1HNWO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnwO00
4LF4O 2ZKOA 4JI0O 2UU9O 2UUCO 2DJVA 2UXDO 3F5TA 1X59A 3SDLA 4OPAA 4B3TO 4DR6O 4B3RO 1G1XB 4LFAO 2FKXA 1F7YA 4DV2O 2DOSA 4LFCO 1J5EO 3RT3C 4X64O 4LF9O 4DR1O 4JI3O 4X65O 1R1BA 2ZM6O 4DR2O 3T1HO 4JI6O 2VQFO 1HNWO 4GKKO 4DUZO 4JI5O 3JAMN 4OPHA 1KUQA 3T1YO 4JI4O 4YHHO 1XNQO 1HR0O 4K0KO 4OX9O 4X62O 1N34O 1NS1A 2HHHO 1IBMO 4GKJO 5BY1A 4YY3O 1HNXO 4JI2O 4A5UB 4DR4O 4NXMO 5IT9N 1DK1A 2LW7A 3J81N 1XMOO 4LF6O 1N36O 2AGAA 2F4VO 2UXBO 4JI1O 5BR8O 3J7AU 1XMQO 4JV5O 1D2DA 4JYAO 3O65A 5H5NA 1A32A 5LMUO 4B3MO 1YZBA 5A2QN 2JRIA 2VQEO 4LF5O 1IBKO 1XEQA 4X66O 4KHPO 1FYJA 4DR7O 1N32O 4DV1O 1XNRO 4JI8O 2Z0AA 4DV6O 2UUBO 1FKAO 5IWAO 4DR5O 4DV4O 4LFBO 5FLXN 4AQYO 1I94O 5LL6Y 4LF8O 4B3SO 2N74A 3M8AA 4JI7O 1AB3A 3OTOO 4DV3O 4DV7O 4DR3O 4DV5O 1IBLO 1N33O 4NXNO 3J80N 4DV0O 2UXCO 1HNZO 5LMNO 4DUYO 5BXZA 2E5LO 1FJGO 2UUAO 1AILA 3R66A 1R6TA 4LF7O
chains in the Genus database with same CATH superfamily
4UV9A 3B4SA 2ZKOA 1IBKB 2DYRC 4UV8A 4UB6Z 5H6QA 1SQGA 3K58A 4K8ZA 3TETA 5C93A 4IHJB 1J5EO 1GN2A 1BQZA 5D5PA 2HKOA 4JI3O 1TVKA 1G4YB 2JGUA 1UJWB 2P6JA 2Q5ZA 3FYIB 1AJPA 1ZX3A 4JYCA 3DC5A 4AQYB 1FS0G 3CRRA 4JYYA 3M7MX 2JJ1G 5LMUB 1KU9A 4OX9O 2V7QG 3CMEV 1P7GA 1QLNA 2Q7HA 4LH7A 3OMNB 5IDJA 4N21A 4NXMO 1EM1A 1KC8W 3Q4HA 2F43G 1Z2GA 2WLLB 1YCIA 1J95A 4DV6B 2A3QA 1RPOA 3UO2A 1T5EA 3ZMSA 5KA5A 1AROP 2EJRA 2RQ6A 2ZE6A 1ZTEA 3RYCA 3WB1A 3L9DA 5IYZA 2EIKB 3W7XA 3QVNA 1SETA 3L72H 3CP1A 2LGWA 1S76D 4H13B 3ZN1A 1JA8A 1YJ9V 2YI8A 2Q73A 1FYJA 1YTFB 1XNRO 2BTOA 5JJNB 1JMKC 1WB8A 2Q68A 2PZSA 2EILC 4CS3A 5IWAO 5JH7A 4LFBO 1XL6A 4IL6Z 4JYBA 1GRJA 4HBNA 4GX1A 2ITCC 1GH6A 1GTOA 3TJTA 5L3CA 1EFRG 1Q6IA 3JALB 4ZOLA 3X2QC 4NXNO 4X65B 1LR1A 2EINB 4RQEA 4G27B 1PP9H 3I56V 5BXZA 4K8XA 5J2UB 2HHHB 5IY5C 4G2KA 3F5TA 3VBBA 2WAMA 1TUEB 1N36B 1VQKV 2R72A 4LFCO 2ZXWC 4LF9O 4FM2A 1DF5A 1PNMA 4MT8A 2UXBB 2EX3A 4N23A 4DR2O 4K35A 2B1GA 3E8GA 5LXTA 3U11A 3H1JH 2WWWA 3OMIB 3W7TA 3E83A 5B1BB 3W7SA 3ETDA 1KKDA 2BTQB 2QJ1A 3L73H 3MDSA 4FFKA 4O4IA 5DEDA 4XBFA 1EN4A 3LNMB 1XMQO 4DR5B 2QR4A 1X4TA 3O65A 2YUAA 5JJEB 4B3SB 4GLXA 2CE4A 3RWRD 3LDDA 3JD2A 3H9VA 3K5MA 1BGYH 4BIUA 4X66O 4DR7O 1I7FA 4Z1VA 4J7ZA 1P49A 3SR2C 5KHKA 4CS4A 3GB7C 1JOYA 3IGAC 2Z0AA 3CRMA 2OTJV 4P2ZA 4XDKA 1SRYA 2B9ZA 4EEQA 1FD9A 4PDMA 3CB2A 1GM8A 2GBOA 3E8HA 1SQFA 1TUBA 5FLXN 4R7CA 4HNAA 3OMAB 4NKGB 3BCCH 1BZKA 2ZIOA 3UQ8A 2F4VB 1N33O 4GYCB 2FTKA 3J80N 2AZ0A 4TUYB 4ASUG 3FB7C 3N2GA 4MVZA 1RM1B 3TXQA 1FPOA 1VF6C 1Q6UA 1FFXB 3T1YB 3K5NA 4TSFG 1SQBH 3CCJV 4B7KA 5JWPA 4QNHB 4YY3B 3AG1C 3AK2A 2UXDO 1M57C 4LF6B 3B8NA 2A79B 3GWKC 4F6RA 2EIMC 3T1HO 2VQFO 2VRZA 2NR5A 3JAMN 4OPHA 1KQSU 1K92A 4UCOA 2AHZA 4X62O 1NS1A 2LO1A 3JATA 2GUZA 1XBLA 3N27A 2Q9LA 3OAAG 2Z5UA 2AGAA 3JAWB 3O9OA 3KKYA 5KHJA 4FFBB 3RYFB 1JR9A 4QIWF 5KHGA 4LR3A 1KBHA 3E22A 4DV4B 4I0XB 1Y76A 4FVMA 3TXSA 3ZRWA 3CPWU 3CEIA 3NXSA 2BOBC 2ZR2A 4B3RB 4DXWA 1AP6A 3K06A 2ZNJA 5GW7A 4PJ0Z 1ZL8A 2DN9A 3AG4B 2KKWA 1NH2B 4NR1A 4LNUB 1IX9A 2OT5A 4RO2A 3CCMV 2P22C 4KP4A 4JI5B 3K59A 1TVKB 4UCSA 2HG5C 4WFFA 3LDCA 2LJ2A 4DW0A 3ZRSA 1NKDA 1AR5A 1I94O 4B3TB 2ETNA 2YEVB 5JVDB 4BAYA 2X0LA 5LYJB 4DV7O 4X1KB 4Q6GA 3DC6A 4DV0O 3ABKB 1Q86W 3DXRA 1OCOC 3ZHSA 4DUYO 5C8YB 4J10A 4WFEA 3ML0A 2Y69C 3LDEA 4X8AA 2JEXA 4YJ2A 3C90A 1H2GA 3RYIA 3VOUA 3KCYA 4IYIA 5DM6V 5LHHA 5CB4B 1Y74A 4CC5A 3ZRXA 1M9NA 5LP6B 1S0VA 4JV5B 4UXNA 5EK0A 4GKKO 2QWOB 3THOA 2WLKA 1GAXA 1WA8A 1K34A 5JH7B 2X6CA 3HB3B 2IBZH 4JAAA 3E35A 2JIZG 5IYCO 3OR6C 4TQDA 1SC5B 2LW7A 1VEWA 4DK1A 4PA9A 4GX2A 4CH5A 5HFLA 2WLHA 4MS2A 5LHGA 5LA6A 4UVCA 2YIBA 2JGDA 3HKBB 4I9QA 3JASA 2W6JG 4H37A 4YJ3A 4B3MO 4FM1A 2X6AA 3JCZA 1XEQA 2G38A 4JI6B 1R3LC 4FZ1A 2YXYA 4TV8A 2QM7A 1G6UA 1FJGB 4YHHB 3PN1A 1CP9A 2UXNA 1QVGU 4TOIA 5LXTB 4JI0B 3JARB 4ABMA 1EN5A 3WU2Z 4R8CA 2P7TC 2PYLA 2YS8A 4DR4B 4LFAB 3CE2A 3ABLC 1I5YA 5GTIZ 4DR1B 3ZCCA 2EBOA 3K3WA 3ZJZA 3BVOA 1YDXA 3D8CA 4Z1MG 2CTRA 4GX5A 1BS3A 3OT7A 4EFEA 1DF4A 2ZIMA 1S72V 4UVAA 3T4ZA 4LF4O 3MAQA 1GMGA 1HNXB 1EZJA 1PV0A 1IZ3A 4PA7A 4DYLA 1Q6HA 1XMOB 4X64O 1HP8A 1R6KA 3STZC 5F2VO 3RW0A 1K4DC 3K5LA 2CDYA 5EYPA 1O9GA 2VS0A 1N4CA 3FB5C 4D6TH 1RFYA 4LF8B 2WSSG 3N2KB 2Q67A 4QGPA 1IBMO 1N0JA 2PGGA 2K9PA 2RNBA 4PA3A 3W7WA 2OTLV 3RYHA 1N32B 1DK1A 3SYCA 3ZHVA 1B3QA 1BSMA 1DGSA 1OCZC 5AG2A 3VQWA 3KZIZ 3J7AU 1M56C 1XOUA 4UB8Z 2Q0OC 4D7SA 2UU9B 5EBWC 4PHZA 5H5NA 5CBGA 2FL4A 3IC9A 1M4UA 4DV3B 2OIGA 2IH1C 4QE7A 4O4LA 2QEXV 1K33A 5KX5B 3SYOA 3JD4A 5EIBD 2PY5A 4F6RB 4P9OA 2X7RB 2E5LB 1Q82W 2UUAB 2CUGA 3K0GA 4RUEA 2N04A 4LF7B 1FKAO 5KLVH 4YXWG 2ITDC 5TISZ 2IJIA 3AG7A 4X20A 1ENVA 1OCCC 4FJCC 3VQXA 1Y4MA 2IU3A 4IIJA 2R9IA 5LMNO 1JFFB 1F23A 2EILB 4JI4B 3AG3C 1K5SA 2WPDG 5EC1C 4LF5B 1YTFD 4KHPB 4DR6O 3ZS8C 1AP5A 1ZL8B 3L75H 3X2QB 5KMGA 4DV2O 2P90A 3BRCA 5CA0B 4TWKA 2PTMA 2UUBB 2B5UA 4F4LA 4B08A 5LOVA 3F7VC 2AZ2A 2WLNA 1H8EG 5IY5B 3JAKA 5FPOA 4FLYA 1OCRC 4F6EA 1OZ0A 1EBOA 1SESA 4RWUA 1B6QA 1TAEA 2EJ7A 4JI2O 2IH3C 1SERA 4AHCA 2ZXWB 2RDCA 3HKDB 3JSLA 3OGCC 2HJFC 5JQGA 2CH7B 4UVBA 4O2BB 3EVKA 4U3FH 1QU7A 5CBHA 4MVUA 2JJ2G 3MD0A 4YJ2B 5IJ0B 3RYIB 5LMUO 3H01A 4WFHA 4J80A 1Q81W 1PL4A 2Y0IA 2A06H 4GX0A 5EZYB 1J5EB 4J11A 4KFMA 5L3EA 3WG7B 1XQ8A 2FYUH 1YJWV 2QM8A 4GZRB 3R65A 4BW9A 1JQ0A 4DV6O 5FPRA 5L3GA 4OX9B 4MW3A 3HR0A 5BZBA 1VF5B 2AXTZ 1SQXH 5FNVA 2N74A 2BSKB 1AI7A 1I5XA 4D7TA 1G8MA 5K1XA 1NBMG 2ZQMA 1S5LZ 3E8FA 4DUZB 3JCUZ 3S3WA 2ZNIA 5LGUA 4AI8A 3APOA 2Q69A 5LA6B 4DRXA 3H1KH 1VQOV 4RUFA 3QO7A 3CCLV 2W0FC 3E2EA 3CCUV 3ABMC 4I4TB 5E1AC 2OCCC 2WLIA 1XNRB 3ZMUA 1QHTA 2DQ3A 1FXKB 4X65O 3CCQV 4TV8B 5IWAB 3G4SV 4LFBB 2CTQA 2H8PC 4PV1B 1NR1A 1Q3EA 1ZUQA 2JEUA 3PJSK 3L74H 5JCOA 3AG1B 3ZRVA 1M57B 2L6LA 2HHHO 1K97A 1Y67A 2WA3A 3SYQA 4UCUA 1SQPH 2YICA 5KAFZ 4WFAV 3A2FA 1N36O 4JI8B 2EIMB 2UXBO 3CXHF 2IJHA 4CH4A 2ZCEA 1BCCH 1H2SB 4JYAO 3CJHB 2IU0A 3ZHTA 4JI7B 3FB6C 2LQTA 3UT5A 3FAVA 4TQFA 1H38A 3ASNC 1LUWA 4DR2B 2F1MA 3SPJA 1EZVH 1I0HA 5L3FA 2R9RB 4JPRA 1K5QA 1VIBA 1WB7A 4DR5O 5J2TA 4NYKA 4O4JA 2VWKA 4B3SO 3T4DA 3ABTA 4QE9A 1YF2A 2MW2B 1AB3A 3LSSA 5EBLC 1E79G 4K3AA 3WFVA 1V54C 2P4KA 2WA4A 2XAFA 1KKCA 5LHIA 1VQ8V 3G71V 4LWSA 1XMQB 5IJ9B 2Y48A 4I50B 2A9HA 4TV9B 4K0KB 3CRQA 4X1YA 2EIKC 4IT5A 4GCZA 1VQMV 5CA1A 4J42A 1NH2D 1K8AW 4I55B 2PUSA 4WBNB 4OPAA 3G6BA 3HKCA 1K9MW 4ZHQA 3I55V 4PI2A 3QO5A 2QWQB 3HKEA 2RJZA 4KL1A 2DWEC 3G6EV 2YC0A 1H2NA 1AVMA 2Y69B 2ATKC 4O2AA 3T1YO 3IC7A 3SJQC 4O4HA 1N34O 3D36A 4WFGA 1H2MA 1YIJV 1UPGA 1AJQA 4YY3O 4R50A 5KAIZ 2XAGA 3RN4A 1GO3F 1YSCA 3CS5A 1YEWA 4LF6O 4EB6A 5BMVB 2JVDA 1W0KG 1D2DA 4FMTA 2E75B 4U3JB 4UCTA 3ICXA 2Y0PA 4J41A 2XTAA 3OTOB 2GTSA 3H1IH 3SYAA 2DW4A 1DLBA 2LGQA 5GONA 1VP7A 3K9AA 1R73A 4RAIA 4XDJA 4ZKIA 4DV4O 4PELA 3CRCA 3KG2A 2Q7EA 2QA4V 3W7UA 2PYJA 3CD6V 1YJNV 1KD1W 1V55C 4CBCA 3BABA 1W59A 1AILA 3CWBH 5E79Z 4UCVA 1SKVA 3CCSV 2ZDIC 1RSOA 1THZA 2IW5A 1QR8A 2C2AA 3F7YC 1KYOF 3SDLA 3ABLB 4B3TO 3L71H 3SJCC 1Q7YW 2A7WA 4PDRA 3STLC 1IDSA 3Q4HB 5KA6A 3JSNA 1HNWO 4QPJA 2QKAA 5FL7G 3RYCB 4W4LA 2N05A 1URFA 5EBMC 5IYZB 2VQEB 4J9YB 4MTXA 4ZBMA 2CGNA 2YIAA 4IHJA 2Y4TA 1MMMA 4L8JA 3A0BZ 2HLDG 1HWYA 4Q20A 2Q7GA 4CH3A 2JDIG 1U97A 1PNKA 4JV5O 5B3SC 1NI8A 4CH6A 1ZWIC 5CA3A 4IGGA 4NVPA 3L70H 1AJNA 2X6BA 1COWG 1EN6A 3P3PA 3K57A 3DSQA 2WLIB 2UXCB 2WLLA 3B8MA 2RN9A 1YI2V 4EKWA 1HNZB 4ZOLB 1L0NH 4DV1O 2Q8VA 4FZ0A 4GKKB 1M56B 5IE9A 2JS3A 4B7EA 5B1AB 2DWDC 3K08A 1MSWD 1KP3A 3FD9A 4J7KA 3FFQA 1LUVA 3BPZA 4I9WA 4MW8A 3CYOA 1GN6A 3EXAA 4FLUA 3ETQA 2EIJC 4PDVA 3QTCA 3K0DA 2QM4A 1XNQB 1MZFA 3K9SA 4U7NA 1FJGO 3R66A 1HR0B 2YIDA 1QCEA 4JZ2A 4JI0O 1AI6A 4MTOA 4HYOA 1OCCB 1X59A 3JD0A 4MVRA 3JALA 4LFAO 2P67A 2XAHA 5B5EZ 3QO8A 3BAAA 4DR1O 5CBFA 4JI1B 4BR6A 1I08A 4G28B 4O4IB 5DECA 3AG3B 5J2UA 1GM9A 1N0NA 1KB9F 3CCEV 1NU1H 4HAMA 1NJIW 3RGBA 1F4MA 5LGTA 3LSUA 3ZEDA 4GT1A 1KMIZ 4GKJO 5BY1A 1HNXO 1PD3A 3DTUB 1V9PA 5EC2C 1XMOO 3OGIB 1ZAUA 3GVMA 3JYCA 1JX9A 5D5QA 1SQQH 3G80A 5BR8O 4FLVA 4PA6A 4LF4B 3IFXA 2HEPA 2XAJA 3T2MA 2W0XA 1OCRB 2KB1A 1L8DA 1K3EA 3D3IA 1S77D 2DYRB 2OCHA 1TUBB 1VQ5V 3AG2C 1F4NA 2BTQA 2YXHA 4DR3B 1YZBA 4BWAA 4MVSA 5IYBO 4X64B 5CN0A 4HNAB 1XL4A 2QTOA 2F95B 4KXRA 1N32O 4NB5A 2EULA 2LFSA 5DN6G 3N2GB 1PM9A 1IXBA 4E2LA 1WJZA 2ZDIA 2ADQB 1JPXA 4PI0A 1Z5WA 5JCOC 1E1RG 4DV3O 2YSUB 2ZM6B 2GTAA 2QWNB 3TK1A 1U96A 2XUMA 2QE7G 2E5LO 4QJFB 2UUAO 4YIPA 2DYSC 4LF7O 5KHHA 1YXBA 4JTAB 2UUCO 2ZT9B 1VQLV 2DQ0A 4PD4F 1DTOA 4DO2A 3JATB 1G1XB 2PI5A 1O9HA 2XOKG 1K7DA 1QLEC 2GUZB 3ZHUA 2DOSA 2GSMB 1WP7A 1JJOA 3P32A 3ZHRA 1FFXA 4LC1A 1IXMA 1P4RA 1VF7A 2Z3YA 1KUQA 5GTHZ 4JI4O 3E22B 1HW7A 2GDSA 3K79A 1GN3A 3UM7A 1Y76B 3ZHQA 3ZRWB 3ABMB 4BW5A 2HP8A 2OCCB 3A8TA 1WLEA 3J81N 1R6NA 2M7WA 5LMNB 2YIBD 1PKXA 1H8HG 1ORQC 1SF9A 3VQYA 3RBZA 1NZ6A 2F66C 4FLXA 4CC6A 3U10A 2Q0AA 1YITV 3OUFA 4HZ3A 1SA0A 2NN4A 3P3NA 2V1DA 1WPXA 2KG7A 3E86A 4JAVA 4DV5B 1IBLB 1IBKO 4MVMA 1MABG 1L1FA 3JAWA 3LUTB 4FFBA 3VQVA 3SPCA 5B66Z 1VMGA 3DXRB 4I0XA 2JS5A 1AI4A 1S5JA 3CXCU 1BHAA 3LNNA 4AQYO 2OIEA 1VQ7V 4JI2B 3D3QA 2E74B 3U0ZA 3D36C 3ASNB 1R3KC 3BA9A 4LNUA 1QQCA 2RCVA 1P7BA 1Y74B 4JI3B 3ASOC 3BY6A 2K1EA 1FXHA 1IURA 2ZR3A 4J9ZB 3ABUA 4NTWA 1W0JG 1TA8A 1WA8B 4JF3A 2QWRB 2YEVA 5JVDA 1XHZA 4CZZA 5LYJA 4NXMB 1V54B 4X1KA 1S3JA 1F7YA 1BHBA 3E8BA 3BEHA 5ITZA 3KCXA 1R1BA 5C8YA 3CC2V 3ZX6A 5CMUA 4DUZO 1H2LA 1OV9A 2JGDB 5JJJB 1B06A 3I5DA 3JASB 4ZI7A 5CB4A 3IAYA 1VQNV 4YJ3B 3C3SA 2OWOA 4JZGA 5IT9N 2FMLA 3FYEB 5LP6A 3K04A 1KP2A 4KUMA 5L3DA 4JASA 1Y6XA 1UFIA 2DMXA 2A0LA 2ILMA 2P06A 4JAUA 1BT8A 5J9PC 4X1IA 1M93A 3FKSG 4MVQA 2HVKC 4P30A 3JD3A 1P84F 1ZSPA 1YHQV 2CAZC 5B1OA 4MTFA 2MK3A 4NXNB 3OTFA 2ZE7A 3SGIA 1XI1A 1XHXA 4JI8O 3HKBA 3S3XA 3APQA 1BL8A 1L0LH 3UKMA 1MNGA 3RFRA 1QNMA 3E89A 2V4DA 4MVOA 2FB5A 1K4CC 4WFBV 3EFFK 3QF7A 4U7OA 4JI7O 2OYQA 4LFCB 4LF9B 1Z5VA 2IJJA 2VWJA 4NTXA 1MZEA 4JYAB 3JARA 5EYPB 3CHXA 1RPRA 5EIBC 3ZMTA 3P30A 1D5NA 3QG5A 1SZXA 3A0RA 1FAFA 1AR4A 2FKXA 3DGEA 3OEHG 1V55B 4LBEC 2ADPA 3WG7C 4W4KA 3RYHB 3OM3B 1BQ0A 4FLTA 2EZOA 2KSDA 2QTSA 2WLJA 1VARA 1OHHG 3BHPA 1D5AA 4K0KO 2B1IA 2Q4PA 2NNUA 3MHSC 2XT9A 4X66B 4CS2A 3SYPA 4DR7B 4O4LB 4UUJC 3B09A 2E76B 1MSDA 2F4VO 1F51A 1NT2B 1OCOB 4FPPA 4UFZA 2ZE8A 2E3CA 4BIZA 2WLMA 3CX5F 4XDLA 3N2KA 2ARHA 3SJAC 4X20B 1N33B 4AILC 2R9AA 4UCRA 3AK3A 2EINC 1FXKC 3OD4A 2CTWA 3JD1A 4QPKA 4IIJB 5B3SB 1N8RW 2YI9A 1QR9A 1SS3A 1N34B 4WCEV 2UXDB 2GV9A 3GWOA 3CC7V 1QVFU 3OTOO 5KX5A 2R70A 1NTKH 5KMGB 3T1HB 2VQFB 1WPBA 2QDOA 3RVYA 4FIPC 3BA8A 2D3OW 1H2KA 3ZMZA 5LOVB 1SQVH 1YVWA 2ZD9A 4X62B 1XREA 3AEIA 3OFNG 1VQPV 3JAKB 5LBQA 4H33A 1SA0B 4FK5C 1ZLZA 4Z2WA 4P9PA 5B1BC 4B3RO 1PNLA 2KG7B 1OJHA 1JJ2U 4OXSA 3RT3C 2ODMA 3AK1A 5JQGB 2EIJB 1JFFA 3TGUH 2AHYA 1MA1A 4JI5O 1US6A 1WN7A 1K73W 4DK0A 3UCSC 1RP3B 3TCUA 2BE3A 2NLJC 3OE7G 1FFTB 3FB8C 1W2BU 4X89A 2EZPA 5CA0A 5KHIA 1JVMA 3C3TA 1HDJA 4TT3G 1M5IA 3UO3A 5KUKA 1R3IC 4IYHA 1I94B 2HJDA 2P5OA 4DW1A 2BOCC 3OUSA 4DV7B 2VQEO 3HKDA 1JCHA 4X88A 5FNVB 4C7UA 2CH7A 4O2BA 4DV0B 1CPYA 2O57A 2F23A 1HNWB 4DUYB 5ITZB 4YIOA 1RM1C 1XUQA 5IJ0A 2GHYA 4DRXB 2QGNA 3AG2B 2KQXA 5H6RA 5EZYA 2PI4A 3CRAA 4ZI7B 3M8AA 1GKFA 2YXLA 4ICGA 2UXCO 1OCZB 1HNZO 2YDEA 3ZBHA 2F93B 4J7JA 1S5HC 1GK9A 2Y4UA 1VQ6V 4JTCB 3ZIAG 4X1IB 1QBZA 1CEZA 1CXZB 2BSKA 1SZTA 4H0LB 4I5SA 2XNDG 3A0HZ 4DV1B 1VQ4V 3MHHC 1LNQA 4E4EA 4JI6O 5H9CA 4FLZA 2DYSB 2IM9A 4BIOA 4YHHO 1XNQO 3OR7C 1HR0O 3CSXA 2HFEC 4I4TA 4B3MB 2ZINA 2XHBA 1WNSA 1XILA 1QLEB 4JGSA 1KECA 4DR4O 3AG4C 3K5OA 3UT5B 3FAVB 1FXKA 1VF6A 1WAZA 4JI1O 3IJ4A 3EHBB 4LCUC 1B04A 4LH6A 3B40A 1TGOA 3H1LH 3WB2A 5J2TB 2D2CB 3ZN0A 1GM7A 4O4JB 2JRIA 1IVSA 4PA4A 4WF9V 5L3BA 5IYDO 3ABKC 3K03A 3SPGA 4LWSB 4MSWC 3M99B 3CJHA 2QKSA 4L87A 1NTMH 4I7ZB 2ZE5A 2LW1A 2H94A 2AW9A 4X1YB 4GKJB 1BE3H 4JTDB 5CA1B 5LL6Y 4LF8O 2JK5C 4FM0A 4H44B 4DR3O 3HKCB 3CC4V 4ZHQB 3SJBC 1Y66A 5B1NA 1MOFA 5BR8B 3HKEB 5LP6C 2HR3A 3OW2U 1PL0A 1E1QG 2P4VA 5H2FZ 4O2AB 1NVPD 1XDCA 2UU9O 1IBMB 2QWPB 2DJVA 3G67A 2BCCH 4O4HB 3NR7A 3CMAV 2UXXA 3T1CA 2XAQA 1Q5OA 4NTYA 3RVZA 3ASOB 1PPJH 4RQFA 2IJKA 2QKCA 2HVJC 5A9GA 2RMKB 2LP7A 5IJ9A 2ZM6O 1FXVA 4I50A 2M6YA 4TV9A 5K1PA 5LGNA 1WP8A 4EB6B 3HPLC 5B1AC 2CTPA 4R6ZA 2Q6AA 4I55A 1NTZH 4WBNA 2DE0X 1VQ9V 3ETEA 2XASA 5KUMA 4A5UB 3WB0A 4TUYA 3H1HH 4PDLA 1R3JC 4ZIBA 4LP8A 5GONB 3OEEG 1Q43A 2UUCB 2CK3G 1Q90D 1A32A 3ZMVA 2L35A 2W6IG 2PF4E 5A2QN 4LF5O 1ROPA 3BFRA 4EFBA 1NR7A 1BMFG 3SPHA 4KHPO 3B77A 2H3OA 3SPIA 5BMVA 4GUNA 1GN4A 2CGOA 2UUBO 1NQTA 4U3JA 3FX7A 1Q8IA 3LSQA 1AR1B 3ETGA 1MG1A 2QSAA 1M90W 4DR6B 1RSOB 4DV2B 4OGQB 2LFRA 1NVPB 1AI5A 4DV5O 4X9QA 1IBLO 3CCRV 4FLWA 3QNEA 3RYFA 3B2EE 3F5WC 4MTGA 3CCVV 1M1KW 5HFMA 1R6TA
chains in the Genus database with same CATH topology
4LF4O 2ZKOA 4JI0O 2UU9O 2UUCO 2DJVA 2UXDO 3F5TA 1X59A 3SDLA 4OPAA 4B3TO 4DR6O 4B3RO 1G1XB 4LFAO 2FKXA 1F7YA 4DV2O 2DOSA 4LFCO 1J5EO 3RT3C 4X64O 4LF9O 4DR1O 4JI3O 4X65O 1R1BA 2ZM6O 4DR2O 3T1HO 4JI6O 2VQFO 1HNWO 4GKKO 4DUZO 4JI5O 3JAMN 4OPHA 1KUQA 3T1YO 4JI4O 4YHHO 1XNQO 1HR0O 4K0KO 4OX9O 4X62O 1N34O 1NS1A 2HHHO 1IBMO 4GKJO 5BY1A 4YY3O 1HNXO 4JI2O 4A5UB 4DR4O 4NXMO 5IT9N 1DK1A 2LW7A 3J81N 1XMOO 4LF6O 1N36O 2AGAA 2F4VO 2UXBO 4JI1O 5BR8O 3J7AU 1XMQO 4JV5O 1D2DA 4JYAO 3O65A 5H5NA 1A32A 5LMUO 4B3MO 1YZBA 5A2QN 2JRIA 2VQEO 4LF5O 1IBKO 1XEQA 4X66O 4KHPO 1FYJA 4DR7O 1N32O 4DV1O 1XNRO 4JI8O 2Z0AA 4DV6O 2UUBO 1FKAO 5IWAO 4DR5O 4DV4O 4LFBO 5FLXN 4AQYO 1I94O 5LL6Y 4LF8O 4B3SO 2N74A 3M8AA 4JI7O 1AB3A 3OTOO 4DV3O 4DV7O 4DR3O 4DV5O 1IBLO 1N33O 4NXNO 3J80N 4DV0O 2UXCO 1HNZO 5LMNO 4DUYO 5BXZA 2E5LO 1FJGO 2UUAO 1AILA 3R66A 1R6TA 4LF7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 O;  2ZKO A;  4JI0 O;  2UU9 O;  2UUC O;  2DJV A;  2UXD O;  3F5T A;  1X59 A;  3SDL A;  4OPA A;  4B3T O;  4DR6 O;  4B3R O;  1G1X B;  4LFA O;  2FKX A;  1F7Y A;  4DV2 O;  2DOS A;  4LFC O;  1J5E O;  3RT3 C;  4X64 O;  4LF9 O;  4DR1 O;  4JI3 O;  4X65 O;  1R1B A;  2ZM6 O;  4DR2 O;  3T1H O;  4JI6 O;  2VQF O;  1HNW O;  4GKK O;  4DUZ O;  4JI5 O;  3JAM N;  4OPH A;  1KUQ A;  3T1Y O;  4JI4 O;  4YHH O;  1XNQ O;  1HR0 O;  4K0K O;  4OX9 O;  4X62 O;  1N34 O;  1NS1 A;  2HHH O;  1IBM O;  4GKJ O;  5BY1 A;  4YY3 O;  1HNX O;  4JI2 O;  4A5U B;  4DR4 O;  4NXM O;  5IT9 N;  1DK1 A;  2LW7 A;  3J81 N;  1XMO O;  4LF6 O;  1N36 O;  2AGA A;  2F4V O;  2UXB O;  4JI1 O;  5BR8 O;  3J7A U;  1XMQ O;  4JV5 O;  1D2D A;  4JYA O;  3O65 A;  5H5N A;  1A32 A;  5LMU O;  4B3M O;  1YZB A;  5A2Q N;  2JRI A;  2VQE O;  4LF5 O;  1IBK O;  1XEQ A;  4X66 O;  4KHP O;  1FYJ A;  4DR7 O;  1N32 O;  4DV1 O;  1XNR O;  4JI8 O;  2Z0A A;  4DV6 O;  2UUB O;  1FKA O;  5IWA O;  4DR5 O;  4DV4 O;  4LFB O;  5FLX N;  4AQY O;  1I94 O;  5LL6 Y;  4LF8 O;  4B3S O;  2N74 A;  3M8A A;  4JI7 O;  1AB3 A;  3OTO O;  4DV3 O;  4DV7 O;  4DR3 O;  4DV5 O;  1IBL O;  1N33 O;  4NXN O;  3J80 N;  4DV0 O;  2UXC O;  1HNZ O;  5LMN O;  4DUY O;  5BXZ A;  2E5L O;  1FJG O;  2UUA O;  1AIL A;  3R66 A;  1R6T A;  4LF7 O; 
#chains in the Genus database with same CATH topology
 4UV9 A;  3B4S A;  2ZKO A;  1IBK B;  2DYR C;  4UV8 A;  4UB6 Z;  5H6Q A;  1SQG A;  3K58 A;  4K8Z A;  3TET A;  5C93 A;  4IHJ B;  1J5E O;  1GN2 A;  1BQZ A;  5D5P A;  2HKO A;  4JI3 O;  1TVK A;  1G4Y B;  2JGU A;  1UJW B;  2P6J A;  2Q5Z A;  3FYI B;  1AJP A;  1ZX3 A;  4JYC A;  3DC5 A;  4AQY B;  1FS0 G;  3CRR A;  4JYY A;  3M7M X;  2JJ1 G;  5LMU B;  1KU9 A;  4OX9 O;  2V7Q G;  3CME V;  1P7G A;  1QLN A;  2Q7H A;  4LH7 A;  3OMN B;  5IDJ A;  4N21 A;  4NXM O;  1EM1 A;  1KC8 W;  3Q4H A;  2F43 G;  1Z2G A;  2WLL B;  1YCI A;  1J95 A;  4DV6 B;  2A3Q A;  1RPO A;  3UO2 A;  1T5E A;  3ZMS A;  5KA5 A;  1ARO P;  2EJR A;  2RQ6 A;  2ZE6 A;  1ZTE A;  3RYC A;  3WB1 A;  3L9D A;  5IYZ A;  2EIK B;  3W7X A;  3QVN A;  1SET A;  3L72 H;  3CP1 A;  2LGW A;  1S76 D;  4H13 B;  3ZN1 A;  1JA8 A;  1YJ9 V;  2YI8 A;  2Q73 A;  1FYJ A;  1YTF B;  1XNR O;  2BTO A;  5JJN B;  1JMK C;  1WB8 A;  2Q68 A;  2PZS A;  2EIL C;  4CS3 A;  5IWA O;  5JH7 A;  4LFB O;  1XL6 A;  4IL6 Z;  4JYB A;  1GRJ A;  4HBN A;  4GX1 A;  2ITC C;  1GH6 A;  1GTO A;  3TJT A;  5L3C A;  1EFR G;  1Q6I A;  3JAL B;  4ZOL A;  3X2Q C;  4NXN O;  4X65 B;  1LR1 A;  2EIN B;  4RQE A;  4G27 B;  1PP9 H;  3I56 V;  5BXZ A;  4K8X A;  5J2U B;  2HHH B;  5IY5 C;  4G2K A;  3F5T A;  3VBB A;  2WAM A;  1TUE B;  1N36 B;  1VQK V;  2R72 A;  4LFC O;  2ZXW C;  4LF9 O;  4FM2 A;  1DF5 A;  1PNM A;  4MT8 A;  2UXB B;  2EX3 A;  4N23 A;  4DR2 O;  4K35 A;  2B1G A;  3E8G A;  5LXT A;  3U11 A;  3H1J H;  2WWW A;  3OMI B;  3W7T A;  3E83 A;  5B1B B;  3W7S A;  3ETD A;  1KKD A;  2BTQ B;  2QJ1 A;  3L73 H;  3MDS A;  4FFK A;  4O4I A;  5DED A;  4XBF A;  1EN4 A;  3LNM B;  1XMQ O;  4DR5 B;  2QR4 A;  1X4T A;  3O65 A;  2YUA A;  5JJE B;  4B3S B;  4GLX A;  2CE4 A;  3RWR D;  3LDD A;  3JD2 A;  3H9V A;  3K5M A;  1BGY H;  4BIU A;  4X66 O;  4DR7 O;  1I7F A;  4Z1V A;  4J7Z A;  1P49 A;  3SR2 C;  5KHK A;  4CS4 A;  3GB7 C;  1JOY A;  3IGA C;  2Z0A A;  3CRM A;  2OTJ V;  4P2Z A;  4XDK A;  1SRY A;  2B9Z A;  4EEQ A;  1FD9 A;  4PDM A;  3CB2 A;  1GM8 A;  2GBO A;  3E8H A;  1SQF A;  1TUB A;  5FLX N;  4R7C A;  4HNA A;  3OMA B;  4NKG B;  3BCC H;  1BZK A;  2ZIO A;  3UQ8 A;  2F4V B;  1N33 O;  4GYC B;  2FTK A;  3J80 N;  2AZ0 A;  4TUY B;  4ASU G;  3FB7 C;  3N2G A;  4MVZ A;  1RM1 B;  3TXQ A;  1FPO A;  1VF6 C;  1Q6U A;  1FFX B;  3T1Y B;  3K5N A;  4TSF G;  1SQB H;  3CCJ V;  4B7K A;  5JWP A;  4QNH B;  4YY3 B;  3AG1 C;  3AK2 A;  2UXD O;  1M57 C;  4LF6 B;  3B8N A;  2A79 B;  3GWK C;  4F6R A;  2EIM C;  3T1H O;  2VQF O;  2VRZ A;  2NR5 A;  3JAM N;  4OPH A;  1KQS U;  1K92 A;  4UCO A;  2AHZ A;  4X62 O;  1NS1 A;  2LO1 A;  3JAT A;  2GUZ A;  1XBL A;  3N27 A;  2Q9L A;  3OAA G;  2Z5U A;  2AGA A;  3JAW B;  3O9O A;  3KKY A;  5KHJ A;  4FFB B;  3RYF B;  1JR9 A;  4QIW F;  5KHG A;  4LR3 A;  1KBH A;  3E22 A;  4DV4 B;  4I0X B;  1Y76 A;  4FVM A;  3TXS A;  3ZRW A;  3CPW U;  3CEI A;  3NXS A;  2BOB C;  2ZR2 A;  4B3R B;  4DXW A;  1AP6 A;  3K06 A;  2ZNJ A;  5GW7 A;  4PJ0 Z;  1ZL8 A;  2DN9 A;  3AG4 B;  2KKW A;  1NH2 B;  4NR1 A;  4LNU B;  1IX9 A;  2OT5 A;  4RO2 A;  3CCM V;  2P22 C;  4KP4 A;  4JI5 B;  3K59 A;  1TVK B;  4UCS A;  2HG5 C;  4WFF A;  3LDC A;  2LJ2 A;  4DW0 A;  3ZRS A;  1NKD A;  1AR5 A;  1I94 O;  4B3T B;  2ETN A;  2YEV B;  5JVD B;  4BAY A;  2X0L A;  5LYJ B;  4DV7 O;  4X1K B;  4Q6G A;  3DC6 A;  4DV0 O;  3ABK B;  1Q86 W;  3DXR A;  1OCO C;  3ZHS A;  4DUY O;  5C8Y B;  4J10 A;  4WFE A;  3ML0 A;  2Y69 C;  3LDE A;  4X8A A;  2JEX A;  4YJ2 A;  3C90 A;  1H2G A;  3RYI A;  3VOU A;  3KCY A;  4IYI A;  5DM6 V;  5LHH A;  5CB4 B;  1Y74 A;  4CC5 A;  3ZRX A;  1M9N A;  5LP6 B;  1S0V A;  4JV5 B;  4UXN A;  5EK0 A;  4GKK O;  2QWO B;  3THO A;  2WLK A;  1GAX A;  1WA8 A;  1K34 A;  5JH7 B;  2X6C A;  3HB3 B;  2IBZ H;  4JAA A;  3E35 A;  2JIZ G;  5IYC O;  3OR6 C;  4TQD A;  1SC5 B;  2LW7 A;  1VEW A;  4DK1 A;  4PA9 A;  4GX2 A;  4CH5 A;  5HFL A;  2WLH A;  4MS2 A;  5LHG A;  5LA6 A;  4UVC A;  2YIB A;  2JGD A;  3HKB B;  4I9Q A;  3JAS A;  2W6J G;  4H37 A;  4YJ3 A;  4B3M O;  4FM1 A;  2X6A A;  3JCZ A;  1XEQ A;  2G38 A;  4JI6 B;  1R3L C;  4FZ1 A;  2YXY A;  4TV8 A;  2QM7 A;  1G6U A;  1FJG B;  4YHH B;  3PN1 A;  1CP9 A;  2UXN A;  1QVG U;  4TOI A;  5LXT B;  4JI0 B;  3JAR B;  4ABM A;  1EN5 A;  3WU2 Z;  4R8C A;  2P7T C;  2PYL A;  2YS8 A;  4DR4 B;  4LFA B;  3CE2 A;  3ABL C;  1I5Y A;  5GTI Z;  4DR1 B;  3ZCC A;  2EBO A;  3K3W A;  3ZJZ A;  3BVO A;  1YDX A;  3D8C A;  4Z1M G;  2CTR A;  4GX5 A;  1BS3 A;  3OT7 A;  4EFE A;  1DF4 A;  2ZIM A;  1S72 V;  4UVA A;  3T4Z A;  4LF4 O;  3MAQ A;  1GMG A;  1HNX B;  1EZJ A;  1PV0 A;  1IZ3 A;  4PA7 A;  4DYL A;  1Q6H A;  1XMO B;  4X64 O;  1HP8 A;  1R6K A;  3STZ C;  5F2V O;  3RW0 A;  1K4D C;  3K5L A;  2CDY A;  5EYP A;  1O9G A;  2VS0 A;  1N4C A;  3FB5 C;  4D6T H;  1RFY A;  4LF8 B;  2WSS G;  3N2K B;  2Q67 A;  4QGP A;  1IBM O;  1N0J A;  2PGG A;  2K9P A;  2RNB A;  4PA3 A;  3W7W A;  2OTL V;  3RYH A;  1N32 B;  1DK1 A;  3SYC A;  3ZHV A;  1B3Q A;  1BSM A;  1DGS A;  1OCZ C;  5AG2 A;  3VQW A;  3KZI Z;  3J7A U;  1M56 C;  1XOU A;  4UB8 Z;  2Q0O C;  4D7S A;  2UU9 B;  5EBW C;  4PHZ A;  5H5N A;  5CBG A;  2FL4 A;  3IC9 A;  1M4U A;  4DV3 B;  2OIG A;  2IH1 C;  4QE7 A;  4O4L A;  2QEX V;  1K33 A;  5KX5 B;  3SYO A;  3JD4 A;  5EIB D;  2PY5 A;  4F6R B;  4P9O A;  2X7R B;  2E5L B;  1Q82 W;  2UUA B;  2CUG A;  3K0G A;  4RUE A;  2N04 A;  4LF7 B;  1FKA O;  5KLV H;  4YXW G;  2ITD C;  5TIS Z;  2IJI A;  3AG7 A;  4X20 A;  1ENV A;  1OCC C;  4FJC C;  3VQX A;  1Y4M A;  2IU3 A;  4IIJ A;  2R9I A;  5LMN O;  1JFF B;  1F23 A;  2EIL B;  4JI4 B;  3AG3 C;  1K5S A;  2WPD G;  5EC1 C;  4LF5 B;  1YTF D;  4KHP B;  4DR6 O;  3ZS8 C;  1AP5 A;  1ZL8 B;  3L75 H;  3X2Q B;  5KMG A;  4DV2 O;  2P90 A;  3BRC A;  5CA0 B;  4TWK A;  2PTM A;  2UUB B;  2B5U A;  4F4L A;  4B08 A;  5LOV A;  3F7V C;  2AZ2 A;  2WLN A;  1H8E G;  5IY5 B;  3JAK A;  5FPO A;  4FLY A;  1OCR C;  4F6E A;  1OZ0 A;  1EBO A;  1SES A;  4RWU A;  1B6Q A;  1TAE A;  2EJ7 A;  4JI2 O;  2IH3 C;  1SER A;  4AHC A;  2ZXW B;  2RDC A;  3HKD B;  3JSL A;  3OGC C;  2HJF C;  5JQG A;  2CH7 B;  4UVB A;  4O2B B;  3EVK A;  4U3F H;  1QU7 A;  5CBH A;  4MVU A;  2JJ2 G;  3MD0 A;  4YJ2 B;  5IJ0 B;  3RYI B;  5LMU O;  3H01 A;  4WFH A;  4J80 A;  1Q81 W;  1PL4 A;  2Y0I A;  2A06 H;  4GX0 A;  5EZY B;  1J5E B;  4J11 A;  4KFM A;  5L3E A;  3WG7 B;  1XQ8 A;  2FYU H;  1YJW V;  2QM8 A;  4GZR B;  3R65 A;  4BW9 A;  1JQ0 A;  4DV6 O;  5FPR A;  5L3G A;  4OX9 B;  4MW3 A;  3HR0 A;  5BZB A;  1VF5 B;  2AXT Z;  1SQX H;  5FNV A;  2N74 A;  2BSK B;  1AI7 A;  1I5X A;  4D7T A;  1G8M A;  5K1X A;  1NBM G;  2ZQM A;  1S5L Z;  3E8F A;  4DUZ B;  3JCU Z;  3S3W A;  2ZNI A;  5LGU A;  4AI8 A;  3APO A;  2Q69 A;  5LA6 B;  4DRX A;  3H1K H;  1VQO V;  4RUF A;  3QO7 A;  3CCL V;  2W0F C;  3E2E A;  3CCU V;  3ABM C;  4I4T B;  5E1A C;  2OCC C;  2WLI A;  1XNR B;  3ZMU A;  1QHT A;  2DQ3 A;  1FXK B;  4X65 O;  3CCQ V;  4TV8 B;  5IWA B;  3G4S V;  4LFB B;  2CTQ A;  2H8P C;  4PV1 B;  1NR1 A;  1Q3E A;  1ZUQ A;  2JEU A;  3PJS K;  3L74 H;  5JCO A;  3AG1 B;  3ZRV A;  1M57 B;  2L6L A;  2HHH O;  1K97 A;  1Y67 A;  2WA3 A;  3SYQ A;  4UCU A;  1SQP H;  2YIC A;  5KAF Z;  4WFA V;  3A2F A;  1N36 O;  4JI8 B;  2EIM B;  2UXB O;  3CXH F;  2IJH A;  4CH4 A;  2ZCE A;  1BCC H;  1H2S B;  4JYA O;  3CJH B;  2IU0 A;  3ZHT A;  4JI7 B;  3FB6 C;  2LQT A;  3UT5 A;  3FAV A;  4TQF A;  1H38 A;  3ASN C;  1LUW A;  4DR2 B;  2F1M A;  3SPJ A;  1EZV H;  1I0H A;  5L3F A;  2R9R B;  4JPR A;  1K5Q A;  1VIB A;  1WB7 A;  4DR5 O;  5J2T A;  4NYK A;  4O4J A;  2VWK A;  4B3S O;  3T4D A;  3ABT A;  4QE9 A;  1YF2 A;  2MW2 B;  1AB3 A;  3LSS A;  5EBL C;  1E79 G;  4K3A A;  3WFV A;  1V54 C;  2P4K A;  2WA4 A;  2XAF A;  1KKC A;  5LHI A;  1VQ8 V;  3G71 V;  4LWS A;  1XMQ B;  5IJ9 B;  2Y48 A;  4I50 B;  2A9H A;  4TV9 B;  4K0K B;  3CRQ A;  4X1Y A;  2EIK C;  4IT5 A;  4GCZ A;  1VQM V;  5CA1 A;  4J42 A;  1NH2 D;  1K8A W;  4I55 B;  2PUS A;  4WBN B;  4OPA A;  3G6B A;  3HKC A;  1K9M W;  4ZHQ A;  3I55 V;  4PI2 A;  3QO5 A;  2QWQ B;  3HKE A;  2RJZ A;  4KL1 A;  2DWE C;  3G6E V;  2YC0 A;  1H2N A;  1AVM A;  2Y69 B;  2ATK C;  4O2A A;  3T1Y O;  3IC7 A;  3SJQ C;  4O4H A;  1N34 O;  3D36 A;  4WFG A;  1H2M A;  1YIJ V;  1UPG A;  1AJQ A;  4YY3 O;  4R50 A;  5KAI Z;  2XAG A;  3RN4 A;  1GO3 F;  1YSC A;  3CS5 A;  1YEW A;  4LF6 O;  4EB6 A;  5BMV B;  2JVD A;  1W0K G;  1D2D A;  4FMT A;  2E75 B;  4U3J B;  4UCT A;  3ICX A;  2Y0P A;  4J41 A;  2XTA A;  3OTO B;  2GTS A;  3H1I H;  3SYA A;  2DW4 A;  1DLB A;  2LGQ A;  5GON A;  1VP7 A;  3K9A A;  1R73 A;  4RAI A;  4XDJ A;  4ZKI A;  4DV4 O;  4PEL A;  3CRC A;  3KG2 A;  2Q7E A;  2QA4 V;  3W7U A;  2PYJ A;  3CD6 V;  1YJN V;  1KD1 W;  1V55 C;  4CBC A;  3BAB A;  1W59 A;  1AIL A;  3CWB H;  5E79 Z;  4UCV A;  1SKV A;  3CCS V;  2ZDI C;  1RSO A;  1THZ A;  2IW5 A;  1QR8 A;  2C2A A;  3F7Y C;  1KYO F;  3SDL A;  3ABL B;  4B3T O;  3L71 H;  3SJC C;  1Q7Y W;  2A7W A;  4PDR A;  3STL C;  1IDS A;  3Q4H B;  5KA6 A;  3JSN A;  1HNW O;  4QPJ A;  2QKA A;  5FL7 G;  3RYC B;  4W4L A;  2N05 A;  1URF A;  5EBM C;  5IYZ B;  2VQE B;  4J9Y B;  4MTX A;  4ZBM A;  2CGN A;  2YIA A;  4IHJ A;  2Y4T A;  1MMM A;  4L8J A;  3A0B Z;  2HLD G;  1HWY A;  4Q20 A;  2Q7G A;  4CH3 A;  2JDI G;  1U97 A;  1PNK A;  4JV5 O;  5B3S C;  1NI8 A;  4CH6 A;  1ZWI C;  5CA3 A;  4IGG A;  4NVP A;  3L70 H;  1AJN A;  2X6B A;  1COW G;  1EN6 A;  3P3P A;  3K57 A;  3DSQ A;  2WLI B;  2UXC B;  2WLL A;  3B8M A;  2RN9 A;  1YI2 V;  4EKW A;  1HNZ B;  4ZOL B;  1L0N H;  4DV1 O;  2Q8V A;  4FZ0 A;  4GKK B;  1M56 B;  5IE9 A;  2JS3 A;  4B7E A;  5B1A B;  2DWD C;  3K08 A;  1MSW D;  1KP3 A;  3FD9 A;  4J7K A;  3FFQ A;  1LUV A;  3BPZ A;  4I9W A;  4MW8 A;  3CYO A;  1GN6 A;  3EXA A;  4FLU A;  3ETQ A;  2EIJ C;  4PDV A;  3QTC A;  3K0D A;  2QM4 A;  1XNQ B;  1MZF A;  3K9S A;  4U7N A;  1FJG O;  3R66 A;  1HR0 B;  2YID A;  1QCE A;  4JZ2 A;  4JI0 O;  1AI6 A;  4MTO A;  4HYO A;  1OCC B;  1X59 A;  3JD0 A;  4MVR A;  3JAL A;  4LFA O;  2P67 A;  2XAH A;  5B5E Z;  3QO8 A;  3BAA A;  4DR1 O;  5CBF A;  4JI1 B;  4BR6 A;  1I08 A;  4G28 B;  4O4I B;  5DEC A;  3AG3 B;  5J2U A;  1GM9 A;  1N0N A;  1KB9 F;  3CCE V;  1NU1 H;  4HAM A;  1NJI W;  3RGB A;  1F4M A;  5LGT A;  3LSU A;  3ZED A;  4GT1 A;  1KMI Z;  4GKJ O;  5BY1 A;  1HNX O;  1PD3 A;  3DTU B;  1V9P A;  5EC2 C;  1XMO O;  3OGI B;  1ZAU A;  3GVM A;  3JYC A;  1JX9 A;  5D5Q A;  1SQQ H;  3G80 A;  5BR8 O;  4FLV A;  4PA6 A;  4LF4 B;  3IFX A;  2HEP A;  2XAJ A;  3T2M A;  2W0X A;  1OCR B;  2KB1 A;  1L8D A;  1K3E A;  3D3I A;  1S77 D;  2DYR B;  2OCH A;  1TUB B;  1VQ5 V;  3AG2 C;  1F4N A;  2BTQ A;  2YXH A;  4DR3 B;  1YZB A;  4BWA A;  4MVS A;  5IYB O;  4X64 B;  5CN0 A;  4HNA B;  1XL4 A;  2QTO A;  2F95 B;  4KXR A;  1N32 O;  4NB5 A;  2EUL A;  2LFS A;  5DN6 G;  3N2G B;  1PM9 A;  1IXB A;  4E2L A;  1WJZ A;  2ZDI A;  2ADQ B;  1JPX A;  4PI0 A;  1Z5W A;  5JCO C;  1E1R G;  4DV3 O;  2YSU B;  2ZM6 B;  2GTA A;  2QWN B;  3TK1 A;  1U96 A;  2XUM A;  2QE7 G;  2E5L O;  4QJF B;  2UUA O;  4YIP A;  2DYS C;  4LF7 O;  5KHH A;  1YXB A;  4JTA B;  2UUC O;  2ZT9 B;  1VQL V;  2DQ0 A;  4PD4 F;  1DTO A;  4DO2 A;  3JAT B;  1G1X B;  2PI5 A;  1O9H A;  2XOK G;  1K7D A;  1QLE C;  2GUZ B;  3ZHU A;  2DOS A;  2GSM B;  1WP7 A;  1JJO A;  3P32 A;  3ZHR A;  1FFX A;  4LC1 A;  1IXM A;  1P4R A;  1VF7 A;  2Z3Y A;  1KUQ A;  5GTH Z;  4JI4 O;  3E22 B;  1HW7 A;  2GDS A;  3K79 A;  1GN3 A;  3UM7 A;  1Y76 B;  3ZHQ A;  3ZRW B;  3ABM B;  4BW5 A;  2HP8 A;  2OCC B;  3A8T A;  1WLE A;  3J81 N;  1R6N A;  2M7W A;  5LMN B;  2YIB D;  1PKX A;  1H8H G;  1ORQ C;  1SF9 A;  3VQY A;  3RBZ A;  1NZ6 A;  2F66 C;  4FLX A;  4CC6 A;  3U10 A;  2Q0A A;  1YIT V;  3OUF A;  4HZ3 A;  1SA0 A;  2NN4 A;  3P3N A;  2V1D A;  1WPX A;  2KG7 A;  3E86 A;  4JAV A;  4DV5 B;  1IBL B;  1IBK O;  4MVM A;  1MAB G;  1L1F A;  3JAW A;  3LUT B;  4FFB A;  3VQV A;  3SPC A;  5B66 Z;  1VMG A;  3DXR B;  4I0X A;  2JS5 A;  1AI4 A;  1S5J A;  3CXC U;  1BHA A;  3LNN A;  4AQY O;  2OIE A;  1VQ7 V;  4JI2 B;  3D3Q A;  2E74 B;  3U0Z A;  3D36 C;  3ASN B;  1R3K C;  3BA9 A;  4LNU A;  1QQC A;  2RCV A;  1P7B A;  1Y74 B;  4JI3 B;  3ASO C;  3BY6 A;  2K1E A;  1FXH A;  1IUR A;  2ZR3 A;  4J9Z B;  3ABU A;  4NTW A;  1W0J G;  1TA8 A;  1WA8 B;  4JF3 A;  2QWR B;  2YEV A;  5JVD A;  1XHZ A;  4CZZ A;  5LYJ A;  4NXM B;  1V54 B;  4X1K A;  1S3J A;  1F7Y A;  1BHB A;  3E8B A;  3BEH A;  5ITZ A;  3KCX A;  1R1B A;  5C8Y A;  3CC2 V;  3ZX6 A;  5CMU A;  4DUZ O;  1H2L A;  1OV9 A;  2JGD B;  5JJJ B;  1B06 A;  3I5D A;  3JAS B;  4ZI7 A;  5CB4 A;  3IAY A;  1VQN V;  4YJ3 B;  3C3S A;  2OWO A;  4JZG A;  5IT9 N;  2FML A;  3FYE B;  5LP6 A;  3K04 A;  1KP2 A;  4KUM A;  5L3D A;  4JAS A;  1Y6X A;  1UFI A;  2DMX A;  2A0L A;  2ILM A;  2P06 A;  4JAU A;  1BT8 A;  5J9P C;  4X1I A;  1M93 A;  3FKS G;  4MVQ A;  2HVK C;  4P30 A;  3JD3 A;  1P84 F;  1ZSP A;  1YHQ V;  2CAZ C;  5B1O A;  4MTF A;  2MK3 A;  4NXN B;  3OTF A;  2ZE7 A;  3SGI A;  1XI1 A;  1XHX A;  4JI8 O;  3HKB A;  3S3X A;  3APQ A;  1BL8 A;  1L0L H;  3UKM A;  1MNG A;  3RFR A;  1QNM A;  3E89 A;  2V4D A;  4MVO A;  2FB5 A;  1K4C C;  4WFB V;  3EFF K;  3QF7 A;  4U7O A;  4JI7 O;  2OYQ A;  4LFC B;  4LF9 B;  1Z5V A;  2IJJ A;  2VWJ A;  4NTX A;  1MZE A;  4JYA B;  3JAR A;  5EYP B;  3CHX A;  1RPR A;  5EIB C;  3ZMT A;  3P30 A;  1D5N A;  3QG5 A;  1SZX A;  3A0R A;  1FAF A;  1AR4 A;  2FKX A;  3DGE A;  3OEH G;  1V55 B;  4LBE C;  2ADP A;  3WG7 C;  4W4K A;  3RYH B;  3OM3 B;  1BQ0 A;  4FLT A;  2EZO A;  2KSD A;  2QTS A;  2WLJ A;  1VAR A;  1OHH G;  3BHP A;  1D5A A;  4K0K O;  2B1I A;  2Q4P A;  2NNU A;  3MHS C;  2XT9 A;  4X66 B;  4CS2 A;  3SYP A;  4DR7 B;  4O4L B;  4UUJ C;  3B09 A;  2E76 B;  1MSD A;  2F4V O;  1F51 A;  1NT2 B;  1OCO B;  4FPP A;  4UFZ A;  2ZE8 A;  2E3C A;  4BIZ A;  2WLM A;  3CX5 F;  4XDL A;  3N2K A;  2ARH A;  3SJA C;  4X20 B;  1N33 B;  4AIL C;  2R9A A;  4UCR A;  3AK3 A;  2EIN C;  1FXK C;  3OD4 A;  2CTW A;  3JD1 A;  4QPK A;  4IIJ B;  5B3S B;  1N8R W;  2YI9 A;  1QR9 A;  1SS3 A;  1N34 B;  4WCE V;  2UXD B;  2GV9 A;  3GWO A;  3CC7 V;  1QVF U;  3OTO O;  5KX5 A;  2R70 A;  1NTK H;  5KMG B;  3T1H B;  2VQF B;  1WPB A;  2QDO A;  3RVY A;  4FIP C;  3BA8 A;  2D3O W;  1H2K A;  3ZMZ A;  5LOV B;  1SQV H;  1YVW A;  2ZD9 A;  4X62 B;  1XRE A;  3AEI A;  3OFN G;  1VQP V;  3JAK B;  5LBQ A;  4H33 A;  1SA0 B;  4FK5 C;  1ZLZ A;  4Z2W A;  4P9P A;  5B1B C;  4B3R O;  1PNL A;  2KG7 B;  1OJH A;  1JJ2 U;  4OXS A;  3RT3 C;  2ODM A;  3AK1 A;  5JQG B;  2EIJ B;  1JFF A;  3TGU H;  2AHY A;  1MA1 A;  4JI5 O;  1US6 A;  1WN7 A;  1K73 W;  4DK0 A;  3UCS C;  1RP3 B;  3TCU A;  2BE3 A;  2NLJ C;  3OE7 G;  1FFT B;  3FB8 C;  1W2B U;  4X89 A;  2EZP A;  5CA0 A;  5KHI A;  1JVM A;  3C3T A;  1HDJ A;  4TT3 G;  1M5I A;  3UO3 A;  5KUK A;  1R3I C;  4IYH A;  1I94 B;  2HJD A;  2P5O A;  4DW1 A;  2BOC C;  3OUS A;  4DV7 B;  2VQE O;  3HKD A;  1JCH A;  4X88 A;  5FNV B;  4C7U A;  2CH7 A;  4O2B A;  4DV0 B;  1CPY A;  2O57 A;  2F23 A;  1HNW B;  4DUY B;  5ITZ B;  4YIO A;  1RM1 C;  1XUQ A;  5IJ0 A;  2GHY A;  4DRX B;  2QGN A;  3AG2 B;  2KQX A;  5H6R A;  5EZY A;  2PI4 A;  3CRA A;  4ZI7 B;  3M8A A;  1GKF A;  2YXL A;  4ICG A;  2UXC O;  1OCZ B;  1HNZ O;  2YDE A;  3ZBH A;  2F93 B;  4J7J A;  1S5H C;  1GK9 A;  2Y4U A;  1VQ6 V;  4JTC B;  3ZIA G;  4X1I B;  1QBZ A;  1CEZ A;  1CXZ B;  2BSK A;  1SZT A;  4H0L B;  4I5S A;  2XND G;  3A0H Z;  4DV1 B;  1VQ4 V;  3MHH C;  1LNQ A;  4E4E A;  4JI6 O;  5H9C A;  4FLZ A;  2DYS B;  2IM9 A;  4BIO A;  4YHH O;  1XNQ O;  3OR7 C;  1HR0 O;  3CSX A;  2HFE C;  4I4T A;  4B3M B;  2ZIN A;  2XHB A;  1WNS A;  1XIL A;  1QLE B;  4JGS A;  1KEC A;  4DR4 O;  3AG4 C;  3K5O A;  3UT5 B;  3FAV B;  1FXK A;  1VF6 A;  1WAZ A;  4JI1 O;  3IJ4 A;  3EHB B;  4LCU C;  1B04 A;  4LH6 A;  3B40 A;  1TGO A;  3H1L H;  3WB2 A;  5J2T B;  2D2C B;  3ZN0 A;  1GM7 A;  4O4J B;  2JRI A;  1IVS A;  4PA4 A;  4WF9 V;  5L3B A;  5IYD O;  3ABK C;  3K03 A;  3SPG A;  4LWS B;  4MSW C;  3M99 B;  3CJH A;  2QKS A;  4L87 A;  1NTM H;  4I7Z B;  2ZE5 A;  2LW1 A;  2H94 A;  2AW9 A;  4X1Y B;  4GKJ B;  1BE3 H;  4JTD B;  5CA1 B;  5LL6 Y;  4LF8 O;  2JK5 C;  4FM0 A;  4H44 B;  4DR3 O;  3HKC B;  3CC4 V;  4ZHQ B;  3SJB C;  1Y66 A;  5B1N A;  1MOF A;  5BR8 B;  3HKE B;  5LP6 C;  2HR3 A;  3OW2 U;  1PL0 A;  1E1Q G;  2P4V A;  5H2F Z;  4O2A B;  1NVP D;  1XDC A;  2UU9 O;  1IBM B;  2QWP B;  2DJV A;  3G67 A;  2BCC H;  4O4H B;  3NR7 A;  3CMA V;  2UXX A;  3T1C A;  2XAQ A;  1Q5O A;  4NTY A;  3RVZ A;  3ASO B;  1PPJ H;  4RQF A;  2IJK A;  2QKC A;  2HVJ C;  5A9G A;  2RMK B;  2LP7 A;  5IJ9 A;  2ZM6 O;  1FXV A;  4I50 A;  2M6Y A;  4TV9 A;  5K1P A;  5LGN A;  1WP8 A;  4EB6 B;  3HPL C;  5B1A C;  2CTP A;  4R6Z A;  2Q6A A;  4I55 A;  1NTZ H;  4WBN A;  2DE0 X;  1VQ9 V;  3ETE A;  2XAS A;  5KUM A;  4A5U B;  3WB0 A;  4TUY A;  3H1H H;  4PDL A;  1R3J C;  4ZIB A;  4LP8 A;  5GON B;  3OEE G;  1Q43 A;  2UUC B;  2CK3 G;  1Q90 D;  1A32 A;  3ZMV A;  2L35 A;  2W6I G;  2PF4 E;  5A2Q N;  4LF5 O;  1ROP A;  3BFR A;  4EFB A;  1NR7 A;  1BMF G;  3SPH A;  4KHP O;  3B77 A;  2H3O A;  3SPI A;  5BMV A;  4GUN A;  1GN4 A;  2CGO A;  2UUB O;  1NQT A;  4U3J A;  3FX7 A;  1Q8I A;  3LSQ A;  1AR1 B;  3ETG A;  1MG1 A;  2QSA A;  1M90 W;  4DR6 B;  1RSO B;  4DV2 B;  4OGQ B;  2LFR A;  1NVP B;  1AI5 A;  4DV5 O;  4X9Q A;  1IBL O;  3CCR V;  4FLW A;  3QNE A;  3RYF A;  3B2E E;  3F5W C;  4MTG A;  3CCV V;  1M1K W;  5HFM A;  1R6T A; 
#chains in the Genus database with same CATH homology
 4LF4 O;  2ZKO A;  4JI0 O;  2UU9 O;  2UUC O;  2DJV A;  2UXD O;  3F5T A;  1X59 A;  3SDL A;  4OPA A;  4B3T O;  4DR6 O;  4B3R O;  1G1X B;  4LFA O;  2FKX A;  1F7Y A;  4DV2 O;  2DOS A;  4LFC O;  1J5E O;  3RT3 C;  4X64 O;  4LF9 O;  4DR1 O;  4JI3 O;  4X65 O;  1R1B A;  2ZM6 O;  4DR2 O;  3T1H O;  4JI6 O;  2VQF O;  1HNW O;  4GKK O;  4DUZ O;  4JI5 O;  3JAM N;  4OPH A;  1KUQ A;  3T1Y O;  4JI4 O;  4YHH O;  1XNQ O;  1HR0 O;  4K0K O;  4OX9 O;  4X62 O;  1N34 O;  1NS1 A;  2HHH O;  1IBM O;  4GKJ O;  5BY1 A;  4YY3 O;  1HNX O;  4JI2 O;  4A5U B;  4DR4 O;  4NXM O;  5IT9 N;  1DK1 A;  2LW7 A;  3J81 N;  1XMO O;  4LF6 O;  1N36 O;  2AGA A;  2F4V O;  2UXB O;  4JI1 O;  5BR8 O;  3J7A U;  1XMQ O;  4JV5 O;  1D2D A;  4JYA O;  3O65 A;  5H5N A;  1A32 A;  5LMU O;  4B3M O;  1YZB A;  5A2Q N;  2JRI A;  2VQE O;  4LF5 O;  1IBK O;  1XEQ A;  4X66 O;  4KHP O;  1FYJ A;  4DR7 O;  1N32 O;  4DV1 O;  1XNR O;  4JI8 O;  2Z0A A;  4DV6 O;  2UUB O;  1FKA O;  5IWA O;  4DR5 O;  4DV4 O;  4LFB O;  5FLX N;  4AQY O;  1I94 O;  5LL6 Y;  4LF8 O;  4B3S O;  2N74 A;  3M8A A;  4JI7 O;  1AB3 A;  3OTO O;  4DV3 O;  4DV7 O;  4DR3 O;  4DV5 O;  1IBL O;  1N33 O;  4NXN O;  3J80 N;  4DV0 O;  2UXC O;  1HNZ O;  5LMN O;  4DUY O;  5BXZ A;  2E5L O;  1FJG O;  2UUA O;  1AIL A;  3R66 A;  1R6T A;  4LF7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...