1HNWO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnwO00
1XEQA 5BXZA 4DV2O 4DV3O 4GKKO 5A2QN 2UUAO 3T1HO 4JI8O 2UU9O 4DV6O 2N74A 1XMQO 4X65O 1IBKO 1N36O 3RT3C 4X62O 4JI0O 4JI7O 4B3SO 3R66A 1XMOO 1HNWO 4LF6O 4LFAO 4JI1O 1XNQO 4DR3O 2UXCO 1A32A 4JI6O 1R1BA 4DV7O 1YZBA 4K0KO 4LFCO 2UUBO 2Z0AA 4OPHA 2VQFO 4GKJO 4YHHO 4DR2O 4DR4O 4JV5O 1HNXO 1G1XB 2LW7A 3JAMN 3J81N 1HR0O 1NS1A 4JI5O 2UXDO 1FYJA 1X59A 4B3RO 4DR7O 4X64O 1FJGO 1N33O 3T1YO 4NXMO 4DV4O 5IT9N 4DV5O 1D2DA 1J5EO 5LL6Y 1DK1A 1N34O 4AQYO 2VQEO 4DUZO 1XNRO 2DJVA 4LFBO 2ZKOA 1IBMO 1KUQA 4OX9O 4OPAA 5LMUO 3J80N 4DR6O 1N32O 4KHPO 3O65A 4JI4O 1R6TA 3OTOO 5BR8O 4LF5O 3F5TA 4DV1O 1AB3A 4LF8O 4LF9O 5IWAO 5H5NA 2UUCO 2UXBO 2HHHO 2FKXA 1IBLO 2E5LO 3J7AU 1FKAO 4DR5O 4JYAO 1I94O 2JRIA 4B3MO 4LF4O 2AGAA 4DUYO 1HNZO 4YY3O 5BY1A 4X66O 3M8AA 4DV0O 4JI2O 2F4VO 2ZM6O 2DOSA 3SDLA 4B3TO 4LF7O 1AILA 5FLXN 4DR1O 4NXNO 4JI3O 5LMNO 1F7YA 4A5UB
chains in the Genus database with same CATH superfamily
2X6AA 5FNVB 2ZNJA 2JS5A 3CS5A 4CH6A 3KZIZ 1K7DA 1M1KW 1KB9F 4DV1B 2P4VA 1EZJA 1THZA 5EBWC 3ZHRA 4LF6O 2EULA 1GAXA 2UXCO 2BSKA 4X62B 4TQDA 3UCSC 3RW0A 2V1DA 4K0KO 1XMOB 3FKSG 5CB4A 4HZ3A 4B7KA 2YUAA 1FFXB 4H37A 1UJWB 1L8DA 3E22A 1HR0O 4TT3G 2QWQB 5JVDB 5EK0A 5JCOA 4ICGA 5FPOA 3RYIB 2WA3A 5KHKA 1XL6A 2P22C 1QU7A 5FPRA 1TA8A 3RYFB 4FLWA 1NJIW 2ZR2A 5E79Z 1K34A 1JJ2U 3L9DA 3FYEB 4WFGA 3T1HB 4WFFA 5KMGB 4FLYA 3RWRD 3ZCCA 4U3JA 1NH2D 1OCRB 3ASOC 1F4NA 5KAIZ 4YIPA 4CBCA 1XNQB 1XBLA 4DR3B 1BZKA 3FX7A 2VRZA 2JJ2G 5KUKA 5JCOC 5H6QA 2UUBB 1PD3A 2EIJB 4DR5O 4CC6A 1YEWA 4BIZA 4PHZA 1SQBH 1WPBA 1AR5A 3ZHQA 4K35A 2ZM6O 4OGQB 3K9AA 2X6CA 1P4RA 3A0HZ 1Z2GA 1SESA 3JD3A 1L0NH 1V54B 3CHXA 1KP2A 1TUBB 2EIMB 5GW7A 4XDJA 3VBBA 2DMXA 4GKKB 2HFEC 1Q3EA 1RPOA 4DV2B 4GLXA 2AZ0A 3OW2U 1M5IA 4O4LB 4HBNA 2IU3A 4JTCB 4PA7A 3I5DA 1BHBA 4FLTA 4IYHA 4J10A 1KP3A 1R1BA 2W6JG 3OFNG 1QCEA 2ZE6A 4YJ2A 3SYCA 1N0NA 5CB4B 4WF9V 4ZHQB 1NR1A 2YEVB 4X1KA 2D2CB 2L35A 2QWRB 4DR7O 5B1OA 3HR0A 2FMLA 5HFMA 5LXTA 1V9PA 2JGDA 4I50B 3OAAG 1R73A 1DK1A 4X1YA 2VQEO 3AG7A 2QWPB 4LC1A 2ZDIA 5KA5A 2Q8VA 4N21A 3SR2C 2UU9B 1EM1A 4LBEC 1Y76A 4X89A 1TVKB 1AJPA 4JI1B 1FD9A 3SPJA 1NVPB 3CCVV 2W6IG 3CC4V 3LUTB 2PYLA 2CUGA 2ITCC 1VQ4V 4K0KB 5CA1A 5KUMA 5H6RA 4ASUG 1NR7A 3CEIA 3I55V 4TOIA 4J11A 3JARB 1GKFA 4YY3O 3ZRWA 1HR0B 3ZBHA 2Q7GA 5IJ0B 1K5SA 1OCOC 4NXNO 4JAAA 1SERA 5LMNO 1N34O 1F7YA 4A5UB 3S3XA 3CCQV 3W7TA 4EFBA 4UV9A 2FB5A 1SQQH 2G38A 1ZTEA 1Q6HA 2Y4UA 3TCUA 3WB0A 4YJ2B 4X65B 1IXBA 1ROPA 3VQYA 3W7SA 3P30A 1L1FA 4KUMA 2Q7EA 1QHTA 4JF3A 4IGGA 5J2TA 5CA3A 2YSUB 4MVZA 1KKDA 2HJDA 4O4IA 3CCJV 4D7SA 2E5LB 5IYZA 1YF2A 3PN1A 3SJQC 1B06A 1LUWA 1FFXA 3ZRWB 2LW7A 3JD2A 3E22B 2UXDB 5JH7A 4DV0B 1I7FA 3P32A 1NU1H 1QLEC 4X1KB 1TUBA 5EIBC 1QR9A 1S5LZ 3SPGA 1HNZB 4DV4O 4D6TH 2DW4A 2EIKC 2LQTA 3X2QB 5L3CA 2Y48A 4BAYA 4CZZA 5DM6V 3DSQA 3STZC 4LR3A 5IJ0A 2GHYA 4FLXA 3LDEA 5JJEB 5FNVA 4WFEA 3HKDA 1H2GA 4GT1A 4TUYB 4DV3B 5FL7G 2P6JA 1K5QA 4IL6Z 3AG3C 3UQ8A 1S5HC 1IZ3A 5DN6G 3A0RA 4FFBB 1R3JC 1MABG 4DR2B 2JRIA 2GV9A 3WG7C 3K5OA 2A9HA 5ITZB 4DUYO 2YS8A 1CEZA 3CC7V 4UB8Z 4B3TB 2FYUH 3SDLA 4DK1A 4B3TO 1OCOB 1Y4MA 5K1PA 3RYCB 1WPXA 1YJ9V 4JASA 2P90A 4FZ1A 4MSWC 2LP7A 1NTMH 5EZYA 4AI8A 1OZ0A 3GB7C 3K79A 1JCHA 3OMAB 5B1BB 1XMQB 1DTOA 2EILC 3ZHVA 3EHBB 3SJAC 4DUZB 1B04A 4NYKA 3RYHA 2IH3C 1Q7YW 4YJ3A 4AILC 1NH2B 4I4TB 1ZUQA 2XOKG 1Q8IA 4GX5A 4MT8A 4CH4A 1W2BU 1I08A 1P49A 2XHBA 4LF8B 4JV5O 4JV5B 3J81N 1AROP 1KC8W 4MTGA 1HP8A 5B3SB 5CBGA 3A8TA 4UVAA 1X59A 5J2UB 2BOCC 4MS2A 5EIBD 1J95A 4IIJA 4JI5B 1FXKA 1L0LH 1BQ0A 4AQYO 2PTMA 2LGQA 1XNRO 1W0KG 5LYJA 4DO2A 1VP7A 3BEHA 1N4CA 3CXHF 4K3AA 1YIJV 4PJ0Z 1Y76B 2HLDG 5LYJB 4I55A 3CCSV 5LMUB 5IWAB 1JVMA 4TV8A 4JYAO 3K58A 4YHHB 1YDXA 1WAZA 2Y0PA 4LF4O 1HDJA 2LGWA 4FLVA 1IBLB 3SPIA 4LP8A 1QR8A 4JYBA 4DR5B 4JPRA 4NR1A 2W0XA 3E8HA 2CDYA 1GM9A 4EB6B 4CH5A 1M9NA 4J7JA 1K73W 3MD0A 3AEIA 4X20B 1XI1A 2YDEA 2UUAO 3TXQA 2IU0A 4UB6Z 1HW7A 4JZGA 1PL4A 2JVDA 1VQ8V 4DRXA 1GTOA 3JARA 3R66A 1XOUA 2LO1A 1MZFA 4B7EA 2XT9A 3BRCA 1I5YA 4QE7A 1YZBA 2Q67A 1P7GA 4PDMA 4J7KA 1SQGA 1G8MA 4B3RB 2WPDG 4LCUC 4O4JB 4DR2O 4X1IA 1HNXO 1VQ6V 2IJKA 1VIBA 3E86A 1QVGU 3W7WA 3AK3A 3E35A 2Z5UA 1JQ0A 4X64O 4KFMA 4NB5A 4X64B 1S3JA 1Y74B 3MHSC 2IJHA 2EZOA 3CRCA 2AW9A 3ZRXA 2QA4V 4DV5O 1AJNA 4I9WA 1P7BA 4I9QA 1WB8A 2CK3G 1K33A 3HKCB 3CMAV 3OGCC 1E1QG 1VARA 2RDCA 2ZDIC 1AI6A 1I5XA 4Z2WA 2H8PC 2WLJA 4QNHB 4KHPO 3O65A 2QTSA 3C90A 1AI5A 2B1IA 2BE3A 4B3MB 5LGUA 4LF9O 3ETQA 3BAAA 4LF9B 4DV7B 1M93A 2MK3A 1PNMA 1AP6A 3K0GA 2A06H 3VQVA 1I94O 3CC2V 3CWBH 3WG7B 1JA8A 2R9AA 5BY1A 4LFCB 4LWSA 2F23A 4F6EA 1M56B 2BTOA 1WA8A 3OR6C 3L72H 4JI3O 4QJFB 4E2LA 1AR4A 3WB1A 2EINB 3KKYA 2P06A 3E8FA 1ZWIC 1GMGA 4LF6B 2HKOA 2BTQB 2QR4A 3JCZA 2N74A 1JJOA 4U3JB 1IURA 3RT3C 4X62O 3K03A 3RVZA 3OUFA 1XMOO 5EYPB 2ZR3A 3LNNA 3CMEV 5D5PA 4IIJB 1SRYA 1GN3A 1OCCC 4DR6B 3ABKC 1Q5OA 2WAMA 2Z0AA 2UXNA 1T5EA 5CBFA 2ZE5A 4JYAB 4YHHO 2XUMA 4L8JA 2H94A 4UXNA 3ZEDA 4PI0A 4J80A 1JOYA 2OCHA 1SQFA 2B1GA 3KCYA 1GRJA 1SZTA 3E8GA 3JATA 4WBNB 3JD1A 2XAJA 3QO8A 1M57C 3CYOA 1J5EO 5D5QA 1BSMA 3VQWA 5JH7B 1Q90D 2HP8A 1MA1A 3K0DA 3E8BA 1VQOV 2P5OA 2BTQA 3OGIB 4WFHA 2GBOA 1AR1B 2UUAB 2IH1C 2YXYA 1F51A 4YXWG 3F5WC 4K8XA 2IW5A 3HPLC 1BE3H 5J2TB 4I55B 2PI4A 2GTSA 2NNUA 4Q6GA 2KG7B 1QBZA 2WLIB 1WA8B 3J7AU 2QTOA 1VQKV 4L87A 5KLVH 3H9VA 1EN6A 2AGAA 1GH6A 1HNZO 2ZQMA 4IYIA 5C8YB 4EB6A 1VMGA 2WWWA 1X4TA 3RFRA 2CTRA 5B5EZ 3JD0A 4PV1B 5BXZA 2YXLA 4DV3O 4FMTA 3ABMB 3T1CA 5H2FZ 1GN6A 1G4YB 5EBMC 1YTFD 2WLHA 4JI6B 3RYIA 1KQSU 4AHCA 4PDRA 3JSLA 4X9QA 3JCUZ 5JWPA 1QLNA 5BR8B 1EBOA 1M4UA 1ZL8B 1RM1C 3TGUH 1B3QA 1XHXA 2A7WA 4IT5A 4JYCA 2Q9LA 1KKCA 3JAMN 5KHJA 3JD4A 3ZHTA 4J41A 4BW5A 3JSNA 2KG7A 4RQFA 2NN4A 4OX9B 1OHHG 4O4LA 3ETDA 3HKDB 4JI3B 2JGDB 3EFFK 1WNSA 3CCEV 4FFKA 4DUZO 5J2UA 2EJRA 1IBMO 3DXRB 2OIEA 3OTOB 3THOA 4NXNB 3CRRA 3PJSK 2PY5A 4X20A 2P7TC 3WU2Z 2B9ZA 2EIMC 4HAMA 1H38A 1BT8A 1SZXA 4YJ3B 4I4TA 4LF8O 3FB6C 1FAFA 3H1IH 1Q43A 3JAWA 1K8AW 1RSOA 3N27A 1PPJH 2E3CA 3OT7A 3FB7C 5CN0A 3G6BA 3OEHG 4MTOA 4X66O 3ABKB 1N34B 4LWSB 1M56C 1IDSA 2JDIG 3ZMZA 1CP9A 3HKEA 1AILA 4U7NA 4J42A 1LUVA 1XEQA 3K9SA 5DEDA 2OTLV 2XAGA 3S3WA 4UCVA 4JI4B 1V55B 2PUSA 4FIPC 4WFAV 3T1HO 4BR6A 2QWOB 2ZCEA 2RN9A 3CB2A 2OTJV 5BMVA 1FXKC 2B5UA 5IE9A 3X2QC 5LOVB 1VQ9V 1BGYH 4DR3O 1GN4A 1AP5A 5LHIA 2LFSA 3GVMA 5KAFZ 1JX9A 1PL0A 1VQLV 1NVPD 2AXTZ 3ML0A 4PA6A 1KYOF 3AG3B 5CA1B 4RQEA 3OUSA 3P3PA 2F4VB 3QVNA 1N33O 3CRQA 2ZE8A 1AVMA 3K06A 2XAHA 1XREA 3ZMVA 3D36C 4ZBMA 2YICA 2DWEC 1NQTA 4X1YB 4P9PA 4O4IB 2HVKC 3ZRSA 4MW8A 3VOUA 2BSKB 2Q6AA 1YI2V 1N36B 3B09A 1HNXB 3B8NA 2M6YA 5CMUA 4DXWA 2FKXA 4TWKA 1SC5B 1FKAO 2MW2B 2YIDA 4B3MO 1DGSA 3BHPA 4X8AA 3E2EA 3U0ZA 1WJZA 4MVOA 1VF5B 4DR7B 4KP4A 2DWDC 1I94B 1XUQA 1S0VA 2Q0AA 4DR1O 1ZL8A 3LSQA 3AG1B 1K4CC 2QSAA 1IBKB 2AHYA 3B77A 4TUYA 3P3NA 2ZE7A 4QE9A 1YXBA 2E76B 1BHAA 2UU9O 4DV6O 2R70A 2E75B 4AQYB 3LDDA 3HKCA 5KX5B 2IJIA 2JJ1G 2JS3A 1VF7A 3VQXA 4EEQA 5HFLA 2F43G 4LFCO 2OCCB 2HHHB 1TVKA 3RN4A 2RNBA 3ZMUA 3SGIA 4DR4O 3LNMB 3QO5A 2Q68A 1US6A 4JI5O 4JAUA 2A79B 4X66B 1O9GA 3RBZA 4H13B 4NKGB 1K9MW 3ZHUA 4FM0A 1K92A 2YIAA 1EFRG 3DTUB 3B40A 3KCXA 1AI7A 2GSMB 3G80A 4FM1A 4U7OA 5KHIA 1J5EB 5LMUO 3ZMTA 3LSUA 1Y6XA 4DR6O 3OR7C 3E89A 1LR1A 1FPOA 4LH6A 3CE2A 4LF5O 3CCLV 1SA0A 2XTAA 2UXBO 2Q7HA 1K3EA 2ZD9A 3C3SA 1IBLO 2E5LO 2CH7A 1FXVA 2GTAA 1YSCA 1YHQV 1MSDA 3LDCA 3EVKA 3IAYA 4ZOLA 3M8AA 3E83A 5BMVB 3G4SV 2O57A 1F23A 5KHHA 1QNMA 3H1KH 5H9CA 1EZVH 1TGOA 4HNAB 1YTFB 1S72V 4R8CA 4WCEV 3U10A 1SETA 5E1AC 4DV2O 2WLIA 4GKKO 5LA6A 2AHZA 1XL4A 4H33A 4KL1A 3AK1A 3JAKA 2VWKA 3HB3B 4JI0B 4TSFG 4JI0O 1SKVA 3ETEA 4U3FH 1QLEB 1YJNV 2IBZH 4JTAB 1HNWO 1NT2B 4O2BB 3T2MA 3AG4C 1AI4A 1BL8A 4JI6O 1EN5A 4GX0A 3DC6A 3Q4HB 4F6RB 1ZAUA 5J9PC 4RO2A 3D3QA 4GKJO 1Q81W 3I56V 1H2NA 1NTZH 4NTXA 3BY6A 5KMGA 1MSWD 2FL4A 1NS1A 4JZ2A 1M90W 1QQCA 2LFRA 1FS0G 2DYSC 4DR1B 3ZMSA 4MTFA 3QF7A 4G27B 1EN4A 4FLUA 4O4HB 2YC0A 4WFBV 2ZKOA 1KUQA 4IHJA 4OX9O 4NVPA 4R6ZA 4GX1A 4R50A 1JFFB 1KECA 2CTPA 3OTOO 3N2GB 2ZXWB 5A9GA 3F5TA 3FFQA 1W59A 2UUCO 4LNUB 4MVSA 4JI2B 2LW1A 2ZINA 2V4DA 3B4SA 4YY3B 5L3EA 2F66C 4GUNA 2Q5ZA 4W4LA 3K59A 2KQXA 4LFBB 5LGNA 5B1AC 5IYCO 3L70H 3TJTA 4E4EA 5LMNB 3L71H 4DK0A 4J9YB 3T1YB 2VWJA 1OCZB 2DYRB 2QKCA 2X7RB 4H0LB 4ZHQA 1JPXA 1VEWA 4PD4F 4PELA 1ZLZA 2PF4E 2YEVA 3GWKC 4X65O 5B3SC 2EBOA 2WLLB 4UFZA 4JI7O 1H2SB 3SYOA 4FZ0A 1S76D 2IM9A 2X6BA 5B66Z 3SYPA 4LF5B 2KB1A 1Z5VA 2Q69A 2P4KA 2Q4PA 5LGTA 2CAZC 1Q86W 4OPHA 3GWOA 2JK5C 2UXDO 4QGPA 2DN9A 3WFVA 4PDVA 2LJ2A 1K4DC 1OCRC 1P84F 3IGAC 2CTWA 4PA9A 4O2AB 4DV4B 3RYCA 1PNLA 5IT9N 4UVBA 1CXZB 2YXHA 4RUFA 5LXTB 2JGUA 5LL6Y 1FFTB 3ZS8C 2DJVA 2DQ3A 2W0FC 3B2EE 4NTWA 2EINC 1HWYA 3M99B 3BPZA 5LA6B 4Z1MG 3ZRVA 3K5NA 2QM4A 4BWAA 1G6UA 2P67A 1B6QA 2CE4A 2WLKA 2YIBD 5JQGB 3RYHB 1FJGB 3HKBB 4DUYB 1GM8A 3ICXA 4TV9B 4NXMB 1O9HA 2N04A 4ZOLB 4XDKA 3ASNB 2HVJC 4O4JA 5FLXN 4CS4A 2HJFC 3FB5C 3IFXA 5B1AB 3WB2A 5CA0B 3CPWU 2KKWA 1JR9A 1N32B 1DF5A 3SJBC 4JI8O 1XMQO 1IBKO 1N36O 4K8ZA 5F2VO 5GONB 3L73H 3AG2B 4JI1O 3ZHSA 3K08A 4BIUA 3FAVA 5B1NA 5IJ9A 2AZ2A 1MZEA 3Q4HA 3UT5A 3IJ4A 2OIGA 5DECA 2QEXV 4RAIA 5KHGA 3CCUV 3OE7G 4GYCB 3T4ZA 3A0BZ 1PV0A 2ILMA 1OV9A 2GUZB 3CCMV 2UXXA 2CH7B 3SPHA 2K1EA 3JAKB 4BW9A 1WN7A 4FLZA 5TISZ 2GDSA 5KA6A 4DW1A 3AK2A 5EYPA 2RJZA 1D2DA 4B08A 4I0XA 5GTHZ 2K9PA 3K5MA 1XNRB 1PKXA 4X1IB 2Y69B 2R9IA 3QNEA 3TETA 4D7TA 3ABUA 5BZBA 4JI4O 3HKBA 1F4MA 2ZNIA 1K97A 4OXSA 4XDLA 1V55C 1XDCA 2H3OA 3T4DA 5IWAO 5H5NA 1R6NA 2JEUA 4MVMA 3JALA 1Z5WA 2YIBA 2A0LA 2GUZA 1AJQA 1RM1B 1DF4A 2WLLA 4DV0O 1NI8A 2ZT9B 4PDLA 3OMIB 1D5AA 3N2KA 3BA8A 2HR3A 5L3DA 2NLJC 2QKAA 1YITV 1OCCB 5C8YA 4G28B 5L3FA 4CS2A 2HEPA 4MW3A 3UT5B 4LH7A 4JYYA 5CBHA 2Y0IA 3UO3A 4B3SO 4B3SB 1Y67A 3AG2C 2DE0X 4IHJB 1VQPV 1YCIA 5IYZB 2PZSA 5LBQA 3ABLC 2PGGA 2ARHA 5C93A 1DLBA 3SYQA 4UCTA 5EC1C 2VQFO 2ZXWC 4MTXA 3CD6V 3ABMC 1G1XB 4C7UA 4J7ZA 1VQ5V 1BMFG 1RP3B 1VQ7V 1W0JG 1ORQC 3UO2A 1H8HG 1BCCH 4PA3A 5LHHA 1UPGA 1H8EG 4W4KA 1ZX3A 3SPCA 3JYCA 4QPKA 4GCZA 1SA0B 3D3IA 4DYLA 3AG1C 3DC5A 1ENVA 3W7UA 1OCZC 2DYRC 3IC7A 2N05A 2VS0A 5BR8O 1KMIZ 4DV1O 4YIOA 2QE7G 1PNKA 4F6RA 5IY5C 4R7CA 2ODMA 3ETGA 4MVQA 1KU9A 3SJCC 2PI5A 4GX2A 1NTKH 1PP9H 1Q6IA 4TV8B 3CX5F 2EIKB 3H1LH 4QPJA 4JI2O 2OCCC 2DOSA 4UV8A 1FXHA 4MVRA 5EBLC 1R3LC 4BIOA 1H2KA 3CSXA 3CJHB 4Z1VA 1Y74A 1MMMA 4O4HA 4EFEA 1RPRA 2ETNA 2EX3A 1R3KC 4ZIBA 1IBMB 4LNUA 5JVDA 5LP6B 1Q6UA 2UXCB 3ZIAG 3QO7A 1SQPH 2UUCB 3N2GA 3UKMA 5GTIZ 3B8MA 4LFAO 2WLMA 2XAQA 2ITDC 1A32A 4DR4B 2IJJA 5ITZA 4X88A 1SQVH 1GM7A 2FTKA 3K5LA 2QWNB 1IX9A 2WLNA 2UXBB 4I5SA 1MOFA 3JALB 2ADPA 5AG2A 1H2LA 1I0HA 3ZJZA 1RSOB 3STLC 3T1YO 2EZPA 2JEXA 2DQ0A 4RUEA 5B1BC 1TUEB 4UCSA 1U97A 2RQ6A 2EILB 4JTDB 4I7ZB 1OJHA 1MNGA 3HKEB 4EKWA 5L3GA 3APOA 4P30A 2PYJA 1BQZA 4I50A 4O2BA 1NZ6A 3G71V 4KXRA 1S5JA 4P2ZA 1R6KA 1GK9A 3BCCH 3L75H 3UM7A 2ZM6B 1GN2A 4PA4A 2F93B 2VQFB 1KBHA 2KSDA 1S77D 5L3BA 2YI8A 1D5NA 3K3WA 2F4VO 1FXKB 4ABMA 3QTCA 4FM2A 3D8CA 5KX5A 1XILA 3KG2A 2CGOA 1COWG 3N2KB 3JATB 2M7WA 4WBNA 2D3OW 1LNQA 4ZI7B 3ASOB 5EZYB 3ZX6A 5A2QN 2V7QG 4UVCA 5LOVA 4FJCC 4MVUA 5K1XA 4ZKIA 2VQEB 5CA0A 4KHPB 2Y69C 2BCCH 1MG1A 2Q0OC 4DV7O 3BABA 1E1RG 3A2FA 4UCRA 3CRMA 4TV9A 3L74H 3FD9A 3F7YC 1R3IC 3H1JH 4PI2A 1NBMG 2WA4A 2L6LA 3RVYA 3OTFA 1IVSA 4FVMA 3DGEA 2F95B 1JFFA 4I0XB 3OMNB 2XAFA 3G6EV 4FPPA 2Y4TA 4JAVA 3K57A 1VF6C 4TQFA 4ZI7A 1UFIA 3BVOA 4NTYA 4DRXB 2WSSG 4LFBO 1TAEA 4DV6B 1WB7A 2ZIMA 3MDSA 3APQA 3ZN0A 2QM8A 4RWUA 3CCRV 1R6TA 2Z3YA 3U11A 3FAVB 5IJ9B 3CP1A 4LFAB 2QJ1A 1AB3A 5LP6C 2YI9A 5IY5B 4JI7B 3RYFA 2ATKC 2HHHO 2JIZG 5GONA 3CRAA 3JASA 3BA9A 2Q73A 1CPYA 1GO3F 3ABLB 4G2KA 1N0JA 4HNAA 1PM9A 2CTQA 2QKSA 3NXSA 2OWOA 2E74B 3OEEG 2ADQB 4CS3A 3H1HH 1U96A 1WP8A 2R72A 1H2MA 2QM7A 3ABTA 1SQXH 1Q82W 2A3QA 2OT5A 5LP6A 4CC5A 1VQMV 3G67A 3MAQA 3FB8C 3IC9A 1YVWA 1URFA 1XQ8A 5IDJA 3H01A 4DW0A 1SF9A 2EIJC 4JGSA 3R65A 3SYAA 3OD4A 4UCOA 1XNQO 1WLEA 4LF4B 3MHHC 1QVFU 1M57B 3CJHA 1RFYA 2QGNA 2XASA 3ZN1A 2UUBO 4H44B 3OM3B 3JAWB 3TXSA 2RMKB 1V54C 1N8RW 1E79G 4F4LA 1FYJA 2XNDG 3LSSA 4B3RO 3K04A 4GZRB 4XBFA 1FJGO 5EC2C 1N33B 5JJJB 3AG4B 1WP7A 4NXMO 2R9RB 4O2AA 5IYBO 1ZSPA 2CGNA 1JMKC 2QDOA 2BOBC 3RGBA 1SS3A 3TK1A 1VQNV 2NR5A 3ASNC 3W7XA 2HG5C 3FYIB 4P9OA 4OPAA 4DV5B 3J80N 5JJNB 2OYQA 3C3TA 1N32O 3BFRA 1VF6A 1HNWB 1XHZA 2ZIOA 3JASB 4CH3A 4UUJC 2DYSB 1YJWV 1KD1W 4N23A 5LHGA 3QG5A 3EXAA 2C2AA 5IYDO 3D36A 3F7VC 4GKJB 4FK5C 3M7MX 1BS3A 5JQGA 4FFBA 2RCVA 3CXCU 1IXMA 4Q20A 2F1MA 1NKDA 1Y66A 4UCUA 4QIWF 2X0LA 3O9OA 4J9ZB 4LF7B 3DXRA 2EJ7A 4LF7O 4HYOA 4JI8B 3NR7A
chains in the Genus database with same CATH topology
1XEQA 5BXZA 4DV2O 4DV3O 4GKKO 5A2QN 2UUAO 3T1HO 4JI8O 2UU9O 4DV6O 2N74A 1XMQO 4X65O 1IBKO 1N36O 3RT3C 4X62O 4JI0O 4JI7O 4B3SO 3R66A 1XMOO 1HNWO 4LF6O 4LFAO 4JI1O 1XNQO 4DR3O 2UXCO 1A32A 4JI6O 1R1BA 4DV7O 1YZBA 4K0KO 4LFCO 2UUBO 2Z0AA 4OPHA 2VQFO 4GKJO 4YHHO 4DR2O 4DR4O 4JV5O 1HNXO 1G1XB 2LW7A 3JAMN 3J81N 1HR0O 1NS1A 4JI5O 2UXDO 1FYJA 1X59A 4B3RO 4DR7O 4X64O 1FJGO 1N33O 3T1YO 4NXMO 4DV4O 5IT9N 4DV5O 1D2DA 1J5EO 5LL6Y 1DK1A 1N34O 4AQYO 2VQEO 4DUZO 1XNRO 2DJVA 4LFBO 2ZKOA 1IBMO 1KUQA 4OX9O 4OPAA 5LMUO 3J80N 4DR6O 1N32O 4KHPO 3O65A 4JI4O 1R6TA 3OTOO 5BR8O 4LF5O 3F5TA 4DV1O 1AB3A 4LF8O 4LF9O 5IWAO 5H5NA 2UUCO 2UXBO 2HHHO 2FKXA 1IBLO 2E5LO 3J7AU 1FKAO 4DR5O 4JYAO 1I94O 2JRIA 4B3MO 4LF4O 2AGAA 4DUYO 1HNZO 4YY3O 5BY1A 4X66O 3M8AA 4DV0O 4JI2O 2F4VO 2ZM6O 2DOSA 3SDLA 4B3TO 4LF7O 1AILA 5FLXN 4DR1O 4NXNO 4JI3O 5LMNO 1F7YA 4A5UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEQ A;  5BXZ A;  4DV2 O;  4DV3 O;  4GKK O;  5A2Q N;  2UUA O;  3T1H O;  4JI8 O;  2UU9 O;  4DV6 O;  2N74 A;  1XMQ O;  4X65 O;  1IBK O;  1N36 O;  3RT3 C;  4X62 O;  4JI0 O;  4JI7 O;  4B3S O;  3R66 A;  1XMO O;  1HNW O;  4LF6 O;  4LFA O;  4JI1 O;  1XNQ O;  4DR3 O;  2UXC O;  1A32 A;  4JI6 O;  1R1B A;  4DV7 O;  1YZB A;  4K0K O;  4LFC O;  2UUB O;  2Z0A A;  4OPH A;  2VQF O;  4GKJ O;  4YHH O;  4DR2 O;  4DR4 O;  4JV5 O;  1HNX O;  1G1X B;  2LW7 A;  3JAM N;  3J81 N;  1HR0 O;  1NS1 A;  4JI5 O;  2UXD O;  1FYJ A;  1X59 A;  4B3R O;  4DR7 O;  4X64 O;  1FJG O;  1N33 O;  3T1Y O;  4NXM O;  4DV4 O;  5IT9 N;  4DV5 O;  1D2D A;  1J5E O;  5LL6 Y;  1DK1 A;  1N34 O;  4AQY O;  2VQE O;  4DUZ O;  1XNR O;  2DJV A;  4LFB O;  2ZKO A;  1IBM O;  1KUQ A;  4OX9 O;  4OPA A;  5LMU O;  3J80 N;  4DR6 O;  1N32 O;  4KHP O;  3O65 A;  4JI4 O;  1R6T A;  3OTO O;  5BR8 O;  4LF5 O;  3F5T A;  4DV1 O;  1AB3 A;  4LF8 O;  4LF9 O;  5IWA O;  5H5N A;  2UUC O;  2UXB O;  2HHH O;  2FKX A;  1IBL O;  2E5L O;  3J7A U;  1FKA O;  4DR5 O;  4JYA O;  1I94 O;  2JRI A;  4B3M O;  4LF4 O;  2AGA A;  4DUY O;  1HNZ O;  4YY3 O;  5BY1 A;  4X66 O;  3M8A A;  4DV0 O;  4JI2 O;  2F4V O;  2ZM6 O;  2DOS A;  3SDL A;  4B3T O;  4LF7 O;  1AIL A;  5FLX N;  4DR1 O;  4NXN O;  4JI3 O;  5LMN O;  1F7Y A;  4A5U B; 
#chains in the Genus database with same CATH topology
 2X6A A;  5FNV B;  2ZNJ A;  2JS5 A;  3CS5 A;  4CH6 A;  3KZI Z;  1K7D A;  1M1K W;  1KB9 F;  4DV1 B;  2P4V A;  1EZJ A;  1THZ A;  5EBW C;  3ZHR A;  4LF6 O;  2EUL A;  1GAX A;  2UXC O;  2BSK A;  4X62 B;  4TQD A;  3UCS C;  3RW0 A;  2V1D A;  4K0K O;  1XMO B;  3FKS G;  5CB4 A;  4HZ3 A;  4B7K A;  2YUA A;  1FFX B;  4H37 A;  1UJW B;  1L8D A;  3E22 A;  1HR0 O;  4TT3 G;  2QWQ B;  5JVD B;  5EK0 A;  5JCO A;  4ICG A;  5FPO A;  3RYI B;  2WA3 A;  5KHK A;  1XL6 A;  2P22 C;  1QU7 A;  5FPR A;  1TA8 A;  3RYF B;  4FLW A;  1NJI W;  2ZR2 A;  5E79 Z;  1K34 A;  1JJ2 U;  3L9D A;  3FYE B;  4WFG A;  3T1H B;  4WFF A;  5KMG B;  4FLY A;  3RWR D;  3ZCC A;  4U3J A;  1NH2 D;  1OCR B;  3ASO C;  1F4N A;  5KAI Z;  4YIP A;  4CBC A;  1XNQ B;  1XBL A;  4DR3 B;  1BZK A;  3FX7 A;  2VRZ A;  2JJ2 G;  5KUK A;  5JCO C;  5H6Q A;  2UUB B;  1PD3 A;  2EIJ B;  4DR5 O;  4CC6 A;  1YEW A;  4BIZ A;  4PHZ A;  1SQB H;  1WPB A;  1AR5 A;  3ZHQ A;  4K35 A;  2ZM6 O;  4OGQ B;  3K9A A;  2X6C A;  1P4R A;  3A0H Z;  1Z2G A;  1SES A;  3JD3 A;  1L0N H;  1V54 B;  3CHX A;  1KP2 A;  1TUB B;  2EIM B;  5GW7 A;  4XDJ A;  3VBB A;  2DMX A;  4GKK B;  2HFE C;  1Q3E A;  1RPO A;  4DV2 B;  4GLX A;  2AZ0 A;  3OW2 U;  1M5I A;  4O4L B;  4HBN A;  2IU3 A;  4JTC B;  4PA7 A;  3I5D A;  1BHB A;  4FLT A;  4IYH A;  4J10 A;  1KP3 A;  1R1B A;  2W6J G;  3OFN G;  1QCE A;  2ZE6 A;  4YJ2 A;  3SYC A;  1N0N A;  5CB4 B;  4WF9 V;  4ZHQ B;  1NR1 A;  2YEV B;  4X1K A;  2D2C B;  2L35 A;  2QWR B;  4DR7 O;  5B1O A;  3HR0 A;  2FML A;  5HFM A;  5LXT A;  1V9P A;  2JGD A;  4I50 B;  3OAA G;  1R73 A;  1DK1 A;  4X1Y A;  2VQE O;  3AG7 A;  2QWP B;  4LC1 A;  2ZDI A;  5KA5 A;  2Q8V A;  4N21 A;  3SR2 C;  2UU9 B;  1EM1 A;  4LBE C;  1Y76 A;  4X89 A;  1TVK B;  1AJP A;  4JI1 B;  1FD9 A;  3SPJ A;  1NVP B;  3CCV V;  2W6I G;  3CC4 V;  3LUT B;  2PYL A;  2CUG A;  2ITC C;  1VQ4 V;  4K0K B;  5CA1 A;  5KUM A;  5H6R A;  4ASU G;  1NR7 A;  3CEI A;  3I55 V;  4TOI A;  4J11 A;  3JAR B;  1GKF A;  4YY3 O;  3ZRW A;  1HR0 B;  3ZBH A;  2Q7G A;  5IJ0 B;  1K5S A;  1OCO C;  4NXN O;  4JAA A;  1SER A;  5LMN O;  1N34 O;  1F7Y A;  4A5U B;  3S3X A;  3CCQ V;  3W7T A;  4EFB A;  4UV9 A;  2FB5 A;  1SQQ H;  2G38 A;  1ZTE A;  1Q6H A;  2Y4U A;  3TCU A;  3WB0 A;  4YJ2 B;  4X65 B;  1IXB A;  1ROP A;  3VQY A;  3W7S A;  3P30 A;  1L1F A;  4KUM A;  2Q7E A;  1QHT A;  4JF3 A;  4IGG A;  5J2T A;  5CA3 A;  2YSU B;  4MVZ A;  1KKD A;  2HJD A;  4O4I A;  3CCJ V;  4D7S A;  2E5L B;  5IYZ A;  1YF2 A;  3PN1 A;  3SJQ C;  1B06 A;  1LUW A;  1FFX A;  3ZRW B;  2LW7 A;  3JD2 A;  3E22 B;  2UXD B;  5JH7 A;  4DV0 B;  1I7F A;  3P32 A;  1NU1 H;  1QLE C;  4X1K B;  1TUB A;  5EIB C;  1QR9 A;  1S5L Z;  3SPG A;  1HNZ B;  4DV4 O;  4D6T H;  2DW4 A;  2EIK C;  2LQT A;  3X2Q B;  5L3C A;  2Y48 A;  4BAY A;  4CZZ A;  5DM6 V;  3DSQ A;  3STZ C;  4LR3 A;  5IJ0 A;  2GHY A;  4FLX A;  3LDE A;  5JJE B;  5FNV A;  4WFE A;  3HKD A;  1H2G A;  4GT1 A;  4TUY B;  4DV3 B;  5FL7 G;  2P6J A;  1K5Q A;  4IL6 Z;  3AG3 C;  3UQ8 A;  1S5H C;  1IZ3 A;  5DN6 G;  3A0R A;  4FFB B;  1R3J C;  1MAB G;  4DR2 B;  2JRI A;  2GV9 A;  3WG7 C;  3K5O A;  2A9H A;  5ITZ B;  4DUY O;  2YS8 A;  1CEZ A;  3CC7 V;  4UB8 Z;  4B3T B;  2FYU H;  3SDL A;  4DK1 A;  4B3T O;  1OCO B;  1Y4M A;  5K1P A;  3RYC B;  1WPX A;  1YJ9 V;  4JAS A;  2P90 A;  4FZ1 A;  4MSW C;  2LP7 A;  1NTM H;  5EZY A;  4AI8 A;  1OZ0 A;  3GB7 C;  3K79 A;  1JCH A;  3OMA B;  5B1B B;  1XMQ B;  1DTO A;  2EIL C;  3ZHV A;  3EHB B;  3SJA C;  4DUZ B;  1B04 A;  4NYK A;  3RYH A;  2IH3 C;  1Q7Y W;  4YJ3 A;  4AIL C;  1NH2 B;  4I4T B;  1ZUQ A;  2XOK G;  1Q8I A;  4GX5 A;  4MT8 A;  4CH4 A;  1W2B U;  1I08 A;  1P49 A;  2XHB A;  4LF8 B;  4JV5 O;  4JV5 B;  3J81 N;  1ARO P;  1KC8 W;  4MTG A;  1HP8 A;  5B3S B;  5CBG A;  3A8T A;  4UVA A;  1X59 A;  5J2U B;  2BOC C;  4MS2 A;  5EIB D;  1J95 A;  4IIJ A;  4JI5 B;  1FXK A;  1L0L H;  1BQ0 A;  4AQY O;  2PTM A;  2LGQ A;  1XNR O;  1W0K G;  5LYJ A;  4DO2 A;  1VP7 A;  3BEH A;  1N4C A;  3CXH F;  4K3A A;  1YIJ V;  4PJ0 Z;  1Y76 B;  2HLD G;  5LYJ B;  4I55 A;  3CCS V;  5LMU B;  5IWA B;  1JVM A;  4TV8 A;  4JYA O;  3K58 A;  4YHH B;  1YDX A;  1WAZ A;  2Y0P A;  4LF4 O;  1HDJ A;  2LGW A;  4FLV A;  1IBL B;  3SPI A;  4LP8 A;  1QR8 A;  4JYB A;  4DR5 B;  4JPR A;  4NR1 A;  2W0X A;  3E8H A;  2CDY A;  1GM9 A;  4EB6 B;  4CH5 A;  1M9N A;  4J7J A;  1K73 W;  3MD0 A;  3AEI A;  4X20 B;  1XI1 A;  2YDE A;  2UUA O;  3TXQ A;  2IU0 A;  4UB6 Z;  1HW7 A;  4JZG A;  1PL4 A;  2JVD A;  1VQ8 V;  4DRX A;  1GTO A;  3JAR A;  3R66 A;  1XOU A;  2LO1 A;  1MZF A;  4B7E A;  2XT9 A;  3BRC A;  1I5Y A;  4QE7 A;  1YZB A;  2Q67 A;  1P7G A;  4PDM A;  4J7K A;  1SQG A;  1G8M A;  4B3R B;  2WPD G;  4LCU C;  4O4J B;  4DR2 O;  4X1I A;  1HNX O;  1VQ6 V;  2IJK A;  1VIB A;  3E86 A;  1QVG U;  3W7W A;  3AK3 A;  3E35 A;  2Z5U A;  1JQ0 A;  4X64 O;  4KFM A;  4NB5 A;  4X64 B;  1S3J A;  1Y74 B;  3MHS C;  2IJH A;  2EZO A;  3CRC A;  2AW9 A;  3ZRX A;  2QA4 V;  4DV5 O;  1AJN A;  4I9W A;  1P7B A;  4I9Q A;  1WB8 A;  2CK3 G;  1K33 A;  3HKC B;  3CMA V;  3OGC C;  1E1Q G;  1VAR A;  2RDC A;  2ZDI C;  1AI6 A;  1I5X A;  4Z2W A;  2H8P C;  2WLJ A;  4QNH B;  4KHP O;  3O65 A;  2QTS A;  3C90 A;  1AI5 A;  2B1I A;  2BE3 A;  4B3M B;  5LGU A;  4LF9 O;  3ETQ A;  3BAA A;  4LF9 B;  4DV7 B;  1M93 A;  2MK3 A;  1PNM A;  1AP6 A;  3K0G A;  2A06 H;  3VQV A;  1I94 O;  3CC2 V;  3CWB H;  3WG7 B;  1JA8 A;  2R9A A;  5BY1 A;  4LFC B;  4LWS A;  2F23 A;  4F6E A;  1M56 B;  2BTO A;  1WA8 A;  3OR6 C;  3L72 H;  4JI3 O;  4QJF B;  4E2L A;  1AR4 A;  3WB1 A;  2EIN B;  3KKY A;  2P06 A;  3E8F A;  1ZWI C;  1GMG A;  4LF6 B;  2HKO A;  2BTQ B;  2QR4 A;  3JCZ A;  2N74 A;  1JJO A;  4U3J B;  1IUR A;  3RT3 C;  4X62 O;  3K03 A;  3RVZ A;  3OUF A;  1XMO O;  5EYP B;  2ZR3 A;  3LNN A;  3CME V;  5D5P A;  4IIJ B;  1SRY A;  1GN3 A;  1OCC C;  4DR6 B;  3ABK C;  1Q5O A;  2WAM A;  2Z0A A;  2UXN A;  1T5E A;  5CBF A;  2ZE5 A;  4JYA B;  4YHH O;  2XUM A;  4L8J A;  2H94 A;  4UXN A;  3ZED A;  4PI0 A;  4J80 A;  1JOY A;  2OCH A;  1SQF A;  2B1G A;  3KCY A;  1GRJ A;  1SZT A;  3E8G A;  3JAT A;  4WBN B;  3JD1 A;  2XAJ A;  3QO8 A;  1M57 C;  3CYO A;  1J5E O;  5D5Q A;  1BSM A;  3VQW A;  5JH7 B;  1Q90 D;  2HP8 A;  1MA1 A;  3K0D A;  3E8B A;  1VQO V;  2P5O A;  2BTQ A;  3OGI B;  4WFH A;  2GBO A;  1AR1 B;  2UUA B;  2IH1 C;  2YXY A;  1F51 A;  4YXW G;  3F5W C;  4K8X A;  2IW5 A;  3HPL C;  1BE3 H;  5J2T B;  4I55 B;  2PI4 A;  2GTS A;  2NNU A;  4Q6G A;  2KG7 B;  1QBZ A;  2WLI B;  1WA8 B;  3J7A U;  2QTO A;  1VQK V;  4L87 A;  5KLV H;  3H9V A;  1EN6 A;  2AGA A;  1GH6 A;  1HNZ O;  2ZQM A;  4IYI A;  5C8Y B;  4EB6 A;  1VMG A;  2WWW A;  1X4T A;  3RFR A;  2CTR A;  5B5E Z;  3JD0 A;  4PV1 B;  5BXZ A;  2YXL A;  4DV3 O;  4FMT A;  3ABM B;  3T1C A;  5H2F Z;  1GN6 A;  1G4Y B;  5EBM C;  1YTF D;  2WLH A;  4JI6 B;  3RYI A;  1KQS U;  4AHC A;  4PDR A;  3JSL A;  4X9Q A;  3JCU Z;  5JWP A;  1QLN A;  5BR8 B;  1EBO A;  1M4U A;  1ZL8 B;  1RM1 C;  3TGU H;  1B3Q A;  1XHX A;  2A7W A;  4IT5 A;  4JYC A;  2Q9L A;  1KKC A;  3JAM N;  5KHJ A;  3JD4 A;  3ZHT A;  4J41 A;  4BW5 A;  3JSN A;  2KG7 A;  4RQF A;  2NN4 A;  4OX9 B;  1OHH G;  4O4L A;  3ETD A;  3HKD B;  4JI3 B;  2JGD B;  3EFF K;  1WNS A;  3CCE V;  4FFK A;  4DUZ O;  5J2U A;  2EJR A;  1IBM O;  3DXR B;  2OIE A;  3OTO B;  3THO A;  4NXN B;  3CRR A;  3PJS K;  2PY5 A;  4X20 A;  2P7T C;  3WU2 Z;  2B9Z A;  2EIM C;  4HAM A;  1H38 A;  1BT8 A;  1SZX A;  4YJ3 B;  4I4T A;  4LF8 O;  3FB6 C;  1FAF A;  3H1I H;  1Q43 A;  3JAW A;  1K8A W;  1RSO A;  3N27 A;  1PPJ H;  2E3C A;  3OT7 A;  3FB7 C;  5CN0 A;  3G6B A;  3OEH G;  4MTO A;  4X66 O;  3ABK B;  1N34 B;  4LWS B;  1M56 C;  1IDS A;  2JDI G;  3ZMZ A;  1CP9 A;  3HKE A;  1AIL A;  4U7N A;  4J42 A;  1LUV A;  1XEQ A;  3K9S A;  5DED A;  2OTL V;  2XAG A;  3S3W A;  4UCV A;  4JI4 B;  1V55 B;  2PUS A;  4FIP C;  4WFA V;  3T1H O;  4BR6 A;  2QWO B;  2ZCE A;  2RN9 A;  3CB2 A;  2OTJ V;  5BMV A;  1FXK C;  2B5U A;  5IE9 A;  3X2Q C;  5LOV B;  1VQ9 V;  1BGY H;  4DR3 O;  1GN4 A;  1AP5 A;  5LHI A;  2LFS A;  3GVM A;  5KAF Z;  1JX9 A;  1PL0 A;  1VQL V;  1NVP D;  2AXT Z;  3ML0 A;  4PA6 A;  1KYO F;  3AG3 B;  5CA1 B;  4RQE A;  3OUS A;  3P3P A;  2F4V B;  3QVN A;  1N33 O;  3CRQ A;  2ZE8 A;  1AVM A;  3K06 A;  2XAH A;  1XRE A;  3ZMV A;  3D36 C;  4ZBM A;  2YIC A;  2DWE C;  1NQT A;  4X1Y B;  4P9P A;  4O4I B;  2HVK C;  3ZRS A;  4MW8 A;  3VOU A;  2BSK B;  2Q6A A;  1YI2 V;  1N36 B;  3B09 A;  1HNX B;  3B8N A;  2M6Y A;  5CMU A;  4DXW A;  2FKX A;  4TWK A;  1SC5 B;  1FKA O;  2MW2 B;  2YID A;  4B3M O;  1DGS A;  3BHP A;  4X8A A;  3E2E A;  3U0Z A;  1WJZ A;  4MVO A;  1VF5 B;  4DR7 B;  4KP4 A;  2DWD C;  1I94 B;  1XUQ A;  1S0V A;  2Q0A A;  4DR1 O;  1ZL8 A;  3LSQ A;  3AG1 B;  1K4C C;  2QSA A;  1IBK B;  2AHY A;  3B77 A;  4TUY A;  3P3N A;  2ZE7 A;  4QE9 A;  1YXB A;  2E76 B;  1BHA A;  2UU9 O;  4DV6 O;  2R70 A;  2E75 B;  4AQY B;  3LDD A;  3HKC A;  5KX5 B;  2IJI A;  2JJ1 G;  2JS3 A;  1VF7 A;  3VQX A;  4EEQ A;  5HFL A;  2F43 G;  4LFC O;  2OCC B;  2HHH B;  1TVK A;  3RN4 A;  2RNB A;  3ZMU A;  3SGI A;  4DR4 O;  3LNM B;  3QO5 A;  2Q68 A;  1US6 A;  4JI5 O;  4JAU A;  2A79 B;  4X66 B;  1O9G A;  3RBZ A;  4H13 B;  4NKG B;  1K9M W;  3ZHU A;  4FM0 A;  1K92 A;  2YIA A;  1EFR G;  3DTU B;  3B40 A;  3KCX A;  1AI7 A;  2GSM B;  3G80 A;  4FM1 A;  4U7O A;  5KHI A;  1J5E B;  5LMU O;  3ZMT A;  3LSU A;  1Y6X A;  4DR6 O;  3OR7 C;  3E89 A;  1LR1 A;  1FPO A;  4LH6 A;  3CE2 A;  4LF5 O;  3CCL V;  1SA0 A;  2XTA A;  2UXB O;  2Q7H A;  1K3E A;  2ZD9 A;  3C3S A;  1IBL O;  2E5L O;  2CH7 A;  1FXV A;  2GTA A;  1YSC A;  1YHQ V;  1MSD A;  3LDC A;  3EVK A;  3IAY A;  4ZOL A;  3M8A A;  3E83 A;  5BMV B;  3G4S V;  2O57 A;  1F23 A;  5KHH A;  1QNM A;  3H1K H;  5H9C A;  1EZV H;  1TGO A;  4HNA B;  1YTF B;  1S72 V;  4R8C A;  4WCE V;  3U10 A;  1SET A;  5E1A C;  4DV2 O;  2WLI A;  4GKK O;  5LA6 A;  2AHZ A;  1XL4 A;  4H33 A;  4KL1 A;  3AK1 A;  3JAK A;  2VWK A;  3HB3 B;  4JI0 B;  4TSF G;  4JI0 O;  1SKV A;  3ETE A;  4U3F H;  1QLE B;  1YJN V;  2IBZ H;  4JTA B;  1HNW O;  1NT2 B;  4O2B B;  3T2M A;  3AG4 C;  1AI4 A;  1BL8 A;  4JI6 O;  1EN5 A;  4GX0 A;  3DC6 A;  3Q4H B;  4F6R B;  1ZAU A;  5J9P C;  4RO2 A;  3D3Q A;  4GKJ O;  1Q81 W;  3I56 V;  1H2N A;  1NTZ H;  4NTX A;  3BY6 A;  5KMG A;  1MSW D;  2FL4 A;  1NS1 A;  4JZ2 A;  1M90 W;  1QQC A;  2LFR A;  1FS0 G;  2DYS C;  4DR1 B;  3ZMS A;  4MTF A;  3QF7 A;  4G27 B;  1EN4 A;  4FLU A;  4O4H B;  2YC0 A;  4WFB V;  2ZKO A;  1KUQ A;  4IHJ A;  4OX9 O;  4NVP A;  4R6Z A;  4GX1 A;  4R50 A;  1JFF B;  1KEC A;  2CTP A;  3OTO O;  3N2G B;  2ZXW B;  5A9G A;  3F5T A;  3FFQ A;  1W59 A;  2UUC O;  4LNU B;  4MVS A;  4JI2 B;  2LW1 A;  2ZIN A;  2V4D A;  3B4S A;  4YY3 B;  5L3E A;  2F66 C;  4GUN A;  2Q5Z A;  4W4L A;  3K59 A;  2KQX A;  4LFB B;  5LGN A;  5B1A C;  5IYC O;  3L70 H;  3TJT A;  4E4E A;  5LMN B;  3L71 H;  4DK0 A;  4J9Y B;  3T1Y B;  2VWJ A;  1OCZ B;  2DYR B;  2QKC A;  2X7R B;  4H0L B;  4ZHQ A;  1JPX A;  1VEW A;  4PD4 F;  4PEL A;  1ZLZ A;  2PF4 E;  2YEV A;  3GWK C;  4X65 O;  5B3S C;  2EBO A;  2WLL B;  4UFZ A;  4JI7 O;  1H2S B;  3SYO A;  4FZ0 A;  1S76 D;  2IM9 A;  2X6B A;  5B66 Z;  3SYP A;  4LF5 B;  2KB1 A;  1Z5V A;  2Q69 A;  2P4K A;  2Q4P A;  5LGT A;  2CAZ C;  1Q86 W;  4OPH A;  3GWO A;  2JK5 C;  2UXD O;  4QGP A;  2DN9 A;  3WFV A;  4PDV A;  2LJ2 A;  1K4D C;  1OCR C;  1P84 F;  3IGA C;  2CTW A;  4PA9 A;  4O2A B;  4DV4 B;  3RYC A;  1PNL A;  5IT9 N;  4UVB A;  1CXZ B;  2YXH A;  4RUF A;  5LXT B;  2JGU A;  5LL6 Y;  1FFT B;  3ZS8 C;  2DJV A;  2DQ3 A;  2W0F C;  3B2E E;  4NTW A;  2EIN C;  1HWY A;  3M99 B;  3BPZ A;  5LA6 B;  4Z1M G;  3ZRV A;  3K5N A;  2QM4 A;  4BWA A;  1G6U A;  2P67 A;  1B6Q A;  2CE4 A;  2WLK A;  2YIB D;  5JQG B;  3RYH B;  1FJG B;  3HKB B;  4DUY B;  1GM8 A;  3ICX A;  4TV9 B;  4NXM B;  1O9H A;  2N04 A;  4ZOL B;  4XDK A;  3ASN B;  2HVJ C;  4O4J A;  5FLX N;  4CS4 A;  2HJF C;  3FB5 C;  3IFX A;  5B1A B;  3WB2 A;  5CA0 B;  3CPW U;  2KKW A;  1JR9 A;  1N32 B;  1DF5 A;  3SJB C;  4JI8 O;  1XMQ O;  1IBK O;  1N36 O;  4K8Z A;  5F2V O;  5GON B;  3L73 H;  3AG2 B;  4JI1 O;  3ZHS A;  3K08 A;  4BIU A;  3FAV A;  5B1N A;  5IJ9 A;  2AZ2 A;  1MZE A;  3Q4H A;  3UT5 A;  3IJ4 A;  2OIG A;  5DEC A;  2QEX V;  4RAI A;  5KHG A;  3CCU V;  3OE7 G;  4GYC B;  3T4Z A;  3A0B Z;  1PV0 A;  2ILM A;  1OV9 A;  2GUZ B;  3CCM V;  2UXX A;  2CH7 B;  3SPH A;  2K1E A;  3JAK B;  4BW9 A;  1WN7 A;  4FLZ A;  5TIS Z;  2GDS A;  5KA6 A;  4DW1 A;  3AK2 A;  5EYP A;  2RJZ A;  1D2D A;  4B08 A;  4I0X A;  5GTH Z;  2K9P A;  3K5M A;  1XNR B;  1PKX A;  4X1I B;  2Y69 B;  2R9I A;  3QNE A;  3TET A;  4D7T A;  3ABU A;  5BZB A;  4JI4 O;  3HKB A;  1F4M A;  2ZNI A;  1K97 A;  4OXS A;  4XDL A;  1V55 C;  1XDC A;  2H3O A;  3T4D A;  5IWA O;  5H5N A;  1R6N A;  2JEU A;  4MVM A;  3JAL A;  1Z5W A;  2YIB A;  2A0L A;  2GUZ A;  1AJQ A;  1RM1 B;  1DF4 A;  2WLL A;  4DV0 O;  1NI8 A;  2ZT9 B;  4PDL A;  3OMI B;  1D5A A;  3N2K A;  3BA8 A;  2HR3 A;  5L3D A;  2NLJ C;  2QKA A;  1YIT V;  1OCC B;  5C8Y A;  4G28 B;  5L3F A;  4CS2 A;  2HEP A;  4MW3 A;  3UT5 B;  4LH7 A;  4JYY A;  5CBH A;  2Y0I A;  3UO3 A;  4B3S O;  4B3S B;  1Y67 A;  3AG2 C;  2DE0 X;  4IHJ B;  1VQP V;  1YCI A;  5IYZ B;  2PZS A;  5LBQ A;  3ABL C;  2PGG A;  2ARH A;  5C93 A;  1DLB A;  3SYQ A;  4UCT A;  5EC1 C;  2VQF O;  2ZXW C;  4MTX A;  3CD6 V;  3ABM C;  1G1X B;  4C7U A;  4J7Z A;  1VQ5 V;  1BMF G;  1RP3 B;  1VQ7 V;  1W0J G;  1ORQ C;  3UO2 A;  1H8H G;  1BCC H;  4PA3 A;  5LHH A;  1UPG A;  1H8E G;  4W4K A;  1ZX3 A;  3SPC A;  3JYC A;  4QPK A;  4GCZ A;  1SA0 B;  3D3I A;  4DYL A;  3AG1 C;  3DC5 A;  1ENV A;  3W7U A;  1OCZ C;  2DYR C;  3IC7 A;  2N05 A;  2VS0 A;  5BR8 O;  1KMI Z;  4DV1 O;  4YIO A;  2QE7 G;  1PNK A;  4F6R A;  5IY5 C;  4R7C A;  2ODM A;  3ETG A;  4MVQ A;  1KU9 A;  3SJC C;  2PI5 A;  4GX2 A;  1NTK H;  1PP9 H;  1Q6I A;  4TV8 B;  3CX5 F;  2EIK B;  3H1L H;  4QPJ A;  4JI2 O;  2OCC C;  2DOS A;  4UV8 A;  1FXH A;  4MVR A;  5EBL C;  1R3L C;  4BIO A;  1H2K A;  3CSX A;  3CJH B;  4Z1V A;  1Y74 A;  1MMM A;  4O4H A;  4EFE A;  1RPR A;  2ETN A;  2EX3 A;  1R3K C;  4ZIB A;  1IBM B;  4LNU A;  5JVD A;  5LP6 B;  1Q6U A;  2UXC B;  3ZIA G;  3QO7 A;  1SQP H;  2UUC B;  3N2G A;  3UKM A;  5GTI Z;  3B8M A;  4LFA O;  2WLM A;  2XAQ A;  2ITD C;  1A32 A;  4DR4 B;  2IJJ A;  5ITZ A;  4X88 A;  1SQV H;  1GM7 A;  2FTK A;  3K5L A;  2QWN B;  1IX9 A;  2WLN A;  2UXB B;  4I5S A;  1MOF A;  3JAL B;  2ADP A;  5AG2 A;  1H2L A;  1I0H A;  3ZJZ A;  1RSO B;  3STL C;  3T1Y O;  2EZP A;  2JEX A;  2DQ0 A;  4RUE A;  5B1B C;  1TUE B;  4UCS A;  1U97 A;  2RQ6 A;  2EIL B;  4JTD B;  4I7Z B;  1OJH A;  1MNG A;  3HKE B;  4EKW A;  5L3G A;  3APO A;  4P30 A;  2PYJ A;  1BQZ A;  4I50 A;  4O2B A;  1NZ6 A;  3G71 V;  4KXR A;  1S5J A;  4P2Z A;  1R6K A;  1GK9 A;  3BCC H;  3L75 H;  3UM7 A;  2ZM6 B;  1GN2 A;  4PA4 A;  2F93 B;  2VQF B;  1KBH A;  2KSD A;  1S77 D;  5L3B A;  2YI8 A;  1D5N A;  3K3W A;  2F4V O;  1FXK B;  4ABM A;  3QTC A;  4FM2 A;  3D8C A;  5KX5 A;  1XIL A;  3KG2 A;  2CGO A;  1COW G;  3N2K B;  3JAT B;  2M7W A;  4WBN A;  2D3O W;  1LNQ A;  4ZI7 B;  3ASO B;  5EZY B;  3ZX6 A;  5A2Q N;  2V7Q G;  4UVC A;  5LOV A;  4FJC C;  4MVU A;  5K1X A;  4ZKI A;  2VQE B;  5CA0 A;  4KHP B;  2Y69 C;  2BCC H;  1MG1 A;  2Q0O C;  4DV7 O;  3BAB A;  1E1R G;  3A2F A;  4UCR A;  3CRM A;  4TV9 A;  3L74 H;  3FD9 A;  3F7Y C;  1R3I C;  3H1J H;  4PI2 A;  1NBM G;  2WA4 A;  2L6L A;  3RVY A;  3OTF A;  1IVS A;  4FVM A;  3DGE A;  2F95 B;  1JFF A;  4I0X B;  3OMN B;  2XAF A;  3G6E V;  4FPP A;  2Y4T A;  4JAV A;  3K57 A;  1VF6 C;  4TQF A;  4ZI7 A;  1UFI A;  3BVO A;  4NTY A;  4DRX B;  2WSS G;  4LFB O;  1TAE A;  4DV6 B;  1WB7 A;  2ZIM A;  3MDS A;  3APQ A;  3ZN0 A;  2QM8 A;  4RWU A;  3CCR V;  1R6T A;  2Z3Y A;  3U11 A;  3FAV B;  5IJ9 B;  3CP1 A;  4LFA B;  2QJ1 A;  1AB3 A;  5LP6 C;  2YI9 A;  5IY5 B;  4JI7 B;  3RYF A;  2ATK C;  2HHH O;  2JIZ G;  5GON A;  3CRA A;  3JAS A;  3BA9 A;  2Q73 A;  1CPY A;  1GO3 F;  3ABL B;  4G2K A;  1N0J A;  4HNA A;  1PM9 A;  2CTQ A;  2QKS A;  3NXS A;  2OWO A;  2E74 B;  3OEE G;  2ADQ B;  4CS3 A;  3H1H H;  1U96 A;  1WP8 A;  2R72 A;  1H2M A;  2QM7 A;  3ABT A;  1SQX H;  1Q82 W;  2A3Q A;  2OT5 A;  5LP6 A;  4CC5 A;  1VQM V;  3G67 A;  3MAQ A;  3FB8 C;  3IC9 A;  1YVW A;  1URF A;  1XQ8 A;  5IDJ A;  3H01 A;  4DW0 A;  1SF9 A;  2EIJ C;  4JGS A;  3R65 A;  3SYA A;  3OD4 A;  4UCO A;  1XNQ O;  1WLE A;  4LF4 B;  3MHH C;  1QVF U;  1M57 B;  3CJH A;  1RFY A;  2QGN A;  2XAS A;  3ZN1 A;  2UUB O;  4H44 B;  3OM3 B;  3JAW B;  3TXS A;  2RMK B;  1V54 C;  1N8R W;  1E79 G;  4F4L A;  1FYJ A;  2XND G;  3LSS A;  4B3R O;  3K04 A;  4GZR B;  4XBF A;  1FJG O;  5EC2 C;  1N33 B;  5JJJ B;  3AG4 B;  1WP7 A;  4NXM O;  2R9R B;  4O2A A;  5IYB O;  1ZSP A;  2CGN A;  1JMK C;  2QDO A;  2BOB C;  3RGB A;  1SS3 A;  3TK1 A;  1VQN V;  2NR5 A;  3ASN C;  3W7X A;  2HG5 C;  3FYI B;  4P9O A;  4OPA A;  4DV5 B;  3J80 N;  5JJN B;  2OYQ A;  3C3T A;  1N32 O;  3BFR A;  1VF6 A;  1HNW B;  1XHZ A;  2ZIO A;  3JAS B;  4CH3 A;  4UUJ C;  2DYS B;  1YJW V;  1KD1 W;  4N23 A;  5LHG A;  3QG5 A;  3EXA A;  2C2A A;  5IYD O;  3D36 A;  3F7V C;  4GKJ B;  4FK5 C;  3M7M X;  1BS3 A;  5JQG A;  4FFB A;  2RCV A;  3CXC U;  1IXM A;  4Q20 A;  2F1M A;  1NKD A;  1Y66 A;  4UCU A;  4QIW F;  2X0L A;  3O9O A;  4J9Z B;  4LF7 B;  3DXR A;  2EJ7 A;  4LF7 O;  4HYO A;  4JI8 B;  3NR7 A; 
#chains in the Genus database with same CATH homology
 1XEQ A;  5BXZ A;  4DV2 O;  4DV3 O;  4GKK O;  5A2Q N;  2UUA O;  3T1H O;  4JI8 O;  2UU9 O;  4DV6 O;  2N74 A;  1XMQ O;  4X65 O;  1IBK O;  1N36 O;  3RT3 C;  4X62 O;  4JI0 O;  4JI7 O;  4B3S O;  3R66 A;  1XMO O;  1HNW O;  4LF6 O;  4LFA O;  4JI1 O;  1XNQ O;  4DR3 O;  2UXC O;  1A32 A;  4JI6 O;  1R1B A;  4DV7 O;  1YZB A;  4K0K O;  4LFC O;  2UUB O;  2Z0A A;  4OPH A;  2VQF O;  4GKJ O;  4YHH O;  4DR2 O;  4DR4 O;  4JV5 O;  1HNX O;  1G1X B;  2LW7 A;  3JAM N;  3J81 N;  1HR0 O;  1NS1 A;  4JI5 O;  2UXD O;  1FYJ A;  1X59 A;  4B3R O;  4DR7 O;  4X64 O;  1FJG O;  1N33 O;  3T1Y O;  4NXM O;  4DV4 O;  5IT9 N;  4DV5 O;  1D2D A;  1J5E O;  5LL6 Y;  1DK1 A;  1N34 O;  4AQY O;  2VQE O;  4DUZ O;  1XNR O;  2DJV A;  4LFB O;  2ZKO A;  1IBM O;  1KUQ A;  4OX9 O;  4OPA A;  5LMU O;  3J80 N;  4DR6 O;  1N32 O;  4KHP O;  3O65 A;  4JI4 O;  1R6T A;  3OTO O;  5BR8 O;  4LF5 O;  3F5T A;  4DV1 O;  1AB3 A;  4LF8 O;  4LF9 O;  5IWA O;  5H5N A;  2UUC O;  2UXB O;  2HHH O;  2FKX A;  1IBL O;  2E5L O;  3J7A U;  1FKA O;  4DR5 O;  4JYA O;  1I94 O;  2JRI A;  4B3M O;  4LF4 O;  2AGA A;  4DUY O;  1HNZ O;  4YY3 O;  5BY1 A;  4X66 O;  3M8A A;  4DV0 O;  4JI2 O;  2F4V O;  2ZM6 O;  2DOS A;  3SDL A;  4B3T O;  4LF7 O;  1AIL A;  5FLX N;  4DR1 O;  4NXN O;  4JI3 O;  5LMN O;  1F7Y A;  4A5U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...