1CXZB

Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
86
structure length
86
Chain Sequence
WSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-181))
publication title The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 86
sequence length 86
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1cxzB00
1US6A 2HJDA 4NKGB 1URFA 2Q0OC 1UPGA 1CXZB 2RMKB 4NB5A 4IGGA 4DYLA 1RFYA
chains in the Genus database with same CATH superfamily
5LMUO 1WN7A 2Z3YA 3SYCA 1RSOA 1Q5OA 5KA5A 2QWRB 2EIMC 4X64O 3BCCH 4D7TA 4NTXA 3E86A 3CJHB 5LOVB 2GV9A 1Q6UA 1F4NA 1YHQV 2EINB 2P67A 3W7UA 5KMGA 2IJIA 3CCVV 4FLWA 3A2FA 1YJWV 1I0HA 3QO8A 2DQ0A 2YIBA 3P3PA 2JGUA 4LWSA 4B7EA 3BY6A 2UUCB 3UO2A 3K58A 3RVYA 4NXMO 1H2SB 1L8DA 5AG2A 4RO2A 3JAMN 2GTAA 4UB6Z 2ZR3A 1N36B 4DV7O 3A0HZ 2V1DA 2QGNA 4UCUA 1Y76A 1EN5A 1QBZA 3ETDA 1SA0A 3HKCA 4JTAB 2ZXWC 1J5EO 3CRRA 3P3NA 5KAIZ 4F6RB 3D3IA 4JI8O 3SJCC 3VQYA 2QE7G 3ZJZA 5LHGA 4X9QA 4JI5B 2VQEO 4JZGA 1JFFB 1VEWA 1M90W 4NB5A 5IJ0B 4FM0A 4H37A 2XNDG 4JI1O 3AG1B 2ETNA 1WPBA 3IAYA 3DC6A 4O4IB 1V55B 2WLNA 4EB6A 1R6NA 4QJFB 3FKSG 2WLMA 4NXNO 4JZ2A 1E79G 3DGEA 2Q5ZA 1GN6A 4PI0A 4WFGA 3ABKC 3TGUH 3ASNC 5CA1A 1THZA 4CH4A 3JD3A 3AK2A 5F2VO 2HLDG 4O2AB 4G2KA 4JTCB 2PZSA 2OCCC 3L70H 4KL1A 4MTOA 1R6TA 4HAMA 3ZEDA 1OCZC 1FXKA 3QO7A 4MVZA 4B08A 1GN4A 1D5AA 1AILA 2VWKA 3STZC 4DV0O 2QEXV 3FB5C 4W4KA 2DN9A 3SJAC 3CEIA 1Q90D 3CJHA 5LOVA 4TV8B 4DXWA 5IT9N 3AG3B 3ABLC 1S0VA 1B3QA 4YJ2B 1HNZB 4O2BB 2IJHA 5KHKA 4X1IA 3Q4HB 3LUTB 1NVPD 2Q68A 4DR6B 1AR1B 2PY5A 3CMEV 3K3WA 2XAGA 3JALA 3TCUA 3T1YO 1H2MA 5ITZB 1KD1W 4OGQB 1MG1A 3K5OA 4O4LA 3X2QC 1CPYA 3CS5A 3DXRB 4DRXA 4O4HA 1JQ0A 3ETGA 1I5XA 3BA8A 3LNMB 3WFVA 3OMAB 4PDMA 4UCTA 4DW0A 1SQPH 1B06A 1BE3H 3J7AU 2JGDB 4K3AA 4UV8A 3TXSA 2B5UA 3ZMZA 1VQ7V 3BEHA 1YSCA 2HR3A 3IJ4A 4FJCC 4FPPA 5L3FA 2VRZA 1JFFA 3CCMV 1SKVA 4LC1A 2XAHA 5IJ0A 3NR7A 4X66O 4X88A 3A8TA 1YEWA 4X65O 1R1BA 1IBMB 2CAZC 3CCLV 2UUBO 1SQVH 2E3CA 2F1MA 1MSDA 1K97A 4GCZA 4LF4O 3ZHQA 1U96A 1OCRC 3G6BA 3JD0A 3JCUZ 4X89A 1K34A 4J42A 3T1HB 3G67A 2EIKC 5KA6A 3O65A 3CCSV 2CH7B 4O2AA 2PUSA 1VQ9V 1AI5A 4LFCB 3WU2Z 4PJ0Z 4FLVA 4XDLA 3PN1A 4I7ZB 1EN6A 4DW1A 4FMTA 4LFAO 1JOYA 1GAXA 3R66A 3RYCB 1NTKH 2ARHA 3BRCA 3L73H 4NXMB 1XMOO 2Y0IA 3N2KB 3B4SA 1KP2A 4DR5B 3JYCA 4TV8A 4N23A 2JRIA 3HKDB 5K1XA 2OTLV 4XDJA 1NTMH 2ILMA 5KHJA 1TUEB 5K1PA 4JI8B 3IFXA 4UB8Z 2YIBD 3CCJV 2QTOA 3Q4HA 3ZMSA 2A0LA 1SQQH 4OX9B 2Y48A 2PYLA 4D6TH 2EJRA 1RPRA 1BGYH 2LFSA 3OGIB 1DF4A 5ITZA 3ABKB 3H9VA 3ASNB 2UUAB 2AZ2A 5LYJB 3K0DA 2JEXA 3FFQA 1D5NA 3JASB 1TVKB 1UFIA 4DUYO 1GK9A 3HKEB 4GKJB 2JGDA 4RWUA 5JCOA 1ZX3A 4MVQA 1KYOF 1Q7YW 1MA1A 1VF6A 4CH5A 3HKBB 1WB8A 2GSMB 1YCIA 3G4SV 1N34B 2Y69C 1Y74B 5CMUA 2VWJA 2E74B 4PELA 2KSDA 4GT1A 4QE7A 2G38A 3SYQA 2LGQA 3ABLB 2ADPA 4ZHQA 3E22A 1I5YA 2FL4A 4HNAA 3I56V 4DV0B 4IIJB 4WBNA 4DR3O 2QA4V 2Q7EA 1R3KC 4ZIBA 3QNEA 1PKXA 3BAAA 1IBLO 3OMNB 2QWOB 2CTQA 1XDCA 1Q82W 4JF3A 4LNUA 1XNQB 1ZAUA 3N2GB 1BZKA 2Q8VA 4UCSA 3B40A 2OTJV 1AJNA 1WPXA 4B3TB 2ADQB 2JJ2G 2YICA 2D3OW 2F43G 3JAKA 3T1YB 3ZHTA 1I7FA 3N2KA 3WG7B 5D5QA 2NNUA 3ZHSA 2P6JA 3S3XA 3H1HH 4U7OA 1PV0A 3E83A 5EZYB 2HP8A 3RVZA 1FXKC 5BR8O 4I9WA 2CK3G 3H1JH 3WB2A 4QGPA 3VQVA 1HW7A 3ZMVA 1AR4A 1YIJV 2AHYA 1MSWD 4X66B 3CSXA 4R8CA 4X65B 4J41A 2VQFO 2W6IG 4DV1B 2EINC 2L6LA 1F51A 2Y4TA 2UUBB 2EIJC 4CC6A 1L1FA 3LDCA 3MHSC 4N21A 3JASA 1TVKA 1W0JG 5EBLC 3RYFA 5IDJA 1PNLA 4LF4B 1H2KA 3AG7A 1Y6XA 3I5DA 4HBNA 3ICXA 1UJWB 4GKKB 1SETA 3SJQC 1X4TA 5IWAB 2YXLA 5KAFZ 2ZT9B 2EILB 3FB6C 4ZBMA 3OT7A 4JI5O 3EXAA 5LA6A 3L9DA 5IY5B 2HEPA 1XMOB 5C8YA 3OR7C 1P7BA 5LGUA 2F4VB 4P2ZA 3D36C 3WB1A 4F6EA 2WWWA 4NKGB 3ZBHA 2QWPB 2WLHA 2F66C 4YJ3B 1M57B 3TK1A 3K08A 4JAVA 3CRAA 3W7TA 5KX5A 1XHXA 2WA4A 3AG1C 4Z1MG 4J10A 4JAAA 1FJGB 1W0KG 4X1YB 1H2GA 1GN3A 2HHHO 1V55C 2X6AA 2YI9A 2ZCEA 4BAYA 5J9PC 5B3SC 4BW9A 1G1XB 1YJ9V 4JASA 2ZE7A 1VQ5V 4FFBA 4X1KA 1JCHA 5HFLA 4JI7O 1BL8A 3OM3B 4MTFA 4W4LA 2HJDA 2XHBA 5EZYA 4IL6Z 2DWDC 2RN9A 2Y4UA 2CE4A 1Q6IA 2QJ1A 3ZCCA 3OEEG 3AK1A 1ZWIC 1GO3F 3OFNG 2BTQB 1AB3A 4GX2A 4MW8A 1HNZO 5GW7A 4DR6O 2BSKB 3AG3C 1QU7A 1Y4MA 4DR2O 2A06H 1H8EG 3K04A 1NU1H 5DEDA 1P84F 3G6EV 1G4YB 3IGAC 3OTFA 3ZRWB 3H1IH 1KC8W 3K9AA 4WFBV 3B8NA 3T2MA 5IYBO 3OR6C 3W7XA 4J9ZB 4CC5A 4LFBO 4PHZA 4L8JA 5FPRA 1NKDA 5LBQA 2QKAA 1GRJA 3UM7A 4UV9A 2WLIB 3OE7G 5LP6B 4DV2B 4UXNA 1M5IA 1O9GA 1COWG 2IH3C 4FM1A 4OPHA 1VF5B 1IBMO 4YJ3A 5LGNA 3JAWA 4GX1A 5BR8B 2LO1A 4LF6B 4UCRA 2BE3A 2ITDC 4KXRA 4O4JB 4UFZA 2Z5UA 5FNVB 3T1HO 2AHZA 4JI3B 2FKXA 4X62B 1F7YA 2L35A 4DR7B 2EIJB 5JQGB 4LFCO 2CUGA 4OPAA 1VQKV 3OAAG 4MVRA 2F95B 2VQFB 3K5LA 1AR5A 1NT2B 1SRYA 3NXSA 3ZRSA 1BSMA 2Q6AA 3AK3A 1IVSA 4J11A 1Q3EA 2HJFC 2QWNB 5DECA 4IHJA 1B6QA 1R3JC 3RW0A 2PGGA 1K5QA 4WFHA 3K57A 4DR5O 2HG5C 1WAZA 2ZE6A 1XL6A 4JTDB 1AI7A 2BTQA 2WLJA 2Q0OC 3UO3A 1SQGA 4OX9O 1JA8A 3SPCA 4QIWF 2M7WA 5J2TB 1FPOA 2FB5A 3G71V 4B3MB 5BZBA 1Q8IA 3K0GA 3ZRWA 5L3BA 2UUAO 2N04A 2YIDA 5B3SB 1U97A 2WA3A 4GKJO 3JSNA 3CRQA 3RT3C 4IT5A 2HHHB 1M9NA 2H3OA 4X20B 2PTMA 4FLTA 3LDDA 3VQWA 5J2UB 1BS3A 5FLXN 1N34O 3KG2A 1FFXB 3DTUB 3D3QA 1N32B 3RYIB 2FTKA 1YF2A 4JI7B 1KP3A 1JPXA 5CBFA 3SYPA 2ATKC 1VQ6V 3S3WA 1N0JA 3ZMUA 1YVWA 5CBHA 5H5NA 3D8CA 1RM1B 1US6A 5FNVA 1SQFA 3OW2U 4WCEV 4TUYB 3E35A 1FYJA 1E1RG 2Q73A 2CGNA 5JQGA 1XNQO 1HNWO 4GUNA 5KHIA 2KG7B 3EVKA 3CXHF 4B3TO 3CCRV 4J7ZA 4JI0B 2E75B 4DR2B 3ETQA 4JI6B 3ASOB 3GWOA 4MVMA 2WLLB 1KBHA 1VF7A 2LW7A 4QNHB 1N33B 5D5PA 1GM8A 1WLEA 3CC4V 1WP8A 4FZ0A 1SESA 1JX9A 4JAUA 2DOSA 4DYLA 2P5OA 2YC0A 4LFBB 5IJ9B 3WG7C 4CS4A 2D2CB 4KHPO 4F6RA 3D36A 4ZOLB 3TJTA 1W2BU 4PI2A 2OYQA 2GTSA 3CWBH 2V7QG 5JVDB 2HVJC 2P90A 1XNRB 2RQ6A 5FL7G 3ZS8C 1XREA 1XHZA 1OCOB 3SYAA 3FX7A 4YIPA 4O4IA 3EHBB 1FAFA 4FLZA 1G6UA 4DV1O 4I5SA 1PM9A 1S3JA 3BPZA 2DYRC 2YI8A 4DO2A 1TA8A 1VQPV 1VQ4V 2NN4A 2OWOA 1VARA 2EZOA 3FYIB 4GKKO 3BVOA 4UVBA 3FYEB 5IWAO 5E1AC 2Z0AA 5EIBD 1K9MW 5B1AB 2XUMA 5A9GA 1WB7A 5LMNB 4AI8A 4U3FH 2R70A 2PI4A 1I08A 1S77D 4R6ZA 2F4VO 3U11A 1F4MA 2XAJA 4AHCA 2EILC 1ZTEA 3IC7A 3KKYA 3RYHB 3GVMA 4FLYA 1MZFA 1FFTB 4LP8A 2CTWA 2YEVB 5IY5C 1AI4A 3CXCU 3RBZA 4MVUA 2YXHA 1P49A 4J80A 4TWKA 5EIBC 4YJ2A 1FJGO 2UXBO 2MK3A 4FZ1A 4O2BA 1LNQA 3TETA 1M57C 4DR1B 2KG7A 5JWPA 4L87A 3H1KH 4P9OA 3FD9A 2PYJA 1PPJH 4MTGA 3DXRA 2IM9A 4UVAA 2AW9A 1S76D 4JYBA 3U10A 3VQXA 2CDYA 2ZD9A 1BCCH 4IYHA 3SPJA 3UCSC 2BTOA 1QCEA 2UXCO 1FS0G 2ZE8A 1K3EA 4EEQA 1XI1A 1AJQA 2ZINA 5JVDA 5LGTA 2O57A 1IBKB 1PNMA 1S5JA 3OD4A 4BIZA 2JK5C 3W7WA 4H0LB 3B09A 5IYCO 1RFYA 1LUWA 1RPOA 4WFFA 1Q86W 3ZX6A 3CD6V 1AJPA 4I0XB 2CH7A 4LH7A 1WA8B 3K06A 1GTOA 1HNWB 3N27A 4NTYA 1OCCC 2UXXA 4BR6A 1Q6HA 1EZJA 2W0FC 2LJ2A 3RYCA 3HR0A 1PD3A 5EYPB 4DV2O 3CCEV 1WNSA 3G80A 1M56B 1XBLA 3ABUA 3KZIZ 1Q81W 2IBZH 3ABMB 4JGSA 5LP6C 3LSUA 2P4VA 2DQ3A 3UQ8A 3APQA 3KCYA 3HKDA 4DV5O 4LF6O 4KHPB 3MAQA 5LHHA 3RWRD 1DK1A 2RDCA 4JI3O 3SDLA 1R3IC 1CEZA 3OGCC 4X62O 4U3JB 4DR7O 2DYRB 4CH3A 1KKCA 1NZ6A 3OUFA 5JH7B 3CX5F 3C3TA 4XDKA 4YIOA 4EFBA 1T5EA 5LYJA 4HZ3A 3P30A 1K92A 5KLVH 1D2DA 3HKEA 2EJ7A 4LF5B 1PL4A 4OXSA 3UT5B 3OEHG 1JJOA 3HKBA 1Y66A 2H8PC 1QVGU 1Y74A 2P06A 2ZNJA 2OT5A 1AROP 1N0NA 1HWYA 1IX9A 3AG2B 3H01A 3QG5A 1H8HG 3ETEA 5IYDO 2RCVA 4MW3A 4H33A 3ZHVA 1R6KA 4IIJA 3ZRXA 5A2QN 4BWAA 2EBOA 2ZDIC 4B3MO 1SF9A 1HR0O 1DGSA 1CP9A 2DYSB 2N05A 1AP5A 1K7DA 1NI8A 3E8FA 4WF9V 3J80N 4I50B 3MDSA 1NH2D 2UXBB 1WA8A 2DMXA 1K4DC 3CB2A 3N2GA 4LH6A 1MMMA 4JV5B 1NBMG 4J7KA 3ZN0A 2QSAA 4H44B 3VOUA 1VP7A 5EYPA 2QWQB 1MOFA 1RSOB 1N32O 1WP7A 5GTIZ 3R65A 1HDJA 3BABA 1K4CC 3A0BZ 3CMAV 3QF7A 2WAMA 3PJSK 4LF7O 5CA0B 5CA3A 2IJJA 3K79A 5KMGB 4I4TB 2HKOA 1FXVA 1R3LC 2Q7HA 5EC2C 2UXCB 3K03A 2IW5A 4MTXA 5LL6Y 4LWSB 3OUSA 2YIAA 1LR1A 4CZZA 4U3JA 1QNMA 1RM1C 3M7MX 2AZ0A 4UCOA 1PNKA 1V54B 1GMGA 1KECA 2IU3A 5H2FZ 4JI0O 4JI6O 1Y76B 5B1BB 1VQMV 1SA0B 2E5LB 1N33O 1ZLZA 3JD1A 1KQSU 1QLEB 2JDIG 1OCCB 1IXMA 4BIOA 1GM7A 3E8BA 4PV1B 2BOBC 4C7UA 3BFRA 3UT5A 3ASOC 3ZN1A 1N8RW 4B3RO 3AG4C 1GKFA 4B7KA 1K8AW 2F93B 1PL0A 2UXNA 4PD4F 1M4UA 4EB6B 1TGOA 1XNRO 5BY1A 4UCVA 3E8HA 4FM2A 5BXZA 1XMQO 1BQ0A 1JMKC 1XILA 1SQBH 5CA1B 1AVMA 2CTRA 2XAFA 4DV5B 1OCOC 4LF9O 4PA6A 2HFEC 2OCHA 4TSFG 4I50A 4J7JA 4X1YA 1VQ8V 1SC5B 3C90A 4PDVA 3CE2A 3K59A 4MS2A 5JJNB 4B3SO 5KHHA 5TISZ 1KU9A 1YJNV 1SS3A 1QVFU 2QDOA 1Y67A 1L0LH 4GZRB 5LMNO 4IGGA 4PDRA 2ZQMA 3T4DA 1WJZA 2CTPA 5CA0A 1ORQC 4FIPC 5B1AC 3A0RA 4I4TA 3B2EE 2LP7A 1J95A 4X1IB 5DM6V 1VQOV 1DLBA 2UU9O 2Q7GA 2X0LA 1H2LA 2A3QA 2M6YA 4UVCA 3JARB 1V9PA 3K5MA 4JI4B 3JATB 3JALB 4TQFA 4NVPA 3LSSA 1SZXA 4O4LB 4DRXB 4G28B 4DR1O 4O4HB 2BSKA 2Q9LA 2MW2B 1ZUQA 1GH6A 3ML0A 3LDEA 1P7GA 4RAIA 4FLUA 2YUAA 2RJZA 1HR0B 3EFFK 4GYCB 3I55V 2GDSA 1ROPA 3HB3B 1I94O 4UUJC 5EC1C 2JS3A 2WLIA 3DC5A 1NQTA 4YXWG 2H94A 5LP6A 2PF4E 3APOA 4DV6B 1ZSPA 1OJHA 5CN0A 4F4LA 1O9HA 2JVDA 1NH2B 5EBWC 1MNGA 1BHBA 3ZHUA 4MVOA 5HFMA 4LF8B 1IBKO 2GUZB 3J81N 2UXDO 4LF7B 5H6RA 4PDLA 3L71H 4YHHB 1H38A 1W59A 2RMKB 3GWKC 3M99B 4GX0A 4MSWC 4GLXA 2B1IA 5LXTB 1K33A 4O4JA 2X6BA 3K5NA 4DV4O 3SYOA 3STLC 1S5LZ 2DJVA 2GHYA 3F7VC 4KFMA 2X7RB 3SPIA 1YTFB 4E4EA 2IU0A 2QKSA 2R9IA 3MHHC 2QR4A 3QVNA 3L72H 3E89A 3AG4B 1IZ3A 4LCUC 1QLNA 1ENVA 4P30A 1L0NH 2K1EA 2LFRA 4JYAB 5C93A 4B3RB 3JARA 1M56C 5DN6G 2CGOA 4FLXA 5L3EA 2Q4PA 3JATA 5KHGA 4H13B 4DV3B 2OIEA 3ZMTA 2X6CA 3ABMC 3IC9A 2KKWA 2ZDIA 1FD9A 4QE9A 3ZHRA 3F5WC 2XAQA 4YY3O 5J2TA 1XMQB 3OTOB 5CBGA 3B8MA 2LGWA 2ZNIA 1DF5A 3ZIAG 2P22C 4LF9B 4AQYB 2A79B 4G27B 4DK1A 4LF5O 2EIMB 3F5TA 2DWEC 4JI2B 1B04A 4X20A 4X8AA 1NTZH 5J2UA 1TUBB 5LMUB 4FVMA 4B3SB 4ZHQB 3E22B 4K0KO 2JJ1G 4HNAB 1FFXA 1GN2A 2XT9A 4I55B 4WBNB 3CP1A 2F23A 4RQFA 3RYIA 4X64B 1HNXO 3JD4A 5H9CA 4KUMA 3CCUV 2DE0X 4JYCA 1QR9A 2GUZA 3B77A 4CS2A 1H2NA 4LNUB 2Q69A 3AG2C 4JPRA 2WLKA 5LXTA 2UU9B 3JSLA 4RQEA 3L75H 4TUYA 1VQLV 4DUZO 4AILC 2ZR2A 4EFEA 2HVKC 3JAKB 2ZXWB 2EZPA 4KP4A 4JV5O 4DV7B 2DYSC 1G8MA 1QHTA 3ABTA 2BCCH 2LQTA 1M1KW 1AP6A 1CXZB 2WLLA 1BT8A 3C3SA 1J5EB 2P7TC 2W6JG 4PA9A 2EULA 1KMIZ 4TQDA 4BW5A 1PP9H 4K8XA 3RN4A 4WFEA 1BHAA 2RNBA 4NYKA 3L74H 2GBOA 4TV9B 2VQEB 3RFRA 4Q6GA 1HP8A 2ZM6O 5IJ9A 1I94B 4JI1B 1OZ0A 4ZOLA 1NJIW 3BHPA 2A9HA 1VQNV 1IDSA 1UPGA 4K35A 3RYFB 4NXNB 2LW1A 5JJEB 2OCCB 3T4ZA 1OCZB 3CCQV 4CS3A 1S5HC 1BMFG 5BMVB 2UXDB 4TOIA 1SQXH 3SPGA 2C2AA 2E5LO 2FYUH 2OIGA 3SPHA 1NS1A 3LNNA 1V54C 1P4RA 2QM4A 2ODMA 5B5EZ 2QKCA 4ZI7B 3SR2C 4DV4B 5B1BC 5LA6B 1TUBA 4PA4A 5C8YB 3WB0A 4RUFA 1QLEC 2QTSA 5L3CA 4MT8A 2XASA 4I55A 5KUKA 3M8AA 4BIUA 1EM1A 4PA3A 1MABG 2QM8A 3FB7C 2YS8A 4FK5C 1OV9A 5KX5B 4NR1A 4A5UB 5B66Z 5E79Z 1IURA 3RGBA 1JVMA 3RYHA 1QR8A 1X59A 3X2QB 5L3DA 1QQCA 2YEVA 1FXHA 3FB8C 4D7SA 2JIZG 4DR4O 2B1GA 4FFBB 4X1KB 2P4KA 3H1LH 5KUMA 5CB4B 1VMGA 1NVPB 4Q20A 4PA7A 2ZIOA 5GTHZ 2DW4A 3K9SA 4U7NA 2JEUA 4YY3B 1YZBA 3U0ZA 4ABMA 2XTAA 3CC2V 2ZIMA 3LSQA 1JR9A 1XQ8A 4QPKA 2R72A 1K5SA 3P32A 3E8GA 1FKAO 3CYOA 1XOUA 5IYZB 4DK0A 4TV9A 2A7WA 3FAVB 4ZKIA 1XUQA 1IXBA 3SGIA 2FMLA 3HPLC 1F23A 4IYIA 1OCRB 2N74A 4RUEA 4K0KB 2EIKB 2UUCO 4JI4O 3CPWU 4LBEC 4QPJA 3THOA 1Z5VA 1HNXB 1ZL8B 4HYOA 2W0XA 1BQZA 1YDXA 1LUVA 2Q67A 4WFAV 1N36O 2ZKOA 5GONB 5BMVA 1Z2GA 2EX3A 3MD0A 4MVSA 4J9YB 4JYYA 4P9PA 1YITV 1KUQA 1EFRG 4LFAB 3E2EA 2ZE5A 4CBCA 4ZI7A 1EN4A 1SZTA 4DUZB 4I0XA 2E76B 5L3GA 1Z5WA 1OHHG 5LHIA 1Q43A 1MZEA 2KQXA 1SERA 3JAWB 4DV6O 4NTWA 2PI5A 1YI2V 2WPDG 2Y0PA 1EBOA 3ZRVA 2R9RB 3VBBA 1RP3B 2JS5A 4E2LA 4LF8O 4EKWA 4I9QA 1DTOA 1N4CA 1E1QG 2ZM6B 2IH1C 1XEQA 2KB1A 4YHHO 5IE9A 3OMIB 1YTFD 1NR7A 3BA9A 3KCXA 5EK0A 2QM7A 2NLJC 5CB4A 1VIBA 5FPOA 1GM9A 4DUYB 4IHJB 4K8ZA 3TXQA 5H6QA 5JH7A 3CRCA 2Y69B 3SJBC 1AI6A 2R9AA 2B9ZA 2AXTZ 5JJJB 3HKCB 3O9OA 1XL4A 2ITCC 3DSQA 3JCZA 5IYZA 2K9PA 3JD2A 3FAVA 4FFKA 4ASUG 2Q0AA 1M93A 1K73W 2YSUB 4R50A 5B1NA 2IJKA 3T1CA 3GB7C 4R7CA 4ICGA 1KB9F 4JYAO 1KKDA 1A32A 1URFA 4GX5A 3UKMA 4TT3G 3CC7V 3AEIA 2XOKG 4Z2WA 1JJ2U 2YXYA 4DR3B 1R73A 4DV3O 1ZL8A 3W7SA 1NR1A 4CH6A 3F7YC 2NR5A 5GONA 1IBLB 3CHXA 2V4DA 5EBMC 3OTOO 2AGAA 3CRMA 2VS0A 4LR3A 4XBFA 1S72V 4AQYO 1YXBA 4DR4B 4Z1VA 2BOCC 5JCOC 2WSSG 1EZVH 1FXKB 1TAEA 5B1OA 3QO5A 4JI2O 1VF6C 3QTCA 2YDEA
chains in the Genus database with same CATH topology
1US6A 2HJDA 4NKGB 1URFA 2Q0OC 1UPGA 1CXZB 2RMKB 4NB5A 4IGGA 4DYLA 1RFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US6 A;  2HJD A;  4NKG B;  1URF A;  2Q0O C;  1UPG A;  1CXZ B;  2RMK B;  4NB5 A;  4IGG A;  4DYL A;  1RFY A; 
#chains in the Genus database with same CATH topology
 5LMU O;  1WN7 A;  2Z3Y A;  3SYC A;  1RSO A;  1Q5O A;  5KA5 A;  2QWR B;  2EIM C;  4X64 O;  3BCC H;  4D7T A;  4NTX A;  3E86 A;  3CJH B;  5LOV B;  2GV9 A;  1Q6U A;  1F4N A;  1YHQ V;  2EIN B;  2P67 A;  3W7U A;  5KMG A;  2IJI A;  3CCV V;  4FLW A;  3A2F A;  1YJW V;  1I0H A;  3QO8 A;  2DQ0 A;  2YIB A;  3P3P A;  2JGU A;  4LWS A;  4B7E A;  3BY6 A;  2UUC B;  3UO2 A;  3K58 A;  3RVY A;  4NXM O;  1H2S B;  1L8D A;  5AG2 A;  4RO2 A;  3JAM N;  2GTA A;  4UB6 Z;  2ZR3 A;  1N36 B;  4DV7 O;  3A0H Z;  2V1D A;  2QGN A;  4UCU A;  1Y76 A;  1EN5 A;  1QBZ A;  3ETD A;  1SA0 A;  3HKC A;  4JTA B;  2ZXW C;  1J5E O;  3CRR A;  3P3N A;  5KAI Z;  4F6R B;  3D3I A;  4JI8 O;  3SJC C;  3VQY A;  2QE7 G;  3ZJZ A;  5LHG A;  4X9Q A;  4JI5 B;  2VQE O;  4JZG A;  1JFF B;  1VEW A;  1M90 W;  4NB5 A;  5IJ0 B;  4FM0 A;  4H37 A;  2XND G;  4JI1 O;  3AG1 B;  2ETN A;  1WPB A;  3IAY A;  3DC6 A;  4O4I B;  1V55 B;  2WLN A;  4EB6 A;  1R6N A;  4QJF B;  3FKS G;  2WLM A;  4NXN O;  4JZ2 A;  1E79 G;  3DGE A;  2Q5Z A;  1GN6 A;  4PI0 A;  4WFG A;  3ABK C;  3TGU H;  3ASN C;  5CA1 A;  1THZ A;  4CH4 A;  3JD3 A;  3AK2 A;  5F2V O;  2HLD G;  4O2A B;  4G2K A;  4JTC B;  2PZS A;  2OCC C;  3L70 H;  4KL1 A;  4MTO A;  1R6T A;  4HAM A;  3ZED A;  1OCZ C;  1FXK A;  3QO7 A;  4MVZ A;  4B08 A;  1GN4 A;  1D5A A;  1AIL A;  2VWK A;  3STZ C;  4DV0 O;  2QEX V;  3FB5 C;  4W4K A;  2DN9 A;  3SJA C;  3CEI A;  1Q90 D;  3CJH A;  5LOV A;  4TV8 B;  4DXW A;  5IT9 N;  3AG3 B;  3ABL C;  1S0V A;  1B3Q A;  4YJ2 B;  1HNZ B;  4O2B B;  2IJH A;  5KHK A;  4X1I A;  3Q4H B;  3LUT B;  1NVP D;  2Q68 A;  4DR6 B;  1AR1 B;  2PY5 A;  3CME V;  3K3W A;  2XAG A;  3JAL A;  3TCU A;  3T1Y O;  1H2M A;  5ITZ B;  1KD1 W;  4OGQ B;  1MG1 A;  3K5O A;  4O4L A;  3X2Q C;  1CPY A;  3CS5 A;  3DXR B;  4DRX A;  4O4H A;  1JQ0 A;  3ETG A;  1I5X A;  3BA8 A;  3LNM B;  3WFV A;  3OMA B;  4PDM A;  4UCT A;  4DW0 A;  1SQP H;  1B06 A;  1BE3 H;  3J7A U;  2JGD B;  4K3A A;  4UV8 A;  3TXS A;  2B5U A;  3ZMZ A;  1VQ7 V;  3BEH A;  1YSC A;  2HR3 A;  3IJ4 A;  4FJC C;  4FPP A;  5L3F A;  2VRZ A;  1JFF A;  3CCM V;  1SKV A;  4LC1 A;  2XAH A;  5IJ0 A;  3NR7 A;  4X66 O;  4X88 A;  3A8T A;  1YEW A;  4X65 O;  1R1B A;  1IBM B;  2CAZ C;  3CCL V;  2UUB O;  1SQV H;  2E3C A;  2F1M A;  1MSD A;  1K97 A;  4GCZ A;  4LF4 O;  3ZHQ A;  1U96 A;  1OCR C;  3G6B A;  3JD0 A;  3JCU Z;  4X89 A;  1K34 A;  4J42 A;  3T1H B;  3G67 A;  2EIK C;  5KA6 A;  3O65 A;  3CCS V;  2CH7 B;  4O2A A;  2PUS A;  1VQ9 V;  1AI5 A;  4LFC B;  3WU2 Z;  4PJ0 Z;  4FLV A;  4XDL A;  3PN1 A;  4I7Z B;  1EN6 A;  4DW1 A;  4FMT A;  4LFA O;  1JOY A;  1GAX A;  3R66 A;  3RYC B;  1NTK H;  2ARH A;  3BRC A;  3L73 H;  4NXM B;  1XMO O;  2Y0I A;  3N2K B;  3B4S A;  1KP2 A;  4DR5 B;  3JYC A;  4TV8 A;  4N23 A;  2JRI A;  3HKD B;  5K1X A;  2OTL V;  4XDJ A;  1NTM H;  2ILM A;  5KHJ A;  1TUE B;  5K1P A;  4JI8 B;  3IFX A;  4UB8 Z;  2YIB D;  3CCJ V;  2QTO A;  3Q4H A;  3ZMS A;  2A0L A;  1SQQ H;  4OX9 B;  2Y48 A;  2PYL A;  4D6T H;  2EJR A;  1RPR A;  1BGY H;  2LFS A;  3OGI B;  1DF4 A;  5ITZ A;  3ABK B;  3H9V A;  3ASN B;  2UUA B;  2AZ2 A;  5LYJ B;  3K0D A;  2JEX A;  3FFQ A;  1D5N A;  3JAS B;  1TVK B;  1UFI A;  4DUY O;  1GK9 A;  3HKE B;  4GKJ B;  2JGD A;  4RWU A;  5JCO A;  1ZX3 A;  4MVQ A;  1KYO F;  1Q7Y W;  1MA1 A;  1VF6 A;  4CH5 A;  3HKB B;  1WB8 A;  2GSM B;  1YCI A;  3G4S V;  1N34 B;  2Y69 C;  1Y74 B;  5CMU A;  2VWJ A;  2E74 B;  4PEL A;  2KSD A;  4GT1 A;  4QE7 A;  2G38 A;  3SYQ A;  2LGQ A;  3ABL B;  2ADP A;  4ZHQ A;  3E22 A;  1I5Y A;  2FL4 A;  4HNA A;  3I56 V;  4DV0 B;  4IIJ B;  4WBN A;  4DR3 O;  2QA4 V;  2Q7E A;  1R3K C;  4ZIB A;  3QNE A;  1PKX A;  3BAA A;  1IBL O;  3OMN B;  2QWO B;  2CTQ A;  1XDC A;  1Q82 W;  4JF3 A;  4LNU A;  1XNQ B;  1ZAU A;  3N2G B;  1BZK A;  2Q8V A;  4UCS A;  3B40 A;  2OTJ V;  1AJN A;  1WPX A;  4B3T B;  2ADQ B;  2JJ2 G;  2YIC A;  2D3O W;  2F43 G;  3JAK A;  3T1Y B;  3ZHT A;  1I7F A;  3N2K A;  3WG7 B;  5D5Q A;  2NNU A;  3ZHS A;  2P6J A;  3S3X A;  3H1H H;  4U7O A;  1PV0 A;  3E83 A;  5EZY B;  2HP8 A;  3RVZ A;  1FXK C;  5BR8 O;  4I9W A;  2CK3 G;  3H1J H;  3WB2 A;  4QGP A;  3VQV A;  1HW7 A;  3ZMV A;  1AR4 A;  1YIJ V;  2AHY A;  1MSW D;  4X66 B;  3CSX A;  4R8C A;  4X65 B;  4J41 A;  2VQF O;  2W6I G;  4DV1 B;  2EIN C;  2L6L A;  1F51 A;  2Y4T A;  2UUB B;  2EIJ C;  4CC6 A;  1L1F A;  3LDC A;  3MHS C;  4N21 A;  3JAS A;  1TVK A;  1W0J G;  5EBL C;  3RYF A;  5IDJ A;  1PNL A;  4LF4 B;  1H2K A;  3AG7 A;  1Y6X A;  3I5D A;  4HBN A;  3ICX A;  1UJW B;  4GKK B;  1SET A;  3SJQ C;  1X4T A;  5IWA B;  2YXL A;  5KAF Z;  2ZT9 B;  2EIL B;  3FB6 C;  4ZBM A;  3OT7 A;  4JI5 O;  3EXA A;  5LA6 A;  3L9D A;  5IY5 B;  2HEP A;  1XMO B;  5C8Y A;  3OR7 C;  1P7B A;  5LGU A;  2F4V B;  4P2Z A;  3D36 C;  3WB1 A;  4F6E A;  2WWW A;  4NKG B;  3ZBH A;  2QWP B;  2WLH A;  2F66 C;  4YJ3 B;  1M57 B;  3TK1 A;  3K08 A;  4JAV A;  3CRA A;  3W7T A;  5KX5 A;  1XHX A;  2WA4 A;  3AG1 C;  4Z1M G;  4J10 A;  4JAA A;  1FJG B;  1W0K G;  4X1Y B;  1H2G A;  1GN3 A;  2HHH O;  1V55 C;  2X6A A;  2YI9 A;  2ZCE A;  4BAY A;  5J9P C;  5B3S C;  4BW9 A;  1G1X B;  1YJ9 V;  4JAS A;  2ZE7 A;  1VQ5 V;  4FFB A;  4X1K A;  1JCH A;  5HFL A;  4JI7 O;  1BL8 A;  3OM3 B;  4MTF A;  4W4L A;  2HJD A;  2XHB A;  5EZY A;  4IL6 Z;  2DWD C;  2RN9 A;  2Y4U A;  2CE4 A;  1Q6I A;  2QJ1 A;  3ZCC A;  3OEE G;  3AK1 A;  1ZWI C;  1GO3 F;  3OFN G;  2BTQ B;  1AB3 A;  4GX2 A;  4MW8 A;  1HNZ O;  5GW7 A;  4DR6 O;  2BSK B;  3AG3 C;  1QU7 A;  1Y4M A;  4DR2 O;  2A06 H;  1H8E G;  3K04 A;  1NU1 H;  5DED A;  1P84 F;  3G6E V;  1G4Y B;  3IGA C;  3OTF A;  3ZRW B;  3H1I H;  1KC8 W;  3K9A A;  4WFB V;  3B8N A;  3T2M A;  5IYB O;  3OR6 C;  3W7X A;  4J9Z B;  4CC5 A;  4LFB O;  4PHZ A;  4L8J A;  5FPR A;  1NKD A;  5LBQ A;  2QKA A;  1GRJ A;  3UM7 A;  4UV9 A;  2WLI B;  3OE7 G;  5LP6 B;  4DV2 B;  4UXN A;  1M5I A;  1O9G A;  1COW G;  2IH3 C;  4FM1 A;  4OPH A;  1VF5 B;  1IBM O;  4YJ3 A;  5LGN A;  3JAW A;  4GX1 A;  5BR8 B;  2LO1 A;  4LF6 B;  4UCR A;  2BE3 A;  2ITD C;  4KXR A;  4O4J B;  4UFZ A;  2Z5U A;  5FNV B;  3T1H O;  2AHZ A;  4JI3 B;  2FKX A;  4X62 B;  1F7Y A;  2L35 A;  4DR7 B;  2EIJ B;  5JQG B;  4LFC O;  2CUG A;  4OPA A;  1VQK V;  3OAA G;  4MVR A;  2F95 B;  2VQF B;  3K5L A;  1AR5 A;  1NT2 B;  1SRY A;  3NXS A;  3ZRS A;  1BSM A;  2Q6A A;  3AK3 A;  1IVS A;  4J11 A;  1Q3E A;  2HJF C;  2QWN B;  5DEC A;  4IHJ A;  1B6Q A;  1R3J C;  3RW0 A;  2PGG A;  1K5Q A;  4WFH A;  3K57 A;  4DR5 O;  2HG5 C;  1WAZ A;  2ZE6 A;  1XL6 A;  4JTD B;  1AI7 A;  2BTQ A;  2WLJ A;  2Q0O C;  3UO3 A;  1SQG A;  4OX9 O;  1JA8 A;  3SPC A;  4QIW F;  2M7W A;  5J2T B;  1FPO A;  2FB5 A;  3G71 V;  4B3M B;  5BZB A;  1Q8I A;  3K0G A;  3ZRW A;  5L3B A;  2UUA O;  2N04 A;  2YID A;  5B3S B;  1U97 A;  2WA3 A;  4GKJ O;  3JSN A;  3CRQ A;  3RT3 C;  4IT5 A;  2HHH B;  1M9N A;  2H3O A;  4X20 B;  2PTM A;  4FLT A;  3LDD A;  3VQW A;  5J2U B;  1BS3 A;  5FLX N;  1N34 O;  3KG2 A;  1FFX B;  3DTU B;  3D3Q A;  1N32 B;  3RYI B;  2FTK A;  1YF2 A;  4JI7 B;  1KP3 A;  1JPX A;  5CBF A;  3SYP A;  2ATK C;  1VQ6 V;  3S3W A;  1N0J A;  3ZMU A;  1YVW A;  5CBH A;  5H5N A;  3D8C A;  1RM1 B;  1US6 A;  5FNV A;  1SQF A;  3OW2 U;  4WCE V;  4TUY B;  3E35 A;  1FYJ A;  1E1R G;  2Q73 A;  2CGN A;  5JQG A;  1XNQ O;  1HNW O;  4GUN A;  5KHI A;  2KG7 B;  3EVK A;  3CXH F;  4B3T O;  3CCR V;  4J7Z A;  4JI0 B;  2E75 B;  4DR2 B;  3ETQ A;  4JI6 B;  3ASO B;  3GWO A;  4MVM A;  2WLL B;  1KBH A;  1VF7 A;  2LW7 A;  4QNH B;  1N33 B;  5D5P A;  1GM8 A;  1WLE A;  3CC4 V;  1WP8 A;  4FZ0 A;  1SES A;  1JX9 A;  4JAU A;  2DOS A;  4DYL A;  2P5O A;  2YC0 A;  4LFB B;  5IJ9 B;  3WG7 C;  4CS4 A;  2D2C B;  4KHP O;  4F6R A;  3D36 A;  4ZOL B;  3TJT A;  1W2B U;  4PI2 A;  2OYQ A;  2GTS A;  3CWB H;  2V7Q G;  5JVD B;  2HVJ C;  2P90 A;  1XNR B;  2RQ6 A;  5FL7 G;  3ZS8 C;  1XRE A;  1XHZ A;  1OCO B;  3SYA A;  3FX7 A;  4YIP A;  4O4I A;  3EHB B;  1FAF A;  4FLZ A;  1G6U A;  4DV1 O;  4I5S A;  1PM9 A;  1S3J A;  3BPZ A;  2DYR C;  2YI8 A;  4DO2 A;  1TA8 A;  1VQP V;  1VQ4 V;  2NN4 A;  2OWO A;  1VAR A;  2EZO A;  3FYI B;  4GKK O;  3BVO A;  4UVB A;  3FYE B;  5IWA O;  5E1A C;  2Z0A A;  5EIB D;  1K9M W;  5B1A B;  2XUM A;  5A9G A;  1WB7 A;  5LMN B;  4AI8 A;  4U3F H;  2R70 A;  2PI4 A;  1I08 A;  1S77 D;  4R6Z A;  2F4V O;  3U11 A;  1F4M A;  2XAJ A;  4AHC A;  2EIL C;  1ZTE A;  3IC7 A;  3KKY A;  3RYH B;  3GVM A;  4FLY A;  1MZF A;  1FFT B;  4LP8 A;  2CTW A;  2YEV B;  5IY5 C;  1AI4 A;  3CXC U;  3RBZ A;  4MVU A;  2YXH A;  1P49 A;  4J80 A;  4TWK A;  5EIB C;  4YJ2 A;  1FJG O;  2UXB O;  2MK3 A;  4FZ1 A;  4O2B A;  1LNQ A;  3TET A;  1M57 C;  4DR1 B;  2KG7 A;  5JWP A;  4L87 A;  3H1K H;  4P9O A;  3FD9 A;  2PYJ A;  1PPJ H;  4MTG A;  3DXR A;  2IM9 A;  4UVA A;  2AW9 A;  1S76 D;  4JYB A;  3U10 A;  3VQX A;  2CDY A;  2ZD9 A;  1BCC H;  4IYH A;  3SPJ A;  3UCS C;  2BTO A;  1QCE A;  2UXC O;  1FS0 G;  2ZE8 A;  1K3E A;  4EEQ A;  1XI1 A;  1AJQ A;  2ZIN A;  5JVD A;  5LGT A;  2O57 A;  1IBK B;  1PNM A;  1S5J A;  3OD4 A;  4BIZ A;  2JK5 C;  3W7W A;  4H0L B;  3B09 A;  5IYC O;  1RFY A;  1LUW A;  1RPO A;  4WFF A;  1Q86 W;  3ZX6 A;  3CD6 V;  1AJP A;  4I0X B;  2CH7 A;  4LH7 A;  1WA8 B;  3K06 A;  1GTO A;  1HNW B;  3N27 A;  4NTY A;  1OCC C;  2UXX A;  4BR6 A;  1Q6H A;  1EZJ A;  2W0F C;  2LJ2 A;  3RYC A;  3HR0 A;  1PD3 A;  5EYP B;  4DV2 O;  3CCE V;  1WNS A;  3G80 A;  1M56 B;  1XBL A;  3ABU A;  3KZI Z;  1Q81 W;  2IBZ H;  3ABM B;  4JGS A;  5LP6 C;  3LSU A;  2P4V A;  2DQ3 A;  3UQ8 A;  3APQ A;  3KCY A;  3HKD A;  4DV5 O;  4LF6 O;  4KHP B;  3MAQ A;  5LHH A;  3RWR D;  1DK1 A;  2RDC A;  4JI3 O;  3SDL A;  1R3I C;  1CEZ A;  3OGC C;  4X62 O;  4U3J B;  4DR7 O;  2DYR B;  4CH3 A;  1KKC A;  1NZ6 A;  3OUF A;  5JH7 B;  3CX5 F;  3C3T A;  4XDK A;  4YIO A;  4EFB A;  1T5E A;  5LYJ A;  4HZ3 A;  3P30 A;  1K92 A;  5KLV H;  1D2D A;  3HKE A;  2EJ7 A;  4LF5 B;  1PL4 A;  4OXS A;  3UT5 B;  3OEH G;  1JJO A;  3HKB A;  1Y66 A;  2H8P C;  1QVG U;  1Y74 A;  2P06 A;  2ZNJ A;  2OT5 A;  1ARO P;  1N0N A;  1HWY A;  1IX9 A;  3AG2 B;  3H01 A;  3QG5 A;  1H8H G;  3ETE A;  5IYD O;  2RCV A;  4MW3 A;  4H33 A;  3ZHV A;  1R6K A;  4IIJ A;  3ZRX A;  5A2Q N;  4BWA A;  2EBO A;  2ZDI C;  4B3M O;  1SF9 A;  1HR0 O;  1DGS A;  1CP9 A;  2DYS B;  2N05 A;  1AP5 A;  1K7D A;  1NI8 A;  3E8F A;  4WF9 V;  3J80 N;  4I50 B;  3MDS A;  1NH2 D;  2UXB B;  1WA8 A;  2DMX A;  1K4D C;  3CB2 A;  3N2G A;  4LH6 A;  1MMM A;  4JV5 B;  1NBM G;  4J7K A;  3ZN0 A;  2QSA A;  4H44 B;  3VOU A;  1VP7 A;  5EYP A;  2QWQ B;  1MOF A;  1RSO B;  1N32 O;  1WP7 A;  5GTI Z;  3R65 A;  1HDJ A;  3BAB A;  1K4C C;  3A0B Z;  3CMA V;  3QF7 A;  2WAM A;  3PJS K;  4LF7 O;  5CA0 B;  5CA3 A;  2IJJ A;  3K79 A;  5KMG B;  4I4T B;  2HKO A;  1FXV A;  1R3L C;  2Q7H A;  5EC2 C;  2UXC B;  3K03 A;  2IW5 A;  4MTX A;  5LL6 Y;  4LWS B;  3OUS A;  2YIA A;  1LR1 A;  4CZZ A;  4U3J A;  1QNM A;  1RM1 C;  3M7M X;  2AZ0 A;  4UCO A;  1PNK A;  1V54 B;  1GMG A;  1KEC A;  2IU3 A;  5H2F Z;  4JI0 O;  4JI6 O;  1Y76 B;  5B1B B;  1VQM V;  1SA0 B;  2E5L B;  1N33 O;  1ZLZ A;  3JD1 A;  1KQS U;  1QLE B;  2JDI G;  1OCC B;  1IXM A;  4BIO A;  1GM7 A;  3E8B A;  4PV1 B;  2BOB C;  4C7U A;  3BFR A;  3UT5 A;  3ASO C;  3ZN1 A;  1N8R W;  4B3R O;  3AG4 C;  1GKF A;  4B7K A;  1K8A W;  2F93 B;  1PL0 A;  2UXN A;  4PD4 F;  1M4U A;  4EB6 B;  1TGO A;  1XNR O;  5BY1 A;  4UCV A;  3E8H A;  4FM2 A;  5BXZ A;  1XMQ O;  1BQ0 A;  1JMK C;  1XIL A;  1SQB H;  5CA1 B;  1AVM A;  2CTR A;  2XAF A;  4DV5 B;  1OCO C;  4LF9 O;  4PA6 A;  2HFE C;  2OCH A;  4TSF G;  4I50 A;  4J7J A;  4X1Y A;  1VQ8 V;  1SC5 B;  3C90 A;  4PDV A;  3CE2 A;  3K59 A;  4MS2 A;  5JJN B;  4B3S O;  5KHH A;  5TIS Z;  1KU9 A;  1YJN V;  1SS3 A;  1QVF U;  2QDO A;  1Y67 A;  1L0L H;  4GZR B;  5LMN O;  4IGG A;  4PDR A;  2ZQM A;  3T4D A;  1WJZ A;  2CTP A;  5CA0 A;  1ORQ C;  4FIP C;  5B1A C;  3A0R A;  4I4T A;  3B2E E;  2LP7 A;  1J95 A;  4X1I B;  5DM6 V;  1VQO V;  1DLB A;  2UU9 O;  2Q7G A;  2X0L A;  1H2L A;  2A3Q A;  2M6Y A;  4UVC A;  3JAR B;  1V9P A;  3K5M A;  4JI4 B;  3JAT B;  3JAL B;  4TQF A;  4NVP A;  3LSS A;  1SZX A;  4O4L B;  4DRX B;  4G28 B;  4DR1 O;  4O4H B;  2BSK A;  2Q9L A;  2MW2 B;  1ZUQ A;  1GH6 A;  3ML0 A;  3LDE A;  1P7G A;  4RAI A;  4FLU A;  2YUA A;  2RJZ A;  1HR0 B;  3EFF K;  4GYC B;  3I55 V;  2GDS A;  1ROP A;  3HB3 B;  1I94 O;  4UUJ C;  5EC1 C;  2JS3 A;  2WLI A;  3DC5 A;  1NQT A;  4YXW G;  2H94 A;  5LP6 A;  2PF4 E;  3APO A;  4DV6 B;  1ZSP A;  1OJH A;  5CN0 A;  4F4L A;  1O9H A;  2JVD A;  1NH2 B;  5EBW C;  1MNG A;  1BHB A;  3ZHU A;  4MVO A;  5HFM A;  4LF8 B;  1IBK O;  2GUZ B;  3J81 N;  2UXD O;  4LF7 B;  5H6R A;  4PDL A;  3L71 H;  4YHH B;  1H38 A;  1W59 A;  2RMK B;  3GWK C;  3M99 B;  4GX0 A;  4MSW C;  4GLX A;  2B1I A;  5LXT B;  1K33 A;  4O4J A;  2X6B A;  3K5N A;  4DV4 O;  3SYO A;  3STL C;  1S5L Z;  2DJV A;  2GHY A;  3F7V C;  4KFM A;  2X7R B;  3SPI A;  1YTF B;  4E4E A;  2IU0 A;  2QKS A;  2R9I A;  3MHH C;  2QR4 A;  3QVN A;  3L72 H;  3E89 A;  3AG4 B;  1IZ3 A;  4LCU C;  1QLN A;  1ENV A;  4P30 A;  1L0N H;  2K1E A;  2LFR A;  4JYA B;  5C93 A;  4B3R B;  3JAR A;  1M56 C;  5DN6 G;  2CGO A;  4FLX A;  5L3E A;  2Q4P A;  3JAT A;  5KHG A;  4H13 B;  4DV3 B;  2OIE A;  3ZMT A;  2X6C A;  3ABM C;  3IC9 A;  2KKW A;  2ZDI A;  1FD9 A;  4QE9 A;  3ZHR A;  3F5W C;  2XAQ A;  4YY3 O;  5J2T A;  1XMQ B;  3OTO B;  5CBG A;  3B8M A;  2LGW A;  2ZNI A;  1DF5 A;  3ZIA G;  2P22 C;  4LF9 B;  4AQY B;  2A79 B;  4G27 B;  4DK1 A;  4LF5 O;  2EIM B;  3F5T A;  2DWE C;  4JI2 B;  1B04 A;  4X20 A;  4X8A A;  1NTZ H;  5J2U A;  1TUB B;  5LMU B;  4FVM A;  4B3S B;  4ZHQ B;  3E22 B;  4K0K O;  2JJ1 G;  4HNA B;  1FFX A;  1GN2 A;  2XT9 A;  4I55 B;  4WBN B;  3CP1 A;  2F23 A;  4RQF A;  3RYI A;  4X64 B;  1HNX O;  3JD4 A;  5H9C A;  4KUM A;  3CCU V;  2DE0 X;  4JYC A;  1QR9 A;  2GUZ A;  3B77 A;  4CS2 A;  1H2N A;  4LNU B;  2Q69 A;  3AG2 C;  4JPR A;  2WLK A;  5LXT A;  2UU9 B;  3JSL A;  4RQE A;  3L75 H;  4TUY A;  1VQL V;  4DUZ O;  4AIL C;  2ZR2 A;  4EFE A;  2HVK C;  3JAK B;  2ZXW B;  2EZP A;  4KP4 A;  4JV5 O;  4DV7 B;  2DYS C;  1G8M A;  1QHT A;  3ABT A;  2BCC H;  2LQT A;  1M1K W;  1AP6 A;  1CXZ B;  2WLL A;  1BT8 A;  3C3S A;  1J5E B;  2P7T C;  2W6J G;  4PA9 A;  2EUL A;  1KMI Z;  4TQD A;  4BW5 A;  1PP9 H;  4K8X A;  3RN4 A;  4WFE A;  1BHA A;  2RNB A;  4NYK A;  3L74 H;  2GBO A;  4TV9 B;  2VQE B;  3RFR A;  4Q6G A;  1HP8 A;  2ZM6 O;  5IJ9 A;  1I94 B;  4JI1 B;  1OZ0 A;  4ZOL A;  1NJI W;  3BHP A;  2A9H A;  1VQN V;  1IDS A;  1UPG A;  4K35 A;  3RYF B;  4NXN B;  2LW1 A;  5JJE B;  2OCC B;  3T4Z A;  1OCZ B;  3CCQ V;  4CS3 A;  1S5H C;  1BMF G;  5BMV B;  2UXD B;  4TOI A;  1SQX H;  3SPG A;  2C2A A;  2E5L O;  2FYU H;  2OIG A;  3SPH A;  1NS1 A;  3LNN A;  1V54 C;  1P4R A;  2QM4 A;  2ODM A;  5B5E Z;  2QKC A;  4ZI7 B;  3SR2 C;  4DV4 B;  5B1B C;  5LA6 B;  1TUB A;  4PA4 A;  5C8Y B;  3WB0 A;  4RUF A;  1QLE C;  2QTS A;  5L3C A;  4MT8 A;  2XAS A;  4I55 A;  5KUK A;  3M8A A;  4BIU A;  1EM1 A;  4PA3 A;  1MAB G;  2QM8 A;  3FB7 C;  2YS8 A;  4FK5 C;  1OV9 A;  5KX5 B;  4NR1 A;  4A5U B;  5B66 Z;  5E79 Z;  1IUR A;  3RGB A;  1JVM A;  3RYH A;  1QR8 A;  1X59 A;  3X2Q B;  5L3D A;  1QQC A;  2YEV A;  1FXH A;  3FB8 C;  4D7S A;  2JIZ G;  4DR4 O;  2B1G A;  4FFB B;  4X1K B;  2P4K A;  3H1L H;  5KUM A;  5CB4 B;  1VMG A;  1NVP B;  4Q20 A;  4PA7 A;  2ZIO A;  5GTH Z;  2DW4 A;  3K9S A;  4U7N A;  2JEU A;  4YY3 B;  1YZB A;  3U0Z A;  4ABM A;  2XTA A;  3CC2 V;  2ZIM A;  3LSQ A;  1JR9 A;  1XQ8 A;  4QPK A;  2R72 A;  1K5S A;  3P32 A;  3E8G A;  1FKA O;  3CYO A;  1XOU A;  5IYZ B;  4DK0 A;  4TV9 A;  2A7W A;  3FAV B;  4ZKI A;  1XUQ A;  1IXB A;  3SGI A;  2FML A;  3HPL C;  1F23 A;  4IYI A;  1OCR B;  2N74 A;  4RUE A;  4K0K B;  2EIK B;  2UUC O;  4JI4 O;  3CPW U;  4LBE C;  4QPJ A;  3THO A;  1Z5V A;  1HNX B;  1ZL8 B;  4HYO A;  2W0X A;  1BQZ A;  1YDX A;  1LUV A;  2Q67 A;  4WFA V;  1N36 O;  2ZKO A;  5GON B;  5BMV A;  1Z2G A;  2EX3 A;  3MD0 A;  4MVS A;  4J9Y B;  4JYY A;  4P9P A;  1YIT V;  1KUQ A;  1EFR G;  4LFA B;  3E2E A;  2ZE5 A;  4CBC A;  4ZI7 A;  1EN4 A;  1SZT A;  4DUZ B;  4I0X A;  2E76 B;  5L3G A;  1Z5W A;  1OHH G;  5LHI A;  1Q43 A;  1MZE A;  2KQX A;  1SER A;  3JAW B;  4DV6 O;  4NTW A;  2PI5 A;  1YI2 V;  2WPD G;  2Y0P A;  1EBO A;  3ZRV A;  2R9R B;  3VBB A;  1RP3 B;  2JS5 A;  4E2L A;  4LF8 O;  4EKW A;  4I9Q A;  1DTO A;  1N4C A;  1E1Q G;  2ZM6 B;  2IH1 C;  1XEQ A;  2KB1 A;  4YHH O;  5IE9 A;  3OMI B;  1YTF D;  1NR7 A;  3BA9 A;  3KCX A;  5EK0 A;  2QM7 A;  2NLJ C;  5CB4 A;  1VIB A;  5FPO A;  1GM9 A;  4DUY B;  4IHJ B;  4K8Z A;  3TXQ A;  5H6Q A;  5JH7 A;  3CRC A;  2Y69 B;  3SJB C;  1AI6 A;  2R9A A;  2B9Z A;  2AXT Z;  5JJJ B;  3HKC B;  3O9O A;  1XL4 A;  2ITC C;  3DSQ A;  3JCZ A;  5IYZ A;  2K9P A;  3JD2 A;  3FAV A;  4FFK A;  4ASU G;  2Q0A A;  1M93 A;  1K73 W;  2YSU B;  4R50 A;  5B1N A;  2IJK A;  3T1C A;  3GB7 C;  4R7C A;  4ICG A;  1KB9 F;  4JYA O;  1KKD A;  1A32 A;  1URF A;  4GX5 A;  3UKM A;  4TT3 G;  3CC7 V;  3AEI A;  2XOK G;  4Z2W A;  1JJ2 U;  2YXY A;  4DR3 B;  1R73 A;  4DV3 O;  1ZL8 A;  3W7S A;  1NR1 A;  4CH6 A;  3F7Y C;  2NR5 A;  5GON A;  1IBL B;  3CHX A;  2V4D A;  5EBM C;  3OTO O;  2AGA A;  3CRM A;  2VS0 A;  4LR3 A;  4XBF A;  1S72 V;  4AQY O;  1YXB A;  4DR4 B;  4Z1V A;  2BOC C;  5JCO C;  2WSS G;  1EZV H;  1FXK B;  1TAE A;  5B1O A;  3QO5 A;  4JI2 O;  1VF6 C;  3QTC A;  2YDE A; 
#chains in the Genus database with same CATH homology
 1US6 A;  2HJD A;  4NKG B;  1URF A;  2Q0O C;  1UPG A;  1CXZ B;  2RMK B;  4NB5 A;  4IGG A;  4DYL A;  1RFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...