1CXZB

Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
86
structure length
86
Chain Sequence
WSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-181))
publication title The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1cxzB00
2HJDA 2Q0OC 2RMKB 4IGGA 1CXZB 4NB5A 1URFA 4NKGB 1UPGA 4DYLA 1RFYA 1US6A
chains in the Genus database with same CATH superfamily
4YJ2B 5E1AC 2V1DA 2P06A 2LGQA 1NR7A 3ICXA 4J7ZA 1QQCA 5LXTB 1XILA 3N27A 4LFBB 3B77A 4CBCA 1WA8A 1NT2B 4R6ZA 4I5SA 1FD9A 2NN4A 1HW7A 4CS2A 1PKXA 2YXYA 3SR2C 3ABUA 5CA0B 2WPDG 3OGCC 4HYOA 4U3JB 2QWRB 5JJNB 2EINC 1S76D 4JTCB 1HNZO 3FAVA 4UCTA 1R1BA 4JZ2A 2GTSA 5B66Z 1K92A 1WJZA 4E2LA 2YIAA 2IU3A 1M9NA 2YSUB 1K73W 2M7WA 3CC2V 2YEVB 1AI6A 4I0XA 1LUWA 4F6RB 1G8MA 4MW8A 1QLEC 4IIJB 3Q4HB 3G71V 3ZCCA 4LF5B 3CCUV 3WG7C 3ZRVA 4LWSB 3W7XA 1SERA 3ZMVA 2BSKB 1H2GA 4LFAB 1NQTA 3JCZA 4WFAV 4I55B 1H2KA 3ZHUA 3U10A 3AG4C 4K0KO 3JD4A 1WN7A 1UJWB 2P5OA 4BWAA 4I9WA 3F5TA 4JAUA 1N33B 3K9AA 1JFFA 2JIZG 4C7UA 2QM8A 5L3GA 1EZJA 1GH6A 4KFMA 1PPJH 1RSOB 1GO3F 4YY3B 1SQXH 1NVPD 3DGEA 4Z2WA 3DC6A 5HFMA 3RFRA 2RQ6A 2JJ2G 1HNWO 3J80N 1O9HA 2CTWA 4DK1A 3JASA 3ABLC 5FNVA 3T1HO 4JI7B 4YJ2A 4JAVA 1GM7A 4RQEA 4LCUC 4U7NA 1I5XA 4FFBB 4NB5A 1SQGA 5LXTA 4LF4O 2QR4A 4F6EA 1I94B 4DV1O 2PZSA 4CC6A 4ZKIA 3TJTA 4X66O 3APQA 4JYBA 5H2FZ 1YEWA 3DXRB 5BR8B 4LH6A 4LFCB 1Q8IA 2ZDIC 5IWAO 1N4CA 2AW9A 4U3JA 1OZ0A 1JVMA 2QSAA 4UV8A 2JRIA 3D36C 4X65B 5J2TB 1DF4A 4I4TB 1N0JA 1OCRC 1US6A 1OCZC 5LHHA 1W59A 4UUJC 4N21A 1FFXB 4Q20A 3JSLA 4EB6B 5BY1A 4GKKB 4DV6B 2YEVA 2QKSA 2LQTA 2YXHA 1EZVH 1D2DA 4F6RA 3K59A 3ZMSA 4IIJA 3VOUA 1X4TA 3Q4HA 2EIJB 1HP8A 4LWSA 3ZN1A 1JOYA 2BSKA 1WLEA 1P7BA 1YTFB 1AR4A 2JGUA 4I55A 4LF9B 1E1QG 4JI5O 1R6TA 2Q73A 4GLXA 3HKDB 4DR6B 3KG2A 3CRMA 1JQ0A 3A8TA 2CGNA 1QVGU 4U3FH 1D5NA 3EHBB 4O2BB 3JSNA 1RSOA 4LR3A 4RO2A 1XUQA 3S3WA 3ZN0A 2ZM6O 2BOBC 3QO8A 1IX9A 4CS3A 1AB3A 3I5DA 4UVAA 3U11A 5CA1B 2Z5UA 1R73A 3FB7C 2BCCH 2A06H 4MTXA 4TOIA 3QG5A 4DR7O 1DTOA 1MSWD 2Q7HA 1MABG 3VQYA 3CCJV 4DV5O 2HKOA 2LFSA 2XAQA 2JDIG 2CDYA 2A0LA 4ZI7B 3CRAA 1GK9A 4PA7A 3JYCA 4BIZA 5IJ9B 2DQ3A 1XMOO 3SPHA 3CEIA 4LF8O 1QR9A 2A79B 4O4IB 3O65A 3MHHC 2UUAB 3M99B 3CB2A 1YCIA 4TT3G 1N36B 3DXRA 5KAFZ 2F4VO 1K8AW 2DYSC 2XAJA 4NXMB 1XNRO 1T5EA 1K9MW 3B8MA 5CB4B 2YUAA 3J7AU 3ETEA 5J2TA 5B1NA 4I4TA 4ZHQA 2WLNA 1SA0B 1S5HC 4FLTA 4Q6GA 3K04A 5LYJB 4PA9A 2C2AA 2QWOB 4DR2O 1SQVH 4DV2B 1FFXA 4EB6A 3RYHB 4DV0O 1NR1A 1SKVA 2WLMA 1SRYA 5JH7B 3IAYA 5FLXN 2Y48A 4JI3O 1YHQV 5KHJA 4AI8A 4MVRA 3SYOA 3C3TA 5KA5A 4X88A 4GX1A 4NR1A 3TCUA 5IJ0A 4GKJO 4FJCC 1XOUA 1M5IA 2JS5A 2EZOA 3BHPA 5CA3A 1M93A 4LNUB 3KKYA 3QO5A 3HKDA 2W0FC 1IBKO 1Y66A 4DR5B 2OWOA 4NVPA 1HR0B 1HDJA 1THZA 3K0DA 2JGDB 1XL4A 2V7QG 3K03A 4RWUA 5BMVA 3A2FA 4O2BA 2UUCB 3CSXA 3CCSV 1ZTEA 1NKDA 1TUBB 3ABKC 1GN3A 3G6EV 4X1IB 2H8PC 4FM0A 3MAQA 3AG3C 1V55C 4RQFA 2OTJV 3ZRXA 1OCOC 2MK3A 1VIBA 4K3AA 2CAZC 3G80A 3HKBB 2X6AA 4JI6O 2BTOA 4TUYB 3K5OA 2IW5A 1N32O 5B1AB 5GTIZ 4ZI7A 2Q7EA 1Z5WA 1BQ0A 1KYOF 5IJ9A 3VQXA 2IJJA 1W0KG 1VF5B 4YXWG 3LSSA 4O4IA 1HNZB 1H38A 5CBFA 2XTAA 3BCCH 1AJNA 2Y0PA 1DLBA 2CH7B 1R3KC 3NR7A 2UXNA 3VQVA 4PV1B 1FFTB 4PDLA 3OTFA 5CB4A 5DEDA 4U7OA 3JATB 1SA0A 3W7WA 2Q5ZA 3BAAA 1SZXA 1J5EO 5LYJA 2VRZA 1Z5VA 1NH2B 4I7ZB 4P9PA 4XDLA 3RYHA 3E86A 5JH7A 3F5WC 2F93B 3L72H 3BRCA 1OCCC 1QVFU 4K0KB 2EIKC 4X64O 2JS3A 2Q69A 2WA3A 4DRXB 2EIMB 3D8CA 3CE2A 1XMQO 4J41A 3OTOO 3AG1C 5JWPA 2UUBO 4JI8O 3SYAA 4JYCA 2YIBA 3TGUH 4LNUA 1FKAO 3P3NA 5L3EA 5AG2A 3OMAB 2QA4V 1A32A 2W6IG 1ZL8A 4BAYA 3CC7V 2JGDA 1HNWB 4NKGB 3CWBH 2ZE8A 4ZBMA 3SPGA 1W0JG 4EFBA 2RCVA 1GTOA 4JYYA 1TUBA 4GYCB 1PP9H 1RPOA 3BPZA 4PA4A 4X1IA 1QCEA 4B7KA 1KB9F 2FB5A 4KUMA 1GAXA 3UCSC 1F23A 1MZFA 3HKBA 4H0LB 4CH3A 4UCUA 2F1MA 4LF4B 3G4SV 1CPYA 4X62O 4TUYA 2R9AA 2JJ1G 1FXHA 4UV9A 5LOVB 3LSQA 2DW4A 4CS4A 5LMUO 1QLNA 2H94A 2VS0A 4DR4O 2XOKG 4DR1O 3B4SA 5IWAB 4X8AA 4TV9B 4CC5A 4CZZA 1K4CC 3AG2B 5IY5B 4QIWF 5JCOA 1EN5A 5C8YB 2PI5A 3MD0A 2CH7A 2ZE5A 3E8HA 2HEPA 5KMGB 1K97A 1CP9A 5B1OA 2KSDA 1H2LA 1F4NA 2CTPA 4B3TO 5LHIA 3AK2A 2YXLA 2WLLB 3ZIAG 3JATA 4JI4O 2ODMA 2XASA 1EFRG 1M57B 4B3MB 4L87A 3OGIB 3BFRA 5EIBD 3WB2A 4HAMA 5H9CA 3RW0A 1AR5A 3JASB 1H8HG 2VQEO 4CH6A 2GUZB 1COWG 1H2MA 2E3CA 1NU1H 3HR0A 1KKCA 4D6TH 1PL4A 1FJGB 1JJ2U 1QNMA 4UB8Z 3OUSA 3FYIB 5B1AC 4JI5B 4DRXA 2H3OA 3JD1A 4PDVA 2ILMA 4DYLA 1WB8A 1VQ5V 2IJKA 3ZRSA 2IJIA 1AILA 2QE7G 4TV8B 3UO3A 2PGGA 1VQ4V 4LC1A 2ZM6B 1M90W 1N34O 3GB7C 1VQNV 1BHAA 2QTSA 4DXWA 5F2VO 2CUGA 4IYHA 3T1YB 3T1CA 2WLIB 3ZS8C 4DR7B 4UCRA 4IL6Z 1I7FA 1JX9A 2OCCB 4DV5B 5LL6Y 1Y74B 4I9QA 4HNAB 1JR9A 3WFVA 1EN4A 1U97A 1YTFD 2G38A 1E1RG 4EFEA 1KP2A 2QGNA 1VP7A 4H13B 2Y4TA 5FL7G 1V54B 1BMFG 2QJ1A 1WB7A 4LF8B 2PY5A 2WWWA 2DOSA 1P84F 3FB6C 4PDRA 3E2EA 2Q67A 1KECA 5LOVA 3LNMB 4DUYO 4JTDB 3OEEG 1XNRB 4CH4A 3O9OA 2BTQB 2EILB 4TV9A 2PYJA 3H1HH 1IZ3A 5B3SB 3SYPA 4G27B 4ASUG 3ZMTA 5C8YA 5LGUA 3BABA 2DYRC 1IBMO 2YC0A 4DW1A 5KMGA 4JI2B 4FLZA 4WF9V 4LH7A 4DR2B 3ZHQA 4XDKA 1Q81W 4GCZA 4DV0B 4PA6A 1PL0A 2Y69C 4MTFA 2WLLA 3JARB 4JI3B 5DECA 4Z1MG 2UU9B 3UQ8A 1PD3A 4FLVA 3G6BA 3E8GA 1GM8A 3ABTA 4OXSA 2GUZA 2ZIMA 4GKJB 2HHHO 1KKDA 2FL4A 5KAIZ 2YS8A 5ITZB 1XI1A 1B6QA 1E79G 1G6UA 3RGBA 1Q3EA 1MOFA 3ML0A 2VQFO 1CXZB 2DJVA 1SF9A 1NZ6A 1H8EG 4JI1O 1DF5A 2B5UA 4DV7B 4TV8A 3ZHTA 1B06A 3KCXA 1VARA 3IJ4A 4B3SB 4J9ZB 4LP8A 5TISZ 1QHTA 1IDSA 3BEHA 2GSMB 5B1BB 1VQ9V 3GWKC 4LBEC 2WLIA 4ZHQB 2Q6AA 2QDOA 2N74A 4MVSA 1GN6A 1H2SB 1Y74A 2QTOA 1XREA 2YI9A 4HNAA 2PTMA 1N32B 1RM1C 2ADPA 2R9RB 3IFXA 1VQLV 2YIBD 3ASOC 1AROP 2E5LB 4LF6O 1MG1A 2N04A 4B3RO 2PF4E 2UXXA 1OHHG 3STLC 1HNXO 3L74H 4B08A 4DUZO 5LMNO 1FXVA 3CCMV 4GUNA 5IJ0B 2XT9A 4ABMA 3L71H 5H6RA 2BTQA 1ZUQA 4OX9O 3SPIA 3UM7A 3M7MX 1UFIA 2Q4PA 3U0ZA 2R72A 2DE0X 1J5EB 2DWEC 4O4HB 3OD4A 5BMVB 3K5MA 1XNQO 3X2QB 5L3BA 2AXTZ 1AR1B 3A0HZ 3SPJA 1GMGA 4PI2A 3J81N 2CE4A 1NJIW 1YI2V 2E75B 3JARA 2HVKC 1QBZA 3RWRD 5FPRA 4X64B 1F51A 3I56V 4G2KA 3PN1A 3T2MA 1XMQB 4LFBO 1M4UA 3OTOB 3ETDA 3ABMB 3AK3A 3SYQA 3CP1A 1YJNV 3BY6A 2XHBA 3RYFB 1MMMA 5ITZA 1SQPH 5HFLA 4JTAB 4UXNA 1FXKB 1MNGA 3OFNG 4FZ1A 3B09A 1YJWV 1IBLO 4JZGA 1TVKB 2ZXWB 3BA9A 2KQXA 4HZ3A 2ZR2A 4FFKA 1NH2D 3E8FA 5EBLC 3CD6V 2X7RB 4JI0O 2GHYA 4YJ3B 1AI7A 1DGSA 1PNKA 2QM4A 3TETA 4JYAO 3C90A 4LF5O 2IH3C 1JPXA 1XHZA 4P9OA 1NI8A 1GN4A 2Y0IA 3EFFK 2ZE7A 4FVMA 4X62B 2Q0AA 2UXCO 1JCHA 1YIJV 2XAHA 4FM1A 5JVDB 2ZQMA 4TSFG 4GT1A 3G67A 3VQWA 2GTAA 4DR4B 3EXAA 4UFZA 3QO7A 4RUFA 3JD0A 1N33O 2Z0AA 5IE9A 1R6NA 1SZTA 4WCEV 5EIBC 1DK1A 3FFQA 1S0VA 1I5YA 1VQ8V 1LUVA 4YY3O 4UCOA 4J9YB 3H1JH 5GW7A 3JAMN 1VQMV 3PJSK 1K34A 3UKMA 5IYDO 1ROPA 4JI4B 2B9ZA 2WAMA 1ZL8B 3IC7A 4GZRB 1VF6A 2P90A 3ASNB 1Q6HA 4O4HA 4BIOA 5LP6B 3CJHB 3LDDA 1S5JA 2VQEB 4FLYA 3CRQA 4GX0A 2KG7B 1H2NA 2UXBO 1IURA 3MDSA 3D3IA 3P30A 4WBNB 3FB5C 3ZEDA 1I94O 3IC9A 4HBNA 4O4JB 5B5EZ 2EIJC 3RYFA 1ZX3A 5BR8O 2NNUA 4O4LB 3JD3A 3RYIB 1FXKA 1N34B 2D2CB 4WFBV 5GONB 1FS0G 5FPOA 3H1LH 4ICGA 4MS2A 1S72V 2P4VA 5BXZA 4EKWA 1TVKA 3T4DA 4I50B 3P32A 4NXNO 1YVWA 2PUSA 2QKAA 5H6QA 4MT8A 5EC1C 4YJ3A 2QEXV 3UT5B 2XNDG 1YDXA 1YF2A 3L75H 2OIEA 4WFEA 2X0LA 1KP3A 3WU2Z 2AZ0A 3DTUB 5KA6A 3JD2A 5JVDA 3JALB 2Z3YA 4J42A 1R3JC 4JF3A 2EINB 5IYCO 4YIOA 3THOA 4DK0A 4DR6O 4KHPO 2OYQA 1Y67A 5IT9N 1GKFA 4GX2A 1K3EA 2ATKC 4X1YB 3K08A 1QLEB 3ZX6A 2EJ7A 2ITDC 4XBFA 3WG7B 4W4KA 2ETNA 4YIPA 2HP8A 2QKCA 1P49A 2ZNIA 3FKSG 4FLXA 3CC4V 4QE9A 5J2UB 5E79Z 5LP6A 3CJHA 1VQ6V 5A9GA 3AG4B 2GV9A 5LA6B 2KG7A 2HHHB 1Q6UA 3T1HB 4WBNA 3CRRA 2VQFB 2P4KA 4MVZA 3K79A 4F4LA 1N0NA 3LNNA 1S5LZ 3EVKA 5JJEB 3QF7A 2EBOA 2UXDO 3FYEB 4IT5A 3W7SA 5C93A 4O4JA 4DV1B 2WLHA 1Q43A 3H1IH 1F4MA 2F95B 3CHXA 3H1KH 4X66B 4NXMO 4O4LA 3CCVV 2RJZA 3RYIA 1JMKC 2E74B 3K5LA 5GONA 1YZBA 3ETQA 3ABLB 1W2BU 5KHHA 4IGGA 2D3OW 5EZYB 4FM2A 4I50A 5EK0A 1XEQA 2JK5C 1X59A 3SJAC 4DV2O 1P7GA 3SGIA 3UT5A 2PYLA 4PDMA 3CPWU 3W7UA 5IDJA 5D5QA 2R70A 4UCVA 5K1XA 2X6BA 1SQFA 3KCYA 4LF6B 4JPRA 3OE7G 2LJ2A 4AQYO 1NTKH 2HVJC 3LUTB 2HJDA 4DUZB 5KHGA 5LMNB 3JALA 4JGSA 2JVDA 3RYCB 1Q7YW 2HR3A 5L3DA 1OCRB 3B2EE 1OCZB 2P67A 4DR5O 4OX9B 3SJQC 4G28B 4JV5O 3CMEV 3SDLA 4L8JA 3D3QA 2QM7A 4WFHA 2AHYA 1K7DA 2XAGA 3E89A 4QE7A 1IXBA 4X1YA 1KMIZ 1JJOA 4H37A 2ZCEA 5JCOC 2LP7A 3STZC 4E4EA 5D5PA 3NXSA 4QGPA 1SQQH 1MSDA 1P4RA 4R50A 1VQPV 5J2UA 3AK1A 3N2GB 3OR7C 1CEZA 3RT3C 5LA6A 3ZBHA 1Q5OA 1KBHA 2NLJC 3K3WA 2AGAA 4WFGA 1B3QA 1JA8A 3JCUZ 4W4LA 5L3CA 4X1KB 1XQ8A 4BR6A 5CBGA 4DV4O 1QR8A 2Q9LA 1L8DA 3TXSA 1XMOB 4OPAA 4UVBA 4YHHO 1IBLB 1WPBA 4DR3O 2OT5A 1K4DC 2YI8A 4D7SA 2JEUA 2EIMC 5LGTA 4O2AB 2DQ0A 5CBHA 1ENVA 2HLDG 2F4VB 2ZINA 2CTQA 3FB8C 4JI0B 1AP5A 3IGAC 1NS1A 3E22B 5LHGA 1WP7A 1PNMA 1PV0A 3ZRWB 4JYAB 1G4YB 5EZYA 1FPOA 2KKWA 5EYPB 2BOCC 1YJ9V 2KB1A 2IU0A 4B7EA 5CN0A 5JQGB 2UXCB 1BHBA 2HG5C 3HKEB 4UB6Z 1L0NH 3HKCB 4JAAA 3WB0A 1EBOA 4PA3A 2W0XA 1WP8A 3ZMZA 2WA4A 1J95A 4BW5A 1ORQC 2Q8VA 1L0LH 1BQZA 2OCHA 2CTRA 1WPXA 2DYSB 5KX5B 4H44B 2ZDIA 4FMTA 2P7TC 2EULA 2VWKA 3D36A 4DO2A 4TWKA 3RYCA 4NTYA 4ZOLB 4X9QA 1RP3B 1FYJA 3L9DA 2LW7A 2N05A 3APOA 1IBKB 4ZIBA 1Q90D 3C3SA 4DV3O 1WNSA 1R3LC 5IYZB 2FTKA 3AG2C 5IY5C 4KL1A 5H5NA 2F23A 2FMLA 4LF7O 1BCCH 3BVOA 1VMGA 2UXBB 2L6LA 1KUQA 3OM3B 1KC8W 2LGWA 4FIPC 3P3PA 3N2GA 3ZHVA 2OIGA 3CMAV 2DN9A 4JI6B 4J80A 1M57C 3TXQA 5CA0A 3BA8A 4XDJA 2LO1A 4X1KA 3ZHRA 3F7YC 4K8ZA 4FZ0A 2QWQB 4X89A 1TA8A 4AHCA 1YITV 1K33A 3ABKB 4RAIA 5LBQA 3K06A 1Q86W 3KZIZ 4O2AA 1F7YA 4NXNB 3AG3B 1V55B 2XAFA 3T4ZA 1ZSPA 1YXBA 1OCOB 1B04A 3E22A 1ZWIC 3DSQA 3ZRWA 2HJFC 2Y4UA 4B3MO 3CS5A 3E35A 5EYPA 3QNEA 1I0HA 1KQSU 1EN6A 1M56B 4J11A 4TQFA 4A5UB 5JQGA 2A7WA 3HKEA 3HKCA 1FJGO 2EX3A 2OCCC 4MVUA 2AHZA 1K5SA 1VEWA 2LFRA 4KHPB 4J7JA 4X20B 3AEIA 2A3QA 3I55V 3K0GA 1BGYH 2LW1A 2EJRA 2RNBA 5KX5A 1BE3H 1FAFA 1KU9A 1V54C 1QU7A 3QTCA 2UUBB 4JI8B 4Z1VA 3M8AA 4ZOLA 4OGQB 3R65A 1S3JA 4K8XA 4QNHB 2K1EA 1BS3A 1SC5B 2GBOA 3T1YO 4PJ0Z 1AJPA 2BE3A 2ZD9A 1PM9A 3E83A 2EILC 3OEHG 3OT7A 5B3SC 5IYZA 3HB3B 1OCCB 1GN2A 1NVPB 1TAEA 2EIKB 1BSMA 3SYCA 4EEQA 4FK5C 4QJFB 1MZEA 3AG1B 4FFBA 4P30A 2GDSA 4MTGA 2R9IA 3CCQV 2UXDB 3CYOA 4QPJA 4LFAO 1XL6A 4KP4A 1Y76B 2HFEC 2W6JG 3K57A 3SJCC 4BIUA 5LMUB 1IXMA 2P22C 4DR1B 5A2QN 4PI0A 1OV9A 3OW2U 3ETGA 5DM6V 4N23A 2ARHA 4JI2O 1LR1A 1IVSA 4J10A 2ZIOA 1YSCA 1RFYA 2WLKA 4IYIA 3H9VA 4BW9A 1LNQA 2ZE6A 2K9PA 4B3TB 2PI4A 2UU9O 3S3XA 2IH1C 2QWNB 2RN9A 1O9GA 4UVCA 4MW3A 1KD1W 4RUEA 5B1BC 2ADQB 4AQYB 2IBZH 1AJQA 1U96A 4JI7O 2AZ2A 3TK1A 5EBMC 3WB1A 4PHZA 4X20A 4GX5A 3UO2A 2JEXA 3OUFA 3JAWB 1AP6A 3VBBA 1VQ7V 4JV5B 3ZJZA 4DV7O 1ZAUA 2EZPA 3L73H 3HPLC 4TQDA 1R6KA 3GVMA 2CGOA 1OJHA 2DMXA 1Q6IA 3A0RA 3FD9A 1XHXA 4B3SO 4LFCO 2B1IA 2ITCC 5CA1A 3W7TA 3CRCA 2WSSG 3ZMUA 3A0BZ 3CX5F 3RVYA 4X65O 1N8RW 3R66A 2E76B 1VQKV 5IYBO 3OAAG 3H01A 5L3FA 5GTHZ 1NBMG 3N2KB 3FX7A 1VF6C 1M56C 1NTZH 4GKKO 4DV6O 1GRJA 2WLJA 2NR5A 1SESA 3DC5A 5LGNA 3X2QC 4JASA 2E5LO 4DV4B 4FPPA 1URFA 5EC2C 4OPHA 4QPKA 1WAZA 3JAKB 2L35A 4YHHB 3OMNB 4DR3B 4PD4F 1HWYA 3OMIB 1Y76A 1Y6XA 1AVMA 1GM9A 3AG7A 3RBZA 4LF9O 4PELA 4DUYB 3ABMC 4IHJB 4KXRA 1Y4MA 1G1XB 2YICA 3ZHSA 5KLVH 1BZKA 3QVNA 4FLWA 3OR6C 3LSUA 1FXKC 1TGOA 1V9PA 1IBMB 1XDCA 3CCRV 5J9PC 5KHKA 4MVOA 2P6JA 2ZXWC 2B1GA 4NTWA 2A9HA 1Z2GA 2X6CA 1R3IC 3CXHF 2DWDC 1SS3A 1SETA 2V4DA 3SJBC 4K35A 5DN6G 5KUKA 4FLUA 1VQOV 1NTMH 3K58A 4CH5A 2FKXA 2Q68A 1XBLA 2XUMA 4R8CA 2YIDA 1Q82W 3CXCU 1WA8B 1UPGA 3LDEA 3L70H 2RMKB 1D5AA 2DYRB 3CCEV 2ZNJA 3JAWA 1I08A 3CCLV 5KHIA 3FAVB 4JI1B 3E8BA 4NTXA 4DV3B 1MA1A 4D7TA 2UUAO 1BL8A 3B40A 2VWJA 1N36O 2Y69B 3LDCA 4NYKA 1AI4A 2FYUH 4DW0A 3SPCA 4MSWC 5CMUA 4LF7B 1PNLA 4I0XB 1S77D 4J7KA 2MW2B 2OTLV 2F43G 2ZR3A 2F66C 1EM1A 3N2KA 3MHSC 1L1FA 3ASNC 5LP6C 4MVMA 2YDEA 2IM9A 3F7VC 2Q7GA 4UCSA 5K1PA 2CK3G 1VF7A 5KUMA 1M1KW 1RPRA 3B8NA 3JAKA 3GWOA 4AILC 1JFFB 3RVZA 4B3RB 3RN4A 1TUEB 2RDCA 2O57A 2ZT9B 2QWPB 1HNXB 1K5QA 4IHJA 3K9SA 2IJHA 1AI5A 5EBWC 4H33A 4R7CA 4WFFA 2Q0OC 1HR0O 1BT8A 3K5NA 1ZLZA 5JJJB 1RM1B 2M6YA 2UUCO 1SQBH 4MVQA 4P2ZA 2ZKOA 5BZBA 3ASOB 4MTOA 1XNQB 5FNVB
chains in the Genus database with same CATH topology
2HJDA 2Q0OC 2RMKB 4IGGA 1CXZB 4NB5A 1URFA 4NKGB 1UPGA 4DYLA 1RFYA 1US6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJD A;  2Q0O C;  2RMK B;  4IGG A;  1CXZ B;  4NB5 A;  1URF A;  4NKG B;  1UPG A;  4DYL A;  1RFY A;  1US6 A; 
#chains in the Genus database with same CATH topology
 4YJ2 B;  5E1A C;  2V1D A;  2P06 A;  2LGQ A;  1NR7 A;  3ICX A;  4J7Z A;  1QQC A;  5LXT B;  1XIL A;  3N27 A;  4LFB B;  3B77 A;  4CBC A;  1WA8 A;  1NT2 B;  4R6Z A;  4I5S A;  1FD9 A;  2NN4 A;  1HW7 A;  4CS2 A;  1PKX A;  2YXY A;  3SR2 C;  3ABU A;  5CA0 B;  2WPD G;  3OGC C;  4HYO A;  4U3J B;  2QWR B;  5JJN B;  2EIN C;  1S76 D;  4JTC B;  1HNZ O;  3FAV A;  4UCT A;  1R1B A;  4JZ2 A;  2GTS A;  5B66 Z;  1K92 A;  1WJZ A;  4E2L A;  2YIA A;  2IU3 A;  1M9N A;  2YSU B;  1K73 W;  2M7W A;  3CC2 V;  2YEV B;  1AI6 A;  4I0X A;  1LUW A;  4F6R B;  1G8M A;  4MW8 A;  1QLE C;  4IIJ B;  3Q4H B;  3G71 V;  3ZCC A;  4LF5 B;  3CCU V;  3WG7 C;  3ZRV A;  4LWS B;  3W7X A;  1SER A;  3ZMV A;  2BSK B;  1H2G A;  4LFA B;  1NQT A;  3JCZ A;  4WFA V;  4I55 B;  1H2K A;  3ZHU A;  3U10 A;  3AG4 C;  4K0K O;  3JD4 A;  1WN7 A;  1UJW B;  2P5O A;  4BWA A;  4I9W A;  3F5T A;  4JAU A;  1N33 B;  3K9A A;  1JFF A;  2JIZ G;  4C7U A;  2QM8 A;  5L3G A;  1EZJ A;  1GH6 A;  4KFM A;  1PPJ H;  1RSO B;  1GO3 F;  4YY3 B;  1SQX H;  1NVP D;  3DGE A;  4Z2W A;  3DC6 A;  5HFM A;  3RFR A;  2RQ6 A;  2JJ2 G;  1HNW O;  3J80 N;  1O9H A;  2CTW A;  4DK1 A;  3JAS A;  3ABL C;  5FNV A;  3T1H O;  4JI7 B;  4YJ2 A;  4JAV A;  1GM7 A;  4RQE A;  4LCU C;  4U7N A;  1I5X A;  4FFB B;  4NB5 A;  1SQG A;  5LXT A;  4LF4 O;  2QR4 A;  4F6E A;  1I94 B;  4DV1 O;  2PZS A;  4CC6 A;  4ZKI A;  3TJT A;  4X66 O;  3APQ A;  4JYB A;  5H2F Z;  1YEW A;  3DXR B;  5BR8 B;  4LH6 A;  4LFC B;  1Q8I A;  2ZDI C;  5IWA O;  1N4C A;  2AW9 A;  4U3J A;  1OZ0 A;  1JVM A;  2QSA A;  4UV8 A;  2JRI A;  3D36 C;  4X65 B;  5J2T B;  1DF4 A;  4I4T B;  1N0J A;  1OCR C;  1US6 A;  1OCZ C;  5LHH A;  1W59 A;  4UUJ C;  4N21 A;  1FFX B;  4Q20 A;  3JSL A;  4EB6 B;  5BY1 A;  4GKK B;  4DV6 B;  2YEV A;  2QKS A;  2LQT A;  2YXH A;  1EZV H;  1D2D A;  4F6R A;  3K59 A;  3ZMS A;  4IIJ A;  3VOU A;  1X4T A;  3Q4H A;  2EIJ B;  1HP8 A;  4LWS A;  3ZN1 A;  1JOY A;  2BSK A;  1WLE A;  1P7B A;  1YTF B;  1AR4 A;  2JGU A;  4I55 A;  4LF9 B;  1E1Q G;  4JI5 O;  1R6T A;  2Q73 A;  4GLX A;  3HKD B;  4DR6 B;  3KG2 A;  3CRM A;  1JQ0 A;  3A8T A;  2CGN A;  1QVG U;  4U3F H;  1D5N A;  3EHB B;  4O2B B;  3JSN A;  1RSO A;  4LR3 A;  4RO2 A;  1XUQ A;  3S3W A;  3ZN0 A;  2ZM6 O;  2BOB C;  3QO8 A;  1IX9 A;  4CS3 A;  1AB3 A;  3I5D A;  4UVA A;  3U11 A;  5CA1 B;  2Z5U A;  1R73 A;  3FB7 C;  2BCC H;  2A06 H;  4MTX A;  4TOI A;  3QG5 A;  4DR7 O;  1DTO A;  1MSW D;  2Q7H A;  1MAB G;  3VQY A;  3CCJ V;  4DV5 O;  2HKO A;  2LFS A;  2XAQ A;  2JDI G;  2CDY A;  2A0L A;  4ZI7 B;  3CRA A;  1GK9 A;  4PA7 A;  3JYC A;  4BIZ A;  5IJ9 B;  2DQ3 A;  1XMO O;  3SPH A;  3CEI A;  4LF8 O;  1QR9 A;  2A79 B;  4O4I B;  3O65 A;  3MHH C;  2UUA B;  3M99 B;  3CB2 A;  1YCI A;  4TT3 G;  1N36 B;  3DXR A;  5KAF Z;  2F4V O;  1K8A W;  2DYS C;  2XAJ A;  4NXM B;  1XNR O;  1T5E A;  1K9M W;  3B8M A;  5CB4 B;  2YUA A;  3J7A U;  3ETE A;  5J2T A;  5B1N A;  4I4T A;  4ZHQ A;  2WLN A;  1SA0 B;  1S5H C;  4FLT A;  4Q6G A;  3K04 A;  5LYJ B;  4PA9 A;  2C2A A;  2QWO B;  4DR2 O;  1SQV H;  4DV2 B;  1FFX A;  4EB6 A;  3RYH B;  4DV0 O;  1NR1 A;  1SKV A;  2WLM A;  1SRY A;  5JH7 B;  3IAY A;  5FLX N;  2Y48 A;  4JI3 O;  1YHQ V;  5KHJ A;  4AI8 A;  4MVR A;  3SYO A;  3C3T A;  5KA5 A;  4X88 A;  4GX1 A;  4NR1 A;  3TCU A;  5IJ0 A;  4GKJ O;  4FJC C;  1XOU A;  1M5I A;  2JS5 A;  2EZO A;  3BHP A;  5CA3 A;  1M93 A;  4LNU B;  3KKY A;  3QO5 A;  3HKD A;  2W0F C;  1IBK O;  1Y66 A;  4DR5 B;  2OWO A;  4NVP A;  1HR0 B;  1HDJ A;  1THZ A;  3K0D A;  2JGD B;  1XL4 A;  2V7Q G;  3K03 A;  4RWU A;  5BMV A;  3A2F A;  4O2B A;  2UUC B;  3CSX A;  3CCS V;  1ZTE A;  1NKD A;  1TUB B;  3ABK C;  1GN3 A;  3G6E V;  4X1I B;  2H8P C;  4FM0 A;  3MAQ A;  3AG3 C;  1V55 C;  4RQF A;  2OTJ V;  3ZRX A;  1OCO C;  2MK3 A;  1VIB A;  4K3A A;  2CAZ C;  3G80 A;  3HKB B;  2X6A A;  4JI6 O;  2BTO A;  4TUY B;  3K5O A;  2IW5 A;  1N32 O;  5B1A B;  5GTI Z;  4ZI7 A;  2Q7E A;  1Z5W A;  1BQ0 A;  1KYO F;  5IJ9 A;  3VQX A;  2IJJ A;  1W0K G;  1VF5 B;  4YXW G;  3LSS A;  4O4I A;  1HNZ B;  1H38 A;  5CBF A;  2XTA A;  3BCC H;  1AJN A;  2Y0P A;  1DLB A;  2CH7 B;  1R3K C;  3NR7 A;  2UXN A;  3VQV A;  4PV1 B;  1FFT B;  4PDL A;  3OTF A;  5CB4 A;  5DED A;  4U7O A;  3JAT B;  1SA0 A;  3W7W A;  2Q5Z A;  3BAA A;  1SZX A;  1J5E O;  5LYJ A;  2VRZ A;  1Z5V A;  1NH2 B;  4I7Z B;  4P9P A;  4XDL A;  3RYH A;  3E86 A;  5JH7 A;  3F5W C;  2F93 B;  3L72 H;  3BRC A;  1OCC C;  1QVF U;  4K0K B;  2EIK C;  4X64 O;  2JS3 A;  2Q69 A;  2WA3 A;  4DRX B;  2EIM B;  3D8C A;  3CE2 A;  1XMQ O;  4J41 A;  3OTO O;  3AG1 C;  5JWP A;  2UUB O;  4JI8 O;  3SYA A;  4JYC A;  2YIB A;  3TGU H;  4LNU A;  1FKA O;  3P3N A;  5L3E A;  5AG2 A;  3OMA B;  2QA4 V;  1A32 A;  2W6I G;  1ZL8 A;  4BAY A;  3CC7 V;  2JGD A;  1HNW B;  4NKG B;  3CWB H;  2ZE8 A;  4ZBM A;  3SPG A;  1W0J G;  4EFB A;  2RCV A;  1GTO A;  4JYY A;  1TUB A;  4GYC B;  1PP9 H;  1RPO A;  3BPZ A;  4PA4 A;  4X1I A;  1QCE A;  4B7K A;  1KB9 F;  2FB5 A;  4KUM A;  1GAX A;  3UCS C;  1F23 A;  1MZF A;  3HKB A;  4H0L B;  4CH3 A;  4UCU A;  2F1M A;  4LF4 B;  3G4S V;  1CPY A;  4X62 O;  4TUY A;  2R9A A;  2JJ1 G;  1FXH A;  4UV9 A;  5LOV B;  3LSQ A;  2DW4 A;  4CS4 A;  5LMU O;  1QLN A;  2H94 A;  2VS0 A;  4DR4 O;  2XOK G;  4DR1 O;  3B4S A;  5IWA B;  4X8A A;  4TV9 B;  4CC5 A;  4CZZ A;  1K4C C;  3AG2 B;  5IY5 B;  4QIW F;  5JCO A;  1EN5 A;  5C8Y B;  2PI5 A;  3MD0 A;  2CH7 A;  2ZE5 A;  3E8H A;  2HEP A;  5KMG B;  1K97 A;  1CP9 A;  5B1O A;  2KSD A;  1H2L A;  1F4N A;  2CTP A;  4B3T O;  5LHI A;  3AK2 A;  2YXL A;  2WLL B;  3ZIA G;  3JAT A;  4JI4 O;  2ODM A;  2XAS A;  1EFR G;  1M57 B;  4B3M B;  4L87 A;  3OGI B;  3BFR A;  5EIB D;  3WB2 A;  4HAM A;  5H9C A;  3RW0 A;  1AR5 A;  3JAS B;  1H8H G;  2VQE O;  4CH6 A;  2GUZ B;  1COW G;  1H2M A;  2E3C A;  1NU1 H;  3HR0 A;  1KKC A;  4D6T H;  1PL4 A;  1FJG B;  1JJ2 U;  1QNM A;  4UB8 Z;  3OUS A;  3FYI B;  5B1A C;  4JI5 B;  4DRX A;  2H3O A;  3JD1 A;  4PDV A;  2ILM A;  4DYL A;  1WB8 A;  1VQ5 V;  2IJK A;  3ZRS A;  2IJI A;  1AIL A;  2QE7 G;  4TV8 B;  3UO3 A;  2PGG A;  1VQ4 V;  4LC1 A;  2ZM6 B;  1M90 W;  1N34 O;  3GB7 C;  1VQN V;  1BHA A;  2QTS A;  4DXW A;  5F2V O;  2CUG A;  4IYH A;  3T1Y B;  3T1C A;  2WLI B;  3ZS8 C;  4DR7 B;  4UCR A;  4IL6 Z;  1I7F A;  1JX9 A;  2OCC B;  4DV5 B;  5LL6 Y;  1Y74 B;  4I9Q A;  4HNA B;  1JR9 A;  3WFV A;  1EN4 A;  1U97 A;  1YTF D;  2G38 A;  1E1R G;  4EFE A;  1KP2 A;  2QGN A;  1VP7 A;  4H13 B;  2Y4T A;  5FL7 G;  1V54 B;  1BMF G;  2QJ1 A;  1WB7 A;  4LF8 B;  2PY5 A;  2WWW A;  2DOS A;  1P84 F;  3FB6 C;  4PDR A;  3E2E A;  2Q67 A;  1KEC A;  5LOV A;  3LNM B;  4DUY O;  4JTD B;  3OEE G;  1XNR B;  4CH4 A;  3O9O A;  2BTQ B;  2EIL B;  4TV9 A;  2PYJ A;  3H1H H;  1IZ3 A;  5B3S B;  3SYP A;  4G27 B;  4ASU G;  3ZMT A;  5C8Y A;  5LGU A;  3BAB A;  2DYR C;  1IBM O;  2YC0 A;  4DW1 A;  5KMG A;  4JI2 B;  4FLZ A;  4WF9 V;  4LH7 A;  4DR2 B;  3ZHQ A;  4XDK A;  1Q81 W;  4GCZ A;  4DV0 B;  4PA6 A;  1PL0 A;  2Y69 C;  4MTF A;  2WLL A;  3JAR B;  4JI3 B;  5DEC A;  4Z1M G;  2UU9 B;  3UQ8 A;  1PD3 A;  4FLV A;  3G6B A;  3E8G A;  1GM8 A;  3ABT A;  4OXS A;  2GUZ A;  2ZIM A;  4GKJ B;  2HHH O;  1KKD A;  2FL4 A;  5KAI Z;  2YS8 A;  5ITZ B;  1XI1 A;  1B6Q A;  1E79 G;  1G6U A;  3RGB A;  1Q3E A;  1MOF A;  3ML0 A;  2VQF O;  1CXZ B;  2DJV A;  1SF9 A;  1NZ6 A;  1H8E G;  4JI1 O;  1DF5 A;  2B5U A;  4DV7 B;  4TV8 A;  3ZHT A;  1B06 A;  3KCX A;  1VAR A;  3IJ4 A;  4B3S B;  4J9Z B;  4LP8 A;  5TIS Z;  1QHT A;  1IDS A;  3BEH A;  2GSM B;  5B1B B;  1VQ9 V;  3GWK C;  4LBE C;  2WLI A;  4ZHQ B;  2Q6A A;  2QDO A;  2N74 A;  4MVS A;  1GN6 A;  1H2S B;  1Y74 A;  2QTO A;  1XRE A;  2YI9 A;  4HNA A;  2PTM A;  1N32 B;  1RM1 C;  2ADP A;  2R9R B;  3IFX A;  1VQL V;  2YIB D;  3ASO C;  1ARO P;  2E5L B;  4LF6 O;  1MG1 A;  2N04 A;  4B3R O;  2PF4 E;  2UXX A;  1OHH G;  3STL C;  1HNX O;  3L74 H;  4B08 A;  4DUZ O;  5LMN O;  1FXV A;  3CCM V;  4GUN A;  5IJ0 B;  2XT9 A;  4ABM A;  3L71 H;  5H6R A;  2BTQ A;  1ZUQ A;  4OX9 O;  3SPI A;  3UM7 A;  3M7M X;  1UFI A;  2Q4P A;  3U0Z A;  2R72 A;  2DE0 X;  1J5E B;  2DWE C;  4O4H B;  3OD4 A;  5BMV B;  3K5M A;  1XNQ O;  3X2Q B;  5L3B A;  2AXT Z;  1AR1 B;  3A0H Z;  3SPJ A;  1GMG A;  4PI2 A;  3J81 N;  2CE4 A;  1NJI W;  1YI2 V;  2E75 B;  3JAR A;  2HVK C;  1QBZ A;  3RWR D;  5FPR A;  4X64 B;  1F51 A;  3I56 V;  4G2K A;  3PN1 A;  3T2M A;  1XMQ B;  4LFB O;  1M4U A;  3OTO B;  3ETD A;  3ABM B;  3AK3 A;  3SYQ A;  3CP1 A;  1YJN V;  3BY6 A;  2XHB A;  3RYF B;  1MMM A;  5ITZ A;  1SQP H;  5HFL A;  4JTA B;  4UXN A;  1FXK B;  1MNG A;  3OFN G;  4FZ1 A;  3B09 A;  1YJW V;  1IBL O;  4JZG A;  1TVK B;  2ZXW B;  3BA9 A;  2KQX A;  4HZ3 A;  2ZR2 A;  4FFK A;  1NH2 D;  3E8F A;  5EBL C;  3CD6 V;  2X7R B;  4JI0 O;  2GHY A;  4YJ3 B;  1AI7 A;  1DGS A;  1PNK A;  2QM4 A;  3TET A;  4JYA O;  3C90 A;  4LF5 O;  2IH3 C;  1JPX A;  1XHZ A;  4P9O A;  1NI8 A;  1GN4 A;  2Y0I A;  3EFF K;  2ZE7 A;  4FVM A;  4X62 B;  2Q0A A;  2UXC O;  1JCH A;  1YIJ V;  2XAH A;  4FM1 A;  5JVD B;  2ZQM A;  4TSF G;  4GT1 A;  3G67 A;  3VQW A;  2GTA A;  4DR4 B;  3EXA A;  4UFZ A;  3QO7 A;  4RUF A;  3JD0 A;  1N33 O;  2Z0A A;  5IE9 A;  1R6N A;  1SZT A;  4WCE V;  5EIB C;  1DK1 A;  3FFQ A;  1S0V A;  1I5Y A;  1VQ8 V;  1LUV A;  4YY3 O;  4UCO A;  4J9Y B;  3H1J H;  5GW7 A;  3JAM N;  1VQM V;  3PJS K;  1K34 A;  3UKM A;  5IYD O;  1ROP A;  4JI4 B;  2B9Z A;  2WAM A;  1ZL8 B;  3IC7 A;  4GZR B;  1VF6 A;  2P90 A;  3ASN B;  1Q6H A;  4O4H A;  4BIO A;  5LP6 B;  3CJH B;  3LDD A;  1S5J A;  2VQE B;  4FLY A;  3CRQ A;  4GX0 A;  2KG7 B;  1H2N A;  2UXB O;  1IUR A;  3MDS A;  3D3I A;  3P30 A;  4WBN B;  3FB5 C;  3ZED A;  1I94 O;  3IC9 A;  4HBN A;  4O4J B;  5B5E Z;  2EIJ C;  3RYF A;  1ZX3 A;  5BR8 O;  2NNU A;  4O4L B;  3JD3 A;  3RYI B;  1FXK A;  1N34 B;  2D2C B;  4WFB V;  5GON B;  1FS0 G;  5FPO A;  3H1L H;  4ICG A;  4MS2 A;  1S72 V;  2P4V A;  5BXZ A;  4EKW A;  1TVK A;  3T4D A;  4I50 B;  3P32 A;  4NXN O;  1YVW A;  2PUS A;  2QKA A;  5H6Q A;  4MT8 A;  5EC1 C;  4YJ3 A;  2QEX V;  3UT5 B;  2XND G;  1YDX A;  1YF2 A;  3L75 H;  2OIE A;  4WFE A;  2X0L A;  1KP3 A;  3WU2 Z;  2AZ0 A;  3DTU B;  5KA6 A;  3JD2 A;  5JVD A;  3JAL B;  2Z3Y A;  4J42 A;  1R3J C;  4JF3 A;  2EIN B;  5IYC O;  4YIO A;  3THO A;  4DK0 A;  4DR6 O;  4KHP O;  2OYQ A;  1Y67 A;  5IT9 N;  1GKF A;  4GX2 A;  1K3E A;  2ATK C;  4X1Y B;  3K08 A;  1QLE B;  3ZX6 A;  2EJ7 A;  2ITD C;  4XBF A;  3WG7 B;  4W4K A;  2ETN A;  4YIP A;  2HP8 A;  2QKC A;  1P49 A;  2ZNI A;  3FKS G;  4FLX A;  3CC4 V;  4QE9 A;  5J2U B;  5E79 Z;  5LP6 A;  3CJH A;  1VQ6 V;  5A9G A;  3AG4 B;  2GV9 A;  5LA6 B;  2KG7 A;  2HHH B;  1Q6U A;  3T1H B;  4WBN A;  3CRR A;  2VQF B;  2P4K A;  4MVZ A;  3K79 A;  4F4L A;  1N0N A;  3LNN A;  1S5L Z;  3EVK A;  5JJE B;  3QF7 A;  2EBO A;  2UXD O;  3FYE B;  4IT5 A;  3W7S A;  5C93 A;  4O4J A;  4DV1 B;  2WLH A;  1Q43 A;  3H1I H;  1F4M A;  2F95 B;  3CHX A;  3H1K H;  4X66 B;  4NXM O;  4O4L A;  3CCV V;  2RJZ A;  3RYI A;  1JMK C;  2E74 B;  3K5L A;  5GON A;  1YZB A;  3ETQ A;  3ABL B;  1W2B U;  5KHH A;  4IGG A;  2D3O W;  5EZY B;  4FM2 A;  4I50 A;  5EK0 A;  1XEQ A;  2JK5 C;  1X59 A;  3SJA C;  4DV2 O;  1P7G A;  3SGI A;  3UT5 A;  2PYL A;  4PDM A;  3CPW U;  3W7U A;  5IDJ A;  5D5Q A;  2R70 A;  4UCV A;  5K1X A;  2X6B A;  1SQF A;  3KCY A;  4LF6 B;  4JPR A;  3OE7 G;  2LJ2 A;  4AQY O;  1NTK H;  2HVJ C;  3LUT B;  2HJD A;  4DUZ B;  5KHG A;  5LMN B;  3JAL A;  4JGS A;  2JVD A;  3RYC B;  1Q7Y W;  2HR3 A;  5L3D A;  1OCR B;  3B2E E;  1OCZ B;  2P67 A;  4DR5 O;  4OX9 B;  3SJQ C;  4G28 B;  4JV5 O;  3CME V;  3SDL A;  4L8J A;  3D3Q A;  2QM7 A;  4WFH A;  2AHY A;  1K7D A;  2XAG A;  3E89 A;  4QE7 A;  1IXB A;  4X1Y A;  1KMI Z;  1JJO A;  4H37 A;  2ZCE A;  5JCO C;  2LP7 A;  3STZ C;  4E4E A;  5D5P A;  3NXS A;  4QGP A;  1SQQ H;  1MSD A;  1P4R A;  4R50 A;  1VQP V;  5J2U A;  3AK1 A;  3N2G B;  3OR7 C;  1CEZ A;  3RT3 C;  5LA6 A;  3ZBH A;  1Q5O A;  1KBH A;  2NLJ C;  3K3W A;  2AGA A;  4WFG A;  1B3Q A;  1JA8 A;  3JCU Z;  4W4L A;  5L3C A;  4X1K B;  1XQ8 A;  4BR6 A;  5CBG A;  4DV4 O;  1QR8 A;  2Q9L A;  1L8D A;  3TXS A;  1XMO B;  4OPA A;  4UVB A;  4YHH O;  1IBL B;  1WPB A;  4DR3 O;  2OT5 A;  1K4D C;  2YI8 A;  4D7S A;  2JEU A;  2EIM C;  5LGT A;  4O2A B;  2DQ0 A;  5CBH A;  1ENV A;  2HLD G;  2F4V B;  2ZIN A;  2CTQ A;  3FB8 C;  4JI0 B;  1AP5 A;  3IGA C;  1NS1 A;  3E22 B;  5LHG A;  1WP7 A;  1PNM A;  1PV0 A;  3ZRW B;  4JYA B;  1G4Y B;  5EZY A;  1FPO A;  2KKW A;  5EYP B;  2BOC C;  1YJ9 V;  2KB1 A;  2IU0 A;  4B7E A;  5CN0 A;  5JQG B;  2UXC B;  1BHB A;  2HG5 C;  3HKE B;  4UB6 Z;  1L0N H;  3HKC B;  4JAA A;  3WB0 A;  1EBO A;  4PA3 A;  2W0X A;  1WP8 A;  3ZMZ A;  2WA4 A;  1J95 A;  4BW5 A;  1ORQ C;  2Q8V A;  1L0L H;  1BQZ A;  2OCH A;  2CTR A;  1WPX A;  2DYS B;  5KX5 B;  4H44 B;  2ZDI A;  4FMT A;  2P7T C;  2EUL A;  2VWK A;  3D36 A;  4DO2 A;  4TWK A;  3RYC A;  4NTY A;  4ZOL B;  4X9Q A;  1RP3 B;  1FYJ A;  3L9D A;  2LW7 A;  2N05 A;  3APO A;  1IBK B;  4ZIB A;  1Q90 D;  3C3S A;  4DV3 O;  1WNS A;  1R3L C;  5IYZ B;  2FTK A;  3AG2 C;  5IY5 C;  4KL1 A;  5H5N A;  2F23 A;  2FML A;  4LF7 O;  1BCC H;  3BVO A;  1VMG A;  2UXB B;  2L6L A;  1KUQ A;  3OM3 B;  1KC8 W;  2LGW A;  4FIP C;  3P3P A;  3N2G A;  3ZHV A;  2OIG A;  3CMA V;  2DN9 A;  4JI6 B;  4J80 A;  1M57 C;  3TXQ A;  5CA0 A;  3BA8 A;  4XDJ A;  2LO1 A;  4X1K A;  3ZHR A;  3F7Y C;  4K8Z A;  4FZ0 A;  2QWQ B;  4X89 A;  1TA8 A;  4AHC A;  1YIT V;  1K33 A;  3ABK B;  4RAI A;  5LBQ A;  3K06 A;  1Q86 W;  3KZI Z;  4O2A A;  1F7Y A;  4NXN B;  3AG3 B;  1V55 B;  2XAF A;  3T4Z A;  1ZSP A;  1YXB A;  1OCO B;  1B04 A;  3E22 A;  1ZWI C;  3DSQ A;  3ZRW A;  2HJF C;  2Y4U A;  4B3M O;  3CS5 A;  3E35 A;  5EYP A;  3QNE A;  1I0H A;  1KQS U;  1EN6 A;  1M56 B;  4J11 A;  4TQF A;  4A5U B;  5JQG A;  2A7W A;  3HKE A;  3HKC A;  1FJG O;  2EX3 A;  2OCC C;  4MVU A;  2AHZ A;  1K5S A;  1VEW A;  2LFR A;  4KHP B;  4J7J A;  4X20 B;  3AEI A;  2A3Q A;  3I55 V;  3K0G A;  1BGY H;  2LW1 A;  2EJR A;  2RNB A;  5KX5 A;  1BE3 H;  1FAF A;  1KU9 A;  1V54 C;  1QU7 A;  3QTC A;  2UUB B;  4JI8 B;  4Z1V A;  3M8A A;  4ZOL A;  4OGQ B;  3R65 A;  1S3J A;  4K8X A;  4QNH B;  2K1E A;  1BS3 A;  1SC5 B;  2GBO A;  3T1Y O;  4PJ0 Z;  1AJP A;  2BE3 A;  2ZD9 A;  1PM9 A;  3E83 A;  2EIL C;  3OEH G;  3OT7 A;  5B3S C;  5IYZ A;  3HB3 B;  1OCC B;  1GN2 A;  1NVP B;  1TAE A;  2EIK B;  1BSM A;  3SYC A;  4EEQ A;  4FK5 C;  4QJF B;  1MZE A;  3AG1 B;  4FFB A;  4P30 A;  2GDS A;  4MTG A;  2R9I A;  3CCQ V;  2UXD B;  3CYO A;  4QPJ A;  4LFA O;  1XL6 A;  4KP4 A;  1Y76 B;  2HFE C;  2W6J G;  3K57 A;  3SJC C;  4BIU A;  5LMU B;  1IXM A;  2P22 C;  4DR1 B;  5A2Q N;  4PI0 A;  1OV9 A;  3OW2 U;  3ETG A;  5DM6 V;  4N23 A;  2ARH A;  4JI2 O;  1LR1 A;  1IVS A;  4J10 A;  2ZIO A;  1YSC A;  1RFY A;  2WLK A;  4IYI A;  3H9V A;  4BW9 A;  1LNQ A;  2ZE6 A;  2K9P A;  4B3T B;  2PI4 A;  2UU9 O;  3S3X A;  2IH1 C;  2QWN B;  2RN9 A;  1O9G A;  4UVC A;  4MW3 A;  1KD1 W;  4RUE A;  5B1B C;  2ADQ B;  4AQY B;  2IBZ H;  1AJQ A;  1U96 A;  4JI7 O;  2AZ2 A;  3TK1 A;  5EBM C;  3WB1 A;  4PHZ A;  4X20 A;  4GX5 A;  3UO2 A;  2JEX A;  3OUF A;  3JAW B;  1AP6 A;  3VBB A;  1VQ7 V;  4JV5 B;  3ZJZ A;  4DV7 O;  1ZAU A;  2EZP A;  3L73 H;  3HPL C;  4TQD A;  1R6K A;  3GVM A;  2CGO A;  1OJH A;  2DMX A;  1Q6I A;  3A0R A;  3FD9 A;  1XHX A;  4B3S O;  4LFC O;  2B1I A;  2ITC C;  5CA1 A;  3W7T A;  3CRC A;  2WSS G;  3ZMU A;  3A0B Z;  3CX5 F;  3RVY A;  4X65 O;  1N8R W;  3R66 A;  2E76 B;  1VQK V;  5IYB O;  3OAA G;  3H01 A;  5L3F A;  5GTH Z;  1NBM G;  3N2K B;  3FX7 A;  1VF6 C;  1M56 C;  1NTZ H;  4GKK O;  4DV6 O;  1GRJ A;  2WLJ A;  2NR5 A;  1SES A;  3DC5 A;  5LGN A;  3X2Q C;  4JAS A;  2E5L O;  4DV4 B;  4FPP A;  1URF A;  5EC2 C;  4OPH A;  4QPK A;  1WAZ A;  3JAK B;  2L35 A;  4YHH B;  3OMN B;  4DR3 B;  4PD4 F;  1HWY A;  3OMI B;  1Y76 A;  1Y6X A;  1AVM A;  1GM9 A;  3AG7 A;  3RBZ A;  4LF9 O;  4PEL A;  4DUY B;  3ABM C;  4IHJ B;  4KXR A;  1Y4M A;  1G1X B;  2YIC A;  3ZHS A;  5KLV H;  1BZK A;  3QVN A;  4FLW A;  3OR6 C;  3LSU A;  1FXK C;  1TGO A;  1V9P A;  1IBM B;  1XDC A;  3CCR V;  5J9P C;  5KHK A;  4MVO A;  2P6J A;  2ZXW C;  2B1G A;  4NTW A;  2A9H A;  1Z2G A;  2X6C A;  1R3I C;  3CXH F;  2DWD C;  1SS3 A;  1SET A;  2V4D A;  3SJB C;  4K35 A;  5DN6 G;  5KUK A;  4FLU A;  1VQO V;  1NTM H;  3K58 A;  4CH5 A;  2FKX A;  2Q68 A;  1XBL A;  2XUM A;  4R8C A;  2YID A;  1Q82 W;  3CXC U;  1WA8 B;  1UPG A;  3LDE A;  3L70 H;  2RMK B;  1D5A A;  2DYR B;  3CCE V;  2ZNJ A;  3JAW A;  1I08 A;  3CCL V;  5KHI A;  3FAV B;  4JI1 B;  3E8B A;  4NTX A;  4DV3 B;  1MA1 A;  4D7T A;  2UUA O;  1BL8 A;  3B40 A;  2VWJ A;  1N36 O;  2Y69 B;  3LDC A;  4NYK A;  1AI4 A;  2FYU H;  4DW0 A;  3SPC A;  4MSW C;  5CMU A;  4LF7 B;  1PNL A;  4I0X B;  1S77 D;  4J7K A;  2MW2 B;  2OTL V;  2F43 G;  2ZR3 A;  2F66 C;  1EM1 A;  3N2K A;  3MHS C;  1L1F A;  3ASN C;  5LP6 C;  4MVM A;  2YDE A;  2IM9 A;  3F7V C;  2Q7G A;  4UCS A;  5K1P A;  2CK3 G;  1VF7 A;  5KUM A;  1M1K W;  1RPR A;  3B8N A;  3JAK A;  3GWO A;  4AIL C;  1JFF B;  3RVZ A;  4B3R B;  3RN4 A;  1TUE B;  2RDC A;  2O57 A;  2ZT9 B;  2QWP B;  1HNX B;  1K5Q A;  4IHJ A;  3K9S A;  2IJH A;  1AI5 A;  5EBW C;  4H33 A;  4R7C A;  4WFF A;  2Q0O C;  1HR0 O;  1BT8 A;  3K5N A;  1ZLZ A;  5JJJ B;  1RM1 B;  2M6Y A;  2UUC O;  1SQB H;  4MVQ A;  4P2Z A;  2ZKO A;  5BZB A;  3ASO B;  4MTO A;  1XNQ B;  5FNV B; 
#chains in the Genus database with same CATH homology
 2HJD A;  2Q0O C;  2RMK B;  4IGG A;  1CXZ B;  4NB5 A;  1URF A;  4NKG B;  1UPG A;  4DYL A;  1RFY A;  1US6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...