1HNWO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnwO00
4LFBO 5LL6Y 4X65O 1R6TA 2Z0AA 5BXZA 4AQYO 1HNXO 2UXDO 3F5TA 4JI4O 4JI3O 4YHHO 4DR7O 4DR1O 4GKJO 4JV5O 4DV3O 3JAMN 1KUQA 4B3SO 5BR8O 1D2DA 1X59A 2JRIA 4LF5O 1AB3A 1FJGO 5BY1A 2DOSA 2N74A 1AILA 4DV5O 1N36O 1HNWO 1R1BA 2UXBO 1XNRO 3T1YO 5H5NA 4DR6O 4GKKO 4LFCO 4B3TO 1J5EO 1HNZO 2FKXA 2VQEO 2HHHO 5FLXN 4DV4O 5LMUO 1HR0O 4DR2O 4B3RO 2UUBO 4DV0O 2LW7A 4DV7O 4LF6O 4DUZO 4DV1O 2UUCO 4X66O 4LF7O 3RT3C 5A2QN 2UU9O 2UUAO 3T1HO 4X62O 3SDLA 4YY3O 4NXMO 1NS1A 2VQFO 4JI6O 4DR4O 3OTOO 4JI7O 1FYJA 3M8AA 1XMOO 4DV6O 4JI8O 1N34O 1XNQO 2E5LO 5IWAO 4JI0O 1XMQO 4DR5O 4LF4O 1IBKO 1YZBA 2F4VO 1A32A 1IBLO 4LF9O 1IBMO 1XEQA 2AGAA 4A5UB 2ZKOA 4DUYO 4OX9O 1F7YA 1FKAO 1N32O 4OPHA 5IT9N 4NXNO 3J80N 1G1XB 4KHPO 3J7AU 3R66A 4LFAO 1DK1A 3O65A 4LF8O 1I94O 4JI2O 2ZM6O 3J81N 4JYAO 4DR3O 2DJVA 4B3MO 4K0KO 4OPAA 4JI5O 4JI1O 1N33O 4X64O 5LMNO 2UXCO 4DV2O
chains in the Genus database with same CATH superfamily
2YEVB 1HNXO 1Z5WA 4R8CA 4X1YB 1JQ0A 1K5QA 2FTKA 2OIEA 2KKWA 4JV5O 3ZHRA 4CH6A 4QPKA 5LA6B 5KHHA 1DF4A 1PL0A 4X8AA 1P84F 2AXTZ 3AK1A 3WB1A 1O9GA 3OR6C 1AROP 2JGUA 1N0JA 2QDOA 4DRXA 4DV4O 1S0VA 4JI8B 4DV7O 3VOUA 4JI0B 4FJCC 5EBLC 1TUBB 2EILC 2CGNA 3JASA 4P9PA 3CC7V 3AG1C 4JZ2A 1SA0B 4NXMO 2P22C 1N33B 1SQFA 4UCTA 3OW2U 3A0HZ 3LNMB 1M9NA 4FZ1A 3CCRV 2LJ2A 3UQ8A 2NN4A 2E74B 1OCZB 2KQXA 1A32A 4FZ0A 1QU7A 3CRQA 4WF9V 3IAYA 2Q7HA 4I9WA 5CB4A 2CTWA 4TT3G 4LFBB 1K8AW 1NVPD 4YIPA 1HW7A 3G67A 1MZFA 1FXKA 1GK9A 3K5OA 3QO7A 4DR7B 5KMGA 4GKJB 1FS0G 5J2UA 4B3SB 3X2QB 4GX5A 3E8GA 5B1AB 2BE3A 3K59A 2O57A 1R3LC 4PI2A 1R3KC 5GTIZ 1AJPA 4NTYA 5IJ9A 1NQTA 4YY3B 2GHYA 1OCOC 2Z0AA 4JI6B 1YXBA 2ITCC 3CD6V 1E1QG 5ITZB 1ENVA 4GLXA 3K9SA 1OV9A 4O4JA 2ZINA 2PF4E 5CA0A 4LF5O 1PNKA 4PDVA 2DW4A 1YEWA 2ZE7A 3DXRA 5K1PA 2P06A 1EFRG 1L1FA 3BA9A 3JALB 1F51A 2F66C 2YS8A 3UT5A 4TUYA 1PPJH 1NBMG 2JEUA 2WA3A 3BCCH 2OIGA 4K3AA 5DN6G 4DV6B 4KL1A 2OTLV 3QNEA 3ZJZA 4JTAB 5EIBC 1VQ5V 4GT1A 3OE7G 5KX5A 2OWOA 4F4LA 3QF7A 5FNVB 1FD9A 1PKXA 1H2MA 3T1HO 1KKDA 2XAGA 2XUMA 1Q43A 4HBNA 2F1MA 4PD4F 3KCXA 5LHIA 1VP7A 4QPJA 4DR1B 4LNUB 2F43G 5JQGA 1URFA 1K92A 5B66Z 2F4VO 5A9GA 3RYHB 3ZMTA 5JJJB 2PUSA 2FYUH 3OTFA 2ZKOA 3H9VA 1ROPA 1MOFA 4YXWG 5IT9N 2Y48A 3FYEB 4CC5A 5CBHA 4AQYB 1GH6A 1Y74B 4MVOA 2X6CA 5IYBO 4QGPA 1RM1C 1COWG 3SPIA 2PI4A 1VF6A 1P7GA 4JI5O 3ABLC 2ZDIA 2ADPA 3TK1A 4CH4A 3H1JH 4UV8A 1E79G 3L74H 5IDJA 1KU9A 4I55B 3QO5A 4DR6B 3G71V 1FFXB 4MTOA 1M5IA 1JJ2U 1JFFA 4X20B 4I50B 1S5JA 5BY1A 4D6TH 2QEXV 3C90A 1VF5B 3VQWA 1MZEA 2F93B 1T5EA 2P6JA 3JD2A 1VMGA 3JAKB 2QA4V 4Q6GA 1LR1A 2FKXA 3LDCA 4MTFA 3ASOB 1N0NA 4O4IA 2Q68A 1MSDA 4FLZA 2NNUA 1NT2B 1JPXA 4JTCB 3HB3B 1PD3A 1YVWA 4O2AB 4DK0A 3A8TA 4LF6O 1VQNV 1NU1H 2RNBA 4DR3B 1FXVA 1XMQB 4X88A 2JIZG 4WFAV 3W7XA 3RT3C 1R3IC 3JSNA 2AHYA 3WB0A 4LF9B 2UXXA 1V55C 4FK5C 1G8MA 1MSWD 2HKOA 5EYPA 4N21A 3VQXA 3ZRSA 3ASNC 2HG5C 3K79A 2ZNJA 3FAVA 1QHTA 5IJ0B 2PGGA 1KP2A 4E2LA 3B2EE 3ZMZA 4PI0A 5KA6A 1S5LZ 3MD0A 3PN1A 1U97A 3OR7C 4OX9O 1HNWB 3ZRWB 5EZYA 2LFRA 4MVRA 2YUAA 2VQEB 2AHZA 1NTZH 4Q20A 1Q3EA 3BFRA 4LF8O 2ZM6O 5BR8B 2Q7GA 1NI8A 2W0FC 2CTPA 2BOBC 2FL4A 2EZPA 3CCJV 5LL6Y 2UXBB 4BIUA 3JAWB 3B4SA 4ZOLA 4J42A 1WA8B 1XUQA 4H37A 1CXZB 3CJHA 1X59A 4YJ2B 3RBZA 3CRRA 3K57A 4B3RB 4NTWA 1QQCA 3ABUA 3L70H 3L75H 2YXHA 1IXMA 4TQDA 3STZC 1RP3B 5BMVB 3T1YO 3OD4A 5HFMA 4B3TO 4LFCO 3VQYA 4NXNB 3CEIA 2CH7B 5IE9A 3JATB 1FXHA 4MW3A 1K73W 1BE3H 2WLLB 3ZEDA 3GVMA 4P2ZA 1IBMB 2VQFO 4CS3A 1NTKH 3ZRXA 5L3GA 1KB9F 2AZ2A 3N27A 3MHHC 2E5LO 3R65A 3FKSG 4G27B 4UB8Z 2EIMB 2LFSA 4ASUG 4MT8A 1AR5A 2Q69A 3KZIZ 1ZAUA 3U0ZA 1NH2D 2BSKB 3W7TA 3OUSA 4DUYO 3RVZA 4JI1B 2Z5UA 1B6QA 1SERA 2Y4TA 1H2SB 1FPOA 3R66A 2QJ1A 3ZBHA 1K4DC 3OT7A 4I0XB 1OCZC 3G80A 5KAFZ 1XI1A 1VARA 2GSMB 3WB2A 1GAXA 2P4VA 3J81N 4JYAO 2DWEC 4WFGA 2DJVA 4CS2A 5D5PA 4YJ3A 5KHGA 4TV8A 2EZOA 1XNRB 2EJRA 1DF5A 4YHHO 3OTOB 1RSOA 2X6BA 4EFBA 2CTQA 5H2FZ 1AI5A 1M56B 3X2QC 3DC5A 3ZS8C 5LMUB 1NZ6A 2GUZA 5B1AC 3ETEA 2ZE8A 1YSCA 4GKKO 1DGSA 2JJ1G 1M1KW 1HNZO 2RQ6A 1XQ8A 4UV9A 2B1GA 2CDYA 2F23A 2HHHO 3OM3B 4G2KA 4U3FH 2PY5A 3TGUH 1H38A 1NTMH 2NR5A 1OCRB 2UUCO 4DR5B 2OCCB 4K0KB 4WFHA 2QWRB 4PA3A 4X62O 2A06H 2ZD9A 4MSWC 1Q81W 3B40A 3BRCA 4D7SA 4JI8O 2A79B 1QR8A 4G28B 4IIJB 4D7TA 4JI0O 3T2MA 1Q7YW 5CBGA 2FMLA 3SJAC 5LYJA 3L73H 2KB1A 4RO2A 1I94B 3GWOA 1LNQA 1YZBA 4ZI7A 3BVOA 1K7DA 5GONB 3T4DA 3K5LA 1S72V 3CMEV 1N36B 3B77A 1F4NA 5E79Z 1SRYA 2YIBA 1KC8W 1VQ4V 4LWSA 1IDSA 4H44B 4UFZA 5DECA 1XL6A 2X6AA 3CE2A 5IYDO 4DXWA 3FB6C 2HVKC 2QR4A 1M4UA 1KKCA 1IZ3A 1KYOF 1K97A 4UCRA 2Q4PA 3JD0A 1EN5A 4LFBO 3RYFA 4XBFA 2L6LA 2M7WA 2JGDB 3IC7A 1TUBA 1OZ0A 4DR7O 4GKJO 3SPCA 5HFLA 4X1KB 2W6JG 4B3SO 1SA0A 2BTQA 3OMAB 5C8YB 1HR0B 1AB3A 1FJGO 4J10A 2YXYA 4I4TB 1SQGA 1B3QA 1CEZA 2IH3C 2QWOB 2OYQA 4MVUA 4U3JA 5DM6V 1H2KA 3ABKB 1I5YA 3JD3A 3FFQA 4UCSA 4TV9A 3CMAV 3MAQA 2Q5ZA 4GUNA 2IU0A 4X1IA 3CCUV 3JSLA 1S5HC 4DV0O 2JK5C 1AVMA 4FVMA 4IHJA 1H2GA 5LOVA 5A2QN 3RW0A 3K3WA 4PA9A 4ZIBA 4DV6O 4HNAB 1Y76A 5H6QA 4BIOA 2UXNA 4QJFB 3HKDA 4O4LA 3ZCCA 2RMKB 2ZR3A 4DV3B 1SQBH 1L8DA 2BCCH 1VQPV 3N2KA 2EINB 1O9HA 4B3MB 4AILC 1S77D 1F23A 3WFVA 5LXTA 4JAAA 2WA4A 5LMNB 1P7BA 4FLWA 1VQ8V 4JI4B 5JH7A 5KUMA 4WFEA 3LDDA 3QVNA 4UCUA 1GRJA 1J95A 2M6YA 3APOA 4FLTA 2E76B 3QTCA 3E83A 3UKMA 4ZHQB 2UUAB 3K06A 3JCUZ 4AQYO 3F5TA 5JWPA 5LGNA 5BZBA 1P4RA 2WLIB 1XNQB 4J11A 5IYZB 1EBOA 2ARHA 5B1OA 2F95B 4RQFA 1WB7A 3F7VC 2JRIA 2Q0OC 1YITV 1JCHA 5GTHZ 1IBKB 4WFFA 1WP7A 4JASA 2OTJV 4OGQB 3KKYA 4DUZB 4DV1B 4LNUA 3B09A 1GN2A 2YSUB 1ZTEA 2UU9B 4JYCA 4DR6O 2YI8A 4BWAA 3CPWU 2YDEA 1AI4A 4X9QA 2KG7A 5E1AC 3U10A 1WLEA 4O4HA 1ZX3A 2UUBO 2XAJA 2QGNA 3SPHA 4BW9A 4DRXB 3ZRVA 3RWRD 2XAHA 3ZX6A 2XTAA 2YIAA 2YICA 2DMXA 2P5OA 4PDMA 4LH6A 3G6EV 2PI5A 1Y74A 1IBLB 4PDLA 5B3SB 4IYIA 2DQ0A 3JASB 1N32B 3HR0A 4MVQA 4H33A 1YTFB 1K33A 1NKDA 1XMQO 5JCOA 1BHAA 3SYAA 2YXLA 5KUKA 3W7WA 3SGIA 1OHHG 4LF9O 4NKGB 1VQ6V 2WPDG 2D2CB 2VS0A 3P3PA 1FKAO 1PP9H 4W4LA 2ZIMA 3VQVA 3PJSK 1VQOV 4L87A 2EIMC 2RDCA 1YDXA 4DV4B 5CB4B 4JI2O 3SPJA 1AR4A 1ZUQA 1FXKB 4HZ3A 1IXBA 3ZMVA 5KMGB 5J2UB 2UXCO 4DV2O 3CYOA 4CS4A 4RAIA 3JARA 4JI3O 5LP6B 1BZKA 1K9MW 2PYLA 4FMTA 1SQPH 3ABMB 5IJ9B 3A0RA 5BR8O 3E86A 3THOA 1Q6IA 1VQLV 2WLKA 4JYYA 1SZXA 3ZN0A 1JR9A 4K8ZA 2HJFC 4O4JB 3CX5F 1R1BA 2UXBO 5CA0B 4X66B 1HDJA 5H5NA 3DXRB 5LHHA 1M56C 4B3RO 3RFRA 4TUYB 3CXCU 3A2FA 2Q7EA 3AG2B 1GMGA 3K9AA 1ORQC 3FB5C 2P4KA 1YTFD 5KX5B 3JD4A 3E22A 1VQ7V 2Y4UA 3M8AA 1YI2V 3K0DA 2ZNIA 5LGTA 4U7OA 4LF4O 1OCRC 3BHPA 2OCCC 3CCLV 2P7TC 3OGCC 1Y66A 1IBMO 4JZGA 1V9PA 1XEQA 1WA8A 4UCVA 3SR2C 2DQ3A 4YJ2A 1PV0A 1KQSU 1QVFU 3J80N 2A3QA 3S3WA 3CCSV 3HKCA 4OXSA 3H1HH 3E8HA 4ABMA 4FFBA 4F6EA 2QKAA 1BS3A 2V7QG 4C7UA 1G6UA 3JYCA 1TVKA 1Q8IA 2EILB 4JI1O 3HPLC 3M99B 3T1HB 4JF3A 3D36C 1NH2B 1N8RW 3UM7A 1VQ9V 3IJ4A 2WLHA 2Q6AA 4EB6A 4MW8A 2LGWA 3B8MA 1V54B 3LSQA 4JTDB 3ZMUA 3HKEA 1DTOA 3HKBA 1JFFB 4QNHB 1XNRO 1I08A 2ZXWB 2L35A 2Y69B 5JVDA 3ML0A 4DR4B 1JA8A 2LO1A 3AK2A 5FLXN 4B7KA 1VEWA 5LMUO 2H3OA 2Z3YA 1N34B 2BSKA 1SC5B 4O4IB 3RYCA 1ZWIC 3ABKC 3CRMA 2VWKA 1GN4A 4J7KA 1Q6UA 3CCQV 2IH1C 1YF2A 4FLVA 5IWAO 1EN6A 3BABA 3DGEA 4P9OA 3W7SA 2JS5A 5EYPB 4DR5O 3H1KH 3VBBA 3CXHF 1GM7A 2X0LA 3FAVB 2AGAA 1EN4A 2DYSB 4BR6A 1F7YA 1SETA 5IYCO 1G1XB 3O9OA 4X65B 1NJIW 4JAUA 1BMFG 3FB7C 3J7AU 2DYRB 3JD1A 3L72H 2GBOA 5CMUA 3CHXA 3O65A 4LCUC 3OEEG 5EZYB 1I94O 1QLEB 4LF6B 2EINC 1BQ0A 2Q73A 2R9AA 1XBLA 3IFXA 3RGBA 1WPBA 1H2NA 1UPGA 2GTAA 4JAVA 1Q90D 3OGIB 2XOKG 4J9YB 1J5EB 4MVMA 1KUQA 4IGGA 1N4CA 4L8JA 2BTOA 2LQTA 4ZOLB 2YIDA 5CA1A 4JPRA 1QVGU 4GYCB 4DV5O 3CJHB 2ZQMA 1R3JC 3K03A 5H9CA 1ZL8A 1KP3A 4OX9B 4UVAA 1GTOA 3ZN1A 5IY5B 3OUFA 5JJNB 4QE7A 4JI7B 2D3OW 4LP8A 4CH3A 4NYKA 1HR0O 1JOYA 1WB8A 2LP7A 2ZM6B 3N2GA 4J80A 2B1IA 3ABLB 1W0JG 4WBNB 3GWKC 1SZTA 2OT5A 2R9RB 3Q4HA 3EXAA 2H8PC 2EBOA 4KHPB 3ETDA 5C93A 3G4SV 1D5AA 3D8CA 4CH5A 2QWQB 3K04A 3K08A 5B3SC 5J2TB 1GO3F 1W2BU 2R70A 4K8XA 3M7MX 1DLBA 4B3TB 1JX9A 1R6KA 3G6BA 5EIBD 2ZE6A 4PA4A 3FX7A 1CPYA 3UCSC 4GX1A 1GM8A 1Y6XA 2YEVA 2CE4A 4B3MO 1PL4A 4X1YA 2CAZC 2GV9A 4I9QA 3CSXA 1N33O 1KMIZ 3WU2Z 5LMNO 5LA6A 1AJQA 4AI8A 2ILMA 4YJ3B 1MA1A 1OCCB 4JI4O 1QR9A 3APQA 3FB8C 2RJZA 2LGQA 4DYLA 3ETQA 2E5LB 4TV8B 3AG3B 2N05A 1WPXA 2VWJA 4WFBV 1RSOB 5EBWC 3E35A 1FXKC 2DOSA 1AILA 5EK0A 2JVDA 4E4EA 1LUVA 2ZR2A 4LF7B 5LP6C 2EIKB 4RQEA 1BT8A 2XHBA 2IBZH 3ABMC 4HYOA 1K3EA 2LW1A 3E2EA 1X4TA 3CRCA 4JYAB 4DUZO 4DV1O 3CC2V 2UU9O 3EHBB 2QM8A 4YY3O 5KLVH 1NS1A 2MW2B 4JI6O 3CRAA 3LSUA 2NLJC 1FYJA 3TXSA 2QTOA 1XHXA 1GKFA 3AG2C 3BPZA 3H1LH 4RUEA 2DWDC 2VRZA 5LBQA 1IBLO 2WLIA 3TJTA 1P49A 1AP5A 1S3JA 5EBMC 4X64B 2XNDG 1N32O 4ZI7B 4GKKB 4NB5A 3ASOC 1HNZB 2UXDB 2QM7A 3BY6A 4JYBA 4AHCA 1DK1A 1SKVA 2QSAA 2HHHB 4UCOA 3UO3A 4MS2A 4OPAA 4W4KA 4EFEA 5KHJA 1GN6A 5FPOA 4LWSB 4FLUA 3OEHG 2UUCB 5ITZA 3UO2A 4F6RB 4X62B 1QCEA 3OAAG 1YCIA 1AJNA 3EVKA 3RN4A 4DR1O 4NVPA 2AZ0A 4J41A 3RYFB 4DR2B 2IJHA 3DC6A 3I5DA 2W6IG 3JALA 4J9ZB 3SYOA 3KCYA 2PTMA 4Z1VA 1VF7A 1BHBA 2K1EA 1MMMA 2BTQB 2QKCA 3RYIB 3CCVV 3IGAC 2CGOA 1VF6C 1TA8A 2ZDIC 2XT9A 2DN9A 1Y4MA 4EKWA 5CN0A 4BAYA 1IURA 4U3JB 2QM4A 4KUMA 4O2BB 3DTUB 1M57B 1TGOA 1XMOB 5FNVA 2JS3A 2ETNA 1V54C 4TV9B 2ZE5A 3CCEV 4X1IB 4X66O 2IJJA 2ZXWC 2Y69C 3W7UA 4IHJB 1RPOA 2EX3A 2RN9A 3D3IA 1B04A 2Y0IA 4TOIA 3STLC 5LOVB 1K4CC 4IT5A 2BOCC 2N04A 2QWPB 3RYHA 2K9PA 4Z1MG 4LFAB 2OCHA 1UJWB 4ZKIA 3FD9A 1Y76B 2CTRA 1FJGB 4GCZA 5LP6A 1SF9A 4XDLA 3HKDB 4O4LB 4GZRB 2HVJC 4UB6Z 4OPHA 2HEPA 1SQQH 1PNMA 2WLNA 2A9HA 1XDCA 3N2KB 3JCZA 1HNXB 4MTXA 2YIBD 4IL6Z 4U7NA 2HP8A 5LXTB 2Y0PA 4JV5B 1YJWV 4TWKA 3AG4B 3LDEA 4DV0B 4DR3O 5B1NA 2R9IA 5B1BB 5JH7B 4I55A 2DYSC 4NR1A 1FFXA 1M93A 3LNNA 5AG2A 4EEQA 4X20A 4I50A 3F7YC 3BAAA 2DYRC 5FL7G 1OJHA 3CCMV 3CP1A 2V4DA 2IU3A 1UFIA 2H94A 4YIOA 2B5UA 3JAKA 1QLEC 4DV7B 1Q6HA 2QTSA 4R6ZA 3SJBC 3TCUA 3WG7B 1HNWO 1M90W 4NXMB 4O2AA 4UVBA 1YJ9V 2VQEO 3LSSA 4ICGA 5CA3A 1BSMA 4DK1A 4FLYA 1S76D 3CWBH 1F4MA 3SPGA 2KG7B 4O4HB 1W59A 1VQMV 3TETA 1TAEA 4CC6A 1L0NH 1B06A 1Y67A 4WCEV 4DR4O 2EIJB 3BEHA 5IY5C 5IJ0A 1R6NA 1N34O 1EZVH 3SYCA 1MNGA 4PA7A 5H6RA 3AG7A 2WSSG 3UT5B 2E3CA 3ZRWA 3NXSA 4DO2A 1BCCH 5EC2C 1NR7A 4Z2WA 1W0KG 4MVZA 5JJEB 1XHZA 1THZA 5LHGA 1FFTB 4NXNO 1WAZA 2WLJA 1Q82W 3SYQA 4FLXA 2QKSA 1XOUA 3CC4V 3QO8A 1MG1A 2UUBB 4XDJA 2P90A 2YI9A 1PNLA 4LF5B 3JAWA 2JEXA 3CS5A 4P30A 4B08A 2KSDA 1I7FA 3C3TA 5JQGB 1Q86W 2Q9LA 4X65O 1R6TA 1US6A 2ODMA 4PDRA 1ZLZA 3P30A 4NTXA 4LC1A 5DEDA 1LUWA 3JAMN 5BMVA 1D2DA 1D5NA 3JARB 4JGSA 5KHIA 5F2VO 1JJOA 2N74A 4HAMA 4LR3A 1Q5OA 1YHQV 3B8NA 3AG1B 2CH7A 1OCCC 3JATA 3ZHUA 1J5EO 3ZMSA 3IC9A 1SQXH 4B7EA 1R73A 3AG3C 1Z5VA 2DE0X 2WLLA 2QWNB 2LW7A 1MABG 3SYPA 2EULA 4JI2B 4TQFA 3NR7A 3K58A 1U96A 2W0XA 2JJ2G 3KG2A 4LBEC 2F4VB 5D5QA 1HWYA 2EIKC 2UXCB 3OTOO 4DV2B 4JI7O 4FIPC 1K5SA 5LGUA 5TISZ 4JI3B 4FFKA 1YJNV 2Q8VA 2FB5A 3U11A 1NR1A 2HLDG 3E22B 3ETGA 2E75B 1RFYA 1QLNA 4GX2A 5J9PC 2ZT9B 3SJQC 1WNSA 3QG5A 4JI5B 1SQVH 4DW0A 4A5UB 2XASA 3BA8A 4CZZA 4I0XA 3AK3A 1YIJV 1OCOB 3F5WC 2X7RB 1VQKV 3E8BA 3OMNB 5KHKA 4KHPO 1RPRA 2Q0AA 2PYJA 4FM1A 3TXQA 4PA6A 3L9DA 3HKCB 1BGYH 3E8FA 4K0KO 4FFBB 2YC0A 5K1XA 2IM9A 4KFMA 5BXZA 1TVKB 3I55V 1XILA 1G4YB 2RCVA 4K35A 2HFEC 4UUJC 5L3DA 4WBNA 2A0LA 4GX0A 3ZHTA 4LH7A 2GTSA 5EC1C 3SJCC 4LF4B 3ICXA 1WN7A 1AR1B 4UVCA 1N36O 2IJIA 4EB6B 4BIZA 2XAFA 4MVSA 2P67A 3OMIB 3HKEB 4PV1B 4I5SA 1QBZA 2ATKC 3HKBB 4XDKA 5JVDB 1AI6A 3L71H 5J2TA 2V1DA 1K34A 4FPPA 1H2LA 1IX9A 4KP4A 5B5EZ 4PJ0Z 4LF7O 2G38A 1L0LH 4IIJA 2ITDC 1GN3A 4H13B 3RYCB 4I7ZB 1CP9A 1M57C 3ZHVA 4CBCA 4DW1A 2WAMA 1I0HA 4N23A 5GONA 3GB7C 4LF8B 1JMKC 1RM1B 3K0GA 4ZBMA 3AEIA 3D36A 4PHZA 1EM1A 2QE7G 4PELA 4BW5A 3CB2A 4J7ZA 3MDSA 1PM9A 2WWWA 1KD1W 5L3FA 5GW7A 1GM9A 1BL8A 1JVMA 4R50A 3P32A 3ABTA 2JGDA 4RUFA 5L3CA 4X64O 2CK3G 4X1KA 3OFNG 2ADQB 2UXDO 5C8YA 3T1YB 1E1RG 1KBHA 4LFCB 2MK3A 1FAFA 4I4TA 4DV3O 4FM2A 3AG4C 5IWAB 1SESA 4QIWF 2HJDA 1ZSPA 2R72A 3ZHSA 5B1BC 1WJZA 3D3QA 3K5NA 4UXNA 2ZCEA 2AW9A 2JDIG 2XAQA 4QE9A 5CA1B 1Z2GA 5KA5A 1SS3A 3FYIB 1V55B 1H8HG 2VQFB 1H8EG 4DR2O 1QNMA 2ZIOA 3ASNB 1ZL8B 5FPRA 1TUEB 4X89A 2PZSA 2IJKA 3T1CA 1BQZA 2GDSA 1XL4A 3WG7C 3ZIAG 1WP8A 1KECA 3T4ZA 2IW5A 4HNAA 2UUAO 4H0LB 2Q67A 1IVSA 3SDLA 3RVYA 2EJ7A 2WLMA 3DSQA 3N2GB 2GUZB 4DUYB 3H01A 3I56V 2CUGA 1EZJA 1XMOO 5KAIZ 1XNQO 1XREA 4F6RA 3Q4HB 3ZHQA 1IBKO 3H1IH 3C3SA 5L3EA 4DV5B 2EIJC 3S3XA 1HP8A 2HR3A 3K5MA 1I5XA 4FM0A 4LFAO 3E89A 4YHHB 3MHSC 4IYHA 5CBFA 3A0BZ 3RYIA 4R7CA 4KXRA 4RWUA 1NVPB 4J7JA 4MTGA 3P3NA 4ZHQA 2A7WA 2C2AA 1AI7A 2B9ZA 5L3BA 3LUTB 3EFFK 1AP6A 5JCOC 4TSFG 4O2BA 1VIBA 5LYJB 5IYZA
chains in the Genus database with same CATH topology
4LFBO 5LL6Y 4X65O 1R6TA 2Z0AA 5BXZA 4AQYO 1HNXO 2UXDO 3F5TA 4JI4O 4JI3O 4YHHO 4DR7O 4DR1O 4GKJO 4JV5O 4DV3O 3JAMN 1KUQA 4B3SO 5BR8O 1D2DA 1X59A 2JRIA 4LF5O 1AB3A 1FJGO 5BY1A 2DOSA 2N74A 1AILA 4DV5O 1N36O 1HNWO 1R1BA 2UXBO 1XNRO 3T1YO 5H5NA 4DR6O 4GKKO 4LFCO 4B3TO 1J5EO 1HNZO 2FKXA 2VQEO 2HHHO 5FLXN 4DV4O 5LMUO 1HR0O 4DR2O 4B3RO 2UUBO 4DV0O 2LW7A 4DV7O 4LF6O 4DUZO 4DV1O 2UUCO 4X66O 4LF7O 3RT3C 5A2QN 2UU9O 2UUAO 3T1HO 4X62O 3SDLA 4YY3O 4NXMO 1NS1A 2VQFO 4JI6O 4DR4O 3OTOO 4JI7O 1FYJA 3M8AA 1XMOO 4DV6O 4JI8O 1N34O 1XNQO 2E5LO 5IWAO 4JI0O 1XMQO 4DR5O 4LF4O 1IBKO 1YZBA 2F4VO 1A32A 1IBLO 4LF9O 1IBMO 1XEQA 2AGAA 4A5UB 2ZKOA 4DUYO 4OX9O 1F7YA 1FKAO 1N32O 4OPHA 5IT9N 4NXNO 3J80N 1G1XB 4KHPO 3J7AU 3R66A 4LFAO 1DK1A 3O65A 4LF8O 1I94O 4JI2O 2ZM6O 3J81N 4JYAO 4DR3O 2DJVA 4B3MO 4K0KO 4OPAA 4JI5O 4JI1O 1N33O 4X64O 5LMNO 2UXCO 4DV2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB O;  5LL6 Y;  4X65 O;  1R6T A;  2Z0A A;  5BXZ A;  4AQY O;  1HNX O;  2UXD O;  3F5T A;  4JI4 O;  4JI3 O;  4YHH O;  4DR7 O;  4DR1 O;  4GKJ O;  4JV5 O;  4DV3 O;  3JAM N;  1KUQ A;  4B3S O;  5BR8 O;  1D2D A;  1X59 A;  2JRI A;  4LF5 O;  1AB3 A;  1FJG O;  5BY1 A;  2DOS A;  2N74 A;  1AIL A;  4DV5 O;  1N36 O;  1HNW O;  1R1B A;  2UXB O;  1XNR O;  3T1Y O;  5H5N A;  4DR6 O;  4GKK O;  4LFC O;  4B3T O;  1J5E O;  1HNZ O;  2FKX A;  2VQE O;  2HHH O;  5FLX N;  4DV4 O;  5LMU O;  1HR0 O;  4DR2 O;  4B3R O;  2UUB O;  4DV0 O;  2LW7 A;  4DV7 O;  4LF6 O;  4DUZ O;  4DV1 O;  2UUC O;  4X66 O;  4LF7 O;  3RT3 C;  5A2Q N;  2UU9 O;  2UUA O;  3T1H O;  4X62 O;  3SDL A;  4YY3 O;  4NXM O;  1NS1 A;  2VQF O;  4JI6 O;  4DR4 O;  3OTO O;  4JI7 O;  1FYJ A;  3M8A A;  1XMO O;  4DV6 O;  4JI8 O;  1N34 O;  1XNQ O;  2E5L O;  5IWA O;  4JI0 O;  1XMQ O;  4DR5 O;  4LF4 O;  1IBK O;  1YZB A;  2F4V O;  1A32 A;  1IBL O;  4LF9 O;  1IBM O;  1XEQ A;  2AGA A;  4A5U B;  2ZKO A;  4DUY O;  4OX9 O;  1F7Y A;  1FKA O;  1N32 O;  4OPH A;  5IT9 N;  4NXN O;  3J80 N;  1G1X B;  4KHP O;  3J7A U;  3R66 A;  4LFA O;  1DK1 A;  3O65 A;  4LF8 O;  1I94 O;  4JI2 O;  2ZM6 O;  3J81 N;  4JYA O;  4DR3 O;  2DJV A;  4B3M O;  4K0K O;  4OPA A;  4JI5 O;  4JI1 O;  1N33 O;  4X64 O;  5LMN O;  2UXC O;  4DV2 O; 
#chains in the Genus database with same CATH topology
 2YEV B;  1HNX O;  1Z5W A;  4R8C A;  4X1Y B;  1JQ0 A;  1K5Q A;  2FTK A;  2OIE A;  2KKW A;  4JV5 O;  3ZHR A;  4CH6 A;  4QPK A;  5LA6 B;  5KHH A;  1DF4 A;  1PL0 A;  4X8A A;  1P84 F;  2AXT Z;  3AK1 A;  3WB1 A;  1O9G A;  3OR6 C;  1ARO P;  2JGU A;  1N0J A;  2QDO A;  4DRX A;  4DV4 O;  1S0V A;  4JI8 B;  4DV7 O;  3VOU A;  4JI0 B;  4FJC C;  5EBL C;  1TUB B;  2EIL C;  2CGN A;  3JAS A;  4P9P A;  3CC7 V;  3AG1 C;  4JZ2 A;  1SA0 B;  4NXM O;  2P22 C;  1N33 B;  1SQF A;  4UCT A;  3OW2 U;  3A0H Z;  3LNM B;  1M9N A;  4FZ1 A;  3CCR V;  2LJ2 A;  3UQ8 A;  2NN4 A;  2E74 B;  1OCZ B;  2KQX A;  1A32 A;  4FZ0 A;  1QU7 A;  3CRQ A;  4WF9 V;  3IAY A;  2Q7H A;  4I9W A;  5CB4 A;  2CTW A;  4TT3 G;  4LFB B;  1K8A W;  1NVP D;  4YIP A;  1HW7 A;  3G67 A;  1MZF A;  1FXK A;  1GK9 A;  3K5O A;  3QO7 A;  4DR7 B;  5KMG A;  4GKJ B;  1FS0 G;  5J2U A;  4B3S B;  3X2Q B;  4GX5 A;  3E8G A;  5B1A B;  2BE3 A;  3K59 A;  2O57 A;  1R3L C;  4PI2 A;  1R3K C;  5GTI Z;  1AJP A;  4NTY A;  5IJ9 A;  1NQT A;  4YY3 B;  2GHY A;  1OCO C;  2Z0A A;  4JI6 B;  1YXB A;  2ITC C;  3CD6 V;  1E1Q G;  5ITZ B;  1ENV A;  4GLX A;  3K9S A;  1OV9 A;  4O4J A;  2ZIN A;  2PF4 E;  5CA0 A;  4LF5 O;  1PNK A;  4PDV A;  2DW4 A;  1YEW A;  2ZE7 A;  3DXR A;  5K1P A;  2P06 A;  1EFR G;  1L1F A;  3BA9 A;  3JAL B;  1F51 A;  2F66 C;  2YS8 A;  3UT5 A;  4TUY A;  1PPJ H;  1NBM G;  2JEU A;  2WA3 A;  3BCC H;  2OIG A;  4K3A A;  5DN6 G;  4DV6 B;  4KL1 A;  2OTL V;  3QNE A;  3ZJZ A;  4JTA B;  5EIB C;  1VQ5 V;  4GT1 A;  3OE7 G;  5KX5 A;  2OWO A;  4F4L A;  3QF7 A;  5FNV B;  1FD9 A;  1PKX A;  1H2M A;  3T1H O;  1KKD A;  2XAG A;  2XUM A;  1Q43 A;  4HBN A;  2F1M A;  4PD4 F;  3KCX A;  5LHI A;  1VP7 A;  4QPJ A;  4DR1 B;  4LNU B;  2F43 G;  5JQG A;  1URF A;  1K92 A;  5B66 Z;  2F4V O;  5A9G A;  3RYH B;  3ZMT A;  5JJJ B;  2PUS A;  2FYU H;  3OTF A;  2ZKO A;  3H9V A;  1ROP A;  1MOF A;  4YXW G;  5IT9 N;  2Y48 A;  3FYE B;  4CC5 A;  5CBH A;  4AQY B;  1GH6 A;  1Y74 B;  4MVO A;  2X6C A;  5IYB O;  4QGP A;  1RM1 C;  1COW G;  3SPI A;  2PI4 A;  1VF6 A;  1P7G A;  4JI5 O;  3ABL C;  2ZDI A;  2ADP A;  3TK1 A;  4CH4 A;  3H1J H;  4UV8 A;  1E79 G;  3L74 H;  5IDJ A;  1KU9 A;  4I55 B;  3QO5 A;  4DR6 B;  3G71 V;  1FFX B;  4MTO A;  1M5I A;  1JJ2 U;  1JFF A;  4X20 B;  4I50 B;  1S5J A;  5BY1 A;  4D6T H;  2QEX V;  3C90 A;  1VF5 B;  3VQW A;  1MZE A;  2F93 B;  1T5E A;  2P6J A;  3JD2 A;  1VMG A;  3JAK B;  2QA4 V;  4Q6G A;  1LR1 A;  2FKX A;  3LDC A;  4MTF A;  3ASO B;  1N0N A;  4O4I A;  2Q68 A;  1MSD A;  4FLZ A;  2NNU A;  1NT2 B;  1JPX A;  4JTC B;  3HB3 B;  1PD3 A;  1YVW A;  4O2A B;  4DK0 A;  3A8T A;  4LF6 O;  1VQN V;  1NU1 H;  2RNB A;  4DR3 B;  1FXV A;  1XMQ B;  4X88 A;  2JIZ G;  4WFA V;  3W7X A;  3RT3 C;  1R3I C;  3JSN A;  2AHY A;  3WB0 A;  4LF9 B;  2UXX A;  1V55 C;  4FK5 C;  1G8M A;  1MSW D;  2HKO A;  5EYP A;  4N21 A;  3VQX A;  3ZRS A;  3ASN C;  2HG5 C;  3K79 A;  2ZNJ A;  3FAV A;  1QHT A;  5IJ0 B;  2PGG A;  1KP2 A;  4E2L A;  3B2E E;  3ZMZ A;  4PI0 A;  5KA6 A;  1S5L Z;  3MD0 A;  3PN1 A;  1U97 A;  3OR7 C;  4OX9 O;  1HNW B;  3ZRW B;  5EZY A;  2LFR A;  4MVR A;  2YUA A;  2VQE B;  2AHZ A;  1NTZ H;  4Q20 A;  1Q3E A;  3BFR A;  4LF8 O;  2ZM6 O;  5BR8 B;  2Q7G A;  1NI8 A;  2W0F C;  2CTP A;  2BOB C;  2FL4 A;  2EZP A;  3CCJ V;  5LL6 Y;  2UXB B;  4BIU A;  3JAW B;  3B4S A;  4ZOL A;  4J42 A;  1WA8 B;  1XUQ A;  4H37 A;  1CXZ B;  3CJH A;  1X59 A;  4YJ2 B;  3RBZ A;  3CRR A;  3K57 A;  4B3R B;  4NTW A;  1QQC A;  3ABU A;  3L70 H;  3L75 H;  2YXH A;  1IXM A;  4TQD A;  3STZ C;  1RP3 B;  5BMV B;  3T1Y O;  3OD4 A;  5HFM A;  4B3T O;  4LFC O;  3VQY A;  4NXN B;  3CEI A;  2CH7 B;  5IE9 A;  3JAT B;  1FXH A;  4MW3 A;  1K73 W;  1BE3 H;  2WLL B;  3ZED A;  3GVM A;  4P2Z A;  1IBM B;  2VQF O;  4CS3 A;  1NTK H;  3ZRX A;  5L3G A;  1KB9 F;  2AZ2 A;  3N27 A;  3MHH C;  2E5L O;  3R65 A;  3FKS G;  4G27 B;  4UB8 Z;  2EIM B;  2LFS A;  4ASU G;  4MT8 A;  1AR5 A;  2Q69 A;  3KZI Z;  1ZAU A;  3U0Z A;  1NH2 D;  2BSK B;  3W7T A;  3OUS A;  4DUY O;  3RVZ A;  4JI1 B;  2Z5U A;  1B6Q A;  1SER A;  2Y4T A;  1H2S B;  1FPO A;  3R66 A;  2QJ1 A;  3ZBH A;  1K4D C;  3OT7 A;  4I0X B;  1OCZ C;  3G80 A;  5KAF Z;  1XI1 A;  1VAR A;  2GSM B;  3WB2 A;  1GAX A;  2P4V A;  3J81 N;  4JYA O;  2DWE C;  4WFG A;  2DJV A;  4CS2 A;  5D5P A;  4YJ3 A;  5KHG A;  4TV8 A;  2EZO A;  1XNR B;  2EJR A;  1DF5 A;  4YHH O;  3OTO B;  1RSO A;  2X6B A;  4EFB A;  2CTQ A;  5H2F Z;  1AI5 A;  1M56 B;  3X2Q C;  3DC5 A;  3ZS8 C;  5LMU B;  1NZ6 A;  2GUZ A;  5B1A C;  3ETE A;  2ZE8 A;  1YSC A;  4GKK O;  1DGS A;  2JJ1 G;  1M1K W;  1HNZ O;  2RQ6 A;  1XQ8 A;  4UV9 A;  2B1G A;  2CDY A;  2F23 A;  2HHH O;  3OM3 B;  4G2K A;  4U3F H;  2PY5 A;  3TGU H;  1H38 A;  1NTM H;  2NR5 A;  1OCR B;  2UUC O;  4DR5 B;  2OCC B;  4K0K B;  4WFH A;  2QWR B;  4PA3 A;  4X62 O;  2A06 H;  2ZD9 A;  4MSW C;  1Q81 W;  3B40 A;  3BRC A;  4D7S A;  4JI8 O;  2A79 B;  1QR8 A;  4G28 B;  4IIJ B;  4D7T A;  4JI0 O;  3T2M A;  1Q7Y W;  5CBG A;  2FML A;  3SJA C;  5LYJ A;  3L73 H;  2KB1 A;  4RO2 A;  1I94 B;  3GWO A;  1LNQ A;  1YZB A;  4ZI7 A;  3BVO A;  1K7D A;  5GON B;  3T4D A;  3K5L A;  1S72 V;  3CME V;  1N36 B;  3B77 A;  1F4N A;  5E79 Z;  1SRY A;  2YIB A;  1KC8 W;  1VQ4 V;  4LWS A;  1IDS A;  4H44 B;  4UFZ A;  5DEC A;  1XL6 A;  2X6A A;  3CE2 A;  5IYD O;  4DXW A;  3FB6 C;  2HVK C;  2QR4 A;  1M4U A;  1KKC A;  1IZ3 A;  1KYO F;  1K97 A;  4UCR A;  2Q4P A;  3JD0 A;  1EN5 A;  4LFB O;  3RYF A;  4XBF A;  2L6L A;  2M7W A;  2JGD B;  3IC7 A;  1TUB A;  1OZ0 A;  4DR7 O;  4GKJ O;  3SPC A;  5HFL A;  4X1K B;  2W6J G;  4B3S O;  1SA0 A;  2BTQ A;  3OMA B;  5C8Y B;  1HR0 B;  1AB3 A;  1FJG O;  4J10 A;  2YXY A;  4I4T B;  1SQG A;  1B3Q A;  1CEZ A;  2IH3 C;  2QWO B;  2OYQ A;  4MVU A;  4U3J A;  5DM6 V;  1H2K A;  3ABK B;  1I5Y A;  3JD3 A;  3FFQ A;  4UCS A;  4TV9 A;  3CMA V;  3MAQ A;  2Q5Z A;  4GUN A;  2IU0 A;  4X1I A;  3CCU V;  3JSL A;  1S5H C;  4DV0 O;  2JK5 C;  1AVM A;  4FVM A;  4IHJ A;  1H2G A;  5LOV A;  5A2Q N;  3RW0 A;  3K3W A;  4PA9 A;  4ZIB A;  4DV6 O;  4HNA B;  1Y76 A;  5H6Q A;  4BIO A;  2UXN A;  4QJF B;  3HKD A;  4O4L A;  3ZCC A;  2RMK B;  2ZR3 A;  4DV3 B;  1SQB H;  1L8D A;  2BCC H;  1VQP V;  3N2K A;  2EIN B;  1O9H A;  4B3M B;  4AIL C;  1S77 D;  1F23 A;  3WFV A;  5LXT A;  4JAA A;  2WA4 A;  5LMN B;  1P7B A;  4FLW A;  1VQ8 V;  4JI4 B;  5JH7 A;  5KUM A;  4WFE A;  3LDD A;  3QVN A;  4UCU A;  1GRJ A;  1J95 A;  2M6Y A;  3APO A;  4FLT A;  2E76 B;  3QTC A;  3E83 A;  3UKM A;  4ZHQ B;  2UUA B;  3K06 A;  3JCU Z;  4AQY O;  3F5T A;  5JWP A;  5LGN A;  5BZB A;  1P4R A;  2WLI B;  1XNQ B;  4J11 A;  5IYZ B;  1EBO A;  2ARH A;  5B1O A;  2F95 B;  4RQF A;  1WB7 A;  3F7V C;  2JRI A;  2Q0O C;  1YIT V;  1JCH A;  5GTH Z;  1IBK B;  4WFF A;  1WP7 A;  4JAS A;  2OTJ V;  4OGQ B;  3KKY A;  4DUZ B;  4DV1 B;  4LNU A;  3B09 A;  1GN2 A;  2YSU B;  1ZTE A;  2UU9 B;  4JYC A;  4DR6 O;  2YI8 A;  4BWA A;  3CPW U;  2YDE A;  1AI4 A;  4X9Q A;  2KG7 A;  5E1A C;  3U10 A;  1WLE A;  4O4H A;  1ZX3 A;  2UUB O;  2XAJ A;  2QGN A;  3SPH A;  4BW9 A;  4DRX B;  3ZRV A;  3RWR D;  2XAH A;  3ZX6 A;  2XTA A;  2YIA A;  2YIC A;  2DMX A;  2P5O A;  4PDM A;  4LH6 A;  3G6E V;  2PI5 A;  1Y74 A;  1IBL B;  4PDL A;  5B3S B;  4IYI A;  2DQ0 A;  3JAS B;  1N32 B;  3HR0 A;  4MVQ A;  4H33 A;  1YTF B;  1K33 A;  1NKD A;  1XMQ O;  5JCO A;  1BHA A;  3SYA A;  2YXL A;  5KUK A;  3W7W A;  3SGI A;  1OHH G;  4LF9 O;  4NKG B;  1VQ6 V;  2WPD G;  2D2C B;  2VS0 A;  3P3P A;  1FKA O;  1PP9 H;  4W4L A;  2ZIM A;  3VQV A;  3PJS K;  1VQO V;  4L87 A;  2EIM C;  2RDC A;  1YDX A;  4DV4 B;  5CB4 B;  4JI2 O;  3SPJ A;  1AR4 A;  1ZUQ A;  1FXK B;  4HZ3 A;  1IXB A;  3ZMV A;  5KMG B;  5J2U B;  2UXC O;  4DV2 O;  3CYO A;  4CS4 A;  4RAI A;  3JAR A;  4JI3 O;  5LP6 B;  1BZK A;  1K9M W;  2PYL A;  4FMT A;  1SQP H;  3ABM B;  5IJ9 B;  3A0R A;  5BR8 O;  3E86 A;  3THO A;  1Q6I A;  1VQL V;  2WLK A;  4JYY A;  1SZX A;  3ZN0 A;  1JR9 A;  4K8Z A;  2HJF C;  4O4J B;  3CX5 F;  1R1B A;  2UXB O;  5CA0 B;  4X66 B;  1HDJ A;  5H5N A;  3DXR B;  5LHH A;  1M56 C;  4B3R O;  3RFR A;  4TUY B;  3CXC U;  3A2F A;  2Q7E A;  3AG2 B;  1GMG A;  3K9A A;  1ORQ C;  3FB5 C;  2P4K A;  1YTF D;  5KX5 B;  3JD4 A;  3E22 A;  1VQ7 V;  2Y4U A;  3M8A A;  1YI2 V;  3K0D A;  2ZNI A;  5LGT A;  4U7O A;  4LF4 O;  1OCR C;  3BHP A;  2OCC C;  3CCL V;  2P7T C;  3OGC C;  1Y66 A;  1IBM O;  4JZG A;  1V9P A;  1XEQ A;  1WA8 A;  4UCV A;  3SR2 C;  2DQ3 A;  4YJ2 A;  1PV0 A;  1KQS U;  1QVF U;  3J80 N;  2A3Q A;  3S3W A;  3CCS V;  3HKC A;  4OXS A;  3H1H H;  3E8H A;  4ABM A;  4FFB A;  4F6E A;  2QKA A;  1BS3 A;  2V7Q G;  4C7U A;  1G6U A;  3JYC A;  1TVK A;  1Q8I A;  2EIL B;  4JI1 O;  3HPL C;  3M99 B;  3T1H B;  4JF3 A;  3D36 C;  1NH2 B;  1N8R W;  3UM7 A;  1VQ9 V;  3IJ4 A;  2WLH A;  2Q6A A;  4EB6 A;  4MW8 A;  2LGW A;  3B8M A;  1V54 B;  3LSQ A;  4JTD B;  3ZMU A;  3HKE A;  1DTO A;  3HKB A;  1JFF B;  4QNH B;  1XNR O;  1I08 A;  2ZXW B;  2L35 A;  2Y69 B;  5JVD A;  3ML0 A;  4DR4 B;  1JA8 A;  2LO1 A;  3AK2 A;  5FLX N;  4B7K A;  1VEW A;  5LMU O;  2H3O A;  2Z3Y A;  1N34 B;  2BSK A;  1SC5 B;  4O4I B;  3RYC A;  1ZWI C;  3ABK C;  3CRM A;  2VWK A;  1GN4 A;  4J7K A;  1Q6U A;  3CCQ V;  2IH1 C;  1YF2 A;  4FLV A;  5IWA O;  1EN6 A;  3BAB A;  3DGE A;  4P9O A;  3W7S A;  2JS5 A;  5EYP B;  4DR5 O;  3H1K H;  3VBB A;  3CXH F;  1GM7 A;  2X0L A;  3FAV B;  2AGA A;  1EN4 A;  2DYS B;  4BR6 A;  1F7Y A;  1SET A;  5IYC O;  1G1X B;  3O9O A;  4X65 B;  1NJI W;  4JAU A;  1BMF G;  3FB7 C;  3J7A U;  2DYR B;  3JD1 A;  3L72 H;  2GBO A;  5CMU A;  3CHX A;  3O65 A;  4LCU C;  3OEE G;  5EZY B;  1I94 O;  1QLE B;  4LF6 B;  2EIN C;  1BQ0 A;  2Q73 A;  2R9A A;  1XBL A;  3IFX A;  3RGB A;  1WPB A;  1H2N A;  1UPG A;  2GTA A;  4JAV A;  1Q90 D;  3OGI B;  2XOK G;  4J9Y B;  1J5E B;  4MVM A;  1KUQ A;  4IGG A;  1N4C A;  4L8J A;  2BTO A;  2LQT A;  4ZOL B;  2YID A;  5CA1 A;  4JPR A;  1QVG U;  4GYC B;  4DV5 O;  3CJH B;  2ZQM A;  1R3J C;  3K03 A;  5H9C A;  1ZL8 A;  1KP3 A;  4OX9 B;  4UVA A;  1GTO A;  3ZN1 A;  5IY5 B;  3OUF A;  5JJN B;  4QE7 A;  4JI7 B;  2D3O W;  4LP8 A;  4CH3 A;  4NYK A;  1HR0 O;  1JOY A;  1WB8 A;  2LP7 A;  2ZM6 B;  3N2G A;  4J80 A;  2B1I A;  3ABL B;  1W0J G;  4WBN B;  3GWK C;  1SZT A;  2OT5 A;  2R9R B;  3Q4H A;  3EXA A;  2H8P C;  2EBO A;  4KHP B;  3ETD A;  5C93 A;  3G4S V;  1D5A A;  3D8C A;  4CH5 A;  2QWQ B;  3K04 A;  3K08 A;  5B3S C;  5J2T B;  1GO3 F;  1W2B U;  2R70 A;  4K8X A;  3M7M X;  1DLB A;  4B3T B;  1JX9 A;  1R6K A;  3G6B A;  5EIB D;  2ZE6 A;  4PA4 A;  3FX7 A;  1CPY A;  3UCS C;  4GX1 A;  1GM8 A;  1Y6X A;  2YEV A;  2CE4 A;  4B3M O;  1PL4 A;  4X1Y A;  2CAZ C;  2GV9 A;  4I9Q A;  3CSX A;  1N33 O;  1KMI Z;  3WU2 Z;  5LMN O;  5LA6 A;  1AJQ A;  4AI8 A;  2ILM A;  4YJ3 B;  1MA1 A;  1OCC B;  4JI4 O;  1QR9 A;  3APQ A;  3FB8 C;  2RJZ A;  2LGQ A;  4DYL A;  3ETQ A;  2E5L B;  4TV8 B;  3AG3 B;  2N05 A;  1WPX A;  2VWJ A;  4WFB V;  1RSO B;  5EBW C;  3E35 A;  1FXK C;  2DOS A;  1AIL A;  5EK0 A;  2JVD A;  4E4E A;  1LUV A;  2ZR2 A;  4LF7 B;  5LP6 C;  2EIK B;  4RQE A;  1BT8 A;  2XHB A;  2IBZ H;  3ABM C;  4HYO A;  1K3E A;  2LW1 A;  3E2E A;  1X4T A;  3CRC A;  4JYA B;  4DUZ O;  4DV1 O;  3CC2 V;  2UU9 O;  3EHB B;  2QM8 A;  4YY3 O;  5KLV H;  1NS1 A;  2MW2 B;  4JI6 O;  3CRA A;  3LSU A;  2NLJ C;  1FYJ A;  3TXS A;  2QTO A;  1XHX A;  1GKF A;  3AG2 C;  3BPZ A;  3H1L H;  4RUE A;  2DWD C;  2VRZ A;  5LBQ A;  1IBL O;  2WLI A;  3TJT A;  1P49 A;  1AP5 A;  1S3J A;  5EBM C;  4X64 B;  2XND G;  1N32 O;  4ZI7 B;  4GKK B;  4NB5 A;  3ASO C;  1HNZ B;  2UXD B;  2QM7 A;  3BY6 A;  4JYB A;  4AHC A;  1DK1 A;  1SKV A;  2QSA A;  2HHH B;  4UCO A;  3UO3 A;  4MS2 A;  4OPA A;  4W4K A;  4EFE A;  5KHJ A;  1GN6 A;  5FPO A;  4LWS B;  4FLU A;  3OEH G;  2UUC B;  5ITZ A;  3UO2 A;  4F6R B;  4X62 B;  1QCE A;  3OAA G;  1YCI A;  1AJN A;  3EVK A;  3RN4 A;  4DR1 O;  4NVP A;  2AZ0 A;  4J41 A;  3RYF B;  4DR2 B;  2IJH A;  3DC6 A;  3I5D A;  2W6I G;  3JAL A;  4J9Z B;  3SYO A;  3KCY A;  2PTM A;  4Z1V A;  1VF7 A;  1BHB A;  2K1E A;  1MMM A;  2BTQ B;  2QKC A;  3RYI B;  3CCV V;  3IGA C;  2CGO A;  1VF6 C;  1TA8 A;  2ZDI C;  2XT9 A;  2DN9 A;  1Y4M A;  4EKW A;  5CN0 A;  4BAY A;  1IUR A;  4U3J B;  2QM4 A;  4KUM A;  4O2B B;  3DTU B;  1M57 B;  1TGO A;  1XMO B;  5FNV A;  2JS3 A;  2ETN A;  1V54 C;  4TV9 B;  2ZE5 A;  3CCE V;  4X1I B;  4X66 O;  2IJJ A;  2ZXW C;  2Y69 C;  3W7U A;  4IHJ B;  1RPO A;  2EX3 A;  2RN9 A;  3D3I A;  1B04 A;  2Y0I A;  4TOI A;  3STL C;  5LOV B;  1K4C C;  4IT5 A;  2BOC C;  2N04 A;  2QWP B;  3RYH A;  2K9P A;  4Z1M G;  4LFA B;  2OCH A;  1UJW B;  4ZKI A;  3FD9 A;  1Y76 B;  2CTR A;  1FJG B;  4GCZ A;  5LP6 A;  1SF9 A;  4XDL A;  3HKD B;  4O4L B;  4GZR B;  2HVJ C;  4UB6 Z;  4OPH A;  2HEP A;  1SQQ H;  1PNM A;  2WLN A;  2A9H A;  1XDC A;  3N2K B;  3JCZ A;  1HNX B;  4MTX A;  2YIB D;  4IL6 Z;  4U7N A;  2HP8 A;  5LXT B;  2Y0P A;  4JV5 B;  1YJW V;  4TWK A;  3AG4 B;  3LDE A;  4DV0 B;  4DR3 O;  5B1N A;  2R9I A;  5B1B B;  5JH7 B;  4I55 A;  2DYS C;  4NR1 A;  1FFX A;  1M93 A;  3LNN A;  5AG2 A;  4EEQ A;  4X20 A;  4I50 A;  3F7Y C;  3BAA A;  2DYR C;  5FL7 G;  1OJH A;  3CCM V;  3CP1 A;  2V4D A;  2IU3 A;  1UFI A;  2H94 A;  4YIO A;  2B5U A;  3JAK A;  1QLE C;  4DV7 B;  1Q6H A;  2QTS A;  4R6Z A;  3SJB C;  3TCU A;  3WG7 B;  1HNW O;  1M90 W;  4NXM B;  4O2A A;  4UVB A;  1YJ9 V;  2VQE O;  3LSS A;  4ICG A;  5CA3 A;  1BSM A;  4DK1 A;  4FLY A;  1S76 D;  3CWB H;  1F4M A;  3SPG A;  2KG7 B;  4O4H B;  1W59 A;  1VQM V;  3TET A;  1TAE A;  4CC6 A;  1L0N H;  1B06 A;  1Y67 A;  4WCE V;  4DR4 O;  2EIJ B;  3BEH A;  5IY5 C;  5IJ0 A;  1R6N A;  1N34 O;  1EZV H;  3SYC A;  1MNG A;  4PA7 A;  5H6R A;  3AG7 A;  2WSS G;  3UT5 B;  2E3C A;  3ZRW A;  3NXS A;  4DO2 A;  1BCC H;  5EC2 C;  1NR7 A;  4Z2W A;  1W0K G;  4MVZ A;  5JJE B;  1XHZ A;  1THZ A;  5LHG A;  1FFT B;  4NXN O;  1WAZ A;  2WLJ A;  1Q82 W;  3SYQ A;  4FLX A;  2QKS A;  1XOU A;  3CC4 V;  3QO8 A;  1MG1 A;  2UUB B;  4XDJ A;  2P90 A;  2YI9 A;  1PNL A;  4LF5 B;  3JAW A;  2JEX A;  3CS5 A;  4P30 A;  4B08 A;  2KSD A;  1I7F A;  3C3T A;  5JQG B;  1Q86 W;  2Q9L A;  4X65 O;  1R6T A;  1US6 A;  2ODM A;  4PDR A;  1ZLZ A;  3P30 A;  4NTX A;  4LC1 A;  5DED A;  1LUW A;  3JAM N;  5BMV A;  1D2D A;  1D5N A;  3JAR B;  4JGS A;  5KHI A;  5F2V O;  1JJO A;  2N74 A;  4HAM A;  4LR3 A;  1Q5O A;  1YHQ V;  3B8N A;  3AG1 B;  2CH7 A;  1OCC C;  3JAT A;  3ZHU A;  1J5E O;  3ZMS A;  3IC9 A;  1SQX H;  4B7E A;  1R73 A;  3AG3 C;  1Z5V A;  2DE0 X;  2WLL A;  2QWN B;  2LW7 A;  1MAB G;  3SYP A;  2EUL A;  4JI2 B;  4TQF A;  3NR7 A;  3K58 A;  1U96 A;  2W0X A;  2JJ2 G;  3KG2 A;  4LBE C;  2F4V B;  5D5Q A;  1HWY A;  2EIK C;  2UXC B;  3OTO O;  4DV2 B;  4JI7 O;  4FIP C;  1K5S A;  5LGU A;  5TIS Z;  4JI3 B;  4FFK A;  1YJN V;  2Q8V A;  2FB5 A;  3U11 A;  1NR1 A;  2HLD G;  3E22 B;  3ETG A;  2E75 B;  1RFY A;  1QLN A;  4GX2 A;  5J9P C;  2ZT9 B;  3SJQ C;  1WNS A;  3QG5 A;  4JI5 B;  1SQV H;  4DW0 A;  4A5U B;  2XAS A;  3BA8 A;  4CZZ A;  4I0X A;  3AK3 A;  1YIJ V;  1OCO B;  3F5W C;  2X7R B;  1VQK V;  3E8B A;  3OMN B;  5KHK A;  4KHP O;  1RPR A;  2Q0A A;  2PYJ A;  4FM1 A;  3TXQ A;  4PA6 A;  3L9D A;  3HKC B;  1BGY H;  3E8F A;  4K0K O;  4FFB B;  2YC0 A;  5K1X A;  2IM9 A;  4KFM A;  5BXZ A;  1TVK B;  3I55 V;  1XIL A;  1G4Y B;  2RCV A;  4K35 A;  2HFE C;  4UUJ C;  5L3D A;  4WBN A;  2A0L A;  4GX0 A;  3ZHT A;  4LH7 A;  2GTS A;  5EC1 C;  3SJC C;  4LF4 B;  3ICX A;  1WN7 A;  1AR1 B;  4UVC A;  1N36 O;  2IJI A;  4EB6 B;  4BIZ A;  2XAF A;  4MVS A;  2P67 A;  3OMI B;  3HKE B;  4PV1 B;  4I5S A;  1QBZ A;  2ATK C;  3HKB B;  4XDK A;  5JVD B;  1AI6 A;  3L71 H;  5J2T A;  2V1D A;  1K34 A;  4FPP A;  1H2L A;  1IX9 A;  4KP4 A;  5B5E Z;  4PJ0 Z;  4LF7 O;  2G38 A;  1L0L H;  4IIJ A;  2ITD C;  1GN3 A;  4H13 B;  3RYC B;  4I7Z B;  1CP9 A;  1M57 C;  3ZHV A;  4CBC A;  4DW1 A;  2WAM A;  1I0H A;  4N23 A;  5GON A;  3GB7 C;  4LF8 B;  1JMK C;  1RM1 B;  3K0G A;  4ZBM A;  3AEI A;  3D36 A;  4PHZ A;  1EM1 A;  2QE7 G;  4PEL A;  4BW5 A;  3CB2 A;  4J7Z A;  3MDS A;  1PM9 A;  2WWW A;  1KD1 W;  5L3F A;  5GW7 A;  1GM9 A;  1BL8 A;  1JVM A;  4R50 A;  3P32 A;  3ABT A;  2JGD A;  4RUF A;  5L3C A;  4X64 O;  2CK3 G;  4X1K A;  3OFN G;  2ADQ B;  2UXD O;  5C8Y A;  3T1Y B;  1E1R G;  1KBH A;  4LFC B;  2MK3 A;  1FAF A;  4I4T A;  4DV3 O;  4FM2 A;  3AG4 C;  5IWA B;  1SES A;  4QIW F;  2HJD A;  1ZSP A;  2R72 A;  3ZHS A;  5B1B C;  1WJZ A;  3D3Q A;  3K5N A;  4UXN A;  2ZCE A;  2AW9 A;  2JDI G;  2XAQ A;  4QE9 A;  5CA1 B;  1Z2G A;  5KA5 A;  1SS3 A;  3FYI B;  1V55 B;  1H8H G;  2VQF B;  1H8E G;  4DR2 O;  1QNM A;  2ZIO A;  3ASN B;  1ZL8 B;  5FPR A;  1TUE B;  4X89 A;  2PZS A;  2IJK A;  3T1C A;  1BQZ A;  2GDS A;  1XL4 A;  3WG7 C;  3ZIA G;  1WP8 A;  1KEC A;  3T4Z A;  2IW5 A;  4HNA A;  2UUA O;  4H0L B;  2Q67 A;  1IVS A;  3SDL A;  3RVY A;  2EJ7 A;  2WLM A;  3DSQ A;  3N2G B;  2GUZ B;  4DUY B;  3H01 A;  3I56 V;  2CUG A;  1EZJ A;  1XMO O;  5KAI Z;  1XNQ O;  1XRE A;  4F6R A;  3Q4H B;  3ZHQ A;  1IBK O;  3H1I H;  3C3S A;  5L3E A;  4DV5 B;  2EIJ C;  3S3X A;  1HP8 A;  2HR3 A;  3K5M A;  1I5X A;  4FM0 A;  4LFA O;  3E89 A;  4YHH B;  3MHS C;  4IYH A;  5CBF A;  3A0B Z;  3RYI A;  4R7C A;  4KXR A;  4RWU A;  1NVP B;  4J7J A;  4MTG A;  3P3N A;  4ZHQ A;  2A7W A;  2C2A A;  1AI7 A;  2B9Z A;  5L3B A;  3LUT B;  3EFF K;  1AP6 A;  5JCO C;  4TSF G;  4O2B A;  1VIB A;  5LYJ B;  5IYZ A; 
#chains in the Genus database with same CATH homology
 4LFB O;  5LL6 Y;  4X65 O;  1R6T A;  2Z0A A;  5BXZ A;  4AQY O;  1HNX O;  2UXD O;  3F5T A;  4JI4 O;  4JI3 O;  4YHH O;  4DR7 O;  4DR1 O;  4GKJ O;  4JV5 O;  4DV3 O;  3JAM N;  1KUQ A;  4B3S O;  5BR8 O;  1D2D A;  1X59 A;  2JRI A;  4LF5 O;  1AB3 A;  1FJG O;  5BY1 A;  2DOS A;  2N74 A;  1AIL A;  4DV5 O;  1N36 O;  1HNW O;  1R1B A;  2UXB O;  1XNR O;  3T1Y O;  5H5N A;  4DR6 O;  4GKK O;  4LFC O;  4B3T O;  1J5E O;  1HNZ O;  2FKX A;  2VQE O;  2HHH O;  5FLX N;  4DV4 O;  5LMU O;  1HR0 O;  4DR2 O;  4B3R O;  2UUB O;  4DV0 O;  2LW7 A;  4DV7 O;  4LF6 O;  4DUZ O;  4DV1 O;  2UUC O;  4X66 O;  4LF7 O;  3RT3 C;  5A2Q N;  2UU9 O;  2UUA O;  3T1H O;  4X62 O;  3SDL A;  4YY3 O;  4NXM O;  1NS1 A;  2VQF O;  4JI6 O;  4DR4 O;  3OTO O;  4JI7 O;  1FYJ A;  3M8A A;  1XMO O;  4DV6 O;  4JI8 O;  1N34 O;  1XNQ O;  2E5L O;  5IWA O;  4JI0 O;  1XMQ O;  4DR5 O;  4LF4 O;  1IBK O;  1YZB A;  2F4V O;  1A32 A;  1IBL O;  4LF9 O;  1IBM O;  1XEQ A;  2AGA A;  4A5U B;  2ZKO A;  4DUY O;  4OX9 O;  1F7Y A;  1FKA O;  1N32 O;  4OPH A;  5IT9 N;  4NXN O;  3J80 N;  1G1X B;  4KHP O;  3J7A U;  3R66 A;  4LFA O;  1DK1 A;  3O65 A;  4LF8 O;  1I94 O;  4JI2 O;  2ZM6 O;  3J81 N;  4JYA O;  4DR3 O;  2DJV A;  4B3M O;  4K0K O;  4OPA A;  4JI5 O;  4JI1 O;  1N33 O;  4X64 O;  5LMN O;  2UXC O;  4DV2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...