1EBOA

Crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIGEADGLIEGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCRIEPHDWTKNITDKIDQIIHDFVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords EBOLA VIRUS ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMEN
publication title Crystal structure of the Ebola virus membrane fusion subunit, GP2, from the envelope glycoprotein ectodomain.
pubmed doi rcsb
source organism Ebola virus sp.
total genus 45
structure length 112
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1eboA00
1DF5A 1MOFA 1QR9A 2MK3A 4JF3A 3B8MA 2EZOA 2EZPA 1K33A 1MG1A 3MHHC 3H01A 5KA6A 1SZTA 1DLBA 3MHSC 5CN0A 4N23A 4FJCC 3M99B 4JPRA 1I5YA 1ENVA 1Y4MA 3B77A 4JGSA 1QCEA 1JQ0A 1Y66A 1F23A 1QBZA 3P30A 2LP7A 4FK5C 3GWOA 3WFVA 5KA5A 5HFMA 3B8NA 1JPXA 5H9CA 5HFLA 1K34A 3CP1A 1I5XA 4G2KA 3K9AA 2OT5A 1EBOA 3CYOA 5CMUA 1DF4A 2M7WA 4N21A 2P6JA 4FIPC 1QR8A 2EBOA 2X7RB 4E2LA
chains in the Genus database with same CATH superfamily
1QU7A 4MVSA 3MHHC 3A8TA 5KX5B 5LGUA 5A9GA 1R6KA 4LF4O 4I0XB 4FM1A 4WFFA 5IYDO 4ZI7B 3WG7C 2YEVA 3JAWB 4X1YA 2D3OW 4B08A 1XOUA 4GKJB 3AG4C 1L0LH 3CMEV 3T1HO 1YF2A 4DV7O 4LNUB 1QQCA 1N36O 2UUCO 5CBFA 5DN6G 1FXKB 4OX9B 4UVCA 2VQEO 3FYIB 2P4VA 2QEXV 1H2LA 3EXAA 3U0ZA 1Q3EA 3FB8C 1XMOB 4O4IB 1IVSA 3RBZA 4UCUA 3CRQA 3H01A 5C8YA 2DYRB 4YIPA 3F7YC 3VQYA 3LDCA 1PNLA 4Z1VA 2RQ6A 1JX9A 1HNWB 4DYLA 1VF5B 1WAZA 4IIJB 5KHHA 1KP3A 3I56V 3EFFK 1U97A 2HFEC 2Q7EA 4YJ3B 2LW7A 1W0JG 4JAVA 1TVKB 2WPDG 4MVUA 4O2AB 1PKXA 1ZL8A 2VRZA 4K0KB 4GZRB 4JGSA 1YJNV 1E1QG 5K1XA 4JI7O 1KKDA 1VQMV 5EBMC 2W6IG 1GTOA 1OCRB 1H2KA 2FTKA 1NVPD 2QWOB 4EB6B 2Q6AA 3VQVA 4WCEV 2HKOA 4JV5B 2DYSB 2KSDA 1M1KW 3BA8A 3L75H 3B09A 3FAVB 3FYEB 2LQTA 1FJGO 3UM7A 1RPRA 1W2BU 1Z5VA 1VQKV 1BCCH 4HBNA 2CTQA 5BMVB 4O2BB 3KZIZ 2LFRA 3CEIA 2QM7A 1QR8A 2V4DA 2UXDO 4GKKO 3RVZA 2HVKC 3ZS8C 3GVMA 3G71V 5CA0A 1HNZO 4K8XA 3N2GB 5FLXN 4PA3A 3TK1A 4JI3B 2OCCC 1P49A 3H9VA 1IBKB 1FPOA 3E8BA 1Z2GA 5LMUO 3OEHG 5H6RA 5LBQA 1WA8B 3SYAA 1IX9A 1R73A 3ZCCA 1XDCA 3RYCB 4GLXA 4LF9O 1V54B 3CMAV 3QF7A 3RYFB 5IJ9B 2W0FC 5KMGA 2ZR3A 3FD9A 2DMXA 4OPHA 4QPJA 4GX2A 4E4EA 2QWPB 2FL4A 4JI1B 5DM6V 5E1AC 3ZRWB 3H1HH 2BTQA 4U3FH 1H8EG 3RYIB 2ZE8A 2EIKC 1BGYH 3S3WA 2EINC 3P3PA 5CB4B 4WFAV 1IBMO 1YITV 2A9HA 3ZMUA 4HNAB 3ZHSA 1VF6C 2GBOA 3UT5B 4IHJB 1N32O 1XHZA 5JQGA 1SA0A 3T1YO 4QE9A 5KHJA 1N34B 1FFXA 4PHZA 2EJ7A 5KUMA 3QVNA 2QKCA 4YHHO 2Q4PA 1QLNA 5HFLA 2ZKOA 1QVFU 1FKAO 3W7TA 4BAYA 2QKSA 4TV9A 4AILC 1MNGA 3OGCC 4Q20A 4DV5O 2EIJB 3G6BA 2F93B 1RM1C 4F4LA 3ZEDA 2IU3A 2WLIA 2XAHA 1NTKH 1MMMA 5C93A 1VQ5V 4FVMA 3HKCA 3F5WC 3SJQC 3AG3C 5JVDA 1F7YA 5IJ0A 1YCIA 4PA7A 3QO7A 4UCVA 4Z2WA 2IM9A 3B77A 2ZXWB 1ROPA 2PTMA 2ETNA 3K08A 4QGPA 1VMGA 3UQ8A 1N33O 1BMFG 1VP7A 5CA1B 2XAQA 2A7WA 1I94B 4MTOA 3K5NA 1KYOF 2HHHO 4J80A 3K5MA 3IJ4A 1TUBB 4QIWF 2E75B 2CGNA 2ZD9A 1GN6A 3T4DA 2LP7A 4AQYB 4DRXB 1R3KC 2DWEC 1R3JC 3WB0A 1YEWA 2E74B 1SKVA 2GUZA 1XL4A 5EZYA 2ZQMA 1MG1A 4ZBMA 1Q5OA 1XUQA 1OJHA 3H1KH 1CEZA 1N4CA 4GKJO 5L3GA 2E5LB 4DUYB 1NH2D 1VARA 4ZKIA 2YSUB 4IT5A 4U3JA 2P5OA 3ZRVA 4UUJC 1IXBA 3OGIB 1I0HA 1Y74A 4PD4F 4PJ0Z 4OX9O 2EBOA 4PDVA 5BZBA 1MOFA 5AG2A 4I55A 3AG4B 4DV6B 2IJJA 2BOBC 2XAGA 5GTIZ 5GONA 1CXZB 2B1GA 4TWKA 4JTCB 2AZ2A 1XMOO 1VQ8V 1BS3A 2P7TC 4MSWC 1JPXA 1RSOA 4PDMA 4ZHQB 2RNBA 3SPGA 4JI8B 1ZUQA 5A2QN 1B6QA 4H0LB 3J81N 1JFFA 3HPLC 4CZZA 1HNWO 4B3MB 3JSNA 1DLBA 4L8JA 4FJCC 5LXTA 1RPOA 2GDSA 1NBMG 4NR1A 2N05A 1F23A 2DWDC 4JZ2A 4K35A 1RFYA 3CCJV 2IH3C 1VQOV 1I5XA 4X1IA 5IYZB 4X89A 1MABG 1HNZB 2R72A 2UU9B 2XUMA 3ZRSA 4H13B 4DV1B 4K0KO 2Q0OC 4JI6B 2KG7A 1M4UA 5ITZB 2CUGA 3Q4HA 2XAJA 3K3WA 1YIJV 2ZCEA 4JV5O 4UCSA 4FLUA 1VQPV 3OTFA 3CHXA 1N0NA 2R9AA 4FLTA 1NI8A 1N0JA 3ZHQA 2L35A 4X64O 3VQXA 1WB8A 4GX1A 3L9DA 4DR2B 4UCOA 2HLDG 4XDKA 3K0GA 1SESA 2P22C 3CRAA 1MA1A 2QA4V 2BSKB 3CCQV 2N04A 1K73W 3STZC 3JD3A 3MDSA 1S5JA 4LCUC 3PN1A 5BY1A 2ITDC 4G28B 2E76B 3HKBA 2Q9LA 3T2MA 2YXYA 1KP2A 4JI3O 3S3XA 3QO8A 1IBKO 1O9HA 1VEWA 4FPPA 1I5YA 2Q5ZA 1TUEB 4FZ1A 2MW2B 2DQ0A 4CS2A 3ZN0A 2ADQB 3SPJA 2RCVA 3OW2U 4QJFB 1M90W 5CMUA 1PPJH 2OCCB 4TV8A 1MSWD 4GX5A 5LP6A 4F6RA 1VF7A 4P30A 3SJBC 4B3SB 1AI7A 4DO2A 4JI1O 3AG1C 3CJHA 4FZ0A 3W7SA 2JEXA 3OE7G 4FIPC 5L3BA 5J9PC 1K4DC 2XAFA 1K9MW 4P2ZA 2EULA 3AG7A 3OFNG 3D8CA 4WFGA 2ODMA 3OMAB 4I4TA 1W59A 5KUKA 5LGTA 4LFCB 3JALA 2ZDIC 4KXRA 2EINB 5CA0B 1S72V 3BAAA 2CGOA 3JARA 5LOVB 4DK0A 1I7FA 3NXSA 1R3IC 3ABLC 2EX3A 4J42A 5J2TA 4DR3B 5LP6C 4MVRA 2EIMB 1FXHA 5D5QA 1ZTEA 3UKMA 2EZPA 2ZIMA 4BWAA 2CTPA 3L71H 3TCUA 3G80A 5JH7A 3CPWU 1GRJA 4JYBA 2N74A 1G1XB 2H94A 4PELA 5H9CA 3E2EA 1AR4A 3N2KA 4DUZB 1B06A 5KMGB 1IBLB 2FKXA 3FFQA 1DK1A 3KKYA 1H2MA 4IL6Z 2WLHA 2CH7A 2V7QG 1AJPA 3SYQA 4UB6Z 1TA8A 1B04A 4J9YB 1H38A 2XT9A 4JAAA 2CK3G 4DR6B 3RWRD 4J7JA 1GKFA 4MTFA 3A2FA 1RM1B 2BOCC 3HKDA 2PYLA 1S5HC 2UUAB 4L87A 3L72H 1S76D 2FYUH 3ZX6A 4BIOA 1IDSA 2H3OA 1J95A 4D6TH 1OCZC 2PGGA 1EM1A 5EYPA 3AG3B 4JTDB 1Q6UA 3DXRB 5JQGB 1SA0B 2PI4A 1I94O 4LF5B 2B1IA 3U10A 5IWAB 5LGNA 1FFXB 1OV9A 3CP1A 1XMQB 2QE7G 2DW4A 1Q6HA 5KAIZ 4O4HB 4FLZA 2X7RB 1GN4A 4NXNO 1JVMA 3ZHRA 4LWSB 2LO1A 1YXBA 4KUMA 4DXWA 1SQPH 1YDXA 4AQYO 4TV9B 3JD2A 3CXHF 2Y69C 4MW3A 4YY3B 3VOUA 3ZMVA 4OXSA 4KHPB 2ATKC 3BY6A 4XDLA 2JK5C 4MVMA 2GV9A 5IE9A 3K59A 3W7UA 3QG5A 4X66B 2WLIB 1AI6A 1Y76A 2EILC 4JI4B 2E5LO 2Q73A 4DUYO 4NVPA 2WSSG 3ETGA 2GHYA 1BZKA 1SZTA 3HKCB 1KQSU 1F4MA 5JCOA 5IJ0B 1HWYA 4BR6A 1AP6A 4LF7B 3CCMV 5DECA 4FK5C 2K9PA 4DV6O 1H2NA 3H1LH 3E83A 5B1AB 3DSQA 4I9QA 4NXMB 1VQ6V 2LGQA 4X64B 1SQXH 4JI8O 1BL8A 3ZHTA 1QCEA 1Q43A 1V55C 1XREA 1K3EA 4WBNA 3ZJZA 4B3MO 1JR9A 5LYJB 2WLLA 2GSMB 1HNXB 2Y0PA 2F4VO 1BSMA 3K03A 3K5LA 4NYKA 5KAFZ 3BFRA 4HZ3A 2QWQB 4Q6GA 1YJ9V 4J7KA 2O57A 5JCOC 1XNRO 1EN5A 5EZYB 2UU9O 3MD0A 2IJHA 3SJAC 4DV1O 3OT7A 1JMKC 4FLWA 4JI6O 1SRYA 1GN3A 3E22A 2P6JA 1S0VA 3O9OA 1AVMA 2OYQA 3B8MA 5L3FA 3D3IA 4H37A 1QVGU 3EHBB 1Y4MA 4DR2O 4EFEA 1U96A 4I5SA 1GM8A 4BIUA 1KD1W 4JI5B 2LFSA 4H44B 1Y67A 1Q82W 3F7VC 1P7BA 3QNEA 1YI2V 5KHGA 3AK2A 1SF9A 5JJEB 3JATA 2IJKA 3U11A 4CH4A 2HR3A 1JFFB 2IH1C 3SPIA 4JPRA 4LF8B 3BCCH 4ASUG 4UB8Z 4JI2B 2R9IA 1XHXA 5LXTB 2UXNA 3WB2A 2AXTZ 2HVJC 2QDOA 3JD1A 2EIMC 1WNSA 2AHYA 4R8CA 3X2QB 4ZI7A 3OD4A 3B40A 4OPAA 2ILMA 3IGAC 1YSCA 3M99B 3HB3B 1ENVA 1ZSPA 4LNUA 5TISZ 1PV0A 4Z1MG 2CTRA 1L0NH 2OT5A 3T1CA 4J41A 1FXKA 1O9GA 4B3SO 1TGOA 2EJRA 5LHGA 4J9ZB 3ZHUA 2PF4E 4LH7A 5E79Z 2QM4A 3A0BZ 3RFRA 1VIBA 2FMLA 2ZINA 3E8FA 3SYOA 2WA4A 3K9AA 4TQDA 3CCSV 4YJ2A 2YS8A 3APOA 3AG1B 3B2EE 1B3QA 4O4JA 5FNVA 1AI4A 5KHKA 4LFCO 5CBGA 3QO5A 1PM9A 1ZX3A 4RUFA 1XEQA 2CE4A 5LA6A 1T5EA 4IIJA 4MTXA 1NJIW 1NS1A 1JJ2U 1H2SB 2B5UA 4DR3O 3ASNC 1JJOA 2YICA 2R70A 3AK1A 2AHZA 1AB3A 1Q6IA 2WLKA 1SQBH 3A0RA 3OUFA 2OIEA 2P4KA 3CCEV 1BHBA 4TV8B 4F6EA 3ABLB 5LP6B 1IZ3A 4F6RB 4DUZO 1IBLO 1K4CC 1GH6A 3FKSG 2YI8A 4NXNB 1PD3A 4U7OA 4RWUA 2PY5A 2VWJA 3RYHB 4B3TB 4MVOA 4U7NA 5JJJB 3FAVA 3PJSK 4J11A 2OWOA 2OTJV 4OGQB 4TT3G 4DR6O 2VWKA 4GYCB 5LHIA 1THZA 1YJWV 4X8AA 3ICXA 1AI5A 4X1KA 2Z5UA 1EFRG 1AR5A 5BMVA 4GCZA 4O2BA 4KL1A 2UUAO 4LFAB 3J7AU 3E8HA 4I4TB 2JIZG 4QPKA 3WB1A 2LW1A 5B1AC 3R65A 1UPGA 1M57C 2WA3A 3JALB 1HP8A 1XNQB 1GM9A 3N2GA 3CS5A 4LF5O 2RN9A 2ZIOA 2YUAA 5KA6A 5IWAO 3THOA 2NNUA 1XMQO 1OCCC 5BXZA 3JAKA 3CC7V 3ML0A 4FM2A 1OCZB 2JRIA 5KHIA 4DV2B 1Q81W 4UVBA 1K97A 2A0LA 3L70H 5EIBC 1XL6A 5GTHZ 2JJ1G 2QGNA 3IC7A 2M7WA 1EZVH 3RYCA 4YY3O 1Z5WA 3E35A 4KHPO 5EK0A 3N2KB 1YHQV 1JA8A 2IW5A 4NTWA 3K0DA 4WFHA 4X66O 3CCUV 2F4VB 3LSQA 1VQNV 3K9SA 4JI4O 1IURA 1L8DA 3ZRWA 4W4KA 2Y69B 3CCLV 5CA3A 5K1PA 3OUSA 1XNRB 2YEVB 4X1YB 1X59A 3HKDB 4LF7O 5CB4A 1WLEA 2YIBD 1DTOA 4I50A 2EILB 4PA4A 5CN0A 1F4NA 4JASA 2X6AA 5EYPB 3CC2V 5KA5A 1SQFA 3UT5A 4IHJA 4YIOA 4NXMO 4ABMA 4JYAB 4X65B 3FX7A 3L73H 1H2GA 2QWRB 3D36A 1NKDA 1KECA 2QWNB 4ZOLA 5B1OA 2Z3YA 1P4RA 3FB7C 3JD0A 1SETA 3VBBA 4R7CA 1HNXO 4QNHB 1SQVH 4DR5B 2Y4TA 4B7KA 5C8YB 4JYYA 5B5EZ 1HW7A 2YIAA 4DR7B 3X2QC 1V55B 1YTFB 2A3QA 1US6A 3OM3B 2L6LA 3ZMZA 1Y76B 2IBZH 3OEEG 4IGGA 3MHSC 1KMIZ 2X0LA 4DV0B 3GWOA 2UXBO 3RT3C 1ZL8B 3OR7C 3LNNA 2E3CA 1K5SA 2ZNIA 3B4SA 3D36C 3ABUA 2JGUA 3STLC 3CRCA 4RO2A 2JEUA 1A32A 2CDYA 4JI5O 3JCUZ 3ETQA 2YDEA 3RN4A 1AROP 4DV3B 2BCCH 4CH5A 1KUQA 5CA1A 3OTOB 5KLVH 1L1FA 2H8PC 2Q8VA 2YI9A 4K3AA 2GTSA 2PZSA 1TUBA 1GAXA 4WBNB 4E2LA 4MS2A 4LF8O 3LSSA 5EBLC 4C7UA 4TUYA 4JI2O 2WLLB 1KBHA 2F95B 3CC4V 1KB9F 4LC1A 1ZAUA 4DRXA 3SPHA 4LF6B 2NN4A 4GUNA 3G6EV 3IFXA 1D5NA 3JYCA 1GO3F 4NB5A 3ZMTA 2Q67A 2F23A 3DGEA 3LDEA 4N21A 2DN9A 5H6QA 1M56C 4X20A 3ZHVA 1DF5A 3CSXA 4DW0A 4LBEC 4X9QA 3E22B 5LL6Y 2W0XA 3E89A 4MTGA 3F5TA 4FFBA 4HAMA 3APQA 2ARHA 4RQFA 5LMNO 1S77D 3BRCA 2DE0X 2NR5A 1ORQC 5B3SC 5F2VO 3CX5F 2JVDA 2WLNA 1SQGA 1E1RG 3SYCA 2PUSA 1D5AA 2BTQB 4CC5A 4LH6A 3BEHA 3JATB 3NR7A 4GX0A 3UO2A 1SC5B 1BQZA 1R6TA 1XILA 2UUBB 2Q7GA 1KC8W 3K06A 1M93A 2XTAA 2F43G 3C3TA 4PA9A 5IYZA 4CBCA 4R6ZA 1NZ6A 5BR8B 4JZGA 2CTWA 1GM7A 3ASNB 5ITZA 1FXVA 4FLYA 1IXMA 3K79A 3TJTA 2P90A 3KG2A 4B3RB 2ZM6O 4O4LA 4B3TO 1HR0B 1FAFA 5GW7A 3LDDA 1KU9A 4UV9A 3BA9A 3P30A 1SZXA 2F1MA 3LUTB 2JJ2G 2JGDA 1NU1H 2UXCB 3H1IH 2F66C 4HYOA 4LFAO 2KB1A 2BSKA 4IYIA 4YJ2B 4O4JB 5FNVB 4RUEA 4EKWA 2GTAA 5JVDB 3ZRXA 1J5EB 3HKEA 5IT9N 2IU0A 5LA6B 3OR6C 1XNQO 1S5LZ 2BE3A 5HFMA 1EZJA 4LFBB 4RQEA 3OAAG 3CE2A 2OTLV 4DV4B 4LP8A 3P3NA 4DV2O 4JF3A 1M57B 2WWWA 3RGBA 2KQXA 1R6NA 4DW1A 3K58A 2ADPA 3ZMSA 1GK9A 2QTSA 1OCCB 3K04A 1K92A 4PA6A 1EBOA 1I08A 3K57A 3UO3A 1G6UA 2QTOA 2ZNJA 3HR0A 5JJNB 4NTYA 5FPRA 4X88A 3IC9A 3AEIA 3H1JH 3JAMN 5H5NA 3CRRA 5CBHA 4AI8A 2GUZB 4X1KB 4X62B 2JS3A 1K34A 5B66Z 4LR3A 4NKGB 4FLVA 5B1BC 4U3JB 1LR1A 3W7XA 4D7TA 2VQFB 1Y74B 3JASA 2UXBB 3ABMC 3KCYA 4DK1A 5L3CA 4JYAO 4X65O 4FLXA 2DQ3A 4UCTA 4I55B 1Q86W 1UFIA 3BHPA 5LOVA 5GONB 5D5PA 2YC0A 4FM0A 1K8AW 3JAKB 4P9PA 1PL0A 2JDIG 2VS0A 3DC6A 1VF6A 1QLEC 3CYOA 1OCOC 1RSOB 5DEDA 5FPOA 4DR5O 1XI1A 3L74H 5J2UA 2HP8A 3RW0A 4DR7O 1JOYA 1VQLV 3WFVA 2NLJC 4UCRA 2HJFC 3ABKC 3BPZA 3ZIAG 4MVQA 2DJVA 4MW8A 1Q90D 5KX5A 2B9ZA 3TXQA 4DV0O 4I0XA 3J80N 3AG2C 4WF9V 4X1IB 3SYPA 4DR1B 3JAWA 1AILA 2YIBA 3E86A 4IYHA 4I50B 2KG7B 2QM8A 3CRMA 2RMKB 2OCHA 3Q4HB 1G8MA 3TXSA 3LSUA 1DF4A 5IY5C 2WLJA 3ABTA 3K5OA 3DXRA 1LUWA 4DV3O 4I7ZB 1QR9A 2EZOA 1WB7A 1P7GA 3OTOO 4D7SA 5LMNB 4DR4B 3GB7C 1YZBA 1SQQH 1G4YB 4O4HA 4O4IA 4ZOLB 4JI0B 4LWSA 1K7DA 2W6JG 4TSFG 2DOSA 4PV1B 3ETEA 4A5UB 1XBLA 2X6CA 3LNMB 4LF6O 1WN7A 4QE7A 3R66A 1K33A 4YXWG 1LNQA 1D2DA 1YTFD 4P9OA 3HKBB 4YJ3A 1R1BA 2P06A 4JTAB 1TVKA 3ZN1A 4LF4B 3ASOB 4CH3A 3I5DA 4BW9A 4O2AA 3UCSC 1FXKC 2QKAA 1AJQA 2Q7HA 2HJDA 1NTZH 1OHHG 2PI5A 1M56B 3I55V 4MVZA 3T1HB 3DC5A 4DV7B 3C3SA 1NVPB 2YXHA 2AW9A 4EB6A 1N36B 2UUCB 3W7WA 1FYJA 4WFBV 2Q68A 2Y0IA 2Y48A 3D3QA 2ZM6B 3OMIB 2ZE5A 2VQEB 1PP9H 3QTCA 3G67A 3CJHB 1SERA 2DYRC 1NR1A 2ZR2A 3M8AA 2Q0AA 5B3SB 1WP8A 4N23A 5EC2C 3VQWA 4TUYB 5LYJA 5EC1C 1VQ4V 1PNMA 1JQ0A 3TGUH 2V1DA 2ZT9B 2UUBO 1OZ0A 4TOIA 1QHTA 2XNDG 2QJ1A 4FMTA 1URFA 4BIZA 2IJIA 1FS0G 2PYJA 5JWPA 3SGIA 3CCVV 1HDJA 3JARB 1S3JA 3SR2C 5BR8O 1MZEA 1PL4A 2Q69A 3FB6C 4X20B 1OCRC 5J2TB 2YXLA 3MAQA 4EEQA 2XOKG 1WA8A 2BTOA 1XQ8A 4TQFA 2DYSC 5JH7B 4MT8A 2WLMA 1EN6A 4B3RO 4JYCA 1JCHA 3WG7B 2XASA 1VQ9V 1HR0O 2WAMA 4FFKA 4JI7B 4FFBB 3WU2Z 2MK3A 5LHHA 3RYFA 5IJ9A 2X6BA 1QNMA 1MZFA 2HEPA 2CH7B 1AP5A 5H2FZ 4WFEA 2UXCO 2A79B 1CPYA 2HG5C 1Y66A 1Q7YW 1AJNA 1WPXA 5IDJA 2RJZA 1E79G 2P67A 3FB5C 4CC6A 1N8RW 1FJGB 3CWBH 2YIDA 4UFZA 3RYIA 5L3EA 1FFTB 2K1EA 1J5EO 4CS4A 3C90A 4LFBO 4J10A 2LJ2A 2AZ0A 1KKCA 3ETDA 4HNAA 1WP7A 1NR7A 2UXDB 4GKKB 4DV4O 3B8NA 4CH6A 2JS5A 1R3LC 5FL7G 3A0HZ 4AHCA 3N27A 4UV8A 1V54C 4CS3A 1M5IA 3BABA 5LMUB 4XBFA 2R9RB 2ZE6A 1ZWIC 4NTXA 4O4LB 1V9PA 1NQTA 4LF9B 4ICGA 5B1NA 4W4LA 1M9NA 3OMNB 2FB5A 2D2CB 3CD6V 3CB2A 3JD4A 4X62O 2JGDB 1GMGA 4KP4A 3EVKA 1COWG 1BT8A 1BHAA 2CAZC 4PDRA 3IAYA 4UXNA 2VQFO 3BVOA 4PI0A 4H33A 1WPBA 3HKEB 4R50A 3SDLA 1VQ7V 3SJCC 1IBMB 4BW5A 1X4TA 5IYBO 1P84F 5B1BB 4ZIBA 1SS3A 2Z0AA 1W0KG 3ABMB 1N32B 1NT2B 2ZDIA 3T1YB 1QBZA 1BQ0A 1TAEA 3KCXA 4K8ZA 2XHBA 3M7MX 3SPCA 4EFBA 4YHHB 4G27B 3RVYA 2EIJC 4PDLA 1K5QA 1PNKA 2C2AA 1AR1B 4GT1A 1QLEB 1NTMH 1OCOB 2QSAA 1WJZA 3P32A 5EIBD 3ZBHA 1UJWB 3RYHA 1F51A 3DTUB 4PI2A 3AK3A 1FD9A 1ZLZA 4RAIA 4J7ZA 3ASOC 2RDCA 4DV5B 5IYCO 3G4SV 4DR1O 1EN4A 1MSDA 4XDJA 3ABKB 4I9WA 1NH2B 1GN2A 2ZXWC 2OIGA 2UXXA 5EBWC 2QR4A 3AG2B 3JASB 1H8HG 2AGAA 2M6YA 1Y6XA 2EIKB 1Q8IA 1BE3H 4B7EA 2Y4UA 4G2KA 1LUVA 4DR4O 3CXCU 1N34O 4KFMA 2LGWA 2G38A 3E8GA 2KKWA 1CP9A 5IY5B 1DGSA 4JI0O 1N33B 1YVWA 2ZE7A 4ZHQA 3GWKC 4UVAA 3CCRV 5J2UB 2HHHB 3O65A 3JSLA 4JAUA 3T4ZA 2ITCC 1RP3B 3JCZA 5L3DA 3TETA 2A06H
chains in the Genus database with same CATH topology
4MVSA 4XDKA 3CCEV 1BHBA 3MHHC 3ABMC 3K0GA 1SESA 5LGUA 3ABLB 5L3CA 1R6KA 2QA4V 3CCQV 1K4CC 2DQ3A 3FKSG 4WFFA 5IYDO 1Q86W 1PD3A 1K73W 4U7OA 1K8AW 3STZC 3JD3A 3WG7C 2YEVA 2D3OW 4LCUC 4P9PA 1PL0A 2JDIG 4MVOA 4U7NA 3AG4C 1QLEC 3CYOA 1OCOC 3PJSK 3CMEV 2ITDC 2OTJV 4G28B 4TT3G 3T2MA 5LHIA 1KP2A 1THZA 1YJWV 4X8AA 3QO8A 5CBFA 1AI5A 2Z5UA 1EFRG 5DN6G 4GCZA 1FXKB 3RW0A 4FPPA 1I5YA 4UVCA 1JOYA 3FYIB 1VQLV 1TUEB 2DQ0A 3WFVA 3E8HA 2NLJC 2JIZG 4QPKA 2HJFC 3ABKC 3ZN0A 3ZIAG 5B1AC 4MVQA 3R65A 3SPJA 2QEXV 4MW8A 3FB8C 1M57C 3OW2U 4QJFB 1M90W 5CMUA 2OCCB 1MSWD 1GM9A 4GX5A 3RBZA 3AG2C 4WF9V 3H01A 5KA6A 4P30A 3SYPA 2NNUA 1OCCC 2DYRB 3F7YC 3CC7V 3LDCA 3ML0A 1PNLA 1AI7A 3E86A 1OCZB 4DO2A 1Q81W 2QM8A 4UVBA 1K97A 1JX9A 3AG1C 2A0LA 1KP3A 3I56V 1XL6A 3EFFK 3W7SA 1G8MA 2JJ1G 2HFEC 2JEXA 3IC7A 1DF4A 2M7WA 3OE7G 5IY5C 4FIPC 2WLJA 3ABTA 5J9PC 5L3BA 1K4DC 2XAFA 1K9MW 3E35A 1W0JG 4P2ZA 1QR9A 4JAVA 5EK0A 1YHQV 2EZOA 2WPDG 3OFNG 4MVUA 2IW5A 3K0DA 4WFHA 4WFGA 3OMAB 3GB7C 3CCUV 3LSQA 1PKXA 5KUKA 5LGTA 1G4YB 4JGSA 1YJNV 1E1QG 1VQNV 1KKDA 1VQMV 5EBMC 2W6IG 2ZDIC 3ZRWA 2Y69B 1GTOA 1OCRB 2EINB 3CCLV 1S72V 2FTKA 1K7DA 2W6JG 4TSFG 5CA3A 1NVPD 2Q6AA 3OUSA 4WCEV 2HKOA 3NXSA 1R3IC 2DYSB 3ABLC 2YEVB 3ETEA 2X6CA 3LNMB 4QE7A 4MVRA 2EIMB 1FXHA 1M1KW 1WLEA 3UKMA 1DTOA 2EZPA 1K33A 4YXWG 1LNQA 2EILB 3FYEB 4PA4A 3TCUA 1YTFD 5CN0A 1F4NA 3UM7A 4P9OA 1RPRA 3CPWU 1W2BU 4JASA 4JYBA 1VQKV 2X6AA 3CC2V 5KA5A 2H94A 4PELA 5H9CA 3E2EA 4JTAB 2LFRA 3ZN1A 2QM7A 3ASOB 1QR8A 1H2GA 2WLHA 1FXKC 2V7QG 3D36A 1AJPA 1AJQA 1NKDA 3SYQA 2PI5A 1OHHG 3RVZA 1KECA 2HVKC 4J9YB 5B1OA 2Z3YA 3G71V 1P4RA 1M56B 3I55V 1H38A 4MVZA 3FB7C 3JD0A 1SETA 3VBBA 4R7CA 1NVPB 2CK3G 4PA3A 3TK1A 1GKFA 4QNHB 4MTFA 2OCCC 1RM1B 3W7WA 4WFBV 2BOCC 2Q68A 3E8BA 2Y48A 3OEHG 1S5HC 5H6RA 5LBQA 3OMIB 3X2QC 3SYAA 1V55B 1YTFB 4L87A 3OM3B 1SERA 2DYRC 1S76D 1R73A 3ZMZA 1NR1A 3ZCCA 1J95A 1OCZC 2ZR2A 3OEEG 5B3SB 3MHSC 2X0LA 3AG3B 4N23A 5EC2C 1V54B 4JTDB 3CMAV 5EC1C 1VQ4V 2PI4A 2W0FC 1PNMA 1JQ0A 2ZR3A 2V1DA 2B1IA 3GWOA 1OZ0A 5LGNA 4QPJA 3CP1A 4GX2A 2XNDG 2QE7G 3OR7C 2DW4A 4FMTA 4BIZA 2IJIA 1FS0G 1K5SA 5DM6V 2X7RB 5E1AC 3ZRWB 1JVMA 3ABUA 3CCVV 1H8EG 3STLC 4KUMA 4DXWA 4RO2A 3JD2A 1S3JA 2JEUA 2EIKC 2Q69A 3FB6C 2Y69C 1OCRC 2EINC 4MW3A 3VOUA 3ZMVA 1AROP 4WFAV 2XOKG 4OXSA 1YITV 2ATKC 3BY6A 4XDLA 2JK5C 2DYSC 2A9HA 4MVMA 4MT8A 1L1FA 2H8PC 2WLMA 3ZMUA 3W7UA 4JYCA 1JCHA 3WG7B 2WLIB 1AI6A 2XASA 1VQ9V 2WAMA 2EILC 4E2LA 4MS2A 3LSSA 2MK3A 5EBLC 5LHHA 2WSSG 3ETGA 2GHYA 2WLLB 2X6BA 1SZTA 4QE9A 1KQSU 1F4MA 3CC4V 4LC1A 5KUMA 1HWYA 4WFEA 3SPHA 1QLNA 2A79B 3CCMV 3G6EV 1CPYA 2HG5C 1Y66A 1Q7YW 4FK5C 1AJNA 3IFXA 3JYCA 1WPXA 5IDJA 5HFLA 1E79G 2P67A 3FB5C 1GO3F 1N8RW 1QVFU 3ZMTA 5L3EA 2Q67A 3DGEA 3E83A 3W7TA 3LDEA 4N21A 1FFTB 2QKSA 2K1EA 5H6QA 4BAYA 5B1AB 1M56C 3OGCC 1DF5A 4Q20A 4LBEC 1VQ6V 2EIJB 1RM1C 3E89A 4MTGA 1BL8A 3ETDA 4F4LA 1QCEA 1NR7A 2IU3A 2WLIA 2XAHA 1V55C 4HAMA 3B8NA 1K3EA 3ZJZA 1R3LC 4RQFA 1S77D 5FL7G 5C93A 2WLLA 1VQ5V 2GSMB 1ORQC 3F5WC 5B3SC 3K03A 3SJQC 3AG3C 4UV8A 1V54C 2WLNA 4PA7A 4XBFA 4HZ3A 3QO7A 1E1RG 1YJ9V 3SYCA 2R9RB 3B77A 2ZXWB 3BEHA 1ZWIC 3MD0A 2IJHA 1ROPA 4GX0A 3K08A 1NQTA 1SRYA 5B1NA 1M9NA 3OMNB 1BMFG 2P6JA 1S0VA 2XAQA 4MTOA 3CD6V 1KC8W 3B8MA 3JD4A 3K06A 5L3FA 1GMGA 4KP4A 1COWG 3D3IA 4H37A 2F43G 4QIWF 4PA9A 1QVGU 1BHAA 3EHBB 1Y4MA 4PDRA 2ZD9A 4CBCA 3T4DA 4R6ZA 4I5SA 4UXNA 2LP7A 1GM8A 4BIUA 4H33A 1KD1W 4R50A 2LFSA 1R3KC 1Q82W 2DWEC 3F7VC 1VQ7V 1GM7A 3ASNB 1P7BA 1R3JC 3QNEA 1YI2V 4BW5A 1FXVA 5IYBO 1IXMA 3K79A 1XL4A 2P90A 2ZQMA 1MG1A 3KG2A 4ZBMA 5B1BB 2IJKA 1CEZA 1W0KG 2HR3A 2IH1C 5L3GA 3SPIA 4JPRA 1NH2D 5GW7A 3LDDA 4ZKIA 3ABMB 4ASUG 2YSUB 2ZDIA 4UV9A 3P30A 1QBZA 2R9IA 3ZRVA 4UUJC 2UXNA 3LUTB 2HVJC 3JD1A 2JJ2G 2EIMC 3SPCA 2AHYA 4R8CA 4G27B 3RVYA 2EIJC 2EBOA 4PDLA 1K5QA 1PNKA 4HYOA 4PDVA 2KB1A 2C2AA 5BZBA 1MOFA 1AR1B 4GT1A 3X2QB 3AG4B 1QLEB 2IJJA 2BOBC 2XAGA 1OCOB 4RUEA 4EKWA 2B1GA 3P32A 4TWKA 3IGAC 4JTCB 1YSCA 1UJWB 1F51A 3M99B 3HB3B 3DTUB 1ENVA 3ZRXA 1VQ8V 4RAIA 2P7TC 2IU0A 3OR6C 4MSWC 3ASOC 5HFMA 1JPXA 1EZJA 4PDMA 5IYCO 4Z1MG 3G4SV 3SPGA 4RQEA 2OT5A 3OAAG 3T1CA 4XDJA 1FXKA 1B6QA 3ABKB 2OTLV 4LP8A 2EJRA 4I9WA 1NH2B 3HPLC 4JF3A 1M57B 5LHGA 4CZZA 2WWWA 4J9ZB 2ZXWC 1DLBA 2UXXA 1R6NA 5EBWC 4FJCC 1RPOA 3AG2B 1H8HG 3ZMSA 1NBMG 1GK9A 2EIKB 1F23A 2DWDC 1OCCB 3K04A 1K92A 3CCJV 2IH3C 3E8FA 3SYOA 1VQOV 1I5XA 4G2KA 4PA6A 3K9AA 3CCSV 1EBOA 4X89A 3AG1B 1MABG 3CXCU 2QTOA 3ZRSA 1AI4A 4KFMA 5CBGA 4X88A 3E8GA 3QO5A 4RUFA 1CP9A 5IY5B 3AEIA 4MTXA 5CBHA 2XAJA 3K3WA 1YIJV 1NJIW 4UVAA 3CCRV 1JJ2U 1VQPV 2B5UA 3ASNC 4JAUA 3T4ZA 2ITCC 1K34A 2AHZA 3JCZA 5L3DA 3TETA 4GX1A 5B1BC 2WLKA 3A0RA 3OUFA 3W7XA 2HLDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF5 A;  1MOF A;  1QR9 A;  2MK3 A;  4JF3 A;  3B8M A;  2EZO A;  2EZP A;  1K33 A;  1MG1 A;  3MHH C;  3H01 A;  5KA6 A;  1SZT A;  1DLB A;  3MHS C;  5CN0 A;  4N23 A;  4FJC C;  3M99 B;  4JPR A;  1I5Y A;  1ENV A;  1Y4M A;  3B77 A;  4JGS A;  1QCE A;  1JQ0 A;  1Y66 A;  1F23 A;  1QBZ A;  3P30 A;  2LP7 A;  4FK5 C;  3GWO A;  3WFV A;  5KA5 A;  5HFM A;  3B8N A;  1JPX A;  5H9C A;  5HFL A;  1K34 A;  3CP1 A;  1I5X A;  4G2K A;  3K9A A;  2OT5 A;  1EBO A;  3CYO A;  5CMU A;  1DF4 A;  2M7W A;  4N21 A;  2P6J A;  4FIP C;  1QR8 A;  2EBO A;  2X7R B;  4E2L A; 
#chains in the Genus database with same CATH topology
 1QU7 A;  4MVS A;  3MHH C;  3A8T A;  5KX5 B;  5LGU A;  5A9G A;  1R6K A;  4LF4 O;  4I0X B;  4FM1 A;  4WFF A;  5IYD O;  4ZI7 B;  3WG7 C;  2YEV A;  3JAW B;  4X1Y A;  2D3O W;  4B08 A;  1XOU A;  4GKJ B;  3AG4 C;  1L0L H;  3CME V;  3T1H O;  1YF2 A;  4DV7 O;  4LNU B;  1QQC A;  1N36 O;  2UUC O;  5CBF A;  5DN6 G;  1FXK B;  4OX9 B;  4UVC A;  2VQE O;  3FYI B;  2P4V A;  2QEX V;  1H2L A;  3EXA A;  3U0Z A;  1Q3E A;  3FB8 C;  1XMO B;  4O4I B;  1IVS A;  3RBZ A;  4UCU A;  3CRQ A;  3H01 A;  5C8Y A;  2DYR B;  4YIP A;  3F7Y C;  3VQY A;  3LDC A;  1PNL A;  4Z1V A;  2RQ6 A;  1JX9 A;  1HNW B;  4DYL A;  1VF5 B;  1WAZ A;  4IIJ B;  5KHH A;  1KP3 A;  3I56 V;  3EFF K;  1U97 A;  2HFE C;  2Q7E A;  4YJ3 B;  2LW7 A;  1W0J G;  4JAV A;  1TVK B;  2WPD G;  4MVU A;  4O2A B;  1PKX A;  1ZL8 A;  2VRZ A;  4K0K B;  4GZR B;  4JGS A;  1YJN V;  1E1Q G;  5K1X A;  4JI7 O;  1KKD A;  1VQM V;  5EBM C;  2W6I G;  1GTO A;  1OCR B;  1H2K A;  2FTK A;  1NVP D;  2QWO B;  4EB6 B;  2Q6A A;  3VQV A;  4WCE V;  2HKO A;  4JV5 B;  2DYS B;  2KSD A;  1M1K W;  3BA8 A;  3L75 H;  3B09 A;  3FAV B;  3FYE B;  2LQT A;  1FJG O;  3UM7 A;  1RPR A;  1W2B U;  1Z5V A;  1VQK V;  1BCC H;  4HBN A;  2CTQ A;  5BMV B;  4O2B B;  3KZI Z;  2LFR A;  3CEI A;  2QM7 A;  1QR8 A;  2V4D A;  2UXD O;  4GKK O;  3RVZ A;  2HVK C;  3ZS8 C;  3GVM A;  3G71 V;  5CA0 A;  1HNZ O;  4K8X A;  3N2G B;  5FLX N;  4PA3 A;  3TK1 A;  4JI3 B;  2OCC C;  1P49 A;  3H9V A;  1IBK B;  1FPO A;  3E8B A;  1Z2G A;  5LMU O;  3OEH G;  5H6R A;  5LBQ A;  1WA8 B;  3SYA A;  1IX9 A;  1R73 A;  3ZCC A;  1XDC A;  3RYC B;  4GLX A;  4LF9 O;  1V54 B;  3CMA V;  3QF7 A;  3RYF B;  5IJ9 B;  2W0F C;  5KMG A;  2ZR3 A;  3FD9 A;  2DMX A;  4OPH A;  4QPJ A;  4GX2 A;  4E4E A;  2QWP B;  2FL4 A;  4JI1 B;  5DM6 V;  5E1A C;  3ZRW B;  3H1H H;  2BTQ A;  4U3F H;  1H8E G;  3RYI B;  2ZE8 A;  2EIK C;  1BGY H;  3S3W A;  2EIN C;  3P3P A;  5CB4 B;  4WFA V;  1IBM O;  1YIT V;  2A9H A;  3ZMU A;  4HNA B;  3ZHS A;  1VF6 C;  2GBO A;  3UT5 B;  4IHJ B;  1N32 O;  1XHZ A;  5JQG A;  1SA0 A;  3T1Y O;  4QE9 A;  5KHJ A;  1N34 B;  1FFX A;  4PHZ A;  2EJ7 A;  5KUM A;  3QVN A;  2QKC A;  4YHH O;  2Q4P A;  1QLN A;  5HFL A;  2ZKO A;  1QVF U;  1FKA O;  3W7T A;  4BAY A;  2QKS A;  4TV9 A;  4AIL C;  1MNG A;  3OGC C;  4Q20 A;  4DV5 O;  2EIJ B;  3G6B A;  2F93 B;  1RM1 C;  4F4L A;  3ZED A;  2IU3 A;  2WLI A;  2XAH A;  1NTK H;  1MMM A;  5C93 A;  1VQ5 V;  4FVM A;  3HKC A;  3F5W C;  3SJQ C;  3AG3 C;  5JVD A;  1F7Y A;  5IJ0 A;  1YCI A;  4PA7 A;  3QO7 A;  4UCV A;  4Z2W A;  2IM9 A;  3B77 A;  2ZXW B;  1ROP A;  2PTM A;  2ETN A;  3K08 A;  4QGP A;  1VMG A;  3UQ8 A;  1N33 O;  1BMF G;  1VP7 A;  5CA1 B;  2XAQ A;  2A7W A;  1I94 B;  4MTO A;  3K5N A;  1KYO F;  2HHH O;  4J80 A;  3K5M A;  3IJ4 A;  1TUB B;  4QIW F;  2E75 B;  2CGN A;  2ZD9 A;  1GN6 A;  3T4D A;  2LP7 A;  4AQY B;  4DRX B;  1R3K C;  2DWE C;  1R3J C;  3WB0 A;  1YEW A;  2E74 B;  1SKV A;  2GUZ A;  1XL4 A;  5EZY A;  2ZQM A;  1MG1 A;  4ZBM A;  1Q5O A;  1XUQ A;  1OJH A;  3H1K H;  1CEZ A;  1N4C A;  4GKJ O;  5L3G A;  2E5L B;  4DUY B;  1NH2 D;  1VAR A;  4ZKI A;  2YSU B;  4IT5 A;  4U3J A;  2P5O A;  3ZRV A;  4UUJ C;  1IXB A;  3OGI B;  1I0H A;  1Y74 A;  4PD4 F;  4PJ0 Z;  4OX9 O;  2EBO A;  4PDV A;  5BZB A;  1MOF A;  5AG2 A;  4I55 A;  3AG4 B;  4DV6 B;  2IJJ A;  2BOB C;  2XAG A;  5GTI Z;  5GON A;  1CXZ B;  2B1G A;  4TWK A;  4JTC B;  2AZ2 A;  1XMO O;  1VQ8 V;  1BS3 A;  2P7T C;  4MSW C;  1JPX A;  1RSO A;  4PDM A;  4ZHQ B;  2RNB A;  3SPG A;  4JI8 B;  1ZUQ A;  5A2Q N;  1B6Q A;  4H0L B;  3J81 N;  1JFF A;  3HPL C;  4CZZ A;  1HNW O;  4B3M B;  3JSN A;  1DLB A;  4L8J A;  4FJC C;  5LXT A;  1RPO A;  2GDS A;  1NBM G;  4NR1 A;  2N05 A;  1F23 A;  2DWD C;  4JZ2 A;  4K35 A;  1RFY A;  3CCJ V;  2IH3 C;  1VQO V;  1I5X A;  4X1I A;  5IYZ B;  4X89 A;  1MAB G;  1HNZ B;  2R72 A;  2UU9 B;  2XUM A;  3ZRS A;  4H13 B;  4DV1 B;  4K0K O;  2Q0O C;  4JI6 B;  2KG7 A;  1M4U A;  5ITZ B;  2CUG A;  3Q4H A;  2XAJ A;  3K3W A;  1YIJ V;  2ZCE A;  4JV5 O;  4UCS A;  4FLU A;  1VQP V;  3OTF A;  3CHX A;  1N0N A;  2R9A A;  4FLT A;  1NI8 A;  1N0J A;  3ZHQ A;  2L35 A;  4X64 O;  3VQX A;  1WB8 A;  4GX1 A;  3L9D A;  4DR2 B;  4UCO A;  2HLD G;  4XDK A;  3K0G A;  1SES A;  2P22 C;  3CRA A;  1MA1 A;  2QA4 V;  2BSK B;  3CCQ V;  2N04 A;  1K73 W;  3STZ C;  3JD3 A;  3MDS A;  1S5J A;  4LCU C;  3PN1 A;  5BY1 A;  2ITD C;  4G28 B;  2E76 B;  3HKB A;  2Q9L A;  3T2M A;  2YXY A;  1KP2 A;  4JI3 O;  3S3X A;  3QO8 A;  1IBK O;  1O9H A;  1VEW A;  4FPP A;  1I5Y A;  2Q5Z A;  1TUE B;  4FZ1 A;  2MW2 B;  2DQ0 A;  4CS2 A;  3ZN0 A;  2ADQ B;  3SPJ A;  2RCV A;  3OW2 U;  4QJF B;  1M90 W;  5CMU A;  1PPJ H;  2OCC B;  4TV8 A;  1MSW D;  4GX5 A;  5LP6 A;  4F6R A;  1VF7 A;  4P30 A;  3SJB C;  4B3S B;  1AI7 A;  4DO2 A;  4JI1 O;  3AG1 C;  3CJH A;  4FZ0 A;  3W7S A;  2JEX A;  3OE7 G;  4FIP C;  5L3B A;  5J9P C;  1K4D C;  2XAF A;  1K9M W;  4P2Z A;  2EUL A;  3AG7 A;  3OFN G;  3D8C A;  4WFG A;  2ODM A;  3OMA B;  4I4T A;  1W59 A;  5KUK A;  5LGT A;  4LFC B;  3JAL A;  2ZDI C;  4KXR A;  2EIN B;  5CA0 B;  1S72 V;  3BAA A;  2CGO A;  3JAR A;  5LOV B;  4DK0 A;  1I7F A;  3NXS A;  1R3I C;  3ABL C;  2EX3 A;  4J42 A;  5J2T A;  4DR3 B;  5LP6 C;  4MVR A;  2EIM B;  1FXH A;  5D5Q A;  1ZTE A;  3UKM A;  2EZP A;  2ZIM A;  4BWA A;  2CTP A;  3L71 H;  3TCU A;  3G80 A;  5JH7 A;  3CPW U;  1GRJ A;  4JYB A;  2N74 A;  1G1X B;  2H94 A;  4PEL A;  5H9C A;  3E2E A;  1AR4 A;  3N2K A;  4DUZ B;  1B06 A;  5KMG B;  1IBL B;  2FKX A;  3FFQ A;  1DK1 A;  3KKY A;  1H2M A;  4IL6 Z;  2WLH A;  2CH7 A;  2V7Q G;  1AJP A;  3SYQ A;  4UB6 Z;  1TA8 A;  1B04 A;  4J9Y B;  1H38 A;  2XT9 A;  4JAA A;  2CK3 G;  4DR6 B;  3RWR D;  4J7J A;  1GKF A;  4MTF A;  3A2F A;  1RM1 B;  2BOC C;  3HKD A;  2PYL A;  1S5H C;  2UUA B;  4L87 A;  3L72 H;  1S76 D;  2FYU H;  3ZX6 A;  4BIO A;  1IDS A;  2H3O A;  1J95 A;  4D6T H;  1OCZ C;  2PGG A;  1EM1 A;  5EYP A;  3AG3 B;  4JTD B;  1Q6U A;  3DXR B;  5JQG B;  1SA0 B;  2PI4 A;  1I94 O;  4LF5 B;  2B1I A;  3U10 A;  5IWA B;  5LGN A;  1FFX B;  1OV9 A;  3CP1 A;  1XMQ B;  2QE7 G;  2DW4 A;  1Q6H A;  5KAI Z;  4O4H B;  4FLZ A;  2X7R B;  1GN4 A;  4NXN O;  1JVM A;  3ZHR A;  4LWS B;  2LO1 A;  1YXB A;  4KUM A;  4DXW A;  1SQP H;  1YDX A;  4AQY O;  4TV9 B;  3JD2 A;  3CXH F;  2Y69 C;  4MW3 A;  4YY3 B;  3VOU A;  3ZMV A;  4OXS A;  4KHP B;  2ATK C;  3BY6 A;  4XDL A;  2JK5 C;  4MVM A;  2GV9 A;  5IE9 A;  3K59 A;  3W7U A;  3QG5 A;  4X66 B;  2WLI B;  1AI6 A;  1Y76 A;  2EIL C;  4JI4 B;  2E5L O;  2Q73 A;  4DUY O;  4NVP A;  2WSS G;  3ETG A;  2GHY A;  1BZK A;  1SZT A;  3HKC B;  1KQS U;  1F4M A;  5JCO A;  5IJ0 B;  1HWY A;  4BR6 A;  1AP6 A;  4LF7 B;  3CCM V;  5DEC A;  4FK5 C;  2K9P A;  4DV6 O;  1H2N A;  3H1L H;  3E83 A;  5B1A B;  3DSQ A;  4I9Q A;  4NXM B;  1VQ6 V;  2LGQ A;  4X64 B;  1SQX H;  4JI8 O;  1BL8 A;  3ZHT A;  1QCE A;  1Q43 A;  1V55 C;  1XRE A;  1K3E A;  4WBN A;  3ZJZ A;  4B3M O;  1JR9 A;  5LYJ B;  2WLL A;  2GSM B;  1HNX B;  2Y0P A;  2F4V O;  1BSM A;  3K03 A;  3K5L A;  4NYK A;  5KAF Z;  3BFR A;  4HZ3 A;  2QWQ B;  4Q6G A;  1YJ9 V;  4J7K A;  2O57 A;  5JCO C;  1XNR O;  1EN5 A;  5EZY B;  2UU9 O;  3MD0 A;  2IJH A;  3SJA C;  4DV1 O;  3OT7 A;  1JMK C;  4FLW A;  4JI6 O;  1SRY A;  1GN3 A;  3E22 A;  2P6J A;  1S0V A;  3O9O A;  1AVM A;  2OYQ A;  3B8M A;  5L3F A;  3D3I A;  4H37 A;  1QVG U;  3EHB B;  1Y4M A;  4DR2 O;  4EFE A;  1U96 A;  4I5S A;  1GM8 A;  4BIU A;  1KD1 W;  4JI5 B;  2LFS A;  4H44 B;  1Y67 A;  1Q82 W;  3F7V C;  1P7B A;  3QNE A;  1YI2 V;  5KHG A;  3AK2 A;  1SF9 A;  5JJE B;  3JAT A;  2IJK A;  3U11 A;  4CH4 A;  2HR3 A;  1JFF B;  2IH1 C;  3SPI A;  4JPR A;  4LF8 B;  3BCC H;  4ASU G;  4UB8 Z;  4JI2 B;  2R9I A;  1XHX A;  5LXT B;  2UXN A;  3WB2 A;  2AXT Z;  2HVJ C;  2QDO A;  3JD1 A;  2EIM C;  1WNS A;  2AHY A;  4R8C A;  3X2Q B;  4ZI7 A;  3OD4 A;  3B40 A;  4OPA A;  2ILM A;  3IGA C;  1YSC A;  3M99 B;  3HB3 B;  1ENV A;  1ZSP A;  4LNU A;  5TIS Z;  1PV0 A;  4Z1M G;  2CTR A;  1L0N H;  2OT5 A;  3T1C A;  4J41 A;  1FXK A;  1O9G A;  4B3S O;  1TGO A;  2EJR A;  5LHG A;  4J9Z B;  3ZHU A;  2PF4 E;  4LH7 A;  5E79 Z;  2QM4 A;  3A0B Z;  3RFR A;  1VIB A;  2FML A;  2ZIN A;  3E8F A;  3SYO A;  2WA4 A;  3K9A A;  4TQD A;  3CCS V;  4YJ2 A;  2YS8 A;  3APO A;  3AG1 B;  3B2E E;  1B3Q A;  4O4J A;  5FNV A;  1AI4 A;  5KHK A;  4LFC O;  5CBG A;  3QO5 A;  1PM9 A;  1ZX3 A;  4RUF A;  1XEQ A;  2CE4 A;  5LA6 A;  1T5E A;  4IIJ A;  4MTX A;  1NJI W;  1NS1 A;  1JJ2 U;  1H2S B;  2B5U A;  4DR3 O;  3ASN C;  1JJO A;  2YIC A;  2R70 A;  3AK1 A;  2AHZ A;  1AB3 A;  1Q6I A;  2WLK A;  1SQB H;  3A0R A;  3OUF A;  2OIE A;  2P4K A;  3CCE V;  1BHB A;  4TV8 B;  4F6E A;  3ABL B;  5LP6 B;  1IZ3 A;  4F6R B;  4DUZ O;  1IBL O;  1K4C C;  1GH6 A;  3FKS G;  2YI8 A;  4NXN B;  1PD3 A;  4U7O A;  4RWU A;  2PY5 A;  2VWJ A;  3RYH B;  4B3T B;  4MVO A;  4U7N A;  5JJJ B;  3FAV A;  3PJS K;  4J11 A;  2OWO A;  2OTJ V;  4OGQ B;  4TT3 G;  4DR6 O;  2VWK A;  4GYC B;  5LHI A;  1THZ A;  1YJW V;  4X8A A;  3ICX A;  1AI5 A;  4X1K A;  2Z5U A;  1EFR G;  1AR5 A;  5BMV A;  4GCZ A;  4O2B A;  4KL1 A;  2UUA O;  4LFA B;  3J7A U;  3E8H A;  4I4T B;  2JIZ G;  4QPK A;  3WB1 A;  2LW1 A;  5B1A C;  3R65 A;  1UPG A;  1M57 C;  2WA3 A;  3JAL B;  1HP8 A;  1XNQ B;  1GM9 A;  3N2G A;  3CS5 A;  4LF5 O;  2RN9 A;  2ZIO A;  2YUA A;  5KA6 A;  5IWA O;  3THO A;  2NNU A;  1XMQ O;  1OCC C;  5BXZ A;  3JAK A;  3CC7 V;  3ML0 A;  4FM2 A;  1OCZ B;  2JRI A;  5KHI A;  4DV2 B;  1Q81 W;  4UVB A;  1K97 A;  2A0L A;  3L70 H;  5EIB C;  1XL6 A;  5GTH Z;  2JJ1 G;  2QGN A;  3IC7 A;  2M7W A;  1EZV H;  3RYC A;  4YY3 O;  1Z5W A;  3E35 A;  4KHP O;  5EK0 A;  3N2K B;  1YHQ V;  1JA8 A;  2IW5 A;  4NTW A;  3K0D A;  4WFH A;  4X66 O;  3CCU V;  2F4V B;  3LSQ A;  1VQN V;  3K9S A;  4JI4 O;  1IUR A;  1L8D A;  3ZRW A;  4W4K A;  2Y69 B;  3CCL V;  5CA3 A;  5K1P A;  3OUS A;  1XNR B;  2YEV B;  4X1Y B;  1X59 A;  3HKD B;  4LF7 O;  5CB4 A;  1WLE A;  2YIB D;  1DTO A;  4I50 A;  2EIL B;  4PA4 A;  5CN0 A;  1F4N A;  4JAS A;  2X6A A;  5EYP B;  3CC2 V;  5KA5 A;  1SQF A;  3UT5 A;  4IHJ A;  4YIO A;  4NXM O;  4ABM A;  4JYA B;  4X65 B;  3FX7 A;  3L73 H;  1H2G A;  2QWR B;  3D36 A;  1NKD A;  1KEC A;  2QWN B;  4ZOL A;  5B1O A;  2Z3Y A;  1P4R A;  3FB7 C;  3JD0 A;  1SET A;  3VBB A;  4R7C A;  1HNX O;  4QNH B;  1SQV H;  4DR5 B;  2Y4T A;  4B7K A;  5C8Y B;  4JYY A;  5B5E Z;  1HW7 A;  2YIA A;  4DR7 B;  3X2Q C;  1V55 B;  1YTF B;  2A3Q A;  1US6 A;  3OM3 B;  2L6L A;  3ZMZ A;  1Y76 B;  2IBZ H;  3OEE G;  4IGG A;  3MHS C;  1KMI Z;  2X0L A;  4DV0 B;  3GWO A;  2UXB O;  3RT3 C;  1ZL8 B;  3OR7 C;  3LNN A;  2E3C A;  1K5S A;  2ZNI A;  3B4S A;  3D36 C;  3ABU A;  2JGU A;  3STL C;  3CRC A;  4RO2 A;  2JEU A;  1A32 A;  2CDY A;  4JI5 O;  3JCU Z;  3ETQ A;  2YDE A;  3RN4 A;  1ARO P;  4DV3 B;  2BCC H;  4CH5 A;  1KUQ A;  5CA1 A;  3OTO B;  5KLV H;  1L1F A;  2H8P C;  2Q8V A;  2YI9 A;  4K3A A;  2GTS A;  2PZS A;  1TUB A;  1GAX A;  4WBN B;  4E2L A;  4MS2 A;  4LF8 O;  3LSS A;  5EBL C;  4C7U A;  4TUY A;  4JI2 O;  2WLL B;  1KBH A;  2F95 B;  3CC4 V;  1KB9 F;  4LC1 A;  1ZAU A;  4DRX A;  3SPH A;  4LF6 B;  2NN4 A;  4GUN A;  3G6E V;  3IFX A;  1D5N A;  3JYC A;  1GO3 F;  4NB5 A;  3ZMT A;  2Q67 A;  2F23 A;  3DGE A;  3LDE A;  4N21 A;  2DN9 A;  5H6Q A;  1M56 C;  4X20 A;  3ZHV A;  1DF5 A;  3CSX A;  4DW0 A;  4LBE C;  4X9Q A;  3E22 B;  5LL6 Y;  2W0X A;  3E89 A;  4MTG A;  3F5T A;  4FFB A;  4HAM A;  3APQ A;  2ARH A;  4RQF A;  5LMN O;  1S77 D;  3BRC A;  2DE0 X;  2NR5 A;  1ORQ C;  5B3S C;  5F2V O;  3CX5 F;  2JVD A;  2WLN A;  1SQG A;  1E1R G;  3SYC A;  2PUS A;  1D5A A;  2BTQ B;  4CC5 A;  4LH6 A;  3BEH A;  3JAT B;  3NR7 A;  4GX0 A;  3UO2 A;  1SC5 B;  1BQZ A;  1R6T A;  1XIL A;  2UUB B;  2Q7G A;  1KC8 W;  3K06 A;  1M93 A;  2XTA A;  2F43 G;  3C3T A;  4PA9 A;  5IYZ A;  4CBC A;  4R6Z A;  1NZ6 A;  5BR8 B;  4JZG A;  2CTW A;  1GM7 A;  3ASN B;  5ITZ A;  1FXV A;  4FLY A;  1IXM A;  3K79 A;  3TJT A;  2P90 A;  3KG2 A;  4B3R B;  2ZM6 O;  4O4L A;  4B3T O;  1HR0 B;  1FAF A;  5GW7 A;  3LDD A;  1KU9 A;  4UV9 A;  3BA9 A;  3P30 A;  1SZX A;  2F1M A;  3LUT B;  2JJ2 G;  2JGD A;  1NU1 H;  2UXC B;  3H1I H;  2F66 C;  4HYO A;  4LFA O;  2KB1 A;  2BSK A;  4IYI A;  4YJ2 B;  4O4J B;  5FNV B;  4RUE A;  4EKW A;  2GTA A;  5JVD B;  3ZRX A;  1J5E B;  3HKE A;  5IT9 N;  2IU0 A;  5LA6 B;  3OR6 C;  1XNQ O;  1S5L Z;  2BE3 A;  5HFM A;  1EZJ A;  4LFB B;  4RQE A;  3OAA G;  3CE2 A;  2OTL V;  4DV4 B;  4LP8 A;  3P3N A;  4DV2 O;  4JF3 A;  1M57 B;  2WWW A;  3RGB A;  2KQX A;  1R6N A;  4DW1 A;  3K58 A;  2ADP A;  3ZMS A;  1GK9 A;  2QTS A;  1OCC B;  3K04 A;  1K92 A;  4PA6 A;  1EBO A;  1I08 A;  3K57 A;  3UO3 A;  1G6U A;  2QTO A;  2ZNJ A;  3HR0 A;  5JJN B;  4NTY A;  5FPR A;  4X88 A;  3IC9 A;  3AEI A;  3H1J H;  3JAM N;  5H5N A;  3CRR A;  5CBH A;  4AI8 A;  2GUZ B;  4X1K B;  4X62 B;  2JS3 A;  1K34 A;  5B66 Z;  4LR3 A;  4NKG B;  4FLV A;  5B1B C;  4U3J B;  1LR1 A;  3W7X A;  4D7T A;  2VQF B;  1Y74 B;  3JAS A;  2UXB B;  3ABM C;  3KCY A;  4DK1 A;  5L3C A;  4JYA O;  4X65 O;  4FLX A;  2DQ3 A;  4UCT A;  4I55 B;  1Q86 W;  1UFI A;  3BHP A;  5LOV A;  5GON B;  5D5P A;  2YC0 A;  4FM0 A;  1K8A W;  3JAK B;  4P9P A;  1PL0 A;  2JDI G;  2VS0 A;  3DC6 A;  1VF6 A;  1QLE C;  3CYO A;  1OCO C;  1RSO B;  5DED A;  5FPO A;  4DR5 O;  1XI1 A;  3L74 H;  5J2U A;  2HP8 A;  3RW0 A;  4DR7 O;  1JOY A;  1VQL V;  3WFV A;  2NLJ C;  4UCR A;  2HJF C;  3ABK C;  3BPZ A;  3ZIA G;  4MVQ A;  2DJV A;  4MW8 A;  1Q90 D;  5KX5 A;  2B9Z A;  3TXQ A;  4DV0 O;  4I0X A;  3J80 N;  3AG2 C;  4WF9 V;  4X1I B;  3SYP A;  4DR1 B;  3JAW A;  1AIL A;  2YIB A;  3E86 A;  4IYH A;  4I50 B;  2KG7 B;  2QM8 A;  3CRM A;  2RMK B;  2OCH A;  3Q4H B;  1G8M A;  3TXS A;  3LSU A;  1DF4 A;  5IY5 C;  2WLJ A;  3ABT A;  3K5O A;  3DXR A;  1LUW A;  4DV3 O;  4I7Z B;  1QR9 A;  2EZO A;  1WB7 A;  1P7G A;  3OTO O;  4D7S A;  5LMN B;  4DR4 B;  3GB7 C;  1YZB A;  1SQQ H;  1G4Y B;  4O4H A;  4O4I A;  4ZOL B;  4JI0 B;  4LWS A;  1K7D A;  2W6J G;  4TSF G;  2DOS A;  4PV1 B;  3ETE A;  4A5U B;  1XBL A;  2X6C A;  3LNM B;  4LF6 O;  1WN7 A;  4QE7 A;  3R66 A;  1K33 A;  4YXW G;  1LNQ A;  1D2D A;  1YTF D;  4P9O A;  3HKB B;  4YJ3 A;  1R1B A;  2P06 A;  4JTA B;  1TVK A;  3ZN1 A;  4LF4 B;  3ASO B;  4CH3 A;  3I5D A;  4BW9 A;  4O2A A;  3UCS C;  1FXK C;  2QKA A;  1AJQ A;  2Q7H A;  2HJD A;  1NTZ H;  1OHH G;  2PI5 A;  1M56 B;  3I55 V;  4MVZ A;  3T1H B;  3DC5 A;  4DV7 B;  3C3S A;  1NVP B;  2YXH A;  2AW9 A;  4EB6 A;  1N36 B;  2UUC B;  3W7W A;  1FYJ A;  4WFB V;  2Q68 A;  2Y0I A;  2Y48 A;  3D3Q A;  2ZM6 B;  3OMI B;  2ZE5 A;  2VQE B;  1PP9 H;  3QTC A;  3G67 A;  3CJH B;  1SER A;  2DYR C;  1NR1 A;  2ZR2 A;  3M8A A;  2Q0A A;  5B3S B;  1WP8 A;  4N23 A;  5EC2 C;  3VQW A;  4TUY B;  5LYJ A;  5EC1 C;  1VQ4 V;  1PNM A;  1JQ0 A;  3TGU H;  2V1D A;  2ZT9 B;  2UUB O;  1OZ0 A;  4TOI A;  1QHT A;  2XND G;  2QJ1 A;  4FMT A;  1URF A;  4BIZ A;  2IJI A;  1FS0 G;  2PYJ A;  5JWP A;  3SGI A;  3CCV V;  1HDJ A;  3JAR B;  1S3J A;  3SR2 C;  5BR8 O;  1MZE A;  1PL4 A;  2Q69 A;  3FB6 C;  4X20 B;  1OCR C;  5J2T B;  2YXL A;  3MAQ A;  4EEQ A;  2XOK G;  1WA8 A;  2BTO A;  1XQ8 A;  4TQF A;  2DYS C;  5JH7 B;  4MT8 A;  2WLM A;  1EN6 A;  4B3R O;  4JYC A;  1JCH A;  3WG7 B;  2XAS A;  1VQ9 V;  1HR0 O;  2WAM A;  4FFK A;  4JI7 B;  4FFB B;  3WU2 Z;  2MK3 A;  5LHH A;  3RYF A;  5IJ9 A;  2X6B A;  1QNM A;  1MZF A;  2HEP A;  2CH7 B;  1AP5 A;  5H2F Z;  4WFE A;  2UXC O;  2A79 B;  1CPY A;  2HG5 C;  1Y66 A;  1Q7Y W;  1AJN A;  1WPX A;  5IDJ A;  2RJZ A;  1E79 G;  2P67 A;  3FB5 C;  4CC6 A;  1N8R W;  1FJG B;  3CWB H;  2YID A;  4UFZ A;  3RYI A;  5L3E A;  1FFT B;  2K1E A;  1J5E O;  4CS4 A;  3C90 A;  4LFB O;  4J10 A;  2LJ2 A;  2AZ0 A;  1KKC A;  3ETD A;  4HNA A;  1WP7 A;  1NR7 A;  2UXD B;  4GKK B;  4DV4 O;  3B8N A;  4CH6 A;  2JS5 A;  1R3L C;  5FL7 G;  3A0H Z;  4AHC A;  3N27 A;  4UV8 A;  1V54 C;  4CS3 A;  1M5I A;  3BAB A;  5LMU B;  4XBF A;  2R9R B;  2ZE6 A;  1ZWI C;  4NTX A;  4O4L B;  1V9P A;  1NQT A;  4LF9 B;  4ICG A;  5B1N A;  4W4L A;  1M9N A;  3OMN B;  2FB5 A;  2D2C B;  3CD6 V;  3CB2 A;  3JD4 A;  4X62 O;  2JGD B;  1GMG A;  4KP4 A;  3EVK A;  1COW G;  1BT8 A;  1BHA A;  2CAZ C;  4PDR A;  3IAY A;  4UXN A;  2VQF O;  3BVO A;  4PI0 A;  4H33 A;  1WPB A;  3HKE B;  4R50 A;  3SDL A;  1VQ7 V;  3SJC C;  1IBM B;  4BW5 A;  1X4T A;  5IYB O;  1P84 F;  5B1B B;  4ZIB A;  1SS3 A;  2Z0A A;  1W0K G;  3ABM B;  1N32 B;  1NT2 B;  2ZDI A;  3T1Y B;  1QBZ A;  1BQ0 A;  1TAE A;  3KCX A;  4K8Z A;  2XHB A;  3M7M X;  3SPC A;  4EFB A;  4YHH B;  4G27 B;  3RVY A;  2EIJ C;  4PDL A;  1K5Q A;  1PNK A;  2C2A A;  1AR1 B;  4GT1 A;  1QLE B;  1NTM H;  1OCO B;  2QSA A;  1WJZ A;  3P32 A;  5EIB D;  3ZBH A;  1UJW B;  3RYH A;  1F51 A;  3DTU B;  4PI2 A;  3AK3 A;  1FD9 A;  1ZLZ A;  4RAI A;  4J7Z A;  3ASO C;  2RDC A;  4DV5 B;  5IYC O;  3G4S V;  4DR1 O;  1EN4 A;  1MSD A;  4XDJ A;  3ABK B;  4I9W A;  1NH2 B;  1GN2 A;  2ZXW C;  2OIG A;  2UXX A;  5EBW C;  2QR4 A;  3AG2 B;  3JAS B;  1H8H G;  2AGA A;  2M6Y A;  1Y6X A;  2EIK B;  1Q8I A;  1BE3 H;  4B7E A;  2Y4U A;  4G2K A;  1LUV A;  4DR4 O;  3CXC U;  1N34 O;  4KFM A;  2LGW A;  2G38 A;  3E8G A;  2KKW A;  1CP9 A;  5IY5 B;  1DGS A;  4JI0 O;  1N33 B;  1YVW A;  2ZE7 A;  4ZHQ A;  3GWK C;  4UVA A;  3CCR V;  5J2U B;  2HHH B;  3O65 A;  3JSL A;  4JAU A;  3T4Z A;  2ITC C;  1RP3 B;  3JCZ A;  5L3D A;  3TET A;  2A06 H; 
#chains in the Genus database with same CATH homology
 4MVS A;  4XDK A;  3CCE V;  1BHB A;  3MHH C;  3ABM C;  3K0G A;  1SES A;  5LGU A;  3ABL B;  5L3C A;  1R6K A;  2QA4 V;  3CCQ V;  1K4C C;  2DQ3 A;  3FKS G;  4WFF A;  5IYD O;  1Q86 W;  1PD3 A;  1K73 W;  4U7O A;  1K8A W;  3STZ C;  3JD3 A;  3WG7 C;  2YEV A;  2D3O W;  4LCU C;  4P9P A;  1PL0 A;  2JDI G;  4MVO A;  4U7N A;  3AG4 C;  1QLE C;  3CYO A;  1OCO C;  3PJS K;  3CME V;  2ITD C;  2OTJ V;  4G28 B;  4TT3 G;  3T2M A;  5LHI A;  1KP2 A;  1THZ A;  1YJW V;  4X8A A;  3QO8 A;  5CBF A;  1AI5 A;  2Z5U A;  1EFR G;  5DN6 G;  4GCZ A;  1FXK B;  3RW0 A;  4FPP A;  1I5Y A;  4UVC A;  1JOY A;  3FYI B;  1VQL V;  1TUE B;  2DQ0 A;  3WFV A;  3E8H A;  2NLJ C;  2JIZ G;  4QPK A;  2HJF C;  3ABK C;  3ZN0 A;  3ZIA G;  5B1A C;  4MVQ A;  3R65 A;  3SPJ A;  2QEX V;  4MW8 A;  3FB8 C;  1M57 C;  3OW2 U;  4QJF B;  1M90 W;  5CMU A;  2OCC B;  1MSW D;  1GM9 A;  4GX5 A;  3RBZ A;  3AG2 C;  4WF9 V;  3H01 A;  5KA6 A;  4P30 A;  3SYP A;  2NNU A;  1OCC C;  2DYR B;  3F7Y C;  3CC7 V;  3LDC A;  3ML0 A;  1PNL A;  1AI7 A;  3E86 A;  1OCZ B;  4DO2 A;  1Q81 W;  2QM8 A;  4UVB A;  1K97 A;  1JX9 A;  3AG1 C;  2A0L A;  1KP3 A;  3I56 V;  1XL6 A;  3EFF K;  3W7S A;  1G8M A;  2JJ1 G;  2HFE C;  2JEX A;  3IC7 A;  1DF4 A;  2M7W A;  3OE7 G;  5IY5 C;  4FIP C;  2WLJ A;  3ABT A;  5J9P C;  5L3B A;  1K4D C;  2XAF A;  1K9M W;  3E35 A;  1W0J G;  4P2Z A;  1QR9 A;  4JAV A;  5EK0 A;  1YHQ V;  2EZO A;  2WPD G;  3OFN G;  4MVU A;  2IW5 A;  3K0D A;  4WFH A;  4WFG A;  3OMA B;  3GB7 C;  3CCU V;  3LSQ A;  1PKX A;  5KUK A;  5LGT A;  1G4Y B;  4JGS A;  1YJN V;  1E1Q G;  1VQN V;  1KKD A;  1VQM V;  5EBM C;  2W6I G;  2ZDI C;  3ZRW A;  2Y69 B;  1GTO A;  1OCR B;  2EIN B;  3CCL V;  1S72 V;  2FTK A;  1K7D A;  2W6J G;  4TSF G;  5CA3 A;  1NVP D;  2Q6A A;  3OUS A;  4WCE V;  2HKO A;  3NXS A;  1R3I C;  2DYS B;  3ABL C;  2YEV B;  3ETE A;  2X6C A;  3LNM B;  4QE7 A;  4MVR A;  2EIM B;  1FXH A;  1M1K W;  1WLE A;  3UKM A;  1DTO A;  2EZP A;  1K33 A;  4YXW G;  1LNQ A;  2EIL B;  3FYE B;  4PA4 A;  3TCU A;  1YTF D;  5CN0 A;  1F4N A;  3UM7 A;  4P9O A;  1RPR A;  3CPW U;  1W2B U;  4JAS A;  4JYB A;  1VQK V;  2X6A A;  3CC2 V;  5KA5 A;  2H94 A;  4PEL A;  5H9C A;  3E2E A;  4JTA B;  2LFR A;  3ZN1 A;  2QM7 A;  3ASO B;  1QR8 A;  1H2G A;  2WLH A;  1FXK C;  2V7Q G;  3D36 A;  1AJP A;  1AJQ A;  1NKD A;  3SYQ A;  2PI5 A;  1OHH G;  3RVZ A;  1KEC A;  2HVK C;  4J9Y B;  5B1O A;  2Z3Y A;  3G71 V;  1P4R A;  1M56 B;  3I55 V;  1H38 A;  4MVZ A;  3FB7 C;  3JD0 A;  1SET A;  3VBB A;  4R7C A;  1NVP B;  2CK3 G;  4PA3 A;  3TK1 A;  1GKF A;  4QNH B;  4MTF A;  2OCC C;  1RM1 B;  3W7W A;  4WFB V;  2BOC C;  2Q68 A;  3E8B A;  2Y48 A;  3OEH G;  1S5H C;  5H6R A;  5LBQ A;  3OMI B;  3X2Q C;  3SYA A;  1V55 B;  1YTF B;  4L87 A;  3OM3 B;  1SER A;  2DYR C;  1S76 D;  1R73 A;  3ZMZ A;  1NR1 A;  3ZCC A;  1J95 A;  1OCZ C;  2ZR2 A;  3OEE G;  5B3S B;  3MHS C;  2X0L A;  3AG3 B;  4N23 A;  5EC2 C;  1V54 B;  4JTD B;  3CMA V;  5EC1 C;  1VQ4 V;  2PI4 A;  2W0F C;  1PNM A;  1JQ0 A;  2ZR3 A;  2V1D A;  2B1I A;  3GWO A;  1OZ0 A;  5LGN A;  4QPJ A;  3CP1 A;  4GX2 A;  2XND G;  2QE7 G;  3OR7 C;  2DW4 A;  4FMT A;  4BIZ A;  2IJI A;  1FS0 G;  1K5S A;  5DM6 V;  2X7R B;  5E1A C;  3ZRW B;  1JVM A;  3ABU A;  3CCV V;  1H8E G;  3STL C;  4KUM A;  4DXW A;  4RO2 A;  3JD2 A;  1S3J A;  2JEU A;  2EIK C;  2Q69 A;  3FB6 C;  2Y69 C;  1OCR C;  2EIN C;  4MW3 A;  3VOU A;  3ZMV A;  1ARO P;  4WFA V;  2XOK G;  4OXS A;  1YIT V;  2ATK C;  3BY6 A;  4XDL A;  2JK5 C;  2DYS C;  2A9H A;  4MVM A;  4MT8 A;  1L1F A;  2H8P C;  2WLM A;  3ZMU A;  3W7U A;  4JYC A;  1JCH A;  3WG7 B;  2WLI B;  1AI6 A;  2XAS A;  1VQ9 V;  2WAM A;  2EIL C;  4E2L A;  4MS2 A;  3LSS A;  2MK3 A;  5EBL C;  5LHH A;  2WSS G;  3ETG A;  2GHY A;  2WLL B;  2X6B A;  1SZT A;  4QE9 A;  1KQS U;  1F4M A;  3CC4 V;  4LC1 A;  5KUM A;  1HWY A;  4WFE A;  3SPH A;  1QLN A;  2A79 B;  3CCM V;  3G6E V;  1CPY A;  2HG5 C;  1Y66 A;  1Q7Y W;  4FK5 C;  1AJN A;  3IFX A;  3JYC A;  1WPX A;  5IDJ A;  5HFL A;  1E79 G;  2P67 A;  3FB5 C;  1GO3 F;  1N8R W;  1QVF U;  3ZMT A;  5L3E A;  2Q67 A;  3DGE A;  3E83 A;  3W7T A;  3LDE A;  4N21 A;  1FFT B;  2QKS A;  2K1E A;  5H6Q A;  4BAY A;  5B1A B;  1M56 C;  3OGC C;  1DF5 A;  4Q20 A;  4LBE C;  1VQ6 V;  2EIJ B;  1RM1 C;  3E89 A;  4MTG A;  1BL8 A;  3ETD A;  4F4L A;  1QCE A;  1NR7 A;  2IU3 A;  2WLI A;  2XAH A;  1V55 C;  4HAM A;  3B8N A;  1K3E A;  3ZJZ A;  1R3L C;  4RQF A;  1S77 D;  5FL7 G;  5C93 A;  2WLL A;  1VQ5 V;  2GSM B;  1ORQ C;  3F5W C;  5B3S C;  3K03 A;  3SJQ C;  3AG3 C;  4UV8 A;  1V54 C;  2WLN A;  4PA7 A;  4XBF A;  4HZ3 A;  3QO7 A;  1E1R G;  1YJ9 V;  3SYC A;  2R9R B;  3B77 A;  2ZXW B;  3BEH A;  1ZWI C;  3MD0 A;  2IJH A;  1ROP A;  4GX0 A;  3K08 A;  1NQT A;  1SRY A;  5B1N A;  1M9N A;  3OMN B;  1BMF G;  2P6J A;  1S0V A;  2XAQ A;  4MTO A;  3CD6 V;  1KC8 W;  3B8M A;  3JD4 A;  3K06 A;  5L3F A;  1GMG A;  4KP4 A;  1COW G;  3D3I A;  4H37 A;  2F43 G;  4QIW F;  4PA9 A;  1QVG U;  1BHA A;  3EHB B;  1Y4M A;  4PDR A;  2ZD9 A;  4CBC A;  3T4D A;  4R6Z A;  4I5S A;  4UXN A;  2LP7 A;  1GM8 A;  4BIU A;  4H33 A;  1KD1 W;  4R50 A;  2LFS A;  1R3K C;  1Q82 W;  2DWE C;  3F7V C;  1VQ7 V;  1GM7 A;  3ASN B;  1P7B A;  1R3J C;  3QNE A;  1YI2 V;  4BW5 A;  1FXV A;  5IYB O;  1IXM A;  3K79 A;  1XL4 A;  2P90 A;  2ZQM A;  1MG1 A;  3KG2 A;  4ZBM A;  5B1B B;  2IJK A;  1CEZ A;  1W0K G;  2HR3 A;  2IH1 C;  5L3G A;  3SPI A;  4JPR A;  1NH2 D;  5GW7 A;  3LDD A;  4ZKI A;  3ABM B;  4ASU G;  2YSU B;  2ZDI A;  4UV9 A;  3P30 A;  1QBZ A;  2R9I A;  3ZRV A;  4UUJ C;  2UXN A;  3LUT B;  2HVJ C;  3JD1 A;  2JJ2 G;  2EIM C;  3SPC A;  2AHY A;  4R8C A;  4G27 B;  3RVY A;  2EIJ C;  2EBO A;  4PDL A;  1K5Q A;  1PNK A;  4HYO A;  4PDV A;  2KB1 A;  2C2A A;  5BZB A;  1MOF A;  1AR1 B;  4GT1 A;  3X2Q B;  3AG4 B;  1QLE B;  2IJJ A;  2BOB C;  2XAG A;  1OCO B;  4RUE A;  4EKW A;  2B1G A;  3P32 A;  4TWK A;  3IGA C;  4JTC B;  1YSC A;  1UJW B;  1F51 A;  3M99 B;  3HB3 B;  3DTU B;  1ENV A;  3ZRX A;  1VQ8 V;  4RAI A;  2P7T C;  2IU0 A;  3OR6 C;  4MSW C;  3ASO C;  5HFM A;  1JPX A;  1EZJ A;  4PDM A;  5IYC O;  4Z1M G;  3G4S V;  3SPG A;  4RQE A;  2OT5 A;  3OAA G;  3T1C A;  4XDJ A;  1FXK A;  1B6Q A;  3ABK B;  2OTL V;  4LP8 A;  2EJR A;  4I9W A;  1NH2 B;  3HPL C;  4JF3 A;  1M57 B;  5LHG A;  4CZZ A;  2WWW A;  4J9Z B;  2ZXW C;  1DLB A;  2UXX A;  1R6N A;  5EBW C;  4FJC C;  1RPO A;  3AG2 B;  1H8H G;  3ZMS A;  1NBM G;  1GK9 A;  2EIK B;  1F23 A;  2DWD C;  1OCC B;  3K04 A;  1K92 A;  3CCJ V;  2IH3 C;  3E8F A;  3SYO A;  1VQO V;  1I5X A;  4G2K A;  4PA6 A;  3K9A A;  3CCS V;  1EBO A;  4X89 A;  3AG1 B;  1MAB G;  3CXC U;  2QTO A;  3ZRS A;  1AI4 A;  4KFM A;  5CBG A;  4X88 A;  3E8G A;  3QO5 A;  4RUF A;  1CP9 A;  5IY5 B;  3AEI A;  4MTX A;  5CBH A;  2XAJ A;  3K3W A;  1YIJ V;  1NJI W;  4UVA A;  3CCR V;  1JJ2 U;  1VQP V;  2B5U A;  3ASN C;  4JAU A;  3T4Z A;  2ITC C;  1K34 A;  2AHZ A;  3JCZ A;  5L3D A;  3TET A;  4GX1 A;  5B1B C;  2WLK A;  3A0R A;  3OUF A;  3W7X A;  2HLD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...