2LP7A

Structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Envelope glycoprotein
total genus 11
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lp7A00
1ENVA 1QR9A 1EBOA 1F23A 2P6JA 5KA6A 1DF5A 2EZOA 2X7RB 3B77A 1K33A 3B8MA 3MHHC 5CMUA 1SZTA 2MK3A 3B8NA 2EBOA 5HFMA 5HFLA 4JPRA 1K34A 3H01A 4FJCC 4N23A 1DLBA 1QBZA 3CP1A 3P30A 4E2LA 2OT5A 3K9AA 2LP7A 3M99B 1JPXA 2EZPA 5H9CA 1I5YA 5CN0A 1JQ0A 4N21A 1Y4MA 4JF3A 3MHSC 4FIPC 1MOFA 4JGSA 1Y66A 4FK5C 1QCEA 4G2KA 5KA5A 1I5XA 3CYOA 1DF4A 3GWOA 3WFVA 2M7WA 1QR8A 1MG1A
chains in the Genus database with same CATH superfamily
1F23A 4AHCA 4BW9A 4UVCA 4I0XA 5CBFA 4JTCB 3CXCU 1HNWB 4WCEV 1TVKA 4DYLA 3JD1A 4X8AA 4E4EA 4GYCB 2WA3A 5H9CA 4AQYO 5KMGB 4DR5O 5B1BB 4FK5C 2X0LA 1VQKV 3EVKA 5FNVB 2RJZA 3OT7A 2HHHO 4DV0O 4MW8A 4RO2A 4RQEA 2DW4A 3ZHRA 1NKDA 2VQEB 4X62B 1LNQA 1M5IA 3Q4HB 4NTYA 1ZUQA 2UUAB 5LMUB 1YDXA 1VQ7V 2LFSA 4F6EA 3ZX6A 4ASUG 5LBQA 5H2FZ 4DR6B 2UXDB 2UU9B 3JAWA 2QKAA 2Y0IA 2ZE5A 1G4YB 3SPGA 4GLXA 1DGSA 3ASOC 1DF5A 2P06A 1WPXA 4DR2O 4JYCA 3TCUA 2VQEO 1P7BA 4LWSA 1URFA 4DR4O 3O9OA 4DUYB 3SJAC 1N36O 1WNSA 4WFEA 4R6ZA 5GTHZ 3UO2A 1VEWA 3J7AU 3E8BA 4LF9O 1TA8A 2G38A 1N32B 2YXHA 4Q6GA 4FM0A 3DTUB 2B9ZA 1K5SA 5JJNB 4A5UB 3K59A 4QE9A 1OJHA 2F4VO 3GB7C 1M56C 5IY5B 1R1BA 3ZRSA 3TGUH 4LF4O 3RYHA 3AG4C 4MVRA 3W7WA 4KUMA 2Q73A 1R3JC 1AP5A 3A0RA 1VF5B 1XHXA 4NXMB 5EBWC 4YJ2A 1Q81W 5J2TB 3ASNB 2LGWA 2JIZG 2P7TC 3T4DA 1NH2D 4UCOA 5LXTA 3G6BA 3A2FA 1IXMA 1S5JA 3PN1A 4LF7O 1FAFA 1WP8A 1YJ9V 1XQ8A 4KP4A 5KAIZ 4RQFA 2X7RB 1XUQA 4I50A 2AXTZ 2QWOB 2EIKB 1FFTB 4P9PA 2KG7A 2WLKA 3RWRD 1AVMA 4LF7B 1VF7A 3UO3A 5DECA 1YIJV 4ZHQB 3HKBB 4JYAO 4JF3A 3H1KH 3TK1A 1I0HA 1I5XA 2BTOA 4QJFB 2R70A 1WP7A 5C8YB 1JJOA 4QIWF 3BCCH 1YJNV 4K3AA 3ZRXA 1CXZB 3CE2A 3E8HA 1Q8IA 4LFBO 1TAEA 3CC4V 4FM1A 1RP3B 5B1AC 1YI2V 2EINB 1SS3A 4GCZA 1XNQB 1KB9F 2ODMA 1AI7A 1SQVH 3SJCC 1DF4A 3ABUA 1YEWA 2YS8A 4MTXA 2YIBA 1GK9A 2X6CA 2Y0PA 1GN6A 5D5QA 3K0DA 4PA6A 4JI2O 1Q6IA 1H2SB 1R6NA 3I56V 3JASA 1XMOO 1JQ0A 5JJJB 2ZM6B 2YI9A 2BOCC 3CCSV 1KC8W 4LFCB 4MSWC 2R72A 1QR9A 2PUSA 2GHYA 1HNXO 2P90A 3APQA 4NR1A 1K34A 5JCOA 1GN3A 2Q6AA 2Q8VA 5B5EZ 3JYCA 4IT5A 1NVPB 4YHHO 3JAKB 2D3OW 5A9GA 3BPZA 1NQTA 3JAMN 3CCJV 2EILC 4B7KA 1TUBB 4Q20A 3SPJA 5LA6A 2PYLA 2E75B 3HKDB 1HNXB 4L87A 2L35A 4CH6A 4AI8A 3P3NA 3P32A 2H8PC 3SYPA 3X2QC 3TJTA 3IFXA 2GDSA 1SRYA 2OCCB 4PA3A 5J2TA 4FFBB 4GX2A 3HB3B 2Q9LA 1Z5VA 3L72H 1YTFD 4NB5A 3WB1A 1J5EB 5E1AC 1SZTA 2ADPA 1M4UA 1KD1W 4TV8B 2BCCH 4JAUA 4DR5B 2IH1C 3ZN0A 2JEUA 3KCYA 4YIPA 5IT9N 4K0KO 2PYJA 3CRQA 2UUAO 4D6TH 3FB5C 3D8CA 2DYRC 2FL4A 3BY6A 1TGOA 4TT3G 4JASA 4DXWA 3RW0A 2CH7B 1OCOC 2N74A 4NTXA 5FNVA 1Y76B 1L8DA 3OFNG 2YXYA 4X20A 4X1IA 3B4SA 1VQLV 2R9RB 1EN4A 5IJ0B 5DN6G 3MHSC 1YHQV 1OCZC 2IJKA 3CMEV 2GUZA 2ZE6A 2YUAA 1G6UA 2RN9A 4MTOA 1XNQO 2D2CB 1AJQA 4JYYA 5LP6C 3LNMB 5EBLC 1I94B 2E5LB 3CS5A 4EB6B 2WLIB 4B08A 5FL7G 5KHHA 3JARA 4JI3B 2WPDG 1S0VA 4UUJC 2F4VB 2JRIA 2E76B 4IYHA 4UCSA 4XDJA 4ZI7B 2VWJA 2XNDG 5LA6B 4DR2B 4DV6B 2GBOA 4JI1B 1H2MA 4U7NA 2QA4V 4DV1B 1PKXA 3JARB 4TV9B 5H6QA 3K58A 1Y6XA 2DOSA 3OUFA 3CRMA 4J9YB 2V1DA 2CGOA 2LQTA 3HKCA 1R6KA 4EEQA 2KSDA 5CA3A 5KUKA 3G71V 1MSDA 1SQXH 1BT8A 1VQNV 1R3KC 3I5DA 5EC1C 2UUBO 1M93A 2KG7B 3FAVB 3KCXA 3SPHA 2ADQB 1NR1A 2RCVA 1L0NH 4I55A 3RGBA 1M1KW 1K7DA 2IJJA 5JH7A 5BMVB 4J7KA 2KKWA 2QWRB 4MT8A 1CP9A 1XDCA 2UXNA 3M8AA 4TUYA 4NTWA 2W0FC 4XDLA 2BTQA 4JI8O 4PA4A 5CBHA 3MD0A 1XBLA 4X62O 3ETEA 1EFRG 3DXRB 3AG2C 3MDSA 1N34O 1R6TA 5CB4B 1Y4MA 4MTFA 3K0GA 2AZ0A 3DC6A 1GN4A 3L75H 2JS5A 1NTKH 4KL1A 3RVZA 2NR5A 2O57A 1F51A 4D7SA 3HKBA 5GONA 4WFGA 4I5SA 5K1PA 4RUEA 3BA9A 3CJHA 4LWSB 3QTCA 2ARHA 1AR1B 1Q3EA 4QPKA 5JH7B 3EFFK 4C7UA 1O9GA 1XOUA 3UKMA 1WB7A 2WA4A 5BXZA 3DXRA 3WFVA 1XL4A 1EBOA 1FXKA 3UT5A 5CBGA 3ASOB 3MHHC 4OPHA 1K33A 2BTQB 3CPWU 4FLXA 5D5PA 3IC7A 3OTOB 4WFBV 4I4TB 2DYRB 4F4LA 3T4ZA 1MZEA 4N21A 3UM7A 4U3JB 3HKCB 1SF9A 1G1XB 2ZNJA 5L3CA 4B3TB 5EC2C 2UXCB 4XBFA 3ABKC 5FPRA 4GKJO 3G4SV 2ITDC 4LF9B 5CA0A 2VRZA 1OV9A 3G80A 3ZHSA 3CCEV 5K1XA 3B09A 4I9WA 1AI6A 5LP6B 4ZBMA 1M56B 4DV3O 4HNAA 3JCUZ 3KG2A 1VQ5V 2UXBO 2XOKG 1KBHA 3G6EV 2CTQA 5KA6A 4PDLA 2WLMA 4ZIBA 1S5LZ 3OEHG 5BMVA 3ZRWB 4DUZB 1V55B 2PGGA 5J2UB 4Z1VA 3CMAV 3BHPA 4BAYA 1IBKB 5LOVA 2XHBA 4O4HB 1J5EO 3RFRA 4OX9O 4GZRB 3BAAA 1TUEB 3HKEA 1IBLO 3RYCA 3E89A 4H37A 1EM1A 1Z2GA 1K97A 4CC5A 3CC7V 4BR6A 3CCVV 3K57A 2E3CA 3RYFB 4FZ0A 5H5NA 3ABMB 2IM9A 5EIBC 3ZMZA 5F2VO 1N34B 5KAFZ 1TVKB 2XAFA 5LHIA 1JFFB 1ZL8A 3GVMA 3C90A 2W0XA 1H38A 3B40A 5BR8O 5JJEB 5CMUA 4DV7B 5IJ9B 3OTFA 4J80A 1BCCH 3VOUA 3IGAC 3JALB 5IE9A 2UXDO 4DO2A 4LFAO 1L0LH 3AEIA 3L9DA 4BIZA 2LW7A 2FB5A 4H0LB 4MVUA 4FLUA 4UV8A 3RBZA 2V7QG 4DV7O 1QLEC 1SQBH 3SPCA 4KXRA 5JWPA 5HFLA 4DV6O 1X4TA 1NH2B 4TSFG 3WB0A 1EN6A 4CZZA 5EBMC 5KHKA 3D36A 4JI0O 5L3FA 1FJGO 4PDMA 1MABG 1TUBA 1ZSPA 2JGUA 2WAMA 1FS0G 2ZQMA 1S72V 1BMFG 1NTZH 4OPAA 1OCCC 1NU1H 4HNAB 2F43G 1WN7A 2CGNA 2EBOA 4GX5A 4D7TA 1JOYA 1OCOB 1B6QA 3N2GA 2GTAA 2WLLB 4E2LA 1IBMO 5CA1B 1HNZB 1FXVA 1LR1A 4O4HA 3PJSK 1R3IC 2YIBD 2Y69C 3GWKC 3L70H 3QVNA 5KX5A 1ZWIC 4W4KA 1XHZA 5L3BA 3JD0A 2Q0AA 1EZVH 3CP1A 1XEQA 2JEXA 2YSUB 3O65A 2ETNA 4UCTA 4LC1A 1ZL8B 3LSSA 2XASA 5LGTA 2LW1A 3QF7A 3J81N 4GKKO 1HNWO 1LUWA 3ABLB 4BIUA 2W6JG 5KLVH 1ZX3A 2QDOA 4CH4A 2QGNA 1DTOA 2F1MA 4PDVA 3KKYA 3FYEB 3CCUV 3SR2C 2OWOA 4LNUA 4JTAB 1N36B 3H1IH 4X64O 2HR3A 1ZAUA 3U0ZA 2XAGA 2K1EA 4WFFA 4X1KB 4RWUA 2OT5A 4P9OA 4DUYO 1IX9A 4FMTA 5IYCO 1QCEA 1B3QA 1KECA 5LMNO 3ICXA 1VQ4V 4LNUB 3W7SA 3CRRA 4QNHB 4X89A 1X59A 1AR5A 1XMQO 2N05A 4EKWA 2XT9A 3CCQV 3BABA 4FPPA 4RAIA 1XMQB 3AG3B 2PI5A 3RYHB 3DSQA 3OR7C 3STLC 1NR7A 4HYOA 1GN2A 1H8EG 3OMNB 5EZYA 1PPJH 2Q7HA 3OMIB 3BA8A 1AJNA 1MSWD 1NBMG 2UXBB 2ZKOA 3IC9A 2B1IA 3ZHUA 4FLYA 2IU3A 4TV9A 3CB2A 3LUTB 4JYBA 1P84F 1KKCA 2FMLA 4AILC 4FM2A 1QLEB 1MOFA 1PD3A 5BZBA 1K3EA 3NR7A 2QWQB 5LGUA 5JVDA 4DV1O 1H2LA 2QE7G 3E22B 1VF6A 4I50B 3RVYA 3S3WA 3H9VA 2P6JA 5TISZ 2NLJC 2YEVB 4U3JA 3J80N 2CUGA 3ZS8C 1IBLB 3FAVA 3STZC 4O4LA 2OYQA 4TUYB 4DV0B 1I7FA 4PA7A 3CWBH 1VF6C 4CS2A 1FYJA 5J9PC 2W6IG 1XILA 1ORQC 1Q43A 2AHZA 2NNUA 4JYAB 1GRJA 3ML0A 4LF6O 4MS2A 4NKGB 4J7ZA 4JI5O 3QO7A 4X9QA 1H2GA 5CB4A 5ITZA 3JALA 1PL4A 3CJHB 4N23A 2DWEC 3E22A 1WPBA 1B06A 4YIOA 4JI5B 2DJVA 4MVZA 4LFBB 2A0LA 1VQPV 4JGSA 4R7CA 5BR8B 1F4NA 3QO5A 3F5WC 2GSMB 5KHIA 2X6BA 3E86A 1BS3A 3SYQA 1QVFU 3R65A 2EINC 3WB2A 4UV9A 3JSNA 3RYCB 1KP2A 2ZDIA 4FLVA 2CTWA 2R9IA 4UCRA 4ICGA 1GM9A 3OMAB 4H13B 1YZBA 3K5MA 2IBZH 1OHHG 2FTKA 3ABLC 4CH3A 1WLEA 2UU9O 3N27A 4X1YA 4B3SO 3K5OA 1ZLZA 5C93A 4MVMA 1JX9A 1NTMH 1KUQA 2QR4A 3CEIA 3HR0A 3H1HH 2Q69A 4IL6Z 1N33O 2QJ1A 3JAWB 3APOA 4MW3A 4J10A 4O2BA 2GUZB 2IW5A 4CS3A 2VQFO 4MTGA 1NT2B 3OE7G 3VQVA 3VQXA 1XL6A 1VMGA 2KB1A 4F6RA 2DE0X 4DV2B 2HKOA 3AK2A 4FLZA 2VQFB 1M57C 1M9NA 4DR3O 1PM9A 1IBMB 5AG2A 1KMIZ 1N4CA 2OTLV 5C8YA 3P30A 4YY3B 2WLIA 1PNKA 2YI8A 4J9ZB 3IAYA 1PV0A 4LFCO 3ZRWA 2F23A 2EJ7A 3HKEB 3B2EE 3K5NA 5LOVB 1HWYA 4YHHB 1Q5OA 2QWNB 5IY5C 3VBBA 4OXSA 4K8ZA 1NVPD 1B04A 2A3QA 4LR3A 4FFBA 1SQPH 2R9AA 5KX5B 4PHZA 2PI4A 2Q5ZA 3T1YB 3Q4HA 4OX9B 1SQQH 4NXNO 3A0BZ 5A2QN 4GT1A 5IJ9A 4G27B 4X20B 4LF5B 4LFAB 3T1YO 1EZJA 1JA8A 5LMUO 2JVDA 4MVQA 1K4DC 2EIKC 4PV1B 1KKDA 4W4LA 4JI7B 5CA0B 1V54C 3VQWA 2Y69B 3T1CA 1V9PA 1E1RG 3OGCC 2PZSA 2H94A 2A06H 4JPRA 1IURA 3ZHTA 4CC6A 3H1JH 1I94O 1AR4A 4X1YB 4TOIA 2CK3G 3OEEG 1JPXA 2OTJV 2WSSG 4B3RB 3L71H 4H33A 2K9PA 1CPYA 4R50A 1QLNA 1XREA 4TQDA 2DYSB 4DR7B 3RN4A 2FYUH 1T5EA 3K04A 2Y4TA 3ZJZA 1SC5B 3K5LA 2AGAA 3AG1B 1NI8A 3CRCA 4DR7O 4CS4A 3FD9A 4O2AA 1O9HA 4HZ3A 4X88A 5EYPB 4UXNA 1P4RA 3WG7B 2E5LO 1BQ0A 3JATB 2HJDA 2Q4PA 2B1GA 1THZA 5L3GA 1K4CC 5JCOC 2YXLA 1IVSA 1FXHA 3LSQA 1FD9A 2XTAA 1Y74B 5DEDA 4UFZA 1MA1A 5CN0A 2PTMA 4ZOLA 4ZKIA 1HNZO 4LBEC 2KQXA 4GUNA 1MG1A 3ABKB 4B7EA 4MVSA 4PD4F 1SQFA 2BSKB 4PA9A 2C2AA 4DK0A 1D2DA 5JQGA 2CAZC 1M57B 1HDJA 3W7TA 1KQSU 5H6RA 1PL0A 4I7ZB 1AI4A 3N2KA 1G8MA 1YVWA 1GAXA 4EFEA 2RQ6A 4J7JA 4Z2WA 3SYOA 2HP8A 4KHPB 1UJWB 2HJFC 5EIBD 4UVAA 4X64B 1DLBA 4JI8B 1V55C 1KP3A 1GO3F 4LH7A 4DR6O 1BGYH 1SA0B 2UXXA 3ETQA 2HHHB 4PI2A 3A8TA 3CRAA 4DV4O 3H1LH 2Y4UA 3A0HZ 5LYJA 3FB7C 1XNRO 4X65B 3E8GA 4I4TA 4MVOA 3QG5A 2IJHA 1FXKC 2JDIG 1BHAA 1BQZA 2QSAA 4IYIA 4B3TO 2A7WA 5LMNB 2F66C 3K9SA 1PNLA 3ZBHA 5HFMA 2ZINA 4DW0A 2YC0A 4DV3B 3ETGA 2DQ3A 1W59A 2UUBB 1YXBA 4UVBA 4P30A 1QNMA 3F5TA 1VQ9V 3BRCA 2Z3YA 1PNMA 4DW1A 3CD6V 1IZ3A 1QR8A 2ILMA 5FPOA 1BHBA 2A9HA 2DYSC 4JAVA 3B8MA 4JZGA 1Q6UA 2F95B 2ZXWB 3JSLA 2UXCO 2HFEC 2Q7GA 4IIJA 1YSCA 2YICA 1SERA 1SKVA 1AB3A 2F93B 4K35A 5IYDO 2Q0OC 3OD4A 2XAQA 4LH6A 5B1BC 1KYOF 3R66A 4BWAA 2BE3A 2A79B 2N04A 2QKCA 4O4LB 2EJRA 5KHJA 3S3XA 4QGPA 5B1AB 3RT3C 2YEVA 4O4JB 3IJ4A 1K73W 2OIGA 4G28B 3K03A 4NXMO 3OR6C 3TETA 2RNBA 2LP7A 3FFQA 4ABMA 5CA1A 2B5UA 3D3QA 1Y67A 4FLWA 1K9MW 4HBNA 1N0JA 4IIJB 1BE3H 1S77D 3UQ8A 5L3DA 3D3IA 4IHJB 4U7OA 5B1NA 1HP8A 1JFFA 1LUVA 1SQGA 3ZEDA 4YJ3B 4PELA 1OCRB 2P67A 2ZE8A 1YF2A 4HAMA 1JMKC 1K5QA 2EZPA 2M6YA 4J41A 3K79A 4NXNB 5IYBO 4ZI7A 1K92A 1JJ2U 3HPLC 3FYIB 3GWOA 4ZHQA 2Z5UA 3OGIB 4CH5A 4YJ3A 3T1HB 3M7MX 1WAZA 1RSOA 4DV4B 1R73A 3BFRA 1L1FA 2UUCB 4X65O 1WJZA 3RYIB 1FJGB 2H3OA 1DK1A 1JCHA 4I0XB 2MW2B 3T1HO 4DV5B 2LGQA 1GMGA 1RPOA 1RFYA 3AG4B 1WA8A 3SPIA 4JI2B 4B3SB 1SESA 2WLNA 2ATKC 5LL6Y 2VWKA 1Y74A 3U11A 4DV5O 4LP8A 2GV9A 5ITZB 2LJ2A 2YIAA 2Y48A 2AZ2A 3SYAA 3ZIAG 2P4KA 3ZMTA 5E79Z 1COWG 1US6A 1YJWV 2Q67A 4JI3O 3B8NA 2CDYA 3ZCCA 3AG3C 3X2QB 5B3SB 4O4IA 2QWPB 2YIDA 5GTIZ 1Q86W 2BOBC 3OUSA 4RUFA 4DR3B 2X6AA 1UFIA 1W2BU 3LSUA 3THOA 5KA5A 3T2MA 1JVMA 5LYJB 4K0KB 1GTOA 2ZR2A 3KZIZ 3EXAA 3B77A 5BY1A 5GW7A 4AQYB 3ZN1A 4U3FH 2XAJA 4I9QA 3TXQA 3CC2V 3AK1A 1IXBA 1RPRA 1VIBA 2OCHA 2XAHA 1NJIW 1VP7A 4PJ0Z 4K8XA 2EIJC 1KU9A 4NVPA 3WG7C 2CTPA 1BL8A 3ZHVA 1E79G 2MK3A 2Z0AA 4PI0A 3SYCA 4JI6B 4LF5O 1GKFA 3CXHF 3P3PA 4Z1MG 1QBZA 5IDJA 4R8CA 1I5YA 5KMGA 4LCUC 4GX1A 2QTOA 1K8AW 4JI6O 4LF8O 1V54B 2QTSA 2AHYA 3RYFA 5L3EA 1VQOV 2IH3C 1Q82W 4LF8B 1P49A 3CCMV 4WF9V 1Q90D 2JJ1G 1QHTA 5LGNA 2PF4E 1N33B 1F4MA 5KHGA 4QE7A 5IYZA 5IJ0A 3WU2Z 4X1IB 4EB6A 1XNRB 4L8JA 3LDDA 1FKAO 4FLTA 4EFBA 1JR9A 2P4VA 1HR0B 1FFXB 1P7GA 3E8FA 2GTSA 3UCSC 2QM8A 1WB8A 1RM1C 1Q7YW 3AG7A 5LP6A 3ZRVA 4LF4B 1HR0O 3CYOA 1F7YA 2IJIA 4O2AB 5IWAB 5EYPA 1ENVA 3G67A 1N32O 4H44B 1RM1B 1HW7A 1BSMA 1FFXA 2JK5C 4FJCC 3ZMUA 4DR1B 4J11A 1FXKB 3UT5B 5LHHA 3CSXA 2ZCEA 4X66B 1IDSA 1N8RW 2LO1A 2ZD9A 4LF6B 4KFMA 4GKKB 1ROPA 4KHPO 3AK3A 3CCRV 1PP9H 5KUMA 2ZT9B 3OW2U 2EIMC 3ZMVA 1VARA 2DWDC 3N2GB 1AI5A 1J95A 1H8HG 4YJ2B 1D5AA 4DRXA 1AP6A 1R3LC 4JZ2A 1AJPA 2EILB 5FLXN 2JS3A 2QEXV 3JAKA 1NZ6A 1YITV 4DUZO 5EK0A 3VQYA 1SA0A 3E35A 2RDCA 2ZXWC 2EULA 4QPJA 5GONB 3CX5F 3M99B 2DN9A 1QVGU 3OTOO 3QNEA 2Q68A 4GX0A 3JD3A 4CBCA 2ZIOA 3BVOA 3FKSG 4JAAA 4DRXB 1XMOB 3LDEA 2EIJB 3W7XA 4GKJB 3LDCA 2ITCC 1XI1A 4JI4B 5IYZB 4JI0B 4FIPC 3F7YC 3FB8C 2ZNIA 4X1KA 4WFAV 2QKSA 2E74B 4WBNB 3C3TA 4TQFA 1H2KA 3RYIA 4DR4B 2HLDG 2NN4A 1OCRC 3U10A 3LNNA 4UB8Z 4JI4O 4TWKA 5DM6V 3W7UA 3K3WA 4BW5A 1YTFB 3L73H 2EIMB 1OCZB 3MAQA 2ZDIC 1VQ8V 1W0KG 4WFHA 1A32A 3AG1C 3QO8A 1U97A 3JATA 5IWAO 5EZYB 1SETA 4P2ZA 5J2UA 4WBNA 3ZMSA 1FPOA 4O4JA 2CE4A 3EHBB 2CTRA 2XUMA 4DR1O 2ZIMA 2M7WA 4X66O 4UCVA 4O4IB 1GM7A 4OGQB 1NS1A 4ZOLB 4YY3O 2IU0A 2BSKA 3FX7A 3OM3B 5JVDB 4B3MO 1N0NA 2RMKB 1IBKO 4JTDB 3JD4A 4DK1A 2OIEA 1BZKA 2FKXA 1Z5WA 1SZXA 1S3JA 2HVJC 3DC5A 2QM4A 3JCZA 1EN5A 3ABMC 3FB6C 4JI7O 4IHJA 4JV5O 3ZHQA 1U96A 2CH7A 3H01A 4TV8A 3ETDA 3OAAG 3N2KB 2VS0A 4B3MB 1S5HC 3AG2B 3K9AA 2WLJA 2JJ2G 4JV5B 2V4DA 1QQCA 4G2KA 4YXWG 2HEPA 4B3RO 3NXSA 2P22C 3SDLA 1QU7A 1CEZA 3E83A 1MZFA 1OZ0A 1WA8B 5B66Z 1VQ6V 4UCUA 3DGEA 4J42A 2JGDA 1M90W 2OCCC 4DV2O 1I08A 1AILA 2P5OA 3L74H 2L6LA 4FVMA 4JI1O 1Y76A 3CCLV 2LFRA 1H2NA 2UUCO 3ASNC 3ABTA 3D36C 4FFKA 4PDRA 2WWWA 2ZM6O 2EZOA 2JGDB 2AW9A 1ZTEA 1OCCB 2DMXA 2WLHA 3SJBC 2ZR3A 3F7VC 3HKDA 2Q7EA 3TXSA 4XDKA 3BEHA 2WLLA 2EX3A 3CHXA 2DQ0A 4F6RB 4FZ1A 1MMMA 1GM8A 1GH6A 1YCIA 3K06A 4NYKA 2YDEA 4O2BB 3SJQC 1VQMV 2ZE7A 3JD2A 3I55V 3K08A 5B1OA 1Q6HA 4UB6Z 4I55B 2HVKC 5LHGA 1E1QG 5B3SC 1UPGA 1MNGA 5LXTB 2HG5C 2QM7A 1W0JG 4IGGA 1Y66A 3JASB 1RSOB 1D5NA 3SGIA 4BIOA 2PY5A 3E2EA 3C3SA 1S76D 5JQGB 1AROP
chains in the Genus database with same CATH topology
3ZMTA 1F23A 1COWG 1YJWV 2Q69A 2Q67A 3RVZA 3B8NA 4UVCA 1F51A 3AG3C 4JTCB 3ZCCA 5CBFA 3CXCU 4WFGA 4I5SA 3X2QB 4MW3A 4WCEV 4RUEA 5B3SB 3JD1A 4X8AA 2IW5A 1Q86W 2BOBC 3OUSA 4MTGA 3OE7G 1AR1B 4RUFA 1XL6A 5H9CA 4QPKA 2X6AA 3EFFK 1W2BU 5B1BB 4FK5C 2X0LA 5KA5A 1VQKV 3UKMA 2KB1A 3T2MA 3WFVA 1JVMA 2HKOA 1GTOA 1XL4A 2ZR2A 4MW8A 4RO2A 4RQEA 1EBOA 1FXKA 2DW4A 5CBGA 3ASOB 3MHHC 3B77A 1K33A 5GW7A 3CPWU 1M57C 1M9NA 1NKDA 3ZN1A 2XAJA 3CC2V 1LNQA 3IC7A 1RPRA 4WFBV 2XAHA 2OTLV 1NJIW 3P30A 2WLIA 2DYRB 4F4LA 3T4ZA 1VQ7V 1PNKA 4J9ZB 2LFSA 4N21A 3UM7A 2EIJC 4ASUG 5LBQA 3ZRWA 5L3CA 5EC2C 4XBFA 3ABKC 3WG7C 1BL8A 1G4YB 3SPGA 1E79G 3ASOC 3G4SV 1DF5A 2ITDC 1WPXA 2MK3A 1HWYA 4JYCA 3TCUA 5IY5C 3SYCA 4OXSA 3VBBA 1P7BA 1GKFA 1NVPD 4Z1MG 1QBZA 5IDJA 4R8CA 3CCEV 4I9WA 1AI6A 4WFEA 4R6ZA 4ZBMA 1I5YA 1M56B 4LCUC 4GX1A 3KG2A 2QTOA 1K8AW 2PI4A 1V54B 1VQ5V 2XOKG 2AHYA 5L3EA 1VQOV 3G6EV 3E8BA 5KA6A 2IH3C 4GT1A 4PDLA 2WLMA 4G27B 1Q82W 3OEHG 3DTUB 3ZRWB 1K5SA 1V55B 3CCMV 4QE9A 4WF9V 3CMAV 1EZJA 4BAYA 3GB7C 2JJ1G 1M56C 5LGNA 4MVQA 1K4DC 1F4MA 2EIKC 5IY5B 3ZRSA 1KKDA 4QE7A 1V54C 3AG4C 4MVRA 1TUEB 3W7WA 2Y69B 4KUMA 3LDDA 3T1CA 3E89A 4H37A 1R3JC 1E1RG 3OGCC 2H94A 1K97A 3A0RA 4JPRA 3CC7V 5EBWC 1Q81W 3CCVV 3ASNB 2CK3G 2JIZG 2P7TC 3T4DA 3ABMB 1NH2D 3E8FA 3OEEG 1JPXA 2OTJV 2QM8A 2WSSG 3ZMZA 1RM1C 1Q7YW 4H33A 1IXMA 2XAFA 3ZRVA 4R50A 1CPYA 5LHIA 3CYOA 1QLNA 2IJIA 1YJ9V 1ENVA 2DYSB 1H38A 4KP4A 4RQFA 2X7RB 5CMUA 3K04A 2EIKB 1FFTB 3ZJZA 1RM1B 3VOUA 3IGAC 4P9PA 2WLKA 3ZIAG 2JK5C 4DO2A 4FJCC 3ZMUA 3AG1B 3AEIA 1YIJV 1FXKB 4BIZA 5LHHA 4JF3A 3TK1A 4HZ3A 4MVUA 2ZD9A 4X88A 1N8RW 1I5XA 4UXNA 4QJFB 1P4RA 3WG7B 4UV8A 3RBZA 4KFMA 1ROPA 2V7QG 4QIWF 1QLEC 3CCRV 3SPCA 1YJNV 2B1GA 5KUMA 1THZA 5HFLA 5L3GA 1NH2B 1K4CC 4TSFG 3OW2U 3ZRXA 2EIMC 4CZZA 5EBMC 1FXHA 2DWDC 3E8HA 3LSQA 3ZMVA 1AI5A 1J95A 1H8HG 3CC4V 3D36A 5B1AC 5L3FA 1YI2V 5CN0A 1R3LC 4ZKIA 4PDMA 2EINB 1MABG 4GCZA 4LBEC 1AJPA 2EILB 2QEXV 1AI7A 2WAMA 1DF4A 1YITV 3ABUA 5EK0A 1FS0G 1MG1A 3ABKB 2ZQMA 1S72V 1BMFG 3E35A 4MTXA 2ZXWC 1OCCC 2F43G 1GK9A 2X6CA 4GX5A 1JOYA 2EBOA 4MVSA 3K0DA 4QPJA 4PA6A 4PA9A 1OCOB 1B6QA 2C2AA 2WLLB 4E2LA 1R6NA 3M99B 3I56V 1QVGU 1JQ0A 1M57B 1FXVA 3W7TA 3QNEA 2Q68A 1KQSU 4GX0A 5H6RA 3PJSK 1PL0A 1R3IC 2BOCC 2Y69C 1AI4A 3JD3A 3CCSV 1KC8W 1G8MA 4MSWC 1QR9A 4CBCA 2GHYA 3SYOA 1ZWIC 3FKSG 1UJWB 2HJFC 2P90A 3LDEA 2EIJB 1K34A 3W7XA 4UVAA 5L3BA 3LDCA 2Q6AA 3JD0A 3JYCA 2ITCC 1DLBA 1V55C 1NVPB 1KP3A 3CP1A 1GO3F 2D3OW 2JEXA 1NQTA 2YSUB 3CCJV 2UXXA 2EILC 4FIPC 3F7YC 3FB8C 4Q20A 4WFAV 2QKSA 3SPJA 4LC1A 3LSSA 2XASA 5LGTA 4L87A 3FB7C 3E8GA 2HLDG 3P32A 2H8PC 3SYPA 3X2QC 4MVOA 1OCRC 3IFXA 1SRYA 2OCCB 4TWKA 5DM6V 2IJHA 4PA3A 3W7UA 1FXKC 3K3WA 2JDIG 1BHAA 4BW5A 3ABLB 4GX2A 3HB3B 1YTFB 2EIMB 4BIUA 1YTFD 2W6JG 1OCZB 2ZDIC 1VQ8V 1DTOA 1W0KG 4PDVA 4WFHA 3AG1C 3FYEB 3QO8A 3CCUV 1PNLA 5E1AC 1SZTA 5HFMA 4JTAB 1KD1W 1SETA 4P2ZA 4JAUA 2IH1C 2HR3A 2JEUA 3ZN0A 3ZMSA 2XAGA 2K1EA 4WFFA 3ETGA 2DQ3A 2OT5A 3EHBB 4P9OA 4UVBA 4P30A 1VQ9V 4FMTA 5IYCO 1QCEA 1KECA 2Z3YA 1PNMA 3CD6V 3FB5C 1VQ4V 2M7WA 1QR8A 3W7SA 2DYRC 4QNHB 4X89A 1BHBA 2A9HA 3BY6A 2DYSC 4JAVA 3B8MA 4TT3G 4EKWA 1GM7A 4JASA 3CCQV 2ZXWB 4DXWA 3RW0A 4FPPA 2IU0A 1OCOC 2HFEC 4RAIA 1YSCA 3OM3B 1SERA 3OFNG 4JTDB 5IYDO 3JD4A 1VQLV 3AG3B 2R9RB 2PI5A 2XAQA 5DN6G 3MHSC 5B1BC 3OR7C 3STLC 1YHQV 1NR7A 4HYOA 1OCZC 2IJKA 3CMEV 1H8EG 2A79B 3OMNB 2EJRA 4MTOA 1S3JA 2HVJC 3JCZA 3ABMC 3FB6C 3OMIB 2YEVA 5B1AB 1AJQA 1AJNA 1MSWD 1NBMG 3LNMB 5EBLC 3H01A 3ETDA 3OAAG 2B1IA 2WLIB 1K73W 2IU3A 1S5HC 5FL7G 3AG2B 4G28B 3K03A 3LUTB 3OR6C 4JYBA 3TETA 3K9AA 2LP7A 2WLJA 2JJ2G 1QLEB 2WPDG 1S0VA 4UUJC 2B5UA 1MOFA 1PD3A 4G2KA 5BZBA 1K9MW 1K3EA 4XDJA 4YXWG 5LGUA 2QE7G 2XNDG 3NXSA 3RVYA 1CEZA 1S77D 2P6JA 5L3DA 3E83A 2NLJC 2YEVB 3D3IA 4U7OA 5B1NA 1OZ0A 4U7NA 2QA4V 1VQ6V 3DGEA 3STZC 1M90W 2OCCC 4PELA 1OCRB 1PKXA 4PA7A 5H6QA 2P67A 4HAMA 3OUFA 1K5QA 4J9YB 2EZPA 2V1DA 3CCLV 3K79A 5J9PC 2W6IG 5IYBO 2LFRA 1ORQC 1R6KA 1K92A 1JJ2U 3ASNC 2AHZA 2NNUA 3FYIB 3GWOA 3HPLC 5CA3A 5KUKA 3G71V 3ML0A 3ABTA 2Z5UA 4PDRA 4MS2A 1VQNV 2WWWA 1R3KC 5EC1C 2EZOA 3QO7A 1OCCB 1H2GA 2WLHA 1R73A 2ZR3A 3F7VC 3SPHA 1L1FA 1NR1A 4N23A 4XDKA 2DWEC 3BEHA 2WLLA 1JCHA 1M1KW 2DQ0A 4MVZA 1K7DA 2IJJA 2A0LA 1GMGA 1RPOA 4JGSA 4R7CA 1VQPV 1F4NA 1GM8A 4MT8A 3AG4B 3QO5A 1CP9A 3F5WC 3K06A 2UXNA 2GSMB 2X6BA 3SJQC 3E86A 1VQMV 3JD2A 3I55V 2W0FC 3K08A 4XDLA 3SYQA 1QVFU 3SPIA 5B1OA 3R65A 2EINC 4PA4A 5CBHA 3MD0A 1SESA 3ETEA 4UV9A 1EFRG 2HVKC 2WLNA 1E1QG 1KP2A 2ATKC 2ZDIA 5B3SC 3AG2C 5LHGA 2R9IA 1GM9A 3OMAB 2HG5C 2QM7A 1W0JG 4LP8A 1OHHG 3ABLC 1Y4MA 2FTKA 4MTFA 1WLEA 1Y66A 3K0GA 2Y48A 3E2EA 5C93A 3SYAA 1S76D 4MVMA 1JX9A 1AROP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENV A;  1QR9 A;  1EBO A;  1F23 A;  2P6J A;  5KA6 A;  1DF5 A;  2EZO A;  2X7R B;  3B77 A;  1K33 A;  3B8M A;  3MHH C;  5CMU A;  1SZT A;  2MK3 A;  3B8N A;  2EBO A;  5HFM A;  5HFL A;  4JPR A;  1K34 A;  3H01 A;  4FJC C;  4N23 A;  1DLB A;  1QBZ A;  3CP1 A;  3P30 A;  4E2L A;  2OT5 A;  3K9A A;  2LP7 A;  3M99 B;  1JPX A;  2EZP A;  5H9C A;  1I5Y A;  5CN0 A;  1JQ0 A;  4N21 A;  1Y4M A;  4JF3 A;  3MHS C;  4FIP C;  1MOF A;  4JGS A;  1Y66 A;  4FK5 C;  1QCE A;  4G2K A;  5KA5 A;  1I5X A;  3CYO A;  1DF4 A;  3GWO A;  3WFV A;  2M7W A;  1QR8 A;  1MG1 A; 
#chains in the Genus database with same CATH topology
 1F23 A;  4AHC A;  4BW9 A;  4UVC A;  4I0X A;  5CBF A;  4JTC B;  3CXC U;  1HNW B;  4WCE V;  1TVK A;  4DYL A;  3JD1 A;  4X8A A;  4E4E A;  4GYC B;  2WA3 A;  5H9C A;  4AQY O;  5KMG B;  4DR5 O;  5B1B B;  4FK5 C;  2X0L A;  1VQK V;  3EVK A;  5FNV B;  2RJZ A;  3OT7 A;  2HHH O;  4DV0 O;  4MW8 A;  4RO2 A;  4RQE A;  2DW4 A;  3ZHR A;  1NKD A;  2VQE B;  4X62 B;  1LNQ A;  1M5I A;  3Q4H B;  4NTY A;  1ZUQ A;  2UUA B;  5LMU B;  1YDX A;  1VQ7 V;  2LFS A;  4F6E A;  3ZX6 A;  4ASU G;  5LBQ A;  5H2F Z;  4DR6 B;  2UXD B;  2UU9 B;  3JAW A;  2QKA A;  2Y0I A;  2ZE5 A;  1G4Y B;  3SPG A;  4GLX A;  1DGS A;  3ASO C;  1DF5 A;  2P06 A;  1WPX A;  4DR2 O;  4JYC A;  3TCU A;  2VQE O;  1P7B A;  4LWS A;  1URF A;  4DR4 O;  3O9O A;  4DUY B;  3SJA C;  1N36 O;  1WNS A;  4WFE A;  4R6Z A;  5GTH Z;  3UO2 A;  1VEW A;  3J7A U;  3E8B A;  4LF9 O;  1TA8 A;  2G38 A;  1N32 B;  2YXH A;  4Q6G A;  4FM0 A;  3DTU B;  2B9Z A;  1K5S A;  5JJN B;  4A5U B;  3K59 A;  4QE9 A;  1OJH A;  2F4V O;  3GB7 C;  1M56 C;  5IY5 B;  1R1B A;  3ZRS A;  3TGU H;  4LF4 O;  3RYH A;  3AG4 C;  4MVR A;  3W7W A;  4KUM A;  2Q73 A;  1R3J C;  1AP5 A;  3A0R A;  1VF5 B;  1XHX A;  4NXM B;  5EBW C;  4YJ2 A;  1Q81 W;  5J2T B;  3ASN B;  2LGW A;  2JIZ G;  2P7T C;  3T4D A;  1NH2 D;  4UCO A;  5LXT A;  3G6B A;  3A2F A;  1IXM A;  1S5J A;  3PN1 A;  4LF7 O;  1FAF A;  1WP8 A;  1YJ9 V;  1XQ8 A;  4KP4 A;  5KAI Z;  4RQF A;  2X7R B;  1XUQ A;  4I50 A;  2AXT Z;  2QWO B;  2EIK B;  1FFT B;  4P9P A;  2KG7 A;  2WLK A;  3RWR D;  1AVM A;  4LF7 B;  1VF7 A;  3UO3 A;  5DEC A;  1YIJ V;  4ZHQ B;  3HKB B;  4JYA O;  4JF3 A;  3H1K H;  3TK1 A;  1I0H A;  1I5X A;  2BTO A;  4QJF B;  2R70 A;  1WP7 A;  5C8Y B;  1JJO A;  4QIW F;  3BCC H;  1YJN V;  4K3A A;  3ZRX A;  1CXZ B;  3CE2 A;  3E8H A;  1Q8I A;  4LFB O;  1TAE A;  3CC4 V;  4FM1 A;  1RP3 B;  5B1A C;  1YI2 V;  2EIN B;  1SS3 A;  4GCZ A;  1XNQ B;  1KB9 F;  2ODM A;  1AI7 A;  1SQV H;  3SJC C;  1DF4 A;  3ABU A;  1YEW A;  2YS8 A;  4MTX A;  2YIB A;  1GK9 A;  2X6C A;  2Y0P A;  1GN6 A;  5D5Q A;  3K0D A;  4PA6 A;  4JI2 O;  1Q6I A;  1H2S B;  1R6N A;  3I56 V;  3JAS A;  1XMO O;  1JQ0 A;  5JJJ B;  2ZM6 B;  2YI9 A;  2BOC C;  3CCS V;  1KC8 W;  4LFC B;  4MSW C;  2R72 A;  1QR9 A;  2PUS A;  2GHY A;  1HNX O;  2P90 A;  3APQ A;  4NR1 A;  1K34 A;  5JCO A;  1GN3 A;  2Q6A A;  2Q8V A;  5B5E Z;  3JYC A;  4IT5 A;  1NVP B;  4YHH O;  3JAK B;  2D3O W;  5A9G A;  3BPZ A;  1NQT A;  3JAM N;  3CCJ V;  2EIL C;  4B7K A;  1TUB B;  4Q20 A;  3SPJ A;  5LA6 A;  2PYL A;  2E75 B;  3HKD B;  1HNX B;  4L87 A;  2L35 A;  4CH6 A;  4AI8 A;  3P3N A;  3P32 A;  2H8P C;  3SYP A;  3X2Q C;  3TJT A;  3IFX A;  2GDS A;  1SRY A;  2OCC B;  4PA3 A;  5J2T A;  4FFB B;  4GX2 A;  3HB3 B;  2Q9L A;  1Z5V A;  3L72 H;  1YTF D;  4NB5 A;  3WB1 A;  1J5E B;  5E1A C;  1SZT A;  2ADP A;  1M4U A;  1KD1 W;  4TV8 B;  2BCC H;  4JAU A;  4DR5 B;  2IH1 C;  3ZN0 A;  2JEU A;  3KCY A;  4YIP A;  5IT9 N;  4K0K O;  2PYJ A;  3CRQ A;  2UUA O;  4D6T H;  3FB5 C;  3D8C A;  2DYR C;  2FL4 A;  3BY6 A;  1TGO A;  4TT3 G;  4JAS A;  4DXW A;  3RW0 A;  2CH7 B;  1OCO C;  2N74 A;  4NTX A;  5FNV A;  1Y76 B;  1L8D A;  3OFN G;  2YXY A;  4X20 A;  4X1I A;  3B4S A;  1VQL V;  2R9R B;  1EN4 A;  5IJ0 B;  5DN6 G;  3MHS C;  1YHQ V;  1OCZ C;  2IJK A;  3CME V;  2GUZ A;  2ZE6 A;  2YUA A;  1G6U A;  2RN9 A;  4MTO A;  1XNQ O;  2D2C B;  1AJQ A;  4JYY A;  5LP6 C;  3LNM B;  5EBL C;  1I94 B;  2E5L B;  3CS5 A;  4EB6 B;  2WLI B;  4B08 A;  5FL7 G;  5KHH A;  3JAR A;  4JI3 B;  2WPD G;  1S0V A;  4UUJ C;  2F4V B;  2JRI A;  2E76 B;  4IYH A;  4UCS A;  4XDJ A;  4ZI7 B;  2VWJ A;  2XND G;  5LA6 B;  4DR2 B;  4DV6 B;  2GBO A;  4JI1 B;  1H2M A;  4U7N A;  2QA4 V;  4DV1 B;  1PKX A;  3JAR B;  4TV9 B;  5H6Q A;  3K58 A;  1Y6X A;  2DOS A;  3OUF A;  3CRM A;  4J9Y B;  2V1D A;  2CGO A;  2LQT A;  3HKC A;  1R6K A;  4EEQ A;  2KSD A;  5CA3 A;  5KUK A;  3G71 V;  1MSD A;  1SQX H;  1BT8 A;  1VQN V;  1R3K C;  3I5D A;  5EC1 C;  2UUB O;  1M93 A;  2KG7 B;  3FAV B;  3KCX A;  3SPH A;  2ADQ B;  1NR1 A;  2RCV A;  1L0N H;  4I55 A;  3RGB A;  1M1K W;  1K7D A;  2IJJ A;  5JH7 A;  5BMV B;  4J7K A;  2KKW A;  2QWR B;  4MT8 A;  1CP9 A;  1XDC A;  2UXN A;  3M8A A;  4TUY A;  4NTW A;  2W0F C;  4XDL A;  2BTQ A;  4JI8 O;  4PA4 A;  5CBH A;  3MD0 A;  1XBL A;  4X62 O;  3ETE A;  1EFR G;  3DXR B;  3AG2 C;  3MDS A;  1N34 O;  1R6T A;  5CB4 B;  1Y4M A;  4MTF A;  3K0G A;  2AZ0 A;  3DC6 A;  1GN4 A;  3L75 H;  2JS5 A;  1NTK H;  4KL1 A;  3RVZ A;  2NR5 A;  2O57 A;  1F51 A;  4D7S A;  3HKB A;  5GON A;  4WFG A;  4I5S A;  5K1P A;  4RUE A;  3BA9 A;  3CJH A;  4LWS B;  3QTC A;  2ARH A;  1AR1 B;  1Q3E A;  4QPK A;  5JH7 B;  3EFF K;  4C7U A;  1O9G A;  1XOU A;  3UKM A;  1WB7 A;  2WA4 A;  5BXZ A;  3DXR A;  3WFV A;  1XL4 A;  1EBO A;  1FXK A;  3UT5 A;  5CBG A;  3ASO B;  3MHH C;  4OPH A;  1K33 A;  2BTQ B;  3CPW U;  4FLX A;  5D5P A;  3IC7 A;  3OTO B;  4WFB V;  4I4T B;  2DYR B;  4F4L A;  3T4Z A;  1MZE A;  4N21 A;  3UM7 A;  4U3J B;  3HKC B;  1SF9 A;  1G1X B;  2ZNJ A;  5L3C A;  4B3T B;  5EC2 C;  2UXC B;  4XBF A;  3ABK C;  5FPR A;  4GKJ O;  3G4S V;  2ITD C;  4LF9 B;  5CA0 A;  2VRZ A;  1OV9 A;  3G80 A;  3ZHS A;  3CCE V;  5K1X A;  3B09 A;  4I9W A;  1AI6 A;  5LP6 B;  4ZBM A;  1M56 B;  4DV3 O;  4HNA A;  3JCU Z;  3KG2 A;  1VQ5 V;  2UXB O;  2XOK G;  1KBH A;  3G6E V;  2CTQ A;  5KA6 A;  4PDL A;  2WLM A;  4ZIB A;  1S5L Z;  3OEH G;  5BMV A;  3ZRW B;  4DUZ B;  1V55 B;  2PGG A;  5J2U B;  4Z1V A;  3CMA V;  3BHP A;  4BAY A;  1IBK B;  5LOV A;  2XHB A;  4O4H B;  1J5E O;  3RFR A;  4OX9 O;  4GZR B;  3BAA A;  1TUE B;  3HKE A;  1IBL O;  3RYC A;  3E89 A;  4H37 A;  1EM1 A;  1Z2G A;  1K97 A;  4CC5 A;  3CC7 V;  4BR6 A;  3CCV V;  3K57 A;  2E3C A;  3RYF B;  4FZ0 A;  5H5N A;  3ABM B;  2IM9 A;  5EIB C;  3ZMZ A;  5F2V O;  1N34 B;  5KAF Z;  1TVK B;  2XAF A;  5LHI A;  1JFF B;  1ZL8 A;  3GVM A;  3C90 A;  2W0X A;  1H38 A;  3B40 A;  5BR8 O;  5JJE B;  5CMU A;  4DV7 B;  5IJ9 B;  3OTF A;  4J80 A;  1BCC H;  3VOU A;  3IGA C;  3JAL B;  5IE9 A;  2UXD O;  4DO2 A;  4LFA O;  1L0L H;  3AEI A;  3L9D A;  4BIZ A;  2LW7 A;  2FB5 A;  4H0L B;  4MVU A;  4FLU A;  4UV8 A;  3RBZ A;  2V7Q G;  4DV7 O;  1QLE C;  1SQB H;  3SPC A;  4KXR A;  5JWP A;  5HFL A;  4DV6 O;  1X4T A;  1NH2 B;  4TSF G;  3WB0 A;  1EN6 A;  4CZZ A;  5EBM C;  5KHK A;  3D36 A;  4JI0 O;  5L3F A;  1FJG O;  4PDM A;  1MAB G;  1TUB A;  1ZSP A;  2JGU A;  2WAM A;  1FS0 G;  2ZQM A;  1S72 V;  1BMF G;  1NTZ H;  4OPA A;  1OCC C;  1NU1 H;  4HNA B;  2F43 G;  1WN7 A;  2CGN A;  2EBO A;  4GX5 A;  4D7T A;  1JOY A;  1OCO B;  1B6Q A;  3N2G A;  2GTA A;  2WLL B;  4E2L A;  1IBM O;  5CA1 B;  1HNZ B;  1FXV A;  1LR1 A;  4O4H A;  3PJS K;  1R3I C;  2YIB D;  2Y69 C;  3GWK C;  3L70 H;  3QVN A;  5KX5 A;  1ZWI C;  4W4K A;  1XHZ A;  5L3B A;  3JD0 A;  2Q0A A;  1EZV H;  3CP1 A;  1XEQ A;  2JEX A;  2YSU B;  3O65 A;  2ETN A;  4UCT A;  4LC1 A;  1ZL8 B;  3LSS A;  2XAS A;  5LGT A;  2LW1 A;  3QF7 A;  3J81 N;  4GKK O;  1HNW O;  1LUW A;  3ABL B;  4BIU A;  2W6J G;  5KLV H;  1ZX3 A;  2QDO A;  4CH4 A;  2QGN A;  1DTO A;  2F1M A;  4PDV A;  3KKY A;  3FYE B;  3CCU V;  3SR2 C;  2OWO A;  4LNU A;  4JTA B;  1N36 B;  3H1I H;  4X64 O;  2HR3 A;  1ZAU A;  3U0Z A;  2XAG A;  2K1E A;  4WFF A;  4X1K B;  4RWU A;  2OT5 A;  4P9O A;  4DUY O;  1IX9 A;  4FMT A;  5IYC O;  1QCE A;  1B3Q A;  1KEC A;  5LMN O;  3ICX A;  1VQ4 V;  4LNU B;  3W7S A;  3CRR A;  4QNH B;  4X89 A;  1X59 A;  1AR5 A;  1XMQ O;  2N05 A;  4EKW A;  2XT9 A;  3CCQ V;  3BAB A;  4FPP A;  4RAI A;  1XMQ B;  3AG3 B;  2PI5 A;  3RYH B;  3DSQ A;  3OR7 C;  3STL C;  1NR7 A;  4HYO A;  1GN2 A;  1H8E G;  3OMN B;  5EZY A;  1PPJ H;  2Q7H A;  3OMI B;  3BA8 A;  1AJN A;  1MSW D;  1NBM G;  2UXB B;  2ZKO A;  3IC9 A;  2B1I A;  3ZHU A;  4FLY A;  2IU3 A;  4TV9 A;  3CB2 A;  3LUT B;  4JYB A;  1P84 F;  1KKC A;  2FML A;  4AIL C;  4FM2 A;  1QLE B;  1MOF A;  1PD3 A;  5BZB A;  1K3E A;  3NR7 A;  2QWQ B;  5LGU A;  5JVD A;  4DV1 O;  1H2L A;  2QE7 G;  3E22 B;  1VF6 A;  4I50 B;  3RVY A;  3S3W A;  3H9V A;  2P6J A;  5TIS Z;  2NLJ C;  2YEV B;  4U3J A;  3J80 N;  2CUG A;  3ZS8 C;  1IBL B;  3FAV A;  3STZ C;  4O4L A;  2OYQ A;  4TUY B;  4DV0 B;  1I7F A;  4PA7 A;  3CWB H;  1VF6 C;  4CS2 A;  1FYJ A;  5J9P C;  2W6I G;  1XIL A;  1ORQ C;  1Q43 A;  2AHZ A;  2NNU A;  4JYA B;  1GRJ A;  3ML0 A;  4LF6 O;  4MS2 A;  4NKG B;  4J7Z A;  4JI5 O;  3QO7 A;  4X9Q A;  1H2G A;  5CB4 A;  5ITZ A;  3JAL A;  1PL4 A;  3CJH B;  4N23 A;  2DWE C;  3E22 A;  1WPB A;  1B06 A;  4YIO A;  4JI5 B;  2DJV A;  4MVZ A;  4LFB B;  2A0L A;  1VQP V;  4JGS A;  4R7C A;  5BR8 B;  1F4N A;  3QO5 A;  3F5W C;  2GSM B;  5KHI A;  2X6B A;  3E86 A;  1BS3 A;  3SYQ A;  1QVF U;  3R65 A;  2EIN C;  3WB2 A;  4UV9 A;  3JSN A;  3RYC B;  1KP2 A;  2ZDI A;  4FLV A;  2CTW A;  2R9I A;  4UCR A;  4ICG A;  1GM9 A;  3OMA B;  4H13 B;  1YZB A;  3K5M A;  2IBZ H;  1OHH G;  2FTK A;  3ABL C;  4CH3 A;  1WLE A;  2UU9 O;  3N27 A;  4X1Y A;  4B3S O;  3K5O A;  1ZLZ A;  5C93 A;  4MVM A;  1JX9 A;  1NTM H;  1KUQ A;  2QR4 A;  3CEI A;  3HR0 A;  3H1H H;  2Q69 A;  4IL6 Z;  1N33 O;  2QJ1 A;  3JAW B;  3APO A;  4MW3 A;  4J10 A;  4O2B A;  2GUZ B;  2IW5 A;  4CS3 A;  2VQF O;  4MTG A;  1NT2 B;  3OE7 G;  3VQV A;  3VQX A;  1XL6 A;  1VMG A;  2KB1 A;  4F6R A;  2DE0 X;  4DV2 B;  2HKO A;  3AK2 A;  4FLZ A;  2VQF B;  1M57 C;  1M9N A;  4DR3 O;  1PM9 A;  1IBM B;  5AG2 A;  1KMI Z;  1N4C A;  2OTL V;  5C8Y A;  3P30 A;  4YY3 B;  2WLI A;  1PNK A;  2YI8 A;  4J9Z B;  3IAY A;  1PV0 A;  4LFC O;  3ZRW A;  2F23 A;  2EJ7 A;  3HKE B;  3B2E E;  3K5N A;  5LOV B;  1HWY A;  4YHH B;  1Q5O A;  2QWN B;  5IY5 C;  3VBB A;  4OXS A;  4K8Z A;  1NVP D;  1B04 A;  2A3Q A;  4LR3 A;  4FFB A;  1SQP H;  2R9A A;  5KX5 B;  4PHZ A;  2PI4 A;  2Q5Z A;  3T1Y B;  3Q4H A;  4OX9 B;  1SQQ H;  4NXN O;  3A0B Z;  5A2Q N;  4GT1 A;  5IJ9 A;  4G27 B;  4X20 B;  4LF5 B;  4LFA B;  3T1Y O;  1EZJ A;  1JA8 A;  5LMU O;  2JVD A;  4MVQ A;  1K4D C;  2EIK C;  4PV1 B;  1KKD A;  4W4L A;  4JI7 B;  5CA0 B;  1V54 C;  3VQW A;  2Y69 B;  3T1C A;  1V9P A;  1E1R G;  3OGC C;  2PZS A;  2H94 A;  2A06 H;  4JPR A;  1IUR A;  3ZHT A;  4CC6 A;  3H1J H;  1I94 O;  1AR4 A;  4X1Y B;  4TOI A;  2CK3 G;  3OEE G;  1JPX A;  2OTJ V;  2WSS G;  4B3R B;  3L71 H;  4H33 A;  2K9P A;  1CPY A;  4R50 A;  1QLN A;  1XRE A;  4TQD A;  2DYS B;  4DR7 B;  3RN4 A;  2FYU H;  1T5E A;  3K04 A;  2Y4T A;  3ZJZ A;  1SC5 B;  3K5L A;  2AGA A;  3AG1 B;  1NI8 A;  3CRC A;  4DR7 O;  4CS4 A;  3FD9 A;  4O2A A;  1O9H A;  4HZ3 A;  4X88 A;  5EYP B;  4UXN A;  1P4R A;  3WG7 B;  2E5L O;  1BQ0 A;  3JAT B;  2HJD A;  2Q4P A;  2B1G A;  1THZ A;  5L3G A;  1K4C C;  5JCO C;  2YXL A;  1IVS A;  1FXH A;  3LSQ A;  1FD9 A;  2XTA A;  1Y74 B;  5DED A;  4UFZ A;  1MA1 A;  5CN0 A;  2PTM A;  4ZOL A;  4ZKI A;  1HNZ O;  4LBE C;  2KQX A;  4GUN A;  1MG1 A;  3ABK B;  4B7E A;  4MVS A;  4PD4 F;  1SQF A;  2BSK B;  4PA9 A;  2C2A A;  4DK0 A;  1D2D A;  5JQG A;  2CAZ C;  1M57 B;  1HDJ A;  3W7T A;  1KQS U;  5H6R A;  1PL0 A;  4I7Z B;  1AI4 A;  3N2K A;  1G8M A;  1YVW A;  1GAX A;  4EFE A;  2RQ6 A;  4J7J A;  4Z2W A;  3SYO A;  2HP8 A;  4KHP B;  1UJW B;  2HJF C;  5EIB D;  4UVA A;  4X64 B;  1DLB A;  4JI8 B;  1V55 C;  1KP3 A;  1GO3 F;  4LH7 A;  4DR6 O;  1BGY H;  1SA0 B;  2UXX A;  3ETQ A;  2HHH B;  4PI2 A;  3A8T A;  3CRA A;  4DV4 O;  3H1L H;  2Y4U A;  3A0H Z;  5LYJ A;  3FB7 C;  1XNR O;  4X65 B;  3E8G A;  4I4T A;  4MVO A;  3QG5 A;  2IJH A;  1FXK C;  2JDI G;  1BHA A;  1BQZ A;  2QSA A;  4IYI A;  4B3T O;  2A7W A;  5LMN B;  2F66 C;  3K9S A;  1PNL A;  3ZBH A;  5HFM A;  2ZIN A;  4DW0 A;  2YC0 A;  4DV3 B;  3ETG A;  2DQ3 A;  1W59 A;  2UUB B;  1YXB A;  4UVB A;  4P30 A;  1QNM A;  3F5T A;  1VQ9 V;  3BRC A;  2Z3Y A;  1PNM A;  4DW1 A;  3CD6 V;  1IZ3 A;  1QR8 A;  2ILM A;  5FPO A;  1BHB A;  2A9H A;  2DYS C;  4JAV A;  3B8M A;  4JZG A;  1Q6U A;  2F95 B;  2ZXW B;  3JSL A;  2UXC O;  2HFE C;  2Q7G A;  4IIJ A;  1YSC A;  2YIC A;  1SER A;  1SKV A;  1AB3 A;  2F93 B;  4K35 A;  5IYD O;  2Q0O C;  3OD4 A;  2XAQ A;  4LH6 A;  5B1B C;  1KYO F;  3R66 A;  4BWA A;  2BE3 A;  2A79 B;  2N04 A;  2QKC A;  4O4L B;  2EJR A;  5KHJ A;  3S3X A;  4QGP A;  5B1A B;  3RT3 C;  2YEV A;  4O4J B;  3IJ4 A;  1K73 W;  2OIG A;  4G28 B;  3K03 A;  4NXM O;  3OR6 C;  3TET A;  2RNB A;  2LP7 A;  3FFQ A;  4ABM A;  5CA1 A;  2B5U A;  3D3Q A;  1Y67 A;  4FLW A;  1K9M W;  4HBN A;  1N0J A;  4IIJ B;  1BE3 H;  1S77 D;  3UQ8 A;  5L3D A;  3D3I A;  4IHJ B;  4U7O A;  5B1N A;  1HP8 A;  1JFF A;  1LUV A;  1SQG A;  3ZED A;  4YJ3 B;  4PEL A;  1OCR B;  2P67 A;  2ZE8 A;  1YF2 A;  4HAM A;  1JMK C;  1K5Q A;  2EZP A;  2M6Y A;  4J41 A;  3K79 A;  4NXN B;  5IYB O;  4ZI7 A;  1K92 A;  1JJ2 U;  3HPL C;  3FYI B;  3GWO A;  4ZHQ A;  2Z5U A;  3OGI B;  4CH5 A;  4YJ3 A;  3T1H B;  3M7M X;  1WAZ A;  1RSO A;  4DV4 B;  1R73 A;  3BFR A;  1L1F A;  2UUC B;  4X65 O;  1WJZ A;  3RYI B;  1FJG B;  2H3O A;  1DK1 A;  1JCH A;  4I0X B;  2MW2 B;  3T1H O;  4DV5 B;  2LGQ A;  1GMG A;  1RPO A;  1RFY A;  3AG4 B;  1WA8 A;  3SPI A;  4JI2 B;  4B3S B;  1SES A;  2WLN A;  2ATK C;  5LL6 Y;  2VWK A;  1Y74 A;  3U11 A;  4DV5 O;  4LP8 A;  2GV9 A;  5ITZ B;  2LJ2 A;  2YIA A;  2Y48 A;  2AZ2 A;  3SYA A;  3ZIA G;  2P4K A;  3ZMT A;  5E79 Z;  1COW G;  1US6 A;  1YJW V;  2Q67 A;  4JI3 O;  3B8N A;  2CDY A;  3ZCC A;  3AG3 C;  3X2Q B;  5B3S B;  4O4I A;  2QWP B;  2YID A;  5GTI Z;  1Q86 W;  2BOB C;  3OUS A;  4RUF A;  4DR3 B;  2X6A A;  1UFI A;  1W2B U;  3LSU A;  3THO A;  5KA5 A;  3T2M A;  1JVM A;  5LYJ B;  4K0K B;  1GTO A;  2ZR2 A;  3KZI Z;  3EXA A;  3B77 A;  5BY1 A;  5GW7 A;  4AQY B;  3ZN1 A;  4U3F H;  2XAJ A;  4I9Q A;  3TXQ A;  3CC2 V;  3AK1 A;  1IXB A;  1RPR A;  1VIB A;  2OCH A;  2XAH A;  1NJI W;  1VP7 A;  4PJ0 Z;  4K8X A;  2EIJ C;  1KU9 A;  4NVP A;  3WG7 C;  2CTP A;  1BL8 A;  3ZHV A;  1E79 G;  2MK3 A;  2Z0A A;  4PI0 A;  3SYC A;  4JI6 B;  4LF5 O;  1GKF A;  3CXH F;  3P3P A;  4Z1M G;  1QBZ A;  5IDJ A;  4R8C A;  1I5Y A;  5KMG A;  4LCU C;  4GX1 A;  2QTO A;  1K8A W;  4JI6 O;  4LF8 O;  1V54 B;  2QTS A;  2AHY A;  3RYF A;  5L3E A;  1VQO V;  2IH3 C;  1Q82 W;  4LF8 B;  1P49 A;  3CCM V;  4WF9 V;  1Q90 D;  2JJ1 G;  1QHT A;  5LGN A;  2PF4 E;  1N33 B;  1F4M A;  5KHG A;  4QE7 A;  5IYZ A;  5IJ0 A;  3WU2 Z;  4X1I B;  4EB6 A;  1XNR B;  4L8J A;  3LDD A;  1FKA O;  4FLT A;  4EFB A;  1JR9 A;  2P4V A;  1HR0 B;  1FFX B;  1P7G A;  3E8F A;  2GTS A;  3UCS C;  2QM8 A;  1WB8 A;  1RM1 C;  1Q7Y W;  3AG7 A;  5LP6 A;  3ZRV A;  4LF4 B;  1HR0 O;  3CYO A;  1F7Y A;  2IJI A;  4O2A B;  5IWA B;  5EYP A;  1ENV A;  3G67 A;  1N32 O;  4H44 B;  1RM1 B;  1HW7 A;  1BSM A;  1FFX A;  2JK5 C;  4FJC C;  3ZMU A;  4DR1 B;  4J11 A;  1FXK B;  3UT5 B;  5LHH A;  3CSX A;  2ZCE A;  4X66 B;  1IDS A;  1N8R W;  2LO1 A;  2ZD9 A;  4LF6 B;  4KFM A;  4GKK B;  1ROP A;  4KHP O;  3AK3 A;  3CCR V;  1PP9 H;  5KUM A;  2ZT9 B;  3OW2 U;  2EIM C;  3ZMV A;  1VAR A;  2DWD C;  3N2G B;  1AI5 A;  1J95 A;  1H8H G;  4YJ2 B;  1D5A A;  4DRX A;  1AP6 A;  1R3L C;  4JZ2 A;  1AJP A;  2EIL B;  5FLX N;  2JS3 A;  2QEX V;  3JAK A;  1NZ6 A;  1YIT V;  4DUZ O;  5EK0 A;  3VQY A;  1SA0 A;  3E35 A;  2RDC A;  2ZXW C;  2EUL A;  4QPJ A;  5GON B;  3CX5 F;  3M99 B;  2DN9 A;  1QVG U;  3OTO O;  3QNE A;  2Q68 A;  4GX0 A;  3JD3 A;  4CBC A;  2ZIO A;  3BVO A;  3FKS G;  4JAA A;  4DRX B;  1XMO B;  3LDE A;  2EIJ B;  3W7X A;  4GKJ B;  3LDC A;  2ITC C;  1XI1 A;  4JI4 B;  5IYZ B;  4JI0 B;  4FIP C;  3F7Y C;  3FB8 C;  2ZNI A;  4X1K A;  4WFA V;  2QKS A;  2E74 B;  4WBN B;  3C3T A;  4TQF A;  1H2K A;  3RYI A;  4DR4 B;  2HLD G;  2NN4 A;  1OCR C;  3U10 A;  3LNN A;  4UB8 Z;  4JI4 O;  4TWK A;  5DM6 V;  3W7U A;  3K3W A;  4BW5 A;  1YTF B;  3L73 H;  2EIM B;  1OCZ B;  3MAQ A;  2ZDI C;  1VQ8 V;  1W0K G;  4WFH A;  1A32 A;  3AG1 C;  3QO8 A;  1U97 A;  3JAT A;  5IWA O;  5EZY B;  1SET A;  4P2Z A;  5J2U A;  4WBN A;  3ZMS A;  1FPO A;  4O4J A;  2CE4 A;  3EHB B;  2CTR A;  2XUM A;  4DR1 O;  2ZIM A;  2M7W A;  4X66 O;  4UCV A;  4O4I B;  1GM7 A;  4OGQ B;  1NS1 A;  4ZOL B;  4YY3 O;  2IU0 A;  2BSK A;  3FX7 A;  3OM3 B;  5JVD B;  4B3M O;  1N0N A;  2RMK B;  1IBK O;  4JTD B;  3JD4 A;  4DK1 A;  2OIE A;  1BZK A;  2FKX A;  1Z5W A;  1SZX A;  1S3J A;  2HVJ C;  3DC5 A;  2QM4 A;  3JCZ A;  1EN5 A;  3ABM C;  3FB6 C;  4JI7 O;  4IHJ A;  4JV5 O;  3ZHQ A;  1U96 A;  2CH7 A;  3H01 A;  4TV8 A;  3ETD A;  3OAA G;  3N2K B;  2VS0 A;  4B3M B;  1S5H C;  3AG2 B;  3K9A A;  2WLJ A;  2JJ2 G;  4JV5 B;  2V4D A;  1QQC A;  4G2K A;  4YXW G;  2HEP A;  4B3R O;  3NXS A;  2P22 C;  3SDL A;  1QU7 A;  1CEZ A;  3E83 A;  1MZF A;  1OZ0 A;  1WA8 B;  5B66 Z;  1VQ6 V;  4UCU A;  3DGE A;  4J42 A;  2JGD A;  1M90 W;  2OCC C;  4DV2 O;  1I08 A;  1AIL A;  2P5O A;  3L74 H;  2L6L A;  4FVM A;  4JI1 O;  1Y76 A;  3CCL V;  2LFR A;  1H2N A;  2UUC O;  3ASN C;  3ABT A;  3D36 C;  4FFK A;  4PDR A;  2WWW A;  2ZM6 O;  2EZO A;  2JGD B;  2AW9 A;  1ZTE A;  1OCC B;  2DMX A;  2WLH A;  3SJB C;  2ZR3 A;  3F7V C;  3HKD A;  2Q7E A;  3TXS A;  4XDK A;  3BEH A;  2WLL A;  2EX3 A;  3CHX A;  2DQ0 A;  4F6R B;  4FZ1 A;  1MMM A;  1GM8 A;  1GH6 A;  1YCI A;  3K06 A;  4NYK A;  2YDE A;  4O2B B;  3SJQ C;  1VQM V;  2ZE7 A;  3JD2 A;  3I55 V;  3K08 A;  5B1O A;  1Q6H A;  4UB6 Z;  4I55 B;  2HVK C;  5LHG A;  1E1Q G;  5B3S C;  1UPG A;  1MNG A;  5LXT B;  2HG5 C;  2QM7 A;  1W0J G;  4IGG A;  1Y66 A;  3JAS B;  1RSO B;  1D5N A;  3SGI A;  4BIO A;  2PY5 A;  3E2E A;  3C3S A;  1S76 D;  5JQG B;  1ARO P; 
#chains in the Genus database with same CATH homology
 3ZMT A;  1F23 A;  1COW G;  1YJW V;  2Q69 A;  2Q67 A;  3RVZ A;  3B8N A;  4UVC A;  1F51 A;  3AG3 C;  4JTC B;  3ZCC A;  5CBF A;  3CXC U;  4WFG A;  4I5S A;  3X2Q B;  4MW3 A;  4WCE V;  4RUE A;  5B3S B;  3JD1 A;  4X8A A;  2IW5 A;  1Q86 W;  2BOB C;  3OUS A;  4MTG A;  3OE7 G;  1AR1 B;  4RUF A;  1XL6 A;  5H9C A;  4QPK A;  2X6A A;  3EFF K;  1W2B U;  5B1B B;  4FK5 C;  2X0L A;  5KA5 A;  1VQK V;  3UKM A;  2KB1 A;  3T2M A;  3WFV A;  1JVM A;  2HKO A;  1GTO A;  1XL4 A;  2ZR2 A;  4MW8 A;  4RO2 A;  4RQE A;  1EBO A;  1FXK A;  2DW4 A;  5CBG A;  3ASO B;  3MHH C;  3B77 A;  1K33 A;  5GW7 A;  3CPW U;  1M57 C;  1M9N A;  1NKD A;  3ZN1 A;  2XAJ A;  3CC2 V;  1LNQ A;  3IC7 A;  1RPR A;  4WFB V;  2XAH A;  2OTL V;  1NJI W;  3P30 A;  2WLI A;  2DYR B;  4F4L A;  3T4Z A;  1VQ7 V;  1PNK A;  4J9Z B;  2LFS A;  4N21 A;  3UM7 A;  2EIJ C;  4ASU G;  5LBQ A;  3ZRW A;  5L3C A;  5EC2 C;  4XBF A;  3ABK C;  3WG7 C;  1BL8 A;  1G4Y B;  3SPG A;  1E79 G;  3ASO C;  3G4S V;  1DF5 A;  2ITD C;  1WPX A;  2MK3 A;  1HWY A;  4JYC A;  3TCU A;  5IY5 C;  3SYC A;  4OXS A;  3VBB A;  1P7B A;  1GKF A;  1NVP D;  4Z1M G;  1QBZ A;  5IDJ A;  4R8C A;  3CCE V;  4I9W A;  1AI6 A;  4WFE A;  4R6Z A;  4ZBM A;  1I5Y A;  1M56 B;  4LCU C;  4GX1 A;  3KG2 A;  2QTO A;  1K8A W;  2PI4 A;  1V54 B;  1VQ5 V;  2XOK G;  2AHY A;  5L3E A;  1VQO V;  3G6E V;  3E8B A;  5KA6 A;  2IH3 C;  4GT1 A;  4PDL A;  2WLM A;  4G27 B;  1Q82 W;  3OEH G;  3DTU B;  3ZRW B;  1K5S A;  1V55 B;  3CCM V;  4QE9 A;  4WF9 V;  3CMA V;  1EZJ A;  4BAY A;  3GB7 C;  2JJ1 G;  1M56 C;  5LGN A;  4MVQ A;  1K4D C;  1F4M A;  2EIK C;  5IY5 B;  3ZRS A;  1KKD A;  4QE7 A;  1V54 C;  3AG4 C;  4MVR A;  1TUE B;  3W7W A;  2Y69 B;  4KUM A;  3LDD A;  3T1C A;  3E89 A;  4H37 A;  1R3J C;  1E1R G;  3OGC C;  2H94 A;  1K97 A;  3A0R A;  4JPR A;  3CC7 V;  5EBW C;  1Q81 W;  3CCV V;  3ASN B;  2CK3 G;  2JIZ G;  2P7T C;  3T4D A;  3ABM B;  1NH2 D;  3E8F A;  3OEE G;  1JPX A;  2OTJ V;  2QM8 A;  2WSS G;  3ZMZ A;  1RM1 C;  1Q7Y W;  4H33 A;  1IXM A;  2XAF A;  3ZRV A;  4R50 A;  1CPY A;  5LHI A;  3CYO A;  1QLN A;  2IJI A;  1YJ9 V;  1ENV A;  2DYS B;  1H38 A;  4KP4 A;  4RQF A;  2X7R B;  5CMU A;  3K04 A;  2EIK B;  1FFT B;  3ZJZ A;  1RM1 B;  3VOU A;  3IGA C;  4P9P A;  2WLK A;  3ZIA G;  2JK5 C;  4DO2 A;  4FJC C;  3ZMU A;  3AG1 B;  3AEI A;  1YIJ V;  1FXK B;  4BIZ A;  5LHH A;  4JF3 A;  3TK1 A;  4HZ3 A;  4MVU A;  2ZD9 A;  4X88 A;  1N8R W;  1I5X A;  4UXN A;  4QJF B;  1P4R A;  3WG7 B;  4UV8 A;  3RBZ A;  4KFM A;  1ROP A;  2V7Q G;  4QIW F;  1QLE C;  3CCR V;  3SPC A;  1YJN V;  2B1G A;  5KUM A;  1THZ A;  5HFL A;  5L3G A;  1NH2 B;  1K4C C;  4TSF G;  3OW2 U;  3ZRX A;  2EIM C;  4CZZ A;  5EBM C;  1FXH A;  2DWD C;  3E8H A;  3LSQ A;  3ZMV A;  1AI5 A;  1J95 A;  1H8H G;  3CC4 V;  3D36 A;  5B1A C;  5L3F A;  1YI2 V;  5CN0 A;  1R3L C;  4ZKI A;  4PDM A;  2EIN B;  1MAB G;  4GCZ A;  4LBE C;  1AJP A;  2EIL B;  2QEX V;  1AI7 A;  2WAM A;  1DF4 A;  1YIT V;  3ABU A;  5EK0 A;  1FS0 G;  1MG1 A;  3ABK B;  2ZQM A;  1S72 V;  1BMF G;  3E35 A;  4MTX A;  2ZXW C;  1OCC C;  2F43 G;  1GK9 A;  2X6C A;  4GX5 A;  1JOY A;  2EBO A;  4MVS A;  3K0D A;  4QPJ A;  4PA6 A;  4PA9 A;  1OCO B;  1B6Q A;  2C2A A;  2WLL B;  4E2L A;  1R6N A;  3M99 B;  3I56 V;  1QVG U;  1JQ0 A;  1M57 B;  1FXV A;  3W7T A;  3QNE A;  2Q68 A;  1KQS U;  4GX0 A;  5H6R A;  3PJS K;  1PL0 A;  1R3I C;  2BOC C;  2Y69 C;  1AI4 A;  3JD3 A;  3CCS V;  1KC8 W;  1G8M A;  4MSW C;  1QR9 A;  4CBC A;  2GHY A;  3SYO A;  1ZWI C;  3FKS G;  1UJW B;  2HJF C;  2P90 A;  3LDE A;  2EIJ B;  1K34 A;  3W7X A;  4UVA A;  5L3B A;  3LDC A;  2Q6A A;  3JD0 A;  3JYC A;  2ITC C;  1DLB A;  1V55 C;  1NVP B;  1KP3 A;  3CP1 A;  1GO3 F;  2D3O W;  2JEX A;  1NQT A;  2YSU B;  3CCJ V;  2UXX A;  2EIL C;  4FIP C;  3F7Y C;  3FB8 C;  4Q20 A;  4WFA V;  2QKS A;  3SPJ A;  4LC1 A;  3LSS A;  2XAS A;  5LGT A;  4L87 A;  3FB7 C;  3E8G A;  2HLD G;  3P32 A;  2H8P C;  3SYP A;  3X2Q C;  4MVO A;  1OCR C;  3IFX A;  1SRY A;  2OCC B;  4TWK A;  5DM6 V;  2IJH A;  4PA3 A;  3W7U A;  1FXK C;  3K3W A;  2JDI G;  1BHA A;  4BW5 A;  3ABL B;  4GX2 A;  3HB3 B;  1YTF B;  2EIM B;  4BIU A;  1YTF D;  2W6J G;  1OCZ B;  2ZDI C;  1VQ8 V;  1DTO A;  1W0K G;  4PDV A;  4WFH A;  3AG1 C;  3FYE B;  3QO8 A;  3CCU V;  1PNL A;  5E1A C;  1SZT A;  5HFM A;  4JTA B;  1KD1 W;  1SET A;  4P2Z A;  4JAU A;  2IH1 C;  2HR3 A;  2JEU A;  3ZN0 A;  3ZMS A;  2XAG A;  2K1E A;  4WFF A;  3ETG A;  2DQ3 A;  2OT5 A;  3EHB B;  4P9O A;  4UVB A;  4P30 A;  1VQ9 V;  4FMT A;  5IYC O;  1QCE A;  1KEC A;  2Z3Y A;  1PNM A;  3CD6 V;  3FB5 C;  1VQ4 V;  2M7W A;  1QR8 A;  3W7S A;  2DYR C;  4QNH B;  4X89 A;  1BHB A;  2A9H A;  3BY6 A;  2DYS C;  4JAV A;  3B8M A;  4TT3 G;  4EKW A;  1GM7 A;  4JAS A;  3CCQ V;  2ZXW B;  4DXW A;  3RW0 A;  4FPP A;  2IU0 A;  1OCO C;  2HFE C;  4RAI A;  1YSC A;  3OM3 B;  1SER A;  3OFN G;  4JTD B;  5IYD O;  3JD4 A;  1VQL V;  3AG3 B;  2R9R B;  2PI5 A;  2XAQ A;  5DN6 G;  3MHS C;  5B1B C;  3OR7 C;  3STL C;  1YHQ V;  1NR7 A;  4HYO A;  1OCZ C;  2IJK A;  3CME V;  1H8E G;  2A79 B;  3OMN B;  2EJR A;  4MTO A;  1S3J A;  2HVJ C;  3JCZ A;  3ABM C;  3FB6 C;  3OMI B;  2YEV A;  5B1A B;  1AJQ A;  1AJN A;  1MSW D;  1NBM G;  3LNM B;  5EBL C;  3H01 A;  3ETD A;  3OAA G;  2B1I A;  2WLI B;  1K73 W;  2IU3 A;  1S5H C;  5FL7 G;  3AG2 B;  4G28 B;  3K03 A;  3LUT B;  3OR6 C;  4JYB A;  3TET A;  3K9A A;  2LP7 A;  2WLJ A;  2JJ2 G;  1QLE B;  2WPD G;  1S0V A;  4UUJ C;  2B5U A;  1MOF A;  1PD3 A;  4G2K A;  5BZB A;  1K9M W;  1K3E A;  4XDJ A;  4YXW G;  5LGU A;  2QE7 G;  2XND G;  3NXS A;  3RVY A;  1CEZ A;  1S77 D;  2P6J A;  5L3D A;  3E83 A;  2NLJ C;  2YEV B;  3D3I A;  4U7O A;  5B1N A;  1OZ0 A;  4U7N A;  2QA4 V;  1VQ6 V;  3DGE A;  3STZ C;  1M90 W;  2OCC C;  4PEL A;  1OCR B;  1PKX A;  4PA7 A;  5H6Q A;  2P67 A;  4HAM A;  3OUF A;  1K5Q A;  4J9Y B;  2EZP A;  2V1D A;  3CCL V;  3K79 A;  5J9P C;  2W6I G;  5IYB O;  2LFR A;  1ORQ C;  1R6K A;  1K92 A;  1JJ2 U;  3ASN C;  2AHZ A;  2NNU A;  3FYI B;  3GWO A;  3HPL C;  5CA3 A;  5KUK A;  3G71 V;  3ML0 A;  3ABT A;  2Z5U A;  4PDR A;  4MS2 A;  1VQN V;  2WWW A;  1R3K C;  5EC1 C;  2EZO A;  3QO7 A;  1OCC B;  1H2G A;  2WLH A;  1R73 A;  2ZR3 A;  3F7V C;  3SPH A;  1L1F A;  1NR1 A;  4N23 A;  4XDK A;  2DWE C;  3BEH A;  2WLL A;  1JCH A;  1M1K W;  2DQ0 A;  4MVZ A;  1K7D A;  2IJJ A;  2A0L A;  1GMG A;  1RPO A;  4JGS A;  4R7C A;  1VQP V;  1F4N A;  1GM8 A;  4MT8 A;  3AG4 B;  3QO5 A;  1CP9 A;  3F5W C;  3K06 A;  2UXN A;  2GSM B;  2X6B A;  3SJQ C;  3E86 A;  1VQM V;  3JD2 A;  3I55 V;  2W0F C;  3K08 A;  4XDL A;  3SYQ A;  1QVF U;  3SPI A;  5B1O A;  3R65 A;  2EIN C;  4PA4 A;  5CBH A;  3MD0 A;  1SES A;  3ETE A;  4UV9 A;  1EFR G;  2HVK C;  2WLN A;  1E1Q G;  1KP2 A;  2ATK C;  2ZDI A;  5B3S C;  3AG2 C;  5LHG A;  2R9I A;  1GM9 A;  3OMA B;  2HG5 C;  2QM7 A;  1W0J G;  4LP8 A;  1OHH G;  3ABL C;  1Y4M A;  2FTK A;  4MTF A;  1WLE A;  1Y66 A;  3K0G A;  2Y48 A;  3E2E A;  5C93 A;  3SYA A;  1S76 D;  4MVM A;  1JX9 A;  1ARO P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...