1EBOA

Crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIGEADGLIEGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCRIEPHDWTKNITDKIDQIIHDFVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Ebola virus membrane fusion subunit, GP2, from the envelope glycoprotein ectodomain.
pubmed doi rcsb
source organism Ebola virus sp.
molecule tags Viral protein
molecule keywords EBOLA VIRUS ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMEN
total genus 45
structure length 112
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1eboA00
1EBOA 1QBZA 1SZTA 1DF4A 3GWOA 1QCEA 4G2KA 1MOFA 1I5XA 2EZPA 2P6JA 1DLBA 2EBOA 1MG1A 4JGSA 5KA5A 3H01A 1I5YA 4N21A 1JPXA 2EZOA 5KA6A 1K34A 3B8NA 3MHHC 2M7WA 5HFLA 5CMUA 3MHSC 1QR8A 5HFMA 5CN0A 4N23A 4JPRA 4E2LA 1QR9A 1DF5A 2MK3A 3B8MA 4FK5C 3B77A 1ENVA 2OT5A 3CYOA 2LP7A 1Y4MA 1K33A 4FJCC 2X7RB 3M99B 1F23A 1JQ0A 1Y66A 3CP1A 3K9AA 5H9CA 4FIPC 3P30A 4JF3A 3WFVA
chains in the Genus database with same CATH superfamily
4IIJB 1VQPV 2WWWA 1N0JA 3BABA 1SERA 3ZHSA 4XBFA 3JCUZ 1BGYH 1H2KA 1B04A 2OIEA 3E22A 4I55B 4ZOLA 3SDLA 2UXXA 5K1PA 1S0VA 1SS3A 2XT9A 4QGPA 4AQYB 2JRIA 3ASNC 1GN4A 3JD0A 3BEHA 1YIJV 2BOBC 3RN4A 3N2KB 3SPCA 2Q68A 3IAYA 4J10A 4K0KB 3AG4B 4GX5A 2E5LO 5B1NA 2P7TC 4MVZA 3SJBC 4JI0O 2X6BA 2LQTA 2A9HA 2R9IA 2ARHA 3A0HZ 3OEEG 4MVRA 4JI7O 4TSFG 3RYIA 3UO3A 2ATKC 5JCOA 1YI2V 1R73A 1TUEB 4FLUA 1K9MW 4P30A 4UCOA 4EB6A 3GB7C 3ABTA 1R6NA 5GONA 1OZ0A 3I5DA 4O4HB 1Q6UA 2WLHA 1NQTA 2PYJA 5CB4A 5EC2C 1GN6A 3D3QA 5LXTB 3CD6V 1N33O 1FXKA 3W7XA 2X0LA 5TISZ 3AK3A 4I50A 1YZBA 2WLJA 3ZMSA 1CP9A 1OHHG 2BSKA 3UM7A 4IGGA 1V9PA 3JATA 1X59A 1FFXA 3ZRWB 1R6TA 4BAYA 2NNUA 4DR4O 4P2ZA 2YEVB 3FKSG 3RYCB 2LW7A 4X64O 2ZXWC 1AJNA 4KHPB 4HNAB 4JI7B 1P7GA 2B9ZA 5C93A 1QLNA 4DW1A 3J7AU 1H8EG 2WAMA 3OMNB 1Q81W 2WLLB 3RYHA 3B40A 2DMXA 4RUEA 2ZE5A 2P6JA 1DLBA 2X6AA 1MG1A 2QM4A 3FX7A 1TVKB 3RVYA 2Q0AA 3ABLB 3E22B 2DJVA 3KZIZ 4IIJA 1N36O 2DQ3A 4FM1A 5LGTA 5JH7A 1M90W 4LBEC 3RGBA 2UXBO 5H5NA 4UVCA 2P90A 3FD9A 4YHHB 2NN4A 2Q0OC 1F4MA 3ZS8C 1GM8A 1NU1H 3SYCA 4AQYO 3H1LH 4NXMB 1XMQB 2VQFB 3H1HH 3WU2Z 1PKXA 2E3CA 5LHGA 4LC1A 2R70A 4B3MO 4OGQB 4E4EA 1N32B 1BL8A 2IH1C 4YY3O 4FK5C 1VF6C 2ADQB 1H2GA 3JAWB 3N2GB 2UXNA 2Q8VA 2JVDA 2QWNB 5IJ9B 2ZKOA 1JR9A 3ZHTA 4I9QA 1MZFA 3CRAA 2F4VO 4U3JB 2IJJA 4GLXA 4J9ZB 3IFXA 1AB3A 2EILB 4YIOA 3JD2A 1DF5A 1Y74B 3BPZA 4EEQA 2QEXV 5KMGA 5DM6V 4TUYA 1XMQO 2IH3C 1PPJH 2B5UA 3K9SA 4QPKA 3FFQA 5CB4B 5JVDB 2CTWA 3EVKA 3G4SV 3AG2C 3U10A 4P9OA 2AZ0A 3OTOO 2Q73A 1CPYA 2QM7A 3B4SA 5IE9A 1XNRB 4U7OA 1PNMA 3VQXA 2PY5A 3JARB 5LP6A 1PNKA 4CS3A 1SESA 4DR3B 1N36B 4UVAA 3RYFA 1MZEA 3R66A 2ZM6B 5EZYB 4FM2A 2Z3YA 2YICA 5KHGA 5CA1A 4I50B 4D6TH 4JYYA 1VEWA 3ABLC 1RM1C 1PP9H 4KXRA 3ABKC 1V54C 4FIPC 4I4TA 4F4LA 5LGUA 4FZ0A 2XASA 1R6KA 4PELA 1CEZA 2EBOA 4DUYO 2D2CB 4N21A 1QLEC 2BTOA 4HAMA 1AI6A 4LF9B 2DE0X 4LF7O 1K97A 3OUSA 2OCCC 1N33B 4B3TO 4LF5O 3ZJZA 3ZHUA 4FFBA 4EFBA 1IBMO 3HKEB 4DV6B 2A0LA 3ABKB 1W0JG 5DECA 4JI8O 5LGNA 4X66O 2CH7B 4NB5A 5CBGA 2EIKC 1EBOA 1GO3F 2A06H 4NTYA 1M57B 2P06A 3K3WA 3E35A 5LMUB 4LF9O 1HNZO 3NXSA 4ZHQA 3E83A 1IXMA 4RWUA 3S3XA 3OGCC 3EFFK 1NBMG 4MVQA 3KG2A 1FXVA 4L8JA 1SA0B 2PI5A 4JZ2A 1SETA 1TUBA 4GYCB 4J9YB 1FKAO 2M6YA 1KB9F 2ZIMA 4UV9A 1WB8A 3J81N 2B1GA 3QVNA 1R1BA 2B1IA 2P67A 4PA3A 5H2FZ 1AR1B 4E2LA 2GTSA 2W6JG 4DK1A 1A32A 4RQFA 1HNWB 4JI1O 4DV0B 4DV4B 3T4ZA 1HW7A 4TV8B 4B3RO 3JD1A 4IL6Z 2EILC 5KMGB 2VQEO 5EYPA 3ZX6A 1V55B 4LNUB 4H13B 4CH5A 1NTMH 2E75B 4F6EA 3TGUH 1LUWA 1EN4A 2E76B 2EIJC 3E89A 3CE2A 4O4LA 1S76D 1VQ4V 4O4HA 4X20B 5KUMA 3K04A 4FLZA 5LHIA 4X1YA 2LGWA 1US6A 1BQ0A 3D36C 1X4TA 4TQFA 3BCCH 3JARA 5LP6B 3FYEB 1RPOA 2JJ2G 3FB6C 3HR0A 1SQQH 4AHCA 2VS0A 1L1FA 2BSKB 1BHAA 1YVWA 2YIBA 2A3QA 4PA7A 4WBNA 3CP1A 3ZMUA 4IHJA 5LXTA 1S5JA 2O57A 4UCTA 3ASNB 4FPPA 1XMOO 2GTAA 4YY3B 4DUZO 3HB3B 1RM1B 2KKWA 2VQFO 5CN0A 2OCHA 3ZRSA 4FLWA 2KQXA 2WLLA 2EIMB 3AK1A 5LMUO 3CRCA 1GM7A 4QE7A 4DYLA 5CBFA 1M56B 1JQ0A 4KUMA 4JI3B 3OAAG 2GHYA 4YHHO 4DR7O 2EJRA 2HVKC 4X8AA 4PDLA 1G1XB 4X62O 2Y48A 2BTQA 2FKXA 3ZHVA 1P84F 1E1RG 2OT5A 1MSWD 4L87A 5LMNB 3ZMVA 3CCEV 3JASB 3LDCA 3G71V 3AG3C 5KHIA 1XREA 3LUTB 1AR5A 2XAGA 3AG1B 2GUZA 4YXWG 3CCQV 1BHBA 4O4JB 1KP3A 4TV8A 2LGQA 3OMIB 4LP8A 1OCZB 4MW8A 4ICGA 1YJNV 3SPGA 3RVZA 2CDYA 4B3SB 2OCCB 2CTPA 5IYCO 2DN9A 1XNRO 3C3TA 2ZE7A 2BOCC 5CBHA 5BY1A 1Y74A 4O2AA 3L75H 3RYHB 2YS8A 4X20A 2PYLA 4LF6B 1QVFU 2ZXWB 1Y4MA 1GMGA 4I7ZB 1BZKA 1E79G 2LFSA 1KU9A 3VQWA 2YI8A 1E1QG 4O4LB 3MAQA 4K35A 2CUGA 4MVUA 3WB1A 3E8GA 3F7YC 4TT3G 5H6RA 3U11A 1H2LA 2Y0PA 2BCCH 4IHJB 5DN6G 4X88A 5IT9N 2MK3A 4W4LA 2RDCA 3ETDA 1SKVA 2DW4A 1PV0A 5BMVB 1XL4A 1NVPB 1KP2A 3H1JH 1Y66A 2E5LB 2K1EA 3JAMN 4DV3O 1QVGU 1ZSPA 3UO2A 1K5QA 1OCCC 1QCEA 1I94B 3AG1C 1KUQA 4MVMA 4WBNB 4LCUC 2JDIG 3ZN1A 2EZOA 3K57A 2HVJC 4B3MB 2M7WA 4CH3A 1I08A 1XNQB 2F23A 3HKBA 2ZDIC 3CYOA 2H94A 4JAUA 2IJKA 1XNQO 4OPHA 2F95B 4JI5O 1HDJA 1Q8IA 1AI7A 1SQFA 2DYSB 2X6CA 4ZI7A 4DV7O 5CMUA 2QDOA 5JVDA 1VQKV 3SR2C 5KAFZ 2CH7A 1K4CC 3QTCA 3DC6A 3BFRA 4CS4A 4MTXA 3G80A 2VRZA 3C90A 5C8YA 4ZHQB 4BWAA 2V1DA 1VQ6V 1XBLA 2ETNA 3RYFB 1K92A 4BIUA 5EZYA 4CC5A 3I55V 2GUZB 4FLVA 1KKCA 2XOKG 1Q6HA 3M99B 3VQYA 4J80A 4LFAO 2N05A 5B1BC 4J11A 3QO7A 4O4JA 1V54B 1G6UA 2RJZA 1EN5A 5EBWC 2PI4A 3HPLC 1TUBB 3IGAC 3CXHF 1HR0B 5IYBO 1GTOA 3LSQA 2XTAA 1MA1A 2HEPA 3NR7A 3ZRXA 1JA8A 5EYPB 2JGDA 5J2TB 2AGAA 1EZJA 4RO2A 1UPGA 1I94O 4LFBB 2OTJV 1IX9A 4FFBB 1MOFA 2EZPA 1ZX3A 4GKJO 1VF7A 3CMAV 2LO1A 3ABMB 3ZMZA 3K03A 1S77D 1NR7A 1AJQA 1ORQC 3LDDA 3BAAA 2DYRC 2ZINA 1RFYA 2Y69C 3QF7A 3TXQA 2E74B 5KHJA 1IZ3A 4ZIBA 2WPDG 4FZ1A 1EM1A 1KECA 2F93B 5LP6C 4X62B 5B1BB 4GKKB 1VARA 1N0NA 3EXAA 4JI6B 3T4DA 4X1YB 4DRXB 4DV2B 4NTXA 4LF6O 4QJFB 3K5LA 2ZNIA 4JAVA 5CA0A 2QKCA 3FAVB 4FM0A 3ICXA 1ZL8B 2LW1A 2QM8A 3CC2V 1FPOA 2HR3A 5BR8O 3WG7C 3BRCA 2ITCC 1LR1A 5KX5A 4UCVA 1AP5A 3L73H 1Q86W 5JQGB 2F66C 4FLXA 3OT7A 2Q67A 1YSCA 3J80N 5FPRA 3CCMV 1YCIA 2UUBO 4J41A 3LSUA 3L74H 5D5PA 1W59A 4DR2O 4OX9B 5BXZA 4AILC 4IT5A 4TOIA 3K5OA 3BHPA 1BE3H 3K59A 1J95A 2BE3A 2KSDA 1NTZH 2F43G 4R50A 2C2AA 3CCVV 1GN3A 3A2FA 2V7QG 1BCCH 4RAIA 3BY6A 1VQNV 4JYCA 3WFVA 4O2BA 2Y4UA 2HHHO 3JSNA 1ZWIC 1O9GA 3CCUV 1NH2B 2YDEA 4NXNB 4X65O 5LYJA 2HLDG 4IYHA 1HNWO 4DV5B 5EIBC 5LA6A 5FL7G 1N8RW 3SJCC 1YDXA 4LF4O 4JYAO 4GX0A 1DTOA 1XMOB 4DR5O 4AI8A 3H01A 1YEWA 1NJIW 1JX9A 1RSOA 1Y76B 3FB5C 3A8TA 3B8MA 4O2AB 2P5OA 4DXWA 1EFRG 4K8ZA 4DV5O 1AR4A 2RQ6A 1K7DA 4Q6GA 1FXKC 1L0NH 3JASA 1MSDA 1Q7YW 3BA8A 3CCRV 2WA4A 4WF9V 1OCRC 1B06A 3ML0A 2WLIA 3DGEA 1KKDA 2DOSA 3THOA 2ZE6A 3I56V 5IYZB 2JS3A 4MTFA 4TQDA 4B3TB 5IY5C 3N2KA 5KX5B 2VQEB 1YJ9V 4PJ0Z 5JQGA 4B3RB 2Q69A 4JZGA 2RN9A 4UB6Z 5L3GA 1SQXH 4WFBV 3CS5A 2K9PA 4UXNA 2DQ0A 3CMEV 1Y6XA 4Q20A 4JI1B 3SYPA 3D3IA 2HKOA 5GW7A 5GONB 1GK9A 4WFGA 2UUBB 1WP8A 3M8AA 3ZRVA 1IBLB 1IBLO 4DR1O 3K5NA 3HKCA 4DR6B 3L70H 1ROPA 1I7FA 5AG2A 1QHTA 3W7TA 3T1HO 2N74A 1G4YB 1HNXB 5IWAB 5C8YB 3KCXA 2QE7G 1R3JC 1SQBH 3K5MA 2PGGA 2IU3A 3P30A 1XHZA 1WJZA 4DW0A 4WFAV 2NLJC 1KD1W 4JI2B 3E2EA 3OTOB 3EHBB 3DC5A 1JFFA 4HYOA 1P7BA 1FXKB 3F5TA 4OXSA 3TETA 1LNQA 5FPOA 4DV6O 5B1AC 4JI6O 4D7SA 1IBMB 5FNVB 4RUFA 4GT1A 1OCRB 2X7RB 3JALA 3B2EE 3W7SA 3K9AA 2GBOA 2LFRA 1M5IA 2XAJA 4PA4A 1FAFA 3ZHQA 3O65A 5HFLA 3ZMTA 2EIJB 2IBZH 2A7WA 1FJGB 1ENVA 3E8HA 1VF5B 4LR3A 2AW9A 2GSMB 4U7NA 4DV1B 5JH7B 4LF4B 4JYAB 2WLIB 1KMIZ 1OJHA 1HR0O 3SPHA 5IYZA 1K3EA 4NXNO 4WCEV 2HP8A 4PI0A 4O4IA 3P3NA 4ZOLB 2JEUA 4F6RB 4MVOA 2LP7A 2MW2B 1NS1A 4MTGA 3DTUB 2UXBB 3ZIAG 1CXZB 1VQOV 1NH2D 2IU0A 2YIAA 4B7EA 4DRXA 4DO2A 1SZXA 3F5WC 2RNBA 2L6LA 1YTFD 4X9QA 1EN6A 1QR8A 1O9HA 1WAZA 4JTCB 4Z1VA 2UXCB 2DYRB 4DR2B 4QNHB 3ZBHA 5H9CA 4DR4B 2HG5C 2ZQMA 1W0KG 2ILMA 4NYKA 2ZIOA 3K0DA 2L35A 2G38A 2EJ7A 3MHHC 1ZL8A 3SGIA 3B09A 3QNEA 4MTOA 1GH6A 3RFRA 3B77A 5BR8B 2NR5A 1T5EA 3AG7A 4HBNA 3FYIB 4NTWA 3CCSV 2R9AA 1N34B 2XUMA 4NR1A 1GRJA 2QGNA 4UCUA 4JI2O 2JIZG 3OUFA 1H8HG 5KHHA 5GTHZ 1S5LZ 3CEIA 2Z0AA 1H38A 2YSUB 5LHHA 1S5HC 2EX3A 2P4KA 4WFEA 4J7ZA 2AXTZ 1VMGA 1UJWB 1AP6A 3AG2B 3T1YO 1ZUQA 5A9GA 1VQ9V 1NZ6A 4UV8A 5L3EA 2UUAO 2RMKB 2UUAB 1I5YA 4JI0B 4I4TB 2CTRA 5LA6B 1MMMA 2WSSG 1W2BU 1WA8A 5JJNB 2QTOA 4JAAA 3SPJA 3OE7G 1Q90D 4GCZA 2CAZC 1TVKA 1M1KW 2YC0A 5B1OA 4O4IB 1K4DC 3TJTA 4MT8A 3JD3A 3FB8C 3VBBA 1ZTEA 2AHYA 3ASOB 3UCSC 1Q43A 2UUCO 4EKWA 5EBMC 2OYQA 1FYJA 3CCJV 2YXHA 1XL6A 4R7CA 4B3SO 1TAEA 5LBQA 3SPIA 5KLVH 3ZN0A 3OMAB 4JYBA 2H8PC 1K34A 3HKDB 3W7WA 3CRMA 1AI5A 1OCOC 1S72V 1TA8A 3OD4A 1WPXA 4UVBA 4UCRA 4U3JA 2YIDA 4BW5A 1XILA 2KG7B 1GAXA 4DK0A 2IJIA 4DR5B 2GDSA 2ZT9B 2Q4PA 2PF4E 1NR1A 1AJPA 1Z2GA 3TK1A 5CA3A 4H37A 2UU9B 4K0KO 3OW2U 2ITDC 3ETEA 1YXBA 4DR7B 1OCCB 3IJ4A 3CX5F 4X65B 1F4NA 3L72H 1OV9A 1AILA 3Q4HB 3UT5B 2HHHB 4UCSA 5F2VO 1QQCA 4LH6A 2OTLV 3ZHRA 2HFEC 2QKSA 3HKCB 2PUSA 4XDLA 1JOYA 4JPRA 4YJ3B 2UXDB 3ETQA 1FJGO 1D2DA 3QG5A 2DYSC 1JFFB 1YTFB 4QIWF 5KA6A 2QTSA 3B8NA 1HWYA 2QSAA 1PL4A 2ADPA 5HFMA 3CPWU 4CZZA 1J5EB 2QWQB 4GX2A 4KFMA 3VQVA 1HP8A 1H2SB 1GKFA 1VF6A 3CC7V 1VQ8V 4J7KA 1R3KC 2YXYA 2RCVA 2ZE8A 1ZAUA 2EIMC 5BZBA 5CA0B 3WB2A 1VIBA 3T1CA 3STZC 1VQLV 4TV9B 4CBCA 2ZDIA 2HJDA 5EBLC 5KUKA 2Q7EA 5A2QN 1WPBA 3SYQA 2PZSA 5IWAO 1HNXO 1WN7A 2BTQB 4BW9A 4DV2O 3RWRD 3CJHB 4DV0O 4NKGB 4GKKO 1TGOA 1KYOF 3ABMC 5L3DA 5IJ0B 1MNGA 2XAHA 1PM9A 4ZBMA 3CXCU 1NVPD 5K1XA 1IBKB 2W6IG 4J42A 2Y69B 2XAQA 5FLXN 2ZD9A 4BIZA 4RQEA 5FNVA 4QE9A 1JMKC 3T1YB 4R6ZA 1XDCA 3P3PA 4GKJB 1IVSA 4PD4F 1SC5B 3LNNA 1U97A 4LFBO 3RT3C 1HNZB 1VQ5V 3BVOA 3LNMB 4FFKA 2IM9A 3OEHG 2QR4A 5L3BA 3CRQA 4KP4A 1N34O 2OWOA 4X66B 1LUVA 3DSQA 1JVMA 3E86A 4H0LB 2QJ1A 3UQ8A 3C3SA 1BT8A 4PDRA 2XAFA 1DF4A 1WP7A 1L0LH 3K58A 4YIPA 4BIOA 5KA5A 2EINC 2Q6AA 1QU7A 4IYIA 4K8XA 4JV5B 5EK0A 4PA9A 3SJAC 2UU9O 4WFFA 2Q7GA 4DUZB 1H2NA 4LNUA 1UFIA 3JATB 3AK2A 4PDMA 1KC8W 3ZRWA 2ODMA 2IW5A 2QWOB 1BQZA 4UUJC 3JYCA 4WFHA 1S3JA 2JS5A 1XI1A 4FMTA 3X2QB 4YJ2A 5J2UA 1VP7A 1KQSU 1K73W 3G6BA 1SRYA 2F1MA 1Q6IA 1JCHA 2AHZA 2ZR2A 2CGOA 3BA9A 4X1KA 4DV7B 4B08A 3JAKA 3H1KH 4JTDB 4CS2A 5E79Z 1FXHA 1YHQV 4B7KA 1JPXA 1M57C 5JJEB 1BMFG 1L8DA 4XDJA 2UUCB 3DXRB 2V4DA 2Q5ZA 4UB8Z 3G6EV 2CE4A 4Z1MG 3FB7C 5B66Z 4TV9A 4I5SA 1IXBA 1IURA 3OR7C 4PHZA 1WA8B 5IJ0A 4DV1O 4DV4O 1VQ7V 1NTKH 1F7YA 1YF2A 1D5NA 3H1IH 4BR6A 3OTFA 1AVMA 4G28B 1DK1A 3CCLV 1Z5VA 4P9PA 2F4VB 1Y67A 1EZVH 3AG3B 4FVMA 1GM9A 2CGNA 2WA3A 3D36A 1F23A 4PA6A 2DWDC 1SQVH 1XQ8A 3A0BZ 4I9WA 3UKMA 1N32O 4GX1A 4NXMO 4MSWC 3OM3B 2EIKB 2EINB 5D5QA 3K06A 2EULA 2XHBA 1QR9A 5LOVA 2WLMA 3HKDA 2JEXA 3JD4A 2R9RB 3RBZA 5L3CA 5ITZA 3GWOA 1KBHA 1XUQA 3RW0A 1Q5OA 3JALB 4LF5B 3E8BA 1JJ2U 4H33A 1RP3B 1B6QA 5DEDA 1MABG 4ASUG 4N23A 4DUYB 4PV1B 4LF8B 4J7JA 1K8AW 3UT5A 3APQA 4LFCO 4X1IA 4LWSA 3MDSA 2Z5UA 4KHPO 3GVMA 1SF9A 3T2MA 2QWRB 2Q7HA 2UXCO 4I55A 3PN1A 3VOUA 1RPRA 4XDKA 1FFTB 2YXLA 3Q4HA 1PL0A 4GUNA 5BMVA 4X1KB 4LFCB 5H6QA 1QNMA 4G27B 3JCZA 4ABMA 3QO8A 3K08A 4LF8O 1FD9A 1M9NA 4Z2WA 1OCOB 4JASA 3MD0A 4FJCC 4DR3O 3H9VA 4F6RA 1WB7A 1M56C 4C7UA 2YEVA 4FLYA 3E8FA 2WLNA 3FAVA 4FLTA 2LJ2A 1COWG 4JI3O 4LFAB 3WB0A 1BSMA 2KG7A 3MHSC 5EC1C 3LDEA 2HJFC 3X2QC 3A0RA 4MVSA 5IDJA 1G8MA 1N4CA 3K79A 1R3IC 1B3QA 3ASOC 2FL4A 3M7MX 4ZI7B 3HKBB 3ABUA 3LSSA 2VWKA 2VWJA 4CC6A 1JJOA 3IC9A 3ETGA 2Y4TA 5JWPA 1XEQA 5J9PC 1SA0A 1XOUA 2A79B 3SYOA 1VQMV 2ZNJA 2Q9LA 4H44B 3PJSK 4R8CA 5GTIZ 1DGSA 1WLEA 3D8CA 4YJ3A 3CWBH 1Z5WA 4JV5O 2FB5A 2YIBD 1I5XA 3APOA 3TXSA 4GZRB 5LOVB 1AROP 4JI5B 1SQGA 3KCYA 1M4UA 1R3LC 1H2MA 3JAWA 3N2GA 4HZ3A 1FS0G 1V55C 5E1AC 5LYJB 5B3SB 2FMLA 2ZR3A 3OGIB 4K3AA 1RSOB 1Y76A 4PDVA 3CSXA 2CTQA 1F51A 4X1IB 3T1HB 5ITZB 4DV3B 3JSLA 1YJWV 4I0XA 1GN2A 4TUYB 3CRRA 2AZ2A 2PTMA 2IJHA 3S3WA 3R65A 3CC4V 4DR6O 2CK3G 4OX9O 3W7UA 1OCZC 4DR1B 4NVPA 1P4RA 1NI8A 2OIGA 1BS3A 1SZTA 1WNSA 4X64B 4LWSB 1URFA 4JI4B 2JGDB 5J2TA 2Y0IA 3CJHA 3L9DA 5B1AB 3TCUA 1NKDA 2YI9A 5IJ9A 2P4VA 1M93A 2JK5C 3ZCCA 3KKYA 2GV9A 4CH4A 4MW3A 4YJ2B 5J2UB 1PNLA 1Q3EA 5CA1B 3WG7B 5KAIZ 1QBZA 4A5UB 2QWPB 4JGSA 3AEIA 1IDSA 1PD3A 1NT2B 2QA4V 1ZLZA 4TWKA 1QLEB 3IC7A 4JI8B 3SYAA 1AI4A 4ZKIA 4OPAA 4LH7A 1K33A 4LF7B 2H3OA 4PI2A 3G67A 2KB1A 2XNDG 2R72A 4JF3A 4KL1A 2YUAA 4JTAB 1SQPH 3L71H 1D5AA 5B5EZ 2W0XA 5B3SC 4EFEA 3STLC 4U3FH 5LMNO 1I0HA 1IBKO 3AG4C 2D3OW 3GWKC 4D7TA 3F7VC 3CHXA 1U96A 2UXDO 4X89A 3DXRA 3P32A 1K5SA 5IYDO 4UFZA 3RYIB 4G2KA 2ZM6O 3N27A 3O9OA 5KHKA 4MS2A 3K0GA 4EB6B 2ZCEA 2W0FC 2JJ1G 5LL6Y 2WLKA 3SJQC 2FYUH 2P22C 4O2BB 2JGUA 5JJJB 4CH6A 3ZEDA 5EIBD 4I0XB 1XHXA 3RYCA 2QKAA 5JCOC 1YITV 5L3FA 3OFNG 5IY5B 3JAKB 4HNAA 3CB2A 4W4KA 3HKEA 2N04A 4JI4O 1J5EO 2FTKA 1FFXB 2DWEC 1THZA 3OR6C 3QO5A 1P49A 3U0ZA 4QPJA 1Q82W
chains in the Genus database with same CATH topology
4PDRA 2XAFA 1DF4A 2EJRA 2HVKC 1VQPV 4X8AA 4PDLA 5KA5A 2WWWA 2EINC 2Q6AA 2Y48A 5EK0A 1ROPA 1SERA 4PA9A 4XBFA 3W7TA 4WFFA 1E1RG 1G4YB 2OT5A 1MSWD 4L87A 3ZMVA 3CCEV 2QE7G 1R3JC 4PDMA 1KC8W 3ZRWA 2IU3A 2UXXA 2IW5A 3P30A 3LDCA 3G71V 1S0VA 3AG3C 4UUJC 3JYCA 2NLJC 4WFHA 4WFAV 1KD1W 3E2EA 3ASNC 3EHBB 1S3JA 3LUTB 4FMTA 4HYOA 1P7BA 2XAGA 3AG1B 1FXKB 3JD0A 4OXSA 3TETA 1LNQA 3X2QB 5B1AC 4YXWG 3BEHA 3CCQV 1KQSU 1YIJV 1BHBA 1K73W 2BOBC 3SPCA 1SRYA 2Q68A 1JCHA 2AHZA 4RUFA 1KP3A 2ZR2A 3OMIB 4GT1A 4LP8A 1OCZB 3AG4B 1OCRB 2X7RB 4MW8A 4GX5A 3W7SA 3K9AA 1YJNV 3SPGA 4JTDB 3RVZA 5B1NA 2P7TC 4MVZA 1FXHA 2OCCB 2X6BA 1YHQV 2LFRA 5IYCO 2XAJA 4PA4A 2BOCC 5CBHA 2A9HA 1JPXA 1M57C 1BMFG 4XDJA 5HFLA 2R9IA 3ZMTA 2EIJB 3OEEG 4MVRA 1QVFU 3G6EV 4TSFG 4Z1MG 3FB7C 1ENVA 4I5SA 2ZXWB 3E8HA 2ATKC 1Y4MA 2GSMB 4U7NA 1YI2V 1GMGA 1R73A 1TUEB 3OR7C 1K9MW 4P30A 1E79G 2LFSA 3GB7C 1VQ7V 3ABTA 1R6NA 1OZ0A 2WLIB 1E1QG 4G28B 3SPHA 2WLHA 1K3EA 1NQTA 3CCLV 4MVUA 4WCEV 4P9PA 3E8GA 3F7YC 4TT3G 5H6RA 2JEUA 5EC2C 5DN6G 4X88A 2MK3A 3AG3B 3ETDA 4MVOA 2DW4A 3CD6V 1GM9A 2LP7A 4MTGA 4QPJA 1NVPB 1XL4A 3DTUB 3D36A 1FXKA 1KP2A 1F23A 4PA6A 3ZIAG 3W7XA 1Y66A 2K1EA 2X0LA 1QVGU 2DWDC 1VQOV 1NH2D 2IU0A 2WLJA 1OCCC 1K5QA 3ZMSA 1CP9A 1OHHG 4I9WA 1QCEA 3UKMA 3UM7A 4DO2A 3AG1C 4MVMA 3F5WC 4LCUC 2JDIG 3ZN1A 2EZOA 3ZRWB 4GX1A 1YTFD 4MSWC 2HVJC 3OM3B 2M7WA 2EIKB 4BAYA 2EINB 2NNUA 3K06A 1QR8A 4P2ZA 2YEVB 3FKSG 1QR9A 2ZDIC 2WLMA 3CYOA 4JTCB 2ZXWC 1AJNA 2H94A 2DYRB 5C93A 4JAUA 2IJKA 2JEXA 4QNHB 3JD4A 1QLNA 1H8EG 2R9RB 5H9CA 3RBZA 2HG5C 2ZQMA 2WAMA 3OMNB 5L3CA 1Q81W 1AI7A 2WLLB 3GWOA 1W0KG 4RUEA 2DYSB 2P6JA 3RW0A 1DLBA 2X6AA 1MG1A 3E8BA 2X6CA 3K0DA 1JJ2U 4H33A 3RVYA 3ABLB 3MHHC 5CMUA 1B6QA 2DQ3A 5LGTA 4MTOA 3QNEA 1MABG 4ASUG 4N23A 1M90W 4LBEC 1VQKV 1K4CC 1K8AW 3B77A 4UVCA 2P90A 3FYIB 3CCSV 2Z5UA 4MTXA 3T2MA 1F4MA 1GM8A 3VOUA 1RPRA 3SYCA 2JIZG 2V1DA 4XDKA 3OUFA 1H8HG 1FFTB 1VQ6V 1PL0A 1H38A 1K92A 4BIUA 2YSUB 1PKXA 5H6QA 5LHHA 5LHGA 1S5HC 4G27B 4LC1A 3JCZA 3QO8A 3K08A 1BL8A 3I55V 2IH1C 1M9NA 4FK5C 1OCOB 4WFEA 4JASA 3MD0A 1UJWB 3AG2B 4FJCC 2XOKG 1H2GA 3M99B 2UXNA 5B1BC 3QO7A 1V54B 1M56C 1VQ9V 4UV8A 5L3EA 2YEVA 5EBWC 3E8FA 2WLNA 2PI4A 1I5YA 3HPLC 1COWG 3IGAC 2IJJA 3MHSC 5IYBO 4J9ZB 3IFXA 2EILB 2WSSG 1W2BU 5EC1C 3LDEA 1GTOA 3LSQA 2HJFC 3JD2A 1DF5A 3X2QC 2QTOA 3SPJA 3A0RA 4MVSA 3OE7G 5IDJA 1G8MA 3K79A 4GCZA 1R3IC 2QEXV 3ASOC 3ZRXA 5DM6V 1M1KW 1EZJA 2IH3C 4RO2A 2B5UA 5B1OA 2OTJV 3ABUA 3LSSA 4QPKA 1K4DC 1MOFA 2EZPA 3G4SV 3AG2C 4MT8A 3JD3A 4P9OA 3FB8C 3VBBA 3CMAV 2AHYA 3ETGA 1CPYA 3ASOB 3ABMB 3ZMZA 3K03A 5J9PC 4EKWA 2QM7A 5EBMC 2A79B 3SYOA 1VQMV 1S77D 1NR7A 3CCJV 1AJQA 1ORQC 3PJSK 4R8CA 1XL6A 3LDDA 4R7CA 2DYRC 2Y69C 4U7OA 5LBQA 1PNMA 1WLEA 1PNKA 3SPIA 1SESA 4UVAA 3ZN0A 2WPDG 3OMAB 1KECA 1I5XA 4JYBA 2Z3YA 5B1BB 2H8PC 1K34A 1AROP 3T4DA 1R3LC 3W7WA 1AI5A 1OCOC 3ABLC 4QJFB 4JAVA 4HZ3A 1RM1C 1S72V 1FS0G 1V55C 3ABKC 1WPXA 4UVBA 1V54C 5E1AC 4FIPC 4F4LA 5B3SB 2ZR3A 5LGUA 2QM8A 4BW5A 3CC2V 2XASA 1R6KA 4PELA 2HR3A 2IJIA 3WG7C 1CEZA 2EBOA 2ITCC 4PDVA 4N21A 1NR1A 1AJPA 1F51A 1QLEC 4HAMA 3TK1A 1AI6A 5CA3A 1Q86W 4H37A 1YJWV 3OW2U 2ITDC 3ETEA 1K97A 3OUSA 2OCCC 2IJHA 3ZJZA 1OCCB 1YSCA 2Q67A 3R65A 3CC4V 2CK3G 3CCMV 1F4NA 3W7UA 1OCZC 2A0LA 1W0JG 3ABKB 5LGNA 5CBGA 1P4RA 2EIKC 1EBOA 1GO3F 1SZTA 1M57B 3K3WA 3E35A 1J95A 5B1AB 2OTLV 3NXSA 3TCUA 2F43G 1NKDA 3E83A 2HFEC 2QKSA 4XDLA 1IXMA 1JOYA 4R50A 4JPRA 3OGCC 3EFFK 1NBMG 2C2AA 4MVQA 3KG2A 3CCVV 1FXVA 2JK5C 2V7QG 2DYSC 3ZCCA 1YTFB 4RAIA 2PI5A 4MW3A 1PNLA 3BY6A 4JYCA 4QIWF 3WFVA 1VQNV 1SETA 3WG7B 4J9YB 1QBZA 4UV9A 2B1GA 4JGSA 3AEIA 1PD3A 2QA4V 1ZWIC 4TWKA 5KA6A 3CCUV 2B1IA 1QLEB 3B8NA 2P67A 3IC7A 4PA3A 1HWYA 3SYAA 1NH2B 1AI4A 1AR1B 5HFMA 3CPWU 4CZZA 4E2LA 2HLDG 4GX2A 2W6JG 4KFMA 4ZKIA 1GKFA 4RQFA 3CC7V 1K33A 5FL7G 1VQ8V 1N8RW 2KB1A 3T4ZA 2XNDG 1R3KC 4JF3A 4GX0A 2EIMC 5BZBA 4JTAB 1DTOA 3JD1A 2EILC 3T1CA 3H01A 1V55B 3STZC 1VQLV 4CBCA 2ZDIA 5B3SC 5EBLC 5KUKA 1NJIW 3STLC 1JX9A 3FB5C 3SYQA 3AG4C 3B8MA 2D3OW 3F7VC 2EIJC 3E89A 4DXWA 1S76D 1VQ4V 4X89A 3P32A 5KUMA 1EFRG 1K5SA 3K04A 5IYDO 5LHIA 1K7DA 4G2KA 1FXKC 3FYEB 1Q7YW 3ABMC 4MS2A 3CCRV 1RPOA 5L3DA 2JJ2G 3FB6C 3K0GA 1OCRC 4WF9V 2XAHA 4ZBMA 3ML0A 2WLIA 3DGEA 1KKDA 3CXCU 2W0FC 2JJ1G 1NVPD 2WLKA 3I56V 3SJQC 1L1FA 2W6IG 2Y69B 2XAQA 4MTFA 2ZD9A 1BHAA 4BIZA 4RQEA 5IY5C 4PA7A 3CP1A 4QE9A 3ZMUA 4R6ZA 1YJ9V 3ASNB 4FPPA 2Q69A 3HB3B 1YITV 5L3GA 1RM1B 5L3FA 4WFBV 3OFNG 5IY5B 4UXNA 1VQ5V 2DQ0A 3LNMB 3CMEV 3OEHG 4Q20A 3SYPA 5CN0A 3D3IA 3ZRSA 5L3BA 2HKOA 5GW7A 2FTKA 4KP4A 2WLLA 2EIMB 1GK9A 1GM7A 4WFGA 4QE7A 2DWEC 1THZA 1JVMA 3OR6C 3QO5A 5CBFA 1M56B 3E86A 1JQ0A 3ZRVA 4KUMA 3OAAG 2GHYA 1Q82W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EBO A;  1QBZ A;  1SZT A;  1DF4 A;  3GWO A;  1QCE A;  4G2K A;  1MOF A;  1I5X A;  2EZP A;  2P6J A;  1DLB A;  2EBO A;  1MG1 A;  4JGS A;  5KA5 A;  3H01 A;  1I5Y A;  4N21 A;  1JPX A;  2EZO A;  5KA6 A;  1K34 A;  3B8N A;  3MHH C;  2M7W A;  5HFL A;  5CMU A;  3MHS C;  1QR8 A;  5HFM A;  5CN0 A;  4N23 A;  4JPR A;  4E2L A;  1QR9 A;  1DF5 A;  2MK3 A;  3B8M A;  4FK5 C;  3B77 A;  1ENV A;  2OT5 A;  3CYO A;  2LP7 A;  1Y4M A;  1K33 A;  4FJC C;  2X7R B;  3M99 B;  1F23 A;  1JQ0 A;  1Y66 A;  3CP1 A;  3K9A A;  5H9C A;  4FIP C;  3P30 A;  4JF3 A;  3WFV A; 
#chains in the Genus database with same CATH topology
 4IIJ B;  1VQP V;  2WWW A;  1N0J A;  3BAB A;  1SER A;  3ZHS A;  4XBF A;  3JCU Z;  1BGY H;  1H2K A;  1B04 A;  2OIE A;  3E22 A;  4I55 B;  4ZOL A;  3SDL A;  2UXX A;  5K1P A;  1S0V A;  1SS3 A;  2XT9 A;  4QGP A;  4AQY B;  2JRI A;  3ASN C;  1GN4 A;  3JD0 A;  3BEH A;  1YIJ V;  2BOB C;  3RN4 A;  3N2K B;  3SPC A;  2Q68 A;  3IAY A;  4J10 A;  4K0K B;  3AG4 B;  4GX5 A;  2E5L O;  5B1N A;  2P7T C;  4MVZ A;  3SJB C;  4JI0 O;  2X6B A;  2LQT A;  2A9H A;  2R9I A;  2ARH A;  3A0H Z;  3OEE G;  4MVR A;  4JI7 O;  4TSF G;  3RYI A;  3UO3 A;  2ATK C;  5JCO A;  1YI2 V;  1R73 A;  1TUE B;  4FLU A;  1K9M W;  4P30 A;  4UCO A;  4EB6 A;  3GB7 C;  3ABT A;  1R6N A;  5GON A;  1OZ0 A;  3I5D A;  4O4H B;  1Q6U A;  2WLH A;  1NQT A;  2PYJ A;  5CB4 A;  5EC2 C;  1GN6 A;  3D3Q A;  5LXT B;  3CD6 V;  1N33 O;  1FXK A;  3W7X A;  2X0L A;  5TIS Z;  3AK3 A;  4I50 A;  1YZB A;  2WLJ A;  3ZMS A;  1CP9 A;  1OHH G;  2BSK A;  3UM7 A;  4IGG A;  1V9P A;  3JAT A;  1X59 A;  1FFX A;  3ZRW B;  1R6T A;  4BAY A;  2NNU A;  4DR4 O;  4P2Z A;  2YEV B;  3FKS G;  3RYC B;  2LW7 A;  4X64 O;  2ZXW C;  1AJN A;  4KHP B;  4HNA B;  4JI7 B;  1P7G A;  2B9Z A;  5C93 A;  1QLN A;  4DW1 A;  3J7A U;  1H8E G;  2WAM A;  3OMN B;  1Q81 W;  2WLL B;  3RYH A;  3B40 A;  2DMX A;  4RUE A;  2ZE5 A;  2P6J A;  1DLB A;  2X6A A;  1MG1 A;  2QM4 A;  3FX7 A;  1TVK B;  3RVY A;  2Q0A A;  3ABL B;  3E22 B;  2DJV A;  3KZI Z;  4IIJ A;  1N36 O;  2DQ3 A;  4FM1 A;  5LGT A;  5JH7 A;  1M90 W;  4LBE C;  3RGB A;  2UXB O;  5H5N A;  4UVC A;  2P90 A;  3FD9 A;  4YHH B;  2NN4 A;  2Q0O C;  1F4M A;  3ZS8 C;  1GM8 A;  1NU1 H;  3SYC A;  4AQY O;  3H1L H;  4NXM B;  1XMQ B;  2VQF B;  3H1H H;  3WU2 Z;  1PKX A;  2E3C A;  5LHG A;  4LC1 A;  2R70 A;  4B3M O;  4OGQ B;  4E4E A;  1N32 B;  1BL8 A;  2IH1 C;  4YY3 O;  4FK5 C;  1VF6 C;  2ADQ B;  1H2G A;  3JAW B;  3N2G B;  2UXN A;  2Q8V A;  2JVD A;  2QWN B;  5IJ9 B;  2ZKO A;  1JR9 A;  3ZHT A;  4I9Q A;  1MZF A;  3CRA A;  2F4V O;  4U3J B;  2IJJ A;  4GLX A;  4J9Z B;  3IFX A;  1AB3 A;  2EIL B;  4YIO A;  3JD2 A;  1DF5 A;  1Y74 B;  3BPZ A;  4EEQ A;  2QEX V;  5KMG A;  5DM6 V;  4TUY A;  1XMQ O;  2IH3 C;  1PPJ H;  2B5U A;  3K9S A;  4QPK A;  3FFQ A;  5CB4 B;  5JVD B;  2CTW A;  3EVK A;  3G4S V;  3AG2 C;  3U10 A;  4P9O A;  2AZ0 A;  3OTO O;  2Q73 A;  1CPY A;  2QM7 A;  3B4S A;  5IE9 A;  1XNR B;  4U7O A;  1PNM A;  3VQX A;  2PY5 A;  3JAR B;  5LP6 A;  1PNK A;  4CS3 A;  1SES A;  4DR3 B;  1N36 B;  4UVA A;  3RYF A;  1MZE A;  3R66 A;  2ZM6 B;  5EZY B;  4FM2 A;  2Z3Y A;  2YIC A;  5KHG A;  5CA1 A;  4I50 B;  4D6T H;  4JYY A;  1VEW A;  3ABL C;  1RM1 C;  1PP9 H;  4KXR A;  3ABK C;  1V54 C;  4FIP C;  4I4T A;  4F4L A;  5LGU A;  4FZ0 A;  2XAS A;  1R6K A;  4PEL A;  1CEZ A;  2EBO A;  4DUY O;  2D2C B;  4N21 A;  1QLE C;  2BTO A;  4HAM A;  1AI6 A;  4LF9 B;  2DE0 X;  4LF7 O;  1K97 A;  3OUS A;  2OCC C;  1N33 B;  4B3T O;  4LF5 O;  3ZJZ A;  3ZHU A;  4FFB A;  4EFB A;  1IBM O;  3HKE B;  4DV6 B;  2A0L A;  3ABK B;  1W0J G;  5DEC A;  4JI8 O;  5LGN A;  4X66 O;  2CH7 B;  4NB5 A;  5CBG A;  2EIK C;  1EBO A;  1GO3 F;  2A06 H;  4NTY A;  1M57 B;  2P06 A;  3K3W A;  3E35 A;  5LMU B;  4LF9 O;  1HNZ O;  3NXS A;  4ZHQ A;  3E83 A;  1IXM A;  4RWU A;  3S3X A;  3OGC C;  3EFF K;  1NBM G;  4MVQ A;  3KG2 A;  1FXV A;  4L8J A;  1SA0 B;  2PI5 A;  4JZ2 A;  1SET A;  1TUB A;  4GYC B;  4J9Y B;  1FKA O;  2M6Y A;  1KB9 F;  2ZIM A;  4UV9 A;  1WB8 A;  3J81 N;  2B1G A;  3QVN A;  1R1B A;  2B1I A;  2P67 A;  4PA3 A;  5H2F Z;  1AR1 B;  4E2L A;  2GTS A;  2W6J G;  4DK1 A;  1A32 A;  4RQF A;  1HNW B;  4JI1 O;  4DV0 B;  4DV4 B;  3T4Z A;  1HW7 A;  4TV8 B;  4B3R O;  3JD1 A;  4IL6 Z;  2EIL C;  5KMG B;  2VQE O;  5EYP A;  3ZX6 A;  1V55 B;  4LNU B;  4H13 B;  4CH5 A;  1NTM H;  2E75 B;  4F6E A;  3TGU H;  1LUW A;  1EN4 A;  2E76 B;  2EIJ C;  3E89 A;  3CE2 A;  4O4L A;  1S76 D;  1VQ4 V;  4O4H A;  4X20 B;  5KUM A;  3K04 A;  4FLZ A;  5LHI A;  4X1Y A;  2LGW A;  1US6 A;  1BQ0 A;  3D36 C;  1X4T A;  4TQF A;  3BCC H;  3JAR A;  5LP6 B;  3FYE B;  1RPO A;  2JJ2 G;  3FB6 C;  3HR0 A;  1SQQ H;  4AHC A;  2VS0 A;  1L1F A;  2BSK B;  1BHA A;  1YVW A;  2YIB A;  2A3Q A;  4PA7 A;  4WBN A;  3CP1 A;  3ZMU A;  4IHJ A;  5LXT A;  1S5J A;  2O57 A;  4UCT A;  3ASN B;  4FPP A;  1XMO O;  2GTA A;  4YY3 B;  4DUZ O;  3HB3 B;  1RM1 B;  2KKW A;  2VQF O;  5CN0 A;  2OCH A;  3ZRS A;  4FLW A;  2KQX A;  2WLL A;  2EIM B;  3AK1 A;  5LMU O;  3CRC A;  1GM7 A;  4QE7 A;  4DYL A;  5CBF A;  1M56 B;  1JQ0 A;  4KUM A;  4JI3 B;  3OAA G;  2GHY A;  4YHH O;  4DR7 O;  2EJR A;  2HVK C;  4X8A A;  4PDL A;  1G1X B;  4X62 O;  2Y48 A;  2BTQ A;  2FKX A;  3ZHV A;  1P84 F;  1E1R G;  2OT5 A;  1MSW D;  4L87 A;  5LMN B;  3ZMV A;  3CCE V;  3JAS B;  3LDC A;  3G71 V;  3AG3 C;  5KHI A;  1XRE A;  3LUT B;  1AR5 A;  2XAG A;  3AG1 B;  2GUZ A;  4YXW G;  3CCQ V;  1BHB A;  4O4J B;  1KP3 A;  4TV8 A;  2LGQ A;  3OMI B;  4LP8 A;  1OCZ B;  4MW8 A;  4ICG A;  1YJN V;  3SPG A;  3RVZ A;  2CDY A;  4B3S B;  2OCC B;  2CTP A;  5IYC O;  2DN9 A;  1XNR O;  3C3T A;  2ZE7 A;  2BOC C;  5CBH A;  5BY1 A;  1Y74 A;  4O2A A;  3L75 H;  3RYH B;  2YS8 A;  4X20 A;  2PYL A;  4LF6 B;  1QVF U;  2ZXW B;  1Y4M A;  1GMG A;  4I7Z B;  1BZK A;  1E79 G;  2LFS A;  1KU9 A;  3VQW A;  2YI8 A;  1E1Q G;  4O4L B;  3MAQ A;  4K35 A;  2CUG A;  4MVU A;  3WB1 A;  3E8G A;  3F7Y C;  4TT3 G;  5H6R A;  3U11 A;  1H2L A;  2Y0P A;  2BCC H;  4IHJ B;  5DN6 G;  4X88 A;  5IT9 N;  2MK3 A;  4W4L A;  2RDC A;  3ETD A;  1SKV A;  2DW4 A;  1PV0 A;  5BMV B;  1XL4 A;  1NVP B;  1KP2 A;  3H1J H;  1Y66 A;  2E5L B;  2K1E A;  3JAM N;  4DV3 O;  1QVG U;  1ZSP A;  3UO2 A;  1K5Q A;  1OCC C;  1QCE A;  1I94 B;  3AG1 C;  1KUQ A;  4MVM A;  4WBN B;  4LCU C;  2JDI G;  3ZN1 A;  2EZO A;  3K57 A;  2HVJ C;  4B3M B;  2M7W A;  4CH3 A;  1I08 A;  1XNQ B;  2F23 A;  3HKB A;  2ZDI C;  3CYO A;  2H94 A;  4JAU A;  2IJK A;  1XNQ O;  4OPH A;  2F95 B;  4JI5 O;  1HDJ A;  1Q8I A;  1AI7 A;  1SQF A;  2DYS B;  2X6C A;  4ZI7 A;  4DV7 O;  5CMU A;  2QDO A;  5JVD A;  1VQK V;  3SR2 C;  5KAF Z;  2CH7 A;  1K4C C;  3QTC A;  3DC6 A;  3BFR A;  4CS4 A;  4MTX A;  3G80 A;  2VRZ A;  3C90 A;  5C8Y A;  4ZHQ B;  4BWA A;  2V1D A;  1VQ6 V;  1XBL A;  2ETN A;  3RYF B;  1K92 A;  4BIU A;  5EZY A;  4CC5 A;  3I55 V;  2GUZ B;  4FLV A;  1KKC A;  2XOK G;  1Q6H A;  3M99 B;  3VQY A;  4J80 A;  4LFA O;  2N05 A;  5B1B C;  4J11 A;  3QO7 A;  4O4J A;  1V54 B;  1G6U A;  2RJZ A;  1EN5 A;  5EBW C;  2PI4 A;  3HPL C;  1TUB B;  3IGA C;  3CXH F;  1HR0 B;  5IYB O;  1GTO A;  3LSQ A;  2XTA A;  1MA1 A;  2HEP A;  3NR7 A;  3ZRX A;  1JA8 A;  5EYP B;  2JGD A;  5J2T B;  2AGA A;  1EZJ A;  4RO2 A;  1UPG A;  1I94 O;  4LFB B;  2OTJ V;  1IX9 A;  4FFB B;  1MOF A;  2EZP A;  1ZX3 A;  4GKJ O;  1VF7 A;  3CMA V;  2LO1 A;  3ABM B;  3ZMZ A;  3K03 A;  1S77 D;  1NR7 A;  1AJQ A;  1ORQ C;  3LDD A;  3BAA A;  2DYR C;  2ZIN A;  1RFY A;  2Y69 C;  3QF7 A;  3TXQ A;  2E74 B;  5KHJ A;  1IZ3 A;  4ZIB A;  2WPD G;  4FZ1 A;  1EM1 A;  1KEC A;  2F93 B;  5LP6 C;  4X62 B;  5B1B B;  4GKK B;  1VAR A;  1N0N A;  3EXA A;  4JI6 B;  3T4D A;  4X1Y B;  4DRX B;  4DV2 B;  4NTX A;  4LF6 O;  4QJF B;  3K5L A;  2ZNI A;  4JAV A;  5CA0 A;  2QKC A;  3FAV B;  4FM0 A;  3ICX A;  1ZL8 B;  2LW1 A;  2QM8 A;  3CC2 V;  1FPO A;  2HR3 A;  5BR8 O;  3WG7 C;  3BRC A;  2ITC C;  1LR1 A;  5KX5 A;  4UCV A;  1AP5 A;  3L73 H;  1Q86 W;  5JQG B;  2F66 C;  4FLX A;  3OT7 A;  2Q67 A;  1YSC A;  3J80 N;  5FPR A;  3CCM V;  1YCI A;  2UUB O;  4J41 A;  3LSU A;  3L74 H;  5D5P A;  1W59 A;  4DR2 O;  4OX9 B;  5BXZ A;  4AIL C;  4IT5 A;  4TOI A;  3K5O A;  3BHP A;  1BE3 H;  3K59 A;  1J95 A;  2BE3 A;  2KSD A;  1NTZ H;  2F43 G;  4R50 A;  2C2A A;  3CCV V;  1GN3 A;  3A2F A;  2V7Q G;  1BCC H;  4RAI A;  3BY6 A;  1VQN V;  4JYC A;  3WFV A;  4O2B A;  2Y4U A;  2HHH O;  3JSN A;  1ZWI C;  1O9G A;  3CCU V;  1NH2 B;  2YDE A;  4NXN B;  4X65 O;  5LYJ A;  2HLD G;  4IYH A;  1HNW O;  4DV5 B;  5EIB C;  5LA6 A;  5FL7 G;  1N8R W;  3SJC C;  1YDX A;  4LF4 O;  4JYA O;  4GX0 A;  1DTO A;  1XMO B;  4DR5 O;  4AI8 A;  3H01 A;  1YEW A;  1NJI W;  1JX9 A;  1RSO A;  1Y76 B;  3FB5 C;  3A8T A;  3B8M A;  4O2A B;  2P5O A;  4DXW A;  1EFR G;  4K8Z A;  4DV5 O;  1AR4 A;  2RQ6 A;  1K7D A;  4Q6G A;  1FXK C;  1L0N H;  3JAS A;  1MSD A;  1Q7Y W;  3BA8 A;  3CCR V;  2WA4 A;  4WF9 V;  1OCR C;  1B06 A;  3ML0 A;  2WLI A;  3DGE A;  1KKD A;  2DOS A;  3THO A;  2ZE6 A;  3I56 V;  5IYZ B;  2JS3 A;  4MTF A;  4TQD A;  4B3T B;  5IY5 C;  3N2K A;  5KX5 B;  2VQE B;  1YJ9 V;  4PJ0 Z;  5JQG A;  4B3R B;  2Q69 A;  4JZG A;  2RN9 A;  4UB6 Z;  5L3G A;  1SQX H;  4WFB V;  3CS5 A;  2K9P A;  4UXN A;  2DQ0 A;  3CME V;  1Y6X A;  4Q20 A;  4JI1 B;  3SYP A;  3D3I A;  2HKO A;  5GW7 A;  5GON B;  1GK9 A;  4WFG A;  2UUB B;  1WP8 A;  3M8A A;  3ZRV A;  1IBL B;  1IBL O;  4DR1 O;  3K5N A;  3HKC A;  4DR6 B;  3L70 H;  1ROP A;  1I7F A;  5AG2 A;  1QHT A;  3W7T A;  3T1H O;  2N74 A;  1G4Y B;  1HNX B;  5IWA B;  5C8Y B;  3KCX A;  2QE7 G;  1R3J C;  1SQB H;  3K5M A;  2PGG A;  2IU3 A;  3P30 A;  1XHZ A;  1WJZ A;  4DW0 A;  4WFA V;  2NLJ C;  1KD1 W;  4JI2 B;  3E2E A;  3OTO B;  3EHB B;  3DC5 A;  1JFF A;  4HYO A;  1P7B A;  1FXK B;  3F5T A;  4OXS A;  3TET A;  1LNQ A;  5FPO A;  4DV6 O;  5B1A C;  4JI6 O;  4D7S A;  1IBM B;  5FNV B;  4RUF A;  4GT1 A;  1OCR B;  2X7R B;  3JAL A;  3B2E E;  3W7S A;  3K9A A;  2GBO A;  2LFR A;  1M5I A;  2XAJ A;  4PA4 A;  1FAF A;  3ZHQ A;  3O65 A;  5HFL A;  3ZMT A;  2EIJ B;  2IBZ H;  2A7W A;  1FJG B;  1ENV A;  3E8H A;  1VF5 B;  4LR3 A;  2AW9 A;  2GSM B;  4U7N A;  4DV1 B;  5JH7 B;  4LF4 B;  4JYA B;  2WLI B;  1KMI Z;  1OJH A;  1HR0 O;  3SPH A;  5IYZ A;  1K3E A;  4NXN O;  4WCE V;  2HP8 A;  4PI0 A;  4O4I A;  3P3N A;  4ZOL B;  2JEU A;  4F6R B;  4MVO A;  2LP7 A;  2MW2 B;  1NS1 A;  4MTG A;  3DTU B;  2UXB B;  3ZIA G;  1CXZ B;  1VQO V;  1NH2 D;  2IU0 A;  2YIA A;  4B7E A;  4DRX A;  4DO2 A;  1SZX A;  3F5W C;  2RNB A;  2L6L A;  1YTF D;  4X9Q A;  1EN6 A;  1QR8 A;  1O9H A;  1WAZ A;  4JTC B;  4Z1V A;  2UXC B;  2DYR B;  4DR2 B;  4QNH B;  3ZBH A;  5H9C A;  4DR4 B;  2HG5 C;  2ZQM A;  1W0K G;  2ILM A;  4NYK A;  2ZIO A;  3K0D A;  2L35 A;  2G38 A;  2EJ7 A;  3MHH C;  1ZL8 A;  3SGI A;  3B09 A;  3QNE A;  4MTO A;  1GH6 A;  3RFR A;  3B77 A;  5BR8 B;  2NR5 A;  1T5E A;  3AG7 A;  4HBN A;  3FYI B;  4NTW A;  3CCS V;  2R9A A;  1N34 B;  2XUM A;  4NR1 A;  1GRJ A;  2QGN A;  4UCU A;  4JI2 O;  2JIZ G;  3OUF A;  1H8H G;  5KHH A;  5GTH Z;  1S5L Z;  3CEI A;  2Z0A A;  1H38 A;  2YSU B;  5LHH A;  1S5H C;  2EX3 A;  2P4K A;  4WFE A;  4J7Z A;  2AXT Z;  1VMG A;  1UJW B;  1AP6 A;  3AG2 B;  3T1Y O;  1ZUQ A;  5A9G A;  1VQ9 V;  1NZ6 A;  4UV8 A;  5L3E A;  2UUA O;  2RMK B;  2UUA B;  1I5Y A;  4JI0 B;  4I4T B;  2CTR A;  5LA6 B;  1MMM A;  2WSS G;  1W2B U;  1WA8 A;  5JJN B;  2QTO A;  4JAA A;  3SPJ A;  3OE7 G;  1Q90 D;  4GCZ A;  2CAZ C;  1TVK A;  1M1K W;  2YC0 A;  5B1O A;  4O4I B;  1K4D C;  3TJT A;  4MT8 A;  3JD3 A;  3FB8 C;  3VBB A;  1ZTE A;  2AHY A;  3ASO B;  3UCS C;  1Q43 A;  2UUC O;  4EKW A;  5EBM C;  2OYQ A;  1FYJ A;  3CCJ V;  2YXH A;  1XL6 A;  4R7C A;  4B3S O;  1TAE A;  5LBQ A;  3SPI A;  5KLV H;  3ZN0 A;  3OMA B;  4JYB A;  2H8P C;  1K34 A;  3HKD B;  3W7W A;  3CRM A;  1AI5 A;  1OCO C;  1S72 V;  1TA8 A;  3OD4 A;  1WPX A;  4UVB A;  4UCR A;  4U3J A;  2YID A;  4BW5 A;  1XIL A;  2KG7 B;  1GAX A;  4DK0 A;  2IJI A;  4DR5 B;  2GDS A;  2ZT9 B;  2Q4P A;  2PF4 E;  1NR1 A;  1AJP A;  1Z2G A;  3TK1 A;  5CA3 A;  4H37 A;  2UU9 B;  4K0K O;  3OW2 U;  2ITD C;  3ETE A;  1YXB A;  4DR7 B;  1OCC B;  3IJ4 A;  3CX5 F;  4X65 B;  1F4N A;  3L72 H;  1OV9 A;  1AIL A;  3Q4H B;  3UT5 B;  2HHH B;  4UCS A;  5F2V O;  1QQC A;  4LH6 A;  2OTL V;  3ZHR A;  2HFE C;  2QKS A;  3HKC B;  2PUS A;  4XDL A;  1JOY A;  4JPR A;  4YJ3 B;  2UXD B;  3ETQ A;  1FJG O;  1D2D A;  3QG5 A;  2DYS C;  1JFF B;  1YTF B;  4QIW F;  5KA6 A;  2QTS A;  3B8N A;  1HWY A;  2QSA A;  1PL4 A;  2ADP A;  5HFM A;  3CPW U;  4CZZ A;  1J5E B;  2QWQ B;  4GX2 A;  4KFM A;  3VQV A;  1HP8 A;  1H2S B;  1GKF A;  1VF6 A;  3CC7 V;  1VQ8 V;  4J7K A;  1R3K C;  2YXY A;  2RCV A;  2ZE8 A;  1ZAU A;  2EIM C;  5BZB A;  5CA0 B;  3WB2 A;  1VIB A;  3T1C A;  3STZ C;  1VQL V;  4TV9 B;  4CBC A;  2ZDI A;  2HJD A;  5EBL C;  5KUK A;  2Q7E A;  5A2Q N;  1WPB A;  3SYQ A;  2PZS A;  5IWA O;  1HNX O;  1WN7 A;  2BTQ B;  4BW9 A;  4DV2 O;  3RWR D;  3CJH B;  4DV0 O;  4NKG B;  4GKK O;  1TGO A;  1KYO F;  3ABM C;  5L3D A;  5IJ0 B;  1MNG A;  2XAH A;  1PM9 A;  4ZBM A;  3CXC U;  1NVP D;  5K1X A;  1IBK B;  2W6I G;  4J42 A;  2Y69 B;  2XAQ A;  5FLX N;  2ZD9 A;  4BIZ A;  4RQE A;  5FNV A;  4QE9 A;  1JMK C;  3T1Y B;  4R6Z A;  1XDC A;  3P3P A;  4GKJ B;  1IVS A;  4PD4 F;  1SC5 B;  3LNN A;  1U97 A;  4LFB O;  3RT3 C;  1HNZ B;  1VQ5 V;  3BVO A;  3LNM B;  4FFK A;  2IM9 A;  3OEH G;  2QR4 A;  5L3B A;  3CRQ A;  4KP4 A;  1N34 O;  2OWO A;  4X66 B;  1LUV A;  3DSQ A;  1JVM A;  3E86 A;  4H0L B;  2QJ1 A;  3UQ8 A;  3C3S A;  1BT8 A;  4PDR A;  2XAF A;  1DF4 A;  1WP7 A;  1L0L H;  3K58 A;  4YIP A;  4BIO A;  5KA5 A;  2EIN C;  2Q6A A;  1QU7 A;  4IYI A;  4K8X A;  4JV5 B;  5EK0 A;  4PA9 A;  3SJA C;  2UU9 O;  4WFF A;  2Q7G A;  4DUZ B;  1H2N A;  4LNU A;  1UFI A;  3JAT B;  3AK2 A;  4PDM A;  1KC8 W;  3ZRW A;  2ODM A;  2IW5 A;  2QWO B;  1BQZ A;  4UUJ C;  3JYC A;  4WFH A;  1S3J A;  2JS5 A;  1XI1 A;  4FMT A;  3X2Q B;  4YJ2 A;  5J2U A;  1VP7 A;  1KQS U;  1K73 W;  3G6B A;  1SRY A;  2F1M A;  1Q6I A;  1JCH A;  2AHZ A;  2ZR2 A;  2CGO A;  3BA9 A;  4X1K A;  4DV7 B;  4B08 A;  3JAK A;  3H1K H;  4JTD B;  4CS2 A;  5E79 Z;  1FXH A;  1YHQ V;  4B7K A;  1JPX A;  1M57 C;  5JJE B;  1BMF G;  1L8D A;  4XDJ A;  2UUC B;  3DXR B;  2V4D A;  2Q5Z A;  4UB8 Z;  3G6E V;  2CE4 A;  4Z1M G;  3FB7 C;  5B66 Z;  4TV9 A;  4I5S A;  1IXB A;  1IUR A;  3OR7 C;  4PHZ A;  1WA8 B;  5IJ0 A;  4DV1 O;  4DV4 O;  1VQ7 V;  1NTK H;  1F7Y A;  1YF2 A;  1D5N A;  3H1I H;  4BR6 A;  3OTF A;  1AVM A;  4G28 B;  1DK1 A;  3CCL V;  1Z5V A;  4P9P A;  2F4V B;  1Y67 A;  1EZV H;  3AG3 B;  4FVM A;  1GM9 A;  2CGN A;  2WA3 A;  3D36 A;  1F23 A;  4PA6 A;  2DWD C;  1SQV H;  1XQ8 A;  3A0B Z;  4I9W A;  3UKM A;  1N32 O;  4GX1 A;  4NXM O;  4MSW C;  3OM3 B;  2EIK B;  2EIN B;  5D5Q A;  3K06 A;  2EUL A;  2XHB A;  1QR9 A;  5LOV A;  2WLM A;  3HKD A;  2JEX A;  3JD4 A;  2R9R B;  3RBZ A;  5L3C A;  5ITZ A;  3GWO A;  1KBH A;  1XUQ A;  3RW0 A;  1Q5O A;  3JAL B;  4LF5 B;  3E8B A;  1JJ2 U;  4H33 A;  1RP3 B;  1B6Q A;  5DED A;  1MAB G;  4ASU G;  4N23 A;  4DUY B;  4PV1 B;  4LF8 B;  4J7J A;  1K8A W;  3UT5 A;  3APQ A;  4LFC O;  4X1I A;  4LWS A;  3MDS A;  2Z5U A;  4KHP O;  3GVM A;  1SF9 A;  3T2M A;  2QWR B;  2Q7H A;  2UXC O;  4I55 A;  3PN1 A;  3VOU A;  1RPR A;  4XDK A;  1FFT B;  2YXL A;  3Q4H A;  1PL0 A;  4GUN A;  5BMV A;  4X1K B;  4LFC B;  5H6Q A;  1QNM A;  4G27 B;  3JCZ A;  4ABM A;  3QO8 A;  3K08 A;  4LF8 O;  1FD9 A;  1M9N A;  4Z2W A;  1OCO B;  4JAS A;  3MD0 A;  4FJC C;  4DR3 O;  3H9V A;  4F6R A;  1WB7 A;  1M56 C;  4C7U A;  2YEV A;  4FLY A;  3E8F A;  2WLN A;  3FAV A;  4FLT A;  2LJ2 A;  1COW G;  4JI3 O;  4LFA B;  3WB0 A;  1BSM A;  2KG7 A;  3MHS C;  5EC1 C;  3LDE A;  2HJF C;  3X2Q C;  3A0R A;  4MVS A;  5IDJ A;  1G8M A;  1N4C A;  3K79 A;  1R3I C;  1B3Q A;  3ASO C;  2FL4 A;  3M7M X;  4ZI7 B;  3HKB B;  3ABU A;  3LSS A;  2VWK A;  2VWJ A;  4CC6 A;  1JJO A;  3IC9 A;  3ETG A;  2Y4T A;  5JWP A;  1XEQ A;  5J9P C;  1SA0 A;  1XOU A;  2A79 B;  3SYO A;  1VQM V;  2ZNJ A;  2Q9L A;  4H44 B;  3PJS K;  4R8C A;  5GTI Z;  1DGS A;  1WLE A;  3D8C A;  4YJ3 A;  3CWB H;  1Z5W A;  4JV5 O;  2FB5 A;  2YIB D;  1I5X A;  3APO A;  3TXS A;  4GZR B;  5LOV B;  1ARO P;  4JI5 B;  1SQG A;  3KCY A;  1M4U A;  1R3L C;  1H2M A;  3JAW A;  3N2G A;  4HZ3 A;  1FS0 G;  1V55 C;  5E1A C;  5LYJ B;  5B3S B;  2FML A;  2ZR3 A;  3OGI B;  4K3A A;  1RSO B;  1Y76 A;  4PDV A;  3CSX A;  2CTQ A;  1F51 A;  4X1I B;  3T1H B;  5ITZ B;  4DV3 B;  3JSL A;  1YJW V;  4I0X A;  1GN2 A;  4TUY B;  3CRR A;  2AZ2 A;  2PTM A;  2IJH A;  3S3W A;  3R65 A;  3CC4 V;  4DR6 O;  2CK3 G;  4OX9 O;  3W7U A;  1OCZ C;  4DR1 B;  4NVP A;  1P4R A;  1NI8 A;  2OIG A;  1BS3 A;  1SZT A;  1WNS A;  4X64 B;  4LWS B;  1URF A;  4JI4 B;  2JGD B;  5J2T A;  2Y0I A;  3CJH A;  3L9D A;  5B1A B;  3TCU A;  1NKD A;  2YI9 A;  5IJ9 A;  2P4V A;  1M93 A;  2JK5 C;  3ZCC A;  3KKY A;  2GV9 A;  4CH4 A;  4MW3 A;  4YJ2 B;  5J2U B;  1PNL A;  1Q3E A;  5CA1 B;  3WG7 B;  5KAI Z;  1QBZ A;  4A5U B;  2QWP B;  4JGS A;  3AEI A;  1IDS A;  1PD3 A;  1NT2 B;  2QA4 V;  1ZLZ A;  4TWK A;  1QLE B;  3IC7 A;  4JI8 B;  3SYA A;  1AI4 A;  4ZKI A;  4OPA A;  4LH7 A;  1K33 A;  4LF7 B;  2H3O A;  4PI2 A;  3G67 A;  2KB1 A;  2XND G;  2R72 A;  4JF3 A;  4KL1 A;  2YUA A;  4JTA B;  1SQP H;  3L71 H;  1D5A A;  5B5E Z;  2W0X A;  5B3S C;  4EFE A;  3STL C;  4U3F H;  5LMN O;  1I0H A;  1IBK O;  3AG4 C;  2D3O W;  3GWK C;  4D7T A;  3F7V C;  3CHX A;  1U96 A;  2UXD O;  4X89 A;  3DXR A;  3P32 A;  1K5S A;  5IYD O;  4UFZ A;  3RYI B;  4G2K A;  2ZM6 O;  3N27 A;  3O9O A;  5KHK A;  4MS2 A;  3K0G A;  4EB6 B;  2ZCE A;  2W0F C;  2JJ1 G;  5LL6 Y;  2WLK A;  3SJQ C;  2FYU H;  2P22 C;  4O2B B;  2JGU A;  5JJJ B;  4CH6 A;  3ZED A;  5EIB D;  4I0X B;  1XHX A;  3RYC A;  2QKA A;  5JCO C;  1YIT V;  5L3F A;  3OFN G;  5IY5 B;  3JAK B;  4HNA A;  3CB2 A;  4W4K A;  3HKE A;  2N04 A;  4JI4 O;  1J5E O;  2FTK A;  1FFX B;  2DWE C;  1THZ A;  3OR6 C;  3QO5 A;  1P49 A;  3U0Z A;  4QPJ A;  1Q82 W; 
#chains in the Genus database with same CATH homology
 4PDR A;  2XAF A;  1DF4 A;  2EJR A;  2HVK C;  1VQP V;  4X8A A;  4PDL A;  5KA5 A;  2WWW A;  2EIN C;  2Q6A A;  2Y48 A;  5EK0 A;  1ROP A;  1SER A;  4PA9 A;  4XBF A;  3W7T A;  4WFF A;  1E1R G;  1G4Y B;  2OT5 A;  1MSW D;  4L87 A;  3ZMV A;  3CCE V;  2QE7 G;  1R3J C;  4PDM A;  1KC8 W;  3ZRW A;  2IU3 A;  2UXX A;  2IW5 A;  3P30 A;  3LDC A;  3G71 V;  1S0V A;  3AG3 C;  4UUJ C;  3JYC A;  2NLJ C;  4WFH A;  4WFA V;  1KD1 W;  3E2E A;  3ASN C;  3EHB B;  1S3J A;  3LUT B;  4FMT A;  4HYO A;  1P7B A;  2XAG A;  3AG1 B;  1FXK B;  3JD0 A;  4OXS A;  3TET A;  1LNQ A;  3X2Q B;  5B1A C;  4YXW G;  3BEH A;  3CCQ V;  1KQS U;  1YIJ V;  1BHB A;  1K73 W;  2BOB C;  3SPC A;  1SRY A;  2Q68 A;  1JCH A;  2AHZ A;  4RUF A;  1KP3 A;  2ZR2 A;  3OMI B;  4GT1 A;  4LP8 A;  1OCZ B;  3AG4 B;  1OCR B;  2X7R B;  4MW8 A;  4GX5 A;  3W7S A;  3K9A A;  1YJN V;  3SPG A;  4JTD B;  3RVZ A;  5B1N A;  2P7T C;  4MVZ A;  1FXH A;  2OCC B;  2X6B A;  1YHQ V;  2LFR A;  5IYC O;  2XAJ A;  4PA4 A;  2BOC C;  5CBH A;  2A9H A;  1JPX A;  1M57 C;  1BMF G;  4XDJ A;  5HFL A;  2R9I A;  3ZMT A;  2EIJ B;  3OEE G;  4MVR A;  1QVF U;  3G6E V;  4TSF G;  4Z1M G;  3FB7 C;  1ENV A;  4I5S A;  2ZXW B;  3E8H A;  2ATK C;  1Y4M A;  2GSM B;  4U7N A;  1YI2 V;  1GMG A;  1R73 A;  1TUE B;  3OR7 C;  1K9M W;  4P30 A;  1E79 G;  2LFS A;  3GB7 C;  1VQ7 V;  3ABT A;  1R6N A;  1OZ0 A;  2WLI B;  1E1Q G;  4G28 B;  3SPH A;  2WLH A;  1K3E A;  1NQT A;  3CCL V;  4MVU A;  4WCE V;  4P9P A;  3E8G A;  3F7Y C;  4TT3 G;  5H6R A;  2JEU A;  5EC2 C;  5DN6 G;  4X88 A;  2MK3 A;  3AG3 B;  3ETD A;  4MVO A;  2DW4 A;  3CD6 V;  1GM9 A;  2LP7 A;  4MTG A;  4QPJ A;  1NVP B;  1XL4 A;  3DTU B;  3D36 A;  1FXK A;  1KP2 A;  1F23 A;  4PA6 A;  3ZIA G;  3W7X A;  1Y66 A;  2K1E A;  2X0L A;  1QVG U;  2DWD C;  1VQO V;  1NH2 D;  2IU0 A;  2WLJ A;  1OCC C;  1K5Q A;  3ZMS A;  1CP9 A;  1OHH G;  4I9W A;  1QCE A;  3UKM A;  3UM7 A;  4DO2 A;  3AG1 C;  4MVM A;  3F5W C;  4LCU C;  2JDI G;  3ZN1 A;  2EZO A;  3ZRW B;  4GX1 A;  1YTF D;  4MSW C;  2HVJ C;  3OM3 B;  2M7W A;  2EIK B;  4BAY A;  2EIN B;  2NNU A;  3K06 A;  1QR8 A;  4P2Z A;  2YEV B;  3FKS G;  1QR9 A;  2ZDI C;  2WLM A;  3CYO A;  4JTC B;  2ZXW C;  1AJN A;  2H94 A;  2DYR B;  5C93 A;  4JAU A;  2IJK A;  2JEX A;  4QNH B;  3JD4 A;  1QLN A;  1H8E G;  2R9R B;  5H9C A;  3RBZ A;  2HG5 C;  2ZQM A;  2WAM A;  3OMN B;  5L3C A;  1Q81 W;  1AI7 A;  2WLL B;  3GWO A;  1W0K G;  4RUE A;  2DYS B;  2P6J A;  3RW0 A;  1DLB A;  2X6A A;  1MG1 A;  3E8B A;  2X6C A;  3K0D A;  1JJ2 U;  4H33 A;  3RVY A;  3ABL B;  3MHH C;  5CMU A;  1B6Q A;  2DQ3 A;  5LGT A;  4MTO A;  3QNE A;  1MAB G;  4ASU G;  4N23 A;  1M90 W;  4LBE C;  1VQK V;  1K4C C;  1K8A W;  3B77 A;  4UVC A;  2P90 A;  3FYI B;  3CCS V;  2Z5U A;  4MTX A;  3T2M A;  1F4M A;  1GM8 A;  3VOU A;  1RPR A;  3SYC A;  2JIZ G;  2V1D A;  4XDK A;  3OUF A;  1H8H G;  1FFT B;  1VQ6 V;  1PL0 A;  1H38 A;  1K92 A;  4BIU A;  2YSU B;  1PKX A;  5H6Q A;  5LHH A;  5LHG A;  1S5H C;  4G27 B;  4LC1 A;  3JCZ A;  3QO8 A;  3K08 A;  1BL8 A;  3I55 V;  2IH1 C;  1M9N A;  4FK5 C;  1OCO B;  4WFE A;  4JAS A;  3MD0 A;  1UJW B;  3AG2 B;  4FJC C;  2XOK G;  1H2G A;  3M99 B;  2UXN A;  5B1B C;  3QO7 A;  1V54 B;  1M56 C;  1VQ9 V;  4UV8 A;  5L3E A;  2YEV A;  5EBW C;  3E8F A;  2WLN A;  2PI4 A;  1I5Y A;  3HPL C;  1COW G;  3IGA C;  2IJJ A;  3MHS C;  5IYB O;  4J9Z B;  3IFX A;  2EIL B;  2WSS G;  1W2B U;  5EC1 C;  3LDE A;  1GTO A;  3LSQ A;  2HJF C;  3JD2 A;  1DF5 A;  3X2Q C;  2QTO A;  3SPJ A;  3A0R A;  4MVS A;  3OE7 G;  5IDJ A;  1G8M A;  3K79 A;  4GCZ A;  1R3I C;  2QEX V;  3ASO C;  3ZRX A;  5DM6 V;  1M1K W;  1EZJ A;  2IH3 C;  4RO2 A;  2B5U A;  5B1O A;  2OTJ V;  3ABU A;  3LSS A;  4QPK A;  1K4D C;  1MOF A;  2EZP A;  3G4S V;  3AG2 C;  4MT8 A;  3JD3 A;  4P9O A;  3FB8 C;  3VBB A;  3CMA V;  2AHY A;  3ETG A;  1CPY A;  3ASO B;  3ABM B;  3ZMZ A;  3K03 A;  5J9P C;  4EKW A;  2QM7 A;  5EBM C;  2A79 B;  3SYO A;  1VQM V;  1S77 D;  1NR7 A;  3CCJ V;  1AJQ A;  1ORQ C;  3PJS K;  4R8C A;  1XL6 A;  3LDD A;  4R7C A;  2DYR C;  2Y69 C;  4U7O A;  5LBQ A;  1PNM A;  1WLE A;  1PNK A;  3SPI A;  1SES A;  4UVA A;  3ZN0 A;  2WPD G;  3OMA B;  1KEC A;  1I5X A;  4JYB A;  2Z3Y A;  5B1B B;  2H8P C;  1K34 A;  1ARO P;  3T4D A;  1R3L C;  3W7W A;  1AI5 A;  1OCO C;  3ABL C;  4QJF B;  4JAV A;  4HZ3 A;  1RM1 C;  1S72 V;  1FS0 G;  1V55 C;  3ABK C;  1WPX A;  4UVB A;  1V54 C;  5E1A C;  4FIP C;  4F4L A;  5B3S B;  2ZR3 A;  5LGU A;  2QM8 A;  4BW5 A;  3CC2 V;  2XAS A;  1R6K A;  4PEL A;  2HR3 A;  2IJI A;  3WG7 C;  1CEZ A;  2EBO A;  2ITC C;  4PDV A;  4N21 A;  1NR1 A;  1AJP A;  1F51 A;  1QLE C;  4HAM A;  3TK1 A;  1AI6 A;  5CA3 A;  1Q86 W;  4H37 A;  1YJW V;  3OW2 U;  2ITD C;  3ETE A;  1K97 A;  3OUS A;  2OCC C;  2IJH A;  3ZJZ A;  1OCC B;  1YSC A;  2Q67 A;  3R65 A;  3CC4 V;  2CK3 G;  3CCM V;  1F4N A;  3W7U A;  1OCZ C;  2A0L A;  1W0J G;  3ABK B;  5LGN A;  5CBG A;  1P4R A;  2EIK C;  1EBO A;  1GO3 F;  1SZT A;  1M57 B;  3K3W A;  3E35 A;  1J95 A;  5B1A B;  2OTL V;  3NXS A;  3TCU A;  2F43 G;  1NKD A;  3E83 A;  2HFE C;  2QKS A;  4XDL A;  1IXM A;  1JOY A;  4R50 A;  4JPR A;  3OGC C;  3EFF K;  1NBM G;  2C2A A;  4MVQ A;  3KG2 A;  3CCV V;  1FXV A;  2JK5 C;  2V7Q G;  2DYS C;  3ZCC A;  1YTF B;  4RAI A;  2PI5 A;  4MW3 A;  1PNL A;  3BY6 A;  4JYC A;  4QIW F;  3WFV A;  1VQN V;  1SET A;  3WG7 B;  4J9Y B;  1QBZ A;  4UV9 A;  2B1G A;  4JGS A;  3AEI A;  1PD3 A;  2QA4 V;  1ZWI C;  4TWK A;  5KA6 A;  3CCU V;  2B1I A;  1QLE B;  3B8N A;  2P67 A;  3IC7 A;  4PA3 A;  1HWY A;  3SYA A;  1NH2 B;  1AI4 A;  1AR1 B;  5HFM A;  3CPW U;  4CZZ A;  4E2L A;  2HLD G;  4GX2 A;  2W6J G;  4KFM A;  4ZKI A;  1GKF A;  4RQF A;  3CC7 V;  1K33 A;  5FL7 G;  1VQ8 V;  1N8R W;  2KB1 A;  3T4Z A;  2XND G;  1R3K C;  4JF3 A;  4GX0 A;  2EIM C;  5BZB A;  4JTA B;  1DTO A;  3JD1 A;  2EIL C;  3T1C A;  3H01 A;  1V55 B;  3STZ C;  1VQL V;  4CBC A;  2ZDI A;  5B3S C;  5EBL C;  5KUK A;  1NJI W;  3STL C;  1JX9 A;  3FB5 C;  3SYQ A;  3AG4 C;  3B8M A;  2D3O W;  3F7V C;  2EIJ C;  3E89 A;  4DXW A;  1S76 D;  1VQ4 V;  4X89 A;  3P32 A;  5KUM A;  1EFR G;  1K5S A;  3K04 A;  5IYD O;  5LHI A;  1K7D A;  4G2K A;  1FXK C;  3FYE B;  1Q7Y W;  3ABM C;  4MS2 A;  3CCR V;  1RPO A;  5L3D A;  2JJ2 G;  3FB6 C;  3K0G A;  1OCR C;  4WF9 V;  2XAH A;  4ZBM A;  3ML0 A;  2WLI A;  3DGE A;  1KKD A;  3CXC U;  2W0F C;  2JJ1 G;  1NVP D;  2WLK A;  3I56 V;  3SJQ C;  1L1F A;  2W6I G;  2Y69 B;  2XAQ A;  4MTF A;  2ZD9 A;  1BHA A;  4BIZ A;  4RQE A;  5IY5 C;  4PA7 A;  3CP1 A;  4QE9 A;  3ZMU A;  4R6Z A;  1YJ9 V;  3ASN B;  4FPP A;  2Q69 A;  3HB3 B;  1YIT V;  5L3G A;  1RM1 B;  5L3F A;  4WFB V;  3OFN G;  5IY5 B;  4UXN A;  1VQ5 V;  2DQ0 A;  3LNM B;  3CME V;  3OEH G;  4Q20 A;  3SYP A;  5CN0 A;  3D3I A;  3ZRS A;  5L3B A;  2HKO A;  5GW7 A;  2FTK A;  4KP4 A;  2WLL A;  2EIM B;  1GK9 A;  1GM7 A;  4WFG A;  4QE7 A;  2DWE C;  1THZ A;  1JVM A;  3OR6 C;  3QO5 A;  5CBF A;  1M56 B;  3E86 A;  1JQ0 A;  3ZRV A;  4KUM A;  3OAA G;  2GHY A;  1Q82 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...