2LP7A

Structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope glycoprotein
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 11
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lp7A00
5HFMA 3MHHC 5KA6A 4E2LA 1SZTA 2EZPA 2EZOA 2MK3A 2LP7A 1I5XA 4FJCC 1QBZA 1K34A 3GWOA 4JPRA 3P30A 1QR9A 1Y66A 5HFLA 1DLBA 3B8MA 2M7WA 1I5YA 5H9CA 4FK5C 4JGSA 3B8NA 1JQ0A 3CP1A 5KA5A 4N23A 1Y4MA 5CMUA 1DF4A 1QR8A 1MOFA 2OT5A 2P6JA 1K33A 3K9AA 4N21A 3MHSC 3CYOA 1DF5A 1ENVA 3B77A 1EBOA 1JPXA 4JF3A 4G2KA 5CN0A 1QCEA 2EBOA 3H01A 3M99B 1F23A 1MG1A 3WFVA 4FIPC 2X7RB
chains in the Genus database with same CATH superfamily
4QPKA 2Y69C 4O4LA 4GKKB 4K0KB 4DV3B 3OE7G 1I94O 1FS0G 2L6LA 4DV0B 4H0LB 5FPRA 4TV9B 3CP1A 2IJHA 3ZRWA 2ZDIC 2ZXWC 1MABG 3CC4V 3AK2A 4TWKA 3FAVA 4JI6O 4HYOA 1W59A 3OGCC 1PV0A 5L3FA 5IYZA 2WLKA 1WAZA 2AZ0A 4FVMA 1OCZB 3EFFK 3ZHVA 2YSUB 1PD3A 2HHHB 1PM9A 4MVZA 4YJ3B 4EB6B 5B5EZ 3AG7A 1JJOA 2RNBA 3R66A 4X62O 3F5TA 3WFVA 5EC2C 4OXSA 5KUKA 1AVMA 2UUBB 4EFEA 2Z0AA 1KC8W 5KUMA 2OWOA 2Z5UA 4LP8A 1PKXA 3BVOA 2OIGA 1M56C 1JQ0A 2CH7B 5CA0A 4QJFB 2ZM6O 1L0NH 4JAUA 3I56V 5CN0A 1FXKC 3MHSC 4F6RB 3TETA 3J7AU 2QWNB 4CBCA 1N8RW 2VWKA 4DV5B 2HEPA 4O2AB 2IU3A 3P3PA 2UUAO 2WA4A 4NVPA 2GBOA 3O65A 1MZEA 4MVMA 1H8HG 3SYPA 1FFXB 4NTWA 1SRYA 4JI4O 1I94B 3OT7A 2ZT9B 3E2EA 2EIJC 1E79G 3K79A 2IJIA 2PY5A 4ZIBA 1K92A 2M6YA 3EXAA 1GM9A 4BIOA 4DR7B 1O9GA 4LF7O 3IGAC 2PTMA 1YCIA 1CEZA 1NR7A 2VRZA 4QPJA 1MZFA 3SPIA 2ZR2A 4MTXA 1FXHA 4OX9B 3FB8C 5D5QA 4X1YB 4DR1O 5KA6A 4GZRB 4UB6Z 4KP4A 2YUAA 2YIAA 2XOKG 3HB3B 3OMAB 3A8TA 5BZBA 1VF6C 3P32A 4WFBV 2X6CA 3Q4HB 1YIJV 1XNQB 1BZKA 3OEHG 1IBKB 1XHXA 2E3CA 2DYRB 4AI8A 4AQYB 2XAFA 1Q43A 1AR4A 1WA8B 2OCCB 3L9DA 3BPZA 2HJFC 4QE7A 2ETNA 3MDSA 4MW3A 4H44B 2F4VO 3N2GA 2YC0A 1YI2V 4JGSA 1SKVA 2E75B 4JI7O 4UCSA 4DRXA 4YHHO 1WPBA 2UUAB 2HR3A 2X6AA 1F51A 3DTUB 1BMFG 3KKYA 3RYFA 4B3MB 1US6A 3K9SA 2QSAA 4G27B 3ZRSA 3CXCU 3DC5A 3BABA 3B40A 1ZTEA 4KL1A 3UM7A 4YY3B 2XAQA 3J80N 2DWDC 5J2UA 5IY5B 3ASOC 3CMAV 4LF7B 4CS4A 1R6TA 4K8ZA 3RN4A 5LOVB 1VP7A 3G67A 5IWAO 2LFRA 4UCUA 4NB5A 2Q0OC 4JAVA 5CB4B 3EHBB 2WLIB 1S0VA 3TXSA 5JJJB 2CTRA 1Q6IA 4NR1A 1XL6A 3SJCC 2LW1A 4RUEA 5JQGB 1VEWA 4J9ZB 1HNZB 1EN6A 1QLEB 4DR5B 1U96A 2PUSA 1M56B 1XL4A 3CEIA 2PI4A 2VS0A 1GM8A 2PYLA 4MVOA 2XNDG 1WB7A 1R3LC 4I50B 4FM2A 4K3AA 2PI5A 3L71H 4CH3A 5CBGA 4X64O 4FLZA 4ZOLB 1DLBA 2Q69A 1AILA 2DE0X 3ZRXA 1XMOO 4PA6A 4HZ3A 4FFBA 3ZMSA 4Z1MG 3KG2A 4NTXA 3CMEV 1G6UA 5LBQA 4GX2A 2Q8VA 2GDSA 1Z2GA 3P30A 3ZS8C 2XTAA 3VQYA 3FB6C 1OV9A 5B3SB 4DV2B 1SESA 2HP8A 2YI8A 3ZRWB 2CTWA 3T1YB 3FAVB 2Q9LA 4BWAA 1M4UA 2EILC 1YITV 1NTKH 4CS2A 1NQTA 2ZIMA 5IYZB 1NH2D 1GM7A 4XDKA 4GLXA 5IWAB 4W4LA 2G38A 1A32A 4J42A 1H38A 1ZL8A 1VQ8V 2QWQB 4DUZB 3CCMV 4G28B 3TCUA 3L73H 2Q73A 1YZBA 2RCVA 4LFCO 3X2QC 4LBEC 4PA9A 1XI1A 1QVGU 3L72H 4BIZA 4LF4B 3FB5C 2DJVA 4UUJC 4D6TH 5CA0B 4K35A 2VQEO 4C7UA 5B1NA 2R72A 2QKAA 5LHIA 3OR6C 4LF9O 3P3NA 1WJZA 1HR0O 3CCSV 4I0XA 2JEXA 5K1XA 2KG7B 3ZN0A 3FYEB 4MVUA 1PNLA 4JASA 1AI6A 1K97A 3STLC 5CA3A 4B3SO 1NS1A 1K73W 2IJJA 4DR3B 3QF7A 3D36C 5GTHZ 1I08A 4IYHA 2ADQB 2E5LO 3ETGA 2QM8A 2CTPA 4QGPA 1N36O 3JAKA 3LNMB 3SJAC 2AGAA 5LMNB 4H33A 2QGNA 3AG4C 3UO3A 1EN5A 5GTIZ 4X66B 3IAYA 2UUCO 4F6EA 1BS3A 1OCOB 2DYSB 2YIDA 2LP7A 3JYCA 5LA6A 1NTZH 3ASNC 3OR7C 2F66C 3JAWA 4JI1O 3SPJA 4R7CA 3T1HB 4O4JA 4J9YB 2EBOA 3SR2C 1KUQA 4FZ1A 1VF5B 1WP7A 5EC1C 2LO1A 3JATA 4KXRA 1WN7A 4JZGA 3GWOA 4NYKA 3KCYA 1NJIW 2JJ2G 1Y66A 2W0XA 2ZINA 5HFLA 1NTMH 2ZNIA 3ZN1A 3N2GB 1FFTB 2E76B 1BGYH 3OEEG 3E35A 4DRXB 2P6JA 2A7WA 1CP9A 4O4IA 3QO8A 3K5LA 5A9GA 4XDLA 4NXMO 2MW2B 4TOIA 3RYFB 1HNXO 4DR6B 1IDSA 4LF5O 2DOSA 4JI8B 2JS3A 3T4ZA 4JV5O 1IBMB 4B3TO 3ZEDA 2CUGA 2DW4A 3ML0A 3APQA 2E5LB 1E1QG 2FKXA 4TSFG 4LNUA 2WWWA 1K4CC 3AK1A 3QO5A 3HKCB 2CK3G 4IL6Z 4W4KA 1RPOA 3K5MA 4K8XA 1HDJA 4ZI7A 1AB3A 2ZDIA 4GT1A 1N0JA 3OW2U 4A5UB 3ZHRA 3FKSG 1S76D 2GV9A 4MW8A 2Y4UA 1OCRB 4X20A 1IBLB 3ABUA 2JDIG 3KCXA 4FPPA 1TA8A 2UXXA 1XNRO 4JF3A 3A0HZ 4DUYB 3AG1C 1TUBA 1UFIA 3BA9A 1BT8A 3ETQA 3B4SA 4JZ2A 4PELA 1DGSA 4CS3A 1B04A 1JR9A 1XHZA 3ABLB 3AG2C 4MTFA 3ABKB 4B3RB 3PN1A 1AJPA 2JRIA 4ICGA 3PJSK 1RM1C 3JCZA 1EM1A 2FTKA 3JD1A 2JS5A 4QIWF 4FFBB 1P49A 2R70A 1YSCA 1DK1A 3LDCA 1FXKA 5DEDA 4NXMB 1HNXB 1FKAO 1VQ9V 4PDMA 4NXNB 4B7EA 3GB7C 4WFHA 1N0NA 4Q20A 1K5SA 4X65O 4JV5B 4B3TB 1FAFA 2AHYA 2D2CB 3AG3B 1KQSU 2ADPA 1V55C 3F7VC 2AZ2A 4DK1A 5LP6C 1M57B 2EINB 2CTQA 2ZE6A 2RJZA 4JI0O 3E8HA 3CJHB 2CDYA 1OZ0A 3KZIZ 4IYIA 3T2MA 3E8FA 2BSKA 2CGNA 1ZL8B 2OT5A 1EN4A 2LJ2A 1FJGB 3CS5A 4Q6GA 4FLUA 4JI5B 3VQWA 1R6KA 3RT3C 4WF9V 3C90A 4P9OA 3CWBH 3JD2A 5FLXN 2MK3A 2F95B 3H1KH 3D3QA 1VQ4V 1OCCC 2FL4A 2CE4A 2ITCC 3RYIA 1PPJH 3T1CA 1VF6A 2YIBD 4OGQB 3LSQA 1EZJA 2H3OA 5IJ9A 5JWPA 4DW0A 1H2NA 3CXHF 3L75H 3UO2A 4PA4A 2YXHA 4I0XB 1M9NA 1ZSPA 4PD4F 2D3OW 4KHPO 3DSQA 1NVPD 1JJ2U 1G4YB 1Y74A 3CCLV 5B1BC 1X4TA 4JI3B 5IJ0A 4LFBO 1VIBA 1Q81W 2PF4E 2NN4A 5B1AB 3CCQV 3U11A 1GRJA 2KG7A 2Q67A 4PA3A 2JGDA 3JAKB 3U0ZA 2YEVA 3N27A 4BR6A 3BHPA 5E79Z 4G2KA 3B2EE 1PL0A 1YJ9V 1SETA 3K08A 1QLNA 5LA6B 1Z5WA 4JI6B 5F2VO 3ABMC 1VQPV 3K04A 1TAEA 5CMUA 1J5EO 3JAWB 4I4TB 2UU9O 1K4DC 1AP5A 1Q86W 4Z2WA 3STZC 4LWSA 3QVNA 5GW7A 3H01A 1Q6HA 3RFRA 4O4JB 4WCEV 2EIMC 3SPHA 4X62B 5FPOA 3JATB 5LGNA 3K59A 1DTOA 3H9VA 3FB7C 1VQ5V 1SQGA 4FZ0A 3WG7B 3ZMUA 1RPRA 2HVJC 2Y4TA 4O4IB 1VQMV 3OTFA 2UXDO 2ZM6B 1OHHG 2K9PA 2EIKC 2WPDG 2PYJA 5D5PA 2Y69B 2WLMA 2OIEA 1YDXA 5BY1A 1BE3H 4LNUB 1ZLZA 1VQLV 1SQPH 1BSMA 2N05A 2WLJA 1M5IA 1MG1A 3JAMN 1AJQA 2E74B 4JI4B 4HAMA 4JYCA 4ZI7B 1FPOA 2ZXWB 4I5SA 4OPAA 5FL7G 2W6IG 4X20B 4FLWA 1S5LZ 4EEQA 3B77A 1WP8A 3F5WC 3HKCA 4PA7A 2QM4A 1J5EB 1F23A 4LC1A 5CBHA 2IM9A 2Q5ZA 1TUBB 4UVBA 2CAZC 3SGIA 1JOYA 2A0LA 5IYDO 1ZWIC 4MSWC 1HNWO 1HP8A 2ZQMA 3NXSA 4DR1B 1VARA 3B8MA 3DC6A 1HWYA 3SJQC 3GVMA 3ZBHA 2JVDA 1AROP 5LGTA 4JYAO 2AW9A 2QDOA 4IGGA 4MVRA 5KHHA 4YIPA 4DR4O 1YJWV 3FX7A 4Z1VA 4GX1A 3SJBC 1NZ6A 3VQVA 1VQ7V 3EVKA 3ZX6A 3TGUH 1K8AW 1FXKB 2YICA 1PNMA 5CA1B 5KMGA 5KLVH 1ROPA 3OUSA 3E89A 3A0BZ 4BAYA 5BMVA 3JCUZ 2F4VB 1VQNV 2EJRA 4GX0A 1XBLA 4JI7B 3TJTA 4JI2O 4YHHB 1MNGA 2EIJB 4TT3G 1X59A 4TUYA 3D36A 5EZYA 2JIZG 2OCHA 1BQZA 3OGIB 5EBWC 5EK0A 3ZHTA 4QNHB 2BSKB 2QA4V 1IXMA 3W7XA 4UB8Z 2N74A 1GK9A 3AK3A 2GUZA 2IBZH 4X1KA 2AXTZ 3CJHA 3QG5A 4J7KA 1XMQO 3RBZA 4LFAO 1EZVH 1LUVA 2JEUA 3RYIB 3QNEA 1WPXA 4UCRA 1DF5A 4X9QA 1N33O 1V9PA 4B7KA 5IJ9B 4FIPC 4R50A 4I7ZB 1SZTA 2EZPA 5L3DA 2UXBO 3LNNA 4AHCA 1RFYA 4PHZA 2ZIOA 4J41A 1PNKA 1ZX3A 2JK5C 1R3JC 1VMGA 4CH6A 1CXZB 4MVQA 4X64B 1K33A 4FM0A 1VQOV 2BTQA 1N32O 1Y74B 5EBMC 2VQFO 2KB1A 3RYHA 5IJ0B 1XMOB 2W6JG 4I55A 5B66Z 3WB0A 1GN2A 4PJ0Z 4OPHA 4E4EA 2YS8A 5H9CA 2JGDB 1XUQA 3CB2A 5JJNB 5CBFA 2YEVB 1AI5A 1U97A 4LH7A 4UVCA 1VQKV 2HJDA 3ASOB 1JFFA 3BRCA 3H1LH 2UXNA 1L8DA 1SQFA 4BIUA 1AP6A 1YTFD 5JJEB 3CD6V 4GKJO 3E8GA 2FYUH 1YEWA 2OTLV 5JCOC 4LWSB 2IH3C 4WFFA 2BCCH 3S3WA 4L8JA 5LMUO 3G80A 5H6QA 1V54C 3CRMA 3OUFA 3OD4A 5EIBD 4LR3A 2UXBB 2NR5A 1BCCH 4I4TA 4LFCB 1MOFA 2ARHA 4JYBA 1H2LA 2F1MA 3JSNA 2HKOA 4WFGA 2A3QA 2VQEB 4E2LA 2WLNA 3BEHA 2HFEC 4DV6O 4DK0A 1GMGA 3HKDA 3JD4A 4FLYA 1N34O 1QR9A 1F4NA 3SDLA 4DV1O 2IU0A 4LF9B 4FM1A 1HR0B 2BTOA 2IH1C 2WA3A 3JALA 1OCZC 4J11A 4ABMA 1GTOA 1H8EG 3JASB 3ZMVA 3OFNG 4U3JA 5HFMA 3C3TA 4DR2O 2Q0AA 4B3SB 4DV4O 1NT2B 1GN4A 3E86A 5EYPA 2OYQA 5LP6A 4JPRA 2JJ1G 3I55V 4LF6O 2EILB 3MD0A 1B6QA 5FNVA 1WLEA 3A0RA 4X89A 1KP2A 5IYBO 5AG2A 1AR1B 3K9AA 1N36B 1J95A 5L3CA 3W7SA 1OJHA 5KHIA 2ODMA 1URFA 2QWPB 1IXBA 2YDEA 5KHGA 3HKEA 3E83A 4UCOA 2C2AA 5A2QN 1PP9H 4GYCB 4RO2A 4LF8O 1Q7YW 2H94A 2UUCB 3K3WA 5LMUB 1SQXH 4O4HA 3H1IH 3W7TA 3B09A 5KHKA 1JMKC 3X2QB 4J80A 1NKDA 4K0KO 2Z3YA 4DV3O 2R9IA 2LFSA 4DV0O 3RWRD 1TGOA 4RWUA 3CCVV 4ASUG 4JI1B 5L3GA 3IJ4A 1S3JA 2BE3A 4IHJA 4JTAB 3ZMTA 5BXZA 5KMGB 2IW5A 4MT8A 5BMVB 5LL6Y 1YHQV 1S72V 1RP3B 4R8CA 4FMTA 3ABTA 5KAIZ 1LUWA 3UKMA 4PI2A 2HHHO 3BCCH 2NLJC 4TUYB 5EZYB 1JVMA 3O9OA 4TQFA 1BHBA 5CA1A 4LF5B 5DECA 1KU9A 2EX3A 2YI9A 1GAXA 3UCSC 1K5QA 1JPXA 3UQ8A 1QCEA 2A9HA 2QR4A 3AG4B 3W7WA 1E1RG 2GUZB 4IIJA 4QE9A 4X1KB 2EULA 3MAQA 2F43G 1K34A 1Q5OA 3VBBA 1FD9A 1YXBA 3JD0A 2DYRC 1I5YA 1DF4A 4H13B 4EKWA 2QJ1A 1QQCA 2ATKC 1H2GA 3ASNB 2OCCC 1QVFU 1N4CA 4DV5O 1SC5B 2PZSA 1KP3A 2QTOA 3H1HH 3ZHSA 3HKBA 4I9WA 1XNRB 2Q7HA 4BW9A 4P2ZA 2EJ7A 2KQXA 4FLVA 4YXWG 3JARA 3SPCA 3AEIA 4L87A 3E22A 3CC2V 2RN9A 3GWKC 2BTQB 4DR7O 3CHXA 1W0JG 1PL4A 2F93B 5IT9N 4D7TA 3OMNB 4NTYA 3RYHB 1SF9A 5LYJA 3SYQA 5IY5C 4J7JA 4I55B 4LH6A 4OX9O 3A2FA 2QWRB 2QM7A 4I9QA 3IC9A 1JCHA 1KECA 2GHYA 1VQ6V 4X65B 2R9RB 1P7BA 1JFFB 1Q90D 2V7QG 5JH7A 1ZUQA 1XNQO 2PGGA 1KKCA 1QNMA 1IBKO 1QLEC 3FYIB 4O2BB 1XQ8A 2KSDA 4JI0B 4AQYO 3M8AA 4UCTA 4EFBA 2P4KA 2X6BA 2KKWA 4J7ZA 1AI4A 4UV8A 3VQXA 1P84F 4LCUC 5LXTB 1COWG 1L0LH 3DXRB 4GUNA 3W7UA 1K9MW 3AG1B 2B1IA 2XAHA 4ZHQA 4YJ2A 4FLTA 4B3MO 1Y4MA 1Q6UA 1D2DA 3D3IA 2ZD9A 1RSOA 1WNSA 3NR7A 3AG2B 1GKFA 1SS3A 4P9PA 4YY3O 5EIBC 1RM1B 3ETEA 4MVSA 1LNQA 5B3SC 3RGBA 3K58A 2NNUA 1P4RA 2YXLA 4CC6A 3HKDB 2P5OA 2O57A 4XBFA 1ZAUA 4HNAA 1R3KC 2DN9A 3CX5F 3JALB 5IDJA 4KHPB 1G8MA 4U3JB 1UPGA 3RVYA 1I0HA 1I5XA 1GH6A 1HNZO 1V55B 1SQBH 4DO2A 4DR5O 5EYPB 5LP6B 4LFBB 1R1BA 5FNVB 2WLLA 1YVWA 4IT5A 3ZIAG 4H37A 3CYOA 1UJWB 4JYYA 1Q3EA 3WB2A 3K0DA 3JASA 1I7FA 2JGUA 1W0KG 2GTSA 3BA8A 3HKEB 5ITZA 5TISZ 1NH2B 1Y67A 2XAGA 2ZNJA 4KFMA 3UT5A 3ZHUA 4PDVA 4GX5A 5LHHA 1P7GA 4O4HB 3J81N 2LGWA 4CH5A 4TV8A 3K57A 1OCCB 1XEQA 2GTAA 4N21A 5H5NA 3F7YC 1Q8IA 3HR0A 3SYCA 2UU9B 2ITDC 3C3SA 4PV1B 2HLDG 2P7TC 1JA8A 1Y76A 3N2KA 4DV2O 3VOUA 3OMIB 3T1YO 2DQ0A 3CSXA 3RVZA 4IHJB 3B8NA 4UXNA 1F4MA 4MS2A 5IYCO 4DV7O 2YIBA 1TVKA 2QTSA 1M93A 3CPWU 4FJCC 2H8PC 3THOA 1CPYA 1IVSA 1KMIZ 2Q6AA 5B1BB 3LUTB 3BY6A 4DUZO 4WBNA 1O9HA 4X1IA 2UXDB 1SQQH 2UXCO 2ZE5A 3DGEA 1OCOC 2DYSC 4ZKIA 1M1KW 1GN6A 2HVKC 2IJKA 5L3EA 2Y0IA 2V1DA 2K1EA 1L1FA 2W0FC 1K7DA 2Q7EA 4LF4O 4IIJB 2ZE7A 5KX5A 3K06A 1YTFB 5JVDA 2B1GA 1XDCA 2VWJA 1Q82W 5J2TA 5C8YA 5B1OA 2GSMB 1H2KA 4B08A 4UCVA 2RMKB 3L70H 2XUMA 3ABMB 3LDEA 4MTOA 3RYCA 2Q68A 5GONA 1SA0A 3CCEV 5DM6V 1S5HC 5KHJA 4U7OA 5JCOA 3APOA 4O4LB 3HKBB 4RAIA 2YXYA 5LHGA 5J9PC 2EIMB 3CCUV 2XHBA 2LW7A 4DR3O 4MTGA 3JARB 5L3BA 1HNWB 1D5NA 5E1AC 1KB9F 3G4SV 5EBLC 2RQ6A 3E22B 3ZCCA 4JYAB 4DV7B 3SYAA 5IE9A 4DR4B 1SZXA 4D7SA 2Q4PA 4TQDA 5LYJB 5LMNO 1QBZA 3ICXA 4TV9A 2M7WA 4PI0A 4CC5A 4CZZA 5KA5A 4X66O 2ZE8A 3RW0A 4X88A 1VF7A 1SQVH 1TUEB 2EIKB 1BHAA 3WB1A 1ENVA 3K5OA 1AJNA 1MMMA 2N04A 3K03A 2UXCB 1FXVA 1YJNV 4HBNA 1OCRC 4JTDB 2BOBC 3H1JH 2EZOA 5JH7B 2A79B 3FFQA 4JTCB 4JI2B 2Q7GA 1KBHA 3S3XA 3T1HO 3CRRA 2Y0PA 3CC7V 4YJ3A 4EB6A 1YF2A 1MSDA 2V4DA 2FB5A 2DQ3A 1EBOA 2X0LA 5H2FZ 1R3IC 4UFZA 2R9AA 3ABLC 2WLHA 3ABKC 4F4LA 3CCJV 1XOUA 3D8CA 3ZMZA 1BQ0A 4O2BA 4ZHQB 1XILA 2CH7A 4YJ2B 1QR8A 1XMQB 2DWEC 4DR6O 4LFAB 3OTOO 2P22C 1S77D 4FLXA 1RSOB 2XT9A 3LDDA 4F6RA 4JI8O 1IBMO 3G6EV 3T4DA 3L74H 5LXTA 5KAFZ 2P67A 4O2AA 3TXQA 3DXRA 3ZJZA 1N33B 2B9ZA 4UV9A 3AG3C 3IC7A 1FFXA 3G6BA 2Y48A 4RQEA 1M57C 2EINC 4ZBMA 2QWOB 4HNAB 1GO3F 3M7MX 2P90A 1HW7A 1NR1A 3BFRA 1IBLO 1AI7A 1N32B 2VQFB 1MSWD 2QE7G 1JX9A 1SERA 4DUYO 1AR5A 2XASA 1ORQC 4UVAA 1IX9A 2WLLB 3JSLA 3K0GA 4R6ZA 4YIOA 4X1YA 1NBMG 3JD3A 1NI8A 3TK1A 3CRAA 3ETDA 2LQTA 4B3RO 2WSSG 2QEXV 4NKGB 5ITZB 2HG5C 3G71V 3Q4HA 3UT5B 4FK5C 3ZHQA 1B3QA 3ZRVA 1IZ3A 4N23A 1F7YA 3WU2Z 4TV8B 1R6NA 2ILMA 4GKJB 1R73A 4FFKA 4CH4A 4NXNO 3LSSA 1H2SB 3OTOB 1QU7A 1WA8A 4GCZA 5C93A 4RQFA 1Y6XA 2CGOA 1Y76B 3N2KB 2LGQA 4P30A 3OM3B 1T5EA 2DMXA 4X8AA 4WFAV 5J2UB 4U3FH 5K1PA 5BR8O 4RUFA 2RDCA 1TVKB 2ZCEA 2P06A 4GKKO 1H2MA 2A06H 5B1AC 3LSUA 3K5NA 3FD9A 3MHHC 3SPGA 1S5JA 1LR1A 1B06A 4DYLA 1FJGO 1KYOF 2BOCC 4WBNB 4X1IB 4JI5O 5LGUA 1GN3A 4DV6B 1M90W 1K3EA 5LOVA 1NVPB 1EFRG 1N34B 1FYJA 1KD1W 3OAAG 1IURA 3I5DA 4DV1B 2X7RB 2ZR3A 5CB4A 3HPLC 2WLIA 1W2BU 2P4VA 4U7NA 5KX5B 2ZKOA 4BW5A 5DN6G 1XREA 4PDLA 5JVDB 2B5UA 4WFEA 1G1XB 2F23A 1BL8A 5C8YB 5JQGA 5J2TB 2QKCA 4DXWA 4DR2B 4DV4B 3SYOA 3BAAA 1KKDA 2AHZA 4LF6B 2WAMA 2UUBO 3RYCB 1QHTA 4PDRA 3M99B 1MA1A 5GONB 4JAAA 1SA0B 4I50A 4AILC 4KUMA 3WG7C 3CCRV 2XAJA 3QTCA 2L35A 3CE2A 4ZOLA 3U10A 4DW1A 3IFXA 3CRQA 4XDJA 3R65A 4J10A 3CRCA 3E8BA 3QO7A 4JI3O 1WB8A 1D5AA 4LF8B 1V54B 5H6RA 2FMLA 1NU1H 2QKSA 1Z5VA 2OTJV 5BR8B 1THZA
chains in the Genus database with same CATH topology
1G8MA 1GK9A 5EC1C 4QPKA 2Y69C 3RVYA 1I5XA 3OE7G 3RBZA 1FS0G 1V55B 3GWOA 4DO2A 1NJIW 2JJ2G 1Y66A 5HFLA 3ZN1A 1FFTB 3CP1A 2JEUA 2WLLA 3QNEA 3OEEG 3E35A 3ZIAG 1WPXA 2IJHA 2P6JA 3ZRWA 4H37A 1CP9A 2ZDIC 3CYOA 2ZXWC 1MABG 1DF5A 1UJWB 3CC4V 4TWKA 3QO8A 3K0DA 4XDLA 4HYOA 4FIPC 3OGCC 5L3FA 4R50A 1W0KG 1SZTA 2EZPA 2WLKA 5L3DA 1NH2B 1OCZB 2XAGA 1PNKA 3T4ZA 3EFFK 2JK5C 2YSUB 1R3JC 1PD3A 4KFMA 2DW4A 4PDVA 3ML0A 4GX5A 5LHHA 1E1QG 4MVZA 4MVQA 4TSFG 1K33A 2WWWA 1OCCB 4N21A 1K4CC 1VQOV 3QO5A 3F7YC 5EBMC 2CK3G 2KB1A 3WFVA 1RPOA 5EC2C 4OXSA 3SYCA 5KUKA 2ITDC 2W6JG 2ZDIA 4GT1A 3OW2U 2HLDG 2P7TC 1KC8W 5KUMA 3FKSG 3VOUA 2Z5UA 1S76D 4LP8A 4MW8A 1PKXA 3OMIB 1OCRB 1M56C 2DQ0A 5H9CA 3RVZA 3B8NA 1JQ0A 4UXNA 1F4MA 3ABUA 2JDIG 4MS2A 5IYCO 5CBFA 4QJFB 2YEVB 1AI5A 4FPPA 2UXXA 4JAUA 4UVCA 3I56V 4JF3A 5CN0A 1FXKC 3CPWU 3MHSC 4FJCC 2H8PC 1VQKV 3AG1C 3TETA 3ASOB 1CPYA 2UXNA 4PELA 4CBCA 2Q6AA 1N8RW 4BIUA 5B1BB 1YTFD 3LUTB 2IU3A 3BY6A 3ABLB 3AG2C 3CD6V 4MTFA 4MVMA 3ABKB 1H8HG 3E8GA 3SYPA 1SRYA 1AJPA 2OTLV 3PJSK 3DGEA 1OCOC 3JCZA 1RM1C 3E2EA 2DYSC 2EIJC 4ZKIA 1M1KW 2FTKA 2HVKC 2IJKA 3JD1A 2IH3C 1E79G 5L3EA 4WFFA 2V1DA 2IJIA 3K79A 2K1EA 4QIWF 1L1FA 1YSCA 2W0FC 1K7DA 1K92A 1GM9A 3LDCA 5H6QA 1FXKA 3K06A 1YTFB 1V54C 3IGAC 1VQ9V 4PDMA 2B1GA 3OUFA 1CEZA 1Q82W 1NR7A 5B1OA 4QPJA 3GB7C 3SPIA 4WFHA 4Q20A 1K5SA 2GSMB 1MOFA 2ZR2A 4JYBA 4MTXA 2AHYA 3AG3B 1KQSU 1FXHA 3ABMB 3LDEA 4MTOA 3FB8C 2Q68A 2HKOA 1V55C 3F7VC 4WFGA 3CCEV 5DM6V 1S5HC 1M57B 4U7OA 2EINB 5KA6A 4E2LA 2WLNA 4KP4A 3BEHA 3E8HA 2HFEC 2XOKG 4RAIA 3HB3B 3OMAB 5BZBA 1OZ0A 1GMGA 3JD4A 5LHGA 3P32A 5J9PC 1QR9A 4WFBV 1F4NA 2EIMB 2X6CA 3CCUV 1YIJV 4MTGA 3T2MA 3E8FA 5L3BA 2IU0A 5E1AC 3OEHG 2OT5A 3G4SV 5EBLC 2IH1C 1OCZC 1GTOA 2DYRB 1H8EG 3ZCCA 1R6KA 3ZMVA 2XAFA 3OFNG 5HFMA 4WF9V 3SYAA 4P9OA 3JD2A 2MK3A 2OCCB 2HJFC 1QBZA 4QE7A 1OCCC 1VQ4V 3E86A 4MW3A 4JPRA 2JJ1G 3I55V 2ITCC 2M7WA 2EILB 3MD0A 1B6QA 4CZZA 4JGSA 1YI2V 1WLEA 3A0RA 5KA5A 4X89A 1KP2A 3RW0A 4X88A 1TUEB 2EIKB 3T1CA 5IYBO 1AR1B 2HR3A 2X6AA 3K9AA 1BHAA 1J95A 1F51A 5L3CA 3W7SA 3LSQA 1EZJA 1ENVA 3DTUB 1BMFG 1AJNA 3K03A 1FXVA 1YJNV 1OCRC 4JTDB 4G27B 3ZRSA 2BOBC 3CXCU 3E83A 2EZOA 2A79B 2C2AA 4PA4A 4RO2A 4JTCB 1M9NA 3UM7A 1Q7YW 2XAQA 2H94A 2DWDC 3CC7V 3K3WA 2D3OW 3W7TA 5IY5B 3ASOC 3CMAV 1NVPD 3X2QB 1JJ2U 1G4YB 2DQ3A 1NKDA 3CCLV 1EBOA 2X0LA 1R3IC 2Z3YA 5B1BC 2R9IA 3ABLC 2LFSA 2LFRA 2WLHA 3ABKC 3CCVV 4F4LA 4ASUG 4JAVA 5L3GA 3CCJV 3EHBB 1Q81W 2WLIB 1S0VA 3ZMZA 1S3JA 5B1AB 1XL6A 3CCQV 2Q67A 4PA3A 4JTAB 3ZMTA 4RUEA 2IW5A 1QR8A 2YEVA 2DWEC 4J9ZB 1QLEB 4MT8A 1S77D 1M56B 1XL4A 1YHQV 4G2KA 1S72V 2PI4A 1PL0A 3LDDA 1GM8A 4R8CA 4FMTA 3ABTA 2XNDG 4MVOA 1YJ9V 3UKMA 1R3LC 3G6EV 3T4DA 1SETA 2PI5A 2NLJC 2P67A 3K08A 3ZJZA 5CBGA 1QLNA 4UV9A 3AG3C 3ABMC 3IC7A 1JVMA 1DLBA 2Q69A 1BHBA 1VQPV 2Y48A 3K04A 5CMUA 4RQEA 3ZRXA 1M57C 2EINC 1K4DC 4ZBMA 1Q86W 3STZC 1GO3F 4PA6A 5GW7A 1K5QA 1JPXA 4HZ3A 1QCEA 3H01A 2P90A 4WCEV 2A9HA 2EIMC 3AG4B 3W7WA 1NR1A 3SPHA 3ZMSA 1E1RG 4Z1MG 4QE9A 1AI7A 3KG2A 3CMEV 5LBQA 2F43G 4GX2A 5LGNA 1K34A 1MSWD 1DTOA 3VBBA 2QE7G 1JX9A 3P30A 3FB7C 1VQ5V 1SERA 3JD0A 2DYRC 3WG7B 1I5YA 1ORQC 2XASA 3FB6C 4UVAA 1DF4A 3ZMUA 2WLLB 4EKWA 5B3SB 1RPRA 2ATKC 1H2GA 1SESA 3K0GA 4R6ZA 3ASNB 2OCCC 3ZRWB 2HVJC 1QVFU 1VQMV 1NBMG 3JD3A 3TK1A 3ETDA 2EILC 1YITV 1OHHG 1KP3A 2QTOA 1NQTA 1NH2D 2WSSG 4I9WA 2QEXV 1GM7A 2EIKC 4XDKA 2WPDG 4P2ZA 2HG5C 3G71V 4YXWG 1H38A 4FK5C 3SPCA 3ZRVA 2Y69B 2WLMA 4N23A 1VQ8V 3AEIA 4L87A 1VQLV 3CC2V 1R6NA 3CCMV 4G28B 1R73A 2WLJA 1MG1A 1AJQA 1W0JG 3LSSA 3TCUA 3OMNB 4HAMA 4JYCA 5C93A 4GCZA 3SYQA 5IY5C 2ZXWB 4I5SA 4RQFA 3X2QC 4LBEC 4P30A 3OM3B 4PA9A 4X8AA 1QVGU 5FL7G 4WFAV 2W6IG 4BIZA 2QM7A 3FB5C 1JCHA 1KECA 4UUJC 2GHYA 4RUFA 5B1NA 3B77A 3F5WC 4PA7A 1VQ6V 1F23A 5B1AC 5LHIA 4LC1A 3OR6C 5CBHA 2R9RB 1P7BA 4UVBA 3MHHC 2V7QG 1JOYA 2A0LA 5IYDO 1ZWIC 4MSWC 3SPGA 2ZQMA 1QLEC 3FYIB 3NXSA 2JEXA 3CCSV 2BOCC 3ZN0A 3FYEB 3B8MA 3SJQC 1HWYA 4MVUA 1PNLA 1AROP 5LGTA 5LGUA 4JASA 1M90W 1AI6A 1K97A 4MVRA 3STLC 5CA3A 1K3EA 1YJWV 1NVPB 1EFRG 1KD1W 1K73W 3OAAG 4GX1A 2IJJA 2X6BA 2X7RB 2ZR3A 1VQ7V 4UV8A 1AI4A 4LCUC 3HPLC 2WLIA 1W2BU 1COWG 3ETGA 1K8AW 4U7NA 2QM8A 1FXKB 3W7UA 4BW5A 5DN6G 1K9MW 4PDLA 3AG1B 2B5UA 2B1IA 2XAHA 1PNMA 4WFEA 1BL8A 3LNMB 4DXWA 1Y4MA 4H33A 3D3IA 1ROPA 3OUSA 3AG4C 3SYOA 2ZD9A 3E89A 4BAYA 1KKDA 2AHZA 3AG2B 2WAMA 1VQNV 2EJRA 1GKFA 4GX0A 3M99B 4PDRA 4P9PA 4KUMA 3WG7C 3CCRV 2XAJA 1RM1B 1OCOB 3ETEA 4MVSA 2DYSB 2EIJB 4TT3G 1LNQA 5B3SC 2LP7A 3JYCA 2NNUA 1P4RA 3D36A 2JIZG 3ASNC 3IFXA 4XDJA 3R65A 5EBWC 3OR7C 5EK0A 4XBFA 4QNHB 3E8BA 3QO7A 1R3KC 1V54B 5H6RA 2QA4V 1IXMA 3SPJA 3W7XA 4R7CA 2QKSA 4J9YB 2EBOA 5IDJA 2OTJV 1THZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFM A;  3MHH C;  5KA6 A;  4E2L A;  1SZT A;  2EZP A;  2EZO A;  2MK3 A;  2LP7 A;  1I5X A;  4FJC C;  1QBZ A;  1K34 A;  3GWO A;  4JPR A;  3P30 A;  1QR9 A;  1Y66 A;  5HFL A;  1DLB A;  3B8M A;  2M7W A;  1I5Y A;  5H9C A;  4FK5 C;  4JGS A;  3B8N A;  1JQ0 A;  3CP1 A;  5KA5 A;  4N23 A;  1Y4M A;  5CMU A;  1DF4 A;  1QR8 A;  1MOF A;  2OT5 A;  2P6J A;  1K33 A;  3K9A A;  4N21 A;  3MHS C;  3CYO A;  1DF5 A;  1ENV A;  3B77 A;  1EBO A;  1JPX A;  4JF3 A;  4G2K A;  5CN0 A;  1QCE A;  2EBO A;  3H01 A;  3M99 B;  1F23 A;  1MG1 A;  3WFV A;  4FIP C;  2X7R B; 
#chains in the Genus database with same CATH topology
 4QPK A;  2Y69 C;  4O4L A;  4GKK B;  4K0K B;  4DV3 B;  3OE7 G;  1I94 O;  1FS0 G;  2L6L A;  4DV0 B;  4H0L B;  5FPR A;  4TV9 B;  3CP1 A;  2IJH A;  3ZRW A;  2ZDI C;  2ZXW C;  1MAB G;  3CC4 V;  3AK2 A;  4TWK A;  3FAV A;  4JI6 O;  4HYO A;  1W59 A;  3OGC C;  1PV0 A;  5L3F A;  5IYZ A;  2WLK A;  1WAZ A;  2AZ0 A;  4FVM A;  1OCZ B;  3EFF K;  3ZHV A;  2YSU B;  1PD3 A;  2HHH B;  1PM9 A;  4MVZ A;  4YJ3 B;  4EB6 B;  5B5E Z;  3AG7 A;  1JJO A;  2RNB A;  3R66 A;  4X62 O;  3F5T A;  3WFV A;  5EC2 C;  4OXS A;  5KUK A;  1AVM A;  2UUB B;  4EFE A;  2Z0A A;  1KC8 W;  5KUM A;  2OWO A;  2Z5U A;  4LP8 A;  1PKX A;  3BVO A;  2OIG A;  1M56 C;  1JQ0 A;  2CH7 B;  5CA0 A;  4QJF B;  2ZM6 O;  1L0N H;  4JAU A;  3I56 V;  5CN0 A;  1FXK C;  3MHS C;  4F6R B;  3TET A;  3J7A U;  2QWN B;  4CBC A;  1N8R W;  2VWK A;  4DV5 B;  2HEP A;  4O2A B;  2IU3 A;  3P3P A;  2UUA O;  2WA4 A;  4NVP A;  2GBO A;  3O65 A;  1MZE A;  4MVM A;  1H8H G;  3SYP A;  1FFX B;  4NTW A;  1SRY A;  4JI4 O;  1I94 B;  3OT7 A;  2ZT9 B;  3E2E A;  2EIJ C;  1E79 G;  3K79 A;  2IJI A;  2PY5 A;  4ZIB A;  1K92 A;  2M6Y A;  3EXA A;  1GM9 A;  4BIO A;  4DR7 B;  1O9G A;  4LF7 O;  3IGA C;  2PTM A;  1YCI A;  1CEZ A;  1NR7 A;  2VRZ A;  4QPJ A;  1MZF A;  3SPI A;  2ZR2 A;  4MTX A;  1FXH A;  4OX9 B;  3FB8 C;  5D5Q A;  4X1Y B;  4DR1 O;  5KA6 A;  4GZR B;  4UB6 Z;  4KP4 A;  2YUA A;  2YIA A;  2XOK G;  3HB3 B;  3OMA B;  3A8T A;  5BZB A;  1VF6 C;  3P32 A;  4WFB V;  2X6C A;  3Q4H B;  1YIJ V;  1XNQ B;  1BZK A;  3OEH G;  1IBK B;  1XHX A;  2E3C A;  2DYR B;  4AI8 A;  4AQY B;  2XAF A;  1Q43 A;  1AR4 A;  1WA8 B;  2OCC B;  3L9D A;  3BPZ A;  2HJF C;  4QE7 A;  2ETN A;  3MDS A;  4MW3 A;  4H44 B;  2F4V O;  3N2G A;  2YC0 A;  1YI2 V;  4JGS A;  1SKV A;  2E75 B;  4JI7 O;  4UCS A;  4DRX A;  4YHH O;  1WPB A;  2UUA B;  2HR3 A;  2X6A A;  1F51 A;  3DTU B;  1BMF G;  3KKY A;  3RYF A;  4B3M B;  1US6 A;  3K9S A;  2QSA A;  4G27 B;  3ZRS A;  3CXC U;  3DC5 A;  3BAB A;  3B40 A;  1ZTE A;  4KL1 A;  3UM7 A;  4YY3 B;  2XAQ A;  3J80 N;  2DWD C;  5J2U A;  5IY5 B;  3ASO C;  3CMA V;  4LF7 B;  4CS4 A;  1R6T A;  4K8Z A;  3RN4 A;  5LOV B;  1VP7 A;  3G67 A;  5IWA O;  2LFR A;  4UCU A;  4NB5 A;  2Q0O C;  4JAV A;  5CB4 B;  3EHB B;  2WLI B;  1S0V A;  3TXS A;  5JJJ B;  2CTR A;  1Q6I A;  4NR1 A;  1XL6 A;  3SJC C;  2LW1 A;  4RUE A;  5JQG B;  1VEW A;  4J9Z B;  1HNZ B;  1EN6 A;  1QLE B;  4DR5 B;  1U96 A;  2PUS A;  1M56 B;  1XL4 A;  3CEI A;  2PI4 A;  2VS0 A;  1GM8 A;  2PYL A;  4MVO A;  2XND G;  1WB7 A;  1R3L C;  4I50 B;  4FM2 A;  4K3A A;  2PI5 A;  3L71 H;  4CH3 A;  5CBG A;  4X64 O;  4FLZ A;  4ZOL B;  1DLB A;  2Q69 A;  1AIL A;  2DE0 X;  3ZRX A;  1XMO O;  4PA6 A;  4HZ3 A;  4FFB A;  3ZMS A;  4Z1M G;  3KG2 A;  4NTX A;  3CME V;  1G6U A;  5LBQ A;  4GX2 A;  2Q8V A;  2GDS A;  1Z2G A;  3P30 A;  3ZS8 C;  2XTA A;  3VQY A;  3FB6 C;  1OV9 A;  5B3S B;  4DV2 B;  1SES A;  2HP8 A;  2YI8 A;  3ZRW B;  2CTW A;  3T1Y B;  3FAV B;  2Q9L A;  4BWA A;  1M4U A;  2EIL C;  1YIT V;  1NTK H;  4CS2 A;  1NQT A;  2ZIM A;  5IYZ B;  1NH2 D;  1GM7 A;  4XDK A;  4GLX A;  5IWA B;  4W4L A;  2G38 A;  1A32 A;  4J42 A;  1H38 A;  1ZL8 A;  1VQ8 V;  2QWQ B;  4DUZ B;  3CCM V;  4G28 B;  3TCU A;  3L73 H;  2Q73 A;  1YZB A;  2RCV A;  4LFC O;  3X2Q C;  4LBE C;  4PA9 A;  1XI1 A;  1QVG U;  3L72 H;  4BIZ A;  4LF4 B;  3FB5 C;  2DJV A;  4UUJ C;  4D6T H;  5CA0 B;  4K35 A;  2VQE O;  4C7U A;  5B1N A;  2R72 A;  2QKA A;  5LHI A;  3OR6 C;  4LF9 O;  3P3N A;  1WJZ A;  1HR0 O;  3CCS V;  4I0X A;  2JEX A;  5K1X A;  2KG7 B;  3ZN0 A;  3FYE B;  4MVU A;  1PNL A;  4JAS A;  1AI6 A;  1K97 A;  3STL C;  5CA3 A;  4B3S O;  1NS1 A;  1K73 W;  2IJJ A;  4DR3 B;  3QF7 A;  3D36 C;  5GTH Z;  1I08 A;  4IYH A;  2ADQ B;  2E5L O;  3ETG A;  2QM8 A;  2CTP A;  4QGP A;  1N36 O;  3JAK A;  3LNM B;  3SJA C;  2AGA A;  5LMN B;  4H33 A;  2QGN A;  3AG4 C;  3UO3 A;  1EN5 A;  5GTI Z;  4X66 B;  3IAY A;  2UUC O;  4F6E A;  1BS3 A;  1OCO B;  2DYS B;  2YID A;  2LP7 A;  3JYC A;  5LA6 A;  1NTZ H;  3ASN C;  3OR7 C;  2F66 C;  3JAW A;  4JI1 O;  3SPJ A;  4R7C A;  3T1H B;  4O4J A;  4J9Y B;  2EBO A;  3SR2 C;  1KUQ A;  4FZ1 A;  1VF5 B;  1WP7 A;  5EC1 C;  2LO1 A;  3JAT A;  4KXR A;  1WN7 A;  4JZG A;  3GWO A;  4NYK A;  3KCY A;  1NJI W;  2JJ2 G;  1Y66 A;  2W0X A;  2ZIN A;  5HFL A;  1NTM H;  2ZNI A;  3ZN1 A;  3N2G B;  1FFT B;  2E76 B;  1BGY H;  3OEE G;  3E35 A;  4DRX B;  2P6J A;  2A7W A;  1CP9 A;  4O4I A;  3QO8 A;  3K5L A;  5A9G A;  4XDL A;  4NXM O;  2MW2 B;  4TOI A;  3RYF B;  1HNX O;  4DR6 B;  1IDS A;  4LF5 O;  2DOS A;  4JI8 B;  2JS3 A;  3T4Z A;  4JV5 O;  1IBM B;  4B3T O;  3ZED A;  2CUG A;  2DW4 A;  3ML0 A;  3APQ A;  2E5L B;  1E1Q G;  2FKX A;  4TSF G;  4LNU A;  2WWW A;  1K4C C;  3AK1 A;  3QO5 A;  3HKC B;  2CK3 G;  4IL6 Z;  4W4K A;  1RPO A;  3K5M A;  4K8X A;  1HDJ A;  4ZI7 A;  1AB3 A;  2ZDI A;  4GT1 A;  1N0J A;  3OW2 U;  4A5U B;  3ZHR A;  3FKS G;  1S76 D;  2GV9 A;  4MW8 A;  2Y4U A;  1OCR B;  4X20 A;  1IBL B;  3ABU A;  2JDI G;  3KCX A;  4FPP A;  1TA8 A;  2UXX A;  1XNR O;  4JF3 A;  3A0H Z;  4DUY B;  3AG1 C;  1TUB A;  1UFI A;  3BA9 A;  1BT8 A;  3ETQ A;  3B4S A;  4JZ2 A;  4PEL A;  1DGS A;  4CS3 A;  1B04 A;  1JR9 A;  1XHZ A;  3ABL B;  3AG2 C;  4MTF A;  3ABK B;  4B3R B;  3PN1 A;  1AJP A;  2JRI A;  4ICG A;  3PJS K;  1RM1 C;  3JCZ A;  1EM1 A;  2FTK A;  3JD1 A;  2JS5 A;  4QIW F;  4FFB B;  1P49 A;  2R70 A;  1YSC A;  1DK1 A;  3LDC A;  1FXK A;  5DED A;  4NXM B;  1HNX B;  1FKA O;  1VQ9 V;  4PDM A;  4NXN B;  4B7E A;  3GB7 C;  4WFH A;  1N0N A;  4Q20 A;  1K5S A;  4X65 O;  4JV5 B;  4B3T B;  1FAF A;  2AHY A;  2D2C B;  3AG3 B;  1KQS U;  2ADP A;  1V55 C;  3F7V C;  2AZ2 A;  4DK1 A;  5LP6 C;  1M57 B;  2EIN B;  2CTQ A;  2ZE6 A;  2RJZ A;  4JI0 O;  3E8H A;  3CJH B;  2CDY A;  1OZ0 A;  3KZI Z;  4IYI A;  3T2M A;  3E8F A;  2BSK A;  2CGN A;  1ZL8 B;  2OT5 A;  1EN4 A;  2LJ2 A;  1FJG B;  3CS5 A;  4Q6G A;  4FLU A;  4JI5 B;  3VQW A;  1R6K A;  3RT3 C;  4WF9 V;  3C90 A;  4P9O A;  3CWB H;  3JD2 A;  5FLX N;  2MK3 A;  2F95 B;  3H1K H;  3D3Q A;  1VQ4 V;  1OCC C;  2FL4 A;  2CE4 A;  2ITC C;  3RYI A;  1PPJ H;  3T1C A;  1VF6 A;  2YIB D;  4OGQ B;  3LSQ A;  1EZJ A;  2H3O A;  5IJ9 A;  5JWP A;  4DW0 A;  1H2N A;  3CXH F;  3L75 H;  3UO2 A;  4PA4 A;  2YXH A;  4I0X B;  1M9N A;  1ZSP A;  4PD4 F;  2D3O W;  4KHP O;  3DSQ A;  1NVP D;  1JJ2 U;  1G4Y B;  1Y74 A;  3CCL V;  5B1B C;  1X4T A;  4JI3 B;  5IJ0 A;  4LFB O;  1VIB A;  1Q81 W;  2PF4 E;  2NN4 A;  5B1A B;  3CCQ V;  3U11 A;  1GRJ A;  2KG7 A;  2Q67 A;  4PA3 A;  2JGD A;  3JAK B;  3U0Z A;  2YEV A;  3N27 A;  4BR6 A;  3BHP A;  5E79 Z;  4G2K A;  3B2E E;  1PL0 A;  1YJ9 V;  1SET A;  3K08 A;  1QLN A;  5LA6 B;  1Z5W A;  4JI6 B;  5F2V O;  3ABM C;  1VQP V;  3K04 A;  1TAE A;  5CMU A;  1J5E O;  3JAW B;  4I4T B;  2UU9 O;  1K4D C;  1AP5 A;  1Q86 W;  4Z2W A;  3STZ C;  4LWS A;  3QVN A;  5GW7 A;  3H01 A;  1Q6H A;  3RFR A;  4O4J B;  4WCE V;  2EIM C;  3SPH A;  4X62 B;  5FPO A;  3JAT B;  5LGN A;  3K59 A;  1DTO A;  3H9V A;  3FB7 C;  1VQ5 V;  1SQG A;  4FZ0 A;  3WG7 B;  3ZMU A;  1RPR A;  2HVJ C;  2Y4T A;  4O4I B;  1VQM V;  3OTF A;  2UXD O;  2ZM6 B;  1OHH G;  2K9P A;  2EIK C;  2WPD G;  2PYJ A;  5D5P A;  2Y69 B;  2WLM A;  2OIE A;  1YDX A;  5BY1 A;  1BE3 H;  4LNU B;  1ZLZ A;  1VQL V;  1SQP H;  1BSM A;  2N05 A;  2WLJ A;  1M5I A;  1MG1 A;  3JAM N;  1AJQ A;  2E74 B;  4JI4 B;  4HAM A;  4JYC A;  4ZI7 B;  1FPO A;  2ZXW B;  4I5S A;  4OPA A;  5FL7 G;  2W6I G;  4X20 B;  4FLW A;  1S5L Z;  4EEQ A;  3B77 A;  1WP8 A;  3F5W C;  3HKC A;  4PA7 A;  2QM4 A;  1J5E B;  1F23 A;  4LC1 A;  5CBH A;  2IM9 A;  2Q5Z A;  1TUB B;  4UVB A;  2CAZ C;  3SGI A;  1JOY A;  2A0L A;  5IYD O;  1ZWI C;  4MSW C;  1HNW O;  1HP8 A;  2ZQM A;  3NXS A;  4DR1 B;  1VAR A;  3B8M A;  3DC6 A;  1HWY A;  3SJQ C;  3GVM A;  3ZBH A;  2JVD A;  1ARO P;  5LGT A;  4JYA O;  2AW9 A;  2QDO A;  4IGG A;  4MVR A;  5KHH A;  4YIP A;  4DR4 O;  1YJW V;  3FX7 A;  4Z1V A;  4GX1 A;  3SJB C;  1NZ6 A;  3VQV A;  1VQ7 V;  3EVK A;  3ZX6 A;  3TGU H;  1K8A W;  1FXK B;  2YIC A;  1PNM A;  5CA1 B;  5KMG A;  5KLV H;  1ROP A;  3OUS A;  3E89 A;  3A0B Z;  4BAY A;  5BMV A;  3JCU Z;  2F4V B;  1VQN V;  2EJR A;  4GX0 A;  1XBL A;  4JI7 B;  3TJT A;  4JI2 O;  4YHH B;  1MNG A;  2EIJ B;  4TT3 G;  1X59 A;  4TUY A;  3D36 A;  5EZY A;  2JIZ G;  2OCH A;  1BQZ A;  3OGI B;  5EBW C;  5EK0 A;  3ZHT A;  4QNH B;  2BSK B;  2QA4 V;  1IXM A;  3W7X A;  4UB8 Z;  2N74 A;  1GK9 A;  3AK3 A;  2GUZ A;  2IBZ H;  4X1K A;  2AXT Z;  3CJH A;  3QG5 A;  4J7K A;  1XMQ O;  3RBZ A;  4LFA O;  1EZV H;  1LUV A;  2JEU A;  3RYI B;  3QNE A;  1WPX A;  4UCR A;  1DF5 A;  4X9Q A;  1N33 O;  1V9P A;  4B7K A;  5IJ9 B;  4FIP C;  4R50 A;  4I7Z B;  1SZT A;  2EZP A;  5L3D A;  2UXB O;  3LNN A;  4AHC A;  1RFY A;  4PHZ A;  2ZIO A;  4J41 A;  1PNK A;  1ZX3 A;  2JK5 C;  1R3J C;  1VMG A;  4CH6 A;  1CXZ B;  4MVQ A;  4X64 B;  1K33 A;  4FM0 A;  1VQO V;  2BTQ A;  1N32 O;  1Y74 B;  5EBM C;  2VQF O;  2KB1 A;  3RYH A;  5IJ0 B;  1XMO B;  2W6J G;  4I55 A;  5B66 Z;  3WB0 A;  1GN2 A;  4PJ0 Z;  4OPH A;  4E4E A;  2YS8 A;  5H9C A;  2JGD B;  1XUQ A;  3CB2 A;  5JJN B;  5CBF A;  2YEV B;  1AI5 A;  1U97 A;  4LH7 A;  4UVC A;  1VQK V;  2HJD A;  3ASO B;  1JFF A;  3BRC A;  3H1L H;  2UXN A;  1L8D A;  1SQF A;  4BIU A;  1AP6 A;  1YTF D;  5JJE B;  3CD6 V;  4GKJ O;  3E8G A;  2FYU H;  1YEW A;  2OTL V;  5JCO C;  4LWS B;  2IH3 C;  4WFF A;  2BCC H;  3S3W A;  4L8J A;  5LMU O;  3G80 A;  5H6Q A;  1V54 C;  3CRM A;  3OUF A;  3OD4 A;  5EIB D;  4LR3 A;  2UXB B;  2NR5 A;  1BCC H;  4I4T A;  4LFC B;  1MOF A;  2ARH A;  4JYB A;  1H2L A;  2F1M A;  3JSN A;  2HKO A;  4WFG A;  2A3Q A;  2VQE B;  4E2L A;  2WLN A;  3BEH A;  2HFE C;  4DV6 O;  4DK0 A;  1GMG A;  3HKD A;  3JD4 A;  4FLY A;  1N34 O;  1QR9 A;  1F4N A;  3SDL A;  4DV1 O;  2IU0 A;  4LF9 B;  4FM1 A;  1HR0 B;  2BTO A;  2IH1 C;  2WA3 A;  3JAL A;  1OCZ C;  4J11 A;  4ABM A;  1GTO A;  1H8E G;  3JAS B;  3ZMV A;  3OFN G;  4U3J A;  5HFM A;  3C3T A;  4DR2 O;  2Q0A A;  4B3S B;  4DV4 O;  1NT2 B;  1GN4 A;  3E86 A;  5EYP A;  2OYQ A;  5LP6 A;  4JPR A;  2JJ1 G;  3I55 V;  4LF6 O;  2EIL B;  3MD0 A;  1B6Q A;  5FNV A;  1WLE A;  3A0R A;  4X89 A;  1KP2 A;  5IYB O;  5AG2 A;  1AR1 B;  3K9A A;  1N36 B;  1J95 A;  5L3C A;  3W7S A;  1OJH A;  5KHI A;  2ODM A;  1URF A;  2QWP B;  1IXB A;  2YDE A;  5KHG A;  3HKE A;  3E83 A;  4UCO A;  2C2A A;  5A2Q N;  1PP9 H;  4GYC B;  4RO2 A;  4LF8 O;  1Q7Y W;  2H94 A;  2UUC B;  3K3W A;  5LMU B;  1SQX H;  4O4H A;  3H1I H;  3W7T A;  3B09 A;  5KHK A;  1JMK C;  3X2Q B;  4J80 A;  1NKD A;  4K0K O;  2Z3Y A;  4DV3 O;  2R9I A;  2LFS A;  4DV0 O;  3RWR D;  1TGO A;  4RWU A;  3CCV V;  4ASU G;  4JI1 B;  5L3G A;  3IJ4 A;  1S3J A;  2BE3 A;  4IHJ A;  4JTA B;  3ZMT A;  5BXZ A;  5KMG B;  2IW5 A;  4MT8 A;  5BMV B;  5LL6 Y;  1YHQ V;  1S72 V;  1RP3 B;  4R8C A;  4FMT A;  3ABT A;  5KAI Z;  1LUW A;  3UKM A;  4PI2 A;  2HHH O;  3BCC H;  2NLJ C;  4TUY B;  5EZY B;  1JVM A;  3O9O A;  4TQF A;  1BHB A;  5CA1 A;  4LF5 B;  5DEC A;  1KU9 A;  2EX3 A;  2YI9 A;  1GAX A;  3UCS C;  1K5Q A;  1JPX A;  3UQ8 A;  1QCE A;  2A9H A;  2QR4 A;  3AG4 B;  3W7W A;  1E1R G;  2GUZ B;  4IIJ A;  4QE9 A;  4X1K B;  2EUL A;  3MAQ A;  2F43 G;  1K34 A;  1Q5O A;  3VBB A;  1FD9 A;  1YXB A;  3JD0 A;  2DYR C;  1I5Y A;  1DF4 A;  4H13 B;  4EKW A;  2QJ1 A;  1QQC A;  2ATK C;  1H2G A;  3ASN B;  2OCC C;  1QVF U;  1N4C A;  4DV5 O;  1SC5 B;  2PZS A;  1KP3 A;  2QTO A;  3H1H H;  3ZHS A;  3HKB A;  4I9W A;  1XNR B;  2Q7H A;  4BW9 A;  4P2Z A;  2EJ7 A;  2KQX A;  4FLV A;  4YXW G;  3JAR A;  3SPC A;  3AEI A;  4L87 A;  3E22 A;  3CC2 V;  2RN9 A;  3GWK C;  2BTQ B;  4DR7 O;  3CHX A;  1W0J G;  1PL4 A;  2F93 B;  5IT9 N;  4D7T A;  3OMN B;  4NTY A;  3RYH B;  1SF9 A;  5LYJ A;  3SYQ A;  5IY5 C;  4J7J A;  4I55 B;  4LH6 A;  4OX9 O;  3A2F A;  2QWR B;  2QM7 A;  4I9Q A;  3IC9 A;  1JCH A;  1KEC A;  2GHY A;  1VQ6 V;  4X65 B;  2R9R B;  1P7B A;  1JFF B;  1Q90 D;  2V7Q G;  5JH7 A;  1ZUQ A;  1XNQ O;  2PGG A;  1KKC A;  1QNM A;  1IBK O;  1QLE C;  3FYI B;  4O2B B;  1XQ8 A;  2KSD A;  4JI0 B;  4AQY O;  3M8A A;  4UCT A;  4EFB A;  2P4K A;  2X6B A;  2KKW A;  4J7Z A;  1AI4 A;  4UV8 A;  3VQX A;  1P84 F;  4LCU C;  5LXT B;  1COW G;  1L0L H;  3DXR B;  4GUN A;  3W7U A;  1K9M W;  3AG1 B;  2B1I A;  2XAH A;  4ZHQ A;  4YJ2 A;  4FLT A;  4B3M O;  1Y4M A;  1Q6U A;  1D2D A;  3D3I A;  2ZD9 A;  1RSO A;  1WNS A;  3NR7 A;  3AG2 B;  1GKF A;  1SS3 A;  4P9P A;  4YY3 O;  5EIB C;  1RM1 B;  3ETE A;  4MVS A;  1LNQ A;  5B3S C;  3RGB A;  3K58 A;  2NNU A;  1P4R A;  2YXL A;  4CC6 A;  3HKD B;  2P5O A;  2O57 A;  4XBF A;  1ZAU A;  4HNA A;  1R3K C;  2DN9 A;  3CX5 F;  3JAL B;  5IDJ A;  4KHP B;  1G8M A;  4U3J B;  1UPG A;  3RVY A;  1I0H A;  1I5X A;  1GH6 A;  1HNZ O;  1V55 B;  1SQB H;  4DO2 A;  4DR5 O;  5EYP B;  5LP6 B;  4LFB B;  1R1B A;  5FNV B;  2WLL A;  1YVW A;  4IT5 A;  3ZIA G;  4H37 A;  3CYO A;  1UJW B;  4JYY A;  1Q3E A;  3WB2 A;  3K0D A;  3JAS A;  1I7F A;  2JGU A;  1W0K G;  2GTS A;  3BA8 A;  3HKE B;  5ITZ A;  5TIS Z;  1NH2 B;  1Y67 A;  2XAG A;  2ZNJ A;  4KFM A;  3UT5 A;  3ZHU A;  4PDV A;  4GX5 A;  5LHH A;  1P7G A;  4O4H B;  3J81 N;  2LGW A;  4CH5 A;  4TV8 A;  3K57 A;  1OCC B;  1XEQ A;  2GTA A;  4N21 A;  5H5N A;  3F7Y C;  1Q8I A;  3HR0 A;  3SYC A;  2UU9 B;  2ITD C;  3C3S A;  4PV1 B;  2HLD G;  2P7T C;  1JA8 A;  1Y76 A;  3N2K A;  4DV2 O;  3VOU A;  3OMI B;  3T1Y O;  2DQ0 A;  3CSX A;  3RVZ A;  4IHJ B;  3B8N A;  4UXN A;  1F4M A;  4MS2 A;  5IYC O;  4DV7 O;  2YIB A;  1TVK A;  2QTS A;  1M93 A;  3CPW U;  4FJC C;  2H8P C;  3THO A;  1CPY A;  1IVS A;  1KMI Z;  2Q6A A;  5B1B B;  3LUT B;  3BY6 A;  4DUZ O;  4WBN A;  1O9H A;  4X1I A;  2UXD B;  1SQQ H;  2UXC O;  2ZE5 A;  3DGE A;  1OCO C;  2DYS C;  4ZKI A;  1M1K W;  1GN6 A;  2HVK C;  2IJK A;  5L3E A;  2Y0I A;  2V1D A;  2K1E A;  1L1F A;  2W0F C;  1K7D A;  2Q7E A;  4LF4 O;  4IIJ B;  2ZE7 A;  5KX5 A;  3K06 A;  1YTF B;  5JVD A;  2B1G A;  1XDC A;  2VWJ A;  1Q82 W;  5J2T A;  5C8Y A;  5B1O A;  2GSM B;  1H2K A;  4B08 A;  4UCV A;  2RMK B;  3L70 H;  2XUM A;  3ABM B;  3LDE A;  4MTO A;  3RYC A;  2Q68 A;  5GON A;  1SA0 A;  3CCE V;  5DM6 V;  1S5H C;  5KHJ A;  4U7O A;  5JCO A;  3APO A;  4O4L B;  3HKB B;  4RAI A;  2YXY A;  5LHG A;  5J9P C;  2EIM B;  3CCU V;  2XHB A;  2LW7 A;  4DR3 O;  4MTG A;  3JAR B;  5L3B A;  1HNW B;  1D5N A;  5E1A C;  1KB9 F;  3G4S V;  5EBL C;  2RQ6 A;  3E22 B;  3ZCC A;  4JYA B;  4DV7 B;  3SYA A;  5IE9 A;  4DR4 B;  1SZX A;  4D7S A;  2Q4P A;  4TQD A;  5LYJ B;  5LMN O;  1QBZ A;  3ICX A;  4TV9 A;  2M7W A;  4PI0 A;  4CC5 A;  4CZZ A;  5KA5 A;  4X66 O;  2ZE8 A;  3RW0 A;  4X88 A;  1VF7 A;  1SQV H;  1TUE B;  2EIK B;  1BHA A;  3WB1 A;  1ENV A;  3K5O A;  1AJN A;  1MMM A;  2N04 A;  3K03 A;  2UXC B;  1FXV A;  1YJN V;  4HBN A;  1OCR C;  4JTD B;  2BOB C;  3H1J H;  2EZO A;  5JH7 B;  2A79 B;  3FFQ A;  4JTC B;  4JI2 B;  2Q7G A;  1KBH A;  3S3X A;  3T1H O;  3CRR A;  2Y0P A;  3CC7 V;  4YJ3 A;  4EB6 A;  1YF2 A;  1MSD A;  2V4D A;  2FB5 A;  2DQ3 A;  1EBO A;  2X0L A;  5H2F Z;  1R3I C;  4UFZ A;  2R9A A;  3ABL C;  2WLH A;  3ABK C;  4F4L A;  3CCJ V;  1XOU A;  3D8C A;  3ZMZ A;  1BQ0 A;  4O2B A;  4ZHQ B;  1XIL A;  2CH7 A;  4YJ2 B;  1QR8 A;  1XMQ B;  2DWE C;  4DR6 O;  4LFA B;  3OTO O;  2P22 C;  1S77 D;  4FLX A;  1RSO B;  2XT9 A;  3LDD A;  4F6R A;  4JI8 O;  1IBM O;  3G6E V;  3T4D A;  3L74 H;  5LXT A;  5KAF Z;  2P67 A;  4O2A A;  3TXQ A;  3DXR A;  3ZJZ A;  1N33 B;  2B9Z A;  4UV9 A;  3AG3 C;  3IC7 A;  1FFX A;  3G6B A;  2Y48 A;  4RQE A;  1M57 C;  2EIN C;  4ZBM A;  2QWO B;  4HNA B;  1GO3 F;  3M7M X;  2P90 A;  1HW7 A;  1NR1 A;  3BFR A;  1IBL O;  1AI7 A;  1N32 B;  2VQF B;  1MSW D;  2QE7 G;  1JX9 A;  1SER A;  4DUY O;  1AR5 A;  2XAS A;  1ORQ C;  4UVA A;  1IX9 A;  2WLL B;  3JSL A;  3K0G A;  4R6Z A;  4YIO A;  4X1Y A;  1NBM G;  3JD3 A;  1NI8 A;  3TK1 A;  3CRA A;  3ETD A;  2LQT A;  4B3R O;  2WSS G;  2QEX V;  4NKG B;  5ITZ B;  2HG5 C;  3G71 V;  3Q4H A;  3UT5 B;  4FK5 C;  3ZHQ A;  1B3Q A;  3ZRV A;  1IZ3 A;  4N23 A;  1F7Y A;  3WU2 Z;  4TV8 B;  1R6N A;  2ILM A;  4GKJ B;  1R73 A;  4FFK A;  4CH4 A;  4NXN O;  3LSS A;  1H2S B;  3OTO B;  1QU7 A;  1WA8 A;  4GCZ A;  5C93 A;  4RQF A;  1Y6X A;  2CGO A;  1Y76 B;  3N2K B;  2LGQ A;  4P30 A;  3OM3 B;  1T5E A;  2DMX A;  4X8A A;  4WFA V;  5J2U B;  4U3F H;  5K1P A;  5BR8 O;  4RUF A;  2RDC A;  1TVK B;  2ZCE A;  2P06 A;  4GKK O;  1H2M A;  2A06 H;  5B1A C;  3LSU A;  3K5N A;  3FD9 A;  3MHH C;  3SPG A;  1S5J A;  1LR1 A;  1B06 A;  4DYL A;  1FJG O;  1KYO F;  2BOC C;  4WBN B;  4X1I B;  4JI5 O;  5LGU A;  1GN3 A;  4DV6 B;  1M90 W;  1K3E A;  5LOV A;  1NVP B;  1EFR G;  1N34 B;  1FYJ A;  1KD1 W;  3OAA G;  1IUR A;  3I5D A;  4DV1 B;  2X7R B;  2ZR3 A;  5CB4 A;  3HPL C;  2WLI A;  1W2B U;  2P4V A;  4U7N A;  5KX5 B;  2ZKO A;  4BW5 A;  5DN6 G;  1XRE A;  4PDL A;  5JVD B;  2B5U A;  4WFE A;  1G1X B;  2F23 A;  1BL8 A;  5C8Y B;  5JQG A;  5J2T B;  2QKC A;  4DXW A;  4DR2 B;  4DV4 B;  3SYO A;  3BAA A;  1KKD A;  2AHZ A;  4LF6 B;  2WAM A;  2UUB O;  3RYC B;  1QHT A;  4PDR A;  3M99 B;  1MA1 A;  5GON B;  4JAA A;  1SA0 B;  4I50 A;  4AIL C;  4KUM A;  3WG7 C;  3CCR V;  2XAJ A;  3QTC A;  2L35 A;  3CE2 A;  4ZOL A;  3U10 A;  4DW1 A;  3IFX A;  3CRQ A;  4XDJ A;  3R65 A;  4J10 A;  3CRC A;  3E8B A;  3QO7 A;  4JI3 O;  1WB8 A;  1D5A A;  4LF8 B;  1V54 B;  5H6R A;  2FML A;  1NU1 H;  2QKS A;  1Z5V A;  2OTJ V;  5BR8 B;  1THZ A; 
#chains in the Genus database with same CATH homology
 1G8M A;  1GK9 A;  5EC1 C;  4QPK A;  2Y69 C;  3RVY A;  1I5X A;  3OE7 G;  3RBZ A;  1FS0 G;  1V55 B;  3GWO A;  4DO2 A;  1NJI W;  2JJ2 G;  1Y66 A;  5HFL A;  3ZN1 A;  1FFT B;  3CP1 A;  2JEU A;  2WLL A;  3QNE A;  3OEE G;  3E35 A;  3ZIA G;  1WPX A;  2IJH A;  2P6J A;  3ZRW A;  4H37 A;  1CP9 A;  2ZDI C;  3CYO A;  2ZXW C;  1MAB G;  1DF5 A;  1UJW B;  3CC4 V;  4TWK A;  3QO8 A;  3K0D A;  4XDL A;  4HYO A;  4FIP C;  3OGC C;  5L3F A;  4R50 A;  1W0K G;  1SZT A;  2EZP A;  2WLK A;  5L3D A;  1NH2 B;  1OCZ B;  2XAG A;  1PNK A;  3T4Z A;  3EFF K;  2JK5 C;  2YSU B;  1R3J C;  1PD3 A;  4KFM A;  2DW4 A;  4PDV A;  3ML0 A;  4GX5 A;  5LHH A;  1E1Q G;  4MVZ A;  4MVQ A;  4TSF G;  1K33 A;  2WWW A;  1OCC B;  4N21 A;  1K4C C;  1VQO V;  3QO5 A;  3F7Y C;  5EBM C;  2CK3 G;  2KB1 A;  3WFV A;  1RPO A;  5EC2 C;  4OXS A;  3SYC A;  5KUK A;  2ITD C;  2W6J G;  2ZDI A;  4GT1 A;  3OW2 U;  2HLD G;  2P7T C;  1KC8 W;  5KUM A;  3FKS G;  3VOU A;  2Z5U A;  1S76 D;  4LP8 A;  4MW8 A;  1PKX A;  3OMI B;  1OCR B;  1M56 C;  2DQ0 A;  5H9C A;  3RVZ A;  3B8N A;  1JQ0 A;  4UXN A;  1F4M A;  3ABU A;  2JDI G;  4MS2 A;  5IYC O;  5CBF A;  4QJF B;  2YEV B;  1AI5 A;  4FPP A;  2UXX A;  4JAU A;  4UVC A;  3I56 V;  4JF3 A;  5CN0 A;  1FXK C;  3CPW U;  3MHS C;  4FJC C;  2H8P C;  1VQK V;  3AG1 C;  3TET A;  3ASO B;  1CPY A;  2UXN A;  4PEL A;  4CBC A;  2Q6A A;  1N8R W;  4BIU A;  5B1B B;  1YTF D;  3LUT B;  2IU3 A;  3BY6 A;  3ABL B;  3AG2 C;  3CD6 V;  4MTF A;  4MVM A;  3ABK B;  1H8H G;  3E8G A;  3SYP A;  1SRY A;  1AJP A;  2OTL V;  3PJS K;  3DGE A;  1OCO C;  3JCZ A;  1RM1 C;  3E2E A;  2DYS C;  2EIJ C;  4ZKI A;  1M1K W;  2FTK A;  2HVK C;  2IJK A;  3JD1 A;  2IH3 C;  1E79 G;  5L3E A;  4WFF A;  2V1D A;  2IJI A;  3K79 A;  2K1E A;  4QIW F;  1L1F A;  1YSC A;  2W0F C;  1K7D A;  1K92 A;  1GM9 A;  3LDC A;  5H6Q A;  1FXK A;  3K06 A;  1YTF B;  1V54 C;  3IGA C;  1VQ9 V;  4PDM A;  2B1G A;  3OUF A;  1CEZ A;  1Q82 W;  1NR7 A;  5B1O A;  4QPJ A;  3GB7 C;  3SPI A;  4WFH A;  4Q20 A;  1K5S A;  2GSM B;  1MOF A;  2ZR2 A;  4JYB A;  4MTX A;  2AHY A;  3AG3 B;  1KQS U;  1FXH A;  3ABM B;  3LDE A;  4MTO A;  3FB8 C;  2Q68 A;  2HKO A;  1V55 C;  3F7V C;  4WFG A;  3CCE V;  5DM6 V;  1S5H C;  1M57 B;  4U7O A;  2EIN B;  5KA6 A;  4E2L A;  2WLN A;  4KP4 A;  3BEH A;  3E8H A;  2HFE C;  2XOK G;  4RAI A;  3HB3 B;  3OMA B;  5BZB A;  1OZ0 A;  1GMG A;  3JD4 A;  5LHG A;  3P32 A;  5J9P C;  1QR9 A;  4WFB V;  1F4N A;  2EIM B;  2X6C A;  3CCU V;  1YIJ V;  4MTG A;  3T2M A;  3E8F A;  5L3B A;  2IU0 A;  5E1A C;  3OEH G;  2OT5 A;  3G4S V;  5EBL C;  2IH1 C;  1OCZ C;  1GTO A;  2DYR B;  1H8E G;  3ZCC A;  1R6K A;  3ZMV A;  2XAF A;  3OFN G;  5HFM A;  4WF9 V;  3SYA A;  4P9O A;  3JD2 A;  2MK3 A;  2OCC B;  2HJF C;  1QBZ A;  4QE7 A;  1OCC C;  1VQ4 V;  3E86 A;  4MW3 A;  4JPR A;  2JJ1 G;  3I55 V;  2ITC C;  2M7W A;  2EIL B;  3MD0 A;  1B6Q A;  4CZZ A;  4JGS A;  1YI2 V;  1WLE A;  3A0R A;  5KA5 A;  4X89 A;  1KP2 A;  3RW0 A;  4X88 A;  1TUE B;  2EIK B;  3T1C A;  5IYB O;  1AR1 B;  2HR3 A;  2X6A A;  3K9A A;  1BHA A;  1J95 A;  1F51 A;  5L3C A;  3W7S A;  3LSQ A;  1EZJ A;  1ENV A;  3DTU B;  1BMF G;  1AJN A;  3K03 A;  1FXV A;  1YJN V;  1OCR C;  4JTD B;  4G27 B;  3ZRS A;  2BOB C;  3CXC U;  3E83 A;  2EZO A;  2A79 B;  2C2A A;  4PA4 A;  4RO2 A;  4JTC B;  1M9N A;  3UM7 A;  1Q7Y W;  2XAQ A;  2H94 A;  2DWD C;  3CC7 V;  3K3W A;  2D3O W;  3W7T A;  5IY5 B;  3ASO C;  3CMA V;  1NVP D;  3X2Q B;  1JJ2 U;  1G4Y B;  2DQ3 A;  1NKD A;  3CCL V;  1EBO A;  2X0L A;  1R3I C;  2Z3Y A;  5B1B C;  2R9I A;  3ABL C;  2LFS A;  2LFR A;  2WLH A;  3ABK C;  3CCV V;  4F4L A;  4ASU G;  4JAV A;  5L3G A;  3CCJ V;  3EHB B;  1Q81 W;  2WLI B;  1S0V A;  3ZMZ A;  1S3J A;  5B1A B;  1XL6 A;  3CCQ V;  2Q67 A;  4PA3 A;  4JTA B;  3ZMT A;  4RUE A;  2IW5 A;  1QR8 A;  2YEV A;  2DWE C;  4J9Z B;  1QLE B;  4MT8 A;  1S77 D;  1M56 B;  1XL4 A;  1YHQ V;  4G2K A;  1S72 V;  2PI4 A;  1PL0 A;  3LDD A;  1GM8 A;  4R8C A;  4FMT A;  3ABT A;  2XND G;  4MVO A;  1YJ9 V;  3UKM A;  1R3L C;  3G6E V;  3T4D A;  1SET A;  2PI5 A;  2NLJ C;  2P67 A;  3K08 A;  3ZJZ A;  5CBG A;  1QLN A;  4UV9 A;  3AG3 C;  3ABM C;  3IC7 A;  1JVM A;  1DLB A;  2Q69 A;  1BHB A;  1VQP V;  2Y48 A;  3K04 A;  5CMU A;  4RQE A;  3ZRX A;  1M57 C;  2EIN C;  1K4D C;  4ZBM A;  1Q86 W;  3STZ C;  1GO3 F;  4PA6 A;  5GW7 A;  1K5Q A;  1JPX A;  4HZ3 A;  1QCE A;  3H01 A;  2P90 A;  4WCE V;  2A9H A;  2EIM C;  3AG4 B;  3W7W A;  1NR1 A;  3SPH A;  3ZMS A;  1E1R G;  4Z1M G;  4QE9 A;  1AI7 A;  3KG2 A;  3CME V;  5LBQ A;  2F43 G;  4GX2 A;  5LGN A;  1K34 A;  1MSW D;  1DTO A;  3VBB A;  2QE7 G;  1JX9 A;  3P30 A;  3FB7 C;  1VQ5 V;  1SER A;  3JD0 A;  2DYR C;  3WG7 B;  1I5Y A;  1ORQ C;  2XAS A;  3FB6 C;  4UVA A;  1DF4 A;  3ZMU A;  2WLL B;  4EKW A;  5B3S B;  1RPR A;  2ATK C;  1H2G A;  1SES A;  3K0G A;  4R6Z A;  3ASN B;  2OCC C;  3ZRW B;  2HVJ C;  1QVF U;  1VQM V;  1NBM G;  3JD3 A;  3TK1 A;  3ETD A;  2EIL C;  1YIT V;  1OHH G;  1KP3 A;  2QTO A;  1NQT A;  1NH2 D;  2WSS G;  4I9W A;  2QEX V;  1GM7 A;  2EIK C;  4XDK A;  2WPD G;  4P2Z A;  2HG5 C;  3G71 V;  4YXW G;  1H38 A;  4FK5 C;  3SPC A;  3ZRV A;  2Y69 B;  2WLM A;  4N23 A;  1VQ8 V;  3AEI A;  4L87 A;  1VQL V;  3CC2 V;  1R6N A;  3CCM V;  4G28 B;  1R73 A;  2WLJ A;  1MG1 A;  1AJQ A;  1W0J G;  3LSS A;  3TCU A;  3OMN B;  4HAM A;  4JYC A;  5C93 A;  4GCZ A;  3SYQ A;  5IY5 C;  2ZXW B;  4I5S A;  4RQF A;  3X2Q C;  4LBE C;  4P30 A;  3OM3 B;  4PA9 A;  4X8A A;  1QVG U;  5FL7 G;  4WFA V;  2W6I G;  4BIZ A;  2QM7 A;  3FB5 C;  1JCH A;  1KEC A;  4UUJ C;  2GHY A;  4RUF A;  5B1N A;  3B77 A;  3F5W C;  4PA7 A;  1VQ6 V;  1F23 A;  5B1A C;  5LHI A;  4LC1 A;  3OR6 C;  5CBH A;  2R9R B;  1P7B A;  4UVB A;  3MHH C;  2V7Q G;  1JOY A;  2A0L A;  5IYD O;  1ZWI C;  4MSW C;  3SPG A;  2ZQM A;  1QLE C;  3FYI B;  3NXS A;  2JEX A;  3CCS V;  2BOC C;  3ZN0 A;  3FYE B;  3B8M A;  3SJQ C;  1HWY A;  4MVU A;  1PNL A;  1ARO P;  5LGT A;  5LGU A;  4JAS A;  1M90 W;  1AI6 A;  1K97 A;  4MVR A;  3STL C;  5CA3 A;  1K3E A;  1YJW V;  1NVP B;  1EFR G;  1KD1 W;  1K73 W;  3OAA G;  4GX1 A;  2IJJ A;  2X6B A;  2X7R B;  2ZR3 A;  1VQ7 V;  4UV8 A;  1AI4 A;  4LCU C;  3HPL C;  2WLI A;  1W2B U;  1COW G;  3ETG A;  1K8A W;  4U7N A;  2QM8 A;  1FXK B;  3W7U A;  4BW5 A;  5DN6 G;  1K9M W;  4PDL A;  3AG1 B;  2B5U A;  2B1I A;  2XAH A;  1PNM A;  4WFE A;  1BL8 A;  3LNM B;  4DXW A;  1Y4M A;  4H33 A;  3D3I A;  1ROP A;  3OUS A;  3AG4 C;  3SYO A;  2ZD9 A;  3E89 A;  4BAY A;  1KKD A;  2AHZ A;  3AG2 B;  2WAM A;  1VQN V;  2EJR A;  1GKF A;  4GX0 A;  3M99 B;  4PDR A;  4P9P A;  4KUM A;  3WG7 C;  3CCR V;  2XAJ A;  1RM1 B;  1OCO B;  3ETE A;  4MVS A;  2DYS B;  2EIJ B;  4TT3 G;  1LNQ A;  5B3S C;  2LP7 A;  3JYC A;  2NNU A;  1P4R A;  3D36 A;  2JIZ G;  3ASN C;  3IFX A;  4XDJ A;  3R65 A;  5EBW C;  3OR7 C;  5EK0 A;  4XBF A;  4QNH B;  3E8B A;  3QO7 A;  1R3K C;  1V54 B;  5H6R A;  2QA4 V;  1IXM A;  3SPJ A;  3W7X A;  4R7C A;  2QKS A;  4J9Y B;  2EBO A;  5IDJ A;  2OTJ V;  1THZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...