1EBOA

Crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIGEADGLIEGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCRIEPHDWTKNITDKIDQIIHDFVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EBOLA VIRUS ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMEN
publication title Crystal structure of the Ebola virus membrane fusion subunit, GP2, from the envelope glycoprotein ectodomain.
pubmed doi rcsb
source organism Ebola virus sp.
molecule tags Viral protein
total genus 45
structure length 112
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1eboA00
1Y66A 2OT5A 2EBOA 1Y4MA 3B77A 1SZTA 3H01A 5HFLA 4JGSA 4N23A 2MK3A 1ENVA 3CP1A 3MHSC 2M7WA 4G2KA 4JF3A 4FK5C 1F23A 1JPXA 4JPRA 1DLBA 1QR8A 3P30A 5CN0A 4N21A 3B8NA 5H9CA 1MOFA 2EZPA 2P6JA 1I5XA 3MHHC 4FJCC 3GWOA 3M99B 3K9AA 5KA6A 1EBOA 1DF4A 4E2LA 5KA5A 1K34A 4FIPC 3B8MA 1K33A 3CYOA 1QCEA 5CMUA 5HFMA 1JQ0A 3WFVA 1QR9A 1QBZA 2LP7A 1DF5A 1MG1A 1I5YA 2X7RB 2EZOA
chains in the Genus database with same CATH superfamily
4UVAA 1PL0A 3K3WA 1OJHA 4G2KA 4H33A 3K58A 5CN0A 4P9PA 1M57C 3J81N 2PZSA 3KKYA 4OPAA 1SA0B 3CC2V 2QKCA 4I50B 1G6UA 5KHJA 2XAGA 2DWEC 1Q8IA 1T5EA 2EINB 3LNNA 3WFVA 1N36B 1FXVA 4B3MB 4NYKA 3OE7G 3F7VC 2F23A 1Q86W 1Y76B 3K5OA 4G28B 1Z5WA 5CA0B 2HJDA 4IL6Z 4GX5A 1EM1A 1HP8A 1JA8A 1NR1A 2BE3A 3JAWB 1VQ5V 4DV7B 1NVPD 2X7RB 1E1QG 3CWBH 2F66C 2BTQB 2ZDIA 4LF4O 1KMIZ 2F1MA 3P30A 3RT3C 4DV3O 4U3JB 3VBBA 2JGDA 4JYCA 2DQ3A 2XNDG 3RVZA 1DGSA 2B1IA 5EIBD 5HFMA 4DV1O 5LGNA 5FL7G 2JDIG 4PDLA 4TV9B 1AI5A 3A0BZ 1WPBA 3LDEA 4UVBA 4X64O 5JJEB 5EYPA 3ZRSA 1IURA 2ZT9B 4FFBB 1WAZA 1G8MA 4QPJA 1FXKA 5JQGB 2P7TC 1I5XA 4LP8A 4B7EA 2W6IG 3JATA 5J2TA 3QF7A 1TUEB 4K0KB 1BHAA 2WLIB 4UCUA 4LFAO 1BE3H 5KMGA 4TV8A 4RO2A 3SJQC 4YXWG 4YJ2B 3W7TA 1YJNV 4O2BA 1DK1A 5A2QN 5JVDB 1PV0A 4FK5C 2IU3A 5L3CA 1MSWD 1JPXA 3AG4C 3T1YO 1YXBA 3BFRA 3FD9A 2XTAA 3CRAA 3CMAV 2XAJA 1JR9A 1RM1C 3E83A 3SYOA 4X65O 4LFBB 5DN6G 1M56B 3VOUA 1VF7A 3OM3B 4LF8O 4KP4A 2OWOA 4X8AA 2QEXV 3WB1A 4FLTA 4EFBA 2VWKA 4KFMA 1AILA 2HHHB 3H1KH 1SQPH 1JJOA 4NTYA 3AK2A 1PM9A 2AGAA 5KHIA 3DTUB 2ZQMA 3RW0A 1M56C 1Q6HA 1XHXA 4JAVA 1XOUA 3ZMZA 2R9IA 3WG7B 1O9HA 1R6NA 4I5SA 1OZ0A 4WBNB 1XEQA 3LUTB 1HNZO 2PYLA 3H9VA 4X1YA 3SYAA 3I55V 2UU9B 1YZBA 3OW2U 1FPOA 3G6BA 1RPRA 2AXTZ 3E35A 3UO3A 1FJGO 3RYCB 2BCCH 2IJJA 4X1IB 4OX9B 1XNRB 3ZHSA 3OD4A 5H6RA 1VQ9V 4B3RB 2Z3YA 1DF5A 1MG1A 3DC6A 4WFEA 5JCOC 4JI0B 4J41A 1SQBH 3R65A 3J80N 2B5UA 3ZHTA 2ZE5A 3E8GA 3G80A 5L3EA 1IBMB 3K03A 1FAFA 5EBLC 1AR5A 1RSOA 3FAVB 1S76D 2ADPA 5CBFA 3L74H 4DR7O 3A0RA 4LF9O 5IJ9B 3BRCA 3E22B 1M4UA 2HP8A 4J9YB 2ZXWB 2QKSA 4CH6A 4R7CA 1HNWB 3BHPA 5KUKA 3JARA 3RN4A 3ZHVA 2GBOA 2VQFO 3CCSV 2QWQB 4LC1A 3PN1A 4LNUB 1I0HA 1V55B 3D36A 2NNUA 3RVYA 3JSNA 2ZXWC 3OFNG 3JALB 2Q5ZA 2K1EA 1WP7A 3AG1C 1GM9A 3B8MA 3CS5A 3O65A 3A8TA 4UB8Z 4TOIA 2X0LA 4J7KA 3DGEA 1FYJA 3HKCA 1V55C 4RAIA 3Q4HA 4DRXA 1FFXA 3DSQA 5ITZB 3AG3B 5L3BA 4LF5B 4FM0A 2JEXA 2KKWA 5KA5A 4W4LA 4BW5A 1EZJA 3K06A 2UXBB 4CBCA 3SYQA 5D5QA 3C90A 2XASA 3BY6A 2CGNA 4U3FH 1W2BU 1N36O 3ZMSA 2BSKA 2P4VA 3AG3C 5B5EZ 2Y4TA 2YC0A 4MVRA 3ZBHA 1BHBA 4X89A 2XUMA 4PELA 4PDMA 4FMTA 4DW0A 2IU0A 5KLVH 3JAMN 1KD1W 1OHHG 4NTWA 2OT5A 4HNAB 4ASUG 2B9ZA 2EIJB 2MK3A 1J5EB 4DV7O 1AR1B 1P7BA 1NR7A 1ZUQA 2P06A 2P4KA 1BSMA 1COWG 4BWAA 2PF4E 4QIWF 3FX7A 2YIBD 4LH7A 2EIJC 3N27A 1PD3A 1ZL8B 2XAFA 1NTMH 3KCXA 3L9DA 3IJ4A 1DLBA 2P90A 4EB6A 3E86A 3T4ZA 4JI4B 2FKXA 4FLVA 4JI6B 3TXQA 3CB2A 1N8RW 1AJQA 4RWUA 4CH3A 3CX5F 2RCVA 2Y69C 2YI8A 3ABTA 2VQEO 2HKOA 2XT9A 1Q6UA 1ZTEA 4ZI7A 1KU9A 1M93A 4K0KO 2LQTA 2R72A 3TK1A 1QVGU 4DR5B 1TUBA 3T1HB 2YIBA 3AEIA 4DV4B 2UXDB 1L0LH 4I4TA 2ZNIA 1GN2A 4PI0A 4GZRB 2E74B 4I55B 1M1KW 4LF6B 4K3AA 1VQKV 5LOVA 2KSDA 4CS3A 1BCCH 4O4HB 2DWDC 3E2EA 1JOYA 1CP9A 4YIPA 3UT5B 4EEQA 1VQ8V 3JAKB 3AK3A 2CAZC 2A7WA 3CCLV 4MSWC 1URFA 2CTPA 1MABG 4LFBO 1S72V 3OUFA 5L3GA 3B09A 4WFAV 1TVKA 2JJ1G 4X66B 1SC5B 3SGIA 1XMQO 2JS3A 2HHHO 4O4IA 2OIGA 3CXHF 4J9ZB 1Q90D 3ZN0A 1KKCA 2KG7A 2OCCC 2V7QG 1U97A 2HLDG 3FYIB 4UUJC 4I7ZB 1BQ0A 3CCEV 3EHBB 1OCOB 3SJAC 3N2KA 2UU9O 4RUEA 3D3QA 2YICA 4AQYB 1TAEA 2ODMA 2IJIA 5HFLA 4OX9O 1EZVH 1XNRO 4KHPB 5B3SB 2P22C 1VQ6V 4B3RO 4UCRA 3SPIA 3GWOA 1OCOC 2PY5A 4FIPC 4WFGA 4JI0O 1XNQO 3T1CA 4YJ3B 3HKBA 5B1BB 5LGUA 1F4MA 3W7XA 5CB4B 3APQA 3QO7A 2KB1A 5B3SC 2RDCA 3FFQA 3MHSC 4UCSA 3U10A 1PNMA 5LHGA 1IBMO 4NXMB 3OTOB 5IE9A 1SA0A 1J95A 2ITDC 4GKKB 4HYOA 2O57A 2RMKB 4F4LA 3OMAB 4DUYO 5B1BC 5CA3A 2R9AA 3T4DA 4IHJB 1JCHA 2YS8A 3CJHB 1HNWO 4X1KB 1GN3A 1Y76A 2Q7EA 1YITV 1HWYA 3G6EV 1LNQA 1HW7A 2ZCEA 1HDJA 1QNMA 3LDDA 4X62B 3CRMA 2KQXA 4I0XB 5LXTA 4ZHQB 1H8HG 3JAWA 4ZKIA 4F6EA 1BS3A 1V9PA 1QBZA 2LJ2A 5BY1A 4JV5B 4Z1VA 4LWSB 4DR3B 2BTQA 2YDEA 2PI4A 2YIDA 2EIKB 4ZIBA 5H5NA 2WLLB 4FJCC 3ZRXA 3K9AA 4IYIA 4YHHO 1Y6XA 4FZ1A 5BR8B 3OT7A 2ZM6B 5LA6B 4ZOLB 4Z1MG 3QTCA 4H13B 4LF5O 4TV9A 3K9SA 3ZCCA 1F51A 2Z0AA 3UCSC 1G1XB 2EIKC 1W0KG 1N33O 1X4TA 1P7GA 2ZR3A 3WB0A 2UXBO 3ZRWA 4FFBA 1NQTA 1WA8B 3UKMA 3SPHA 2A79B 1GM8A 4GUNA 3E8HA 3CD6V 2Q8VA 4XBFA 2CE4A 1Y74B 2Y0IA 2EJ7A 4TQDA 3VQVA 1WPXA 5LP6B 5IYCO 2AW9A 2PYJA 3X2QB 4DV6B 5JVDA 4UV9A 4DV2O 1JFFB 1J5EO 1FKAO 1IDSA 3RYHB 4C7UA 2F95B 2M6YA 5J2UB 5LP6C 2CUGA 4RQFA 3CCMV 1RP3B 2DN9A 4QJFB 2F4VB 3X2QC 4RUFA 2QM8A 1F7YA 1R3KC 1XHZA 2HG5C 4RQEA 2HEPA 5IYZB 4N21A 4Q6GA 4DR1B 2JEUA 1VF6C 2UXXA 2GUZB 3FB7C 3JASB 3HKDB 1Y67A 4DK0A 1IXMA 2LFSA 4R50A 3JD0A 1D5NA 4DV5B 1JJ2U 4JI4O 5LBQA 1E79G 4GLXA 2WA3A 2EZOA 3LDCA 4IT5A 4JI6O 3B77A 1SZTA 2UUAB 3U11A 2OTJV 3O9OA 4WBNA 3IC7A 3UM7A 5J9PC 4PDRA 4QPKA 2V1DA 5JCOA 2CGOA 4PA3A 2R9RB 2DOSA 3AG4B 3P32A 4PHZA 4DR5O 3HKEB 3T1HO 3RYCA 5EZYB 4B08A 4ZBMA 4X1IA 2UXDO 2DQ0A 3DXRB 4FM2A 1RM1B 4LF6O 5JH7B 3K79A 4XDKA 1IBLB 1FS0G 1WN7A 1SF9A 5IJ0B 1N32B 5FLXN 1QVFU 4MVOA 1ZLZA 1YTFB 3C3TA 1K33A 2WSSG 3MAQA 1WB8A 2YXHA 1YJ9V 2UUCO 3CMEV 5A9GA 3ABUA 2Q7HA 3ZS8C 4X66O 1HR0B 3ETGA 3FAVA 5IYBO 3ZX6A 3QNEA 4LF7B 1I08A 2QJ1A 1F4NA 4OGQB 1NH2B 4IYHA 3BAAA 2UXNA 1QU7A 3E22A 4JAAA 5EK0A 4JZ2A 1YSCA 2VRZA 1AI4A 4IIJA 4GKJB 1XL4A 1XMOB 2WLJA 5IY5B 1IBKB 3JSLA 5CA1B 4JASA 4LNUA 1SZXA 3T2MA 1KB9F 4AQYO 1AP5A 3JALA 2NR5A 4G27B 1S0VA 1VQLV 4KHPO 1YEWA 2BOCC 2IBZH 4DR6B 1S5LZ 5IY5C 3D3IA 3ABKB 2E3CA 1NI8A 4FFKA 2ZDIC 3PJSK 2Q6AA 1ZSPA 5IT9N 2HVKC 1K5SA 2JIZG 1ROPA 4WFBV 3ZHQA 1BT8A 2ZD9A 3JATB 3SPJA 5ITZA 5KA6A 5H6QA 3CPWU 5FPOA 5IWAO 2WA4A 2HFEC 3THOA 2Q9LA 4J80A 1YVWA 1A32A 3ABKC 3VQYA 4NXMO 3OTOO 1MZFA 4BR6A 4GKKO 3BA8A 3HB3B 1AI7A 1N4CA 2QM4A 4TSFG 1K97A 1AJPA 3STLC 4WFHA 1PNLA 2AZ2A 3P3NA 4BAYA 3TCUA 4R6ZA 3SDLA 2WAMA 4P2ZA 4FPPA 3AG1B 3G67A 1Z2GA 3J7AU 1PPJH 2XAHA 1GMGA 4X62O 3VQXA 1ZX3A 1XDCA 4YIOA 1K73W 2Q73A 2ZR2A 4JV5O 4DR3O 2WLKA 3AG7A 2WLHA 4FVMA 3OUSA 1SS3A 1Q7YW 3S3XA 1AVMA 4L8JA 5F2VO 1XUQA 2LW7A 2GDSA 1Q5OA 5K1XA 1K8AW 1QQCA 3CRCA 1PL4A 1XREA 3BEHA 3LSUA 1ZL8A 4N23A 1ZWIC 2AHZA 5BR8O 2NN4A 2ZM6O 5FNVB 2W0XA 2D3OW 4UCTA 5AG2A 2JS5A 3E89A 1P84F 4PV1B 4UCOA 4BIUA 1BGYH 1M90W 2CH7B 1DTOA 1JQ0A 3SYPA 4FLWA 1W59A 2IH3C 4LCUC 3ZHUA 4O4JB 4DUZB 1GH6A 5EC2C 4BIOA 3RYIA 2V4DA 4JI7B 4GX1A 4B3MO 5L3DA 4I55A 5B1NA 3W7SA 4DV6O 2W0FC 2PGGA 3OEEG 2WLMA 1K9MW 2BOBC 4O4HA 3OGCC 1LUWA 4D7TA 4BW9A 3UT5A 2ZE7A 3EFFK 3JAKA 3OR7C 4JI1B 1I94B 5KHKA 4PA6A 3G4SV 1M9NA 2F4VO 4K8ZA 1YHQV 2CK3G 1NJIW 2LGWA 2Z5UA 3CCRV 3CYOA 2VWJA 4DR1O 1K5QA 3BA9A 2OIEA 3ML0A 4GX2A 1Y66A 5LL6Y 2RQ6A 2RJZA 2Y69B 3JCZA 1EN5A 1P4RA 3WB2A 2ZE6A 3H1IH 1LUVA 4FLXA 3RGBA 3CC7V 3S3WA 1SRYA 4LFCB 2UUAO 1KUQA 2ZKOA 4JTAB 1PP9H 3JD2A 3ABMB 4PD4F 4FLZA 4NXNB 3N2GB 3A2FA 4MTXA 1M5IA 3D8CA 4A5UB 2GTSA 5CBHA 5FPRA 5LMNB 1SQXH 5GW7A 3CCUV 3E8FA 1B6QA 1SQVH 5LYJB 1K3EA 2QSAA 3ABMC 1IBLO 4YJ3A 3I56V 2R70A 1N32O 5CB4A 2QWRB 3L71H 1ENVA 4JZGA 3ZMUA 2BSKB 4MVMA 3CCQV 1L1FA 1BL8A 4O2AB 2OCCB 1HR0O 2E75B 1YIJV 4CC6A 4LF7O 3K59A 2XHBA 1NT2B 1BMFG 5EBWC 3T1YB 4IHJA 4ICGA 4PA7A 3OMNB 1O9GA 3CJHA 3L73H 4X1KA 4GKJO 2A06H 2K9PA 1XMOO 2H94A 5C93A 1IBKO 2P6JA 4HBNA 3AG2C 4KUMA 3WU2Z 1GM7A 3RYFB 1IZ3A 1R6TA 1K4DC 4QE9A 4I0XA 4ZHQA 2ITCC 5KX5B 1AP6A 1MA1A 4LWSA 4DR6O 4LR3A 3MD0A 2Q4PA 4JI8B 3CRQA 5BMVB 3IAYA 3GWKC 4E4EA 3R66A 1NU1H 4X9QA 3STZC 1L0NH 1EN4A 4Q20A 1VP7A 4J7ZA 1SETA 5GONB 5LA6A 4K8XA 4ZOLA 1V54B 3BVOA 4UVCA 2IJKA 4NKGB 4I4TB 2YEVB 1GKFA 1WA8A 1R3LC 1WLEA 5LOVB 3K57A 4I50A 4MW3A 4X20B 4H0LB 1Z5VA 4EFEA 3JD4A 1R3JC 1V54C 1H2SB 1Y74A 1Q6IA 1SESA 3VQWA 1WNSA 5LP6A 1Y4MA 4TQFA 2P5OA 2EBOA 3FB5C 5LHHA 4O4LB 2YSUB 4D7SA 1AI6A 4IGGA 5IYDO 3CHXA 5CA0A 1MMMA 2CTRA 3UQ8A 1VF6A 1NBMG 5JWPA 4B3TB 1N34B 3K5LA 3BABA 4XDLA 1AB3A 2DYRB 5J2UA 3OGIB 3L70H 4MTGA 4TUYB 3TETA 3SR2C 4J11A 4BIZA 4JF3A 4YY3B 5GTHZ 1JMKC 2L6LA 5IYZA 2EIMB 2EZPA 2GUZA 3JASA 1BZKA 3HKDA 1YF2A 4U3JA 1FFTB 3QVNA 2DYRC 2A9HA 4B3SB 1SKVA 1W0JG 4CS2A 1G4YB 2Q0AA 1L8DA 3CXCU 2D2CB 2EIMC 1AJNA 2PUSA 1H8EG 4DV0B 1KECA 3ZIAG 2EJRA 5JQGA 4DUZO 1SQGA 4PDVA 1YTFD 2FL4A 1PKXA 3HKEA 4PA4A 3CRRA 5EZYA 4JI7O 2WLIA 1YI2V 2QTSA 2UUBB 3DXRA 2QWNB 3TJTA 5JH7A 1NH2D 4YJ2A 4AILC 4MW8A 5C8YB 1S5HC 3M7MX 4DR2B 4HZ3A 4Z2WA 1AROP 1NTKH 4JI1O 1I94O 3CE2A 5IJ0A 3SPCA 4DXWA 3ZN1A 3HPLC 4HAMA 1LR1A 4WCEV 2LP7A 2ATKC 2VS0A 1R3IC 1ZAUA 2Y4UA 1WJZA 3A0HZ 3K5MA 3MHHC 2EINC 3ASOB 2X6AA 4MVQA 5LXTB 1GO3F 3JD1A 1IX9A 1SQQH 4LBEC 3LNMB 4LFCO 2EULA 4J10A 4F6RB 5CA1A 4JGSA 5BZBA 4TWKA 1UFIA 3JYCA 4NXNO 3GVMA 3CCJV 4DO2A 4FLUA 3ASOC 5E79Z 1QLNA 3K5NA 3EXAA 1TGOA 3EVKA 3F7YC 4CH4A 5LMNO 4DV4O 1XI1A 4WFFA 2WLNA 5BXZA 1XL6A 2DW4A 1TA8A 4W4KA 2X6BA 2L35A 1YDXA 3ZRWB 4CS4A 3E8BA 3ETEA 1QLEB 1I7FA 1NS1A 1OCZB 2VQEB 3H1HH 4QNHB 3RFRA 2GV9A 2CTWA 4UXNA 3IGAC 4OXSA 3FYEB 4JI2B 2FB5A 1N0NA 1HNXB 1OCRB 2Q7GA 2RN9A 5TISZ 3SYCA 4MT8A 4J7JA 2X6CA 3LSQA 4CH5A 3K0DA 1QR8A 1QLEC 5IJ9A 1OCZC 1RPOA 2FMLA 3CC4V 1VQMV 1RFYA 1ORQC 5KHGA 3QG5A 1QR9A 1OCRC 4JYAB 3CP1A 2AZ0A 2F93B 5LHIA 3NXSA 2QWPB 3C3SA 3MDSA 1OV9A 2IH1C 1BQZA 1XMQB 4JTCB 5H9CA 2LFRA 2JGDB 4DR4B 2ZIOA 3NR7A 4I9WA 3DC5A 2LW1A 4JI8O 1U96A 3M8AA 2QE7G 3BCCH 4JI5B 1NVPB 3W7UA 2YXYA 5EYPB 5FNVA 2QKAA 1FXKB 2E5LB 2UXCB 4QGPA 2YI9A 5DEDA 4UV8A 2JGUA 5J2TB 4GYCB 1IVSA 5CMUA 5KMGB 5EC1C 4TV8B 2CH7A 3WG7C 1K7DA 2IM9A 4P9OA 4PI2A 2ILMA 3ZRVA 4O4JA 2N74A 4O2BB 4DW1A 1FXKC 1GTOA 4FZ0A 1XNQB 3F5TA 1NKDA 1K4CC 1Q43A 1EFRG 3TGUH 1OCCB 1VQ7V 5LMUB 3QO5A 2Q0OC 3LSSA 1VARA 5EIBC 2ZINA 3B40A 2G38A 2BTOA 2YIAA 1R1BA 4B3TO 1YJWV 1N34O 1K92A 4JYYA 4HNAA 4DUYB 1F23A 1R73A 1OCCC 3B8NA 2FTKA 1MOFA 3M99B 4IIJB 4YY3O 2JRIA 3FKSG 3OMIB 5B1OA 2GSMB 2A3QA 1VQOV 2F43G 4GT1A 2FYUH 2WWWA 1S3JA 4MTFA 4B3SO 4P30A 4JI3B 4X1YB 3SJCC 3W7WA 3B2EE 1JX9A 2ADQB 2EILB 2YXLA 1VF5B 2LGQA 1UPGA 4MVUA 1K34A 1AR4A 4DV0O 2HJFC 2DYSB 2XOKG 3RWRD 2JJ2G 3N2GA 4YHHB 1D2DA 5LGTA 4AHCA 2EILC 3KCYA 4JPRA 3FB6C 2UUBO 2ZNJA 1PNKA 5D5PA 1B06A 2DMXA 4TT3G 2GHYA 5LYJA 2EX3A 2DYSC 4L87A 1N33B 1KP2A 4DR2O 5B66Z 4PJ0Z 1RSOB 4MVZA 5DM6V 2LO1A 1KBHA 2RNBA 1SQFA 4U7OA 1VQ4V 1VQNV 3ZHRA 2C2AA 4O2AA 5DECA 2N04A 3KZIZ 1R6KA 5K1PA 3CSXA 1B04A 3ZJZA 3JARB 3OR6C 2OYQA 4J42A 1XQ8A 1XILA 3G71V 4EKWA 4DV2B 2OTLV 1VMGA 2H8PC 5KHHA 3SJBC 2YUAA 1H2GA 1KP3A 5CBGA 3K0GA 4GCZA 2ETNA 4DV5O 1WP8A 3ABLB 4NTXA 3BPZA 4JAUA 4MVSA 2QWOB 4R8CA 5L3FA 3RYFA 4LF4B 1GAXA 5KX5A 5E1AC 4GX0A 3F5WC 2IJHA 4DV3B 3HKCB 4KXRA 3D36C 2QGNA 3Q4HB 3KG2A 4DRXB 4MTOA 3ABLC 1FFXB 5BMVA 4DV1B 1KQSU 1E1RG 3TXSA 1KC8W 4X64B 3K04A 1Q81W 4PA9A 3ZMTA 5GONA 1JVMA 1GN4A 1H2LA 1KKDA 2JK5C 2A0LA 1CEZA 3L75H 1KYOF 3OTFA 3H1LH 3RYIB 4MS2A 1VEWA 3B4SA 4JI2O 4LFAB 1GRJA 2YEVA 1HNXO 3ZMVA 4DK1A 3ZEDA 1GN6A 4KL1A 4X20A 3AG2B 1H2KA 4XDJA 2W6JG 5B1AB 1VQPV 1H2NA 1SERA 4H44B 2QDOA 1WB7A 2P67A 5GTIZ 3I5DA 3JD3A 4O4LA 3L72H 1H38A 2PI5A 2M7WA 2QTOA 2UUCB 4JYAO 2IW5A 2HR3A 2GTAA 4X65B 1NTZH 2DJVA 2Y48A 4JTDB 3ETDA 2B1GA 1DF4A 1MNGA 3OAAG 4LF8B 1NZ6A 5EBMC 5B1AC 3H1JH 2QR4A 4U7NA 3IC9A 4NB5A 4DR4O 2Q68A 4UB6Z 4TUYA 4I9QA 4CZZA 1N0JA 3H01A 2N05A 2PTMA 1XBLA 5KAFZ 1MZEA 3FB8C 4EB6B 1US6A 4H37A 3P3PA 4JI5O 2WLLA 3CCVV 2ARHA 1THZA 3JCUZ 1P49A 2E5LO 2UXCO 3RBZA 1HNZB 2OCHA 2CDYA 2ZIMA 3ASNB 2CTQA 4ABMA 4ZI7B 4NVPA 3GB7C 1FJGB 1TUBB 1CPYA 1S77D 4D6TH 4FLYA 4NR1A 2MW2B 1D5AA 2Y0PA 4UFZA 1QCEA 3ASNC 4UCVA 5LMUO 2QA4V 3IFXA 5IDJA 5IWAB 4WF9V 1X59A 3SPGA 1QHTA 4X88A 4B7KA 2AHYA 4LH6A 5C8YA 3HR0A 1TVKB 4JYBA 1JFFA 3U0ZA 3RYHA 4DR7B 4O4IB 4LF9B 4OPHA 1GK9A 3OEHG 1B3QA 4CC5A 2KG7B 3QO8A 4AI8A 4DYLA 2H3OA 2WPDG 2VQFB 1Q3EA 2ZE8A 1UJWB 1H2MA 3AK1A 4JI3O 1IXBA 3N2KB 2Q67A 2Q69A 3CEIA 1I5YA 3K08A 1CXZB 4F6RA 2JVDA 5JJNB 4QE7A 1S5JA 1VIBA 3ETQA 2XAQA 1FD9A 3UO2A 1EN6A 2DE0X 2E76B 2NLJC 2HVJC 1M57B 1Q82W 1FXHA 1EBOA 3APOA 4FM1A 4E2LA 4K35A 5KAIZ 1YCIA 1MSDA 5H2FZ 3HKBB 3ICXA 5KUMA 5JJJB 2QM7A
chains in the Genus database with same CATH topology
3NXSA 4UVAA 3ZN0A 1PL0A 5EC2C 3K3WA 2IH1C 4G2KA 4H33A 2OCCC 5CN0A 2V7QG 4P9PA 4JTCB 1M57C 5H9CA 2HLDG 3FYIB 4GX1A 5L3DA 2LFRA 3CC2V 4UUJC 2XAGA 4I9WA 5B1NA 3W7SA 3CCEV 2W0FC 2DWEC 3EHBB 2EINB 1OCOB 3OEEG 2WLMA 4RUEA 2BOBC 3WFVA 1K9MW 1FXVA 3OGCC 3OE7G 2QE7G 3F7VC 3EFFK 2IJIA 1Q86W 5HFLA 1NVPB 3W7UA 3OR7C 5B3SB 1VQ6V 4G28B 4PA6A 3G4SV 1M9NA 3SPIA 1FXKB 4GX5A 4UV8A 3GWOA 1YHQV 2CK3G 1NJIW 1OCOC 2Z5UA 4FIPC 3CCRV 4WFGA 1NR1A 3CYOA 5CMUA 1K5QA 1VQ5V 5EC1C 3T1CA 3WG7C 1K7DA 1NVPD 5B1BB 5LGUA 1F4MA 3W7XA 3ML0A 4P9OA 4GX2A 2X7RB 1Y66A 3QO7A 1E1QG 2KB1A 3ZRVA 5B3SC 2Y69B 3JCZA 1P4RA 2ZDIA 3MHSC 1FXKC 1GTOA 1NKDA 1PNMA 3P30A 5LHGA 1K4CC 1EFRG 1OCCB 3CC7V 1J95A 1SRYA 2ITDC 4JYCA 4HYOA 3VBBA 1VQ7V 2DQ3A 3QO5A 2XNDG 3RVZA 2B1IA 4F4LA 3OMAB 5HFMA 4JTAB 3LSSA 5B1BC 5CA3A 5LGNA 3T4DA 3JD2A 3ABMB 5FL7G 2JDIG 4PDLA 1JCHA 1AI5A 4MTXA 1YJWV 1K92A 3LDEA 4UVBA 1YITV 3ZRSA 1HWYA 1F23A 1R73A 5CBHA 1OCCC 3G6EV 3B8NA 5GW7A 2FTKA 1G8MA 1MOFA 4QPJA 5LHIA 1FXKA 3E8FA 2P7TC 1I5XA 4LP8A 3CCUV 1LNQA 3M99B 2W6IG 1B6QA 3LDDA 1TUEB 1K3EA 3FKSG 1BHAA 2WLIB 3ABMC 3OMIB 5B1OA 1H8HG 2GSMB 4ZKIA 4RO2A 3I56V 1QBZA 1VQOV 2F43G 3SJQC 4GT1A 4YXWG 3W7TA 2WWWA 1S3JA 4MTFA 1YJNV 2PI4A 1ENVA 4J9ZB 4P30A 4FK5C 3ZMUA 2IU3A 5L3CA 1MSWD 1JPXA 3AG4C 4MVMA 3CCQV 2EIKB 1BL8A 1L1FA 3W7WA 1JX9A 2EILB 2WLLB 4FJCC 3ZRXA 2OCCB 1YIJV 3K9AA 4MVUA 3CMAV 1K34A 2XAJA 2HJFC 1RM1C 1BMFG 3E83A 2DYSB 3SYOA 4Z1MG 2XOKG 5EBWC 5DN6G 2JJ2G 1M56B 4PA7A 3VOUA 3OMNB 3OM3B 3ZCCA 4KP4A 4X8AA 1F51A 2QEXV 5LGTA 2EIKC 1W0KG 2H94A 2EILC 2ZR3A 4JPRA 3FB6C 4KFMA 3ZRWA 5C93A 1NQTA 2P6JA 3UKMA 1PNKA 4TT3G 3AG2C 2GHYA 2A79B 1GM8A 4KUMA 3SPHA 1GM7A 3E8HA 3CD6V 2DYSC 4XBFA 3DTUB 2ZQMA 1K4DC 1KP2A 4L87A 4QE9A 2ITCC 3RW0A 1M56C 1WPXA 4JAVA 3ZMZA 2R9IA 3WG7B 4MVZA 5IYCO 5DM6V 1R6NA 4I5SA 1OZ0A 3X2QB 3MD0A 4UV9A 3LUTB 4U7OA 3SYAA 3I55V 1VQ4V 1VQNV 3OW2U 2C2AA 1RPRA 3E35A 1R6KA 3STZC 3ZJZA 4Q20A 2IJJA 3OR6C 1SETA 5H6RA 3G71V 4EKWA 4RQFA 1VQ9V 2OTLV 3CCMV 2Z3YA 2H8PC 1V54B 4UVCA 4QJFB 1DF5A 1MG1A 1H2GA 1KP3A 3X2QC 4RUFA 5CBGA 2QM8A 1R3KC 2IJKA 3K0GA 4GCZA 2HG5C 4WFEA 4RQEA 2YEVB 4N21A 2JEUA 2UXXA 1GKFA 3FB7C 3ABLB 1R3LC 3R65A 4JAUA 4MVSA 4R8CA 1WLEA 2B5UA 4MW3A 1IXMA 2LFSA 3E8GA 3JD4A 1R3JC 4R50A 3JD0A 1V54C 5L3FA 5L3EA 5E1AC 1JJ2U 1SESA 4GX0A 3F5WC 1E79G 2IJHA 5LBQA 3K03A 1Y4MA 2EZOA 3LDCA 5EBLC 2EBOA 3B77A 3FB5C 1SZTA 1S76D 5LHHA 2YSUB 5CBFA 1AI6A 3A0RA 3KG2A 2OTJV 3IC7A 4MTOA 3ABLC 3UM7A 5J9PC 4PDRA 5IYDO 4QPKA 2V1DA 4J9YB 1KQSU 2ZXWB 4PA3A 2R9RB 3AG4B 2QKSA 3P32A 1E1RG 4R7CA 1NBMG 5KUKA 1KC8W 4ZBMA 3K04A 4XDLA 1Q81W 4PA9A 2DYRB 3ZMTA 1JVMA 2DQ0A 3CCSV 1KKDA 2JK5C 2A0LA 1CEZA 4LC1A 1RM1B 4MTGA 3TETA 4BIZA 4JF3A 1V55B 3D36A 3K79A 4MS2A 2NNUA 3RVYA 2ZXWC 4XDKA 3OFNG 2EIMB 2YEVA 2EZPA 1FS0G 2K1EA 3ZMVA 1FFTB 3AG1C 1GM9A 2DYRC 2A9HA 1QVFU 4MVOA 1YTFB 3B8MA 1K33A 1W0JG 2WSSG 3AG2B 4XDJA 1YJ9V 3CMEV 2W6JG 5B1AB 1VQPV 1SERA 1G4YB 3ABUA 2P67A 2X0LA 3DGEA 3ETGA 3JD3A 3CXCU 1V55C 5IYBO 3QNEA 1H38A 2PI5A 2M7WA 4RAIA 2EIMC 1F4NA 1AJNA 1NH2B 1H8EG 1KECA 2QTOA 3ZIAG 2UXNA 2EJRA 2IW5A 2HR3A 2Y48A 3AG3B 4JTDB 3ETDA 2B1GA 4PDVA 5EK0A 5L3BA 1YTFD 1DF4A 2JEXA 1YSCA 3OAAG 1PKXA 5KA5A 4PA4A 1AI4A 5EBMC 4BW5A 5B1AC 1EZJA 1XL4A 3K06A 2WLIA 1YI2V 4U7NA 2WLJA 4CBCA 3SYQA 5IY5B 2Q68A 2XASA 3BY6A 4CZZA 1NH2D 3H01A 4JASA 4MW8A 1W2BU 3FB8C 1S5HC 3ZMSA 3T2MA 3AG3C 4HZ3A 4G27B 4H37A 1S0VA 4MVRA 2WLLA 1AROP 1BHBA 4X89A 1VQLV 2BOCC 3CCVV 1THZA 4PELA 3SPCA 4DXWA 4PDMA 4FMTA 3ZN1A 3HPLC 4HAMA 5IY5C 3D3IA 2IU0A 3RBZA 4WCEV 1KD1W 3ABKB 2LP7A 2ATKC 1OHHG 3ASNB 2ZDIC 1R3IC 2OT5A 3PJSK 2Q6AA 3GB7C 4ASUG 2EIJB 2MK3A 1CPYA 1S77D 2HVKC 1AR1B 1K5SA 2JIZG 1ROPA 4WFBV 1P7BA 3MHHC 2ZD9A 3SPJA 2EINC 5KA6A 3ASOB 5H6QA 3CPWU 1NR7A 2HFEC 2X6AA 4MVQA 1GO3F 1QCEA 1COWG 3JD1A 3ABKC 3ASNC 4QIWF 4LBEC 3LNMB 2QA4V 2EIJC 3IFXA 5IDJA 1PD3A 2XAFA 4JGSA 4WF9V 3HB3B 3SPGA 5BZBA 4TWKA 1AI7A 3JYCA 4X88A 4TSFG 1K97A 2AHYA 1AJPA 3STLC 4WFHA 1PNLA 1DLBA 2P90A 3E86A 4BAYA 3CCJV 4DO2A 3TCUA 3ASOC 3T4ZA 4R6ZA 1QLNA 2WAMA 4JYBA 4P2ZA 3F7YC 1N8RW 4FPPA 3AG1B 1AJQA 1GK9A 3OEHG 2WLNA 2Y69C 1XL6A 4WFFA 2DW4A 2XAHA 1GMGA 2HKOA 3ABTA 2X6BA 3TK1A 1QVGU 3ZRWB 3QO8A 3AEIA 1K73W 3E8BA 2ZR2A 3ETEA 2WPDG 1QLEB 1UJWB 1OCZB 2WLKA 4QNHB 2WLHA 1M1KW 3OUSA 1VQKV 1Q7YW 2Q67A 4UXNA 3IGAC 4OXSA 2DWDC 3E2EA 1JOYA 1CP9A 2Q69A 3FYEB 1I5YA 1K8AW 1VQ8V 1OCRB 3K08A 3BEHA 4QE7A 3CCLV 4MSWC 1ZWIC 2AHZA 4N23A 3SYCA 2XAQA 3CP1A 4MT8A 2X6CA 3LSQA 3K0DA 1QR8A 1MABG 2D3OW 1QLEC 1S72V 1OCZC 1RPOA 2NLJC 3OUFA 2HVJC 5L3GA 1M57B 3CC4V 3E89A 1Q82W 1FXHA 1EBOA 4WFAV 1VQMV 2JJ1G 4E2LA 4BIUA 1M90W 1DTOA 1JQ0A 3SYPA 1ORQC 1QR9A 1OCRC 2IH3C 5KUMA 2QM7A 4LCUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y66 A;  2OT5 A;  2EBO A;  1Y4M A;  3B77 A;  1SZT A;  3H01 A;  5HFL A;  4JGS A;  4N23 A;  2MK3 A;  1ENV A;  3CP1 A;  3MHS C;  2M7W A;  4G2K A;  4JF3 A;  4FK5 C;  1F23 A;  1JPX A;  4JPR A;  1DLB A;  1QR8 A;  3P30 A;  5CN0 A;  4N21 A;  3B8N A;  5H9C A;  1MOF A;  2EZP A;  2P6J A;  1I5X A;  3MHH C;  4FJC C;  3GWO A;  3M99 B;  3K9A A;  5KA6 A;  1EBO A;  1DF4 A;  4E2L A;  5KA5 A;  1K34 A;  4FIP C;  3B8M A;  1K33 A;  3CYO A;  1QCE A;  5CMU A;  5HFM A;  1JQ0 A;  3WFV A;  1QR9 A;  1QBZ A;  2LP7 A;  1DF5 A;  1MG1 A;  1I5Y A;  2X7R B;  2EZO A; 
#chains in the Genus database with same CATH topology
 4UVA A;  1PL0 A;  3K3W A;  1OJH A;  4G2K A;  4H33 A;  3K58 A;  5CN0 A;  4P9P A;  1M57 C;  3J81 N;  2PZS A;  3KKY A;  4OPA A;  1SA0 B;  3CC2 V;  2QKC A;  4I50 B;  1G6U A;  5KHJ A;  2XAG A;  2DWE C;  1Q8I A;  1T5E A;  2EIN B;  3LNN A;  3WFV A;  1N36 B;  1FXV A;  4B3M B;  4NYK A;  3OE7 G;  3F7V C;  2F23 A;  1Q86 W;  1Y76 B;  3K5O A;  4G28 B;  1Z5W A;  5CA0 B;  2HJD A;  4IL6 Z;  4GX5 A;  1EM1 A;  1HP8 A;  1JA8 A;  1NR1 A;  2BE3 A;  3JAW B;  1VQ5 V;  4DV7 B;  1NVP D;  2X7R B;  1E1Q G;  3CWB H;  2F66 C;  2BTQ B;  2ZDI A;  4LF4 O;  1KMI Z;  2F1M A;  3P30 A;  3RT3 C;  4DV3 O;  4U3J B;  3VBB A;  2JGD A;  4JYC A;  2DQ3 A;  2XND G;  3RVZ A;  1DGS A;  2B1I A;  5EIB D;  5HFM A;  4DV1 O;  5LGN A;  5FL7 G;  2JDI G;  4PDL A;  4TV9 B;  1AI5 A;  3A0B Z;  1WPB A;  3LDE A;  4UVB A;  4X64 O;  5JJE B;  5EYP A;  3ZRS A;  1IUR A;  2ZT9 B;  4FFB B;  1WAZ A;  1G8M A;  4QPJ A;  1FXK A;  5JQG B;  2P7T C;  1I5X A;  4LP8 A;  4B7E A;  2W6I G;  3JAT A;  5J2T A;  3QF7 A;  1TUE B;  4K0K B;  1BHA A;  2WLI B;  4UCU A;  4LFA O;  1BE3 H;  5KMG A;  4TV8 A;  4RO2 A;  3SJQ C;  4YXW G;  4YJ2 B;  3W7T A;  1YJN V;  4O2B A;  1DK1 A;  5A2Q N;  5JVD B;  1PV0 A;  4FK5 C;  2IU3 A;  5L3C A;  1MSW D;  1JPX A;  3AG4 C;  3T1Y O;  1YXB A;  3BFR A;  3FD9 A;  2XTA A;  3CRA A;  3CMA V;  2XAJ A;  1JR9 A;  1RM1 C;  3E83 A;  3SYO A;  4X65 O;  4LFB B;  5DN6 G;  1M56 B;  3VOU A;  1VF7 A;  3OM3 B;  4LF8 O;  4KP4 A;  2OWO A;  4X8A A;  2QEX V;  3WB1 A;  4FLT A;  4EFB A;  2VWK A;  4KFM A;  1AIL A;  2HHH B;  3H1K H;  1SQP H;  1JJO A;  4NTY A;  3AK2 A;  1PM9 A;  2AGA A;  5KHI A;  3DTU B;  2ZQM A;  3RW0 A;  1M56 C;  1Q6H A;  1XHX A;  4JAV A;  1XOU A;  3ZMZ A;  2R9I A;  3WG7 B;  1O9H A;  1R6N A;  4I5S A;  1OZ0 A;  4WBN B;  1XEQ A;  3LUT B;  1HNZ O;  2PYL A;  3H9V A;  4X1Y A;  3SYA A;  3I55 V;  2UU9 B;  1YZB A;  3OW2 U;  1FPO A;  3G6B A;  1RPR A;  2AXT Z;  3E35 A;  3UO3 A;  1FJG O;  3RYC B;  2BCC H;  2IJJ A;  4X1I B;  4OX9 B;  1XNR B;  3ZHS A;  3OD4 A;  5H6R A;  1VQ9 V;  4B3R B;  2Z3Y A;  1DF5 A;  1MG1 A;  3DC6 A;  4WFE A;  5JCO C;  4JI0 B;  4J41 A;  1SQB H;  3R65 A;  3J80 N;  2B5U A;  3ZHT A;  2ZE5 A;  3E8G A;  3G80 A;  5L3E A;  1IBM B;  3K03 A;  1FAF A;  5EBL C;  1AR5 A;  1RSO A;  3FAV B;  1S76 D;  2ADP A;  5CBF A;  3L74 H;  4DR7 O;  3A0R A;  4LF9 O;  5IJ9 B;  3BRC A;  3E22 B;  1M4U A;  2HP8 A;  4J9Y B;  2ZXW B;  2QKS A;  4CH6 A;  4R7C A;  1HNW B;  3BHP A;  5KUK A;  3JAR A;  3RN4 A;  3ZHV A;  2GBO A;  2VQF O;  3CCS V;  2QWQ B;  4LC1 A;  3PN1 A;  4LNU B;  1I0H A;  1V55 B;  3D36 A;  2NNU A;  3RVY A;  3JSN A;  2ZXW C;  3OFN G;  3JAL B;  2Q5Z A;  2K1E A;  1WP7 A;  3AG1 C;  1GM9 A;  3B8M A;  3CS5 A;  3O65 A;  3A8T A;  4UB8 Z;  4TOI A;  2X0L A;  4J7K A;  3DGE A;  1FYJ A;  3HKC A;  1V55 C;  4RAI A;  3Q4H A;  4DRX A;  1FFX A;  3DSQ A;  5ITZ B;  3AG3 B;  5L3B A;  4LF5 B;  4FM0 A;  2JEX A;  2KKW A;  5KA5 A;  4W4L A;  4BW5 A;  1EZJ A;  3K06 A;  2UXB B;  4CBC A;  3SYQ A;  5D5Q A;  3C90 A;  2XAS A;  3BY6 A;  2CGN A;  4U3F H;  1W2B U;  1N36 O;  3ZMS A;  2BSK A;  2P4V A;  3AG3 C;  5B5E Z;  2Y4T A;  2YC0 A;  4MVR A;  3ZBH A;  1BHB A;  4X89 A;  2XUM A;  4PEL A;  4PDM A;  4FMT A;  4DW0 A;  2IU0 A;  5KLV H;  3JAM N;  1KD1 W;  1OHH G;  4NTW A;  2OT5 A;  4HNA B;  4ASU G;  2B9Z A;  2EIJ B;  2MK3 A;  1J5E B;  4DV7 O;  1AR1 B;  1P7B A;  1NR7 A;  1ZUQ A;  2P06 A;  2P4K A;  1BSM A;  1COW G;  4BWA A;  2PF4 E;  4QIW F;  3FX7 A;  2YIB D;  4LH7 A;  2EIJ C;  3N27 A;  1PD3 A;  1ZL8 B;  2XAF A;  1NTM H;  3KCX A;  3L9D A;  3IJ4 A;  1DLB A;  2P90 A;  4EB6 A;  3E86 A;  3T4Z A;  4JI4 B;  2FKX A;  4FLV A;  4JI6 B;  3TXQ A;  3CB2 A;  1N8R W;  1AJQ A;  4RWU A;  4CH3 A;  3CX5 F;  2RCV A;  2Y69 C;  2YI8 A;  3ABT A;  2VQE O;  2HKO A;  2XT9 A;  1Q6U A;  1ZTE A;  4ZI7 A;  1KU9 A;  1M93 A;  4K0K O;  2LQT A;  2R72 A;  3TK1 A;  1QVG U;  4DR5 B;  1TUB A;  3T1H B;  2YIB A;  3AEI A;  4DV4 B;  2UXD B;  1L0L H;  4I4T A;  2ZNI A;  1GN2 A;  4PI0 A;  4GZR B;  2E74 B;  4I55 B;  1M1K W;  4LF6 B;  4K3A A;  1VQK V;  5LOV A;  2KSD A;  4CS3 A;  1BCC H;  4O4H B;  2DWD C;  3E2E A;  1JOY A;  1CP9 A;  4YIP A;  3UT5 B;  4EEQ A;  1VQ8 V;  3JAK B;  3AK3 A;  2CAZ C;  2A7W A;  3CCL V;  4MSW C;  1URF A;  2CTP A;  1MAB G;  4LFB O;  1S72 V;  3OUF A;  5L3G A;  3B09 A;  4WFA V;  1TVK A;  2JJ1 G;  4X66 B;  1SC5 B;  3SGI A;  1XMQ O;  2JS3 A;  2HHH O;  4O4I A;  2OIG A;  3CXH F;  4J9Z B;  1Q90 D;  3ZN0 A;  1KKC A;  2KG7 A;  2OCC C;  2V7Q G;  1U97 A;  2HLD G;  3FYI B;  4UUJ C;  4I7Z B;  1BQ0 A;  3CCE V;  3EHB B;  1OCO B;  3SJA C;  3N2K A;  2UU9 O;  4RUE A;  3D3Q A;  2YIC A;  4AQY B;  1TAE A;  2ODM A;  2IJI A;  5HFL A;  4OX9 O;  1EZV H;  1XNR O;  4KHP B;  5B3S B;  2P22 C;  1VQ6 V;  4B3R O;  4UCR A;  3SPI A;  3GWO A;  1OCO C;  2PY5 A;  4FIP C;  4WFG A;  4JI0 O;  1XNQ O;  3T1C A;  4YJ3 B;  3HKB A;  5B1B B;  5LGU A;  1F4M A;  3W7X A;  5CB4 B;  3APQ A;  3QO7 A;  2KB1 A;  5B3S C;  2RDC A;  3FFQ A;  3MHS C;  4UCS A;  3U10 A;  1PNM A;  5LHG A;  1IBM O;  4NXM B;  3OTO B;  5IE9 A;  1SA0 A;  1J95 A;  2ITD C;  4GKK B;  4HYO A;  2O57 A;  2RMK B;  4F4L A;  3OMA B;  4DUY O;  5B1B C;  5CA3 A;  2R9A A;  3T4D A;  4IHJ B;  1JCH A;  2YS8 A;  3CJH B;  1HNW O;  4X1K B;  1GN3 A;  1Y76 A;  2Q7E A;  1YIT V;  1HWY A;  3G6E V;  1LNQ A;  1HW7 A;  2ZCE A;  1HDJ A;  1QNM A;  3LDD A;  4X62 B;  3CRM A;  2KQX A;  4I0X B;  5LXT A;  4ZHQ B;  1H8H G;  3JAW A;  4ZKI A;  4F6E A;  1BS3 A;  1V9P A;  1QBZ A;  2LJ2 A;  5BY1 A;  4JV5 B;  4Z1V A;  4LWS B;  4DR3 B;  2BTQ A;  2YDE A;  2PI4 A;  2YID A;  2EIK B;  4ZIB A;  5H5N A;  2WLL B;  4FJC C;  3ZRX A;  3K9A A;  4IYI A;  4YHH O;  1Y6X A;  4FZ1 A;  5BR8 B;  3OT7 A;  2ZM6 B;  5LA6 B;  4ZOL B;  4Z1M G;  3QTC A;  4H13 B;  4LF5 O;  4TV9 A;  3K9S A;  3ZCC A;  1F51 A;  2Z0A A;  3UCS C;  1G1X B;  2EIK C;  1W0K G;  1N33 O;  1X4T A;  1P7G A;  2ZR3 A;  3WB0 A;  2UXB O;  3ZRW A;  4FFB A;  1NQT A;  1WA8 B;  3UKM A;  3SPH A;  2A79 B;  1GM8 A;  4GUN A;  3E8H A;  3CD6 V;  2Q8V A;  4XBF A;  2CE4 A;  1Y74 B;  2Y0I A;  2EJ7 A;  4TQD A;  3VQV A;  1WPX A;  5LP6 B;  5IYC O;  2AW9 A;  2PYJ A;  3X2Q B;  4DV6 B;  5JVD A;  4UV9 A;  4DV2 O;  1JFF B;  1J5E O;  1FKA O;  1IDS A;  3RYH B;  4C7U A;  2F95 B;  2M6Y A;  5J2U B;  5LP6 C;  2CUG A;  4RQF A;  3CCM V;  1RP3 B;  2DN9 A;  4QJF B;  2F4V B;  3X2Q C;  4RUF A;  2QM8 A;  1F7Y A;  1R3K C;  1XHZ A;  2HG5 C;  4RQE A;  2HEP A;  5IYZ B;  4N21 A;  4Q6G A;  4DR1 B;  2JEU A;  1VF6 C;  2UXX A;  2GUZ B;  3FB7 C;  3JAS B;  3HKD B;  1Y67 A;  4DK0 A;  1IXM A;  2LFS A;  4R50 A;  3JD0 A;  1D5N A;  4DV5 B;  1JJ2 U;  4JI4 O;  5LBQ A;  1E79 G;  4GLX A;  2WA3 A;  2EZO A;  3LDC A;  4IT5 A;  4JI6 O;  3B77 A;  1SZT A;  2UUA B;  3U11 A;  2OTJ V;  3O9O A;  4WBN A;  3IC7 A;  3UM7 A;  5J9P C;  4PDR A;  4QPK A;  2V1D A;  5JCO A;  2CGO A;  4PA3 A;  2R9R B;  2DOS A;  3AG4 B;  3P32 A;  4PHZ A;  4DR5 O;  3HKE B;  3T1H O;  3RYC A;  5EZY B;  4B08 A;  4ZBM A;  4X1I A;  2UXD O;  2DQ0 A;  3DXR B;  4FM2 A;  1RM1 B;  4LF6 O;  5JH7 B;  3K79 A;  4XDK A;  1IBL B;  1FS0 G;  1WN7 A;  1SF9 A;  5IJ0 B;  1N32 B;  5FLX N;  1QVF U;  4MVO A;  1ZLZ A;  1YTF B;  3C3T A;  1K33 A;  2WSS G;  3MAQ A;  1WB8 A;  2YXH A;  1YJ9 V;  2UUC O;  3CME V;  5A9G A;  3ABU A;  2Q7H A;  3ZS8 C;  4X66 O;  1HR0 B;  3ETG A;  3FAV A;  5IYB O;  3ZX6 A;  3QNE A;  4LF7 B;  1I08 A;  2QJ1 A;  1F4N A;  4OGQ B;  1NH2 B;  4IYH A;  3BAA A;  2UXN A;  1QU7 A;  3E22 A;  4JAA A;  5EK0 A;  4JZ2 A;  1YSC A;  2VRZ A;  1AI4 A;  4IIJ A;  4GKJ B;  1XL4 A;  1XMO B;  2WLJ A;  5IY5 B;  1IBK B;  3JSL A;  5CA1 B;  4JAS A;  4LNU A;  1SZX A;  3T2M A;  1KB9 F;  4AQY O;  1AP5 A;  3JAL A;  2NR5 A;  4G27 B;  1S0V A;  1VQL V;  4KHP O;  1YEW A;  2BOC C;  2IBZ H;  4DR6 B;  1S5L Z;  5IY5 C;  3D3I A;  3ABK B;  2E3C A;  1NI8 A;  4FFK A;  2ZDI C;  3PJS K;  2Q6A A;  1ZSP A;  5IT9 N;  2HVK C;  1K5S A;  2JIZ G;  1ROP A;  4WFB V;  3ZHQ A;  1BT8 A;  2ZD9 A;  3JAT B;  3SPJ A;  5ITZ A;  5KA6 A;  5H6Q A;  3CPW U;  5FPO A;  5IWA O;  2WA4 A;  2HFE C;  3THO A;  2Q9L A;  4J80 A;  1YVW A;  1A32 A;  3ABK C;  3VQY A;  4NXM O;  3OTO O;  1MZF A;  4BR6 A;  4GKK O;  3BA8 A;  3HB3 B;  1AI7 A;  1N4C A;  2QM4 A;  4TSF G;  1K97 A;  1AJP A;  3STL C;  4WFH A;  1PNL A;  2AZ2 A;  3P3N A;  4BAY A;  3TCU A;  4R6Z A;  3SDL A;  2WAM A;  4P2Z A;  4FPP A;  3AG1 B;  3G67 A;  1Z2G A;  3J7A U;  1PPJ H;  2XAH A;  1GMG A;  4X62 O;  3VQX A;  1ZX3 A;  1XDC A;  4YIO A;  1K73 W;  2Q73 A;  2ZR2 A;  4JV5 O;  4DR3 O;  2WLK A;  3AG7 A;  2WLH A;  4FVM A;  3OUS A;  1SS3 A;  1Q7Y W;  3S3X A;  1AVM A;  4L8J A;  5F2V O;  1XUQ A;  2LW7 A;  2GDS A;  1Q5O A;  5K1X A;  1K8A W;  1QQC A;  3CRC A;  1PL4 A;  1XRE A;  3BEH A;  3LSU A;  1ZL8 A;  4N23 A;  1ZWI C;  2AHZ A;  5BR8 O;  2NN4 A;  2ZM6 O;  5FNV B;  2W0X A;  2D3O W;  4UCT A;  5AG2 A;  2JS5 A;  3E89 A;  1P84 F;  4PV1 B;  4UCO A;  4BIU A;  1BGY H;  1M90 W;  2CH7 B;  1DTO A;  1JQ0 A;  3SYP A;  4FLW A;  1W59 A;  2IH3 C;  4LCU C;  3ZHU A;  4O4J B;  4DUZ B;  1GH6 A;  5EC2 C;  4BIO A;  3RYI A;  2V4D A;  4JI7 B;  4GX1 A;  4B3M O;  5L3D A;  4I55 A;  5B1N A;  3W7S A;  4DV6 O;  2W0F C;  2PGG A;  3OEE G;  2WLM A;  1K9M W;  2BOB C;  4O4H A;  3OGC C;  1LUW A;  4D7T A;  4BW9 A;  3UT5 A;  2ZE7 A;  3EFF K;  3JAK A;  3OR7 C;  4JI1 B;  1I94 B;  5KHK A;  4PA6 A;  3G4S V;  1M9N A;  2F4V O;  4K8Z A;  1YHQ V;  2CK3 G;  1NJI W;  2LGW A;  2Z5U A;  3CCR V;  3CYO A;  2VWJ A;  4DR1 O;  1K5Q A;  3BA9 A;  2OIE A;  3ML0 A;  4GX2 A;  1Y66 A;  5LL6 Y;  2RQ6 A;  2RJZ A;  2Y69 B;  3JCZ A;  1EN5 A;  1P4R A;  3WB2 A;  2ZE6 A;  3H1I H;  1LUV A;  4FLX A;  3RGB A;  3CC7 V;  3S3W A;  1SRY A;  4LFC B;  2UUA O;  1KUQ A;  2ZKO A;  4JTA B;  1PP9 H;  3JD2 A;  3ABM B;  4PD4 F;  4FLZ A;  4NXN B;  3N2G B;  3A2F A;  4MTX A;  1M5I A;  3D8C A;  4A5U B;  2GTS A;  5CBH A;  5FPR A;  5LMN B;  1SQX H;  5GW7 A;  3CCU V;  3E8F A;  1B6Q A;  1SQV H;  5LYJ B;  1K3E A;  2QSA A;  3ABM C;  1IBL O;  4YJ3 A;  3I56 V;  2R70 A;  1N32 O;  5CB4 A;  2QWR B;  3L71 H;  1ENV A;  4JZG A;  3ZMU A;  2BSK B;  4MVM A;  3CCQ V;  1L1F A;  1BL8 A;  4O2A B;  2OCC B;  1HR0 O;  2E75 B;  1YIJ V;  4CC6 A;  4LF7 O;  3K59 A;  2XHB A;  1NT2 B;  1BMF G;  5EBW C;  3T1Y B;  4IHJ A;  4ICG A;  4PA7 A;  3OMN B;  1O9G A;  3CJH A;  3L73 H;  4X1K A;  4GKJ O;  2A06 H;  2K9P A;  1XMO O;  2H94 A;  5C93 A;  1IBK O;  2P6J A;  4HBN A;  3AG2 C;  4KUM A;  3WU2 Z;  1GM7 A;  3RYF B;  1IZ3 A;  1R6T A;  1K4D C;  4QE9 A;  4I0X A;  4ZHQ A;  2ITC C;  5KX5 B;  1AP6 A;  1MA1 A;  4LWS A;  4DR6 O;  4LR3 A;  3MD0 A;  2Q4P A;  4JI8 B;  3CRQ A;  5BMV B;  3IAY A;  3GWK C;  4E4E A;  3R66 A;  1NU1 H;  4X9Q A;  3STZ C;  1L0N H;  1EN4 A;  4Q20 A;  1VP7 A;  4J7Z A;  1SET A;  5GON B;  5LA6 A;  4K8X A;  4ZOL A;  1V54 B;  3BVO A;  4UVC A;  2IJK A;  4NKG B;  4I4T B;  2YEV B;  1GKF A;  1WA8 A;  1R3L C;  1WLE A;  5LOV B;  3K57 A;  4I50 A;  4MW3 A;  4X20 B;  4H0L B;  1Z5V A;  4EFE A;  3JD4 A;  1R3J C;  1V54 C;  1H2S B;  1Y74 A;  1Q6I A;  1SES A;  3VQW A;  1WNS A;  5LP6 A;  1Y4M A;  4TQF A;  2P5O A;  2EBO A;  3FB5 C;  5LHH A;  4O4L B;  2YSU B;  4D7S A;  1AI6 A;  4IGG A;  5IYD O;  3CHX A;  5CA0 A;  1MMM A;  2CTR A;  3UQ8 A;  1VF6 A;  1NBM G;  5JWP A;  4B3T B;  1N34 B;  3K5L A;  3BAB A;  4XDL A;  1AB3 A;  2DYR B;  5J2U A;  3OGI B;  3L70 H;  4MTG A;  4TUY B;  3TET A;  3SR2 C;  4J11 A;  4BIZ A;  4JF3 A;  4YY3 B;  5GTH Z;  1JMK C;  2L6L A;  5IYZ A;  2EIM B;  2EZP A;  2GUZ A;  3JAS A;  1BZK A;  3HKD A;  1YF2 A;  4U3J A;  1FFT B;  3QVN A;  2DYR C;  2A9H A;  4B3S B;  1SKV A;  1W0J G;  4CS2 A;  1G4Y B;  2Q0A A;  1L8D A;  3CXC U;  2D2C B;  2EIM C;  1AJN A;  2PUS A;  1H8E G;  4DV0 B;  1KEC A;  3ZIA G;  2EJR A;  5JQG A;  4DUZ O;  1SQG A;  4PDV A;  1YTF D;  2FL4 A;  1PKX A;  3HKE A;  4PA4 A;  3CRR A;  5EZY A;  4JI7 O;  2WLI A;  1YI2 V;  2QTS A;  2UUB B;  3DXR A;  2QWN B;  3TJT A;  5JH7 A;  1NH2 D;  4YJ2 A;  4AIL C;  4MW8 A;  5C8Y B;  1S5H C;  3M7M X;  4DR2 B;  4HZ3 A;  4Z2W A;  1ARO P;  1NTK H;  4JI1 O;  1I94 O;  3CE2 A;  5IJ0 A;  3SPC A;  4DXW A;  3ZN1 A;  3HPL C;  4HAM A;  1LR1 A;  4WCE V;  2LP7 A;  2ATK C;  2VS0 A;  1R3I C;  1ZAU A;  2Y4U A;  1WJZ A;  3A0H Z;  3K5M A;  3MHH C;  2EIN C;  3ASO B;  2X6A A;  4MVQ A;  5LXT B;  1GO3 F;  3JD1 A;  1IX9 A;  1SQQ H;  4LBE C;  3LNM B;  4LFC O;  2EUL A;  4J10 A;  4F6R B;  5CA1 A;  4JGS A;  5BZB A;  4TWK A;  1UFI A;  3JYC A;  4NXN O;  3GVM A;  3CCJ V;  4DO2 A;  4FLU A;  3ASO C;  5E79 Z;  1QLN A;  3K5N A;  3EXA A;  1TGO A;  3EVK A;  3F7Y C;  4CH4 A;  5LMN O;  4DV4 O;  1XI1 A;  4WFF A;  2WLN A;  5BXZ A;  1XL6 A;  2DW4 A;  1TA8 A;  4W4K A;  2X6B A;  2L35 A;  1YDX A;  3ZRW B;  4CS4 A;  3E8B A;  3ETE A;  1QLE B;  1I7F A;  1NS1 A;  1OCZ B;  2VQE B;  3H1H H;  4QNH B;  3RFR A;  2GV9 A;  2CTW A;  4UXN A;  3IGA C;  4OXS A;  3FYE B;  4JI2 B;  2FB5 A;  1N0N A;  1HNX B;  1OCR B;  2Q7G A;  2RN9 A;  5TIS Z;  3SYC A;  4MT8 A;  4J7J A;  2X6C A;  3LSQ A;  4CH5 A;  3K0D A;  1QR8 A;  1QLE C;  5IJ9 A;  1OCZ C;  1RPO A;  2FML A;  3CC4 V;  1VQM V;  1RFY A;  1ORQ C;  5KHG A;  3QG5 A;  1QR9 A;  1OCR C;  4JYA B;  3CP1 A;  2AZ0 A;  2F93 B;  5LHI A;  3NXS A;  2QWP B;  3C3S A;  3MDS A;  1OV9 A;  2IH1 C;  1BQZ A;  1XMQ B;  4JTC B;  5H9C A;  2LFR A;  2JGD B;  4DR4 B;  2ZIO A;  3NR7 A;  4I9W A;  3DC5 A;  2LW1 A;  4JI8 O;  1U96 A;  3M8A A;  2QE7 G;  3BCC H;  4JI5 B;  1NVP B;  3W7U A;  2YXY A;  5EYP B;  5FNV A;  2QKA A;  1FXK B;  2E5L B;  2UXC B;  4QGP A;  2YI9 A;  5DED A;  4UV8 A;  2JGU A;  5J2T B;  4GYC B;  1IVS A;  5CMU A;  5KMG B;  5EC1 C;  4TV8 B;  2CH7 A;  3WG7 C;  1K7D A;  2IM9 A;  4P9O A;  4PI2 A;  2ILM A;  3ZRV A;  4O4J A;  2N74 A;  4O2B B;  4DW1 A;  1FXK C;  1GTO A;  4FZ0 A;  1XNQ B;  3F5T A;  1NKD A;  1K4C C;  1Q43 A;  1EFR G;  3TGU H;  1OCC B;  1VQ7 V;  5LMU B;  3QO5 A;  2Q0O C;  3LSS A;  1VAR A;  5EIB C;  2ZIN A;  3B40 A;  2G38 A;  2BTO A;  2YIA A;  1R1B A;  4B3T O;  1YJW V;  1N34 O;  1K92 A;  4JYY A;  4HNA A;  4DUY B;  1F23 A;  1R73 A;  1OCC C;  3B8N A;  2FTK A;  1MOF A;  3M99 B;  4IIJ B;  4YY3 O;  2JRI A;  3FKS G;  3OMI B;  5B1O A;  2GSM B;  2A3Q A;  1VQO V;  2F43 G;  4GT1 A;  2FYU H;  2WWW A;  1S3J A;  4MTF A;  4B3S O;  4P30 A;  4JI3 B;  4X1Y B;  3SJC C;  3W7W A;  3B2E E;  1JX9 A;  2ADQ B;  2EIL B;  2YXL A;  1VF5 B;  2LGQ A;  1UPG A;  4MVU A;  1K34 A;  1AR4 A;  4DV0 O;  2HJF C;  2DYS B;  2XOK G;  3RWR D;  2JJ2 G;  3N2G A;  4YHH B;  1D2D A;  5LGT A;  4AHC A;  2EIL C;  3KCY A;  4JPR A;  3FB6 C;  2UUB O;  2ZNJ A;  1PNK A;  5D5P A;  1B06 A;  2DMX A;  4TT3 G;  2GHY A;  5LYJ A;  2EX3 A;  2DYS C;  4L87 A;  1N33 B;  1KP2 A;  4DR2 O;  5B66 Z;  4PJ0 Z;  1RSO B;  4MVZ A;  5DM6 V;  2LO1 A;  1KBH A;  2RNB A;  1SQF A;  4U7O A;  1VQ4 V;  1VQN V;  3ZHR A;  2C2A A;  4O2A A;  5DEC A;  2N04 A;  3KZI Z;  1R6K A;  5K1P A;  3CSX A;  1B04 A;  3ZJZ A;  3JAR B;  3OR6 C;  2OYQ A;  4J42 A;  1XQ8 A;  1XIL A;  3G71 V;  4EKW A;  4DV2 B;  2OTL V;  1VMG A;  2H8P C;  5KHH A;  3SJB C;  2YUA A;  1H2G A;  1KP3 A;  5CBG A;  3K0G A;  4GCZ A;  2ETN A;  4DV5 O;  1WP8 A;  3ABL B;  4NTX A;  3BPZ A;  4JAU A;  4MVS A;  2QWO B;  4R8C A;  5L3F A;  3RYF A;  4LF4 B;  1GAX A;  5KX5 A;  5E1A C;  4GX0 A;  3F5W C;  2IJH A;  4DV3 B;  3HKC B;  4KXR A;  3D36 C;  2QGN A;  3Q4H B;  3KG2 A;  4DRX B;  4MTO A;  3ABL C;  1FFX B;  5BMV A;  4DV1 B;  1KQS U;  1E1R G;  3TXS A;  1KC8 W;  4X64 B;  3K04 A;  1Q81 W;  4PA9 A;  3ZMT A;  5GON A;  1JVM A;  1GN4 A;  1H2L A;  1KKD A;  2JK5 C;  2A0L A;  1CEZ A;  3L75 H;  1KYO F;  3OTF A;  3H1L H;  3RYI B;  4MS2 A;  1VEW A;  3B4S A;  4JI2 O;  4LFA B;  1GRJ A;  2YEV A;  1HNX O;  3ZMV A;  4DK1 A;  3ZED A;  1GN6 A;  4KL1 A;  4X20 A;  3AG2 B;  1H2K A;  4XDJ A;  2W6J G;  5B1A B;  1VQP V;  1H2N A;  1SER A;  4H44 B;  2QDO A;  1WB7 A;  2P67 A;  5GTI Z;  3I5D A;  3JD3 A;  4O4L A;  3L72 H;  1H38 A;  2PI5 A;  2M7W A;  2QTO A;  2UUC B;  4JYA O;  2IW5 A;  2HR3 A;  2GTA A;  4X65 B;  1NTZ H;  2DJV A;  2Y48 A;  4JTD B;  3ETD A;  2B1G A;  1DF4 A;  1MNG A;  3OAA G;  4LF8 B;  1NZ6 A;  5EBM C;  5B1A C;  3H1J H;  2QR4 A;  4U7N A;  3IC9 A;  4NB5 A;  4DR4 O;  2Q68 A;  4UB6 Z;  4TUY A;  4I9Q A;  4CZZ A;  1N0J A;  3H01 A;  2N05 A;  2PTM A;  1XBL A;  5KAF Z;  1MZE A;  3FB8 C;  4EB6 B;  1US6 A;  4H37 A;  3P3P A;  4JI5 O;  2WLL A;  3CCV V;  2ARH A;  1THZ A;  3JCU Z;  1P49 A;  2E5L O;  2UXC O;  3RBZ A;  1HNZ B;  2OCH A;  2CDY A;  2ZIM A;  3ASN B;  2CTQ A;  4ABM A;  4ZI7 B;  4NVP A;  3GB7 C;  1FJG B;  1TUB B;  1CPY A;  1S77 D;  4D6T H;  4FLY A;  4NR1 A;  2MW2 B;  1D5A A;  2Y0P A;  4UFZ A;  1QCE A;  3ASN C;  4UCV A;  5LMU O;  2QA4 V;  3IFX A;  5IDJ A;  5IWA B;  4WF9 V;  1X59 A;  3SPG A;  1QHT A;  4X88 A;  4B7K A;  2AHY A;  4LH6 A;  5C8Y A;  3HR0 A;  1TVK B;  4JYB A;  1JFF A;  3U0Z A;  3RYH A;  4DR7 B;  4O4I B;  4LF9 B;  4OPH A;  1GK9 A;  3OEH G;  1B3Q A;  4CC5 A;  2KG7 B;  3QO8 A;  4AI8 A;  4DYL A;  2H3O A;  2WPD G;  2VQF B;  1Q3E A;  2ZE8 A;  1UJW B;  1H2M A;  3AK1 A;  4JI3 O;  1IXB A;  3N2K B;  2Q67 A;  2Q69 A;  3CEI A;  1I5Y A;  3K08 A;  1CXZ B;  4F6R A;  2JVD A;  5JJN B;  4QE7 A;  1S5J A;  1VIB A;  3ETQ A;  2XAQ A;  1FD9 A;  3UO2 A;  1EN6 A;  2DE0 X;  2E76 B;  2NLJ C;  2HVJ C;  1M57 B;  1Q82 W;  1FXH A;  1EBO A;  3APO A;  4FM1 A;  4E2L A;  4K35 A;  5KAI Z;  1YCI A;  1MSD A;  5H2F Z;  3HKB B;  3ICX A;  5KUM A;  5JJJ B;  2QM7 A; 
#chains in the Genus database with same CATH homology
 3NXS A;  4UVA A;  3ZN0 A;  1PL0 A;  5EC2 C;  3K3W A;  2IH1 C;  4G2K A;  4H33 A;  2OCC C;  5CN0 A;  2V7Q G;  4P9P A;  4JTC B;  1M57 C;  5H9C A;  2HLD G;  3FYI B;  4GX1 A;  5L3D A;  2LFR A;  3CC2 V;  4UUJ C;  2XAG A;  4I9W A;  5B1N A;  3W7S A;  3CCE V;  2W0F C;  2DWE C;  3EHB B;  2EIN B;  1OCO B;  3OEE G;  2WLM A;  4RUE A;  2BOB C;  3WFV A;  1K9M W;  1FXV A;  3OGC C;  3OE7 G;  2QE7 G;  3F7V C;  3EFF K;  2IJI A;  1Q86 W;  5HFL A;  1NVP B;  3W7U A;  3OR7 C;  5B3S B;  1VQ6 V;  4G28 B;  4PA6 A;  3G4S V;  1M9N A;  3SPI A;  1FXK B;  4GX5 A;  4UV8 A;  3GWO A;  1YHQ V;  2CK3 G;  1NJI W;  1OCO C;  2Z5U A;  4FIP C;  3CCR V;  4WFG A;  1NR1 A;  3CYO A;  5CMU A;  1K5Q A;  1VQ5 V;  5EC1 C;  3T1C A;  3WG7 C;  1K7D A;  1NVP D;  5B1B B;  5LGU A;  1F4M A;  3W7X A;  3ML0 A;  4P9O A;  4GX2 A;  2X7R B;  1Y66 A;  3QO7 A;  1E1Q G;  2KB1 A;  3ZRV A;  5B3S C;  2Y69 B;  3JCZ A;  1P4R A;  2ZDI A;  3MHS C;  1FXK C;  1GTO A;  1NKD A;  1PNM A;  3P30 A;  5LHG A;  1K4C C;  1EFR G;  1OCC B;  3CC7 V;  1J95 A;  1SRY A;  2ITD C;  4JYC A;  4HYO A;  3VBB A;  1VQ7 V;  2DQ3 A;  3QO5 A;  2XND G;  3RVZ A;  2B1I A;  4F4L A;  3OMA B;  5HFM A;  4JTA B;  3LSS A;  5B1B C;  5CA3 A;  5LGN A;  3T4D A;  3JD2 A;  3ABM B;  5FL7 G;  2JDI G;  4PDL A;  1JCH A;  1AI5 A;  4MTX A;  1YJW V;  1K92 A;  3LDE A;  4UVB A;  1YIT V;  3ZRS A;  1HWY A;  1F23 A;  1R73 A;  5CBH A;  1OCC C;  3G6E V;  3B8N A;  5GW7 A;  2FTK A;  1G8M A;  1MOF A;  4QPJ A;  5LHI A;  1FXK A;  3E8F A;  2P7T C;  1I5X A;  4LP8 A;  3CCU V;  1LNQ A;  3M99 B;  2W6I G;  1B6Q A;  3LDD A;  1TUE B;  1K3E A;  3FKS G;  1BHA A;  2WLI B;  3ABM C;  3OMI B;  5B1O A;  1H8H G;  2GSM B;  4ZKI A;  4RO2 A;  3I56 V;  1QBZ A;  1VQO V;  2F43 G;  3SJQ C;  4GT1 A;  4YXW G;  3W7T A;  2WWW A;  1S3J A;  4MTF A;  1YJN V;  2PI4 A;  1ENV A;  4J9Z B;  4P30 A;  4FK5 C;  3ZMU A;  2IU3 A;  5L3C A;  1MSW D;  1JPX A;  3AG4 C;  4MVM A;  3CCQ V;  2EIK B;  1BL8 A;  1L1F A;  3W7W A;  1JX9 A;  2EIL B;  2WLL B;  4FJC C;  3ZRX A;  2OCC B;  1YIJ V;  3K9A A;  4MVU A;  3CMA V;  1K34 A;  2XAJ A;  2HJF C;  1RM1 C;  1BMF G;  3E83 A;  2DYS B;  3SYO A;  4Z1M G;  2XOK G;  5EBW C;  5DN6 G;  2JJ2 G;  1M56 B;  4PA7 A;  3VOU A;  3OMN B;  3OM3 B;  3ZCC A;  4KP4 A;  4X8A A;  1F51 A;  2QEX V;  5LGT A;  2EIK C;  1W0K G;  2H94 A;  2EIL C;  2ZR3 A;  4JPR A;  3FB6 C;  4KFM A;  3ZRW A;  5C93 A;  1NQT A;  2P6J A;  3UKM A;  1PNK A;  4TT3 G;  3AG2 C;  2GHY A;  2A79 B;  1GM8 A;  4KUM A;  3SPH A;  1GM7 A;  3E8H A;  3CD6 V;  2DYS C;  4XBF A;  3DTU B;  2ZQM A;  1K4D C;  1KP2 A;  4L87 A;  4QE9 A;  2ITC C;  3RW0 A;  1M56 C;  1WPX A;  4JAV A;  3ZMZ A;  2R9I A;  3WG7 B;  4MVZ A;  5IYC O;  5DM6 V;  1R6N A;  4I5S A;  1OZ0 A;  3X2Q B;  3MD0 A;  4UV9 A;  3LUT B;  4U7O A;  3SYA A;  3I55 V;  1VQ4 V;  1VQN V;  3OW2 U;  2C2A A;  1RPR A;  3E35 A;  1R6K A;  3STZ C;  3ZJZ A;  4Q20 A;  2IJJ A;  3OR6 C;  1SET A;  5H6R A;  3G71 V;  4EKW A;  4RQF A;  1VQ9 V;  2OTL V;  3CCM V;  2Z3Y A;  2H8P C;  1V54 B;  4UVC A;  4QJF B;  1DF5 A;  1MG1 A;  1H2G A;  1KP3 A;  3X2Q C;  4RUF A;  5CBG A;  2QM8 A;  1R3K C;  2IJK A;  3K0G A;  4GCZ A;  2HG5 C;  4WFE A;  4RQE A;  2YEV B;  4N21 A;  2JEU A;  2UXX A;  1GKF A;  3FB7 C;  3ABL B;  1R3L C;  3R65 A;  4JAU A;  4MVS A;  4R8C A;  1WLE A;  2B5U A;  4MW3 A;  1IXM A;  2LFS A;  3E8G A;  3JD4 A;  1R3J C;  4R50 A;  3JD0 A;  1V54 C;  5L3F A;  5L3E A;  5E1A C;  1JJ2 U;  1SES A;  4GX0 A;  3F5W C;  1E79 G;  2IJH A;  5LBQ A;  3K03 A;  1Y4M A;  2EZO A;  3LDC A;  5EBL C;  2EBO A;  3B77 A;  3FB5 C;  1SZT A;  1S76 D;  5LHH A;  2YSU B;  5CBF A;  1AI6 A;  3A0R A;  3KG2 A;  2OTJ V;  3IC7 A;  4MTO A;  3ABL C;  3UM7 A;  5J9P C;  4PDR A;  5IYD O;  4QPK A;  2V1D A;  4J9Y B;  1KQS U;  2ZXW B;  4PA3 A;  2R9R B;  3AG4 B;  2QKS A;  3P32 A;  1E1R G;  4R7C A;  1NBM G;  5KUK A;  1KC8 W;  4ZBM A;  3K04 A;  4XDL A;  1Q81 W;  4PA9 A;  2DYR B;  3ZMT A;  1JVM A;  2DQ0 A;  3CCS V;  1KKD A;  2JK5 C;  2A0L A;  1CEZ A;  4LC1 A;  1RM1 B;  4MTG A;  3TET A;  4BIZ A;  4JF3 A;  1V55 B;  3D36 A;  3K79 A;  4MS2 A;  2NNU A;  3RVY A;  2ZXW C;  4XDK A;  3OFN G;  2EIM B;  2YEV A;  2EZP A;  1FS0 G;  2K1E A;  3ZMV A;  1FFT B;  3AG1 C;  1GM9 A;  2DYR C;  2A9H A;  1QVF U;  4MVO A;  1YTF B;  3B8M A;  1K33 A;  1W0J G;  2WSS G;  3AG2 B;  4XDJ A;  1YJ9 V;  3CME V;  2W6J G;  5B1A B;  1VQP V;  1SER A;  1G4Y B;  3ABU A;  2P67 A;  2X0L A;  3DGE A;  3ETG A;  3JD3 A;  3CXC U;  1V55 C;  5IYB O;  3QNE A;  1H38 A;  2PI5 A;  2M7W A;  4RAI A;  2EIM C;  1F4N A;  1AJN A;  1NH2 B;  1H8E G;  1KEC A;  2QTO A;  3ZIA G;  2UXN A;  2EJR A;  2IW5 A;  2HR3 A;  2Y48 A;  3AG3 B;  4JTD B;  3ETD A;  2B1G A;  4PDV A;  5EK0 A;  5L3B A;  1YTF D;  1DF4 A;  2JEX A;  1YSC A;  3OAA G;  1PKX A;  5KA5 A;  4PA4 A;  1AI4 A;  5EBM C;  4BW5 A;  5B1A C;  1EZJ A;  1XL4 A;  3K06 A;  2WLI A;  1YI2 V;  4U7N A;  2WLJ A;  4CBC A;  3SYQ A;  5IY5 B;  2Q68 A;  2XAS A;  3BY6 A;  4CZZ A;  1NH2 D;  3H01 A;  4JAS A;  4MW8 A;  1W2B U;  3FB8 C;  1S5H C;  3ZMS A;  3T2M A;  3AG3 C;  4HZ3 A;  4G27 B;  4H37 A;  1S0V A;  4MVR A;  2WLL A;  1ARO P;  1BHB A;  4X89 A;  1VQL V;  2BOC C;  3CCV V;  1THZ A;  4PEL A;  3SPC A;  4DXW A;  4PDM A;  4FMT A;  3ZN1 A;  3HPL C;  4HAM A;  5IY5 C;  3D3I A;  2IU0 A;  3RBZ A;  4WCE V;  1KD1 W;  3ABK B;  2LP7 A;  2ATK C;  1OHH G;  3ASN B;  2ZDI C;  1R3I C;  2OT5 A;  3PJS K;  2Q6A A;  3GB7 C;  4ASU G;  2EIJ B;  2MK3 A;  1CPY A;  1S77 D;  2HVK C;  1AR1 B;  1K5S A;  2JIZ G;  1ROP A;  4WFB V;  1P7B A;  3MHH C;  2ZD9 A;  3SPJ A;  2EIN C;  5KA6 A;  3ASO B;  5H6Q A;  3CPW U;  1NR7 A;  2HFE C;  2X6A A;  4MVQ A;  1GO3 F;  1QCE A;  1COW G;  3JD1 A;  3ABK C;  3ASN C;  4QIW F;  4LBE C;  3LNM B;  2QA4 V;  2EIJ C;  3IFX A;  5IDJ A;  1PD3 A;  2XAF A;  4JGS A;  4WF9 V;  3HB3 B;  3SPG A;  5BZB A;  4TWK A;  1AI7 A;  3JYC A;  4X88 A;  4TSF G;  1K97 A;  2AHY A;  1AJP A;  3STL C;  4WFH A;  1PNL A;  1DLB A;  2P90 A;  3E86 A;  4BAY A;  3CCJ V;  4DO2 A;  3TCU A;  3ASO C;  3T4Z A;  4R6Z A;  1QLN A;  2WAM A;  4JYB A;  4P2Z A;  3F7Y C;  1N8R W;  4FPP A;  3AG1 B;  1AJQ A;  1GK9 A;  3OEH G;  2WLN A;  2Y69 C;  1XL6 A;  4WFF A;  2DW4 A;  2XAH A;  1GMG A;  2HKO A;  3ABT A;  2X6B A;  3TK1 A;  1QVG U;  3ZRW B;  3QO8 A;  3AEI A;  1K73 W;  3E8B A;  2ZR2 A;  3ETE A;  2WPD G;  1QLE B;  1UJW B;  1OCZ B;  2WLK A;  4QNH B;  2WLH A;  1M1K W;  3OUS A;  1VQK V;  1Q7Y W;  2Q67 A;  4UXN A;  3IGA C;  4OXS A;  2DWD C;  3E2E A;  1JOY A;  1CP9 A;  2Q69 A;  3FYE B;  1I5Y A;  1K8A W;  1VQ8 V;  1OCR B;  3K08 A;  3BEH A;  4QE7 A;  3CCL V;  4MSW C;  1ZWI C;  2AHZ A;  4N23 A;  3SYC A;  2XAQ A;  3CP1 A;  4MT8 A;  2X6C A;  3LSQ A;  3K0D A;  1QR8 A;  1MAB G;  2D3O W;  1QLE C;  1S72 V;  1OCZ C;  1RPO A;  2NLJ C;  3OUF A;  2HVJ C;  5L3G A;  1M57 B;  3CC4 V;  3E89 A;  1Q82 W;  1FXH A;  1EBO A;  4WFA V;  1VQM V;  2JJ1 G;  4E2L A;  4BIU A;  1M90 W;  1DTO A;  1JQ0 A;  3SYP A;  1ORQ C;  1QR9 A;  1OCR C;  2IH3 C;  5KUM A;  2QM7 A;  4LCU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...