2KG7B

Structure and features of the complex formed by the tuberculosis virulence factors rv0287 and rv0288
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
SMSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Uncharacterized protein esxG (PE family protein)
publication title Solution structure of the M. tuberculosis EsxG-EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes
rcsb
source organism Mycobacterium tuberculosis
total genus 23
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2kg7B00
3Q4HA 2AZ0A 3GVMA 2KG7B 2DE0X 2AZ2A 4ABMA 4I0XB 3TXQA 1WA8A 4LWSB 3HR0A 2VS0A 3G80A 3TXSA 4GZRB 3FD9A 3OGIB 3FAVB 3Q4HB 3O9OA 1WA8B 3GWKC 2KG7A 4I0XA 3ZBHA 4LWSA 2B9ZA 2VRZA 3FAVA
chains in the Genus database with same CATH superfamily
3BA9A 1H38A 4MVMA 5GONB 4MTOA 2EJRA 5LHGA 3DXRA 2ZIMA 2PGGA 4I50A 5IWAO 1IX9A 1YXBA 4PJ0Z 5KHIA 5D5PA 2CTRA 1RPRA 2VWKA 1H2LA 1M57C 2FB5A 1YHQV 2EULA 2L35A 3BAAA 3O65A 2R70A 1G8MA 1AR5A 4PDMA 5KA6A 4JI4O 3CMAV 2R9IA 5LYJB 1VMGA 2DYRB 1R6TA 3F7YC 2Y0PA 1K9MW 3FFQA 2BOCC 1ORQC 4NTYA 4DV4B 1BMFG 4BIUA 3R65A 5DECA 3STZC 4NXMO 3OW2U 2FL4A 1NZ6A 4DUZO 4JASA 4JI7B 1NU1H 1M90W 3ASOC 1OHHG 1MZEA 2HG5C 3FYIB 1P7GA 4GYCB 3B2EE 4X1YA 4I5SA 2O57A 5EBMC 3T1HO 3H1LH 1N0JA 2QWQB 3Q4HB 2X6AA 2PUSA 2Q0OC 2YXLA 1AI7A 1OCZC 1AR1B 1NVPD 4AQYB 4UV9A 1K4CC 1KKCA 1H2SB 1XHXA 3LDDA 2IW5A 3RYHA 5IYDO 4JTCB 4JPRA 2B1IA 2EIMB 1XL4A 2EIKB 5JQGB 2FMLA 5B1AC 4LF6B 5DEDA 1EZVH 2CTPA 1QLEC 1MSWD 4NR1A 2EZPA 1S5LZ 2ZIOA 5JH7B 3SR2C 3OMIB 3JATB 3VQXA 2Q4PA 3LUTB 4JZ2A 5LXTB 4GX2A 5EIBD 1K73W 5CBHA 4X20B 4HNAB 2OCCB 3B4SA 3K9SA 1FXKB 3DXRB 3SYOA 2BCCH 4I50B 3FB7C 5LP6B 2GHYA 2XAJA 1KQSU 1T5EA 1K4DC 4G2KA 2EIJB 1I5YA 1IBKB 2VRZA 4N23A 1P7BA 4MS2A 2JJ2G 1FAFA 2UUCO 2XTAA 3CB2A 3L74H 4CS4A 2PTMA 1OCCB 1GMGA 1PM9A 3FAVB 2Y48A 3SPGA 5CN0A 2RMKB 4MTXA 1K97A 2QWRB 4DV3O 2B9ZA 2E5LB 2F95B 3OMAB 2XUMA 1V9PA 3H1JH 3H01A 2YS8A 5F2VO 2XAHA 2JVDA 5H6RA 1R3LC 1ZLZA 2UXBO 3QO5A 4UCTA 3BA8A 4UCRA 2GTAA 1E79G 4FZ1A 4X9QA 3QVNA 4X1YB 4CBCA 3AK3A 3AG3C 4YXWG 2OT5A 5L3CA 4DR6B 3K3WA 4PD4F 5JJJB 3MHSC 4DV6O 1EN5A 1J5EO 2ZXWB 4E4EA 3ZRVA 1PNKA 4FZ0A 1E1RG 4Q20A 3G6EV 5DM6V 4R7CA 1IBMB 3OGCC 2A79B 5CMUA 2HLDG 2LJ2A 1R6KA 3RYHB 5CB4A 4UVBA 3UKMA 2GTSA 2QTOA 4EFEA 2MK3A 2QKAA 1WB8A 5L3DA 3JAKA 4I9WA 4JI5O 3WB0A 1BT8A 4CZZA 4KP4A 2ZE7A 1YCIA 2UXCO 4GLXA 1HR0B 3OGIB 1OZ0A 3MD0A 2ZDIC 5JVDA 3VQVA 1I08A 3ZRWA 5B3SB 1VQOV 4HYOA 4L8JA 1K92A 4G28B 2WSSG 3HKDA 1F7YA 5JCOC 5K1PA 1H2NA 1JVMA 3UT5A 1JR9A 1EM1A 1NVPB 3JD3A 1VQKV 2G38A 3ETDA 3PN1A 2DQ3A 3CC2V 4Z1MG 5JJEB 5H6QA 4B3MO 2WLIB 1YTFD 4JI1B 3NR7A 4B3RB 2QM4A 1FD9A 4KHPB 2MW2B 2YC0A 3JCZA 3UQ8A 5HFLA 4FM2A 1G1XB 4G27B 4MVOA 2XASA 4O4HB 3SYQA 2UUBB 1VEWA 1QCEA 3EVKA 2YIAA 4LBEC 4DK1A 2BTQA 3J7AU 4DO2A 1SQFA 1NT2B 2AHYA 3ZN0A 1VQ7V 3T1CA 4LR3A 4CH3A 1HNXO 4JI8B 4LF5O 3I5DA 3CRAA 1L8DA 2LGWA 2EJ7A 4K0KO 3G6BA 3CD6V 2EIMC 4NTWA 1M56B 2EIKC 1IBLO 3I56V 1VF6A 1SA0B 4DR4B 1N32O 4MVQA 1HP8A 5BXZA 4GKKB 5CB4B 4B3SO 4LFAO 3S3WA 3GVMA 4IHJA 3SPJA 4YHHO 1AJQA 4ABMA 4DR5O 2F4VB 3AK1A 1JOYA 1GAXA 1VQNV 3JAKB 1GH6A 5CA3A 2RNBA 2OCCC 1FXKC 4BW9A 4LWSA 5LMNO 1W2BU 1GM9A 1S72V 5LP6C 5KMGB 3ZRWB 1Q90D 1UFIA 1IZ3A 4OXSA 2EIJC 3LSQA 1V54B 3HKEB 1Q82W 1NTKH 2ZR3A 4O2AA 2KSDA 4W4KA 5L3GA 4X65B 1Z2GA 1KD1W 1HDJA 4WFHA 3UT5B 1Y74A 4MTGA 4UB6Z 1XREA 4PDVA 3VOUA 3LNMB 3TCUA 1NTMH 3CEIA 2IM9A 4DR1O 1HNWO 3HKCB 1AI5A 4J10A 4LNUA 3RGBA 2BTOA 1W0KG 1US6A 3ETGA 1MSDA 2OIEA 4PI2A 1W59A 1RM1B 2Z0AA 4IYHA 4NTXA 2WLMA 2X0LA 2Z3YA 3H1HH 3P3PA 3DTUB 4H44B 5EBWC 1D5NA 4U7NA 3N2GB 1Q7YW 5FPRA 2BTQB 4WF9V 1TA8A 1WP8A 2ZXWC 4FIPC 1L1FA 4U7OA 2V7QG 4XDKA 1Z5VA 5EZYA 1GTOA 2XNDG 1V55B 4YIOA 1ZTEA 2DYSB 1PP9H 3AK2A 4PHZA 3CCLV 3HKBA 1IDSA 1FPOA 3SPIA 5H2FZ 4LF9B 1QVGU 5B1BB 3SPHA 1B6QA 3T2MA 1RFYA 3ZMUA 5IY5B 2QWOB 2ZNJA 1KBHA 3E22B 3OUFA 2OWOA 4BW5A 4IHJB 1IVSA 2JGDA 3RYIA 1I94B 1YTFB 3J80N 5B3SC 4UXNA 4NKGB 1PD3A 3CCUV 1FJGO 2DMXA 2H8PC 3ZIAG 3OTOB 2VQFB 4LWSB 1X59A 1PPJH 1CP9A 2FYUH 2OTLV 3AEIA 1XMQB 3E8HA 4MT8A 2ZM6O 2YUAA 3G71V 1NQTA 1BGYH 4FM0A 1HNZB 5EYPB 5FLXN 1ZX3A 2HHHB 5L3EA 3CHXA 2YICA 1Y74B 2M6YA 4WFEA 4QE7A 1ZWIC 3UO3A 1NS1A 1QR8A 2IH1C 2Q8VA 3QTCA 2NLJC 3E86A 4LNUB 2WAMA 2UXDO 2HVJC 3OE7G 2P4KA 2CTWA 1OV9A 3ZHRA 4B7EA 2LGQA 5L3FA 4LF7B 1WN7A 3KZIZ 1THZA 4JI4B 4DV0O 3B77A 4ZHQA 4D7TA 2XOKG 1M56C 5EZYB 3QNEA 1SERA 5H5NA 3IC9A 2IU3A 1RP3B 4NXMB 1QHTA 5CA0A 2F66C 2OYQA 1XI1A 3CCEV 2PI4A 5LA6A 3JD0A 4DV5O 2JS5A 4UV8A 2EILB 3ASNB 3RW0A 2PI5A 1VQLV 3T1HB 1R3JC 4BIOA 4LF8B 3K0DA 3CCVV 1WPBA 4KUMA 2JGDB 3RYIB 4YJ2A 4QIWF 2P6JA 4DUYB 1YJ9V 2UU9O 3JASA 2Q9LA 5DN6G 1V54C 2GUZB 4DYLA 4TV8B 4W4LA 4OPHA 4U3JA 1LUVA 3OM3B 4MVUA 2WA3A 1MG1A 2IH3C 3T1YO 4MW8A 1QBZA 4DV2O 3SJCC 1AI6A 4H33A 3B09A 2QGNA 2OCHA 2ZR2A 1FXVA 3TXQA 3X2QB 4NB5A 3DGEA 1XUQA 5JWPA 3K03A 2IU0A 2YEVA 3K0GA 5KX5B 1XNQO 3CC7V 1SKVA 4AHCA 1EBOA 2CH7A 2DOSA 3WU2Z 3RVYA 2Y4UA 1URFA 1RM1C 3LSUA 3LNNA 2R9AA 4NXNO 3ZBHA 4JTAB 1IXMA 1R3IC 2X6BA 1PNLA 1Y66A 4Z2WA 3KCYA 2IJHA 1SZXA 3FX7A 1N34B 4YY3O 4UFZA 5LMUB 1HWYA 5BR8O 2LW7A 3D36C 4JI0O 3K5LA 2M7WA 3VQYA 1V55C 2UUCB 2W6IG 2DYSC 1UJWB 3OEHG 4H37A 1XNRO 1J95A 2QSAA 4PA6A 4ZHQB 2HJFC 3ZHQA 1VF5B 4R8CA 5B1BC 4DV3B 3U10A 2Y69B 4KFMA 1VF6C 5KHGA 3QF7A 4YJ3A 2VS0A 5IY5C 3ZMSA 4JV5B 1YITV 4O2BA 5CA0B 5CA1A 2N74A 3JD4A 4AI8A 1F23A 4XDLA 3SDLA 1HW7A 2CGOA 1AROP 2A9HA 1N36B 1XBLA 5IYZB 4DK0A 5J9PC 4GX1A 1ROPA 4YJ2B 3ZEDA 3K08A 3JASB 4K3AA 4UVCA 2OTJV 4LFBO 1F51A 1GKFA 4LF4O 5KLVH 4U3JB 2DN9A 4OGQB 1S0VA 1Q6HA 2Y4TA 4JI6B 2VWJA 2CTQA 4DV4O 1Z5WA 4GKJO 2YXYA 2JEUA 1FFXA 4J42A 5TISZ 5K1XA 1Q5OA 1VQ5V 3O9OA 4GT1A 1WAZA 4Z1VA 2R9RB 3K06A 1H2KA 2ZCEA 1DGSA 3F5WC 4I0XA 1PNMA 1GRJA 2YEVB 2VQEB 4RO2A 3F7VC 5KUKA 4TQFA 2V4DA 3BCCH 1I7FA 3D3QA 3AG4B 3GWOA 1JX9A 1E1QG 2UXNA 4DR3B 1B3QA 2Q5ZA 4TUYA 3VBBA 1JA8A 4MVSA 2P7TC 4KXRA 2ZE8A 2HKOA 4LF6O 4JI3B 1COWG 4JAVA 2IJIA 3A0RA 3CX5F 2QKCA 4GCZA 1YJWV 3E2EA 4QGPA 1XL6A 4RUFA 3ABKB 4FLUA 5FL7G 4LH7A 2EILC 3ASNC 2KG7A 4NVPA 4QPJA 4JTDB 1YSCA 2ZQMA 3S3XA 4GUNA 3T4ZA 5C93A 4O2BB 4DR2O 5CA1B 4HBNA 2Q69A 3THOA 4DXWA 3EHBB 1KP3A 3JALA 2JGUA 5LBQA 1NH2D 4MW3A 3E89A 4FPPA 1D5AA 1IBKO 5LGTA 1B06A 2EX3A 3ICXA 3WB1A 4WFFA 4B7KA 4LF5B 4X88A 1GM7A 4HAMA 4XDJA 4FM1A 3A0BZ 1TAEA 4OX9B 4K0KB 3H9VA 4C7UA 1N4CA 1IBLB 1KYOF 4BAYA 3E8GA 4UUJC 3X2QC 3DC5A 2E5LO 3H1KH 4CC6A 1VQ6V 4X1IA 1SQBH 4JYAB 1DF4A 1XILA 2WLNA 3HB3B 2A3QA 1TVKA 4X62O 1B04A 2ARHA 4PA3A 2QWNB 1SZTA 2W0XA 3CS5A 1I5XA 3ZCCA 1YJNV 4I0XB 5C8YA 5LMNB 4UCSA 1AP5A 3R66A 4FJCC 1CPYA 5IYCO 2LFRA 4JI2B 2Q0AA 3ZX6A 3UM7A 3CCMV 5KAFZ 1IBMO 4DRXA 2IJKA 1UPGA 5CBGA 3I55V 3A2FA 2XHBA 1S76D 2Q73A 4QE9A 2HP8A 3JYCA 2V1DA 1QU7A 3N2KA 1QLNA 2RJZA 3CCJV 2Y69C 2DWEC 2PYJA 4B3TO 2PY5A 1SC5B 3K58A 4L87A 1HNWB 3K57A 3U0ZA 3CC4V 2GBOA 4XBFA 4FLYA 1KU9A 1RPOA 3C3TA 1H8HG 5LHIA 2WWWA 2CGNA 1HR0O 1ENVA 3CMEV 1U96A 4FLTA 3G67A 1S5HC 3QG5A 1XQ8A 3AG2B 3APQA 4P30A 2KG7B 3H1IH 3B40A 3M99B 5J2UA 4JAAA 1VIBA 4JAUA 2DQ0A 3CJHA 3D3IA 3JALB 2A7WA 2EINB 4K8ZA 3P3NA 4UCOA 4X64B 2E75B 2PF4E 3JSNA 1GN4A 3BVOA 2P5OA 4FMTA 1QNMA 5JVDB 1RSOA 4DV1O 2AZ0A 1MA1A 4PV1B 5GW7A 1YZBA 4EB6A 3BHPA 4JI1O 4PELA 4FK5C 2H94A 2ZINA 4O4IA 1VQ9V 1LNQA 3HKDB 4KHPO 5H9CA 1Y6XA 3WB2A 2WLJA 5ITZA 4DR7B 4DV7B 4LP8A 4X1IB 4NYKA 1TVKB 2UUBO 2JEXA 1YF2A 1F4MA 1FJGB 3AG4C 2YI8A 2YIBD 3BPZA 4CS2A 4EKWA 4BR6A 1NKDA 5KUMA 5KHHA 3ZMTA 1OCRB 1P4RA 3ZJZA 5IJ0A 1S3JA 3RT3C 5D5QA 3E8BA 2XAGA 3EXAA 1WA8A 2Q6AA 4CH4A 2IBZH 1NH2B 4DR4O 5IE9A 2CUGA 5B1OA 1TUBA 4DRXB 3CCQV 5B66Z 4WBNA 4GKKO 2GDSA 4UCUA 2HEPA 1KMIZ 4ASUG 3N2KB 5EBLC 3BRCA 3ABKC 4JGSA 2F4VO 3IAYA 2Z5UA 2DE0X 1R1BA 2C2AA 1S77D 4O4LA 1NR1A 4FFBA 3OTFA 4F4LA 3JARA 1PL0A 5B5EZ 1WNSA 4MSWC 1QVFU 3HPLC 3W7XA 4X66B 3GB7C 1JQ0A 1AJPA 1VQMV 2QTSA 1GN3A 3JD1A 5FPOA 2P22C 2LFSA 2YIBA 2K1EA 5BMVA 3CJHB 4RQFA 4X65O 5JJNB 3ZS8C 3BABA 4QPKA 2HJDA 4QJFB 3FB6C 1MOFA 1RSOB 1NBMG 2ADQB 4FVMA 5IJ9A 3LDEA 4ZI7A 1AILA 4EB6B 5GONA 1KECA 4DV5B 4O2AB 2B1GA 3KG2A 4O4IB 1BQ0A 4J11A 4LFCB 1PL4A 3RN4A 2JS3A 4PDRA 5B1NA 2UUAB 3JD2A 1SQGA 1K7DA 3FD9A 3K5NA 1Y4MA 2KKWA 3TJTA 3ABTA 3L9DA 3U11A 1VF7A 1L0NH 4JYCA 5IWAB 2LP7A 1Q81W 5EC2C 4EEQA 1QR9A 4J7JA 3OUSA 1SESA 2AZ2A 3SJQC 2LW1A 4FLXA 3ZN1A 4DV2B 3CRCA 5EIBC 3FB8C 2H3OA 4LF9O 3IC7A 3RYFA 3CXCU 2ODMA 1WA8B 1YDXA 2E76B 4WBNB 1XNQB 3ETQA 1H8EG 3Q4HA 1XMOO 3AG2C 1I94O 3HKBB 4DUZB 4DW1A 2LQTA 4O4LB 4FFBB 2P90A 2P67A 4RWUA 4PA9A 4YY3B 4FLVA 1NI8A 3JARB 2WLKA 1NR7A 3GWKC 2VQFO 2EINC 1LUWA 1KUQA 3B8NA 3ZMVA 1XOUA 3L73H 2JK5C 2FKXA 1SQQH 1N0NA 1N33O 3SPCA 2RCVA 3SYPA 3TXSA 1AB3A 4WFGA 4F6EA 3CCRV 3F5TA 3DC6A 1HNZO 2XAQA 3ML0A 1VQ4V 2QWPB 1OJHA 2ITCC 3ZRSA 5IJ9B 4ZI7B 4J80A 1ZL8A 3A0HZ 4R6ZA 1FXKA 2WA4A 4P9PA 5BY1A 4TV9A 5LP6A 1SQVH 1GN6A 3ZHUA 3K59A 3LSSA 2R72A 2X6CA 5BZBA 4EFBA 1QQCA 4D6TH 4WCEV 3E35A 1OCRC 4LF7O 4FFKA 1GK9A 4RUEA 3FAVA 4LFBB 4LF4B 1MZFA 1K34A 4JZGA 3HR0A 3G80A 4HZ3A 3E83A 2ILMA 1SETA 3RVZA 5EC1C 2YDEA 4CC5A 4J9ZB 4GKJB 1KB9F 3P32A 3BFRA 3RYFB 1BS3A 4R50A 2W6JG 4H0LB 4PA4A 1VP7A 2JDIG 2N04A 3UO2A 1WLEA 1BSMA 4LF8O 3STLC 3ZMZA 1FS0G 4MVRA 1K33A 2QA4V 4DUYO 2BSKA 1EN6A 5LA6B 5AG2A 2UXBB 1JJOA 3W7SA 1OCOB 2Q7GA 2QM8A 2F23A 2RDCA 3L71H 2YXHA 2PZSA 1JJ2U 1Q6IA 1Y67A 2AW9A 1N8RW 1ZSPA 2NR5A 1P84F 1A32A 2BE3A 4DV6B 3SJBC 4TWKA 1J5EB 3CE2A 1M5IA 4PDLA 2Y0IA 3TETA 1SQXH 4PI0A 2JJ1G 3CRRA 2ZKOA 4O4JA 2HR3A 1D2DA 1S5JA 2ZD9A 4K35A 4E2LA 2Q7EA 5IT9N 4DR2B 5L3BA 3ZHSA 4JI7O 1ZL8B 4J9YB 2UXXA 3RWRD 4JI5B 1Q86W 1MABG 1K8AW 2ZNIA 4TV9B 4ICGA 2QR4A 1F4NA 2HVKC 1MMMA 2FTKA 4ZIBA 3W7WA 1DK1A 1N34O 2UXCB 5LMUO 2JRIA 2JIZG 1ZUQA 1AR4A 3IFXA 1VARA 3K04A 2CH7B 4ZOLA 3CRQA 4TQDA 2CDYA 4B08A 2D2CB 2QEXV 4MTFA 3ABLB 4WFAV 2WLIA 3OAAG 4AQYO 3APOA 2OIGA 1PKXA 3NXSA 4X89A 3JAWA 1CEZA 3VQWA 4JYBA 5LL6Y 4UVAA 4CH6A 1VQ8V 5LGUA 4JV5O 4GX5A 4O4HA 4P2ZA 4B3MB 4X62B 4H13B 4TSFG 4J41A 1Q43A 4FLWA 1N36O 1W0JG 1SQPH 4Q6GA 1M1KW 4YJ3B 1I0HA 3L70H 4K8XA 1VQPV 3J81N 3K5OA 2L6LA 3EFFK 2BSKB 1O9GA 4DW0A 3M8AA 1X4TA 2Q67A 3K9AA 1SA0A 1R73A 4WFBV 4X1KA 5FNVA 2DWDC 1Y76A 1GM8A 1WJZA 1TUEB 3LDCA 4JI6O 5A9GA 1HNXB 2QM7A 1FKAO 3WG7C 1EZJA 2WLHA 4B3TB 3B8MA 2A06H 2ZT9B 3OR6C 1N32B 5A2QN 1G6UA 2VQEO 4O4JB 4B3SB 2Q68A 5KMGA 4LFAB 2CK3G 4YHHB 3A8TA 4RAIA 4DR5B 5E79Z 3T4DA 3HKEA 5HFMA 1FFXB 2RQ6A 4ZBMA 3MHHC 4TOIA 1TGOA 3ABMB 4UB8Z 2RN9A 1WB7A 4DR3O 1XEQA 2XT9A 1YIJV 1R6NA 4GX0A 1BHAA 2DYRC 4ZOLB 4DV1B 4DR6O 3D8CA 3OR7C 3SYAA 3RYCA 5LGNA 1M9NA 3SJAC 4JI3O 3HKCA 2P06A 3BY6A 2DW4A 3JAWB 4FLZA 2YIDA 4IL6Z 3AG1B 4TUYB 3JCUZ 2F93B 4MVZA 4GZRB 3AG7A 2NN4A 3OFNG 3N2GA 4DR1B 1GO3F 3FYEB 2YI9A 1YVWA 3D36A 2XAFA 1H2GA 5GTIZ 1OCOC 3CXHF 5IYBO 2AHZA 2AXTZ 5LOVA 5E1AC 3RBZA 5IDJA 1JCHA 2F1MA 4OX9O 1JFFA 4CS3A 1YEWA 5KHJA 3DSQA 4X1KB 5FNVB 3KKYA 1O9HA 1Y76B 3QO8A 3E22A 4YIPA 1DF5A 4D7SA 1FYJA 1WPXA 2EZOA 4JYAO 1L0LH 2ATKC 3TK1A 4IGGA 2B5UA 3IGAC 4B3RO 1M4UA 1FXHA 5KHKA 3KCXA 2LO1A 1U97A 4TT3G 1KC8W 4IIJA 1BL8A 4I55A 4JI2O 2PYLA 1KP2A 4AILC 2YSUB 1M57B 4F6RA 3ABLC 3K79A 1NJIW 1OCCC 1AJNA 3CCSV 1EN4A 3CYOA 5EYPA 5C8YB 1FFTB 1XHZA 1KKDA 4JI8O 4OPAA 3RYCB 1K5QA 1BZKA 1EFRG 2D3OW 1ZAUA 2KB1A 3RFRA 4I4TA 2ZM6B 3E8FA 1R3KC 2WLLA 3L75H 2GV9A 2N05A 4UCVA 4I7ZB 3MDSA 1Q6UA 4BIZA 2E3CA 4U3FH 4JF3A 3ASOB 2F43G 1SRYA 5J2TA 2KQXA 3SYCA 2E74B 3ZHVA 5KA5A 4P9OA 2Q7HA 1YI2V 2UXDB 4X64O 4ZKIA 2HFEC 3TGUH 4IT5A 1SS3A 1DTOA 1OCZB 3JSLA 1G4YB 5LOVB 2ADPA 1SF9A 3ZRXA 3P30A 3MAQA 2CE4A 5J2UB 1Q3EA 1LR1A 3G4SV 2K9PA 1JFFB 3CRMA 4DV0B 3FKSG 3C90A 4RQEA 2ETNA 2GSMB 1JPXA 3ETEA 4DR7O 3CP1A 5B1AB 4I9QA 1XMOB 4DV7O 1IXBA 1H2MA 3JAMN 1QLEB 3QO7A 4CH5A 1BE3H 3PJSK 4IYIA 2GUZA 1AP6A 3CSXA 1M93A 4TV8A 4J7KA 2ZDIA 1WP7A 3IJ4A 3ABMC 4QNHB 5ITZB 2X7RB 2ZE5A 2NNUA 2EBOA 4N21A 2QJ1A 4IIJB 5KAIZ 2UU9B 1N33B 4I55B 4BWAA 1MNGA 3C3SA 5JCOA 3BEHA 4F6RB 5LYJA 5LHHA 1CXZB 2QE7G 3OEEG 5KX5A 1AVMA 2AGAA 2ZE6A 3AG1C 3T1YB 4LC1A 5IJ0B 3WFVA 4I4TB 3UCSC 2WLLB 1AI4A 1IURA 1PV0A 1TUBB 2P4VA 3L72H 2QKSA 2BOBC 3W7UA 4X66O 4X8AA 4A5UB 1K3EA 1BCCH 1K5SA 5J2TB 5CBFA 1P49A 2DJVA 4NXNB 3ABUA 4PA7A 3W7TA 2QDOA 3AG3B 3N27A 3CPWU 4LH6A 4J7ZA 3OT7A 3OTOO 3OD4A 5BR8B 3CWBH 1NTZH 2WPDG 5EK0A 1XDCA 4KL1A 3ZHTA 3SGIA 4JI0B 3K5MA 3M7MX 4JYYA 5JQGA 4LCUC 1Q8IA 1XMQO 1XNRB 1DLBA 3OMNB 5BMVB 5JH7A 2W0FC 5GTHZ 2IJJA 3JATA 4LFCO 5IYZA 2A0LA 3WG7B 2HHHO 2UUAO 5LXTA 2ITDC 1BQZA 2CAZC 1GN2A 1JMKC 3FB5C 1BHBA 4X20A 4HNAA
chains in the Genus database with same CATH topology
3Q4HA 2AZ0A 3GVMA 2KG7B 2DE0X 2AZ2A 4ABMA 4I0XB 3TXQA 1WA8A 4LWSB 3HR0A 2VS0A 3G80A 3TXSA 4GZRB 3FD9A 3OGIB 3FAVB 3Q4HB 3O9OA 1WA8B 3GWKC 2KG7A 4I0XA 3ZBHA 4LWSA 2B9ZA 2VRZA 3FAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4H A;  2AZ0 A;  3GVM A;  2KG7 B;  2DE0 X;  2AZ2 A;  4ABM A;  4I0X B;  3TXQ A;  1WA8 A;  4LWS B;  3HR0 A;  2VS0 A;  3G80 A;  3TXS A;  4GZR B;  3FD9 A;  3OGI B;  3FAV B;  3Q4H B;  3O9O A;  1WA8 B;  3GWK C;  2KG7 A;  4I0X A;  3ZBH A;  4LWS A;  2B9Z A;  2VRZ A;  3FAV A; 
#chains in the Genus database with same CATH topology
 3BA9 A;  1H38 A;  4MVM A;  5GON B;  4MTO A;  2EJR A;  5LHG A;  3DXR A;  2ZIM A;  2PGG A;  4I50 A;  5IWA O;  1IX9 A;  1YXB A;  4PJ0 Z;  5KHI A;  5D5P A;  2CTR A;  1RPR A;  2VWK A;  1H2L A;  1M57 C;  2FB5 A;  1YHQ V;  2EUL A;  2L35 A;  3BAA A;  3O65 A;  2R70 A;  1G8M A;  1AR5 A;  4PDM A;  5KA6 A;  4JI4 O;  3CMA V;  2R9I A;  5LYJ B;  1VMG A;  2DYR B;  1R6T A;  3F7Y C;  2Y0P A;  1K9M W;  3FFQ A;  2BOC C;  1ORQ C;  4NTY A;  4DV4 B;  1BMF G;  4BIU A;  3R65 A;  5DEC A;  3STZ C;  4NXM O;  3OW2 U;  2FL4 A;  1NZ6 A;  4DUZ O;  4JAS A;  4JI7 B;  1NU1 H;  1M90 W;  3ASO C;  1OHH G;  1MZE A;  2HG5 C;  3FYI B;  1P7G A;  4GYC B;  3B2E E;  4X1Y A;  4I5S A;  2O57 A;  5EBM C;  3T1H O;  3H1L H;  1N0J A;  2QWQ B;  3Q4H B;  2X6A A;  2PUS A;  2Q0O C;  2YXL A;  1AI7 A;  1OCZ C;  1AR1 B;  1NVP D;  4AQY B;  4UV9 A;  1K4C C;  1KKC A;  1H2S B;  1XHX A;  3LDD A;  2IW5 A;  3RYH A;  5IYD O;  4JTC B;  4JPR A;  2B1I A;  2EIM B;  1XL4 A;  2EIK B;  5JQG B;  2FML A;  5B1A C;  4LF6 B;  5DED A;  1EZV H;  2CTP A;  1QLE C;  1MSW D;  4NR1 A;  2EZP A;  1S5L Z;  2ZIO A;  5JH7 B;  3SR2 C;  3OMI B;  3JAT B;  3VQX A;  2Q4P A;  3LUT B;  4JZ2 A;  5LXT B;  4GX2 A;  5EIB D;  1K73 W;  5CBH A;  4X20 B;  4HNA B;  2OCC B;  3B4S A;  3K9S A;  1FXK B;  3DXR B;  3SYO A;  2BCC H;  4I50 B;  3FB7 C;  5LP6 B;  2GHY A;  2XAJ A;  1KQS U;  1T5E A;  1K4D C;  4G2K A;  2EIJ B;  1I5Y A;  1IBK B;  2VRZ A;  4N23 A;  1P7B A;  4MS2 A;  2JJ2 G;  1FAF A;  2UUC O;  2XTA A;  3CB2 A;  3L74 H;  4CS4 A;  2PTM A;  1OCC B;  1GMG A;  1PM9 A;  3FAV B;  2Y48 A;  3SPG A;  5CN0 A;  2RMK B;  4MTX A;  1K97 A;  2QWR B;  4DV3 O;  2B9Z A;  2E5L B;  2F95 B;  3OMA B;  2XUM A;  1V9P A;  3H1J H;  3H01 A;  2YS8 A;  5F2V O;  2XAH A;  2JVD A;  5H6R A;  1R3L C;  1ZLZ A;  2UXB O;  3QO5 A;  4UCT A;  3BA8 A;  4UCR A;  2GTA A;  1E79 G;  4FZ1 A;  4X9Q A;  3QVN A;  4X1Y B;  4CBC A;  3AK3 A;  3AG3 C;  4YXW G;  2OT5 A;  5L3C A;  4DR6 B;  3K3W A;  4PD4 F;  5JJJ B;  3MHS C;  4DV6 O;  1EN5 A;  1J5E O;  2ZXW B;  4E4E A;  3ZRV A;  1PNK A;  4FZ0 A;  1E1R G;  4Q20 A;  3G6E V;  5DM6 V;  4R7C A;  1IBM B;  3OGC C;  2A79 B;  5CMU A;  2HLD G;  2LJ2 A;  1R6K A;  3RYH B;  5CB4 A;  4UVB A;  3UKM A;  2GTS A;  2QTO A;  4EFE A;  2MK3 A;  2QKA A;  1WB8 A;  5L3D A;  3JAK A;  4I9W A;  4JI5 O;  3WB0 A;  1BT8 A;  4CZZ A;  4KP4 A;  2ZE7 A;  1YCI A;  2UXC O;  4GLX A;  1HR0 B;  3OGI B;  1OZ0 A;  3MD0 A;  2ZDI C;  5JVD A;  3VQV A;  1I08 A;  3ZRW A;  5B3S B;  1VQO V;  4HYO A;  4L8J A;  1K92 A;  4G28 B;  2WSS G;  3HKD A;  1F7Y A;  5JCO C;  5K1P A;  1H2N A;  1JVM A;  3UT5 A;  1JR9 A;  1EM1 A;  1NVP B;  3JD3 A;  1VQK V;  2G38 A;  3ETD A;  3PN1 A;  2DQ3 A;  3CC2 V;  4Z1M G;  5JJE B;  5H6Q A;  4B3M O;  2WLI B;  1YTF D;  4JI1 B;  3NR7 A;  4B3R B;  2QM4 A;  1FD9 A;  4KHP B;  2MW2 B;  2YC0 A;  3JCZ A;  3UQ8 A;  5HFL A;  4FM2 A;  1G1X B;  4G27 B;  4MVO A;  2XAS A;  4O4H B;  3SYQ A;  2UUB B;  1VEW A;  1QCE A;  3EVK A;  2YIA A;  4LBE C;  4DK1 A;  2BTQ A;  3J7A U;  4DO2 A;  1SQF A;  1NT2 B;  2AHY A;  3ZN0 A;  1VQ7 V;  3T1C A;  4LR3 A;  4CH3 A;  1HNX O;  4JI8 B;  4LF5 O;  3I5D A;  3CRA A;  1L8D A;  2LGW A;  2EJ7 A;  4K0K O;  3G6B A;  3CD6 V;  2EIM C;  4NTW A;  1M56 B;  2EIK C;  1IBL O;  3I56 V;  1VF6 A;  1SA0 B;  4DR4 B;  1N32 O;  4MVQ A;  1HP8 A;  5BXZ A;  4GKK B;  5CB4 B;  4B3S O;  4LFA O;  3S3W A;  3GVM A;  4IHJ A;  3SPJ A;  4YHH O;  1AJQ A;  4ABM A;  4DR5 O;  2F4V B;  3AK1 A;  1JOY A;  1GAX A;  1VQN V;  3JAK B;  1GH6 A;  5CA3 A;  2RNB A;  2OCC C;  1FXK C;  4BW9 A;  4LWS A;  5LMN O;  1W2B U;  1GM9 A;  1S72 V;  5LP6 C;  5KMG B;  3ZRW B;  1Q90 D;  1UFI A;  1IZ3 A;  4OXS A;  2EIJ C;  3LSQ A;  1V54 B;  3HKE B;  1Q82 W;  1NTK H;  2ZR3 A;  4O2A A;  2KSD A;  4W4K A;  5L3G A;  4X65 B;  1Z2G A;  1KD1 W;  1HDJ A;  4WFH A;  3UT5 B;  1Y74 A;  4MTG A;  4UB6 Z;  1XRE A;  4PDV A;  3VOU A;  3LNM B;  3TCU A;  1NTM H;  3CEI A;  2IM9 A;  4DR1 O;  1HNW O;  3HKC B;  1AI5 A;  4J10 A;  4LNU A;  3RGB A;  2BTO A;  1W0K G;  1US6 A;  3ETG A;  1MSD A;  2OIE A;  4PI2 A;  1W59 A;  1RM1 B;  2Z0A A;  4IYH A;  4NTX A;  2WLM A;  2X0L A;  2Z3Y A;  3H1H H;  3P3P A;  3DTU B;  4H44 B;  5EBW C;  1D5N A;  4U7N A;  3N2G B;  1Q7Y W;  5FPR A;  2BTQ B;  4WF9 V;  1TA8 A;  1WP8 A;  2ZXW C;  4FIP C;  1L1F A;  4U7O A;  2V7Q G;  4XDK A;  1Z5V A;  5EZY A;  1GTO A;  2XND G;  1V55 B;  4YIO A;  1ZTE A;  2DYS B;  1PP9 H;  3AK2 A;  4PHZ A;  3CCL V;  3HKB A;  1IDS A;  1FPO A;  3SPI A;  5H2F Z;  4LF9 B;  1QVG U;  5B1B B;  3SPH A;  1B6Q A;  3T2M A;  1RFY A;  3ZMU A;  5IY5 B;  2QWO B;  2ZNJ A;  1KBH A;  3E22 B;  3OUF A;  2OWO A;  4BW5 A;  4IHJ B;  1IVS A;  2JGD A;  3RYI A;  1I94 B;  1YTF B;  3J80 N;  5B3S C;  4UXN A;  4NKG B;  1PD3 A;  3CCU V;  1FJG O;  2DMX A;  2H8P C;  3ZIA G;  3OTO B;  2VQF B;  4LWS B;  1X59 A;  1PPJ H;  1CP9 A;  2FYU H;  2OTL V;  3AEI A;  1XMQ B;  3E8H A;  4MT8 A;  2ZM6 O;  2YUA A;  3G71 V;  1NQT A;  1BGY H;  4FM0 A;  1HNZ B;  5EYP B;  5FLX N;  1ZX3 A;  2HHH B;  5L3E A;  3CHX A;  2YIC A;  1Y74 B;  2M6Y A;  4WFE A;  4QE7 A;  1ZWI C;  3UO3 A;  1NS1 A;  1QR8 A;  2IH1 C;  2Q8V A;  3QTC A;  2NLJ C;  3E86 A;  4LNU B;  2WAM A;  2UXD O;  2HVJ C;  3OE7 G;  2P4K A;  2CTW A;  1OV9 A;  3ZHR A;  4B7E A;  2LGQ A;  5L3F A;  4LF7 B;  1WN7 A;  3KZI Z;  1THZ A;  4JI4 B;  4DV0 O;  3B77 A;  4ZHQ A;  4D7T A;  2XOK G;  1M56 C;  5EZY B;  3QNE A;  1SER A;  5H5N A;  3IC9 A;  2IU3 A;  1RP3 B;  4NXM B;  1QHT A;  5CA0 A;  2F66 C;  2OYQ A;  1XI1 A;  3CCE V;  2PI4 A;  5LA6 A;  3JD0 A;  4DV5 O;  2JS5 A;  4UV8 A;  2EIL B;  3ASN B;  3RW0 A;  2PI5 A;  1VQL V;  3T1H B;  1R3J C;  4BIO A;  4LF8 B;  3K0D A;  3CCV V;  1WPB A;  4KUM A;  2JGD B;  3RYI B;  4YJ2 A;  4QIW F;  2P6J A;  4DUY B;  1YJ9 V;  2UU9 O;  3JAS A;  2Q9L A;  5DN6 G;  1V54 C;  2GUZ B;  4DYL A;  4TV8 B;  4W4L A;  4OPH A;  4U3J A;  1LUV A;  3OM3 B;  4MVU A;  2WA3 A;  1MG1 A;  2IH3 C;  3T1Y O;  4MW8 A;  1QBZ A;  4DV2 O;  3SJC C;  1AI6 A;  4H33 A;  3B09 A;  2QGN A;  2OCH A;  2ZR2 A;  1FXV A;  3TXQ A;  3X2Q B;  4NB5 A;  3DGE A;  1XUQ A;  5JWP A;  3K03 A;  2IU0 A;  2YEV A;  3K0G A;  5KX5 B;  1XNQ O;  3CC7 V;  1SKV A;  4AHC A;  1EBO A;  2CH7 A;  2DOS A;  3WU2 Z;  3RVY A;  2Y4U A;  1URF A;  1RM1 C;  3LSU A;  3LNN A;  2R9A A;  4NXN O;  3ZBH A;  4JTA B;  1IXM A;  1R3I C;  2X6B A;  1PNL A;  1Y66 A;  4Z2W A;  3KCY A;  2IJH A;  1SZX A;  3FX7 A;  1N34 B;  4YY3 O;  4UFZ A;  5LMU B;  1HWY A;  5BR8 O;  2LW7 A;  3D36 C;  4JI0 O;  3K5L A;  2M7W A;  3VQY A;  1V55 C;  2UUC B;  2W6I G;  2DYS C;  1UJW B;  3OEH G;  4H37 A;  1XNR O;  1J95 A;  2QSA A;  4PA6 A;  4ZHQ B;  2HJF C;  3ZHQ A;  1VF5 B;  4R8C A;  5B1B C;  4DV3 B;  3U10 A;  2Y69 B;  4KFM A;  1VF6 C;  5KHG A;  3QF7 A;  4YJ3 A;  2VS0 A;  5IY5 C;  3ZMS A;  4JV5 B;  1YIT V;  4O2B A;  5CA0 B;  5CA1 A;  2N74 A;  3JD4 A;  4AI8 A;  1F23 A;  4XDL A;  3SDL A;  1HW7 A;  2CGO A;  1ARO P;  2A9H A;  1N36 B;  1XBL A;  5IYZ B;  4DK0 A;  5J9P C;  4GX1 A;  1ROP A;  4YJ2 B;  3ZED A;  3K08 A;  3JAS B;  4K3A A;  4UVC A;  2OTJ V;  4LFB O;  1F51 A;  1GKF A;  4LF4 O;  5KLV H;  4U3J B;  2DN9 A;  4OGQ B;  1S0V A;  1Q6H A;  2Y4T A;  4JI6 B;  2VWJ A;  2CTQ A;  4DV4 O;  1Z5W A;  4GKJ O;  2YXY A;  2JEU A;  1FFX A;  4J42 A;  5TIS Z;  5K1X A;  1Q5O A;  1VQ5 V;  3O9O A;  4GT1 A;  1WAZ A;  4Z1V A;  2R9R B;  3K06 A;  1H2K A;  2ZCE A;  1DGS A;  3F5W C;  4I0X A;  1PNM A;  1GRJ A;  2YEV B;  2VQE B;  4RO2 A;  3F7V C;  5KUK A;  4TQF A;  2V4D A;  3BCC H;  1I7F A;  3D3Q A;  3AG4 B;  3GWO A;  1JX9 A;  1E1Q G;  2UXN A;  4DR3 B;  1B3Q A;  2Q5Z A;  4TUY A;  3VBB A;  1JA8 A;  4MVS A;  2P7T C;  4KXR A;  2ZE8 A;  2HKO A;  4LF6 O;  4JI3 B;  1COW G;  4JAV A;  2IJI A;  3A0R A;  3CX5 F;  2QKC A;  4GCZ A;  1YJW V;  3E2E A;  4QGP A;  1XL6 A;  4RUF A;  3ABK B;  4FLU A;  5FL7 G;  4LH7 A;  2EIL C;  3ASN C;  2KG7 A;  4NVP A;  4QPJ A;  4JTD B;  1YSC A;  2ZQM A;  3S3X A;  4GUN A;  3T4Z A;  5C93 A;  4O2B B;  4DR2 O;  5CA1 B;  4HBN A;  2Q69 A;  3THO A;  4DXW A;  3EHB B;  1KP3 A;  3JAL A;  2JGU A;  5LBQ A;  1NH2 D;  4MW3 A;  3E89 A;  4FPP A;  1D5A A;  1IBK O;  5LGT A;  1B06 A;  2EX3 A;  3ICX A;  3WB1 A;  4WFF A;  4B7K A;  4LF5 B;  4X88 A;  1GM7 A;  4HAM A;  4XDJ A;  4FM1 A;  3A0B Z;  1TAE A;  4OX9 B;  4K0K B;  3H9V A;  4C7U A;  1N4C A;  1IBL B;  1KYO F;  4BAY A;  3E8G A;  4UUJ C;  3X2Q C;  3DC5 A;  2E5L O;  3H1K H;  4CC6 A;  1VQ6 V;  4X1I A;  1SQB H;  4JYA B;  1DF4 A;  1XIL A;  2WLN A;  3HB3 B;  2A3Q A;  1TVK A;  4X62 O;  1B04 A;  2ARH A;  4PA3 A;  2QWN B;  1SZT A;  2W0X A;  3CS5 A;  1I5X A;  3ZCC A;  1YJN V;  4I0X B;  5C8Y A;  5LMN B;  4UCS A;  1AP5 A;  3R66 A;  4FJC C;  1CPY A;  5IYC O;  2LFR A;  4JI2 B;  2Q0A A;  3ZX6 A;  3UM7 A;  3CCM V;  5KAF Z;  1IBM O;  4DRX A;  2IJK A;  1UPG A;  5CBG A;  3I55 V;  3A2F A;  2XHB A;  1S76 D;  2Q73 A;  4QE9 A;  2HP8 A;  3JYC A;  2V1D A;  1QU7 A;  3N2K A;  1QLN A;  2RJZ A;  3CCJ V;  2Y69 C;  2DWE C;  2PYJ A;  4B3T O;  2PY5 A;  1SC5 B;  3K58 A;  4L87 A;  1HNW B;  3K57 A;  3U0Z A;  3CC4 V;  2GBO A;  4XBF A;  4FLY A;  1KU9 A;  1RPO A;  3C3T A;  1H8H G;  5LHI A;  2WWW A;  2CGN A;  1HR0 O;  1ENV A;  3CME V;  1U96 A;  4FLT A;  3G67 A;  1S5H C;  3QG5 A;  1XQ8 A;  3AG2 B;  3APQ A;  4P30 A;  2KG7 B;  3H1I H;  3B40 A;  3M99 B;  5J2U A;  4JAA A;  1VIB A;  4JAU A;  2DQ0 A;  3CJH A;  3D3I A;  3JAL B;  2A7W A;  2EIN B;  4K8Z A;  3P3N A;  4UCO A;  4X64 B;  2E75 B;  2PF4 E;  3JSN A;  1GN4 A;  3BVO A;  2P5O A;  4FMT A;  1QNM A;  5JVD B;  1RSO A;  4DV1 O;  2AZ0 A;  1MA1 A;  4PV1 B;  5GW7 A;  1YZB A;  4EB6 A;  3BHP A;  4JI1 O;  4PEL A;  4FK5 C;  2H94 A;  2ZIN A;  4O4I A;  1VQ9 V;  1LNQ A;  3HKD B;  4KHP O;  5H9C A;  1Y6X A;  3WB2 A;  2WLJ A;  5ITZ A;  4DR7 B;  4DV7 B;  4LP8 A;  4X1I B;  4NYK A;  1TVK B;  2UUB O;  2JEX A;  1YF2 A;  1F4M A;  1FJG B;  3AG4 C;  2YI8 A;  2YIB D;  3BPZ A;  4CS2 A;  4EKW A;  4BR6 A;  1NKD A;  5KUM A;  5KHH A;  3ZMT A;  1OCR B;  1P4R A;  3ZJZ A;  5IJ0 A;  1S3J A;  3RT3 C;  5D5Q A;  3E8B A;  2XAG A;  3EXA A;  1WA8 A;  2Q6A A;  4CH4 A;  2IBZ H;  1NH2 B;  4DR4 O;  5IE9 A;  2CUG A;  5B1O A;  1TUB A;  4DRX B;  3CCQ V;  5B66 Z;  4WBN A;  4GKK O;  2GDS A;  4UCU A;  2HEP A;  1KMI Z;  4ASU G;  3N2K B;  5EBL C;  3BRC A;  3ABK C;  4JGS A;  2F4V O;  3IAY A;  2Z5U A;  2DE0 X;  1R1B A;  2C2A A;  1S77 D;  4O4L A;  1NR1 A;  4FFB A;  3OTF A;  4F4L A;  3JAR A;  1PL0 A;  5B5E Z;  1WNS A;  4MSW C;  1QVF U;  3HPL C;  3W7X A;  4X66 B;  3GB7 C;  1JQ0 A;  1AJP A;  1VQM V;  2QTS A;  1GN3 A;  3JD1 A;  5FPO A;  2P22 C;  2LFS A;  2YIB A;  2K1E A;  5BMV A;  3CJH B;  4RQF A;  4X65 O;  5JJN B;  3ZS8 C;  3BAB A;  4QPK A;  2HJD A;  4QJF B;  3FB6 C;  1MOF A;  1RSO B;  1NBM G;  2ADQ B;  4FVM A;  5IJ9 A;  3LDE A;  4ZI7 A;  1AIL A;  4EB6 B;  5GON A;  1KEC A;  4DV5 B;  4O2A B;  2B1G A;  3KG2 A;  4O4I B;  1BQ0 A;  4J11 A;  4LFC B;  1PL4 A;  3RN4 A;  2JS3 A;  4PDR A;  5B1N A;  2UUA B;  3JD2 A;  1SQG A;  1K7D A;  3FD9 A;  3K5N A;  1Y4M A;  2KKW A;  3TJT A;  3ABT A;  3L9D A;  3U11 A;  1VF7 A;  1L0N H;  4JYC A;  5IWA B;  2LP7 A;  1Q81 W;  5EC2 C;  4EEQ A;  1QR9 A;  4J7J A;  3OUS A;  1SES A;  2AZ2 A;  3SJQ C;  2LW1 A;  4FLX A;  3ZN1 A;  4DV2 B;  3CRC A;  5EIB C;  3FB8 C;  2H3O A;  4LF9 O;  3IC7 A;  3RYF A;  3CXC U;  2ODM A;  1WA8 B;  1YDX A;  2E76 B;  4WBN B;  1XNQ B;  3ETQ A;  1H8E G;  3Q4H A;  1XMO O;  3AG2 C;  1I94 O;  3HKB B;  4DUZ B;  4DW1 A;  2LQT A;  4O4L B;  4FFB B;  2P90 A;  2P67 A;  4RWU A;  4PA9 A;  4YY3 B;  4FLV A;  1NI8 A;  3JAR B;  2WLK A;  1NR7 A;  3GWK C;  2VQF O;  2EIN C;  1LUW A;  1KUQ A;  3B8N A;  3ZMV A;  1XOU A;  3L73 H;  2JK5 C;  2FKX A;  1SQQ H;  1N0N A;  1N33 O;  3SPC A;  2RCV A;  3SYP A;  3TXS A;  1AB3 A;  4WFG A;  4F6E A;  3CCR V;  3F5T A;  3DC6 A;  1HNZ O;  2XAQ A;  3ML0 A;  1VQ4 V;  2QWP B;  1OJH A;  2ITC C;  3ZRS A;  5IJ9 B;  4ZI7 B;  4J80 A;  1ZL8 A;  3A0H Z;  4R6Z A;  1FXK A;  2WA4 A;  4P9P A;  5BY1 A;  4TV9 A;  5LP6 A;  1SQV H;  1GN6 A;  3ZHU A;  3K59 A;  3LSS A;  2R72 A;  2X6C A;  5BZB A;  4EFB A;  1QQC A;  4D6T H;  4WCE V;  3E35 A;  1OCR C;  4LF7 O;  4FFK A;  1GK9 A;  4RUE A;  3FAV A;  4LFB B;  4LF4 B;  1MZF A;  1K34 A;  4JZG A;  3HR0 A;  3G80 A;  4HZ3 A;  3E83 A;  2ILM A;  1SET A;  3RVZ A;  5EC1 C;  2YDE A;  4CC5 A;  4J9Z B;  4GKJ B;  1KB9 F;  3P32 A;  3BFR A;  3RYF B;  1BS3 A;  4R50 A;  2W6J G;  4H0L B;  4PA4 A;  1VP7 A;  2JDI G;  2N04 A;  3UO2 A;  1WLE A;  1BSM A;  4LF8 O;  3STL C;  3ZMZ A;  1FS0 G;  4MVR A;  1K33 A;  2QA4 V;  4DUY O;  2BSK A;  1EN6 A;  5LA6 B;  5AG2 A;  2UXB B;  1JJO A;  3W7S A;  1OCO B;  2Q7G A;  2QM8 A;  2F23 A;  2RDC A;  3L71 H;  2YXH A;  2PZS A;  1JJ2 U;  1Q6I A;  1Y67 A;  2AW9 A;  1N8R W;  1ZSP A;  2NR5 A;  1P84 F;  1A32 A;  2BE3 A;  4DV6 B;  3SJB C;  4TWK A;  1J5E B;  3CE2 A;  1M5I A;  4PDL A;  2Y0I A;  3TET A;  1SQX H;  4PI0 A;  2JJ1 G;  3CRR A;  2ZKO A;  4O4J A;  2HR3 A;  1D2D A;  1S5J A;  2ZD9 A;  4K35 A;  4E2L A;  2Q7E A;  5IT9 N;  4DR2 B;  5L3B A;  3ZHS A;  4JI7 O;  1ZL8 B;  4J9Y B;  2UXX A;  3RWR D;  4JI5 B;  1Q86 W;  1MAB G;  1K8A W;  2ZNI A;  4TV9 B;  4ICG A;  2QR4 A;  1F4N A;  2HVK C;  1MMM A;  2FTK A;  4ZIB A;  3W7W A;  1DK1 A;  1N34 O;  2UXC B;  5LMU O;  2JRI A;  2JIZ G;  1ZUQ A;  1AR4 A;  3IFX A;  1VAR A;  3K04 A;  2CH7 B;  4ZOL A;  3CRQ A;  4TQD A;  2CDY A;  4B08 A;  2D2C B;  2QEX V;  4MTF A;  3ABL B;  4WFA V;  2WLI A;  3OAA G;  4AQY O;  3APO A;  2OIG A;  1PKX A;  3NXS A;  4X89 A;  3JAW A;  1CEZ A;  3VQW A;  4JYB A;  5LL6 Y;  4UVA A;  4CH6 A;  1VQ8 V;  5LGU A;  4JV5 O;  4GX5 A;  4O4H A;  4P2Z A;  4B3M B;  4X62 B;  4H13 B;  4TSF G;  4J41 A;  1Q43 A;  4FLW A;  1N36 O;  1W0J G;  1SQP H;  4Q6G A;  1M1K W;  4YJ3 B;  1I0H A;  3L70 H;  4K8X A;  1VQP V;  3J81 N;  3K5O A;  2L6L A;  3EFF K;  2BSK B;  1O9G A;  4DW0 A;  3M8A A;  1X4T A;  2Q67 A;  3K9A A;  1SA0 A;  1R73 A;  4WFB V;  4X1K A;  5FNV A;  2DWD C;  1Y76 A;  1GM8 A;  1WJZ A;  1TUE B;  3LDC A;  4JI6 O;  5A9G A;  1HNX B;  2QM7 A;  1FKA O;  3WG7 C;  1EZJ A;  2WLH A;  4B3T B;  3B8M A;  2A06 H;  2ZT9 B;  3OR6 C;  1N32 B;  5A2Q N;  1G6U A;  2VQE O;  4O4J B;  4B3S B;  2Q68 A;  5KMG A;  4LFA B;  2CK3 G;  4YHH B;  3A8T A;  4RAI A;  4DR5 B;  5E79 Z;  3T4D A;  3HKE A;  5HFM A;  1FFX B;  2RQ6 A;  4ZBM A;  3MHH C;  4TOI A;  1TGO A;  3ABM B;  4UB8 Z;  2RN9 A;  1WB7 A;  4DR3 O;  1XEQ A;  2XT9 A;  1YIJ V;  1R6N A;  4GX0 A;  1BHA A;  2DYR C;  4ZOL B;  4DV1 B;  4DR6 O;  3D8C A;  3OR7 C;  3SYA A;  3RYC A;  5LGN A;  1M9N A;  3SJA C;  4JI3 O;  3HKC A;  2P06 A;  3BY6 A;  2DW4 A;  3JAW B;  4FLZ A;  2YID A;  4IL6 Z;  3AG1 B;  4TUY B;  3JCU Z;  2F93 B;  4MVZ A;  4GZR B;  3AG7 A;  2NN4 A;  3OFN G;  3N2G A;  4DR1 B;  1GO3 F;  3FYE B;  2YI9 A;  1YVW A;  3D36 A;  2XAF A;  1H2G A;  5GTI Z;  1OCO C;  3CXH F;  5IYB O;  2AHZ A;  2AXT Z;  5LOV A;  5E1A C;  3RBZ A;  5IDJ A;  1JCH A;  2F1M A;  4OX9 O;  1JFF A;  4CS3 A;  1YEW A;  5KHJ A;  3DSQ A;  4X1K B;  5FNV B;  3KKY A;  1O9H A;  1Y76 B;  3QO8 A;  3E22 A;  4YIP A;  1DF5 A;  4D7S A;  1FYJ A;  1WPX A;  2EZO A;  4JYA O;  1L0L H;  2ATK C;  3TK1 A;  4IGG A;  2B5U A;  3IGA C;  4B3R O;  1M4U A;  1FXH A;  5KHK A;  3KCX A;  2LO1 A;  1U97 A;  4TT3 G;  1KC8 W;  4IIJ A;  1BL8 A;  4I55 A;  4JI2 O;  2PYL A;  1KP2 A;  4AIL C;  2YSU B;  1M57 B;  4F6R A;  3ABL C;  3K79 A;  1NJI W;  1OCC C;  1AJN A;  3CCS V;  1EN4 A;  3CYO A;  5EYP A;  5C8Y B;  1FFT B;  1XHZ A;  1KKD A;  4JI8 O;  4OPA A;  3RYC B;  1K5Q A;  1BZK A;  1EFR G;  2D3O W;  1ZAU A;  2KB1 A;  3RFR A;  4I4T A;  2ZM6 B;  3E8F A;  1R3K C;  2WLL A;  3L75 H;  2GV9 A;  2N05 A;  4UCV A;  4I7Z B;  3MDS A;  1Q6U A;  4BIZ A;  2E3C A;  4U3F H;  4JF3 A;  3ASO B;  2F43 G;  1SRY A;  5J2T A;  2KQX A;  3SYC A;  2E74 B;  3ZHV A;  5KA5 A;  4P9O A;  2Q7H A;  1YI2 V;  2UXD B;  4X64 O;  4ZKI A;  2HFE C;  3TGU H;  4IT5 A;  1SS3 A;  1DTO A;  1OCZ B;  3JSL A;  1G4Y B;  5LOV B;  2ADP A;  1SF9 A;  3ZRX A;  3P30 A;  3MAQ A;  2CE4 A;  5J2U B;  1Q3E A;  1LR1 A;  3G4S V;  2K9P A;  1JFF B;  3CRM A;  4DV0 B;  3FKS G;  3C90 A;  4RQE A;  2ETN A;  2GSM B;  1JPX A;  3ETE A;  4DR7 O;  3CP1 A;  5B1A B;  4I9Q A;  1XMO B;  4DV7 O;  1IXB A;  1H2M A;  3JAM N;  1QLE B;  3QO7 A;  4CH5 A;  1BE3 H;  3PJS K;  4IYI A;  2GUZ A;  1AP6 A;  3CSX A;  1M93 A;  4TV8 A;  4J7K A;  2ZDI A;  1WP7 A;  3IJ4 A;  3ABM C;  4QNH B;  5ITZ B;  2X7R B;  2ZE5 A;  2NNU A;  2EBO A;  4N21 A;  2QJ1 A;  4IIJ B;  5KAI Z;  2UU9 B;  1N33 B;  4I55 B;  4BWA A;  1MNG A;  3C3S A;  5JCO A;  3BEH A;  4F6R B;  5LYJ A;  5LHH A;  1CXZ B;  2QE7 G;  3OEE G;  5KX5 A;  1AVM A;  2AGA A;  2ZE6 A;  3AG1 C;  3T1Y B;  4LC1 A;  5IJ0 B;  3WFV A;  4I4T B;  3UCS C;  2WLL B;  1AI4 A;  1IUR A;  1PV0 A;  1TUB B;  2P4V A;  3L72 H;  2QKS A;  2BOB C;  3W7U A;  4X66 O;  4X8A A;  4A5U B;  1K3E A;  1BCC H;  1K5S A;  5J2T B;  5CBF A;  1P49 A;  2DJV A;  4NXN B;  3ABU A;  4PA7 A;  3W7T A;  2QDO A;  3AG3 B;  3N27 A;  3CPW U;  4LH6 A;  4J7Z A;  3OT7 A;  3OTO O;  3OD4 A;  5BR8 B;  3CWB H;  1NTZ H;  2WPD G;  5EK0 A;  1XDC A;  4KL1 A;  3ZHT A;  3SGI A;  4JI0 B;  3K5M A;  3M7M X;  4JYY A;  5JQG A;  4LCU C;  1Q8I A;  1XMQ O;  1XNR B;  1DLB A;  3OMN B;  5BMV B;  5JH7 A;  2W0F C;  5GTH Z;  2IJJ A;  3JAT A;  4LFC O;  5IYZ A;  2A0L A;  3WG7 B;  2HHH O;  2UUA O;  5LXT A;  2ITD C;  1BQZ A;  2CAZ C;  1GN2 A;  1JMK C;  3FB5 C;  1BHB A;  4X20 A;  4HNA A; 
#chains in the Genus database with same CATH homology
 3Q4H A;  2AZ0 A;  3GVM A;  2KG7 B;  2DE0 X;  2AZ2 A;  4ABM A;  4I0X B;  3TXQ A;  1WA8 A;  4LWS B;  3HR0 A;  2VS0 A;  3G80 A;  3TXS A;  4GZR B;  3FD9 A;  3OGI B;  3FAV B;  3Q4H B;  3O9O A;  1WA8 B;  3GWK C;  2KG7 A;  4I0X A;  3ZBH A;  4LWS A;  2B9Z A;  2VRZ A;  3FAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...