1CXZB

Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
86
structure length
86
Chain Sequence
WSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-181))
total genus 38
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1cxzB00
4NB5A 1CXZB 1UPGA 2RMKB 1US6A 4NKGB 1URFA 2HJDA 4DYLA 1RFYA 4IGGA 2Q0OC
chains in the Genus database with same CATH superfamily
2E3CA 4GZRB 2EJRA 5LXTB 1XMOO 4DV4O 4TWKA 2UU9O 3FYIB 3K57A 4DV6B 1SF9A 5LGTA 1OCCB 1YSCA 2AGAA 1AR5A 2ODMA 4FFKA 1FXHA 4FLUA 3A8TA 3RGBA 1PM9A 5J2UB 4DR5B 2WAMA 4O2BB 3CRMA 3K59A 2Q0AA 1SQPH 4LFAB 1FJGB 2LW7A 4JI8B 5KA5A 3W7UA 1N34O 2FB5A 3JALB 3ASOB 1IX9A 1GH6A 1FXVA 1SRYA 1QR8A 2ZXWB 4FZ1A 1YTFB 4LF4O 1VQ4V 4FFBA 5LMNB 1SQGA 3CEIA 1SS3A 1QLEB 3RYIA 2HG5C 2PYJA 5CMUA 3CCVV 1CPYA 5EBWC 4JI4O 1VARA 3B2EE 1JVMA 5H2FZ 2WLLB 4J9ZB 3CMEV 1QQCA 3W7TA 1QCEA 4X62O 3APQA 3IJ4A 3L75H 3K58A 4HNAA 4UVAA 4X1IA 4JV5O 2JJ1G 3JAMN 3JASA 1M9NA 1US6A 3L71H 1G6UA 1RPRA 4KHPO 1T5EA 2Z0AA 5LP6C 1Z5WA 2R9IA 2ZE5A 3HKCA 3ZHTA 1BQ0A 2YXYA 3TK1A 5L3DA 2Q4PA 2JGDB 1COWG 4PHZA 2ADQB 3MHSC 2B1IA 4JI3B 4CC6A 3ZJZA 4O2AB 3T4ZA 2R70A 4JI0B 1KUQA 2DYRB 1WNSA 1SETA 3E89A 1H2NA 5FNVB 1BMFG 4I9WA 1GTOA 5FLXN 3CC7V 4DR7O 1ZUQA 3ZRWB 1F7YA 4FLZA 1YVWA 2KKWA 1G4YB 1I0HA 3ABLB 4X1KB 4DUYB 1KD1W 5LHGA 4GX2A 1HNZO 1NI8A 2HP8A 3OE7G 4JF3A 4GX1A 2KSDA 3LUTB 3OGCC 3LDCA 5TISZ 2ZIOA 1R3KC 1JMKC 2AHYA 4F6EA 5BMVA 1KKCA 4JAVA 4PELA 4WFFA 5CA3A 1KP2A 2QGNA 2QSAA 1K3EA 1OCOB 4K8XA 3DGEA 1OCZC 4JI8O 2R9RB 2QWRB 4H13B 1IDSA 3FB6C 4DV5B 1VF6A 3JCZA 1V55B 4FZ0A 5JH7A 3K9AA 3OMAB 4NR1A 2A0LA 4EFEA 2CH7A 4LNUB 2A3QA 2ZINA 3QNEA 5IYBO 4WFBV 5J2TB 1CXZB 3BY6A 2UXCB 2EINB 3ABTA 2H8PC 1R6NA 2YUAA 5C8YB 3ZS8C 3TJTA 1JJ2U 2JEUA 2DW4A 4N21A 3APOA 2AW9A 4LBEC 4J80A 1PV0A 2KQXA 4X20B 2GBOA 2YICA 2WLIB 1XMOB 3X2QB 1Q7YW 4R7CA 1M93A 4X9QA 2ITDC 3EFFK 2IBZH 4GUNA 2Q6AA 2AZ2A 3ZN1A 1G1XB 4FMTA 1JPXA 4MVRA 4E4EA 3GWKC 3NXSA 4BW5A 3CWBH 5KAFZ 2V7QG 3LNMB 1WN7A 1BS3A 3RYFA 2UUBB 1M90W 4LF7B 3G67A 5LYJB 2L35A 5ITZB 4WFHA 3CYOA 4DRXB 5KLVH 2FYUH 3LDDA 3W7WA 1XNQO 4YY3O 4PI2A 1BT8A 3ZMTA 1P7BA 4H0LB 1AVMA 1YJ9V 3P32A 1NH2B 3SYPA 5H6QA 2GSMB 1SZXA 1GN6A 2W6IG 3SJQC 2UXXA 1I94B 4DXWA 1HP8A 3E8GA 5LHHA 4P2ZA 1Y67A 2VRZA 1VQ5V 1K9MW 4FM0A 1AP6A 3OD4A 2EJ7A 2DN9A 4Z2WA 4O4HB 4LF8O 3K5LA 5KMGB 3B8NA 1HR0O 1JR9A 2A06H 1I94O 4DV1O 4RUFA 3SPJA 2UUCO 1Y74A 2XUMA 5EZYB 4D6TH 3W7XA 4OX9O 3H9VA 3HKDA 1IZ3A 2QA4V 1GN2A 3CRAA 4B3TB 2P6JA 2BTQA 1QU7A 2XAJA 1B06A 1KQSU 1VQ7V 1EZJA 1TA8A 3ASOC 3K08A 3CX5F 1XNRO 2YXLA 2BCCH 3IAYA 1KU9A 2Q69A 2XAFA 1Z5VA 4UFZA 1H8EG 3RFRA 3FB7C 3LSSA 2E75B 4NXMO 2M6YA 2XOKG 4MT8A 3OTOB 1TVKB 1OV9A 2NLJC 3E35A 2HVKC 4UUJC 3A0BZ 4YJ3B 3B4SA 2EINC 1RFYA 3ZRXA 4PDRA 4DV7B 3CC4V 3ZMSA 5KUMA 5LGNA 2RCVA 3JASB 3OMNB 5JQGA 5LMNO 2PI4A 2QDOA 2F95B 4FIPC 2Y69B 1BHBA 4LR3A 5IYZA 1XUQA 4O4LA 2YIBA 3B09A 1XOUA 5EYPB 3FKSG 3FYEB 3RW0A 3S3XA 2Y4TA 5F2VO 4NVPA 3OW2U 4K0KO 1Q86W 4WFGA 5B1AC 2ZR2A 5HFMA 3TETA 4I50B 4PI0A 1XMQB 1XL4A 3SYCA 4K8ZA 4RUEA 1EZVH 4DR2B 2EIJC 2PF4E 5KHJA 1ORQC 5KHGA 4CC5A 3SGIA 1E1QG 1NH2D 2WLNA 1EBOA 3SDLA 1H8HG 3AEIA 1XNRB 3R66A 3T2MA 3K5MA 1VQLV 2JRIA 2ILMA 2IW5A 1P84F 2YDEA 1NT2B 5JCOC 1N33O 1K8AW 4I55B 1Q43A 1AI5A 3SPGA 3AK2A 2HHHB 3UT5B 3NR7A 2QTSA 3ZCCA 4AQYO 1NTMH 2DOSA 3ABKC 5B5EZ 4JTAB 1WA8A 2IH3C 4QPJA 2EIMB 3QO8A 4CS2A 3BA9A 3W7SA 1D5AA 4B3SB 3ZRWA 2QM7A 4LFCO 5KHKA 1FS0G 3VQXA 4GT1A 3J81N 3UM7A 4OX9B 1W0JG 4X1KA 2GHYA 3ZHRA 4JI0O 1K4DC 1Z2GA 2PYLA 5HFLA 1FXKC 1NBMG 1ZTEA 3X2QC 3SJAC 1S5JA 4MVZA 5IJ0A 4PA6A 3WG7B 5DN6G 4Z1VA 4QE9A 1BGYH 4DK0A 4XDLA 3U10A 5IY5C 5FPRA 3CCJV 3RYHB 3FB5C 1Y76B 3AK1A 4U7NA 3RYIB 4JYYA 2F1MA 2WLKA 4R8CA 1XMQO 5L3CA 1L0LH 5CB4A 2H94A 3ZX6A 3DSQA 4JI1O 1N8RW 2CDYA 2QM8A 3JYCA 1N32O 2CK3G 3ZRVA 2DYSB 1N34B 4IYIA 2YIDA 5BXZA 3VQWA 4FM2A 5IWAB 2EIJB 3BABA 4OPAA 5JVDB 1Q82W 4PD4F 3ZMVA 4B7EA 3CRCA 4FVMA 4DR5O 1HNWO 1QLEC 4WBNA 4ZOLA 4DR2O 4J10A 3TCUA 1V55C 1PP9H 3ZIAG 1SQBH 4BW9A 4LP8A 1M57B 4CS4A 2BOCC 5L3FA 4UCOA 3CCUV 1VF6C 2IJKA 5JCOA 4DV6O 4FK5C 2JGDA 4UB6Z 4DV4B 2CTQA 4F6RB 3D3QA 1PL0A 3CRRA 2JIZG 3JAKA 3CPWU 4J41A 5L3BA 2R9AA 3FX7A 1MMMA 2Y69C 1MG1A 3ZRSA 3ETQA 4CBCA 1YJNV 1LUWA 3QO5A 2QEXV 3TXSA 1JOYA 2HKOA 4X20A 1WAZA 4EB6B 1NZ6A 2M7WA 2UU9B 4TQFA 1YXBA 3N2KB 3DC6A 2A79B 4UV8A 1QHTA 2Q7GA 1NTZH 2EX3A 3K03A 4J11A 2ZE7A 3P30A 5IYDO 3C3TA 4YIOA 1P49A 2XASA 3L72H 4K35A 3L9DA 2ZM6O 1FPOA 2XAQA 2P7TC 3AG3C 4DR4B 2BSKA 1N36B 1PNLA 1I08A 2BE3A 4JI6B 4F4LA 1QVGU 2Y0PA 4HZ3A 1IXMA 2FTKA 2BTQB 2ITCC 4P9PA 1I5YA 4O4LB 5J2TA 2P5OA 1SA0B 1W59A 3I5DA 2YS8A 2LFSA 4UXNA 2DYSC 2GUZA 2JJ2G 3E22B 1Y6XA 4Q20A 4MVQA 5GONB 3CE2A 2F43G 2P22C 2QWQB 4AHCA 3UKMA 1XNQB 3QO7A 3H1IH 3CMAV 5KMGA 3PJSK 4LWSB 4W4LA 1AJPA 1Q5OA 5LXTA 1ZLZA 1H2LA 4RQEA 2Q7HA 4IT5A 1NU1H 2VQFO 5IDJA 1YF2A 3UCSC 3CJHA 3E8HA 4P30A 5GONA 2MW2B 4B3MO 3CS5A 2YI9A 2OTLV 3THOA 1R3LC 2KB1A 1KBHA 3UT5A 2PTMA 2LQTA 5J2UA 2X7RB 5IJ9B 5H5NA 2UUAO 2F93B 4YIPA 1S77D 2EILB 2VWKA 4EFBA 2W0XA 3Q4HA 4HBNA 4DW0A 3G6EV 4TV8A 1MNGA 2E76B 2ZM6B 4B7KA 3A0HZ 4CH5A 2XT9A 2Q8VA 1Y66A 1MZEA 3P3NA 1F51A 3CCEV 4JYAB 3I55V 4DR3O 3QF7A 3I56V 1SC5B 3L74H 4QJFB 4K0KB 3JATB 4TUYA 4RAIA 4B3RB 4OPHA 1J5EB 4BAYA 3STZC 1ZX3A 3DXRA 4LF9B 3GVMA 5JJJB 3RVZA 4YHHO 3ETGA 4B08A 4W4KA 4I55A 1X4TA 5CN0A 1JQ0A 3H01A 4J42A 3B77A 1M4UA 2N05A 5IWAO 1VMGA 2QE7G 4O2BA 1FJGO 1SQXH 3E83A 4UVBA 2UXBO 5K1PA 4FLXA 3HPLC 2YXHA 4IGGA 3SYAA 3OMIB 3JARA 4UVCA 4J7ZA 3ZHSA 4UCUA 1TUBA 3BCCH 4JI5O 1M56C 4JYCA 3WFVA 1TVKA 2F23A 1YJWV 5CBFA 4YJ3A 3JSNA 1QNMA 3E8FA 3WB2A 1WB7A 1K33A 1SZTA 3ABMC 1MA1A 3ZHUA 1I5XA 2K9PA 2WWWA 1Q81W 1R3IC 4MW8A 2Z3YA 2HJDA 4WCEV 4MVMA 5KHHA 2OT5A 1Q8IA 2Q5ZA 4X88A 2AXTZ 2HHHO 3ZMZA 5LA6B 4GKJB 2VQFB 1D2DA 2EIKC 3BVOA 1X59A 2CTWA 4A5UB 4B3SO 4U3FH 1K73W 2P90A 5IE9A 4UV9A 5E79Z 3ICXA 1K97A 4GLXA 1H2GA 2FKXA 4FM1A 2WA3A 5CA1A 1QR9A 5GW7A 3JAWA 4B3TO 1V9PA 3QG5A 2RNBA 4PA7A 2Y4UA 3OM3B 1KYOF 1VEWA 4X8AA 2JDIG 4BIOA 3H1KH 4YHHB 1WP7A 2C2AA 2FL4A 3SYQA 1Y4MA 4ZOLB 3G80A 2DE0X 2IJJA 1OJHA 4JZ2A 3STLC 1AJNA 1AILA 4B3RO 3T1YO 4DYLA 4X1IB 1N4CA 2Y48A 3SJCC 4X1YA 1AR1B 5LP6A 1HNXO 5EC1C 3KCXA 1H2SB 2A7WA 2ZXWC 4X64O 1B04A 2MK3A 3H1LH 3UQ8A 2JS5A 2AZ0A 4QIWF 4Z1MG 1WP8A 2CUGA 5JJEB 2UXDO 4MVSA 4UCSA 2CE4A 3F5TA 1UPGA 2O57A 3K9SA 3EXAA 3MHHC 1J5EO 5GTHZ 2ZNIA 2WSSG 2YEVA 4O4IB 4DV5O 3ZBHA 2UUAB 3F5WC 2ARHA 3A0RA 3CCLV 5A9GA 3ABKB 4GX0A 5CBHA 5L3GA 4MW3A 1M1KW 2CTPA 3ABMB 4GX5A 3P3PA 2ZKOA 4CH3A 4HAMA 5EIBD 5EBLC 3ABUA 1ROPA 3UO2A 1M56B 4DV7O 3K5OA 2XHBA 4DR1O 2PUSA 5BR8B 1SQVH 2E5LO 3J7AU 1THZA 3JD1A 4QGPA 5KAIZ 1FKAO 1WJZA 4RO2A 5DEDA 5CA0A 2RMKB 3N27A 1FXKA 4ZHQA 5B1BB 5GTIZ 4JZGA 4DUZO 3LSUA 4GKKB 4LFBO 3Q4HB 3ASNB 1SQQH 5E1AC 5B1BC 2D2CB 5DM6V 3IFXA 2EZOA 1EN4A 4TSFG 5ITZA 2L6LA 4DV0B 1S5HC 5H6RA 1VQPV 2GTAA 3SPIA 2JGUA 4WFAV 4NXMB 4U3JB 4GKJO 3G71V 5A2QN 1R6KA 1DK1A 2QWNB 1OCRB 3OR7C 1IURA 3ZHVA 1O9HA 3BFRA 3CRQA 2IH1C 5BY1A 3T1CA 3B40A 1K5SA 2DMXA 1L1FA 1MOFA 2ZIMA 1YHQV 1IBKO 4PJ0Z 3RN4A 3FFQA 3OEEG 5IYCO 3MDSA 1S3JA 1YIJV 1P7GA 1JFFB 1NR1A 1XQ8A 1PD3A 3BAAA 3F7YC 3JARB 1K5QA 4EB6A 4TV8B 3ETEA 5EC2C 2IU0A 1LNQA 3SPHA 3VOUA 4X62B 3CC2V 1HR0B 1KP3A 5IYZB 3FD9A 2GV9A 3TGUH 2GDSA 1IBKB 4JTCB 2RDCA 4KL1A 1AJQA 4LF5O 3HKBA 4D7SA 1TAEA 5B3SB 1F4MA 5B66Z 3IC7A 3MD0A 3ETDA 1JFFA 2R72A 1ZAUA 5B1NA 2XAHA 4I0XB 3CJHB 3AG1C 3DXRB 1GM7A 4DUZB 4I50A 2OCCC 4DV3B 5FL7G 1VP7A 2IM9A 1YCIA 2Q67A 5C93A 3RYCB 5CBGA 1W0KG 2B9ZA 2GUZB 1DF4A 1BCCH 1HDJA 1N0NA 2EZPA 1RP3B 3KG2A 4E2LA 4I0XA 2Q7EA 1KECA 3T4DA 1GN4A 1H2MA 3AG4C 1K7DA 4XDKA 4H33A 3JD3A 1WPBA 2V4DA 1Q6IA 1LR1A 4HNAB 3CCSV 4GYCB 1DGSA 1B6QA 1YDXA 2N04A 4DUYO 4DR1B 4TT3G 2CGNA 3K3WA 1YITV 4FLYA 1AB3A 1AROP 2LGQA 3SYOA 1H2KA 3CB2A 2JK5C 2F66C 2G38A 3D3IA 1SQFA 4FFBB 4BR6A 4O4JA 1KKDA 4X1YB 1FYJA 1RPOA 4NYKA 1RSOA 3K5NA 5B1AB 4LC1A 2F4VB 3OUSA 1UFIA 1E79G 1HNXB 2HFEC 4LFCB 3CXHF 5JQGB 4X65B 3F7VC 2K1EA 3T1YB 4HYOA 3HR0A 5IJ0B 2H3OA 3CCQV 2VQEO 3WB1A 3RVYA 1ZL8B 2QKCA 1FFXB 1NTKH 3FAVB 4MTGA 3OTOO 1VF5B 4NTYA 4OGQB 4AQYB 3QVNA 4IHJA 4O4JB 1RSOB 3ML0A 4XBFA 4TUYB 5CB4B 2EILC 2HJFC 1ZWIC 4LF8B 5KUKA 3HKCB 4ABMA 4EKWA 3VQYA 4LF6B 3ZMUA 1NKDA 1K34A 5LOVB 1ZL8A 4MTXA 1N36O 3CSXA 4QE7A 5LA6A 1ENVA 4BWAA 5K1XA 5LP6B 4JI3O 2D3OW 4WBNB 2LFRA 4MVOA 4FPPA 4P9OA 4PV1B 2E5LB 2HLDG 3K0GA 2HEPA 4DV0O 1YI2V 4YY3B 1JJOA 1CP9A 5DECA 2B5UA 5BZBA 4JI7B 2OCCB 3GWOA 3A2FA 5LHIA 1PKXA 1M5IA 3K79A 4O4IA 2QM4A 2ZCEA 2EULA 1F4NA 4GKKO 4JASA 2V1DA 3MAQA 1XI1A 1V54B 3OTFA 4RQFA 1I7FA 1XL6A 5BR8O 2IU3A 1GAXA 4FLTA 1YEWA 5IY5B 3N2KA 4R50A 4LFBB 3BRCA 4ZIBA 3M8AA 4DRXA 2IJHA 1FD9A 2ZR3A 4UB8Z 4X89A 3AG1B 1OCCC 1RM1C 5LGUA 4BIZA 4LF9O 1N0JA 5CA1B 3RWRD 3L73H 4Q6GA 3RYHA 3E8BA 1OCOC 1H38A 4F6RA 3AG4B 1Q3EA 1HWYA 3AG7A 5AG2A 5LMUO 3CD6V 2RQ6A 2DQ3A 1XILA 1IBMB 1EN5A 1DLBA 5BMVB 3AG3B 4NB5A 4NXNB 4UCVA 1IBMO 1NS1A 3AG2C 4JI2O 4UCTA 3ASNC 4QPKA 1HNWB 3UO3A 2YIAA 3M99B 4H37A 1GN3A 2Y0IA 5L3EA 2XNDG 4AILC 2DWEC 2CH7B 3HKEB 4X66B 3N2GA 1PPJH 1N32B 2JVDA 4ZHQB 3H1JH 4JYAO 2YI8A 4JI1B 3RYCA 1GM9A 4BIUA 2Q73A 3IGAC 2WLJA 2XTAA 1TUEB 3CP1A 2YEVB 3VBBA 4JAUA 2BSKB 2KG7B 1SKVA 3AK3A 2QWPB 1IXBA 5KX5B 3LNNA 2PZSA 4LF5B 3CCMV 3K06A 4DR6O 4O4HA 3WU2Z 1EN6A 1VQ6V 1S0VA 5H9CA 2CAZC 4G2KA 3N2GB 1SERA 4D7TA 4G27B 1BSMA 1LUVA 1R73A 1NVPB 4FLWA 4DR7B 4LF7O 2VWJA 3BPZA 5IT9N 1SA0A 3HKBB 3D36A 2HVJC 4WFEA 3HKDB 4FLVA 3GB7C 1JA8A 1N33B 1HW7A 4PDLA 4YJ2B 5FPOA 4RWUA 4TV9A 5D5PA 3JD4A 2VQEB 2NNUA 2E74B 3S3WA 4H44B 4PA9A 1NR7A 4FJCC 4DR6B 3OGIB 3OR6C 1Q90D 4JI6O 2RJZA 2LGWA 4DR4O 3R65A 1O9GA 2WPDG 1IBLO 3SPCA 1RM1B 2PGGA 4JV5B 2P67A 3K0DA 2BTOA 1GM8A 3D36C 2ZNJA 4IIJB 3RT3C 4ZI7B 5JWPA 3FB8C 2OWOA 1VF7A 4I5SA 4MSWC 4MVUA 1VIBA 2P06A 1PNKA 1OHHG 1S5LZ 2QKSA 4NTWA 4CZZA 5LL6Y 2W6JG 1XDCA 2P4VA 5EZYA 2WLLA 3BHPA 4NXNO 1IVSA 1GMGA 1BQZA 4I4TB 4PA3A 1QVFU 3OAAG 4ICGA 4IIJA 4ZI7A 5EK0A 1R3JC 1URFA 1MZFA 4LH6A 3SJBC 3OUFA 2QKAA 4PDVA 1PNMA 1OZ0A 4X65O 2EIKB 4R6ZA 3CCRV 2JS3A 4QNHB 1R6TA 1WB8A 4J7KA 3KZIZ 1VQMV 1DF5A 3OFNG 1WA8B 2LP7A 1P4RA 2X6CA 2OTJV 1Q6UA 4DV3O 2ZDIC 2UXDB 1VQOV 4I4TA 3B8MA 1FFXA 2NN4A 3FAVA 1GKFA 1IBLB 2YSUB 1MSWD 3OT7A 1AI7A 1A32A 2B1GA 3CXCU 1BL8A 4JTDB 4ASUG 1XEQA 3EHBB 1S72V 4DO2A 2PY5A 2EBOA 5FNVA 3C3SA 4DV2B 1U96A 4DR3B 3O9OA 2LW1A 1V54C 1YZBA 3LSQA 3JD2A 4G28B 1XREA 3H1HH 3U0ZA 5LOVA 5B1OA 1AI6A 1E1RG 4L8JA 1WPXA 4U7OA 1FFTB 3D8CA 2AHZA 5EYPA 1G8MA 2P4KA 4KFMA 4WF9V 2QJ1A 1EFRG 1L0NH 4JI7O 4C7UA 2CGOA 2CTRA 3ZEDA 4KUMA 2DJVA 1GRJA 4KHPB 4J9YB 1UJWB 3RBZA 4IHJB 3DC5A 2JEXA 3E2EA 3U11A 3WB0A 2UUCB 5JVDA 2ZE6A 4ZKIA 4LH7A 4J7JA 5C8YA 1QLNA 4ZBMA 4NTXA 4LF6O 2A9HA 4X66O 1AR4A 3SR2C 1NJIW 4JAAA 1QBZA 4I9QA 5JJNB 5KHIA 1M57C 4KXRA 1WLEA 1VQNV 2Q9LA 4JI2B 2Q68A 3L70H 1S76D 1MSDA 2ZDIA 1GK9A 3J80N 2Q0OC 5B3SC 1Q6HA 5EBMC 3JALA 2OYQA 1XHXA 4TOIA 2RN9A 4JI4B 4K3AA 1NQTA 2UUBO 2ETNA 4YXWG 4CH4A 2UXBB 2XAGA 2UXNA 5J9PC 2QR4A 3BEHA 2YIBD 4N23A 5CA0B 2OCHA 2PI5A 4KP4A 1KC8W 1CEZA 3KKYA 3ZHQA 1BZKA 1KB9F 4X64B 3JAWB 4EEQA 4MTOA 4LFAO 2OIEA 3JAKB 1BHAA 4YJ2A 2QWOB 4CS3A 1JCHA 1Y76A 2HR3A 1K92A 2WLHA 1ZSPA 2FMLA 4I7ZB 1XHZA 3CHXA 1DTOA 3AG2B 3T1HO 2WA4A 2Z5UA 3E22A 3M7MX 5D5QA 3HB3B 1FAFA 5EIBC 4O2AA 2ZD9A 4PDMA 2OIGA 5KX5A 2QTOA 2GTSA 1YTFD 4B3MB 3DTUB 3IC9A 2LO1A 2ADPA 4JYBA 1AP5A 1VQ8V 1U97A 1HNZB 3JSLA 4IYHA 4LCUC 3G4SV 2WLIA 4DV1B 2ZQMA 1TGOA 1J95A 3EVKA 1W2BU 3TXQA 4TQDA 2DQ0A 3OEHG 2LJ2A 1OCZB 4MS2A 1GO3F 2DWDC 4U3JA 1JX9A 1AI4A 3BA8A 3RYFB 1NVPD 4PA4A 1Y74B 4GCZA 4MTFA 4DW1A 3PN1A 2WLMA 3LDEA 2YC0A 5JH7B 3ABLC 1MABG 4LNUA 4JPRA 2DYRC 1FXKB 1D5NA 1EM1A 1B3QA 4AI8A 1R1BA 2VS0A 1XBLA 3KCYA 1OCRC 3JATA 2N74A 3E86A 2NR5A 3T1HB 1L8DA 3K04A 5KA6A 4LF4B 2ATKC 1VQ9V 2W0FC 2X0LA 1F23A 2ZE8A 4DK1A 4IL6Z 4JI5B 4TV9B 3G6BA 4XDJA 4NKGB 3HKEA 2BOBC 2X6AA 3C90A 2EIMC 5IJ9A 1VQKV 2X6BA 4DV2O 4OXSA 1KMIZ 2ZT9B 3ZN0A 4UCRA 2F4VO 4CH6A 3JD0A 1K4CC 1BE3H 4L87A 2KG7A 3JCUZ 5LBQA 5LYJA 4JGSA 2UXCO 1PL4A 3QTCA 3VQVA 1TUBB 1SESA 5LMUB 4LWSA 3WG7C 3O65A 2IJIA
chains in the Genus database with same CATH topology
4NB5A 1CXZB 1UPGA 2RMKB 1US6A 4NKGB 1URFA 2HJDA 4DYLA 1RFYA 4IGGA 2Q0OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB5 A;  1CXZ B;  1UPG A;  2RMK B;  1US6 A;  4NKG B;  1URF A;  2HJD A;  4DYL A;  1RFY A;  4IGG A;  2Q0O C; 
#chains in the Genus database with same CATH topology
 2E3C A;  4GZR B;  2EJR A;  5LXT B;  1XMO O;  4DV4 O;  4TWK A;  2UU9 O;  3FYI B;  3K57 A;  4DV6 B;  1SF9 A;  5LGT A;  1OCC B;  1YSC A;  2AGA A;  1AR5 A;  2ODM A;  4FFK A;  1FXH A;  4FLU A;  3A8T A;  3RGB A;  1PM9 A;  5J2U B;  4DR5 B;  2WAM A;  4O2B B;  3CRM A;  3K59 A;  2Q0A A;  1SQP H;  4LFA B;  1FJG B;  2LW7 A;  4JI8 B;  5KA5 A;  3W7U A;  1N34 O;  2FB5 A;  3JAL B;  3ASO B;  1IX9 A;  1GH6 A;  1FXV A;  1SRY A;  1QR8 A;  2ZXW B;  4FZ1 A;  1YTF B;  4LF4 O;  1VQ4 V;  4FFB A;  5LMN B;  1SQG A;  3CEI A;  1SS3 A;  1QLE B;  3RYI A;  2HG5 C;  2PYJ A;  5CMU A;  3CCV V;  1CPY A;  5EBW C;  4JI4 O;  1VAR A;  3B2E E;  1JVM A;  5H2F Z;  2WLL B;  4J9Z B;  3CME V;  1QQC A;  3W7T A;  1QCE A;  4X62 O;  3APQ A;  3IJ4 A;  3L75 H;  3K58 A;  4HNA A;  4UVA A;  4X1I A;  4JV5 O;  2JJ1 G;  3JAM N;  3JAS A;  1M9N A;  1US6 A;  3L71 H;  1G6U A;  1RPR A;  4KHP O;  1T5E A;  2Z0A A;  5LP6 C;  1Z5W A;  2R9I A;  2ZE5 A;  3HKC A;  3ZHT A;  1BQ0 A;  2YXY A;  3TK1 A;  5L3D A;  2Q4P A;  2JGD B;  1COW G;  4PHZ A;  2ADQ B;  3MHS C;  2B1I A;  4JI3 B;  4CC6 A;  3ZJZ A;  4O2A B;  3T4Z A;  2R70 A;  4JI0 B;  1KUQ A;  2DYR B;  1WNS A;  1SET A;  3E89 A;  1H2N A;  5FNV B;  1BMF G;  4I9W A;  1GTO A;  5FLX N;  3CC7 V;  4DR7 O;  1ZUQ A;  3ZRW B;  1F7Y A;  4FLZ A;  1YVW A;  2KKW A;  1G4Y B;  1I0H A;  3ABL B;  4X1K B;  4DUY B;  1KD1 W;  5LHG A;  4GX2 A;  1HNZ O;  1NI8 A;  2HP8 A;  3OE7 G;  4JF3 A;  4GX1 A;  2KSD A;  3LUT B;  3OGC C;  3LDC A;  5TIS Z;  2ZIO A;  1R3K C;  1JMK C;  2AHY A;  4F6E A;  5BMV A;  1KKC A;  4JAV A;  4PEL A;  4WFF A;  5CA3 A;  1KP2 A;  2QGN A;  2QSA A;  1K3E A;  1OCO B;  4K8X A;  3DGE A;  1OCZ C;  4JI8 O;  2R9R B;  2QWR B;  4H13 B;  1IDS A;  3FB6 C;  4DV5 B;  1VF6 A;  3JCZ A;  1V55 B;  4FZ0 A;  5JH7 A;  3K9A A;  3OMA B;  4NR1 A;  2A0L A;  4EFE A;  2CH7 A;  4LNU B;  2A3Q A;  2ZIN A;  3QNE A;  5IYB O;  4WFB V;  5J2T B;  1CXZ B;  3BY6 A;  2UXC B;  2EIN B;  3ABT A;  2H8P C;  1R6N A;  2YUA A;  5C8Y B;  3ZS8 C;  3TJT A;  1JJ2 U;  2JEU A;  2DW4 A;  4N21 A;  3APO A;  2AW9 A;  4LBE C;  4J80 A;  1PV0 A;  2KQX A;  4X20 B;  2GBO A;  2YIC A;  2WLI B;  1XMO B;  3X2Q B;  1Q7Y W;  4R7C A;  1M93 A;  4X9Q A;  2ITD C;  3EFF K;  2IBZ H;  4GUN A;  2Q6A A;  2AZ2 A;  3ZN1 A;  1G1X B;  4FMT A;  1JPX A;  4MVR A;  4E4E A;  3GWK C;  3NXS A;  4BW5 A;  3CWB H;  5KAF Z;  2V7Q G;  3LNM B;  1WN7 A;  1BS3 A;  3RYF A;  2UUB B;  1M90 W;  4LF7 B;  3G67 A;  5LYJ B;  2L35 A;  5ITZ B;  4WFH A;  3CYO A;  4DRX B;  5KLV H;  2FYU H;  3LDD A;  3W7W A;  1XNQ O;  4YY3 O;  4PI2 A;  1BT8 A;  3ZMT A;  1P7B A;  4H0L B;  1AVM A;  1YJ9 V;  3P32 A;  1NH2 B;  3SYP A;  5H6Q A;  2GSM B;  1SZX A;  1GN6 A;  2W6I G;  3SJQ C;  2UXX A;  1I94 B;  4DXW A;  1HP8 A;  3E8G A;  5LHH A;  4P2Z A;  1Y67 A;  2VRZ A;  1VQ5 V;  1K9M W;  4FM0 A;  1AP6 A;  3OD4 A;  2EJ7 A;  2DN9 A;  4Z2W A;  4O4H B;  4LF8 O;  3K5L A;  5KMG B;  3B8N A;  1HR0 O;  1JR9 A;  2A06 H;  1I94 O;  4DV1 O;  4RUF A;  3SPJ A;  2UUC O;  1Y74 A;  2XUM A;  5EZY B;  4D6T H;  3W7X A;  4OX9 O;  3H9V A;  3HKD A;  1IZ3 A;  2QA4 V;  1GN2 A;  3CRA A;  4B3T B;  2P6J A;  2BTQ A;  1QU7 A;  2XAJ A;  1B06 A;  1KQS U;  1VQ7 V;  1EZJ A;  1TA8 A;  3ASO C;  3K08 A;  3CX5 F;  1XNR O;  2YXL A;  2BCC H;  3IAY A;  1KU9 A;  2Q69 A;  2XAF A;  1Z5V A;  4UFZ A;  1H8E G;  3RFR A;  3FB7 C;  3LSS A;  2E75 B;  4NXM O;  2M6Y A;  2XOK G;  4MT8 A;  3OTO B;  1TVK B;  1OV9 A;  2NLJ C;  3E35 A;  2HVK C;  4UUJ C;  3A0B Z;  4YJ3 B;  3B4S A;  2EIN C;  1RFY A;  3ZRX A;  4PDR A;  4DV7 B;  3CC4 V;  3ZMS A;  5KUM A;  5LGN A;  2RCV A;  3JAS B;  3OMN B;  5JQG A;  5LMN O;  2PI4 A;  2QDO A;  2F95 B;  4FIP C;  2Y69 B;  1BHB A;  4LR3 A;  5IYZ A;  1XUQ A;  4O4L A;  2YIB A;  3B09 A;  1XOU A;  5EYP B;  3FKS G;  3FYE B;  3RW0 A;  3S3X A;  2Y4T A;  5F2V O;  4NVP A;  3OW2 U;  4K0K O;  1Q86 W;  4WFG A;  5B1A C;  2ZR2 A;  5HFM A;  3TET A;  4I50 B;  4PI0 A;  1XMQ B;  1XL4 A;  3SYC A;  4K8Z A;  4RUE A;  1EZV H;  4DR2 B;  2EIJ C;  2PF4 E;  5KHJ A;  1ORQ C;  5KHG A;  4CC5 A;  3SGI A;  1E1Q G;  1NH2 D;  2WLN A;  1EBO A;  3SDL A;  1H8H G;  3AEI A;  1XNR B;  3R66 A;  3T2M A;  3K5M A;  1VQL V;  2JRI A;  2ILM A;  2IW5 A;  1P84 F;  2YDE A;  1NT2 B;  5JCO C;  1N33 O;  1K8A W;  4I55 B;  1Q43 A;  1AI5 A;  3SPG A;  3AK2 A;  2HHH B;  3UT5 B;  3NR7 A;  2QTS A;  3ZCC A;  4AQY O;  1NTM H;  2DOS A;  3ABK C;  5B5E Z;  4JTA B;  1WA8 A;  2IH3 C;  4QPJ A;  2EIM B;  3QO8 A;  4CS2 A;  3BA9 A;  3W7S A;  1D5A A;  4B3S B;  3ZRW A;  2QM7 A;  4LFC O;  5KHK A;  1FS0 G;  3VQX A;  4GT1 A;  3J81 N;  3UM7 A;  4OX9 B;  1W0J G;  4X1K A;  2GHY A;  3ZHR A;  4JI0 O;  1K4D C;  1Z2G A;  2PYL A;  5HFL A;  1FXK C;  1NBM G;  1ZTE A;  3X2Q C;  3SJA C;  1S5J A;  4MVZ A;  5IJ0 A;  4PA6 A;  3WG7 B;  5DN6 G;  4Z1V A;  4QE9 A;  1BGY H;  4DK0 A;  4XDL A;  3U10 A;  5IY5 C;  5FPR A;  3CCJ V;  3RYH B;  3FB5 C;  1Y76 B;  3AK1 A;  4U7N A;  3RYI B;  4JYY A;  2F1M A;  2WLK A;  4R8C A;  1XMQ O;  5L3C A;  1L0L H;  5CB4 A;  2H94 A;  3ZX6 A;  3DSQ A;  4JI1 O;  1N8R W;  2CDY A;  2QM8 A;  3JYC A;  1N32 O;  2CK3 G;  3ZRV A;  2DYS B;  1N34 B;  4IYI A;  2YID A;  5BXZ A;  3VQW A;  4FM2 A;  5IWA B;  2EIJ B;  3BAB A;  4OPA A;  5JVD B;  1Q82 W;  4PD4 F;  3ZMV A;  4B7E A;  3CRC A;  4FVM A;  4DR5 O;  1HNW O;  1QLE C;  4WBN A;  4ZOL A;  4DR2 O;  4J10 A;  3TCU A;  1V55 C;  1PP9 H;  3ZIA G;  1SQB H;  4BW9 A;  4LP8 A;  1M57 B;  4CS4 A;  2BOC C;  5L3F A;  4UCO A;  3CCU V;  1VF6 C;  2IJK A;  5JCO A;  4DV6 O;  4FK5 C;  2JGD A;  4UB6 Z;  4DV4 B;  2CTQ A;  4F6R B;  3D3Q A;  1PL0 A;  3CRR A;  2JIZ G;  3JAK A;  3CPW U;  4J41 A;  5L3B A;  2R9A A;  3FX7 A;  1MMM A;  2Y69 C;  1MG1 A;  3ZRS A;  3ETQ A;  4CBC A;  1YJN V;  1LUW A;  3QO5 A;  2QEX V;  3TXS A;  1JOY A;  2HKO A;  4X20 A;  1WAZ A;  4EB6 B;  1NZ6 A;  2M7W A;  2UU9 B;  4TQF A;  1YXB A;  3N2K B;  3DC6 A;  2A79 B;  4UV8 A;  1QHT A;  2Q7G A;  1NTZ H;  2EX3 A;  3K03 A;  4J11 A;  2ZE7 A;  3P30 A;  5IYD O;  3C3T A;  4YIO A;  1P49 A;  2XAS A;  3L72 H;  4K35 A;  3L9D A;  2ZM6 O;  1FPO A;  2XAQ A;  2P7T C;  3AG3 C;  4DR4 B;  2BSK A;  1N36 B;  1PNL A;  1I08 A;  2BE3 A;  4JI6 B;  4F4L A;  1QVG U;  2Y0P A;  4HZ3 A;  1IXM A;  2FTK A;  2BTQ B;  2ITC C;  4P9P A;  1I5Y A;  4O4L B;  5J2T A;  2P5O A;  1SA0 B;  1W59 A;  3I5D A;  2YS8 A;  2LFS A;  4UXN A;  2DYS C;  2GUZ A;  2JJ2 G;  3E22 B;  1Y6X A;  4Q20 A;  4MVQ A;  5GON B;  3CE2 A;  2F43 G;  2P22 C;  2QWQ B;  4AHC A;  3UKM A;  1XNQ B;  3QO7 A;  3H1I H;  3CMA V;  5KMG A;  3PJS K;  4LWS B;  4W4L A;  1AJP A;  1Q5O A;  5LXT A;  1ZLZ A;  1H2L A;  4RQE A;  2Q7H A;  4IT5 A;  1NU1 H;  2VQF O;  5IDJ A;  1YF2 A;  3UCS C;  3CJH A;  3E8H A;  4P30 A;  5GON A;  2MW2 B;  4B3M O;  3CS5 A;  2YI9 A;  2OTL V;  3THO A;  1R3L C;  2KB1 A;  1KBH A;  3UT5 A;  2PTM A;  2LQT A;  5J2U A;  2X7R B;  5IJ9 B;  5H5N A;  2UUA O;  2F93 B;  4YIP A;  1S77 D;  2EIL B;  2VWK A;  4EFB A;  2W0X A;  3Q4H A;  4HBN A;  4DW0 A;  3G6E V;  4TV8 A;  1MNG A;  2E76 B;  2ZM6 B;  4B7K A;  3A0H Z;  4CH5 A;  2XT9 A;  2Q8V A;  1Y66 A;  1MZE A;  3P3N A;  1F51 A;  3CCE V;  4JYA B;  3I55 V;  4DR3 O;  3QF7 A;  3I56 V;  1SC5 B;  3L74 H;  4QJF B;  4K0K B;  3JAT B;  4TUY A;  4RAI A;  4B3R B;  4OPH A;  1J5E B;  4BAY A;  3STZ C;  1ZX3 A;  3DXR A;  4LF9 B;  3GVM A;  5JJJ B;  3RVZ A;  4YHH O;  3ETG A;  4B08 A;  4W4K A;  4I55 A;  1X4T A;  5CN0 A;  1JQ0 A;  3H01 A;  4J42 A;  3B77 A;  1M4U A;  2N05 A;  5IWA O;  1VMG A;  2QE7 G;  4O2B A;  1FJG O;  1SQX H;  3E83 A;  4UVB A;  2UXB O;  5K1P A;  4FLX A;  3HPL C;  2YXH A;  4IGG A;  3SYA A;  3OMI B;  3JAR A;  4UVC A;  4J7Z A;  3ZHS A;  4UCU A;  1TUB A;  3BCC H;  4JI5 O;  1M56 C;  4JYC A;  3WFV A;  1TVK A;  2F23 A;  1YJW V;  5CBF A;  4YJ3 A;  3JSN A;  1QNM A;  3E8F A;  3WB2 A;  1WB7 A;  1K33 A;  1SZT A;  3ABM C;  1MA1 A;  3ZHU A;  1I5X A;  2K9P A;  2WWW A;  1Q81 W;  1R3I C;  4MW8 A;  2Z3Y A;  2HJD A;  4WCE V;  4MVM A;  5KHH A;  2OT5 A;  1Q8I A;  2Q5Z A;  4X88 A;  2AXT Z;  2HHH O;  3ZMZ A;  5LA6 B;  4GKJ B;  2VQF B;  1D2D A;  2EIK C;  3BVO A;  1X59 A;  2CTW A;  4A5U B;  4B3S O;  4U3F H;  1K73 W;  2P90 A;  5IE9 A;  4UV9 A;  5E79 Z;  3ICX A;  1K97 A;  4GLX A;  1H2G A;  2FKX A;  4FM1 A;  2WA3 A;  5CA1 A;  1QR9 A;  5GW7 A;  3JAW A;  4B3T O;  1V9P A;  3QG5 A;  2RNB A;  4PA7 A;  2Y4U A;  3OM3 B;  1KYO F;  1VEW A;  4X8A A;  2JDI G;  4BIO A;  3H1K H;  4YHH B;  1WP7 A;  2C2A A;  2FL4 A;  3SYQ A;  1Y4M A;  4ZOL B;  3G80 A;  2DE0 X;  2IJJ A;  1OJH A;  4JZ2 A;  3STL C;  1AJN A;  1AIL A;  4B3R O;  3T1Y O;  4DYL A;  4X1I B;  1N4C A;  2Y48 A;  3SJC C;  4X1Y A;  1AR1 B;  5LP6 A;  1HNX O;  5EC1 C;  3KCX A;  1H2S B;  2A7W A;  2ZXW C;  4X64 O;  1B04 A;  2MK3 A;  3H1L H;  3UQ8 A;  2JS5 A;  2AZ0 A;  4QIW F;  4Z1M G;  1WP8 A;  2CUG A;  5JJE B;  2UXD O;  4MVS A;  4UCS A;  2CE4 A;  3F5T A;  1UPG A;  2O57 A;  3K9S A;  3EXA A;  3MHH C;  1J5E O;  5GTH Z;  2ZNI A;  2WSS G;  2YEV A;  4O4I B;  4DV5 O;  3ZBH A;  2UUA B;  3F5W C;  2ARH A;  3A0R A;  3CCL V;  5A9G A;  3ABK B;  4GX0 A;  5CBH A;  5L3G A;  4MW3 A;  1M1K W;  2CTP A;  3ABM B;  4GX5 A;  3P3P A;  2ZKO A;  4CH3 A;  4HAM A;  5EIB D;  5EBL C;  3ABU A;  1ROP A;  3UO2 A;  1M56 B;  4DV7 O;  3K5O A;  2XHB A;  4DR1 O;  2PUS A;  5BR8 B;  1SQV H;  2E5L O;  3J7A U;  1THZ A;  3JD1 A;  4QGP A;  5KAI Z;  1FKA O;  1WJZ A;  4RO2 A;  5DED A;  5CA0 A;  2RMK B;  3N27 A;  1FXK A;  4ZHQ A;  5B1B B;  5GTI Z;  4JZG A;  4DUZ O;  3LSU A;  4GKK B;  4LFB O;  3Q4H B;  3ASN B;  1SQQ H;  5E1A C;  5B1B C;  2D2C B;  5DM6 V;  3IFX A;  2EZO A;  1EN4 A;  4TSF G;  5ITZ A;  2L6L A;  4DV0 B;  1S5H C;  5H6R A;  1VQP V;  2GTA A;  3SPI A;  2JGU A;  4WFA V;  4NXM B;  4U3J B;  4GKJ O;  3G71 V;  5A2Q N;  1R6K A;  1DK1 A;  2QWN B;  1OCR B;  3OR7 C;  1IUR A;  3ZHV A;  1O9H A;  3BFR A;  3CRQ A;  2IH1 C;  5BY1 A;  3T1C A;  3B40 A;  1K5S A;  2DMX A;  1L1F A;  1MOF A;  2ZIM A;  1YHQ V;  1IBK O;  4PJ0 Z;  3RN4 A;  3FFQ A;  3OEE G;  5IYC O;  3MDS A;  1S3J A;  1YIJ V;  1P7G A;  1JFF B;  1NR1 A;  1XQ8 A;  1PD3 A;  3BAA A;  3F7Y C;  3JAR B;  1K5Q A;  4EB6 A;  4TV8 B;  3ETE A;  5EC2 C;  2IU0 A;  1LNQ A;  3SPH A;  3VOU A;  4X62 B;  3CC2 V;  1HR0 B;  1KP3 A;  5IYZ B;  3FD9 A;  2GV9 A;  3TGU H;  2GDS A;  1IBK B;  4JTC B;  2RDC A;  4KL1 A;  1AJQ A;  4LF5 O;  3HKB A;  4D7S A;  1TAE A;  5B3S B;  1F4M A;  5B66 Z;  3IC7 A;  3MD0 A;  3ETD A;  1JFF A;  2R72 A;  1ZAU A;  5B1N A;  2XAH A;  4I0X B;  3CJH B;  3AG1 C;  3DXR B;  1GM7 A;  4DUZ B;  4I50 A;  2OCC C;  4DV3 B;  5FL7 G;  1VP7 A;  2IM9 A;  1YCI A;  2Q67 A;  5C93 A;  3RYC B;  5CBG A;  1W0K G;  2B9Z A;  2GUZ B;  1DF4 A;  1BCC H;  1HDJ A;  1N0N A;  2EZP A;  1RP3 B;  3KG2 A;  4E2L A;  4I0X A;  2Q7E A;  1KEC A;  3T4D A;  1GN4 A;  1H2M A;  3AG4 C;  1K7D A;  4XDK A;  4H33 A;  3JD3 A;  1WPB A;  2V4D A;  1Q6I A;  1LR1 A;  4HNA B;  3CCS V;  4GYC B;  1DGS A;  1B6Q A;  1YDX A;  2N04 A;  4DUY O;  4DR1 B;  4TT3 G;  2CGN A;  3K3W A;  1YIT V;  4FLY A;  1AB3 A;  1ARO P;  2LGQ A;  3SYO A;  1H2K A;  3CB2 A;  2JK5 C;  2F66 C;  2G38 A;  3D3I A;  1SQF A;  4FFB B;  4BR6 A;  4O4J A;  1KKD A;  4X1Y B;  1FYJ A;  1RPO A;  4NYK A;  1RSO A;  3K5N A;  5B1A B;  4LC1 A;  2F4V B;  3OUS A;  1UFI A;  1E79 G;  1HNX B;  2HFE C;  4LFC B;  3CXH F;  5JQG B;  4X65 B;  3F7V C;  2K1E A;  3T1Y B;  4HYO A;  3HR0 A;  5IJ0 B;  2H3O A;  3CCQ V;  2VQE O;  3WB1 A;  3RVY A;  1ZL8 B;  2QKC A;  1FFX B;  1NTK H;  3FAV B;  4MTG A;  3OTO O;  1VF5 B;  4NTY A;  4OGQ B;  4AQY B;  3QVN A;  4IHJ A;  4O4J B;  1RSO B;  3ML0 A;  4XBF A;  4TUY B;  5CB4 B;  2EIL C;  2HJF C;  1ZWI C;  4LF8 B;  5KUK A;  3HKC B;  4ABM A;  4EKW A;  3VQY A;  4LF6 B;  3ZMU A;  1NKD A;  1K34 A;  5LOV B;  1ZL8 A;  4MTX A;  1N36 O;  3CSX A;  4QE7 A;  5LA6 A;  1ENV A;  4BWA A;  5K1X A;  5LP6 B;  4JI3 O;  2D3O W;  4WBN B;  2LFR A;  4MVO A;  4FPP A;  4P9O A;  4PV1 B;  2E5L B;  2HLD G;  3K0G A;  2HEP A;  4DV0 O;  1YI2 V;  4YY3 B;  1JJO A;  1CP9 A;  5DEC A;  2B5U A;  5BZB A;  4JI7 B;  2OCC B;  3GWO A;  3A2F A;  5LHI A;  1PKX A;  1M5I A;  3K79 A;  4O4I A;  2QM4 A;  2ZCE A;  2EUL A;  1F4N A;  4GKK O;  4JAS A;  2V1D A;  3MAQ A;  1XI1 A;  1V54 B;  3OTF A;  4RQF A;  1I7F A;  1XL6 A;  5BR8 O;  2IU3 A;  1GAX A;  4FLT A;  1YEW A;  5IY5 B;  3N2K A;  4R50 A;  4LFB B;  3BRC A;  4ZIB A;  3M8A A;  4DRX A;  2IJH A;  1FD9 A;  2ZR3 A;  4UB8 Z;  4X89 A;  3AG1 B;  1OCC C;  1RM1 C;  5LGU A;  4BIZ A;  4LF9 O;  1N0J A;  5CA1 B;  3RWR D;  3L73 H;  4Q6G A;  3RYH A;  3E8B A;  1OCO C;  1H38 A;  4F6R A;  3AG4 B;  1Q3E A;  1HWY A;  3AG7 A;  5AG2 A;  5LMU O;  3CD6 V;  2RQ6 A;  2DQ3 A;  1XIL A;  1IBM B;  1EN5 A;  1DLB A;  5BMV B;  3AG3 B;  4NB5 A;  4NXN B;  4UCV A;  1IBM O;  1NS1 A;  3AG2 C;  4JI2 O;  4UCT A;  3ASN C;  4QPK A;  1HNW B;  3UO3 A;  2YIA A;  3M99 B;  4H37 A;  1GN3 A;  2Y0I A;  5L3E A;  2XND G;  4AIL C;  2DWE C;  2CH7 B;  3HKE B;  4X66 B;  3N2G A;  1PPJ H;  1N32 B;  2JVD A;  4ZHQ B;  3H1J H;  4JYA O;  2YI8 A;  4JI1 B;  3RYC A;  1GM9 A;  4BIU A;  2Q73 A;  3IGA C;  2WLJ A;  2XTA A;  1TUE B;  3CP1 A;  2YEV B;  3VBB A;  4JAU A;  2BSK B;  2KG7 B;  1SKV A;  3AK3 A;  2QWP B;  1IXB A;  5KX5 B;  3LNN A;  2PZS A;  4LF5 B;  3CCM V;  3K06 A;  4DR6 O;  4O4H A;  3WU2 Z;  1EN6 A;  1VQ6 V;  1S0V A;  5H9C A;  2CAZ C;  4G2K A;  3N2G B;  1SER A;  4D7T A;  4G27 B;  1BSM A;  1LUV A;  1R73 A;  1NVP B;  4FLW A;  4DR7 B;  4LF7 O;  2VWJ A;  3BPZ A;  5IT9 N;  1SA0 A;  3HKB B;  3D36 A;  2HVJ C;  4WFE A;  3HKD B;  4FLV A;  3GB7 C;  1JA8 A;  1N33 B;  1HW7 A;  4PDL A;  4YJ2 B;  5FPO A;  4RWU A;  4TV9 A;  5D5P A;  3JD4 A;  2VQE B;  2NNU A;  2E74 B;  3S3W A;  4H44 B;  4PA9 A;  1NR7 A;  4FJC C;  4DR6 B;  3OGI B;  3OR6 C;  1Q90 D;  4JI6 O;  2RJZ A;  2LGW A;  4DR4 O;  3R65 A;  1O9G A;  2WPD G;  1IBL O;  3SPC A;  1RM1 B;  2PGG A;  4JV5 B;  2P67 A;  3K0D A;  2BTO A;  1GM8 A;  3D36 C;  2ZNJ A;  4IIJ B;  3RT3 C;  4ZI7 B;  5JWP A;  3FB8 C;  2OWO A;  1VF7 A;  4I5S A;  4MSW C;  4MVU A;  1VIB A;  2P06 A;  1PNK A;  1OHH G;  1S5L Z;  2QKS A;  4NTW A;  4CZZ A;  5LL6 Y;  2W6J G;  1XDC A;  2P4V A;  5EZY A;  2WLL A;  3BHP A;  4NXN O;  1IVS A;  1GMG A;  1BQZ A;  4I4T B;  4PA3 A;  1QVF U;  3OAA G;  4ICG A;  4IIJ A;  4ZI7 A;  5EK0 A;  1R3J C;  1URF A;  1MZF A;  4LH6 A;  3SJB C;  3OUF A;  2QKA A;  4PDV A;  1PNM A;  1OZ0 A;  4X65 O;  2EIK B;  4R6Z A;  3CCR V;  2JS3 A;  4QNH B;  1R6T A;  1WB8 A;  4J7K A;  3KZI Z;  1VQM V;  1DF5 A;  3OFN G;  1WA8 B;  2LP7 A;  1P4R A;  2X6C A;  2OTJ V;  1Q6U A;  4DV3 O;  2ZDI C;  2UXD B;  1VQO V;  4I4T A;  3B8M A;  1FFX A;  2NN4 A;  3FAV A;  1GKF A;  1IBL B;  2YSU B;  1MSW D;  3OT7 A;  1AI7 A;  1A32 A;  2B1G A;  3CXC U;  1BL8 A;  4JTD B;  4ASU G;  1XEQ A;  3EHB B;  1S72 V;  4DO2 A;  2PY5 A;  2EBO A;  5FNV A;  3C3S A;  4DV2 B;  1U96 A;  4DR3 B;  3O9O A;  2LW1 A;  1V54 C;  1YZB A;  3LSQ A;  3JD2 A;  4G28 B;  1XRE A;  3H1H H;  3U0Z A;  5LOV A;  5B1O A;  1AI6 A;  1E1R G;  4L8J A;  1WPX A;  4U7O A;  1FFT B;  3D8C A;  2AHZ A;  5EYP A;  1G8M A;  2P4K A;  4KFM A;  4WF9 V;  2QJ1 A;  1EFR G;  1L0N H;  4JI7 O;  4C7U A;  2CGO A;  2CTR A;  3ZED A;  4KUM A;  2DJV A;  1GRJ A;  4KHP B;  4J9Y B;  1UJW B;  3RBZ A;  4IHJ B;  3DC5 A;  2JEX A;  3E2E A;  3U11 A;  3WB0 A;  2UUC B;  5JVD A;  2ZE6 A;  4ZKI A;  4LH7 A;  4J7J A;  5C8Y A;  1QLN A;  4ZBM A;  4NTX A;  4LF6 O;  2A9H A;  4X66 O;  1AR4 A;  3SR2 C;  1NJI W;  4JAA A;  1QBZ A;  4I9Q A;  5JJN B;  5KHI A;  1M57 C;  4KXR A;  1WLE A;  1VQN V;  2Q9L A;  4JI2 B;  2Q68 A;  3L70 H;  1S76 D;  1MSD A;  2ZDI A;  1GK9 A;  3J80 N;  2Q0O C;  5B3S C;  1Q6H A;  5EBM C;  3JAL A;  2OYQ A;  1XHX A;  4TOI A;  2RN9 A;  4JI4 B;  4K3A A;  1NQT A;  2UUB O;  2ETN A;  4YXW G;  4CH4 A;  2UXB B;  2XAG A;  2UXN A;  5J9P C;  2QR4 A;  3BEH A;  2YIB D;  4N23 A;  5CA0 B;  2OCH A;  2PI5 A;  4KP4 A;  1KC8 W;  1CEZ A;  3KKY A;  3ZHQ A;  1BZK A;  1KB9 F;  4X64 B;  3JAW B;  4EEQ A;  4MTO A;  4LFA O;  2OIE A;  3JAK B;  1BHA A;  4YJ2 A;  2QWO B;  4CS3 A;  1JCH A;  1Y76 A;  2HR3 A;  1K92 A;  2WLH A;  1ZSP A;  2FML A;  4I7Z B;  1XHZ A;  3CHX A;  1DTO A;  3AG2 B;  3T1H O;  2WA4 A;  2Z5U A;  3E22 A;  3M7M X;  5D5Q A;  3HB3 B;  1FAF A;  5EIB C;  4O2A A;  2ZD9 A;  4PDM A;  2OIG A;  5KX5 A;  2QTO A;  2GTS A;  1YTF D;  4B3M B;  3DTU B;  3IC9 A;  2LO1 A;  2ADP A;  4JYB A;  1AP5 A;  1VQ8 V;  1U97 A;  1HNZ B;  3JSL A;  4IYH A;  4LCU C;  3G4S V;  2WLI A;  4DV1 B;  2ZQM A;  1TGO A;  1J95 A;  3EVK A;  1W2B U;  3TXQ A;  4TQD A;  2DQ0 A;  3OEH G;  2LJ2 A;  1OCZ B;  4MS2 A;  1GO3 F;  2DWD C;  4U3J A;  1JX9 A;  1AI4 A;  3BA8 A;  3RYF B;  1NVP D;  4PA4 A;  1Y74 B;  4GCZ A;  4MTF A;  4DW1 A;  3PN1 A;  2WLM A;  3LDE A;  2YC0 A;  5JH7 B;  3ABL C;  1MAB G;  4LNU A;  4JPR A;  2DYR C;  1FXK B;  1D5N A;  1EM1 A;  1B3Q A;  4AI8 A;  1R1B A;  2VS0 A;  1XBL A;  3KCY A;  1OCR C;  3JAT A;  2N74 A;  3E86 A;  2NR5 A;  3T1H B;  1L8D A;  3K04 A;  5KA6 A;  4LF4 B;  2ATK C;  1VQ9 V;  2W0F C;  2X0L A;  1F23 A;  2ZE8 A;  4DK1 A;  4IL6 Z;  4JI5 B;  4TV9 B;  3G6B A;  4XDJ A;  4NKG B;  3HKE A;  2BOB C;  2X6A A;  3C90 A;  2EIM C;  5IJ9 A;  1VQK V;  2X6B A;  4DV2 O;  4OXS A;  1KMI Z;  2ZT9 B;  3ZN0 A;  4UCR A;  2F4V O;  4CH6 A;  3JD0 A;  1K4C C;  1BE3 H;  4L87 A;  2KG7 A;  3JCU Z;  5LBQ A;  5LYJ A;  4JGS A;  2UXC O;  1PL4 A;  3QTC A;  3VQV A;  1TUB B;  1SES A;  5LMU B;  4LWS A;  3WG7 C;  3O65 A;  2IJI A; 
#chains in the Genus database with same CATH homology
 4NB5 A;  1CXZ B;  1UPG A;  2RMK B;  1US6 A;  4NKG B;  1URF A;  2HJD A;  4DYL A;  1RFY A;  4IGG A;  2Q0O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...