1CXZB

Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
86
structure length
86
Chain Sequence
WSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-181))
total genus 38
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1cxzB00
4NB5A 1CXZB 4NKGB 4DYLA 1URFA 1US6A 1UPGA 2Q0OC 2HJDA 2RMKB 1RFYA 4IGGA
chains in the Genus database with same CATH superfamily
1FFXB 2R72A 1YJWV 4O4IA 1K73W 1Z2GA 4DR3O 1L0NH 1H2NA 2A0LA 2WLIB 3ZMVA 1RSOB 5GONB 2E74B 1SQQH 5A2QN 1V9PA 4UB8Z 4X64B 5L3FA 5LOVB 3ABTA 5L3DA 1VQ9V 4OGQB 3ZHTA 4CH3A 2QGNA 2HLDG 2QWOB 1IX9A 3RYHB 4PDMA 5KHHA 1QNMA 1B6QA 1BMFG 4DV6O 4H33A 1B06A 4O4IB 4DV5B 2FYUH 3BEHA 5IWAB 1AI7A 4WFHA 4ZHQA 3SR2C 4Z1MG 2P67A 2QWPB 4CS4A 2P06A 5K1PA 1Q5OA 1HNZO 4LF4B 2XHBA 2RMKB 1OHHG 4DXWA 1XDCA 1LUWA 1OCOB 4TUYA 2W6JG 1NTZH 3JD1A 3CJHA 1KECA 1N32B 3WU2Z 3U10A 2W6IG 2E5LB 1MOFA 5IY5C 4U7NA 5BR8O 5B1AC 4J80A 3AG7A 3RW0A 3MAQA 3SPIA 1V54B 1H2GA 4X1KB 2B5UA 2V4DA 1SQVH 3CCUV 4MVOA 1XBLA 3ZIAG 1K97A 5BY1A 3VOUA 3UT5B 4PDLA 1GN4A 5CA1A 3CYOA 4DV5O 1OJHA 5KAIZ 2HR3A 4TQDA 4QGPA 1JJ2U 1YF2A 2Q7HA 4LF8B 1TVKA 3M7MX 3B8MA 3ASNB 1HWYA 2LJ2A 1AJNA 2UU9O 3ZMSA 1K7DA 4IYHA 1VQPV 3OR6C 4TV9B 1XNRB 2ZINA 1OCCB 4PD4F 1Q86W 2KG7B 2WWWA 2YEVB 1O9GA 4WFFA 4LFBB 2EIKC 1IDSA 5J2TB 5IJ9A 1BZKA 1SERA 5JQGA 3JASA 3IC9A 4FLWA 4H44B 2L35A 2X6BA 4K0KO 3K5NA 3CSXA 3AG2B 5ITZB 4O2AB 2A06H 3TXSA 2ATKC 3GB7C 3IC7A 4LH7A 1US6A 2PF4E 2Q68A 1W0JG 2AHZA 5JH7B 1CPYA 5IT9N 2XTAA 2RDCA 4TSFG 4X1YB 3K9SA 1NR1A 1JFFA 4RO2A 3ABMB 1NVPD 4I4TA 1LR1A 1FS0G 3KCXA 3WB0A 1H2MA 3HKDA 2CK3G 3H01A 3JD2A 3AG1B 4BIUA 5EBWC 3CCEV 4B3TB 4FFBA 2P22C 4X8AA 4KL1A 2UU9B 4DR6O 3U0ZA 1QU7A 3U11A 2G38A 2IH3C 4O4LB 1QQCA 1Y76A 4NXMB 2F66C 4B3RO 5H5NA 2Q6AA 1PPJH 2E76B 4QPKA 1DF5A 2BSKB 1SQFA 4DV7O 2P4KA 4MVMA 2CH7A 1HNWB 1RM1B 3DTUB 4TUYB 2CTQA 1XQ8A 3J81N 2ZE7A 4RWUA 1GM7A 1I08A 5KLVH 1K4CC 2F4VO 2EIMB 2DJVA 4JZGA 2DWDC 1KKCA 1U96A 3HKCB 2DE0X 1OCRC 3K03A 2X6AA 5FNVA 5D5QA 1D2DA 1NKDA 3LNNA 3S3WA 3SYPA 1NH2D 2N05A 2QKAA 4LF9O 2GBOA 1AROP 3HKEB 3OAAG 2PZSA 2N74A 1HNWO 4FLVA 2ZXWC 2OT5A 3ZN1A 1JR9A 4YJ2A 1M1KW 4JI4O 2Y69C 4DR5B 3JATB 4B3RB 4K8ZA 2OTLV 4MTGA 3RWRD 3TGUH 1KQSU 1Y4MA 1PL0A 1YEWA 1WNSA 1X4TA 4DO2A 1EFRG 5LHIA 3CWBH 1QBZA 5LL6Y 3L74H 1RFYA 1E1QG 4JAAA 5LP6A 2Q73A 3CD6V 2UUAO 3JASB 1QR8A 5IE9A 1E79G 4UV8A 3BABA 4Z2WA 5EIBC 4O2AA 4X66B 4FM0A 3OD4A 4X1IA 1ENVA 2QSAA 4IGGA 3QF7A 4UXNA 2ADQB 5JVDB 1BHBA 4XBFA 2VWKA 2XAJA 4MVRA 2KKWA 1XNQB 2QWQB 5JCOC 4R7CA 1XHXA 4MTOA 5LP6C 1VQNV 1URFA 2AZ0A 1MZFA 4MVUA 2ZIOA 5LMUB 3ICXA 1J95A 1AILA 1WPBA 3CEIA 3AG2C 2OIGA 4JTDB 3JD0A 1V54C 4X20A 4KFMA 3HKDB 4X62B 4I4TB 2WA3A 4QIWF 4DV2B 2WLLB 3AK1A 3D3IA 3RN4A 1QR9A 4WF9V 1COWG 3GWOA 3K5OA 4FPPA 2WPDG 2LFSA 1L0LH 2BTOA 4I9WA 4FM1A 3DXRB 1OZ0A 3A8TA 3T4ZA 3CCVV 1ZAUA 2ZIMA 5CB4B 3PN1A 1SQGA 3CRMA 4LR3A 1AI6A 1FJGB 3E86A 2LQTA 5BR8B 3PJSK 4QPJA 2AXTZ 5DECA 3OE7G 1H2KA 4CZZA 1VARA 2M7WA 3VQWA 2C2AA 1NQTA 3CC7V 3L70H 1N8RW 4JI3B 4BWAA 4DV4B 1RM1C 1XOUA 3SYOA 3K06A 2JGDB 3CCLV 1GRJA 5FLXN 3O9OA 4AI8A 1PNLA 1H38A 1HNXO 2PUSA 1S5JA 1G6UA 4UB6Z 1FJGO 1FFXA 2YEVA 4FZ0A 4LWSA 1OCRB 3ZRXA 4JI2O 3O65A 2CDYA 2EINC 2UUBB 4PHZA 1FXHA 4FVMA 3MHHC 4JI5O 1M57C 3M99B 4IHJA 5B3SB 3CRRA 2KSDA 1Z5VA 5CA0B 1XILA 4BAYA 1I94B 1HNZB 2YSUB 1JPXA 5IJ0A 2GHYA 2F1MA 3WG7C 1K5SA 5J2UA 4JI6O 3JAWB 3ZRWB 2EJ7A 1VP7A 1XL4A 2A3QA 2OCCC 5IWAO 5LYJB 2DYSB 4DYLA 1N36O 3J7AU 3HB3B 1EZJA 4F4LA 4TV8B 4O4JB 4Q6GA 4YY3B 3HKBB 2XUMA 3ZS8C 2OWOA 1LUVA 2CAZC 4IL6Z 3UCSC 2HFEC 2D3OW 2ZE5A 4P9OA 2EBOA 4XDKA 5LBQA 1QHTA 2YI8A 3EVKA 5HFMA 3S3XA 5LGNA 1Z5WA 2EIMC 4J7JA 1ORQC 1L8DA 1FXVA 4CH4A 5EC2C 3QNEA 3OW2U 2QDOA 3DC5A 1XEQA 2VQFB 4UVCA 4JI8O 4DR4O 3MD0A 2VQEB 1VQLV 5IDJA 5IYZA 3OUSA 3SYCA 4EB6B 4DV3O 1GM9A 1WPXA 2VQEO 1YDXA 2LW7A 3B8NA 2JIZG 4RUEA 2Q9LA 2Y69B 5KX5A 1K8AW 3K9AA 2OIEA 4BW5A 1GN3A 1XL6A 3FX7A 1MNGA 3UO2A 4J7ZA 1GAXA 1AI4A 1U97A 4DR2B 4CH5A 1M56B 4DV1B 1HDJA 1M93A 5LA6A 2YIBA 4LFCB 4LF5O 1IVSA 4H13B 5E79Z 1TUBB 3FAVA 1QVFU 4LFBO 3N27A 3JD4A 1VQMV 1PNKA 3UM7A 1K9MW 5B1OA 4PI2A 3SJAC 1NTKH 2AZ2A 1FXKB 1M4UA 2ZDIC 3R65A 3R66A 5KUMA 3EXAA 1Q90D 4LF7O 5LXTB 1PP9H 3KKYA 4PA3A 3OT7A 4UCRA 2QEXV 2F93B 1NS1A 1AJPA 3K57A 2RCVA 3ABKC 4JASA 3RYFB 2HHHB 4GKKB 1NZ6A 1JFFB 3CCQV 4JI2B 5LHGA 3BPZA 3T1CA 1EN4A 5KHKA 1VQ7V 2NLJC 1DTOA 1FKAO 4O4HB 1I0HA 4MVQA 2BTQB 3K59A 3QTCA 2LP7A 1BL8A 1THZA 2IW5A 2YXHA 3D8CA 1T5EA 4EFBA 3RYIB 2F4VB 4K3AA 5L3GA 4DR6B 2DN9A 1M9NA 3LSUA 5KHGA 4LFCO 2E75B 5EZYB 3DGEA 5TISZ 5H6QA 3G67A 3LSSA 1Q8IA 1H8EG 1JJOA 4WFEA 5KA5A 3CRAA 1SA0B 2H3OA 3OM3B 1GH6A 2ZT9B 1P49A 4O2BB 3JAKB 2QE7G 3DSQA 4KHPO 3SJQC 1JMKC 4ZOLA 1SZTA 4JI7B 3G6BA 3L75H 2H8PC 3ZRSA 4DR4B 2WA4A 3L71H 2AHYA 3T2MA 2JGDA 4U3FH 2ZNJA 2CE4A 3H9VA 2UXCO 3CMAV 4UCSA 4LP8A 3A0RA 1VEWA 2Q0AA 4LF6O 4R6ZA 4FIPC 1Q3EA 1F4MA 4DV2O 3CX5F 3AG4C 1AVMA 3CMEV 3JSLA 4LNUB 4JYBA 3D36A 4BIOA 4U3JA 4LF6B 2B1IA 2Q4PA 4G28B 3E83A 3W7SA 1RP3B 2EZOA 2PYLA 5GTIZ 4H37A 1GK9A 1M5IA 1DGSA 1XNQO 3K0DA 1A32A 4FFKA 4J42A 1YSCA 5LA6B 3ZMTA 1FAFA 4UVBA 2F43G 4P2ZA 5LOVA 3TJTA 3JALB 4QNHB 4I50B 4LBEC 4NVPA 3OMNB 3W7WA 1IXBA 4B7EA 2DYSC 2JEXA 4L8JA 1NU1H 2HEPA 2H94A 2QKSA 5EK0A 3OR7C 1YTFB 1RPOA 3OMAB 1H2SB 1R1BA 4YIOA 3LDEA 1KKDA 2Q0OC 2NR5A 4UCOA 2BCCH 4NKGB 4PA4A 4P9PA 4PA9A 1IBLB 3GWKC 4JI3O 4DV4O 4NXNO 3ZMUA 1K5QA 3ETEA 4FLUA 2IJHA 1MSDA 4BIZA 3OEEG 1JA8A 4X1IB 3CCJV 3AG3B 3TXQA 3DC6A 4DW0A 1SETA 2ITCC 5IYCO 3WB2A 1SQBH 4F6EA 2QM8A 4DV6B 2ADPA 2F95B 2QM7A 3APOA 4GT1A 2RJZA 4B3SB 1VF6C 2P6JA 2O57A 4MSWC 2P4VA 2CTRA 1PD3A 1XUQA 2BOCC 5KMGB 2WAMA 4X1YA 1HNXB 2GV9A 2Q7GA 3RYCA 5CA0A 2PI4A 2HG5C 4GKJO 1R73A 4IYIA 5C8YB 1FXKC 2WSSG 3JAWA 1N0JA 1NT2B 3VBBA 2QR4A 1H8HG 4DUYB 1IBKB 5BMVA 2OCHA 2IBZH 3ABUA 3B77A 2YDEA 1EZVH 1X59A 1DF4A 2LGQA 1D5AA 4LCUC 2B9ZA 5JQGB 1YHQV 3BFRA 2XT9A 1N0NA 2WLHA 5LGUA 3VQVA 3D36C 4N21A 5CBFA 3KCYA 4DR1O 1HR0O 2Q5ZA 1BCCH 1BT8A 1F7YA 1I7FA 4Z1VA 4DV1O 2LO1A 5L3CA 3E2EA 4ZI7A 3T4DA 1AI5A 2JRIA 3JYCA 2WLIA 1WJZA 2DMXA 1PM9A 2XAHA 1OV9A 4DR7B 2DYRB 1Q6HA 1D5NA 4RAIA 2JS5A 4PELA 2ZM6O 1P4RA 1KU9A 4DUYO 2IM9A 5CA3A 2D2CB 1N34B 2CGNA 3A0HZ 4J41A 1G8MA 5LHHA 2DOSA 3OEHG 3CCMV 2DQ0A 2OYQA 4JPRA 4B3MO 3ZMZA 3UO3A 3Q4HA 3STZC 2PI5A 1Q6UA 2UUAB 2BTQA 1XNRO 1TUBA 1E1RG 5K1XA 3WG7B 4MW8A 2Z3YA 2UXBO 3HKBA 4YHHB 4DV0B 1YJNV 2DQ3A 1Y74B 3CRQA 4BW9A 4EFEA 4TQFA 4FLYA 4DR5O 1LNQA 2YIAA 2ILMA 4JI4B 1OCZC 4LH6A 1GMGA 3ASOB 4WFBV 3FD9A 4UFZA 1SF9A 2ARHA 3JATA 4J9YB 1K92A 4FK5C 4LF9B 2ETNA 3UT5A 2XAGA 3L73H 4JGSA 2EJRA 3CC2V 5CBHA 1RPRA 2BE3A 2X6CA 1KP3A 4I9QA 3TETA 1S72V 1ZL8B 2YXLA 4UVAA 2QTOA 1XREA 1YZBA 4X89A 3B2EE 2UXBB 1BE3H 2IH1C 3RYHA 1XMQB 1SC5B 5IJ9B 3E8FA 2LW1A 3QO7A 3ZBHA 3CXCU 3H1HH 4ZIBA 1Q43A 1VQ6V 3SJBC 3F7VC 5L3EA 2RN9A 4JZ2A 3X2QC 1JX9A 4O4JA 1VIBA 3MDSA 3TK1A 1CXZB 3ZHSA 1AP6A 4I0XB 3T1YB 1AP5A 3E22B 3RFRA 1M56C 2WLJA 1N33O 2K9PA 2UXDO 5IYDO 2P7TC 1FD9A 3ETQA 4IIJB 4JV5B 4HYOA 3RVZA 4DV7B 1W2BU 1M90W 4PDVA 4WFGA 4EEQA 3RT3C 3P32A 2CGOA 1AR1B 3ZHRA 3W7UA 3AG3C 1R3LC 4NXMO 3MHSC 3SYQA 1AR5A 3RYFA 2JJ1G 3JARB 5H9CA 2ZM6B 5HFLA 5IYBO 1FFTB 5KAFZ 2V7QG 4F6RA 3P30A 1V55C 1GM8A 5JCOA 4X1KA 4P30A 4NTXA 4FLXA 1BS3A 4GX1A 3SPHA 3JARA 2EINB 3DXRA 5DEDA 3QVNA 3CB2A 5J2TA 2XNDG 4B7KA 4JI1B 1S5HC 1Y74A 3OUFA 1EN6A 4DUZB 4MW3A 3LSQA 2KB1A 1ZTEA 4PA6A 4XDJA 1YTFD 4GX0A 4CS2A 2QJ1A 4KHPB 4OPHA 4JI5B 3IGAC 3CHXA 4YY3O 1H2LA 4I50A 3BY6A 2ITDC 1HW7A 4LF4O 3ZJZA 1UJWB 2YS8A 1N36B 3NXSA 4X9QA 3F5TA 1HP8A 1XMOB 3RVYA 5LGTA 2N04A 3ASOC 4PI0A 5FL7G 3L9DA 4DRXA 3BAAA 3SPGA 3THOA 4KUMA 1YCIA 3ZX6A 5JJJB 3E8HA 3SPCA 5GW7A 4MTFA 2ZD9A 1MSWD 4OXSA 2XOKG 1W59A 1YJ9V 2ZXWB 4LF7B 1JCHA 1OCOC 2FMLA 4YJ3B 3H1JH 1WA8A 3E22A 2QM4A 4QE9A 4WFAV 3JSNA 2WLMA 5J9PC 4I55A 3LUTB 4CC5A 4B3MB 4K35A 1NBMG 5DN6G 4HNAA 2Y0PA 4F6RB 1YITV 1BSMA 3K08A 5CBGA 1R3KC 3WFVA 1XHZA 4B3TO 2JJ2G 1GN2A 2DW4A 1IBMB 5CA1B 1WAZA 4EB6A 2L6LA 2GTAA 2XAQA 4N23A 4R8CA 2MW2B 4HZ3A 4DV3B 5LYJA 4UV9A 4X65O 5B66Z 1SZXA 4AHCA 4LFAB 1TUEB 2WLKA 4JAVA 4CH6A 1N34O 4DR1B 2GUZB 3LNMB 2QKCA 5B1NA 3N2GB 4IT5A 5H2FZ 1ZSPA 4X64O 1CEZA 2YI9A 3CJHB 1Y67A 2W0XA 4DK1A 5FNVB 2VRZA 5KUKA 1YI2V 4MVZA 4BR6A 4PJ0Z 1J5EO 1WP7A 4WBNB 4ZKIA 2CH7B 2QTSA 2Q67A 1KP2A 1KC8W 3IJ4A 3E89A 4K8XA 3C90A 2JVDA 2ODMA 4JI8B 5ITZA 1K34A 3OGIB 1R6NA 3P3NA 1R6TA 3BHPA 1SESA 2QWNB 2A7WA 3ZCCA 2Q7EA 2BOBC 4IHJB 1B04A 1P7GA 2EIJB 1KMIZ 4J9ZB 2X0LA 2JGUA 1ZX3A 3EHBB 4J7KA 5L3BA 3T1YO 3VQYA 1S5LZ 3T1HO 1EBOA 4FFBB 2EIJC 3SPJA 5B1BB 1SQPH 3RYIA 2JK5C 4WCEV 1EN5A 2HVKC 4ASUG 1ZWIC 5EBLC 2GDSA 3ZHUA 1XMQO 2FB5A 1UFIA 4DRXB 3K58A 4HNAB 3K79A 1BQ0A 1SQXH 2AW9A 3D3QA 2P5OA 2XAFA 2NNUA 1YVWA 1PNMA 1I94O 3ABKB 4UUJC 3JCZA 1SS3A 2XASA 4UCTA 1F23A 4NXNB 5CMUA 4O4HA 2EILB 4ZBMA 4FM2A 2ZE8A 3SGIA 1VQ8V 2P90A 1BGYH 3K04A 5KX5B 4I5SA 1V55B 3AK3A 4JTCB 4I7ZB 1QCEA 1TVKB 3ZEDA 1KB9F 4HAMA 3G80A 5JVDA 3P3PA 2ZE6A 3CE2A 5GTHZ 2R70A 4AQYO 3CCRV 4GYCB 5DM6V 4QJFB 5C8YA 1P7BA 1Y66A 1WA8B 1IZ3A 2V1DA 3G6EV 1IXMA 1MA1A 4JYAO 3AEIA 4RQEA 4GX2A 2YICA 3C3SA 1GKFA 1FXKA 3B4SA 3H1KH 5H6RA 3J80N 2ZNIA 4GLXA 4YHHO 4DV0O 1M57B 3G71V 1VF7A 1Y76B 4JI1O 5IYZB 1AR4A 3JALA 3I55V 2IJJA 3W7TA 2R9RB 4W4LA 1OCZB 3QO8A 1VF5B 4XDLA 3K5MA 1MMMA 3OMIB 3A2FA 5JJNB 2CTPA 2R9AA 1QLEC 4RQFA 2PY5A 3JD3A 1K4DC 4LF5B 1W0KG 1Y6XA 2IU3A 3FFQA 4ZI7B 4FLZA 2IJIA 2VQFO 2Q69A 1S76D 2EULA 2FL4A 3H1LH 4TT3G 5F2VO 3OTOO 4PA7A 3G4SV 4NB5A 5EIBD 1XI1A 2HKOA 2ZDIA 1UPGA 4YIPA 5LMNB 3K3WA 3OGCC 1K33A 1VQ4V 5EC1C 2UXNA 3N2KB 5B1AB 3HKEA 3ZRWA 1G4YB 3KG2A 3CC4V 2YIBD 1S3JA 4UCUA 1WN7A 1ZUQA 5AG2A 4NTWA 2F23A 4LNUA 3AK2A 4QE7A 3CS5A 2UUCB 1R3JC 3ABLC 4JTAB 1VQ5V 4ZOLB 1NVPB 4KP4A 3E35A 1R3IC 4LWSB 1RSOA 5GONA 4LF8O 1IBKO 3RBZA 4LFAO 1N4CA 5KMGA 4JI7O 2WLLA 2HJFC 1OCCC 2NN4A 3SYAA 4CS3A 5J2UB 4YJ3A 4AILC 1KBHA 1Q82W 4JI6B 1IBMO 1JOYA 3OFNG 2M6YA 1JVMA 2X7RB 4MT8A 4E4EA 4NYKA 3F7YC 1NI8A 3F5WC 4JYCA 5B5EZ 4IIJA 3FKSG 4B3SO 1G1XB 3GVMA 3SDLA 2MK3A 4GKJB 3CCSV 3L72H 2OTJV 1TA8A 2PYJA 3CPWU 1KYOF 3Q4HB 5JJEB 2Y4UA 4GX5A 4AQYB 1EM1A 4LC1A 3ZHQA 1XMOO 2EILC 4C7UA 5JWPA 5FPOA 2Y0IA 2HHHO 1VF6A 1PV0A 2FTKA 4GKKO 4OPAA 1R6KA 2PGGA 3BVOA 4U7OA 2E5LO 3ZRVA 3UQ8A 3W7XA 4NR1A 3FB7C 4GCZA 1IURA 1N32O 5CB4A 3E8GA 4DUZO 4HBNA 1NTMH 3APQA 3FAVB 1SRYA 5B3SC 3CP1A 4G27B 1S77D 3QO5A 1VQOV 1NH2B 1GTOA 1F4NA 2DWEC 3ZN0A 5B1BC 3HR0A 4TV8A 3AG1C 1WB7A 1KD1W 1FPOA 2PTMA 1IBLO 4PV1B 4PDRA 3IFXA 5EYPB 2IJKA 2YIDA 4U3JB 2JEUA 1WP8A 4DR2O 4ICGA 2EX3A 4W4KA 4YXWG 2VS0A 1TAEA 1O9HA 3FB8C 3ML0A 5E1AC 1QLEB 2ZKOA 4K0KB 4B08A 5JH7A 1MZEA 2ZR3A 1K3EA 2HJDA 4DK0A 2ZQMA 3VQXA 3B09A 3N2GA 1P84F 3H1IH 1J5EB 1F51A 1MABG 4X65B 1VMGA 3JCUZ 1PL4A 3STLC 2FKXA 1SKVA 4D7SA 4O4LA 2KQXA 3BRCA 5EZYA 3E8BA 2E3CA 4YJ2B 1Q6IA 2WLNA 4UCVA 4KXRA 5CN0A 1S0VA 4FJCC 3RYCB 4I55B 2CUGA 2KG7A 4FLTA 3WB1A 1BHAA 1YXBA 2BSKA 4X66O 4GZRB 1QLNA 1Q7YW 4JYAB 3LDCA 4GUNA 4FMTA 1GO3F 4MS2A 2K1EA 1HR0B 3I5DA 3CXHF 2A9HA 5D5PA 3X2QB 5BMVB 2ZCEA 4JV5O 1L1FA 4JF3A 2QWRB 3BA8A 2UXCB 1FYJA 5KHIA 3JAKA 4OX9O 3I56V 4J10A 1N33B 3ASNC 2Z5UA 2UXDB 1SA0A 4O2BA 2QA4V 5LP6B 5BXZA 4MVSA 2GUZA 4ABMA 4ZHQB 1KUQA 2UUBO 3IAYA 2LFRA 3TCUA 3FB5C 1ZL8A 3JAMN 4JI0B 2IU0A 2RNBA 5BZBA 4CC6A 4JYYA 4I0XA 4JI0O 1WB8A 5FPRA 3ZHVA 4WBNA 2JS3A 5IY5B 1YIJV 4DW1A 4A5UB 1B3QA 3ABLB 2GTSA 1BQZA 2LGWA 3ETGA 1WLEA 4FZ1A 4EKWA 3K5LA 3SJCC 3B40A 4OX9B 4J11A 3BA9A 2HVJC 2ZR2A 4G2KA 1AB3A 1CP9A 5LXTA 3EFFK 3LDDA 2B1GA 1DLBA 3UKMA 4Q20A 4DR3B 3N2KA 1AJQA 4E2LA 2Z0AA 1PKXA 5EBMC 4MTXA 3T1HB 1GN6A 1I5YA 2JDIG 2VWJA 4TOIA 5A9GA 1NJIW 2CTWA 4D7TA 1VQKV 2YXYA 3KZIZ 3QG5A 5IJ0B 2AGAA 3HKCA 3FYEB 3BCCH 2YUAA 5EYPA 2EIKB 4X20B 3NR7A 1QVGU 1ZLZA 2UXXA 5C93A 1Q81W 4NTYA 5KA6A 4L87A 2UUCO 2YC0A 3RGBA 1NR7A 4TWKA 4H0LB 2A79B 3K0GA 2HP8A 3FB6C 4X88A 4X62O 3ETDA 2DYRC 2EZPA 1MG1A 1ROPA 2R9IA 3FYIB 2Y48A 3CRCA 1I5XA 5KHJA 2Q8VA 3OTOB 2W0FC 3AG4B 5LMUO 4D6TH 5LMNO 4R50A 3OTFA 1JQ0A 2GSMB 3A0BZ 4DR7O 3ABMC 2Y4TA 4JAUA 3C3TA 1DK1A 4RUFA 4TV9A 4CBCA 1TGOA 2RQ6A 3HPLC 3M8AA 2OCCB
chains in the Genus database with same CATH topology
4NB5A 1CXZB 4NKGB 4DYLA 1URFA 1US6A 1UPGA 2Q0OC 2HJDA 2RMKB 1RFYA 4IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB5 A;  1CXZ B;  4NKG B;  4DYL A;  1URF A;  1US6 A;  1UPG A;  2Q0O C;  2HJD A;  2RMK B;  1RFY A;  4IGG A; 
#chains in the Genus database with same CATH topology
 1FFX B;  2R72 A;  1YJW V;  4O4I A;  1K73 W;  1Z2G A;  4DR3 O;  1L0N H;  1H2N A;  2A0L A;  2WLI B;  3ZMV A;  1RSO B;  5GON B;  2E74 B;  1SQQ H;  5A2Q N;  1V9P A;  4UB8 Z;  4X64 B;  5L3F A;  5LOV B;  3ABT A;  5L3D A;  1VQ9 V;  4OGQ B;  3ZHT A;  4CH3 A;  2QGN A;  2HLD G;  2QWO B;  1IX9 A;  3RYH B;  4PDM A;  5KHH A;  1QNM A;  1B6Q A;  1BMF G;  4DV6 O;  4H33 A;  1B06 A;  4O4I B;  4DV5 B;  2FYU H;  3BEH A;  5IWA B;  1AI7 A;  4WFH A;  4ZHQ A;  3SR2 C;  4Z1M G;  2P67 A;  2QWP B;  4CS4 A;  2P06 A;  5K1P A;  1Q5O A;  1HNZ O;  4LF4 B;  2XHB A;  2RMK B;  1OHH G;  4DXW A;  1XDC A;  1LUW A;  1OCO B;  4TUY A;  2W6J G;  1NTZ H;  3JD1 A;  3CJH A;  1KEC A;  1N32 B;  3WU2 Z;  3U10 A;  2W6I G;  2E5L B;  1MOF A;  5IY5 C;  4U7N A;  5BR8 O;  5B1A C;  4J80 A;  3AG7 A;  3RW0 A;  3MAQ A;  3SPI A;  1V54 B;  1H2G A;  4X1K B;  2B5U A;  2V4D A;  1SQV H;  3CCU V;  4MVO A;  1XBL A;  3ZIA G;  1K97 A;  5BY1 A;  3VOU A;  3UT5 B;  4PDL A;  1GN4 A;  5CA1 A;  3CYO A;  4DV5 O;  1OJH A;  5KAI Z;  2HR3 A;  4TQD A;  4QGP A;  1JJ2 U;  1YF2 A;  2Q7H A;  4LF8 B;  1TVK A;  3M7M X;  3B8M A;  3ASN B;  1HWY A;  2LJ2 A;  1AJN A;  2UU9 O;  3ZMS A;  1K7D A;  4IYH A;  1VQP V;  3OR6 C;  4TV9 B;  1XNR B;  2ZIN A;  1OCC B;  4PD4 F;  1Q86 W;  2KG7 B;  2WWW A;  2YEV B;  1O9G A;  4WFF A;  4LFB B;  2EIK C;  1IDS A;  5J2T B;  5IJ9 A;  1BZK A;  1SER A;  5JQG A;  3JAS A;  3IC9 A;  4FLW A;  4H44 B;  2L35 A;  2X6B A;  4K0K O;  3K5N A;  3CSX A;  3AG2 B;  5ITZ B;  4O2A B;  2A06 H;  3TXS A;  2ATK C;  3GB7 C;  3IC7 A;  4LH7 A;  1US6 A;  2PF4 E;  2Q68 A;  1W0J G;  2AHZ A;  5JH7 B;  1CPY A;  5IT9 N;  2XTA A;  2RDC A;  4TSF G;  4X1Y B;  3K9S A;  1NR1 A;  1JFF A;  4RO2 A;  3ABM B;  1NVP D;  4I4T A;  1LR1 A;  1FS0 G;  3KCX A;  3WB0 A;  1H2M A;  3HKD A;  2CK3 G;  3H01 A;  3JD2 A;  3AG1 B;  4BIU A;  5EBW C;  3CCE V;  4B3T B;  4FFB A;  2P22 C;  4X8A A;  4KL1 A;  2UU9 B;  4DR6 O;  3U0Z A;  1QU7 A;  3U11 A;  2G38 A;  2IH3 C;  4O4L B;  1QQC A;  1Y76 A;  4NXM B;  2F66 C;  4B3R O;  5H5N A;  2Q6A A;  1PPJ H;  2E76 B;  4QPK A;  1DF5 A;  2BSK B;  1SQF A;  4DV7 O;  2P4K A;  4MVM A;  2CH7 A;  1HNW B;  1RM1 B;  3DTU B;  4TUY B;  2CTQ A;  1XQ8 A;  3J81 N;  2ZE7 A;  4RWU A;  1GM7 A;  1I08 A;  5KLV H;  1K4C C;  2F4V O;  2EIM B;  2DJV A;  4JZG A;  2DWD C;  1KKC A;  1U96 A;  3HKC B;  2DE0 X;  1OCR C;  3K03 A;  2X6A A;  5FNV A;  5D5Q A;  1D2D A;  1NKD A;  3LNN A;  3S3W A;  3SYP A;  1NH2 D;  2N05 A;  2QKA A;  4LF9 O;  2GBO A;  1ARO P;  3HKE B;  3OAA G;  2PZS A;  2N74 A;  1HNW O;  4FLV A;  2ZXW C;  2OT5 A;  3ZN1 A;  1JR9 A;  4YJ2 A;  1M1K W;  4JI4 O;  2Y69 C;  4DR5 B;  3JAT B;  4B3R B;  4K8Z A;  2OTL V;  4MTG A;  3RWR D;  3TGU H;  1KQS U;  1Y4M A;  1PL0 A;  1YEW A;  1WNS A;  1X4T A;  4DO2 A;  1EFR G;  5LHI A;  3CWB H;  1QBZ A;  5LL6 Y;  3L74 H;  1RFY A;  1E1Q G;  4JAA A;  5LP6 A;  2Q73 A;  3CD6 V;  2UUA O;  3JAS B;  1QR8 A;  5IE9 A;  1E79 G;  4UV8 A;  3BAB A;  4Z2W A;  5EIB C;  4O2A A;  4X66 B;  4FM0 A;  3OD4 A;  4X1I A;  1ENV A;  2QSA A;  4IGG A;  3QF7 A;  4UXN A;  2ADQ B;  5JVD B;  1BHB A;  4XBF A;  2VWK A;  2XAJ A;  4MVR A;  2KKW A;  1XNQ B;  2QWQ B;  5JCO C;  4R7C A;  1XHX A;  4MTO A;  5LP6 C;  1VQN V;  1URF A;  2AZ0 A;  1MZF A;  4MVU A;  2ZIO A;  5LMU B;  3ICX A;  1J95 A;  1AIL A;  1WPB A;  3CEI A;  3AG2 C;  2OIG A;  4JTD B;  3JD0 A;  1V54 C;  4X20 A;  4KFM A;  3HKD B;  4X62 B;  4I4T B;  2WA3 A;  4QIW F;  4DV2 B;  2WLL B;  3AK1 A;  3D3I A;  3RN4 A;  1QR9 A;  4WF9 V;  1COW G;  3GWO A;  3K5O A;  4FPP A;  2WPD G;  2LFS A;  1L0L H;  2BTO A;  4I9W A;  4FM1 A;  3DXR B;  1OZ0 A;  3A8T A;  3T4Z A;  3CCV V;  1ZAU A;  2ZIM A;  5CB4 B;  3PN1 A;  1SQG A;  3CRM A;  4LR3 A;  1AI6 A;  1FJG B;  3E86 A;  2LQT A;  5BR8 B;  3PJS K;  4QPJ A;  2AXT Z;  5DEC A;  3OE7 G;  1H2K A;  4CZZ A;  1VAR A;  2M7W A;  3VQW A;  2C2A A;  1NQT A;  3CC7 V;  3L70 H;  1N8R W;  4JI3 B;  4BWA A;  4DV4 B;  1RM1 C;  1XOU A;  3SYO A;  3K06 A;  2JGD B;  3CCL V;  1GRJ A;  5FLX N;  3O9O A;  4AI8 A;  1PNL A;  1H38 A;  1HNX O;  2PUS A;  1S5J A;  1G6U A;  4UB6 Z;  1FJG O;  1FFX A;  2YEV A;  4FZ0 A;  4LWS A;  1OCR B;  3ZRX A;  4JI2 O;  3O65 A;  2CDY A;  2EIN C;  2UUB B;  4PHZ A;  1FXH A;  4FVM A;  3MHH C;  4JI5 O;  1M57 C;  3M99 B;  4IHJ A;  5B3S B;  3CRR A;  2KSD A;  1Z5V A;  5CA0 B;  1XIL A;  4BAY A;  1I94 B;  1HNZ B;  2YSU B;  1JPX A;  5IJ0 A;  2GHY A;  2F1M A;  3WG7 C;  1K5S A;  5J2U A;  4JI6 O;  3JAW B;  3ZRW B;  2EJ7 A;  1VP7 A;  1XL4 A;  2A3Q A;  2OCC C;  5IWA O;  5LYJ B;  2DYS B;  4DYL A;  1N36 O;  3J7A U;  3HB3 B;  1EZJ A;  4F4L A;  4TV8 B;  4O4J B;  4Q6G A;  4YY3 B;  3HKB B;  2XUM A;  3ZS8 C;  2OWO A;  1LUV A;  2CAZ C;  4IL6 Z;  3UCS C;  2HFE C;  2D3O W;  2ZE5 A;  4P9O A;  2EBO A;  4XDK A;  5LBQ A;  1QHT A;  2YI8 A;  3EVK A;  5HFM A;  3S3X A;  5LGN A;  1Z5W A;  2EIM C;  4J7J A;  1ORQ C;  1L8D A;  1FXV A;  4CH4 A;  5EC2 C;  3QNE A;  3OW2 U;  2QDO A;  3DC5 A;  1XEQ A;  2VQF B;  4UVC A;  4JI8 O;  4DR4 O;  3MD0 A;  2VQE B;  1VQL V;  5IDJ A;  5IYZ A;  3OUS A;  3SYC A;  4EB6 B;  4DV3 O;  1GM9 A;  1WPX A;  2VQE O;  1YDX A;  2LW7 A;  3B8N A;  2JIZ G;  4RUE A;  2Q9L A;  2Y69 B;  5KX5 A;  1K8A W;  3K9A A;  2OIE A;  4BW5 A;  1GN3 A;  1XL6 A;  3FX7 A;  1MNG A;  3UO2 A;  4J7Z A;  1GAX A;  1AI4 A;  1U97 A;  4DR2 B;  4CH5 A;  1M56 B;  4DV1 B;  1HDJ A;  1M93 A;  5LA6 A;  2YIB A;  4LFC B;  4LF5 O;  1IVS A;  4H13 B;  5E79 Z;  1TUB B;  3FAV A;  1QVF U;  4LFB O;  3N27 A;  3JD4 A;  1VQM V;  1PNK A;  3UM7 A;  1K9M W;  5B1O A;  4PI2 A;  3SJA C;  1NTK H;  2AZ2 A;  1FXK B;  1M4U A;  2ZDI C;  3R65 A;  3R66 A;  5KUM A;  3EXA A;  1Q90 D;  4LF7 O;  5LXT B;  1PP9 H;  3KKY A;  4PA3 A;  3OT7 A;  4UCR A;  2QEX V;  2F93 B;  1NS1 A;  1AJP A;  3K57 A;  2RCV A;  3ABK C;  4JAS A;  3RYF B;  2HHH B;  4GKK B;  1NZ6 A;  1JFF B;  3CCQ V;  4JI2 B;  5LHG A;  3BPZ A;  3T1C A;  1EN4 A;  5KHK A;  1VQ7 V;  2NLJ C;  1DTO A;  1FKA O;  4O4H B;  1I0H A;  4MVQ A;  2BTQ B;  3K59 A;  3QTC A;  2LP7 A;  1BL8 A;  1THZ A;  2IW5 A;  2YXH A;  3D8C A;  1T5E A;  4EFB A;  3RYI B;  2F4V B;  4K3A A;  5L3G A;  4DR6 B;  2DN9 A;  1M9N A;  3LSU A;  5KHG A;  4LFC O;  2E75 B;  5EZY B;  3DGE A;  5TIS Z;  5H6Q A;  3G67 A;  3LSS A;  1Q8I A;  1H8E G;  1JJO A;  4WFE A;  5KA5 A;  3CRA A;  1SA0 B;  2H3O A;  3OM3 B;  1GH6 A;  2ZT9 B;  1P49 A;  4O2B B;  3JAK B;  2QE7 G;  3DSQ A;  4KHP O;  3SJQ C;  1JMK C;  4ZOL A;  1SZT A;  4JI7 B;  3G6B A;  3L75 H;  2H8P C;  3ZRS A;  4DR4 B;  2WA4 A;  3L71 H;  2AHY A;  3T2M A;  2JGD A;  4U3F H;  2ZNJ A;  2CE4 A;  3H9V A;  2UXC O;  3CMA V;  4UCS A;  4LP8 A;  3A0R A;  1VEW A;  2Q0A A;  4LF6 O;  4R6Z A;  4FIP C;  1Q3E A;  1F4M A;  4DV2 O;  3CX5 F;  3AG4 C;  1AVM A;  3CME V;  3JSL A;  4LNU B;  4JYB A;  3D36 A;  4BIO A;  4U3J A;  4LF6 B;  2B1I A;  2Q4P A;  4G28 B;  3E83 A;  3W7S A;  1RP3 B;  2EZO A;  2PYL A;  5GTI Z;  4H37 A;  1GK9 A;  1M5I A;  1DGS A;  1XNQ O;  3K0D A;  1A32 A;  4FFK A;  4J42 A;  1YSC A;  5LA6 B;  3ZMT A;  1FAF A;  4UVB A;  2F43 G;  4P2Z A;  5LOV A;  3TJT A;  3JAL B;  4QNH B;  4I50 B;  4LBE C;  4NVP A;  3OMN B;  3W7W A;  1IXB A;  4B7E A;  2DYS C;  2JEX A;  4L8J A;  1NU1 H;  2HEP A;  2H94 A;  2QKS A;  5EK0 A;  3OR7 C;  1YTF B;  1RPO A;  3OMA B;  1H2S B;  1R1B A;  4YIO A;  3LDE A;  1KKD A;  2Q0O C;  2NR5 A;  4UCO A;  2BCC H;  4NKG B;  4PA4 A;  4P9P A;  4PA9 A;  1IBL B;  3GWK C;  4JI3 O;  4DV4 O;  4NXN O;  3ZMU A;  1K5Q A;  3ETE A;  4FLU A;  2IJH A;  1MSD A;  4BIZ A;  3OEE G;  1JA8 A;  4X1I B;  3CCJ V;  3AG3 B;  3TXQ A;  3DC6 A;  4DW0 A;  1SET A;  2ITC C;  5IYC O;  3WB2 A;  1SQB H;  4F6E A;  2QM8 A;  4DV6 B;  2ADP A;  2F95 B;  2QM7 A;  3APO A;  4GT1 A;  2RJZ A;  4B3S B;  1VF6 C;  2P6J A;  2O57 A;  4MSW C;  2P4V A;  2CTR A;  1PD3 A;  1XUQ A;  2BOC C;  5KMG B;  2WAM A;  4X1Y A;  1HNX B;  2GV9 A;  2Q7G A;  3RYC A;  5CA0 A;  2PI4 A;  2HG5 C;  4GKJ O;  1R73 A;  4IYI A;  5C8Y B;  1FXK C;  2WSS G;  3JAW A;  1N0J A;  1NT2 B;  3VBB A;  2QR4 A;  1H8H G;  4DUY B;  1IBK B;  5BMV A;  2OCH A;  2IBZ H;  3ABU A;  3B77 A;  2YDE A;  1EZV H;  1X59 A;  1DF4 A;  2LGQ A;  1D5A A;  4LCU C;  2B9Z A;  5JQG B;  1YHQ V;  3BFR A;  2XT9 A;  1N0N A;  2WLH A;  5LGU A;  3VQV A;  3D36 C;  4N21 A;  5CBF A;  3KCY A;  4DR1 O;  1HR0 O;  2Q5Z A;  1BCC H;  1BT8 A;  1F7Y A;  1I7F A;  4Z1V A;  4DV1 O;  2LO1 A;  5L3C A;  3E2E A;  4ZI7 A;  3T4D A;  1AI5 A;  2JRI A;  3JYC A;  2WLI A;  1WJZ A;  2DMX A;  1PM9 A;  2XAH A;  1OV9 A;  4DR7 B;  2DYR B;  1Q6H A;  1D5N A;  4RAI A;  2JS5 A;  4PEL A;  2ZM6 O;  1P4R A;  1KU9 A;  4DUY O;  2IM9 A;  5CA3 A;  2D2C B;  1N34 B;  2CGN A;  3A0H Z;  4J41 A;  1G8M A;  5LHH A;  2DOS A;  3OEH G;  3CCM V;  2DQ0 A;  2OYQ A;  4JPR A;  4B3M O;  3ZMZ A;  3UO3 A;  3Q4H A;  3STZ C;  2PI5 A;  1Q6U A;  2UUA B;  2BTQ A;  1XNR O;  1TUB A;  1E1R G;  5K1X A;  3WG7 B;  4MW8 A;  2Z3Y A;  2UXB O;  3HKB A;  4YHH B;  4DV0 B;  1YJN V;  2DQ3 A;  1Y74 B;  3CRQ A;  4BW9 A;  4EFE A;  4TQF A;  4FLY A;  4DR5 O;  1LNQ A;  2YIA A;  2ILM A;  4JI4 B;  1OCZ C;  4LH6 A;  1GMG A;  3ASO B;  4WFB V;  3FD9 A;  4UFZ A;  1SF9 A;  2ARH A;  3JAT A;  4J9Y B;  1K92 A;  4FK5 C;  4LF9 B;  2ETN A;  3UT5 A;  2XAG A;  3L73 H;  4JGS A;  2EJR A;  3CC2 V;  5CBH A;  1RPR A;  2BE3 A;  2X6C A;  1KP3 A;  4I9Q A;  3TET A;  1S72 V;  1ZL8 B;  2YXL A;  4UVA A;  2QTO A;  1XRE A;  1YZB A;  4X89 A;  3B2E E;  2UXB B;  1BE3 H;  2IH1 C;  3RYH A;  1XMQ B;  1SC5 B;  5IJ9 B;  3E8F A;  2LW1 A;  3QO7 A;  3ZBH A;  3CXC U;  3H1H H;  4ZIB A;  1Q43 A;  1VQ6 V;  3SJB C;  3F7V C;  5L3E A;  2RN9 A;  4JZ2 A;  3X2Q C;  1JX9 A;  4O4J A;  1VIB A;  3MDS A;  3TK1 A;  1CXZ B;  3ZHS A;  1AP6 A;  4I0X B;  3T1Y B;  1AP5 A;  3E22 B;  3RFR A;  1M56 C;  2WLJ A;  1N33 O;  2K9P A;  2UXD O;  5IYD O;  2P7T C;  1FD9 A;  3ETQ A;  4IIJ B;  4JV5 B;  4HYO A;  3RVZ A;  4DV7 B;  1W2B U;  1M90 W;  4PDV A;  4WFG A;  4EEQ A;  3RT3 C;  3P32 A;  2CGO A;  1AR1 B;  3ZHR A;  3W7U A;  3AG3 C;  1R3L C;  4NXM O;  3MHS C;  3SYQ A;  1AR5 A;  3RYF A;  2JJ1 G;  3JAR B;  5H9C A;  2ZM6 B;  5HFL A;  5IYB O;  1FFT B;  5KAF Z;  2V7Q G;  4F6R A;  3P30 A;  1V55 C;  1GM8 A;  5JCO A;  4X1K A;  4P30 A;  4NTX A;  4FLX A;  1BS3 A;  4GX1 A;  3SPH A;  3JAR A;  2EIN B;  3DXR A;  5DED A;  3QVN A;  3CB2 A;  5J2T A;  2XND G;  4B7K A;  4JI1 B;  1S5H C;  1Y74 A;  3OUF A;  1EN6 A;  4DUZ B;  4MW3 A;  3LSQ A;  2KB1 A;  1ZTE A;  4PA6 A;  4XDJ A;  1YTF D;  4GX0 A;  4CS2 A;  2QJ1 A;  4KHP B;  4OPH A;  4JI5 B;  3IGA C;  3CHX A;  4YY3 O;  1H2L A;  4I50 A;  3BY6 A;  2ITD C;  1HW7 A;  4LF4 O;  3ZJZ A;  1UJW B;  2YS8 A;  1N36 B;  3NXS A;  4X9Q A;  3F5T A;  1HP8 A;  1XMO B;  3RVY A;  5LGT A;  2N04 A;  3ASO C;  4PI0 A;  5FL7 G;  3L9D A;  4DRX A;  3BAA A;  3SPG A;  3THO A;  4KUM A;  1YCI A;  3ZX6 A;  5JJJ B;  3E8H A;  3SPC A;  5GW7 A;  4MTF A;  2ZD9 A;  1MSW D;  4OXS A;  2XOK G;  1W59 A;  1YJ9 V;  2ZXW B;  4LF7 B;  1JCH A;  1OCO C;  2FML A;  4YJ3 B;  3H1J H;  1WA8 A;  3E22 A;  2QM4 A;  4QE9 A;  4WFA V;  3JSN A;  2WLM A;  5J9P C;  4I55 A;  3LUT B;  4CC5 A;  4B3M B;  4K35 A;  1NBM G;  5DN6 G;  4HNA A;  2Y0P A;  4F6R B;  1YIT V;  1BSM A;  3K08 A;  5CBG A;  1R3K C;  3WFV A;  1XHZ A;  4B3T O;  2JJ2 G;  1GN2 A;  2DW4 A;  1IBM B;  5CA1 B;  1WAZ A;  4EB6 A;  2L6L A;  2GTA A;  2XAQ A;  4N23 A;  4R8C A;  2MW2 B;  4HZ3 A;  4DV3 B;  5LYJ A;  4UV9 A;  4X65 O;  5B66 Z;  1SZX A;  4AHC A;  4LFA B;  1TUE B;  2WLK A;  4JAV A;  4CH6 A;  1N34 O;  4DR1 B;  2GUZ B;  3LNM B;  2QKC A;  5B1N A;  3N2G B;  4IT5 A;  5H2F Z;  1ZSP A;  4X64 O;  1CEZ A;  2YI9 A;  3CJH B;  1Y67 A;  2W0X A;  4DK1 A;  5FNV B;  2VRZ A;  5KUK A;  1YI2 V;  4MVZ A;  4BR6 A;  4PJ0 Z;  1J5E O;  1WP7 A;  4WBN B;  4ZKI A;  2CH7 B;  2QTS A;  2Q67 A;  1KP2 A;  1KC8 W;  3IJ4 A;  3E89 A;  4K8X A;  3C90 A;  2JVD A;  2ODM A;  4JI8 B;  5ITZ A;  1K34 A;  3OGI B;  1R6N A;  3P3N A;  1R6T A;  3BHP A;  1SES A;  2QWN B;  2A7W A;  3ZCC A;  2Q7E A;  2BOB C;  4IHJ B;  1B04 A;  1P7G A;  2EIJ B;  1KMI Z;  4J9Z B;  2X0L A;  2JGU A;  1ZX3 A;  3EHB B;  4J7K A;  5L3B A;  3T1Y O;  3VQY A;  1S5L Z;  3T1H O;  1EBO A;  4FFB B;  2EIJ C;  3SPJ A;  5B1B B;  1SQP H;  3RYI A;  2JK5 C;  4WCE V;  1EN5 A;  2HVK C;  4ASU G;  1ZWI C;  5EBL C;  2GDS A;  3ZHU A;  1XMQ O;  2FB5 A;  1UFI A;  4DRX B;  3K58 A;  4HNA B;  3K79 A;  1BQ0 A;  1SQX H;  2AW9 A;  3D3Q A;  2P5O A;  2XAF A;  2NNU A;  1YVW A;  1PNM A;  1I94 O;  3ABK B;  4UUJ C;  3JCZ A;  1SS3 A;  2XAS A;  4UCT A;  1F23 A;  4NXN B;  5CMU A;  4O4H A;  2EIL B;  4ZBM A;  4FM2 A;  2ZE8 A;  3SGI A;  1VQ8 V;  2P90 A;  1BGY H;  3K04 A;  5KX5 B;  4I5S A;  1V55 B;  3AK3 A;  4JTC B;  4I7Z B;  1QCE A;  1TVK B;  3ZED A;  1KB9 F;  4HAM A;  3G80 A;  5JVD A;  3P3P A;  2ZE6 A;  3CE2 A;  5GTH Z;  2R70 A;  4AQY O;  3CCR V;  4GYC B;  5DM6 V;  4QJF B;  5C8Y A;  1P7B A;  1Y66 A;  1WA8 B;  1IZ3 A;  2V1D A;  3G6E V;  1IXM A;  1MA1 A;  4JYA O;  3AEI A;  4RQE A;  4GX2 A;  2YIC A;  3C3S A;  1GKF A;  1FXK A;  3B4S A;  3H1K H;  5H6R A;  3J80 N;  2ZNI A;  4GLX A;  4YHH O;  4DV0 O;  1M57 B;  3G71 V;  1VF7 A;  1Y76 B;  4JI1 O;  5IYZ B;  1AR4 A;  3JAL A;  3I55 V;  2IJJ A;  3W7T A;  2R9R B;  4W4L A;  1OCZ B;  3QO8 A;  1VF5 B;  4XDL A;  3K5M A;  1MMM A;  3OMI B;  3A2F A;  5JJN B;  2CTP A;  2R9A A;  1QLE C;  4RQF A;  2PY5 A;  3JD3 A;  1K4D C;  4LF5 B;  1W0K G;  1Y6X A;  2IU3 A;  3FFQ A;  4ZI7 B;  4FLZ A;  2IJI A;  2VQF O;  2Q69 A;  1S76 D;  2EUL A;  2FL4 A;  3H1L H;  4TT3 G;  5F2V O;  3OTO O;  4PA7 A;  3G4S V;  4NB5 A;  5EIB D;  1XI1 A;  2HKO A;  2ZDI A;  1UPG A;  4YIP A;  5LMN B;  3K3W A;  3OGC C;  1K33 A;  1VQ4 V;  5EC1 C;  2UXN A;  3N2K B;  5B1A B;  3HKE A;  3ZRW A;  1G4Y B;  3KG2 A;  3CC4 V;  2YIB D;  1S3J A;  4UCU A;  1WN7 A;  1ZUQ A;  5AG2 A;  4NTW A;  2F23 A;  4LNU A;  3AK2 A;  4QE7 A;  3CS5 A;  2UUC B;  1R3J C;  3ABL C;  4JTA B;  1VQ5 V;  4ZOL B;  1NVP B;  4KP4 A;  3E35 A;  1R3I C;  4LWS B;  1RSO A;  5GON A;  4LF8 O;  1IBK O;  3RBZ A;  4LFA O;  1N4C A;  5KMG A;  4JI7 O;  2WLL A;  2HJF C;  1OCC C;  2NN4 A;  3SYA A;  4CS3 A;  5J2U B;  4YJ3 A;  4AIL C;  1KBH A;  1Q82 W;  4JI6 B;  1IBM O;  1JOY A;  3OFN G;  2M6Y A;  1JVM A;  2X7R B;  4MT8 A;  4E4E A;  4NYK A;  3F7Y C;  1NI8 A;  3F5W C;  4JYC A;  5B5E Z;  4IIJ A;  3FKS G;  4B3S O;  1G1X B;  3GVM A;  3SDL A;  2MK3 A;  4GKJ B;  3CCS V;  3L72 H;  2OTJ V;  1TA8 A;  2PYJ A;  3CPW U;  1KYO F;  3Q4H B;  5JJE B;  2Y4U A;  4GX5 A;  4AQY B;  1EM1 A;  4LC1 A;  3ZHQ A;  1XMO O;  2EIL C;  4C7U A;  5JWP A;  5FPO A;  2Y0I A;  2HHH O;  1VF6 A;  1PV0 A;  2FTK A;  4GKK O;  4OPA A;  1R6K A;  2PGG A;  3BVO A;  4U7O A;  2E5L O;  3ZRV A;  3UQ8 A;  3W7X A;  4NR1 A;  3FB7 C;  4GCZ A;  1IUR A;  1N32 O;  5CB4 A;  3E8G A;  4DUZ O;  4HBN A;  1NTM H;  3APQ A;  3FAV B;  1SRY A;  5B3S C;  3CP1 A;  4G27 B;  1S77 D;  3QO5 A;  1VQO V;  1NH2 B;  1GTO A;  1F4N A;  2DWE C;  3ZN0 A;  5B1B C;  3HR0 A;  4TV8 A;  3AG1 C;  1WB7 A;  1KD1 W;  1FPO A;  2PTM A;  1IBL O;  4PV1 B;  4PDR A;  3IFX A;  5EYP B;  2IJK A;  2YID A;  4U3J B;  2JEU A;  1WP8 A;  4DR2 O;  4ICG A;  2EX3 A;  4W4K A;  4YXW G;  2VS0 A;  1TAE A;  1O9H A;  3FB8 C;  3ML0 A;  5E1A C;  1QLE B;  2ZKO A;  4K0K B;  4B08 A;  5JH7 A;  1MZE A;  2ZR3 A;  1K3E A;  2HJD A;  4DK0 A;  2ZQM A;  3VQX A;  3B09 A;  3N2G A;  1P84 F;  3H1I H;  1J5E B;  1F51 A;  1MAB G;  4X65 B;  1VMG A;  3JCU Z;  1PL4 A;  3STL C;  2FKX A;  1SKV A;  4D7S A;  4O4L A;  2KQX A;  3BRC A;  5EZY A;  3E8B A;  2E3C A;  4YJ2 B;  1Q6I A;  2WLN A;  4UCV A;  4KXR A;  5CN0 A;  1S0V A;  4FJC C;  3RYC B;  4I55 B;  2CUG A;  2KG7 A;  4FLT A;  3WB1 A;  1BHA A;  1YXB A;  2BSK A;  4X66 O;  4GZR B;  1QLN A;  1Q7Y W;  4JYA B;  3LDC A;  4GUN A;  4FMT A;  1GO3 F;  4MS2 A;  2K1E A;  1HR0 B;  3I5D A;  3CXH F;  2A9H A;  5D5P A;  3X2Q B;  5BMV B;  2ZCE A;  4JV5 O;  1L1F A;  4JF3 A;  2QWR B;  3BA8 A;  2UXC B;  1FYJ A;  5KHI A;  3JAK A;  4OX9 O;  3I56 V;  4J10 A;  1N33 B;  3ASN C;  2Z5U A;  2UXD B;  1SA0 A;  4O2B A;  2QA4 V;  5LP6 B;  5BXZ A;  4MVS A;  2GUZ A;  4ABM A;  4ZHQ B;  1KUQ A;  2UUB O;  3IAY A;  2LFR A;  3TCU A;  3FB5 C;  1ZL8 A;  3JAM N;  4JI0 B;  2IU0 A;  2RNB A;  5BZB A;  4CC6 A;  4JYY A;  4I0X A;  4JI0 O;  1WB8 A;  5FPR A;  3ZHV A;  4WBN A;  2JS3 A;  5IY5 B;  1YIJ V;  4DW1 A;  4A5U B;  1B3Q A;  3ABL B;  2GTS A;  1BQZ A;  2LGW A;  3ETG A;  1WLE A;  4FZ1 A;  4EKW A;  3K5L A;  3SJC C;  3B40 A;  4OX9 B;  4J11 A;  3BA9 A;  2HVJ C;  2ZR2 A;  4G2K A;  1AB3 A;  1CP9 A;  5LXT A;  3EFF K;  3LDD A;  2B1G A;  1DLB A;  3UKM A;  4Q20 A;  4DR3 B;  3N2K A;  1AJQ A;  4E2L A;  2Z0A A;  1PKX A;  5EBM C;  4MTX A;  3T1H B;  1GN6 A;  1I5Y A;  2JDI G;  2VWJ A;  4TOI A;  5A9G A;  1NJI W;  2CTW A;  4D7T A;  1VQK V;  2YXY A;  3KZI Z;  3QG5 A;  5IJ0 B;  2AGA A;  3HKC A;  3FYE B;  3BCC H;  2YUA A;  5EYP A;  2EIK B;  4X20 B;  3NR7 A;  1QVG U;  1ZLZ A;  2UXX A;  5C93 A;  1Q81 W;  4NTY A;  5KA6 A;  4L87 A;  2UUC O;  2YC0 A;  3RGB A;  1NR7 A;  4TWK A;  4H0L B;  2A79 B;  3K0G A;  2HP8 A;  3FB6 C;  4X88 A;  4X62 O;  3ETD A;  2DYR C;  2EZP A;  1MG1 A;  1ROP A;  2R9I A;  3FYI B;  2Y48 A;  3CRC A;  1I5X A;  5KHJ A;  2Q8V A;  3OTO B;  2W0F C;  3AG4 B;  5LMU O;  4D6T H;  5LMN O;  4R50 A;  3OTF A;  1JQ0 A;  2GSM B;  3A0B Z;  4DR7 O;  3ABM C;  2Y4T A;  4JAU A;  3C3T A;  1DK1 A;  4RUF A;  4TV9 A;  4CBC A;  1TGO A;  2RQ6 A;  3HPL C;  3M8A A;  2OCC B; 
#chains in the Genus database with same CATH homology
 4NB5 A;  1CXZ B;  4NKG B;  4DYL A;  1URF A;  1US6 A;  1UPG A;  2Q0O C;  2HJD A;  2RMK B;  1RFY A;  4IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...