2KG7B

Structure and features of the complex formed by the tuberculosis virulence factors rv0287 and rv0288
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
SMSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein esxG (PE family protein)
publication title Solution structure of the M. tuberculosis EsxG-EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 23
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2kg7B00
1WA8A 3Q4HB 4I0XA 3TXSA 4ABMA 2VS0A 4LWSA 1WA8B 2DE0X 3FD9A 2AZ2A 3G80A 2VRZA 4I0XB 2KG7A 3OGIB 3FAVA 4LWSB 3ZBHA 3HR0A 3GVMA 3Q4HA 2KG7B 2B9ZA 3O9OA 3TXQA 2AZ0A 3FAVB 4GZRB 3GWKC
chains in the Genus database with same CATH superfamily
3CMEV 5IWAB 4B3MO 2RN9A 2ZNIA 2KSDA 1VIBA 4X62B 1FPOA 1WN7A 1SQGA 1HNXO 3EVKA 2JS3A 3A0BZ 4YXWG 4FVMA 3OR6C 4HNAB 1Q3EA 1VQNV 2V7QG 1I0HA 5EBMC 5LHIA 3JASB 5LP6B 1N34B 2UUAO 2YUAA 3RWRD 3K3WA 2AXTZ 5J2TB 3D36A 2HVJC 1TGOA 4JI7B 3UO2A 1M57C 1WPXA 4GCZA 2YEVB 4LF5B 2PYJA 5CB4A 5IWAO 4MW8A 2LW7A 1MG1A 3F5TA 2HFEC 2O57A 3W7TA 5IYCO 4X62O 1K4CC 2CH7B 4GX1A 3QF7A 4FMTA 2OTLV 4UCVA 5LL6Y 2WA3A 5IYZA 1SKVA 2QKCA 2R9IA 3B40A 3OUSA 2A79B 5CA1B 1BSMA 4I7ZB 4MW3A 5IJ0B 3W7WA 2EULA 2UXCB 5IYBO 2KQXA 1XNRB 2JS5A 4CS3A 5KX5B 1D2DA 1S5LZ 1BGYH 5EBWC 1TVKB 2B5UA 4JI0B 1AI4A 3WB2A 2QM4A 2ZE5A 3ASNC 3K9AA 1AILA 1ZUQA 3CC7V 1K73W 4JTAB 1KMIZ 3RVZA 1H2SB 3WG7B 2Y0PA 5GTIZ 1PNMA 1MNGA 4FM1A 2LFRA 5AG2A 2UXCO 2ZXWB 4LNUA 3HKBB 2Q7GA 2Q0AA 4I4TB 5IE9A 3E8BA 2OTJV 4PA6A 5HFMA 2V1DA 4RO2A 4B7EA 3K0DA 4KHPB 2PTMA 4NTXA 4H0LB 3P3PA 2H94A 3K79A 3VBBA 5DEDA 4DV0B 1NQTA 1KBHA 1YTFB 4FZ0A 4DR6O 4XBFA 4DW0A 3H1JH 1PKXA 3RYCB 2MK3A 2X6AA 1ROPA 3JAWA 4FFKA 3OW2U 1NR1A 1M5IA 4O4LB 4FFBB 2RDCA 3S3XA 3KCXA 1MSWD 5ITZA 1AP5A 1QU7A 2ZIOA 3E2EA 5B1NA 2QTOA 4QE7A 4QPJA 1B3QA 5EC2C 3LSSA 4CH6A 4KHPO 2KG7A 1OCOB 2IH1C 5IJ9B 2FL4A 1GH6A 5BR8B 2ZINA 1X4TA 2FB5A 1KQSU 4XDKA 1NBMG 1Y76A 2DWDC 4FPPA 3ZHUA 3LDDA 2JEUA 1JOYA 5CBHA 2UXBB 4TUYB 2XAJA 2VWKA 4PI2A 4KP4A 2ZD9A 4GX5A 3STLC 2NR5A 2QKSA 3OTFA 4JPRA 1VQ5V 1QNMA 4FK5C 5LHGA 3CXHF 3W7XA 3WU2Z 2YXLA 4P9OA 1JFFB 5IY5C 4AI8A 3K04A 2Q8VA 5CMUA 3CJHA 2ZNJA 1GAXA 5BR8O 1VMGA 4X66O 2QKAA 1DGSA 2ZDIC 3ZHQA 2UXDB 2A9HA 4AILC 5LOVB 1G8MA 1FKAO 4JAAA 4B08A 2WLIB 3M99B 4JZGA 2P90A 3JALA 2X7RB 5JH7A 2ILMA 4HYOA 5KLVH 2VQEB 3HKEA 4O2BB 1VF6A 2N74A 2BSKB 3OD4A 4OPHA 1WNSA 5EK0A 2ITCC 4TQDA 1WA8B 1MZFA 2LQTA 2GTAA 1N32B 4UCUA 3BPZA 5L3DA 5B3SC 2UUCB 3JCZA 1N0NA 3Q4HA 4JV5B 1VQ8V 1OV9A 5BY1A 3SGIA 2QGNA 2DYRB 5LHHA 2UXDO 2JIZG 3AG4C 3FKSG 4X8AA 4E2LA 3RFRA 5EIBD 2QWRB 5JVDB 3X2QC 4DV1O 1N0JA 1PNKA 3A0RA 3FAVA 1YJWV 1R73A 1SERA 2LW1A 4TV8B 3HKCB 1N32O 1L0NH 2F43G 4LCUC 3K5MA 2ETNA 4X20A 2UUCO 3SJAC 1YXBA 2IU3A 3UT5B 4JYBA 4Z1VA 1M56B 3K08A 3SJQC 3SYOA 4JV5O 3ICXA 2HG5C 5IT9N 4MTOA 4GKKB 3E35A 4BIZA 4DUYB 2Z0AA 1R6NA 1P49A 1HNZB 2ZR3A 3N2GA 1QLNA 1PPJH 5GONB 4J9ZB 2L6LA 4IIJB 1QVFU 1SA0B 4OXSA 1LUVA 3JATB 2WLNA 1XUQA 3JAMN 3BY6A 1RPRA 2MW2B 2YI8A 2Y69B 2IW5A 3ZRXA 1W2BU 1N36B 2P7TC 3HR0A 4MS2A 5FLXN 3R65A 4H33A 4O4HB 4OPAA 1IBMO 1N33B 2QJ1A 2F93B 2IJJA 3DSQA 1EM1A 5DN6G 4AHCA 4Q20A 4JASA 5BZBA 4I0XA 2GUZB 2RCVA 3CCMV 3C3SA 2WLLB 5IY5B 1QR9A 3IC9A 4TQFA 2DE0X 1HNZO 1NVPD 1PNLA 4PDLA 3M7MX 1SZXA 1SQFA 2E74B 4DUZO 1F4NA 4MSWC 3SYPA 5JQGB 5B1BB 3I5DA 3CYOA 4G28B 1YDXA 3CP1A 1YF2A 1N36O 4U7NA 1AR4A 4WBNB 1L8DA 2HVKC 1N33O 3ABLB 4X1KA 3AK1A 4R8CA 4X1YB 3RYFB 3EXAA 2BOCC 1XL4A 3CCEV 1NKDA 1AJNA 2ODMA 3SPJA 1MSDA 4JF3A 1NH2D 1HP8A 1U96A 3W7SA 3G80A 2EIJB 1AVMA 1ZTEA 1QLEB 1NT2B 3L70H 1K3EA 1D5NA 3DTUB 4U3FH 4B7KA 1NTMH 3UKMA 4KL1A 1PV0A 4IGGA 3U0ZA 1ENVA 2OYQA 4ZOLA 5JCOA 2B1IA 3VQXA 2DMXA 2OIEA 4LF6O 5B66Z 4CC5A 3WB0A 4LH6A 1S0VA 1V9PA 5LP6C 3CCSV 5CBGA 5KHIA 2QTSA 3T4ZA 4F4LA 1XOUA 4LF7B 4WFHA 5CB4B 2AZ0A 4H37A 5KUKA 3JSLA 4P30A 5C8YA 3E86A 1B6QA 2XT9A 3HKDA 4J9YB 2OT5A 2N05A 1RFYA 1TA8A 5CA3A 1F7YA 4JI3B 3G71V 2QWPB 3CRQA 5L3GA 2PYLA 5GW7A 3ZN1A 5IYZB 5BXZA 3J80N 4LF9B 1BCCH 1IURA 4MVQA 4LF7O 1DLBA 4IYIA 2VQFB 4CH5A 1VQLV 2ZCEA 2EILB 5KAIZ 3RN4A 3CX5F 4ICGA 3ZRVA 5C93A 3JYCA 3P3NA 1ZAUA 4JI3O 1BQZA 1Q82W 1AR1B 3WG7C 3ZEDA 4UCSA 2Q6AA 4O4JA 3OEEG 3AG3B 4LP8A 4DV4O 1RPOA 5K1XA 1YITV 1ZL8B 1KD1W 3SYQA 1TAEA 3G67A 1Q5OA 3B8NA 4I9WA 4IHJA 1XBLA 1YCIA 4LFCB 4DV7B 1FS0G 2ARHA 2A3QA 4CC6A 1KKCA 1MZEA 1R6KA 1SQPH 1M9NA 2IJHA 1MOFA 1OHHG 3SJCC 3BEHA 3CS5A 4ZHQA 3RGBA 1DTOA 4MVMA 3VOUA 2CE4A 4O2AB 1KU9A 3RVYA 5D5PA 1JJ2U 3JAWB 4RWUA 4TT3G 3RYIB 5JWPA 3ABMC 2F95B 4PELA 1S77D 5ITZB 3JARA 5LBQA 5CN0A 3B8MA 2UXXA 4DV7O 2K9PA 3OMIB 1XEQA 1NS1A 4EB6A 2IJIA 4DR7B 2KKWA 2KG7B 1E1RG 1OCCB 3CSXA 1O9HA 3IGAC 4YY3B 4LF8B 1OCOC 4ZKIA 1W0JG 2P4KA 3AG2B 2WLHA 1Q6HA 3OAAG 2M6YA 1QQCA 1Y67A 2ZM6B 2X6CA 3CRCA 5A2QN 4H44B 2FMLA 2EX3A 1IXMA 1FXKA 1H2LA 5HFLA 4NVPA 4YIPA 3D3IA 4FJCC 3E8HA 4FIPC 4PDVA 4DR7O 3CJHB 4DV5B 2LP7A 1JA8A 2EJRA 1N34O 3G4SV 4YY3O 3QO7A 4LF8O 1Q43A 1M90W 3KG2A 1S5HC 4JI7O 1FFXB 2ZM6O 2W0FC 3K06A 3JALB 4LF5O 3QVNA 4D7TA 4J10A 1FJGB 4NB5A 1MMMA 4K35A 5L3FA 2CTPA 3LSUA 4RUFA 4PA3A 2Q68A 4NXNB 2AHYA 2GV9A 4GX2A 2Z3YA 3BRCA 1AI6A 3CPWU 3LSQA 3TXQA 4FLXA 4DV5O 2E76B 5LMUB 3Q4HB 2A7WA 4ABMA 2YXYA 1SS3A 2Q9LA 3LDCA 2K1EA 4LFAB 1EN6A 1Q6UA 2DYRC 5IDJA 1XNRO 1SZTA 1GM7A 5LGNA 4Z1MG 2JGDA 5FPRA 1VQKV 3T1HB 4LC1A 2CAZC 3ZRWA 4FM0A 3FAVB 4JI0O 3MD0A 1O9GA 1I08A 3O65A 3S3WA 4NXNO 3DC6A 3ZMSA 3JD3A 1P7GA 1G6UA 2R70A 3G6BA 4YJ3A 4YIOA 3K03A 4X20B 5LMUO 1Q90D 3ABMB 3DC5A 1E1QG 4MVZA 1Y4MA 4PDMA 3PJSK 2JEXA 1HR0B 3E89A 1M56C 1Q81W 2CTQA 5H6RA 4LFAO 1OCZB 3N2KA 1F23A 1KP2A 3T1HO 3N2GB 4JTDB 4UVCA 2WSSG 3OTOB 2B1GA 2DWEC 1VARA 3VQYA 3E8GA 1GK9A 4X65B 3L75H 4DV0O 1XMOB 3O9OA 4TV9A 5LA6A 2Y4UA 5H5NA 4QGPA 5LXTA 2Y69C 3SJBC 2A0LA 3TK1A 4O4IA 1GRJA 5FNVB 4BR6A 1HR0O 2Q4PA 1VQOV 3OT7A 2YI9A 2DQ3A 1UJWB 3IFXA 3K5NA 1CPYA 4DRXA 3GWKC 3L74H 3OTOO 3CCVV 1TUBA 2ZR2A 2RQ6A 3E83A 5EBLC 4FLWA 4QNHB 2EIKB 2EBOA 4X65O 4CS4A 4H13B 2E5LB 1K34A 1XMOO 5BMVA 2CH7A 1M93A 5B1BC 4EKWA 4WCEV 1V55B 1NVPB 4RAIA 3ETEA 2YIBD 2UXBO 3ZN0A 4X1KB 1OCRC 1XMQB 3RBZA 3BA8A 1TUEB 3ABLC 3J7AU 5LYJA 3LNNA 1BS3A 4OGQB 2WLKA 1ORQC 1FD9A 1Z5VA 1R3LC 3ZHVA 2YIBA 1NTKH 2QWOB 2DQ0A 2EIJC 4QE9A 1QLEC 5LMNB 3FYEB 2E5LO 1TVKA 2P4VA 4DR4B 3JCUZ 5KMGA 1HW7A 3ZRSA 4EFBA 3UCSC 2LFSA 2QE7G 1K7DA 4ZOLB 1LR1A 1XMQO 1Y66A 5EZYA 4I9QA 3SPIA 2VQEO 3MDSA 2LGQA 4L8JA 3ZBHA 4LBEC 2LGWA 4ZIBA 4ASUG 4IT5A 1UPGA 3SYAA 3ZJZA 3D36C 1S3JA 2JRIA 3H1HH 4LF4B 5LMNO 4FLTA 2G38A 1YTFD 5C8YB 2OIGA 4DR4O 3ZMUA 2Y0IA 1GN2A 3RYHA 3HKDB 5LGUA 3E22B 4U3JB 1R3IC 3AK3A 1S5JA 2W6IG 1K92A 1UFIA 3AEIA 4FLYA 4X64B 3FB7C 2P5OA 1XL6A 2PGGA 3L73H 3RYCA 2GBOA 1JCHA 3OM3B 1F4MA 3FD9A 4JGSA 2Q0OC 1US6A 4BW5A 4LH7A 3MHHC 2DOSA 4UB6Z 3F7VC 3FB6C 1KKDA 3CRAA 4GKKO 4MTGA 2EILC 1VQ4V 4A5UB 4DUYO 2ZKOA 2CK3G 1M4UA 2ZQMA 3SPHA 1K8AW 2PI4A 1XNQB 4X64O 3QO8A 1VQ9V 2GTSA 2OWOA 1RM1B 1MA1A 2WLJA 3UM7A 3AK2A 2XTAA 2JJ1G 3A0HZ 4NTYA 4XDJA 4MVOA 2CTWA 4B3SB 3AG3C 1Y74B 1L1FA 1OCRB 3CD6V 4NXMB 4UVAA 1P7BA 1H8EG 4ZI7B 4XDLA 4UFZA 4F6EA 4JI8B 3GB7C 2R9RB 4R7CA 1YSCA 2GDSA 3JD0A 1NR7A 2QWNB 2CGNA 3AG1B 3IAYA 1PL4A 4JYCA 4ZHQB 1R3KC 1XNQO 4I55B 1GMGA 2WLIA 3CRMA 4DK0A 2AW9A 2GSMB 3CC4V 2QEXV 5B5EZ 4UXNA 4B3SO 1WB8A 1SQBH 3JARB 4NXMO 3THOA 3OMNB 2HHHB 3BCCH 1QR8A 4CZZA 1EN4A 1JJOA 2EZPA 4JI8O 3TCUA 2YIDA 4EB6B 2ZE7A 5GTHZ 4JI6B 4G27B 4X88A 1AR5A 1OCCC 3ETDA 2AGAA 2PY5A 4JYYA 3CB2A 1K5QA 3AG2C 3FB8C 1CP9A 3U11A 2YXHA 1BQ0A 1FXKB 2A06H 4D7SA 1HDJA 4E4EA 3ZHRA 1IBLB 2UU9B 3OGIB 4EFEA 2BTQA 1AJPA 1CEZA 3BA9A 3I55V 4CS2A 4YJ2A 1L0LH 4WFEA 2C2AA 5F2VO 2WLMA 1X59A 2E3CA 5DECA 4WF9V 3UQ8A 5LGTA 2VWJA 1RP3B 4IIJA 3LDEA 1SA0A 3SYCA 1JQ0A 3APQA 4UV8A 2Y4TA 2BCCH 4ZBMA 1VF6C 1IBLO 3E8FA 2UU9O 2FYUH 1AI5A 4PI0A 1OJHA 1QHTA 2CDYA 1YI2V 1GM8A 2EJ7A 4FLZA 1LUWA 5KA5A 4K0KB 2ZT9B 5K1PA 4LF9O 2GUZA 4JAUA 1AROP 2RJZA 4LNUB 2VQFO 4Z2WA 1S72V 2YSUB 2JGDB 3CMAV 3BFRA 3OUFA 1COWG 5B1OA 1BZKA 1Q8IA 3ZRWB 2VS0A 4LFBB 4LWSA 5D5QA 3W7UA 1FXHA 2D2CB 1I5YA 4X9QA 3CCLV 4JTCB 5JQGA 2ZDIA 2E75B 2WPDG 4UB8Z 4YJ3B 5J9PC 1NI8A 1NU1H 3JD1A 5EC1C 4K8ZA 4X1IA 1URFA 1JR9A 1IVSA 2PZSA 2EINB 2Y48A 4FLVA 4K0KO 5EIBC 3DXRA 1GN4A 2BTOA 2DW4A 1SRYA 5H9CA 3M8AA 4JI2B 2JDIG 3CHXA 4FM2A 3N2KB 3GWOA 3B4SA 2W6JG 3JAKA 3B77A 4LFCO 1OCZC 4R50A 4W4KA 4PD4F 3T4DA 4JI5B 4LFBO 4F6RA 4MT8A 3J81N 1XILA 1YJNV 4RUEA 4KFMA 1H2MA 5CA0A 4UUJC 1VQMV 2WA4A 2EIMB 3ASOC 5E79Z 5JJNB 2X6BA 4TV9B 5LA6B 1VEWA 1Y76B 1VQ7V 1Q7YW 4CH4A 5LXTB 3OGCC 1SQXH 2HLDG 4O4IB 2LJ2A 5KHKA 4CBCA 2QA4V 3CCUV 4PDRA 4WFAV 2Q67A 4QJFB 4JI2O 4FZ1A 3LNMB 1DF4A 1AP6A 1SETA 3N27A 5B1AB 4DRXB 4JI5O 1TUBB 1IZ3A 2IU0A 5J2UA 3D3QA 1E79G 1YJ9V 4I50A 4L87A 2YIAA 2JVDA 5BMVB 4PA7A 2EIKC 1RSOA 1JVMA 1MABG 3ABTA 1KECA 1K33A 2OCCB 4K8XA 5JH7B 1V55C 3K9SA 4BIUA 4J7KA 3K5OA 1YVWA 1BT8A 1YIJV 4DK1A 5LYJB 3HKEB 1SC5B 5E1AC 1H38A 3PN1A 4MTFA 1HWYA 1EFRG 3CCQV 2N04A 4IYHA 4WFBV 1VF7A 4J7ZA 5KMGB 1WAZA 1F51A 2YC0A 3HB3B 4JZ2A 4PA4A 2V4DA 1KB9F 1Y6XA 4GUNA 3ABUA 3NXSA 2WWWA 1FJGO 5JCOC 2XASA 5EZYB 2HJFC 3CRRA 3VQVA 2GHYA 3EHBB 4DR6B 4LR3A 4NKGB 2XAFA 2H3OA 1PP9H 2QDOA 3TJTA 1ZL8A 1VQPV 5A9GA 3H1LH 4NR1A 4UCOA 3WFVA 1WB7A 4J80A 1GN3A 4BWAA 5EYPA 2RMKB 1K5SA 3RYHB 1WP7A 3BABA 4MVRA 2RNBA 2CUGA 1AI7A 4DV2B 1WJZA 4O2AA 1GKFA 3CWBH 5H6QA 4GLXA 3ASOB 4EEQA 2PI5A 1VF5B 3RYIA 4TSFG 1AB3A 1ZX3A 1XHZA 4KUMA 3APOA 2BOBC 2P22C 2Q7EA 3K5LA 3K58A 4DV3B 1P84F 4HNAA 1XHXA 3QO5A 4I0XB 3JASA 3KKYA 3ZHSA 5LP6A 4BW9A 1LNQA 3H1KH 1T5EA 4DV2O 4X66B 1M57B 5J2TA 2HR3A 4DR3B 5H2FZ 1FAFA 3P32A 1KYOF 2YEVA 1J5EB 4GYCB 1H2GA 4UCRA 4RQFA 1JMKC 3BAAA 1RM1C 4GX0A 3BVOA 3ZCCA 1JX9A 4JI4B 4DV3O 2ADQB 1OZ0A 2F4VB 4J11A 3STZC 2ZIMA 3NR7A 3UO3A 2XAQA 1SESA 2QWQB 5CA1A 1I5XA 5DM6V 4J7JA 4W4LA 4G2KA 3AG1C 4FLUA 2KB1A 2QM7A 5FPOA 4DR3O 5IJ0A 4HZ3A 1FFXA 1J5EO 3L9DA 4DR2B 1FXVA 2NLJC 4UCTA 5KX5A 3K57A 4CH3A 4DV1B 1NH2B 2IJKA 4BIOA 5L3CA 3H1IH 3ASNB 3OMAB 4JI4O 3FB5C 3B2EE 4WFFA 2F4VO 2HP8A 3SR2C 3ABKC 3TETA 2JK5C 2ADPA 3BHPA 2DYSC 4PA9A 1CXZB 1K4DC 2QSAA 3FFQA 1THZA 2QR4A 3HKBA 4OX9B 1GM9A 4K3AA 4DR2O 4I4TA 1I94B 1V54C 2P67A 2CGOA 3ZMTA 2UUBB 4I5SA 1PD3A 2DJVA 4B3RB 3L72H 1FXKC 2IM9A 5L3EA 1WLEA 1GTOA 5JJJB 2PUSA 4WFGA 2BTQB 2NNUA 1WP8A 2FTKA 4GT1A 2IBZH 2EZOA 1IBMB 3EFFK 4YJ2B 2BE3A 1YZBA 2JGUA 3TGUH 3ZMZA 3L71H 1ZLZA 4O4LA 4JYAB 4FFBA 3MHSC 1SF9A 1DK1A 4OX9O 1WPBA 2L35A 3U10A 3ZX6A 3JD2A 2XUMA 3JD4A 3DGEA 2F1MA 1I94O 4LF4O 3QNEA 4QIWF 2NN4A 4QPKA 2UUBO 2B9ZA 1GN6A 3LUTB 4HAMA 1Z5WA 4DUZB 4B3RO 4DO2A 4DW1A 5IJ9A 2X0LA 5KUMA 3KCYA 1M1KW 2AZ2A 4D6TH 4MVSA 5TISZ 3H01A 2M7WA 1EN5A 1QBZA 2YDEA 1DF5A 1H2NA 1BHAA 2H8PC 3F7YC 4TUYA 2XNDG 1U97A 2ZE8A 4O4JB 5FNVA 3VQWA 3CE2A 3FX7A 4JYAO 3K0GA 4MVUA 2HJDA 2W0XA 2AHZA 3I56V 4IHJB 1IXBA 1JFFA 4YHHB 1KP3A 1PM9A 2HKOA 1ZSPA 3KZIZ 4B3TB 4LWSB 1IBKB 3MAQA 3F5WC 3ETGA 5FL7G 3CEIA 2FKXA 1G4YB 1EZJA 3ML0A 1QCEA 3QG5A 3OFNG 2XOKG 4X1IB 5LOVA 2Q5ZA 4UVBA 2Q7HA 4LF6B 3CCRV 1QVGU 3SPCA 3DXRB 3SDLA 1FFTB 2EINC 4J42A 1BHBA 3A8TA 3G6EV 4DV6B 2D3OW 4O2BA 1N4CA 4BAYA 3A2FA 1W0KG 2BSKA 3ZIAG 1B04A 4X89A 2XAGA 3JAKB 4YHHO 1NZ6A 3ABKB 1WA8A 5B3SB 4RQEA 2DYSB 3QTCA 3RT3C 4B3TO 3IC7A 1IBKO 3OEHG 4F6RB 3T1YB 5CA0B 1VP7A 3AG4B 5KHGA 3OE7G 4PHZA 1SQQH 2EIMC 3ZHTA 2Q73A 1V54B 2YICA 4AQYB 1AJQA 4NYKA 2JJ2G 1P4RA 3R66A 3C90A 3X2QB 2DN9A 5KHHA 3SPGA 3IJ4A 3T2MA 3FYIB 4PJ0Z 2YS8A 3JSNA 3D8CA 5JVDA 5JJEB 4DV6O 3H9VA 2UXNA 1HNWB 1W59A 4DR5B 3CXCU 1Q86W 2HHHO 1YEWA 1N8RW 2VRZA 3ZS8C 3OR7C 1VQ6V 1H2KA 4JI1B 1IX9A 4TV8A 2F23A 3HKCA 2XHBA 3T1YO 3HPLC 3AG7A 5J2UB 4JI6O 1R6TA 1XDCA 3UT5A 3RW0A 5B1AC 4GZRB 3CCJV 4I50B 4P9PA 1YHQV 4TOIA 1BE3H 1S76D 1RSOB 4AQYO 2R72A 2Q69A 2XAHA 3CC2V 3E22A 4U3JA 4UV9A 2ZE6A 1R3JC 1B06A 4U7OA 1H8HG 2OCCC 5GONA 4JAVA 3GVMA 1HNWO 4DR5O 5L3BA 1A32A 1EBOA 1D5AA 3JATA 1XQ8A 1JPXA 4DV4B 1BL8A 4JI1O 3TXSA 4DR1B 1Z2GA 4P2ZA 3B09A 1I7FA 3WB1A 2QM8A 4O4HA 4N23A 4GKJB 2PF4E 3K59A 2F66C 4C7UA 2R9AA 1KUQA 2WLLA 4DXWA 2HEPA 1IDSA 4HBNA 4KXRA 2OCHA 1K97A 4Q6GA 2P6JA 4DYLA 1SQVH 5KAFZ 4PV1B 2ATKC 4J41A 1KC8W 4NTWA 1K9MW 1J95A 1Q6IA 1BMFG 4B3MB 4N21A 5CBFA 1PL0A 4DR1O 1EZVH 2ITDC 2P06A 4R6ZA 5IYDO 1Y74A 2CTRA 1R1BA 4WBNA 2WAMA 1HNXB 2ZXWC 1GO3F 1XREA 4MTXA 4ZI7A 5KHJA 2IH3C 1FYJA 5KA6A 4GKJO 3C3TA 4X1YA 5EYPB 3RYFA 1ZWIC 2Z5UA 3T1CA 3ZMVA 3ETQA 3P30A 2UUAB 1NTZH 2LO1A 1XI1A 4I55A 4TWKA 4IL6Z 1G1XB 1NJIW
chains in the Genus database with same CATH topology
1WA8A 3Q4HB 4I0XA 3TXSA 4ABMA 2VS0A 4LWSA 1WA8B 2DE0X 3FD9A 2AZ2A 3G80A 2VRZA 4I0XB 2KG7A 3OGIB 3FAVA 4LWSB 3ZBHA 3HR0A 3GVMA 3Q4HA 2KG7B 2B9ZA 3O9OA 3TXQA 2AZ0A 3FAVB 4GZRB 3GWKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA8 A;  3Q4H B;  4I0X A;  3TXS A;  4ABM A;  2VS0 A;  4LWS A;  1WA8 B;  2DE0 X;  3FD9 A;  2AZ2 A;  3G80 A;  2VRZ A;  4I0X B;  2KG7 A;  3OGI B;  3FAV A;  4LWS B;  3ZBH A;  3HR0 A;  3GVM A;  3Q4H A;  2KG7 B;  2B9Z A;  3O9O A;  3TXQ A;  2AZ0 A;  3FAV B;  4GZR B;  3GWK C; 
#chains in the Genus database with same CATH topology
 3CME V;  5IWA B;  4B3M O;  2RN9 A;  2ZNI A;  2KSD A;  1VIB A;  4X62 B;  1FPO A;  1WN7 A;  1SQG A;  1HNX O;  3EVK A;  2JS3 A;  3A0B Z;  4YXW G;  4FVM A;  3OR6 C;  4HNA B;  1Q3E A;  1VQN V;  2V7Q G;  1I0H A;  5EBM C;  5LHI A;  3JAS B;  5LP6 B;  1N34 B;  2UUA O;  2YUA A;  3RWR D;  3K3W A;  2AXT Z;  5J2T B;  3D36 A;  2HVJ C;  1TGO A;  4JI7 B;  3UO2 A;  1M57 C;  1WPX A;  4GCZ A;  2YEV B;  4LF5 B;  2PYJ A;  5CB4 A;  5IWA O;  4MW8 A;  2LW7 A;  1MG1 A;  3F5T A;  2HFE C;  2O57 A;  3W7T A;  5IYC O;  4X62 O;  1K4C C;  2CH7 B;  4GX1 A;  3QF7 A;  4FMT A;  2OTL V;  4UCV A;  5LL6 Y;  2WA3 A;  5IYZ A;  1SKV A;  2QKC A;  2R9I A;  3B40 A;  3OUS A;  2A79 B;  5CA1 B;  1BSM A;  4I7Z B;  4MW3 A;  5IJ0 B;  3W7W A;  2EUL A;  2UXC B;  5IYB O;  2KQX A;  1XNR B;  2JS5 A;  4CS3 A;  5KX5 B;  1D2D A;  1S5L Z;  1BGY H;  5EBW C;  1TVK B;  2B5U A;  4JI0 B;  1AI4 A;  3WB2 A;  2QM4 A;  2ZE5 A;  3ASN C;  3K9A A;  1AIL A;  1ZUQ A;  3CC7 V;  1K73 W;  4JTA B;  1KMI Z;  3RVZ A;  1H2S B;  3WG7 B;  2Y0P A;  5GTI Z;  1PNM A;  1MNG A;  4FM1 A;  2LFR A;  5AG2 A;  2UXC O;  2ZXW B;  4LNU A;  3HKB B;  2Q7G A;  2Q0A A;  4I4T B;  5IE9 A;  3E8B A;  2OTJ V;  4PA6 A;  5HFM A;  2V1D A;  4RO2 A;  4B7E A;  3K0D A;  4KHP B;  2PTM A;  4NTX A;  4H0L B;  3P3P A;  2H94 A;  3K79 A;  3VBB A;  5DED A;  4DV0 B;  1NQT A;  1KBH A;  1YTF B;  4FZ0 A;  4DR6 O;  4XBF A;  4DW0 A;  3H1J H;  1PKX A;  3RYC B;  2MK3 A;  2X6A A;  1ROP A;  3JAW A;  4FFK A;  3OW2 U;  1NR1 A;  1M5I A;  4O4L B;  4FFB B;  2RDC A;  3S3X A;  3KCX A;  1MSW D;  5ITZ A;  1AP5 A;  1QU7 A;  2ZIO A;  3E2E A;  5B1N A;  2QTO A;  4QE7 A;  4QPJ A;  1B3Q A;  5EC2 C;  3LSS A;  4CH6 A;  4KHP O;  2KG7 A;  1OCO B;  2IH1 C;  5IJ9 B;  2FL4 A;  1GH6 A;  5BR8 B;  2ZIN A;  1X4T A;  2FB5 A;  1KQS U;  4XDK A;  1NBM G;  1Y76 A;  2DWD C;  4FPP A;  3ZHU A;  3LDD A;  2JEU A;  1JOY A;  5CBH A;  2UXB B;  4TUY B;  2XAJ A;  2VWK A;  4PI2 A;  4KP4 A;  2ZD9 A;  4GX5 A;  3STL C;  2NR5 A;  2QKS A;  3OTF A;  4JPR A;  1VQ5 V;  1QNM A;  4FK5 C;  5LHG A;  3CXH F;  3W7X A;  3WU2 Z;  2YXL A;  4P9O A;  1JFF B;  5IY5 C;  4AI8 A;  3K04 A;  2Q8V A;  5CMU A;  3CJH A;  2ZNJ A;  1GAX A;  5BR8 O;  1VMG A;  4X66 O;  2QKA A;  1DGS A;  2ZDI C;  3ZHQ A;  2UXD B;  2A9H A;  4AIL C;  5LOV B;  1G8M A;  1FKA O;  4JAA A;  4B08 A;  2WLI B;  3M99 B;  4JZG A;  2P90 A;  3JAL A;  2X7R B;  5JH7 A;  2ILM A;  4HYO A;  5KLV H;  2VQE B;  3HKE A;  4O2B B;  1VF6 A;  2N74 A;  2BSK B;  3OD4 A;  4OPH A;  1WNS A;  5EK0 A;  2ITC C;  4TQD A;  1WA8 B;  1MZF A;  2LQT A;  2GTA A;  1N32 B;  4UCU A;  3BPZ A;  5L3D A;  5B3S C;  2UUC B;  3JCZ A;  1N0N A;  3Q4H A;  4JV5 B;  1VQ8 V;  1OV9 A;  5BY1 A;  3SGI A;  2QGN A;  2DYR B;  5LHH A;  2UXD O;  2JIZ G;  3AG4 C;  3FKS G;  4X8A A;  4E2L A;  3RFR A;  5EIB D;  2QWR B;  5JVD B;  3X2Q C;  4DV1 O;  1N0J A;  1PNK A;  3A0R A;  3FAV A;  1YJW V;  1R73 A;  1SER A;  2LW1 A;  4TV8 B;  3HKC B;  1N32 O;  1L0N H;  2F43 G;  4LCU C;  3K5M A;  2ETN A;  4X20 A;  2UUC O;  3SJA C;  1YXB A;  2IU3 A;  3UT5 B;  4JYB A;  4Z1V A;  1M56 B;  3K08 A;  3SJQ C;  3SYO A;  4JV5 O;  3ICX A;  2HG5 C;  5IT9 N;  4MTO A;  4GKK B;  3E35 A;  4BIZ A;  4DUY B;  2Z0A A;  1R6N A;  1P49 A;  1HNZ B;  2ZR3 A;  3N2G A;  1QLN A;  1PPJ H;  5GON B;  4J9Z B;  2L6L A;  4IIJ B;  1QVF U;  1SA0 B;  4OXS A;  1LUV A;  3JAT B;  2WLN A;  1XUQ A;  3JAM N;  3BY6 A;  1RPR A;  2MW2 B;  2YI8 A;  2Y69 B;  2IW5 A;  3ZRX A;  1W2B U;  1N36 B;  2P7T C;  3HR0 A;  4MS2 A;  5FLX N;  3R65 A;  4H33 A;  4O4H B;  4OPA A;  1IBM O;  1N33 B;  2QJ1 A;  2F93 B;  2IJJ A;  3DSQ A;  1EM1 A;  5DN6 G;  4AHC A;  4Q20 A;  4JAS A;  5BZB A;  4I0X A;  2GUZ B;  2RCV A;  3CCM V;  3C3S A;  2WLL B;  5IY5 B;  1QR9 A;  3IC9 A;  4TQF A;  2DE0 X;  1HNZ O;  1NVP D;  1PNL A;  4PDL A;  3M7M X;  1SZX A;  1SQF A;  2E74 B;  4DUZ O;  1F4N A;  4MSW C;  3SYP A;  5JQG B;  5B1B B;  3I5D A;  3CYO A;  4G28 B;  1YDX A;  3CP1 A;  1YF2 A;  1N36 O;  4U7N A;  1AR4 A;  4WBN B;  1L8D A;  2HVK C;  1N33 O;  3ABL B;  4X1K A;  3AK1 A;  4R8C A;  4X1Y B;  3RYF B;  3EXA A;  2BOC C;  1XL4 A;  3CCE V;  1NKD A;  1AJN A;  2ODM A;  3SPJ A;  1MSD A;  4JF3 A;  1NH2 D;  1HP8 A;  1U96 A;  3W7S A;  3G80 A;  2EIJ B;  1AVM A;  1ZTE A;  1QLE B;  1NT2 B;  3L70 H;  1K3E A;  1D5N A;  3DTU B;  4U3F H;  4B7K A;  1NTM H;  3UKM A;  4KL1 A;  1PV0 A;  4IGG A;  3U0Z A;  1ENV A;  2OYQ A;  4ZOL A;  5JCO A;  2B1I A;  3VQX A;  2DMX A;  2OIE A;  4LF6 O;  5B66 Z;  4CC5 A;  3WB0 A;  4LH6 A;  1S0V A;  1V9P A;  5LP6 C;  3CCS V;  5CBG A;  5KHI A;  2QTS A;  3T4Z A;  4F4L A;  1XOU A;  4LF7 B;  4WFH A;  5CB4 B;  2AZ0 A;  4H37 A;  5KUK A;  3JSL A;  4P30 A;  5C8Y A;  3E86 A;  1B6Q A;  2XT9 A;  3HKD A;  4J9Y B;  2OT5 A;  2N05 A;  1RFY A;  1TA8 A;  5CA3 A;  1F7Y A;  4JI3 B;  3G71 V;  2QWP B;  3CRQ A;  5L3G A;  2PYL A;  5GW7 A;  3ZN1 A;  5IYZ B;  5BXZ A;  3J80 N;  4LF9 B;  1BCC H;  1IUR A;  4MVQ A;  4LF7 O;  1DLB A;  4IYI A;  2VQF B;  4CH5 A;  1VQL V;  2ZCE A;  2EIL B;  5KAI Z;  3RN4 A;  3CX5 F;  4ICG A;  3ZRV A;  5C93 A;  3JYC A;  3P3N A;  1ZAU A;  4JI3 O;  1BQZ A;  1Q82 W;  1AR1 B;  3WG7 C;  3ZED A;  4UCS A;  2Q6A A;  4O4J A;  3OEE G;  3AG3 B;  4LP8 A;  4DV4 O;  1RPO A;  5K1X A;  1YIT V;  1ZL8 B;  1KD1 W;  3SYQ A;  1TAE A;  3G67 A;  1Q5O A;  3B8N A;  4I9W A;  4IHJ A;  1XBL A;  1YCI A;  4LFC B;  4DV7 B;  1FS0 G;  2ARH A;  2A3Q A;  4CC6 A;  1KKC A;  1MZE A;  1R6K A;  1SQP H;  1M9N A;  2IJH A;  1MOF A;  1OHH G;  3SJC C;  3BEH A;  3CS5 A;  4ZHQ A;  3RGB A;  1DTO A;  4MVM A;  3VOU A;  2CE4 A;  4O2A B;  1KU9 A;  3RVY A;  5D5P A;  1JJ2 U;  3JAW B;  4RWU A;  4TT3 G;  3RYI B;  5JWP A;  3ABM C;  2F95 B;  4PEL A;  1S77 D;  5ITZ B;  3JAR A;  5LBQ A;  5CN0 A;  3B8M A;  2UXX A;  4DV7 O;  2K9P A;  3OMI B;  1XEQ A;  1NS1 A;  4EB6 A;  2IJI A;  4DR7 B;  2KKW A;  2KG7 B;  1E1R G;  1OCC B;  3CSX A;  1O9H A;  3IGA C;  4YY3 B;  4LF8 B;  1OCO C;  4ZKI A;  1W0J G;  2P4K A;  3AG2 B;  2WLH A;  1Q6H A;  3OAA G;  2M6Y A;  1QQC A;  1Y67 A;  2ZM6 B;  2X6C A;  3CRC A;  5A2Q N;  4H44 B;  2FML A;  2EX3 A;  1IXM A;  1FXK A;  1H2L A;  5HFL A;  4NVP A;  4YIP A;  3D3I A;  4FJC C;  3E8H A;  4FIP C;  4PDV A;  4DR7 O;  3CJH B;  4DV5 B;  2LP7 A;  1JA8 A;  2EJR A;  1N34 O;  3G4S V;  4YY3 O;  3QO7 A;  4LF8 O;  1Q43 A;  1M90 W;  3KG2 A;  1S5H C;  4JI7 O;  1FFX B;  2ZM6 O;  2W0F C;  3K06 A;  3JAL B;  4LF5 O;  3QVN A;  4D7T A;  4J10 A;  1FJG B;  4NB5 A;  1MMM A;  4K35 A;  5L3F A;  2CTP A;  3LSU A;  4RUF A;  4PA3 A;  2Q68 A;  4NXN B;  2AHY A;  2GV9 A;  4GX2 A;  2Z3Y A;  3BRC A;  1AI6 A;  3CPW U;  3LSQ A;  3TXQ A;  4FLX A;  4DV5 O;  2E76 B;  5LMU B;  3Q4H B;  2A7W A;  4ABM A;  2YXY A;  1SS3 A;  2Q9L A;  3LDC A;  2K1E A;  4LFA B;  1EN6 A;  1Q6U A;  2DYR C;  5IDJ A;  1XNR O;  1SZT A;  1GM7 A;  5LGN A;  4Z1M G;  2JGD A;  5FPR A;  1VQK V;  3T1H B;  4LC1 A;  2CAZ C;  3ZRW A;  4FM0 A;  3FAV B;  4JI0 O;  3MD0 A;  1O9G A;  1I08 A;  3O65 A;  3S3W A;  4NXN O;  3DC6 A;  3ZMS A;  3JD3 A;  1P7G A;  1G6U A;  2R70 A;  3G6B A;  4YJ3 A;  4YIO A;  3K03 A;  4X20 B;  5LMU O;  1Q90 D;  3ABM B;  3DC5 A;  1E1Q G;  4MVZ A;  1Y4M A;  4PDM A;  3PJS K;  2JEX A;  1HR0 B;  3E89 A;  1M56 C;  1Q81 W;  2CTQ A;  5H6R A;  4LFA O;  1OCZ B;  3N2K A;  1F23 A;  1KP2 A;  3T1H O;  3N2G B;  4JTD B;  4UVC A;  2WSS G;  3OTO B;  2B1G A;  2DWE C;  1VAR A;  3VQY A;  3E8G A;  1GK9 A;  4X65 B;  3L75 H;  4DV0 O;  1XMO B;  3O9O A;  4TV9 A;  5LA6 A;  2Y4U A;  5H5N A;  4QGP A;  5LXT A;  2Y69 C;  3SJB C;  2A0L A;  3TK1 A;  4O4I A;  1GRJ A;  5FNV B;  4BR6 A;  1HR0 O;  2Q4P A;  1VQO V;  3OT7 A;  2YI9 A;  2DQ3 A;  1UJW B;  3IFX A;  3K5N A;  1CPY A;  4DRX A;  3GWK C;  3L74 H;  3OTO O;  3CCV V;  1TUB A;  2ZR2 A;  2RQ6 A;  3E83 A;  5EBL C;  4FLW A;  4QNH B;  2EIK B;  2EBO A;  4X65 O;  4CS4 A;  4H13 B;  2E5L B;  1K34 A;  1XMO O;  5BMV A;  2CH7 A;  1M93 A;  5B1B C;  4EKW A;  4WCE V;  1V55 B;  1NVP B;  4RAI A;  3ETE A;  2YIB D;  2UXB O;  3ZN0 A;  4X1K B;  1OCR C;  1XMQ B;  3RBZ A;  3BA8 A;  1TUE B;  3ABL C;  3J7A U;  5LYJ A;  3LNN A;  1BS3 A;  4OGQ B;  2WLK A;  1ORQ C;  1FD9 A;  1Z5V A;  1R3L C;  3ZHV A;  2YIB A;  1NTK H;  2QWO B;  2DQ0 A;  2EIJ C;  4QE9 A;  1QLE C;  5LMN B;  3FYE B;  2E5L O;  1TVK A;  2P4V A;  4DR4 B;  3JCU Z;  5KMG A;  1HW7 A;  3ZRS A;  4EFB A;  3UCS C;  2LFS A;  2QE7 G;  1K7D A;  4ZOL B;  1LR1 A;  1XMQ O;  1Y66 A;  5EZY A;  4I9Q A;  3SPI A;  2VQE O;  3MDS A;  2LGQ A;  4L8J A;  3ZBH A;  4LBE C;  2LGW A;  4ZIB A;  4ASU G;  4IT5 A;  1UPG A;  3SYA A;  3ZJZ A;  3D36 C;  1S3J A;  2JRI A;  3H1H H;  4LF4 B;  5LMN O;  4FLT A;  2G38 A;  1YTF D;  5C8Y B;  2OIG A;  4DR4 O;  3ZMU A;  2Y0I A;  1GN2 A;  3RYH A;  3HKD B;  5LGU A;  3E22 B;  4U3J B;  1R3I C;  3AK3 A;  1S5J A;  2W6I G;  1K92 A;  1UFI A;  3AEI A;  4FLY A;  4X64 B;  3FB7 C;  2P5O A;  1XL6 A;  2PGG A;  3L73 H;  3RYC A;  2GBO A;  1JCH A;  3OM3 B;  1F4M A;  3FD9 A;  4JGS A;  2Q0O C;  1US6 A;  4BW5 A;  4LH7 A;  3MHH C;  2DOS A;  4UB6 Z;  3F7V C;  3FB6 C;  1KKD A;  3CRA A;  4GKK O;  4MTG A;  2EIL C;  1VQ4 V;  4A5U B;  4DUY O;  2ZKO A;  2CK3 G;  1M4U A;  2ZQM A;  3SPH A;  1K8A W;  2PI4 A;  1XNQ B;  4X64 O;  3QO8 A;  1VQ9 V;  2GTS A;  2OWO A;  1RM1 B;  1MA1 A;  2WLJ A;  3UM7 A;  3AK2 A;  2XTA A;  2JJ1 G;  3A0H Z;  4NTY A;  4XDJ A;  4MVO A;  2CTW A;  4B3S B;  3AG3 C;  1Y74 B;  1L1F A;  1OCR B;  3CD6 V;  4NXM B;  4UVA A;  1P7B A;  1H8E G;  4ZI7 B;  4XDL A;  4UFZ A;  4F6E A;  4JI8 B;  3GB7 C;  2R9R B;  4R7C A;  1YSC A;  2GDS A;  3JD0 A;  1NR7 A;  2QWN B;  2CGN A;  3AG1 B;  3IAY A;  1PL4 A;  4JYC A;  4ZHQ B;  1R3K C;  1XNQ O;  4I55 B;  1GMG A;  2WLI A;  3CRM A;  4DK0 A;  2AW9 A;  2GSM B;  3CC4 V;  2QEX V;  5B5E Z;  4UXN A;  4B3S O;  1WB8 A;  1SQB H;  3JAR B;  4NXM O;  3THO A;  3OMN B;  2HHH B;  3BCC H;  1QR8 A;  4CZZ A;  1EN4 A;  1JJO A;  2EZP A;  4JI8 O;  3TCU A;  2YID A;  4EB6 B;  2ZE7 A;  5GTH Z;  4JI6 B;  4G27 B;  4X88 A;  1AR5 A;  1OCC C;  3ETD A;  2AGA A;  2PY5 A;  4JYY A;  3CB2 A;  1K5Q A;  3AG2 C;  3FB8 C;  1CP9 A;  3U11 A;  2YXH A;  1BQ0 A;  1FXK B;  2A06 H;  4D7S A;  1HDJ A;  4E4E A;  3ZHR A;  1IBL B;  2UU9 B;  3OGI B;  4EFE A;  2BTQ A;  1AJP A;  1CEZ A;  3BA9 A;  3I55 V;  4CS2 A;  4YJ2 A;  1L0L H;  4WFE A;  2C2A A;  5F2V O;  2WLM A;  1X59 A;  2E3C A;  5DEC A;  4WF9 V;  3UQ8 A;  5LGT A;  2VWJ A;  1RP3 B;  4IIJ A;  3LDE A;  1SA0 A;  3SYC A;  1JQ0 A;  3APQ A;  4UV8 A;  2Y4T A;  2BCC H;  4ZBM A;  1VF6 C;  1IBL O;  3E8F A;  2UU9 O;  2FYU H;  1AI5 A;  4PI0 A;  1OJH A;  1QHT A;  2CDY A;  1YI2 V;  1GM8 A;  2EJ7 A;  4FLZ A;  1LUW A;  5KA5 A;  4K0K B;  2ZT9 B;  5K1P A;  4LF9 O;  2GUZ A;  4JAU A;  1ARO P;  2RJZ A;  4LNU B;  2VQF O;  4Z2W A;  1S72 V;  2YSU B;  2JGD B;  3CMA V;  3BFR A;  3OUF A;  1COW G;  5B1O A;  1BZK A;  1Q8I A;  3ZRW B;  2VS0 A;  4LFB B;  4LWS A;  5D5Q A;  3W7U A;  1FXH A;  2D2C B;  1I5Y A;  4X9Q A;  3CCL V;  4JTC B;  5JQG A;  2ZDI A;  2E75 B;  2WPD G;  4UB8 Z;  4YJ3 B;  5J9P C;  1NI8 A;  1NU1 H;  3JD1 A;  5EC1 C;  4K8Z A;  4X1I A;  1URF A;  1JR9 A;  1IVS A;  2PZS A;  2EIN B;  2Y48 A;  4FLV A;  4K0K O;  5EIB C;  3DXR A;  1GN4 A;  2BTO A;  2DW4 A;  1SRY A;  5H9C A;  3M8A A;  4JI2 B;  2JDI G;  3CHX A;  4FM2 A;  3N2K B;  3GWO A;  3B4S A;  2W6J G;  3JAK A;  3B77 A;  4LFC O;  1OCZ C;  4R50 A;  4W4K A;  4PD4 F;  3T4D A;  4JI5 B;  4LFB O;  4F6R A;  4MT8 A;  3J81 N;  1XIL A;  1YJN V;  4RUE A;  4KFM A;  1H2M A;  5CA0 A;  4UUJ C;  1VQM V;  2WA4 A;  2EIM B;  3ASO C;  5E79 Z;  5JJN B;  2X6B A;  4TV9 B;  5LA6 B;  1VEW A;  1Y76 B;  1VQ7 V;  1Q7Y W;  4CH4 A;  5LXT B;  3OGC C;  1SQX H;  2HLD G;  4O4I B;  2LJ2 A;  5KHK A;  4CBC A;  2QA4 V;  3CCU V;  4PDR A;  4WFA V;  2Q67 A;  4QJF B;  4JI2 O;  4FZ1 A;  3LNM B;  1DF4 A;  1AP6 A;  1SET A;  3N27 A;  5B1A B;  4DRX B;  4JI5 O;  1TUB B;  1IZ3 A;  2IU0 A;  5J2U A;  3D3Q A;  1E79 G;  1YJ9 V;  4I50 A;  4L87 A;  2YIA A;  2JVD A;  5BMV B;  4PA7 A;  2EIK C;  1RSO A;  1JVM A;  1MAB G;  3ABT A;  1KEC A;  1K33 A;  2OCC B;  4K8X A;  5JH7 B;  1V55 C;  3K9S A;  4BIU A;  4J7K A;  3K5O A;  1YVW A;  1BT8 A;  1YIJ V;  4DK1 A;  5LYJ B;  3HKE B;  1SC5 B;  5E1A C;  1H38 A;  3PN1 A;  4MTF A;  1HWY A;  1EFR G;  3CCQ V;  2N04 A;  4IYH A;  4WFB V;  1VF7 A;  4J7Z A;  5KMG B;  1WAZ A;  1F51 A;  2YC0 A;  3HB3 B;  4JZ2 A;  4PA4 A;  2V4D A;  1KB9 F;  1Y6X A;  4GUN A;  3ABU A;  3NXS A;  2WWW A;  1FJG O;  5JCO C;  2XAS A;  5EZY B;  2HJF C;  3CRR A;  3VQV A;  2GHY A;  3EHB B;  4DR6 B;  4LR3 A;  4NKG B;  2XAF A;  2H3O A;  1PP9 H;  2QDO A;  3TJT A;  1ZL8 A;  1VQP V;  5A9G A;  3H1L H;  4NR1 A;  4UCO A;  3WFV A;  1WB7 A;  4J80 A;  1GN3 A;  4BWA A;  5EYP A;  2RMK B;  1K5S A;  3RYH B;  1WP7 A;  3BAB A;  4MVR A;  2RNB A;  2CUG A;  1AI7 A;  4DV2 B;  1WJZ A;  4O2A A;  1GKF A;  3CWB H;  5H6Q A;  4GLX A;  3ASO B;  4EEQ A;  2PI5 A;  1VF5 B;  3RYI A;  4TSF G;  1AB3 A;  1ZX3 A;  1XHZ A;  4KUM A;  3APO A;  2BOB C;  2P22 C;  2Q7E A;  3K5L A;  3K58 A;  4DV3 B;  1P84 F;  4HNA A;  1XHX A;  3QO5 A;  4I0X B;  3JAS A;  3KKY A;  3ZHS A;  5LP6 A;  4BW9 A;  1LNQ A;  3H1K H;  1T5E A;  4DV2 O;  4X66 B;  1M57 B;  5J2T A;  2HR3 A;  4DR3 B;  5H2F Z;  1FAF A;  3P32 A;  1KYO F;  2YEV A;  1J5E B;  4GYC B;  1H2G A;  4UCR A;  4RQF A;  1JMK C;  3BAA A;  1RM1 C;  4GX0 A;  3BVO A;  3ZCC A;  1JX9 A;  4JI4 B;  4DV3 O;  2ADQ B;  1OZ0 A;  2F4V B;  4J11 A;  3STZ C;  2ZIM A;  3NR7 A;  3UO3 A;  2XAQ A;  1SES A;  2QWQ B;  5CA1 A;  1I5X A;  5DM6 V;  4J7J A;  4W4L A;  4G2K A;  3AG1 C;  4FLU A;  2KB1 A;  2QM7 A;  5FPO A;  4DR3 O;  5IJ0 A;  4HZ3 A;  1FFX A;  1J5E O;  3L9D A;  4DR2 B;  1FXV A;  2NLJ C;  4UCT A;  5KX5 A;  3K57 A;  4CH3 A;  4DV1 B;  1NH2 B;  2IJK A;  4BIO A;  5L3C A;  3H1I H;  3ASN B;  3OMA B;  4JI4 O;  3FB5 C;  3B2E E;  4WFF A;  2F4V O;  2HP8 A;  3SR2 C;  3ABK C;  3TET A;  2JK5 C;  2ADP A;  3BHP A;  2DYS C;  4PA9 A;  1CXZ B;  1K4D C;  2QSA A;  3FFQ A;  1THZ A;  2QR4 A;  3HKB A;  4OX9 B;  1GM9 A;  4K3A A;  4DR2 O;  4I4T A;  1I94 B;  1V54 C;  2P67 A;  2CGO A;  3ZMT A;  2UUB B;  4I5S A;  1PD3 A;  2DJV A;  4B3R B;  3L72 H;  1FXK C;  2IM9 A;  5L3E A;  1WLE A;  1GTO A;  5JJJ B;  2PUS A;  4WFG A;  2BTQ B;  2NNU A;  1WP8 A;  2FTK A;  4GT1 A;  2IBZ H;  2EZO A;  1IBM B;  3EFF K;  4YJ2 B;  2BE3 A;  1YZB A;  2JGU A;  3TGU H;  3ZMZ A;  3L71 H;  1ZLZ A;  4O4L A;  4JYA B;  4FFB A;  3MHS C;  1SF9 A;  1DK1 A;  4OX9 O;  1WPB A;  2L35 A;  3U10 A;  3ZX6 A;  3JD2 A;  2XUM A;  3JD4 A;  3DGE A;  2F1M A;  1I94 O;  4LF4 O;  3QNE A;  4QIW F;  2NN4 A;  4QPK A;  2UUB O;  2B9Z A;  1GN6 A;  3LUT B;  4HAM A;  1Z5W A;  4DUZ B;  4B3R O;  4DO2 A;  4DW1 A;  5IJ9 A;  2X0L A;  5KUM A;  3KCY A;  1M1K W;  2AZ2 A;  4D6T H;  4MVS A;  5TIS Z;  3H01 A;  2M7W A;  1EN5 A;  1QBZ A;  2YDE A;  1DF5 A;  1H2N A;  1BHA A;  2H8P C;  3F7Y C;  4TUY A;  2XND G;  1U97 A;  2ZE8 A;  4O4J B;  5FNV A;  3VQW A;  3CE2 A;  3FX7 A;  4JYA O;  3K0G A;  4MVU A;  2HJD A;  2W0X A;  2AHZ A;  3I56 V;  4IHJ B;  1IXB A;  1JFF A;  4YHH B;  1KP3 A;  1PM9 A;  2HKO A;  1ZSP A;  3KZI Z;  4B3T B;  4LWS B;  1IBK B;  3MAQ A;  3F5W C;  3ETG A;  5FL7 G;  3CEI A;  2FKX A;  1G4Y B;  1EZJ A;  3ML0 A;  1QCE A;  3QG5 A;  3OFN G;  2XOK G;  4X1I B;  5LOV A;  2Q5Z A;  4UVB A;  2Q7H A;  4LF6 B;  3CCR V;  1QVG U;  3SPC A;  3DXR B;  3SDL A;  1FFT B;  2EIN C;  4J42 A;  1BHB A;  3A8T A;  3G6E V;  4DV6 B;  2D3O W;  4O2B A;  1N4C A;  4BAY A;  3A2F A;  1W0K G;  2BSK A;  3ZIA G;  1B04 A;  4X89 A;  2XAG A;  3JAK B;  4YHH O;  1NZ6 A;  3ABK B;  1WA8 A;  5B3S B;  4RQE A;  2DYS B;  3QTC A;  3RT3 C;  4B3T O;  3IC7 A;  1IBK O;  3OEH G;  4F6R B;  3T1Y B;  5CA0 B;  1VP7 A;  3AG4 B;  5KHG A;  3OE7 G;  4PHZ A;  1SQQ H;  2EIM C;  3ZHT A;  2Q73 A;  1V54 B;  2YIC A;  4AQY B;  1AJQ A;  4NYK A;  2JJ2 G;  1P4R A;  3R66 A;  3C90 A;  3X2Q B;  2DN9 A;  5KHH A;  3SPG A;  3IJ4 A;  3T2M A;  3FYI B;  4PJ0 Z;  2YS8 A;  3JSN A;  3D8C A;  5JVD A;  5JJE B;  4DV6 O;  3H9V A;  2UXN A;  1HNW B;  1W59 A;  4DR5 B;  3CXC U;  1Q86 W;  2HHH O;  1YEW A;  1N8R W;  2VRZ A;  3ZS8 C;  3OR7 C;  1VQ6 V;  1H2K A;  4JI1 B;  1IX9 A;  4TV8 A;  2F23 A;  3HKC A;  2XHB A;  3T1Y O;  3HPL C;  3AG7 A;  5J2U B;  4JI6 O;  1R6T A;  1XDC A;  3UT5 A;  3RW0 A;  5B1A C;  4GZR B;  3CCJ V;  4I50 B;  4P9P A;  1YHQ V;  4TOI A;  1BE3 H;  1S76 D;  1RSO B;  4AQY O;  2R72 A;  2Q69 A;  2XAH A;  3CC2 V;  3E22 A;  4U3J A;  4UV9 A;  2ZE6 A;  1R3J C;  1B06 A;  4U7O A;  1H8H G;  2OCC C;  5GON A;  4JAV A;  3GVM A;  1HNW O;  4DR5 O;  5L3B A;  1A32 A;  1EBO A;  1D5A A;  3JAT A;  1XQ8 A;  1JPX A;  4DV4 B;  1BL8 A;  4JI1 O;  3TXS A;  4DR1 B;  1Z2G A;  4P2Z A;  3B09 A;  1I7F A;  3WB1 A;  2QM8 A;  4O4H A;  4N23 A;  4GKJ B;  2PF4 E;  3K59 A;  2F66 C;  4C7U A;  2R9A A;  1KUQ A;  2WLL A;  4DXW A;  2HEP A;  1IDS A;  4HBN A;  4KXR A;  2OCH A;  1K97 A;  4Q6G A;  2P6J A;  4DYL A;  1SQV H;  5KAF Z;  4PV1 B;  2ATK C;  4J41 A;  1KC8 W;  4NTW A;  1K9M W;  1J95 A;  1Q6I A;  1BMF G;  4B3M B;  4N21 A;  5CBF A;  1PL0 A;  4DR1 O;  1EZV H;  2ITD C;  2P06 A;  4R6Z A;  5IYD O;  1Y74 A;  2CTR A;  1R1B A;  4WBN A;  2WAM A;  1HNX B;  2ZXW C;  1GO3 F;  1XRE A;  4MTX A;  4ZI7 A;  5KHJ A;  2IH3 C;  1FYJ A;  5KA6 A;  4GKJ O;  3C3T A;  4X1Y A;  5EYP B;  3RYF A;  1ZWI C;  2Z5U A;  3T1C A;  3ZMV A;  3ETQ A;  3P30 A;  2UUA B;  1NTZ H;  2LO1 A;  1XI1 A;  4I55 A;  4TWK A;  4IL6 Z;  1G1X B;  1NJI W; 
#chains in the Genus database with same CATH homology
 1WA8 A;  3Q4H B;  4I0X A;  3TXS A;  4ABM A;  2VS0 A;  4LWS A;  1WA8 B;  2DE0 X;  3FD9 A;  2AZ2 A;  3G80 A;  2VRZ A;  4I0X B;  2KG7 A;  3OGI B;  3FAV A;  4LWS B;  3ZBH A;  3HR0 A;  3GVM A;  3Q4H A;  2KG7 B;  2B9Z A;  3O9O A;  3TXQ A;  2AZ0 A;  3FAV B;  4GZR B;  3GWK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...