1DK1A

Detailed view of a key element of the ribosome assembly: crystal structure of the s15-rrna complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords RRNA FRAGMENT
publication title Crystal structure of the S15-rRNA complex.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1999-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1dk1A00
4KHPO 3M8AA 4JI8O 4LF6O 4GKJO 1R1BA 4DV7O 4JI7O 4LF4O 1KUQA 1XNQO 5LMNO 4B3TO 4OX9O 1IBLO 4B3RO 1N34O 1F7YA 1AILA 1A32A 4DR6O 4LFCO 3T1HO 1XNRO 5BR8O 1IBKO 1HNXO 4DV4O 5LL6Y 3F5TA 3J80N 3J81N 1FYJA 3OTOO 4DR7O 2HHHO 1HR0O 1N32O 4X65O 4LF9O 1R6TA 1FKAO 1D2DA 4DV5O 3JAMN 2ZKOA 3J7AU 3SDLA 5A2QN 2F4VO 2UXDO 1AB3A 2Z0AA 2ZM6O 1G1XB 1I94O 4A5UB 2DOSA 4JI3O 1DK1A 4X64O 4LFAO 4B3MO 2UUAO 4DV2O 1FJGO 2VQFO 1XMQO 1HNZO 2UXBO 1XEQA 5BXZA 1X59A 1XMOO 4OPAA 4X62O 5BY1A 5IWAO 4DR4O 4K0KO 4LF7O 4JI6O 2DJVA 4NXNO 2N74A 4DV1O 4JI1O 2E5LO 1N36O 2LW7A 2JRIA 3R66A 4B3SO 2FKXA 4JI4O 4DV0O 4AQYO 2UUCO 4DR3O 4DV6O 4DR5O 3O65A 4NXMO 5FLXN 2AGAA 4LF5O 5LMUO 4JI2O 4JYAO 4DR2O 1NS1A 4X66O 1N33O 5IT9N 4LF8O 5H5NA 4GKKO 4JV5O 4YY3O 4DUYO 1J5EO 4YHHO 3T1YO 2UU9O 1IBMO 1HNWO 2UXCO 1YZBA 4DUZO 4DV3O 4OPHA 4JI0O 2UUBO 4JI5O 3RT3C 4DR1O 2VQEO 4LFBO
chains in the Genus database with same CATH superfamily
3I55V 2H3OA 3HKDA 1Q82W 5KHKA 4JI7O 1PP9H 2YIBA 5DEDA 2CTRA 1Y67A 2ZDIC 4X1IB 2AZ2A 3L72H 3SJBC 1Y6XA 2XAHA 3ZX6A 3RBZA 3MD0A 3T1HB 3AG1B 5LYJB 3CCEV 1R73A 3RYCA 2PTMA 2PZSA 2BSKA 4DV4O 1GTOA 3N2GA 2Q7GA 3OTOO 1AR5A 3BA9A 1US6A 3W7XA 3E8HA 3FKSG 3ZBHA 3A0RA 4BIUA 2E76B 2Q0OC 2DQ0A 5KMGB 4LF9O 1N32O 1R6TA 4QPKA 5EK0A 1OCOC 3IGAC 4GCZA 3KCYA 4DO2A 3U10A 2ETNA 2CH7B 5LXTA 3A8TA 4UCOA 3G4SV 1Y4MA 3L73H 1ZSPA 3OTOB 4K0KO 1MSWD 4JF3A 4WCEV 2DJVA 2IH3C 5EYPB 5JCOC 1BQ0A 5B1BC 4NR1A 2YXLA 4DV0B 4U7OA 4TV9B 4I5SA 4JYCA 2ZE5A 1KD1W 2UUCB 4WFHA 3K59A 3CPWU 5KX5A 1ROPA 2EZOA 2DYRC 1W0JG 1FXHA 3RYHB 3F7VC 1N33O 2UXNA 3CC7V 4JV5B 1IBMO 1S76D 1K3EA 1WA8B 2WLIB 4JI5B 1SETA 4FLYA 1OCOB 4ZIBA 2VRZA 1GMGA 2OTJV 1I5XA 3K9SA 2R9IA 5LOVA 3N27A 2Q69A 5IE9A 4KHPO 1FD9A 4GKJB 3CEIA 1WAZA 3OD4A 1OCZC 3L70H 2P7TC 4J80A 4DK1A 1OV9A 3VQVA 2QWRB 3FAVA 3SPIA 1XDCA 1ZX3A 2P4VA 5IYZB 4B08A 3L75H 3OGCC 1RSOB 2N04A 5J2TB 1BCCH 3J81N 3SYOA 3CB2A 1WB7A 3W7TA 3LSQA 4N23A 2XASA 1Y74B 3W7WA 3OUSA 3JAMN 3E8GA 1ZTEA 4I50B 3CRQA 3K5LA 3TJTA 2E75B 4WBNB 1OHHG 5IJ0A 3G6EV 2UUAO 4EFEA 3RVZA 4I4TA 5IYDO 1S5HC 3E22B 1NQTA 2EINC 2WLLA 1MOFA 2HLDG 4NXNO 1LNQA 2YEVB 5JQGB 1SZXA 1YXBA 5B1AB 3R66A 3EVKA 1CXZB 2XHBA 4EEQA 5JCOA 5EBWC 3RVYA 3CCRV 5B1NA 1P49A 3MHHC 2DE0X 3JD3A 3LDCA 2GUZA 5JH7B 2RMKB 1XL4A 2M7WA 3BAAA 2ZIOA 1M57C 3OFNG 3K03A 3K04A 1VIBA 3U0ZA 2UU9B 1NTKH 1NVPD 1YZBA 2ITCC 2ZT9B 1R3KC 4OPHA 4F6RB 4PV1B 3ZMSA 5KHJA 4FMTA 1B3QA 4LCUC 3T4ZA 1L0LH 4LF6O 5E1AC 2EINB 2CGNA 4MTXA 4LF4O 5CA0B 2X6AA 1XNQO 4Z2WA 2WAMA 2IJHA 1GM7A 4HYOA 1CPYA 4LFCO 3G67A 4JPRA 1GO3F 3CSXA 3M99B 2F93B 3HR0A 4H0LB 5BMVA 3FYEB 4LWSB 1H2KA 3JAWB 1AVMA 4LF6B 1HR0O 3OR7C 4JYYA 3MHSC 1G8MA 1M57B 4TV8B 4UCTA 2IU3A 2F4VO 2UXDB 4BIOA 1VQ4V 1FFTB 2QTSA 2ZM6B 1XNQB 3ZN1A 4DRXB 3B8MA 4RUFA 1QLEC 1M4UA 2P6JA 1CP9A 5A9GA 3ABUA 5IWAO 1JPXA 2KG7B 2YIDA 1D5AA 3JALB 3P3PA 1N36O 3KZIZ 2F4VB 2AXTZ 2YXYA 2L6LA 1N4CA 4O2AB 1NVPB 2YXHA 1M93A 1WP7A 4FFBB 3CCSV 3ETEA 4WFFA 2DQ3A 5L3CA 4Q6GA 3BVOA 4FFKA 3BEHA 4DW0A 5LMUO 1PNLA 3HKBA 4D6TH 1Q81W 5IWAB 4NTYA 1KP3A 5B3SB 1NR1A 3JASA 4J7ZA 4E4EA 4DUYB 4R6ZA 2H8PC 4O4IA 4IHJB 2DYSB 2D3OW 3CRAA 4WFGA 3ZMUA 3ZEDA 5JWPA 1QBZA 4LFBB 1SQQH 1K34A 1KB9F 3FB7C 2F95B 1M1KW 4Z1MG 4QPJA 5LMUB 3K0DA 2Y0PA 4UFZA 4O2BA 1N34B 1ZL8A 2F66C 2VS0A 3CCVV 4DR6B 3N2KB 2YC0A 5EZYB 1AJQA 1NR7A 5H2FZ 1WNSA 4X1YB 3CCUV 1NTMH 1IBKB 2HG5C 2HFEC 2VWJA 1VQPV 3AG4C 5LA6A 3CJHB 1TAEA 4DR7O 2LO1A 2XAJA 1BGYH 3P32A 4EB6A 1F51A 3AG3C 5ITZA 2PUSA 4UCUA 1FPOA 4MTFA 3TXSA 1K5SA 4DV2O 2IM9A 1ORQC 5GTIZ 1F23A 4IIJA 1P84F 4OPAA 2P90A 4DR4B 1KKDA 1QQCA 4P9PA 2KKWA 3CP1A 1FXKC 1W2BU 5KA6A 1K73W 1W0KG 2EIJC 4BWAA 2ODMA 1K9MW 1TVKA 2H94A 4KUMA 4JAUA 3EFFK 4DV2B 1SERA 3OUFA 2EIKC 4PDMA 2DW4A 2LFRA 4YJ3B 1EN5A 5EIBD 2JS3A 2B9ZA 3AG4B 1V55B 3QO5A 3H9VA 3BABA 1PL0A 4G28B 3CXCU 3D36A 2CUGA 3KG2A 3E8FA 3OGIB 1YDXA 3D3QA 2ZNJA 1KQSU 5FL7G 3DSQA 3AG3B 2RCVA 1N0JA 1V54B 5EIBC 5H6QA 2JDIG 4PDRA 4JI8O 4FLZA 3JARB 3ZIAG 4JYBA 1FFXB 4W4KA 1FS0G 5IJ9A 1IBLB 1R3LC 1K33A 4LNUB 2CTPA 4FPPA 1AILA 3E8BA 3LDDA 3T1CA 2XUMA 1XNRB 5BR8B 1HNXB 5CA1A 2JGUA 3ABTA 3F5TA 4FIPC 2F1MA 4RWUA 2AW9A 1V9PA 4O4JA 4JI8B 2OIGA 3OM3B 2QWPB 3RYFA 1YITV 2O57A 3IC7A 3OTFA 4KFMA 4X20B 3DTUB 1K8AW 2RN9A 2Y69C 1G1XB 4PA4A 3F7YC 3T4DA 4GX5A 4YXWG 5CBHA 2W6JG 4TT3G 1EFRG 1IVSA 4R8CA 4DYLA 1L1FA 1WP8A 5HFMA 5E79Z 3OW2U 2JJ1G 1Q6HA 4J10A 4X62O 2ZR2A 4JI6O 3DXRA 4DV1B 2JGDA 2E5LB 5EC1C 2JS5A 1KMIZ 3JSLA 1FXKA 3ICXA 3HKEB 4AQYO 3SPGA 1VQMV 5J2UB 2GTAA 4CZZA 1CEZA 2HKOA 3ZHVA 4N21A 2ZD9A 4QJFB 1MA1A 2GSMB 4X66O 1X4TA 3RW0A 4H44B 4JI6B 1HNWB 5KAFZ 4MW8A 4B7EA 3AG1C 4CS3A 3B77A 1JFFB 2Y69B 3AEIA 2WA4A 2GBOA 5CB4A 1AI5A 2EJ7A 3IFXA 1H2SB 2PI5A 2N05A 3K0GA 3OE7G 4YJ2A 1KUQA 4D7SA 1M9NA 2BOCC 5LMNB 1XBLA 5KHHA 2E74B 4WF9V 4X89A 3APOA 3T1HO 4NB5A 1HP8A 1SKVA 1Y76B 3L74H 3SPHA 1MMMA 3ZRWA 1DLBA 3ETGA 4LC1A 2EILC 2HJDA 1JOYA 1GN6A 3BHPA 1I0HA 1GK9A 5FNVA 4HZ3A 3QO7A 4I9QA 4UVAA 4UCVA 2QM4A 2XT9A 4TUYA 3Q4HB 3A0BZ 4ZHQA 4X1KA 2YI8A 4PA6A 3RGBA 3FB8C 1XEQA 4MS2A 1WB8A 3SYPA 3S3XA 1F4NA 1Q7YW 3CRMA 4PELA 4ZI7A 1M90W 4UUJC 1JJOA 3WB2A 1DF5A 2W6IG 3TXQA 4DV0O 4UVBA 2ADQB 2UUCO 4I55A 4YIOA 4NXMB 3HKCA 5K1XA 3ABMB 2QR4A 1EZJA 2QSAA 1AI4A 2EILB 1VP7A 3EHBB 2YICA 3ETDA 3CC4V 4JV5O 4RQFA 1KBHA 1Q43A 3A0HZ 3MAQA 1EM1A 1NBMG 4X1IA 3H01A 4PHZA 1HWYA 2UUBB 4JI5O 3CCLV 4NTWA 3CX5F 2ZE7A 5LYJA 1AR4A 2IH1C 3ETQA 2Q68A 3M7MX 4J41A 2GV9A 5EBLC 1O9HA 2B5UA 1R3JC 3APQA 2XOKG 4GKJO 3OR6C 1NH2D 4TQDA 2CTQA 2QA4V 2XAFA 5KMGA 3K5NA 3OEHG 4B3RB 3VOUA 1VMGA 1JA8A 1KC8W 2AHYA 3B8NA 4O4LB 2CH7A 3TETA 4GUNA 4DK0A 1EBOA 1W59A 2WPDG 4P2ZA 5B1AC 2GHYA 1VQ6V 5EYPA 3SDLA 5A2QN 1SQFA 2OTLV 2W0FC 3SYCA 2JVDA 4JZ2A 2X6BA 4JI3O 1DK1A 4X64O 1Q6UA 4TV9A 2ZDIA 2CE4A 1LUWA 4LFAB 1PD3A 2BTQB 1S77D 1YEWA 2DWEC 5J9PC 4GT1A 2ZNIA 1VF7A 1I08A 1BE3H 3RYIB 2UXXA 2NNUA 3RYHA 1NZ6A 4JI1B 1H8EG 3JATB 3RN4A 1WA8A 2WLIA 1PM9A 4JI3B 1VQNV 4HNAB 4X64B 5B66Z 1EN4A 4KP4A 2HJFC 3E89A 4UVCA 4NYKA 4CH4A 5IT9N 4LF8B 3JAKB 3E86A 4J42A 4YHHB 1NH2B 2UU9O 2OCCB 5LHHA 2UXCB 2A7WA 3TCUA 2A0LA 5IYZA 4BW9A 1UPGA 5KHGA 3CD6V 2HP8A 1RSOA 5J2TA 3CYOA 1SA0B 1DTOA 4IYHA 3ZHRA 1HDJA 5IYCO 1E1QG 1OZ0A 1Y74A 3X2QB 4I50A 2QWNB 2Y4UA 4WBNA 1JVMA 4Z1VA 1UJWB 4CS2A 2PF4E 1EZVH 1EN6A 1R6NA 4WFBV 4G27B 2YDEA 1NKDA 3ABKB 1VARA 3WB0A 1G6UA 1YJWV 3E22A 2HHHB 3RWRD 1PV0A 4U7NA 5LBQA 3VQYA 4X65B 4DV5B 2YEVA 4MTOA 5JQGA 2CK3G 3OEEG 4K8ZA 2UXDO 2YI9A 2ZM6O 1I94B 2DOSA 2B1IA 1FAFA 1XREA 3AG2C 2VWKA 4JAVA 1VQOV 2P4KA 2QTOA 2EX3A 1VQ8V 3VQXA 1NU1H 2WLHA 5JH7A 3H1LH 5B3SC 3E83A 4GX1A 3ZHTA 2JK5C 3KCXA 2DYSC 2BOBC 2R9RB 1SQVH 1SQGA 3QG5A 1K97A 4MT8A 5IY5B 4F6RA 1Z5WA 4E2LA 4DV6B 3O65A 5FPRA 1GM9A 4ABMA 5JJJB 4FK5C 3BA8A 4AILC 4JYAB 4DR2B 2HR3A 1R6KA 4YY3B 4DUYO 4FLTA 5CA0A 1YF2A 1XI1A 4I0XB 2X6CA 2EIMB 4LFBO 4YIPA 4BAYA 2QWQB 3AG2B 1IXMA 3B40A 1ENVA 4LWSA 3ZRSA 5LP6B 1VF6C 1H2NA 3JAWA 3TGUH 4XBFA 4UXNA 3ASNB 4TV8A 3UT5B 3H1JH 1T5EA 1N34O 1VEWA 2ARHA 4DR6O 3DGEA 4DRXA 1IBKO 3K5MA 1IX9A 1RPRA 3HB3B 5LL6Y 1RM1B 3UO2A 5JJEB 4NTXA 2IJIA 1NTZH 1SZTA 3ZMZA 4U3FH 5GONB 1QR8A 2IBZH 2KG7A 3IC9A 1PL4A 4ZOLB 1YHQV 3JALA 3SYQA 1BQZA 2P22C 4FZ0A 1B04A 3K08A 1AB3A 1QVFU 4LBEC 4O2AA 4MTGA 4B3MB 2ZE6A 4RQEA 4FFBA 1HNZO 1XMQB 2UXBB 4JTDB 4ZBMA 1RPOA 4DR4O 1V55C 1F4MA 4W4LA 4XDKA 4O4HB 1AP5A 3ABLB 4MVSA 1KU9A 1ZUQA 4IHJA 4UV9A 1AP6A 1JR9A 3U11A 3RFRA 4X88A 5EBMC 2K9PA 5JVDB 1JMKC 4GZRB 5KUKA 1V54C 1VQKV 1HNZB 2AGAA 4LF5B 1MSDA 4C7UA 1SQBH 3VQWA 1O9GA 3ZRVA 1QR9A 1XILA 3ZMVA 4DUZB 5EC2C 4I9WA 2WWWA 3N2KA 2Q5ZA 5EZYA 3I56V 4K8XA 1GAXA 4X1YA 2K1EA 4WFAV 4UB6Z 1OJHA 3W7UA 2CTWA 4ASUG 2OCHA 3KKYA 1I7FA 3CJHA 3MDSA 4IT5A 4H37A 1OCCB 5KAIZ 4H13B 2FTKA 3JD0A 1VF6A 2WLMA 3K5OA 3WU2Z 1KP2A 4B3TB 1IBLO 3BRCA 2Q8VA 1XNRO 4BIZA 1QHTA 5BR8O 4X9QA 1HNXO 4HBNA 2GDSA 4MVUA 4FZ1A 2RDCA 3ML0A 1N8RW 2ILMA 4JAAA 3J7AU 1PPJH 3GWKC 1OCRB 3HPLC 1THZA 5L3EA 3AG7A 1TUBB 2QM7A 4ICGA 1FJGB 1Q86W 1X59A 4YJ3A 1S72V 1M56B 3B4SA 2YIBD 3QVNA 4MVOA 1K7DA 1S5LZ 1DGSA 5D5QA 3ZN0A 1WPBA 4U3JB 4DV1O 2E5LO 2ADPA 2LW7A 2FKXA 1Q6IA 5CMUA 3P30A 3JCZA 5GTHZ 1NT2B 4FLUA 2PY5A 2JEXA 3ASOB 4DR3O 1WPXA 3THOA 2PYLA 1GN2A 1LUVA 1P7GA 4GKKB 4FM1A 1J5EB 3T1YB 3JARA 1HNWO 4PA9A 1FFXA 1JX9A 4RAIA 4LNUA 2ZR3A 1SQXH 4DV3B 2G38A 4LR3A 1XHXA 1GKFA 4PDLA 2Q73A 1JCHA 1BS3A 3E35A 2FMLA 1IZ3A 2VQEB 1FXVA 3SJCC 4DR3B 4HAMA 1WLEA 1JJ2U 5C8YB 3GWOA 4MVZA 4DV7B 3I5DA 3WG7C 3L9DA 2XAGA 4J9YB 2EZPA 4X20A 3F5WC 3R65A 2AHZA 2GTSA 5LMNO 4OX9B 1AROP 1UFIA 1Q90D 3LUTB 3WB1A 4GYCB 3B09A 4CH6A 1P7BA 4B7KA 4J7KA 5BZBA 4EFBA 3BPZA 4AHCA 3C3SA 2LJ2A 3HKDB 4L8JA 1H2MA 1FKAO 5L3GA 4JTCB 4RO2A 3SYAA 5H6RA 2DN9A 3HKEA 4IYIA 3RYCB 2BSKB 3ABMC 3N2GB 2WSSG 5J2UA 4KL1A 2R72A 1S5JA 3AK3A 5LGNA 2R70A 4LF7B 1BHAA 4OXSA 1YVWA 2KSDA 5GW7A 3WG7B 3FB5C 1N0NA 4GX2A 4I7ZB 1S3JA 4B3SO 1YSCA 3CS5A 5KUMA 1YIJV 5LXTB 1JFFA 1GH6A 5CBFA 2NLJC 1AJPA 2M6YA 3AK1A 4DR5B 4NXMO 4QNHB 1D5NA 3DC5A 4JI2B 3D8CA 2LP7A 2CGOA 3OT7A 5HFLA 1K4DC 1QCEA 1BSMA 2ZXWB 2RQ6A 3ZCCA 1L8DA 2A06H 4B3SB 4PJ0Z 4JI0B 2UUBO 4JZGA 1Y66A 5DECA 2A9HA 1AJNA 1ZLZA 2V7QG 1Y76A 5KX5B 2ZIMA 1YTFB 2LQTA 3CRRA 3CE2A 1COWG 2JEUA 4JI7B 3H1KH 5CA3A 2Y4TA 4B3RO 2F43G 2LW1A 1Z5VA 2MK3A 1IDSA 2OIEA 2Q9LA 5LHIA 3OMNB 3Q4HA 4QIWF 4L87A 5CBGA 1VQ5V 1H2GA 1I5YA 2C2AA 3L71H 4F4LA 5LOVB 4RUEA 1AI7A 3D3IA 4NVPA 4DV4B 3G6BA 2A79B 1QU7A 4CH5A 2FYUH 2ZINA 4UCSA 3FFQA 1N32B 4LF9B 1D2DA 4NKGB 2Q67A 3FAVB 2Q6AA 4FJCC 2Q7HA 1GN3A 5TISZ 4LFAO 3B2EE 4BR6A 5F2VO 2CDYA 1J95A 5CN0A 4K0KB 4J9ZB 2YS8A 2N74A 2XNDG 2OCCC 4JI1O 5B5EZ 1E79G 3DC6A 5C93A 1YJ9V 3IJ4A 5IJ0B 4F6EA 1L0NH 5B1OA 2BE3A 4ZKIA 2EULA 1AR1B 3K57A 3QTCA 4I4TB 1MZEA 3ZS8C 2WLLB 3AK2A 4JASA 1NS1A 1N33B 4MSWC 2F23A 4LF8O 2Q0AA 3X2QC 1BHBA 3SR2C 4YHHO 1IBMB 4R50A 1XOUA 4H33A 2UXCO 3CCJV 1H38A 4KXRA 5B1BB 4DR1O 3OMAB 4PA3A 4O4LA 3ABKC 2GUZB 4WFEA 2KQXA 1B06A 4QE9A 4KHPB 2DYRB 1YI2V 2NN4A 2L35A 3LNMB 1KYOF 1VF5B 2YUAA 1Z2GA 2PGGA 2D2CB 5IDJA 3CXHF 1URFA 3SPJA 1A32A 2QWOB 1E1RG 1PKXA 3K9AA 3ZHQA 1K4CC 1NJIW 4D7TA 3C90A 1GM8A 4DR1B 3PJSK 2XTAA 4MVQA 2V4DA 4CBCA 4AI8A 1RFYA 1BMFG 2BTQA 3QO8A 3E2EA 4IGGA 3CCMV 2Y0IA 3RYIA 2HHHO 2WLKA 4X8AA 4XDJA 4X65O 4DV5O 3G71V 2ZKOA 1OCZB 3K58A 1WN7A 3JATA 1KKCA 2Z0AA 1I94O 3JD2A 5IY5C 2BTOA 2OYQA 4HNAA 2UUAB 5BMVB 2JJ2G 2VQFO 5BXZA 4QGPA 1H2LA 2WA3A 2ZQMA 1QNMA 1Q5OA 3VBBA 4FLVA 2NR5A 4NXNB 4FM2A 5LHGA 3JAKA 2JRIA 5H9CA 3H1IH 2EIMC 4OGQB 3PN1A 4MW3A 3CMAV 4DV6O 3ZMTA 2VQFB 1SESA 1SRYA 5LP6C 1SA0A 2P06A 3K06A 4JYAO 2OT5A 4DR2O 2PYJA 2R9AA 4K3AA 5H5NA 5KHIA 3ASNC 4YY3O 4DW1A 1G4YB 3LSSA 4PI2A 2B1GA 4DXWA 1LR1A 3JD4A 1RM1C 4LH6A 3HKBB 1M5IA 2WLJA 1P4RA 2DMXA 4XDLA 2LFSA 1MZFA 4PI0A 1QLNA 1MNGA 4TQFA 3UCSC 3JASB 4LF4B 3FD9A 3FYIB 3S3WA 1GRJA 4O4IB 3WFVA 1U97A 1B6QA 2Q7EA 4CC6A 2QDOA 2KB1A 4LFCB 1Q8IA 3ZHUA 1YJNV 2LGWA 5KLVH 3C3TA 5K1PA 5LGTA 4JTAB 3A2FA 3BY6A 1HR0B 3ABLC 3EXAA 2HVKC 2ATKC 3UM7A 4IL6Z 4O2BB 1ZL8B 3GB7C 1AI6A 5DN6G 3FB6C 4K35A 2YSUB 4UV8A 4B3MO 1XMQO 5LA6B 2UXBO 1QVGU 2IU0A 1XMOO 2DWDC 1PNKA 4PDVA 5BY1A 3OAAG 1YCIA 3D36C 1JQ0A 1N36B 4MVMA 3O9OA 1SQPH 4EB6B 3TK1A 2X0LA 5ITZB 1BZKA 2ITDC 2RNBA 4I0XA 4J7JA 4FLWA 1H8HG 1TUEB 2QM8A 1QLEB 4LH7A 4IIJB 4LF5O 1XMOB 1MG1A 1OCCC 5LP6A 2WLNA 4QE7A 1NI8A 1TA8A 3UT5A 3CMEV 2QJ1A 4DUZO 2IW5A 2P67A 1TVKB 2LGQA 1KECA 5IYBO 4G2KA 3JSNA 4FLXA 1R1BA 4GLXA 4MVRA 1XUQA 5GONA 1OCRC 5L3DA 3CCQV 4CC5A 4ZOLA 4B3TO 1F7YA 2YIAA 4R7CA 1VQLV 4TWKA 4LP8A 1SS3A 3NR7A 3STZC 5FPOA 1M56C 3T2MA 1FYJA 2CAZC 4DR7B 3CHXA 3CRCA 4O4HA 4TSFG 5IJ9B 1ZAUA 3JYCA 3ASOC 5CA1B 1DF4A 5L3BA 3G80A 4CS4A 2MW2B 5JVDA 1FJGO 4FVMA 2X7RB 2QKSA 1XQ8A 3FX7A 2QE7G 4O4JB 2EBOA 3RYFB 1IXBA 2V1DA 3OMIB 4Q20A 3UO3A 3LNNA 2QKAA 4PD4F 4JI4O 3UQ8A 4J11A 3K79A 2QGNA 1BT8A 3CWBH 1PNMA 2PI4A 3K3WA 2Y48A 3DXRB 4PA7A 2JGDB 3W7SA 4GKKO 2A3QA 3LSUA 3ZJZA 1FXKB 3T1YO 1J5EO 5L3FA 4DV3O 2EIJB 4JI4B 5LGUA 1SC5B 3QNEA 4FM0A 2FB5A 1RP3B 2VQEO 2IJKA 5AG2A 4UB8Z 2Z3YA 3P3NA 2EIKB 3GVMA 1HW7A 3M8AA 3BFRA 4DV7O 2RJZA 3SPCA 4EKWA 1VQ9V 4OX9O 2ZE8A 3STLC 5D5PA 1GN4A 3UKMA 2E3CA 3SGIA 5CB4B 1IURA 1TUBA 2HEPA 1VQ7V 1R3IC 1SF9A 3J80N 2IJJA 2BCCH 3H1HH 4YJ2B 3JCUZ 4U3JA 3IAYA 2AZ0A 3SJQC 5DM6V 5JJNB 4A5UB 4UCRA 1K92A 1YTFD 3SJAC 1XHZA 2QEXV 1TGOA 3ZRWB 3ZHSA 4X62B 3LDEA 2P5OA 4LF7O 2QKCA 1XL6A 5FNVB 4P9OA 2FL4A 4GX0A 2ZXWC 3QF7A 4TUYB 4AQYB 4ZHQB 3ZRXA 1BL8A 2Q4PA 4X1KB 2OWOA 1WJZA 4JGSA 4DR5O 2JIZG 3NXSA 5FLXN 4TOIA 4JI2O 2ZCEA 5C8YA 3BCCH 4X66B 2HVJC 5KA5A 4ZI7B 3JD1A 1K5QA 1S0VA 2XAQA 4P30A 1U96A 4JI0O 1MABG 1Q3EA 2Z5UA 3CC2V 3RT3C 4I55B 2W0XA 4BW5A 4CH3A 2EJRA 1ZWIC 3HKCB
chains in the Genus database with same CATH topology
4KHPO 3M8AA 4JI8O 4LF6O 4GKJO 1R1BA 4DV7O 4JI7O 4LF4O 1KUQA 1XNQO 5LMNO 4B3TO 4OX9O 1IBLO 4B3RO 1N34O 1F7YA 1AILA 1A32A 4DR6O 4LFCO 3T1HO 1XNRO 5BR8O 1IBKO 1HNXO 4DV4O 5LL6Y 3F5TA 3J80N 3J81N 1FYJA 3OTOO 4DR7O 2HHHO 1HR0O 1N32O 4X65O 4LF9O 1R6TA 1FKAO 1D2DA 4DV5O 3JAMN 2ZKOA 3J7AU 3SDLA 5A2QN 2F4VO 2UXDO 1AB3A 2Z0AA 2ZM6O 1G1XB 1I94O 4A5UB 2DOSA 4JI3O 1DK1A 4X64O 4LFAO 4B3MO 2UUAO 4DV2O 1FJGO 2VQFO 1XMQO 1HNZO 2UXBO 1XEQA 5BXZA 1X59A 1XMOO 4OPAA 4X62O 5BY1A 5IWAO 4DR4O 4K0KO 4LF7O 4JI6O 2DJVA 4NXNO 2N74A 4DV1O 4JI1O 2E5LO 1N36O 2LW7A 2JRIA 3R66A 4B3SO 2FKXA 4JI4O 4DV0O 4AQYO 2UUCO 4DR3O 4DV6O 4DR5O 3O65A 4NXMO 5FLXN 2AGAA 4LF5O 5LMUO 4JI2O 4JYAO 4DR2O 1NS1A 4X66O 1N33O 5IT9N 4LF8O 5H5NA 4GKKO 4JV5O 4YY3O 4DUYO 1J5EO 4YHHO 3T1YO 2UU9O 1IBMO 1HNWO 2UXCO 1YZBA 4DUZO 4DV3O 4OPHA 4JI0O 2UUBO 4JI5O 3RT3C 4DR1O 2VQEO 4LFBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP O;  3M8A A;  4JI8 O;  4LF6 O;  4GKJ O;  1R1B A;  4DV7 O;  4JI7 O;  4LF4 O;  1KUQ A;  1XNQ O;  5LMN O;  4B3T O;  4OX9 O;  1IBL O;  4B3R O;  1N34 O;  1F7Y A;  1AIL A;  1A32 A;  4DR6 O;  4LFC O;  3T1H O;  1XNR O;  5BR8 O;  1IBK O;  1HNX O;  4DV4 O;  5LL6 Y;  3F5T A;  3J80 N;  3J81 N;  1FYJ A;  3OTO O;  4DR7 O;  2HHH O;  1HR0 O;  1N32 O;  4X65 O;  4LF9 O;  1R6T A;  1FKA O;  1D2D A;  4DV5 O;  3JAM N;  2ZKO A;  3J7A U;  3SDL A;  5A2Q N;  2F4V O;  2UXD O;  1AB3 A;  2Z0A A;  2ZM6 O;  1G1X B;  1I94 O;  4A5U B;  2DOS A;  4JI3 O;  1DK1 A;  4X64 O;  4LFA O;  4B3M O;  2UUA O;  4DV2 O;  1FJG O;  2VQF O;  1XMQ O;  1HNZ O;  2UXB O;  1XEQ A;  5BXZ A;  1X59 A;  1XMO O;  4OPA A;  4X62 O;  5BY1 A;  5IWA O;  4DR4 O;  4K0K O;  4LF7 O;  4JI6 O;  2DJV A;  4NXN O;  2N74 A;  4DV1 O;  4JI1 O;  2E5L O;  1N36 O;  2LW7 A;  2JRI A;  3R66 A;  4B3S O;  2FKX A;  4JI4 O;  4DV0 O;  4AQY O;  2UUC O;  4DR3 O;  4DV6 O;  4DR5 O;  3O65 A;  4NXM O;  5FLX N;  2AGA A;  4LF5 O;  5LMU O;  4JI2 O;  4JYA O;  4DR2 O;  1NS1 A;  4X66 O;  1N33 O;  5IT9 N;  4LF8 O;  5H5N A;  4GKK O;  4JV5 O;  4YY3 O;  4DUY O;  1J5E O;  4YHH O;  3T1Y O;  2UU9 O;  1IBM O;  1HNW O;  2UXC O;  1YZB A;  4DUZ O;  4DV3 O;  4OPH A;  4JI0 O;  2UUB O;  4JI5 O;  3RT3 C;  4DR1 O;  2VQE O;  4LFB O; 
#chains in the Genus database with same CATH topology
 3I55 V;  2H3O A;  3HKD A;  1Q82 W;  5KHK A;  4JI7 O;  1PP9 H;  2YIB A;  5DED A;  2CTR A;  1Y67 A;  2ZDI C;  4X1I B;  2AZ2 A;  3L72 H;  3SJB C;  1Y6X A;  2XAH A;  3ZX6 A;  3RBZ A;  3MD0 A;  3T1H B;  3AG1 B;  5LYJ B;  3CCE V;  1R73 A;  3RYC A;  2PTM A;  2PZS A;  2BSK A;  4DV4 O;  1GTO A;  3N2G A;  2Q7G A;  3OTO O;  1AR5 A;  3BA9 A;  1US6 A;  3W7X A;  3E8H A;  3FKS G;  3ZBH A;  3A0R A;  4BIU A;  2E76 B;  2Q0O C;  2DQ0 A;  5KMG B;  4LF9 O;  1N32 O;  1R6T A;  4QPK A;  5EK0 A;  1OCO C;  3IGA C;  4GCZ A;  3KCY A;  4DO2 A;  3U10 A;  2ETN A;  2CH7 B;  5LXT A;  3A8T A;  4UCO A;  3G4S V;  1Y4M A;  3L73 H;  1ZSP A;  3OTO B;  4K0K O;  1MSW D;  4JF3 A;  4WCE V;  2DJV A;  2IH3 C;  5EYP B;  5JCO C;  1BQ0 A;  5B1B C;  4NR1 A;  2YXL A;  4DV0 B;  4U7O A;  4TV9 B;  4I5S A;  4JYC A;  2ZE5 A;  1KD1 W;  2UUC B;  4WFH A;  3K59 A;  3CPW U;  5KX5 A;  1ROP A;  2EZO A;  2DYR C;  1W0J G;  1FXH A;  3RYH B;  3F7V C;  1N33 O;  2UXN A;  3CC7 V;  4JV5 B;  1IBM O;  1S76 D;  1K3E A;  1WA8 B;  2WLI B;  4JI5 B;  1SET A;  4FLY A;  1OCO B;  4ZIB A;  2VRZ A;  1GMG A;  2OTJ V;  1I5X A;  3K9S A;  2R9I A;  5LOV A;  3N27 A;  2Q69 A;  5IE9 A;  4KHP O;  1FD9 A;  4GKJ B;  3CEI A;  1WAZ A;  3OD4 A;  1OCZ C;  3L70 H;  2P7T C;  4J80 A;  4DK1 A;  1OV9 A;  3VQV A;  2QWR B;  3FAV A;  3SPI A;  1XDC A;  1ZX3 A;  2P4V A;  5IYZ B;  4B08 A;  3L75 H;  3OGC C;  1RSO B;  2N04 A;  5J2T B;  1BCC H;  3J81 N;  3SYO A;  3CB2 A;  1WB7 A;  3W7T A;  3LSQ A;  4N23 A;  2XAS A;  1Y74 B;  3W7W A;  3OUS A;  3JAM N;  3E8G A;  1ZTE A;  4I50 B;  3CRQ A;  3K5L A;  3TJT A;  2E75 B;  4WBN B;  1OHH G;  5IJ0 A;  3G6E V;  2UUA O;  4EFE A;  3RVZ A;  4I4T A;  5IYD O;  1S5H C;  3E22 B;  1NQT A;  2EIN C;  2WLL A;  1MOF A;  2HLD G;  4NXN O;  1LNQ A;  2YEV B;  5JQG B;  1SZX A;  1YXB A;  5B1A B;  3R66 A;  3EVK A;  1CXZ B;  2XHB A;  4EEQ A;  5JCO A;  5EBW C;  3RVY A;  3CCR V;  5B1N A;  1P49 A;  3MHH C;  2DE0 X;  3JD3 A;  3LDC A;  2GUZ A;  5JH7 B;  2RMK B;  1XL4 A;  2M7W A;  3BAA A;  2ZIO A;  1M57 C;  3OFN G;  3K03 A;  3K04 A;  1VIB A;  3U0Z A;  2UU9 B;  1NTK H;  1NVP D;  1YZB A;  2ITC C;  2ZT9 B;  1R3K C;  4OPH A;  4F6R B;  4PV1 B;  3ZMS A;  5KHJ A;  4FMT A;  1B3Q A;  4LCU C;  3T4Z A;  1L0L H;  4LF6 O;  5E1A C;  2EIN B;  2CGN A;  4MTX A;  4LF4 O;  5CA0 B;  2X6A A;  1XNQ O;  4Z2W A;  2WAM A;  2IJH A;  1GM7 A;  4HYO A;  1CPY A;  4LFC O;  3G67 A;  4JPR A;  1GO3 F;  3CSX A;  3M99 B;  2F93 B;  3HR0 A;  4H0L B;  5BMV A;  3FYE B;  4LWS B;  1H2K A;  3JAW B;  1AVM A;  4LF6 B;  1HR0 O;  3OR7 C;  4JYY A;  3MHS C;  1G8M A;  1M57 B;  4TV8 B;  4UCT A;  2IU3 A;  2F4V O;  2UXD B;  4BIO A;  1VQ4 V;  1FFT B;  2QTS A;  2ZM6 B;  1XNQ B;  3ZN1 A;  4DRX B;  3B8M A;  4RUF A;  1QLE C;  1M4U A;  2P6J A;  1CP9 A;  5A9G A;  3ABU A;  5IWA O;  1JPX A;  2KG7 B;  2YID A;  1D5A A;  3JAL B;  3P3P A;  1N36 O;  3KZI Z;  2F4V B;  2AXT Z;  2YXY A;  2L6L A;  1N4C A;  4O2A B;  1NVP B;  2YXH A;  1M93 A;  1WP7 A;  4FFB B;  3CCS V;  3ETE A;  4WFF A;  2DQ3 A;  5L3C A;  4Q6G A;  3BVO A;  4FFK A;  3BEH A;  4DW0 A;  5LMU O;  1PNL A;  3HKB A;  4D6T H;  1Q81 W;  5IWA B;  4NTY A;  1KP3 A;  5B3S B;  1NR1 A;  3JAS A;  4J7Z A;  4E4E A;  4DUY B;  4R6Z A;  2H8P C;  4O4I A;  4IHJ B;  2DYS B;  2D3O W;  3CRA A;  4WFG A;  3ZMU A;  3ZED A;  5JWP A;  1QBZ A;  4LFB B;  1SQQ H;  1K34 A;  1KB9 F;  3FB7 C;  2F95 B;  1M1K W;  4Z1M G;  4QPJ A;  5LMU B;  3K0D A;  2Y0P A;  4UFZ A;  4O2B A;  1N34 B;  1ZL8 A;  2F66 C;  2VS0 A;  3CCV V;  4DR6 B;  3N2K B;  2YC0 A;  5EZY B;  1AJQ A;  1NR7 A;  5H2F Z;  1WNS A;  4X1Y B;  3CCU V;  1NTM H;  1IBK B;  2HG5 C;  2HFE C;  2VWJ A;  1VQP V;  3AG4 C;  5LA6 A;  3CJH B;  1TAE A;  4DR7 O;  2LO1 A;  2XAJ A;  1BGY H;  3P32 A;  4EB6 A;  1F51 A;  3AG3 C;  5ITZ A;  2PUS A;  4UCU A;  1FPO A;  4MTF A;  3TXS A;  1K5S A;  4DV2 O;  2IM9 A;  1ORQ C;  5GTI Z;  1F23 A;  4IIJ A;  1P84 F;  4OPA A;  2P90 A;  4DR4 B;  1KKD A;  1QQC A;  4P9P A;  2KKW A;  3CP1 A;  1FXK C;  1W2B U;  5KA6 A;  1K73 W;  1W0K G;  2EIJ C;  4BWA A;  2ODM A;  1K9M W;  1TVK A;  2H94 A;  4KUM A;  4JAU A;  3EFF K;  4DV2 B;  1SER A;  3OUF A;  2EIK C;  4PDM A;  2DW4 A;  2LFR A;  4YJ3 B;  1EN5 A;  5EIB D;  2JS3 A;  2B9Z A;  3AG4 B;  1V55 B;  3QO5 A;  3H9V A;  3BAB A;  1PL0 A;  4G28 B;  3CXC U;  3D36 A;  2CUG A;  3KG2 A;  3E8F A;  3OGI B;  1YDX A;  3D3Q A;  2ZNJ A;  1KQS U;  5FL7 G;  3DSQ A;  3AG3 B;  2RCV A;  1N0J A;  1V54 B;  5EIB C;  5H6Q A;  2JDI G;  4PDR A;  4JI8 O;  4FLZ A;  3JAR B;  3ZIA G;  4JYB A;  1FFX B;  4W4K A;  1FS0 G;  5IJ9 A;  1IBL B;  1R3L C;  1K33 A;  4LNU B;  2CTP A;  4FPP A;  1AIL A;  3E8B A;  3LDD A;  3T1C A;  2XUM A;  1XNR B;  5BR8 B;  1HNX B;  5CA1 A;  2JGU A;  3ABT A;  3F5T A;  4FIP C;  2F1M A;  4RWU A;  2AW9 A;  1V9P A;  4O4J A;  4JI8 B;  2OIG A;  3OM3 B;  2QWP B;  3RYF A;  1YIT V;  2O57 A;  3IC7 A;  3OTF A;  4KFM A;  4X20 B;  3DTU B;  1K8A W;  2RN9 A;  2Y69 C;  1G1X B;  4PA4 A;  3F7Y C;  3T4D A;  4GX5 A;  4YXW G;  5CBH A;  2W6J G;  4TT3 G;  1EFR G;  1IVS A;  4R8C A;  4DYL A;  1L1F A;  1WP8 A;  5HFM A;  5E79 Z;  3OW2 U;  2JJ1 G;  1Q6H A;  4J10 A;  4X62 O;  2ZR2 A;  4JI6 O;  3DXR A;  4DV1 B;  2JGD A;  2E5L B;  5EC1 C;  2JS5 A;  1KMI Z;  3JSL A;  1FXK A;  3ICX A;  3HKE B;  4AQY O;  3SPG A;  1VQM V;  5J2U B;  2GTA A;  4CZZ A;  1CEZ A;  2HKO A;  3ZHV A;  4N21 A;  2ZD9 A;  4QJF B;  1MA1 A;  2GSM B;  4X66 O;  1X4T A;  3RW0 A;  4H44 B;  4JI6 B;  1HNW B;  5KAF Z;  4MW8 A;  4B7E A;  3AG1 C;  4CS3 A;  3B77 A;  1JFF B;  2Y69 B;  3AEI A;  2WA4 A;  2GBO A;  5CB4 A;  1AI5 A;  2EJ7 A;  3IFX A;  1H2S B;  2PI5 A;  2N05 A;  3K0G A;  3OE7 G;  4YJ2 A;  1KUQ A;  4D7S A;  1M9N A;  2BOC C;  5LMN B;  1XBL A;  5KHH A;  2E74 B;  4WF9 V;  4X89 A;  3APO A;  3T1H O;  4NB5 A;  1HP8 A;  1SKV A;  1Y76 B;  3L74 H;  3SPH A;  1MMM A;  3ZRW A;  1DLB A;  3ETG A;  4LC1 A;  2EIL C;  2HJD A;  1JOY A;  1GN6 A;  3BHP A;  1I0H A;  1GK9 A;  5FNV A;  4HZ3 A;  3QO7 A;  4I9Q A;  4UVA A;  4UCV A;  2QM4 A;  2XT9 A;  4TUY A;  3Q4H B;  3A0B Z;  4ZHQ A;  4X1K A;  2YI8 A;  4PA6 A;  3RGB A;  3FB8 C;  1XEQ A;  4MS2 A;  1WB8 A;  3SYP A;  3S3X A;  1F4N A;  1Q7Y W;  3CRM A;  4PEL A;  4ZI7 A;  1M90 W;  4UUJ C;  1JJO A;  3WB2 A;  1DF5 A;  2W6I G;  3TXQ A;  4DV0 O;  4UVB A;  2ADQ B;  2UUC O;  4I55 A;  4YIO A;  4NXM B;  3HKC A;  5K1X A;  3ABM B;  2QR4 A;  1EZJ A;  2QSA A;  1AI4 A;  2EIL B;  1VP7 A;  3EHB B;  2YIC A;  3ETD A;  3CC4 V;  4JV5 O;  4RQF A;  1KBH A;  1Q43 A;  3A0H Z;  3MAQ A;  1EM1 A;  1NBM G;  4X1I A;  3H01 A;  4PHZ A;  1HWY A;  2UUB B;  4JI5 O;  3CCL V;  4NTW A;  3CX5 F;  2ZE7 A;  5LYJ A;  1AR4 A;  2IH1 C;  3ETQ A;  2Q68 A;  3M7M X;  4J41 A;  2GV9 A;  5EBL C;  1O9H A;  2B5U A;  1R3J C;  3APQ A;  2XOK G;  4GKJ O;  3OR6 C;  1NH2 D;  4TQD A;  2CTQ A;  2QA4 V;  2XAF A;  5KMG A;  3K5N A;  3OEH G;  4B3R B;  3VOU A;  1VMG A;  1JA8 A;  1KC8 W;  2AHY A;  3B8N A;  4O4L B;  2CH7 A;  3TET A;  4GUN A;  4DK0 A;  1EBO A;  1W59 A;  2WPD G;  4P2Z A;  5B1A C;  2GHY A;  1VQ6 V;  5EYP A;  3SDL A;  5A2Q N;  1SQF A;  2OTL V;  2W0F C;  3SYC A;  2JVD A;  4JZ2 A;  2X6B A;  4JI3 O;  1DK1 A;  4X64 O;  1Q6U A;  4TV9 A;  2ZDI A;  2CE4 A;  1LUW A;  4LFA B;  1PD3 A;  2BTQ B;  1S77 D;  1YEW A;  2DWE C;  5J9P C;  4GT1 A;  2ZNI A;  1VF7 A;  1I08 A;  1BE3 H;  3RYI B;  2UXX A;  2NNU A;  3RYH A;  1NZ6 A;  4JI1 B;  1H8E G;  3JAT B;  3RN4 A;  1WA8 A;  2WLI A;  1PM9 A;  4JI3 B;  1VQN V;  4HNA B;  4X64 B;  5B66 Z;  1EN4 A;  4KP4 A;  2HJF C;  3E89 A;  4UVC A;  4NYK A;  4CH4 A;  5IT9 N;  4LF8 B;  3JAK B;  3E86 A;  4J42 A;  4YHH B;  1NH2 B;  2UU9 O;  2OCC B;  5LHH A;  2UXC B;  2A7W A;  3TCU A;  2A0L A;  5IYZ A;  4BW9 A;  1UPG A;  5KHG A;  3CD6 V;  2HP8 A;  1RSO A;  5J2T A;  3CYO A;  1SA0 B;  1DTO A;  4IYH A;  3ZHR A;  1HDJ A;  5IYC O;  1E1Q G;  1OZ0 A;  1Y74 A;  3X2Q B;  4I50 A;  2QWN B;  2Y4U A;  4WBN A;  1JVM A;  4Z1V A;  1UJW B;  4CS2 A;  2PF4 E;  1EZV H;  1EN6 A;  1R6N A;  4WFB V;  4G27 B;  2YDE A;  1NKD A;  3ABK B;  1VAR A;  3WB0 A;  1G6U A;  1YJW V;  3E22 A;  2HHH B;  3RWR D;  1PV0 A;  4U7N A;  5LBQ A;  3VQY A;  4X65 B;  4DV5 B;  2YEV A;  4MTO A;  5JQG A;  2CK3 G;  3OEE G;  4K8Z A;  2UXD O;  2YI9 A;  2ZM6 O;  1I94 B;  2DOS A;  2B1I A;  1FAF A;  1XRE A;  3AG2 C;  2VWK A;  4JAV A;  1VQO V;  2P4K A;  2QTO A;  2EX3 A;  1VQ8 V;  3VQX A;  1NU1 H;  2WLH A;  5JH7 A;  3H1L H;  5B3S C;  3E83 A;  4GX1 A;  3ZHT A;  2JK5 C;  3KCX A;  2DYS C;  2BOB C;  2R9R B;  1SQV H;  1SQG A;  3QG5 A;  1K97 A;  4MT8 A;  5IY5 B;  4F6R A;  1Z5W A;  4E2L A;  4DV6 B;  3O65 A;  5FPR A;  1GM9 A;  4ABM A;  5JJJ B;  4FK5 C;  3BA8 A;  4AIL C;  4JYA B;  4DR2 B;  2HR3 A;  1R6K A;  4YY3 B;  4DUY O;  4FLT A;  5CA0 A;  1YF2 A;  1XI1 A;  4I0X B;  2X6C A;  2EIM B;  4LFB O;  4YIP A;  4BAY A;  2QWQ B;  3AG2 B;  1IXM A;  3B40 A;  1ENV A;  4LWS A;  3ZRS A;  5LP6 B;  1VF6 C;  1H2N A;  3JAW A;  3TGU H;  4XBF A;  4UXN A;  3ASN B;  4TV8 A;  3UT5 B;  3H1J H;  1T5E A;  1N34 O;  1VEW A;  2ARH A;  4DR6 O;  3DGE A;  4DRX A;  1IBK O;  3K5M A;  1IX9 A;  1RPR A;  3HB3 B;  5LL6 Y;  1RM1 B;  3UO2 A;  5JJE B;  4NTX A;  2IJI A;  1NTZ H;  1SZT A;  3ZMZ A;  4U3F H;  5GON B;  1QR8 A;  2IBZ H;  2KG7 A;  3IC9 A;  1PL4 A;  4ZOL B;  1YHQ V;  3JAL A;  3SYQ A;  1BQZ A;  2P22 C;  4FZ0 A;  1B04 A;  3K08 A;  1AB3 A;  1QVF U;  4LBE C;  4O2A A;  4MTG A;  4B3M B;  2ZE6 A;  4RQE A;  4FFB A;  1HNZ O;  1XMQ B;  2UXB B;  4JTD B;  4ZBM A;  1RPO A;  4DR4 O;  1V55 C;  1F4M A;  4W4L A;  4XDK A;  4O4H B;  1AP5 A;  3ABL B;  4MVS A;  1KU9 A;  1ZUQ A;  4IHJ A;  4UV9 A;  1AP6 A;  1JR9 A;  3U11 A;  3RFR A;  4X88 A;  5EBM C;  2K9P A;  5JVD B;  1JMK C;  4GZR B;  5KUK A;  1V54 C;  1VQK V;  1HNZ B;  2AGA A;  4LF5 B;  1MSD A;  4C7U A;  1SQB H;  3VQW A;  1O9G A;  3ZRV A;  1QR9 A;  1XIL A;  3ZMV A;  4DUZ B;  5EC2 C;  4I9W A;  2WWW A;  3N2K A;  2Q5Z A;  5EZY A;  3I56 V;  4K8X A;  1GAX A;  4X1Y A;  2K1E A;  4WFA V;  4UB6 Z;  1OJH A;  3W7U A;  2CTW A;  4ASU G;  2OCH A;  3KKY A;  1I7F A;  3CJH A;  3MDS A;  4IT5 A;  4H37 A;  1OCC B;  5KAI Z;  4H13 B;  2FTK A;  3JD0 A;  1VF6 A;  2WLM A;  3K5O A;  3WU2 Z;  1KP2 A;  4B3T B;  1IBL O;  3BRC A;  2Q8V A;  1XNR O;  4BIZ A;  1QHT A;  5BR8 O;  4X9Q A;  1HNX O;  4HBN A;  2GDS A;  4MVU A;  4FZ1 A;  2RDC A;  3ML0 A;  1N8R W;  2ILM A;  4JAA A;  3J7A U;  1PPJ H;  3GWK C;  1OCR B;  3HPL C;  1THZ A;  5L3E A;  3AG7 A;  1TUB B;  2QM7 A;  4ICG A;  1FJG B;  1Q86 W;  1X59 A;  4YJ3 A;  1S72 V;  1M56 B;  3B4S A;  2YIB D;  3QVN A;  4MVO A;  1K7D A;  1S5L Z;  1DGS A;  5D5Q A;  3ZN0 A;  1WPB A;  4U3J B;  4DV1 O;  2E5L O;  2ADP A;  2LW7 A;  2FKX A;  1Q6I A;  5CMU A;  3P30 A;  3JCZ A;  5GTH Z;  1NT2 B;  4FLU A;  2PY5 A;  2JEX A;  3ASO B;  4DR3 O;  1WPX A;  3THO A;  2PYL A;  1GN2 A;  1LUV A;  1P7G A;  4GKK B;  4FM1 A;  1J5E B;  3T1Y B;  3JAR A;  1HNW O;  4PA9 A;  1FFX A;  1JX9 A;  4RAI A;  4LNU A;  2ZR3 A;  1SQX H;  4DV3 B;  2G38 A;  4LR3 A;  1XHX A;  1GKF A;  4PDL A;  2Q73 A;  1JCH A;  1BS3 A;  3E35 A;  2FML A;  1IZ3 A;  2VQE B;  1FXV A;  3SJC C;  4DR3 B;  4HAM A;  1WLE A;  1JJ2 U;  5C8Y B;  3GWO A;  4MVZ A;  4DV7 B;  3I5D A;  3WG7 C;  3L9D A;  2XAG A;  4J9Y B;  2EZP A;  4X20 A;  3F5W C;  3R65 A;  2AHZ A;  2GTS A;  5LMN O;  4OX9 B;  1ARO P;  1UFI A;  1Q90 D;  3LUT B;  3WB1 A;  4GYC B;  3B09 A;  4CH6 A;  1P7B A;  4B7K A;  4J7K A;  5BZB A;  4EFB A;  3BPZ A;  4AHC A;  3C3S A;  2LJ2 A;  3HKD B;  4L8J A;  1H2M A;  1FKA O;  5L3G A;  4JTC B;  4RO2 A;  3SYA A;  5H6R A;  2DN9 A;  3HKE A;  4IYI A;  3RYC B;  2BSK B;  3ABM C;  3N2G B;  2WSS G;  5J2U A;  4KL1 A;  2R72 A;  1S5J A;  3AK3 A;  5LGN A;  2R70 A;  4LF7 B;  1BHA A;  4OXS A;  1YVW A;  2KSD A;  5GW7 A;  3WG7 B;  3FB5 C;  1N0N A;  4GX2 A;  4I7Z B;  1S3J A;  4B3S O;  1YSC A;  3CS5 A;  5KUM A;  1YIJ V;  5LXT B;  1JFF A;  1GH6 A;  5CBF A;  2NLJ C;  1AJP A;  2M6Y A;  3AK1 A;  4DR5 B;  4NXM O;  4QNH B;  1D5N A;  3DC5 A;  4JI2 B;  3D8C A;  2LP7 A;  2CGO A;  3OT7 A;  5HFL A;  1K4D C;  1QCE A;  1BSM A;  2ZXW B;  2RQ6 A;  3ZCC A;  1L8D A;  2A06 H;  4B3S B;  4PJ0 Z;  4JI0 B;  2UUB O;  4JZG A;  1Y66 A;  5DEC A;  2A9H A;  1AJN A;  1ZLZ A;  2V7Q G;  1Y76 A;  5KX5 B;  2ZIM A;  1YTF B;  2LQT A;  3CRR A;  3CE2 A;  1COW G;  2JEU A;  4JI7 B;  3H1K H;  5CA3 A;  2Y4T A;  4B3R O;  2F43 G;  2LW1 A;  1Z5V A;  2MK3 A;  1IDS A;  2OIE A;  2Q9L A;  5LHI A;  3OMN B;  3Q4H A;  4QIW F;  4L87 A;  5CBG A;  1VQ5 V;  1H2G A;  1I5Y A;  2C2A A;  3L71 H;  4F4L A;  5LOV B;  4RUE A;  1AI7 A;  3D3I A;  4NVP A;  4DV4 B;  3G6B A;  2A79 B;  1QU7 A;  4CH5 A;  2FYU H;  2ZIN A;  4UCS A;  3FFQ A;  1N32 B;  4LF9 B;  1D2D A;  4NKG B;  2Q67 A;  3FAV B;  2Q6A A;  4FJC C;  2Q7H A;  1GN3 A;  5TIS Z;  4LFA O;  3B2E E;  4BR6 A;  5F2V O;  2CDY A;  1J95 A;  5CN0 A;  4K0K B;  4J9Z B;  2YS8 A;  2N74 A;  2XND G;  2OCC C;  4JI1 O;  5B5E Z;  1E79 G;  3DC6 A;  5C93 A;  1YJ9 V;  3IJ4 A;  5IJ0 B;  4F6E A;  1L0N H;  5B1O A;  2BE3 A;  4ZKI A;  2EUL A;  1AR1 B;  3K57 A;  3QTC A;  4I4T B;  1MZE A;  3ZS8 C;  2WLL B;  3AK2 A;  4JAS A;  1NS1 A;  1N33 B;  4MSW C;  2F23 A;  4LF8 O;  2Q0A A;  3X2Q C;  1BHB A;  3SR2 C;  4YHH O;  1IBM B;  4R50 A;  1XOU A;  4H33 A;  2UXC O;  3CCJ V;  1H38 A;  4KXR A;  5B1B B;  4DR1 O;  3OMA B;  4PA3 A;  4O4L A;  3ABK C;  2GUZ B;  4WFE A;  2KQX A;  1B06 A;  4QE9 A;  4KHP B;  2DYR B;  1YI2 V;  2NN4 A;  2L35 A;  3LNM B;  1KYO F;  1VF5 B;  2YUA A;  1Z2G A;  2PGG A;  2D2C B;  5IDJ A;  3CXH F;  1URF A;  3SPJ A;  1A32 A;  2QWO B;  1E1R G;  1PKX A;  3K9A A;  3ZHQ A;  1K4C C;  1NJI W;  4D7T A;  3C90 A;  1GM8 A;  4DR1 B;  3PJS K;  2XTA A;  4MVQ A;  2V4D A;  4CBC A;  4AI8 A;  1RFY A;  1BMF G;  2BTQ A;  3QO8 A;  3E2E A;  4IGG A;  3CCM V;  2Y0I A;  3RYI A;  2HHH O;  2WLK A;  4X8A A;  4XDJ A;  4X65 O;  4DV5 O;  3G71 V;  2ZKO A;  1OCZ B;  3K58 A;  1WN7 A;  3JAT A;  1KKC A;  2Z0A A;  1I94 O;  3JD2 A;  5IY5 C;  2BTO A;  2OYQ A;  4HNA A;  2UUA B;  5BMV B;  2JJ2 G;  2VQF O;  5BXZ A;  4QGP A;  1H2L A;  2WA3 A;  2ZQM A;  1QNM A;  1Q5O A;  3VBB A;  4FLV A;  2NR5 A;  4NXN B;  4FM2 A;  5LHG A;  3JAK A;  2JRI A;  5H9C A;  3H1I H;  2EIM C;  4OGQ B;  3PN1 A;  4MW3 A;  3CMA V;  4DV6 O;  3ZMT A;  2VQF B;  1SES A;  1SRY A;  5LP6 C;  1SA0 A;  2P06 A;  3K06 A;  4JYA O;  2OT5 A;  4DR2 O;  2PYJ A;  2R9A A;  4K3A A;  5H5N A;  5KHI A;  3ASN C;  4YY3 O;  4DW1 A;  1G4Y B;  3LSS A;  4PI2 A;  2B1G A;  4DXW A;  1LR1 A;  3JD4 A;  1RM1 C;  4LH6 A;  3HKB B;  1M5I A;  2WLJ A;  1P4R A;  2DMX A;  4XDL A;  2LFS A;  1MZF A;  4PI0 A;  1QLN A;  1MNG A;  4TQF A;  3UCS C;  3JAS B;  4LF4 B;  3FD9 A;  3FYI B;  3S3W A;  1GRJ A;  4O4I B;  3WFV A;  1U97 A;  1B6Q A;  2Q7E A;  4CC6 A;  2QDO A;  2KB1 A;  4LFC B;  1Q8I A;  3ZHU A;  1YJN V;  2LGW A;  5KLV H;  3C3T A;  5K1P A;  5LGT A;  4JTA B;  3A2F A;  3BY6 A;  1HR0 B;  3ABL C;  3EXA A;  2HVK C;  2ATK C;  3UM7 A;  4IL6 Z;  4O2B B;  1ZL8 B;  3GB7 C;  1AI6 A;  5DN6 G;  3FB6 C;  4K35 A;  2YSU B;  4UV8 A;  4B3M O;  1XMQ O;  5LA6 B;  2UXB O;  1QVG U;  2IU0 A;  1XMO O;  2DWD C;  1PNK A;  4PDV A;  5BY1 A;  3OAA G;  1YCI A;  3D36 C;  1JQ0 A;  1N36 B;  4MVM A;  3O9O A;  1SQP H;  4EB6 B;  3TK1 A;  2X0L A;  5ITZ B;  1BZK A;  2ITD C;  2RNB A;  4I0X A;  4J7J A;  4FLW A;  1H8H G;  1TUE B;  2QM8 A;  1QLE B;  4LH7 A;  4IIJ B;  4LF5 O;  1XMO B;  1MG1 A;  1OCC C;  5LP6 A;  2WLN A;  4QE7 A;  1NI8 A;  1TA8 A;  3UT5 A;  3CME V;  2QJ1 A;  4DUZ O;  2IW5 A;  2P67 A;  1TVK B;  2LGQ A;  1KEC A;  5IYB O;  4G2K A;  3JSN A;  4FLX A;  1R1B A;  4GLX A;  4MVR A;  1XUQ A;  5GON A;  1OCR C;  5L3D A;  3CCQ V;  4CC5 A;  4ZOL A;  4B3T O;  1F7Y A;  2YIA A;  4R7C A;  1VQL V;  4TWK A;  4LP8 A;  1SS3 A;  3NR7 A;  3STZ C;  5FPO A;  1M56 C;  3T2M A;  1FYJ A;  2CAZ C;  4DR7 B;  3CHX A;  3CRC A;  4O4H A;  4TSF G;  5IJ9 B;  1ZAU A;  3JYC A;  3ASO C;  5CA1 B;  1DF4 A;  5L3B A;  3G80 A;  4CS4 A;  2MW2 B;  5JVD A;  1FJG O;  4FVM A;  2X7R B;  2QKS A;  1XQ8 A;  3FX7 A;  2QE7 G;  4O4J B;  2EBO A;  3RYF B;  1IXB A;  2V1D A;  3OMI B;  4Q20 A;  3UO3 A;  3LNN A;  2QKA A;  4PD4 F;  4JI4 O;  3UQ8 A;  4J11 A;  3K79 A;  2QGN A;  1BT8 A;  3CWB H;  1PNM A;  2PI4 A;  3K3W A;  2Y48 A;  3DXR B;  4PA7 A;  2JGD B;  3W7S A;  4GKK O;  2A3Q A;  3LSU A;  3ZJZ A;  1FXK B;  3T1Y O;  1J5E O;  5L3F A;  4DV3 O;  2EIJ B;  4JI4 B;  5LGU A;  1SC5 B;  3QNE A;  4FM0 A;  2FB5 A;  1RP3 B;  2VQE O;  2IJK A;  5AG2 A;  4UB8 Z;  2Z3Y A;  3P3N A;  2EIK B;  3GVM A;  1HW7 A;  3M8A A;  3BFR A;  4DV7 O;  2RJZ A;  3SPC A;  4EKW A;  1VQ9 V;  4OX9 O;  2ZE8 A;  3STL C;  5D5P A;  1GN4 A;  3UKM A;  2E3C A;  3SGI A;  5CB4 B;  1IUR A;  1TUB A;  2HEP A;  1VQ7 V;  1R3I C;  1SF9 A;  3J80 N;  2IJJ A;  2BCC H;  3H1H H;  4YJ2 B;  3JCU Z;  4U3J A;  3IAY A;  2AZ0 A;  3SJQ C;  5DM6 V;  5JJN B;  4A5U B;  4UCR A;  1K92 A;  1YTF D;  3SJA C;  1XHZ A;  2QEX V;  1TGO A;  3ZRW B;  3ZHS A;  4X62 B;  3LDE A;  2P5O A;  4LF7 O;  2QKC A;  1XL6 A;  5FNV B;  4P9O A;  2FL4 A;  4GX0 A;  2ZXW C;  3QF7 A;  4TUY B;  4AQY B;  4ZHQ B;  3ZRX A;  1BL8 A;  2Q4P A;  4X1K B;  2OWO A;  1WJZ A;  4JGS A;  4DR5 O;  2JIZ G;  3NXS A;  5FLX N;  4TOI A;  4JI2 O;  2ZCE A;  5C8Y A;  3BCC H;  4X66 B;  2HVJ C;  5KA5 A;  4ZI7 B;  3JD1 A;  1K5Q A;  1S0V A;  2XAQ A;  4P30 A;  1U96 A;  4JI0 O;  1MAB G;  1Q3E A;  2Z5U A;  3CC2 V;  3RT3 C;  4I55 B;  2W0X A;  4BW5 A;  4CH3 A;  2EJR A;  1ZWI C;  3HKC B; 
#chains in the Genus database with same CATH homology
 4KHP O;  3M8A A;  4JI8 O;  4LF6 O;  4GKJ O;  1R1B A;  4DV7 O;  4JI7 O;  4LF4 O;  1KUQ A;  1XNQ O;  5LMN O;  4B3T O;  4OX9 O;  1IBL O;  4B3R O;  1N34 O;  1F7Y A;  1AIL A;  1A32 A;  4DR6 O;  4LFC O;  3T1H O;  1XNR O;  5BR8 O;  1IBK O;  1HNX O;  4DV4 O;  5LL6 Y;  3F5T A;  3J80 N;  3J81 N;  1FYJ A;  3OTO O;  4DR7 O;  2HHH O;  1HR0 O;  1N32 O;  4X65 O;  4LF9 O;  1R6T A;  1FKA O;  1D2D A;  4DV5 O;  3JAM N;  2ZKO A;  3J7A U;  3SDL A;  5A2Q N;  2F4V O;  2UXD O;  1AB3 A;  2Z0A A;  2ZM6 O;  1G1X B;  1I94 O;  4A5U B;  2DOS A;  4JI3 O;  1DK1 A;  4X64 O;  4LFA O;  4B3M O;  2UUA O;  4DV2 O;  1FJG O;  2VQF O;  1XMQ O;  1HNZ O;  2UXB O;  1XEQ A;  5BXZ A;  1X59 A;  1XMO O;  4OPA A;  4X62 O;  5BY1 A;  5IWA O;  4DR4 O;  4K0K O;  4LF7 O;  4JI6 O;  2DJV A;  4NXN O;  2N74 A;  4DV1 O;  4JI1 O;  2E5L O;  1N36 O;  2LW7 A;  2JRI A;  3R66 A;  4B3S O;  2FKX A;  4JI4 O;  4DV0 O;  4AQY O;  2UUC O;  4DR3 O;  4DV6 O;  4DR5 O;  3O65 A;  4NXM O;  5FLX N;  2AGA A;  4LF5 O;  5LMU O;  4JI2 O;  4JYA O;  4DR2 O;  1NS1 A;  4X66 O;  1N33 O;  5IT9 N;  4LF8 O;  5H5N A;  4GKK O;  4JV5 O;  4YY3 O;  4DUY O;  1J5E O;  4YHH O;  3T1Y O;  2UU9 O;  1IBM O;  1HNW O;  2UXC O;  1YZB A;  4DUZ O;  4DV3 O;  4OPH A;  4JI0 O;  2UUB O;  4JI5 O;  3RT3 C;  4DR1 O;  2VQE O;  4LFB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...