1DK1A

Detailed view of a key element of the ribosome assembly: crystal structure of the s15-rrna complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RRNA FRAGMENT
publication title Crystal structure of the S15-rRNA complex.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1999-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1dk1A00
5H5NA 2DOSA 4DR5O 4JI7O 4KHPO 5BY1A 4LF6O 2ZM6O 2UXBO 1R6TA 4DV2O 1IBLO 4JI0O 1XNQO 4B3SO 1HNWO 4JV5O 1HNZO 5IT9N 4DV5O 4LF7O 2VQFO 1IBMO 1N32O 1HNXO 1FJGO 1G1XB 5A2QN 1R1BA 4JI1O 2ZKOA 5LMUO 1XEQA 2VQEO 4GKKO 2UUBO 1KUQA 1YZBA 4LFBO 1A32A 4AQYO 4LF4O 1N33O 3JAMN 4X65O 4OX9O 4DR2O 4LFAO 4DUZO 1XMQO 3F5TA 1D2DA 1F7YA 2DJVA 3J7AU 4GKJO 2AGAA 3R66A 2JRIA 5FLXN 1N34O 4LFCO 1X59A 3T1HO 1XMOO 4B3MO 4DR4O 1HR0O 4DR6O 2Z0AA 5BR8O 4DV1O 1NS1A 4A5UB 2UUCO 4JI6O 5LMNO 1FKAO 2UXCO 4DR1O 1N36O 2UUAO 4JI2O 2FKXA 4DV0O 3J80N 4YHHO 4K0KO 3OTOO 4JI8O 4X62O 4DR7O 3M8AA 4DUYO 2UU9O 4B3TO 4B3RO 3T1YO 4YY3O 3J81N 4X64O 2N74A 4JYAO 4NXNO 4JI5O 4DV3O 1XNRO 3O65A 2UXDO 5LL6Y 4NXMO 4DR3O 3RT3C 4OPHA 4DV4O 4LF8O 4LF5O 2HHHO 1J5EO 2E5LO 1FYJA 5IWAO 5BXZA 4OPAA 4DV6O 2F4VO 1DK1A 1IBKO 4JI4O 1AILA 4JI3O 1I94O 1AB3A 4LF9O 4DV7O 4X66O 2LW7A 3SDLA
chains in the Genus database with same CATH superfamily
3CS5A 1JJ2U 1K5SA 4IT5A 2P22C 2HKOA 1IDSA 5BR8B 4J9ZB 4RO2A 2ADPA 1HNWO 5GONA 4JZGA 5LP6C 2ZDIA 1N36B 4H0LB 3A0HZ 2YS8A 2UUBO 2M7WA 1RPRA 1GM7A 5JCOA 1BE3H 3JD2A 2RJZA 1S5LZ 3STLC 1WLEA 2Q73A 1XMQO 2GV9A 1SQXH 4FFBA 5LBQA 4FLVA 4OGQB 3K5OA 4KP4A 1DGSA 1F51A 1G8MA 5KLVH 3FKSG 3QNEA 1YSCA 2YIBA 2NR5A 3ABTA 1VF7A 3D36C 2L6LA 1IBKB 4JI4B 1YCIA 2XTAA 2VWKA 1MG1A 4JYBA 2FKXA 4DV0O 4PA7A 1ZL8A 3SPCA 2ZIOA 1VF6A 1S76D 2GTAA 1SA0A 2Q67A 4DW0A 4PDMA 2BSKB 4FFKA 5LA6B 3E22B 1HNWB 4I50B 3H1JH 1GMGA 1BSMA 2IH1C 2CH7B 4G27B 1E1RG 2UUBB 2Y0PA 1XILA 1Y66A 3CE2A 1NU1H 2HR3A 2HHHO 2ZR3A 2HVKC 3TXQA 2AZ2A 4LH6A 5KAFZ 3G67A 2B5UA 2HJFC 1XMQB 4JI3O 1BHAA 4LF9O 5GTHZ 1YIJV 1K3EA 2ITDC 1OCOB 3RWRD 4CC5A 2ZINA 2DQ3A 3SJAC 3K58A 1KQSU 4JI0O 1XI1A 3RN4A 3H1LH 3B77A 5L3BA 2HG5C 4H33A 1WB8A 2LGQA 2MK3A 5JQGB 5IT9N 3ASNC 3AG1B 4TUYA 2LGWA 1QHTA 4DV0B 1KU9A 1VARA 4UVAA 1SKVA 1V9PA 2A3QA 5EBWC 3CCQV 4F6EA 4QGPA 4P9OA 4LFAO 1XHXA 4JZ2A 1M1KW 5KHKA 1OCZB 2YI9A 3FAVA 3AG2B 4Q20A 4I7ZB 3CCSV 3SPHA 1RP3B 5KMGA 4R7CA 1L0LH 2WLKA 3B8NA 5J2UA 4X8AA 4GX2A 5J9PC 2OWOA 1AP6A 1M5IA 1OCCC 1UJWB 2HHHB 3ZHUA 4A5UB 1GRJA 4IGGA 1KB9F 1Y6XA 4JI3B 2BOCC 2ZE8A 4LF9B 1VQNV 1R3JC 3UT5A 2OTJV 5IY5B 4PI2A 3UQ8A 3W7UA 5H6RA 2YEVB 4B3TO 5KHJA 2X6BA 4B3RO 4JI0B 3ZMZA 1NZ6A 4WFHA 3OMIB 3ZRSA 3SGIA 5JJJB 1VEWA 3ICXA 5IYCO 3TETA 1VQ5V 3RYIA 2EILC 2Q5ZA 2ZT9B 2WLIB 2KG7B 4DV4O 1OCRB 3W7WA 5CA3A 1WJZA 5BXZA 4LFAB 1I94O 2EULA 2CUGA 5B66Z 1RM1C 3BPZA 4IYIA 1K4DC 2PYLA 4L87A 1R6TA 2V7QG 3ZHVA 1XNQO 1XQ8A 1MABG 5FPRA 2GUZA 3TJTA 1GN6A 5LA6A 3JD3A 1EFRG 3K0GA 4I50A 3IAYA 1JFFA 2JGDA 3AK1A 5KX5B 2ZXWC 5LMUO 2E75B 4FZ0A 5HFLA 2EINB 4B7KA 4DYLA 4B3TB 2CH7A 1A32A 4B3RB 3H1HH 1N33O 3ETQA 4UV8A 2JK5C 1YDXA 2X6CA 4MT8A 4TQDA 2YUAA 4I9QA 3CRMA 4J7JA 2LJ2A 4O4IB 1Q90D 1BS3A 1FS0G 2DQ0A 2MW2B 1Z5VA 3K03A 4IYHA 4DV4B 4L8JA 1US6A 1N0NA 5KUMA 3WU2Z 3DC5A 1Y4MA 1YTFD 1FXKB 1I94B 2UXCO 3VQWA 3SYCA 1CP9A 5JQGA 3FB7C 2QA4V 4LF4B 1H2GA 1AI4A 2Q68A 3RYCB 2Y69B 1DF5A 4PA3A 2P67A 4FJCC 1XNQB 1FD9A 5LYJB 2X0LA 5IYZB 1N0JA 2XOKG 1QLEC 3G4SV 2FB5A 4HAMA 2IJHA 4LNUB 5LMUB 1EZVH 1PD3A 3B40A 4XDJA 4NXMO 3GWKC 1KP2A 3OGIB 2DYSB 3LSSA 5LHHA 1N33B 2ZIMA 3P30A 1OHHG 4AI8A 1GH6A 1DLBA 2F4VO 2Q4PA 4X66O 2B1GA 1BQZA 2ZNIA 5FNVB 2QTOA 4LH7A 2ZM6O 1FFTB 1BHBA 1K5QA 3MHSC 3E35A 3WB0A 2PGGA 1P49A 2YDEA 1XNRB 2UXCB 3JD4A 4F6RB 1ZWIC 4CS2A 2Z5UA 2DW4A 4Z1MG 4BW5A 1R6KA 4GZRB 4O4HB 1QR9A 4BIUA 4I0XA 1XDCA 3JAKB 2C2AA 3OUFA 4H37A 2YIAA 4O4JA 4UCTA 4EEQA 1GN2A 1N34O 4GT1A 3G71V 3BVOA 3CMEV 4MW8A 2W6IG 4NXMB 2F43G 1P7BA 1AJNA 2XUMA 5D5QA 2IJKA 5KHIA 2EIKB 2UUCO 3F5WC 3K9SA 3HKEA 4B08A 2F4VB 1VF6C 2WSSG 4X66B 4JI2O 1MA1A 3ABKC 1VQLV 2Q7HA 3F7YC 1MZFA 4HNAA 1YEWA 3M99B 3OTOO 4DUYO 5KX5A 2ZM6B 5B5EZ 4J80A 1WB7A 1SETA 2WLJA 4BR6A 3AK3A 3DC6A 1ZUQA 2KKWA 1H2SB 2OCHA 2ATKC 3LSQA 5LGUA 3KCYA 2IU3A 5C93A 1KC8W 2EX3A 3O65A 2BOBC 5J2TA 2D2CB 3IC9A 4LWSA 1FYJA 4P2ZA 3ASOC 4TSFG 4XDLA 4DV6O 1AILA 1AROP 1FXKA 1AB3A 3BHPA 2EBOA 4CH5A 5IE9A 4EFEA 2KB1A 4MVOA 3BABA 2UXBO 4RUFA 2UXNA 3K9AA 1N34B 1YXBA 4TQFA 3RFRA 1IURA 2AZ0A 3SYQA 1M56C 4JAVA 5CBHA 3RYCA 1RPOA 1TUBB 2UUCB 5IYDO 2CDYA 4TV8B 1FFXA 4LF7O 4FFBB 1K7DA 5GW7A 2LFRA 4X9QA 5L3FA 3CCRV 5DECA 1R1BA 1V55B 5IYZA 4JI2B 3BA9A 3OTOB 1KECA 3ZHRA 4R50A 1GK9A 2F66C 3LNMB 1I08A 2HLDG 3WG7B 3CCLV 3CD6V 3S3WA 3R66A 3OUSA 4LFCO 4FVMA 3JATA 1ZL8B 1AI6A 2HFEC 3I55V 5FNVA 1JA8A 2R70A 1MSDA 2PI5A 1LUVA 3B4SA 4WFAV 5LMNO 3OEEG 4DV6B 4PELA 4DR1O 4PV1B 3DSQA 1F4NA 1TUEB 2UXBB 3J80N 1QBZA 3ZMSA 2UU9O 3T1YO 2GDSA 4OXSA 1I5YA 2EIMC 1E1QG 4QE9A 1LR1A 2EZOA 5IYBO 4IHJB 5KA6A 2P6JA 4LF7B 5JH7B 3JAKA 3K59A 3A0RA 3D3QA 3ZMUA 4DO2A 4DXWA 3EXAA 2JEXA 1SQQH 1YF2A 3OW2U 3G80A 1Y76A 4FLZA 4DV7O 3ABLB 3H9VA 1AI5A 5TISZ 3VQXA 3A0BZ 3ZBHA 4DW1A 4LFCB 4NTWA 3GWOA 3OMNB 4MVUA 3OM3B 1WP7A 2BE3A 3JYCA 3DTUB 5JWPA 5LMNB 4RUEA 1GM8A 4DR1B 1M57B 1ZX3A 5CA1A 1W59A 3HB3B 1M90W 1XEQA 5IJ0A 5KMGB 1R3IC 3TGUH 2UU9B 3IC7A 5J2UB 3CCVV 3T1YB 3JAMN 3ZS8C 4DR2O 2QM8A 3C90A 4DUZO 1OCOC 5L3DA 3J7AU 5CN0A 2AGAA 4KHPB 1W2BU 5FLXN 5LHGA 3UT5B 4JTDB 3AG3B 3K57A 4O4LB 2PUSA 3BAAA 1WN7A 5L3CA 4DR4O 4DR6O 2Z0AA 5LXTB 3AG1C 5KA5A 3ZN0A 4CH4A 2CK3G 1FXHA 4RWUA 1TUBA 4DV7B 3GB7C 1SS3A 4TV8A 3RYIB 4YHHO 3UCSC 3H1KH 1DF4A 2QKSA 4X62O 4N21A 1H2LA 4BAYA 3C3SA 4EKWA 3IGAC 4LBEC 1OCZC 3FFQA 3L74H 2FTKA 4WFEA 2CTRA 5CBFA 1KYOF 4ZI7A 3F7VC 2KSDA 3U0ZA 4CBCA 4TV9A 2QWQB 3HKCB 3APOA 1JVMA 3BEHA 2HEPA 1VMGA 3HKBA 4JYYA 4DR2B 4OPAA 1S77D 1XUQA 3LDEA 5EYPA 4DUZB 4PDVA 5E1AC 1AVMA 4FLYA 1PM9A 5IY5C 2GUZB 5AG2A 3U10A 2LW7A 3SR2C 2WA4A 1XL4A 1JFFB 2JGDB 3E89A 3ZHQA 5JJEB 1K97A 2YI8A 4DR4B 3X2QB 4FLTA 4DR6B 2ZD9A 2ODMA 3ZCCA 2JIZG 1I7FA 2Y4UA 1KP3A 2ZCEA 3TK1A 1YVWA 4QJFB 1IBMO 4IHJA 2EIJB 1EZJA 4YHHB 5JH7A 4X62B 2Q9LA 3SYOA 4I55B 2DMXA 5H2FZ 3MD0A 3T1CA 4PHZA 3CCEV 4QPKA 4GX5A 2YICA 3I5DA 1PV0A 1PNKA 3LUTB 1NH2B 1GTOA 4HZ3A 4J7KA 3ZIAG 3CC7V 1LNQA 2XAHA 1EN4A 4UCOA 4CZZA 1H2MA 2W6JG 4JAAA 1NTZH 4MVMA 1NS1A 2F1MA 2F95B 2G38A 4U3FH 4JI6O 4J41A 5B1AB 1OZ0A 5LHIA 3K3WA 2CTQA 1SQBH 2ZQMA 4JF3A 3CRCA 3O9OA 2QGNA 4GX0A 3ZHSA 4C7UA 4DR7O 1HDJA 3CB2A 3ZRXA 3ML0A 1YITV 3CMAV 4X88A 1EBOA 3J81N 1ORQC 3TCUA 2JJ2G 2VS0A 3ZEDA 1DTOA 1JPXA 1IBMB 3APQA 3JASA 1ENVA 3RW0A 5B1OA 4O4LA 3CHXA 1SC5B 2ZR2A 1VIBA 4NKGB 4LC1A 1WAZA 5LXTA 1JX9A 1AJQA 4BIOA 4WCEV 3C3TA 1B04A 3SJQC 1U96A 4NTXA 1NQTA 1WPXA 2P4KA 1D5NA 4JI6B 4I0XB 3PJSK 1PP9H 4JV5O 1KD1W 4DV5O 5ITZB 3W7XA 2PYJA 2YXYA 4ZKIA 5A2QN 1H2KA 4O4JB 2ITCC 2ZKOA 3NR7A 4DR7B 1N4CA 4UVCA 1QNMA 1N8RW 3ZX6A 4WBNB 1VQ9V 4LF4O 3HKCA 2F23A 2PZSA 2JS3A 3RGBA 2XAFA 4TOIA 3HKEB 1CEZA 4JGSA 5B3SB 4FM2A 1WPBA 5DEDA 4K35A 1TAEA 2DYRC 4B3MO 5EZYA 4HNAB 2HP8A 2QR4A 1HR0O 3PN1A 2E74B 4EFBA 4YXWG 2WLNA 2A79B 3ASNB 2AW9A 2WAMA 3KCXA 5JVDA 1NT2B 4DRXA 1BL8A 3M8AA 3ZMVA 1FXVA 5J2TB 3BCCH 1Q6IA 4NB5A 1QVGU 4I55A 4F4LA 1PNMA 1UPGA 4LWSB 5K1PA 4JYCA 4NXNO 2A7WA 4KXRA 4JV5B 3HKDA 1SQVH 2Q0AA 1Y74A 4DV5B 2JVDA 3NXSA 5BMVB 2FYUH 3ZN1A 1XNRO 3ETEA 5LL6Y 1Y67A 2H8PC 1MMMA 2EIKC 3CX5F 3SYPA 1V54B 1ROPA 2DE0X 4FLWA 3W7SA 2Q7EA 4Z2WA 2JGUA 3VOUA 3DGEA 4MVQA 3WB2A 4QPJA 4AHCA 2VWJA 1FFXB 4O2BB 3JAWA 5LP6A 4JI7O 5BY1A 5C8YB 4B3MB 4DV2O 1HR0B 4CS4A 1VQOV 2OTLV 4PA6A 5IJ9A 3OGCC 1ZLZA 3JATB 3UM7A 5CA0B 4AQYO 4WFFA 1F23A 1R3KC 5KUKA 2XAGA 5B1NA 4NXNB 2ZDIC 3D36A 4ZIBA 3OT7A 5L3GA 5H6QA 1EN5A 2OCCB 5JCOC 2KQXA 1S3JA 4J11A 1ZSPA 1B6QA 2ADQB 4I9WA 1V55C 3RYFB 2A9HA 2V1DA 4Z1VA 3LDDA 3P3NA 3WB1A 5ITZA 4JI7B 3ZRWA 4J7ZA 3WG7C 3N2GA 4DV2B 3CRAA 4LCUC 4X64O 1UFIA 2WWWA 4WBNA 1IVSA 3ETDA 3HPLC 2PF4E 3FYEB 3L9DA 5EC2C 1L1FA 1Y76B 4DK0A 2A06H 4J9YB 2UXDO 4WFBV 3CXCU 2FL4A 4AQYB 4Q6GA 4D7SA 1K92A 4QNHB 4KUMA 2YIDA 1NJIW 5FPOA 4CH3A 1K4CC 3LDCA 2IH3C 5H5NA 1JR9A 3QG5A 1Z5WA 5CA1B 3L75H 1YHQV 5EIBC 2OIEA 5IJ0B 2QE7G 2CTWA 4B3SO 2ZE5A 3EVKA 2RDCA 3LSUA 2JJ1G 1JMKC 3Q4HA 1G1XB 1QVFU 1PKXA 5BMVA 1QCEA 1H2NA 1J5EB 5EBLC 2QWNB 3B09A 3CJHA 2AXTZ 2WPDG 3G6BA 2A0LA 2V4DA 2Z3YA 4X64B 3VQYA 2JDIG 3UO3A 3ABLC 2L35A 4FLXA 3JCZA 1AR5A 1M4UA 4UCRA 3QTCA 2Q0OC 1KBHA 2WLLB 2UXDB 2RQ6A 4K8XA 1Q6HA 4O2BA 2WLHA 1PL4A 3DXRB 4GCZA 3N2KA 1VQ6V 2W0XA 3OR6C 2GTSA 1KKCA 5C8YA 2P06A 4R6ZA 2VQFB 2WA3A 1M57C 1WNSA 1H38A 2CAZC 1MZEA 4X1KA 3FB8C 3B8MA 2NLJC 4ZI7B 3G6EV 4TV9B 4GYCB 4X20B 4JTAB 2N74A 2UXXA 4B3SB 1URFA 5CA0A 3T2MA 3HKBB 2PI4A 3ZRVA 2OIGA 4MW3A 4G2KA 5EYPB 5B1BB 2OT5A 2XT9A 2YIBD 4BIZA 3CCJV 2LP7A 1G6UA 5K1XA 4DR3O 3K08A 1TA8A 2E5LO 3AG7A 1LUWA 1AI7A 4JI8B 1COWG 1MSWD 3RYFA 3ABKB 2DOSA 4GUNA 2LFSA 3ABUA 4PDLA 1BQ0A 4KHPO 3ETGA 5LGTA 3ABMB 5FL7G 4DK1A 2QWRB 3OD4A 2K1EA 4FZ1A 2GBOA 3I56V 1NVPB 2BTQB 3K79A 1GN4A 3ZJZA 5EIBD 5EBMC 1SZTA 1KUQA 1YZBA 1P84F 1QLNA 4X65O 3OFNG 4MTFA 1QQCA 4NR1A 5EC1C 3A8TA 4TT3G 2QSAA 3B2EE 3W7TA 2Q69A 2JRIA 3N27A 3X2QC 4MSWC 4ASUG 4FM0A 4DR3B 5BZBA 2R9RB 2AHYA 4ZHQA 3QVNA 2E5LB 4YJ2A 4PA9A 2UUAO 1NTKH 1VF5B 4K8ZA 3FB6C 1OV9A 3E2EA 4K0KO 3JASB 1QR8A 2IBZH 4JASA 4TWKA 1VQMV 3E8GA 1YJNV 4U7OA 3K04A 1YI2V 3BA8A 1O9GA 2QTSA 1JJOA 2O57A 1S5HC 2GHYA 1CXZB 2WLLA 1VQ4V 3RT3C 4LF8O 2YXLA 5B1AC 3DXRA 4X89A 4X65B 4I5SA 5IWAO 2H94A 2ZNJA 1BT8A 3RYHB 4KFMA 1PL0A 1AJPA 4O2AB 3L70H 1Q5OA 3K0DA 1Z2GA 3AG2C 4FM1A 4P30A 4CC6A 2N05A 1IZ3A 4D7TA 2EIMB 3FYIB 3JARB 2R9IA 2N04A 4X20A 2LO1A 4PI0A 4PD4F 3OEHG 1N32O 5D5PA 2QKCA 2UUAB 3L73H 3CRQA 1S0VA 1AR1B 2CTPA 4K0KB 1JOYA 5EZYB 5H9CA 1RSOA 3JD0A 3K5LA 1SF9A 1EM1A 1F7YA 3UKMA 4U7NA 4NVPA 4HBNA 1X4TA 2PTMA 3AG4B 4X1IA 1X59A 3T1HO 5JVDB 4DRXB 4U3JA 1XBLA 4LF8B 2FMLA 1OCRC 4LP8A 3LNNA 4JTCB 2X6AA 4N23A 5IWAB 2XASA 5GTIZ 2NN4A 3FX7A 4D6TH 3HKDB 1BMFG 3A2FA 1NR1A 1Y74B 4PDRA 4UV9A 2BTQA 2EJ7A 2D3OW 2EZPA 2IU0A 4UFZA 1H8HG 5B3SC 3CCUV 1WA8A 4RQFA 4DV3O 5L3EA 1N32B 3BFRA 3E8HA 1VP7A 3JAWB 4LR3A 1SQFA 5LP6B 4XDKA 4X1YB 2ETNA 2EINC 1FAFA 3S3XA 4LF5O 1NH2D 2QWOB 3JSLA 5CMUA 3P3PA 3JD1A 4E4EA 5E79Z 3U11A 1H8EG 2XNDG 1BGYH 1YJWV 1HWYA 3SJCC 1HW7A 4MS2A 3HR0A 1Q7YW 4BWAA 4PA4A 1R73A 5CB4B 5IJ9B 2OYQA 3T1HB 3OMAB 2IM9A 2QDOA 1E79G 4MTOA 3K06A 1IBLO 2F93B 3BY6A 1SERA 1FXKC 2Y0IA 4ZOLA 1THZA 4E2LA 1V54C 3SJBC 5LOVB 5EK0A 1VQ7V 4UCUA 1XL6A 2Y69C 4OX9O 2Y48A 1AR4A 3F5TA 1PPJH 2DJVA 1J95A 2ZE7A 4DV3B 2ARHA 4ABMA 3RYHA 2Q6AA 4O2AA 3JALB 4H13B 3CEIA 2DYSC 1P7GA 3ZRWB 4LF5B 3K5NA 1ZAUA 1ZTEA 1Q86W 3N2GB 1XOUA 2JS5A 2YC0A 3JARA 4UVBA 1AP5A 5KHGA 3MDSA 3E83A 2P7TC 1VQPV 1IBLB 5A9GA 2QM7A 3SPIA 1B06A 1K33A 4FIPC 2OCCC 4UB6Z 3K5MA 2XAQA 2QM4A 1IXMA 1T5EA 2BSKA 2Q8VA 2R72A 2IW5A 3H01A 4OX9B 3E22A 4RQEA 3THOA 2JEUA 3IFXA 1Q8IA 1R3LC 3Q4HB 1YTFB 2HVJC 1L8DA 1GM9A 1SQPH 3OTFA 4UXNA 4R8CA 2NNUA 2LW1A 3CJHB 2RMKB 1MOFA 5IDJA 1JQ0A 4JPRA 3ZHTA 1OCCB 2PY5A 2QWPB 3L71H 1PNLA 1FJGO 2XAJA 2P5OA 1OJHA 3CC2V 2DWEC 2VQEO 4BW9A 4YIPA 4W4KA 2W0FC 1VQ8V 3N2KB 4X1YA 4WF9V 1U97A 2K9PA 3CP1A 3QO5A 1D2DA 3MHHC 4X1KB 2QEXV 1XMOO 2EILB 3SPGA 5CB4A 1F4MA 4AILC 4DV1O 3R65A 1XHZA 1FKAO 4MTGA 4NTYA 3EFFK 4UCVA 2VRZA 3SPJA 5HFMA 2BCCH 3VBBA 5LGNA 1GKFA 2P90A 4P9PA 1S72V 2AHZA 1RM1B 5LOVA 4YY3O 2ILMA 4YJ3B 4JYAO 3KKYA 1BZKA 1B3QA 3T4DA 1SRYA 5DN6G 4PJ0Z 1Q6UA 1NBMG 4GLXA 1FJGB 2EJRA 2P4VA 4CH6A 2VQEB 2DYRB 2YEVA 3VQVA 1CPYA 3E8FA 1Q81W 3CPWU 2ZXWB 3JALA 4ZBMA 2ZE6A 3SYAA 1J5EO 3P32A 1DK1A 2GSMB 5DM6V 4MVRA 2LQTA 1TVKB 5CBGA 4DR5O 4IL6Z 3D3IA 4YIOA 2WLIA 2KG7A 3BRCA 4LF6O 4UB8Z 1XMOB 4FLUA 3WFVA 3FD9A 3STZC 4DV1B 1SESA 5B1BC 3AK2A 1HNZO 2VQFO 1NKDA 2B1IA 1HNXO 2QKAA 1FPOA 3CSXA 1D5AA 2QJ1A 1Q43A 3CCMV 3RVZA 4LFBO 4UCSA 4WFGA 4YY3B 3CYOA 4J10A 1W0JG 1I5XA 2YXHA 4ZHQB 4H44B 4JYAB 4HYOA 1KKDA 4YJ2B 1IX9A 1NTMH 3RBZA 3T4ZA 1EN6A 3ABMC 1QLEB 1RFYA 1I0HA 3TXSA 2Q7GA 3RVYA 1IXBA 1GO3F 1MNGA 1NI8A 4EB6B 4IIJB 4I4TB 1BCCH 2DN9A 2M6YA 4XBFA 1L0NH 3E8BA 4QIWF 2X7RB 2CE4A 3QF7A 4O4IA 4DR5B 4JI8O 4W4LA 4LF6B 5GONB 4MTXA 2XHBA 2RNBA 2HJDA 2BTOA 4JI5O 1HNZB 1HNXB 4FMTA 3KG2A 1Q82W 3CXHF 4LFBB 2E3CA 2RN9A 2B9ZA 3L72H 5LYJA 4K3AA 1NR7A 1K73W 4DUYB 3SDLA 1S5JA 4LNUA 4G28B 4KL1A 3AG3C 1GN3A 3FB5C 4RAIA 4CS3A 2Y4TA 3QO7A 2YSUB 4JAUA 1RSOB 3H1IH 3OAAG 1QU7A 4YJ3A 1Q3EA 5JJNB 5KHHA 3AEIA 4JI1O 3IJ4A 4MVZA 1SA0B 1WP8A 1TGOA 4GKKO 5F2VO 4X1IB 3CRRA 3EHBB 1HP8A 3JCUZ 4U3JB 2IJIA 3GVMA 4NYKA 1P4RA 3MAQA 3JSNA 1M9NA 3CWBH 1K34A 1YJ9V 4F6RA 4JI5B 4GKJO 3ZMTA 1JCHA 3E86A 3OE7G 1TVKA 4O4HA 1SQGA 4FK5C 3OR7C 1K8AW 5BR8O 1R6NA 4UUJC 3QO8A 1M93A 1VQKV 1G4YB 1K9MW 1WA8B 3ASOB 1N36O 2E76B 3D8CA 4MVSA 3KZIZ 2R9AA 2DWDC 4QE7A 1NVPD 4FPPA 1XREA 2IJJA 1M56B 4TUYB 3AG4C 3M7MX 2EIJC 1O9HA 1KMIZ 2RCVA 4ICGA 4JI1B 3CC4V 4J42A 3UO2A 4GKKB 4OPHA 4B7EA 1GAXA 5KAIZ 1W0KG 4GX1A 2WLMA 2CGOA 1SZXA 2H3OA 1IBKO 4JI4O 2CGNA 4ZOLB 3FAVB 4EB6A 4IIJA 4GKJB 4I4TA
chains in the Genus database with same CATH topology
5H5NA 2DOSA 4DR5O 4JI7O 4KHPO 5BY1A 4LF6O 2ZM6O 2UXBO 1R6TA 4DV2O 1IBLO 4JI0O 1XNQO 4B3SO 1HNWO 4JV5O 1HNZO 5IT9N 4DV5O 4LF7O 2VQFO 1IBMO 1N32O 1HNXO 1FJGO 1G1XB 5A2QN 1R1BA 4JI1O 2ZKOA 5LMUO 1XEQA 2VQEO 4GKKO 2UUBO 1KUQA 1YZBA 4LFBO 1A32A 4AQYO 4LF4O 1N33O 3JAMN 4X65O 4OX9O 4DR2O 4LFAO 4DUZO 1XMQO 3F5TA 1D2DA 1F7YA 2DJVA 3J7AU 4GKJO 2AGAA 3R66A 2JRIA 5FLXN 1N34O 4LFCO 1X59A 3T1HO 1XMOO 4B3MO 4DR4O 1HR0O 4DR6O 2Z0AA 5BR8O 4DV1O 1NS1A 4A5UB 2UUCO 4JI6O 5LMNO 1FKAO 2UXCO 4DR1O 1N36O 2UUAO 4JI2O 2FKXA 4DV0O 3J80N 4YHHO 4K0KO 3OTOO 4JI8O 4X62O 4DR7O 3M8AA 4DUYO 2UU9O 4B3TO 4B3RO 3T1YO 4YY3O 3J81N 4X64O 2N74A 4JYAO 4NXNO 4JI5O 4DV3O 1XNRO 3O65A 2UXDO 5LL6Y 4NXMO 4DR3O 3RT3C 4OPHA 4DV4O 4LF8O 4LF5O 2HHHO 1J5EO 2E5LO 1FYJA 5IWAO 5BXZA 4OPAA 4DV6O 2F4VO 1DK1A 1IBKO 4JI4O 1AILA 4JI3O 1I94O 1AB3A 4LF9O 4DV7O 4X66O 2LW7A 3SDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5N A;  2DOS A;  4DR5 O;  4JI7 O;  4KHP O;  5BY1 A;  4LF6 O;  2ZM6 O;  2UXB O;  1R6T A;  4DV2 O;  1IBL O;  4JI0 O;  1XNQ O;  4B3S O;  1HNW O;  4JV5 O;  1HNZ O;  5IT9 N;  4DV5 O;  4LF7 O;  2VQF O;  1IBM O;  1N32 O;  1HNX O;  1FJG O;  1G1X B;  5A2Q N;  1R1B A;  4JI1 O;  2ZKO A;  5LMU O;  1XEQ A;  2VQE O;  4GKK O;  2UUB O;  1KUQ A;  1YZB A;  4LFB O;  1A32 A;  4AQY O;  4LF4 O;  1N33 O;  3JAM N;  4X65 O;  4OX9 O;  4DR2 O;  4LFA O;  4DUZ O;  1XMQ O;  3F5T A;  1D2D A;  1F7Y A;  2DJV A;  3J7A U;  4GKJ O;  2AGA A;  3R66 A;  2JRI A;  5FLX N;  1N34 O;  4LFC O;  1X59 A;  3T1H O;  1XMO O;  4B3M O;  4DR4 O;  1HR0 O;  4DR6 O;  2Z0A A;  5BR8 O;  4DV1 O;  1NS1 A;  4A5U B;  2UUC O;  4JI6 O;  5LMN O;  1FKA O;  2UXC O;  4DR1 O;  1N36 O;  2UUA O;  4JI2 O;  2FKX A;  4DV0 O;  3J80 N;  4YHH O;  4K0K O;  3OTO O;  4JI8 O;  4X62 O;  4DR7 O;  3M8A A;  4DUY O;  2UU9 O;  4B3T O;  4B3R O;  3T1Y O;  4YY3 O;  3J81 N;  4X64 O;  2N74 A;  4JYA O;  4NXN O;  4JI5 O;  4DV3 O;  1XNR O;  3O65 A;  2UXD O;  5LL6 Y;  4NXM O;  4DR3 O;  3RT3 C;  4OPH A;  4DV4 O;  4LF8 O;  4LF5 O;  2HHH O;  1J5E O;  2E5L O;  1FYJ A;  5IWA O;  5BXZ A;  4OPA A;  4DV6 O;  2F4V O;  1DK1 A;  1IBK O;  4JI4 O;  1AIL A;  4JI3 O;  1I94 O;  1AB3 A;  4LF9 O;  4DV7 O;  4X66 O;  2LW7 A;  3SDL A; 
#chains in the Genus database with same CATH topology
 3CS5 A;  1JJ2 U;  1K5S A;  4IT5 A;  2P22 C;  2HKO A;  1IDS A;  5BR8 B;  4J9Z B;  4RO2 A;  2ADP A;  1HNW O;  5GON A;  4JZG A;  5LP6 C;  2ZDI A;  1N36 B;  4H0L B;  3A0H Z;  2YS8 A;  2UUB O;  2M7W A;  1RPR A;  1GM7 A;  5JCO A;  1BE3 H;  3JD2 A;  2RJZ A;  1S5L Z;  3STL C;  1WLE A;  2Q73 A;  1XMQ O;  2GV9 A;  1SQX H;  4FFB A;  5LBQ A;  4FLV A;  4OGQ B;  3K5O A;  4KP4 A;  1DGS A;  1F51 A;  1G8M A;  5KLV H;  3FKS G;  3QNE A;  1YSC A;  2YIB A;  2NR5 A;  3ABT A;  1VF7 A;  3D36 C;  2L6L A;  1IBK B;  4JI4 B;  1YCI A;  2XTA A;  2VWK A;  1MG1 A;  4JYB A;  2FKX A;  4DV0 O;  4PA7 A;  1ZL8 A;  3SPC A;  2ZIO A;  1VF6 A;  1S76 D;  2GTA A;  1SA0 A;  2Q67 A;  4DW0 A;  4PDM A;  2BSK B;  4FFK A;  5LA6 B;  3E22 B;  1HNW B;  4I50 B;  3H1J H;  1GMG A;  1BSM A;  2IH1 C;  2CH7 B;  4G27 B;  1E1R G;  2UUB B;  2Y0P A;  1XIL A;  1Y66 A;  3CE2 A;  1NU1 H;  2HR3 A;  2HHH O;  2ZR3 A;  2HVK C;  3TXQ A;  2AZ2 A;  4LH6 A;  5KAF Z;  3G67 A;  2B5U A;  2HJF C;  1XMQ B;  4JI3 O;  1BHA A;  4LF9 O;  5GTH Z;  1YIJ V;  1K3E A;  2ITD C;  1OCO B;  3RWR D;  4CC5 A;  2ZIN A;  2DQ3 A;  3SJA C;  3K58 A;  1KQS U;  4JI0 O;  1XI1 A;  3RN4 A;  3H1L H;  3B77 A;  5L3B A;  2HG5 C;  4H33 A;  1WB8 A;  2LGQ A;  2MK3 A;  5JQG B;  5IT9 N;  3ASN C;  3AG1 B;  4TUY A;  2LGW A;  1QHT A;  4DV0 B;  1KU9 A;  1VAR A;  4UVA A;  1SKV A;  1V9P A;  2A3Q A;  5EBW C;  3CCQ V;  4F6E A;  4QGP A;  4P9O A;  4LFA O;  1XHX A;  4JZ2 A;  1M1K W;  5KHK A;  1OCZ B;  2YI9 A;  3FAV A;  3AG2 B;  4Q20 A;  4I7Z B;  3CCS V;  3SPH A;  1RP3 B;  5KMG A;  4R7C A;  1L0L H;  2WLK A;  3B8N A;  5J2U A;  4X8A A;  4GX2 A;  5J9P C;  2OWO A;  1AP6 A;  1M5I A;  1OCC C;  1UJW B;  2HHH B;  3ZHU A;  4A5U B;  1GRJ A;  4IGG A;  1KB9 F;  1Y6X A;  4JI3 B;  2BOC C;  2ZE8 A;  4LF9 B;  1VQN V;  1R3J C;  3UT5 A;  2OTJ V;  5IY5 B;  4PI2 A;  3UQ8 A;  3W7U A;  5H6R A;  2YEV B;  4B3T O;  5KHJ A;  2X6B A;  4B3R O;  4JI0 B;  3ZMZ A;  1NZ6 A;  4WFH A;  3OMI B;  3ZRS A;  3SGI A;  5JJJ B;  1VEW A;  3ICX A;  5IYC O;  3TET A;  1VQ5 V;  3RYI A;  2EIL C;  2Q5Z A;  2ZT9 B;  2WLI B;  2KG7 B;  4DV4 O;  1OCR B;  3W7W A;  5CA3 A;  1WJZ A;  5BXZ A;  4LFA B;  1I94 O;  2EUL A;  2CUG A;  5B66 Z;  1RM1 C;  3BPZ A;  4IYI A;  1K4D C;  2PYL A;  4L87 A;  1R6T A;  2V7Q G;  3ZHV A;  1XNQ O;  1XQ8 A;  1MAB G;  5FPR A;  2GUZ A;  3TJT A;  1GN6 A;  5LA6 A;  3JD3 A;  1EFR G;  3K0G A;  4I50 A;  3IAY A;  1JFF A;  2JGD A;  3AK1 A;  5KX5 B;  2ZXW C;  5LMU O;  2E75 B;  4FZ0 A;  5HFL A;  2EIN B;  4B7K A;  4DYL A;  4B3T B;  2CH7 A;  1A32 A;  4B3R B;  3H1H H;  1N33 O;  3ETQ A;  4UV8 A;  2JK5 C;  1YDX A;  2X6C A;  4MT8 A;  4TQD A;  2YUA A;  4I9Q A;  3CRM A;  4J7J A;  2LJ2 A;  4O4I B;  1Q90 D;  1BS3 A;  1FS0 G;  2DQ0 A;  2MW2 B;  1Z5V A;  3K03 A;  4IYH A;  4DV4 B;  4L8J A;  1US6 A;  1N0N A;  5KUM A;  3WU2 Z;  3DC5 A;  1Y4M A;  1YTF D;  1FXK B;  1I94 B;  2UXC O;  3VQW A;  3SYC A;  1CP9 A;  5JQG A;  3FB7 C;  2QA4 V;  4LF4 B;  1H2G A;  1AI4 A;  2Q68 A;  3RYC B;  2Y69 B;  1DF5 A;  4PA3 A;  2P67 A;  4FJC C;  1XNQ B;  1FD9 A;  5LYJ B;  2X0L A;  5IYZ B;  1N0J A;  2XOK G;  1QLE C;  3G4S V;  2FB5 A;  4HAM A;  2IJH A;  4LNU B;  5LMU B;  1EZV H;  1PD3 A;  3B40 A;  4XDJ A;  4NXM O;  3GWK C;  1KP2 A;  3OGI B;  2DYS B;  3LSS A;  5LHH A;  1N33 B;  2ZIM A;  3P30 A;  1OHH G;  4AI8 A;  1GH6 A;  1DLB A;  2F4V O;  2Q4P A;  4X66 O;  2B1G A;  1BQZ A;  2ZNI A;  5FNV B;  2QTO A;  4LH7 A;  2ZM6 O;  1FFT B;  1BHB A;  1K5Q A;  3MHS C;  3E35 A;  3WB0 A;  2PGG A;  1P49 A;  2YDE A;  1XNR B;  2UXC B;  3JD4 A;  4F6R B;  1ZWI C;  4CS2 A;  2Z5U A;  2DW4 A;  4Z1M G;  4BW5 A;  1R6K A;  4GZR B;  4O4H B;  1QR9 A;  4BIU A;  4I0X A;  1XDC A;  3JAK B;  2C2A A;  3OUF A;  4H37 A;  2YIA A;  4O4J A;  4UCT A;  4EEQ A;  1GN2 A;  1N34 O;  4GT1 A;  3G71 V;  3BVO A;  3CME V;  4MW8 A;  2W6I G;  4NXM B;  2F43 G;  1P7B A;  1AJN A;  2XUM A;  5D5Q A;  2IJK A;  5KHI A;  2EIK B;  2UUC O;  3F5W C;  3K9S A;  3HKE A;  4B08 A;  2F4V B;  1VF6 C;  2WSS G;  4X66 B;  4JI2 O;  1MA1 A;  3ABK C;  1VQL V;  2Q7H A;  3F7Y C;  1MZF A;  4HNA A;  1YEW A;  3M99 B;  3OTO O;  4DUY O;  5KX5 A;  2ZM6 B;  5B5E Z;  4J80 A;  1WB7 A;  1SET A;  2WLJ A;  4BR6 A;  3AK3 A;  3DC6 A;  1ZUQ A;  2KKW A;  1H2S B;  2OCH A;  2ATK C;  3LSQ A;  5LGU A;  3KCY A;  2IU3 A;  5C93 A;  1KC8 W;  2EX3 A;  3O65 A;  2BOB C;  5J2T A;  2D2C B;  3IC9 A;  4LWS A;  1FYJ A;  4P2Z A;  3ASO C;  4TSF G;  4XDL A;  4DV6 O;  1AIL A;  1ARO P;  1FXK A;  1AB3 A;  3BHP A;  2EBO A;  4CH5 A;  5IE9 A;  4EFE A;  2KB1 A;  4MVO A;  3BAB A;  2UXB O;  4RUF A;  2UXN A;  3K9A A;  1N34 B;  1YXB A;  4TQF A;  3RFR A;  1IUR A;  2AZ0 A;  3SYQ A;  1M56 C;  4JAV A;  5CBH A;  3RYC A;  1RPO A;  1TUB B;  2UUC B;  5IYD O;  2CDY A;  4TV8 B;  1FFX A;  4LF7 O;  4FFB B;  1K7D A;  5GW7 A;  2LFR A;  4X9Q A;  5L3F A;  3CCR V;  5DEC A;  1R1B A;  1V55 B;  5IYZ A;  4JI2 B;  3BA9 A;  3OTO B;  1KEC A;  3ZHR A;  4R50 A;  1GK9 A;  2F66 C;  3LNM B;  1I08 A;  2HLD G;  3WG7 B;  3CCL V;  3CD6 V;  3S3W A;  3R66 A;  3OUS A;  4LFC O;  4FVM A;  3JAT A;  1ZL8 B;  1AI6 A;  2HFE C;  3I55 V;  5FNV A;  1JA8 A;  2R70 A;  1MSD A;  2PI5 A;  1LUV A;  3B4S A;  4WFA V;  5LMN O;  3OEE G;  4DV6 B;  4PEL A;  4DR1 O;  4PV1 B;  3DSQ A;  1F4N A;  1TUE B;  2UXB B;  3J80 N;  1QBZ A;  3ZMS A;  2UU9 O;  3T1Y O;  2GDS A;  4OXS A;  1I5Y A;  2EIM C;  1E1Q G;  4QE9 A;  1LR1 A;  2EZO A;  5IYB O;  4IHJ B;  5KA6 A;  2P6J A;  4LF7 B;  5JH7 B;  3JAK A;  3K59 A;  3A0R A;  3D3Q A;  3ZMU A;  4DO2 A;  4DXW A;  3EXA A;  2JEX A;  1SQQ H;  1YF2 A;  3OW2 U;  3G80 A;  1Y76 A;  4FLZ A;  4DV7 O;  3ABL B;  3H9V A;  1AI5 A;  5TIS Z;  3VQX A;  3A0B Z;  3ZBH A;  4DW1 A;  4LFC B;  4NTW A;  3GWO A;  3OMN B;  4MVU A;  3OM3 B;  1WP7 A;  2BE3 A;  3JYC A;  3DTU B;  5JWP A;  5LMN B;  4RUE A;  1GM8 A;  4DR1 B;  1M57 B;  1ZX3 A;  5CA1 A;  1W59 A;  3HB3 B;  1M90 W;  1XEQ A;  5IJ0 A;  5KMG B;  1R3I C;  3TGU H;  2UU9 B;  3IC7 A;  5J2U B;  3CCV V;  3T1Y B;  3JAM N;  3ZS8 C;  4DR2 O;  2QM8 A;  3C90 A;  4DUZ O;  1OCO C;  5L3D A;  3J7A U;  5CN0 A;  2AGA A;  4KHP B;  1W2B U;  5FLX N;  5LHG A;  3UT5 B;  4JTD B;  3AG3 B;  3K57 A;  4O4L B;  2PUS A;  3BAA A;  1WN7 A;  5L3C A;  4DR4 O;  4DR6 O;  2Z0A A;  5LXT B;  3AG1 C;  5KA5 A;  3ZN0 A;  4CH4 A;  2CK3 G;  1FXH A;  4RWU A;  1TUB A;  4DV7 B;  3GB7 C;  1SS3 A;  4TV8 A;  3RYI B;  4YHH O;  3UCS C;  3H1K H;  1DF4 A;  2QKS A;  4X62 O;  4N21 A;  1H2L A;  4BAY A;  3C3S A;  4EKW A;  3IGA C;  4LBE C;  1OCZ C;  3FFQ A;  3L74 H;  2FTK A;  4WFE A;  2CTR A;  5CBF A;  1KYO F;  4ZI7 A;  3F7V C;  2KSD A;  3U0Z A;  4CBC A;  4TV9 A;  2QWQ B;  3HKC B;  3APO A;  1JVM A;  3BEH A;  2HEP A;  1VMG A;  3HKB A;  4JYY A;  4DR2 B;  4OPA A;  1S77 D;  1XUQ A;  3LDE A;  5EYP A;  4DUZ B;  4PDV A;  5E1A C;  1AVM A;  4FLY A;  1PM9 A;  5IY5 C;  2GUZ B;  5AG2 A;  3U10 A;  2LW7 A;  3SR2 C;  2WA4 A;  1XL4 A;  1JFF B;  2JGD B;  3E89 A;  3ZHQ A;  5JJE B;  1K97 A;  2YI8 A;  4DR4 B;  3X2Q B;  4FLT A;  4DR6 B;  2ZD9 A;  2ODM A;  3ZCC A;  2JIZ G;  1I7F A;  2Y4U A;  1KP3 A;  2ZCE A;  3TK1 A;  1YVW A;  4QJF B;  1IBM O;  4IHJ A;  2EIJ B;  1EZJ A;  4YHH B;  5JH7 A;  4X62 B;  2Q9L A;  3SYO A;  4I55 B;  2DMX A;  5H2F Z;  3MD0 A;  3T1C A;  4PHZ A;  3CCE V;  4QPK A;  4GX5 A;  2YIC A;  3I5D A;  1PV0 A;  1PNK A;  3LUT B;  1NH2 B;  1GTO A;  4HZ3 A;  4J7K A;  3ZIA G;  3CC7 V;  1LNQ A;  2XAH A;  1EN4 A;  4UCO A;  4CZZ A;  1H2M A;  2W6J G;  4JAA A;  1NTZ H;  4MVM A;  1NS1 A;  2F1M A;  2F95 B;  2G38 A;  4U3F H;  4JI6 O;  4J41 A;  5B1A B;  1OZ0 A;  5LHI A;  3K3W A;  2CTQ A;  1SQB H;  2ZQM A;  4JF3 A;  3CRC A;  3O9O A;  2QGN A;  4GX0 A;  3ZHS A;  4C7U A;  4DR7 O;  1HDJ A;  3CB2 A;  3ZRX A;  3ML0 A;  1YIT V;  3CMA V;  4X88 A;  1EBO A;  3J81 N;  1ORQ C;  3TCU A;  2JJ2 G;  2VS0 A;  3ZED A;  1DTO A;  1JPX A;  1IBM B;  3APQ A;  3JAS A;  1ENV A;  3RW0 A;  5B1O A;  4O4L A;  3CHX A;  1SC5 B;  2ZR2 A;  1VIB A;  4NKG B;  4LC1 A;  1WAZ A;  5LXT A;  1JX9 A;  1AJQ A;  4BIO A;  4WCE V;  3C3T A;  1B04 A;  3SJQ C;  1U96 A;  4NTX A;  1NQT A;  1WPX A;  2P4K A;  1D5N A;  4JI6 B;  4I0X B;  3PJS K;  1PP9 H;  4JV5 O;  1KD1 W;  4DV5 O;  5ITZ B;  3W7X A;  2PYJ A;  2YXY A;  4ZKI A;  5A2Q N;  1H2K A;  4O4J B;  2ITC C;  2ZKO A;  3NR7 A;  4DR7 B;  1N4C A;  4UVC A;  1QNM A;  1N8R W;  3ZX6 A;  4WBN B;  1VQ9 V;  4LF4 O;  3HKC A;  2F23 A;  2PZS A;  2JS3 A;  3RGB A;  2XAF A;  4TOI A;  3HKE B;  1CEZ A;  4JGS A;  5B3S B;  4FM2 A;  1WPB A;  5DED A;  4K35 A;  1TAE A;  2DYR C;  4B3M O;  5EZY A;  4HNA B;  2HP8 A;  2QR4 A;  1HR0 O;  3PN1 A;  2E74 B;  4EFB A;  4YXW G;  2WLN A;  2A79 B;  3ASN B;  2AW9 A;  2WAM A;  3KCX A;  5JVD A;  1NT2 B;  4DRX A;  1BL8 A;  3M8A A;  3ZMV A;  1FXV A;  5J2T B;  3BCC H;  1Q6I A;  4NB5 A;  1QVG U;  4I55 A;  4F4L A;  1PNM A;  1UPG A;  4LWS B;  5K1P A;  4JYC A;  4NXN O;  2A7W A;  4KXR A;  4JV5 B;  3HKD A;  1SQV H;  2Q0A A;  1Y74 A;  4DV5 B;  2JVD A;  3NXS A;  5BMV B;  2FYU H;  3ZN1 A;  1XNR O;  3ETE A;  5LL6 Y;  1Y67 A;  2H8P C;  1MMM A;  2EIK C;  3CX5 F;  3SYP A;  1V54 B;  1ROP A;  2DE0 X;  4FLW A;  3W7S A;  2Q7E A;  4Z2W A;  2JGU A;  3VOU A;  3DGE A;  4MVQ A;  3WB2 A;  4QPJ A;  4AHC A;  2VWJ A;  1FFX B;  4O2B B;  3JAW A;  5LP6 A;  4JI7 O;  5BY1 A;  5C8Y B;  4B3M B;  4DV2 O;  1HR0 B;  4CS4 A;  1VQO V;  2OTL V;  4PA6 A;  5IJ9 A;  3OGC C;  1ZLZ A;  3JAT B;  3UM7 A;  5CA0 B;  4AQY O;  4WFF A;  1F23 A;  1R3K C;  5KUK A;  2XAG A;  5B1N A;  4NXN B;  2ZDI C;  3D36 A;  4ZIB A;  3OT7 A;  5L3G A;  5H6Q A;  1EN5 A;  2OCC B;  5JCO C;  2KQX A;  1S3J A;  4J11 A;  1ZSP A;  1B6Q A;  2ADQ B;  4I9W A;  1V55 C;  3RYF B;  2A9H A;  2V1D A;  4Z1V A;  3LDD A;  3P3N A;  3WB1 A;  5ITZ A;  4JI7 B;  3ZRW A;  4J7Z A;  3WG7 C;  3N2G A;  4DV2 B;  3CRA A;  4LCU C;  4X64 O;  1UFI A;  2WWW A;  4WBN A;  1IVS A;  3ETD A;  3HPL C;  2PF4 E;  3FYE B;  3L9D A;  5EC2 C;  1L1F A;  1Y76 B;  4DK0 A;  2A06 H;  4J9Y B;  2UXD O;  4WFB V;  3CXC U;  2FL4 A;  4AQY B;  4Q6G A;  4D7S A;  1K92 A;  4QNH B;  4KUM A;  2YID A;  1NJI W;  5FPO A;  4CH3 A;  1K4C C;  3LDC A;  2IH3 C;  5H5N A;  1JR9 A;  3QG5 A;  1Z5W A;  5CA1 B;  3L75 H;  1YHQ V;  5EIB C;  2OIE A;  5IJ0 B;  2QE7 G;  2CTW A;  4B3S O;  2ZE5 A;  3EVK A;  2RDC A;  3LSU A;  2JJ1 G;  1JMK C;  3Q4H A;  1G1X B;  1QVF U;  1PKX A;  5BMV A;  1QCE A;  1H2N A;  1J5E B;  5EBL C;  2QWN B;  3B09 A;  3CJH A;  2AXT Z;  2WPD G;  3G6B A;  2A0L A;  2V4D A;  2Z3Y A;  4X64 B;  3VQY A;  2JDI G;  3UO3 A;  3ABL C;  2L35 A;  4FLX A;  3JCZ A;  1AR5 A;  1M4U A;  4UCR A;  3QTC A;  2Q0O C;  1KBH A;  2WLL B;  2UXD B;  2RQ6 A;  4K8X A;  1Q6H A;  4O2B A;  2WLH A;  1PL4 A;  3DXR B;  4GCZ A;  3N2K A;  1VQ6 V;  2W0X A;  3OR6 C;  2GTS A;  1KKC A;  5C8Y A;  2P06 A;  4R6Z A;  2VQF B;  2WA3 A;  1M57 C;  1WNS A;  1H38 A;  2CAZ C;  1MZE A;  4X1K A;  3FB8 C;  3B8M A;  2NLJ C;  4ZI7 B;  3G6E V;  4TV9 B;  4GYC B;  4X20 B;  4JTA B;  2N74 A;  2UXX A;  4B3S B;  1URF A;  5CA0 A;  3T2M A;  3HKB B;  2PI4 A;  3ZRV A;  2OIG A;  4MW3 A;  4G2K A;  5EYP B;  5B1B B;  2OT5 A;  2XT9 A;  2YIB D;  4BIZ A;  3CCJ V;  2LP7 A;  1G6U A;  5K1X A;  4DR3 O;  3K08 A;  1TA8 A;  2E5L O;  3AG7 A;  1LUW A;  1AI7 A;  4JI8 B;  1COW G;  1MSW D;  3RYF A;  3ABK B;  2DOS A;  4GUN A;  2LFS A;  3ABU A;  4PDL A;  1BQ0 A;  4KHP O;  3ETG A;  5LGT A;  3ABM B;  5FL7 G;  4DK1 A;  2QWR B;  3OD4 A;  2K1E A;  4FZ1 A;  2GBO A;  3I56 V;  1NVP B;  2BTQ B;  3K79 A;  1GN4 A;  3ZJZ A;  5EIB D;  5EBM C;  1SZT A;  1KUQ A;  1YZB A;  1P84 F;  1QLN A;  4X65 O;  3OFN G;  4MTF A;  1QQC A;  4NR1 A;  5EC1 C;  3A8T A;  4TT3 G;  2QSA A;  3B2E E;  3W7T A;  2Q69 A;  2JRI A;  3N27 A;  3X2Q C;  4MSW C;  4ASU G;  4FM0 A;  4DR3 B;  5BZB A;  2R9R B;  2AHY A;  4ZHQ A;  3QVN A;  2E5L B;  4YJ2 A;  4PA9 A;  2UUA O;  1NTK H;  1VF5 B;  4K8Z A;  3FB6 C;  1OV9 A;  3E2E A;  4K0K O;  3JAS B;  1QR8 A;  2IBZ H;  4JAS A;  4TWK A;  1VQM V;  3E8G A;  1YJN V;  4U7O A;  3K04 A;  1YI2 V;  3BA8 A;  1O9G A;  2QTS A;  1JJO A;  2O57 A;  1S5H C;  2GHY A;  1CXZ B;  2WLL A;  1VQ4 V;  3RT3 C;  4LF8 O;  2YXL A;  5B1A C;  3DXR A;  4X89 A;  4X65 B;  4I5S A;  5IWA O;  2H94 A;  2ZNJ A;  1BT8 A;  3RYH B;  4KFM A;  1PL0 A;  1AJP A;  4O2A B;  3L70 H;  1Q5O A;  3K0D A;  1Z2G A;  3AG2 C;  4FM1 A;  4P30 A;  4CC6 A;  2N05 A;  1IZ3 A;  4D7T A;  2EIM B;  3FYI B;  3JAR B;  2R9I A;  2N04 A;  4X20 A;  2LO1 A;  4PI0 A;  4PD4 F;  3OEH G;  1N32 O;  5D5P A;  2QKC A;  2UUA B;  3L73 H;  3CRQ A;  1S0V A;  1AR1 B;  2CTP A;  4K0K B;  1JOY A;  5EZY B;  5H9C A;  1RSO A;  3JD0 A;  3K5L A;  1SF9 A;  1EM1 A;  1F7Y A;  3UKM A;  4U7N A;  4NVP A;  4HBN A;  1X4T A;  2PTM A;  3AG4 B;  4X1I A;  1X59 A;  3T1H O;  5JVD B;  4DRX B;  4U3J A;  1XBL A;  4LF8 B;  2FML A;  1OCR C;  4LP8 A;  3LNN A;  4JTC B;  2X6A A;  4N23 A;  5IWA B;  2XAS A;  5GTI Z;  2NN4 A;  3FX7 A;  4D6T H;  3HKD B;  1BMF G;  3A2F A;  1NR1 A;  1Y74 B;  4PDR A;  4UV9 A;  2BTQ A;  2EJ7 A;  2D3O W;  2EZP A;  2IU0 A;  4UFZ A;  1H8H G;  5B3S C;  3CCU V;  1WA8 A;  4RQF A;  4DV3 O;  5L3E A;  1N32 B;  3BFR A;  3E8H A;  1VP7 A;  3JAW B;  4LR3 A;  1SQF A;  5LP6 B;  4XDK A;  4X1Y B;  2ETN A;  2EIN C;  1FAF A;  3S3X A;  4LF5 O;  1NH2 D;  2QWO B;  3JSL A;  5CMU A;  3P3P A;  3JD1 A;  4E4E A;  5E79 Z;  3U11 A;  1H8E G;  2XND G;  1BGY H;  1YJW V;  1HWY A;  3SJC C;  1HW7 A;  4MS2 A;  3HR0 A;  1Q7Y W;  4BWA A;  4PA4 A;  1R73 A;  5CB4 B;  5IJ9 B;  2OYQ A;  3T1H B;  3OMA B;  2IM9 A;  2QDO A;  1E79 G;  4MTO A;  3K06 A;  1IBL O;  2F93 B;  3BY6 A;  1SER A;  1FXK C;  2Y0I A;  4ZOL A;  1THZ A;  4E2L A;  1V54 C;  3SJB C;  5LOV B;  5EK0 A;  1VQ7 V;  4UCU A;  1XL6 A;  2Y69 C;  4OX9 O;  2Y48 A;  1AR4 A;  3F5T A;  1PPJ H;  2DJV A;  1J95 A;  2ZE7 A;  4DV3 B;  2ARH A;  4ABM A;  3RYH A;  2Q6A A;  4O2A A;  3JAL B;  4H13 B;  3CEI A;  2DYS C;  1P7G A;  3ZRW B;  4LF5 B;  3K5N A;  1ZAU A;  1ZTE A;  1Q86 W;  3N2G B;  1XOU A;  2JS5 A;  2YC0 A;  3JAR A;  4UVB A;  1AP5 A;  5KHG A;  3MDS A;  3E83 A;  2P7T C;  1VQP V;  1IBL B;  5A9G A;  2QM7 A;  3SPI A;  1B06 A;  1K33 A;  4FIP C;  2OCC C;  4UB6 Z;  3K5M A;  2XAQ A;  2QM4 A;  1IXM A;  1T5E A;  2BSK A;  2Q8V A;  2R72 A;  2IW5 A;  3H01 A;  4OX9 B;  3E22 A;  4RQE A;  3THO A;  2JEU A;  3IFX A;  1Q8I A;  1R3L C;  3Q4H B;  1YTF B;  2HVJ C;  1L8D A;  1GM9 A;  1SQP H;  3OTF A;  4UXN A;  4R8C A;  2NNU A;  2LW1 A;  3CJH B;  2RMK B;  1MOF A;  5IDJ A;  1JQ0 A;  4JPR A;  3ZHT A;  1OCC B;  2PY5 A;  2QWP B;  3L71 H;  1PNL A;  1FJG O;  2XAJ A;  2P5O A;  1OJH A;  3CC2 V;  2DWE C;  2VQE O;  4BW9 A;  4YIP A;  4W4K A;  2W0F C;  1VQ8 V;  3N2K B;  4X1Y A;  4WF9 V;  1U97 A;  2K9P A;  3CP1 A;  3QO5 A;  1D2D A;  3MHH C;  4X1K B;  2QEX V;  1XMO O;  2EIL B;  3SPG A;  5CB4 A;  1F4M A;  4AIL C;  4DV1 O;  3R65 A;  1XHZ A;  1FKA O;  4MTG A;  4NTY A;  3EFF K;  4UCV A;  2VRZ A;  3SPJ A;  5HFM A;  2BCC H;  3VBB A;  5LGN A;  1GKF A;  2P90 A;  4P9P A;  1S72 V;  2AHZ A;  1RM1 B;  5LOV A;  4YY3 O;  2ILM A;  4YJ3 B;  4JYA O;  3KKY A;  1BZK A;  1B3Q A;  3T4D A;  1SRY A;  5DN6 G;  4PJ0 Z;  1Q6U A;  1NBM G;  4GLX A;  1FJG B;  2EJR A;  2P4V A;  4CH6 A;  2VQE B;  2DYR B;  2YEV A;  3VQV A;  1CPY A;  3E8F A;  1Q81 W;  3CPW U;  2ZXW B;  3JAL A;  4ZBM A;  2ZE6 A;  3SYA A;  1J5E O;  3P32 A;  1DK1 A;  2GSM B;  5DM6 V;  4MVR A;  2LQT A;  1TVK B;  5CBG A;  4DR5 O;  4IL6 Z;  3D3I A;  4YIO A;  2WLI A;  2KG7 A;  3BRC A;  4LF6 O;  4UB8 Z;  1XMO B;  4FLU A;  3WFV A;  3FD9 A;  3STZ C;  4DV1 B;  1SES A;  5B1B C;  3AK2 A;  1HNZ O;  2VQF O;  1NKD A;  2B1I A;  1HNX O;  2QKA A;  1FPO A;  3CSX A;  1D5A A;  2QJ1 A;  1Q43 A;  3CCM V;  3RVZ A;  4LFB O;  4UCS A;  4WFG A;  4YY3 B;  3CYO A;  4J10 A;  1W0J G;  1I5X A;  2YXH A;  4ZHQ B;  4H44 B;  4JYA B;  4HYO A;  1KKD A;  4YJ2 B;  1IX9 A;  1NTM H;  3RBZ A;  3T4Z A;  1EN6 A;  3ABM C;  1QLE B;  1RFY A;  1I0H A;  3TXS A;  2Q7G A;  3RVY A;  1IXB A;  1GO3 F;  1MNG A;  1NI8 A;  4EB6 B;  4IIJ B;  4I4T B;  1BCC H;  2DN9 A;  2M6Y A;  4XBF A;  1L0N H;  3E8B A;  4QIW F;  2X7R B;  2CE4 A;  3QF7 A;  4O4I A;  4DR5 B;  4JI8 O;  4W4L A;  4LF6 B;  5GON B;  4MTX A;  2XHB A;  2RNB A;  2HJD A;  2BTO A;  4JI5 O;  1HNZ B;  1HNX B;  4FMT A;  3KG2 A;  1Q82 W;  3CXH F;  4LFB B;  2E3C A;  2RN9 A;  2B9Z A;  3L72 H;  5LYJ A;  4K3A A;  1NR7 A;  1K73 W;  4DUY B;  3SDL A;  1S5J A;  4LNU A;  4G28 B;  4KL1 A;  3AG3 C;  1GN3 A;  3FB5 C;  4RAI A;  4CS3 A;  2Y4T A;  3QO7 A;  2YSU B;  4JAU A;  1RSO B;  3H1I H;  3OAA G;  1QU7 A;  4YJ3 A;  1Q3E A;  5JJN B;  5KHH A;  3AEI A;  4JI1 O;  3IJ4 A;  4MVZ A;  1SA0 B;  1WP8 A;  1TGO A;  4GKK O;  5F2V O;  4X1I B;  3CRR A;  3EHB B;  1HP8 A;  3JCU Z;  4U3J B;  2IJI A;  3GVM A;  4NYK A;  1P4R A;  3MAQ A;  3JSN A;  1M9N A;  3CWB H;  1K34 A;  1YJ9 V;  4F6R A;  4JI5 B;  4GKJ O;  3ZMT A;  1JCH A;  3E86 A;  3OE7 G;  1TVK A;  4O4H A;  1SQG A;  4FK5 C;  3OR7 C;  1K8A W;  5BR8 O;  1R6N A;  4UUJ C;  3QO8 A;  1M93 A;  1VQK V;  1G4Y B;  1K9M W;  1WA8 B;  3ASO B;  1N36 O;  2E76 B;  3D8C A;  4MVS A;  3KZI Z;  2R9A A;  2DWD C;  4QE7 A;  1NVP D;  4FPP A;  1XRE A;  2IJJ A;  1M56 B;  4TUY B;  3AG4 C;  3M7M X;  2EIJ C;  1O9H A;  1KMI Z;  2RCV A;  4ICG A;  4JI1 B;  3CC4 V;  4J42 A;  3UO2 A;  4GKK B;  4OPH A;  4B7E A;  1GAX A;  5KAI Z;  1W0K G;  4GX1 A;  2WLM A;  2CGO A;  1SZX A;  2H3O A;  1IBK O;  4JI4 O;  2CGN A;  4ZOL B;  3FAV B;  4EB6 A;  4IIJ A;  4GKJ B;  4I4T A; 
#chains in the Genus database with same CATH homology
 5H5N A;  2DOS A;  4DR5 O;  4JI7 O;  4KHP O;  5BY1 A;  4LF6 O;  2ZM6 O;  2UXB O;  1R6T A;  4DV2 O;  1IBL O;  4JI0 O;  1XNQ O;  4B3S O;  1HNW O;  4JV5 O;  1HNZ O;  5IT9 N;  4DV5 O;  4LF7 O;  2VQF O;  1IBM O;  1N32 O;  1HNX O;  1FJG O;  1G1X B;  5A2Q N;  1R1B A;  4JI1 O;  2ZKO A;  5LMU O;  1XEQ A;  2VQE O;  4GKK O;  2UUB O;  1KUQ A;  1YZB A;  4LFB O;  1A32 A;  4AQY O;  4LF4 O;  1N33 O;  3JAM N;  4X65 O;  4OX9 O;  4DR2 O;  4LFA O;  4DUZ O;  1XMQ O;  3F5T A;  1D2D A;  1F7Y A;  2DJV A;  3J7A U;  4GKJ O;  2AGA A;  3R66 A;  2JRI A;  5FLX N;  1N34 O;  4LFC O;  1X59 A;  3T1H O;  1XMO O;  4B3M O;  4DR4 O;  1HR0 O;  4DR6 O;  2Z0A A;  5BR8 O;  4DV1 O;  1NS1 A;  4A5U B;  2UUC O;  4JI6 O;  5LMN O;  1FKA O;  2UXC O;  4DR1 O;  1N36 O;  2UUA O;  4JI2 O;  2FKX A;  4DV0 O;  3J80 N;  4YHH O;  4K0K O;  3OTO O;  4JI8 O;  4X62 O;  4DR7 O;  3M8A A;  4DUY O;  2UU9 O;  4B3T O;  4B3R O;  3T1Y O;  4YY3 O;  3J81 N;  4X64 O;  2N74 A;  4JYA O;  4NXN O;  4JI5 O;  4DV3 O;  1XNR O;  3O65 A;  2UXD O;  5LL6 Y;  4NXM O;  4DR3 O;  3RT3 C;  4OPH A;  4DV4 O;  4LF8 O;  4LF5 O;  2HHH O;  1J5E O;  2E5L O;  1FYJ A;  5IWA O;  5BXZ A;  4OPA A;  4DV6 O;  2F4V O;  1DK1 A;  1IBK O;  4JI4 O;  1AIL A;  4JI3 O;  1I94 O;  1AB3 A;  4LF9 O;  4DV7 O;  4X66 O;  2LW7 A;  3SDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...