2LP7A

Structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 11
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lp7A00
1I5YA 1I5XA 4FIPC 3M99B 4JGSA 1ENVA 4JF3A 1JPXA 3MHSC 1F23A 4JPRA 5HFLA 1MG1A 2P6JA 1K34A 3B8NA 4N23A 1DLBA 3K9AA 3B8MA 1SZTA 5H9CA 3WFVA 2M7WA 2OT5A 3CP1A 3MHHC 1QR9A 3B77A 4FK5C 4N21A 5KA6A 5HFMA 3GWOA 5CN0A 1JQ0A 2EZPA 3CYOA 1QCEA 1Y4MA 2LP7A 2EBOA 5KA5A 1DF5A 4FJCC 1QBZA 3H01A 1EBOA 1K33A 1MOFA 4G2KA 2EZOA 5CMUA 1QR8A 1DF4A 4E2LA 2X7RB 3P30A 1Y66A 2MK3A
chains in the Genus database with same CATH superfamily
2K9PA 4U7OA 4UCSA 2LW1A 4TV9A 4PI0A 2L35A 1MG1A 1SQBH 3CE2A 2XAQA 2IJJA 3SYQA 5J2UA 4O4LB 3D36C 3GWOA 1FFXA 2Q5ZA 4TUYA 1TA8A 3JALB 3RGBA 5H5NA 1Y74A 1JOYA 3VQYA 4BIZA 2QDOA 4U3JA 2GSMB 1OCCB 4AQYO 2PYLA 2E76B 3A8TA 3Q4HA 2YEVB 2QGNA 2WLNA 1UPGA 4RQEA 2EJ7A 1KC8W 3EFFK 4EFBA 2JJ2G 1TUEB 1RM1B 2QKSA 1NH2D 1KB9F 5GTIZ 2W6IG 3WFVA 1NVPD 4DR6B 2RN9A 4KFMA 1J5EB 4B3TO 4B3SO 5L3DA 5LGTA 2WLLB 1AVMA 3BRCA 3X2QC 1DTOA 2Q0AA 1MABG 4I55A 1KYOF 3T1CA 1Y6XA 1HNWO 3AG1B 3OFNG 5LHGA 5LXTA 2EJRA 2BSKA 4HAMA 4TQFA 4MVOA 1LUVA 3OMNB 2Q8VA 1OCOB 3I5DA 1K4DC 3LDEA 3UT5B 1ZWIC 3K3WA 1F7YA 2CTRA 1SQVH 2GTAA 2YIBA 1OCRC 1GH6A 4UCOA 4FIPC 2ZXWC 4JGSA 4I50A 1HNXB 2DYRC 4UB6Z 4DUZO 1I94B 5KHIA 3ABLB 3ABMC 3OGCC 5FPRA 1VF5B 1VQ6V 1GO3F 1N36B 3SYCA 3RBZA 4P9PA 3F7YC 2JS5A 4FLZA 2DN9A 3RT3C 4LH6A 1AR4A 1AP6A 3ASOC 5B1NA 4UCRA 5FNVA 3CMEV 4LF8B 3M8AA 3B2EE 2UXDO 4K35A 1Q3EA 4DR4B 4H44B 3QTCA 1BCCH 3CS5A 2YSUB 3LNNA 4CS2A 1L0NH 4JAAA 3AG4C 5KHHA 1M9NA 5LHHA 1MNGA 1WN7A 2VQFO 2OCHA 3ZCCA 2W0XA 4MVMA 2R9IA 3FB7C 4JI7O 4TV9B 3UQ8A 1BE3H 4LF5B 4X65B 1Y66A 1NT2B 1H2NA 5J2UB 3CXCU 1M56C 3HPLC 3GVMA 4DK0A 4JPRA 1FFXB 4DV6B 3O9OA 4TUYB 4XBFA 4UV8A 3VOUA 1AILA 1YCIA 4PV1B 3D3IA 4GX2A 1Y74B 3PJSK 5D5PA 2CK3G 4LFCO 4U3JB 3C90A 3K03A 3JCUZ 1GRJA 2XT9A 1IBMB 1TAEA 3Q4HB 5EBLC 4QJFB 1LNQA 2AHYA 2Q6AA 3MHSC 1JJOA 2JS3A 3IC9A 5JH7A 1IXMA 5H9CA 2CGNA 3L73H 1MMMA 5B3SB 2F4VO 1DGSA 1L1FA 1K33A 1ORQC 1SRYA 1YEWA 3ETEA 4JF3A 1TUBA 3ZHVA 4X9QA 3OMIB 1QLEB 5IY5B 4ZIBA 3I55V 2D3OW 3F5WC 2CDYA 2ZIOA 5DM6V 4I55B 5BZBA 4MTXA 1JCHA 5KLVH 2BSKB 2LW7A 2OCCB 1XILA 1VF7A 2RDCA 4JI2B 4MT8A 4BWAA 4CBCA 4FMTA 1N34B 4X8AA 1NBMG 1WJZA 1RPRA 4L8JA 3TGUH 4JI3B 4CS4A 1QHTA 3KG2A 5B1AB 3SYPA 4XDJA 3ZMVA 4EB6A 3J80N 1ZUQA 3ZMTA 1V54B 3VQVA 4JI5B 3A2FA 2FL4A 5IDJA 3OM3B 4FVMA 1ZSPA 5CA1B 1BS3A 5CN0A 2Y48A 2QWQB 1GMGA 5FNVB 3IC7A 4D6TH 2R9RB 3L74H 4TT3G 2XAHA 5A2QN 4H13B 2UUCO 4DV5B 1Q90D 4RUFA 4D7SA 4LF7O 4NKGB 1TVKB 3ZN1A 3CCJV 4X64O 2Q9LA 3K9AA 4B7EA 4YY3O 2AZ0A 1XDCA 3CXHF 2NR5A 3RYCA 3OR6C 5AG2A 5EYPA 4EFEA 5IWAB 2OTLV 5H2FZ 2Q68A 3H01A 1XQ8A 1OJHA 3OGIB 3B4SA 2ZDIC 4EKWA 4X89A 3VBBA 3ABUA 5KMGA 2EIKC 4ASUG 1NR7A 4ZI7A 3GB7C 1Q6UA 2BCCH 5LA6A 1WAZA 4LCUC 1NTKH 5IJ0A 3TJTA 4QE9A 2LQTA 5CA3A 5EZYA 4JI1O 4PA4A 2HHHO 1P7BA 3KCYA 4OX9B 1W2BU 1R1BA 2Y4UA 1FJGB 4ICGA 1KUQA 2F43G 3OUSA 2ZKOA 1PNKA 2ZD9A 4Z2WA 4KHPB 2GDSA 4DV0O 3ZHSA 1VEWA 2P06A 1AI5A 4B7KA 3K5LA 1QR8A 2RMKB 4FFBA 4PA9A 2V7QG 4JYCA 5JH7B 1YJ9V 1XMQO 3HKDA 1K4CC 1EZJA 2QKCA 1H2LA 1I08A 3B8MA 2M6YA 1IVSA 4FM0A 2LO1A 1HW7A 4JI4B 1MSWD 4DR3B 1TUBB 1FXKA 2NNUA 4AI8A 1GM7A 3K79A 1MA1A 3CX5F 2YEVA 1WLEA 3CRMA 1NH2B 1M57C 3HKEA 4O2BB 1S5JA 1K9MW 1CEZA 2BOCC 1NVPB 2AW9A 2YUAA 1KP2A 1XMOO 3NR7A 1W59A 4MVZA 2A79B 3U11A 1M1KW 2LFRA 4JI6O 3H1JH 5LMUO 4MTOA 2IJKA 2F66C 2LJ2A 1N0NA 4LF9B 1KP3A 4LNUA 3ZMSA 1JJ2U 1SERA 2WLKA 4J7JA 2A3QA 2BTQA 3THOA 1Y4MA 5IYBO 5L3CA 4EB6B 3OTOB 4JI8O 1T5EA 4Q20A 2MK3A 3K57A 1KBHA 4TWKA 4NTXA 3AG2C 2XASA 3U10A 3UM7A 5J9PC 3ASNB 5LGNA 5GTHZ 2M7WA 4NXMB 3ABKC 1ZL8A 3AK1A 4UCVA 4CH5A 5FPOA 4F6EA 4DR1B 1SF9A 2G38A 5CBGA 5BR8B 1NJIW 3K0DA 1X59A 1H38A 4GKJO 3BCCH 4B3RO 1KU9A 4UVAA 1R3IC 4GLXA 3B8NA 3CSXA 5EYPB 2Q4PA 1IZ3A 4I9QA 4IT5A 5LP6C 5KMGB 4JV5B 2A0LA 4GX5A 3P3NA 3E89A 4G2KA 4PA3A 5L3FA 3T1HB 5LA6B 1G8MA 3QVNA 2AHZA 5IJ0B 4F4LA 4K3AA 2VQEB 2Y69B 4DV2O 1RSOA 4UV9A 3AG3B 1SESA 1M5IA 1VQ8V 3W7XA 1GAXA 1FPOA 2OWOA 3C3TA 1PM9A 1PD3A 1WP7A 3CYOA 2ADQB 4ZHQB 3ZRXA 4JYYA 5KUKA 2IJIA 1MZEA 4R6ZA 1VQOV 2IU0A 4J7KA 2F23A 1K5SA 2AGAA 5H6QA 3IAYA 4BIOA 2UUAO 3B09A 4X66B 1AR5A 3CP1A 4FFBB 4OXSA 2EZPA 3SYAA 2DOSA 3HKDB 1QQCA 4IGGA 5DN6G 4DW1A 4IL6Z 4YIOA 4RQFA 4B08A 5BMVA 1FXKB 2ZE6A 4DXWA 1SZTA 4I0XA 5JWPA 4JAVA 1IX9A 4PA7A 1N33B 3RVYA 3E83A 4JTDB 1QCEA 2VS0A 2E75B 1KD1W 3HKEB 2IJHA 1JA8A 4E2LA 2ITDC 2CGOA 2DYSB 2P4KA 4JTAB 1B6QA 4G28B 1WB7A 2E5LB 3QO5A 1J5EO 3JCZA 2YXHA 4LFAO 2H3OA 2W6JG 3CRCA 1R6TA 4RUEA 5KAFZ 2OT5A 1GKFA 4I7ZB 1OV9A 5B1OA 3IGAC 3JSNA 2VRZA 4IHJA 1BHAA 4P9OA 1U96A 4LNUB 2P67A 1E1QG 2BTQB 3K5OA 2Q0OC 5EK0A 3OEEG 4JZGA 4NXNO 1ZLZA 4FK5C 4LF6O 1HWYA 3S3WA 1I94O 3G80A 3RYIA 3EHBB 1VQ7V 1N32B 2LFSA 1N36O 3JAMN 3T1YB 2GBOA 5B66Z 1ZL8B 5LMNB 4B3TB 4PI2A 1N4CA 1OCZC 2EINC 3E8GA 2CUGA 3N27A 1G6UA 4TV8A 2XAGA 4CS3A 1R3LC 1HNWB 2RQ6A 2ZIMA 2R70A 1THZA 5CA1A 4DR4O 5A9GA 3BA9A 3T4ZA 2CTPA 3DC6A 5KX5A 1IDSA 1ZTEA 1R6KA 2ODMA 3IJ4A 3G6EV 4JASA 1CPYA 1QR9A 1WB8A 2QTOA 3DTUB 5KHKA 1TVKA 2DE0X 1H2GA 3D36A 4DUZB 3OR7C 3H9VA 1RSOB 2Y0PA 4DYLA 3B40A 2Q67A 3ZMUA 3PN1A 1VMGA 1K7DA 3OAAG 4IIJA 5EBWC 4LF5O 1SQQH 1GM8A 5FL7G 3HKBA 5CB4B 4J7ZA 4UVCA 1HR0O 3FKSG 2FB5A 2IH3C 4FLYA 1BZKA 2QWNB 4DV6O 4OGQB 4NB5A 3LSQA 1PL4A 4BAYA 2X6BA 4DW0A 4KL1A 3LNMB 1ROPA 3M99B 3BABA 3T4DA 4DUYO 3ML0A 5H6RA 3ZMZA 3EXAA 1QNMA 4DV1B 3JD2A 4X1IA 2PZSA 1R73A 4LFBB 1IBMO 2EILC 3L71H 3SPIA 3QF7A 2EIMB 3E8BA 1AJNA 5BMVB 5EC1C 1WA8A 5B1BC 4UUJC 4JYAO 4I0XB 2VQFB 1LUWA 1BSMA 2JGUA 4EEQA 2EIJB 2BTOA 2PUSA 1F4NA 1XUQA 2VWJA 4MVQA 3IFXA 1V55C 5KA5A 3JAKA 5JCOC 4DR2B 3AK3A 1SQFA 1EM1A 1F4MA 4HZ3A 4W4LA 5IYDO 3FD9A 1VF6C 2Z0AA 2FMLA 3SPGA 1QVGU 4QIWF 5FLXN 1NTMH 3G4SV 3CCEV 1EN6A 2N04A 2GTSA 3OUFA 4IHJB 2UXBO 1Q6IA 4J80A 4HYOA 3SPHA 4J9ZB 1F51A 5KA6A 4O2BA 3K06A 2F95B 4JI2O 4U7NA 2P7TC 1EZVH 1N34O 3I56V 1R3JC 3DGEA 2BE3A 2WWWA 3MD0A 1O9HA 2LGWA 3RW0A 4JI3O 3J81N 3RYIB 2PF4E 3AK2A 3SJAC 4X62O 3FX7A 3A0HZ 3JATB 5HFMA 2ZCEA 1BMFG 2KB1A 4O4IA 4WFAV 2X7RB 2AZ2A 2QM7A 3UO3A 4PD4F 2RNBA 5ITZA 1IBLO 4WFBV 4TV8B 3ZHQA 4RAIA 4O4HB 1U97A 2BOBC 4DR5O 2WAMA 1GN6A 4DV5O 1X4TA 4X1KA 2EBOA 2GHYA 1COWG 4KXRA 5CMUA 5KX5B 1NQTA 2WLIA 3A0BZ 4CH3A 3DXRA 1H2KA 2ETNA 5LL6Y 5IWAO 1YDXA 5KUMA 5LHIA 2JVDA 3ZIAG 1AJQA 4FLWA 1GM9A 1Q43A 2HJFC 2WPDG 1FYJA 1RM1C 1XNRB 1YIJV 2YIDA 4CH6A 2DJVA 4IIJB 2FTKA 3TK1A 3UO2A 3HKBB 2JRIA 3C3SA 4JZ2A 5B5EZ 3JARA 4UFZA 2XHBA 1IBKO 3N2KA 3RYHA 4WFFA 3CHXA 5LYJA 3D3QA 3ZS8C 1VIBA 3APOA 4K8ZA 1R3KC 4OX9O 3AG1C 1FJGO 1Q86W 4GKKB 2GUZA 4X1IB 4KHPO 5D5QA 2PY5A 2L6LA 1OCOC 1O9GA 4QPKA 3CCMV 2UXCB 4ZHQA 3CC2V 2P90A 1J95A 3N2GA 1WA8B 3ABLC 4BIUA 1L8DA 3X2QB 1HNZO 5F2VO 1QBZA 5LGUA 3SJBC 4DR7B 3ZRWA 5IYCO 3P30A 4MVUA 4JI4O 2YXLA 1I5XA 3LUTB 2ADPA 4DV3B 2AXTZ 2E3CA 4JI1B 2QR4A 5L3EA 3SPJA 3JAKB 5JJJB 3CB2A 1V9PA 1N0JA 4GCZA 4ZOLA 4JI0B 4B3MO 3OMAB 1S76D 1OCRB 2CE4A 1P4RA 1NTZH 2ZXWB 2DYRB 1GK9A 2P5OA 3ABMB 2Q69A 3KKYA 4J10A 1ENVA 3FAVA 2HEPA 5HFLA 4E4EA 3BA8A 3K0GA 5J2TA 1YXBA 3ZN0A 4N21A 1G4YB 3E86A 1XMQB 1OZ0A 5L3BA 3SR2C 3QO8A 3ASOB 4FJCC 4LF9O 1XNQB 2QE7G 3ZBHA 2HKOA 3JD3A 3ETQA 3E8HA 1YF2A 1AJPA 3OTOO 2P6JA 2Q7GA 4W4KA 2B5UA 1G1XB 4DV7B 3CCSV 4UCTA 4LF4B 1H2MA 2P4VA 2PI5A 4O4IB 1AR1B 2XNDG 1GN4A 2XUMA 1UFIA 2Q73A 4LP8A 5ITZB 2ZE7A 2ZE5A 2YS8A 2HJDA 1IXBA 3UCSC 1YZBA 3AG4B 3JD1A 4NXMO 3ICXA 2ZDIA 3OT7A 3ZHUA 3P32A 3W7WA 5K1XA 2PGGA 5KAIZ 1KKDA 5E79Z 4X1KB 5BR8O 4FFKA 2ZM6B 4BW5A 1WP8A 1UJWB 2WLIB 4HNAB 3ZHRA 3DXRB 5LMUB 2A7WA 1M56B 2YICA 1DF4A 4QPJA 5B3SC 1Q81W 4LC1A 3TETA 1W0JG 4JV5O 3BHPA 3QG5A 5JQGA 3WB2A 1YHQV 4O2AA 3H1HH 4R7CA 1EN5A 1DLBA 3T1HO 1US6A 5IYZA 4JI8B 1QLEC 3CD6V 4PELA 2R9AA 4I4TA 5IY5C 5KHGA 4NTYA 2VQEO 5B1BB 1S5HC 3JARB 2JDIG 4LH7A 1QU7A 3JYCA 3SYOA 1MOFA 2Q7HA 1HP8A 2P22C 4J11A 4MVRA 3N2KB 3RYHB 1VQNV 5LYJB 4DV4O 3E35A 2JGDA 3QO7A 3H1LH 5EIBC 1V55B 2UU9B 5LBQA 4N23A 4PDMA 5KHJA 4K0KB 2IH1C 1P49A 2OCCC 2GUZB 1S0VA 2ITCC 3JAWA 1XI1A 1EN4A 3APQA 3ABTA 3JASA 2RJZA 3CMAV 4X66O 1XEQA 3CRQA 5CB4A 1VQPV 2QSAA 3N2GB 1FKAO 1SQGA 1K34A 4IYIA 3F5TA 4FZ1A 1IURA 3E8FA 1V54C 2WSSG 1SQPH 3ZRWB 2NN4A 1FFTB 3L70H 1K5QA 4MW8A 4QGPA 5TISZ 2D2CB 4DV2B 4D7TA 3S3XA 4GUNA 2QWRB 1Y76A 4U3FH 1S5LZ 3DC5A 1N33O 2UUBB 2KSDA 2WLJA 4R8CA 4ZOLB 2CH7A 2UXNA 3STZC 3FFQA 4YHHB 3CC4V 1K3EA 5DEDA 4DK1A 2E5LO 4MVSA 1VQ9V 3FAVB 1QVFU 2UUAB 5GW7A 2LGQA 3SPCA 3E22A 1I5YA 3STLC 4X1YA 1A32A 3CC7V 5J2TB 4DR6O 2WA3A 4ZKIA 4LWSA 2WLMA 3TCUA 2QJ1A 5CBHA 1M93A 3WG7C 1VP7A 1AI7A 4JTCB 1E1RG 3FB6C 4J42A 4NVPA 4AQYB 2Z5UA 3W7UA 4CC6A 2CTQA 2KG7A 2ARHA 2Y0IA 2XOKG 4QNHB 3RWRD 1N32O 1ZAUA 3T1YO 2YXYA 3L72H 3HKCA 1HNXO 2YI9A 4PA6A 5LP6A 3G6BA 1K8AW 1AI4A 1VQ4V 3M7MX 4JYBA 3K5MA 5LMNO 3T2MA 2EIKB 4LFAB 2ZR3A 4P30A 2DMXA 4A5UB 3JATA 1I7FA 4P2ZA 3K9SA 5CA0A 4MS2A 3KCXA 4OPAA 2Z3YA 1PP9H 2QWOB 1URFA 4B3SB 3O65A 2O57A 4I5SA 3VQXA 3W7SA 2EX3A 3VQWA 5JQGB 4O4HA 3R65A 1H8EG 1GN2A 2UXXA 4LF8O 2H8PC 3OTFA 3QNEA 4O2AB 1YJNV 2XAJA 4NXNB 3BEHA 5IYZB 2CTWA 4F6RA 4LF6B 4I4TB 3LSUA 4Z1MG 1PNMA 3JSLA 2KQXA 3ZHTA 1PPJH 2WA4A 2JGDB 1S77D 2RCVA 3ZRVA 5BXZA 1YVWA 2DQ3A 1M90W 4LBEC 4CC5A 1N8RW 2PTMA 3JAWB 4GT1A 3L75H 1GN3A 2K1EA 2QTSA 3JASB 4X65O 2QM4A 4YXWG 2JJ1G 1FS0G 1SKVA 1YJWV 4DV1O 1M57B 2R72A 1HDJA 3CEIA 3CCQV 4LFBO 5JVDB 4HBNA 1XBLA 4YJ3A 3LDDA 1W0KG 3CRAA 4JAUA 2UXDB 2F1MA 5JJNB 3KZIZ 4FLTA 4R50A 3EVKA 1FD9A 4WFGA 2QA4V 1Y76B 2B9ZA 3OEHG 1YTFD 4X20A 1VQ5V 3ASNC 1VQKV 2ZR2A 5LOVA 1VQLV 2CH7B 4FLVA 1D5AA 1RFYA 3P3PA 2QWPB 5DECA 4FPPA 1XREA 1HR0B 4Q6GA 4DR2O 1YSCA 4BW9A 4JI7B 1KKCA 4MTGA 3D8CA 2QEXV 4XDKA 4C7UA 3OE7G 1MSDA 1BQ0A 3BY6A 3RYFA 5C8YA 3E22B 4PDLA 4X1YB 4DUYB 2DWEC 4NYKA 1GTOA 2IU3A 4UVBA 1EBOA 3ZEDA 3AG2B 5IJ9A 1NU1H 4LWSB 4GX1A 2HLDG 3HR0A 5GONA 4WCEV 3G71V 3U0ZA 1BGYH 2HFEC 3WB0A 3ABKB 1JX9A 1PKXA 1VARA 4LFCB 3BFRA 4GZRB 1MZFA 3TXSA 4JYAB 2Y69C 3W7TA 3AG3C 4UB8Z 4CZZA 2KG7B 2N74A 2ZNIA 2X6CA 2HVKC 3E2EA 2PI4A 2OIEA 3HKCB 4YIPA 5LP6B 2A9HA 2F4VB 4XDLA 2X0LA 4GYCB 3WB1A 1B3QA 5CBFA 4WBNA 3B77A 4PJ0Z 5IE9A 2X6AA 1DK1A 4JI5O 2QKAA 5CA0B 1AP5A 2YI8A 1FXHA 1Z5VA 2UXBB 5LXTB 2JIZG 4NTWA 1H2SB 1XL4A 2ZT9B 2C2AA 2WLHA 4TQDA 2NLJC 1JFFA 5EC2C 1SA0A 4RO2A 4CH4A 1YI2V 4DO2A 2FKXA 1FXKC 1OCCC 2HG5C 1WNSA 4I50B 1RPOA 2LP7A 4F6RB 3CCLV 4FLUA 2B1IA 2IW5A 3CRRA 1XNRO 4HNAA 1Q7YW 4X62B 2W0FC 2HR3A 1H8HG 2B1GA 2Q7EA 1BHBA 4RWUA 2DYSC 3LDCA 1CXZB 2F93B 2OTJV 3MHHC 3A0RA 1IBLB 2IBZH 1PNLA 1SC5B 3MDSA 4FM2A 1FAFA 1E79G 4DR5B 2ILMA 1EFRG 1XHZA 3NXSA 4J41A 5IT9N 2PYJA 1AB3A 3J7AU 3ETGA 2ZNJA 3L9DA 1P7GA 1D2DA 2JEUA 3CJHA 4WFHA 4GKKO 1Q6HA 1B06A 2YC0A 2OYQA 1K92A 3SDLA 2MW2B 3OD4A 4YJ3B 4BR6A 2UUCB 4YJ2A 2UXCO 4H0LB 4LF7B 2Y4TA 2V1DA 1NS1A 3RFRA 1AROP 4TOIA 5JCOA 4X64B 1KECA 1L0LH 4YY3B 1XOUA 1RP3B 3CCUV 5L3GA 5JJEB 1VF6A 1JPXA 3AEIA 4X20B 2V4DA 4Z1VA 4DR7O 1FXVA 1BL8A 3WG7B 1Q82W 3CCVV 1K73W 5LOVB 2HP8A 2FYUH 4DV3O 1SZXA 1OHHG 4PDVA 2YIAA 4O4JA 1XHXA 1LR1A 1S3JA 1IBKB 1D5NA 3K5NA 5EBMC 2ZQMA 4K8XA 4JI0O 4DRXA 1WPXA 1Z5WA 3RYFB 3ZX6A 5C8YB 4DR3O 3SJQC 1Y67A 3ZRSA 4I9WA 3UKMA 4H37A 3K08A 3ETDA 2HHHB 1YITV 5IJ9B 4AHCA 5C93A 1JQ0A 3SGIA 2ZINA 1B04A 4MSWC 2H94A 5GONB 1SS3A 2CAZC 4J9YB 1TGOA 1PL0A 4MW3A 4O4LA 2E74B 1OCZB 3FB8C 2EINB 4DV0B 2OIGA 3JALA 1XNQO 4WF9V 1HNZB 2EULA 3FB5C 2DW4A 4FLXA 2ATKC 1NI8A 1JVMA 2YDEA 4GX0A 5K1PA 3GWKC 1ZX3A 2ZE8A 4DV7O 4LF4O 1QLNA 1Q5OA 3RVZA 4WBNB 4B3MB 1F23A 3FYEB 5BY1A 2XAFA 1M4UA 3BAAA 2N05A 2QM8A 3BVOA 1I0HA 1KQSU 4PHZA 3WU2Z 4WFEA 4IYHA 1JFFB 3H1KH 1SA0B 2ZM6O 1NZ6A 4FZ0A 3AG7A 2A06H 4LR3A 2EIMC 4FM1A 4UCUA 1JMKC 5EIBD 3CWBH 1BT8A 4L87A 1XMOB 2WLLA 4DR1O 4H33A 1R6NA 2JEXA 3ZJZA 4TSFG 3BPZA 4KP4A 2EIJC 4PDRA 3JD0A 1K97A 2VWKA 4JI6B 1PV0A 2YIBD 2EZOA 3DSQA 2DWDC 1P84F 3OW2U 3UT5A 1NKDA 2EILB 3H1IH 1Q8IA 3LSSA 2XTAA 1AI6A 2DQ0A 1Z2GA 3K59A 2UU9O 1DF5A 3RN4A 4K0KO 3CJHB 4MTFA 4ABMA 3CPWU 2GV9A 4UXNA 3FYIB 3RYCB 4YJ2B 1SQXH 1S72V 5E1AC 3SJCC 3HB3B 1WPBA 4X88A 4GKJB 3G67A 4OPHA 4B3RB 4G27B 4ZI7B 1KMIZ 1JR9A 3JD4A 3K58A 2IM9A 3K04A 4ZBMA 3TXQA 1SETA 4NR1A 2JK5C 1NR1A 2KKWA 2HVJC 5EZYB 5B1AC 4QE7A 4O4JB 5JVDA 1YTFB 3MAQA 1BQZA 3R66A 2UUBO 4AILC 3CCRV 4DV4B 4DRXB 3F7VC 4YHHO 1VQMV 1CP9A 4KUMA 1XL6A
chains in the Genus database with same CATH topology
4U7OA 1NH2B 1M57C 4LBEC 4WFBV 1N8RW 4GT1A 1MG1A 4RAIA 2BOBC 1K9MW 1CEZA 2K1EA 2WAMA 2BOCC 2XAQA 1NVPB 2IJJA 3SYQA 4YXWG 2JJ1G 1FS0G 3GWOA 1YJWV 1KP2A 2EBOA 2GHYA 1COWG 1M57B 5CMUA 4MVZA 2A79B 3CCQV 1NQTA 2WLIA 3LDDA 1JOYA 1W0KG 4JAUA 1M1KW 2LFRA 4BIZA 2GSMB 1OCCB 4MTOA 5KUMA 2IJKA 1KP3A 5LHIA 3ZIAG 4R50A 1AJQA 3ZMSA 1JJ2U 1GM9A 2HJFC 2WLKA 2WPDG 2YEVB 4WFGA 2QA4V 1RM1C 3OEHG 1YTFD 1VQ5V 1Y4MA 3ASNC 5IYBO 5L3CA 1YIJV 1VQKV 2ZR2A 2WLNA 1VQLV 2FTKA 4RQEA 3TK1A 1KC8W 3EFFK 4Q20A 2MK3A 4FPPA 4TWKA 2JJ2G 3AG2C 2XASA 1TUEB 3UM7A 1RM1B 5J9PC 1YSCA 2QKSA 1NH2D 4MTGA 2QEXV 4WFFA 4XDKA 2W6IG 3ASNB 3OE7G 5LGNA 3BY6A 3WFVA 2M7WA 1R3KC 3ABKC 4PDLA 1NVPD 3AG1C 4KFMA 2DWEC 1Q86W 1GTOA 2IU3A 4UVBA 1EBOA 5L3DA 5LGTA 2WLLB 5CBGA 3AG2B 1NJIW 3K0DA 1OCOC 3X2QC 1DTOA 4QPKA 4GX1A 2HLDG 1H38A 1MABG 3CCMV 3T1CA 3G71V 4WCEV 4UVAA 1R3IC 2HFEC 3CC2V 3ABKB 1JX9A 3B8NA 1PKXA 3AG1B 2P90A 3OFNG 5LHGA 2EJRA 1J95A 4HAMA 2Y69C 3W7TA 3ABLC 4BIUA 4MVOA 2A0LA 3AG3C 4CZZA 3OMNB 4GX5A 1OCOB 3X2QB 1K4DC 3LDEA 3E89A 1QBZA 2X6CA 1ZWIC 3K3WA 4G2KA 5LGUA 2HVKC 3E2EA 4PA3A 3ZRWA 5L3FA 5IYCO 3P30A 4MVUA 2PI4A 1OCRC 1G8MA 1I5XA 3LUTB 4FIPC 2ZXWC 4JGSA 2AHZA 2DYRC 4F4LA 2A9HA 2Y69B 4XDLA 5L3EA 2X0LA 3ABLB 3ABMC 3OGCC 3SPJA 4UV9A 1VQ6V 3AG3B 1SESA 1GO3F 4GCZA 1VQ8V 5CBFA 3W7XA 3SYCA 3B77A 1PD3A 2X6AA 3CYOA 3RBZA 3OMAB 1S76D 1OCRB 1P4RA 4P9PA 3F7YC 2ZXWB 2DYRB 1FXHA 3ZRXA 1GK9A 2JIZG 5KUKA 2IJIA 3ASOC 1XL4A 3ABMB 5B1NA 2C2AA 2Q69A 2WLHA 4R6ZA 1ENVA 2NLJC 1VQOV 2IU0A 5EC2C 1K5SA 5HFLA 4RO2A 5H6QA 3CMEV 1YI2V 4DO2A 3K0GA 3ZN0A 4N21A 3CP1A 1FXKC 1G4YB 4OXSA 1OCCC 2HG5C 3E86A 1OZ0A 2EZPA 5L3BA 1RPOA 2LP7A 3CCLV 3QO8A 3ASOB 4FJCC 1SERA 3SYAA 2B1IA 2QE7G 5DN6G 2IW5A 2YSUB 2HKOA 3JD3A 1Q7YW 4RQFA 3E8HA 2W0FC 1AJPA 2HR3A 1H8HG 2B1GA 1BHBA 3AG4C 2DYSC 2P6JA 3LDCA 2B5UA 1FXKB 4DXWA 1M9NA 3CCSV 5LHHA 1SZTA 2PI5A 4JAVA 1AR1B 2XNDG 2OTJV 3MHHC 4PA7A 3A0RA 3RVYA 3ZCCA 3E83A 4JTDB 4MVMA 1QCEA 1PNLA 2R9IA 4LP8A 1KD1W 3FB7C 1E79G 2IJHA 1EFRG 3NXSA 4E2LA 2ITDC 3AG4B 3JD1A 1Y66A 2DYSB 2ZDIA 3ETGA 4G28B 1B6QA 4JTAB 3CXCU 1M56C 3HPLC 3QO5A 3P32A 3W7WA 3JCZA 2JEUA 4JPRA 1KKDA 4WFHA 4XBFA 2W6JG 4UV8A 3VOUA 4BW5A 4RUEA 1UJWB 2OT5A 3D3IA 1K92A 2WLIB 4GX2A 1GKFA 3PJSK 5B1OA 2V1DA 3IGAC 2CK3G 1BHAA 1AROP 1M56B 3K03A 1DF4A 1KECA 4QPJA 4P9OA 5B3SC 1Q81W 3CCUV 5L3GA 4LC1A 3TETA 1W0JG 2P67A 1E1QG 1JPXA 5EBLC 4QJFB 1LNQA 2AHYA 2Q6AA 3MHSC 3AEIA 1YHQV 1WLEA 4R7CA 1FXVA 1BL8A 1DLBA 3WG7B 5EK0A 3CCVV 1Q82W 3OEEG 1K73W 1IXMA 5H9CA 1QLEC 3CD6V 1OHHG 4PELA 4FK5C 5IY5C 1HWYA 4PDVA 5B1BB 1S5HC 5B3SB 1L1FA 2JDIG 1S3JA 3JYCA 3SYOA 1K33A 1MOFA 1ORQC 3EHBB 1VQ7V 1SRYA 5EBMC 4MVRA 2LFSA 2ZQMA 4JF3A 3ETEA 1VQNV 1WPXA 3E35A 3QO7A 3SJQC 3OMIB 1V55B 3ZRSA 1QLEB 4I9WA 3UKMA 5LBQA 4H37A 4N23A 5IY5B 4PDMA 2IH1C 1OCZC 3K08A 2EINC 2OCCC 3E8GA 3ETDA 3I55V 1YITV 2D3OW 3F5WC 1S0VA 2XAGA 2ITCC 5C93A 1R3LC 1JQ0A 5DM6V 4MSWC 2H94A 5BZBA 3ABTA 4MTXA 3CMAV 4J9YB 1PL0A 1VQPV 1JCHA 4MW3A 1THZA 1OCZB 3FB8C 2EINB 3T4ZA 2OCCB 4MT8A 1K34A 4WF9V 4CBCA 4FMTA 1R6KA 3G6EV 3FB5C 2DW4A 3E8FA 4JASA 1V54C 2WSSG 1CPYA 3ZRWB 1QR9A 2QTOA 2ATKC 1NBMG 3DTUB 4X8AA 1FFTB 1JVMA 1H2GA 1K5QA 4GX0A 3D36A 4MW8A 1RPRA 3OR7C 1QLNA 3KG2A 5B1AB 3SYPA 2Q67A 3ZMUA 2WLJA 4XDJA 3ZMVA 4R8CA 3RVZA 1K7DA 3OAAG 1F23A 3FYEB 3ZMTA 1V54B 2XAFA 2UXNA 5EBWC 3STZC 1GM8A 5IDJA 5FL7G 2QM8A 3OM3B 3CC4V 1K3EA 1KQSU 4UVCA 4MVSA 3FKSG 5CN0A 2IH3C 2Y48A 1GMGA 4WFEA 3IC7A 1VQ9V 3LSQA 1QVFU 4BAYA 2R9RB 2X6BA 5GW7A 3SPCA 4TT3G 2XAHA 1I5YA 2EIMC 1ROPA 3LNMB 3STLC 3M99B 3CC7V 4RUFA 3T4DA 3ML0A 5H6RA 3ZN1A 3CCJV 4L87A 3ZMZA 2WLLA 4H33A 1R6NA 3JD2A 3K9AA 4ZKIA 2JEXA 1R73A 3ZJZA 2WLMA 4TSFG 3TCUA 4KP4A 2EIJC 2EILC 4PDRA 3JD0A 5CBHA 3OR6C 1K97A 3WG7C 3SPIA 1AI7A 2EIMB 2OTLV 4JTCB 2Q68A 1AJNA 1E1RG 3E8BA 3FB6C 3H01A 2EZOA 5EC1C 2ZDIC 2Z5UA 4X89A 3VBBA 3ABUA 4EKWA 5B1BC 4UUJC 3W7UA 2DWDC 2EIKC 4ASUG 3OW2U 1NR7A 3GB7C 2XOKG 1NKDA 4QNHB 2EIJB 2EILB 3LSSA 1F4NA 4LCUC 4MVQA 1AI6A 3IFXA 1V55C 2DQ0A 4PA6A 4QE9A 1K8AW 1VQ4V 1AI4A 5CA3A 5KA5A 4PA4A 4JYBA 1DF5A 2EIKB 3T2MA 4MTFA 3CPWU 2ZR3A 4P30A 1F4MA 4HZ3A 5IYDO 1P7BA 4P2ZA 4UXNA 3FYIB 1W2BU 3SPGA 1QVGU 4QIWF 4MS2A 1S72V 5E1AC 2Z3YA 3G4SV 3CCEV 2F43G 3OUSA 3OUFA 1PNKA 2ZD9A 4I5SA 4HYOA 3HB3B 3SPHA 3W7SA 4J9ZB 1F51A 5KA6A 4X88A 3K06A 4U7NA 4G27B 2P7TC 3R65A 1H8EG 3JD4A 1AI5A 2UXXA 3K04A 2H8PC 3QNEA 1QR8A 3I56V 1R3JC 3DGEA 2WWWA 1YJNV 3MD0A 4PA9A 2V7QG 4JYCA 2XAJA 4ZBMA 3BEHA 1SETA 1YJ9V 2JK5C 1NR1A 3RW0A 1K4CC 2HVJC 1EZJA 5B1AC 4QE7A 4Z1MG 1YTFB 1PNMA 3B8MA 3CCRV 5HFMA 1MSWD 1FXKA 2NNUA 3F7VC 1BMFG 2KB1A 1S77D 1GM7A 3K79A 1VQMV 4WFAV 3ZRVA 1CP9A 2X7RB 2QM7A 2YEVA 4KUMA 2DQ3A 1XL6A 1M90W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5Y A;  1I5X A;  4FIP C;  3M99 B;  4JGS A;  1ENV A;  4JF3 A;  1JPX A;  3MHS C;  1F23 A;  4JPR A;  5HFL A;  1MG1 A;  2P6J A;  1K34 A;  3B8N A;  4N23 A;  1DLB A;  3K9A A;  3B8M A;  1SZT A;  5H9C A;  3WFV A;  2M7W A;  2OT5 A;  3CP1 A;  3MHH C;  1QR9 A;  3B77 A;  4FK5 C;  4N21 A;  5KA6 A;  5HFM A;  3GWO A;  5CN0 A;  1JQ0 A;  2EZP A;  3CYO A;  1QCE A;  1Y4M A;  2LP7 A;  2EBO A;  5KA5 A;  1DF5 A;  4FJC C;  1QBZ A;  3H01 A;  1EBO A;  1K33 A;  1MOF A;  4G2K A;  2EZO A;  5CMU A;  1QR8 A;  1DF4 A;  4E2L A;  2X7R B;  3P30 A;  1Y66 A;  2MK3 A; 
#chains in the Genus database with same CATH topology
 2K9P A;  4U7O A;  4UCS A;  2LW1 A;  4TV9 A;  4PI0 A;  2L35 A;  1MG1 A;  1SQB H;  3CE2 A;  2XAQ A;  2IJJ A;  3SYQ A;  5J2U A;  4O4L B;  3D36 C;  3GWO A;  1FFX A;  2Q5Z A;  4TUY A;  1TA8 A;  3JAL B;  3RGB A;  5H5N A;  1Y74 A;  1JOY A;  3VQY A;  4BIZ A;  2QDO A;  4U3J A;  2GSM B;  1OCC B;  4AQY O;  2PYL A;  2E76 B;  3A8T A;  3Q4H A;  2YEV B;  2QGN A;  2WLN A;  1UPG A;  4RQE A;  2EJ7 A;  1KC8 W;  3EFF K;  4EFB A;  2JJ2 G;  1TUE B;  1RM1 B;  2QKS A;  1NH2 D;  1KB9 F;  5GTI Z;  2W6I G;  3WFV A;  1NVP D;  4DR6 B;  2RN9 A;  4KFM A;  1J5E B;  4B3T O;  4B3S O;  5L3D A;  5LGT A;  2WLL B;  1AVM A;  3BRC A;  3X2Q C;  1DTO A;  2Q0A A;  1MAB G;  4I55 A;  1KYO F;  3T1C A;  1Y6X A;  1HNW O;  3AG1 B;  3OFN G;  5LHG A;  5LXT A;  2EJR A;  2BSK A;  4HAM A;  4TQF A;  4MVO A;  1LUV A;  3OMN B;  2Q8V A;  1OCO B;  3I5D A;  1K4D C;  3LDE A;  3UT5 B;  1ZWI C;  3K3W A;  1F7Y A;  2CTR A;  1SQV H;  2GTA A;  2YIB A;  1OCR C;  1GH6 A;  4UCO A;  4FIP C;  2ZXW C;  4JGS A;  4I50 A;  1HNX B;  2DYR C;  4UB6 Z;  4DUZ O;  1I94 B;  5KHI A;  3ABL B;  3ABM C;  3OGC C;  5FPR A;  1VF5 B;  1VQ6 V;  1GO3 F;  1N36 B;  3SYC A;  3RBZ A;  4P9P A;  3F7Y C;  2JS5 A;  4FLZ A;  2DN9 A;  3RT3 C;  4LH6 A;  1AR4 A;  1AP6 A;  3ASO C;  5B1N A;  4UCR A;  5FNV A;  3CME V;  4LF8 B;  3M8A A;  3B2E E;  2UXD O;  4K35 A;  1Q3E A;  4DR4 B;  4H44 B;  3QTC A;  1BCC H;  3CS5 A;  2YSU B;  3LNN A;  4CS2 A;  1L0N H;  4JAA A;  3AG4 C;  5KHH A;  1M9N A;  5LHH A;  1MNG A;  1WN7 A;  2VQF O;  2OCH A;  3ZCC A;  2W0X A;  4MVM A;  2R9I A;  3FB7 C;  4JI7 O;  4TV9 B;  3UQ8 A;  1BE3 H;  4LF5 B;  4X65 B;  1Y66 A;  1NT2 B;  1H2N A;  5J2U B;  3CXC U;  1M56 C;  3HPL C;  3GVM A;  4DK0 A;  4JPR A;  1FFX B;  4DV6 B;  3O9O A;  4TUY B;  4XBF A;  4UV8 A;  3VOU A;  1AIL A;  1YCI A;  4PV1 B;  3D3I A;  4GX2 A;  1Y74 B;  3PJS K;  5D5P A;  2CK3 G;  4LFC O;  4U3J B;  3C90 A;  3K03 A;  3JCU Z;  1GRJ A;  2XT9 A;  1IBM B;  1TAE A;  3Q4H B;  5EBL C;  4QJF B;  1LNQ A;  2AHY A;  2Q6A A;  3MHS C;  1JJO A;  2JS3 A;  3IC9 A;  5JH7 A;  1IXM A;  5H9C A;  2CGN A;  3L73 H;  1MMM A;  5B3S B;  2F4V O;  1DGS A;  1L1F A;  1K33 A;  1ORQ C;  1SRY A;  1YEW A;  3ETE A;  4JF3 A;  1TUB A;  3ZHV A;  4X9Q A;  3OMI B;  1QLE B;  5IY5 B;  4ZIB A;  3I55 V;  2D3O W;  3F5W C;  2CDY A;  2ZIO A;  5DM6 V;  4I55 B;  5BZB A;  4MTX A;  1JCH A;  5KLV H;  2BSK B;  2LW7 A;  2OCC B;  1XIL A;  1VF7 A;  2RDC A;  4JI2 B;  4MT8 A;  4BWA A;  4CBC A;  4FMT A;  1N34 B;  4X8A A;  1NBM G;  1WJZ A;  1RPR A;  4L8J A;  3TGU H;  4JI3 B;  4CS4 A;  1QHT A;  3KG2 A;  5B1A B;  3SYP A;  4XDJ A;  3ZMV A;  4EB6 A;  3J80 N;  1ZUQ A;  3ZMT A;  1V54 B;  3VQV A;  4JI5 B;  3A2F A;  2FL4 A;  5IDJ A;  3OM3 B;  4FVM A;  1ZSP A;  5CA1 B;  1BS3 A;  5CN0 A;  2Y48 A;  2QWQ B;  1GMG A;  5FNV B;  3IC7 A;  4D6T H;  2R9R B;  3L74 H;  4TT3 G;  2XAH A;  5A2Q N;  4H13 B;  2UUC O;  4DV5 B;  1Q90 D;  4RUF A;  4D7S A;  4LF7 O;  4NKG B;  1TVK B;  3ZN1 A;  3CCJ V;  4X64 O;  2Q9L A;  3K9A A;  4B7E A;  4YY3 O;  2AZ0 A;  1XDC A;  3CXH F;  2NR5 A;  3RYC A;  3OR6 C;  5AG2 A;  5EYP A;  4EFE A;  5IWA B;  2OTL V;  5H2F Z;  2Q68 A;  3H01 A;  1XQ8 A;  1OJH A;  3OGI B;  3B4S A;  2ZDI C;  4EKW A;  4X89 A;  3VBB A;  3ABU A;  5KMG A;  2EIK C;  4ASU G;  1NR7 A;  4ZI7 A;  3GB7 C;  1Q6U A;  2BCC H;  5LA6 A;  1WAZ A;  4LCU C;  1NTK H;  5IJ0 A;  3TJT A;  4QE9 A;  2LQT A;  5CA3 A;  5EZY A;  4JI1 O;  4PA4 A;  2HHH O;  1P7B A;  3KCY A;  4OX9 B;  1W2B U;  1R1B A;  2Y4U A;  1FJG B;  4ICG A;  1KUQ A;  2F43 G;  3OUS A;  2ZKO A;  1PNK A;  2ZD9 A;  4Z2W A;  4KHP B;  2GDS A;  4DV0 O;  3ZHS A;  1VEW A;  2P06 A;  1AI5 A;  4B7K A;  3K5L A;  1QR8 A;  2RMK B;  4FFB A;  4PA9 A;  2V7Q G;  4JYC A;  5JH7 B;  1YJ9 V;  1XMQ O;  3HKD A;  1K4C C;  1EZJ A;  2QKC A;  1H2L A;  1I08 A;  3B8M A;  2M6Y A;  1IVS A;  4FM0 A;  2LO1 A;  1HW7 A;  4JI4 B;  1MSW D;  4DR3 B;  1TUB B;  1FXK A;  2NNU A;  4AI8 A;  1GM7 A;  3K79 A;  1MA1 A;  3CX5 F;  2YEV A;  1WLE A;  3CRM A;  1NH2 B;  1M57 C;  3HKE A;  4O2B B;  1S5J A;  1K9M W;  1CEZ A;  2BOC C;  1NVP B;  2AW9 A;  2YUA A;  1KP2 A;  1XMO O;  3NR7 A;  1W59 A;  4MVZ A;  2A79 B;  3U11 A;  1M1K W;  2LFR A;  4JI6 O;  3H1J H;  5LMU O;  4MTO A;  2IJK A;  2F66 C;  2LJ2 A;  1N0N A;  4LF9 B;  1KP3 A;  4LNU A;  3ZMS A;  1JJ2 U;  1SER A;  2WLK A;  4J7J A;  2A3Q A;  2BTQ A;  3THO A;  1Y4M A;  5IYB O;  5L3C A;  4EB6 B;  3OTO B;  4JI8 O;  1T5E A;  4Q20 A;  2MK3 A;  3K57 A;  1KBH A;  4TWK A;  4NTX A;  3AG2 C;  2XAS A;  3U10 A;  3UM7 A;  5J9P C;  3ASN B;  5LGN A;  5GTH Z;  2M7W A;  4NXM B;  3ABK C;  1ZL8 A;  3AK1 A;  4UCV A;  4CH5 A;  5FPO A;  4F6E A;  4DR1 B;  1SF9 A;  2G38 A;  5CBG A;  5BR8 B;  1NJI W;  3K0D A;  1X59 A;  1H38 A;  4GKJ O;  3BCC H;  4B3R O;  1KU9 A;  4UVA A;  1R3I C;  4GLX A;  3B8N A;  3CSX A;  5EYP B;  2Q4P A;  1IZ3 A;  4I9Q A;  4IT5 A;  5LP6 C;  5KMG B;  4JV5 B;  2A0L A;  4GX5 A;  3P3N A;  3E89 A;  4G2K A;  4PA3 A;  5L3F A;  3T1H B;  5LA6 B;  1G8M A;  3QVN A;  2AHZ A;  5IJ0 B;  4F4L A;  4K3A A;  2VQE B;  2Y69 B;  4DV2 O;  1RSO A;  4UV9 A;  3AG3 B;  1SES A;  1M5I A;  1VQ8 V;  3W7X A;  1GAX A;  1FPO A;  2OWO A;  3C3T A;  1PM9 A;  1PD3 A;  1WP7 A;  3CYO A;  2ADQ B;  4ZHQ B;  3ZRX A;  4JYY A;  5KUK A;  2IJI A;  1MZE A;  4R6Z A;  1VQO V;  2IU0 A;  4J7K A;  2F23 A;  1K5S A;  2AGA A;  5H6Q A;  3IAY A;  4BIO A;  2UUA O;  3B09 A;  4X66 B;  1AR5 A;  3CP1 A;  4FFB B;  4OXS A;  2EZP A;  3SYA A;  2DOS A;  3HKD B;  1QQC A;  4IGG A;  5DN6 G;  4DW1 A;  4IL6 Z;  4YIO A;  4RQF A;  4B08 A;  5BMV A;  1FXK B;  2ZE6 A;  4DXW A;  1SZT A;  4I0X A;  5JWP A;  4JAV A;  1IX9 A;  4PA7 A;  1N33 B;  3RVY A;  3E83 A;  4JTD B;  1QCE A;  2VS0 A;  2E75 B;  1KD1 W;  3HKE B;  2IJH A;  1JA8 A;  4E2L A;  2ITD C;  2CGO A;  2DYS B;  2P4K A;  4JTA B;  1B6Q A;  4G28 B;  1WB7 A;  2E5L B;  3QO5 A;  1J5E O;  3JCZ A;  2YXH A;  4LFA O;  2H3O A;  2W6J G;  3CRC A;  1R6T A;  4RUE A;  5KAF Z;  2OT5 A;  1GKF A;  4I7Z B;  1OV9 A;  5B1O A;  3IGA C;  3JSN A;  2VRZ A;  4IHJ A;  1BHA A;  4P9O A;  1U96 A;  4LNU B;  2P67 A;  1E1Q G;  2BTQ B;  3K5O A;  2Q0O C;  5EK0 A;  3OEE G;  4JZG A;  4NXN O;  1ZLZ A;  4FK5 C;  4LF6 O;  1HWY A;  3S3W A;  1I94 O;  3G80 A;  3RYI A;  3EHB B;  1VQ7 V;  1N32 B;  2LFS A;  1N36 O;  3JAM N;  3T1Y B;  2GBO A;  5B66 Z;  1ZL8 B;  5LMN B;  4B3T B;  4PI2 A;  1N4C A;  1OCZ C;  2EIN C;  3E8G A;  2CUG A;  3N27 A;  1G6U A;  4TV8 A;  2XAG A;  4CS3 A;  1R3L C;  1HNW B;  2RQ6 A;  2ZIM A;  2R70 A;  1THZ A;  5CA1 A;  4DR4 O;  5A9G A;  3BA9 A;  3T4Z A;  2CTP A;  3DC6 A;  5KX5 A;  1IDS A;  1ZTE A;  1R6K A;  2ODM A;  3IJ4 A;  3G6E V;  4JAS A;  1CPY A;  1QR9 A;  1WB8 A;  2QTO A;  3DTU B;  5KHK A;  1TVK A;  2DE0 X;  1H2G A;  3D36 A;  4DUZ B;  3OR7 C;  3H9V A;  1RSO B;  2Y0P A;  4DYL A;  3B40 A;  2Q67 A;  3ZMU A;  3PN1 A;  1VMG A;  1K7D A;  3OAA G;  4IIJ A;  5EBW C;  4LF5 O;  1SQQ H;  1GM8 A;  5FL7 G;  3HKB A;  5CB4 B;  4J7Z A;  4UVC A;  1HR0 O;  3FKS G;  2FB5 A;  2IH3 C;  4FLY A;  1BZK A;  2QWN B;  4DV6 O;  4OGQ B;  4NB5 A;  3LSQ A;  1PL4 A;  4BAY A;  2X6B A;  4DW0 A;  4KL1 A;  3LNM B;  1ROP A;  3M99 B;  3BAB A;  3T4D A;  4DUY O;  3ML0 A;  5H6R A;  3ZMZ A;  3EXA A;  1QNM A;  4DV1 B;  3JD2 A;  4X1I A;  2PZS A;  1R73 A;  4LFB B;  1IBM O;  2EIL C;  3L71 H;  3SPI A;  3QF7 A;  2EIM B;  3E8B A;  1AJN A;  5BMV B;  5EC1 C;  1WA8 A;  5B1B C;  4UUJ C;  4JYA O;  4I0X B;  2VQF B;  1LUW A;  1BSM A;  2JGU A;  4EEQ A;  2EIJ B;  2BTO A;  2PUS A;  1F4N A;  1XUQ A;  2VWJ A;  4MVQ A;  3IFX A;  1V55 C;  5KA5 A;  3JAK A;  5JCO C;  4DR2 B;  3AK3 A;  1SQF A;  1EM1 A;  1F4M A;  4HZ3 A;  4W4L A;  5IYD O;  3FD9 A;  1VF6 C;  2Z0A A;  2FML A;  3SPG A;  1QVG U;  4QIW F;  5FLX N;  1NTM H;  3G4S V;  3CCE V;  1EN6 A;  2N04 A;  2GTS A;  3OUF A;  4IHJ B;  2UXB O;  1Q6I A;  4J80 A;  4HYO A;  3SPH A;  4J9Z B;  1F51 A;  5KA6 A;  4O2B A;  3K06 A;  2F95 B;  4JI2 O;  4U7N A;  2P7T C;  1EZV H;  1N34 O;  3I56 V;  1R3J C;  3DGE A;  2BE3 A;  2WWW A;  3MD0 A;  1O9H A;  2LGW A;  3RW0 A;  4JI3 O;  3J81 N;  3RYI B;  2PF4 E;  3AK2 A;  3SJA C;  4X62 O;  3FX7 A;  3A0H Z;  3JAT B;  5HFM A;  2ZCE A;  1BMF G;  2KB1 A;  4O4I A;  4WFA V;  2X7R B;  2AZ2 A;  2QM7 A;  3UO3 A;  4PD4 F;  2RNB A;  5ITZ A;  1IBL O;  4WFB V;  4TV8 B;  3ZHQ A;  4RAI A;  4O4H B;  1U97 A;  2BOB C;  4DR5 O;  2WAM A;  1GN6 A;  4DV5 O;  1X4T A;  4X1K A;  2EBO A;  2GHY A;  1COW G;  4KXR A;  5CMU A;  5KX5 B;  1NQT A;  2WLI A;  3A0B Z;  4CH3 A;  3DXR A;  1H2K A;  2ETN A;  5LL6 Y;  5IWA O;  1YDX A;  5KUM A;  5LHI A;  2JVD A;  3ZIA G;  1AJQ A;  4FLW A;  1GM9 A;  1Q43 A;  2HJF C;  2WPD G;  1FYJ A;  1RM1 C;  1XNR B;  1YIJ V;  2YID A;  4CH6 A;  2DJV A;  4IIJ B;  2FTK A;  3TK1 A;  3UO2 A;  3HKB B;  2JRI A;  3C3S A;  4JZ2 A;  5B5E Z;  3JAR A;  4UFZ A;  2XHB A;  1IBK O;  3N2K A;  3RYH A;  4WFF A;  3CHX A;  5LYJ A;  3D3Q A;  3ZS8 C;  1VIB A;  3APO A;  4K8Z A;  1R3K C;  4OX9 O;  3AG1 C;  1FJG O;  1Q86 W;  4GKK B;  2GUZ A;  4X1I B;  4KHP O;  5D5Q A;  2PY5 A;  2L6L A;  1OCO C;  1O9G A;  4QPK A;  3CCM V;  2UXC B;  4ZHQ A;  3CC2 V;  2P90 A;  1J95 A;  3N2G A;  1WA8 B;  3ABL C;  4BIU A;  1L8D A;  3X2Q B;  1HNZ O;  5F2V O;  1QBZ A;  5LGU A;  3SJB C;  4DR7 B;  3ZRW A;  5IYC O;  3P30 A;  4MVU A;  4JI4 O;  2YXL A;  1I5X A;  3LUT B;  2ADP A;  4DV3 B;  2AXT Z;  2E3C A;  4JI1 B;  2QR4 A;  5L3E A;  3SPJ A;  3JAK B;  5JJJ B;  3CB2 A;  1V9P A;  1N0J A;  4GCZ A;  4ZOL A;  4JI0 B;  4B3M O;  3OMA B;  1S76 D;  1OCR B;  2CE4 A;  1P4R A;  1NTZ H;  2ZXW B;  2DYR B;  1GK9 A;  2P5O A;  3ABM B;  2Q69 A;  3KKY A;  4J10 A;  1ENV A;  3FAV A;  2HEP A;  5HFL A;  4E4E A;  3BA8 A;  3K0G A;  5J2T A;  1YXB A;  3ZN0 A;  4N21 A;  1G4Y B;  3E86 A;  1XMQ B;  1OZ0 A;  5L3B A;  3SR2 C;  3QO8 A;  3ASO B;  4FJC C;  4LF9 O;  1XNQ B;  2QE7 G;  3ZBH A;  2HKO A;  3JD3 A;  3ETQ A;  3E8H A;  1YF2 A;  1AJP A;  3OTO O;  2P6J A;  2Q7G A;  4W4K A;  2B5U A;  1G1X B;  4DV7 B;  3CCS V;  4UCT A;  4LF4 B;  1H2M A;  2P4V A;  2PI5 A;  4O4I B;  1AR1 B;  2XND G;  1GN4 A;  2XUM A;  1UFI A;  2Q73 A;  4LP8 A;  5ITZ B;  2ZE7 A;  2ZE5 A;  2YS8 A;  2HJD A;  1IXB A;  3UCS C;  1YZB A;  3AG4 B;  3JD1 A;  4NXM O;  3ICX A;  2ZDI A;  3OT7 A;  3ZHU A;  3P32 A;  3W7W A;  5K1X A;  2PGG A;  5KAI Z;  1KKD A;  5E79 Z;  4X1K B;  5BR8 O;  4FFK A;  2ZM6 B;  4BW5 A;  1WP8 A;  1UJW B;  2WLI B;  4HNA B;  3ZHR A;  3DXR B;  5LMU B;  2A7W A;  1M56 B;  2YIC A;  1DF4 A;  4QPJ A;  5B3S C;  1Q81 W;  4LC1 A;  3TET A;  1W0J G;  4JV5 O;  3BHP A;  3QG5 A;  5JQG A;  3WB2 A;  1YHQ V;  4O2A A;  3H1H H;  4R7C A;  1EN5 A;  1DLB A;  3T1H O;  1US6 A;  5IYZ A;  4JI8 B;  1QLE C;  3CD6 V;  4PEL A;  2R9A A;  4I4T A;  5IY5 C;  5KHG A;  4NTY A;  2VQE O;  5B1B B;  1S5H C;  3JAR B;  2JDI G;  4LH7 A;  1QU7 A;  3JYC A;  3SYO A;  1MOF A;  2Q7H A;  1HP8 A;  2P22 C;  4J11 A;  4MVR A;  3N2K B;  3RYH B;  1VQN V;  5LYJ B;  4DV4 O;  3E35 A;  2JGD A;  3QO7 A;  3H1L H;  5EIB C;  1V55 B;  2UU9 B;  5LBQ A;  4N23 A;  4PDM A;  5KHJ A;  4K0K B;  2IH1 C;  1P49 A;  2OCC C;  2GUZ B;  1S0V A;  2ITC C;  3JAW A;  1XI1 A;  1EN4 A;  3APQ A;  3ABT A;  3JAS A;  2RJZ A;  3CMA V;  4X66 O;  1XEQ A;  3CRQ A;  5CB4 A;  1VQP V;  2QSA A;  3N2G B;  1FKA O;  1SQG A;  1K34 A;  4IYI A;  3F5T A;  4FZ1 A;  1IUR A;  3E8F A;  1V54 C;  2WSS G;  1SQP H;  3ZRW B;  2NN4 A;  1FFT B;  3L70 H;  1K5Q A;  4MW8 A;  4QGP A;  5TIS Z;  2D2C B;  4DV2 B;  4D7T A;  3S3X A;  4GUN A;  2QWR B;  1Y76 A;  4U3F H;  1S5L Z;  3DC5 A;  1N33 O;  2UUB B;  2KSD A;  2WLJ A;  4R8C A;  4ZOL B;  2CH7 A;  2UXN A;  3STZ C;  3FFQ A;  4YHH B;  3CC4 V;  1K3E A;  5DED A;  4DK1 A;  2E5L O;  4MVS A;  1VQ9 V;  3FAV B;  1QVF U;  2UUA B;  5GW7 A;  2LGQ A;  3SPC A;  3E22 A;  1I5Y A;  3STL C;  4X1Y A;  1A32 A;  3CC7 V;  5J2T B;  4DR6 O;  2WA3 A;  4ZKI A;  4LWS A;  2WLM A;  3TCU A;  2QJ1 A;  5CBH A;  1M93 A;  3WG7 C;  1VP7 A;  1AI7 A;  4JTC B;  1E1R G;  3FB6 C;  4J42 A;  4NVP A;  4AQY B;  2Z5U A;  3W7U A;  4CC6 A;  2CTQ A;  2KG7 A;  2ARH A;  2Y0I A;  2XOK G;  4QNH B;  3RWR D;  1N32 O;  1ZAU A;  3T1Y O;  2YXY A;  3L72 H;  3HKC A;  1HNX O;  2YI9 A;  4PA6 A;  5LP6 A;  3G6B A;  1K8A W;  1AI4 A;  1VQ4 V;  3M7M X;  4JYB A;  3K5M A;  5LMN O;  3T2M A;  2EIK B;  4LFA B;  2ZR3 A;  4P30 A;  2DMX A;  4A5U B;  3JAT A;  1I7F A;  4P2Z A;  3K9S A;  5CA0 A;  4MS2 A;  3KCX A;  4OPA A;  2Z3Y A;  1PP9 H;  2QWO B;  1URF A;  4B3S B;  3O65 A;  2O57 A;  4I5S A;  3VQX A;  3W7S A;  2EX3 A;  3VQW A;  5JQG B;  4O4H A;  3R65 A;  1H8E G;  1GN2 A;  2UXX A;  4LF8 O;  2H8P C;  3OTF A;  3QNE A;  4O2A B;  1YJN V;  2XAJ A;  4NXN B;  3BEH A;  5IYZ B;  2CTW A;  4F6R A;  4LF6 B;  4I4T B;  3LSU A;  4Z1M G;  1PNM A;  3JSL A;  2KQX A;  3ZHT A;  1PPJ H;  2WA4 A;  2JGD B;  1S77 D;  2RCV A;  3ZRV A;  5BXZ A;  1YVW A;  2DQ3 A;  1M90 W;  4LBE C;  4CC5 A;  1N8R W;  2PTM A;  3JAW B;  4GT1 A;  3L75 H;  1GN3 A;  2K1E A;  2QTS A;  3JAS B;  4X65 O;  2QM4 A;  4YXW G;  2JJ1 G;  1FS0 G;  1SKV A;  1YJW V;  4DV1 O;  1M57 B;  2R72 A;  1HDJ A;  3CEI A;  3CCQ V;  4LFB O;  5JVD B;  4HBN A;  1XBL A;  4YJ3 A;  3LDD A;  1W0K G;  3CRA A;  4JAU A;  2UXD B;  2F1M A;  5JJN B;  3KZI Z;  4FLT A;  4R50 A;  3EVK A;  1FD9 A;  4WFG A;  2QA4 V;  1Y76 B;  2B9Z A;  3OEH G;  1YTF D;  4X20 A;  1VQ5 V;  3ASN C;  1VQK V;  2ZR2 A;  5LOV A;  1VQL V;  2CH7 B;  4FLV A;  1D5A A;  1RFY A;  3P3P A;  2QWP B;  5DEC A;  4FPP A;  1XRE A;  1HR0 B;  4Q6G A;  4DR2 O;  1YSC A;  4BW9 A;  4JI7 B;  1KKC A;  4MTG A;  3D8C A;  2QEX V;  4XDK A;  4C7U A;  3OE7 G;  1MSD A;  1BQ0 A;  3BY6 A;  3RYF A;  5C8Y A;  3E22 B;  4PDL A;  4X1Y B;  4DUY B;  2DWE C;  4NYK A;  1GTO A;  2IU3 A;  4UVB A;  1EBO A;  3ZED A;  3AG2 B;  5IJ9 A;  1NU1 H;  4LWS B;  4GX1 A;  2HLD G;  3HR0 A;  5GON A;  4WCE V;  3G71 V;  3U0Z A;  1BGY H;  2HFE C;  3WB0 A;  3ABK B;  1JX9 A;  1PKX A;  1VAR A;  4LFC B;  3BFR A;  4GZR B;  1MZF A;  3TXS A;  4JYA B;  2Y69 C;  3W7T A;  3AG3 C;  4UB8 Z;  4CZZ A;  2KG7 B;  2N74 A;  2ZNI A;  2X6C A;  2HVK C;  3E2E A;  2PI4 A;  2OIE A;  3HKC B;  4YIP A;  5LP6 B;  2A9H A;  2F4V B;  4XDL A;  2X0L A;  4GYC B;  3WB1 A;  1B3Q A;  5CBF A;  4WBN A;  3B77 A;  4PJ0 Z;  5IE9 A;  2X6A A;  1DK1 A;  4JI5 O;  2QKA A;  5CA0 B;  1AP5 A;  2YI8 A;  1FXH A;  1Z5V A;  2UXB B;  5LXT B;  2JIZ G;  4NTW A;  1H2S B;  1XL4 A;  2ZT9 B;  2C2A A;  2WLH A;  4TQD A;  2NLJ C;  1JFF A;  5EC2 C;  1SA0 A;  4RO2 A;  4CH4 A;  1YI2 V;  4DO2 A;  2FKX A;  1FXK C;  1OCC C;  2HG5 C;  1WNS A;  4I50 B;  1RPO A;  2LP7 A;  4F6R B;  3CCL V;  4FLU A;  2B1I A;  2IW5 A;  3CRR A;  1XNR O;  4HNA A;  1Q7Y W;  4X62 B;  2W0F C;  2HR3 A;  1H8H G;  2B1G A;  2Q7E A;  1BHB A;  4RWU A;  2DYS C;  3LDC A;  1CXZ B;  2F93 B;  2OTJ V;  3MHH C;  3A0R A;  1IBL B;  2IBZ H;  1PNL A;  1SC5 B;  3MDS A;  4FM2 A;  1FAF A;  1E79 G;  4DR5 B;  2ILM A;  1EFR G;  1XHZ A;  3NXS A;  4J41 A;  5IT9 N;  2PYJ A;  1AB3 A;  3J7A U;  3ETG A;  2ZNJ A;  3L9D A;  1P7G A;  1D2D A;  2JEU A;  3CJH A;  4WFH A;  4GKK O;  1Q6H A;  1B06 A;  2YC0 A;  2OYQ A;  1K92 A;  3SDL A;  2MW2 B;  3OD4 A;  4YJ3 B;  4BR6 A;  2UUC B;  4YJ2 A;  2UXC O;  4H0L B;  4LF7 B;  2Y4T A;  2V1D A;  1NS1 A;  3RFR A;  1ARO P;  4TOI A;  5JCO A;  4X64 B;  1KEC A;  1L0L H;  4YY3 B;  1XOU A;  1RP3 B;  3CCU V;  5L3G A;  5JJE B;  1VF6 A;  1JPX A;  3AEI A;  4X20 B;  2V4D A;  4Z1V A;  4DR7 O;  1FXV A;  1BL8 A;  3WG7 B;  1Q82 W;  3CCV V;  1K73 W;  5LOV B;  2HP8 A;  2FYU H;  4DV3 O;  1SZX A;  1OHH G;  4PDV A;  2YIA A;  4O4J A;  1XHX A;  1LR1 A;  1S3J A;  1IBK B;  1D5N A;  3K5N A;  5EBM C;  2ZQM A;  4K8X A;  4JI0 O;  4DRX A;  1WPX A;  1Z5W A;  3RYF B;  3ZX6 A;  5C8Y B;  4DR3 O;  3SJQ C;  1Y67 A;  3ZRS A;  4I9W A;  3UKM A;  4H37 A;  3K08 A;  3ETD A;  2HHH B;  1YIT V;  5IJ9 B;  4AHC A;  5C93 A;  1JQ0 A;  3SGI A;  2ZIN A;  1B04 A;  4MSW C;  2H94 A;  5GON B;  1SS3 A;  2CAZ C;  4J9Y B;  1TGO A;  1PL0 A;  4MW3 A;  4O4L A;  2E74 B;  1OCZ B;  3FB8 C;  2EIN B;  4DV0 B;  2OIG A;  3JAL A;  1XNQ O;  4WF9 V;  1HNZ B;  2EUL A;  3FB5 C;  2DW4 A;  4FLX A;  2ATK C;  1NI8 A;  1JVM A;  2YDE A;  4GX0 A;  5K1P A;  3GWK C;  1ZX3 A;  2ZE8 A;  4DV7 O;  4LF4 O;  1QLN A;  1Q5O A;  3RVZ A;  4WBN B;  4B3M B;  1F23 A;  3FYE B;  5BY1 A;  2XAF A;  1M4U A;  3BAA A;  2N05 A;  2QM8 A;  3BVO A;  1I0H A;  1KQS U;  4PHZ A;  3WU2 Z;  4WFE A;  4IYH A;  1JFF B;  3H1K H;  1SA0 B;  2ZM6 O;  1NZ6 A;  4FZ0 A;  3AG7 A;  2A06 H;  4LR3 A;  2EIM C;  4FM1 A;  4UCU A;  1JMK C;  5EIB D;  3CWB H;  1BT8 A;  4L87 A;  1XMO B;  2WLL A;  4DR1 O;  4H33 A;  1R6N A;  2JEX A;  3ZJZ A;  4TSF G;  3BPZ A;  4KP4 A;  2EIJ C;  4PDR A;  3JD0 A;  1K97 A;  2VWK A;  4JI6 B;  1PV0 A;  2YIB D;  2EZO A;  3DSQ A;  2DWD C;  1P84 F;  3OW2 U;  3UT5 A;  1NKD A;  2EIL B;  3H1I H;  1Q8I A;  3LSS A;  2XTA A;  1AI6 A;  2DQ0 A;  1Z2G A;  3K59 A;  2UU9 O;  1DF5 A;  3RN4 A;  4K0K O;  3CJH B;  4MTF A;  4ABM A;  3CPW U;  2GV9 A;  4UXN A;  3FYI B;  3RYC B;  4YJ2 B;  1SQX H;  1S72 V;  5E1A C;  3SJC C;  3HB3 B;  1WPB A;  4X88 A;  4GKJ B;  3G67 A;  4OPH A;  4B3R B;  4G27 B;  4ZI7 B;  1KMI Z;  1JR9 A;  3JD4 A;  3K58 A;  2IM9 A;  3K04 A;  4ZBM A;  3TXQ A;  1SET A;  4NR1 A;  2JK5 C;  1NR1 A;  2KKW A;  2HVJ C;  5EZY B;  5B1A C;  4QE7 A;  4O4J B;  5JVD A;  1YTF B;  3MAQ A;  1BQZ A;  3R66 A;  2UUB O;  4AIL C;  3CCR V;  4DV4 B;  4DRX B;  3F7V C;  4YHH O;  1VQM V;  1CP9 A;  4KUM A;  1XL6 A; 
#chains in the Genus database with same CATH homology
 4U7O A;  1NH2 B;  1M57 C;  4LBE C;  4WFB V;  1N8R W;  4GT1 A;  1MG1 A;  4RAI A;  2BOB C;  1K9M W;  1CEZ A;  2K1E A;  2WAM A;  2BOC C;  2XAQ A;  1NVP B;  2IJJ A;  3SYQ A;  4YXW G;  2JJ1 G;  1FS0 G;  3GWO A;  1YJW V;  1KP2 A;  2EBO A;  2GHY A;  1COW G;  1M57 B;  5CMU A;  4MVZ A;  2A79 B;  3CCQ V;  1NQT A;  2WLI A;  3LDD A;  1JOY A;  1W0K G;  4JAU A;  1M1K W;  2LFR A;  4BIZ A;  2GSM B;  1OCC B;  4MTO A;  5KUM A;  2IJK A;  1KP3 A;  5LHI A;  3ZIA G;  4R50 A;  1AJQ A;  3ZMS A;  1JJ2 U;  1GM9 A;  2HJF C;  2WLK A;  2WPD G;  2YEV B;  4WFG A;  2QA4 V;  1RM1 C;  3OEH G;  1YTF D;  1VQ5 V;  1Y4M A;  3ASN C;  5IYB O;  5L3C A;  1YIJ V;  1VQK V;  2ZR2 A;  2WLN A;  1VQL V;  2FTK A;  4RQE A;  3TK1 A;  1KC8 W;  3EFF K;  4Q20 A;  2MK3 A;  4FPP A;  4TWK A;  2JJ2 G;  3AG2 C;  2XAS A;  1TUE B;  3UM7 A;  1RM1 B;  5J9P C;  1YSC A;  2QKS A;  1NH2 D;  4MTG A;  2QEX V;  4WFF A;  4XDK A;  2W6I G;  3ASN B;  3OE7 G;  5LGN A;  3BY6 A;  3WFV A;  2M7W A;  1R3K C;  3ABK C;  4PDL A;  1NVP D;  3AG1 C;  4KFM A;  2DWE C;  1Q86 W;  1GTO A;  2IU3 A;  4UVB A;  1EBO A;  5L3D A;  5LGT A;  2WLL B;  5CBG A;  3AG2 B;  1NJI W;  3K0D A;  1OCO C;  3X2Q C;  1DTO A;  4QPK A;  4GX1 A;  2HLD G;  1H38 A;  1MAB G;  3CCM V;  3T1C A;  3G71 V;  4WCE V;  4UVA A;  1R3I C;  2HFE C;  3CC2 V;  3ABK B;  1JX9 A;  3B8N A;  1PKX A;  3AG1 B;  2P90 A;  3OFN G;  5LHG A;  2EJR A;  1J95 A;  4HAM A;  2Y69 C;  3W7T A;  3ABL C;  4BIU A;  4MVO A;  2A0L A;  3AG3 C;  4CZZ A;  3OMN B;  4GX5 A;  1OCO B;  3X2Q B;  1K4D C;  3LDE A;  3E89 A;  1QBZ A;  2X6C A;  1ZWI C;  3K3W A;  4G2K A;  5LGU A;  2HVK C;  3E2E A;  4PA3 A;  3ZRW A;  5L3F A;  5IYC O;  3P30 A;  4MVU A;  2PI4 A;  1OCR C;  1G8M A;  1I5X A;  3LUT B;  4FIP C;  2ZXW C;  4JGS A;  2AHZ A;  2DYR C;  4F4L A;  2A9H A;  2Y69 B;  4XDL A;  5L3E A;  2X0L A;  3ABL B;  3ABM C;  3OGC C;  3SPJ A;  4UV9 A;  1VQ6 V;  3AG3 B;  1SES A;  1GO3 F;  4GCZ A;  1VQ8 V;  5CBF A;  3W7X A;  3SYC A;  3B77 A;  1PD3 A;  2X6A A;  3CYO A;  3RBZ A;  3OMA B;  1S76 D;  1OCR B;  1P4R A;  4P9P A;  3F7Y C;  2ZXW B;  2DYR B;  1FXH A;  3ZRX A;  1GK9 A;  2JIZ G;  5KUK A;  2IJI A;  3ASO C;  1XL4 A;  3ABM B;  5B1N A;  2C2A A;  2Q69 A;  2WLH A;  4R6Z A;  1ENV A;  2NLJ C;  1VQO V;  2IU0 A;  5EC2 C;  1K5S A;  5HFL A;  4RO2 A;  5H6Q A;  3CME V;  1YI2 V;  4DO2 A;  3K0G A;  3ZN0 A;  4N21 A;  3CP1 A;  1FXK C;  1G4Y B;  4OXS A;  1OCC C;  2HG5 C;  3E86 A;  1OZ0 A;  2EZP A;  5L3B A;  1RPO A;  2LP7 A;  3CCL V;  3QO8 A;  3ASO B;  4FJC C;  1SER A;  3SYA A;  2B1I A;  2QE7 G;  5DN6 G;  2IW5 A;  2YSU B;  2HKO A;  3JD3 A;  1Q7Y W;  4RQF A;  3E8H A;  2W0F C;  1AJP A;  2HR3 A;  1H8H G;  2B1G A;  1BHB A;  3AG4 C;  2DYS C;  2P6J A;  3LDC A;  2B5U A;  1FXK B;  4DXW A;  1M9N A;  3CCS V;  5LHH A;  1SZT A;  2PI5 A;  4JAV A;  1AR1 B;  2XND G;  2OTJ V;  3MHH C;  4PA7 A;  3A0R A;  3RVY A;  3ZCC A;  3E83 A;  4JTD B;  4MVM A;  1QCE A;  1PNL A;  2R9I A;  4LP8 A;  1KD1 W;  3FB7 C;  1E79 G;  2IJH A;  1EFR G;  3NXS A;  4E2L A;  2ITD C;  3AG4 B;  3JD1 A;  1Y66 A;  2DYS B;  2ZDI A;  3ETG A;  4G28 B;  1B6Q A;  4JTA B;  3CXC U;  1M56 C;  3HPL C;  3QO5 A;  3P32 A;  3W7W A;  3JCZ A;  2JEU A;  4JPR A;  1KKD A;  4WFH A;  4XBF A;  2W6J G;  4UV8 A;  3VOU A;  4BW5 A;  4RUE A;  1UJW B;  2OT5 A;  3D3I A;  1K92 A;  2WLI B;  4GX2 A;  1GKF A;  3PJS K;  5B1O A;  2V1D A;  3IGA C;  2CK3 G;  1BHA A;  1ARO P;  1M56 B;  3K03 A;  1DF4 A;  1KEC A;  4QPJ A;  4P9O A;  5B3S C;  1Q81 W;  3CCU V;  5L3G A;  4LC1 A;  3TET A;  1W0J G;  2P67 A;  1E1Q G;  1JPX A;  5EBL C;  4QJF B;  1LNQ A;  2AHY A;  2Q6A A;  3MHS C;  3AEI A;  1YHQ V;  1WLE A;  4R7C A;  1FXV A;  1BL8 A;  1DLB A;  3WG7 B;  5EK0 A;  3CCV V;  1Q82 W;  3OEE G;  1K73 W;  1IXM A;  5H9C A;  1QLE C;  3CD6 V;  1OHH G;  4PEL A;  4FK5 C;  5IY5 C;  1HWY A;  4PDV A;  5B1B B;  1S5H C;  5B3S B;  1L1F A;  2JDI G;  1S3J A;  3JYC A;  3SYO A;  1K33 A;  1MOF A;  1ORQ C;  3EHB B;  1VQ7 V;  1SRY A;  5EBM C;  4MVR A;  2LFS A;  2ZQM A;  4JF3 A;  3ETE A;  1VQN V;  1WPX A;  3E35 A;  3QO7 A;  3SJQ C;  3OMI B;  1V55 B;  3ZRS A;  1QLE B;  4I9W A;  3UKM A;  5LBQ A;  4H37 A;  4N23 A;  5IY5 B;  4PDM A;  2IH1 C;  1OCZ C;  3K08 A;  2EIN C;  2OCC C;  3E8G A;  3ETD A;  3I55 V;  1YIT V;  2D3O W;  3F5W C;  1S0V A;  2XAG A;  2ITC C;  5C93 A;  1R3L C;  1JQ0 A;  5DM6 V;  4MSW C;  2H94 A;  5BZB A;  3ABT A;  4MTX A;  3CMA V;  4J9Y B;  1PL0 A;  1VQP V;  1JCH A;  4MW3 A;  1THZ A;  1OCZ B;  3FB8 C;  2EIN B;  3T4Z A;  2OCC B;  4MT8 A;  1K34 A;  4WF9 V;  4CBC A;  4FMT A;  1R6K A;  3G6E V;  3FB5 C;  2DW4 A;  3E8F A;  4JAS A;  1V54 C;  2WSS G;  1CPY A;  3ZRW B;  1QR9 A;  2QTO A;  2ATK C;  1NBM G;  3DTU B;  4X8A A;  1FFT B;  1JVM A;  1H2G A;  1K5Q A;  4GX0 A;  3D36 A;  4MW8 A;  1RPR A;  3OR7 C;  1QLN A;  3KG2 A;  5B1A B;  3SYP A;  2Q67 A;  3ZMU A;  2WLJ A;  4XDJ A;  3ZMV A;  4R8C A;  3RVZ A;  1K7D A;  3OAA G;  1F23 A;  3FYE B;  3ZMT A;  1V54 B;  2XAF A;  2UXN A;  5EBW C;  3STZ C;  1GM8 A;  5IDJ A;  5FL7 G;  2QM8 A;  3OM3 B;  3CC4 V;  1K3E A;  1KQS U;  4UVC A;  4MVS A;  3FKS G;  5CN0 A;  2IH3 C;  2Y48 A;  1GMG A;  4WFE A;  3IC7 A;  1VQ9 V;  3LSQ A;  1QVF U;  4BAY A;  2R9R B;  2X6B A;  5GW7 A;  3SPC A;  4TT3 G;  2XAH A;  1I5Y A;  2EIM C;  1ROP A;  3LNM B;  3STL C;  3M99 B;  3CC7 V;  4RUF A;  3T4D A;  3ML0 A;  5H6R A;  3ZN1 A;  3CCJ V;  4L87 A;  3ZMZ A;  2WLL A;  4H33 A;  1R6N A;  3JD2 A;  3K9A A;  4ZKI A;  2JEX A;  1R73 A;  3ZJZ A;  2WLM A;  4TSF G;  3TCU A;  4KP4 A;  2EIJ C;  2EIL C;  4PDR A;  3JD0 A;  5CBH A;  3OR6 C;  1K97 A;  3WG7 C;  3SPI A;  1AI7 A;  2EIM B;  2OTL V;  4JTC B;  2Q68 A;  1AJN A;  1E1R G;  3E8B A;  3FB6 C;  3H01 A;  2EZO A;  5EC1 C;  2ZDI C;  2Z5U A;  4X89 A;  3VBB A;  3ABU A;  4EKW A;  5B1B C;  4UUJ C;  3W7U A;  2DWD C;  2EIK C;  4ASU G;  3OW2 U;  1NR7 A;  3GB7 C;  2XOK G;  1NKD A;  4QNH B;  2EIJ B;  2EIL B;  3LSS A;  1F4N A;  4LCU C;  4MVQ A;  1AI6 A;  3IFX A;  1V55 C;  2DQ0 A;  4PA6 A;  4QE9 A;  1K8A W;  1VQ4 V;  1AI4 A;  5CA3 A;  5KA5 A;  4PA4 A;  4JYB A;  1DF5 A;  2EIK B;  3T2M A;  4MTF A;  3CPW U;  2ZR3 A;  4P30 A;  1F4M A;  4HZ3 A;  5IYD O;  1P7B A;  4P2Z A;  4UXN A;  3FYI B;  1W2B U;  3SPG A;  1QVG U;  4QIW F;  4MS2 A;  1S72 V;  5E1A C;  2Z3Y A;  3G4S V;  3CCE V;  2F43 G;  3OUS A;  3OUF A;  1PNK A;  2ZD9 A;  4I5S A;  4HYO A;  3HB3 B;  3SPH A;  3W7S A;  4J9Z B;  1F51 A;  5KA6 A;  4X88 A;  3K06 A;  4U7N A;  4G27 B;  2P7T C;  3R65 A;  1H8E G;  3JD4 A;  1AI5 A;  2UXX A;  3K04 A;  2H8P C;  3QNE A;  1QR8 A;  3I56 V;  1R3J C;  3DGE A;  2WWW A;  1YJN V;  3MD0 A;  4PA9 A;  2V7Q G;  4JYC A;  2XAJ A;  4ZBM A;  3BEH A;  1SET A;  1YJ9 V;  2JK5 C;  1NR1 A;  3RW0 A;  1K4C C;  2HVJ C;  1EZJ A;  5B1A C;  4QE7 A;  4Z1M G;  1YTF B;  1PNM A;  3B8M A;  3CCR V;  5HFM A;  1MSW D;  1FXK A;  2NNU A;  3F7V C;  1BMF G;  2KB1 A;  1S77 D;  1GM7 A;  3K79 A;  1VQM V;  4WFA V;  3ZRV A;  1CP9 A;  2X7R B;  2QM7 A;  2YEV A;  4KUM A;  2DQ3 A;  1XL6 A;  1M90 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...