1CXZB

Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
86
structure length
86
Chain Sequence
WSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-181))
publication title The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1cxzB00
2Q0OC 1US6A 1CXZB 1URFA 4DYLA 1RFYA 4NB5A 2HJDA 4IGGA 4NKGB 2RMKB 1UPGA
chains in the Genus database with same CATH superfamily
3JD4A 1PPJH 3H1IH 4X65O 1HNWO 1M9NA 3VQYA 3CMEV 4FLYA 4MVUA 1TUBB 4FLXA 3LNMB 4JV5O 1WB8A 1V55C 3KCXA 5IT9N 1GO3F 2LP7A 2V7QG 3ABLC 2Q6AA 4X65B 1HNWB 3CHXA 2RQ6A 4ZBMA 2Q7EA 5IYBO 3JASB 2YXLA 1D2DA 4O4JB 3TXQA 4JV5B 4KFMA 5B1AB 1QLEB 1TUEB 4PA6A 1N0NA 4JI1O 2Q73A 2G38A 5IYCO 2HHHO 1XMQB 2IW5A 3UCSC 1DK1A 2UXXA 1K3EA 1JPXA 1R6NA 2JIZG 3RW0A 2F93B 3DSQA 2CDYA 4FFKA 3JAMN 4ASUG 1FXHA 4K35A 2WLKA 4BIUA 3M99B 4DV5O 4JYCA 1OCCB 4I5SA 1XMOO 2HHHB 3ZMVA 1H38A 4JAAA 3SJBC 2QKCA 2FKXA 4DR4B 4J42A 1RFYA 4PI2A 2OTJV 1P7BA 2MK3A 4DV5B 4ZKIA 4LF6O 3UT5B 1XMOB 2V1DA 3F5WC 1NQTA 4EB6A 5IY5B 4DV4O 1S76D 2L35A 3L70H 1MA1A 3K04A 4E2LA 1P49A 1V55B 2ZNIA 4OXSA 3SYCA 1KUQA 3ABLB 4DW1A 2YS8A 2HFEC 4X89A 4HYOA 5IJ9B 4DV4B 1JJOA 2ODMA 2YIAA 2PY5A 4U3JB 3FKSG 4JAUA 2LW7A 3J81N 4G28B 2GHYA 1YI2V 3K79A 4B7EA 1Q86W 4D7SA 4LF9O 5J9PC 4DYLA 2DOSA 4MVOA 4UVBA 2QSAA 4LH6A 4DV0O 3KKYA 1NI8A 4IT5A 3ZN1A 2O57A 1MOFA 3SGIA 4DXWA 1WA8B 1H2NA 2IM9A 1PV0A 2Y0PA 1WP8A 3TXSA 3P30A 4LF9B 1ZL8B 4TV9B 1EN4A 1YJNV 3CRAA 1P4RA 3G6BA 5B1BC 4UFZA 5BXZA 4DV0B 3N2KA 1J95A 5BR8B 1O9HA 4GKJO 1GN2A 4J7KA 4DV2B 1E1RG 3CCQV 1S5LZ 4P9PA 2FTKA 4CC6A 4UCTA 2GV9A 1MNGA 5A2QN 1KQSU 1S5JA 2WLLA 4GKJB 3ML0A 1Y67A 2CE4A 3APOA 2A7WA 3MHHC 1VQOV 2DYSC 2N05A 4TUYA 3E8FA 2E76B 5CBFA 2KB1A 4XBFA 4BIOA 3O9OA 1WB7A 2ITDC 1K92A 3N27A 2MW2B 3X2QC 2PI5A 2QE7G 3LUTB 1QU7A 4LWSB 1FAFA 5JCOA 4I50A 5LA6B 1IURA 3ZHUA 2UUBO 1Z5VA 2LQTA 3FYEB 1P84F 4JI6O 1AJPA 1NJIW 1N34O 1KKDA 4MTOA 1Q6IA 4X66B 2GTAA 2ATKC 2CGNA 1VEWA 4DV6O 2PYJA 5JH7B 3JCUZ 2EIMB 2ZCEA 3HKDA 1S72V 5LYJB 1N34B 4N23A 1R73A 3ETDA 3FX7A 4DR3O 1MG1A 1Z5WA 4NR1A 1K8AW 1K5QA 5GTHZ 1I08A 4DV6B 3LDDA 4JYAO 1NKDA 2YSUB 4RWUA 3HKEA 4J80A 3CCLV 3OMAB 4WFGA 1HNXO 2NLJC 1VF7A 5IYZA 4U7NA 3B40A 4DR3B 3E89A 5LHHA 1NVPD 4TSFG 4DUYB 4WFHA 2L6LA 3B09A 3TGUH 3OMIB 4CH4A 4QIWF 5LOVA 4B3RO 2F23A 4JYAB 1VF6C 3ZRWB 1JFFB 2M7WA 1HNXB 4YJ2A 5EC2C 4UV8A 1G6UA 5IJ0A 3AG3C 2LJ2A 2AXTZ 4FLWA 1R1BA 1PD3A 4F6RA 4WBNB 5KA6A 1QHTA 3K0DA 4YIPA 1Y66A 2UUAO 1Q6HA 3K9SA 4PA7A 4JGSA 3CRMA 3B4SA 1I0HA 1JX9A 3T1CA 1IBLB 3BCCH 5LMNO 3JATA 2H3OA 4U7OA 2JEXA 2Z5UA 3EHBB 4H37A 5KMGA 2F4VO 2A0LA 2YEVA 3S3XA 4EFEA 4X20A 2HVJC 4UCSA 3M8AA 4RO2A 4UCUA 1B6QA 2ETNA 1N4CA 4JTCB 1YITV 1SC5B 1HW7A 5JJJB 3CJHB 2WLIA 1FXKB 5KLVH 4X62O 3CSXA 1W59A 3HPLC 5L3GA 5BZBA 1IXBA 4PHZA 1L8DA 4BW9A 1TVKA 3W7SA 4FFBB 1YSCA 2ADPA 2EINC 2WA3A 4ZOLB 4NXMB 4LF7O 3BFRA 5GONB 5CA1A 4H13B 3L71H 4MVZA 2Q0AA 4G27B 2YXYA 5KHGA 4O2AA 2DYRB 3RBZA 1NH2D 4MW8A 4KP4A 4LF7B 1VP7A 4O4HA 1YVWA 4DK1A 1VQMV 2PF4E 3RYHB 4DR1O 2JGDB 2YIBD 3AG3B 1WLEA 3Q4HB 2GSMB 3IFXA 4K8XA 2ZR2A 5EIBD 3AG4C 4FJCC 1MZFA 5C93A 2CAZC 5CB4B 2RN9A 4PA3A 2ARHA 2VWJA 2ILMA 1L1FA 1VQNV 2YI9A 5IE9A 2VS0A 1SERA 2Y48A 4DR1B 5DN6G 5FNVA 5B3SB 3H9VA 5LP6A 2XAQA 3K0GA 2KQXA 3STZC 2F1MA 5BMVA 4B7KA 5L3EA 5K1PA 4HAMA 1FXVA 3DC5A 3F7VC 4DV3O 3GB7C 5KUMA 3OTOB 1W2BU 4O4LA 3VQWA 1R3IC 1F51A 3LSSA 4X1IA 4FM1A 4BWAA 3GVMA 5KHJA 1I94O 4I55A 3RYCB 2VQEB 2EINB 3OT7A 4DV1O 4I4TA 4Q20A 2QKAA 4FM2A 2UU9B 1GM9A 4DR6O 1AP5A 1B3QA 2AZ2A 5EZYB 2P4KA 2EZOA 4LFAO 2CTWA 4UV9A 4FPPA 1NT2B 4MVQA 1SA0B 4LF8O 2R70A 4LNUA 4DV1B 5C8YA 5J2TA 2OT5A 3N2GA 5CBGA 4LC1A 2R9AA 3QO5A 5LGNA 1G1XB 2EBOA 2DQ3A 1F23A 3PN1A 2BTQA 2ZE7A 1EN6A 2QJ1A 2ZIMA 2AHZA 3WB0A 3OAAG 4LF8B 2HKOA 4UVAA 1N33O 2ADQB 5EBMC 1Y74A 2XOKG 2RNBA 3HKBA 3JAWB 1BHBA 2KKWA 2ZD9A 4L8JA 4EEQA 2X6CA 2ZE8A 5KUKA 1QLNA 1U96A 3QF7A 2DWDC 2QTSA 2P90A 3OW2U 3L72H 2IJHA 4KXRA 1VARA 5IYDO 4KHPB 4JPRA 1OCRC 5IWAB 5CA3A 4L87A 1K7DA 1CP9A 1M4UA 1L0LH 2EX3A 2P22C 5EBWC 2X0LA 1YEWA 5DECA 4IIJA 1I5YA 1WJZA 1BQZA 2AHYA 4RAIA 5LXTA 2N04A 4DW0A 1XUQA 5JVDA 1HR0B 2F95B 1ZWIC 2W0FC 1YCIA 5B1AC 1NR1A 4J9YB 1PM9A 1URFA 1S3JA 3D3QA 1SQFA 2EJ7A 1FFTB 2R72A 1Z2GA 2XT9A 4RQFA 4QGPA 2LO1A 3QO8A 3LDEA 2HJDA 2CTQA 1N0JA 4AHCA 3J7AU 1H8EG 4EB6B 1F4MA 1OCCC 4JTAB 1COWG 1ZUQA 2YIBA 2RCVA 1EFRG 1YXBA 2A3QA 3WB2A 4O4IA 3E22B 1JA8A 5JJNB 4B3MO 2DW4A 2EILC 3A0BZ 2Q7HA 2H8PC 3D3IA 3FB5C 4OX9B 1Y4MA 1NZ6A 1Q5OA 4GT1A 2BOCC 4JZGA 2E5LO 4MS2A 5IY5C 3OMNB 1GK9A 4B3MB 3ZMSA 3IAYA 4PDMA 4PDVA 4J9ZB 5E1AC 1OCRB 5CN0A 3W7TA 1IZ3A 4IYHA 3TK1A 3K5NA 1M90W 3E83A 3FAVA 1N32O 3SPIA 4FVMA 4ZHQA 1S77D 1HNZO 2ZT9B 4GYCB 1GKFA 1XILA 2P5OA 4MTFA 3NR7A 3N2KB 1M5IA 2X6BA 3CPWU 4HNAA 5H2FZ 4ZI7A 2ZE5A 4OPHA 4CH3A 4PDLA 3DC6A 1PL4A 2W0XA 3JALA 4JI1B 1XOUA 2WLLB 3T4DA 1ORQC 1ROPA 2P4VA 3MDSA 1G4YB 1GN3A 2WSSG 5EBLC 3U10A 4TUYB 3RT3C 2Y0IA 3P3PA 1XHZA 1N36O 3LSQA 2CTPA 2EILB 3VOUA 4TV8A 2LFRA 1AP6A 1FS0G 1AVMA 2LGWA 2D2CB 4MT8A 5KAIZ 4QPKA 4TWKA 2K1EA 4MSWC 5H9CA 3K57A 5B66Z 5KHKA 4MVMA 1Y76B 3VBBA 3VQXA 4NVPA 3CP1A 1QNMA 4NB5A 4LF6B 2B5UA 4AILC 2IBZH 2E75B 1XL4A 3CC4V 3STLC 4JI0O 1D5AA 3E8GA 1K34A 3K5MA 3HKDB 4CS2A 1QR8A 5JWPA 3CCSV 2BSKB 1M56C 1JOYA 1KKCA 1XREA 3W7UA 4NTXA 1EZVH 1YHQV 3E8HA 5H6QA 2VWKA 3HB3B 3HKEB 2EIMC 3UM7A 4W4LA 3RWRD 5F2VO 3CRRA 1OV9A 1ZTEA 1KB9F 3WU2Z 3QTCA 3RYIA 1GAXA 3BA9A 2HG5C 4FLUA 1XEQA 3SYPA 3ICXA 5LOVB 3O65A 1RPOA 1NTZH 4ICGA 2OWOA 2DE0X 3RVYA 3RYFB 1HP8A 4F6RB 2C2AA 2CH7A 4X64O 1VIBA 1PP9H 2QKSA 3CS5A 4PD4F 5J2UB 1SKVA 4EKWA 4J7JA 3ETGA 3JATB 5E79Z 5CA0A 4X64B 3HKCA 1MSWD 4GX1A 2V4DA 2OYQA 4LBEC 1AI7A 2YEVB 3EFFK 2LW1A 3THOA 1Y6XA 3ZMTA 5KHHA 2WLIB 4AQYO 5EYPA 2Q9LA 4YHHO 1VQ9V 1TVKB 2EULA 2A79B 2XTAA 1M56B 5B1OA 2D3OW 4XDLA 4YY3O 3L73H 2UUBB 5D5QA 1AJQA 5A9GA 4AQYB 4UCOA 4JI6B 5CA1B 1XHXA 4IHJA 2QEXV 4QE7A 3I55V 4I9WA 1W0JG 1FXKC 2LFSA 3H1JH 2BTOA 4O2AB 4YY3B 4FMTA 1VQ7V 3D36C 1F4NA 1M57B 3BVOA 3A8TA 3P32A 2XUMA 3SPCA 2EZPA 3CE2A 1VQPV 4FZ0A 2QM4A 2QM7A 2P6JA 3AG7A 3SPHA 1F7YA 3T1YO 2ZDIC 1YZBA 3OEHG 2DYRC 3ABMB 3ETQA 1RSOA 3AK1A 3A0HZ 4P9OA 1WA8A 4I9QA 4B3TO 4DR2O 1V9PA 4DUZO 5LP6B 3MHSC 4YJ3A 3K5LA 5HFLA 3T1YB 3GWOA 3APQA 5LGUA 3OM3B 3CCRV 1BS3A 4K0KO 3IJ4A 2M6YA 3ZBHA 3K59A 3JAKA 1ZAUA 4H44B 1CEZA 4B3RB 1H8HG 2ZQMA 3DGEA 1YTFB 2OCHA 1GN6A 4B3TB 4DUZB 1QR9A 4O4LB 4H0LB 5ITZA 1VQ8V 5B3SC 1IBKO 1WN7A 1IXMA 4X1IB 4K0KB 1CPYA 4FLVA 2UXBO 3BPZA 4I55B 3OGIB 2UUAB 1IDSA 4I4TB 3F5TA 4BW5A 3CEIA 4GUNA 5LMNB 3TJTA 1IBKB 1NR7A 1OCZB 2AGAA 1OHHG 4E4EA 4ZIBA 2UXBB 1NVPB 2F4VB 1FD9A 3ABKB 4LNUB 4YXWG 5C8YB 5J2TB 4CH5A 4LWSA 3I56V 3N2GB 1L0NH 2IH1C 5H5NA 3ABUA 4X62B 3ZN0A 3CXCU 1H2KA 5L3BA 2BTQB 3ZHRA 3JD0A 1IVSA 1U97A 3U0ZA 1JCHA 4UCRA 4WFFA 2XHBA 4LF5O 3ZRXA 5KX5A 5B1NA 3B77A 1JQ0A 3LDCA 1Y74B 2F66C 1KD1W 3HKBB 3OD4A 3JD2A 3JARB 1PNKA 3K08A 2B1IA 4QE9A 3ZHVA 4X1KB 3K3WA 5LHIA 5LYJA 4EFBA 4X8AA 4LF5B 3G67A 3C90A 2YIDA 3PJSK 4XDKA 3CCMV 1B04A 2UUCO 2QGNA 1MSDA 4X88A 3ZMZA 1WNSA 1SZTA 2PYLA 4LFCO 2Q8VA 1VF5B 1KP2A 3JD3A 4IIJB 1ZLZA 3E2EA 3ZRVA 4KUMA 2GTSA 3CC7V 5LXTB 3SDLA 1BSMA 3UQ8A 3ASOB 1IBMO 3RVZA 2UUCB 4PV1B 2JJ1G 3A2FA 4DR5O 4J10A 4LFCB 5L3CA 1SF9A 2WLNA 3W7XA 2XASA 4FLZA 3CCJV 4JI3O 1TA8A 3SJAC 3H1KH 1AI4A 4JAVA 5H6RA 1AROP 1IBMB 4DV3B 4NXNO 1SRYA 1NH2B 4WCEV 4DR5B 4JI7O 1VQLV 3JYCA 5JQGB 3SJQC 2QR4A 4DRXB 2GUZA 3CMAV 4MVRA 5HFMA 3K06A 3OE7G 2YDEA 1I94B 1IX9A 1K9MW 4JI7B 2QWOB 4OGQB 1K5SA 1EZJA 1KP3A 1SQPH 4DR6B 1Q90D 1Q7YW 2ZXWB 1X4TA 1R3JC 3OR7C 3SPGA 4JI5O 3DTUB 4LFAB 1YJWV 1JMKC 3CYOA 4Z1MG 4C7UA 3RN4A 2JK5C 1WPXA 4PI0A 4Z2WA 4A5UB 1QVFU 3ZJZA 3E8BA 3BY6A 3CXHF 3JD1A 3CWBH 5L3DA 4K8ZA 4ZHQB 1UJWB 1N33B 4Q6GA 2IH3C 1XNQO 4MW3A 1OCOB 1X59A 1KC8W 2Q5ZA 2H94A 1RM1B 3AK2A 4BR6A 1VF6A 4CBCA 2W6IG 2FMLA 3BHPA 3ZHSA 4HNAB 3AG2B 2ZE6A 3Q4HA 2QA4V 3DXRA 1FJGO 4UVCA 1G8MA 1PKXA 3UO2A 1ZX3A 4I7ZB 1XNQB 4D7TA 1VQ6V 1NTMH 1Q43A 2FYUH 2NR5A 1J5EO 1KU9A 2UXCO 2NNUA 4GX5A 3CCUV 1FJGB 4NTYA 3ZS8C 3L74H 5D5PA 4B3SO 2YC0A 1P7GA 4TV8B 2P7TC 3G80A 1R6TA 1XNRO 3ASNB 1J5EB 4WFEA 3OEEG 2IU3A 2UXCB 2Y4TA 4I0XA 4JZ2A 2P06A 4FZ1A 1BE3H 2JEUA 3BABA 1SQGA 5LBQA 2WWWA 5L3FA 1XNRB 4PA4A 3ZEDA 1GMGA 3LSUA 2W6JG 3SYAA 1RPRA 2Y4UA 5JCOC 4WF9V 4IL6Z 4NYKA 3T4ZA 1LR1A 3OGCC 4RQEA 2ZIOA 2ZKOA 2EIJB 3BEHA 2OIGA 2Q4PA 4HZ3A 1PNMA 1H2MA 4J11A 1OZ0A 2BCCH 1KYOF 2NN4A 3FB6C 2B1GA 4LH7A 1GH6A 2E5LB 3TCUA 2IU0A 1HDJA 2Q68A 3RYIB 3KG2A 1RP3B 4JI2O 4W4KA 3JAWA 1N32B 1QBZA 2QWNB 1HNZB 1XMQO 4WFAV 1JJ2U 1QVGU 4X1YA 2CH7B 1HWYA 1FFXA 1A32A 3AK3A 4JI2B 4F4LA 5KHIA 5FPRA 4UB8Z 2K9PA 1AJNA 3UKMA 1YIJV 2WLJA 4F6EA 3ABTA 1GN4A 1GM8A 1H2SB 5EC1C 1BCCH 2PZSA 1S0VA 3OUFA 3FYIB 5CA0B 1K4CC 4CS4A 2XNDG 4DR4O 1SZXA 2KSDA 3HKCB 2KG7A 1R3KC 3WG7C 1DF5A 2JS5A 4TT3G 3SPJA 4O2BA 4I50B 2BOBC 1PNLA 4RUFA 1Q81W 1AILA 4DO2A 1N36B 5EYPB 4TQDA 1MZEA 1THZA 3B2EE 5GW7A 1LNQA 1V54C 4P30A 2CGOA 2RMKB 4LCUC 1US6A 3SYOA 1M93A 2GDSA 1LUVA 1H2GA 4IHJB 1DF4A 4NTWA 2N74A 3E22A 2OIEA 4PDRA 1DTOA 2QWQB 2WLHA 3R65A 1BT8A 3G6EV 1JVMA 3C3TA 3J80N 3UO3A 2LGQA 2EIKC 2XAFA 3BRCA 4JI0B 5KA5A 1UPGA 3AEIA 4D6TH 1GTOA 1SQXH 2PUSA 4JYBA 2ZINA 1TUBA 2Z0AA 1Q82W 4BAYA 1NS1A 5IYZB 2JDIG 3B8NA 1O9GA 5CBHA 2JJ2G 2Z3YA 2VRZA 4GLXA 1RSOB 1VMGA 5BR8O 3JSNA 4G2KA 3OUSA 4FIPC 4N21A 3SR2C 4DV2O 1M57C 1AR5A 2IJKA 4YJ2B 1SQQH 1UFIA 2DQ0A 3JASA 4GZRB 3SJCC 4YJ3B 2R9RB 5IJ0B 4O4JA 3OR6C 3WG7B 2ZNJA 3TETA 3CX5F 3WB1A 3JAKB 3M7MX 1YF2A 3ABMC 1BQ0A 1R3LC 2VQFO 2YUAA 4XDJA 2HLDG 3P3NA 5ITZB 1BZKA 5LP6C 4MTGA 5LMUO 3K9AA 1V54B 1DGSA 1ZSPA 3CCVV 2F43G 1K33A 5KMGB 1EBOA 4OPAA 2HP8A 1SQBH 3E35A 1Q6UA 4X20B 1AR1B 1BL8A 1AB3A 1FKAO 2VQFB 3KZIZ 1Q8IA 2HR3A 4R50A 3L75H 2QWRB 1AI6A 5LMUB 5IDJA 4CS3A 2HJFC 2Q67A 4YIOA 1XDCA 2AW9A 2RJZA 2EIKB 2WPDG 3ETEA 4KL1A 4X66O 4WFBV 3UT5A 1DLBA 2B9ZA 2DN9A 2DWEC 2IJIA 5FLXN 3ZMUA 2WAMA 4UB6Z 2YI8A 4UUJC 1S5HC 2ZM6O 1KECA 4LP8A 1Y76A 4YHHB 5LL6Y 1H2LA 2PI4A 3LNNA 1OCZC 1SESA 5JJEB 4HBNA 2OCCC 4Z1VA 2CK3G 5KX5B 3ABKC 5IJ9A 1YTFD 3A0RA 2P67A 4O4HB 1M1KW 2ZM6B 2ZR3A 4U3JA 5KAFZ 3IGAC 1LUWA 1JR9A 4U3FH 1VQ4V 1TGOA 4NKGB 3QNEA 5B1BB 5DEDA 1BHAA 2YXHA 4DUYO 2BSKA 3B8MA 3H01A 3SYQA 2JRIA 2JGUA 4GCZA 1GRJA 1K73W 2JVDA 5FNVB 3CB2A 2CTRA 1ZL8A 1AR4A 4TV9A 5BMVB 3MD0A 2OTLV 5EK0A 2QM8A 4ABMA 2DYSB 4JI8O 3L9DA 3ZX6A 2XAHA 3CRQA 3ZRSA 4DR2B 4CZZA 3EVKA 1IBLO 3RYFA 2Y69C 1KMIZ 3EXAA 3X2QB 4GX0A 4DV7O 1FPOA 3QVNA 4BIZA 4JI8B 3ASOC 5J2UA 2GUZB 2Q7GA 1SETA 3ZHQA 5TISZ 2OCCB 1SS3A 4FLTA 4DV7B 3CD6V 1BMFG 4FK5C 3WFVA 1MABG 4CC5A 5K1XA 4RUEA 2E74B 4NXMO 5LA6A 3FB8C 3ZHTA 4DK0A 1XI1A 3KCYA 2IJJA 1SQVH 2RDCA 4PELA 2QWPB 5EIBC 3ZCCA 1FYJA 2HEPA 5JH7A 3NXSA 1E1QG 5FPOA 2BE3A 4LR3A 3FB7C 2ZXWC 1ENVA 5CMUA 5BY1A 5DM6V 1I5XA 3CCEV 4FM0A 3IC7A 1MMMA 4JI4O 3F7YC 2WLMA 4J7ZA 3H1HH 1VQKV 1B06A 2Y69B 3DXRB 1AI5A 4JF3A 1XQ8A 4UXNA 4IGGA 3MAQA 3I5DA 2PGGA 3OTFA 5JVDB 3QG5A 4P2ZA 1WAZA 1OCOC 4CH6A 1YJ9V 4JTDB 1RM1C 4MVSA 3S3WA 2A06H 4JI4B 3U11A 3OTOO 3ZRWA 1JFFA 4UCVA 3AG2C 1EN5A 2Q69A 3FD9A 1N8RW 4TOIA 4PA9A 4WBNA 1WP7A 2HVKC 2XAGA 2VQEO 1NU1H 2CUGA 2PTMA 1W0KG 4K3AA 2YICA 2UU9O 4IYIA 1CXZB 2X7RB 4I0XB 5AG2A 1GM7A 4JI3B 4O4IB 4MTXA 1VQ5V 1Q3EA 4TQFA 4NXNB 4JASA 3E86A 1I7FA 1EM1A 2E3CA 3ASNC 4JYYA 3K5OA 2FB5A 4B08A 3CJHA 1FXKA 3CRCA 3AG1C 1KBHA 4GKKO 3BAAA 5LGTA 4FFBA 3CC2V 3D36A 3T2MA 3HR0A 2DMXA 4ZOLA 4PJ0Z 2EJRA 4GX2A 1R6KA 1QCEA 2FL4A 3BA8A 5GONA 4H33A 3FAVB 4GKKB 4JI5B 1T5EA 2ZDIA 3AG4B 1PL0A 2EIJC 4QJFB 1BGYH 1XBLA 2QTOA 2UXDO 2ITCC 5LHGA 5GTIZ 4KHPO 3JARA 5IWAO 3RYHA 4ZI7B 2JGDA 3OFNG 2R9IA 4DR7O 4X1KA 3G4SV 3FFQA 4J41A 3ZIAG 5CB4A 1D5NA 4X1YB 2UXDB 3C3SA 1FFXB 1HR0O 3JALB 3T1HO 3JSLA 2Q0OC 1WPBA 4DR7B 1TAEA 3H1LH 3JCZA 2GBOA 3RGBA 1K97A 2AZ0A 2X6AA 4R8CA 2UXNA 2A9HA 2KG7B 3VQVA 3T1HB 1QLEC 1OJHA 1E79G 5B5EZ 3QO7A 4LFBO 1QQCA 3IC9A 4O2BB 3D8CA 3AG1B 5FL7G 3GWKC 4B3SB 4LF4O 2DJVA 3R66A 3RFRA 4R6ZA 3RYCA 4AI8A 1NTKH 1XL6A 4OX9O 4LFBB 1YDXA 5JQGA 4DRXA 2WA4A 1K4DC 3K58A 2JS3A 4QPJA 4LF4B 2QDOA 1NBMG 3W7WA 2XAJA 5EZYA 4X9QA 4R7CA 3G71V 1SA0A 3K03A 4QNHB
chains in the Genus database with same CATH topology
2Q0OC 1US6A 1CXZB 1URFA 4DYLA 1RFYA 4NB5A 2HJDA 4IGGA 4NKGB 2RMKB 1UPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q0O C;  1US6 A;  1CXZ B;  1URF A;  4DYL A;  1RFY A;  4NB5 A;  2HJD A;  4IGG A;  4NKG B;  2RMK B;  1UPG A; 
#chains in the Genus database with same CATH topology
 3JD4 A;  1PPJ H;  3H1I H;  4X65 O;  1HNW O;  1M9N A;  3VQY A;  3CME V;  4FLY A;  4MVU A;  1TUB B;  4FLX A;  3LNM B;  4JV5 O;  1WB8 A;  1V55 C;  3KCX A;  5IT9 N;  1GO3 F;  2LP7 A;  2V7Q G;  3ABL C;  2Q6A A;  4X65 B;  1HNW B;  3CHX A;  2RQ6 A;  4ZBM A;  2Q7E A;  5IYB O;  3JAS B;  2YXL A;  1D2D A;  4O4J B;  3TXQ A;  4JV5 B;  4KFM A;  5B1A B;  1QLE B;  1TUE B;  4PA6 A;  1N0N A;  4JI1 O;  2Q73 A;  2G38 A;  5IYC O;  2HHH O;  1XMQ B;  2IW5 A;  3UCS C;  1DK1 A;  2UXX A;  1K3E A;  1JPX A;  1R6N A;  2JIZ G;  3RW0 A;  2F93 B;  3DSQ A;  2CDY A;  4FFK A;  3JAM N;  4ASU G;  1FXH A;  4K35 A;  2WLK A;  4BIU A;  3M99 B;  4DV5 O;  4JYC A;  1OCC B;  4I5S A;  1XMO O;  2HHH B;  3ZMV A;  1H38 A;  4JAA A;  3SJB C;  2QKC A;  2FKX A;  4DR4 B;  4J42 A;  1RFY A;  4PI2 A;  2OTJ V;  1P7B A;  2MK3 A;  4DV5 B;  4ZKI A;  4LF6 O;  3UT5 B;  1XMO B;  2V1D A;  3F5W C;  1NQT A;  4EB6 A;  5IY5 B;  4DV4 O;  1S76 D;  2L35 A;  3L70 H;  1MA1 A;  3K04 A;  4E2L A;  1P49 A;  1V55 B;  2ZNI A;  4OXS A;  3SYC A;  1KUQ A;  3ABL B;  4DW1 A;  2YS8 A;  2HFE C;  4X89 A;  4HYO A;  5IJ9 B;  4DV4 B;  1JJO A;  2ODM A;  2YIA A;  2PY5 A;  4U3J B;  3FKS G;  4JAU A;  2LW7 A;  3J81 N;  4G28 B;  2GHY A;  1YI2 V;  3K79 A;  4B7E A;  1Q86 W;  4D7S A;  4LF9 O;  5J9P C;  4DYL A;  2DOS A;  4MVO A;  4UVB A;  2QSA A;  4LH6 A;  4DV0 O;  3KKY A;  1NI8 A;  4IT5 A;  3ZN1 A;  2O57 A;  1MOF A;  3SGI A;  4DXW A;  1WA8 B;  1H2N A;  2IM9 A;  1PV0 A;  2Y0P A;  1WP8 A;  3TXS A;  3P30 A;  4LF9 B;  1ZL8 B;  4TV9 B;  1EN4 A;  1YJN V;  3CRA A;  1P4R A;  3G6B A;  5B1B C;  4UFZ A;  5BXZ A;  4DV0 B;  3N2K A;  1J95 A;  5BR8 B;  1O9H A;  4GKJ O;  1GN2 A;  4J7K A;  4DV2 B;  1E1R G;  3CCQ V;  1S5L Z;  4P9P A;  2FTK A;  4CC6 A;  4UCT A;  2GV9 A;  1MNG A;  5A2Q N;  1KQS U;  1S5J A;  2WLL A;  4GKJ B;  3ML0 A;  1Y67 A;  2CE4 A;  3APO A;  2A7W A;  3MHH C;  1VQO V;  2DYS C;  2N05 A;  4TUY A;  3E8F A;  2E76 B;  5CBF A;  2KB1 A;  4XBF A;  4BIO A;  3O9O A;  1WB7 A;  2ITD C;  1K92 A;  3N27 A;  2MW2 B;  3X2Q C;  2PI5 A;  2QE7 G;  3LUT B;  1QU7 A;  4LWS B;  1FAF A;  5JCO A;  4I50 A;  5LA6 B;  1IUR A;  3ZHU A;  2UUB O;  1Z5V A;  2LQT A;  3FYE B;  1P84 F;  4JI6 O;  1AJP A;  1NJI W;  1N34 O;  1KKD A;  4MTO A;  1Q6I A;  4X66 B;  2GTA A;  2ATK C;  2CGN A;  1VEW A;  4DV6 O;  2PYJ A;  5JH7 B;  3JCU Z;  2EIM B;  2ZCE A;  3HKD A;  1S72 V;  5LYJ B;  1N34 B;  4N23 A;  1R73 A;  3ETD A;  3FX7 A;  4DR3 O;  1MG1 A;  1Z5W A;  4NR1 A;  1K8A W;  1K5Q A;  5GTH Z;  1I08 A;  4DV6 B;  3LDD A;  4JYA O;  1NKD A;  2YSU B;  4RWU A;  3HKE A;  4J80 A;  3CCL V;  3OMA B;  4WFG A;  1HNX O;  2NLJ C;  1VF7 A;  5IYZ A;  4U7N A;  3B40 A;  4DR3 B;  3E89 A;  5LHH A;  1NVP D;  4TSF G;  4DUY B;  4WFH A;  2L6L A;  3B09 A;  3TGU H;  3OMI B;  4CH4 A;  4QIW F;  5LOV A;  4B3R O;  2F23 A;  4JYA B;  1VF6 C;  3ZRW B;  1JFF B;  2M7W A;  1HNX B;  4YJ2 A;  5EC2 C;  4UV8 A;  1G6U A;  5IJ0 A;  3AG3 C;  2LJ2 A;  2AXT Z;  4FLW A;  1R1B A;  1PD3 A;  4F6R A;  4WBN B;  5KA6 A;  1QHT A;  3K0D A;  4YIP A;  1Y66 A;  2UUA O;  1Q6H A;  3K9S A;  4PA7 A;  4JGS A;  3CRM A;  3B4S A;  1I0H A;  1JX9 A;  3T1C A;  1IBL B;  3BCC H;  5LMN O;  3JAT A;  2H3O A;  4U7O A;  2JEX A;  2Z5U A;  3EHB B;  4H37 A;  5KMG A;  2F4V O;  2A0L A;  2YEV A;  3S3X A;  4EFE A;  4X20 A;  2HVJ C;  4UCS A;  3M8A A;  4RO2 A;  4UCU A;  1B6Q A;  2ETN A;  1N4C A;  4JTC B;  1YIT V;  1SC5 B;  1HW7 A;  5JJJ B;  3CJH B;  2WLI A;  1FXK B;  5KLV H;  4X62 O;  3CSX A;  1W59 A;  3HPL C;  5L3G A;  5BZB A;  1IXB A;  4PHZ A;  1L8D A;  4BW9 A;  1TVK A;  3W7S A;  4FFB B;  1YSC A;  2ADP A;  2EIN C;  2WA3 A;  4ZOL B;  4NXM B;  4LF7 O;  3BFR A;  5GON B;  5CA1 A;  4H13 B;  3L71 H;  4MVZ A;  2Q0A A;  4G27 B;  2YXY A;  5KHG A;  4O2A A;  2DYR B;  3RBZ A;  1NH2 D;  4MW8 A;  4KP4 A;  4LF7 B;  1VP7 A;  4O4H A;  1YVW A;  4DK1 A;  1VQM V;  2PF4 E;  3RYH B;  4DR1 O;  2JGD B;  2YIB D;  3AG3 B;  1WLE A;  3Q4H B;  2GSM B;  3IFX A;  4K8X A;  2ZR2 A;  5EIB D;  3AG4 C;  4FJC C;  1MZF A;  5C93 A;  2CAZ C;  5CB4 B;  2RN9 A;  4PA3 A;  2ARH A;  2VWJ A;  2ILM A;  1L1F A;  1VQN V;  2YI9 A;  5IE9 A;  2VS0 A;  1SER A;  2Y48 A;  4DR1 B;  5DN6 G;  5FNV A;  5B3S B;  3H9V A;  5LP6 A;  2XAQ A;  3K0G A;  2KQX A;  3STZ C;  2F1M A;  5BMV A;  4B7K A;  5L3E A;  5K1P A;  4HAM A;  1FXV A;  3DC5 A;  3F7V C;  4DV3 O;  3GB7 C;  5KUM A;  3OTO B;  1W2B U;  4O4L A;  3VQW A;  1R3I C;  1F51 A;  3LSS A;  4X1I A;  4FM1 A;  4BWA A;  3GVM A;  5KHJ A;  1I94 O;  4I55 A;  3RYC B;  2VQE B;  2EIN B;  3OT7 A;  4DV1 O;  4I4T A;  4Q20 A;  2QKA A;  4FM2 A;  2UU9 B;  1GM9 A;  4DR6 O;  1AP5 A;  1B3Q A;  2AZ2 A;  5EZY B;  2P4K A;  2EZO A;  4LFA O;  2CTW A;  4UV9 A;  4FPP A;  1NT2 B;  4MVQ A;  1SA0 B;  4LF8 O;  2R70 A;  4LNU A;  4DV1 B;  5C8Y A;  5J2T A;  2OT5 A;  3N2G A;  5CBG A;  4LC1 A;  2R9A A;  3QO5 A;  5LGN A;  1G1X B;  2EBO A;  2DQ3 A;  1F23 A;  3PN1 A;  2BTQ A;  2ZE7 A;  1EN6 A;  2QJ1 A;  2ZIM A;  2AHZ A;  3WB0 A;  3OAA G;  4LF8 B;  2HKO A;  4UVA A;  1N33 O;  2ADQ B;  5EBM C;  1Y74 A;  2XOK G;  2RNB A;  3HKB A;  3JAW B;  1BHB A;  2KKW A;  2ZD9 A;  4L8J A;  4EEQ A;  2X6C A;  2ZE8 A;  5KUK A;  1QLN A;  1U96 A;  3QF7 A;  2DWD C;  2QTS A;  2P90 A;  3OW2 U;  3L72 H;  2IJH A;  4KXR A;  1VAR A;  5IYD O;  4KHP B;  4JPR A;  1OCR C;  5IWA B;  5CA3 A;  4L87 A;  1K7D A;  1CP9 A;  1M4U A;  1L0L H;  2EX3 A;  2P22 C;  5EBW C;  2X0L A;  1YEW A;  5DEC A;  4IIJ A;  1I5Y A;  1WJZ A;  1BQZ A;  2AHY A;  4RAI A;  5LXT A;  2N04 A;  4DW0 A;  1XUQ A;  5JVD A;  1HR0 B;  2F95 B;  1ZWI C;  2W0F C;  1YCI A;  5B1A C;  1NR1 A;  4J9Y B;  1PM9 A;  1URF A;  1S3J A;  3D3Q A;  1SQF A;  2EJ7 A;  1FFT B;  2R72 A;  1Z2G A;  2XT9 A;  4RQF A;  4QGP A;  2LO1 A;  3QO8 A;  3LDE A;  2HJD A;  2CTQ A;  1N0J A;  4AHC A;  3J7A U;  1H8E G;  4EB6 B;  1F4M A;  1OCC C;  4JTA B;  1COW G;  1ZUQ A;  2YIB A;  2RCV A;  1EFR G;  1YXB A;  2A3Q A;  3WB2 A;  4O4I A;  3E22 B;  1JA8 A;  5JJN B;  4B3M O;  2DW4 A;  2EIL C;  3A0B Z;  2Q7H A;  2H8P C;  3D3I A;  3FB5 C;  4OX9 B;  1Y4M A;  1NZ6 A;  1Q5O A;  4GT1 A;  2BOC C;  4JZG A;  2E5L O;  4MS2 A;  5IY5 C;  3OMN B;  1GK9 A;  4B3M B;  3ZMS A;  3IAY A;  4PDM A;  4PDV A;  4J9Z B;  5E1A C;  1OCR B;  5CN0 A;  3W7T A;  1IZ3 A;  4IYH A;  3TK1 A;  3K5N A;  1M90 W;  3E83 A;  3FAV A;  1N32 O;  3SPI A;  4FVM A;  4ZHQ A;  1S77 D;  1HNZ O;  2ZT9 B;  4GYC B;  1GKF A;  1XIL A;  2P5O A;  4MTF A;  3NR7 A;  3N2K B;  1M5I A;  2X6B A;  3CPW U;  4HNA A;  5H2F Z;  4ZI7 A;  2ZE5 A;  4OPH A;  4CH3 A;  4PDL A;  3DC6 A;  1PL4 A;  2W0X A;  3JAL A;  4JI1 B;  1XOU A;  2WLL B;  3T4D A;  1ORQ C;  1ROP A;  2P4V A;  3MDS A;  1G4Y B;  1GN3 A;  2WSS G;  5EBL C;  3U10 A;  4TUY B;  3RT3 C;  2Y0I A;  3P3P A;  1XHZ A;  1N36 O;  3LSQ A;  2CTP A;  2EIL B;  3VOU A;  4TV8 A;  2LFR A;  1AP6 A;  1FS0 G;  1AVM A;  2LGW A;  2D2C B;  4MT8 A;  5KAI Z;  4QPK A;  4TWK A;  2K1E A;  4MSW C;  5H9C A;  3K57 A;  5B66 Z;  5KHK A;  4MVM A;  1Y76 B;  3VBB A;  3VQX A;  4NVP A;  3CP1 A;  1QNM A;  4NB5 A;  4LF6 B;  2B5U A;  4AIL C;  2IBZ H;  2E75 B;  1XL4 A;  3CC4 V;  3STL C;  4JI0 O;  1D5A A;  3E8G A;  1K34 A;  3K5M A;  3HKD B;  4CS2 A;  1QR8 A;  5JWP A;  3CCS V;  2BSK B;  1M56 C;  1JOY A;  1KKC A;  1XRE A;  3W7U A;  4NTX A;  1EZV H;  1YHQ V;  3E8H A;  5H6Q A;  2VWK A;  3HB3 B;  3HKE B;  2EIM C;  3UM7 A;  4W4L A;  3RWR D;  5F2V O;  3CRR A;  1OV9 A;  1ZTE A;  1KB9 F;  3WU2 Z;  3QTC A;  3RYI A;  1GAX A;  3BA9 A;  2HG5 C;  4FLU A;  1XEQ A;  3SYP A;  3ICX A;  5LOV B;  3O65 A;  1RPO A;  1NTZ H;  4ICG A;  2OWO A;  2DE0 X;  3RVY A;  3RYF B;  1HP8 A;  4F6R B;  2C2A A;  2CH7 A;  4X64 O;  1VIB A;  1PP9 H;  2QKS A;  3CS5 A;  4PD4 F;  5J2U B;  1SKV A;  4EKW A;  4J7J A;  3ETG A;  3JAT B;  5E79 Z;  5CA0 A;  4X64 B;  3HKC A;  1MSW D;  4GX1 A;  2V4D A;  2OYQ A;  4LBE C;  1AI7 A;  2YEV B;  3EFF K;  2LW1 A;  3THO A;  1Y6X A;  3ZMT A;  5KHH A;  2WLI B;  4AQY O;  5EYP A;  2Q9L A;  4YHH O;  1VQ9 V;  1TVK B;  2EUL A;  2A79 B;  2XTA A;  1M56 B;  5B1O A;  2D3O W;  4XDL A;  4YY3 O;  3L73 H;  2UUB B;  5D5Q A;  1AJQ A;  5A9G A;  4AQY B;  4UCO A;  4JI6 B;  5CA1 B;  1XHX A;  4IHJ A;  2QEX V;  4QE7 A;  3I55 V;  4I9W A;  1W0J G;  1FXK C;  2LFS A;  3H1J H;  2BTO A;  4O2A B;  4YY3 B;  4FMT A;  1VQ7 V;  3D36 C;  1F4N A;  1M57 B;  3BVO A;  3A8T A;  3P32 A;  2XUM A;  3SPC A;  2EZP A;  3CE2 A;  1VQP V;  4FZ0 A;  2QM4 A;  2QM7 A;  2P6J A;  3AG7 A;  3SPH A;  1F7Y A;  3T1Y O;  2ZDI C;  1YZB A;  3OEH G;  2DYR C;  3ABM B;  3ETQ A;  1RSO A;  3AK1 A;  3A0H Z;  4P9O A;  1WA8 A;  4I9Q A;  4B3T O;  4DR2 O;  1V9P A;  4DUZ O;  5LP6 B;  3MHS C;  4YJ3 A;  3K5L A;  5HFL A;  3T1Y B;  3GWO A;  3APQ A;  5LGU A;  3OM3 B;  3CCR V;  1BS3 A;  4K0K O;  3IJ4 A;  2M6Y A;  3ZBH A;  3K59 A;  3JAK A;  1ZAU A;  4H44 B;  1CEZ A;  4B3R B;  1H8H G;  2ZQM A;  3DGE A;  1YTF B;  2OCH A;  1GN6 A;  4B3T B;  4DUZ B;  1QR9 A;  4O4L B;  4H0L B;  5ITZ A;  1VQ8 V;  5B3S C;  1IBK O;  1WN7 A;  1IXM A;  4X1I B;  4K0K B;  1CPY A;  4FLV A;  2UXB O;  3BPZ A;  4I55 B;  3OGI B;  2UUA B;  1IDS A;  4I4T B;  3F5T A;  4BW5 A;  3CEI A;  4GUN A;  5LMN B;  3TJT A;  1IBK B;  1NR7 A;  1OCZ B;  2AGA A;  1OHH G;  4E4E A;  4ZIB A;  2UXB B;  1NVP B;  2F4V B;  1FD9 A;  3ABK B;  4LNU B;  4YXW G;  5C8Y B;  5J2T B;  4CH5 A;  4LWS A;  3I56 V;  3N2G B;  1L0N H;  2IH1 C;  5H5N A;  3ABU A;  4X62 B;  3ZN0 A;  3CXC U;  1H2K A;  5L3B A;  2BTQ B;  3ZHR A;  3JD0 A;  1IVS A;  1U97 A;  3U0Z A;  1JCH A;  4UCR A;  4WFF A;  2XHB A;  4LF5 O;  3ZRX A;  5KX5 A;  5B1N A;  3B77 A;  1JQ0 A;  3LDC A;  1Y74 B;  2F66 C;  1KD1 W;  3HKB B;  3OD4 A;  3JD2 A;  3JAR B;  1PNK A;  3K08 A;  2B1I A;  4QE9 A;  3ZHV A;  4X1K B;  3K3W A;  5LHI A;  5LYJ A;  4EFB A;  4X8A A;  4LF5 B;  3G67 A;  3C90 A;  2YID A;  3PJS K;  4XDK A;  3CCM V;  1B04 A;  2UUC O;  2QGN A;  1MSD A;  4X88 A;  3ZMZ A;  1WNS A;  1SZT A;  2PYL A;  4LFC O;  2Q8V A;  1VF5 B;  1KP2 A;  3JD3 A;  4IIJ B;  1ZLZ A;  3E2E A;  3ZRV A;  4KUM A;  2GTS A;  3CC7 V;  5LXT B;  3SDL A;  1BSM A;  3UQ8 A;  3ASO B;  1IBM O;  3RVZ A;  2UUC B;  4PV1 B;  2JJ1 G;  3A2F A;  4DR5 O;  4J10 A;  4LFC B;  5L3C A;  1SF9 A;  2WLN A;  3W7X A;  2XAS A;  4FLZ A;  3CCJ V;  4JI3 O;  1TA8 A;  3SJA C;  3H1K H;  1AI4 A;  4JAV A;  5H6R A;  1ARO P;  1IBM B;  4DV3 B;  4NXN O;  1SRY A;  1NH2 B;  4WCE V;  4DR5 B;  4JI7 O;  1VQL V;  3JYC A;  5JQG B;  3SJQ C;  2QR4 A;  4DRX B;  2GUZ A;  3CMA V;  4MVR A;  5HFM A;  3K06 A;  3OE7 G;  2YDE A;  1I94 B;  1IX9 A;  1K9M W;  4JI7 B;  2QWO B;  4OGQ B;  1K5S A;  1EZJ A;  1KP3 A;  1SQP H;  4DR6 B;  1Q90 D;  1Q7Y W;  2ZXW B;  1X4T A;  1R3J C;  3OR7 C;  3SPG A;  4JI5 O;  3DTU B;  4LFA B;  1YJW V;  1JMK C;  3CYO A;  4Z1M G;  4C7U A;  3RN4 A;  2JK5 C;  1WPX A;  4PI0 A;  4Z2W A;  4A5U B;  1QVF U;  3ZJZ A;  3E8B A;  3BY6 A;  3CXH F;  3JD1 A;  3CWB H;  5L3D A;  4K8Z A;  4ZHQ B;  1UJW B;  1N33 B;  4Q6G A;  2IH3 C;  1XNQ O;  4MW3 A;  1OCO B;  1X59 A;  1KC8 W;  2Q5Z A;  2H94 A;  1RM1 B;  3AK2 A;  4BR6 A;  1VF6 A;  4CBC A;  2W6I G;  2FML A;  3BHP A;  3ZHS A;  4HNA B;  3AG2 B;  2ZE6 A;  3Q4H A;  2QA4 V;  3DXR A;  1FJG O;  4UVC A;  1G8M A;  1PKX A;  3UO2 A;  1ZX3 A;  4I7Z B;  1XNQ B;  4D7T A;  1VQ6 V;  1NTM H;  1Q43 A;  2FYU H;  2NR5 A;  1J5E O;  1KU9 A;  2UXC O;  2NNU A;  4GX5 A;  3CCU V;  1FJG B;  4NTY A;  3ZS8 C;  3L74 H;  5D5P A;  4B3S O;  2YC0 A;  1P7G A;  4TV8 B;  2P7T C;  3G80 A;  1R6T A;  1XNR O;  3ASN B;  1J5E B;  4WFE A;  3OEE G;  2IU3 A;  2UXC B;  2Y4T A;  4I0X A;  4JZ2 A;  2P06 A;  4FZ1 A;  1BE3 H;  2JEU A;  3BAB A;  1SQG A;  5LBQ A;  2WWW A;  5L3F A;  1XNR B;  4PA4 A;  3ZED A;  1GMG A;  3LSU A;  2W6J G;  3SYA A;  1RPR A;  2Y4U A;  5JCO C;  4WF9 V;  4IL6 Z;  4NYK A;  3T4Z A;  1LR1 A;  3OGC C;  4RQE A;  2ZIO A;  2ZKO A;  2EIJ B;  3BEH A;  2OIG A;  2Q4P A;  4HZ3 A;  1PNM A;  1H2M A;  4J11 A;  1OZ0 A;  2BCC H;  1KYO F;  2NN4 A;  3FB6 C;  2B1G A;  4LH7 A;  1GH6 A;  2E5L B;  3TCU A;  2IU0 A;  1HDJ A;  2Q68 A;  3RYI B;  3KG2 A;  1RP3 B;  4JI2 O;  4W4K A;  3JAW A;  1N32 B;  1QBZ A;  2QWN B;  1HNZ B;  1XMQ O;  4WFA V;  1JJ2 U;  1QVG U;  4X1Y A;  2CH7 B;  1HWY A;  1FFX A;  1A32 A;  3AK3 A;  4JI2 B;  4F4L A;  5KHI A;  5FPR A;  4UB8 Z;  2K9P A;  1AJN A;  3UKM A;  1YIJ V;  2WLJ A;  4F6E A;  3ABT A;  1GN4 A;  1GM8 A;  1H2S B;  5EC1 C;  1BCC H;  2PZS A;  1S0V A;  3OUF A;  3FYI B;  5CA0 B;  1K4C C;  4CS4 A;  2XND G;  4DR4 O;  1SZX A;  2KSD A;  3HKC B;  2KG7 A;  1R3K C;  3WG7 C;  1DF5 A;  2JS5 A;  4TT3 G;  3SPJ A;  4O2B A;  4I50 B;  2BOB C;  1PNL A;  4RUF A;  1Q81 W;  1AIL A;  4DO2 A;  1N36 B;  5EYP B;  4TQD A;  1MZE A;  1THZ A;  3B2E E;  5GW7 A;  1LNQ A;  1V54 C;  4P30 A;  2CGO A;  2RMK B;  4LCU C;  1US6 A;  3SYO A;  1M93 A;  2GDS A;  1LUV A;  1H2G A;  4IHJ B;  1DF4 A;  4NTW A;  2N74 A;  3E22 A;  2OIE A;  4PDR A;  1DTO A;  2QWQ B;  2WLH A;  3R65 A;  1BT8 A;  3G6E V;  1JVM A;  3C3T A;  3J80 N;  3UO3 A;  2LGQ A;  2EIK C;  2XAF A;  3BRC A;  4JI0 B;  5KA5 A;  1UPG A;  3AEI A;  4D6T H;  1GTO A;  1SQX H;  2PUS A;  4JYB A;  2ZIN A;  1TUB A;  2Z0A A;  1Q82 W;  4BAY A;  1NS1 A;  5IYZ B;  2JDI G;  3B8N A;  1O9G A;  5CBH A;  2JJ2 G;  2Z3Y A;  2VRZ A;  4GLX A;  1RSO B;  1VMG A;  5BR8 O;  3JSN A;  4G2K A;  3OUS A;  4FIP C;  4N21 A;  3SR2 C;  4DV2 O;  1M57 C;  1AR5 A;  2IJK A;  4YJ2 B;  1SQQ H;  1UFI A;  2DQ0 A;  3JAS A;  4GZR B;  3SJC C;  4YJ3 B;  2R9R B;  5IJ0 B;  4O4J A;  3OR6 C;  3WG7 B;  2ZNJ A;  3TET A;  3CX5 F;  3WB1 A;  3JAK B;  3M7M X;  1YF2 A;  3ABM C;  1BQ0 A;  1R3L C;  2VQF O;  2YUA A;  4XDJ A;  2HLD G;  3P3N A;  5ITZ B;  1BZK A;  5LP6 C;  4MTG A;  5LMU O;  3K9A A;  1V54 B;  1DGS A;  1ZSP A;  3CCV V;  2F43 G;  1K33 A;  5KMG B;  1EBO A;  4OPA A;  2HP8 A;  1SQB H;  3E35 A;  1Q6U A;  4X20 B;  1AR1 B;  1BL8 A;  1AB3 A;  1FKA O;  2VQF B;  3KZI Z;  1Q8I A;  2HR3 A;  4R50 A;  3L75 H;  2QWR B;  1AI6 A;  5LMU B;  5IDJ A;  4CS3 A;  2HJF C;  2Q67 A;  4YIO A;  1XDC A;  2AW9 A;  2RJZ A;  2EIK B;  2WPD G;  3ETE A;  4KL1 A;  4X66 O;  4WFB V;  3UT5 A;  1DLB A;  2B9Z A;  2DN9 A;  2DWE C;  2IJI A;  5FLX N;  3ZMU A;  2WAM A;  4UB6 Z;  2YI8 A;  4UUJ C;  1S5H C;  2ZM6 O;  1KEC A;  4LP8 A;  1Y76 A;  4YHH B;  5LL6 Y;  1H2L A;  2PI4 A;  3LNN A;  1OCZ C;  1SES A;  5JJE B;  4HBN A;  2OCC C;  4Z1V A;  2CK3 G;  5KX5 B;  3ABK C;  5IJ9 A;  1YTF D;  3A0R A;  2P67 A;  4O4H B;  1M1K W;  2ZM6 B;  2ZR3 A;  4U3J A;  5KAF Z;  3IGA C;  1LUW A;  1JR9 A;  4U3F H;  1VQ4 V;  1TGO A;  4NKG B;  3QNE A;  5B1B B;  5DED A;  1BHA A;  2YXH A;  4DUY O;  2BSK A;  3B8M A;  3H01 A;  3SYQ A;  2JRI A;  2JGU A;  4GCZ A;  1GRJ A;  1K73 W;  2JVD A;  5FNV B;  3CB2 A;  2CTR A;  1ZL8 A;  1AR4 A;  4TV9 A;  5BMV B;  3MD0 A;  2OTL V;  5EK0 A;  2QM8 A;  4ABM A;  2DYS B;  4JI8 O;  3L9D A;  3ZX6 A;  2XAH A;  3CRQ A;  3ZRS A;  4DR2 B;  4CZZ A;  3EVK A;  1IBL O;  3RYF A;  2Y69 C;  1KMI Z;  3EXA A;  3X2Q B;  4GX0 A;  4DV7 O;  1FPO A;  3QVN A;  4BIZ A;  4JI8 B;  3ASO C;  5J2U A;  2GUZ B;  2Q7G A;  1SET A;  3ZHQ A;  5TIS Z;  2OCC B;  1SS3 A;  4FLT A;  4DV7 B;  3CD6 V;  1BMF G;  4FK5 C;  3WFV A;  1MAB G;  4CC5 A;  5K1X A;  4RUE A;  2E74 B;  4NXM O;  5LA6 A;  3FB8 C;  3ZHT A;  4DK0 A;  1XI1 A;  3KCY A;  2IJJ A;  1SQV H;  2RDC A;  4PEL A;  2QWP B;  5EIB C;  3ZCC A;  1FYJ A;  2HEP A;  5JH7 A;  3NXS A;  1E1Q G;  5FPO A;  2BE3 A;  4LR3 A;  3FB7 C;  2ZXW C;  1ENV A;  5CMU A;  5BY1 A;  5DM6 V;  1I5X A;  3CCE V;  4FM0 A;  3IC7 A;  1MMM A;  4JI4 O;  3F7Y C;  2WLM A;  4J7Z A;  3H1H H;  1VQK V;  1B06 A;  2Y69 B;  3DXR B;  1AI5 A;  4JF3 A;  1XQ8 A;  4UXN A;  4IGG A;  3MAQ A;  3I5D A;  2PGG A;  3OTF A;  5JVD B;  3QG5 A;  4P2Z A;  1WAZ A;  1OCO C;  4CH6 A;  1YJ9 V;  4JTD B;  1RM1 C;  4MVS A;  3S3W A;  2A06 H;  4JI4 B;  3U11 A;  3OTO O;  3ZRW A;  1JFF A;  4UCV A;  3AG2 C;  1EN5 A;  2Q69 A;  3FD9 A;  1N8R W;  4TOI A;  4PA9 A;  4WBN A;  1WP7 A;  2HVK C;  2XAG A;  2VQE O;  1NU1 H;  2CUG A;  2PTM A;  1W0K G;  4K3A A;  2YIC A;  2UU9 O;  4IYI A;  1CXZ B;  2X7R B;  4I0X B;  5AG2 A;  1GM7 A;  4JI3 B;  4O4I B;  4MTX A;  1VQ5 V;  1Q3E A;  4TQF A;  4NXN B;  4JAS A;  3E86 A;  1I7F A;  1EM1 A;  2E3C A;  3ASN C;  4JYY A;  3K5O A;  2FB5 A;  4B08 A;  3CJH A;  1FXK A;  3CRC A;  3AG1 C;  1KBH A;  4GKK O;  3BAA A;  5LGT A;  4FFB A;  3CC2 V;  3D36 A;  3T2M A;  3HR0 A;  2DMX A;  4ZOL A;  4PJ0 Z;  2EJR A;  4GX2 A;  1R6K A;  1QCE A;  2FL4 A;  3BA8 A;  5GON A;  4H33 A;  3FAV B;  4GKK B;  4JI5 B;  1T5E A;  2ZDI A;  3AG4 B;  1PL0 A;  2EIJ C;  4QJF B;  1BGY H;  1XBL A;  2QTO A;  2UXD O;  2ITC C;  5LHG A;  5GTI Z;  4KHP O;  3JAR A;  5IWA O;  3RYH A;  4ZI7 B;  2JGD A;  3OFN G;  2R9I A;  4DR7 O;  4X1K A;  3G4S V;  3FFQ A;  4J41 A;  3ZIA G;  5CB4 A;  1D5N A;  4X1Y B;  2UXD B;  3C3S A;  1FFX B;  1HR0 O;  3JAL B;  3T1H O;  3JSL A;  2Q0O C;  1WPB A;  4DR7 B;  1TAE A;  3H1L H;  3JCZ A;  2GBO A;  3RGB A;  1K97 A;  2AZ0 A;  2X6A A;  4R8C A;  2UXN A;  2A9H A;  2KG7 B;  3VQV A;  3T1H B;  1QLE C;  1OJH A;  1E79 G;  5B5E Z;  3QO7 A;  4LFB O;  1QQC A;  3IC9 A;  4O2B B;  3D8C A;  3AG1 B;  5FL7 G;  3GWK C;  4B3S B;  4LF4 O;  2DJV A;  3R66 A;  3RFR A;  4R6Z A;  3RYC A;  4AI8 A;  1NTK H;  1XL6 A;  4OX9 O;  4LFB B;  1YDX A;  5JQG A;  4DRX A;  2WA4 A;  1K4D C;  3K58 A;  2JS3 A;  4QPJ A;  4LF4 B;  2QDO A;  1NBM G;  3W7W A;  2XAJ A;  5EZY A;  4X9Q A;  4R7C A;  3G71 V;  1SA0 A;  3K03 A;  4QNH B; 
#chains in the Genus database with same CATH homology
 2Q0O C;  1US6 A;  1CXZ B;  1URF A;  4DYL A;  1RFY A;  4NB5 A;  2HJD A;  4IGG A;  4NKG B;  2RMK B;  1UPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...