2LP7A

Structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
b'GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 11
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lp7A00
1F23A 3MHSC 3CYOA 1DLBA 5HFLA 4FK5C 5HFMA 4G2KA 5KA6A 4FIPC 1JQ0A 1EBOA 1QR8A 1MOFA 3B8MA 3B8NA 1DF4A 1Y4MA 4JF3A 4N21A 2P6JA 3M99B 5H9CA 2EZPA 1QR9A 2LP7A 3WFVA 1K34A 1DF5A 4E2LA 2EBOA 2X7RB 4N23A 1SZTA 1QCEA 5CN0A 3CP1A 2OT5A 3GWOA 1I5XA 4JGSA 3P30A 4FJCC 3K9AA 1ENVA 5KA5A 1I5YA 1QBZA 2EZOA 2M7WA 3B77A 2MK3A 4JPRA 5CMUA 3MHHC 1MG1A 3H01A 1Y66A 1K33A 1JPXA
chains in the Genus database with same CATH superfamily
1Y67A 3BHPA 4W4KA 3OMNB 4LF5O 2CH7A 3SYQA 3ZRSA 1UJWB 4ZOLB 3A0BZ 2K1EA 4I55B 4FFBA 1Q8IA 4DR7B 1S77D 3SGIA 3SYOA 1ENVA 3L70H 1IBMB 2Y0IA 3HKEA 5KX5A 4P30A 1G1XB 1K3EA 5KUMA 1K33A 3M7MX 4HZ3A 1NTKH 1DLBA 1M4UA 4KP4A 2BTOA 2CE4A 2CTQA 4LP8A 4FM0A 2JEXA 4NXMO 3ZHTA 3K3WA 1B3QA 1NQTA 1MSDA 1AP5A 1WPBA 1CXZB 1K73W 4JI2O 1Z5VA 2YSUB 1IZ3A 2QDOA 5C93A 5LA6B 1L0LH 3S3WA 1BE3H 2W6IG 1N36B 3M99B 3CCUV 3FB5C 2ZXWC 1S5LZ 3C3SA 1FD9A 1SZTA 1AILA 3OR6C 1EZJA 1JJOA 5B1AB 3L71H 3AG3C 1R3JC 5B1BC 5EC2C 2A3QA 4PDLA 3HPLC 2LO1A 4H33A 3WB0A 1Q5OA 1JPXA 3ZN0A 4CS3A 3VQYA 3SDLA 2BE3A 5JJJB 2F1MA 4LR3A 3CCQV 4CS2A 2GDSA 3BFRA 3X2QC 3WB2A 4KUMA 1SQBH 4B7EA 4DR6O 1SQVH 4H0LB 4TV8B 1CPYA 5D5PA 4FM2A 2YS8A 4DV2O 1COWG 1SF9A 1F7YA 1PL0A 2IH1C 5IY5B 4MVOA 2DWEC 3DC5A 1V55C 1PM9A 2YI8A 5LMNO 3J7AU 2B1IA 2EIKB 4XDKA 4X62O 3BA9A 4KXRA 4UCUA 2LW7A 1I7FA 3F5WC 1YIJV 2MW2B 4IGGA 4YJ2B 4JI7O 4X66B 3ZJZA 3JASB 2BCCH 2BSKA 1I94B 1V9PA 4P9OA 1AI7A 3HKEB 1PL4A 5BZBA 1KKCA 3G67A 1P4RA 4YHHB 3P32A 1IXBA 3TXSA 4FM1A 1H8EG 2XASA 2UUCO 4IIJB 1EN6A 2ZE6A 2HHHB 3N2GA 4TT3G 4NB5A 1YXBA 1WPXA 1AVMA 3UO3A 2UU9B 1EZVH 2ZM6B 2JS3A 4I50B 5K1PA 1JR9A 1TA8A 4OX9B 1HR0B 1IXMA 1PKXA 1VQLV 1PNMA 2UXNA 5J9PC 1Y76B 4CBCA 3B40A 4D7TA 4DV3B 1NR1A 1RP3B 1BGYH 1AROP 1NH2D 4CC6A 3Q4HB 4JPRA 4DXWA 3K04A 4X1IA 3E8BA 4IYHA 4HNAA 3CJHA 4EFBA 4PA6A 2B1GA 4O2AB 1HNWO 5J2TB 1KP2A 4UB8Z 4ZBMA 4GZRB 3CP1A 3JALB 1F4NA 4RQFA 5LGUA 1R3LC 3W7UA 4EEQA 1Q6HA 1N34B 1BZKA 2ZIOA 1ZL8B 3N27A 4TV9A 2GSMB 2ZIMA 3R65A 4IT5A 2CUGA 3ZMZA 2QKSA 1MOFA 2R72A 3OE7G 1XQ8A 2JJ1G 2AZ2A 5GONB 1OCCB 5B1AC 3B4SA 2QM4A 4FFKA 4B3MB 2DYSB 2ARHA 4ASUG 2IJHA 1WJZA 2XAQA 2PI4A 1GKFA 1NJIW 1VQKV 1YSCA 3AK2A 2F43G 5DN6G 1KC8W 4MS2A 4FLWA 3U10A 2ZE7A 4PI0A 2WLIA 3FFQA 1Q7YW 3D36A 4DRXA 5GTHZ 1YTFB 2RJZA 2AHZA 5IYZB 5JVDB 3SJAC 4NXNO 2RNBA 5E79Z 4DV0O 3ZMUA 1W2BU 2RQ6A 3QO8A 3BPZA 4ABMA 1SKVA 4UCOA 5IDJA 3E35A 1NKDA 3N2KB 1YDXA 1WB8A 2HVJC 4D7SA 4CZZA 3ABLB 1XMOO 2D3OW 4A5UB 3OAAG 4IHJB 2LGQA 4UVAA 4B7KA 3NR7A 5KAIZ 4CH6A 1H38A 3T1CA 4WBNA 3DGEA 2W6JG 4X1YB 4U7OA 4J9YB 1TUBB 5LMNB 3JARA 3J81N 1JA8A 3E86A 1HNZO 2L6LA 1NVPD 2RDCA 4TUYB 5EK0A 3CS5A 4JI7B 3D3QA 4UVCA 3OUSA 1E1QG 2EILB 2VWJA 4PA7A 4G28B 2Z5UA 4UV9A 2IM9A 3RYIA 5KHJA 1SQPH 3DXRA 3BAAA 5K1XA 3SYAA 2PF4E 1YJNV 4JI1B 5BY1A 4TWKA 3SPJA 3P3PA 3M8AA 3E8FA 5B5EZ 3BRCA 1D2DA 3E2EA 1QR9A 5LYJA 2X6AA 1EN4A 1MSWD 5J2UA 4GX0A 5IT9N 3FB6C 2Q0AA 1PNLA 1HW7A 4J41A 2Q5ZA 1D5AA 3IFXA 4X64O 4JYAB 1TVKB 4FLVA 1KKDA 2WPDG 4OXSA 3H01A 3K9SA 2Y48A 3AG4B 2PTMA 1I0HA 3OM3B 3I56V 1KMIZ 4JF3A 1VQ9V 4XBFA 5JH7A 4DUZO 5IJ0B 2QGNA 1OCCC 5LMUB 1QQCA 4BIUA 2GHYA 2JVDA 3I5DA 2DYSC 2OTLV 2GUZB 3EXAA 4TQFA 1Q90D 5FNVB 3CC7V 4JTDB 1XL6A 4ZKIA 1OCOB 2R9RB 2P06A 2XOKG 4U7NA 3MD0A 1WNSA 2Y4UA 3L75H 3O65A 5FLXN 2X0LA 1P7BA 2LGWA 4JTCB 4ZHQA 4LF4O 4PA9A 4DUYO 1BCCH 3K9AA 2CDYA 4B3RO 1N33B 4X20B 1XHXA 4MVZA 3VQVA 2Z0AA 3T4ZA 3W7SA 1H2NA 4JI0B 2A79B 4X8AA 3QG5A 4MT8A 1URFA 2LFSA 2XAGA 1SQQH 4QE7A 4ZI7B 3CWBH 4BIOA 3ABLC 4K0KO 3UT5B 2QTOA 4DK0A 2M7WA 1GH6A 2EZOA 4RUEA 4DR5O 2BTQA 4UUJC 4NR1A 5B3SB 1N4CA 1FKAO 3ETGA 5LHIA 1N0JA 4DV0B 4YY3O 3C90A 4PDRA 5EC1C 1NS1A 3K5LA 4B3TO 1YVWA 3THOA 3T1YB 1VQ8V 2OWOA 4CH4A 3JD4A 3JSNA 3ZEDA 2ZXWB 1VQ7V 2OT5A 2HG5C 3TETA 5J2UB 1R6KA 1SQGA 4I4TB 3JCUZ 1Q6UA 4DYLA 4GKJB 1R6TA 3U0ZA 2EILC 2OIGA 3SJBC 3ZHSA 3QVNA 4MVSA 1AI5A 1K34A 3RYFB 4O4LA 2JGDA 2Y69B 5L3BA 5CA0A 4K8XA 4DR3O 1V54C 2HJDA 4LF6O 4UCRA 1RPOA 3A0RA 2QR4A 1VIBA 2GTAA 4JI6O 4PDMA 1L0NH 2VS0A 4H13B 1VQ6V 1XNQO 4L87A 2FMLA 3ETEA 5BR8B 1K5QA 2WLJA 4LNUB 3CC2V 3AG4C 3UM7A 1WB7A 1XOUA 5LHHA 1WA8A 5B66Z 2B5UA 3D36C 4X89A 1OCRC 5L3FA 3HKCA 4X64B 4Z2WA 1H2LA 3HKBB 2QKCA 1PNKA 1M57B 3JATA 2WLKA 4I0XB 5CMUA 4BW9A 4JV5O 2QSAA 1GRJA 2NN4A 1Q43A 3RN4A 1NR7A 1OCOC 2M6YA 1R73A 1QLEB 2PYJA 3B8NA 1OHHG 5CA1B 3LDCA 4O4JA 1RSOB 2JEUA 5CBFA 1ORQC 1P84F 1Q81W 1YJ9V 1N8RW 4X9QA 4DR2B 1YTFD 2JRIA 1GO3F 2WLNA 3NXSA 3ZRWA 4R7CA 1Q3EA 3L74H 3E22A 2YIBD 4UVBA 5LOVA 2PUSA 3CB2A 1XNRO 2WLMA 4MVRA 2Y4TA 5L3CA 2V1DA 3R66A 5CB4A 3KCYA 4DUYB 1KYOF 2XNDG 3AK3A 3CE2A 3BY6A 5B3SC 1Q86W 1IVSA 2ZD9A 3RVYA 3SJQC 2RMKB 2H3OA 3T1HB 2P4VA 5HFLA 1N32O 5DEDA 2QWRB 4J7KA 2R70A 1LNQA 5H9CA 1GM8A 4DR4O 2ZCEA 2YUAA 5JQGB 2AGAA 4LFAB 3K0GA 2BOBC 4O4HA 1VF5B 2CK3G 3KG2A 3B77A 3JAKB 2A9HA 2QM8A 1QLNA 2YIDA 3CCLV 4UV8A 4R6ZA 1VQ4V 2NNUA 3T2MA 4B3TB 3OUFA 2EIMB 4DV6O 3H1HH 1VARA 5ITZA 4I7ZB 2Z3YA 2XAFA 5EYPB 2DYRB 1RFYA 1NU1H 2ZR3A 2X7RB 4LF9B 2E75B 1PV0A 2Y69C 4P2ZA 4X88A 2Q4PA 5C8YA 4JI8O 2AW9A 1SA0A 4UXNA 1Y66A 1TAEA 1FJGB 3JD2A 4J42A 3BA8A 5AG2A 3K03A 2DE0X 1JCHA 1FYJA 1BHBA 2UUAB 1MZEA 5IYCO 4LWSA 4FLZA 1EN5A 3BEHA 2QWPB 5LL6Y 4DR3B 2CH7B 1KU9A 2ITDC 1GN2A 3OTOO 2QE7G 4GKKB 1IBKO 1LR1A 1M9NA 3ABTA 1Q82W 4JYCA 4ZIBA 4I9WA 4FFBB 4JI6B 4BAYA 3CEIA 2H94A 3ICXA 3K08A 2A06H 3ZN1A 3CCEV 4TQDA 5EBWC 5KX5B 2EX3A 4JI5O 1FFXA 3UKMA 2N05A 3JAWA 5IWAB 3E22B 2UXCO 1M57C 3SPCA 5KUKA 3CHXA 5TISZ 3APQA 1XMQB 1VF6A 1YHQV 4DV5O 1QLEC 1JQ0A 2DW4A 4O4IA 1NBMG 2QWQB 3K59A 1Y6XA 3K5MA 4JZGA 1T5EA 3CCMV 4DW1A 4LF8O 1QVFU 2IJIA 1M90W 3CRAA 1FS0G 1GN3A 1TGOA 1AP6A 3OFNG 4JI3B 2KG7A 4YIPA 4LF5B 1J95A 2E74B 3HR0A 1Y74A 1AJPA 3EFFK 5H5NA 3ZHQA 1I08A 2ZKOA 1A32A 1JFFA 1KP3A 2QEXV 1I5XA 2IH3C 2AXTZ 4CS4A 4FJCC 4CH5A 4JI4O 2HLDG 3LNNA 1I5YA 4PV1B 4LFBO 5KHKA 3K0DA 5JCOA 3B2EE 4OPAA 5FPOA 4I5SA 4X1KA 3G71V 3K5OA 3CCJV 4NXMB 2EZPA 4WFGA 2YXLA 3OTFA 1GK9A 3RYHA 1XI1A 5EZYA 4UB6Z 3ETQA 3CRMA 4JI2B 3SYCA 4MVQA 1VMGA 1AJNA 2NLJC 4H44B 4LH7A 2EIMC 1VF7A 1X59A 4QPKA 5CA3A 2EINB 3QF7A 1XEQA 2DYRC 3TXQA 2YIAA 3AG1B 3K06A 3WFVA 4JYYA 1AJQA 5LP6A 2P90A 4FPPA 2BSKB 1IBLO 3A2FA 1R6NA 2VWKA 5H6RA 1TUEB 2ITCC 3OEHG 4DV6B 1ZTEA 3E89A 3AK1A 4K8ZA 3N2GB 4DR6B 1BS3A 3F5TA 2OCHA 4HAMA 4JI8B 2F93B 3FYEB 1MG1A 2Q69A 2A0LA 2WLLA 5FPRA 4DV2B 3ABMC 1ZSPA 1JMKC 5GW7A 1YF2A 1IURA 5DM6V 2VQFO 3G6BA 2UXBO 5IYBO 1LUVA 4X1IB 3SJCC 2F4VO 2HR3A 4HNAB 1FXKA 3OTOB 2EIJB 3CJHB 4X62B 5JJNB 1AI4A 1QNMA 5A2QN 2Q0OC 3O9OA 4EB6A 3CYOA 3FB8C 5IJ9A 4PA3A 4JI5B 3JSLA 3TK1A 4TV9B 4RUFA 3EVKA 3CRCA 2QWOB 1V54B 1DGSA 2UUCB 2W0FC 5KAFZ 2FL4A 3RYHB 3JAMN 1M1KW 2EJ7A 3ZHUA 2UUBO 2V7QG 3D3IA 4DV7O 4WFFA 2NR5A 3VQWA 5L3GA 2XT9A 3CCSV 3HKDA 5BXZA 4D6TH 3MHHC 3CPWU 3OGCC 4NTXA 2WLIB 4UCSA 4G2KA 1S72V 1PD3A 2PI5A 2Q8VA 1BQ0A 4DV4O 1W0KG 3OMAB 3AG7A 4DRXB 4AQYO 1HNWB 2ZDIA 1OCRB 3J80N 2JS5A 4RQEA 5BMVA 2JJ2G 2UXDO 4JI4B 1HWYA 4WFEA 4R8CA 2ILMA 1WLEA 2V4DA 1YITV 2WWWA 2GV9A 4KHPO 1X4TA 5KHGA 3RWRD 2EINC 1THZA 3AG1C 2KB1A 4O2BA 4WBNB 1JOYA 4P9PA 4JAAA 4W4LA 1IBMO 1NTMH 2IJJA 1EFRG 4GX1A 2LJ2A 3JARB 4ICGA 3L9DA 4WF9V 1M56B 3KZIZ 1O9GA 1B06A 1YI2V 2P7TC 4FLYA 5KHIA 4YJ3A 1H2SB 3BVOA 1VF6C 1E1RG 3IC7A 2O57A 5A9GA 1MA1A 2JIZG 2P67A 2QJ1A 2BOCC 4F6RA 4U3JA 4PJ0Z 3RYIB 3H9VA 1ROPA 3QNEA 4AHCA 1QBZA 2FYUH 5KMGA 2EJRA 1NH2B 4OGQB 3DXRB 4YIOA 4NXNB 1VQPV 4KL1A 2YDEA 2ZINA 4GUNA 2YEVA 3IAYA 2IBZH 2EBOA 3FX7A 4B3SO 1H2MA 5LYJB 2EIJC 4NKGB 1J5EO 3ZIAG 2WLHA 1XMOB 2MK3A 1OJHA 4ZOLA 5DECA 1VP7A 4I55A 4MW8A 1S5JA 1XREA 2UXBB 2XAHA 1VQ5V 1S0VA 2QKAA 3FB7C 2ZR2A 1HNZB 3CXCU 2R9IA 4MTGA 3SPGA 1FXVA 1U97A 2HP8A 5JH7B 3STZC 4HBNA 2CTWA 3L73H 3LUTB 2HEPA 5L3EA 2LP7A 5F2VO 1GN4A 4UCVA 4BIZA 2HKOA 4GT1A 1IDSA 2CGOA 3E83A 3DSQA 1RPRA 2LW1A 3UQ8A 3JD3A 5LA6A 4CC5A 1KUQA 2QA4V 4JAUA 1LUWA 3RFRA 2N74A 4X66O 1BQZA 4ZHQB 3SPHA 4UCTA 1JJ2U 1GM7A 3QO5A 4MVUA 1I94O 1BMFG 4QNHB 4EKWA 4YHHO 4B08A 1SRYA 4PELA 4IL6Z 5FL7G 4MTXA 1SC5B 2HHHO 1MMMA 4LC1A 2ZM6O 3AG2B 2R9AA 4GX2A 3PN1A 5KMGB 2PY5A 4OX9O 4TV8A 1HR0O 1SS3A 1GM9A 4N21A 2BTQB 4DUZB 3C3TA 2XTAA 2UXDB 4JGSA 3ZMTA 4DV3O 1F4MA 2P4KA 3H1LH 1ZAUA 1NVPB 2KKWA 4KHPB 1MNGA 4I9QA 1M56C 2X6BA 2JK5C 1K4CC 2Q68A 5CBHA 4GX5A 5KHHA 4YXWG 1DF4A 2DMXA 3CSXA 4YJ2A 3JCZA 1FPOA 2Q7HA 4LF4B 1HP8A 3JASA 2DWDC 1FFTB 3TJTA 1VQMV 4X65O 1KQSU 4B3RB 1GN6A 1N34O 2HJFC 2VQEO 4O4LB 2YI9A 3CXHF 4FLXA 1K4DC 2JGDB 5CA0B 1QR8A 1Y4MA 4IIJA 3UCSC 1M5IA 4J7ZA 3GWOA 1O9HA 3STLC 4I50A 4FVMA 4B3MO 1JVMA 4K0KB 1BT8A 4PHZA 1IX9A 4DR5B 1H8HG 4R50A 5LHGA 1UPGA 1XHZA 4YY3B 3GWKC 4HYOA 2OTJV 4OPHA 1QU7A 1WP7A 1Y76A 2YXYA 4NYKA 5CBGA 3Q4HA 1HNXO 2YC0A 3ZHVA 1K8AW 1HDJA 4B3SB 1OCZB 3ZS8C 1VQNV 1WA8B 2ATKC 1J5EB 1AR4A 2DQ3A 4Q6GA 2ZDIC 3ZX6A 3JD1A 4O2AA 2AZ0A 5J2TA 3HKCB 2A7WA 1SESA 4PI2A 1B04A 3JALA 4BR6A 4PDVA 2WA3A 1CEZA 3JATB 2VRZA 1ZUQA 3RVZA 3HB3B 1Q6IA 1ZL8A 2DQ0A 2G38A 3ZRXA 2OYQA 3ZCCA 1XL4A 4LF7O 3LDDA 4J7JA 1S76D 4O4JB 4LF6B 3FD9A 1OZ0A 4QJFB 5GONA 3KCXA 3CRRA 4NTWA 1AI6A 3ABMB 3OT7A 5H2FZ 2UXXA 3GVMA 1G4YB 4GCZA 3ZRWB 5B1NA 1XNQB 1E79G 5LOVB 4DW0A 5IE9A 5CB4B 2ZE8A 5D5QA 1KECA 5B1OA 1PP9H 4JASA 3AG2C 4KFMA 1NZ6A 3WU2Z 3TCUA 3A0HZ 3H1JH 3CMAV 1H2KA 3MDSA 3OEEG 5IYZA 5JVDA 2FB5A 4JI1O 1BSMA 3ZMVA 3DC6A 3IC9A 3W7XA 2YIBA 5KLVH 4JV5B 4JZ2A 2JGUA 5HFMA 1S5HC 4O4HB 2KQXA 4QIWF 3N2KA 1K92A 1M93A 2PYLA 4DR1O 3DTUB 1K7DA 1ZLZA 1F51A 1YZBA 3RYCA 1OV9A 4IYIA 4IHJA 1QVGU 2WAMA 3A8TA 4JYAO 4J80A 3RGBA 2YICA 5ITZB 4X1YA 4EFEA 1K5SA 1TUBA 2Q7GA 3L72H 1FXHA 2Q67A 4K35A 2ZQMA 1XNRB 5C8YB 4TUYA 5EIBC 1R3IC 4LFCO 4MSWC 1SA0B 3QTCA 4N23A 5E1AC 5LMUO 5H6QA 4X65B 4TOIA 4XDJA 5LBQA 2CTRA 3LNMB 4PD4F 1KD1W 1NI8A 2VQEB 4LWSB 2FKXA 1N32B 2E5LO 2OCCB 1US6A 3VBBA 1WN7A 2P22C 4G27B 4DR4B 1OCZC 4MTOA 2ZE5A 2CAZC 4C7UA 3F7YC 1XUQA 4RWUA 3CCVV 1N33O 2E76B 1FFXB 3JAWB 3FAVA 4FK5C 1TVKA 4DK1A 2ADQB 2EULA 3VOUA 4JI0O 1HNXB 1KBHA 4NVPA 3MAQA 3K57A 1FAFA 5LGNA 3FYIB 4QPJA 3W7WA 2QTSA 3RBZA 3LSUA 2LFRA 4O4IB 4K3AA 1AR1B 5IJ0A 1G8MA 1F23A 3PJSK 5IY5C 3RW0A 1SQFA 1UFIA 1AB3A 2D2CB 3T1YO 1D5NA 1QHTA 2GUZA 1XBLA 2HFEC 3SYPA 3LDEA 2KSDA 3CD6V 3ZBHA 2KG7B 5FNVA 3E8GA 4E2LA 5EBMC 1Z2GA 4LF7B 3ABUA 2EIKC 4WCEV 4MTFA 4DO2A 1WP8A 1CP9A 1Y74B 3ASNB 2PZSA 1IBKB 4GKJO 3RYCB 4DV1O 1JFFB 3E8HA 1SERA 1PPJH 1R3KC 4X20A 1XDCA 2UXCB 3U11A 3S3XA 2F66C 2W0XA 1G6UA 3ASOB 1P49A 1B6QA 2HVKC 4FLTA 4X1KB 2ZNIA 2CTPA 3ML0A 2IU3A 3KKYA 5EZYB 4PA4A 4ZI7A 4DV5B 4H37A 1EBOA 3UT5A 3OR7C 4LH6A 3ABKB 3ZHRA 4UFZA 3P3NA 4JTAB 3SPIA 2OIEA 2QM7A 4LF8B 3W7TA 5BR8O 1RM1B 1K97A 1Z5WA 3K58A 5LP6B 5LGTA 4LCUC 2K9PA 2B9ZA 3ETDA 1MABG 4DR1B 3H1KH 1P7GA 2ADPA 5EIBD 1BHAA 4I4TA 2L35A 3FAVB 4J11A 3CMEV 2H8PC 2ZNJA 3UO2A 3K5NA 4NTYA 3CC4V 1WAZA 3I55V 4LFBB 3RYFA 3G6EV 3MHSC 4BWAA 4F6EA 2OCCC 2Y0PA 2ETNA 5JJEB 4JAVA 1AR5A 4LFCB 1BL8A 3CX5F 3H1IH 3WB1A 5L3DA 1DF5A 5GTIZ 5CN0A 1N0NA 2DJVA 2QWNB 2WLLB 1MZFA 3WG7B 2Q9LA 1U96A 3CCRV 3D8CA 4DR2O 4DR7O 2ODMA 2F95B 2Q7EA 3OD4A 2ZT9B 2E5LB 1FXKB 3FKSG 5KA6A 1L1FA 3B8MA 2XUMA 4FZ0A 4Z1VA 4WFAV 2P6JA 4LNUA 5LXTA 1KB9F 4EB6B 4J10A 5IJ9B 1IBLB 2WA4A 3BABA 3QO7A 4FMTA 4BW5A 1W59A 3AEIA 3TGUH 4QGPA 3T1HO 2AHYA 2XAJA 3HKBA 1SZXA 4Q20A 3G4SV 4I0XA 4GLXA 2RN9A 2FTKA 2WSSG 1N36O 3IJ4A 4AI8A 1DK1A 1SETA 1H2GA 4LFAO 1DTOA 4RO2A 3ASNC 1W0JG 4TSFG 2IU0A 1EM1A 5CA1A 1RSOA 3BCCH 1ZX3A 4JYBA 1R1BA 3HKDB 2VQFB 4MVMA 1YEWA 4MW3A 4WFBV 3OW2U 2IW5A 2F4VB 2IJKA 2Q6AA 4LF9O 5JCOC 1JX9A 2CGNA 3RT3C 3ASOC 3OGIB 4WFHA 1SQXH 3AG3B 5B1BB 1GMGA 4DV1B 1FJGO 3APOA 3CRQA 5BMVB 1NTZH 4RAIA 2DN9A 4FIPC 1ZWIC 4CH3A 3ABKC 2E3CA 2XHBA 4FLUA 2UUAO 3ZMSA 2GBOA 3VQXA 5EBLC 1GAXA 3JYCA 3X2QB 2PGGA 3P30A 2LQTA 3LSQA 1YJWV 5JWPA 1RM1C 3IGAC 4J9ZB 3ZRVA 4GKKO 5LP6C 4L8JA 4Z1MG 4XDLA 2YXHA 1S3JA 5JQGA 4O2BB 2DOSA 2JDIG 3GB7C 4GYCB 1GTOA 3SR2C 4AILC 1K9MW 4U3FH 1XILA 3G80A 2UUBB 3T4DA 3JAKA 4DV7B 3JD0A 4F4LA 1QCEA 1V55B 1VQOV 5IWAO 1NT2B 1YCIA 5LXTB 4QE9A 5EYPA 4YJ3B 1XMQO 2UU9O 3K79A 4DV4B 4F6RB 4U3JB 4AQYB 2RCVA 4E4EA 3WG7C 2P5OA 2Q73A 3B09A 3LSSA 2N04A 3OMIB 5IYDO 3EHBB 5KA5A 1VEWA 4FZ1A 3F7VC 2YEVB 2GTSA 2C2AA 4LBEC 1L8DA 4JI3O 2F23A 2X6CA 1FXKC
chains in the Genus database with same CATH topology
2WLLA 1KECA 5B1OA 3OMNB 4JASA 3ABMC 3T4ZA 3AG2C 4KFMA 3SYQA 3W7SA 5GW7A 3TCUA 3ZRSA 2A79B 4X8AA 5DM6V 1UJWB 5IYBO 3CMAV 4MT8A 3OEEG 2LFSA 2XAGA 2HR3A 4QE7A 1FXKA 2K1EA 2EIJB 1S77D 1AI4A 3ABLC 3ZMVA 3SYOA 3W7XA 1ENVA 2QTOA 2M7WA 4RUEA 2EZOA 4UUJC 5B3SB 4P30A 1K3EA 3ETGA 5LHIA 5KUMA 1K33A 4PDRA 4HZ3A 3CYOA 1DLBA 4KP4A 5EC1C 5HFMA 1S5HC 3FB8C 4LP8A 4QIWF 1K92A 1VQ8V 3DTUB 1K7DA 2JEXA 3JD4A 4PA3A 3TK1A 1F51A 2ZXWB 1VQ7V 3K3WA 1QVGU 2WAMA 2OT5A 4RUFA 1NQTA 2HG5C 3TETA 1R6KA 1V54B 1K5SA 1K73W 2W0FC 1FXHA 2YSUB 1M1KW 2EILC 2Q67A 5C93A 2ZQMA 2V7QG 2W6IG 3D3IA 1R3IC 4MVSA 3M99B 3CCUV 3FB5C 2ZXWC 1AI5A 1K34A 4MSWC 4WFFA 4N23A 1SZTA 5E1AC 5H6QA 2Y69B 5L3BA 3OR6C 5L3GA 1EZJA 5B1AB 1V54C 4XDJA 3CCSV 5LBQA 3LNMB 3AG3C 1R3JC 5B1BC 5EC2C 1KD1W 4PDLA 3HPLC 3MHHC 3CPWU 3OGCC 1RPOA 3A0RA 4H33A 1JPXA 3ZN0A 2WLIB 4G2KA 1S72V 1PD3A 2OCCB 2PI5A 1W0KG 4PDMA 3OMAB 3VBBA 4G27B 2ZDIA 3CCQV 1OCRB 1OCZC 3X2QC 4RQEA 4KUMA 1VQ6V 4MTOA 4L87A 2JJ2G 3ETEA 1HWYA 3F7YC 4WFEA 4R8CA 1WLEA 3CCVV 1K5QA 1CPYA 2WLJA 3CC2V 3AG4C 2WWWA 1YITV 3UM7A 5LHHA 4FK5C 1COWG 3VOUA 2B5UA 1PL0A 2IH1C 2EINC 4X89A 5IY5B 1OCRC 1THZA 5L3FA 3AG1C 4MVOA 2DWEC 2KB1A 1V55C 5LGNA 3FYIB 1PNKA 1M57B 2B1IA 2EIKB 4QPJA 4XDKA 3W7WA 1JOYA 3RBZA 2LFRA 2WLKA 4P9PA 5CMUA 3F5WC 1YIJV 1AR1B 2IJJA 1EFRG 4GX1A 4WF9V 1G8MA 1F23A 1NR7A 1M56B 3ZJZA 3PJSK 5IY5C 1OCOC 3RW0A 1R73A 1QLEB 1YI2V 3B8NA 2P7TC 1OHHG 2HFEC 4P9OA 1AI7A 3SYPA 3LDCA 3LDEA 5BZBA 3CD6V 2JEUA 5CBFA 3E8GA 4E2LA 5EBMC 1E1RG 3ABUA 1P4RA 3IC7A 2EIKC 3P32A 1ORQC 4WCEV 2JIZG 2P67A 1Q81W 1YJ9V 4MTFA 1N8RW 2BOCC 4DO2A 1YTFD 1CP9A 1ROPA 3QNEA 1H8EG 2XASA 1QBZA 3ASNB 2EJRA 1NH2B 1GO3F 2WLNA 3NXSA 4TT3G 3ZRWA 1WPXA 1VQPV 4R7CA 3E8HA 4UVBA 1SERA 2WLMA 4MVRA 1R3KC 5L3CA 2V1DA 2YEVA 1IXMA 1PKXA 2EBOA 1VQLV 1PNMA 2EIJC 2UXNA 5J9PC 4CBCA 3ASOB 1NR1A 2XNDG 1B6QA 2HVKC 3BY6A 1AROP 2WLHA 3ZIAG 1NH2D 5B3SC 2MK3A 4JPRA 4DXWA 2ZD9A 1Q86W 3K04A 3RVYA 3SJQC 3E8BA 3ML0A 5HFLA 2IU3A 4PA4A 4H37A 1EBOA 4MW8A 1LNQA 4PA6A 2B1GA 2XAHA 3OR7C 5H9CA 1GM8A 3ABKB 1VQ5V 4JTAB 3SPIA 1KP2A 1S0VA 4ZBMA 3CP1A 3K0GA 1F4NA 2BOBC 3FB7C 2QM7A 2ZR2A 5LGUA 4RQFA 1R3LC 3CXCU 3W7TA 2R9IA 3W7UA 4MTGA 2CK3G 3KG2A 3B77A 1RM1B 3SPGA 1FXVA 2A9HA 2QM8A 1QLNA 1K97A 3CCLV 5LGTA 4UV8A 4R6ZA 1VQ4V 4LCUC 2NNUA 2GSMB 3R65A 3T2MA 3ETDA 1MABG 3OUFA 3STZC 3ZMZA 2EIMB 2QKSA 1MOFA 1BHAA 3LUTB 2Z3YA 2XAFA 3OE7G 5L3EA 2LP7A 2DYRB 2ZR3A 2X7RB 2JJ1G 2Y69C 4BIZA 1OCCB 2HKOA 4GT1A 4P2ZA 3E83A 5B1AC 2H8PC 3CMEV 4X88A 1RPRA 3JD3A 2DYSB 3CC4V 3I55V 2QA4V 4JAUA 4ASUG 2IJHA 4UXNA 1Y66A 3G6EV 3JD2A 3MHSC 2XAQA 3SPHA 2PI4A 1GKFA 2OCCC 3K03A 1NJIW 1VQKV 1YSCA 1JJ2U 4JAVA 1GM7A 3QO5A 2F43G 1BL8A 1JCHA 4MVUA 5DN6G 1BHBA 1KC8W 4MS2A 5IYCO 1BMFG 1DF5A 5L3DA 4QNHB 5CN0A 3BEHA 2WLLB 4EKWA 3WG7B 2WLIA 3CCRV 1Q7YW 2ITDC 2QE7G 1SRYA 4PELA 3D36A 5FL7G 4MTXA 1YTFB 1M9NA 2AHZA 3ABTA 1Q82W 4JYCA 1FXKB 4I9WA 4LC1A 3FKSG 5KA6A 3ZMUA 4BAYA 1W2BU 1L1FA 3AG2B 3B8MA 4GX2A 2H94A 3K08A 3QO8A 4WFAV 1GM9A 4N21A 2P6JA 3ZN1A 3CCEV 5EBWC 3UKMA 5IDJA 3E35A 1M57C 1NKDA 4JGSA 3ZMTA 3SPCA 1F4MA 2HVJC 4CZZA 3ABLB 5KUKA 3QO7A 1NVPB 2D3OW 4FMTA 4BW5A 3AEIA 3OAAG 1M56C 2X6BA 2AHYA 2XAJA 4UVAA 4Q20A 1YHQV 1QLEC 2JK5C 1K4CC 3T1CA 3G4SV 1JQ0A 2Q68A 3DGEA 5CBHA 1H38A 2W6JG 4GX5A 2DW4A 4YXWG 1DF4A 4U7OA 4J9YB 1NBMG 2FTKA 2WSSG 1SETA 1H2GA 3JCZA 3E86A 1DTOA 3CCMV 2DWDC 1FFTB 1QVFU 2IJIA 1VQMV 1M90W 1KQSU 4RO2A 1FS0G 1NVPD 3ASNC 1W0JG 4TSFG 5EK0A 2IU0A 2HJFC 3OFNG 4UVCA 4JYBA 3OUSA 1E1QG 2EILB 1K4DC 1J95A 4G28B 2Z5UA 4PA7A 4UV9A 1QR8A 1AJPA 1Y4MA 4MVMA 3EFFK 4MW3A 4WFBV 3OW2U 2IW5A 2IJKA 2Q6AA 1JX9A 3SYAA 1KP3A 2QEXV 3GWOA 3STLC 1I5XA 1YJNV 3ASOC 2IH3C 4TWKA 1JVMA 3SPJA 4FJCC 2HLDG 4WFHA 1I5YA 3AG3B 5B1BB 3E8FA 1GMGA 1H8HG 4R50A 5LHGA 3E2EA 1QR9A 3K0DA 4HYOA 2OTJV 2X6AA 4RAIA 4FIPC 1MSWD 5CBGA 1ZWIC 3ABKC 4GX0A 4I5SA 3G71V 3FB6C 3CCJV 1PNLA 2EZPA 4WFGA 3ZMSA 1K8AW 5EBLC 3JYCA 1OCZB 3X2QB 1GK9A 3IFXA 1VQNV 2ATKC 3P30A 3LSQA 1YJWV 2DQ3A 2ZDIC 1RM1C 3IGAC 3JD1A 4J9ZB 1KKDA 3ZRVA 3SYCA 2WPDG 4MVQA 4Z1MG 4OXSA 2Y48A 3AG4B 3H01A 1S3JA 4XDLA 1SESA 1AJNA 2JDIG 2NLJC 3GB7C 1GTOA 1K9MW 2EIMC 4PDVA 1CEZA 3T4DA 3OM3B 3I56V 4QPKA 5CA3A 3RVZA 2EINB 4JF3A 3HB3B 2DYRC 1VQ9V 4XBFA 2DQ0A 3AG1B 3JD0A 3K06A 3WFVA 3ZRXA 4F4LA 1AJQA 3ZCCA 1XL4A 2P90A 1QCEA 1V55B 1OCCC 1VQOV 3LDDA 4BIUA 4FPPA 2GHYA 1R6NA 2DYSC 2OTLV 1S76D 5H6RA 4QE9A 1TUEB 1OZ0A 4QJFB 3CC7V 2ITCC 3OEHG 4JTDB 1XL6A 4ZKIA 3K79A 3E89A 1OCOB 1AI6A 3ABMB 2R9RB 2XOKG 2UXXA 4U7NA 3MD0A 1G4YB 4GCZA 2X0LA 1P7BA 4JTCB 3ZRWB 3WG7C 5B1NA 4PA9A 1E79G 3LSSA 4HAMA 3OMIB 5IYDO 3K9AA 3EHBB 5KA5A 3F7VC 2YEVB 2C2AA 3FYEB 1MG1A 4LBEC 2X6CA 2Q69A 2A0LA 1FXKC 4MVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F23 A;  3MHS C;  3CYO A;  1DLB A;  5HFL A;  4FK5 C;  5HFM A;  4G2K A;  5KA6 A;  4FIP C;  1JQ0 A;  1EBO A;  1QR8 A;  1MOF A;  3B8M A;  3B8N A;  1DF4 A;  1Y4M A;  4JF3 A;  4N21 A;  2P6J A;  3M99 B;  5H9C A;  2EZP A;  1QR9 A;  2LP7 A;  3WFV A;  1K34 A;  1DF5 A;  4E2L A;  2EBO A;  2X7R B;  4N23 A;  1SZT A;  1QCE A;  5CN0 A;  3CP1 A;  2OT5 A;  3GWO A;  1I5X A;  4JGS A;  3P30 A;  4FJC C;  3K9A A;  1ENV A;  5KA5 A;  1I5Y A;  1QBZ A;  2EZO A;  2M7W A;  3B77 A;  2MK3 A;  4JPR A;  5CMU A;  3MHH C;  1MG1 A;  3H01 A;  1Y66 A;  1K33 A;  1JPX A; 
#chains in the Genus database with same CATH topology
 1Y67 A;  3BHP A;  4W4K A;  3OMN B;  4LF5 O;  2CH7 A;  3SYQ A;  3ZRS A;  1UJW B;  4ZOL B;  3A0B Z;  2K1E A;  4I55 B;  4FFB A;  1Q8I A;  4DR7 B;  1S77 D;  3SGI A;  3SYO A;  1ENV A;  3L70 H;  1IBM B;  2Y0I A;  3HKE A;  5KX5 A;  4P30 A;  1G1X B;  1K3E A;  5KUM A;  1K33 A;  3M7M X;  4HZ3 A;  1NTK H;  1DLB A;  1M4U A;  4KP4 A;  2BTO A;  2CE4 A;  2CTQ A;  4LP8 A;  4FM0 A;  2JEX A;  4NXM O;  3ZHT A;  3K3W A;  1B3Q A;  1NQT A;  1MSD A;  1AP5 A;  1WPB A;  1CXZ B;  1K73 W;  4JI2 O;  1Z5V A;  2YSU B;  1IZ3 A;  2QDO A;  5C93 A;  5LA6 B;  1L0L H;  3S3W A;  1BE3 H;  2W6I G;  1N36 B;  3M99 B;  3CCU V;  3FB5 C;  2ZXW C;  1S5L Z;  3C3S A;  1FD9 A;  1SZT A;  1AIL A;  3OR6 C;  1EZJ A;  1JJO A;  5B1A B;  3L71 H;  3AG3 C;  1R3J C;  5B1B C;  5EC2 C;  2A3Q A;  4PDL A;  3HPL C;  2LO1 A;  4H33 A;  3WB0 A;  1Q5O A;  1JPX A;  3ZN0 A;  4CS3 A;  3VQY A;  3SDL A;  2BE3 A;  5JJJ B;  2F1M A;  4LR3 A;  3CCQ V;  4CS2 A;  2GDS A;  3BFR A;  3X2Q C;  3WB2 A;  4KUM A;  1SQB H;  4B7E A;  4DR6 O;  1SQV H;  4H0L B;  4TV8 B;  1CPY A;  5D5P A;  4FM2 A;  2YS8 A;  4DV2 O;  1COW G;  1SF9 A;  1F7Y A;  1PL0 A;  2IH1 C;  5IY5 B;  4MVO A;  2DWE C;  3DC5 A;  1V55 C;  1PM9 A;  2YI8 A;  5LMN O;  3J7A U;  2B1I A;  2EIK B;  4XDK A;  4X62 O;  3BA9 A;  4KXR A;  4UCU A;  2LW7 A;  1I7F A;  3F5W C;  1YIJ V;  2MW2 B;  4IGG A;  4YJ2 B;  4JI7 O;  4X66 B;  3ZJZ A;  3JAS B;  2BCC H;  2BSK A;  1I94 B;  1V9P A;  4P9O A;  1AI7 A;  3HKE B;  1PL4 A;  5BZB A;  1KKC A;  3G67 A;  1P4R A;  4YHH B;  3P32 A;  1IXB A;  3TXS A;  4FM1 A;  1H8E G;  2XAS A;  2UUC O;  4IIJ B;  1EN6 A;  2ZE6 A;  2HHH B;  3N2G A;  4TT3 G;  4NB5 A;  1YXB A;  1WPX A;  1AVM A;  3UO3 A;  2UU9 B;  1EZV H;  2ZM6 B;  2JS3 A;  4I50 B;  5K1P A;  1JR9 A;  1TA8 A;  4OX9 B;  1HR0 B;  1IXM A;  1PKX A;  1VQL V;  1PNM A;  2UXN A;  5J9P C;  1Y76 B;  4CBC A;  3B40 A;  4D7T A;  4DV3 B;  1NR1 A;  1RP3 B;  1BGY H;  1ARO P;  1NH2 D;  4CC6 A;  3Q4H B;  4JPR A;  4DXW A;  3K04 A;  4X1I A;  3E8B A;  4IYH A;  4HNA A;  3CJH A;  4EFB A;  4PA6 A;  2B1G A;  4O2A B;  1HNW O;  5J2T B;  1KP2 A;  4UB8 Z;  4ZBM A;  4GZR B;  3CP1 A;  3JAL B;  1F4N A;  4RQF A;  5LGU A;  1R3L C;  3W7U A;  4EEQ A;  1Q6H A;  1N34 B;  1BZK A;  2ZIO A;  1ZL8 B;  3N27 A;  4TV9 A;  2GSM B;  2ZIM A;  3R65 A;  4IT5 A;  2CUG A;  3ZMZ A;  2QKS A;  1MOF A;  2R72 A;  3OE7 G;  1XQ8 A;  2JJ1 G;  2AZ2 A;  5GON B;  1OCC B;  5B1A C;  3B4S A;  2QM4 A;  4FFK A;  4B3M B;  2DYS B;  2ARH A;  4ASU G;  2IJH A;  1WJZ A;  2XAQ A;  2PI4 A;  1GKF A;  1NJI W;  1VQK V;  1YSC A;  3AK2 A;  2F43 G;  5DN6 G;  1KC8 W;  4MS2 A;  4FLW A;  3U10 A;  2ZE7 A;  4PI0 A;  2WLI A;  3FFQ A;  1Q7Y W;  3D36 A;  4DRX A;  5GTH Z;  1YTF B;  2RJZ A;  2AHZ A;  5IYZ B;  5JVD B;  3SJA C;  4NXN O;  2RNB A;  5E79 Z;  4DV0 O;  3ZMU A;  1W2B U;  2RQ6 A;  3QO8 A;  3BPZ A;  4ABM A;  1SKV A;  4UCO A;  5IDJ A;  3E35 A;  1NKD A;  3N2K B;  1YDX A;  1WB8 A;  2HVJ C;  4D7S A;  4CZZ A;  3ABL B;  1XMO O;  2D3O W;  4A5U B;  3OAA G;  4IHJ B;  2LGQ A;  4UVA A;  4B7K A;  3NR7 A;  5KAI Z;  4CH6 A;  1H38 A;  3T1C A;  4WBN A;  3DGE A;  2W6J G;  4X1Y B;  4U7O A;  4J9Y B;  1TUB B;  5LMN B;  3JAR A;  3J81 N;  1JA8 A;  3E86 A;  1HNZ O;  2L6L A;  1NVP D;  2RDC A;  4TUY B;  5EK0 A;  3CS5 A;  4JI7 B;  3D3Q A;  4UVC A;  3OUS A;  1E1Q G;  2EIL B;  2VWJ A;  4PA7 A;  4G28 B;  2Z5U A;  4UV9 A;  2IM9 A;  3RYI A;  5KHJ A;  1SQP H;  3DXR A;  3BAA A;  5K1X A;  3SYA A;  2PF4 E;  1YJN V;  4JI1 B;  5BY1 A;  4TWK A;  3SPJ A;  3P3P A;  3M8A A;  3E8F A;  5B5E Z;  3BRC A;  1D2D A;  3E2E A;  1QR9 A;  5LYJ A;  2X6A A;  1EN4 A;  1MSW D;  5J2U A;  4GX0 A;  5IT9 N;  3FB6 C;  2Q0A A;  1PNL A;  1HW7 A;  4J41 A;  2Q5Z A;  1D5A A;  3IFX A;  4X64 O;  4JYA B;  1TVK B;  4FLV A;  1KKD A;  2WPD G;  4OXS A;  3H01 A;  3K9S A;  2Y48 A;  3AG4 B;  2PTM A;  1I0H A;  3OM3 B;  3I56 V;  1KMI Z;  4JF3 A;  1VQ9 V;  4XBF A;  5JH7 A;  4DUZ O;  5IJ0 B;  2QGN A;  1OCC C;  5LMU B;  1QQC A;  4BIU A;  2GHY A;  2JVD A;  3I5D A;  2DYS C;  2OTL V;  2GUZ B;  3EXA A;  4TQF A;  1Q90 D;  5FNV B;  3CC7 V;  4JTD B;  1XL6 A;  4ZKI A;  1OCO B;  2R9R B;  2P06 A;  2XOK G;  4U7N A;  3MD0 A;  1WNS A;  2Y4U A;  3L75 H;  3O65 A;  5FLX N;  2X0L A;  1P7B A;  2LGW A;  4JTC B;  4ZHQ A;  4LF4 O;  4PA9 A;  4DUY O;  1BCC H;  3K9A A;  2CDY A;  4B3R O;  1N33 B;  4X20 B;  1XHX A;  4MVZ A;  3VQV A;  2Z0A A;  3T4Z A;  3W7S A;  1H2N A;  4JI0 B;  2A79 B;  4X8A A;  3QG5 A;  4MT8 A;  1URF A;  2LFS A;  2XAG A;  1SQQ H;  4QE7 A;  4ZI7 B;  3CWB H;  4BIO A;  3ABL C;  4K0K O;  3UT5 B;  2QTO A;  4DK0 A;  2M7W A;  1GH6 A;  2EZO A;  4RUE A;  4DR5 O;  2BTQ A;  4UUJ C;  4NR1 A;  5B3S B;  1N4C A;  1FKA O;  3ETG A;  5LHI A;  1N0J A;  4DV0 B;  4YY3 O;  3C90 A;  4PDR A;  5EC1 C;  1NS1 A;  3K5L A;  4B3T O;  1YVW A;  3THO A;  3T1Y B;  1VQ8 V;  2OWO A;  4CH4 A;  3JD4 A;  3JSN A;  3ZED A;  2ZXW B;  1VQ7 V;  2OT5 A;  2HG5 C;  3TET A;  5J2U B;  1R6K A;  1SQG A;  4I4T B;  3JCU Z;  1Q6U A;  4DYL A;  4GKJ B;  1R6T A;  3U0Z A;  2EIL C;  2OIG A;  3SJB C;  3ZHS A;  3QVN A;  4MVS A;  1AI5 A;  1K34 A;  3RYF B;  4O4L A;  2JGD A;  2Y69 B;  5L3B A;  5CA0 A;  4K8X A;  4DR3 O;  1V54 C;  2HJD A;  4LF6 O;  4UCR A;  1RPO A;  3A0R A;  2QR4 A;  1VIB A;  2GTA A;  4JI6 O;  4PDM A;  1L0N H;  2VS0 A;  4H13 B;  1VQ6 V;  1XNQ O;  4L87 A;  2FML A;  3ETE A;  5BR8 B;  1K5Q A;  2WLJ A;  4LNU B;  3CC2 V;  3AG4 C;  3UM7 A;  1WB7 A;  1XOU A;  5LHH A;  1WA8 A;  5B66 Z;  2B5U A;  3D36 C;  4X89 A;  1OCR C;  5L3F A;  3HKC A;  4X64 B;  4Z2W A;  1H2L A;  3HKB B;  2QKC A;  1PNK A;  1M57 B;  3JAT A;  2WLK A;  4I0X B;  5CMU A;  4BW9 A;  4JV5 O;  2QSA A;  1GRJ A;  2NN4 A;  1Q43 A;  3RN4 A;  1NR7 A;  1OCO C;  2M6Y A;  1R73 A;  1QLE B;  2PYJ A;  3B8N A;  1OHH G;  5CA1 B;  3LDC A;  4O4J A;  1RSO B;  2JEU A;  5CBF A;  1ORQ C;  1P84 F;  1Q81 W;  1YJ9 V;  1N8R W;  4X9Q A;  4DR2 B;  1YTF D;  2JRI A;  1GO3 F;  2WLN A;  3NXS A;  3ZRW A;  4R7C A;  1Q3E A;  3L74 H;  3E22 A;  2YIB D;  4UVB A;  5LOV A;  2PUS A;  3CB2 A;  1XNR O;  2WLM A;  4MVR A;  2Y4T A;  5L3C A;  2V1D A;  3R66 A;  5CB4 A;  3KCY A;  4DUY B;  1KYO F;  2XND G;  3AK3 A;  3CE2 A;  3BY6 A;  5B3S C;  1Q86 W;  1IVS A;  2ZD9 A;  3RVY A;  3SJQ C;  2RMK B;  2H3O A;  3T1H B;  2P4V A;  5HFL A;  1N32 O;  5DED A;  2QWR B;  4J7K A;  2R70 A;  1LNQ A;  5H9C A;  1GM8 A;  4DR4 O;  2ZCE A;  2YUA A;  5JQG B;  2AGA A;  4LFA B;  3K0G A;  2BOB C;  4O4H A;  1VF5 B;  2CK3 G;  3KG2 A;  3B77 A;  3JAK B;  2A9H A;  2QM8 A;  1QLN A;  2YID A;  3CCL V;  4UV8 A;  4R6Z A;  1VQ4 V;  2NNU A;  3T2M A;  4B3T B;  3OUF A;  2EIM B;  4DV6 O;  3H1H H;  1VAR A;  5ITZ A;  4I7Z B;  2Z3Y A;  2XAF A;  5EYP B;  2DYR B;  1RFY A;  1NU1 H;  2ZR3 A;  2X7R B;  4LF9 B;  2E75 B;  1PV0 A;  2Y69 C;  4P2Z A;  4X88 A;  2Q4P A;  5C8Y A;  4JI8 O;  2AW9 A;  1SA0 A;  4UXN A;  1Y66 A;  1TAE A;  1FJG B;  3JD2 A;  4J42 A;  3BA8 A;  5AG2 A;  3K03 A;  2DE0 X;  1JCH A;  1FYJ A;  1BHB A;  2UUA B;  1MZE A;  5IYC O;  4LWS A;  4FLZ A;  1EN5 A;  3BEH A;  2QWP B;  5LL6 Y;  4DR3 B;  2CH7 B;  1KU9 A;  2ITD C;  1GN2 A;  3OTO O;  2QE7 G;  4GKK B;  1IBK O;  1LR1 A;  1M9N A;  3ABT A;  1Q82 W;  4JYC A;  4ZIB A;  4I9W A;  4FFB B;  4JI6 B;  4BAY A;  3CEI A;  2H94 A;  3ICX A;  3K08 A;  2A06 H;  3ZN1 A;  3CCE V;  4TQD A;  5EBW C;  5KX5 B;  2EX3 A;  4JI5 O;  1FFX A;  3UKM A;  2N05 A;  3JAW A;  5IWA B;  3E22 B;  2UXC O;  1M57 C;  3SPC A;  5KUK A;  3CHX A;  5TIS Z;  3APQ A;  1XMQ B;  1VF6 A;  1YHQ V;  4DV5 O;  1QLE C;  1JQ0 A;  2DW4 A;  4O4I A;  1NBM G;  2QWQ B;  3K59 A;  1Y6X A;  3K5M A;  4JZG A;  1T5E A;  3CCM V;  4DW1 A;  4LF8 O;  1QVF U;  2IJI A;  1M90 W;  3CRA A;  1FS0 G;  1GN3 A;  1TGO A;  1AP6 A;  3OFN G;  4JI3 B;  2KG7 A;  4YIP A;  4LF5 B;  1J95 A;  2E74 B;  3HR0 A;  1Y74 A;  1AJP A;  3EFF K;  5H5N A;  3ZHQ A;  1I08 A;  2ZKO A;  1A32 A;  1JFF A;  1KP3 A;  2QEX V;  1I5X A;  2IH3 C;  2AXT Z;  4CS4 A;  4FJC C;  4CH5 A;  4JI4 O;  2HLD G;  3LNN A;  1I5Y A;  4PV1 B;  4LFB O;  5KHK A;  3K0D A;  5JCO A;  3B2E E;  4OPA A;  5FPO A;  4I5S A;  4X1K A;  3G71 V;  3K5O A;  3CCJ V;  4NXM B;  2EZP A;  4WFG A;  2YXL A;  3OTF A;  1GK9 A;  3RYH A;  1XI1 A;  5EZY A;  4UB6 Z;  3ETQ A;  3CRM A;  4JI2 B;  3SYC A;  4MVQ A;  1VMG A;  1AJN A;  2NLJ C;  4H44 B;  4LH7 A;  2EIM C;  1VF7 A;  1X59 A;  4QPK A;  5CA3 A;  2EIN B;  3QF7 A;  1XEQ A;  2DYR C;  3TXQ A;  2YIA A;  3AG1 B;  3K06 A;  3WFV A;  4JYY A;  1AJQ A;  5LP6 A;  2P90 A;  4FPP A;  2BSK B;  1IBL O;  3A2F A;  1R6N A;  2VWK A;  5H6R A;  1TUE B;  2ITC C;  3OEH G;  4DV6 B;  1ZTE A;  3E89 A;  3AK1 A;  4K8Z A;  3N2G B;  4DR6 B;  1BS3 A;  3F5T A;  2OCH A;  4HAM A;  4JI8 B;  2F93 B;  3FYE B;  1MG1 A;  2Q69 A;  2A0L A;  2WLL A;  5FPR A;  4DV2 B;  3ABM C;  1ZSP A;  1JMK C;  5GW7 A;  1YF2 A;  1IUR A;  5DM6 V;  2VQF O;  3G6B A;  2UXB O;  5IYB O;  1LUV A;  4X1I B;  3SJC C;  2F4V O;  2HR3 A;  4HNA B;  1FXK A;  3OTO B;  2EIJ B;  3CJH B;  4X62 B;  5JJN B;  1AI4 A;  1QNM A;  5A2Q N;  2Q0O C;  3O9O A;  4EB6 A;  3CYO A;  3FB8 C;  5IJ9 A;  4PA3 A;  4JI5 B;  3JSL A;  3TK1 A;  4TV9 B;  4RUF A;  3EVK A;  3CRC A;  2QWO B;  1V54 B;  1DGS A;  2UUC B;  2W0F C;  5KAF Z;  2FL4 A;  3RYH B;  3JAM N;  1M1K W;  2EJ7 A;  3ZHU A;  2UUB O;  2V7Q G;  3D3I A;  4DV7 O;  4WFF A;  2NR5 A;  3VQW A;  5L3G A;  2XT9 A;  3CCS V;  3HKD A;  5BXZ A;  4D6T H;  3MHH C;  3CPW U;  3OGC C;  4NTX A;  2WLI B;  4UCS A;  4G2K A;  1S72 V;  1PD3 A;  2PI5 A;  2Q8V A;  1BQ0 A;  4DV4 O;  1W0K G;  3OMA B;  3AG7 A;  4DRX B;  4AQY O;  1HNW B;  2ZDI A;  1OCR B;  3J80 N;  2JS5 A;  4RQE A;  5BMV A;  2JJ2 G;  2UXD O;  4JI4 B;  1HWY A;  4WFE A;  4R8C A;  2ILM A;  1WLE A;  2V4D A;  1YIT V;  2WWW A;  2GV9 A;  4KHP O;  1X4T A;  5KHG A;  3RWR D;  2EIN C;  1THZ A;  3AG1 C;  2KB1 A;  4O2B A;  4WBN B;  1JOY A;  4P9P A;  4JAA A;  4W4L A;  1IBM O;  1NTM H;  2IJJ A;  1EFR G;  4GX1 A;  2LJ2 A;  3JAR B;  4ICG A;  3L9D A;  4WF9 V;  1M56 B;  3KZI Z;  1O9G A;  1B06 A;  1YI2 V;  2P7T C;  4FLY A;  5KHI A;  4YJ3 A;  1H2S B;  3BVO A;  1VF6 C;  1E1R G;  3IC7 A;  2O57 A;  5A9G A;  1MA1 A;  2JIZ G;  2P67 A;  2QJ1 A;  2BOC C;  4F6R A;  4U3J A;  4PJ0 Z;  3RYI B;  3H9V A;  1ROP A;  3QNE A;  4AHC A;  1QBZ A;  2FYU H;  5KMG A;  2EJR A;  1NH2 B;  4OGQ B;  3DXR B;  4YIO A;  4NXN B;  1VQP V;  4KL1 A;  2YDE A;  2ZIN A;  4GUN A;  2YEV A;  3IAY A;  2IBZ H;  2EBO A;  3FX7 A;  4B3S O;  1H2M A;  5LYJ B;  2EIJ C;  4NKG B;  1J5E O;  3ZIA G;  2WLH A;  1XMO B;  2MK3 A;  1OJH A;  4ZOL A;  5DEC A;  1VP7 A;  4I55 A;  4MW8 A;  1S5J A;  1XRE A;  2UXB B;  2XAH A;  1VQ5 V;  1S0V A;  2QKA A;  3FB7 C;  2ZR2 A;  1HNZ B;  3CXC U;  2R9I A;  4MTG A;  3SPG A;  1FXV A;  1U97 A;  2HP8 A;  5JH7 B;  3STZ C;  4HBN A;  2CTW A;  3L73 H;  3LUT B;  2HEP A;  5L3E A;  2LP7 A;  5F2V O;  1GN4 A;  4UCV A;  4BIZ A;  2HKO A;  4GT1 A;  1IDS A;  2CGO A;  3E83 A;  3DSQ A;  1RPR A;  2LW1 A;  3UQ8 A;  3JD3 A;  5LA6 A;  4CC5 A;  1KUQ A;  2QA4 V;  4JAU A;  1LUW A;  3RFR A;  2N74 A;  4X66 O;  1BQZ A;  4ZHQ B;  3SPH A;  4UCT A;  1JJ2 U;  1GM7 A;  3QO5 A;  4MVU A;  1I94 O;  1BMF G;  4QNH B;  4EKW A;  4YHH O;  4B08 A;  1SRY A;  4PEL A;  4IL6 Z;  5FL7 G;  4MTX A;  1SC5 B;  2HHH O;  1MMM A;  4LC1 A;  2ZM6 O;  3AG2 B;  2R9A A;  4GX2 A;  3PN1 A;  5KMG B;  2PY5 A;  4OX9 O;  4TV8 A;  1HR0 O;  1SS3 A;  1GM9 A;  4N21 A;  2BTQ B;  4DUZ B;  3C3T A;  2XTA A;  2UXD B;  4JGS A;  3ZMT A;  4DV3 O;  1F4M A;  2P4K A;  3H1L H;  1ZAU A;  1NVP B;  2KKW A;  4KHP B;  1MNG A;  4I9Q A;  1M56 C;  2X6B A;  2JK5 C;  1K4C C;  2Q68 A;  5CBH A;  4GX5 A;  5KHH A;  4YXW G;  1DF4 A;  2DMX A;  3CSX A;  4YJ2 A;  3JCZ A;  1FPO A;  2Q7H A;  4LF4 B;  1HP8 A;  3JAS A;  2DWD C;  1FFT B;  3TJT A;  1VQM V;  4X65 O;  1KQS U;  4B3R B;  1GN6 A;  1N34 O;  2HJF C;  2VQE O;  4O4L B;  2YI9 A;  3CXH F;  4FLX A;  1K4D C;  2JGD B;  5CA0 B;  1QR8 A;  1Y4M A;  4IIJ A;  3UCS C;  1M5I A;  4J7Z A;  3GWO A;  1O9H A;  3STL C;  4I50 A;  4FVM A;  4B3M O;  1JVM A;  4K0K B;  1BT8 A;  4PHZ A;  1IX9 A;  4DR5 B;  1H8H G;  4R50 A;  5LHG A;  1UPG A;  1XHZ A;  4YY3 B;  3GWK C;  4HYO A;  2OTJ V;  4OPH A;  1QU7 A;  1WP7 A;  1Y76 A;  2YXY A;  4NYK A;  5CBG A;  3Q4H A;  1HNX O;  2YC0 A;  3ZHV A;  1K8A W;  1HDJ A;  4B3S B;  1OCZ B;  3ZS8 C;  1VQN V;  1WA8 B;  2ATK C;  1J5E B;  1AR4 A;  2DQ3 A;  4Q6G A;  2ZDI C;  3ZX6 A;  3JD1 A;  4O2A A;  2AZ0 A;  5J2T A;  3HKC B;  2A7W A;  1SES A;  4PI2 A;  1B04 A;  3JAL A;  4BR6 A;  4PDV A;  2WA3 A;  1CEZ A;  3JAT B;  2VRZ A;  1ZUQ A;  3RVZ A;  3HB3 B;  1Q6I A;  1ZL8 A;  2DQ0 A;  2G38 A;  3ZRX A;  2OYQ A;  3ZCC A;  1XL4 A;  4LF7 O;  3LDD A;  4J7J A;  1S76 D;  4O4J B;  4LF6 B;  3FD9 A;  1OZ0 A;  4QJF B;  5GON A;  3KCX A;  3CRR A;  4NTW A;  1AI6 A;  3ABM B;  3OT7 A;  5H2F Z;  2UXX A;  3GVM A;  1G4Y B;  4GCZ A;  3ZRW B;  5B1N A;  1XNQ B;  1E79 G;  5LOV B;  4DW0 A;  5IE9 A;  5CB4 B;  2ZE8 A;  5D5Q A;  1KEC A;  5B1O A;  1PP9 H;  4JAS A;  3AG2 C;  4KFM A;  1NZ6 A;  3WU2 Z;  3TCU A;  3A0H Z;  3H1J H;  3CMA V;  1H2K A;  3MDS A;  3OEE G;  5IYZ A;  5JVD A;  2FB5 A;  4JI1 O;  1BSM A;  3ZMV A;  3DC6 A;  3IC9 A;  3W7X A;  2YIB A;  5KLV H;  4JV5 B;  4JZ2 A;  2JGU A;  5HFM A;  1S5H C;  4O4H B;  2KQX A;  4QIW F;  3N2K A;  1K92 A;  1M93 A;  2PYL A;  4DR1 O;  3DTU B;  1K7D A;  1ZLZ A;  1F51 A;  1YZB A;  3RYC A;  1OV9 A;  4IYI A;  4IHJ A;  1QVG U;  2WAM A;  3A8T A;  4JYA O;  4J80 A;  3RGB A;  2YIC A;  5ITZ B;  4X1Y A;  4EFE A;  1K5S A;  1TUB A;  2Q7G A;  3L72 H;  1FXH A;  2Q67 A;  4K35 A;  2ZQM A;  1XNR B;  5C8Y B;  4TUY A;  5EIB C;  1R3I C;  4LFC O;  4MSW C;  1SA0 B;  3QTC A;  4N23 A;  5E1A C;  5LMU O;  5H6Q A;  4X65 B;  4TOI A;  4XDJ A;  5LBQ A;  2CTR A;  3LNM B;  4PD4 F;  1KD1 W;  1NI8 A;  2VQE B;  4LWS B;  2FKX A;  1N32 B;  2E5L O;  2OCC B;  1US6 A;  3VBB A;  1WN7 A;  2P22 C;  4G27 B;  4DR4 B;  1OCZ C;  4MTO A;  2ZE5 A;  2CAZ C;  4C7U A;  3F7Y C;  1XUQ A;  4RWU A;  3CCV V;  1N33 O;  2E76 B;  1FFX B;  3JAW B;  3FAV A;  4FK5 C;  1TVK A;  4DK1 A;  2ADQ B;  2EUL A;  3VOU A;  4JI0 O;  1HNX B;  1KBH A;  4NVP A;  3MAQ A;  3K57 A;  1FAF A;  5LGN A;  3FYI B;  4QPJ A;  3W7W A;  2QTS A;  3RBZ A;  3LSU A;  2LFR A;  4O4I B;  4K3A A;  1AR1 B;  5IJ0 A;  1G8M A;  1F23 A;  3PJS K;  5IY5 C;  3RW0 A;  1SQF A;  1UFI A;  1AB3 A;  2D2C B;  3T1Y O;  1D5N A;  1QHT A;  2GUZ A;  1XBL A;  2HFE C;  3SYP A;  3LDE A;  2KSD A;  3CD6 V;  3ZBH A;  2KG7 B;  5FNV A;  3E8G A;  4E2L A;  5EBM C;  1Z2G A;  4LF7 B;  3ABU A;  2EIK C;  4WCE V;  4MTF A;  4DO2 A;  1WP8 A;  1CP9 A;  1Y74 B;  3ASN B;  2PZS A;  1IBK B;  4GKJ O;  3RYC B;  4DV1 O;  1JFF B;  3E8H A;  1SER A;  1PPJ H;  1R3K C;  4X20 A;  1XDC A;  2UXC B;  3U11 A;  3S3X A;  2F66 C;  2W0X A;  1G6U A;  3ASO B;  1P49 A;  1B6Q A;  2HVK C;  4FLT A;  4X1K B;  2ZNI A;  2CTP A;  3ML0 A;  2IU3 A;  3KKY A;  5EZY B;  4PA4 A;  4ZI7 A;  4DV5 B;  4H37 A;  1EBO A;  3UT5 A;  3OR7 C;  4LH6 A;  3ABK B;  3ZHR A;  4UFZ A;  3P3N A;  4JTA B;  3SPI A;  2OIE A;  2QM7 A;  4LF8 B;  3W7T A;  5BR8 O;  1RM1 B;  1K97 A;  1Z5W A;  3K58 A;  5LP6 B;  5LGT A;  4LCU C;  2K9P A;  2B9Z A;  3ETD A;  1MAB G;  4DR1 B;  3H1K H;  1P7G A;  2ADP A;  5EIB D;  1BHA A;  4I4T A;  2L35 A;  3FAV B;  4J11 A;  3CME V;  2H8P C;  2ZNJ A;  3UO2 A;  3K5N A;  4NTY A;  3CC4 V;  1WAZ A;  3I55 V;  4LFB B;  3RYF A;  3G6E V;  3MHS C;  4BWA A;  4F6E A;  2OCC C;  2Y0P A;  2ETN A;  5JJE B;  4JAV A;  1AR5 A;  4LFC B;  1BL8 A;  3CX5 F;  3H1I H;  3WB1 A;  5L3D A;  1DF5 A;  5GTI Z;  5CN0 A;  1N0N A;  2DJV A;  2QWN B;  2WLL B;  1MZF A;  3WG7 B;  2Q9L A;  1U96 A;  3CCR V;  3D8C A;  4DR2 O;  4DR7 O;  2ODM A;  2F95 B;  2Q7E A;  3OD4 A;  2ZT9 B;  2E5L B;  1FXK B;  3FKS G;  5KA6 A;  1L1F A;  3B8M A;  2XUM A;  4FZ0 A;  4Z1V A;  4WFA V;  2P6J A;  4LNU A;  5LXT A;  1KB9 F;  4EB6 B;  4J10 A;  5IJ9 B;  1IBL B;  2WA4 A;  3BAB A;  3QO7 A;  4FMT A;  4BW5 A;  1W59 A;  3AEI A;  3TGU H;  4QGP A;  3T1H O;  2AHY A;  2XAJ A;  3HKB A;  1SZX A;  4Q20 A;  3G4S V;  4I0X A;  4GLX A;  2RN9 A;  2FTK A;  2WSS G;  1N36 O;  3IJ4 A;  4AI8 A;  1DK1 A;  1SET A;  1H2G A;  4LFA O;  1DTO A;  4RO2 A;  3ASN C;  1W0J G;  4TSF G;  2IU0 A;  1EM1 A;  5CA1 A;  1RSO A;  3BCC H;  1ZX3 A;  4JYB A;  1R1B A;  3HKD B;  2VQF B;  4MVM A;  1YEW A;  4MW3 A;  4WFB V;  3OW2 U;  2IW5 A;  2F4V B;  2IJK A;  2Q6A A;  4LF9 O;  5JCO C;  1JX9 A;  2CGN A;  3RT3 C;  3ASO C;  3OGI B;  4WFH A;  1SQX H;  3AG3 B;  5B1B B;  1GMG A;  4DV1 B;  1FJG O;  3APO A;  3CRQ A;  5BMV B;  1NTZ H;  4RAI A;  2DN9 A;  4FIP C;  1ZWI C;  4CH3 A;  3ABK C;  2E3C A;  2XHB A;  4FLU A;  2UUA O;  3ZMS A;  2GBO A;  3VQX A;  5EBL C;  1GAX A;  3JYC A;  3X2Q B;  2PGG A;  3P30 A;  2LQT A;  3LSQ A;  1YJW V;  5JWP A;  1RM1 C;  3IGA C;  4J9Z B;  3ZRV A;  4GKK O;  5LP6 C;  4L8J A;  4Z1M G;  4XDL A;  2YXH A;  1S3J A;  5JQG A;  4O2B B;  2DOS A;  2JDI G;  3GB7 C;  4GYC B;  1GTO A;  3SR2 C;  4AIL C;  1K9M W;  4U3F H;  1XIL A;  3G80 A;  2UUB B;  3T4D A;  3JAK A;  4DV7 B;  3JD0 A;  4F4L A;  1QCE A;  1V55 B;  1VQO V;  5IWA O;  1NT2 B;  1YCI A;  5LXT B;  4QE9 A;  5EYP A;  4YJ3 B;  1XMQ O;  2UU9 O;  3K79 A;  4DV4 B;  4F6R B;  4U3J B;  4AQY B;  2RCV A;  4E4E A;  3WG7 C;  2P5O A;  2Q73 A;  3B09 A;  3LSS A;  2N04 A;  3OMI B;  5IYD O;  3EHB B;  5KA5 A;  1VEW A;  4FZ1 A;  3F7V C;  2YEV B;  2GTS A;  2C2A A;  4LBE C;  1L8D A;  4JI3 O;  2F23 A;  2X6C A;  1FXK C; 
#chains in the Genus database with same CATH homology
 2WLL A;  1KEC A;  5B1O A;  3OMN B;  4JAS A;  3ABM C;  3T4Z A;  3AG2 C;  4KFM A;  3SYQ A;  3W7S A;  5GW7 A;  3TCU A;  3ZRS A;  2A79 B;  4X8A A;  5DM6 V;  1UJW B;  5IYB O;  3CMA V;  4MT8 A;  3OEE G;  2LFS A;  2XAG A;  2HR3 A;  4QE7 A;  1FXK A;  2K1E A;  2EIJ B;  1S77 D;  1AI4 A;  3ABL C;  3ZMV A;  3SYO A;  3W7X A;  1ENV A;  2QTO A;  2M7W A;  4RUE A;  2EZO A;  4UUJ C;  5B3S B;  4P30 A;  1K3E A;  3ETG A;  5LHI A;  5KUM A;  1K33 A;  4PDR A;  4HZ3 A;  3CYO A;  1DLB A;  4KP4 A;  5EC1 C;  5HFM A;  1S5H C;  3FB8 C;  4LP8 A;  4QIW F;  1K92 A;  1VQ8 V;  3DTU B;  1K7D A;  2JEX A;  3JD4 A;  4PA3 A;  3TK1 A;  1F51 A;  2ZXW B;  1VQ7 V;  3K3W A;  1QVG U;  2WAM A;  2OT5 A;  4RUF A;  1NQT A;  2HG5 C;  3TET A;  1R6K A;  1V54 B;  1K5S A;  1K73 W;  2W0F C;  1FXH A;  2YSU B;  1M1K W;  2EIL C;  2Q67 A;  5C93 A;  2ZQM A;  2V7Q G;  2W6I G;  3D3I A;  1R3I C;  4MVS A;  3M99 B;  3CCU V;  3FB5 C;  2ZXW C;  1AI5 A;  1K34 A;  4MSW C;  4WFF A;  4N23 A;  1SZT A;  5E1A C;  5H6Q A;  2Y69 B;  5L3B A;  3OR6 C;  5L3G A;  1EZJ A;  5B1A B;  1V54 C;  4XDJ A;  3CCS V;  5LBQ A;  3LNM B;  3AG3 C;  1R3J C;  5B1B C;  5EC2 C;  1KD1 W;  4PDL A;  3HPL C;  3MHH C;  3CPW U;  3OGC C;  1RPO A;  3A0R A;  4H33 A;  1JPX A;  3ZN0 A;  2WLI B;  4G2K A;  1S72 V;  1PD3 A;  2OCC B;  2PI5 A;  1W0K G;  4PDM A;  3OMA B;  3VBB A;  4G27 B;  2ZDI A;  3CCQ V;  1OCR B;  1OCZ C;  3X2Q C;  4RQE A;  4KUM A;  1VQ6 V;  4MTO A;  4L87 A;  2JJ2 G;  3ETE A;  1HWY A;  3F7Y C;  4WFE A;  4R8C A;  1WLE A;  3CCV V;  1K5Q A;  1CPY A;  2WLJ A;  3CC2 V;  3AG4 C;  2WWW A;  1YIT V;  3UM7 A;  5LHH A;  4FK5 C;  1COW G;  3VOU A;  2B5U A;  1PL0 A;  2IH1 C;  2EIN C;  4X89 A;  5IY5 B;  1OCR C;  1THZ A;  5L3F A;  3AG1 C;  4MVO A;  2DWE C;  2KB1 A;  1V55 C;  5LGN A;  3FYI B;  1PNK A;  1M57 B;  2B1I A;  2EIK B;  4QPJ A;  4XDK A;  3W7W A;  1JOY A;  3RBZ A;  2LFR A;  2WLK A;  4P9P A;  5CMU A;  3F5W C;  1YIJ V;  1AR1 B;  2IJJ A;  1EFR G;  4GX1 A;  4WF9 V;  1G8M A;  1F23 A;  1NR7 A;  1M56 B;  3ZJZ A;  3PJS K;  5IY5 C;  1OCO C;  3RW0 A;  1R73 A;  1QLE B;  1YI2 V;  3B8N A;  2P7T C;  1OHH G;  2HFE C;  4P9O A;  1AI7 A;  3SYP A;  3LDC A;  3LDE A;  5BZB A;  3CD6 V;  2JEU A;  5CBF A;  3E8G A;  4E2L A;  5EBM C;  1E1R G;  3ABU A;  1P4R A;  3IC7 A;  2EIK C;  3P32 A;  1ORQ C;  4WCE V;  2JIZ G;  2P67 A;  1Q81 W;  1YJ9 V;  4MTF A;  1N8R W;  2BOC C;  4DO2 A;  1YTF D;  1CP9 A;  1ROP A;  3QNE A;  1H8E G;  2XAS A;  1QBZ A;  3ASN B;  2EJR A;  1NH2 B;  1GO3 F;  2WLN A;  3NXS A;  4TT3 G;  3ZRW A;  1WPX A;  1VQP V;  4R7C A;  3E8H A;  4UVB A;  1SER A;  2WLM A;  4MVR A;  1R3K C;  5L3C A;  2V1D A;  2YEV A;  1IXM A;  1PKX A;  2EBO A;  1VQL V;  1PNM A;  2EIJ C;  2UXN A;  5J9P C;  4CBC A;  3ASO B;  1NR1 A;  2XND G;  1B6Q A;  2HVK C;  3BY6 A;  1ARO P;  2WLH A;  3ZIA G;  1NH2 D;  5B3S C;  2MK3 A;  4JPR A;  4DXW A;  2ZD9 A;  1Q86 W;  3K04 A;  3RVY A;  3SJQ C;  3E8B A;  3ML0 A;  5HFL A;  2IU3 A;  4PA4 A;  4H37 A;  1EBO A;  4MW8 A;  1LNQ A;  4PA6 A;  2B1G A;  2XAH A;  3OR7 C;  5H9C A;  1GM8 A;  3ABK B;  1VQ5 V;  4JTA B;  3SPI A;  1KP2 A;  1S0V A;  4ZBM A;  3CP1 A;  3K0G A;  1F4N A;  2BOB C;  3FB7 C;  2QM7 A;  2ZR2 A;  5LGU A;  4RQF A;  1R3L C;  3CXC U;  3W7T A;  2R9I A;  3W7U A;  4MTG A;  2CK3 G;  3KG2 A;  3B77 A;  1RM1 B;  3SPG A;  1FXV A;  2A9H A;  2QM8 A;  1QLN A;  1K97 A;  3CCL V;  5LGT A;  4UV8 A;  4R6Z A;  1VQ4 V;  4LCU C;  2NNU A;  2GSM B;  3R65 A;  3T2M A;  3ETD A;  1MAB G;  3OUF A;  3STZ C;  3ZMZ A;  2EIM B;  2QKS A;  1MOF A;  1BHA A;  3LUT B;  2Z3Y A;  2XAF A;  3OE7 G;  5L3E A;  2LP7 A;  2DYR B;  2ZR3 A;  2X7R B;  2JJ1 G;  2Y69 C;  4BIZ A;  1OCC B;  2HKO A;  4GT1 A;  4P2Z A;  3E83 A;  5B1A C;  2H8P C;  3CME V;  4X88 A;  1RPR A;  3JD3 A;  2DYS B;  3CC4 V;  3I55 V;  2QA4 V;  4JAU A;  4ASU G;  2IJH A;  4UXN A;  1Y66 A;  3G6E V;  3JD2 A;  3MHS C;  2XAQ A;  3SPH A;  2PI4 A;  1GKF A;  2OCC C;  3K03 A;  1NJI W;  1VQK V;  1YSC A;  1JJ2 U;  4JAV A;  1GM7 A;  3QO5 A;  2F43 G;  1BL8 A;  1JCH A;  4MVU A;  5DN6 G;  1BHB A;  1KC8 W;  4MS2 A;  5IYC O;  1BMF G;  1DF5 A;  5L3D A;  4QNH B;  5CN0 A;  3BEH A;  2WLL B;  4EKW A;  3WG7 B;  2WLI A;  3CCR V;  1Q7Y W;  2ITD C;  2QE7 G;  1SRY A;  4PEL A;  3D36 A;  5FL7 G;  4MTX A;  1YTF B;  1M9N A;  2AHZ A;  3ABT A;  1Q82 W;  4JYC A;  1FXK B;  4I9W A;  4LC1 A;  3FKS G;  5KA6 A;  3ZMU A;  4BAY A;  1W2B U;  1L1F A;  3AG2 B;  3B8M A;  4GX2 A;  2H94 A;  3K08 A;  3QO8 A;  4WFA V;  1GM9 A;  4N21 A;  2P6J A;  3ZN1 A;  3CCE V;  5EBW C;  3UKM A;  5IDJ A;  3E35 A;  1M57 C;  1NKD A;  4JGS A;  3ZMT A;  3SPC A;  1F4M A;  2HVJ C;  4CZZ A;  3ABL B;  5KUK A;  3QO7 A;  1NVP B;  2D3O W;  4FMT A;  4BW5 A;  3AEI A;  3OAA G;  1M56 C;  2X6B A;  2AHY A;  2XAJ A;  4UVA A;  4Q20 A;  1YHQ V;  1QLE C;  2JK5 C;  1K4C C;  3T1C A;  3G4S V;  1JQ0 A;  2Q68 A;  3DGE A;  5CBH A;  1H38 A;  2W6J G;  4GX5 A;  2DW4 A;  4YXW G;  1DF4 A;  4U7O A;  4J9Y B;  1NBM G;  2FTK A;  2WSS G;  1SET A;  1H2G A;  3JCZ A;  3E86 A;  1DTO A;  3CCM V;  2DWD C;  1FFT B;  1QVF U;  2IJI A;  1VQM V;  1M90 W;  1KQS U;  4RO2 A;  1FS0 G;  1NVP D;  3ASN C;  1W0J G;  4TSF G;  5EK0 A;  2IU0 A;  2HJF C;  3OFN G;  4UVC A;  4JYB A;  3OUS A;  1E1Q G;  2EIL B;  1K4D C;  1J95 A;  4G28 B;  2Z5U A;  4PA7 A;  4UV9 A;  1QR8 A;  1AJP A;  1Y4M A;  4MVM A;  3EFF K;  4MW3 A;  4WFB V;  3OW2 U;  2IW5 A;  2IJK A;  2Q6A A;  1JX9 A;  3SYA A;  1KP3 A;  2QEX V;  3GWO A;  3STL C;  1I5X A;  1YJN V;  3ASO C;  2IH3 C;  4TWK A;  1JVM A;  3SPJ A;  4FJC C;  2HLD G;  4WFH A;  1I5Y A;  3AG3 B;  5B1B B;  3E8F A;  1GMG A;  1H8H G;  4R50 A;  5LHG A;  3E2E A;  1QR9 A;  3K0D A;  4HYO A;  2OTJ V;  2X6A A;  4RAI A;  4FIP C;  1MSW D;  5CBG A;  1ZWI C;  3ABK C;  4GX0 A;  4I5S A;  3G71 V;  3FB6 C;  3CCJ V;  1PNL A;  2EZP A;  4WFG A;  3ZMS A;  1K8A W;  5EBL C;  3JYC A;  1OCZ B;  3X2Q B;  1GK9 A;  3IFX A;  1VQN V;  2ATK C;  3P30 A;  3LSQ A;  1YJW V;  2DQ3 A;  2ZDI C;  1RM1 C;  3IGA C;  3JD1 A;  4J9Z B;  1KKD A;  3ZRV A;  3SYC A;  2WPD G;  4MVQ A;  4Z1M G;  4OXS A;  2Y48 A;  3AG4 B;  3H01 A;  1S3J A;  4XDL A;  1SES A;  1AJN A;  2JDI G;  2NLJ C;  3GB7 C;  1GTO A;  1K9M W;  2EIM C;  4PDV A;  1CEZ A;  3T4D A;  3OM3 B;  3I56 V;  4QPK A;  5CA3 A;  3RVZ A;  2EIN B;  4JF3 A;  3HB3 B;  2DYR C;  1VQ9 V;  4XBF A;  2DQ0 A;  3AG1 B;  3JD0 A;  3K06 A;  3WFV A;  3ZRX A;  4F4L A;  1AJQ A;  3ZCC A;  1XL4 A;  2P90 A;  1QCE A;  1V55 B;  1OCC C;  1VQO V;  3LDD A;  4BIU A;  4FPP A;  2GHY A;  1R6N A;  2DYS C;  2OTL V;  1S76 D;  5H6R A;  4QE9 A;  1TUE B;  1OZ0 A;  4QJF B;  3CC7 V;  2ITC C;  3OEH G;  4JTD B;  1XL6 A;  4ZKI A;  3K79 A;  3E89 A;  1OCO B;  1AI6 A;  3ABM B;  2R9R B;  2XOK G;  2UXX A;  4U7N A;  3MD0 A;  1G4Y B;  4GCZ A;  2X0L A;  1P7B A;  4JTC B;  3ZRW B;  3WG7 C;  5B1N A;  4PA9 A;  1E79 G;  3LSS A;  4HAM A;  3OMI B;  5IYD O;  3K9A A;  3EHB B;  5KA5 A;  3F7V C;  2YEV B;  2C2A A;  3FYE B;  1MG1 A;  4LBE C;  2X6C A;  2Q69 A;  2A0L A;  1FXK C;  4MVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...