1CXZB

Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
86
structure length
86
Chain Sequence
b'WSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-181))
publication title The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1cxzB00
1CXZB 1RFYA 2Q0OC 2RMKB 4NB5A 1URFA 2HJDA 4DYLA 1UPGA 4NKGB 4IGGA 1US6A
chains in the Genus database with same CATH superfamily
2KSDA 3T1CA 1M56C 4B3TB 4I4TA 3SJQC 4QPKA 2WLJA 4DR7B 3LSSA 4KHPO 2Q5ZA 3JSLA 1Q5OA 1PL0A 3IAYA 3VBBA 3X2QC 3OUSA 1SQBH 3WB2A 1L0NH 2OCCB 3L73H 3FFQA 3U11A 1NVPB 4DV6B 3GWOA 4UCTA 4ZIBA 4YJ3B 4I9WA 1MSDA 5KUMA 3Q4HA 3VQWA 3FD9A 1RP3B 2Q4PA 3HKEA 1FAFA 5JH7B 4FM0A 1AILA 2O57A 1SA0B 3GWKC 3ZHSA 1XREA 3DSQA 3SYQA 3JD2A 5IT9N 4FLZA 2LW7A 5KX5A 2UU9B 1WA8B 4TSFG 1PL4A 5JCOA 2CUGA 1NQTA 5CB4B 5EZYB 5B1OA 4FMTA 4CH4A 2C2AA 1G8MA 1TVKA 4QIWF 3OR6C 5KMGA 2JDIG 2ZKOA 1RSOB 2OCHA 3E22A 1HP8A 5CMUA 1L8DA 2GTAA 2ITCC 5IYBO 3CSXA 3CRMA 3CMEV 2HFEC 2HG5C 5LHIA 3B09A 3SPCA 5B1BC 1HDJA 4ZOLB 3CRCA 4OX9O 1GTOA 5DECA 4J10A 1BMFG 3KG2A 2JJ2G 2VQFB 2BTOA 3ABLB 2EZPA 1XNRB 4DV3B 4MT8A 2MK3A 5CA3A 2JGUA 2F93B 4K3AA 1F7YA 1R6NA 1Q6IA 4I50B 1H2GA 3OMNB 5KA5A 1W2BU 1QLNA 4J9ZB 4B3SB 4P9OA 4UVBA 3SYOA 3K5LA 5FNVB 1WPXA 2YICA 2UXCB 4B3TO 4UVCA 4TWKA 1GRJA 4FM2A 4AI8A 4PA7A 2QM4A 4BIUA 2DYSC 1W0JG 5JWPA 1K4DC 5K1PA 4DR1B 4J80A 2EIMC 2PTMA 4WCEV 2MW2B 3R66A 3O9OA 1GM9A 2WLIA 2HJFC 1QQCA 4FJCC 3QG5A 1OCCB 4MW8A 1H8EG 2WAMA 1UPGA 1ROPA 4QGPA 4DV6O 2AZ0A 4O4IB 1VF6C 5EYPB 4K0KO 4DRXA 2NNUA 3JAMN 2ZXWC 3ABKB 4TUYA 2KQXA 4AHCA 3W7XA 4BR6A 3JD4A 1MABG 2A79B 3HR0A 3UCSC 4FLTA 2DQ3A 2JRIA 3K59A 4H33A 2FTKA 3JAWA 4O2AA 2HHHB 4IYIA 2IU3A 3CCEV 2ZIOA 4ABMA 1MNGA 4LF6B 5B1BB 3AG4C 1XEQA 3TK1A 4IIJA 1DF4A 3CRAA 1DF5A 3JARA 3JD1A 2AXTZ 2CTWA 3OD4A 1K7DA 3CCRV 1PM9A 4FVMA 2IW5A 3CJHA 4UCSA 3SGIA 4DUZB 3G80A 2DYRC 2VQFO 1R3IC 3JASA 3LDEA 1TUBB 1XNRO 4JPRA 1P49A 4MTXA 3FX7A 4Z1VA 1N32B 1FKAO 2F43G 3OMIB 1DK1A 1WNSA 5GONB 5AG2A 3G4SV 3TCUA 2BSKB 3BA9A 1AP5A 1VF7A 5GTIZ 1BZKA 1QR8A 4NTYA 5IJ0A 1VQNV 3K9SA 2YIBA 1JFFA 2UXNA 2UXCO 5JQGB 4X1KA 1WAZA 2R70A 4RWUA 2IM9A 3ZBHA 1GK9A 3K06A 3LDDA 4B3MB 5C8YB 3ZN0A 4A5UB 3ZHUA 3CE2A 3FAVB 2DW4A 3ZRVA 4DR1O 2DOSA 4ICGA 5JJEB 3QVNA 1PP9H 1NTZH 4YIOA 3ETEA 2AW9A 1GKFA 5CN0A 1OCOC 1GN6A 2QWOB 3LNNA 4O4JB 2HKOA 1S5JA 2Y69B 1KUQA 1FXKA 4O4HB 4I4TB 1AP6A 2DN9A 5D5QA 1FXVA 3HPLC 2XUMA 5J2UA 2QR4A 4J7JA 1OCRC 1K5QA 3F5TA 2LFSA 2P4VA 3ASNB 1MMMA 3JAKA 2HHHO 4DV2B 3B8MA 4D7TA 4DV1B 4GKJO 2E3CA 2HJDA 3R65A 4EKWA 3K5NA 1SC5B 1EN4A 4CC6A 3Q4HB 1ZSPA 2ZE5A 3CX5F 5KHGA 4F6EA 1Y4MA 4Q20A 1ZL8B 3CCUV 4LF6O 3T4DA 1M4UA 4F6RA 5FPRA 1M93A 1R3KC 4ZHQA 5KX5B 1X59A 4DYLA 4DV7B 3OGCC 2QA4V 4N23A 2WLKA 1KB9F 1J5EB 1AI5A 4LF5B 1X4TA 1VQ9V 2GUZA 1WJZA 5E79Z 1UFIA 4J7ZA 3UT5B 5KMGB 4DUZO 1VQ8V 1Y6XA 2BTQA 2QDOA 4PA4A 4GZRB 3H1KH 4DR4O 1S3JA 3DGEA 1BCCH 3H9VA 4FFBA 1VARA 4UFZA 2AZ2A 3CRQA 3RYIA 4P30A 5LHGA 2DWEC 4FFKA 4H44B 3E8HA 4DV5B 1XMOB 1F23A 4EB6B 2JEUA 1V9PA 1O9HA 4B3MO 1BQ0A 3BA8A 2UUBO 4K35A 4KXRA 5GW7A 3LSQA 3WG7C 1VQ6V 4U3JB 1QLEC 1Z5VA 2EIKC 5EBLC 4IYHA 3OM3B 3SDLA 1VQKV 1EZJA 5LOVA 4JI0B 2UXDO 3K0GA 2GBOA 3B40A 3P3NA 2GSMB 4J9YB 4UV8A 4P2ZA 4FPPA 3QTCA 3AG1C 2K1EA 1JJOA 1XMQB 3AK1A 3EXAA 3OR7C 5L3EA 2Q9LA 4B7KA 2V4DA 3E89A 1PD3A 4RUEA 3ABTA 2QM8A 4AQYB 2PZSA 4IGGA 3ZRWB 3ZHQA 1RM1B 4X62B 3ZMUA 1CEZA 2BCCH 3BAAA 4DV1O 1NH2B 1EFRG 1SZTA 4DRXB 1MZFA 1LR1A 5L3FA 3RGBA 3P3PA 5KUKA 1B6QA 4BAYA 1P4RA 4TUYB 4DR2B 4QJFB 1VMGA 4X1IB 2OCCC 3K9AA 2YIBD 4QE9A 5CBFA 2HEPA 1YJ9V 1E1QG 2HVKC 2VWJA 2PI5A 4FLVA 4DV7O 1Y67A 1Y66A 3JAWB 1J5EO 1T5EA 2BE3A 2F66C 1Q86W 4LF5O 1P7GA 2ZIMA 3OTFA 3DTUB 4FZ1A 3QNEA 2WLMA 2WLLB 1R3LC 3J81N 3W7UA 2P7TC 3B77A 5J2TA 2QKSA 1YVWA 1VQOV 2W6IG 1XBLA 3WFVA 2R9IA 2JGDA 5L3GA 3ABUA 3WB1A 2Q8VA 4DUYB 1IBKB 2Y4TA 2EINB 1QU7A 1PNKA 2LFRA 2YXHA 3JARB 2WSSG 4LF7B 4PDVA 2VQEB 3F7VC 4DV5O 1XMOO 1MG1A 4UV9A 4Q6GA 3OT7A 1SETA 2CTPA 1W0KG 3JASB 3D8CA 2Q7HA 2HLDG 1NU1H 1IBMO 5IDJA 1H2LA 1N36B 2AGAA 2R9RB 1ENVA 2D3OW 1AI6A 4PELA 3J7AU 3FB6C 3MHHC 1ZX3A 3ABLC 4NXMO 1GAXA 3A2FA 2BOBC 1TGOA 4JI0O 3AG1B 5ITZA 4G28B 1XMQO 3SPJA 4JYAO 1VQLV 3H1LH 4JI8B 4J41A 3BEHA 3KKYA 2WPDG 4JTAB 3APQA 3H1IH 5KA6A 1KYOF 3P30A 4AQYO 3N2KA 5KHKA 4BW5A 4JI7B 3L72H 2PF4E 2CTRA 1AJPA 4BIZA 3E8BA 2X6CA 3FKSG 2EZOA 5FLXN 3QO7A 1OCCC 1SERA 2FMLA 2ETNA 3DC6A 2QM7A 3SJBC 1VP7A 1OHHG 2ZM6B 1PNMA 1RPRA 1XI1A 4TQFA 3WU2Z 5LGTA 2X6BA 1MSWD 2OTJV 4HNAA 2CAZC 3ABKC 4B7EA 2Z3YA 1Z2GA 3CC7V 4TV8A 4JI1O 4X20B 4WF9V 2WWWA 2DJVA 1Q7YW 4GKKB 1IDSA 3OTOB 4TT3G 4F6RB 2AHZA 3W7WA 2Q73A 4ZHQB 4PDMA 1NT2B 4DUYO 1BS3A 5IYCO 1M90W 4X88A 1G4YB 4R50A 4O4LA 4LF7O 2VQEO 2VS0A 1XNQB 2IJIA 1R6TA 4JI4B 1TAEA 1YJNV 2YSUB 2GUZB 4PV1B 1ZLZA 3AG3B 4PI0A 1JX9A 5EC2C 1N0NA 4LNUB 3CCQV 5LBQA 1N36O 3UQ8A 1IX9A 1I0HA 2LGWA 1XDCA 2WLHA 5EBWC 2XAJA 3SJCC 4LF9O 1EN5A 1JR9A 1YI2V 1YHQV 3K3WA 3RYIB 3VOUA 4LWSA 3CP1A 2Q69A 3JD0A 4ZI7B 1GH6A 3N27A 4N21A 1KKDA 3CHXA 3JCUZ 3RYFB 3KCXA 4JZ2A 3CEIA 3I5DA 1OZ0A 1FFTB 1U97A 4G27B 5LYJB 4I9QA 3G67A 4JI8O 1D5AA 1NKDA 4LF8B 4J42A 4LF4B 3CPWU 1KECA 2XAFA 2CH7A 4DR7O 1PNLA 2OT5A 5LGUA 4NTXA 1K33A 1HNXB 2XAQA 3E8GA 1TA8A 3JATA 4YJ2A 2LGQA 2F95B 4L87A 1Y76B 5L3BA 4CS2A 2HP8A 2IH3C 2XAHA 1K73W 4GX0A 1VQ4V 4I5SA 2EX3A 4RAIA 1SQFA 1KBHA 2GTSA 4GX2A 4DXWA 3SYCA 2LP7A 5B1AB 2Y69C 2HR3A 1IBLB 1Y74A 2ZM6O 2XTAA 1DTOA 4IT5A 2YXLA 1AJNA 2QWPB 2IBZH 2YUAA 1YTFD 2E76B 1BQZA 2B5UA 2Q68A 5H2FZ 2UU9O 1XUQA 1ZUQA 1VF5B 5EBMC 4D6TH 1EBOA 4R6ZA 3ASNC 4GKKO 1K3EA 3OTOO 3SPGA 1XHXA 1W59A 1IXMA 3A0BZ 1QR9A 4PDLA 4X9QA 1XNQO 5HFMA 3W7SA 4JI4O 1VQ7V 3C3SA 1HNWB 4BWAA 3AEIA 2ZQMA 1K9MW 5JVDA 5BR8B 4NXNB 1V55B 5J2TB 1YF2A 1K8AW 1WP7A 3CMAV 2JGDB 2CGNA 4NTWA 3SPIA 1OCZB 4DV3O 3ABMB 5F2VO 2HVJC 4MVUA 3A0RA 4UVAA 1N33B 5LA6B 5LP6A 3M7MX 1YDXA 2A7WA 1YEWA 1QCEA 2CK3G 2FL4A 1WPBA 2QGNA 2PYJA 1IXBA 4PD4F 4B3SO 3RBZA 4WBNA 1MZEA 1BGYH 1YTFB 2V1DA 4ASUG 4LH7A 4LF8O 5EIBD 3RN4A 5CA1B 4LF4O 4IHJA 4JI2B 4GCZA 1GMGA 1JCHA 1H2KA 3UO3A 1GM8A 3ZHTA 4O2BA 5CA0B 4JAVA 3TJTA 4JZGA 1E79G 4LR3A 3IFXA 4CH6A 5GTHZ 3MHSC 1YZBA 3HKDA 4EEQA 3CWBH 2Z5UA 1O9GA 2WA3A 2UUAB 5IY5B 3BPZA 1IBLO 4LFAB 3AK2A 3LUTB 4RQFA 1NR1A 3HB3B 3D36A 1K4CC 1Q6HA 4JI6B 2F1MA 3FYEB 3E35A 2Q7GA 4X64B 1YXBA 2ZT9B 1OJHA 2WLNA 2X7RB 3C3TA 5L3CA 5EC1C 4C7UA 1FJGB 4HBNA 2YDEA 1RM1C 4JYCA 4LFCB 4P9PA 3HKEB 2A3QA 4YJ3A 1K34A 4CBCA 5H6RA 3RFRA 1M57B 1N34B 5JH7A 4HNAB 1DLBA 1SA0A 1B04A 3QF7A 2N04A 1HNWO 4JI5B 1OV9A 5LGNA 4X1YA 2NR5A 3D3IA 1HR0B 4HYOA 4MS2A 5BR8O 4CH5A 4NXNO 1S5LZ 1WA8A 4W4LA 2ZD9A 3A8TA 3RYHA 2FB5A 2JEXA 4MTFA 5EZYA 1TVKB 5BMVA 5IYZA 5KAFZ 2V7QG 2ZDIA 2RJZA 4QE7A 2P22C 4YXWG 2PUSA 3IGAC 2RNBA 4O4LB 1ZTEA 3E22B 1N32O 1XILA 1L1FA 1N33O 3C90A 1H8HG 1SQQH 1XQ8A 5E1AC 1YCIA 3OGIB 5L3DA 3IJ4A 1BT8A 2RN9A 3NXSA 1ZWIC 2EJRA 1JA8A 1NTKH 4KUMA 2EINC 4FK5C 2QTOA 4KL1A 1VQMV 4JI2O 4F4LA 4XDJA 2RCVA 1J95A 4I7ZB 2OIEA 3ZRSA 2XOKG 2UXBB 4CC5A 3RWRD 4CZZA 4Z1MG 2GV9A 4U7OA 3ZS8C 3OW2U 2YEVA 2KB1A 1GM7A 3JYCA 1DGSA 3CXHF 3I56V 1GN4A 2FYUH 2ZINA 1FD9A 1XL4A 3OUFA 3E86A 2H94A 4QPJA 2B9ZA 5FNVA 4JYYA 2DMXA 1GO3F 1URFA 4OXSA 2UUAO 2QSAA 3ZHRA 2EIJB 3E2EA 4Z2WA 1Q6UA 4LFAO 5FL7G 3ZMTA 1KC8W 4XBFA 2KG7A 3BVOA 4H37A 4RO2A 3JATB 3QO8A 4UB6Z 3K5OA 2QE7G 3G6EV 4JI6O 3H1HH 4PDRA 2WLIB 4X64O 2Q67A 3U0ZA 5DM6V 4CS3A 5D5PA 4DV2O 4RQEA 4WFBV 2PI4A 1FJGO 5JJNB 1Y74B 2EILB 4UCVA 5EYPA 4YY3B 1N4CA 1N34O 1NZ6A 3B2EE 1YIJV 2F4VB 3FB5C 4JI5O 2XT9A 3ZMSA 1HR0O 3F7YC 4I0XA 1EM1A 4O2AB 3SPHA 2Y48A 2ZNJA 4XDKA 3BY6A 3ZMVA 2ZR3A 3IC7A 3UKMA 3ZEDA 1AB3A 1E1RG 2DE0X 3JCZA 5KHIA 1THZA 1QNMA 3B8NA 1IZ3A 5KHHA 4GUNA 5B1NA 3CS5A 4X89A 4MVZA 1GN3A 4MW3A 3STZC 1FFXA 5FPOA 1Z5WA 5JVDB 1IVSA 4IIJB 1NBMG 3G71V 5LXTA 1SF9A 5DEDA 2E75B 2F23A 2QTSA 2W0FC 4DR5B 3CJHB 1QBZA 2W6JG 3T1HB 1R3JC 4GX5A 1PV0A 3EHBB 5DN6G 5CBHA 3AG3C 1US6A 2UXBO 1TUBA 2KKWA 4CH3A 5EK0A 3ZCCA 3QO5A 5LP6B 5H6QA 1NVPD 4OGQB 3JALA 5GONA 2DQ0A 3I55V 4MVMA 3L75H 2YI9A 2BSKA 4YHHB 2LW1A 1QHTA 1RFYA 4WBNB 3T1YB 5IJ0B 4TOIA 1JFFB 2UUCB 4X1KB 3ZRXA 2QEXV 3RYCA 1HNZB 1R73A 4TQDA 1F51A 2QWQB 5A9GA 5JQGA 3O65A 1Q43A 2JVDA 1KD1W 2ATKC 3FAVA 4I55A 1FPOA 4BW9A 3M99B 2PY5A 1F4NA 3EFFK 1G1XB 1H38A 1QVGU 3VQXA 2WA4A 1JMKC 4D7SA 4DW1A 4X62O 2ADPA 1FXKB 1VF6A 1KMIZ 3K0DA 4PA9A 3SYAA 1AI7A 4PJ0Z 1KQSU 4MVQA 2QKCA 4O4HA 1YSCA 3KCYA 1K92A 2P06A 4YY3O 2IJJA 3OMAB 4DR2O 1KP3A 5J2UB 2Y0PA 2F4VO 5LL6Y 4GLXA 4DV0B 1JJ2U 2XHBA 1P84F 3S3WA 3E83A 5B1AC 1WN7A 2CDYA 4WFHA 3JAKB 3EVKA 2Q6AA 1MA1A 2LO1A 3UM7A 1XOUA 4BIOA 4U3FH 2AHYA 2YI8A 3L70H 4IL6Z 1B3QA 4K0KB 3ZX6A 2YS8A 1KU9A 2PGGA 4JF3A 1I5XA 1AR1B 4E4EA 4MVSA 3CRRA 1ZL8A 3GVMA 2Y0IA 1Q8IA 4X1YB 3CB2A 1IBKO 1LNQA 4PHZA 1NJIW 5IJ9A 4TV9A 3RVYA 3ETGA 3HKBA 3STLC 2EBOA 3RYHB 3BFRA 2ZE8A 4DR5O 1SQPH 2P90A 3LNMB 5BMVB 5IYZB 3T1HO 3KZIZ 1V54B 2BTQB 1FYJA 4HAMA 2LJ2A 3UT5A 2JK5C 2IJHA 5TISZ 4FIPC 1AROP 2RQ6A 1VQPV 1B06A 3JD3A 1V55C 3CD6V 2N05A 1BSMA 3N2GA 2YIDA 1IURA 4FFBB 2CGOA 4YHHO 3ZIAG 2QWNB 3SR2C 3T1YO 4LBEC 4DR6B 1SESA 3IC9A 2UUCO 1OCZC 3CCVV 3ABMC 2B1GA 1HNZO 3WB0A 3H01A 4EB6A 1S5HC 5B3SB 3HKCA 3SJAC 3ZN1A 5BY1A 1CP9A 4WFEA 1N8RW 3K58A 1FS0G 3CCLV 5H9CA 4NB5A 3K04A 2YEVB 1NR7A 4U3JA 4AILC 2P67A 4GT1A 4H0LB 3RVZA 1M56B 3K57A 1GN2A 4JI7O 5LOVB 4FLXA 4G2KA 1SS3A 4LP8A 4PA6A 5KAIZ 5KLVH 2KG7B 4JV5B 3TETA 3DC5A 3X2QB 3BABA 2L35A 4B3RB 4DV0O 3K79A 1D2DA 2Q0OC 1HW7A 2XASA 5LMUB 4UUJC 5IY5C 3SYPA 1I94B 4DR3B 1QVFU 2ODMA 2QWRB 4UCOA 4LCUC 2ARHA 5K1XA 3ZRWA 3CXCU 5B66Z 3RT3C 4DO2A 3M8AA 4DV4B 2ZCEA 1Q3EA 4WFGA 4PA3A 1AR4A 1CXZB 1EN6A 3AK3A 1NI8A 4X1IA 1SQVH 1EZVH 3OE7G 4R8CA 2ZNIA 4JAAA 2H3OA 4I0XB 1H2SB 1S77D 1LUWA 3H1JH 1M57C 3ICXA 4KP4A 1ZAUA 3AG2C 2RMKB 4KFMA 4U7NA 4GKJB 1D5NA 5EIBC 3LDCA 1NS1A 1S0VA 3CYOA 2WLLA 1U96A 1BL8A 4NYKA 3UO2A 5JCOC 5HFLA 2XNDG 3VQVA 3TXSA 5IWAB 2X0LA 1FFXB 3K03A 5LXTB 4DR6O 4PI2A 3A0HZ 1CPYA 2OTLV 4GYCB 3JSNA 4FM1A 1S72V 2ITDC 3DXRA 1S76D 2PYLA 4FZ0A 1H2MA 2IU0A 1H2NA 3CCJV 1AI4A 4QNHB 4DR4B 3JALB 4RUFA 4X8AA 3J80N 3B4SA 4JI3B 2JJ1G 1HNXO 3ZHVA 1COWG 3W7TA 2ILMA 3RYCB 1MOFA 2QJ1A 4NR1A 1WB7A 2R9AA 4FLWA 2DYSB 4J11A 3F5WC 5ITZB 1Q82W 4JASA 3K08A 5H5NA 3VQYA 4JV5O 2EIMB 2LQTA 2UUBB 3ASOC 2VWKA 4I55B 4B3RO 3BHPA 1N0JA 5LMUO 2FKXA 3MD0A 4J7KA 3OEEG 2A9HA 2EIJC 1I94O 4DR3O 4GX1A 3N2KB 4MVRA 1SQGA 4LC1A 3CC4V 4ZKIA 5LMNB 1YITV 3FYIB 5B5EZ 4E2LA 1K97A 2ZXWB 4MSWC 4DV4O 3G6BA 2RDCA 3THOA 2UXDB 2YC0A 5BZBA 2P4KA 1PKXA 4JTCB 2JIZG 1M5IA 3BCCH 2VRZA 5BXZA 3CCSV 1VIBA 2G38A 3AG2B 2EILC 3NR7A 3CC2V 2GHYA 3P32A 4JGSA 1NTMH 1RPOA 4L8JA 4TV8B 3ZMZA 2Q7EA 1UJWB 2E5LB 4X20A 4K8ZA 1L0LH 4UCRA 2H8PC 4R7CA 5CB4A 4EFBA 4X65B 3ZJZA 3AG4B 2M6YA 2JS3A 1JQ0A 2CTQA 1SRYA 5IWAO 5IJ9B 4TV9B 1RSOA 4X66B 3HKBB 1P7BA 2JS5A 4DW0A 1TUEB 1SZXA 2DYRB 4UCUA 5KHJA 4EFEA 4JTDB 3ML0A 3MDSA 2GDSA 3FB8C 4OPHA 1AJQA 2ZE7A 4ZOLA 2E74B 4LNUA 3N2GB 3K5MA 1G6UA 1NH2D 2ZR2A 4LWSB 4JI3O 1XL6A 2W0XA 3BRCA 1JPXA 4B08A 5IYDO 3OFNG 4ZI7A 3L74H 4I50A 5LP6C 1HWYA 4CS4A 3HKCB 3GB7C 2Z0AA 3RYFA 4HZ3A 3ASOB 3FB7C 1XHZA 2QKAA 3OEHG 3AG7A 1IBMB 4JAUA 1AR5A 1R1BA 5LYJA 5IE9A 1OCOB 1SKVA 2CH7B 2ADQB 4FLUA 1YJWV 1VQ5V 2YXYA 2ZE6A 2X6AA 5C93A 4DK1A 4UB8Z 3TXQA 2NN4A 4YJ2B 4NXMB 5LMNO 2L6LA 4JYBA 4NVPA 4LFBB 4NKGB 1Y76A 1OCRB 4ZBMA 2IJKA 1WLEA 2BOCC 2P6JA 4JYAB 4O4IA 1FXKC 4LFCO 3MAQA 2K9PA 3CCMV 1LUVA 1BHBA 4KHPB 3ETDA 3RW0A 3D36C 3U10A 4UXNA 3L9DA 2E5LO 2EULA 4WFFA 2D2CB 4FLYA 1R6KA 3T4ZA 2OWOA 2Y4UA 1BE3H 2OIGA 4X65O 1A32A 1KKCA 1WP8A 1BHAA 2A0LA 1WB8A 3D3QA 4MTGA 1SQXH 5J9PC 1ORQC 2N74A 4X66O 2M7WA 1JOYA 2B1IA 2DWDC 2IH1C 2P5OA 1F4MA 3L71H 4JI1B 4WFAV 1PPJH 1I5YA 1Q81W 1I08A 1KP2A 3PJSK 4MTOA 1Q90D 1AVMA 4YIPA 5CBGA 2R72A 1JVMA 2ZDIC 1V54C 2Q0AA 4XDLA 5A2QN 1M9NA 2EJ7A 5LA6A 1I7FA 2UXXA 3DXRB 1VEWA 3TGUH 2CE4A 3APOA 2YIAA 4K8XA 3S3XA 3WG7B 4OX9B 1QLEB 1K5SA 5LHHA 4IHJB 4DK0A 3LSUA 3OAAG 2A06H 5CA1A 1FXHA 5C8YA 2OYQA 4LF9B 2EIKB 2NLJC 5B3SC 3ETQA 4LH6A 4O2BB 3T2MA 4OPAA 3PN1A 5JJJB 1M1KW 5CA0A 4H13B 4W4KA 4LFBO 2XAGA 4MVOA 3E8FA 3HKDB 4O4JA
chains in the Genus database with same CATH topology
1CXZB 1RFYA 2Q0OC 2RMKB 4NB5A 1URFA 2HJDA 4DYLA 1UPGA 4NKGB 4IGGA 1US6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXZ B;  1RFY A;  2Q0O C;  2RMK B;  4NB5 A;  1URF A;  2HJD A;  4DYL A;  1UPG A;  4NKG B;  4IGG A;  1US6 A; 
#chains in the Genus database with same CATH topology
 2KSD A;  3T1C A;  1M56 C;  4B3T B;  4I4T A;  3SJQ C;  4QPK A;  2WLJ A;  4DR7 B;  3LSS A;  4KHP O;  2Q5Z A;  3JSL A;  1Q5O A;  1PL0 A;  3IAY A;  3VBB A;  3X2Q C;  3OUS A;  1SQB H;  3WB2 A;  1L0N H;  2OCC B;  3L73 H;  3FFQ A;  3U11 A;  1NVP B;  4DV6 B;  3GWO A;  4UCT A;  4ZIB A;  4YJ3 B;  4I9W A;  1MSD A;  5KUM A;  3Q4H A;  3VQW A;  3FD9 A;  1RP3 B;  2Q4P A;  3HKE A;  1FAF A;  5JH7 B;  4FM0 A;  1AIL A;  2O57 A;  1SA0 B;  3GWK C;  3ZHS A;  1XRE A;  3DSQ A;  3SYQ A;  3JD2 A;  5IT9 N;  4FLZ A;  2LW7 A;  5KX5 A;  2UU9 B;  1WA8 B;  4TSF G;  1PL4 A;  5JCO A;  2CUG A;  1NQT A;  5CB4 B;  5EZY B;  5B1O A;  4FMT A;  4CH4 A;  2C2A A;  1G8M A;  1TVK A;  4QIW F;  3OR6 C;  5KMG A;  2JDI G;  2ZKO A;  1RSO B;  2OCH A;  3E22 A;  1HP8 A;  5CMU A;  1L8D A;  2GTA A;  2ITC C;  5IYB O;  3CSX A;  3CRM A;  3CME V;  2HFE C;  2HG5 C;  5LHI A;  3B09 A;  3SPC A;  5B1B C;  1HDJ A;  4ZOL B;  3CRC A;  4OX9 O;  1GTO A;  5DEC A;  4J10 A;  1BMF G;  3KG2 A;  2JJ2 G;  2VQF B;  2BTO A;  3ABL B;  2EZP A;  1XNR B;  4DV3 B;  4MT8 A;  2MK3 A;  5CA3 A;  2JGU A;  2F93 B;  4K3A A;  1F7Y A;  1R6N A;  1Q6I A;  4I50 B;  1H2G A;  3OMN B;  5KA5 A;  1W2B U;  1QLN A;  4J9Z B;  4B3S B;  4P9O A;  4UVB A;  3SYO A;  3K5L A;  5FNV B;  1WPX A;  2YIC A;  2UXC B;  4B3T O;  4UVC A;  4TWK A;  1GRJ A;  4FM2 A;  4AI8 A;  4PA7 A;  2QM4 A;  4BIU A;  2DYS C;  1W0J G;  5JWP A;  1K4D C;  5K1P A;  4DR1 B;  4J80 A;  2EIM C;  2PTM A;  4WCE V;  2MW2 B;  3R66 A;  3O9O A;  1GM9 A;  2WLI A;  2HJF C;  1QQC A;  4FJC C;  3QG5 A;  1OCC B;  4MW8 A;  1H8E G;  2WAM A;  1UPG A;  1ROP A;  4QGP A;  4DV6 O;  2AZ0 A;  4O4I B;  1VF6 C;  5EYP B;  4K0K O;  4DRX A;  2NNU A;  3JAM N;  2ZXW C;  3ABK B;  4TUY A;  2KQX A;  4AHC A;  3W7X A;  4BR6 A;  3JD4 A;  1MAB G;  2A79 B;  3HR0 A;  3UCS C;  4FLT A;  2DQ3 A;  2JRI A;  3K59 A;  4H33 A;  2FTK A;  3JAW A;  4O2A A;  2HHH B;  4IYI A;  2IU3 A;  3CCE V;  2ZIO A;  4ABM A;  1MNG A;  4LF6 B;  5B1B B;  3AG4 C;  1XEQ A;  3TK1 A;  4IIJ A;  1DF4 A;  3CRA A;  1DF5 A;  3JAR A;  3JD1 A;  2AXT Z;  2CTW A;  3OD4 A;  1K7D A;  3CCR V;  1PM9 A;  4FVM A;  2IW5 A;  3CJH A;  4UCS A;  3SGI A;  4DUZ B;  3G80 A;  2DYR C;  2VQF O;  1R3I C;  3JAS A;  3LDE A;  1TUB B;  1XNR O;  4JPR A;  1P49 A;  4MTX A;  3FX7 A;  4Z1V A;  1N32 B;  1FKA O;  2F43 G;  3OMI B;  1DK1 A;  1WNS A;  5GON B;  5AG2 A;  3G4S V;  3TCU A;  2BSK B;  3BA9 A;  1AP5 A;  1VF7 A;  5GTI Z;  1BZK A;  1QR8 A;  4NTY A;  5IJ0 A;  1VQN V;  3K9S A;  2YIB A;  1JFF A;  2UXN A;  2UXC O;  5JQG B;  4X1K A;  1WAZ A;  2R70 A;  4RWU A;  2IM9 A;  3ZBH A;  1GK9 A;  3K06 A;  3LDD A;  4B3M B;  5C8Y B;  3ZN0 A;  4A5U B;  3ZHU A;  3CE2 A;  3FAV B;  2DW4 A;  3ZRV A;  4DR1 O;  2DOS A;  4ICG A;  5JJE B;  3QVN A;  1PP9 H;  1NTZ H;  4YIO A;  3ETE A;  2AW9 A;  1GKF A;  5CN0 A;  1OCO C;  1GN6 A;  2QWO B;  3LNN A;  4O4J B;  2HKO A;  1S5J A;  2Y69 B;  1KUQ A;  1FXK A;  4O4H B;  4I4T B;  1AP6 A;  2DN9 A;  5D5Q A;  1FXV A;  3HPL C;  2XUM A;  5J2U A;  2QR4 A;  4J7J A;  1OCR C;  1K5Q A;  3F5T A;  2LFS A;  2P4V A;  3ASN B;  1MMM A;  3JAK A;  2HHH O;  4DV2 B;  3B8M A;  4D7T A;  4DV1 B;  4GKJ O;  2E3C A;  2HJD A;  3R65 A;  4EKW A;  3K5N A;  1SC5 B;  1EN4 A;  4CC6 A;  3Q4H B;  1ZSP A;  2ZE5 A;  3CX5 F;  5KHG A;  4F6E A;  1Y4M A;  4Q20 A;  1ZL8 B;  3CCU V;  4LF6 O;  3T4D A;  1M4U A;  4F6R A;  5FPR A;  1M93 A;  1R3K C;  4ZHQ A;  5KX5 B;  1X59 A;  4DYL A;  4DV7 B;  3OGC C;  2QA4 V;  4N23 A;  2WLK A;  1KB9 F;  1J5E B;  1AI5 A;  4LF5 B;  1X4T A;  1VQ9 V;  2GUZ A;  1WJZ A;  5E79 Z;  1UFI A;  4J7Z A;  3UT5 B;  5KMG B;  4DUZ O;  1VQ8 V;  1Y6X A;  2BTQ A;  2QDO A;  4PA4 A;  4GZR B;  3H1K H;  4DR4 O;  1S3J A;  3DGE A;  1BCC H;  3H9V A;  4FFB A;  1VAR A;  4UFZ A;  2AZ2 A;  3CRQ A;  3RYI A;  4P30 A;  5LHG A;  2DWE C;  4FFK A;  4H44 B;  3E8H A;  4DV5 B;  1XMO B;  1F23 A;  4EB6 B;  2JEU A;  1V9P A;  1O9H A;  4B3M O;  1BQ0 A;  3BA8 A;  2UUB O;  4K35 A;  4KXR A;  5GW7 A;  3LSQ A;  3WG7 C;  1VQ6 V;  4U3J B;  1QLE C;  1Z5V A;  2EIK C;  5EBL C;  4IYH A;  3OM3 B;  3SDL A;  1VQK V;  1EZJ A;  5LOV A;  4JI0 B;  2UXD O;  3K0G A;  2GBO A;  3B40 A;  3P3N A;  2GSM B;  4J9Y B;  4UV8 A;  4P2Z A;  4FPP A;  3QTC A;  3AG1 C;  2K1E A;  1JJO A;  1XMQ B;  3AK1 A;  3EXA A;  3OR7 C;  5L3E A;  2Q9L A;  4B7K A;  2V4D A;  3E89 A;  1PD3 A;  4RUE A;  3ABT A;  2QM8 A;  4AQY B;  2PZS A;  4IGG A;  3ZRW B;  3ZHQ A;  1RM1 B;  4X62 B;  3ZMU A;  1CEZ A;  2BCC H;  3BAA A;  4DV1 O;  1NH2 B;  1EFR G;  1SZT A;  4DRX B;  1MZF A;  1LR1 A;  5L3F A;  3RGB A;  3P3P A;  5KUK A;  1B6Q A;  4BAY A;  1P4R A;  4TUY B;  4DR2 B;  4QJF B;  1VMG A;  4X1I B;  2OCC C;  3K9A A;  2YIB D;  4QE9 A;  5CBF A;  2HEP A;  1YJ9 V;  1E1Q G;  2HVK C;  2VWJ A;  2PI5 A;  4FLV A;  4DV7 O;  1Y67 A;  1Y66 A;  3JAW B;  1J5E O;  1T5E A;  2BE3 A;  2F66 C;  1Q86 W;  4LF5 O;  1P7G A;  2ZIM A;  3OTF A;  3DTU B;  4FZ1 A;  3QNE A;  2WLM A;  2WLL B;  1R3L C;  3J81 N;  3W7U A;  2P7T C;  3B77 A;  5J2T A;  2QKS A;  1YVW A;  1VQO V;  2W6I G;  1XBL A;  3WFV A;  2R9I A;  2JGD A;  5L3G A;  3ABU A;  3WB1 A;  2Q8V A;  4DUY B;  1IBK B;  2Y4T A;  2EIN B;  1QU7 A;  1PNK A;  2LFR A;  2YXH A;  3JAR B;  2WSS G;  4LF7 B;  4PDV A;  2VQE B;  3F7V C;  4DV5 O;  1XMO O;  1MG1 A;  4UV9 A;  4Q6G A;  3OT7 A;  1SET A;  2CTP A;  1W0K G;  3JAS B;  3D8C A;  2Q7H A;  2HLD G;  1NU1 H;  1IBM O;  5IDJ A;  1H2L A;  1N36 B;  2AGA A;  2R9R B;  1ENV A;  2D3O W;  1AI6 A;  4PEL A;  3J7A U;  3FB6 C;  3MHH C;  1ZX3 A;  3ABL C;  4NXM O;  1GAX A;  3A2F A;  2BOB C;  1TGO A;  4JI0 O;  3AG1 B;  5ITZ A;  4G28 B;  1XMQ O;  3SPJ A;  4JYA O;  1VQL V;  3H1L H;  4JI8 B;  4J41 A;  3BEH A;  3KKY A;  2WPD G;  4JTA B;  3APQ A;  3H1I H;  5KA6 A;  1KYO F;  3P30 A;  4AQY O;  3N2K A;  5KHK A;  4BW5 A;  4JI7 B;  3L72 H;  2PF4 E;  2CTR A;  1AJP A;  4BIZ A;  3E8B A;  2X6C A;  3FKS G;  2EZO A;  5FLX N;  3QO7 A;  1OCC C;  1SER A;  2FML A;  2ETN A;  3DC6 A;  2QM7 A;  3SJB C;  1VP7 A;  1OHH G;  2ZM6 B;  1PNM A;  1RPR A;  1XI1 A;  4TQF A;  3WU2 Z;  5LGT A;  2X6B A;  1MSW D;  2OTJ V;  4HNA A;  2CAZ C;  3ABK C;  4B7E A;  2Z3Y A;  1Z2G A;  3CC7 V;  4TV8 A;  4JI1 O;  4X20 B;  4WF9 V;  2WWW A;  2DJV A;  1Q7Y W;  4GKK B;  1IDS A;  3OTO B;  4TT3 G;  4F6R B;  2AHZ A;  3W7W A;  2Q73 A;  4ZHQ B;  4PDM A;  1NT2 B;  4DUY O;  1BS3 A;  5IYC O;  1M90 W;  4X88 A;  1G4Y B;  4R50 A;  4O4L A;  4LF7 O;  2VQE O;  2VS0 A;  1XNQ B;  2IJI A;  1R6T A;  4JI4 B;  1TAE A;  1YJN V;  2YSU B;  2GUZ B;  4PV1 B;  1ZLZ A;  3AG3 B;  4PI0 A;  1JX9 A;  5EC2 C;  1N0N A;  4LNU B;  3CCQ V;  5LBQ A;  1N36 O;  3UQ8 A;  1IX9 A;  1I0H A;  2LGW A;  1XDC A;  2WLH A;  5EBW C;  2XAJ A;  3SJC C;  4LF9 O;  1EN5 A;  1JR9 A;  1YI2 V;  1YHQ V;  3K3W A;  3RYI B;  3VOU A;  4LWS A;  3CP1 A;  2Q69 A;  3JD0 A;  4ZI7 B;  1GH6 A;  3N27 A;  4N21 A;  1KKD A;  3CHX A;  3JCU Z;  3RYF B;  3KCX A;  4JZ2 A;  3CEI A;  3I5D A;  1OZ0 A;  1FFT B;  1U97 A;  4G27 B;  5LYJ B;  4I9Q A;  3G67 A;  4JI8 O;  1D5A A;  1NKD A;  4LF8 B;  4J42 A;  4LF4 B;  3CPW U;  1KEC A;  2XAF A;  2CH7 A;  4DR7 O;  1PNL A;  2OT5 A;  5LGU A;  4NTX A;  1K33 A;  1HNX B;  2XAQ A;  3E8G A;  1TA8 A;  3JAT A;  4YJ2 A;  2LGQ A;  2F95 B;  4L87 A;  1Y76 B;  5L3B A;  4CS2 A;  2HP8 A;  2IH3 C;  2XAH A;  1K73 W;  4GX0 A;  1VQ4 V;  4I5S A;  2EX3 A;  4RAI A;  1SQF A;  1KBH A;  2GTS A;  4GX2 A;  4DXW A;  3SYC A;  2LP7 A;  5B1A B;  2Y69 C;  2HR3 A;  1IBL B;  1Y74 A;  2ZM6 O;  2XTA A;  1DTO A;  4IT5 A;  2YXL A;  1AJN A;  2QWP B;  2IBZ H;  2YUA A;  1YTF D;  2E76 B;  1BQZ A;  2B5U A;  2Q68 A;  5H2F Z;  2UU9 O;  1XUQ A;  1ZUQ A;  1VF5 B;  5EBM C;  4D6T H;  1EBO A;  4R6Z A;  3ASN C;  4GKK O;  1K3E A;  3OTO O;  3SPG A;  1XHX A;  1W59 A;  1IXM A;  3A0B Z;  1QR9 A;  4PDL A;  4X9Q A;  1XNQ O;  5HFM A;  3W7S A;  4JI4 O;  1VQ7 V;  3C3S A;  1HNW B;  4BWA A;  3AEI A;  2ZQM A;  1K9M W;  5JVD A;  5BR8 B;  4NXN B;  1V55 B;  5J2T B;  1YF2 A;  1K8A W;  1WP7 A;  3CMA V;  2JGD B;  2CGN A;  4NTW A;  3SPI A;  1OCZ B;  4DV3 O;  3ABM B;  5F2V O;  2HVJ C;  4MVU A;  3A0R A;  4UVA A;  1N33 B;  5LA6 B;  5LP6 A;  3M7M X;  1YDX A;  2A7W A;  1YEW A;  1QCE A;  2CK3 G;  2FL4 A;  1WPB A;  2QGN A;  2PYJ A;  1IXB A;  4PD4 F;  4B3S O;  3RBZ A;  4WBN A;  1MZE A;  1BGY H;  1YTF B;  2V1D A;  4ASU G;  4LH7 A;  4LF8 O;  5EIB D;  3RN4 A;  5CA1 B;  4LF4 O;  4IHJ A;  4JI2 B;  4GCZ A;  1GMG A;  1JCH A;  1H2K A;  3UO3 A;  1GM8 A;  3ZHT A;  4O2B A;  5CA0 B;  4JAV A;  3TJT A;  4JZG A;  1E79 G;  4LR3 A;  3IFX A;  4CH6 A;  5GTH Z;  3MHS C;  1YZB A;  3HKD A;  4EEQ A;  3CWB H;  2Z5U A;  1O9G A;  2WA3 A;  2UUA B;  5IY5 B;  3BPZ A;  1IBL O;  4LFA B;  3AK2 A;  3LUT B;  4RQF A;  1NR1 A;  3HB3 B;  3D36 A;  1K4C C;  1Q6H A;  4JI6 B;  2F1M A;  3FYE B;  3E35 A;  2Q7G A;  4X64 B;  1YXB A;  2ZT9 B;  1OJH A;  2WLN A;  2X7R B;  3C3T A;  5L3C A;  5EC1 C;  4C7U A;  1FJG B;  4HBN A;  2YDE A;  1RM1 C;  4JYC A;  4LFC B;  4P9P A;  3HKE B;  2A3Q A;  4YJ3 A;  1K34 A;  4CBC A;  5H6R A;  3RFR A;  1M57 B;  1N34 B;  5JH7 A;  4HNA B;  1DLB A;  1SA0 A;  1B04 A;  3QF7 A;  2N04 A;  1HNW O;  4JI5 B;  1OV9 A;  5LGN A;  4X1Y A;  2NR5 A;  3D3I A;  1HR0 B;  4HYO A;  4MS2 A;  5BR8 O;  4CH5 A;  4NXN O;  1S5L Z;  1WA8 A;  4W4L A;  2ZD9 A;  3A8T A;  3RYH A;  2FB5 A;  2JEX A;  4MTF A;  5EZY A;  1TVK B;  5BMV A;  5IYZ A;  5KAF Z;  2V7Q G;  2ZDI A;  2RJZ A;  4QE7 A;  2P22 C;  4YXW G;  2PUS A;  3IGA C;  2RNB A;  4O4L B;  1ZTE A;  3E22 B;  1N32 O;  1XIL A;  1L1F A;  1N33 O;  3C90 A;  1H8H G;  1SQQ H;  1XQ8 A;  5E1A C;  1YCI A;  3OGI B;  5L3D A;  3IJ4 A;  1BT8 A;  2RN9 A;  3NXS A;  1ZWI C;  2EJR A;  1JA8 A;  1NTK H;  4KUM A;  2EIN C;  4FK5 C;  2QTO A;  4KL1 A;  1VQM V;  4JI2 O;  4F4L A;  4XDJ A;  2RCV A;  1J95 A;  4I7Z B;  2OIE A;  3ZRS A;  2XOK G;  2UXB B;  4CC5 A;  3RWR D;  4CZZ A;  4Z1M G;  2GV9 A;  4U7O A;  3ZS8 C;  3OW2 U;  2YEV A;  2KB1 A;  1GM7 A;  3JYC A;  1DGS A;  3CXH F;  3I56 V;  1GN4 A;  2FYU H;  2ZIN A;  1FD9 A;  1XL4 A;  3OUF A;  3E86 A;  2H94 A;  4QPJ A;  2B9Z A;  5FNV A;  4JYY A;  2DMX A;  1GO3 F;  1URF A;  4OXS A;  2UUA O;  2QSA A;  3ZHR A;  2EIJ B;  3E2E A;  4Z2W A;  1Q6U A;  4LFA O;  5FL7 G;  3ZMT A;  1KC8 W;  4XBF A;  2KG7 A;  3BVO A;  4H37 A;  4RO2 A;  3JAT B;  3QO8 A;  4UB6 Z;  3K5O A;  2QE7 G;  3G6E V;  4JI6 O;  3H1H H;  4PDR A;  2WLI B;  4X64 O;  2Q67 A;  3U0Z A;  5DM6 V;  4CS3 A;  5D5P A;  4DV2 O;  4RQE A;  4WFB V;  2PI4 A;  1FJG O;  5JJN B;  1Y74 B;  2EIL B;  4UCV A;  5EYP A;  4YY3 B;  1N4C A;  1N34 O;  1NZ6 A;  3B2E E;  1YIJ V;  2F4V B;  3FB5 C;  4JI5 O;  2XT9 A;  3ZMS A;  1HR0 O;  3F7Y C;  4I0X A;  1EM1 A;  4O2A B;  3SPH A;  2Y48 A;  2ZNJ A;  4XDK A;  3BY6 A;  3ZMV A;  2ZR3 A;  3IC7 A;  3UKM A;  3ZED A;  1AB3 A;  1E1R G;  2DE0 X;  3JCZ A;  5KHI A;  1THZ A;  1QNM A;  3B8N A;  1IZ3 A;  5KHH A;  4GUN A;  5B1N A;  3CS5 A;  4X89 A;  4MVZ A;  1GN3 A;  4MW3 A;  3STZ C;  1FFX A;  5FPO A;  1Z5W A;  5JVD B;  1IVS A;  4IIJ B;  1NBM G;  3G71 V;  5LXT A;  1SF9 A;  5DED A;  2E75 B;  2F23 A;  2QTS A;  2W0F C;  4DR5 B;  3CJH B;  1QBZ A;  2W6J G;  3T1H B;  1R3J C;  4GX5 A;  1PV0 A;  3EHB B;  5DN6 G;  5CBH A;  3AG3 C;  1US6 A;  2UXB O;  1TUB A;  2KKW A;  4CH3 A;  5EK0 A;  3ZCC A;  3QO5 A;  5LP6 B;  5H6Q A;  1NVP D;  4OGQ B;  3JAL A;  5GON A;  2DQ0 A;  3I55 V;  4MVM A;  3L75 H;  2YI9 A;  2BSK A;  4YHH B;  2LW1 A;  1QHT A;  1RFY A;  4WBN B;  3T1Y B;  5IJ0 B;  4TOI A;  1JFF B;  2UUC B;  4X1K B;  3ZRX A;  2QEX V;  3RYC A;  1HNZ B;  1R73 A;  4TQD A;  1F51 A;  2QWQ B;  5A9G A;  5JQG A;  3O65 A;  1Q43 A;  2JVD A;  1KD1 W;  2ATK C;  3FAV A;  4I55 A;  1FPO A;  4BW9 A;  3M99 B;  2PY5 A;  1F4N A;  3EFF K;  1G1X B;  1H38 A;  1QVG U;  3VQX A;  2WA4 A;  1JMK C;  4D7S A;  4DW1 A;  4X62 O;  2ADP A;  1FXK B;  1VF6 A;  1KMI Z;  3K0D A;  4PA9 A;  3SYA A;  1AI7 A;  4PJ0 Z;  1KQS U;  4MVQ A;  2QKC A;  4O4H A;  1YSC A;  3KCY A;  1K92 A;  2P06 A;  4YY3 O;  2IJJ A;  3OMA B;  4DR2 O;  1KP3 A;  5J2U B;  2Y0P A;  2F4V O;  5LL6 Y;  4GLX A;  4DV0 B;  1JJ2 U;  2XHB A;  1P84 F;  3S3W A;  3E83 A;  5B1A C;  1WN7 A;  2CDY A;  4WFH A;  3JAK B;  3EVK A;  2Q6A A;  1MA1 A;  2LO1 A;  3UM7 A;  1XOU A;  4BIO A;  4U3F H;  2AHY A;  2YI8 A;  3L70 H;  4IL6 Z;  1B3Q A;  4K0K B;  3ZX6 A;  2YS8 A;  1KU9 A;  2PGG A;  4JF3 A;  1I5X A;  1AR1 B;  4E4E A;  4MVS A;  3CRR A;  1ZL8 A;  3GVM A;  2Y0I A;  1Q8I A;  4X1Y B;  3CB2 A;  1IBK O;  1LNQ A;  4PHZ A;  1NJI W;  5IJ9 A;  4TV9 A;  3RVY A;  3ETG A;  3HKB A;  3STL C;  2EBO A;  3RYH B;  3BFR A;  2ZE8 A;  4DR5 O;  1SQP H;  2P90 A;  3LNM B;  5BMV B;  5IYZ B;  3T1H O;  3KZI Z;  1V54 B;  2BTQ B;  1FYJ A;  4HAM A;  2LJ2 A;  3UT5 A;  2JK5 C;  2IJH A;  5TIS Z;  4FIP C;  1ARO P;  2RQ6 A;  1VQP V;  1B06 A;  3JD3 A;  1V55 C;  3CD6 V;  2N05 A;  1BSM A;  3N2G A;  2YID A;  1IUR A;  4FFB B;  2CGO A;  4YHH O;  3ZIA G;  2QWN B;  3SR2 C;  3T1Y O;  4LBE C;  4DR6 B;  1SES A;  3IC9 A;  2UUC O;  1OCZ C;  3CCV V;  3ABM C;  2B1G A;  1HNZ O;  3WB0 A;  3H01 A;  4EB6 A;  1S5H C;  5B3S B;  3HKC A;  3SJA C;  3ZN1 A;  5BY1 A;  1CP9 A;  4WFE A;  1N8R W;  3K58 A;  1FS0 G;  3CCL V;  5H9C A;  4NB5 A;  3K04 A;  2YEV B;  1NR7 A;  4U3J A;  4AIL C;  2P67 A;  4GT1 A;  4H0L B;  3RVZ A;  1M56 B;  3K57 A;  1GN2 A;  4JI7 O;  5LOV B;  4FLX A;  4G2K A;  1SS3 A;  4LP8 A;  4PA6 A;  5KAI Z;  5KLV H;  2KG7 B;  4JV5 B;  3TET A;  3DC5 A;  3X2Q B;  3BAB A;  2L35 A;  4B3R B;  4DV0 O;  3K79 A;  1D2D A;  2Q0O C;  1HW7 A;  2XAS A;  5LMU B;  4UUJ C;  5IY5 C;  3SYP A;  1I94 B;  4DR3 B;  1QVF U;  2ODM A;  2QWR B;  4UCO A;  4LCU C;  2ARH A;  5K1X A;  3ZRW A;  3CXC U;  5B66 Z;  3RT3 C;  4DO2 A;  3M8A A;  4DV4 B;  2ZCE A;  1Q3E A;  4WFG A;  4PA3 A;  1AR4 A;  1CXZ B;  1EN6 A;  3AK3 A;  1NI8 A;  4X1I A;  1SQV H;  1EZV H;  3OE7 G;  4R8C A;  2ZNI A;  4JAA A;  2H3O A;  4I0X B;  1H2S B;  1S77 D;  1LUW A;  3H1J H;  1M57 C;  3ICX A;  4KP4 A;  1ZAU A;  3AG2 C;  2RMK B;  4KFM A;  4U7N A;  4GKJ B;  1D5N A;  5EIB C;  3LDC A;  1NS1 A;  1S0V A;  3CYO A;  2WLL A;  1U96 A;  1BL8 A;  4NYK A;  3UO2 A;  5JCO C;  5HFL A;  2XND G;  3VQV A;  3TXS A;  5IWA B;  2X0L A;  1FFX B;  3K03 A;  5LXT B;  4DR6 O;  4PI2 A;  3A0H Z;  1CPY A;  2OTL V;  4GYC B;  3JSN A;  4FM1 A;  1S72 V;  2ITD C;  3DXR A;  1S76 D;  2PYL A;  4FZ0 A;  1H2M A;  2IU0 A;  1H2N A;  3CCJ V;  1AI4 A;  4QNH B;  4DR4 B;  3JAL B;  4RUF A;  4X8A A;  3J80 N;  3B4S A;  4JI3 B;  2JJ1 G;  1HNX O;  3ZHV A;  1COW G;  3W7T A;  2ILM A;  3RYC B;  1MOF A;  2QJ1 A;  4NR1 A;  1WB7 A;  2R9A A;  4FLW A;  2DYS B;  4J11 A;  3F5W C;  5ITZ B;  1Q82 W;  4JAS A;  3K08 A;  5H5N A;  3VQY A;  4JV5 O;  2EIM B;  2LQT A;  2UUB B;  3ASO C;  2VWK A;  4I55 B;  4B3R O;  3BHP A;  1N0J A;  5LMU O;  2FKX A;  3MD0 A;  4J7K A;  3OEE G;  2A9H A;  2EIJ C;  1I94 O;  4DR3 O;  4GX1 A;  3N2K B;  4MVR A;  1SQG A;  4LC1 A;  3CC4 V;  4ZKI A;  5LMN B;  1YIT V;  3FYI B;  5B5E Z;  4E2L A;  1K97 A;  2ZXW B;  4MSW C;  4DV4 O;  3G6B A;  2RDC A;  3THO A;  2UXD B;  2YC0 A;  5BZB A;  2P4K A;  1PKX A;  4JTC B;  2JIZ G;  1M5I A;  3BCC H;  2VRZ A;  5BXZ A;  3CCS V;  1VIB A;  2G38 A;  3AG2 B;  2EIL C;  3NR7 A;  3CC2 V;  2GHY A;  3P32 A;  4JGS A;  1NTM H;  1RPO A;  4L8J A;  4TV8 B;  3ZMZ A;  2Q7E A;  1UJW B;  2E5L B;  4X20 A;  4K8Z A;  1L0L H;  4UCR A;  2H8P C;  4R7C A;  5CB4 A;  4EFB A;  4X65 B;  3ZJZ A;  3AG4 B;  2M6Y A;  2JS3 A;  1JQ0 A;  2CTQ A;  1SRY A;  5IWA O;  5IJ9 B;  4TV9 B;  1RSO A;  4X66 B;  3HKB B;  1P7B A;  2JS5 A;  4DW0 A;  1TUE B;  1SZX A;  2DYR B;  4UCU A;  5KHJ A;  4EFE A;  4JTD B;  3ML0 A;  3MDS A;  2GDS A;  3FB8 C;  4OPH A;  1AJQ A;  2ZE7 A;  4ZOL A;  2E74 B;  4LNU A;  3N2G B;  3K5M A;  1G6U A;  1NH2 D;  2ZR2 A;  4LWS B;  4JI3 O;  1XL6 A;  2W0X A;  3BRC A;  1JPX A;  4B08 A;  5IYD O;  3OFN G;  4ZI7 A;  3L74 H;  4I50 A;  5LP6 C;  1HWY A;  4CS4 A;  3HKC B;  3GB7 C;  2Z0A A;  3RYF A;  4HZ3 A;  3ASO B;  3FB7 C;  1XHZ A;  2QKA A;  3OEH G;  3AG7 A;  1IBM B;  4JAU A;  1AR5 A;  1R1B A;  5LYJ A;  5IE9 A;  1OCO B;  1SKV A;  2CH7 B;  2ADQ B;  4FLU A;  1YJW V;  1VQ5 V;  2YXY A;  2ZE6 A;  2X6A A;  5C93 A;  4DK1 A;  4UB8 Z;  3TXQ A;  2NN4 A;  4YJ2 B;  4NXM B;  5LMN O;  2L6L A;  4JYB A;  4NVP A;  4LFB B;  4NKG B;  1Y76 A;  1OCR B;  4ZBM A;  2IJK A;  1WLE A;  2BOC C;  2P6J A;  4JYA B;  4O4I A;  1FXK C;  4LFC O;  3MAQ A;  2K9P A;  3CCM V;  1LUV A;  1BHB A;  4KHP B;  3ETD A;  3RW0 A;  3D36 C;  3U10 A;  4UXN A;  3L9D A;  2E5L O;  2EUL A;  4WFF A;  2D2C B;  4FLY A;  1R6K A;  3T4Z A;  2OWO A;  2Y4U A;  1BE3 H;  2OIG A;  4X65 O;  1A32 A;  1KKC A;  1WP8 A;  1BHA A;  2A0L A;  1WB8 A;  3D3Q A;  4MTG A;  1SQX H;  5J9P C;  1ORQ C;  2N74 A;  4X66 O;  2M7W A;  1JOY A;  2B1I A;  2DWD C;  2IH1 C;  2P5O A;  1F4M A;  3L71 H;  4JI1 B;  4WFA V;  1PPJ H;  1I5Y A;  1Q81 W;  1I08 A;  1KP2 A;  3PJS K;  4MTO A;  1Q90 D;  1AVM A;  4YIP A;  5CBG A;  2R72 A;  1JVM A;  2ZDI C;  1V54 C;  2Q0A A;  4XDL A;  5A2Q N;  1M9N A;  2EJ7 A;  5LA6 A;  1I7F A;  2UXX A;  3DXR B;  1VEW A;  3TGU H;  2CE4 A;  3APO A;  2YIA A;  4K8X A;  3S3X A;  3WG7 B;  4OX9 B;  1QLE B;  1K5S A;  5LHH A;  4IHJ B;  4DK0 A;  3LSU A;  3OAA G;  2A06 H;  5CA1 A;  1FXH A;  5C8Y A;  2OYQ A;  4LF9 B;  2EIK B;  2NLJ C;  5B3S C;  3ETQ A;  4LH6 A;  4O2B B;  3T2M A;  4OPA A;  3PN1 A;  5JJJ B;  1M1K W;  5CA0 A;  4H13 B;  4W4K A;  4LFB O;  2XAG A;  4MVO A;  3E8F A;  3HKD B;  4O4J A; 
#chains in the Genus database with same CATH homology
 1CXZ B;  1RFY A;  2Q0O C;  2RMK B;  4NB5 A;  1URF A;  2HJD A;  4DYL A;  1UPG A;  4NKG B;  4IGG A;  1US6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...