2LP7A

Structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 11
structure length 59
sequence length 59
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lp7A00
5CN0A 3MHHC 1K34A 4G2KA 4FJCC 5HFLA 2X7RB 1QR9A 1I5XA 1DLBA 1JPXA 5H9CA 5KA5A 3CYOA 4JGSA 4JF3A 2EBOA 3B8NA 1QR8A 2OT5A 2MK3A 2P6JA 1QBZA 2M7WA 1MOFA 1Y66A 1K33A 2EZPA 1Y4MA 1EBOA 3B8MA 3P30A 4FIPC 1QCEA 1SZTA 3CP1A 4E2LA 2LP7A 3MHSC 1I5YA 3H01A 3K9AA 2EZOA 4FK5C 1DF4A 3B77A 1ENVA 1JQ0A 4JPRA 1F23A 1MG1A 3GWOA 3WFVA 3M99B 1DF5A 4N21A 5CMUA 5HFMA 5KA6A 4N23A
chains in the Genus database with same CATH superfamily
2ZIOA 1NH2B 4J7ZA 1K34A 1KP3A 3B2EE 3HKDA 4IHJB 2E3CA 4K3AA 2BCCH 1US6A 4G27B 2LGWA 5KUKA 3FB7C 4LF6O 2AXTZ 5LA6B 3H1IH 1MOFA 3OTOB 5KHGA 2DN9A 2HVKC 2NN4A 3K08A 1PPJH 2YIBA 3HB3B 1E79G 3HKEA 2RDCA 5BXZA 3P3PA 3SJCC 2AZ0A 3JARA 3FFQA 1N32O 1V9PA 3HKCA 2KG7B 3AEIA 1K5SA 4Z1VA 1RSOB 5LHHA 3CXCU 3RYFB 5JCOA 3CYOA 4TQDA 5EZYB 4OXSA 4J9ZB 2Y0PA 5EBLC 5EIBC 1WLEA 1XHZA 4KP4A 3ZHTA 1XMQB 2WPDG 1OV9A 4YXWG 3OTOO 2ADQB 4QE9A 3FYEB 3SYOA 4DV4B 1Q8IA 4O2AB 2KQXA 3OD4A 4AILC 1ZX3A 2B9ZA 2IJJA 4I9QA 2E74B 5C8YB 1K4DC 5EC2C 2A9HA 4WFHA 1YI2V 3FB6C 1UFIA 5IWAB 3JD2A 2AW9A 4DV7B 1XL6A 3L74H 4WBNA 2PF4E 1WB8A 2KSDA 3ZRWB 3SYQA 2IU0A 4F6RA 3SYAA 5CB4A 1XMQO 4NR1A 4O4JA 1CXZB 3W7SA 4N21A 1IBLB 1FKAO 4DV4O 5B5EZ 3IC7A 5BZBA 4L8JA 1X4TA 1XBLA 1PL0A 3OAAG 1UPGA 3UKMA 1XHXA 4IIJB 2F43G 5IWAO 4JI5B 1Y74A 4X20B 3ZS8C 3K0GA 5J2UA 3J80N 1Q6IA 2F95B 2BTQB 2ZXWC 3ZN1A 4O4HB 1ZUQA 3AK3A 2LFRA 3SR2C 2PTMA 1LUVA 3QO7A 4X1YA 4LFCO 3K5LA 4CC5A 4DR6O 3FX7A 2FMLA 1SA0A 3N2GA 1BSMA 2NNUA 3AG1B 4NTXA 2XUMA 3F7VC 1QCEA 3JAWA 3KG2A 1DF4A 1KKCA 2Y0IA 4DK0A 3P32A 3CCSV 3VQYA 4NKGB 5EYPA 1R6TA 4K8ZA 2BOBC 2HP8A 5DECA 1KYOF 3BPZA 3C3TA 3B09A 3CRCA 4UCUA 1V55C 4EEQA 4R50A 1HDJA 2DWEC 1TVKA 5EC1C 4IL6Z 2AZ2A 2GV9A 3K9SA 5EBMC 1Q90D 4JTAB 1YJ9V 4Z1MG 5H2FZ 5D5PA 2R72A 4ZI7A 4LF9B 1QR9A 4EFEA 2QR4A 3RW0A 1ZWIC 2YSUB 2LP7A 1N0JA 1S0VA 2Q67A 2UUAB 5DEDA 1KD1W 3DC6A 3TK1A 4XBFA 1JX9A 3ZMTA 1XILA 4FLYA 2HKOA 4PA3A 1HR0B 3T1CA 1FFXB 1Y4MA 2HVJC 4FLUA 4NXMB 1MG1A 4GZRB 2QWOB 1VF7A 2HR3A 4X64B 2UUAO 1YF2A 4G2KA 3SDLA 4PA7A 4DV6B 1K73W 1JPXA 5IJ0B 1G8MA 1S77D 1WPXA 2YIDA 4ZKIA 5KAIZ 3L73H 4RQEA 1HR0O 1YSCA 2KKWA 2V7QG 1V54B 3CC7V 5JH7A 3BCCH 5JQGB 4NXMO 1Q6HA 1S5JA 4UV9A 1B6QA 3RT3C 1HP8A 4DV6O 2RJZA 4JI1B 2PGGA 2RN9A 2XNDG 4MTFA 1AVMA 1B06A 2EZPA 3GB7C 1L0NH 1THZA 3CRRA 5H6RA 2LW1A 2WLHA 2P06A 4DV5B 5IY5B 1J95A 3FKSG 1VQOV 4JI3B 2JGDB 2F23A 2IJIA 3BEHA 4HNAB 3G80A 2HJDA 2JK5C 1M56B 2CGNA 2F66C 4H33A 4FZ0A 3ZX6A 5LGUA 1SKVA 3SJBC 2WLIB 4X1IB 3E83A 3A8TA 4DV3B 1PP9H 4PI2A 5CBGA 1AI6A 2Y4TA 4WFAV 1ZL8B 4I9WA 2JJ2G 4DV5O 2DYRB 2JJ1G 5HFLA 1URFA 4JI3O 1MSWD 5EZYA 1ROPA 2XOKG 1VQ5V 1KMIZ 4LF8B 2E75B 4TV8B 1RPRA 5A2QN 2O57A 3ABLC 2UU9O 4DR7B 4E2LA 1DK1A 3THOA 2X0LA 3K9AA 3RYCA 4FLZA 4B7KA 1N8RW 2GHYA 2EINB 1G6UA 3LDCA 1FFTB 3ZRXA 4OPAA 4DV3O 4TWKA 1KBHA 2ZIMA 3K79A 5KUMA 4FLTA 5F2VO 4PDMA 2DOSA 3E89A 2A06H 3D36C 4B08A 4LBEC 1R1BA 3PN1A 4J42A 4FLVA 1IDSA 1ZSPA 3ZRSA 4DR7O 4BR6A 5BMVA 3CD6V 1VF6C 3APOA 4LWSA 3OFNG 1M1KW 5JVDB 4EKWA 5J9PC 4UFZA 1VQ7V 4UVBA 1SQFA 3ZEDA 3UO2A 3WB2A 4EFBA 4LFBO 4UV8A 1F4NA 2RNBA 2IW5A 3K06A 3TXQA 1N34B 1PKXA 2K9PA 3E8HA 2ITDC 1ZAUA 1J5EB 1AP6A 5B66Z 1M4UA 2BTQA 3D36A 4DK1A 3MD0A 1N4CA 1OCRB 3DGEA 2KB1A 1YCIA 1VQ4V 4WCEV 1VF6A 1GM7A 3E35A 3JASB 4JTDB 2ZR3A 1GO3F 2JEUA 4X8AA 2VQEB 4BWAA 4TUYB 2QWNB 3OUSA 1GH6A 3BA9A 2ZDIC 1G4YB 3CPWU 4YJ3B 1LNQA 4WFGA 3ETDA 1ORQC 2FKXA 5L3GA 1H38A 1FXKB 2YUAA 1WPBA 2EIMB 3ML0A 1IBKB 2WAMA 5LOVB 4DUYB 2UXCB 1PD3A 1FD9A 4D6TH 1NR7A 2XAGA 2E76B 1TUBA 2VQEO 5DM6V 2UXDB 3SPIA 1MABG 1RM1B 3H1HH 3OR6C 2CTQA 5B1NA 1Q82W 1TA8A 4RAIA 3ZHQA 4NXNO 4QPKA 4UCTA 2ZDIA 4YHHB 1IBKO 4DUYO 1VMGA 3JCZA 4LF4B 1RP3B 2WLLA 1R3IC 2UXDO 4UVAA 1V54C 3I56V 2QTOA 2VQFB 1NR1A 4FMTA 3FB5C 1JOYA 2X6CA 2HHHB 3SYPA 2M6YA 4YHHO 4DRXA 5KHJA 1R3KC 3FAVA 4JI2B 1R6NA 4BIOA 1SF9A 1F23A 4D7TA 5LP6C 2FB5A 2QKAA 4LF4O 4GYCB 4BW9A 5HFMA 3OMIB 2OIGA 3ASOB 3WB0A 4R8CA 3AG4C 2ATKC 5B3SB 1M56C 4K0KB 2HHHO 3CJHB 1L8DA 3R66A 1JCHA 4X62B 4J10A 1PNMA 3CS5A 3JAKB 4I5SA 2IU3A 4PA6A 5E79Z 3T1YB 2PI4A 1W0KG 1FPOA 1VQNV 3U10A 3ZJZA 2Q7GA 5LP6A 1FJGB 1SQPH 2DYRC 2MK3A 3TJTA 1VQ8V 2MW2B 2JDIG 4UVCA 2PUSA 5KHIA 4W4LA 2LJ2A 4LF7O 2HEPA 1JJ2U 3ZIAG 4K0KO 2ITCC 2AHYA 4LCUC 2OCHA 1EFRG 4X62O 4HNAA 5LBQA 2EINC 5EBWC 3B4SA 1NKDA 3T1YO 5H9CA 3IAYA 1QLEB 2YS8A 4ICGA 2QGNA 4H0LB 2ZINA 1FJGO 1H2KA 5CA1B 4CS4A 4CBCA 4DR2O 4CS3A 1K92A 4GKKB 1ZL8A 3F7YC 3IFXA 4CS2A 2Q0OC 3JCUZ 3HPLC 2JRIA 1Q43A 1Z2GA 1I94B 2AGAA 1QLNA 2PYLA 4KL1A 4I50B 2C2AA 2QE7G 2D3OW 3RYIA 3DC5A 3JATA 5EK0A 4L87A 2YC0A 1YITV 4DUZB 2QDOA 2W0FC 5IYCO 4D7SA 1AP5A 4QNHB 4X9QA 4CC6A 4I0XB 3UO3A 2CAZC 1F7YA 1I94O 4NTWA 3C90A 1BMFG 1NT2B 3OT7A 3D8CA 1K33A 2ZE6A 1NS1A 2N74A 2LO1A 1Q7YW 1XUQA 4CH5A 3M8AA 2Y69C 1GMGA 5JVDA 1AILA 3RN4A 2PZSA 1OCZB 4DUZO 1M93A 2F93B 2YEVB 4Q20A 3EVKA 5L3BA 4XDJA 3JSLA 1VQLV 5CBFA 2XAFA 1CPYA 1PNKA 3MHSC 4MT8A 1FXKC 4FK5C 2CTPA 3CCJV 2ZNJA 2VWJA 1S5LZ 2UXBB 3ABKB 3IJ4A 2H94A 1H2LA 4OPHA 3J81N 5J2TB 4N23A 4RUFA 2K1EA 4E4EA 3L72H 1P84F 5JWPA 3I5DA 3BFRA 4YIOA 1QHTA 5TISZ 1M5IA 2RMKB 2HJFC 1RM1C 2DYSC 3JASA 5LXTA 3JALB 4DV7O 1GTOA 1M57C 4TUYA 2Q7HA 1GRJA 2DQ3A 1KUQA 2X6AA 5L3FA 1D5AA 4YJ3A 2UXBO 2BTOA 5CN0A 1PM9A 1PL4A 2UUCB 3B40A 3AK2A 1IBLO 2CE4A 1FXKA 2GSMB 2PY5A 2JS3A 1FXHA 4DV1B 1QNMA 1SERA 2B5UA 5B1AB 4LH7A 3K5NA 3ABTA 3CB2A 1JVMA 2UXNA 5AG2A 2XAJA 4JI5O 3F5TA 2OIEA 1S72V 4IYHA 1HW7A 4I55B 1XI1A 4BAYA 2UUCO 1YDXA 2V4DA 3ABUA 2EILC 2OCCB 5IYDO 3ASOC 3F5WC 4O4LB 4DV1O 2QSAA 2EJRA 2DWDC 1PV0A 4TV9B 5LMUB 4JI6B 4O4IA 5B3SC 3OEHG 2HG5C 3ZHVA 1WA8B 3OR7C 1WAZA 5IYBO 1HNXB 1VARA 4MW3A 1YXBA 4FPPA 4ZOLB 3ZMVA 2LW7A 2M7WA 4I4TB 3Q4HA 3E22A 2HFEC 1BL8A 3H1KH 4MVUA 3RYHA 1OHHG 1Y76B 3ZHSA 1T5EA 4J7KA 5LMUO 3EFFK 4JI6O 4PDLA 3CCRV 5JJEB 5IJ9B 1SZXA 3OUFA 2ILMA 2CH7A 1HNXO 2EBOA 4LF9O 4YJ2B 3CMEV 1IBMB 3RFRA 3CCMV 3CXHF 3PJSK 4J80A 1QLEC 1XL4A 2BSKB 3AG3C 4LNUA 3JAKA 1EM1A 4NB5A 4JI7B 2Q68A 2Y48A 2QKSA 4LR3A 2EIJB 1WN7A 3OGIB 4ZHQB 4X65B 5KX5B 1W59A 1IVSA 3E2EA 4F4LA 4PI0A 1IBMO 4JPRA 1NTKH 4FVMA 4R7CA 1DGSA 5BY1A 1JFFB 1OCCB 4HYOA 2W6IG 3CRQA 4JI7O 3MAQA 4X64O 1JMKC 1I08A 1OCOB 3K58A 3CMAV 1AJQA 2P67A 3RWRD 2PYJA 4X65O 5IYZB 4B3TB 3M7MX 1S5HC 4AI8A 4MS2A 4BIZA 4C7UA 2BE3A 1FYJA 3RGBA 2VS0A 4IHJA 1SRYA 3FYIB 3LSUA 2GBOA 4XDKA 3T1HB 1K7DA 3K59A 4JAUA 5LA6A 4TSFG 4LF5B 1L0LH 3LSSA 1Z5WA 4X1KB 2QM8A 1OCZC 4JI1O 2Q4PA 3K04A 4LP8A 4B3TO 4TT3G 1S3JA 4U3JB 4FFBB 4UCSA 2ZKOA 1LUWA 2CGOA 5LHGA 2KG7A 5L3EA 4OGQB 5LGTA 2DJVA 1RSOA 3ABKC 1CP9A 3RYFA 5LHIA 1YJWV 4JASA 1F51A 4JAAA 3ETEA 5LYJB 2Z5UA 4U3FH 1M9NA 1SESA 4XDLA 4O2AA 1B3QA 5C8YA 1BS3A 3HKDB 5KAFZ 2DE0X 5A9GA 4ZBMA 3B8NA 4AHCA 1QVGU 1R3JC 3CRMA 3AG7A 5FNVB 4LF8O 3ZRWA 4DV2B 1SC5B 3SPHA 2P22C 2EZOA 4UCRA 5GONB 4HZ3A 5L3CA 4I7ZB 3AG1C 3JARB 1KB9F 4H37A 3OMAB 4JYCA 3HKCB 4DR3B 4J41A 2IH1C 3GVMA 4QIWF 3KKYA 3CRAA 1WP7A 4WF9V 4IIJA 4ABMA 3JALA 1U97A 3APQA 1YEWA 4X20A 3DTUB 4DV2O 3ASNB 1I0HA 4DXWA 3H1LH 2Q6AA 4GKJB 4O4HA 4P9OA 5IE9A 2YI8A 1P49A 2WWWA 1H2GA 2R70A 5LL6Y 3VOUA 4DYLA 4AQYB 3WG7B 4WBNB 2WA4A 3N27A 3ETGA 4PA9A 4F6RB 2DMXA 1N34O 5L3DA 2RCVA 1VEWA 4O4JB 4IYIA 1K9MW 1GN3A 2DQ0A 4I55A 4WFEA 1J5EO 3STZC 3ZMZA 3UM7A 3KZIZ 2Q7EA 5JJJB 3CCEV 1BQZA 2VRZA 5BR8B 3LSQA 4CZZA 3U11A 1N0NA 3SGIA 4PA4A 2YXHA 3EHBB 2UUBB 3QG5A 2IJKA 3DXRB 4O4LA 3RVYA 1K97A 1X59A 4J7JA 3CP1A 4AQYO 2OWOA 4TV9A 2Z3YA 3D3QA 4MSWC 1Y74B 2QA4V 4DR5B 5GTHZ 4LFAB 3M99B 1K3EA 2UXXA 1XNQB 2Z0AA 4EB6B 4ZOLA 4JYAB 5BR8O 5C93A 5FL7G 3N2GB 3QO5A 4YY3B 2UUBO 3QF7A 2EIJC 2CK3G 2UXCO 1I5YA 3OW2U 4JV5B 1BHAA 3OMNB 1D5NA 3L71H 1Y76A 2N04A 2P4KA 3TCUA 5CMUA 2GUZB 3BABA 5EYPB 1FS0G 1BGYH 3BA8A 4QE7A 3X2QB 4FLWA 4MW8A 2OYQA 1XNQO 1OCCC 3N2KB 1Q3EA 4J9YB 2P6JA 1QBZA 1XMOB 1FFXA 4JYAO 1UJWB 1BCCH 4DW0A 2BSKA 4FM1A 2Q73A 2XASA 4HBNA 1XOUA 4FFKA 2X6BA 1BE3H 2A79B 3OEEG 3SYCA 4PJ0Z 1SQGA 5IJ0A 4ZHQA 5IY5C 5LMNB 1FAFA 4HAMA 2VQFO 4Z2WA 4R6ZA 3ZMSA 1RPOA 1XMOO 3H01A 2ZT9B 1V55B 4G28B 2IH3C 5JQGA 4JI2O 2ZE7A 4J11A 3HR0A 1Q6UA 3A2FA 2P5OA 5B1OA 1KP2A 1CEZA 3ZMUA 4PV1B 1Y6XA 2WLKA 1KKDA 3ETQA 2NR5A 5GW7A 1BT8A 1KECA 3L75H 3D3IA 2FTKA 3E86A 1VQ6V 4P30A 2JGDA 1VF5B 2OTLV 4OX9B 4H13B 1TAEA 3NXSA 3CWBH 3SJAC 3L9DA 2CTWA 4X1KA 3K03A 2QWQB 2WLIA 1Q86W 1MSDA 2Q9LA 4X1IA 4RWUA 1E1QG 4B3MB 4RO2A 3C3SA 1JQ0A 2RQ6A 4U3JA 3UQ8A 2FL4A 1E1RG 5D5QA 2JVDA 5KA6A 1AR4A 4LF6B 1P4RA 2ZR2A 4PHZA 4TV8A 4UCOA 1KQSU 1Z5VA 4QJFB 3CEIA 3ZHUA 1VP7A 1GN2A 3FB8C 2W0XA 2LQTA 2W6JG 3G67A 3SPJA 1IXBA 1EN4A 4MVQA 1N32B 1U96A 3BHPA 1WB7A 2WA3A 4GKKO 3ASNC 3JD3A 3TXSA 3DSQA 3TGUH 1XDCA 2V1DA 2YIBD 4U7OA 1QR8A 5FNVA 2GTAA 2XHBA 1SQXH 1OCRC 1OZ0A 5GONA 4BIUA 2ETNA 3GWOA 3WG7C 4MVSA 2ZNIA 3W7XA 1MZEA 3GWKC 1DLBA 4CH6A 2BOCC 2JIZG 3CSXA 3KCYA 1YZBA 5IDJA 2VWKA 3CHXA 4PDRA 1JR9A 3T2MA 1IXMA 1SQBH 4GT1A 3RYCB 5K1XA 2EIMC 1VIBA 2XTAA 1P7GA 3VBBA 3IGAC 4JZGA 2A0LA 5FLXN 2WLNA 1H8EG 1Y66A 4QPJA 5EIBD 2ZCEA 3CCUV 1SQVH 2FYUH 1YTFB 5BMVB 1R6KA 4LWSB 4CH3A 4LFCB 1YHQV 4RQFA 3ABLB 3LUTB 4DR6B 1AI4A 2Q0AA 4IT5A 2IJHA 1MZFA 4JI4B 5LOVA 3DXRA 2YIAA 1VQ9V 3X2QC 3WB1A 3CE2A 3ABMB 4NVPA 2F4VB 2P7TC 2F1MA 2ADPA 5CA3A 4JAVA 2B1IA 5JJNB 5FPOA 4EB6A 2LFSA 3H1JH 2P4VA 3MDSA 3S3XA 5KHKA 1YJNV 4JI4O 4ZIBA 1QU7A 3B77A 4UCVA 2GUZA 4FZ1A 4GUNA 3R65A 2F4VO 2YDEA 1GM9A 3K3WA 2DW4A 3P3NA 2ODMA 2X7RB 3QO8A 3N2KA 3LNNA 3G6BA 1KC8W 3UT5B 3WU2Z 1NJIW 4KHPB 5KLVH 4NTYA 3E8FA 5B1BB 3RBZA 4PDVA 1TUBB 3LDEA 2EIKB 4MTXA 3SJQC 1I5XA 4IGGA 1SQQH 1SETA 2G38A 4GLXA 1Y67A 2CUGA 3CJHA 3S3WA 4KHPO 1ENVA 2WLLB 3WFVA 4LC1A 4UUJC 1NU1H 2HLDG 3K5MA 1R73A 1IURA 2EJ7A 3HKBB 4U7NA 5KHHA 3OM3B 1MMMA 2Q8VA 1WNSA 5E1AC 3AG2B 5KMGB 3NR7A 3SPGA 2GTSA 3BAAA 3FD9A 4DRXB 3FAVB 4UB6Z 1DF5A 1NBMG 3JSNA 1NI8A 2EX3A 1MA1A 1O9HA 1GK9A 1EN6A 4FJCC 4P2ZA 2YXYA 4JI0B 4O2BB 1XQ8A 1QQCA 2H3OA 2QWRB 1EBOA 4ASUG 1SZTA 5CA1A 4F6EA 1O9GA 1GKFA 3A0BZ 4JYBA 5ITZB 4JI8B 3E8BA 4A5UB 5CA0B 1A32A 1AI5A 4P9PA 2LGQA 1AROP 4I50A 3OE7G 4JI0O 4MVRA 5LP6B 4K8XA 1NH2D 5DN6G 2QJ1A 3CCQV 2YXLA 1W0JG 3LDDA 1KU9A 1NVPB 1AB3A 2B1GA 3AG4B 3H9VA 1Q5OA 4GX1A 2GDSA 4I0XA 1VQMV 4JI8O 2UU9B 1GN6A 4DO2A 3T1HO 1BHBA 3W7TA 1Q81W 3JYCA 2P90A 4LF5O 2QTSA 4WFFA 1BQ0A 2H8PC 3K0DA 1H2NA 2QM4A 1S76D 3O65A 4MTGA 1B04A 3QVNA 3BRCA 1NTMH 1XEQA 1EZJA 1HWYA 2L6LA 2QWPB 3IC9A 2YEVA 2N05A 3JD1A 3G71V 4TQFA 1COWG 3A0RA 3W7WA 1GM8A 4FM0A 3RYIB 2WLMA 1YIJV 3JATB 5J2TA 3HKEB 3G4SV 5B1AC 3ABMC 1N33B 4LFBB 3TETA 3T4ZA 2JS5A 5CBHA 1N36B 4GCZA 1YTFD 5LGNA 4DV0B 3ZBHA 5IT9N 4FIPC 3JAMN 2JGUA 1IZ3A 1L1FA 2OCCC 4B7EA 4FLXA 2R9RB 1NQTA 2ZM6B 3MHHC 4WFBV 1N33O 1SS3A 2XAHA 3LNMB 2R9AA 4DR3O 1N36O 3A0HZ 3KCXA 4DV0O 3JD0A 1XNRB 5CB4B 2E5LB 4B3RB 2QM7A 4DW1A 1AJNA 5B1BC 3ZRVA 2ZM6O 4JZ2A 4GKJO 4YIPA 4KFMA 2EIKC 1WP8A 3ZN0A 2Y69B 2QEXV 1K4CC 3SPCA 1ZTEA 2EULA 4K35A 5LXTB 1TUEB 4X66B 1XNRO 5FPRA 4DR4B 2ZD9A 4JYYA 5J2UB 1WA8A 1YVWA 2E5LO 1HNWB 4B3SB 1RFYA 4B3RO 4KXRA 4NXNB 4MVOA 4Q6GA 4QGPA 3UT5A 4X1YB 1ZLZA 2A3QA 2ARHA 1QVFU 3K57A 1XREA 1SA0B 4UB8Z 4I4TA 4GX2A 1BZKA 3G6EV 3JAWB 3AG2C 4H44B 3EXAA 4X88A 1G1XB 2DYSB 4X66O 2WSSG 1FXVA 4DR5O 3AK1A 1GAXA 4FM2A 4DR4O 4LFAO 2WLJA 2L35A 1HNZB 3CCVV 3O9OA 5IJ9A 1HNWO 1M57B 4B3SO 4JF3A 1M90W 4YJ2A 5GTIZ 1K8AW 3J7AU 3P30A 1AJPA 3ZCCA 1TVKB 2ZXWB 2R9IA 3STLC 4YY3O 4RUEA 4MVZA 4CH4A 1OCOC 5K1PA 4O4IB 1AR5A 4JV5O 4JTCB 1VQKV 2CTRA 3HKBA 1DTOA 4ZI7B 2ZE5A 1HNZO 4JGSA 1AR1B 5KX5A 3QTCA 1AI7A 5KMGA 1OJHA 4UXNA 3Q4HB 3E22B 1D2DA 3CC4V 3RYHB 3E8GA 4DR1B 2YI9A 1EN5A 2EILB 3VQVA 1JFFA 2Q69A 3CX5F 1IX9A 2PI5A 4MTOA 1H2SB 4O2BA 4TOIA 4PELA 2XT9A 3VQWA 3BVOA 1F4MA 4NYKA 2CH7B 3T4DA 2OT5A 5H5NA 1I7FA 4LF7B 3B8MA 5IYZA 5LMNO 1JJOA 3ICXA 1P7BA 4LNUB 4W4KA 1NTZH 2D2CB 2AHZA 5ITZA 3U0ZA 2NLJC 3BY6A 1GN4A 2QKCA 2ZE8A 3VQXA 4DR1O 1LR1A 5CA0A 1EZVH 4GX0A 5H6QA 1K5QA 3L70H 4MVMA 1PNLA 3ZHRA 3I55V 3CC2V 3CCLV 1NVPD 2IBZH 1JA8A 4X89A 4DR2B 2ZQMA 3K5OA 1NZ6A 1W2BU 2Q5ZA 2A7WA 4LH6A 3RVZA 1H8HG 1MNGA 4FFBA 5JH7B 3UCSC 4BW5A 4PD4F 5KA5A 1TGOA 3JD4A 2CDYA 3QNEA 3AG3B 4KUMA 2JEXA 3OTFA 5LYJA 4OX9O 2YICA 2Y4UA 2IM9A 3W7UA 3OGCC 5JCOC 1VQPV 2OTJV 1WJZA 2XAQA 1H2MA 1R3LC 4GX5A 4B3MO
chains in the Genus database with same CATH topology
1NH2B 3OR6C 5LHGA 3K3WA 2DW4A 1K34A 1KP3A 5L3EA 5LGTA 5B1NA 2X7RB 3ABKC 1CP9A 5LHIA 3QO8A 4G27B 1Q82W 5KUKA 1YJWV 3FB7C 4RAIA 4JASA 1KC8W 1F51A 4QPKA 2ZDIA 3ETEA 1MOFA 2Z5UA 1NJIW 2HVKC 3K08A 3JCZA 3E8FA 5B1BB 3RBZA 2WLLA 1M9NA 4PDVA 3HB3B 1SESA 4XDLA 1E79G 3LDEA 2EIKB 4MTXA 1R3IC 4UVAA 3SJQC 3AEIA 1K5SA 1V54C 3I56V 2QTOA 1I5XA 5LHHA 3CXCU 1NR1A 3CYOA 4FMTA 4ZBMA 3FB5C 3B8NA 4OXSA 1QVGU 4J9ZB 1JOYA 1R3JC 1SETA 2X6CA 5EBLC 1WLEA 4KP4A 3SYPA 3ZRWA 2WPDG 4YXWG 3SPHA 2EZOA 1R3KC 1ENVA 1R6NA 4QE9A 4HZ3A 2WLLB 1F23A 3FYEB 3SYOA 3WFVA 4LC1A 5L3CA 4UUJC 3AG1C 5HFMA 2HLDG 3OMIB 1R73A 4H37A 2IJJA 3OMAB 4JYCA 3ASOB 1K4DC 4U7NA 5EC2C 2A9HA 4WFHA 1YI2V 4R8CA 3FB6C 3OM3B 2IH1C 4QIWF 5E1AC 3JD2A 3AG4C 3AG2B 1XL6A 4WF9V 2ATKC 3SPGA 5B3SB 3ZRWB 3SYQA 2IU0A 1M56C 3SYAA 3DTUB 1JCHA 3ASNB 1PNMA 4DXWA 1DF5A 4N21A 3W7SA 1NBMG 2Q6AA 4I5SA 2IU3A 4PA6A 4P9OA 3IC7A 5BZBA 2PI4A 1GK9A 4FJCC 4P2ZA 1W0KG 2WWWA 1H2GA 1VQNV 1PL0A 3OAAG 3VOUA 3UKMA 3ZJZA 2MK3A 2DYRC 3WG7B 1VQ8V 2F43G 2JDIG 1EBOA 4UVCA 4ASUG 1SZTA 3ETGA 4PA9A 1GKFA 5L3DA 1JJ2U 3ZIAG 2ITCC 2AHYA 4LCUC 3K0GA 1EFRG 1K9MW 2DQ0A 4JYBA 2ZXWC 4WFEA 3ZN1A 3STZC 3ZMZA 3E8BA 3UM7A 5LBQA 2EINC 2LFRA 5EBWC 3CCEV 1NKDA 3LSQA 4CZZA 5H9CA 1AI5A 4P9PA 3QO7A 1AROP 4PA4A 3OE7G 3EHBB 2IJKA 1QLEB 4MVRA 2NNUA 3AG1B 3RVYA 1NH2D 5DN6G 1K97A 3F7VC 1QCEA 3CCQV 3CP1A 2Z3YA 3KG2A 1DF4A 4MSWC 2QA4V 4CBCA 1K92A 1W0JG 3LDDA 3P32A 1NVPB 3M99B 3CCSV 3F7YC 1K3EA 3IFXA 2B1GA 3AG4B 2BOBC 2UXXA 3HPLC 4GX1A 1V55C 1QLNA 1VQMV 4R50A 2C2AA 2QE7G 4DO2A 5C93A 5FL7G 1BHBA 3W7TA 3QO5A 3JYCA 1Q81W 2DWEC 2P90A 2EIJC 4WFFA 2D3OW 2CK3G 5EC1C 1I5YA 2H8PC 3OW2U 1BHAA 3K0DA 3OMNB 5EBMC 3TCUA 4JTAB 5EK0A 1S76D 5CMUA 1YJ9V 4L87A 4Z1MG 1YITV 4MTGA 1FS0G 5IYCO 2W0FC 4QNHB 4QE7A 3X2QB 1QR9A 4MW8A 1EZJA 1HWYA 2YEVA 1OCCC 3JD1A 1BMFG 4J9YB 3RW0A 2P6JA 1QBZA 1ZWIC 3G71V 1K33A 1COWG 1UJWB 3A0RA 3W7WA 2YSUB 2LP7A 1S0VA 1GM8A 1Q7YW 2WLMA 2Q67A 1YIJV 2XASA 2Y69C 1GMGA 2X6BA 3G4SV 2A79B 3ABMC 5B1AC 3OEEG 3SYCA 3TETA 1KD1W 3T4ZA 1OCZB 5CBHA 3TK1A 4XBFA 5IY5C 4GCZA 1JX9A 2YEVB 4Q20A 1YTFD 3ZMTA 5LGNA 5L3BA 2HKOA 4PA3A 4XDJA 4HAMA 3T1CA 1VQLV 1Y4MA 2HVJC 4FIPC 4R6ZA 5CBFA 3ZMSA 2XAFA 1CPYA 1PNKA 1RPOA 3MHSC 3H01A 4MT8A 1FXKC 4FK5C 1L1FA 3CCJV 1V55B 2OCCC 4G28B 3ABKB 1MG1A 2H94A 2IH3C 2R9RB 1NQTA 2HR3A 4N23A 4RUFA 2K1EA 3MHHC 4G2KA 4PA7A 4WFBV 1K73W 1JPXA 5B1OA 1KP2A 2XAHA 3LNMB 2HJFC 3ZMUA 1RM1C 1G8MA 2DYSC 1S77D 1CEZA 1WPXA 2WLKA 4ZKIA 1KKDA 4RQEA 3JD0A 1GTOA 1M57C 2DQ3A 2X6AA 1YSCA 5GW7A 2V7QG 1V54B 5L3FA 1KECA 3CC7V 3D3IA 2FTKA 3E86A 1VQ6V 4P30A 4UV9A 2QM7A 5CN0A 1B6QA 2OTLV 1AJNA 5B1BC 3ZRVA 1FXKA 2GSMB 4KFMA 2EIKC 3NXSA 1FXHA 3ZN0A 2Y69B 3K03A 2XNDG 4MTFA 2QEXV 1SERA 1K4CC 2B5UA 2EZPA 3GB7C 5B1AB 3SPCA 2WLIA 1Q86W 1THZA 1E1QG 5H6RA 4RO2A 3ABTA 1JQ0A 1TUEB 2WLHA 1JVMA 2UXNA 5IY5B 1J95A 2XAJA 2ZD9A 3FKSG 1E1RG 1VQOV 5KA6A 1S72V 2IJIA 3BEHA 1P4RA 2ZR2A 4BAYA 4MVOA 2JK5C 1M56B 3ABUA 2EILC 2OCCB 5IYDO 1KQSU 4H33A 4QJFB 1QVFU 5LGUA 3ASOC 3F5WC 3FB8C 4GX2A 2W6JG 3SPJA 3G6EV 2WLIB 2EJRA 2DWDC 3E83A 4MVQA 3AG2C 5CBGA 1AI6A 4X88A 4WFAV 5B3SC 2DYSB 4I9WA 2WSSG 1FXVA 2HG5C 2JJ2G 3OEHG 3OR7C 2DYRB 2JJ1G 2WLJA 3CCVV 5HFLA 5IYBO 3ASNC 3JD3A 4MW3A 1MSWD 1M57B 1ROPA 2XOKG 1VQ5V 2V1DA 4FPPA 4JF3A 3ZMVA 4U7OA 1M90W 1QR8A 1RPRA 2M7WA 1K8AW 3ABLC 1OCRC 3P30A 1AJPA 1OZ0A 3ZCCA 4E2LA 2HFEC 1BL8A 2ZXWB 2X0LA 3K9AA 2R9IA 4MVUA 1OHHG 3STLC 1N8RW 4BIUA 2GHYA 2EINB 4RUEA 3LDCA 3GWOA 1FFTB 4MVZA 3WG7C 1OCOC 3ZRXA 4JTCB 1VQKV 4TWKA 3EFFK 4MVSA 3K79A 5KUMA 3W7XA 4PDLA 4PDMA 3CCRV 1DLBA 1DTOA 2BOCC 2JIZG 3OUFA 4JGSA 3E89A 1AR1B 2EBOA 1AI7A 3CMEV 5IDJA 4PDRA 4UXNA 4LBEC 3CCMV 3T2MA 1IXMA 4GT1A 3CC4V 3PJSK 3ZRSA 2EIMC 1QLEC 1XL4A 3E8GA 3AG3C 3CD6V 2EILB 2Q69A 3OFNG 1M1KW 4EKWA 2Q68A 5J9PC 2PI5A 2Y48A 4MTOA 2QKSA 3VBBA 1VQ7V 4UVBA 2EIJB 4PELA 1F4MA 3IGAC 2A0LA 3T4DA 4UV8A 1F4NA 2OT5A 2IW5A 2WLNA 3K06A 3E2EA 1H8EG 1Y66A 1PKXA 3E8HA 4QPJA 3B8MA 4F4LA 3CCUV 2ITDC 4JPRA 1YTFB 4R7CA 1P7BA 1R6KA 2AHZA 3D36A 1OCCB 2NLJC 3BY6A 3MD0A 4HYOA 1YHQV 2W6IG 4RQFA 3ABLB 3LUTB 3DGEA 1OCRB 2KB1A 1AI4A 4GX0A 1VQ4V 5H6QA 1K5QA 2IJHA 4WCEV 4MVMA 1PNLA 3I55V 3CC2V 3CCLV 1NVPD 1OCOB 3CMAV 1VQ9V 1GM7A 3E35A 1AJQA 2P67A 4X89A 4JTDB 2ZR3A 1GO3F 2JEUA 3X2QC 2ZQMA 3ABMB 4X8AA 1W2BU 1S5HC 4MS2A 2P7TC 3RVZA 1H8HG 5CA3A 3OUSA 4BIZA 2ZDIC 4JAVA 1G4YB 2B1IA 4BW5A 3CPWU 1LNQA 4WFGA 3ETDA 1SRYA 1ORQC 5L3GA 3FYIB 4XDKA 2LFSA 1K7DA 5KA5A 1H38A 3JD4A 4JAUA 1FXKB 2EIMB 3ML0A 4TSFG 2WAMA 3QNEA 3AG3B 4KUMA 2JEXA 3LSSA 1PD3A 1YJNV 2QM8A 1NR7A 2XAGA 1OCZC 3W7UA 3OGCC 1VQPV 3B77A 3K04A 4LP8A 2OTJV 4TT3G 1S3JA 5DM6V 2XAQA 3R65A 1R3LC 4GX5A 3SPIA 1MABG 1RM1B 1GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CN0 A;  3MHH C;  1K34 A;  4G2K A;  4FJC C;  5HFL A;  2X7R B;  1QR9 A;  1I5X A;  1DLB A;  1JPX A;  5H9C A;  5KA5 A;  3CYO A;  4JGS A;  4JF3 A;  2EBO A;  3B8N A;  1QR8 A;  2OT5 A;  2MK3 A;  2P6J A;  1QBZ A;  2M7W A;  1MOF A;  1Y66 A;  1K33 A;  2EZP A;  1Y4M A;  1EBO A;  3B8M A;  3P30 A;  4FIP C;  1QCE A;  1SZT A;  3CP1 A;  4E2L A;  2LP7 A;  3MHS C;  1I5Y A;  3H01 A;  3K9A A;  2EZO A;  4FK5 C;  1DF4 A;  3B77 A;  1ENV A;  1JQ0 A;  4JPR A;  1F23 A;  1MG1 A;  3GWO A;  3WFV A;  3M99 B;  1DF5 A;  4N21 A;  5CMU A;  5HFM A;  5KA6 A;  4N23 A; 
#chains in the Genus database with same CATH topology
 2ZIO A;  1NH2 B;  4J7Z A;  1K34 A;  1KP3 A;  3B2E E;  3HKD A;  4IHJ B;  2E3C A;  4K3A A;  2BCC H;  1US6 A;  4G27 B;  2LGW A;  5KUK A;  3FB7 C;  4LF6 O;  2AXT Z;  5LA6 B;  3H1I H;  1MOF A;  3OTO B;  5KHG A;  2DN9 A;  2HVK C;  2NN4 A;  3K08 A;  1PPJ H;  2YIB A;  3HB3 B;  1E79 G;  3HKE A;  2RDC A;  5BXZ A;  3P3P A;  3SJC C;  2AZ0 A;  3JAR A;  3FFQ A;  1N32 O;  1V9P A;  3HKC A;  2KG7 B;  3AEI A;  1K5S A;  4Z1V A;  1RSO B;  5LHH A;  3CXC U;  3RYF B;  5JCO A;  3CYO A;  4TQD A;  5EZY B;  4OXS A;  4J9Z B;  2Y0P A;  5EBL C;  5EIB C;  1WLE A;  1XHZ A;  4KP4 A;  3ZHT A;  1XMQ B;  2WPD G;  1OV9 A;  4YXW G;  3OTO O;  2ADQ B;  4QE9 A;  3FYE B;  3SYO A;  4DV4 B;  1Q8I A;  4O2A B;  2KQX A;  3OD4 A;  4AIL C;  1ZX3 A;  2B9Z A;  2IJJ A;  4I9Q A;  2E74 B;  5C8Y B;  1K4D C;  5EC2 C;  2A9H A;  4WFH A;  1YI2 V;  3FB6 C;  1UFI A;  5IWA B;  3JD2 A;  2AW9 A;  4DV7 B;  1XL6 A;  3L74 H;  4WBN A;  2PF4 E;  1WB8 A;  2KSD A;  3ZRW B;  3SYQ A;  2IU0 A;  4F6R A;  3SYA A;  5CB4 A;  1XMQ O;  4NR1 A;  4O4J A;  1CXZ B;  3W7S A;  4N21 A;  1IBL B;  1FKA O;  4DV4 O;  5B5E Z;  3IC7 A;  5BZB A;  4L8J A;  1X4T A;  1XBL A;  1PL0 A;  3OAA G;  1UPG A;  3UKM A;  1XHX A;  4IIJ B;  2F43 G;  5IWA O;  4JI5 B;  1Y74 A;  4X20 B;  3ZS8 C;  3K0G A;  5J2U A;  3J80 N;  1Q6I A;  2F95 B;  2BTQ B;  2ZXW C;  3ZN1 A;  4O4H B;  1ZUQ A;  3AK3 A;  2LFR A;  3SR2 C;  2PTM A;  1LUV A;  3QO7 A;  4X1Y A;  4LFC O;  3K5L A;  4CC5 A;  4DR6 O;  3FX7 A;  2FML A;  1SA0 A;  3N2G A;  1BSM A;  2NNU A;  3AG1 B;  4NTX A;  2XUM A;  3F7V C;  1QCE A;  3JAW A;  3KG2 A;  1DF4 A;  1KKC A;  2Y0I A;  4DK0 A;  3P32 A;  3CCS V;  3VQY A;  4NKG B;  5EYP A;  1R6T A;  4K8Z A;  2BOB C;  2HP8 A;  5DEC A;  1KYO F;  3BPZ A;  3C3T A;  3B09 A;  3CRC A;  4UCU A;  1V55 C;  4EEQ A;  4R50 A;  1HDJ A;  2DWE C;  1TVK A;  5EC1 C;  4IL6 Z;  2AZ2 A;  2GV9 A;  3K9S A;  5EBM C;  1Q90 D;  4JTA B;  1YJ9 V;  4Z1M G;  5H2F Z;  5D5P A;  2R72 A;  4ZI7 A;  4LF9 B;  1QR9 A;  4EFE A;  2QR4 A;  3RW0 A;  1ZWI C;  2YSU B;  2LP7 A;  1N0J A;  1S0V A;  2Q67 A;  2UUA B;  5DED A;  1KD1 W;  3DC6 A;  3TK1 A;  4XBF A;  1JX9 A;  3ZMT A;  1XIL A;  4FLY A;  2HKO A;  4PA3 A;  1HR0 B;  3T1C A;  1FFX B;  1Y4M A;  2HVJ C;  4FLU A;  4NXM B;  1MG1 A;  4GZR B;  2QWO B;  1VF7 A;  2HR3 A;  4X64 B;  2UUA O;  1YF2 A;  4G2K A;  3SDL A;  4PA7 A;  4DV6 B;  1K73 W;  1JPX A;  5IJ0 B;  1G8M A;  1S77 D;  1WPX A;  2YID A;  4ZKI A;  5KAI Z;  3L73 H;  4RQE A;  1HR0 O;  1YSC A;  2KKW A;  2V7Q G;  1V54 B;  3CC7 V;  5JH7 A;  3BCC H;  5JQG B;  4NXM O;  1Q6H A;  1S5J A;  4UV9 A;  1B6Q A;  3RT3 C;  1HP8 A;  4DV6 O;  2RJZ A;  4JI1 B;  2PGG A;  2RN9 A;  2XND G;  4MTF A;  1AVM A;  1B06 A;  2EZP A;  3GB7 C;  1L0N H;  1THZ A;  3CRR A;  5H6R A;  2LW1 A;  2WLH A;  2P06 A;  4DV5 B;  5IY5 B;  1J95 A;  3FKS G;  1VQO V;  4JI3 B;  2JGD B;  2F23 A;  2IJI A;  3BEH A;  4HNA B;  3G80 A;  2HJD A;  2JK5 C;  1M56 B;  2CGN A;  2F66 C;  4H33 A;  4FZ0 A;  3ZX6 A;  5LGU A;  1SKV A;  3SJB C;  2WLI B;  4X1I B;  3E83 A;  3A8T A;  4DV3 B;  1PP9 H;  4PI2 A;  5CBG A;  1AI6 A;  2Y4T A;  4WFA V;  1ZL8 B;  4I9W A;  2JJ2 G;  4DV5 O;  2DYR B;  2JJ1 G;  5HFL A;  1URF A;  4JI3 O;  1MSW D;  5EZY A;  1ROP A;  2XOK G;  1VQ5 V;  1KMI Z;  4LF8 B;  2E75 B;  4TV8 B;  1RPR A;  5A2Q N;  2O57 A;  3ABL C;  2UU9 O;  4DR7 B;  4E2L A;  1DK1 A;  3THO A;  2X0L A;  3K9A A;  3RYC A;  4FLZ A;  4B7K A;  1N8R W;  2GHY A;  2EIN B;  1G6U A;  3LDC A;  1FFT B;  3ZRX A;  4OPA A;  4DV3 O;  4TWK A;  1KBH A;  2ZIM A;  3K79 A;  5KUM A;  4FLT A;  5F2V O;  4PDM A;  2DOS A;  3E89 A;  2A06 H;  3D36 C;  4B08 A;  4LBE C;  1R1B A;  3PN1 A;  4J42 A;  4FLV A;  1IDS A;  1ZSP A;  3ZRS A;  4DR7 O;  4BR6 A;  5BMV A;  3CD6 V;  1VF6 C;  3APO A;  4LWS A;  3OFN G;  1M1K W;  5JVD B;  4EKW A;  5J9P C;  4UFZ A;  1VQ7 V;  4UVB A;  1SQF A;  3ZED A;  3UO2 A;  3WB2 A;  4EFB A;  4LFB O;  4UV8 A;  1F4N A;  2RNB A;  2IW5 A;  3K06 A;  3TXQ A;  1N34 B;  1PKX A;  2K9P A;  3E8H A;  2ITD C;  1ZAU A;  1J5E B;  1AP6 A;  5B66 Z;  1M4U A;  2BTQ A;  3D36 A;  4DK1 A;  3MD0 A;  1N4C A;  1OCR B;  3DGE A;  2KB1 A;  1YCI A;  1VQ4 V;  4WCE V;  1VF6 A;  1GM7 A;  3E35 A;  3JAS B;  4JTD B;  2ZR3 A;  1GO3 F;  2JEU A;  4X8A A;  2VQE B;  4BWA A;  4TUY B;  2QWN B;  3OUS A;  1GH6 A;  3BA9 A;  2ZDI C;  1G4Y B;  3CPW U;  4YJ3 B;  1LNQ A;  4WFG A;  3ETD A;  1ORQ C;  2FKX A;  5L3G A;  1H38 A;  1FXK B;  2YUA A;  1WPB A;  2EIM B;  3ML0 A;  1IBK B;  2WAM A;  5LOV B;  4DUY B;  2UXC B;  1PD3 A;  1FD9 A;  4D6T H;  1NR7 A;  2XAG A;  2E76 B;  1TUB A;  2VQE O;  5DM6 V;  2UXD B;  3SPI A;  1MAB G;  1RM1 B;  3H1H H;  3OR6 C;  2CTQ A;  5B1N A;  1Q82 W;  1TA8 A;  4RAI A;  3ZHQ A;  4NXN O;  4QPK A;  4UCT A;  2ZDI A;  4YHH B;  1IBK O;  4DUY O;  1VMG A;  3JCZ A;  4LF4 B;  1RP3 B;  2WLL A;  1R3I C;  2UXD O;  4UVA A;  1V54 C;  3I56 V;  2QTO A;  2VQF B;  1NR1 A;  4FMT A;  3FB5 C;  1JOY A;  2X6C A;  2HHH B;  3SYP A;  2M6Y A;  4YHH O;  4DRX A;  5KHJ A;  1R3K C;  3FAV A;  4JI2 B;  1R6N A;  4BIO A;  1SF9 A;  1F23 A;  4D7T A;  5LP6 C;  2FB5 A;  2QKA A;  4LF4 O;  4GYC B;  4BW9 A;  5HFM A;  3OMI B;  2OIG A;  3ASO B;  3WB0 A;  4R8C A;  3AG4 C;  2ATK C;  5B3S B;  1M56 C;  4K0K B;  2HHH O;  3CJH B;  1L8D A;  3R66 A;  1JCH A;  4X62 B;  4J10 A;  1PNM A;  3CS5 A;  3JAK B;  4I5S A;  2IU3 A;  4PA6 A;  5E79 Z;  3T1Y B;  2PI4 A;  1W0K G;  1FPO A;  1VQN V;  3U10 A;  3ZJZ A;  2Q7G A;  5LP6 A;  1FJG B;  1SQP H;  2DYR C;  2MK3 A;  3TJT A;  1VQ8 V;  2MW2 B;  2JDI G;  4UVC A;  2PUS A;  5KHI A;  4W4L A;  2LJ2 A;  4LF7 O;  2HEP A;  1JJ2 U;  3ZIA G;  4K0K O;  2ITC C;  2AHY A;  4LCU C;  2OCH A;  1EFR G;  4X62 O;  4HNA A;  5LBQ A;  2EIN C;  5EBW C;  3B4S A;  1NKD A;  3T1Y O;  5H9C A;  3IAY A;  1QLE B;  2YS8 A;  4ICG A;  2QGN A;  4H0L B;  2ZIN A;  1FJG O;  1H2K A;  5CA1 B;  4CS4 A;  4CBC A;  4DR2 O;  4CS3 A;  1K92 A;  4GKK B;  1ZL8 A;  3F7Y C;  3IFX A;  4CS2 A;  2Q0O C;  3JCU Z;  3HPL C;  2JRI A;  1Q43 A;  1Z2G A;  1I94 B;  2AGA A;  1QLN A;  2PYL A;  4KL1 A;  4I50 B;  2C2A A;  2QE7 G;  2D3O W;  3RYI A;  3DC5 A;  3JAT A;  5EK0 A;  4L87 A;  2YC0 A;  1YIT V;  4DUZ B;  2QDO A;  2W0F C;  5IYC O;  4D7S A;  1AP5 A;  4QNH B;  4X9Q A;  4CC6 A;  4I0X B;  3UO3 A;  2CAZ C;  1F7Y A;  1I94 O;  4NTW A;  3C90 A;  1BMF G;  1NT2 B;  3OT7 A;  3D8C A;  1K33 A;  2ZE6 A;  1NS1 A;  2N74 A;  2LO1 A;  1Q7Y W;  1XUQ A;  4CH5 A;  3M8A A;  2Y69 C;  1GMG A;  5JVD A;  1AIL A;  3RN4 A;  2PZS A;  1OCZ B;  4DUZ O;  1M93 A;  2F93 B;  2YEV B;  4Q20 A;  3EVK A;  5L3B A;  4XDJ A;  3JSL A;  1VQL V;  5CBF A;  2XAF A;  1CPY A;  1PNK A;  3MHS C;  4MT8 A;  1FXK C;  4FK5 C;  2CTP A;  3CCJ V;  2ZNJ A;  2VWJ A;  1S5L Z;  2UXB B;  3ABK B;  3IJ4 A;  2H94 A;  1H2L A;  4OPH A;  3J81 N;  5J2T B;  4N23 A;  4RUF A;  2K1E A;  4E4E A;  3L72 H;  1P84 F;  5JWP A;  3I5D A;  3BFR A;  4YIO A;  1QHT A;  5TIS Z;  1M5I A;  2RMK B;  2HJF C;  1RM1 C;  2DYS C;  3JAS A;  5LXT A;  3JAL B;  4DV7 O;  1GTO A;  1M57 C;  4TUY A;  2Q7H A;  1GRJ A;  2DQ3 A;  1KUQ A;  2X6A A;  5L3F A;  1D5A A;  4YJ3 A;  2UXB O;  2BTO A;  5CN0 A;  1PM9 A;  1PL4 A;  2UUC B;  3B40 A;  3AK2 A;  1IBL O;  2CE4 A;  1FXK A;  2GSM B;  2PY5 A;  2JS3 A;  1FXH A;  4DV1 B;  1QNM A;  1SER A;  2B5U A;  5B1A B;  4LH7 A;  3K5N A;  3ABT A;  3CB2 A;  1JVM A;  2UXN A;  5AG2 A;  2XAJ A;  4JI5 O;  3F5T A;  2OIE A;  1S72 V;  4IYH A;  1HW7 A;  4I55 B;  1XI1 A;  4BAY A;  2UUC O;  1YDX A;  2V4D A;  3ABU A;  2EIL C;  2OCC B;  5IYD O;  3ASO C;  3F5W C;  4O4L B;  4DV1 O;  2QSA A;  2EJR A;  2DWD C;  1PV0 A;  4TV9 B;  5LMU B;  4JI6 B;  4O4I A;  5B3S C;  3OEH G;  2HG5 C;  3ZHV A;  1WA8 B;  3OR7 C;  1WAZ A;  5IYB O;  1HNX B;  1VAR A;  4MW3 A;  1YXB A;  4FPP A;  4ZOL B;  3ZMV A;  2LW7 A;  2M7W A;  4I4T B;  3Q4H A;  3E22 A;  2HFE C;  1BL8 A;  3H1K H;  4MVU A;  3RYH A;  1OHH G;  1Y76 B;  3ZHS A;  1T5E A;  4J7K A;  5LMU O;  3EFF K;  4JI6 O;  4PDL A;  3CCR V;  5JJE B;  5IJ9 B;  1SZX A;  3OUF A;  2ILM A;  2CH7 A;  1HNX O;  2EBO A;  4LF9 O;  4YJ2 B;  3CME V;  1IBM B;  3RFR A;  3CCM V;  3CXH F;  3PJS K;  4J80 A;  1QLE C;  1XL4 A;  2BSK B;  3AG3 C;  4LNU A;  3JAK A;  1EM1 A;  4NB5 A;  4JI7 B;  2Q68 A;  2Y48 A;  2QKS A;  4LR3 A;  2EIJ B;  1WN7 A;  3OGI B;  4ZHQ B;  4X65 B;  5KX5 B;  1W59 A;  1IVS A;  3E2E A;  4F4L A;  4PI0 A;  1IBM O;  4JPR A;  1NTK H;  4FVM A;  4R7C A;  1DGS A;  5BY1 A;  1JFF B;  1OCC B;  4HYO A;  2W6I G;  3CRQ A;  4JI7 O;  3MAQ A;  4X64 O;  1JMK C;  1I08 A;  1OCO B;  3K58 A;  3CMA V;  1AJQ A;  2P67 A;  3RWR D;  2PYJ A;  4X65 O;  5IYZ B;  4B3T B;  3M7M X;  1S5H C;  4AI8 A;  4MS2 A;  4BIZ A;  4C7U A;  2BE3 A;  1FYJ A;  3RGB A;  2VS0 A;  4IHJ A;  1SRY A;  3FYI B;  3LSU A;  2GBO A;  4XDK A;  3T1H B;  1K7D A;  3K59 A;  4JAU A;  5LA6 A;  4TSF G;  4LF5 B;  1L0L H;  3LSS A;  1Z5W A;  4X1K B;  2QM8 A;  1OCZ C;  4JI1 O;  2Q4P A;  3K04 A;  4LP8 A;  4B3T O;  4TT3 G;  1S3J A;  4U3J B;  4FFB B;  4UCS A;  2ZKO A;  1LUW A;  2CGO A;  5LHG A;  2KG7 A;  5L3E A;  4OGQ B;  5LGT A;  2DJV A;  1RSO A;  3ABK C;  1CP9 A;  3RYF A;  5LHI A;  1YJW V;  4JAS A;  1F51 A;  4JAA A;  3ETE A;  5LYJ B;  2Z5U A;  4U3F H;  1M9N A;  1SES A;  4XDL A;  4O2A A;  1B3Q A;  5C8Y A;  1BS3 A;  3HKD B;  5KAF Z;  2DE0 X;  5A9G A;  4ZBM A;  3B8N A;  4AHC A;  1QVG U;  1R3J C;  3CRM A;  3AG7 A;  5FNV B;  4LF8 O;  3ZRW A;  4DV2 B;  1SC5 B;  3SPH A;  2P22 C;  2EZO A;  4UCR A;  5GON B;  4HZ3 A;  5L3C A;  4I7Z B;  3AG1 C;  3JAR B;  1KB9 F;  4H37 A;  3OMA B;  4JYC A;  3HKC B;  4DR3 B;  4J41 A;  2IH1 C;  3GVM A;  4QIW F;  3KKY A;  3CRA A;  1WP7 A;  4WF9 V;  4IIJ A;  4ABM A;  3JAL A;  1U97 A;  3APQ A;  1YEW A;  4X20 A;  3DTU B;  4DV2 O;  3ASN B;  1I0H A;  4DXW A;  3H1L H;  2Q6A A;  4GKJ B;  4O4H A;  4P9O A;  5IE9 A;  2YI8 A;  1P49 A;  2WWW A;  1H2G A;  2R70 A;  5LL6 Y;  3VOU A;  4DYL A;  4AQY B;  3WG7 B;  4WBN B;  2WA4 A;  3N27 A;  3ETG A;  4PA9 A;  4F6R B;  2DMX A;  1N34 O;  5L3D A;  2RCV A;  1VEW A;  4O4J B;  4IYI A;  1K9M W;  1GN3 A;  2DQ0 A;  4I55 A;  4WFE A;  1J5E O;  3STZ C;  3ZMZ A;  3UM7 A;  3KZI Z;  2Q7E A;  5JJJ B;  3CCE V;  1BQZ A;  2VRZ A;  5BR8 B;  3LSQ A;  4CZZ A;  3U11 A;  1N0N A;  3SGI A;  4PA4 A;  2YXH A;  3EHB B;  2UUB B;  3QG5 A;  2IJK A;  3DXR B;  4O4L A;  3RVY A;  1K97 A;  1X59 A;  4J7J A;  3CP1 A;  4AQY O;  2OWO A;  4TV9 A;  2Z3Y A;  3D3Q A;  4MSW C;  1Y74 B;  2QA4 V;  4DR5 B;  5GTH Z;  4LFA B;  3M99 B;  1K3E A;  2UXX A;  1XNQ B;  2Z0A A;  4EB6 B;  4ZOL A;  4JYA B;  5BR8 O;  5C93 A;  5FL7 G;  3N2G B;  3QO5 A;  4YY3 B;  2UUB O;  3QF7 A;  2EIJ C;  2CK3 G;  2UXC O;  1I5Y A;  3OW2 U;  4JV5 B;  1BHA A;  3OMN B;  1D5N A;  3L71 H;  1Y76 A;  2N04 A;  2P4K A;  3TCU A;  5CMU A;  2GUZ B;  3BAB A;  5EYP B;  1FS0 G;  1BGY H;  3BA8 A;  4QE7 A;  3X2Q B;  4FLW A;  4MW8 A;  2OYQ A;  1XNQ O;  1OCC C;  3N2K B;  1Q3E A;  4J9Y B;  2P6J A;  1QBZ A;  1XMO B;  1FFX A;  4JYA O;  1UJW B;  1BCC H;  4DW0 A;  2BSK A;  4FM1 A;  2Q73 A;  2XAS A;  4HBN A;  1XOU A;  4FFK A;  2X6B A;  1BE3 H;  2A79 B;  3OEE G;  3SYC A;  4PJ0 Z;  1SQG A;  5IJ0 A;  4ZHQ A;  5IY5 C;  5LMN B;  1FAF A;  4HAM A;  2VQF O;  4Z2W A;  4R6Z A;  3ZMS A;  1RPO A;  1XMO O;  3H01 A;  2ZT9 B;  1V55 B;  4G28 B;  2IH3 C;  5JQG A;  4JI2 O;  2ZE7 A;  4J11 A;  3HR0 A;  1Q6U A;  3A2F A;  2P5O A;  5B1O A;  1KP2 A;  1CEZ A;  3ZMU A;  4PV1 B;  1Y6X A;  2WLK A;  1KKD A;  3ETQ A;  2NR5 A;  5GW7 A;  1BT8 A;  1KEC A;  3L75 H;  3D3I A;  2FTK A;  3E86 A;  1VQ6 V;  4P30 A;  2JGD A;  1VF5 B;  2OTL V;  4OX9 B;  4H13 B;  1TAE A;  3NXS A;  3CWB H;  3SJA C;  3L9D A;  2CTW A;  4X1K A;  3K03 A;  2QWQ B;  2WLI A;  1Q86 W;  1MSD A;  2Q9L A;  4X1I A;  4RWU A;  1E1Q G;  4B3M B;  4RO2 A;  3C3S A;  1JQ0 A;  2RQ6 A;  4U3J A;  3UQ8 A;  2FL4 A;  1E1R G;  5D5Q A;  2JVD A;  5KA6 A;  1AR4 A;  4LF6 B;  1P4R A;  2ZR2 A;  4PHZ A;  4TV8 A;  4UCO A;  1KQS U;  1Z5V A;  4QJF B;  3CEI A;  3ZHU A;  1VP7 A;  1GN2 A;  3FB8 C;  2W0X A;  2LQT A;  2W6J G;  3G67 A;  3SPJ A;  1IXB A;  1EN4 A;  4MVQ A;  1N32 B;  1U96 A;  3BHP A;  1WB7 A;  2WA3 A;  4GKK O;  3ASN C;  3JD3 A;  3TXS A;  3DSQ A;  3TGU H;  1XDC A;  2V1D A;  2YIB D;  4U7O A;  1QR8 A;  5FNV A;  2GTA A;  2XHB A;  1SQX H;  1OCR C;  1OZ0 A;  5GON A;  4BIU A;  2ETN A;  3GWO A;  3WG7 C;  4MVS A;  2ZNI A;  3W7X A;  1MZE A;  3GWK C;  1DLB A;  4CH6 A;  2BOC C;  2JIZ G;  3CSX A;  3KCY A;  1YZB A;  5IDJ A;  2VWK A;  3CHX A;  4PDR A;  1JR9 A;  3T2M A;  1IXM A;  1SQB H;  4GT1 A;  3RYC B;  5K1X A;  2EIM C;  1VIB A;  2XTA A;  1P7G A;  3VBB A;  3IGA C;  4JZG A;  2A0L A;  5FLX N;  2WLN A;  1H8E G;  1Y66 A;  4QPJ A;  5EIB D;  2ZCE A;  3CCU V;  1SQV H;  2FYU H;  1YTF B;  5BMV B;  1R6K A;  4LWS B;  4CH3 A;  4LFC B;  1YHQ V;  4RQF A;  3ABL B;  3LUT B;  4DR6 B;  1AI4 A;  2Q0A A;  4IT5 A;  2IJH A;  1MZF A;  4JI4 B;  5LOV A;  3DXR A;  2YIA A;  1VQ9 V;  3X2Q C;  3WB1 A;  3CE2 A;  3ABM B;  4NVP A;  2F4V B;  2P7T C;  2F1M A;  2ADP A;  5CA3 A;  4JAV A;  2B1I A;  5JJN B;  5FPO A;  4EB6 A;  2LFS A;  3H1J H;  2P4V A;  3MDS A;  3S3X A;  5KHK A;  1YJN V;  4JI4 O;  4ZIB A;  1QU7 A;  3B77 A;  4UCV A;  2GUZ A;  4FZ1 A;  4GUN A;  3R65 A;  2F4V O;  2YDE A;  1GM9 A;  3K3W A;  2DW4 A;  3P3N A;  2ODM A;  2X7R B;  3QO8 A;  3N2K A;  3LNN A;  3G6B A;  1KC8 W;  3UT5 B;  3WU2 Z;  1NJI W;  4KHP B;  5KLV H;  4NTY A;  3E8F A;  5B1B B;  3RBZ A;  4PDV A;  1TUB B;  3LDE A;  2EIK B;  4MTX A;  3SJQ C;  1I5X A;  4IGG A;  1SQQ H;  1SET A;  2G38 A;  4GLX A;  1Y67 A;  2CUG A;  3CJH A;  3S3W A;  4KHP O;  1ENV A;  2WLL B;  3WFV A;  4LC1 A;  4UUJ C;  1NU1 H;  2HLD G;  3K5M A;  1R73 A;  1IUR A;  2EJ7 A;  3HKB B;  4U7N A;  5KHH A;  3OM3 B;  1MMM A;  2Q8V A;  1WNS A;  5E1A C;  3AG2 B;  5KMG B;  3NR7 A;  3SPG A;  2GTS A;  3BAA A;  3FD9 A;  4DRX B;  3FAV B;  4UB6 Z;  1DF5 A;  1NBM G;  3JSN A;  1NI8 A;  2EX3 A;  1MA1 A;  1O9H A;  1GK9 A;  1EN6 A;  4FJC C;  4P2Z A;  2YXY A;  4JI0 B;  4O2B B;  1XQ8 A;  1QQC A;  2H3O A;  2QWR B;  1EBO A;  4ASU G;  1SZT A;  5CA1 A;  4F6E A;  1O9G A;  1GKF A;  3A0B Z;  4JYB A;  5ITZ B;  4JI8 B;  3E8B A;  4A5U B;  5CA0 B;  1A32 A;  1AI5 A;  4P9P A;  2LGQ A;  1ARO P;  4I50 A;  3OE7 G;  4JI0 O;  4MVR A;  5LP6 B;  4K8X A;  1NH2 D;  5DN6 G;  2QJ1 A;  3CCQ V;  2YXL A;  1W0J G;  3LDD A;  1KU9 A;  1NVP B;  1AB3 A;  2B1G A;  3AG4 B;  3H9V A;  1Q5O A;  4GX1 A;  2GDS A;  4I0X A;  1VQM V;  4JI8 O;  2UU9 B;  1GN6 A;  4DO2 A;  3T1H O;  1BHB A;  3W7T A;  1Q81 W;  3JYC A;  2P90 A;  4LF5 O;  2QTS A;  4WFF A;  1BQ0 A;  2H8P C;  3K0D A;  1H2N A;  2QM4 A;  1S76 D;  3O65 A;  4MTG A;  1B04 A;  3QVN A;  3BRC A;  1NTM H;  1XEQ A;  1EZJ A;  1HWY A;  2L6L A;  2QWP B;  3IC9 A;  2YEV A;  2N05 A;  3JD1 A;  3G71 V;  4TQF A;  1COW G;  3A0R A;  3W7W A;  1GM8 A;  4FM0 A;  3RYI B;  2WLM A;  1YIJ V;  3JAT B;  5J2T A;  3HKE B;  3G4S V;  5B1A C;  3ABM C;  1N33 B;  4LFB B;  3TET A;  3T4Z A;  2JS5 A;  5CBH A;  1N36 B;  4GCZ A;  1YTF D;  5LGN A;  4DV0 B;  3ZBH A;  5IT9 N;  4FIP C;  3JAM N;  2JGU A;  1IZ3 A;  1L1F A;  2OCC C;  4B7E A;  4FLX A;  2R9R B;  1NQT A;  2ZM6 B;  3MHH C;  4WFB V;  1N33 O;  1SS3 A;  2XAH A;  3LNM B;  2R9A A;  4DR3 O;  1N36 O;  3A0H Z;  3KCX A;  4DV0 O;  3JD0 A;  1XNR B;  5CB4 B;  2E5L B;  4B3R B;  2QM7 A;  4DW1 A;  1AJN A;  5B1B C;  3ZRV A;  2ZM6 O;  4JZ2 A;  4GKJ O;  4YIP A;  4KFM A;  2EIK C;  1WP8 A;  3ZN0 A;  2Y69 B;  2QEX V;  1K4C C;  3SPC A;  1ZTE A;  2EUL A;  4K35 A;  5LXT B;  1TUE B;  4X66 B;  1XNR O;  5FPR A;  4DR4 B;  2ZD9 A;  4JYY A;  5J2U B;  1WA8 A;  1YVW A;  2E5L O;  1HNW B;  4B3S B;  1RFY A;  4B3R O;  4KXR A;  4NXN B;  4MVO A;  4Q6G A;  4QGP A;  3UT5 A;  4X1Y B;  1ZLZ A;  2A3Q A;  2ARH A;  1QVF U;  3K57 A;  1XRE A;  1SA0 B;  4UB8 Z;  4I4T A;  4GX2 A;  1BZK A;  3G6E V;  3JAW B;  3AG2 C;  4H44 B;  3EXA A;  4X88 A;  1G1X B;  2DYS B;  4X66 O;  2WSS G;  1FXV A;  4DR5 O;  3AK1 A;  1GAX A;  4FM2 A;  4DR4 O;  4LFA O;  2WLJ A;  2L35 A;  1HNZ B;  3CCV V;  3O9O A;  5IJ9 A;  1HNW O;  1M57 B;  4B3S O;  4JF3 A;  1M90 W;  4YJ2 A;  5GTI Z;  1K8A W;  3J7A U;  3P30 A;  1AJP A;  3ZCC A;  1TVK B;  2ZXW B;  2R9I A;  3STL C;  4YY3 O;  4RUE A;  4MVZ A;  4CH4 A;  1OCO C;  5K1P A;  4O4I B;  1AR5 A;  4JV5 O;  4JTC B;  1VQK V;  2CTR A;  3HKB A;  1DTO A;  4ZI7 B;  2ZE5 A;  1HNZ O;  4JGS A;  1AR1 B;  5KX5 A;  3QTC A;  1AI7 A;  5KMG A;  1OJH A;  4UXN A;  3Q4H B;  3E22 B;  1D2D A;  3CC4 V;  3RYH B;  3E8G A;  4DR1 B;  2YI9 A;  1EN5 A;  2EIL B;  3VQV A;  1JFF A;  2Q69 A;  3CX5 F;  1IX9 A;  2PI5 A;  4MTO A;  1H2S B;  4O2B A;  4TOI A;  4PEL A;  2XT9 A;  3VQW A;  3BVO A;  1F4M A;  4NYK A;  2CH7 B;  3T4D A;  2OT5 A;  5H5N A;  1I7F A;  4LF7 B;  3B8M A;  5IYZ A;  5LMN O;  1JJO A;  3ICX A;  1P7B A;  4LNU B;  4W4K A;  1NTZ H;  2D2C B;  2AHZ A;  5ITZ A;  3U0Z A;  2NLJ C;  3BY6 A;  1GN4 A;  2QKC A;  2ZE8 A;  3VQX A;  4DR1 O;  1LR1 A;  5CA0 A;  1EZV H;  4GX0 A;  5H6Q A;  1K5Q A;  3L70 H;  4MVM A;  1PNL A;  3ZHR A;  3I55 V;  3CC2 V;  3CCL V;  1NVP D;  2IBZ H;  1JA8 A;  4X89 A;  4DR2 B;  2ZQM A;  3K5O A;  1NZ6 A;  1W2B U;  2Q5Z A;  2A7W A;  4LH6 A;  3RVZ A;  1H8H G;  1MNG A;  4FFB A;  5JH7 B;  3UCS C;  4BW5 A;  4PD4 F;  5KA5 A;  1TGO A;  3JD4 A;  2CDY A;  3QNE A;  3AG3 B;  4KUM A;  2JEX A;  3OTF A;  5LYJ A;  4OX9 O;  2YIC A;  2Y4U A;  2IM9 A;  3W7U A;  3OGC C;  5JCO C;  1VQP V;  2OTJ V;  1WJZ A;  2XAQ A;  1H2M A;  1R3L C;  4GX5 A;  4B3M O; 
#chains in the Genus database with same CATH homology
 1NH2 B;  3OR6 C;  5LHG A;  3K3W A;  2DW4 A;  1K34 A;  1KP3 A;  5L3E A;  5LGT A;  5B1N A;  2X7R B;  3ABK C;  1CP9 A;  5LHI A;  3QO8 A;  4G27 B;  1Q82 W;  5KUK A;  1YJW V;  3FB7 C;  4RAI A;  4JAS A;  1KC8 W;  1F51 A;  4QPK A;  2ZDI A;  3ETE A;  1MOF A;  2Z5U A;  1NJI W;  2HVK C;  3K08 A;  3JCZ A;  3E8F A;  5B1B B;  3RBZ A;  2WLL A;  1M9N A;  4PDV A;  3HB3 B;  1SES A;  4XDL A;  1E79 G;  3LDE A;  2EIK B;  4MTX A;  1R3I C;  4UVA A;  3SJQ C;  3AEI A;  1K5S A;  1V54 C;  3I56 V;  2QTO A;  1I5X A;  5LHH A;  3CXC U;  1NR1 A;  3CYO A;  4FMT A;  4ZBM A;  3FB5 C;  3B8N A;  4OXS A;  1QVG U;  4J9Z B;  1JOY A;  1R3J C;  1SET A;  2X6C A;  5EBL C;  1WLE A;  4KP4 A;  3SYP A;  3ZRW A;  2WPD G;  4YXW G;  3SPH A;  2EZO A;  1R3K C;  1ENV A;  1R6N A;  4QE9 A;  4HZ3 A;  2WLL B;  1F23 A;  3FYE B;  3SYO A;  3WFV A;  4LC1 A;  5L3C A;  4UUJ C;  3AG1 C;  5HFM A;  2HLD G;  3OMI B;  1R73 A;  4H37 A;  2IJJ A;  3OMA B;  4JYC A;  3ASO B;  1K4D C;  4U7N A;  5EC2 C;  2A9H A;  4WFH A;  1YI2 V;  4R8C A;  3FB6 C;  3OM3 B;  2IH1 C;  4QIW F;  5E1A C;  3JD2 A;  3AG4 C;  3AG2 B;  1XL6 A;  4WF9 V;  2ATK C;  3SPG A;  5B3S B;  3ZRW B;  3SYQ A;  2IU0 A;  1M56 C;  3SYA A;  3DTU B;  1JCH A;  3ASN B;  1PNM A;  4DXW A;  1DF5 A;  4N21 A;  3W7S A;  1NBM G;  2Q6A A;  4I5S A;  2IU3 A;  4PA6 A;  4P9O A;  3IC7 A;  5BZB A;  2PI4 A;  1GK9 A;  4FJC C;  4P2Z A;  1W0K G;  2WWW A;  1H2G A;  1VQN V;  1PL0 A;  3OAA G;  3VOU A;  3UKM A;  3ZJZ A;  2MK3 A;  2DYR C;  3WG7 B;  1VQ8 V;  2F43 G;  2JDI G;  1EBO A;  4UVC A;  4ASU G;  1SZT A;  3ETG A;  4PA9 A;  1GKF A;  5L3D A;  1JJ2 U;  3ZIA G;  2ITC C;  2AHY A;  4LCU C;  3K0G A;  1EFR G;  1K9M W;  2DQ0 A;  4JYB A;  2ZXW C;  4WFE A;  3ZN1 A;  3STZ C;  3ZMZ A;  3E8B A;  3UM7 A;  5LBQ A;  2EIN C;  2LFR A;  5EBW C;  3CCE V;  1NKD A;  3LSQ A;  4CZZ A;  5H9C A;  1AI5 A;  4P9P A;  3QO7 A;  1ARO P;  4PA4 A;  3OE7 G;  3EHB B;  2IJK A;  1QLE B;  4MVR A;  2NNU A;  3AG1 B;  3RVY A;  1NH2 D;  5DN6 G;  1K97 A;  3F7V C;  1QCE A;  3CCQ V;  3CP1 A;  2Z3Y A;  3KG2 A;  1DF4 A;  4MSW C;  2QA4 V;  4CBC A;  1K92 A;  1W0J G;  3LDD A;  3P32 A;  1NVP B;  3M99 B;  3CCS V;  3F7Y C;  1K3E A;  3IFX A;  2B1G A;  3AG4 B;  2BOB C;  2UXX A;  3HPL C;  4GX1 A;  1V55 C;  1QLN A;  1VQM V;  4R50 A;  2C2A A;  2QE7 G;  4DO2 A;  5C93 A;  5FL7 G;  1BHB A;  3W7T A;  3QO5 A;  3JYC A;  1Q81 W;  2DWE C;  2P90 A;  2EIJ C;  4WFF A;  2D3O W;  2CK3 G;  5EC1 C;  1I5Y A;  2H8P C;  3OW2 U;  1BHA A;  3K0D A;  3OMN B;  5EBM C;  3TCU A;  4JTA B;  5EK0 A;  1S76 D;  5CMU A;  1YJ9 V;  4L87 A;  4Z1M G;  1YIT V;  4MTG A;  1FS0 G;  5IYC O;  2W0F C;  4QNH B;  4QE7 A;  3X2Q B;  1QR9 A;  4MW8 A;  1EZJ A;  1HWY A;  2YEV A;  1OCC C;  3JD1 A;  1BMF G;  4J9Y B;  3RW0 A;  2P6J A;  1QBZ A;  1ZWI C;  3G71 V;  1K33 A;  1COW G;  1UJW B;  3A0R A;  3W7W A;  2YSU B;  2LP7 A;  1S0V A;  1GM8 A;  1Q7Y W;  2WLM A;  2Q67 A;  1YIJ V;  2XAS A;  2Y69 C;  1GMG A;  2X6B A;  3G4S V;  2A79 B;  3ABM C;  5B1A C;  3OEE G;  3SYC A;  3TET A;  1KD1 W;  3T4Z A;  1OCZ B;  5CBH A;  3TK1 A;  4XBF A;  5IY5 C;  4GCZ A;  1JX9 A;  2YEV B;  4Q20 A;  1YTF D;  3ZMT A;  5LGN A;  5L3B A;  2HKO A;  4PA3 A;  4XDJ A;  4HAM A;  3T1C A;  1VQL V;  1Y4M A;  2HVJ C;  4FIP C;  4R6Z A;  5CBF A;  3ZMS A;  2XAF A;  1CPY A;  1PNK A;  1RPO A;  3MHS C;  3H01 A;  4MT8 A;  1FXK C;  4FK5 C;  1L1F A;  3CCJ V;  1V55 B;  2OCC C;  4G28 B;  3ABK B;  1MG1 A;  2H94 A;  2IH3 C;  2R9R B;  1NQT A;  2HR3 A;  4N23 A;  4RUF A;  2K1E A;  3MHH C;  4G2K A;  4PA7 A;  4WFB V;  1K73 W;  1JPX A;  5B1O A;  1KP2 A;  2XAH A;  3LNM B;  2HJF C;  3ZMU A;  1RM1 C;  1G8M A;  2DYS C;  1S77 D;  1CEZ A;  1WPX A;  2WLK A;  4ZKI A;  1KKD A;  4RQE A;  3JD0 A;  1GTO A;  1M57 C;  2DQ3 A;  2X6A A;  1YSC A;  5GW7 A;  2V7Q G;  1V54 B;  5L3F A;  1KEC A;  3CC7 V;  3D3I A;  2FTK A;  3E86 A;  1VQ6 V;  4P30 A;  4UV9 A;  2QM7 A;  5CN0 A;  1B6Q A;  2OTL V;  1AJN A;  5B1B C;  3ZRV A;  1FXK A;  2GSM B;  4KFM A;  2EIK C;  3NXS A;  1FXH A;  3ZN0 A;  2Y69 B;  3K03 A;  2XND G;  4MTF A;  2QEX V;  1SER A;  1K4C C;  2B5U A;  2EZP A;  3GB7 C;  5B1A B;  3SPC A;  2WLI A;  1Q86 W;  1THZ A;  1E1Q G;  5H6R A;  4RO2 A;  3ABT A;  1JQ0 A;  1TUE B;  2WLH A;  1JVM A;  2UXN A;  5IY5 B;  1J95 A;  2XAJ A;  2ZD9 A;  3FKS G;  1E1R G;  1VQO V;  5KA6 A;  1S72 V;  2IJI A;  3BEH A;  1P4R A;  2ZR2 A;  4BAY A;  4MVO A;  2JK5 C;  1M56 B;  3ABU A;  2EIL C;  2OCC B;  5IYD O;  1KQS U;  4H33 A;  4QJF B;  1QVF U;  5LGU A;  3ASO C;  3F5W C;  3FB8 C;  4GX2 A;  2W6J G;  3SPJ A;  3G6E V;  2WLI B;  2EJR A;  2DWD C;  3E83 A;  4MVQ A;  3AG2 C;  5CBG A;  1AI6 A;  4X88 A;  4WFA V;  5B3S C;  2DYS B;  4I9W A;  2WSS G;  1FXV A;  2HG5 C;  2JJ2 G;  3OEH G;  3OR7 C;  2DYR B;  2JJ1 G;  2WLJ A;  3CCV V;  5HFL A;  5IYB O;  3ASN C;  3JD3 A;  4MW3 A;  1MSW D;  1M57 B;  1ROP A;  2XOK G;  1VQ5 V;  2V1D A;  4FPP A;  4JF3 A;  3ZMV A;  4U7O A;  1M90 W;  1QR8 A;  1RPR A;  2M7W A;  1K8A W;  3ABL C;  1OCR C;  3P30 A;  1AJP A;  1OZ0 A;  3ZCC A;  4E2L A;  2HFE C;  1BL8 A;  2ZXW B;  2X0L A;  3K9A A;  2R9I A;  4MVU A;  1OHH G;  3STL C;  1N8R W;  4BIU A;  2GHY A;  2EIN B;  4RUE A;  3LDC A;  3GWO A;  1FFT B;  4MVZ A;  3WG7 C;  1OCO C;  3ZRX A;  4JTC B;  1VQK V;  4TWK A;  3EFF K;  4MVS A;  3K79 A;  5KUM A;  3W7X A;  4PDL A;  4PDM A;  3CCR V;  1DLB A;  1DTO A;  2BOC C;  2JIZ G;  3OUF A;  4JGS A;  3E89 A;  1AR1 B;  2EBO A;  1AI7 A;  3CME V;  5IDJ A;  4PDR A;  4UXN A;  4LBE C;  3CCM V;  3T2M A;  1IXM A;  4GT1 A;  3CC4 V;  3PJS K;  3ZRS A;  2EIM C;  1QLE C;  1XL4 A;  3E8G A;  3AG3 C;  3CD6 V;  2EIL B;  2Q69 A;  3OFN G;  1M1K W;  4EKW A;  2Q68 A;  5J9P C;  2PI5 A;  2Y48 A;  4MTO A;  2QKS A;  3VBB A;  1VQ7 V;  4UVB A;  2EIJ B;  4PEL A;  1F4M A;  3IGA C;  2A0L A;  3T4D A;  4UV8 A;  1F4N A;  2OT5 A;  2IW5 A;  2WLN A;  3K06 A;  3E2E A;  1H8E G;  1Y66 A;  1PKX A;  3E8H A;  4QPJ A;  3B8M A;  4F4L A;  3CCU V;  2ITD C;  4JPR A;  1YTF B;  4R7C A;  1P7B A;  1R6K A;  2AHZ A;  3D36 A;  1OCC B;  2NLJ C;  3BY6 A;  3MD0 A;  4HYO A;  1YHQ V;  2W6I G;  4RQF A;  3ABL B;  3LUT B;  3DGE A;  1OCR B;  2KB1 A;  1AI4 A;  4GX0 A;  1VQ4 V;  5H6Q A;  1K5Q A;  2IJH A;  4WCE V;  4MVM A;  1PNL A;  3I55 V;  3CC2 V;  3CCL V;  1NVP D;  1OCO B;  3CMA V;  1VQ9 V;  1GM7 A;  3E35 A;  1AJQ A;  2P67 A;  4X89 A;  4JTD B;  2ZR3 A;  1GO3 F;  2JEU A;  3X2Q C;  2ZQM A;  3ABM B;  4X8A A;  1W2B U;  1S5H C;  4MS2 A;  2P7T C;  3RVZ A;  1H8H G;  5CA3 A;  3OUS A;  4BIZ A;  2ZDI C;  4JAV A;  1G4Y B;  2B1I A;  4BW5 A;  3CPW U;  1LNQ A;  4WFG A;  3ETD A;  1SRY A;  1ORQ C;  5L3G A;  3FYI B;  4XDK A;  2LFS A;  1K7D A;  5KA5 A;  1H38 A;  3JD4 A;  4JAU A;  1FXK B;  2EIM B;  3ML0 A;  4TSF G;  2WAM A;  3QNE A;  3AG3 B;  4KUM A;  2JEX A;  3LSS A;  1PD3 A;  1YJN V;  2QM8 A;  1NR7 A;  2XAG A;  1OCZ C;  3W7U A;  3OGC C;  1VQP V;  3B77 A;  3K04 A;  4LP8 A;  2OTJ V;  4TT3 G;  1S3J A;  5DM6 V;  2XAQ A;  3R65 A;  1R3L C;  4GX5 A;  3SPI A;  1MAB G;  1RM1 B;  1GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...