1EBOA

Crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIGEADGLIEGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCRIEPHDWTKNITDKIDQIIHDFVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EBOLA VIRUS ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMEN
publication title Crystal structure of the Ebola virus membrane fusion subunit, GP2, from the envelope glycoprotein ectodomain.
pubmed doi rcsb
source organism Ebola virus sp.
molecule tags Viral protein
total genus 45
structure length 112
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1eboA00
3M99B 4FIPC 3B8MA 1Y66A 1F23A 3WFVA 4JGSA 5H9CA 2M7WA 1QBZA 2LP7A 3GWOA 5KA5A 1JPXA 3B8NA 1DF4A 3B77A 3CYOA 3P30A 4N23A 1I5YA 4JF3A 2EZOA 4FJCC 4N21A 1DF5A 3H01A 3K9AA 1Y4MA 3MHSC 2EBOA 2X7RB 3CP1A 2OT5A 1ENVA 1EBOA 3MHHC 4JPRA 1SZTA 2EZPA 2P6JA 5KA6A 4G2KA 4E2LA 1MG1A 5CMUA 1K33A 1QCEA 1QR9A 1K34A 1QR8A 2MK3A 4FK5C 5CN0A 1MOFA 1I5XA 5HFMA 1DLBA 1JQ0A 5HFLA
chains in the Genus database with same CATH superfamily
4GX2A 4DR3O 4MTFA 3OD4A 1PNMA 4CH3A 3SJCC 2VQFB 2RDCA 3CJHA 5B66Z 1BS3A 4LWSA 4D7SA 4LH7A 2KG7B 1NJIW 3RYFB 1YTFD 4DV1B 2ZE5A 3K3WA 1YZBA 3GVMA 4MS2A 1WB8A 3U11A 4UXNA 4DW1A 1P7GA 1V55B 4DR1B 1I5YA 1KU9A 5JH7B 1M1KW 1K4CC 1IXMA 5FNVA 1B6QA 3O9OA 4O4LB 2EINC 4JI2B 4UCOA 2Q7EA 2XT9A 2JK5C 3JATA 2QA4V 1M93A 4GZRB 2A3QA 3A2FA 3LNNA 2V4DA 5JQGA 2NLJC 4DV2B 3WG7C 2CH7B 5J2UA 1KKDA 4TSFG 2ZDIC 4KFMA 4X65O 4MVQA 4TWKA 1BGYH 4QPJA 2UXNA 1D5AA 3T1YO 4Z1MG 2Y4UA 1VQPV 3FAVB 4G2KA 1R6KA 3CC7V 2JJ2G 2VQEB 3F7VC 3SYOA 2YI9A 3LDCA 4A5UB 1K9MW 1H2GA 1E1RG 1KMIZ 1US6A 4DV0O 5JJNB 4JTAB 2IH3C 2YICA 2HJFC 2PI5A 4FLVA 1S5JA 1THZA 4O2BB 2ADPA 3OTFA 4LF7B 1GN4A 4HYOA 1Q90D 3TETA 1M57B 2QM8A 1I94B 2JGDB 3UCSC 2PYJA 1H2NA 2C2AA 3CD6V 4G28B 1N34O 1R3IC 2EZOA 1OCCC 5ITZB 2ODMA 2X7RB 3HB3B 3RVYA 4DV7O 4UV9A 2ZNIA 1G6UA 2RJZA 4GX5A 4X1IB 1N33O 2QGNA 3ABLB 2ZM6O 1K34A 4LF9B 4X88A 1GN3A 3ABKC 1EFRG 3AG2C 5K1XA 3M99B 5KHGA 4K0KB 4J7ZA 5GTHZ 2B5UA 1PKXA 3JD2A 4DK1A 5IDJA 4EFEA 1SZTA 5JJJB 3CS5A 3G4SV 2P6JA 4JI7B 4J9YB 2MK3A 3FB7C 4UV8A 3K0GA 1N36O 3K06A 1A32A 2B9ZA 4PELA 5L3CA 4LFCO 2ZE6A 1JR9A 1M90W 1B06A 1S3JA 2QM7A 4LFAB 5FPRA 4MVRA 1VQ6V 2BSKA 3FB8C 1FPOA 1VF7A 1OHHG 5LGNA 4PHZA 5KUKA 4TT3G 2AZ0A 2V1DA 1PD3A 1QVFU 2EIMC 4QNHB 2EIKB 1JA8A 4K3AA 1S5LZ 4LC1A 2P06A 3MDSA 2UXCB 2CUGA 5GTIZ 1LNQA 2XAHA 1R3KC 3PJSK 1Q5OA 2WLIA 3FD9A 1XL4A 5BY1A 4RQEA 5LA6B 2X6BA 4O4HB 2P90A 3K5OA 1BL8A 2Z3YA 1SC5B 1VF6A 1YITV 4CC5A 2DW4A 4PA3A 3CRMA 1VARA 5DEDA 3E86A 1M56C 4UCUA 2R9RB 1S76D 3ICXA 3E8BA 1XILA 2HP8A 1YDXA 3AG3C 1UJWB 2PI4A 2RNBA 2L6LA 3E8HA 3I55V 4DR3B 1K33A 1FAFA 3K59A 3H1JH 5EC2C 1S5HC 2QR4A 3AK2A 2A06H 3CMEV 4R7CA 1BSMA 3K5LA 4I4TB 1TVKB 1VQ8V 3CC2V 4FLWA 3Q4HA 1SRYA 4ZIBA 1Z5WA 1FKAO 4DR6O 3N2KB 2R9AA 4EB6B 3ZCCA 3D8CA 5H9CA 2M7WA 3THOA 1Q81W 4FZ1A 1Y74A 2XHBA 4DR2O 4Z1VA 4LBEC 3HKDB 2P22C 5L3FA 1GM8A 4JI0O 2JEXA 4B3MO 3RYIB 3ASOB 4I50B 5KA6A 2OCHA 3DSQA 4JYBA 1EN4A 3JD3A 4IYHA 2F93B 2Y48A 2QKAA 1WAZA 2UXBO 4X65B 1WA8A 4WFHA 3IAYA 1X59A 3ZMZA 1Q43A 3D3QA 3ZHQA 3ZHRA 3T1YB 4U3JB 1DF4A 3B77A 4JYAO 4NTYA 2Q69A 1EZVH 1GAXA 2ETNA 1VQ7V 3TK1A 2ZR2A 5B3SB 4GKJO 1XQ8A 2ITCC 1IBKO 3X2QB 3QVNA 3OMNB 1M5IA 4DV0B 1IURA 1Z5VA 5JVDB 1QBZA 1BMFG 1AR1B 4DR4O 5CA1B 1N4CA 2OWOA 5H6RA 1HR0O 2F66C 1HDJA 4B7KA 1SQPH 1DTOA 3DC5A 3CJHB 1WP7A 4LWSB 1QCEA 3T4ZA 1YJNV 1Q82W 1T5EA 4QIWF 3L73H 1ORQC 4D6TH 3QF7A 1D2DA 4PJ0Z 1H8EG 2CTWA 1N34B 3OGIB 2RQ6A 4CH6A 1VQNV 3SPGA 1PPJH 4DV7B 1N33B 5IJ0A 2ZM6B 2EBOA 1R3LC 1K5QA 3IC9A 2PZSA 4MTXA 2IJIA 3UM7A 3S3WA 4RUFA 2Y4TA 2F23A 4I9WA 4JTDB 3LDDA 3ASNB 3H1IH 1F23A 4J10A 4FM0A 3K5NA 2IM9A 2HR3A 3JATB 3K79A 5LHGA 2VWJA 1XI1A 1HW7A 3OUSA 3ZN0A 3QO7A 1N36B 3EXAA 2XAGA 3ABMB 3ZHSA 5J2UB 4LFCB 5FLXN 4NXMO 5L3DA 1KKCA 3G80A 4BAYA 3D36C 1GN6A 2CGNA 5F2VO 2ZCEA 4G27B 1IDSA 3JAWA 5EBMC 4X89A 1HNWO 4OGQB 4DV4O 2Q6AA 3ETGA 4CS3A 1DF5A 1I0HA 2Q0AA 1GMGA 3G71V 5H6QA 3L74H 1TUBA 1SQGA 1PV0A 3WB2A 3ZJZA 4B7EA 3VBBA 5CB4B 1OJHA 1WLEA 3ZRWA 3T1CA 5CMUA 2QSAA 1RM1B 1MZFA 3K08A 2ZDIA 3IGAC 1YI2V 1R6NA 3H9VA 1EN6A 3ZS8C 5KAFZ 3DGEA 1V55C 1IX9A 1W0JG 3HKEA 4X9QA 1NS1A 1YEWA 2QJ1A 2YXHA 1M4UA 3SYQA 4CBCA 2GDSA 3RWRD 1RSOA 3HR0A 2ZE7A 2CGOA 4QPKA 1AB3A 4B3SO 4JI3O 4N21A 4FJCC 1TUEB 3RVZA 4I55A 4DR6B 5LP6A 1B3QA 5B1OA 2GV9A 3QNEA 1ZWIC 2AHZA 3OGCC 1K3EA 2BSKB 1FS0G 3VQWA 2P4KA 4KXRA 4L8JA 4DR2B 2UUBO 3CEIA 3HKDA 4JI0B 4B3MB 3BPZA 3KZIZ 2Q5ZA 4P9PA 4LF6O 4I50A 3APQA 3UKMA 1AI7A 4UCTA 3HPLC 4X62O 3OEHG 2XASA 4MW3A 2UXBB 5CBFA 4K8XA 2WLIB 1M57C 3ZHTA 1B04A 4JYAB 4LR3A 3A0HZ 4JYYA 2OTJV 1FXKC 1PP9H 3BCCH 2A7WA 3BA8A 4ICGA 1Q6IA 4GKJB 4I0XA 4QE9A 5DECA 1IBKB 3CP1A 5KAIZ 2HLDG 4UB6Z 3OT7A 2VWKA 3T4DA 1WPXA 4UVAA 1KECA 1WB7A 3ABLC 4DR4B 3LDEA 4HZ3A 4PA4A 5LGUA 1HR0B 2XOKG 3BHPA 2FB5A 4PDMA 2N04A 1AROP 4N23A 5B1AC 4ZKIA 1ENVA 4CS4A 3STZC 5D5PA 3D3IA 4E2LA 1ZLZA 1IVSA 2KKWA 1E1QG 2HEPA 1KD1W 5JCOC 2ZR3A 5IT9N 1AP6A 4BR6A 3Q4HB 1KQSU 1BHAA 4LF5O 1Y76A 3AG1C 1LUVA 3WB1A 2CDYA 1WJZA 2JEUA 1DK1A 4DV5O 5JJEB 2IJKA 1Y74B 1H2MA 2OCCB 1K5SA 3BEHA 4UVCA 2DYSB 1HWYA 1PNLA 2YUAA 4UVBA 3QO8A 3UO3A 2EIJB 1MABG 2QKCA 4LF4O 2ZXWC 2EIKC 1S72V 1HNZO 4OX9O 2BOCC 4PDLA 2DE0X 3IJ4A 4NYKA 1WA8B 4NXMB 4LF8O 1MG1A 1OCOB 1QR8A 4B3RO 1NBMG 2XAJA 4JI6O 2WLKA 4ZBMA 2XTAA 1J5EO 1Q6HA 1HNWB 2FKXA 5J9PC 2JIZG 4DV4B 4ASUG 4F4LA 2XAQA 4LFBO 2E74B 4U3FH 2LGQA 2Q7GA 1NKDA 4BIUA 3CCEV 2CTQA 1KP2A 3QG5A 3BFRA 2ZE8A 4QJFB 2ZQMA 4OPAA 2CAZC 1TAEA 1JMKC 1G8MA 3GB7C 5CB4A 5LHIA 3B40A 3CC4V 4OXSA 1K97A 2B1IA 1EM1A 1GH6A 1H2LA 3FX7A 4JI1O 4GCZA 4MVZA 3WB0A 3OE7G 4FPPA 4ZI7A 5IJ0B 4TV9A 1MOFA 5J2TA 2YIBA 5EBWC 4UUJC 3UO2A 5IYDO 1NZ6A 3N2GA 3MD0A 5IYZA 1JVMA 5BMVA 1BQ0A 3RYHB 2CE4A 4I9QA 3JSNA 5A9GA 4BIZA 3ASOC 4DRXB 3BY6A 4H13B 2Q73A 1P7BA 4X66O 1JJ2U 5EZYB 5HFMA 4B3SB 4JI3B 4GKKO 4FMTA 1YF2A 2LQTA 3E22A 3T2MA 2AZ2A 3GWKC 1SQQH 4RUEA 2UUBB 1DGSA 5K1PA 3ZN1A 3CE2A 5B3SC 3JAWB 3X2QC 1QLEB 3OFNG 3G6EV 4LF6B 2DYRB 1MMMA 3B8MA 4YHHO 4J7JA 2QTSA 1XEQA 3P3NA 4GUNA 4X62B 3L75H 3SPJA 4EFBA 1BT8A 1TUBB 1LUWA 4X20A 2EZPA 1VEWA 1H2SB 1TA8A 2ZD9A 3JALA 4FLUA 1ZL8A 4FZ0A 4YJ2B 3ZRWB 1NVPB 2QEXV 5H5NA 2W6JG 1UFIA 2QDOA 4Q20A 2X0LA 1L0NH 3CWBH 3JSLA 3ZRXA 3OM3B 2E3CA 1NT2B 3HKEB 4YXWG 3OEEG 3TXSA 3W7TA 4XDJA 3ZIAG 2GBOA 3ASNC 2IW5A 3GWOA 5KHHA 1RSOB 3AG4B 1SERA 1N0JA 1GRJA 3F5WC 1BHBA 2G38A 3DC6A 3JD1A 1O9HA 1BQZA 3ABMC 1YSCA 4I55B 4LF5B 3ZRSA 1I5XA 5LP6B 1KYOF 2UU9O 1GTOA 4JASA 3SJBC 3CCSV 2JDIG 1ZUQA 3LSSA 3G67A 4WBNB 4DV5B 1G4YB 2E76B 5B5EZ 2ZNJA 3CMAV 3C3SA 2UUCO 4RQFA 4I5SA 3ETQA 1GO3F 4LF4B 4MVOA 2YI8A 5HFLA 1HNZB 1W59A 4OX9B 3WFVA 2YSUB 2D2CB 4LF8B 3TXQA 2R9IA 2D3OW 1VP7A 3J7AU 1GM9A 2WA3A 3CB2A 3I56V 5EIBD 1FFXA 2ATKC 4GX1A 4B3RB 3SJAC 2EX3A 4TQFA 1JFFA 4JI6B 3UT5A 3NXSA 3ZMSA 4HNAA 3CCJV 4I0XB 1XDCA 4JTCB 1WP8A 3FYIB 2QTOA 1J5EB 1RM1C 1NVPD 3J80N 1K92A 4MVSA 2W0XA 4LFBB 2OYQA 3JAMN 3LSUA 3CXHF 4JYCA 4NR1A 5IWAO 1OCZB 2JRIA 2XAFA 1OZ0A 3L9DA 5C8YA 1IZ3A 4JZ2A 4YIPA 3JCUZ 2RMKB 4H33A 2Y0PA 3QTCA 5L3BA 3CX5F 2Y0IA 3VQVA 2HG5C 2E5LO 4QGPA 4H0LB 1CPYA 2UXDO 3C3TA 4JI1B 4C7UA 1IBLO 2JJ1G 1VQOV 4OPHA 1Y76B 4KP4A 3T1HO 5IY5B 2PYLA 1FXKA 4FFBA 5DN6G 2QWPB 4CZZA 3JASA 4AI8A 3RYCA 2LJ2A 2JGUA 3RYHA 1OCRB 3U10A 3NR7A 1LR1A 3M7MX 4NTXA 4NVPA 1EN5A 3AG3B 1F51A 4DRXA 1MZEA 2DJVA 4X66B 1KC8W 5EZYA 5B1BB 2IJHA 2EILC 1ZX3A 1JJOA 2WLMA 3BA9A 4GKKB 5FPOA 5LOVA 3LNMB 2Z5UA 3W7WA 1FXVA 4Q6GA 2ZIOA 4GLXA 2P5OA 2WPDG 3BRCA 1VQ9V 3DXRA 2HVKC 4FLTA 4LNUB 4MSWC 3H01A 4RAIA 1VF6C 4IYIA 4DR7O 1K4DC 5KHIA 5KUMA 4FM1A 4YHHB 1GK9A 4Z2WA 2YXLA 3ZEDA 1VQMV 4P2ZA 3ZHVA 2EULA 2WLLA 1Q3EA 3AK3A 5FL7G 1MA1A 1NI8A 3AG7A 2M6YA 1BE3H 5CA0A 1XNRO 4YJ2A 3CCVV 3JARA 2P67A 2CTRA 4IIJA 4WFAV 5EC1C 4DUZO 4O4JA 2H8PC 3K5MA 4TV8A 2AGAA 1ZTEA 1QHTA 2QWNB 4FIPC 4TUYA 1GM7A 5BXZA 4YY3O 4GX0A 3QO5A 4JAUA 4ZI7B 5E1AC 4TV9B 4R6ZA 5J2TB 4NXNO 1ROPA 2WLNA 1VMGA 3RT3C 5LMNO 2RN9A 2BE3A 2CK3G 2GUZA 2OCCC 3N2GB 5IYZB 5BMVB 3VQYA 2DYSC 1OV9A 3L70H 3E2EA 1NR1A 1P4RA 2EIJC 3ZMUA 3RGBA 2IU0A 5CBHA 3E22B 4XDKA 1P84F 2UU9B 2IJJA 1Q8IA 1CEZA 1H8HG 3TJTA 1OCOC 4WBNA 2Q8VA 4JI7O 4YIOA 2HFEC 3SYPA 2YEVA 3CXCU 3ABUA 4F6RA 3SR2C 5CA3A 5KA5A 4EEQA 1NH2B 4TQDA 2UUCB 4UCRA 3MAQA 1SF9A 3MHHC 4LFAO 3RFRA 4TOIA 2NNUA 1N32O 4X20B 4WFBV 1UPGA 1RFYA 2LW7A 1NTMH 3HKBA 4JGSA 4P30A 1QNMA 2LGWA 1R6TA 3JALB 1VQ5V 1ZL8B 4X64O 2N74A 4YJ3B 4JF3A 3W7UA 1Q86W 4BIOA 1TGOA 3EHBB 5EYPA 2RCVA 1SQFA 4DW0A 3CRQA 2WLJA 4UFZA 4DXWA 3A0BZ 3LSQA 4GT1A 3N27A 1M9NA 4DUYO 4XDLA 4JAAA 4ZHQA 5IWAB 2HJDA 2YIBD 3E8FA 1JOYA 1AJPA 4X1KA 3P30A 3CYOA 3UQ8A 1BZKA 2LFRA 4IHJB 3R65A 4PI2A 2BTQA 2B1GA 2EJRA 2E5LB 2A9HA 2GHYA 2Y69B 3G6BA 1XNQO 2N05A 1U96A 3OMIB 3HKCA 2UXDB 1IBLB 2YDEA 1MSDA 1F4MA 2DQ3A 4XBFA 3T1HB 2DWEC 1SQXH 2X6AA 5IYBO 1S77D 4J80A 4AILC 4J42A 1KB9F 3K57A 3ETEA 2DMXA 4HBNA 5KX5A 1ZAUA 1E79G 4JI4O 5AG2A 4DV3O 1QLEC 2DYRC 2P4VA 5GW7A 1FJGO 2XNDG 1NH2D 4JI8O 1Y6XA 4O4IA 3K9AA 2F95B 1AVMA 3ZMTA 2WAMA 2K9PA 4MVUA 3BABA 1L0LH 1SZXA 5EIBC 2QE7G 1WN7A 5D5QA 1AILA 1FFXB 4MVMA 5GONA 3U0ZA 3SYAA 4JI5O 2QWRB 1JFFB 4LNUA 3UT5B 4KHPO 4HNAB 4DR7B 1WNSA 2GSMB 4U7OA 1V54B 1F7YA 5LXTA 2R70A 3K03A 1Y4MA 2BTOA 4BWAA 4ZOLB 3F5TA 2LO1A 3BAAA 3CCMV 4JV5O 1V9PA 5C8YB 2QM4A 4LH6A 1YVWA 1FD9A 5L3EA 2F43G 3ZX6A 3CCQV 1XNRB 1YIJV 1XMQO 1JPXA 4IGGA 3AG4C 2EJ7A 5L3GA 1VQ4V 4DUZB 1XMOO 1CXZB 2BOBC 1K8AW 2HHHO 3P3PA 4W4LA 4YY3B 4FK5C 4I7ZB 1JCHA 3KCYA 1AI5A 4NXNB 5LP6C 2MW2B 4DV6O 4CS2A 1FXKB 4FFBB 5LMNB 3JASB 3RYCB 1IBMO 1P49A 2Z0AA 5LYJA 5KMGB 5KHJA 1L8DA 2ZKOA 3APOA 4CH5A 2JVDA 3FKSG 1XHXA 4B08A 1SA0A 3ZBHA 3W7XA 1PM9A 3JAKA 4FVMA 5LOVB 5B1AB 3K0DA 2CTPA 4ABMA 5LMUO 3JCZA 1X4TA 5IYCO 5C93A 3EVKA 3SDLA 1N8RW 4K35A 4JZGA 3DXRB 2E75B 1GN2A 4WFGA 2ARHA 4PA7A 2QWQB 3B09A 3RW0A 1XUQA 3R66A 2YS8A 3AG1B 4PDVA 2GTAA 2AXTZ 1XOUA 5IJ9B 2OTLV 2P7TC 1RP3B 2ADQB 1OCZC 4PA9A 3CSXA 5LBQA 1N32B 2EINB 4F6EA 1AR4A 2KB1A 2AHYA 4MT8A 2WLLB 1QU7A 2HKOA 1W0KG 2UUAO 5CA0B 1RPOA 4X1YA 4X64B 1K73W 5H2FZ 3JARB 2Q7HA 1J95A 4YJ3A 4IIJB 2ZXWB 1U97A 1YJWV 4FLZA 2Q68A 4DK0A 3OTOO 3WG7B 4IT5A 4O4JB 4TV8B 1AP5A 1AJNA 4TUYB 4LCUC 1XBLA 4MTOA 2V7QG 2Q9LA 1G1XB 3D36A 3STLC 2WWWA 3ZHUA 4DUYB 4H44B 1Z2GA 5LHHA 1R73A 4KL1A 4O2AA 5IY5C 1PL4A 4E4EA 1JX9A 2NR5A 2X6CA 3FB6C 1PL0A 4J9ZB 2GUZB 1MNGA 3L72H 3ML0A 2AW9A 1YCIA 3ABTA 1SESA 3FYEB 2FL4A 1OCRC 4IHJA 3VQXA 3CCRV 1HNXO 2PF4E 1RPRA 2BCCH 3H1HH 1XNQB 3IFXA 4QE7A 3SJQC 1I7FA 1I08A 5B1BC 4P9OA 3H1KH 3L71H 1WPBA 3OMAB 1SKVA 1SQBH 3KKYA 3H1LH 1XHZA 4AQYO 2KG7A 3CCLV 1W2BU 4BW5A 4J41A 2F1MA 3SPIA 3RYFA 1QVGU 3E89A 3B2EE 4WFFA 1OCCB 2DN9A 4FLYA 2YEVB 4F6RB 2OT5A 2IBZH 4WF9V 4JI4B 4DV3B 3E8GA 1PNKA 1FJGB 1NQTA 3K58A 3ABKB 1D5NA 3AG2B 4JI8B 2WSSG 3K9SA 5EK0A 2ZT9B 5JH7A 1AI6A 2PUSA 1O9GA 3SPHA 3TCUA 2IU3A 1IXBA 4LP8A 1YJ9V 2LP7A 1VF5B 1FFTB 4O4LA 1SS3A 1URFA 2WA4A 3W7SA 3RN4A 3HKBB 4PD4F 2F4VO 4JI5B 4B3TO 3IC7A 4WCEV 4KHPB 5BR8O 4UCVA 1Y67A 3OAAG 2CH7A 5EYPB 3AEIA 5JWPA 1Q7YW 3ZMVA 4CH4A 2KQXA 3FAVA 4ZOLA 5A2QN 4FLXA 4DR5O 4W4KA 4K8ZA 4ZHQB 2FMLA 1FXHA 4JV5B 1SQVH 1CP9A 2YC0A 4NB5A 4X1KB 3A0RA 3FFQA 4WFEA 4JAVA 1N0NA 5CN0A 1XMQB 5KLVH 1XL6A 2EIMB 2VRZA 5TISZ 2BTQB 5DM6V 4PI0A 3RBZA 3KCXA 4RO2A 1XMOB 2W6IG 2LFSA 2HHHB 4O2BA 4R50A 3SYCA 3HKCB 1MSWD 3WU2Z 3O65A 1EBOA 1KP3A 2VQFO 2JGDA 4DV6B 4NKGB 5IE9A 1K7DA 3M8AA 4NTWA 4DV1O 5ITZA 3I5DA 3F7YC 1IBMB 1KUQA 3JYCA 5KMGA 1NTKH 5KX5B 1M56B 2IH1C 4X1IA 4H37A 3CPWU 1EZJA 3BVOA 1YHQV 2A0LA 1ZSPA 1H38A 1XREA 4DR1O 2H94A 3EFFK 2LW1A 1NU1H 1HP8A 1R1BA 4O4IB 4MTGA 2FTKA 5FNVB 4JI2O 2R72A 5LMUB 2NN4A 2PGGA 2QKSA 2W0FC 5GONB 5JCOA 3JD4A 3J81N 4IL6Z 3MHSC 4GYCB 5JQGB 3OR6C 4DV2O 2VS0A 3SGIA 5LXTB 1YXBA 4J11A 5IJ9A 2WLHA 2ITDC 4U7NA 1S0VA 1Y66A 3PN1A 1NTZH 1Q6UA 2VQEO 3OW2U 3A8TA 3CRCA 2UUAB 3DTUB 3KG2A 4D7TA 2Q4PA 4JPRA 2PY5A 2KSDA 3OTOB 2Y69C 2L35A 2ZINA 4LF7O 2YIAA 1FYJA 2OIEA 1I94O 3FB5C 2HVJC 5LA6A 4O4HA 5B1NA 2Q0OC 3ETDA 1L1FA 3S3XA 3OR7C 4EKWA 3AK1A 2K1EA 1H2KA 5LYJB 4PV1B 4PA6A 5LL6Y 5KHKA 4UB8Z 1HNXB 2QWOB 2ILMA 4UCSA 4LF9O 4BW9A 3ZRVA 3B8NA 1F4NA 2FYUH 1SA0B 3CHXA 4K0KO 3JAKB 2XUMA 2GTSA 4AQYB 2YIDA 3LUTB 1BCCH 4FFKA 1YTFB 1AI4A 2UXXA 2YXYA 3P32A 4I4TA 1TVKA 1QQCA 2O57A 3SPCA 2A79B 3OUFA 2Q67A 4CC6A 1V54C 5E79Z 2DWDC 3N2KA 1SETA 4EB6A 1VIBA 4L87A 2JS5A 5CBGA 3CRRA 3JD0A 3B4SA 2PTMA 3RYIA 1GKFA 3CRAA 4X1YB 2F4VB 4R8CA 4B3TB 2H3OA 2ZIMA 4X8AA 4PDRA 5BZBA 2EILB 5BR8B 3E83A 2UXCO 1VQKV 1VQLV 3C90A 4U3JA 4DYLA 3E35A 1KBHA 2JS3A 2OIGA 3K04A 4DR5B 3VOUA 4FM2A 1QLNA 4O2AB 2DQ0A 4KUMA 1AR5A 1NR7A 4MW8A 3TGUH 3CCUV 1R3JC 4HAMA 5EBLC 5JVDA 4DO2A 2DOSA 1AJQA 1QR9A 5CA1A 5LGTA 4AHCA 1COWG 4RWUA 1DLBA 4J7KA 1JQ0A
chains in the Genus database with same CATH topology
4GX2A 4MTFA 3W7XA 3WFVA 2YSUB 1GMGA 3G71V 5H6QA 1PNMA 5B1AB 3K0DA 2R9IA 2D3OW 1GM9A 3ZJZA 3JCZA 3I56V 1NJIW 5IYCO 5C93A 2ATKC 4GX1A 3VBBA 1N8RW 1WLEA 3ZRWA 1YTFD 3NXSA 5CMUA 3T1CA 3ZMSA 3CCJV 4WFGA 4PA7A 1RM1B 4JTCB 3K08A 3FYIB 3K3WA 2QTOA 3RW0A 2ZDIA 1RM1C 4MS2A 1NVPD 3IGAC 1YI2V 1K92A 4MVSA 1R6NA 4UXNA 3AG1B 4PDVA 2OTLV 1V55B 2P7TC 1V55C 3DGEA 1I5YA 4JYCA 1OCZB 1W0JG 2XAFA 1M1KW 1OCZC 1OZ0A 4PA9A 5LBQA 1K4CC 1IXMA 2EINB 1B6QA 3SYQA 2KB1A 4CBCA 2EINC 2AHYA 4MT8A 2WLLB 2HKOA 4H33A 1W0KG 2JK5C 2QA4V 1RPOA 5L3BA 1K73W 1J95A 2ZXWB 4QPKA 2HG5C 1YJWV 2Q68A 3WG7B 2NLJC 3WG7C 1CPYA 1AJNA 1KKDA 4TSFG 2ZDIC 4FJCC 4N21A 4KFMA 4LCUC 1TUEB 4MVQA 3RVZA 4MTOA 2V7QG 4TWKA 2JJ1G 1VQOV 4QPJA 2UXNA 3D36A 3STLC 2WWWA 4Z1MG 1VQPV 4KP4A 5B1OA 4G2KA 3QNEA 1R6KA 3CC7V 1ZWIC 5IY5B 2AHZA 5LHHA 1R73A 3OGCC 1FXKA 5IY5C 1K3EA 5DN6G 2JJ2G 1FS0G 3F7VC 4CZZA 1JX9A 2X6CA 3FB6C 3SYOA 1PL0A 4J9ZB 3LDCA 1OCRB 3ML0A 1K9MW 3ABTA 1SESA 1H2GA 1E1RG 3FYEB 4P9PA 1OCRC 3UKMA 3AG3B 1F51A 1AI7A 3CCRV 4JTAB 2IH3C 1RPRA 3HPLC 2HJFC 3OEHG 1KC8W 2PI5A 3IFXA 2XASA 4QE7A 2IJHA 5B1BB 2EILC 3SJQC 4MW3A 2WLMA 1THZA 5B1BC 4P9OA 5CBFA 4HYOA 3OMAB 3TETA 3LNMB 2Z5UA 1M57B 3W7WA 2WLIB 1M57C 2QM8A 1FXVA 3CCLV 1W2BU 4BW5A 2C2AA 3SPIA 2WPDG 1VQ9V 1QVGU 3CD6V 3E89A 2HVKC 4G28B 1FXKC 1OCCB 4WFFA 2OTJV 4MSWC 1R3IC 2EZOA 1OCCC 3H01A 4QE9A 4RAIA 2YEVB 2X7RB 1K4DC 3CP1A 2OT5A 3HB3B 3RVYA 2HLDG 4UV9A 5KUMA 4WF9V 3T4DA 4GX5A 1WPXA 1PNKA 3E8GA 3ABLB 1GK9A 1K34A 4UVAA 1KECA 1NQTA 3ABLC 3ABKB 3AG2B 3LDEA 4HZ3A 4X88A 3ABKC 2WSSG 1EFRG 3AG2C 4PA4A 5EK0A 5LGUA 3M99B 1AI6A 3TCUA 3SPHA 1VQMV 2IU3A 4LP8A 4P2ZA 1YJ9V 2LP7A 2XOKG 4PDMA 1FFTB 2B5UA 1AROP 1PKXA 2WLLA 4N23A 5B1AC 3JD2A 5FL7G 4ZKIA 3W7SA 5IDJA 1ENVA 3STZC 3CCVV 1SZTA 2P67A 3G4SV 2P6JA 3D3IA 3IC7A 4E2LA 4WCEV 4J9YB 4WFAV 1E1QG 5EC1C 2MK3A 3FB7C 1KD1W 4UV8A 2H8PC 1JQ0A 2ZR3A 3K0GA 3OAAG 4FIPC 3AEIA 1GM7A 3K06A 4PELA 1Q7YW 3ZMVA 5L3CA 4GX0A 3QO5A 4JAUA 1KQSU 1M90W 1BHAA 1S3JA 3AG1C 2QM7A 5E1AC 4R6ZA 4MVRA 1ROPA 2WLNA 1VQ6V 3FB8C 1FXHA 2JEUA 1OHHG 2IJKA 1CP9A 2OCCB 5LGNA 1K5SA 3A0RA 2CK3G 2OCCC 3BEHA 4WFEA 4UVCA 5KUKA 4JAVA 4TT3G 2DYSB 5CN0A 1HWYA 2V1DA 1PD3A 1PNLA 2DYSC 1QVFU 1XL6A 2EIMB 4UVBA 3QO8A 2EIMC 3E2EA 2EIJB 4QNHB 1MABG 1NR1A 1P4RA 5DM6V 2EIKB 2EIJC 3RBZA 2ZXWC 3ZMUA 4RO2A 4LC1A 2EIKC 2IU0A 1S72V 2W6IG 2BOCC 4PDLA 2LFSA 5CBHA 4R50A 1LNQA 3SYCA 1MSWD 2XAHA 1R3KC 1EBOA 1KP3A 2WLIA 3PJSK 1XL4A 4XDKA 1MG1A 4RQEA 2IJJA 1CEZA 1OCOB 1H8HG 1QR8A 2X6BA 1OCOC 2P90A 1NBMG 1BL8A 2XAJA 1K7DA 2Z3YA 2WLKA 1YITV 2HFEC 3SYPA 2YEVA 2DW4A 3ABUA 3F7YC 3CXCU 4PA3A 4ZBMA 3JYCA 5CA3A 5KA5A 5J9PC 1M56B 2IH1C 2JIZG 3E86A 4H37A 3CPWU 1EZJA 4ASUG 1M56C 4F4LA 1NH2B 2R9RB 1YHQV 2XAQA 1S76D 3E8BA 3AG3C 2A0LA 1UJWB 1H38A 3MHHC 2PI4A 4BIUA 1NKDA 3CCEV 2H94A 3EFFK 3E8HA 2NNUA 3I55V 1KP2A 1K33A 4MTGA 2FTKA 5EC2C 1S5HC 4QJFB 2ZQMA 4WFBV 4JGSA 3CMEV 4P30A 1VQ5V 1G8MA 2QKSA 3GB7C 2W0FC 5LHIA 4R7CA 3JD4A 4JF3A 3W7UA 1Q86W 3CC4V 3MHSC 4OXSA 3OR6C 1K97A 3EHBB 1VQ8V 2B1IA 3CC2V 2WLJA 4DXWA 1SRYA 3LSQA 4GCZA 4MVZA 3OE7G 4FPPA 4GT1A 1M9NA 1MOFA 2WLHA 2ITDC 4XDLA 4U7NA 5EBWC 4UUJC 3ZCCA 1Y66A 1S0VA 5IYDO 5H9CA 2M7WA 1Q81W 3E8FA 1JOYA 1AJPA 4LBEC 3OW2U 3P30A 3CYOA 5L3FA 3MD0A 1GM8A 1JVMA 2JEXA 3DTUB 3KG2A 2LFRA 4JPRA 3ASOB 3R65A 5KA6A 4BIZA 3ASOC 3BY6A 4JYBA 2B1GA 2EJRA 1P7BA 2A9HA 2GHYA 2Y69B 1JJ2U 3JD3A 2Y69C 5HFMA 2Y48A 3OMIB 4WFHA 4FMTA 3ZMZA 1F4MA 3T2MA 1DF4A 2DQ3A 3B77A 3FB5C 4XBFA 2HVJC 2DWEC 2Q69A 5B1NA 4RUEA 2X6AA 5IYBO 3ETDA 1L1FA 1S77D 1VQ7V 3TK1A 3OR7C 2ZR2A 3ZN1A 5B3SB 2ITCC 5B3SC 4EKWA 3X2QB 3ETEA 2K1EA 3X2QC 1E79G 1QLEB 3OFNG 3OMNB 3G6EV 2DYRB 4PA6A 1QLEC 3B8MA 2DYRC 5GW7A 1QBZA 2XNDG 1BMFG 1AR1B 1NH2D 3ZRVA 3B8NA 1F4NA 5H6RA 3SPJA 3K9AA 1DTOA 3ZMTA 2WAMA 4MVUA 2EZPA 3LUTB 1YJNV 1QCEA 2QE7G 3T4ZA 2ZD9A 1Q82W 4QIWF 1YTFB 1AI4A 1ORQC 4MVMA 2UXXA 1H8EG 3SYAA 3P32A 3ZRWB 1NVPB 2QEXV 2W6JG 1VQNV 4Q20A 3SPCA 2A79B 3SPGA 2X0LA 2GSMB 3OUFA 4U7OA 2Q67A 1V54B 1V54C 3K03A 1Y4MA 2EBOA 1R3LC 1K5QA 2DWDC 4MTXA 2IJIA 1SETA 3UM7A 3ZRXA 3OM3B 4RUFA 4L87A 4I9WA 4JTDB 4YXWG 3CCMV 5CBGA 3OEEG 3W7TA 3JD0A 3LDDA 3ASNB 4XDJA 3ZIAG 1F23A 3ASNC 2IW5A 3GWOA 5L3EA 2F43G 2HR3A 1GKFA 3CCQV 1YIJV 3K79A 1JPXA 5LHGA 3AG4B 4R8CA 1SERA 3AG4C 4X8AA 3F5WC 3OUSA 4PDRA 5L3GA 1BHBA 5BZBA 1VQ4V 2EILB 3ZN0A 3QO7A 3E83A 2XAGA 3ABMB 2BOBC 3JD1A 1K8AW 1VQKV 3ABMC 1VQLV 1YSCA 4FK5C 5L3DA 1JCHA 3ZRSA 1I5XA 3E35A 1AI5A 4BAYA 1GTOA 3K04A 4JASA 3VOUA 3CCSV 2JDIG 4G27B 1QLNA 1FXKB 3LSSA 2DQ0A 4KUMA 1NR7A 1G4YB 5EBMC 4MW8A 3CCUV 4X89A 1R3JC 4HAMA 3CMAV 5EBLC 2Q6AA 4DO2A 1AJQA 1QR9A 3FKSG 4RQFA 3ETGA 5LGTA 4I5SA 1GO3F 4MVOA 1COWG 1DLBA 1DF5A 5HFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M99 B;  4FIP C;  3B8M A;  1Y66 A;  1F23 A;  3WFV A;  4JGS A;  5H9C A;  2M7W A;  1QBZ A;  2LP7 A;  3GWO A;  5KA5 A;  1JPX A;  3B8N A;  1DF4 A;  3B77 A;  3CYO A;  3P30 A;  4N23 A;  1I5Y A;  4JF3 A;  2EZO A;  4FJC C;  4N21 A;  1DF5 A;  3H01 A;  3K9A A;  1Y4M A;  3MHS C;  2EBO A;  2X7R B;  3CP1 A;  2OT5 A;  1ENV A;  1EBO A;  3MHH C;  4JPR A;  1SZT A;  2EZP A;  2P6J A;  5KA6 A;  4G2K A;  4E2L A;  1MG1 A;  5CMU A;  1K33 A;  1QCE A;  1QR9 A;  1K34 A;  1QR8 A;  2MK3 A;  4FK5 C;  5CN0 A;  1MOF A;  1I5X A;  5HFM A;  1DLB A;  1JQ0 A;  5HFL A; 
#chains in the Genus database with same CATH topology
 4GX2 A;  4DR3 O;  4MTF A;  3OD4 A;  1PNM A;  4CH3 A;  3SJC C;  2VQF B;  2RDC A;  3CJH A;  5B66 Z;  1BS3 A;  4LWS A;  4D7S A;  4LH7 A;  2KG7 B;  1NJI W;  3RYF B;  1YTF D;  4DV1 B;  2ZE5 A;  3K3W A;  1YZB A;  3GVM A;  4MS2 A;  1WB8 A;  3U11 A;  4UXN A;  4DW1 A;  1P7G A;  1V55 B;  4DR1 B;  1I5Y A;  1KU9 A;  5JH7 B;  1M1K W;  1K4C C;  1IXM A;  5FNV A;  1B6Q A;  3O9O A;  4O4L B;  2EIN C;  4JI2 B;  4UCO A;  2Q7E A;  2XT9 A;  2JK5 C;  3JAT A;  2QA4 V;  1M93 A;  4GZR B;  2A3Q A;  3A2F A;  3LNN A;  2V4D A;  5JQG A;  2NLJ C;  4DV2 B;  3WG7 C;  2CH7 B;  5J2U A;  1KKD A;  4TSF G;  2ZDI C;  4KFM A;  4X65 O;  4MVQ A;  4TWK A;  1BGY H;  4QPJ A;  2UXN A;  1D5A A;  3T1Y O;  4Z1M G;  2Y4U A;  1VQP V;  3FAV B;  4G2K A;  1R6K A;  3CC7 V;  2JJ2 G;  2VQE B;  3F7V C;  3SYO A;  2YI9 A;  3LDC A;  4A5U B;  1K9M W;  1H2G A;  1E1R G;  1KMI Z;  1US6 A;  4DV0 O;  5JJN B;  4JTA B;  2IH3 C;  2YIC A;  2HJF C;  2PI5 A;  4FLV A;  1S5J A;  1THZ A;  4O2B B;  2ADP A;  3OTF A;  4LF7 B;  1GN4 A;  4HYO A;  1Q90 D;  3TET A;  1M57 B;  2QM8 A;  1I94 B;  2JGD B;  3UCS C;  2PYJ A;  1H2N A;  2C2A A;  3CD6 V;  4G28 B;  1N34 O;  1R3I C;  2EZO A;  1OCC C;  5ITZ B;  2ODM A;  2X7R B;  3HB3 B;  3RVY A;  4DV7 O;  4UV9 A;  2ZNI A;  1G6U A;  2RJZ A;  4GX5 A;  4X1I B;  1N33 O;  2QGN A;  3ABL B;  2ZM6 O;  1K34 A;  4LF9 B;  4X88 A;  1GN3 A;  3ABK C;  1EFR G;  3AG2 C;  5K1X A;  3M99 B;  5KHG A;  4K0K B;  4J7Z A;  5GTH Z;  2B5U A;  1PKX A;  3JD2 A;  4DK1 A;  5IDJ A;  4EFE A;  1SZT A;  5JJJ B;  3CS5 A;  3G4S V;  2P6J A;  4JI7 B;  4J9Y B;  2MK3 A;  3FB7 C;  4UV8 A;  3K0G A;  1N36 O;  3K06 A;  1A32 A;  2B9Z A;  4PEL A;  5L3C A;  4LFC O;  2ZE6 A;  1JR9 A;  1M90 W;  1B06 A;  1S3J A;  2QM7 A;  4LFA B;  5FPR A;  4MVR A;  1VQ6 V;  2BSK A;  3FB8 C;  1FPO A;  1VF7 A;  1OHH G;  5LGN A;  4PHZ A;  5KUK A;  4TT3 G;  2AZ0 A;  2V1D A;  1PD3 A;  1QVF U;  2EIM C;  4QNH B;  2EIK B;  1JA8 A;  4K3A A;  1S5L Z;  4LC1 A;  2P06 A;  3MDS A;  2UXC B;  2CUG A;  5GTI Z;  1LNQ A;  2XAH A;  1R3K C;  3PJS K;  1Q5O A;  2WLI A;  3FD9 A;  1XL4 A;  5BY1 A;  4RQE A;  5LA6 B;  2X6B A;  4O4H B;  2P90 A;  3K5O A;  1BL8 A;  2Z3Y A;  1SC5 B;  1VF6 A;  1YIT V;  4CC5 A;  2DW4 A;  4PA3 A;  3CRM A;  1VAR A;  5DED A;  3E86 A;  1M56 C;  4UCU A;  2R9R B;  1S76 D;  3ICX A;  3E8B A;  1XIL A;  2HP8 A;  1YDX A;  3AG3 C;  1UJW B;  2PI4 A;  2RNB A;  2L6L A;  3E8H A;  3I55 V;  4DR3 B;  1K33 A;  1FAF A;  3K59 A;  3H1J H;  5EC2 C;  1S5H C;  2QR4 A;  3AK2 A;  2A06 H;  3CME V;  4R7C A;  1BSM A;  3K5L A;  4I4T B;  1TVK B;  1VQ8 V;  3CC2 V;  4FLW A;  3Q4H A;  1SRY A;  4ZIB A;  1Z5W A;  1FKA O;  4DR6 O;  3N2K B;  2R9A A;  4EB6 B;  3ZCC A;  3D8C A;  5H9C A;  2M7W A;  3THO A;  1Q81 W;  4FZ1 A;  1Y74 A;  2XHB A;  4DR2 O;  4Z1V A;  4LBE C;  3HKD B;  2P22 C;  5L3F A;  1GM8 A;  4JI0 O;  2JEX A;  4B3M O;  3RYI B;  3ASO B;  4I50 B;  5KA6 A;  2OCH A;  3DSQ A;  4JYB A;  1EN4 A;  3JD3 A;  4IYH A;  2F93 B;  2Y48 A;  2QKA A;  1WAZ A;  2UXB O;  4X65 B;  1WA8 A;  4WFH A;  3IAY A;  1X59 A;  3ZMZ A;  1Q43 A;  3D3Q A;  3ZHQ A;  3ZHR A;  3T1Y B;  4U3J B;  1DF4 A;  3B77 A;  4JYA O;  4NTY A;  2Q69 A;  1EZV H;  1GAX A;  2ETN A;  1VQ7 V;  3TK1 A;  2ZR2 A;  5B3S B;  4GKJ O;  1XQ8 A;  2ITC C;  1IBK O;  3X2Q B;  3QVN A;  3OMN B;  1M5I A;  4DV0 B;  1IUR A;  1Z5V A;  5JVD B;  1QBZ A;  1BMF G;  1AR1 B;  4DR4 O;  5CA1 B;  1N4C A;  2OWO A;  5H6R A;  1HR0 O;  2F66 C;  1HDJ A;  4B7K A;  1SQP H;  1DTO A;  3DC5 A;  3CJH B;  1WP7 A;  4LWS B;  1QCE A;  3T4Z A;  1YJN V;  1Q82 W;  1T5E A;  4QIW F;  3L73 H;  1ORQ C;  4D6T H;  3QF7 A;  1D2D A;  4PJ0 Z;  1H8E G;  2CTW A;  1N34 B;  3OGI B;  2RQ6 A;  4CH6 A;  1VQN V;  3SPG A;  1PPJ H;  4DV7 B;  1N33 B;  5IJ0 A;  2ZM6 B;  2EBO A;  1R3L C;  1K5Q A;  3IC9 A;  2PZS A;  4MTX A;  2IJI A;  3UM7 A;  3S3W A;  4RUF A;  2Y4T A;  2F23 A;  4I9W A;  4JTD B;  3LDD A;  3ASN B;  3H1I H;  1F23 A;  4J10 A;  4FM0 A;  3K5N A;  2IM9 A;  2HR3 A;  3JAT B;  3K79 A;  5LHG A;  2VWJ A;  1XI1 A;  1HW7 A;  3OUS A;  3ZN0 A;  3QO7 A;  1N36 B;  3EXA A;  2XAG A;  3ABM B;  3ZHS A;  5J2U B;  4LFC B;  5FLX N;  4NXM O;  5L3D A;  1KKC A;  3G80 A;  4BAY A;  3D36 C;  1GN6 A;  2CGN A;  5F2V O;  2ZCE A;  4G27 B;  1IDS A;  3JAW A;  5EBM C;  4X89 A;  1HNW O;  4OGQ B;  4DV4 O;  2Q6A A;  3ETG A;  4CS3 A;  1DF5 A;  1I0H A;  2Q0A A;  1GMG A;  3G71 V;  5H6Q A;  3L74 H;  1TUB A;  1SQG A;  1PV0 A;  3WB2 A;  3ZJZ A;  4B7E A;  3VBB A;  5CB4 B;  1OJH A;  1WLE A;  3ZRW A;  3T1C A;  5CMU A;  2QSA A;  1RM1 B;  1MZF A;  3K08 A;  2ZDI A;  3IGA C;  1YI2 V;  1R6N A;  3H9V A;  1EN6 A;  3ZS8 C;  5KAF Z;  3DGE A;  1V55 C;  1IX9 A;  1W0J G;  3HKE A;  4X9Q A;  1NS1 A;  1YEW A;  2QJ1 A;  2YXH A;  1M4U A;  3SYQ A;  4CBC A;  2GDS A;  3RWR D;  1RSO A;  3HR0 A;  2ZE7 A;  2CGO A;  4QPK A;  1AB3 A;  4B3S O;  4JI3 O;  4N21 A;  4FJC C;  1TUE B;  3RVZ A;  4I55 A;  4DR6 B;  5LP6 A;  1B3Q A;  5B1O A;  2GV9 A;  3QNE A;  1ZWI C;  2AHZ A;  3OGC C;  1K3E A;  2BSK B;  1FS0 G;  3VQW A;  2P4K A;  4KXR A;  4L8J A;  4DR2 B;  2UUB O;  3CEI A;  3HKD A;  4JI0 B;  4B3M B;  3BPZ A;  3KZI Z;  2Q5Z A;  4P9P A;  4LF6 O;  4I50 A;  3APQ A;  3UKM A;  1AI7 A;  4UCT A;  3HPL C;  4X62 O;  3OEH G;  2XAS A;  4MW3 A;  2UXB B;  5CBF A;  4K8X A;  2WLI B;  1M57 C;  3ZHT A;  1B04 A;  4JYA B;  4LR3 A;  3A0H Z;  4JYY A;  2OTJ V;  1FXK C;  1PP9 H;  3BCC H;  2A7W A;  3BA8 A;  4ICG A;  1Q6I A;  4GKJ B;  4I0X A;  4QE9 A;  5DEC A;  1IBK B;  3CP1 A;  5KAI Z;  2HLD G;  4UB6 Z;  3OT7 A;  2VWK A;  3T4D A;  1WPX A;  4UVA A;  1KEC A;  1WB7 A;  3ABL C;  4DR4 B;  3LDE A;  4HZ3 A;  4PA4 A;  5LGU A;  1HR0 B;  2XOK G;  3BHP A;  2FB5 A;  4PDM A;  2N04 A;  1ARO P;  4N23 A;  5B1A C;  4ZKI A;  1ENV A;  4CS4 A;  3STZ C;  5D5P A;  3D3I A;  4E2L A;  1ZLZ A;  1IVS A;  2KKW A;  1E1Q G;  2HEP A;  1KD1 W;  5JCO C;  2ZR3 A;  5IT9 N;  1AP6 A;  4BR6 A;  3Q4H B;  1KQS U;  1BHA A;  4LF5 O;  1Y76 A;  3AG1 C;  1LUV A;  3WB1 A;  2CDY A;  1WJZ A;  2JEU A;  1DK1 A;  4DV5 O;  5JJE B;  2IJK A;  1Y74 B;  1H2M A;  2OCC B;  1K5S A;  3BEH A;  4UVC A;  2DYS B;  1HWY A;  1PNL A;  2YUA A;  4UVB A;  3QO8 A;  3UO3 A;  2EIJ B;  1MAB G;  2QKC A;  4LF4 O;  2ZXW C;  2EIK C;  1S72 V;  1HNZ O;  4OX9 O;  2BOC C;  4PDL A;  2DE0 X;  3IJ4 A;  4NYK A;  1WA8 B;  4NXM B;  4LF8 O;  1MG1 A;  1OCO B;  1QR8 A;  4B3R O;  1NBM G;  2XAJ A;  4JI6 O;  2WLK A;  4ZBM A;  2XTA A;  1J5E O;  1Q6H A;  1HNW B;  2FKX A;  5J9P C;  2JIZ G;  4DV4 B;  4ASU G;  4F4L A;  2XAQ A;  4LFB O;  2E74 B;  4U3F H;  2LGQ A;  2Q7G A;  1NKD A;  4BIU A;  3CCE V;  2CTQ A;  1KP2 A;  3QG5 A;  3BFR A;  2ZE8 A;  4QJF B;  2ZQM A;  4OPA A;  2CAZ C;  1TAE A;  1JMK C;  1G8M A;  3GB7 C;  5CB4 A;  5LHI A;  3B40 A;  3CC4 V;  4OXS A;  1K97 A;  2B1I A;  1EM1 A;  1GH6 A;  1H2L A;  3FX7 A;  4JI1 O;  4GCZ A;  4MVZ A;  3WB0 A;  3OE7 G;  4FPP A;  4ZI7 A;  5IJ0 B;  4TV9 A;  1MOF A;  5J2T A;  2YIB A;  5EBW C;  4UUJ C;  3UO2 A;  5IYD O;  1NZ6 A;  3N2G A;  3MD0 A;  5IYZ A;  1JVM A;  5BMV A;  1BQ0 A;  3RYH B;  2CE4 A;  4I9Q A;  3JSN A;  5A9G A;  4BIZ A;  3ASO C;  4DRX B;  3BY6 A;  4H13 B;  2Q73 A;  1P7B A;  4X66 O;  1JJ2 U;  5EZY B;  5HFM A;  4B3S B;  4JI3 B;  4GKK O;  4FMT A;  1YF2 A;  2LQT A;  3E22 A;  3T2M A;  2AZ2 A;  3GWK C;  1SQQ H;  4RUE A;  2UUB B;  1DGS A;  5K1P A;  3ZN1 A;  3CE2 A;  5B3S C;  3JAW B;  3X2Q C;  1QLE B;  3OFN G;  3G6E V;  4LF6 B;  2DYR B;  1MMM A;  3B8M A;  4YHH O;  4J7J A;  2QTS A;  1XEQ A;  3P3N A;  4GUN A;  4X62 B;  3L75 H;  3SPJ A;  4EFB A;  1BT8 A;  1TUB B;  1LUW A;  4X20 A;  2EZP A;  1VEW A;  1H2S B;  1TA8 A;  2ZD9 A;  3JAL A;  4FLU A;  1ZL8 A;  4FZ0 A;  4YJ2 B;  3ZRW B;  1NVP B;  2QEX V;  5H5N A;  2W6J G;  1UFI A;  2QDO A;  4Q20 A;  2X0L A;  1L0N H;  3CWB H;  3JSL A;  3ZRX A;  3OM3 B;  2E3C A;  1NT2 B;  3HKE B;  4YXW G;  3OEE G;  3TXS A;  3W7T A;  4XDJ A;  3ZIA G;  2GBO A;  3ASN C;  2IW5 A;  3GWO A;  5KHH A;  1RSO B;  3AG4 B;  1SER A;  1N0J A;  1GRJ A;  3F5W C;  1BHB A;  2G38 A;  3DC6 A;  3JD1 A;  1O9H A;  1BQZ A;  3ABM C;  1YSC A;  4I55 B;  4LF5 B;  3ZRS A;  1I5X A;  5LP6 B;  1KYO F;  2UU9 O;  1GTO A;  4JAS A;  3SJB C;  3CCS V;  2JDI G;  1ZUQ A;  3LSS A;  3G67 A;  4WBN B;  4DV5 B;  1G4Y B;  2E76 B;  5B5E Z;  2ZNJ A;  3CMA V;  3C3S A;  2UUC O;  4RQF A;  4I5S A;  3ETQ A;  1GO3 F;  4LF4 B;  4MVO A;  2YI8 A;  5HFL A;  1HNZ B;  1W59 A;  4OX9 B;  3WFV A;  2YSU B;  2D2C B;  4LF8 B;  3TXQ A;  2R9I A;  2D3O W;  1VP7 A;  3J7A U;  1GM9 A;  2WA3 A;  3CB2 A;  3I56 V;  5EIB D;  1FFX A;  2ATK C;  4GX1 A;  4B3R B;  3SJA C;  2EX3 A;  4TQF A;  1JFF A;  4JI6 B;  3UT5 A;  3NXS A;  3ZMS A;  4HNA A;  3CCJ V;  4I0X B;  1XDC A;  4JTC B;  1WP8 A;  3FYI B;  2QTO A;  1J5E B;  1RM1 C;  1NVP D;  3J80 N;  1K92 A;  4MVS A;  2W0X A;  4LFB B;  2OYQ A;  3JAM N;  3LSU A;  3CXH F;  4JYC A;  4NR1 A;  5IWA O;  1OCZ B;  2JRI A;  2XAF A;  1OZ0 A;  3L9D A;  5C8Y A;  1IZ3 A;  4JZ2 A;  4YIP A;  3JCU Z;  2RMK B;  4H33 A;  2Y0P A;  3QTC A;  5L3B A;  3CX5 F;  2Y0I A;  3VQV A;  2HG5 C;  2E5L O;  4QGP A;  4H0L B;  1CPY A;  2UXD O;  3C3T A;  4JI1 B;  4C7U A;  1IBL O;  2JJ1 G;  1VQO V;  4OPH A;  1Y76 B;  4KP4 A;  3T1H O;  5IY5 B;  2PYL A;  1FXK A;  4FFB A;  5DN6 G;  2QWP B;  4CZZ A;  3JAS A;  4AI8 A;  3RYC A;  2LJ2 A;  2JGU A;  3RYH A;  1OCR B;  3U10 A;  3NR7 A;  1LR1 A;  3M7M X;  4NTX A;  4NVP A;  1EN5 A;  3AG3 B;  1F51 A;  4DRX A;  1MZE A;  2DJV A;  4X66 B;  1KC8 W;  5EZY A;  5B1B B;  2IJH A;  2EIL C;  1ZX3 A;  1JJO A;  2WLM A;  3BA9 A;  4GKK B;  5FPO A;  5LOV A;  3LNM B;  2Z5U A;  3W7W A;  1FXV A;  4Q6G A;  2ZIO A;  4GLX A;  2P5O A;  2WPD G;  3BRC A;  1VQ9 V;  3DXR A;  2HVK C;  4FLT A;  4LNU B;  4MSW C;  3H01 A;  4RAI A;  1VF6 C;  4IYI A;  4DR7 O;  1K4D C;  5KHI A;  5KUM A;  4FM1 A;  4YHH B;  1GK9 A;  4Z2W A;  2YXL A;  3ZED A;  1VQM V;  4P2Z A;  3ZHV A;  2EUL A;  2WLL A;  1Q3E A;  3AK3 A;  5FL7 G;  1MA1 A;  1NI8 A;  3AG7 A;  2M6Y A;  1BE3 H;  5CA0 A;  1XNR O;  4YJ2 A;  3CCV V;  3JAR A;  2P67 A;  2CTR A;  4IIJ A;  4WFA V;  5EC1 C;  4DUZ O;  4O4J A;  2H8P C;  3K5M A;  4TV8 A;  2AGA A;  1ZTE A;  1QHT A;  2QWN B;  4FIP C;  4TUY A;  1GM7 A;  5BXZ A;  4YY3 O;  4GX0 A;  3QO5 A;  4JAU A;  4ZI7 B;  5E1A C;  4TV9 B;  4R6Z A;  5J2T B;  4NXN O;  1ROP A;  2WLN A;  1VMG A;  3RT3 C;  5LMN O;  2RN9 A;  2BE3 A;  2CK3 G;  2GUZ A;  2OCC C;  3N2G B;  5IYZ B;  5BMV B;  3VQY A;  2DYS C;  1OV9 A;  3L70 H;  3E2E A;  1NR1 A;  1P4R A;  2EIJ C;  3ZMU A;  3RGB A;  2IU0 A;  5CBH A;  3E22 B;  4XDK A;  1P84 F;  2UU9 B;  2IJJ A;  1Q8I A;  1CEZ A;  1H8H G;  3TJT A;  1OCO C;  4WBN A;  2Q8V A;  4JI7 O;  4YIO A;  2HFE C;  3SYP A;  2YEV A;  3CXC U;  3ABU A;  4F6R A;  3SR2 C;  5CA3 A;  5KA5 A;  4EEQ A;  1NH2 B;  4TQD A;  2UUC B;  4UCR A;  3MAQ A;  1SF9 A;  3MHH C;  4LFA O;  3RFR A;  4TOI A;  2NNU A;  1N32 O;  4X20 B;  4WFB V;  1UPG A;  1RFY A;  2LW7 A;  1NTM H;  3HKB A;  4JGS A;  4P30 A;  1QNM A;  2LGW A;  1R6T A;  3JAL B;  1VQ5 V;  1ZL8 B;  4X64 O;  2N74 A;  4YJ3 B;  4JF3 A;  3W7U A;  1Q86 W;  4BIO A;  1TGO A;  3EHB B;  5EYP A;  2RCV A;  1SQF A;  4DW0 A;  3CRQ A;  2WLJ A;  4UFZ A;  4DXW A;  3A0B Z;  3LSQ A;  4GT1 A;  3N27 A;  1M9N A;  4DUY O;  4XDL A;  4JAA A;  4ZHQ A;  5IWA B;  2HJD A;  2YIB D;  3E8F A;  1JOY A;  1AJP A;  4X1K A;  3P30 A;  3CYO A;  3UQ8 A;  1BZK A;  2LFR A;  4IHJ B;  3R65 A;  4PI2 A;  2BTQ A;  2B1G A;  2EJR A;  2E5L B;  2A9H A;  2GHY A;  2Y69 B;  3G6B A;  1XNQ O;  2N05 A;  1U96 A;  3OMI B;  3HKC A;  2UXD B;  1IBL B;  2YDE A;  1MSD A;  1F4M A;  2DQ3 A;  4XBF A;  3T1H B;  2DWE C;  1SQX H;  2X6A A;  5IYB O;  1S77 D;  4J80 A;  4AIL C;  4J42 A;  1KB9 F;  3K57 A;  3ETE A;  2DMX A;  4HBN A;  5KX5 A;  1ZAU A;  1E79 G;  4JI4 O;  5AG2 A;  4DV3 O;  1QLE C;  2DYR C;  2P4V A;  5GW7 A;  1FJG O;  2XND G;  1NH2 D;  4JI8 O;  1Y6X A;  4O4I A;  3K9A A;  2F95 B;  1AVM A;  3ZMT A;  2WAM A;  2K9P A;  4MVU A;  3BAB A;  1L0L H;  1SZX A;  5EIB C;  2QE7 G;  1WN7 A;  5D5Q A;  1AIL A;  1FFX B;  4MVM A;  5GON A;  3U0Z A;  3SYA A;  4JI5 O;  2QWR B;  1JFF B;  4LNU A;  3UT5 B;  4KHP O;  4HNA B;  4DR7 B;  1WNS A;  2GSM B;  4U7O A;  1V54 B;  1F7Y A;  5LXT A;  2R70 A;  3K03 A;  1Y4M A;  2BTO A;  4BWA A;  4ZOL B;  3F5T A;  2LO1 A;  3BAA A;  3CCM V;  4JV5 O;  1V9P A;  5C8Y B;  2QM4 A;  4LH6 A;  1YVW A;  1FD9 A;  5L3E A;  2F43 G;  3ZX6 A;  3CCQ V;  1XNR B;  1YIJ V;  1XMQ O;  1JPX A;  4IGG A;  3AG4 C;  2EJ7 A;  5L3G A;  1VQ4 V;  4DUZ B;  1XMO O;  1CXZ B;  2BOB C;  1K8A W;  2HHH O;  3P3P A;  4W4L A;  4YY3 B;  4FK5 C;  4I7Z B;  1JCH A;  3KCY A;  1AI5 A;  4NXN B;  5LP6 C;  2MW2 B;  4DV6 O;  4CS2 A;  1FXK B;  4FFB B;  5LMN B;  3JAS B;  3RYC B;  1IBM O;  1P49 A;  2Z0A A;  5LYJ A;  5KMG B;  5KHJ A;  1L8D A;  2ZKO A;  3APO A;  4CH5 A;  2JVD A;  3FKS G;  1XHX A;  4B08 A;  1SA0 A;  3ZBH A;  3W7X A;  1PM9 A;  3JAK A;  4FVM A;  5LOV B;  5B1A B;  3K0D A;  2CTP A;  4ABM A;  5LMU O;  3JCZ A;  1X4T A;  5IYC O;  5C93 A;  3EVK A;  3SDL A;  1N8R W;  4K35 A;  4JZG A;  3DXR B;  2E75 B;  1GN2 A;  4WFG A;  2ARH A;  4PA7 A;  2QWQ B;  3B09 A;  3RW0 A;  1XUQ A;  3R66 A;  2YS8 A;  3AG1 B;  4PDV A;  2GTA A;  2AXT Z;  1XOU A;  5IJ9 B;  2OTL V;  2P7T C;  1RP3 B;  2ADQ B;  1OCZ C;  4PA9 A;  3CSX A;  5LBQ A;  1N32 B;  2EIN B;  4F6E A;  1AR4 A;  2KB1 A;  2AHY A;  4MT8 A;  2WLL B;  1QU7 A;  2HKO A;  1W0K G;  2UUA O;  5CA0 B;  1RPO A;  4X1Y A;  4X64 B;  1K73 W;  5H2F Z;  3JAR B;  2Q7H A;  1J95 A;  4YJ3 A;  4IIJ B;  2ZXW B;  1U97 A;  1YJW V;  4FLZ A;  2Q68 A;  4DK0 A;  3OTO O;  3WG7 B;  4IT5 A;  4O4J B;  4TV8 B;  1AP5 A;  1AJN A;  4TUY B;  4LCU C;  1XBL A;  4MTO A;  2V7Q G;  2Q9L A;  1G1X B;  3D36 A;  3STL C;  2WWW A;  3ZHU A;  4DUY B;  4H44 B;  1Z2G A;  5LHH A;  1R73 A;  4KL1 A;  4O2A A;  5IY5 C;  1PL4 A;  4E4E A;  1JX9 A;  2NR5 A;  2X6C A;  3FB6 C;  1PL0 A;  4J9Z B;  2GUZ B;  1MNG A;  3L72 H;  3ML0 A;  2AW9 A;  1YCI A;  3ABT A;  1SES A;  3FYE B;  2FL4 A;  1OCR C;  4IHJ A;  3VQX A;  3CCR V;  1HNX O;  2PF4 E;  1RPR A;  2BCC H;  3H1H H;  1XNQ B;  3IFX A;  4QE7 A;  3SJQ C;  1I7F A;  1I08 A;  5B1B C;  4P9O A;  3H1K H;  3L71 H;  1WPB A;  3OMA B;  1SKV A;  1SQB H;  3KKY A;  3H1L H;  1XHZ A;  4AQY O;  2KG7 A;  3CCL V;  1W2B U;  4BW5 A;  4J41 A;  2F1M A;  3SPI A;  3RYF A;  1QVG U;  3E89 A;  3B2E E;  4WFF A;  1OCC B;  2DN9 A;  4FLY A;  2YEV B;  4F6R B;  2OT5 A;  2IBZ H;  4WF9 V;  4JI4 B;  4DV3 B;  3E8G A;  1PNK A;  1FJG B;  1NQT A;  3K58 A;  3ABK B;  1D5N A;  3AG2 B;  4JI8 B;  2WSS G;  3K9S A;  5EK0 A;  2ZT9 B;  5JH7 A;  1AI6 A;  2PUS A;  1O9G A;  3SPH A;  3TCU A;  2IU3 A;  1IXB A;  4LP8 A;  1YJ9 V;  2LP7 A;  1VF5 B;  1FFT B;  4O4L A;  1SS3 A;  1URF A;  2WA4 A;  3W7S A;  3RN4 A;  3HKB B;  4PD4 F;  2F4V O;  4JI5 B;  4B3T O;  3IC7 A;  4WCE V;  4KHP B;  5BR8 O;  4UCV A;  1Y67 A;  3OAA G;  2CH7 A;  5EYP B;  3AEI A;  5JWP A;  1Q7Y W;  3ZMV A;  4CH4 A;  2KQX A;  3FAV A;  4ZOL A;  5A2Q N;  4FLX A;  4DR5 O;  4W4K A;  4K8Z A;  4ZHQ B;  2FML A;  1FXH A;  4JV5 B;  1SQV H;  1CP9 A;  2YC0 A;  4NB5 A;  4X1K B;  3A0R A;  3FFQ A;  4WFE A;  4JAV A;  1N0N A;  5CN0 A;  1XMQ B;  5KLV H;  1XL6 A;  2EIM B;  2VRZ A;  5TIS Z;  2BTQ B;  5DM6 V;  4PI0 A;  3RBZ A;  3KCX A;  4RO2 A;  1XMO B;  2W6I G;  2LFS A;  2HHH B;  4O2B A;  4R50 A;  3SYC A;  3HKC B;  1MSW D;  3WU2 Z;  3O65 A;  1EBO A;  1KP3 A;  2VQF O;  2JGD A;  4DV6 B;  4NKG B;  5IE9 A;  1K7D A;  3M8A A;  4NTW A;  4DV1 O;  5ITZ A;  3I5D A;  3F7Y C;  1IBM B;  1KUQ A;  3JYC A;  5KMG A;  1NTK H;  5KX5 B;  1M56 B;  2IH1 C;  4X1I A;  4H37 A;  3CPW U;  1EZJ A;  3BVO A;  1YHQ V;  2A0L A;  1ZSP A;  1H38 A;  1XRE A;  4DR1 O;  2H94 A;  3EFF K;  2LW1 A;  1NU1 H;  1HP8 A;  1R1B A;  4O4I B;  4MTG A;  2FTK A;  5FNV B;  4JI2 O;  2R72 A;  5LMU B;  2NN4 A;  2PGG A;  2QKS A;  2W0F C;  5GON B;  5JCO A;  3JD4 A;  3J81 N;  4IL6 Z;  3MHS C;  4GYC B;  5JQG B;  3OR6 C;  4DV2 O;  2VS0 A;  3SGI A;  5LXT B;  1YXB A;  4J11 A;  5IJ9 A;  2WLH A;  2ITD C;  4U7N A;  1S0V A;  1Y66 A;  3PN1 A;  1NTZ H;  1Q6U A;  2VQE O;  3OW2 U;  3A8T A;  3CRC A;  2UUA B;  3DTU B;  3KG2 A;  4D7T A;  2Q4P A;  4JPR A;  2PY5 A;  2KSD A;  3OTO B;  2Y69 C;  2L35 A;  2ZIN A;  4LF7 O;  2YIA A;  1FYJ A;  2OIE A;  1I94 O;  3FB5 C;  2HVJ C;  5LA6 A;  4O4H A;  5B1N A;  2Q0O C;  3ETD A;  1L1F A;  3S3X A;  3OR7 C;  4EKW A;  3AK1 A;  2K1E A;  1H2K A;  5LYJ B;  4PV1 B;  4PA6 A;  5LL6 Y;  5KHK A;  4UB8 Z;  1HNX B;  2QWO B;  2ILM A;  4UCS A;  4LF9 O;  4BW9 A;  3ZRV A;  3B8N A;  1F4N A;  2FYU H;  1SA0 B;  3CHX A;  4K0K O;  3JAK B;  2XUM A;  2GTS A;  4AQY B;  2YID A;  3LUT B;  1BCC H;  4FFK A;  1YTF B;  1AI4 A;  2UXX A;  2YXY A;  3P32 A;  4I4T A;  1TVK A;  1QQC A;  2O57 A;  3SPC A;  2A79 B;  3OUF A;  2Q67 A;  4CC6 A;  1V54 C;  5E79 Z;  2DWD C;  3N2K A;  1SET A;  4EB6 A;  1VIB A;  4L87 A;  2JS5 A;  5CBG A;  3CRR A;  3JD0 A;  3B4S A;  2PTM A;  3RYI A;  1GKF A;  3CRA A;  4X1Y B;  2F4V B;  4R8C A;  4B3T B;  2H3O A;  2ZIM A;  4X8A A;  4PDR A;  5BZB A;  2EIL B;  5BR8 B;  3E83 A;  2UXC O;  1VQK V;  1VQL V;  3C90 A;  4U3J A;  4DYL A;  3E35 A;  1KBH A;  2JS3 A;  2OIG A;  3K04 A;  4DR5 B;  3VOU A;  4FM2 A;  1QLN A;  4O2A B;  2DQ0 A;  4KUM A;  1AR5 A;  1NR7 A;  4MW8 A;  3TGU H;  3CCU V;  1R3J C;  4HAM A;  5EBL C;  5JVD A;  4DO2 A;  2DOS A;  1AJQ A;  1QR9 A;  5CA1 A;  5LGT A;  4AHC A;  1COW G;  4RWU A;  1DLB A;  4J7K A;  1JQ0 A; 
#chains in the Genus database with same CATH homology
 4GX2 A;  4MTF A;  3W7X A;  3WFV A;  2YSU B;  1GMG A;  3G71 V;  5H6Q A;  1PNM A;  5B1A B;  3K0D A;  2R9I A;  2D3O W;  1GM9 A;  3ZJZ A;  3JCZ A;  3I56 V;  1NJI W;  5IYC O;  5C93 A;  2ATK C;  4GX1 A;  3VBB A;  1N8R W;  1WLE A;  3ZRW A;  1YTF D;  3NXS A;  5CMU A;  3T1C A;  3ZMS A;  3CCJ V;  4WFG A;  4PA7 A;  1RM1 B;  4JTC B;  3K08 A;  3FYI B;  3K3W A;  2QTO A;  3RW0 A;  2ZDI A;  1RM1 C;  4MS2 A;  1NVP D;  3IGA C;  1YI2 V;  1K92 A;  4MVS A;  1R6N A;  4UXN A;  3AG1 B;  4PDV A;  2OTL V;  1V55 B;  2P7T C;  1V55 C;  3DGE A;  1I5Y A;  4JYC A;  1OCZ B;  1W0J G;  2XAF A;  1M1K W;  1OCZ C;  1OZ0 A;  4PA9 A;  5LBQ A;  1K4C C;  1IXM A;  2EIN B;  1B6Q A;  3SYQ A;  2KB1 A;  4CBC A;  2EIN C;  2AHY A;  4MT8 A;  2WLL B;  2HKO A;  4H33 A;  1W0K G;  2JK5 C;  2QA4 V;  1RPO A;  5L3B A;  1K73 W;  1J95 A;  2ZXW B;  4QPK A;  2HG5 C;  1YJW V;  2Q68 A;  3WG7 B;  2NLJ C;  3WG7 C;  1CPY A;  1AJN A;  1KKD A;  4TSF G;  2ZDI C;  4FJC C;  4N21 A;  4KFM A;  4LCU C;  1TUE B;  4MVQ A;  3RVZ A;  4MTO A;  2V7Q G;  4TWK A;  2JJ1 G;  1VQO V;  4QPJ A;  2UXN A;  3D36 A;  3STL C;  2WWW A;  4Z1M G;  1VQP V;  4KP4 A;  5B1O A;  4G2K A;  3QNE A;  1R6K A;  3CC7 V;  1ZWI C;  5IY5 B;  2AHZ A;  5LHH A;  1R73 A;  3OGC C;  1FXK A;  5IY5 C;  1K3E A;  5DN6 G;  2JJ2 G;  1FS0 G;  3F7V C;  4CZZ A;  1JX9 A;  2X6C A;  3FB6 C;  3SYO A;  1PL0 A;  4J9Z B;  3LDC A;  1OCR B;  3ML0 A;  1K9M W;  3ABT A;  1SES A;  1H2G A;  1E1R G;  3FYE B;  4P9P A;  1OCR C;  3UKM A;  3AG3 B;  1F51 A;  1AI7 A;  3CCR V;  4JTA B;  2IH3 C;  1RPR A;  3HPL C;  2HJF C;  3OEH G;  1KC8 W;  2PI5 A;  3IFX A;  2XAS A;  4QE7 A;  2IJH A;  5B1B B;  2EIL C;  3SJQ C;  4MW3 A;  2WLM A;  1THZ A;  5B1B C;  4P9O A;  5CBF A;  4HYO A;  3OMA B;  3TET A;  3LNM B;  2Z5U A;  1M57 B;  3W7W A;  2WLI B;  1M57 C;  2QM8 A;  1FXV A;  3CCL V;  1W2B U;  4BW5 A;  2C2A A;  3SPI A;  2WPD G;  1VQ9 V;  1QVG U;  3CD6 V;  3E89 A;  2HVK C;  4G28 B;  1FXK C;  1OCC B;  4WFF A;  2OTJ V;  4MSW C;  1R3I C;  2EZO A;  1OCC C;  3H01 A;  4QE9 A;  4RAI A;  2YEV B;  2X7R B;  1K4D C;  3CP1 A;  2OT5 A;  3HB3 B;  3RVY A;  2HLD G;  4UV9 A;  5KUM A;  4WF9 V;  3T4D A;  4GX5 A;  1WPX A;  1PNK A;  3E8G A;  3ABL B;  1GK9 A;  1K34 A;  4UVA A;  1KEC A;  1NQT A;  3ABL C;  3ABK B;  3AG2 B;  3LDE A;  4HZ3 A;  4X88 A;  3ABK C;  2WSS G;  1EFR G;  3AG2 C;  4PA4 A;  5EK0 A;  5LGU A;  3M99 B;  1AI6 A;  3TCU A;  3SPH A;  1VQM V;  2IU3 A;  4LP8 A;  4P2Z A;  1YJ9 V;  2LP7 A;  2XOK G;  4PDM A;  1FFT B;  2B5U A;  1ARO P;  1PKX A;  2WLL A;  4N23 A;  5B1A C;  3JD2 A;  5FL7 G;  4ZKI A;  3W7S A;  5IDJ A;  1ENV A;  3STZ C;  3CCV V;  1SZT A;  2P67 A;  3G4S V;  2P6J A;  3D3I A;  3IC7 A;  4E2L A;  4WCE V;  4J9Y B;  4WFA V;  1E1Q G;  5EC1 C;  2MK3 A;  3FB7 C;  1KD1 W;  4UV8 A;  2H8P C;  1JQ0 A;  2ZR3 A;  3K0G A;  3OAA G;  4FIP C;  3AEI A;  1GM7 A;  3K06 A;  4PEL A;  1Q7Y W;  3ZMV A;  5L3C A;  4GX0 A;  3QO5 A;  4JAU A;  1KQS U;  1M90 W;  1BHA A;  1S3J A;  3AG1 C;  2QM7 A;  5E1A C;  4R6Z A;  4MVR A;  1ROP A;  2WLN A;  1VQ6 V;  3FB8 C;  1FXH A;  2JEU A;  1OHH G;  2IJK A;  1CP9 A;  2OCC B;  5LGN A;  1K5S A;  3A0R A;  2CK3 G;  2OCC C;  3BEH A;  4WFE A;  4UVC A;  5KUK A;  4JAV A;  4TT3 G;  2DYS B;  5CN0 A;  1HWY A;  2V1D A;  1PD3 A;  1PNL A;  2DYS C;  1QVF U;  1XL6 A;  2EIM B;  4UVB A;  3QO8 A;  2EIM C;  3E2E A;  2EIJ B;  4QNH B;  1MAB G;  1NR1 A;  1P4R A;  5DM6 V;  2EIK B;  2EIJ C;  3RBZ A;  2ZXW C;  3ZMU A;  4RO2 A;  4LC1 A;  2EIK C;  2IU0 A;  1S72 V;  2W6I G;  2BOC C;  4PDL A;  2LFS A;  5CBH A;  4R50 A;  1LNQ A;  3SYC A;  1MSW D;  2XAH A;  1R3K C;  1EBO A;  1KP3 A;  2WLI A;  3PJS K;  1XL4 A;  4XDK A;  1MG1 A;  4RQE A;  2IJJ A;  1CEZ A;  1OCO B;  1H8H G;  1QR8 A;  2X6B A;  1OCO C;  2P90 A;  1NBM G;  1BL8 A;  2XAJ A;  1K7D A;  2Z3Y A;  2WLK A;  1YIT V;  2HFE C;  3SYP A;  2YEV A;  2DW4 A;  3ABU A;  3F7Y C;  3CXC U;  4PA3 A;  4ZBM A;  3JYC A;  5CA3 A;  5KA5 A;  5J9P C;  1M56 B;  2IH1 C;  2JIZ G;  3E86 A;  4H37 A;  3CPW U;  1EZJ A;  4ASU G;  1M56 C;  4F4L A;  1NH2 B;  2R9R B;  1YHQ V;  2XAQ A;  1S76 D;  3E8B A;  3AG3 C;  2A0L A;  1UJW B;  1H38 A;  3MHH C;  2PI4 A;  4BIU A;  1NKD A;  3CCE V;  2H94 A;  3EFF K;  3E8H A;  2NNU A;  3I55 V;  1KP2 A;  1K33 A;  4MTG A;  2FTK A;  5EC2 C;  1S5H C;  4QJF B;  2ZQM A;  4WFB V;  4JGS A;  3CME V;  4P30 A;  1VQ5 V;  1G8M A;  2QKS A;  3GB7 C;  2W0F C;  5LHI A;  4R7C A;  3JD4 A;  4JF3 A;  3W7U A;  1Q86 W;  3CC4 V;  3MHS C;  4OXS A;  3OR6 C;  1K97 A;  3EHB B;  1VQ8 V;  2B1I A;  3CC2 V;  2WLJ A;  4DXW A;  1SRY A;  3LSQ A;  4GCZ A;  4MVZ A;  3OE7 G;  4FPP A;  4GT1 A;  1M9N A;  1MOF A;  2WLH A;  2ITD C;  4XDL A;  4U7N A;  5EBW C;  4UUJ C;  3ZCC A;  1Y66 A;  1S0V A;  5IYD O;  5H9C A;  2M7W A;  1Q81 W;  3E8F A;  1JOY A;  1AJP A;  4LBE C;  3OW2 U;  3P30 A;  3CYO A;  5L3F A;  3MD0 A;  1GM8 A;  1JVM A;  2JEX A;  3DTU B;  3KG2 A;  2LFR A;  4JPR A;  3ASO B;  3R65 A;  5KA6 A;  4BIZ A;  3ASO C;  3BY6 A;  4JYB A;  2B1G A;  2EJR A;  1P7B A;  2A9H A;  2GHY A;  2Y69 B;  1JJ2 U;  3JD3 A;  2Y69 C;  5HFM A;  2Y48 A;  3OMI B;  4WFH A;  4FMT A;  3ZMZ A;  1F4M A;  3T2M A;  1DF4 A;  2DQ3 A;  3B77 A;  3FB5 C;  4XBF A;  2HVJ C;  2DWE C;  2Q69 A;  5B1N A;  4RUE A;  2X6A A;  5IYB O;  3ETD A;  1L1F A;  1S77 D;  1VQ7 V;  3TK1 A;  3OR7 C;  2ZR2 A;  3ZN1 A;  5B3S B;  2ITC C;  5B3S C;  4EKW A;  3X2Q B;  3ETE A;  2K1E A;  3X2Q C;  1E79 G;  1QLE B;  3OFN G;  3OMN B;  3G6E V;  2DYR B;  4PA6 A;  1QLE C;  3B8M A;  2DYR C;  5GW7 A;  1QBZ A;  2XND G;  1BMF G;  1AR1 B;  1NH2 D;  3ZRV A;  3B8N A;  1F4N A;  5H6R A;  3SPJ A;  3K9A A;  1DTO A;  3ZMT A;  2WAM A;  4MVU A;  2EZP A;  3LUT B;  1YJN V;  1QCE A;  2QE7 G;  3T4Z A;  2ZD9 A;  1Q82 W;  4QIW F;  1YTF B;  1AI4 A;  1ORQ C;  4MVM A;  2UXX A;  1H8E G;  3SYA A;  3P32 A;  3ZRW B;  1NVP B;  2QEX V;  2W6J G;  1VQN V;  4Q20 A;  3SPC A;  2A79 B;  3SPG A;  2X0L A;  2GSM B;  3OUF A;  4U7O A;  2Q67 A;  1V54 B;  1V54 C;  3K03 A;  1Y4M A;  2EBO A;  1R3L C;  1K5Q A;  2DWD C;  4MTX A;  2IJI A;  1SET A;  3UM7 A;  3ZRX A;  3OM3 B;  4RUF A;  4L87 A;  4I9W A;  4JTD B;  4YXW G;  3CCM V;  5CBG A;  3OEE G;  3W7T A;  3JD0 A;  3LDD A;  3ASN B;  4XDJ A;  3ZIA G;  1F23 A;  3ASN C;  2IW5 A;  3GWO A;  5L3E A;  2F43 G;  2HR3 A;  1GKF A;  3CCQ V;  1YIJ V;  3K79 A;  1JPX A;  5LHG A;  3AG4 B;  4R8C A;  1SER A;  3AG4 C;  4X8A A;  3F5W C;  3OUS A;  4PDR A;  5L3G A;  1BHB A;  5BZB A;  1VQ4 V;  2EIL B;  3ZN0 A;  3QO7 A;  3E83 A;  2XAG A;  3ABM B;  2BOB C;  3JD1 A;  1K8A W;  1VQK V;  3ABM C;  1VQL V;  1YSC A;  4FK5 C;  5L3D A;  1JCH A;  3ZRS A;  1I5X A;  3E35 A;  1AI5 A;  4BAY A;  1GTO A;  3K04 A;  4JAS A;  3VOU A;  3CCS V;  2JDI G;  4G27 B;  1QLN A;  1FXK B;  3LSS A;  2DQ0 A;  4KUM A;  1NR7 A;  1G4Y B;  5EBM C;  4MW8 A;  3CCU V;  4X89 A;  1R3J C;  4HAM A;  3CMA V;  5EBL C;  2Q6A A;  4DO2 A;  1AJQ A;  1QR9 A;  3FKS G;  4RQF A;  3ETG A;  5LGT A;  4I5S A;  1GO3 F;  4MVO A;  1COW G;  1DLB A;  1DF5 A;  5HFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...