1DK1A

Detailed view of a key element of the ribosome assembly: crystal structure of the s15-rrna complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the S15-rRNA complex.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
molecule keywords RRNA FRAGMENT
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1999-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1dk1A00
3T1HO 2ZM6O 3OTOO 5FLXN 4LF6O 3J7AU 4DV1O 4JI3O 5IWAO 4NXMO 4KHPO 1FYJA 1HNWO 4B3SO 1IBLO 4DR4O 1R6TA 5BR8O 4K0KO 1XMOO 4JI0O 4NXNO 3T1YO 4LF7O 2UXCO 3M8AA 4X65O 2VQEO 3JAMN 4DV5O 1KUQA 2AGAA 2E5LO 1XEQA 4DR6O 4LF8O 1D2DA 4JI2O 1N34O 4DUZO 4GKJO 1FJGO 1HR0O 4X66O 2DOSA 4B3TO 1N32O 1N36O 3R66A 5A2QN 1G1XB 4OX9O 4DV0O 1IBKO 1AILA 1F7YA 2UUBO 3J81N 1R1BA 4DR5O 1IBMO 3RT3C 1AB3A 2ZKOA 1J5EO 1A32A 4JI8O 2F4VO 2UXDO 4AQYO 4B3RO 4A5UB 4JI4O 2VQFO 4DUYO 4OPAA 4LFAO 5IT9N 4DV6O 4DR2O 2UU9O 4B3MO 4YHHO 1XMQO 3O65A 4X64O 4OPHA 1HNXO 1XNQO 4DR1O 4JI7O 4LF5O 5LMNO 5BXZA 5BY1A 4JI5O 1N33O 2UXBO 5LMUO 4DR3O 4LF9O 4JI1O 4DV4O 3SDLA 4LFCO 2FKXA 4DV2O 2N74A 4X62O 4DV7O 1I94O 1FKAO 4JI6O 1DK1A 1X59A 1HNZO 5H5NA 4GKKO 2DJVA 3F5TA 4YY3O 1XNRO 1YZBA 4LFBO 2Z0AA 2HHHO 4JV5O 4DR7O 3J80N 4DV3O 4LF4O 5LL6Y 2UUAO 2UUCO 4JYAO 2LW7A 2JRIA 1NS1A
chains in the Genus database with same CATH superfamily
1SA0A 1SQVH 5EYPB 2ZR2A 3GWKC 4YY3B 1V55C 1U96A 3K0GA 1RSOB 3JCZA 4FIPC 4EB6A 3M8AA 4W4LA 1V54B 2IJJA 3BY6A 1F51A 1QVGU 1PP9H 2F1MA 2IW5A 2Q7EA 4UVAA 1NTZH 5JJEB 2QWRB 2QTSA 3OFNG 1JR9A 3OMAB 1FAFA 1I0HA 4IT5A 1F7YA 2B1IA 4O2AA 2QWPB 4Q20A 2FYUH 1TUEB 1QBZA 4LF8B 3HPLC 1IXMA 2RNBA 2Y4UA 3F5WC 1FFXB 2Q5ZA 2EJRA 4BIOA 1YF2A 3H1JH 1H2NA 1KC8W 2UU9O 4YJ2B 1K73W 3ZRXA 2CTPA 3SR2C 1OJHA 1NBMG 4G28B 4AHCA 3SJBC 3DTUB 3HKBB 5LMNO 3BRCA 3VOUA 4U7OA 5BMVB 5BY1A 5CB4A 1XNQB 4UV8A 1VF7A 4AI8A 5EIBC 3ETDA 2GTSA 1VQMV 5IYCO 4JZGA 2H8PC 4MVRA 4X1YB 2A06H 1HW7A 4BAYA 1Q81W 1XDCA 1I08A 3CRCA 2DJVA 4NYKA 1G8MA 5J2TB 1WPBA 4OGQB 4N21A 2ITCC 1RFYA 1YHQV 5KHJA 1VQ8V 1EN4A 2IJKA 3QO5A 3JSLA 2FMLA 2IH1C 2NR5A 5IJ9B 3Q4HB 3DC6A 4JYAB 4MVZA 4EB6B 2UU9B 3HR0A 2F95B 1B04A 4B7KA 1THZA 2ZINA 3K5MA 5EYPA 1YSCA 3G6EV 3K5LA 1R6TA 3CCEV 2EILB 4LF7O 2JIZG 1FXVA 4U3JA 4FFKA 1RSOA 1JVMA 4GKJO 3TJTA 5IYBO 3E2EA 4I9QA 2PGGA 1W2BU 1SA0B 4DV0O 2WLIB 1VQLV 3ZHRA 4DR5O 3K5NA 2VRZA 2F4VO 1W59A 4H13B 2PI5A 3B77A 1B6QA 2HVJC 3AG1C 3BA9A 2XUMA 2EIKB 4DV6O 4DR2O 2R9IA 4YHHO 1XMQO 4X64O 3K03A 3LDEA 3SJCC 4QE7A 4JI7O 4JGSA 4DR7B 3W7UA 4JI1B 1TUBA 4FLUA 1Z5WA 3U11A 2Q4PA 5KMGB 1N33B 1K97A 1SQPH 1M90W 2GDSA 4X1IB 3ABUA 3OUFA 1UFIA 3WB1A 4X1KB 1J95A 3HKDB 3O9OA 3CB2A 1LNQA 3LUTB 1Y6XA 2CH7A 2GSMB 1SESA 1XL6A 4AQYB 3STLC 3CCVV 4BW9A 4J11A 5H2FZ 2Y48A 3MAQA 2BOBC 1BQ0A 3CHXA 2UUAO 1P49A 1KD1W 4ASUG 1XMOB 4EFEA 4NVPA 2ZE6A 4K3AA 2VQEB 2YC0A 2JK5C 1FYJA 1IVSA 4DR4B 3CPWU 4LFAB 3CMEV 4JI0O 4J80A 2OT5A 3LSQA 2WA4A 5B66Z 4X65O 4DR6O 2HFEC 5KHKA 4JYYA 3UCSC 3SJQC 5EC1C 3FB5C 2P7TC 3AG4C 4UCTA 1JCHA 2BSKA 1ZLZA 5KHIA 2CH7B 4MVQA 1OHHG 4GUNA 2WLHA 2HVKC 1XL4A 1AI4A 1AI6A 4AQYO 1SKVA 4YHHB 4DW1A 4NXMB 2ETNA 1YEWA 1BT8A 2Z5UA 4W4KA 3CCQV 2QTOA 3KCXA 4X1KA 4IGGA 2EIJC 2X6CA 1AVMA 5EBMC 1N4CA 2IBZH 4JI7B 5KHGA 1IZ3A 1YJNV 1BZKA 1AP6A 4R7CA 2X0LA 2DYSC 5B1NA 4NXNB 4MTXA 4WFAV 4HAMA 4OX9B 5L3BA 4FK5C 3ZHTA 4YIPA 1VQ7V 1KMIZ 4WFGA 2EINC 4KL1A 2HP8A 4I55B 3EFFK 3G80A 5CA0A 4O4JB 1E1QG 2DWDC 4ZBMA 1XUQA 2UUCO 4DUZB 1AI7A 1NKDA 4HZ3A 3SPHA 5J2UA 4FZ1A 4PV1B 3T1HO 4NB5A 3OEHG 4I4TA 4J42A 4X20A 2Q0AA 3AG3B 4DR4O 3P30A 1K34A 3A0BZ 2UXCO 1BL8A 3ZHSA 1VARA 3JARB 5DM6V 2LO1A 1XEQA 1OCCB 4Z1VA 1SERA 3E8GA 2PYLA 1JMKC 3JD4A 3ZBHA 2GTAA 3AG1B 4FLXA 3ABMB 1Q7YW 2DOSA 3OMIB 1K4DC 2OIEA 2K1EA 4MTFA 3W7XA 3H9VA 3R66A 1OV9A 4OX9O 2E75B 1BHAA 1W0JG 2UUBO 4F6RA 1HNZB 1IBMO 2ZE5A 3ZMSA 4K8XA 1FXKA 1ZX3A 2L6LA 4QPKA 3P3PA 3WB2A 2DW4A 3CCUV 2KB1A 4I9WA 2YIAA 5LMUB 3H1HH 2F4VB 2DQ3A 4C7UA 3SPGA 4HBNA 1H8HG 4J10A 2DYSB 4MW8A 3HKBA 1P84F 5D5QA 5KAFZ 2IU3A 3L74H 3MDSA 4G2KA 2E74B 2ADQB 4TSFG 3LDDA 1S77D 2YSUB 3CX5F 2VS0A 3E35A 4RUFA 1X59A 4FFBA 1Q6UA 4QJFB 4O2AB 1J5EB 5KUKA 4UV9A 4BIUA 2GV9A 4OXSA 3ABKB 2MW2B 1PNKA 4PDLA 1AJNA 3G6BA 4O4LB 1WP8A 1QHTA 1MMMA 4UUJC 4ICGA 1V9PA 4LR3A 4F6RB 4TWKA 5GONB 4K35A 4LF5B 1NS1A 2VQFB 5JH7B 5FLXN 3J7AU 2AHZA 3DXRA 4FLWA 4KHPO 1WPXA 2W6IG 4DXWA 1Y74A 3T1YO 2YI9A 4FLZA 3E8HA 3LSUA 2M7WA 3CCLV 2RCVA 3I55V 2HLDG 3APQA 4E4EA 2YIDA 5FNVB 4CBCA 2C2AA 1GN6A 2OCCC 5L3CA 1KU9A 1N36O 5LMNB 5J9PC 2O57A 5A2QN 1AILA 5LOVA 3RVYA 2EIJB 1QQCA 4WCEV 3K06A 2XTAA 1S72V 2BOCC 3OUSA 3RT3C 2XNDG 4LF7B 3L9DA 4YIOA 3L71H 1ROPA 1UJWB 4FMTA 1GM8A 1K4CC 2ZT9B 5HFLA 2Y0PA 1TA8A 1Q90D 4QGPA 1K8AW 2LQTA 3OGIB 3CXCU 4GT1A 5LA6A 4GLXA 2JJ1G 3UT5B 4IIJA 2LFSA 4OPHA 1WA8A 5JVDB 4LF5O 1XMQB 4F4LA 1H2MA 4WFBV 5CBGA 2UXBO 4GZRB 2B9ZA 3OT7A 4DV4O 4LFCO 3FFQA 4DV2O 5IYZB 2G38A 4DR3B 1BS3A 3RYIB 3AK3A 3CYOA 1DK1A 4GX1A 1YDXA 3FX7A 4XDLA 5E79Z 2M6YA 1QNMA 1EZJA 2OWOA 1WLEA 4J7KA 5KLVH 1U97A 3F7VC 3L75H 5KX5A 1VMGA 3M99B 2UUBB 1NT2B 2JS3A 2LW7A 2AZ0A 3CC7V 1O9GA 4O4IA 3RVZA 2CTQA 2R72A 1AJPA 1XQ8A 3VQYA 5KA6A 1M56B 2V1DA 3ZCCA 3STZC 4O4HA 5TISZ 3D8CA 4J9YB 1K3EA 1HR0O 3FD9A 1YTFB 4CH4A 4DV3B 5CA3A 3W7WA 4JZ2A 1IBKO 1KYOF 5B3SC 3J81N 1KP2A 4LF4B 1QLNA 3TCUA 3GB7C 1PKXA 3SYOA 2JGDA 4JI8O 2UXDO 4YXWG 4PELA 4XBFA 1PV0A 4B3RO 5HFMA 1JFFB 3K08A 2EZOA 4RO2A 1XHXA 2V7QG 2HG5C 4TUYB 2MK3A 3K04A 5CBHA 4JYCA 4H0LB 2OTLV 1R3JC 1WAZA 2R9RB 5K1XA 1R73A 2R70A 4QNHB 3CC2V 2A0LA 2DMXA 3MD0A 1EZVH 5B5EZ 3X2QB 2WLLB 2JJ2G 5C8YA 2WSSG 3KCYA 1GN2A 1QLEB 1WB7A 3UT5A 1TVKA 4LCUC 3TGUH 3QTCA 4R8CA 3ZIAG 2Q6AA 2Z0AA 1IURA 3ZMZA 2FL4A 3E22A 3SPJA 5L3EA 2BTQA 5CMUA 5LL6Y 1R3LC 4CS3A 4NKGB 5AG2A 5LOVB 1BE3H 3LDCA 1LR1A 3SGIA 5CA1A 3JAKA 4ZKIA 4CC5A 4DR6B 4NXMO 4IL6Z 3KG2A 4B3SO 3ML0A 4PHZA 1IBLO 4LP8A 3ASOC 5LGUA 2ZM6B 3G4SV 1IBLB 3JAMN 3ABTA 4DV5O 5L3GA 3LSSA 3KZIZ 1ZL8B 4MTGA 3OTOB 4DUZO 2CDYA 2ZIMA 5JH7A 2GUZA 1H2LA 3G67A 1KECA 2E5LB 4FPPA 2YEVB 3FB6C 3ASOB 5LP6C 3ZRWA 4MVSA 3K58A 3BPZA 2Y0IA 4PDMA 3B09A 3GWOA 5LHGA 2DYRB 4U7NA 1VQ9V 4TOIA 2AW9A 3RW0A 3APOA 2ZE7A 5J2TA 4NR1A 1IX9A 4LF9B 2RQ6A 4JASA 3FYIB 4J9ZB 1WA8B 1RP3B 5E1AC 3A0HZ 4B3MB 4IIJB 4X1YA 1VQ4V 4I7ZB 1VQPV 4Z2WA 4WF9V 4JTDB 3SDLA 4DV0B 1BHBA 5BMVA 2X7RB 2ZQMA 3AG4B 4LNUB 4XDKA 1MOFA 2QR4A 5JJNB 1YI2V 3SPCA 1T5EA 3FB8C 3CCMV 1XNRO 1SRYA 2KKWA 2WLMA 4JYBA 1K33A 3I5DA 4UB6Z 1WJZA 1MNGA 2QJ1A 5IWAB 2W0FC 4I0XA 1Y76B 2F93B 1Z5VA 2WLNA 2BE3A 3JAWA 2HR3A 4KXRA 1H8EG 1L0NH 4EEQA 3CCJV 2JRIA 4MT8A 3HKCA 2JGUA 1FD9A 2QWQB 3N2KB 2PF4E 1N36B 1EBOA 2KG7A 1HNWO 3HKCB 1OCOB 3JARA 4FM2A 1HP8A 2LGQA 4UVCA 3B4SA 3A2FA 3A8TA 4B3TB 4Q6GA 2NLJC 4PA9A 4HNAA 4I4TB 1M56C 1YITV 1XHZA 1FXHA 3ZN0A 5EZYA 2QM8A 1VF6C 4FLYA 2QSAA 1S5LZ 5LXTB 2PYJA 1VQNV 1B06A 1A32A 2LP7A 5A9GA 4JAVA 4B3RB 4I50A 3ZRSA 2PZSA 1ZSPA 1D5NA 4DK1A 4DV7B 1S0VA 1P7BA 4B3MO 1SQQH 1Q86W 1H38A 2YICA 4TV8B 3FYEB 3JD0A 2L35A 1FXKC 4MVUA 4NTYA 1VQ5V 1EN5A 4IHJB 3K59A 4GKJB 3K9AA 3SYAA 2GBOA 5JJJB 5B1BC 1MSWD 4JI6O 3VQWA 1AROP 5H5NA 3RYFA 3K5OA 3AEIA 1BMFG 4JV5O 5FPOA 1YCIA 4B7EA 2D3OW 1HR0B 4AILC 5KA5A 2FTKA 1R6NA 2OIGA 2YDEA 1Z2GA 4LWSA 3H1IH 1K5QA 2EINB 2HEPA 1AR4A 1GN3A 4IYHA 4K0KO 2XAGA 1XMOO 4PJ0Z 2IH3C 1F23A 4K0KB 2ZD9A 3BVOA 1SQXH 4PDVA 3FAVB 4LF8O 2QM7A 1SZXA 5GW7A 2AHYA 2Y69B 4I55A 2WPDG 3IJ4A 1G1XB 3E89A 1GRJA 1R1BA 1GO3F 4MW3A 1JJ2U 3VQVA 2YIBA 4JTCB 3QO8A 2F23A 1N8RW 3L72H 4DW0A 4ABMA 3U0ZA 3CEIA 2XT9A 1VIBA 4X62B 3BFRA 2P90A 3B8MA 4PA3A 5LHIA 1GH6A 1QLEC 2Y4TA 3N2GB 4E2LA 1IDSA 5JCOC 3OM3B 3CMAV 4X9QA 5D5PA 1XNQO 2QEXV 4R50A 3N2GA 4PA7A 5BXZA 2QGNA 4H37A 3ETEA 5KMGA 1I7FA 4X62O 3I56V 3ZRVA 2JGDB 5JCOA 3CCSV 4GKKO 4TQFA 1G4YB 3ABLC 4JI6B 4LBEC 1FS0G 3CC4V 1PM9A 3FB7C 3GVMA 2W0XA 2P4KA 1MA1A 4K8ZA 4N23A 4JAAA 4WFEA 3ZS8C 5IWAO 5B1OA 2BTOA 3TXQA 4U3JB 3JD3A 2AGAA 1OCZC 2YXHA 4JI2O 2ZXWB 2YS8A 4QE9A 4JI0B 4O2BA 3WB0A 3JALB 1L0LH 3CRRA 3DSQA 1MZFA 3UKMA 1HDJA 2QDOA 3CCRV 1NVPD 4EFBA 1S5HC 3ZN1A 2ZKOA 1W0KG 1OCZB 1YJWV 2RN9A 3BAAA 1US6A 4WFHA 4DV2B 1M93A 1JX9A 4GYCB 3M7MX 1YVWA 4X1IA 2XHBA 4OPAA 4FM1A 1VQ6V 1H2GA 2XAFA 4H44B 5LP6A 3RYFB 1M57B 1NI8A 2ADPA 4JI3B 3O65A 1TGOA 1BSMA 3MHHC 3JASA 1Q6IA 4JTAB 4TV8A 1OCRC 4P30A 1WB8A 5B3SB 1SZTA 3ASNB 5LA6B 3RN4A 3ICXA 3CRMA 2P4VA 1CXZB 3JATA 3E8FA 3CXHF 1SS3A 2ZNJA 3TK1A 2ZDIA 2WLKA 1I94O 2D2CB 4YJ3A 3BEHA 1YTFD 1GM7A 5LXTA 1JJOA 1K92A 3F5TA 1F4MA 4H33A 2A79B 1NR1A 1K7DA 2VWKA 1FFXA 1CP9A 2W6JG 3S3XA 1UPGA 3J80N 3ASNC 3CRQA 4RUEA 3T4ZA 4QIWF 4JI8B 2UXDB 4LH6A 3BHPA 2PI4A 1WP7A 5EZYB 5KAIZ 4GCZA 1N0NA 3PN1A 1IBKB 5GTHZ 3UQ8A 4LF6O 1XNRB 1RPRA 4UB8Z 5JQGB 1JPXA 3N2KA 4DV1O 4TV9A 3ABLB 5BR8O 2N04A 3JYCA 1VP7A 1GMGA 3CRAA 1H2KA 1RM1C 3Q4HA 1F4NA 4D7SA 3BABA 2ZIOA 1N34O 1VF5B 1WNSA 2KG7B 2EULA 5IE9A 4R6ZA 2Q67A 1ZTEA 5BZBA 4B3TO 2B5UA 3D3QA 1R6KA 3ZX6A 3B2EE 2KSDA 2H94A 4FZ0A 2EJ7A 5LBQA 3OGCC 1R3IC 2HJFC 1TAEA 1Y76A 2CTWA 3ABKC 2EILC 3E86A 2LGWA 1GAXA 4QPJA 3RFRA 4DUYO 2JVDA 1H2SB 4LFAO 3E8BA 3K3WA 2QA4V 3LNNA 5CB4B 3G71V 5F2VO 1I94B 2UXXA 2VWJA 4DR1O 4YJ3B 2AZ2A 4CH3A 5EIBD 4DR1B 4YJ2A 1N33O 4CZZA 5LP6B 1KKCA 5LMUO 4DR3O 1FJGB 1KKDA 4LF9O 3RBZA 4XDJA 4TQDA 2N74A 3SYCA 1R3KC 2PTMA 1AR5A 1FKAO 4J41A 1MZEA 1S3JA 4P9PA 3THOA 5LYJA 4JI2B 2EX3A 5H6RA 3ZRWB 1I5XA 5EBWC 2EZPA 3B8NA 1K5SA 3S3WA 4JI4B 2KQXA 1Y67A 4DR5B 1ZL8A 4LF4O 5LHHA 3H1KH 3JD2A 2UXCB 3K79A 5H9CA 4FLTA 1SQBH 2Q73A 2YEVA 4JF3A 4X8AA 3ZHQA 3ZMTA 3JALA 2EIMC 4O2BB 4MSWC 4JI3O 3JAKB 3VQXA 3AK1A 5J2UB 1OCRB 1RPOA 3OE7G 1Y66A 2ZXWC 2VQEO 5IYDO 2AXTZ 2IU0A 3PJSK 1RM1B 5LGNA 1FFTB 4I5SA 1COWG 4O4JA 1Q82W 4UCUA 3X2QC 4X66O 4HYOA 4F6EA 2NNUA 2UXBB 2A9HA 1JOYA 2ITDC 2BTQB 1M5IA 4PI2A 2EBOA 1OCOC 1K9MW 3IC7A 2V4DA 3AG2B 4LC1A 4TT3G 3RYCB 1TVKB 1MSDA 1DF4A 2YIBD 3UO2A 5C8YB 2CE4A 2YI8A 2Q69A 4FLVA 1WN7A 1X4TA 2RJZA 2FKXA 2XAJA 1EM1A 4PI0A 1NQTA 3AG2C 2LFRA 4GX2A 4IYIA 4KUMA 2R9AA 3IFXA 3B40A 1M1KW 2BSKB 1AI5A 3TETA 2HHHO 4DR7O 1NVPB 1VF6A 3BA8A 2ZCEA 1B3QA 1VEWA 2DN9A 4DV6B 5BR8B 4DR2B 4O4HB 3DC5A 3ZMUA 5B1AC 2XASA 3NR7A 2HJDA 4LF6B 1BGYH 3AG3C 4ZI7B 4LWSB 2EIMB 1GM9A 4O4IB 2XOKG 2UUAB 4FVMA 4KFMA 1SQGA 3T2MA 1BCCH 1GKFA 1QU7A 5L3DA 2Q7HA 5KX5B 3W7SA 2OYQA 1QVFU 2QWNB 1N32O 1V55B 5DN6G 4BWAA 4CS2A 2QKAA 4GX5A 3QO7A 3JSNA 4JAUA 4DO2A 1CPYA 3AG7A 2UUCB 3OMNB 3CWBH 4BW5A 2XAHA 2H3OA 1QR8A 4WBNA 1NH2D 5IYZA 3C3SA 4A5UB 5IJ0A 5LGTA 4JI4O 2Q68A 1LUVA 2Y69C 2QKCA 4Z1MG 3CD6V 5IT9N 3ZMVA 1TUBB 2HKOA 4LH7A 3OW2U 1HNXO 5LYJB 2ZNIA 2YUAA 1EFRG 4UFZA 2Q8VA 2JS5A 1L1FA 3QVNA 2WAMA 1XI1A 4MS2A 1QR9A 4IHJA 4X66B 5B1AB 5ITZB 4L8JA 3SPIA 3WG7B 4PA6A 4BIZA 5IDJA 2BCCH 1MABG 3LNMB 4YY3O 1EN6A 2LJ2A 3OD4A 3ETGA 1NR7A 4UCRA 1IBMB 5FNVA 1HNXB 5CN0A 2HHHB 2N05A 5B1BB 3H01A 4FM0A 2QM4A 1CEZA 4U3FH 1E1RG 3NXSA 1AR1B 5JWPA 4G27B 4HNAB 3D3IA 1ZWIC 3MHSC 3RWRD 4CH6A 3JAWB 5IJ9A 1KUQA 3KKYA 3ZHUA 1V54C 2PY5A 1Y74B 3QNEA 1D2DA 1OZ0A 4I0XB 1SC5B 3T1HB 4TV9B 3DXRB 5JQGA 2A3QA 1QCEA 1NTKH 4DYLA 1M4UA 4X89A 5H6QA 1P7GA 5GONA 2ATKC 4FFBB 3ZEDA 3T1YB 1J5EO 3A0RA 3RGBA 2JEXA 4DRXA 4KHPB 3CS5A 4D6TH 4O4LA 2DQ0A 2EIKC 2VQFO 1SQFA 3H1LH 3P3NA 1M9NA 2XAQA 2P22C 3K0DA 1AJQA 1Q5OA 1PL4A 3HKEB 4ZOLA 5FL7G 4ZOLB 2P6JA 4LNUA 3HKEA 3SYQA 3JATB 3OEEG 5EBLC 4UCSA 2OTJV 4DK0A 4DV7O 3ABMC 4LFBB 4DRXB 4CC6A 1Q8IA 2WLJA 3JASB 4UVBA 3VBBA 5EK0A 1FXKB 4MTOA 1HNWB 4DV5B 2Q7GA 1YZBA 2ILMA 1N32B 1KBHA 1NZ6A 1JQ0A 2GUZB 2QWOB 1XREA 4CH5A 5IJ0B 3L73H 1NTMH 1OCCC 4B08A 1XBLA 1G6UA 5C93A 4JI5B 2ZR3A 2JDIG 1I5YA 3IGAC 4P9OA 2E3CA 3QF7A 3OR7C 3OTOO 3F7YC 4X20B 3AK2A 1PPJH 3K9SA 1VQKV 2UXNA 4UXNA 5CA1B 1S76D 4NXNO 4ZHQA 3P32A 3TXSA 1Q43A 1E79G 1Y4MA 5KHHA 4P2ZA 1ZAUA 2F66C 3CJHB 2CTRA 1SF9A 4JV5B 4ZI7A 1FJGO 4GX0A 4JPRA 3E22B 4RAIA 1YIJV 5CA0B 2YXLA 3CP1A 3SYPA 4J7JA 3D36A 2WWWA 2X6AA 1YXBA 3C90A 1NU1H 4J7ZA 4EKWA 2WLLA 2GHYA 5ITZA 3K57A 2JEUA 1XOUA 4BR6A 5DEDA 2A7WA 3ZJZA 3OR6C 2RDCA 2Z3YA 3D36C 4RWUA 1NH2B 4TUYA 4JI5O 3R65A 4JI1O 2E76B 3JCUZ 4RQFA 4WBNB 1JA8A 2IM9A 4RQEA 1HNZO 3RYHA 1KQSU 4DV1B 1BQZA 2QE7G 3RYCA 4LFBO 1DGSA 1JFFA 2CAZC 2ZDIC 2CUGA 1XILA 5GTIZ 1IXBA 3QG5A 3UO3A 4NTXA 2K9PA 4NTWA 2DYRC 2WA3A 2PUSA 2P5OA 1ENVA 1Q6HA 2NN4A 4JYAO 2CGNA 4PA4A 1KP3A 3ETQA 3L70H 4X65B 2ZM6O 3WU2Z 3EXAA 1S5JA 4B3SB 1DTOA 3CSXA 3FAVA 2QKSA 3ZHVA 5EC2C 4L87A 4D7TA 3OAAG 2OCHA 2E5LO 2ARHA 2CGOA 4PD4F 3U10A 1M57C 4CS4A 3SJAC 1NJIW 1HWYA 1N34B 5K1PA 2OCCB 3OTFA 5CBFA 4X64B 1N0JA 3RYHB 1AB3A 2Q9LA 2DWEC 1Q3EA 3W7TA 3HKDA 3RYIA 3FKSG 4MVOA 4MVMA 5IY5B 2DE0X 1KB9F 1VQOV 4FJCC 1ORQC 2CK3G 4GKKB 2RMKB 2ODMA 2Q0OC 2IJIA 3UM7A 3DGEA 1GTOA 5L3FA 2F43G 3BCCH 5DECA 5JVDA 1PL0A 4UCVA 4LFCB 4DV4B 3CE2A 3WFVA 3T4DA 4DUYB 1ZUQA 1PNLA 4X88A 3EHBB 3C3TA 5FPRA 3N27A 1D5AA 2X6BA 1LUWA 2LW1A 3E83A 1MG1A 3EVKA 4KP4A 5IY5C 1AP5A 2B1GA 3HB3B 1URFA 4ZIBA 2FB5A 4WFFA 2P06A 1PD3A 1FPOA 1GK9A 1DLBA 4UCOA 3IC9A 2ZE8A 1O9HA 1L8DA 4I50B 1GN4A 5KUMA 1SETA 4DV3O 2IJHA 3JD1A 3IAYA 2P67A 1DF5A 1YJ9V 3CJHA 3WG7C 3T1CA 1P4RA 4PDRA 1PNMA 2YXYA 4ZHQB 2WLIA
chains in the Genus database with same CATH topology
3T1HO 2ZM6O 3OTOO 5FLXN 4LF6O 3J7AU 4DV1O 4JI3O 5IWAO 4NXMO 4KHPO 1FYJA 1HNWO 4B3SO 1IBLO 4DR4O 1R6TA 5BR8O 4K0KO 1XMOO 4JI0O 4NXNO 3T1YO 4LF7O 2UXCO 3M8AA 4X65O 2VQEO 3JAMN 4DV5O 1KUQA 2AGAA 2E5LO 1XEQA 4DR6O 4LF8O 1D2DA 4JI2O 1N34O 4DUZO 4GKJO 1FJGO 1HR0O 4X66O 2DOSA 4B3TO 1N32O 1N36O 3R66A 5A2QN 1G1XB 4OX9O 4DV0O 1IBKO 1AILA 1F7YA 2UUBO 3J81N 1R1BA 4DR5O 1IBMO 3RT3C 1AB3A 2ZKOA 1J5EO 1A32A 4JI8O 2F4VO 2UXDO 4AQYO 4B3RO 4A5UB 4JI4O 2VQFO 4DUYO 4OPAA 4LFAO 5IT9N 4DV6O 4DR2O 2UU9O 4B3MO 4YHHO 1XMQO 3O65A 4X64O 4OPHA 1HNXO 1XNQO 4DR1O 4JI7O 4LF5O 5LMNO 5BXZA 5BY1A 4JI5O 1N33O 2UXBO 5LMUO 4DR3O 4LF9O 4JI1O 4DV4O 3SDLA 4LFCO 2FKXA 4DV2O 2N74A 4X62O 4DV7O 1I94O 1FKAO 4JI6O 1DK1A 1X59A 1HNZO 5H5NA 4GKKO 2DJVA 3F5TA 4YY3O 1XNRO 1YZBA 4LFBO 2Z0AA 2HHHO 4JV5O 4DR7O 3J80N 4DV3O 4LF4O 5LL6Y 2UUAO 2UUCO 4JYAO 2LW7A 2JRIA 1NS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H O;  2ZM6 O;  3OTO O;  5FLX N;  4LF6 O;  3J7A U;  4DV1 O;  4JI3 O;  5IWA O;  4NXM O;  4KHP O;  1FYJ A;  1HNW O;  4B3S O;  1IBL O;  4DR4 O;  1R6T A;  5BR8 O;  4K0K O;  1XMO O;  4JI0 O;  4NXN O;  3T1Y O;  4LF7 O;  2UXC O;  3M8A A;  4X65 O;  2VQE O;  3JAM N;  4DV5 O;  1KUQ A;  2AGA A;  2E5L O;  1XEQ A;  4DR6 O;  4LF8 O;  1D2D A;  4JI2 O;  1N34 O;  4DUZ O;  4GKJ O;  1FJG O;  1HR0 O;  4X66 O;  2DOS A;  4B3T O;  1N32 O;  1N36 O;  3R66 A;  5A2Q N;  1G1X B;  4OX9 O;  4DV0 O;  1IBK O;  1AIL A;  1F7Y A;  2UUB O;  3J81 N;  1R1B A;  4DR5 O;  1IBM O;  3RT3 C;  1AB3 A;  2ZKO A;  1J5E O;  1A32 A;  4JI8 O;  2F4V O;  2UXD O;  4AQY O;  4B3R O;  4A5U B;  4JI4 O;  2VQF O;  4DUY O;  4OPA A;  4LFA O;  5IT9 N;  4DV6 O;  4DR2 O;  2UU9 O;  4B3M O;  4YHH O;  1XMQ O;  3O65 A;  4X64 O;  4OPH A;  1HNX O;  1XNQ O;  4DR1 O;  4JI7 O;  4LF5 O;  5LMN O;  5BXZ A;  5BY1 A;  4JI5 O;  1N33 O;  2UXB O;  5LMU O;  4DR3 O;  4LF9 O;  4JI1 O;  4DV4 O;  3SDL A;  4LFC O;  2FKX A;  4DV2 O;  2N74 A;  4X62 O;  4DV7 O;  1I94 O;  1FKA O;  4JI6 O;  1DK1 A;  1X59 A;  1HNZ O;  5H5N A;  4GKK O;  2DJV A;  3F5T A;  4YY3 O;  1XNR O;  1YZB A;  4LFB O;  2Z0A A;  2HHH O;  4JV5 O;  4DR7 O;  3J80 N;  4DV3 O;  4LF4 O;  5LL6 Y;  2UUA O;  2UUC O;  4JYA O;  2LW7 A;  2JRI A;  1NS1 A; 
#chains in the Genus database with same CATH topology
 1SA0 A;  1SQV H;  5EYP B;  2ZR2 A;  3GWK C;  4YY3 B;  1V55 C;  1U96 A;  3K0G A;  1RSO B;  3JCZ A;  4FIP C;  4EB6 A;  3M8A A;  4W4L A;  1V54 B;  2IJJ A;  3BY6 A;  1F51 A;  1QVG U;  1PP9 H;  2F1M A;  2IW5 A;  2Q7E A;  4UVA A;  1NTZ H;  5JJE B;  2QWR B;  2QTS A;  3OFN G;  1JR9 A;  3OMA B;  1FAF A;  1I0H A;  4IT5 A;  1F7Y A;  2B1I A;  4O2A A;  2QWP B;  4Q20 A;  2FYU H;  1TUE B;  1QBZ A;  4LF8 B;  3HPL C;  1IXM A;  2RNB A;  2Y4U A;  3F5W C;  1FFX B;  2Q5Z A;  2EJR A;  4BIO A;  1YF2 A;  3H1J H;  1H2N A;  1KC8 W;  2UU9 O;  4YJ2 B;  1K73 W;  3ZRX A;  2CTP A;  3SR2 C;  1OJH A;  1NBM G;  4G28 B;  4AHC A;  3SJB C;  3DTU B;  3HKB B;  5LMN O;  3BRC A;  3VOU A;  4U7O A;  5BMV B;  5BY1 A;  5CB4 A;  1XNQ B;  4UV8 A;  1VF7 A;  4AI8 A;  5EIB C;  3ETD A;  2GTS A;  1VQM V;  5IYC O;  4JZG A;  2H8P C;  4MVR A;  4X1Y B;  2A06 H;  1HW7 A;  4BAY A;  1Q81 W;  1XDC A;  1I08 A;  3CRC A;  2DJV A;  4NYK A;  1G8M A;  5J2T B;  1WPB A;  4OGQ B;  4N21 A;  2ITC C;  1RFY A;  1YHQ V;  5KHJ A;  1VQ8 V;  1EN4 A;  2IJK A;  3QO5 A;  3JSL A;  2FML A;  2IH1 C;  2NR5 A;  5IJ9 B;  3Q4H B;  3DC6 A;  4JYA B;  4MVZ A;  4EB6 B;  2UU9 B;  3HR0 A;  2F95 B;  1B04 A;  4B7K A;  1THZ A;  2ZIN A;  3K5M A;  5EYP A;  1YSC A;  3G6E V;  3K5L A;  1R6T A;  3CCE V;  2EIL B;  4LF7 O;  2JIZ G;  1FXV A;  4U3J A;  4FFK A;  1RSO A;  1JVM A;  4GKJ O;  3TJT A;  5IYB O;  3E2E A;  4I9Q A;  2PGG A;  1W2B U;  1SA0 B;  4DV0 O;  2WLI B;  1VQL V;  3ZHR A;  4DR5 O;  3K5N A;  2VRZ A;  2F4V O;  1W59 A;  4H13 B;  2PI5 A;  3B77 A;  1B6Q A;  2HVJ C;  3AG1 C;  3BA9 A;  2XUM A;  2EIK B;  4DV6 O;  4DR2 O;  2R9I A;  4YHH O;  1XMQ O;  4X64 O;  3K03 A;  3LDE A;  3SJC C;  4QE7 A;  4JI7 O;  4JGS A;  4DR7 B;  3W7U A;  4JI1 B;  1TUB A;  4FLU A;  1Z5W A;  3U11 A;  2Q4P A;  5KMG B;  1N33 B;  1K97 A;  1SQP H;  1M90 W;  2GDS A;  4X1I B;  3ABU A;  3OUF A;  1UFI A;  3WB1 A;  4X1K B;  1J95 A;  3HKD B;  3O9O A;  3CB2 A;  1LNQ A;  3LUT B;  1Y6X A;  2CH7 A;  2GSM B;  1SES A;  1XL6 A;  4AQY B;  3STL C;  3CCV V;  4BW9 A;  4J11 A;  5H2F Z;  2Y48 A;  3MAQ A;  2BOB C;  1BQ0 A;  3CHX A;  2UUA O;  1P49 A;  1KD1 W;  4ASU G;  1XMO B;  4EFE A;  4NVP A;  2ZE6 A;  4K3A A;  2VQE B;  2YC0 A;  2JK5 C;  1FYJ A;  1IVS A;  4DR4 B;  3CPW U;  4LFA B;  3CME V;  4JI0 O;  4J80 A;  2OT5 A;  3LSQ A;  2WA4 A;  5B66 Z;  4X65 O;  4DR6 O;  2HFE C;  5KHK A;  4JYY A;  3UCS C;  3SJQ C;  5EC1 C;  3FB5 C;  2P7T C;  3AG4 C;  4UCT A;  1JCH A;  2BSK A;  1ZLZ A;  5KHI A;  2CH7 B;  4MVQ A;  1OHH G;  4GUN A;  2WLH A;  2HVK C;  1XL4 A;  1AI4 A;  1AI6 A;  4AQY O;  1SKV A;  4YHH B;  4DW1 A;  4NXM B;  2ETN A;  1YEW A;  1BT8 A;  2Z5U A;  4W4K A;  3CCQ V;  2QTO A;  3KCX A;  4X1K A;  4IGG A;  2EIJ C;  2X6C A;  1AVM A;  5EBM C;  1N4C A;  2IBZ H;  4JI7 B;  5KHG A;  1IZ3 A;  1YJN V;  1BZK A;  1AP6 A;  4R7C A;  2X0L A;  2DYS C;  5B1N A;  4NXN B;  4MTX A;  4WFA V;  4HAM A;  4OX9 B;  5L3B A;  4FK5 C;  3ZHT A;  4YIP A;  1VQ7 V;  1KMI Z;  4WFG A;  2EIN C;  4KL1 A;  2HP8 A;  4I55 B;  3EFF K;  3G80 A;  5CA0 A;  4O4J B;  1E1Q G;  2DWD C;  4ZBM A;  1XUQ A;  2UUC O;  4DUZ B;  1AI7 A;  1NKD A;  4HZ3 A;  3SPH A;  5J2U A;  4FZ1 A;  4PV1 B;  3T1H O;  4NB5 A;  3OEH G;  4I4T A;  4J42 A;  4X20 A;  2Q0A A;  3AG3 B;  4DR4 O;  3P30 A;  1K34 A;  3A0B Z;  2UXC O;  1BL8 A;  3ZHS A;  1VAR A;  3JAR B;  5DM6 V;  2LO1 A;  1XEQ A;  1OCC B;  4Z1V A;  1SER A;  3E8G A;  2PYL A;  1JMK C;  3JD4 A;  3ZBH A;  2GTA A;  3AG1 B;  4FLX A;  3ABM B;  1Q7Y W;  2DOS A;  3OMI B;  1K4D C;  2OIE A;  2K1E A;  4MTF A;  3W7X A;  3H9V A;  3R66 A;  1OV9 A;  4OX9 O;  2E75 B;  1BHA A;  1W0J G;  2UUB O;  4F6R A;  1HNZ B;  1IBM O;  2ZE5 A;  3ZMS A;  4K8X A;  1FXK A;  1ZX3 A;  2L6L A;  4QPK A;  3P3P A;  3WB2 A;  2DW4 A;  3CCU V;  2KB1 A;  4I9W A;  2YIA A;  5LMU B;  3H1H H;  2F4V B;  2DQ3 A;  4C7U A;  3SPG A;  4HBN A;  1H8H G;  4J10 A;  2DYS B;  4MW8 A;  3HKB A;  1P84 F;  5D5Q A;  5KAF Z;  2IU3 A;  3L74 H;  3MDS A;  4G2K A;  2E74 B;  2ADQ B;  4TSF G;  3LDD A;  1S77 D;  2YSU B;  3CX5 F;  2VS0 A;  3E35 A;  4RUF A;  1X59 A;  4FFB A;  1Q6U A;  4QJF B;  4O2A B;  1J5E B;  5KUK A;  4UV9 A;  4BIU A;  2GV9 A;  4OXS A;  3ABK B;  2MW2 B;  1PNK A;  4PDL A;  1AJN A;  3G6B A;  4O4L B;  1WP8 A;  1QHT A;  1MMM A;  4UUJ C;  4ICG A;  1V9P A;  4LR3 A;  4F6R B;  4TWK A;  5GON B;  4K35 A;  4LF5 B;  1NS1 A;  2VQF B;  5JH7 B;  5FLX N;  3J7A U;  2AHZ A;  3DXR A;  4FLW A;  4KHP O;  1WPX A;  2W6I G;  4DXW A;  1Y74 A;  3T1Y O;  2YI9 A;  4FLZ A;  3E8H A;  3LSU A;  2M7W A;  3CCL V;  2RCV A;  3I55 V;  2HLD G;  3APQ A;  4E4E A;  2YID A;  5FNV B;  4CBC A;  2C2A A;  1GN6 A;  2OCC C;  5L3C A;  1KU9 A;  1N36 O;  5LMN B;  5J9P C;  2O57 A;  5A2Q N;  1AIL A;  5LOV A;  3RVY A;  2EIJ B;  1QQC A;  4WCE V;  3K06 A;  2XTA A;  1S72 V;  2BOC C;  3OUS A;  3RT3 C;  2XND G;  4LF7 B;  3L9D A;  4YIO A;  3L71 H;  1ROP A;  1UJW B;  4FMT A;  1GM8 A;  1K4C C;  2ZT9 B;  5HFL A;  2Y0P A;  1TA8 A;  1Q90 D;  4QGP A;  1K8A W;  2LQT A;  3OGI B;  3CXC U;  4GT1 A;  5LA6 A;  4GLX A;  2JJ1 G;  3UT5 B;  4IIJ A;  2LFS A;  4OPH A;  1WA8 A;  5JVD B;  4LF5 O;  1XMQ B;  4F4L A;  1H2M A;  4WFB V;  5CBG A;  2UXB O;  4GZR B;  2B9Z A;  3OT7 A;  4DV4 O;  4LFC O;  3FFQ A;  4DV2 O;  5IYZ B;  2G38 A;  4DR3 B;  1BS3 A;  3RYI B;  3AK3 A;  3CYO A;  1DK1 A;  4GX1 A;  1YDX A;  3FX7 A;  4XDL A;  5E79 Z;  2M6Y A;  1QNM A;  1EZJ A;  2OWO A;  1WLE A;  4J7K A;  5KLV H;  1U97 A;  3F7V C;  3L75 H;  5KX5 A;  1VMG A;  3M99 B;  2UUB B;  1NT2 B;  2JS3 A;  2LW7 A;  2AZ0 A;  3CC7 V;  1O9G A;  4O4I A;  3RVZ A;  2CTQ A;  2R72 A;  1AJP A;  1XQ8 A;  3VQY A;  5KA6 A;  1M56 B;  2V1D A;  3ZCC A;  3STZ C;  4O4H A;  5TIS Z;  3D8C A;  4J9Y B;  1K3E A;  1HR0 O;  3FD9 A;  1YTF B;  4CH4 A;  4DV3 B;  5CA3 A;  3W7W A;  4JZ2 A;  1IBK O;  1KYO F;  5B3S C;  3J81 N;  1KP2 A;  4LF4 B;  1QLN A;  3TCU A;  3GB7 C;  1PKX A;  3SYO A;  2JGD A;  4JI8 O;  2UXD O;  4YXW G;  4PEL A;  4XBF A;  1PV0 A;  4B3R O;  5HFM A;  1JFF B;  3K08 A;  2EZO A;  4RO2 A;  1XHX A;  2V7Q G;  2HG5 C;  4TUY B;  2MK3 A;  3K04 A;  5CBH A;  4JYC A;  4H0L B;  2OTL V;  1R3J C;  1WAZ A;  2R9R B;  5K1X A;  1R73 A;  2R70 A;  4QNH B;  3CC2 V;  2A0L A;  2DMX A;  3MD0 A;  1EZV H;  5B5E Z;  3X2Q B;  2WLL B;  2JJ2 G;  5C8Y A;  2WSS G;  3KCY A;  1GN2 A;  1QLE B;  1WB7 A;  3UT5 A;  1TVK A;  4LCU C;  3TGU H;  3QTC A;  4R8C A;  3ZIA G;  2Q6A A;  2Z0A A;  1IUR A;  3ZMZ A;  2FL4 A;  3E22 A;  3SPJ A;  5L3E A;  2BTQ A;  5CMU A;  5LL6 Y;  1R3L C;  4CS3 A;  4NKG B;  5AG2 A;  5LOV B;  1BE3 H;  3LDC A;  1LR1 A;  3SGI A;  5CA1 A;  3JAK A;  4ZKI A;  4CC5 A;  4DR6 B;  4NXM O;  4IL6 Z;  3KG2 A;  4B3S O;  3ML0 A;  4PHZ A;  1IBL O;  4LP8 A;  3ASO C;  5LGU A;  2ZM6 B;  3G4S V;  1IBL B;  3JAM N;  3ABT A;  4DV5 O;  5L3G A;  3LSS A;  3KZI Z;  1ZL8 B;  4MTG A;  3OTO B;  4DUZ O;  2CDY A;  2ZIM A;  5JH7 A;  2GUZ A;  1H2L A;  3G67 A;  1KEC A;  2E5L B;  4FPP A;  2YEV B;  3FB6 C;  3ASO B;  5LP6 C;  3ZRW A;  4MVS A;  3K58 A;  3BPZ A;  2Y0I A;  4PDM A;  3B09 A;  3GWO A;  5LHG A;  2DYR B;  4U7N A;  1VQ9 V;  4TOI A;  2AW9 A;  3RW0 A;  3APO A;  2ZE7 A;  5J2T A;  4NR1 A;  1IX9 A;  4LF9 B;  2RQ6 A;  4JAS A;  3FYI B;  4J9Z B;  1WA8 B;  1RP3 B;  5E1A C;  3A0H Z;  4B3M B;  4IIJ B;  4X1Y A;  1VQ4 V;  4I7Z B;  1VQP V;  4Z2W A;  4WF9 V;  4JTD B;  3SDL A;  4DV0 B;  1BHB A;  5BMV A;  2X7R B;  2ZQM A;  3AG4 B;  4LNU B;  4XDK A;  1MOF A;  2QR4 A;  5JJN B;  1YI2 V;  3SPC A;  1T5E A;  3FB8 C;  3CCM V;  1XNR O;  1SRY A;  2KKW A;  2WLM A;  4JYB A;  1K33 A;  3I5D A;  4UB6 Z;  1WJZ A;  1MNG A;  2QJ1 A;  5IWA B;  2W0F C;  4I0X A;  1Y76 B;  2F93 B;  1Z5V A;  2WLN A;  2BE3 A;  3JAW A;  2HR3 A;  4KXR A;  1H8E G;  1L0N H;  4EEQ A;  3CCJ V;  2JRI A;  4MT8 A;  3HKC A;  2JGU A;  1FD9 A;  2QWQ B;  3N2K B;  2PF4 E;  1N36 B;  1EBO A;  2KG7 A;  1HNW O;  3HKC B;  1OCO B;  3JAR A;  4FM2 A;  1HP8 A;  2LGQ A;  4UVC A;  3B4S A;  3A2F A;  3A8T A;  4B3T B;  4Q6G A;  2NLJ C;  4PA9 A;  4HNA A;  4I4T B;  1M56 C;  1YIT V;  1XHZ A;  1FXH A;  3ZN0 A;  5EZY A;  2QM8 A;  1VF6 C;  4FLY A;  2QSA A;  1S5L Z;  5LXT B;  2PYJ A;  1VQN V;  1B06 A;  1A32 A;  2LP7 A;  5A9G A;  4JAV A;  4B3R B;  4I50 A;  3ZRS A;  2PZS A;  1ZSP A;  1D5N A;  4DK1 A;  4DV7 B;  1S0V A;  1P7B A;  4B3M O;  1SQQ H;  1Q86 W;  1H38 A;  2YIC A;  4TV8 B;  3FYE B;  3JD0 A;  2L35 A;  1FXK C;  4MVU A;  4NTY A;  1VQ5 V;  1EN5 A;  4IHJ B;  3K59 A;  4GKJ B;  3K9A A;  3SYA A;  2GBO A;  5JJJ B;  5B1B C;  1MSW D;  4JI6 O;  3VQW A;  1ARO P;  5H5N A;  3RYF A;  3K5O A;  3AEI A;  1BMF G;  4JV5 O;  5FPO A;  1YCI A;  4B7E A;  2D3O W;  1HR0 B;  4AIL C;  5KA5 A;  2FTK A;  1R6N A;  2OIG A;  2YDE A;  1Z2G A;  4LWS A;  3H1I H;  1K5Q A;  2EIN B;  2HEP A;  1AR4 A;  1GN3 A;  4IYH A;  4K0K O;  2XAG A;  1XMO O;  4PJ0 Z;  2IH3 C;  1F23 A;  4K0K B;  2ZD9 A;  3BVO A;  1SQX H;  4PDV A;  3FAV B;  4LF8 O;  2QM7 A;  1SZX A;  5GW7 A;  2AHY A;  2Y69 B;  4I55 A;  2WPD G;  3IJ4 A;  1G1X B;  3E89 A;  1GRJ A;  1R1B A;  1GO3 F;  4MW3 A;  1JJ2 U;  3VQV A;  2YIB A;  4JTC B;  3QO8 A;  2F23 A;  1N8R W;  3L72 H;  4DW0 A;  4ABM A;  3U0Z A;  3CEI A;  2XT9 A;  1VIB A;  4X62 B;  3BFR A;  2P90 A;  3B8M A;  4PA3 A;  5LHI A;  1GH6 A;  1QLE C;  2Y4T A;  3N2G B;  4E2L A;  1IDS A;  5JCO C;  3OM3 B;  3CMA V;  4X9Q A;  5D5P A;  1XNQ O;  2QEX V;  4R50 A;  3N2G A;  4PA7 A;  5BXZ A;  2QGN A;  4H37 A;  3ETE A;  5KMG A;  1I7F A;  4X62 O;  3I56 V;  3ZRV A;  2JGD B;  5JCO A;  3CCS V;  4GKK O;  4TQF A;  1G4Y B;  3ABL C;  4JI6 B;  4LBE C;  1FS0 G;  3CC4 V;  1PM9 A;  3FB7 C;  3GVM A;  2W0X A;  2P4K A;  1MA1 A;  4K8Z A;  4N23 A;  4JAA A;  4WFE A;  3ZS8 C;  5IWA O;  5B1O A;  2BTO A;  3TXQ A;  4U3J B;  3JD3 A;  2AGA A;  1OCZ C;  2YXH A;  4JI2 O;  2ZXW B;  2YS8 A;  4QE9 A;  4JI0 B;  4O2B A;  3WB0 A;  3JAL B;  1L0L H;  3CRR A;  3DSQ A;  1MZF A;  3UKM A;  1HDJ A;  2QDO A;  3CCR V;  1NVP D;  4EFB A;  1S5H C;  3ZN1 A;  2ZKO A;  1W0K G;  1OCZ B;  1YJW V;  2RN9 A;  3BAA A;  1US6 A;  4WFH A;  4DV2 B;  1M93 A;  1JX9 A;  4GYC B;  3M7M X;  1YVW A;  4X1I A;  2XHB A;  4OPA A;  4FM1 A;  1VQ6 V;  1H2G A;  2XAF A;  4H44 B;  5LP6 A;  3RYF B;  1M57 B;  1NI8 A;  2ADP A;  4JI3 B;  3O65 A;  1TGO A;  1BSM A;  3MHH C;  3JAS A;  1Q6I A;  4JTA B;  4TV8 A;  1OCR C;  4P30 A;  1WB8 A;  5B3S B;  1SZT A;  3ASN B;  5LA6 B;  3RN4 A;  3ICX A;  3CRM A;  2P4V A;  1CXZ B;  3JAT A;  3E8F A;  3CXH F;  1SS3 A;  2ZNJ A;  3TK1 A;  2ZDI A;  2WLK A;  1I94 O;  2D2C B;  4YJ3 A;  3BEH A;  1YTF D;  1GM7 A;  5LXT A;  1JJO A;  1K92 A;  3F5T A;  1F4M A;  4H33 A;  2A79 B;  1NR1 A;  1K7D A;  2VWK A;  1FFX A;  1CP9 A;  2W6J G;  3S3X A;  1UPG A;  3J80 N;  3ASN C;  3CRQ A;  4RUE A;  3T4Z A;  4QIW F;  4JI8 B;  2UXD B;  4LH6 A;  3BHP A;  2PI4 A;  1WP7 A;  5EZY B;  5KAI Z;  4GCZ A;  1N0N A;  3PN1 A;  1IBK B;  5GTH Z;  3UQ8 A;  4LF6 O;  1XNR B;  1RPR A;  4UB8 Z;  5JQG B;  1JPX A;  3N2K A;  4DV1 O;  4TV9 A;  3ABL B;  5BR8 O;  2N04 A;  3JYC A;  1VP7 A;  1GMG A;  3CRA A;  1H2K A;  1RM1 C;  3Q4H A;  1F4N A;  4D7S A;  3BAB A;  2ZIO A;  1N34 O;  1VF5 B;  1WNS A;  2KG7 B;  2EUL A;  5IE9 A;  4R6Z A;  2Q67 A;  1ZTE A;  5BZB A;  4B3T O;  2B5U A;  3D3Q A;  1R6K A;  3ZX6 A;  3B2E E;  2KSD A;  2H94 A;  4FZ0 A;  2EJ7 A;  5LBQ A;  3OGC C;  1R3I C;  2HJF C;  1TAE A;  1Y76 A;  2CTW A;  3ABK C;  2EIL C;  3E86 A;  2LGW A;  1GAX A;  4QPJ A;  3RFR A;  4DUY O;  2JVD A;  1H2S B;  4LFA O;  3E8B A;  3K3W A;  2QA4 V;  3LNN A;  5CB4 B;  3G71 V;  5F2V O;  1I94 B;  2UXX A;  2VWJ A;  4DR1 O;  4YJ3 B;  2AZ2 A;  4CH3 A;  5EIB D;  4DR1 B;  4YJ2 A;  1N33 O;  4CZZ A;  5LP6 B;  1KKC A;  5LMU O;  4DR3 O;  1FJG B;  1KKD A;  4LF9 O;  3RBZ A;  4XDJ A;  4TQD A;  2N74 A;  3SYC A;  1R3K C;  2PTM A;  1AR5 A;  1FKA O;  4J41 A;  1MZE A;  1S3J A;  4P9P A;  3THO A;  5LYJ A;  4JI2 B;  2EX3 A;  5H6R A;  3ZRW B;  1I5X A;  5EBW C;  2EZP A;  3B8N A;  1K5S A;  3S3W A;  4JI4 B;  2KQX A;  1Y67 A;  4DR5 B;  1ZL8 A;  4LF4 O;  5LHH A;  3H1K H;  3JD2 A;  2UXC B;  3K79 A;  5H9C A;  4FLT A;  1SQB H;  2Q73 A;  2YEV A;  4JF3 A;  4X8A A;  3ZHQ A;  3ZMT A;  3JAL A;  2EIM C;  4O2B B;  4MSW C;  4JI3 O;  3JAK B;  3VQX A;  3AK1 A;  5J2U B;  1OCR B;  1RPO A;  3OE7 G;  1Y66 A;  2ZXW C;  2VQE O;  5IYD O;  2AXT Z;  2IU0 A;  3PJS K;  1RM1 B;  5LGN A;  1FFT B;  4I5S A;  1COW G;  4O4J A;  1Q82 W;  4UCU A;  3X2Q C;  4X66 O;  4HYO A;  4F6E A;  2NNU A;  2UXB B;  2A9H A;  1JOY A;  2ITD C;  2BTQ B;  1M5I A;  4PI2 A;  2EBO A;  1OCO C;  1K9M W;  3IC7 A;  2V4D A;  3AG2 B;  4LC1 A;  4TT3 G;  3RYC B;  1TVK B;  1MSD A;  1DF4 A;  2YIB D;  3UO2 A;  5C8Y B;  2CE4 A;  2YI8 A;  2Q69 A;  4FLV A;  1WN7 A;  1X4T A;  2RJZ A;  2FKX A;  2XAJ A;  1EM1 A;  4PI0 A;  1NQT A;  3AG2 C;  2LFR A;  4GX2 A;  4IYI A;  4KUM A;  2R9A A;  3IFX A;  3B40 A;  1M1K W;  2BSK B;  1AI5 A;  3TET A;  2HHH O;  4DR7 O;  1NVP B;  1VF6 A;  3BA8 A;  2ZCE A;  1B3Q A;  1VEW A;  2DN9 A;  4DV6 B;  5BR8 B;  4DR2 B;  4O4H B;  3DC5 A;  3ZMU A;  5B1A C;  2XAS A;  3NR7 A;  2HJD A;  4LF6 B;  1BGY H;  3AG3 C;  4ZI7 B;  4LWS B;  2EIM B;  1GM9 A;  4O4I B;  2XOK G;  2UUA B;  4FVM A;  4KFM A;  1SQG A;  3T2M A;  1BCC H;  1GKF A;  1QU7 A;  5L3D A;  2Q7H A;  5KX5 B;  3W7S A;  2OYQ A;  1QVF U;  2QWN B;  1N32 O;  1V55 B;  5DN6 G;  4BWA A;  4CS2 A;  2QKA A;  4GX5 A;  3QO7 A;  3JSN A;  4JAU A;  4DO2 A;  1CPY A;  3AG7 A;  2UUC B;  3OMN B;  3CWB H;  4BW5 A;  2XAH A;  2H3O A;  1QR8 A;  4WBN A;  1NH2 D;  5IYZ A;  3C3S A;  4A5U B;  5IJ0 A;  5LGT A;  4JI4 O;  2Q68 A;  1LUV A;  2Y69 C;  2QKC A;  4Z1M G;  3CD6 V;  5IT9 N;  3ZMV A;  1TUB B;  2HKO A;  4LH7 A;  3OW2 U;  1HNX O;  5LYJ B;  2ZNI A;  2YUA A;  1EFR G;  4UFZ A;  2Q8V A;  2JS5 A;  1L1F A;  3QVN A;  2WAM A;  1XI1 A;  4MS2 A;  1QR9 A;  4IHJ A;  4X66 B;  5B1A B;  5ITZ B;  4L8J A;  3SPI A;  3WG7 B;  4PA6 A;  4BIZ A;  5IDJ A;  2BCC H;  1MAB G;  3LNM B;  4YY3 O;  1EN6 A;  2LJ2 A;  3OD4 A;  3ETG A;  1NR7 A;  4UCR A;  1IBM B;  5FNV A;  1HNX B;  5CN0 A;  2HHH B;  2N05 A;  5B1B B;  3H01 A;  4FM0 A;  2QM4 A;  1CEZ A;  4U3F H;  1E1R G;  3NXS A;  1AR1 B;  5JWP A;  4G27 B;  4HNA B;  3D3I A;  1ZWI C;  3MHS C;  3RWR D;  4CH6 A;  3JAW B;  5IJ9 A;  1KUQ A;  3KKY A;  3ZHU A;  1V54 C;  2PY5 A;  1Y74 B;  3QNE A;  1D2D A;  1OZ0 A;  4I0X B;  1SC5 B;  3T1H B;  4TV9 B;  3DXR B;  5JQG A;  2A3Q A;  1QCE A;  1NTK H;  4DYL A;  1M4U A;  4X89 A;  5H6Q A;  1P7G A;  5GON A;  2ATK C;  4FFB B;  3ZED A;  3T1Y B;  1J5E O;  3A0R A;  3RGB A;  2JEX A;  4DRX A;  4KHP B;  3CS5 A;  4D6T H;  4O4L A;  2DQ0 A;  2EIK C;  2VQF O;  1SQF A;  3H1L H;  3P3N A;  1M9N A;  2XAQ A;  2P22 C;  3K0D A;  1AJQ A;  1Q5O A;  1PL4 A;  3HKE B;  4ZOL A;  5FL7 G;  4ZOL B;  2P6J A;  4LNU A;  3HKE A;  3SYQ A;  3JAT B;  3OEE G;  5EBL C;  4UCS A;  2OTJ V;  4DK0 A;  4DV7 O;  3ABM C;  4LFB B;  4DRX B;  4CC6 A;  1Q8I A;  2WLJ A;  3JAS B;  4UVB A;  3VBB A;  5EK0 A;  1FXK B;  4MTO A;  1HNW B;  4DV5 B;  2Q7G A;  1YZB A;  2ILM A;  1N32 B;  1KBH A;  1NZ6 A;  1JQ0 A;  2GUZ B;  2QWO B;  1XRE A;  4CH5 A;  5IJ0 B;  3L73 H;  1NTM H;  1OCC C;  4B08 A;  1XBL A;  1G6U A;  5C93 A;  4JI5 B;  2ZR3 A;  2JDI G;  1I5Y A;  3IGA C;  4P9O A;  2E3C A;  3QF7 A;  3OR7 C;  3OTO O;  3F7Y C;  4X20 B;  3AK2 A;  1PPJ H;  3K9S A;  1VQK V;  2UXN A;  4UXN A;  5CA1 B;  1S76 D;  4NXN O;  4ZHQ A;  3P32 A;  3TXS A;  1Q43 A;  1E79 G;  1Y4M A;  5KHH A;  4P2Z A;  1ZAU A;  2F66 C;  3CJH B;  2CTR A;  1SF9 A;  4JV5 B;  4ZI7 A;  1FJG O;  4GX0 A;  4JPR A;  3E22 B;  4RAI A;  1YIJ V;  5CA0 B;  2YXL A;  3CP1 A;  3SYP A;  4J7J A;  3D36 A;  2WWW A;  2X6A A;  1YXB A;  3C90 A;  1NU1 H;  4J7Z A;  4EKW A;  2WLL A;  2GHY A;  5ITZ A;  3K57 A;  2JEU A;  1XOU A;  4BR6 A;  5DED A;  2A7W A;  3ZJZ A;  3OR6 C;  2RDC A;  2Z3Y A;  3D36 C;  4RWU A;  1NH2 B;  4TUY A;  4JI5 O;  3R65 A;  4JI1 O;  2E76 B;  3JCU Z;  4RQF A;  4WBN B;  1JA8 A;  2IM9 A;  4RQE A;  1HNZ O;  3RYH A;  1KQS U;  4DV1 B;  1BQZ A;  2QE7 G;  3RYC A;  4LFB O;  1DGS A;  1JFF A;  2CAZ C;  2ZDI C;  2CUG A;  1XIL A;  5GTI Z;  1IXB A;  3QG5 A;  3UO3 A;  4NTX A;  2K9P A;  4NTW A;  2DYR C;  2WA3 A;  2PUS A;  2P5O A;  1ENV A;  1Q6H A;  2NN4 A;  4JYA O;  2CGN A;  4PA4 A;  1KP3 A;  3ETQ A;  3L70 H;  4X65 B;  2ZM6 O;  3WU2 Z;  3EXA A;  1S5J A;  4B3S B;  1DTO A;  3CSX A;  3FAV A;  2QKS A;  3ZHV A;  5EC2 C;  4L87 A;  4D7T A;  3OAA G;  2OCH A;  2E5L O;  2ARH A;  2CGO A;  4PD4 F;  3U10 A;  1M57 C;  4CS4 A;  3SJA C;  1NJI W;  1HWY A;  1N34 B;  5K1P A;  2OCC B;  3OTF A;  5CBF A;  4X64 B;  1N0J A;  3RYH B;  1AB3 A;  2Q9L A;  2DWE C;  1Q3E A;  3W7T A;  3HKD A;  3RYI A;  3FKS G;  4MVO A;  4MVM A;  5IY5 B;  2DE0 X;  1KB9 F;  1VQO V;  4FJC C;  1ORQ C;  2CK3 G;  4GKK B;  2RMK B;  2ODM A;  2Q0O C;  2IJI A;  3UM7 A;  3DGE A;  1GTO A;  5L3F A;  2F43 G;  3BCC H;  5DEC A;  5JVD A;  1PL0 A;  4UCV A;  4LFC B;  4DV4 B;  3CE2 A;  3WFV A;  3T4D A;  4DUY B;  1ZUQ A;  1PNL A;  4X88 A;  3EHB B;  3C3T A;  5FPR A;  3N27 A;  1D5A A;  2X6B A;  1LUW A;  2LW1 A;  3E83 A;  1MG1 A;  3EVK A;  4KP4 A;  5IY5 C;  1AP5 A;  2B1G A;  3HB3 B;  1URF A;  4ZIB A;  2FB5 A;  4WFF A;  2P06 A;  1PD3 A;  1FPO A;  1GK9 A;  1DLB A;  4UCO A;  3IC9 A;  2ZE8 A;  1O9H A;  1L8D A;  4I50 B;  1GN4 A;  5KUM A;  1SET A;  4DV3 O;  2IJH A;  3JD1 A;  3IAY A;  2P67 A;  1DF5 A;  1YJ9 V;  3CJH A;  3WG7 C;  3T1C A;  1P4R A;  4PDR A;  1PNM A;  2YXY A;  4ZHQ B;  2WLI A; 
#chains in the Genus database with same CATH homology
 3T1H O;  2ZM6 O;  3OTO O;  5FLX N;  4LF6 O;  3J7A U;  4DV1 O;  4JI3 O;  5IWA O;  4NXM O;  4KHP O;  1FYJ A;  1HNW O;  4B3S O;  1IBL O;  4DR4 O;  1R6T A;  5BR8 O;  4K0K O;  1XMO O;  4JI0 O;  4NXN O;  3T1Y O;  4LF7 O;  2UXC O;  3M8A A;  4X65 O;  2VQE O;  3JAM N;  4DV5 O;  1KUQ A;  2AGA A;  2E5L O;  1XEQ A;  4DR6 O;  4LF8 O;  1D2D A;  4JI2 O;  1N34 O;  4DUZ O;  4GKJ O;  1FJG O;  1HR0 O;  4X66 O;  2DOS A;  4B3T O;  1N32 O;  1N36 O;  3R66 A;  5A2Q N;  1G1X B;  4OX9 O;  4DV0 O;  1IBK O;  1AIL A;  1F7Y A;  2UUB O;  3J81 N;  1R1B A;  4DR5 O;  1IBM O;  3RT3 C;  1AB3 A;  2ZKO A;  1J5E O;  1A32 A;  4JI8 O;  2F4V O;  2UXD O;  4AQY O;  4B3R O;  4A5U B;  4JI4 O;  2VQF O;  4DUY O;  4OPA A;  4LFA O;  5IT9 N;  4DV6 O;  4DR2 O;  2UU9 O;  4B3M O;  4YHH O;  1XMQ O;  3O65 A;  4X64 O;  4OPH A;  1HNX O;  1XNQ O;  4DR1 O;  4JI7 O;  4LF5 O;  5LMN O;  5BXZ A;  5BY1 A;  4JI5 O;  1N33 O;  2UXB O;  5LMU O;  4DR3 O;  4LF9 O;  4JI1 O;  4DV4 O;  3SDL A;  4LFC O;  2FKX A;  4DV2 O;  2N74 A;  4X62 O;  4DV7 O;  1I94 O;  1FKA O;  4JI6 O;  1DK1 A;  1X59 A;  1HNZ O;  5H5N A;  4GKK O;  2DJV A;  3F5T A;  4YY3 O;  1XNR O;  1YZB A;  4LFB O;  2Z0A A;  2HHH O;  4JV5 O;  4DR7 O;  3J80 N;  4DV3 O;  4LF4 O;  5LL6 Y;  2UUA O;  2UUC O;  4JYA O;  2LW7 A;  2JRI A;  1NS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...