H 1G6UA 1DGSA 2QGNA 1HNZB 4DR6O 4K3AA 4DUZB 1T5EA 4JI5O 4FMTA 2R72A 4GZRB 4TV8A 4JYAO 3LSQA 2CAZC 4FLXA 3SPCA 3BFRA 4WF9V 2HVJC 2UU9O 1VF6C 1BL8A 2OTLV 4UCTA 1H2MA 1R6NA 1GTOA 3BAAA 4RQFA 2DW4A 1F4NA 4JAUA 1S5JA 2B5UA 2YICA 1JQ0A 5LMUO 2GUZB 5JCOC 3B2EE 5CBGA 5EZYA 3CJHB 2PUSA 2YEVB 2X6AA 1OCRC 4O2BB 3IC9A 4JAVA 2ZIMA 4RUFA 4DV3B 5IJ0A 1XDCA 1OCOB 1VF6A 3SJQC 5LYJA 3QTCA 1I5YA 4XDKA 1YJ9V 2RJZA 4UV9A 1FYJA 1UJWB 2KB1A 3CMEV 3SYAA 4CH4A 2YIDA 4R50A 4FM2A 2HLDG 1AB3A 1AVMA 1WB8A 5JJNB 1QCEA 4DV7O 3CWBH 3H01A 1N0JA 3FB5C 1VQPV 3L70H 3ASOB 1HNWO 1FD9A 2ZINA 2Q5ZA 3A2FA 3E86A 2V4DA 4BWAA 4JI4B 4JYBA 2VQFB 3D8CA 3ZRSA 5JQGB 3ZRWB 4N23A 3VQWA 1CXZB 1EFRG 4LWSB 5BMVB 1RPOA 4CBCA 1XL4A 3IC7A 1JPXA 1QBZA 2JS3A 1I94O 4IYIA 3L9DA 5K1XA 1RSOB 4J9ZB 2EBOA 4FM1A 4FZ0A 4DW0A 1GKFA 3JD2A 4OX9B 4JGSA 5JH7A 4YHHB 1IBLB 1OJHA 1BCCH 2WSSG 1FAFA 3AG7A 2YC0A 1MSDA 3LSSA 2HP8A 1XHZA 4J41A 1GH6A 3CC4V 3A0HZ 2XAHA 1NBMG 3RW0A 3CCMV 1WPBA 3SJAC 3SPIA 1N36B 3SGIA 4B08A 1JFFA 3ZRXA 1HR0O 4GKKO 4AI8A 1Y4MA 5KHHA 3KKYA 5LXTB 1N33O 2FTKA 1WB7A 4X9QA 5FNVB 1K73W 3MHHC 2VQEO 2VRZA 5LP6A 4HBNA 3IAYA 5EYPB 1V55C 2DWEC 2JEUA 2PYJA 2HFEC 3ZHSA 5IYDO 2EILC 3CXCU 4B7KA 2HHHO 1XL6A 2YXHA 2O57A 4UV8A 2ZXWB 4QE7A 1H2GA 4H44B 3OE7G 3I55V 4PA7A 2Z3YA 1LNQA 3BA9A 1RPRA 4HAMA 2FL4A 1WLEA 3FKSG 4F6EA 1BHBA 1J95A 3SR2C 3AG3B 2YUAA 2JJ1G 4OXSA 4B3TB 3RYCA 4K8XA 5J2UB 4DR4B 4E4EA 3H1KH 3EHBB 1HP8A 1XNRO 3IJ4A 2ADQB 1I0HA 1NTMH 2BE3A 3MD0A 4P9OA 2A7WA 3HKBB 2UUCO 4JI3B 2WLLA 4UUJC 3KZIZ 3HPLC 2PGGA 1MOFA 4BAYA 5IYCO 3ETEA 4X66O 3CCRV 2KQXA 2PTMA 1F23A 4C7UA 3K3WA 3L74H 4IHJA 3AK3A 1FXKB 3IGAC 1FXVA 4TQDA 2HJDA 2M6YA 3OMIB 4TT3G 3OR7C 2Y48A 5AG2A 4K0KO 4JZGA 1VQ8V 3JSLA 2EINB 1KUQA 3ZJZA 3ZRVA 2RQ6A 2RDCA 1M93A 3EVKA 4I4TB 3QNEA 2Q8VA 1ZL8A 2F1MA 2GBOA 1S77D 1B06A 2QSAA 2XAQA 1XEQA 1SKVA 2QWPB 4DV6O 1SF9A 5JCOA 4DK0A 5D5QA 2QM7A 1GM8A 1FJGO 2QTOA 2VQFO 4IT5A 2LGQA 1L8DA 5B66Z 4FLYA 4B3RO 2HJFC 2YXLA 1VQKV 4DR2O 5JJEB 5CN0A 3B8NA 3PN1A 1N8RW 1SS3A 4NYKA 1RM1C 2XT9A 5CB4A 1DTOA 1ZL8B 4XDLA 1XILA 3FX7A 1LUWA 2EIMC 2IW5A 5BR8B 1XUQA 4B3MO 4FJCC 4K35A 4MVUA 5LHIA 5LXTA 5LGTA 1M90W 2K9PA 2YIBA 3JCZA 2P06A 4DR1B 1WN7A 3FFQA 3U10A 5CBFA 3NR7A 1AJQA 4FK5C 3M8AA 1MZFA 4TOIA 2ITDC 4JI7B 2OCCC 1Y66A 5E79Z 2JEXA 3ZEDA 2CUGA 1N36O 3VQXA 2B1GA 1FXKC 3BA8A 1KU9A 3W7UA 4YIOA 2UXBO 1PP9H 2WLKA 1VQLV 1FJGB 1V54B 1PNMA 5KA6A 1SZTA 4JTDB 5CBHA 2ZDIC 1EZVH 1H2SB 3K9AA 5J2UA 1Q81W 4DR6B 2LW7A 1FS0G 4WFAV 4BR6A 2JGUA 4Z1MG 3N2GA 3BCCH 1Q43A 1D5NA 4TV9B 4E2LA 4X64B 3H1LH 4ZBMA 4DV5O 2UUBB 2PI4A 1W2BU 2K1EA 3CB2A 1AI7A 3UO2A 1JJ2U 4EB6A 4W4LA 2DOSA 4MVOA 2ADPA 4QE9A 4JV5B 5B1OA 1W0KG 3CYOA
chains in the Genus database with same CATH topology
4I0XA 3FD9A 3Q4HA 3Q4HB 2AZ2A 3ZBHA 1WA8B 3HR0A 4ABMA 2KG7A 3FAVB 3G80A 3GVMA 3TXSA 3GWKC 4GZRB 2VS0A 4I0XB 2AZ0A 3TXQA 3O9OA 2B9ZA 3OGIB 4LWSB 2KG7B 4LWSA 2VRZA 1WA8A 3FAVA 2DE0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I0X A;  3FD9 A;  3Q4H A;  3Q4H B;  2AZ2 A;  3ZBH A;  1WA8 B;  3HR0 A;  4ABM A;  2KG7 A;  3FAV B;  3G80 A;  3GVM A;  3TXS A;  3GWK C;  4GZR B;  2VS0 A;  4I0X B;  2AZ0 A;  3TXQ A;  3O9O A;  2B9Z A;  3OGI B;  4LWS B;  2KG7 B;  4LWS A;  2VRZ A;  1WA8 A;  3FAV A;  2DE0 X; 
#chains in the Genus database with same CATH topology
 3A8T A;  2L6L A;  5CA0 A;  4JI6 O;  1THZ A;  2H8P C;  2LJ2 A;  1G8M A;  3TXS A;  3EFF K;  1CEZ A;  4AIL C;  1I5X A;  3EXA A;  4I0X B;  1K34 A;  4I55 A;  4X65 B;  1GK9 A;  3ABL B;  4MVR A;  4ZOL A;  1Y76 A;  4LFA B;  1ZAU A;  2Y0P A;  3RBZ A;  4B3S O;  4KHP O;  5JVD A;  1DLB A;  2Q7G A;  4YJ3 B;  1IDS A;  5KX5 B;  5BMV A;  3APQ A;  3F7Y C;  1SER A;  2ARH A;  3IFX A;  5L3G A;  4FFK A;  1R3K C;  3LDC A;  1KC8 W;  5JQG A;  2R9R B;  2QWR B;  1JR9 A;  2WLI A;  1OHH G;  3L71 H;  1H2N A;  1M56 B;  1WNS A;  2P4K A;  4K8Z A;  3X2Q C;  3C90 A;  4TV8 B;  2FML A;  4QPJ A;  3NXS A;  1VF5 B;  3C3S A;  3FAV B;  2Q68 A;  1OCR B;  1I7F A;  2E5L O;  2QDO A;  1AI5 A;  2X6C A;  1XRE A;  3HKB A;  4TUY B;  2OCH A;  4J7Z A;  2YIA A;  1AIL A;  4LBE C;  3JAK B;  2D2C B;  3ZHR A;  1F7Y A;  3N27 A;  2DYR B;  3CRM A;  5KHJ A;  2PZS A;  1NQT A;  3OFN G;  3HKD A;  4YHH O;  1Q3E A;  4ABM A;  3QVN A;  4A5U B;  1U96 A;  1K92 A;  1NU1 H;  2HVK C;  2QKS A;  3B40 A;  1JMK C;  2QWO B;  4FLT A;  4PI2 A;  4KHP B;  2EIJ B;  5C8Y B;  1LUV A;  1S76 D;  4PD4 F;  3AG4 B;  2M7W A;  4DV0 O;  2W6J G;  2F93 B;  2XAS A;  4L8J A;  2YIB D;  5LYJ B;  5A9G A;  3J80 N;  2RMK B;  3E22 A;  2VQE B;  3WU2 Z;  5LHH A;  5B1N A;  3AK2 A;  2XAJ A;  3RGB A;  5EYP A;  4O2B A;  2FKX A;  4TUY A;  2YEV A;  4LF5 B;  1R6K A;  5FNV A;  3FAV A;  3H1H H;  2UXC B;  4QPK A;  1H8H G;  1EM1 A;  2GUZ A;  1WPX A;  4O4I A;  5B3S C;  3AG3 C;  1SA0 B;  4ZOL B;  2CE4 A;  2P90 A;  3G4S V;  1P49 A;  1XNQ B;  2LP7 A;  2WLI B;  1YIT V;  1NH2 B;  1SQG A;  1AR4 A;  1QR9 A;  1Y67 A;  5LOV B;  3R65 A;  4J42 A;  2CGO A;  3TXQ A;  2UXD O;  2QWN B;  1O9G A;  5LOV A;  3SPG A;  2LGW A;  4UCS A;  2YI8 A;  1MG1 A;  3K9S A;  4JI8 O;  4PDR A;  5L3C A;  5B5E Z;  5BZB A;  1Q82 W;  1G4Y B;  4JF3 A;  3GVM A;  4LF7 O;  5LL6 Y;  4EFE A;  1VQ9 V;  5L3D A;  3THO A;  1ORQ C;  4JI1 B;  4X64 O;  2HR3 A;  4QJF B;  4XBF A;  2Y4T A;  1TAE A;  1OCO C;  5IYZ B;  2Q9L A;  2OT5 A;  1NKD A;  4U7O A;  1GN2 A;  5J2T B;  4CZZ A;  2IJI A;  3S3W A;  4GLX A;  3JD3 A;  1NR1 A;  3ML0 A;  3S3X A;  4GKJ B;  2XTA A;  5C93 A;  3M99 B;  3CMA V;  4PDM A;  5FLX N;  4JYA B;  2IBZ H;  1NVP D;  5J2T A;  4PHZ A;  1Z5W A;  4LF6 B;  4LC1 A;  1PKX A;  4RWU A;  2A3Q A;  5LBQ A;  1YJW V;  3KCX A;  2WLM A;  3FYI B;  4NKG B;  2XOK G;  1COW G;  3LDD A;  1Q6H A;  3QO7 A;  4H0L B;  5JVD B;  1MAB G;  3SDL A;  4X1K A;  2IU0 A;  4UCV A;  3UM7 A;  2E75 B;  1QR8 A;  5LMN O;  2ZR3 A;  1QVF U;  4DV3 O;  3RYI A;  3E83 A;  3JAR B;  2WA4 A;  4JI3 O;  4AQY O;  3OMN B;  2OIE A;  3HKE A;  1SZX A;  5D5P A;  3M7M X;  4JYY A;  4DV2 B;  5HFM A;  3HB3 B;  3E8F A;  1N4C A;  1JJO A;  4MTO A;  5KMG B;  5GTH Z;  1V54 C;  4WFB V;  2E5L B;  2CH7 B;  1HNX B;  5CB4 B;  5IWA B;  4PA4 A;  1K8A W;  4H13 B;  2EZP A;  2Y69 C;  2X6B A;  1XHX A;  3CC7 V;  2EIN C;  2CTQ A;  4GX1 A;  3K59 A;  3AG1 B;  2OCC B;  2EJR A;  3SYO A;  2QA4 V;  1E1Q G;  3LSU A;  1KMI Z;  1AI4 A;  3OTO B;  1VQO V;  1IXM A;  1M57 B;  4DV7 B;  3HKD B;  1SET A;  3LNN A;  2ZT9 B;  1SQB H;  4U7N A;  2Y4U A;  4MVZ A;  5KHG A;  4I4T A;  5H5N A;  4O4J B;  3JAK A;  3SYP A;  4DV1 O;  5EC1 C;  5C8Y A;  3WB2 A;  2B9Z A;  1FFX B;  1XOU A;  5IE9 A;  4MTX A;  5B1A B;  3RFR A;  1GAX A;  2A0L A;  3RYF A;  1HWY A;  4LF8 B;  2N05 A;  4U3F H;  1HNX O;  1BQZ A;  1O9H A;  5EIB D;  5KUK A;  4MTF A;  1N32 B;  4HNA B;  2XUM A;  1AR1 B;  4ZI7 B;  4NVP A;  1XMQ B;  1PD3 A;  1ZUQ A;  3P30 A;  5IY5 B;  2WWW A;  1KEC A;  2JS5 A;  4D7S A;  5H6Q A;  1KKC A;  3E89 A;  3F7V C;  3J7A U;  1MNG A;  3JYC A;  3TET A;  2V7Q G;  1XI1 A;  4R7C A;  1TUB B;  4NXN O;  3RN4 A;  4DR3 O;  2PF4 E;  3T4D A;  2GHY A;  3VQY A;  1QLN A;  1IBK O;  3RYC B;  2AGA A;  1YCI A;  4NR1 A;  2H3O A;  3DXR B;  4IGG A;  4YXW G;  5LA6 A;  3LNM B;  4ZKI A;  3UT5 A;  3HR0 A;  4JI4 O;  1P7B A;  1NTK H;  4CS4 A;  5IJ9 B;  1UFI A;  1F51 A;  3OEH G;  3J81 N;  1UPG A;  3ETQ A;  3CHX A;  2F43 G;  1SC5 B;  2HHH B;  2XND G;  5BXZ A;  4UFZ A;  1OCZ C;  4DXW A;  1K97 A;  4KXR A;  5DED A;  4ASU G;  3CEI A;  5LP6 B;  5CA1 A;  1R6T A;  2A79 B;  3MHS C;  2QM8 A;  5B1B C;  5KAI Z;  2X0L A;  2DN9 A;  1QHT A;  4X1I B;  3APO A;  5FL7 G;  4B3T O;  3OM3 B;  1RP3 B;  5IJ9 A;  4TV9 A;  1ENV A;  4I9Q A;  1URF A;  3D3Q A;  1B04 A;  3QF7 A;  4JI6 B;  4X62 B;  4WFG A;  3SYC A;  2DJV A;  1BS3 A;  4HZ3 A;  3G6B A;  3HKC B;  4R8C A;  4X1Y B;  3JAT B;  3T1C A;  5LHG A;  3CCJ V;  3GWO A;  2OYQ A;  4LFC B;  3JAS A;  3ZMZ A;  4P2Z A;  4O2A A;  4PDV A;  3R66 A;  3RVY A;  4X1K B;  5LGU A;  3I5D A;  4X66 B;  2WLN A;  3FB7 C;  1ROP A;  4DV4 O;  2CGN A;  4FLZ A;  2A9H A;  1WAZ A;  4X1Y A;  3JCU Z;  2HG5 C;  2ZNI A;  1VQN V;  5FPO A;  2OIG A;  2E76 B;  2N04 A;  3RT3 C;  3WB0 A;  2KSD A;  3CCQ V;  3K03 A;  4I50 A;  1V9P A;  1BZK A;  4CC6 A;  1ZWI C;  3ICX A;  3ZBH A;  4OPA A;  1AP6 A;  4X89 A;  1G1X B;  2AHZ A;  4DR4 O;  1FFX A;  1H2L A;  3E35 A;  2ZKO A;  2WLL B;  1EBO A;  1GN4 A;  1BQ0 A;  1ARO P;  1YJN V;  3CS5 A;  3BPZ A;  3VBB A;  5CA1 B;  4X62 O;  2Y0I A;  3T1H O;  1Y74 B;  4P9P A;  4UB6 Z;  5H6R A;  4BW9 A;  3U0Z A;  2GTS A;  5KLV H;  1YHQ V;  1JA8 A;  4B3M B;  4P30 A;  1RFY A;  3ABM B;  3OTF A;  3RYF B;  2R70 A;  2MK3 A;  4MW3 A;  1NS1 A;  4NTW A;  2R9I A;  5HFL A;  2HEP A;  1YTF D;  1PNL A;  2P5O A;  3WG7 B;  4ZIB A;  5L3B A;  4DV4 B;  2ETN A;  3H9V A;  4BIU A;  1H8E G;  5EK0 A;  2Q6A A;  4CH3 A;  2WPD G;  4X1I A;  5JH7 B;  1HNW B;  4YY3 B;  2YXY A;  3H1J H;  2UUA B;  1NI8 A;  1L0L H;  2DMX A;  1P84 F;  2MW2 B;  2ODM A;  3ASO C;  1NJI W;  4O4I B;  1SRY A;  2ZD9 A;  3OT7 A;  1GO3 F;  4JI7 O;  5A2Q N;  3ZN1 A;  1IBK B;  3ASN B;  3QG5 A;  3CCU V;  3TJT A;  3ZCC A;  1VQM V;  3MAQ A;  4JPR A;  2DQ3 A;  3A0B Z;  1D2D A;  2DWD C;  3PJS K;  3K57 A;  1P4R A;  1Q6U A;  1WP7 A;  2EIL B;  4CH5 A;  2NN4 A;  3JSN A;  1S72 V;  4N21 A;  4AHC A;  2RN9 A;  4KFM A;  1KD1 W;  2IJK A;  4DUY B;  5KA5 A;  1IVS A;  3T2M A;  4MT8 A;  5DN6 G;  4JI2 O;  3JAR A;  4JV5 O;  2WLJ A;  3F5W C;  3JD4 A;  4FLU A;  2AXT Z;  4EEQ A;  4GYC B;  4LNU B;  2EZO A;  3E8G A;  3X2Q B;  1GN6 A;  4AQY B;  1WJZ A;  1MZE A;  1KKD A;  3CCE V;  4RUE A;  3ABK B;  1GN3 A;  4LWS A;  4H37 A;  3SJC C;  5IYB O;  4DR1 O;  1YF2 A;  2KKW A;  4JI0 B;  3FD9 A;  3E8B A;  1OV9 A;  1BHA A;  1J5E O;  4B3S B;  1K33 A;  3W7T A;  2QR4 A;  3CX5 F;  5E1A C;  4F6R A;  3K06 A;  2LFS A;  2F95 B;  4JAS A;  3OEE G;  4J11 A;  4X65 O;  2B1I A;  1NH2 D;  3G71 V;  1P7G A;  2OWO A;  1S5L Z;  3KCY A;  3CXH F;  2AW9 A;  3ZMV A;  1IBM B;  3ETG A;  5KX5 A;  2EX3 A;  2FB5 A;  3ABM C;  2ZCE A;  2P6J A;  3CRC A;  5TIS Z;  4G2K A;  3ZMS A;  4FPP A;  1Y76 B;  2CTP A;  1XNR B;  1QVG U;  1TVK B;  3ZN0 A;  2IU3 A;  4FFB A;  3C3T A;  3CJH A;  2PYL A;  4JTA B;  4LFB O;  3DC6 A;  1D5A A;  4JZ2 A;  3BAB A;  4MVM A;  3L75 H;  3L72 H;  2BTO A;  5ITZ B;  3E22 B;  2KG7 B;  2E74 B;  3ABU A;  2ZM6 O;  1TGO A;  3STL C;  4JTC B;  3JAL B;  1SA0 A;  3SPJ A;  1VQ7 V;  5EC2 C;  3TGU H;  3MDS A;  3K0G A;  5FPR A;  4X8A A;  1M4U A;  4LF9 B;  2UU9 B;  5B1B B;  3SYQ A;  1MSW D;  1KYO F;  1KB9 F;  1JVM A;  2P67 A;  3N2G B;  2G38 A;  3SJB C;  4TSF G;  3ABL C;  4NXN B;  4IIJ B;  4J7J A;  3CPW U;  2H94 A;  1DF4 A;  1GM9 A;  4PJ0 Z;  4D6T H;  1R3J C;  1M1K W;  1Y6X A;  2DYS C;  1JX9 A;  5IT9 N;  3K5L A;  3E2E A;  2NR5 A;  1A32 A;  2Q69 A;  1Q86 W;  3ETD A;  5JJJ B;  4DV0 B;  1NR7 A;  4IIJ A;  2JVD A;  1N0N A;  3AG2 B;  4MVQ A;  4O4H A;  2ZNJ A;  1E1R G;  4DYL A;  2GV9 A;  2W0F C;  4YY3 O;  4TQF A;  1DF5 A;  3ZHV A;  1AP5 A;  5EZY B;  1IXB A;  2JGD A;  2P7T C;  2ZE6 A;  4O4H B;  1VEW A;  3AK1 A;  3OGC C;  3K5O A;  1Q90 D;  1BSM A;  2P4V A;  3OUS A;  1H38 A;  4UCO A;  3Q4H A;  3JAL A;  3K08 A;  1TA8 A;  1L0N H;  1LR1 A;  1YSC A;  2ITC C;  1N32 O;  3W7X A;  5H9C A;  2ZM6 B;  2BSK B;  4H33 A;  2IH3 C;  1QLE C;  1VAR A;  5K1P A;  1HW7 A;  3OMA B;  5BR8 O;  4GX5 A;  3VQV A;  1HR0 B;  4GKK B;  4FLW A;  1B3Q A;  5CA3 A;  2PI5 A;  3ZIA G;  4DO2 A;  4BIO A;  5GTI Z;  1Q8I A;  3T1Y O;  2ZXW C;  4ZHQ A;  4DUY O;  1JOY A;  2Q7H A;  4PEL A;  2JK5 C;  4FZ1 A;  1VIB A;  5CMU A;  4JI8 B;  1M5I A;  2CTR A;  3CP1 A;  4G28 B;  4I9W A;  2QWQ B;  1YXB A;  1Z5V A;  1U97 A;  4D7T A;  4J10 A;  2RCV A;  2ZR2 A;  4J9Y B;  2ILM A;  4LR3 A;  3UO3 A;  4FVM A;  1KP3 A;  2CTW A;  2L35 A;  4OX9 O;  3K5N A;  4CS2 A;  4WFF A;  3ABT A;  2PY5 A;  4F6R B;  1QQC A;  2DYS B;  1K3E A;  1CP9 A;  2IJJ A;  2YSU B;  4MSW C;  1EN5 A;  1AJP A;  1WA8 A;  4U3J A;  5EBW C;  3K5M A;  1KP2 A;  1XNQ O;  5CA0 B;  2IH1 C;  2BSK A;  3F5T A;  1PM9 A;  4O4L B;  1N33 B;  3B77 A;  3WFV A;  5JWP A;  3D36 C;  4EB6 B;  4MTG A;  3JD1 A;  3CE2 A;  2Z5U A;  4I7Z B;  4DV2 O;  4X88 A;  5EBM C;  2P22 C;  4IHJ B;  2JGD B;  4DR5 O;  4NXM B;  4B7E A;  1SQQ H;  4WBN A;  1N34 B;  2EIM B;  1H2K A;  1VF7 A;  5LMN B;  4MS2 A;  3ZHT A;  4OGQ B;  3OR6 C;  2UXN A;  3TK1 A;  4OPH A;  4Z2W A;  2EJ7 A;  2VWK A;  2JIZ G;  4O2A B;  4CS3 A;  4DW1 A;  3JAS B;  2Q0A A;  4LFA O;  4MVS A;  1IX9 A;  1PL0 A;  2WLH A;  3FB6 C;  4I0X A;  4I55 B;  1VMG A;  3ABK C;  3AG1 C;  3DSQ A;  2EIJ C;  5KUM A;  1S3J A;  3CCS V;  4DUZ O;  3HKC A;  4JAA A;  3JAM N;  2QEX V;  1KQS U;  4DRX B;  2VWJ A;  4DV1 B;  3N2K A;  2JDI G;  1ZTE A;  3A0R A;  4LF6 O;  1US6 A;  5ITZ A;  1EZJ A;  1B6Q A;  1W59 A;  4YJ2 A;  2N74 A;  4EKW A;  2E3C A;  2FYU H;  4CH6 A;  2QKA A;  3FB8 C;  3G80 A;  4UVA A;  4J7K A;  3P3N A;  2R9A A;  4QIW F;  5DM6 V;  4LF4 O;  1BE3 H;  1FKA O;  4PA6 A;  3K79 A;  2UUC B;  1BGY H;  3CCL V;  4YIP A;  3ZMU A;  1OCC B;  4UB8 Z;  4Q6G A;  2YI9 A;  1S0V A;  4DR7 O;  2LO1 A;  3UT5 B;  4HYO A;  5IY5 C;  1Z2G A;  2EIK C;  3JAW B;  4WCE V;  1ZX3 A;  4X20 B;  1YIJ V;  1L1F A;  2ATK C;  3I56 V;  1FXK A;  5J9P C;  5L3F A;  2Q67 A;  1XMQ O;  1X4T A;  2ZQM A;  1EN6 A;  4K0K B;  4I50 B;  2UXB B;  5GW7 A;  3WG7 C;  5L3E A;  1TUB A;  3T1Y B;  4BW5 A;  3CC2 V;  1Y74 A;  2YS8 A;  2AZ0 A;  3OTO O;  2GDS A;  4GUN A;  4LF5 O;  2JJ2 G;  2CDY A;  4LF4 B;  2DYR C;  2AZ2 A;  3AG2 C;  2F23 A;  4W4K A;  3ZRW A;  4QNH B;  3B4S A;  4LH7 A;  1SES A;  2XAG A;  3D3I A;  2ZIO A;  4UVB A;  3RYH B;  3OUF A;  4UCR A;  1YI2 V;  1VP7 A;  2NLJ C;  3JAT A;  4DR2 B;  2GTA A;  2WAM A;  2UXD B;  4X20 A;  2DE0 X;  4LF8 O;  5BY1 A;  2BOB C;  4UCU A;  2X7R B;  3RYH A;  4LF7 B;  2YDE A;  4PV1 B;  4LP8 A;  1Q7Y W;  3UKM A;  5EBL C;  4R6Z A;  4IYH A;  4BIZ A;  5LGN A;  1F4M A;  1K9M W;  4LFC O;  3RWR D;  4KUM A;  4Z1V A;  5KHI A;  1MA1 A;  4U3J B;  1WA8 B;  4RAI A;  4DR5 B;  4NXM O;  4HNA A;  4MW8 A;  4IL6 Z;  1TUE B;  3K04 A;  4EFB A;  1PL4 A;  4F4L A;  4KP4 A;  1K4D C;  4NTY A;  4J80 A;  1JFF B;  1I94 B;  5B3S B;  1JCH A;  1PPJ H;  3K0D A;  4LF9 O;  3CRR A;  2EIK B;  4UVC A;  2RNB A;  2D3O W;  3B09 A;  1GM7 A;  1NZ6 A;  1AR5 A;  1NTZ H;  2F4V B;  4O4J A;  3ZS8 C;  4DV5 B;  2UUB O;  3UQ8 A;  1KBH A;  2WA3 A;  3CCV V;  1X59 A;  3BY6 A;  2VS0 A;  2W6I G;  3QO8 A;  5LP6 C;  3D36 A;  3TCU A;  3WB1 A;  1K5S A;  3OAA G;  1CPY A;  1NVP B;  4NB5 A;  1EN4 A;  1XQ8 A;  5B1A C;  2ZE7 A;  1OZ0 A;  3DTU B;  1SQV H;  4PDL A;  4LFB B;  1VQ4 V;  3DXR A;  1V55 B;  4ZI7 A;  5H2F Z;  4KL1 A;  2V1D A;  1FPO A;  3FYE B;  3DGE A;  3LUT B;  5IWA O;  1YZB A;  4DRX A;  3T1H B;  4DK1 A;  3Q4H B;  3JD0 A;  3U11 A;  4JI5 B;  1AJN A;  1OCC C;  4UXN A;  5DEC A;  3HKE B;  2BOC C;  2QM4 A;  1XMO B;  3RYI B;  1VQ5 V;  2F4V O;  4PA3 A;  4DR7 B;  3O9O A;  2ZDI A;  3OGI B;  1FFT B;  1M56 C;  4GX0 A;  3DC5 A;  5GON A;  1YVW A;  4LCU C;  1GMG A;  4LH6 A;  1XBL A;  3BHP A;  3W7S A;  1BT8 A;  4DV6 B;  3UCS C;  3ASN C;  2W0X A;  3BRC A;  2UUA O;  4PA9 A;  3SPH A;  3JAW A;  4WBN B;  1PV0 A;  1I08 A;  1NT2 B;  4ICG A;  4GCZ A;  4B3R B;  2Q4P A;  4YJ2 B;  4RO2 A;  3CRA A;  1YTF B;  1MMM A;  1K5Q A;  3VOU A;  2KG7 A;  4GT1 A;  2XAF A;  1K4C C;  2Z0A A;  4JI2 B;  1RSO A;  5KMG A;  2XHB A;  4FIP C;  1ZSP A;  4GX2 A;  1YDX A;  1IZ3 A;  3AG4 C;  3P3P A;  5IYZ A;  3G67 A;  3LDE A;  1PNK A;  4JYC A;  1S5H C;  3ZHU A;  4JI1 O;  2LW1 A;  1GRJ A;  3ZHQ A;  1XMO O;  2QKC A;  3BVO A;  1TVK A;  4JI0 O;  3G6E V;  2IJH A;  3B8M A;  3H1I H;  4G27 B;  3CSX A;  4DR3 B;  1DK1 A;  3STZ C;  2DQ0 A;  1Q6I A;  3E8H A;  3N2K B;  1VQ6 V;  3GWK C;  1M57 C;  2CH7 A;  3RVZ A;  4I5S A;  2GSM B;  5LA6 B;  3T4Z A;  5IDJ A;  3CRQ A;  2Y69 B;  2UXC O;  2A06 H;  2BCC H;  1YEW A;  1W0J G;  4NTX A;  3QO5 A;  1Q5O A;  1R3I C;  3BEH A;  2QJ1 A;  4FLV A;  1SQF A;  3OW2 U;  2BTQ B;  2ZE8 A;  2C2A A;  3O65 A;  4PI0 A;  4FFB B;  2UXX A;  1HDJ A;  1BMF G;  4FM0 A;  3ZX6 A;  3GB7 C;  1IBL O;  1WP8 A;  1R3L C;  4ZHQ B;  1K7D A;  1J5E B;  1OCZ B;  2QE7 G;  2AHY A;  2Q0O C;  3P32 A;  2F66 C;  1IUR A;  1IBM O;  1M9N A;  5GON B;  2CK3 G;  2OTJ V;  1HNZ O;  1FXH A;  5IJ0 B;  4WFE A;  1SQP H;  2ZE5 A;  3ZMT A;  5KHK A;  3KG2 A;  2HKO A;  4QGP A;  4CC5 A;  1SQX H;  2Q73 A;  3W7W A;  2Q7E A;  4RQE A;  5LMU B;  1AI6 A;  4LNU A;  3K58 A;  3AEI A;  2EUL A;  4Q20 A;  4O4L A;  1E79 G;  1N34 O;  5KAF Z;  2BTQ A;  4GKJ O;  5F2V O;  1QLE B;  5EIB C;  2LQT A;  2JRI A;  4TWK A;  4WFH A;  4XDJ A;  4YJ3 A;  2LFR A;  1ZLZ A;  1R1B A;  3CD6 V;  4L87 A;  3OD4 A;  1QU7 A;  1QNM A;  1R73 A;  2QTS A;  2NNU A;  1RM1 B;  2IM9 A;  3L73 H;  1G6U A;  1DGS A;  2QGN A;  1HNZ B;  4DR6 O;  4K3A A;  4DUZ B;  1T5E A;  4JI5 O;  4FMT A;  2R72 A;  4GZR B;  4TV8 A;  4JYA O;  3LSQ A;  2CAZ C;  4FLX A;  3SPC A;  3BFR A;  4WF9 V;  2HVJ C;  2UU9 O;  1VF6 C;  1BL8 A;  2OTL V;  4UCT A;  1H2M A;  1R6N A;  1GTO A;  3BAA A;  4RQF A;  2DW4 A;  1F4N A;  4JAU A;  1S5J A;  2B5U A;  2YIC A;  1JQ0 A;  5LMU O;  2GUZ B;  5JCO C;  3B2E E;  5CBG A;  5EZY A;  3CJH B;  2PUS A;  2YEV B;  2X6A A;  1OCR C;  4O2B B;  3IC9 A;  4JAV A;  2ZIM A;  4RUF A;  4DV3 B;  5IJ0 A;  1XDC A;  1OCO B;  1VF6 A;  3SJQ C;  5LYJ A;  3QTC A;  1I5Y A;  4XDK A;  1YJ9 V;  2RJZ A;  4UV9 A;  1FYJ A;  1UJW B;  2KB1 A;  3CME V;  3SYA A;  4CH4 A;  2YID A;  4R50 A;  4FM2 A;  2HLD G;  1AB3 A;  1AVM A;  1WB8 A;  5JJN B;  1QCE A;  4DV7 O;  3CWB H;  3H01 A;  1N0J A;  3FB5 C;  1VQP V;  3L70 H;  3ASO B;  1HNW O;  1FD9 A;  2ZIN A;  2Q5Z A;  3A2F A;  3E86 A;  2V4D A;  4BWA A;  4JI4 B;  4JYB A;  2VQF B;  3D8C A;  3ZRS A;  5JQG B;  3ZRW B;  4N23 A;  3VQW A;  1CXZ B;  1EFR G;  4LWS B;  5BMV B;  1RPO A;  4CBC A;  1XL4 A;  3IC7 A;  1JPX A;  1QBZ A;  2JS3 A;  1I94 O;  4IYI A;  3L9D A;  5K1X A;  1RSO B;  4J9Z B;  2EBO A;  4FM1 A;  4FZ0 A;  4DW0 A;  1GKF A;  3JD2 A;  4OX9 B;  4JGS A;  5JH7 A;  4YHH B;  1IBL B;  1OJH A;  1BCC H;  2WSS G;  1FAF A;  3AG7 A;  2YC0 A;  1MSD A;  3LSS A;  2HP8 A;  1XHZ A;  4J41 A;  1GH6 A;  3CC4 V;  3A0H Z;  2XAH A;  1NBM G;  3RW0 A;  3CCM V;  1WPB A;  3SJA C;  3SPI A;  1N36 B;  3SGI A;  4B08 A;  1JFF A;  3ZRX A;  1HR0 O;  4GKK O;  4AI8 A;  1Y4M A;  5KHH A;  3KKY A;  5LXT B;  1N33 O;  2FTK A;  1WB7 A;  4X9Q A;  5FNV B;  1K73 W;  3MHH C;  2VQE O;  2VRZ A;  5LP6 A;  4HBN A;  3IAY A;  5EYP B;  1V55 C;  2DWE C;  2JEU A;  2PYJ A;  2HFE C;  3ZHS A;  5IYD O;  2EIL C;  3CXC U;  4B7K A;  2HHH O;  1XL6 A;  2YXH A;  2O57 A;  4UV8 A;  2ZXW B;  4QE7 A;  1H2G A;  4H44 B;  3OE7 G;  3I55 V;  4PA7 A;  2Z3Y A;  1LNQ A;  3BA9 A;  1RPR A;  4HAM A;  2FL4 A;  1WLE A;  3FKS G;  4F6E A;  1BHB A;  1J95 A;  3SR2 C;  3AG3 B;  2YUA A;  2JJ1 G;  4OXS A;  4B3T B;  3RYC A;  4K8X A;  5J2U B;  4DR4 B;  4E4E A;  3H1K H;  3EHB B;  1HP8 A;  1XNR O;  3IJ4 A;  2ADQ B;  1I0H A;  1NTM H;  2BE3 A;  3MD0 A;  4P9O A;  2A7W A;  3HKB B;  2UUC O;  4JI3 B;  2WLL A;  4UUJ C;  3KZI Z;  3HPL C;  2PGG A;  1MOF A;  4BAY A;  5IYC O;  3ETE A;  4X66 O;  3CCR V;  2KQX A;  2PTM A;  1F23 A;  4C7U A;  3K3W A;  3L74 H;  4IHJ A;  3AK3 A;  1FXK B;  3IGA C;  1FXV A;  4TQD A;  2HJD A;  2M6Y A;  3OMI B;  4TT3 G;  3OR7 C;  2Y48 A;  5AG2 A;  4K0K O;  4JZG A;  1VQ8 V;  3JSL A;  2EIN B;  1KUQ A;  3ZJZ A;  3ZRV A;  2RQ6 A;  2RDC A;  1M93 A;  3EVK A;  4I4T B;  3QNE A;  2Q8V A;  1ZL8 A;  2F1M A;  2GBO A;  1S77 D;  1B06 A;  2QSA A;  2XAQ A;  1XEQ A;  1SKV A;  2QWP B;  4DV6 O;  1SF9 A;  5JCO A;  4DK0 A;  5D5Q A;  2QM7 A;  1GM8 A;  1FJG O;  2QTO A;  2VQF O;  4IT5 A;  2LGQ A;  1L8D A;  5B66 Z;  4FLY A;  4B3R O;  2HJF C;  2YXL A;  1VQK V;  4DR2 O;  5JJE B;  5CN0 A;  3B8N A;  3PN1 A;  1N8R W;  1SS3 A;  4NYK A;  1RM1 C;  2XT9 A;  5CB4 A;  1DTO A;  1ZL8 B;  4XDL A;  1XIL A;  3FX7 A;  1LUW A;  2EIM C;  2IW5 A;  5BR8 B;  1XUQ A;  4B3M O;  4FJC C;  4K35 A;  4MVU A;  5LHI A;  5LXT A;  5LGT A;  1M90 W;  2K9P A;  2YIB A;  3JCZ A;  2P06 A;  4DR1 B;  1WN7 A;  3FFQ A;  3U10 A;  5CBF A;  3NR7 A;  1AJQ A;  4FK5 C;  3M8A A;  1MZF A;  4TOI A;  2ITD C;  4JI7 B;  2OCC C;  1Y66 A;  5E79 Z;  2JEX A;  3ZED A;  2CUG A;  1N36 O;  3VQX A;  2B1G A;  1FXK C;  3BA8 A;  1KU9 A;  3W7U A;  4YIO A;  2UXB O;  1PP9 H;  2WLK A;  1VQL V;  1FJG B;  1V54 B;  1PNM A;  5KA6 A;  1SZT A;  4JTD B;  5CBH A;  2ZDI C;  1EZV H;  1H2S B;  3K9A A;  5J2U A;  1Q81 W;  4DR6 B;  2LW7 A;  1FS0 G;  4WFA V;  4BR6 A;  2JGU A;  4Z1M G;  3N2G A;  3BCC H;  1Q43 A;  1D5N A;  4TV9 B;  4E2L A;  4X64 B;  3H1L H;  4ZBM A;  4DV5 O;  2UUB B;  2PI4 A;  1W2B U;  2K1E A;  3CB2 A;  1AI7 A;  3UO2 A;  1JJ2 U;  4EB6 A;  4W4L A;  2DOS A;  4MVO A;  2ADP A;  4QE9 A;  4JV5 B;  5B1O A;  1W0K G;  3CYO A; 
#chains in the Genus database with same CATH homology
 4I0X A;  3FD9 A;  3Q4H A;  3Q4H B;  2AZ2 A;  3ZBH A;  1WA8 B;  3HR0 A;  4ABM A;  2KG7 A;  3FAV B;  3G80 A;  3GVM A;  3TXS A;  3GWK C;  4GZR B;  2VS0 A;  4I0X B;  2AZ0 A;  3TXQ A;  3O9O A;  2B9Z A;  3OGI B;  4LWS B;  2KG7 B;  4LWS A;  2VRZ A;  1WA8 A;  3FAV A;  2DE0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...