5HFMA

Gp41-targeting hiv-1 fusion inhibitors with hook-like ile-asp-leu tail
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
77
Chain Sequence
AVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIGGRGGWEEWDKKIEEYTKKIEELIKKSQNQQIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein gp160,gp41 CHR region
publication title Rational improvement of gp41-targeting HIV-1 fusion inhibitors: an innovatively designed Ile-Asp-Leu tail with alternative conformations
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 77
sequence length 79
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5hfmA00
1QBZA 5HFLA 1QR9A 4JGSA 2EZOA 4FJCC 3B8NA 4JF3A 4N23A 5CN0A 4FK5C 3GWOA 2EBOA 1EBOA 4JPRA 4N21A 5CMUA 4FIPC 1K33A 1JQ0A 2LP7A 1DF4A 2M7WA 1I5YA 1Y4MA 1QCEA 2OT5A 3M99B 1MG1A 1K34A 2MK3A 3CP1A 1Y66A 3CYOA 1DLBA 3MHSC 3P30A 4G2KA 1SZTA 1F23A 5KA6A 3MHHC 2X7RB 1I5XA 3B8MA 1JPXA 3B77A 1DF5A 3H01A 1ENVA 1MOFA 2P6JA 5H9CA 3WFVA 4E2LA 3K9AA 2EZPA 5HFMA 5KA5A 1QR8A
chains in the Genus database with same CATH superfamily
1AI6A 2X6BA 4JAVA 2EIMB 4O2BB 2Y0PA 3ZMTA 3ETQA 3UM7A 1K4DC 2CTQA 2GUZA 1Q6IA 2ZCEA 2UXDB 5JQGB 3U11A 3SJAC 1THZA 4GX5A 3I55V 1MZEA 1XNRB 3ML0A 1F23A 1CXZB 1OHHG 1DF5A 3C3SA 3OD4A 3CEIA 1N34B 2W0XA 2IJIA 3FB6C 4IYHA 2PZSA 1P49A 2NN4A 4ZOLA 2EBOA 1WB7A 4RQEA 1NTKH 3AG7A 1Z5VA 3JYCA 3A2FA 2UXNA 2LGQA 2HFEC 3RT3C 1AR1B 2GTAA 2GUZB 4LFBB 2BSKA 2UXBO 2CK3G 1IX9A 1FXVA 4ZBMA 3NR7A 1CPYA 2DJVA 3SR2C 3B2EE 4RUEA 5L3CA 1AP6A 1YTFD 1FJGB 3ABMC 4EFBA 1R6KA 5IDJA 3LSUA 4JTDB 5LMNO 1YCIA 3DC6A 2Y69B 5GW7A 3KKYA 4X8AA 1BZKA 1KKCA 2RCVA 2ITCC 1HNZB 2UUBB 3CRCA 3CB2A 4TQDA 1SETA 1WB8A 4MTFA 3W7UA 3P30A 4JI6B 4QPKA 4LFAB 1VQKV 3L9DA 4FVMA 4JI5O 1B04A 3SPHA 1NQTA 3AG4B 4NTWA 2JGDB 2Q68A 3QO7A 2Q67A 2ZE5A 4WCEV 2HLDG 3JAWB 3P3PA 4B3MO 3JD3A 1NH2D 5IY5B 1AROP 1I94O 3ZCCA 4UCTA 1T5EA 4OPAA 2XAHA 2WA3A 4UCSA 1OCCB 2Q0OC 4LF7B 3L71H 4LF6B 2LQTA 3BFRA 1KMIZ 3ASNC 3VQWA 5J2UA 3J7AU 4GX2A 4FLWA 1MG1A 1WA8B 4EB6B 1IBLO 2CAZC 4X65O 5FNVA 1S0VA 1RM1C 3CSXA 3WFVA 4DR7B 1UJWB 2IM9A 4WFAV 1YVWA 3FD9A 1WAZA 5CA0A 2WLKA 3IJ4A 4N23A 2AW9A 1RSOB 1AJPA 5CMUA 2UUCO 4DW0A 1R3LC 1BE3H 4TV9A 2RDCA 1PM9A 1H2KA 2E5LB 4IL6Z 2KG7B 3M7MX 1HR0O 5JJJB 3MD0A 4PI2A 2O57A 3F5TA 3AK3A 4ABMA 4JZ2A 2ZE6A 5BR8O 1MABG 1KP2A 1VQLV 1V55C 5KA5A 5FL7G 2XAJA 1Y67A 4XDKA 3N2GA 1R73A 4BAYA 3SJBC 4YXWG 2Q7HA 4U3JA 4PJ0Z 3CYOA 3JAKA 2EJ7A 5GONA 1FPOA 4IHJA 3ZN1A 2HEPA 1KUQA 1M90W 5AG2A 4DXWA 2LW7A 2OTLV 1DTOA 3DC5A 1I7FA 3K57A 4MVSA 3R65A 3TGUH 2QKAA 4IGGA 3ZJZA 5H6QA 3I5DA 5H6RA 4B3MB 5LXTA 1FYJA 2Z3YA 2GHYA 3TJTA 4WBNB 1DLBA 4FLUA 2BE3A 1QU7A 1R1BA 2F95B 2Q8VA 3ZHTA 1ENVA 1GO3F 4U3JB 4LWSB 2PGGA 3ASOB 3AK1A 1WLEA 2WLNA 1H2LA 4DK1A 5L3GA 4DV3B 1VQMV 1M56C 5H2FZ 5IJ9A 4DUZO 1XUQA 3HKCB 2QM4A 1IBLB 1YF2A 3CP1A 3L73H 3BRCA 1Z2GA 3RYIA 1YXBA 4JYYA 2GTSA 3F5WC 1PKXA 3CD6V 1VQOV 3T2MA 4YJ3B 2YEVA 1SQXH 2QM7A 1XMOB 3VBBA 2PY5A 3SYCA 2UUCB 3QVNA 2Z0AA 1MNGA 3WB1A 1BSMA 2ODMA 1E1QG 2YIAA 4LH7A 4RAIA 4J7JA 1JX9A 2PYLA 2CGOA 4O4IA 1OCZC 3FB8C 3RYIB 2ADQB 2M6YA 3HB3B 1J95A 4JZGA 4JF3A 4MW3A 1HR0B 4KFMA 4X9QA 1I0HA 2QTSA 4KUMA 3RYHA 2HKOA 5FPOA 2DMXA 2HVJC 3CHXA 1N36B 3O65A 5BR8B 4J10A 5EYPB 2WA4A 2H3OA 3E2EA 3K5MA 2P7TC 1IURA 5B1AC 4I50A 4FJCC 4O4IB 3H1HH 2L35A 4YJ2A 1M4UA 3WB0A 5CB4A 1VF6A 3CCRV 2WLIB 4X20A 3ETEA 4B3RB 4UB8Z 3C90A 3AG3B 1VF6C 2EILC 2JK5C 4UCVA 2GV9A 5IYZA 4ASUG 1IXMA 4NVPA 2QTOA 4P9PA 2JDIG 3E8FA 2A0LA 1W0KG 3LNMB 3EXAA 4X66O 5IE9A 4DV4O 3HKBA 5C8YB 1Y74A 1VIBA 3RYCA 2ZDIA 3CMAV 3OMIB 1Q8IA 2ZDIC 3ABLC 2F23A 5B1BC 2JVDA 1XNQO 1RP3B 3DTUB 5CB4B 3ZRSA 4BIOA 3FAVB 2JEUA 4UCOA 4I9WA 4XDLA 4HNAB 3R66A 2K9PA 3B8NA 1ORQC 5LA6A 1VP7A 4O4JA 4YY3O 5IYDO 3ETDA 1GTOA 2X0LA 2BTOA 1EFRG 4UB6Z 1IBKO 3OGIB 5LP6A 1H2NA 1XDCA 2WLLB 1FKAO 4LC1A 5LP6C 3L75H 1SQQH 3ZBHA 2Y48A 5B3SB 3BHPA 1GN4A 1JOYA 1HNWO 3ZRVA 3D36A 3DSQA 2LGWA 1JJOA 3D36C 3CXCU 1Y76B 3W7WA 4LBEC 3RN4A 3SYOA 3JALA 2P5OA 3AK2A 4CH4A 1Y66A 4OPHA 1GN2A 4JTCB 1DK1A 4J42A 3CE2A 4Q6GA 1MMMA 4FLZA 2EZPA 2HHHO 3CC2V 2UXCB 4OXSA 3OUSA 5B1NA 1NR7A 1ZX3A 4I4TB 3D8CA 2F4VO 1GN3A 1Q81W 3TK1A 3CC7V 4B7KA 1K97A 3ZHQA 2AHYA 4J80A 4PDLA 4E2LA 4JI0O 4X1IB 1SA0B 2PTMA 4X64O 4OX9B 3EFFK 1EBOA 3SDLA 5JH7B 1HDJA 1D2DA 2VWKA 4UV9A 4DV1O 1QVFU 1TUBA 3QO8A 1A32A 5H5NA 3FB7C 3SPJA 3B4SA 1N33O 1NBMG 4TUYA 5KX5B 4X66B 1K9MW 2OCCC 1NR1A 3JD2A 2JGUA 3ABTA 5BZBA 4F4LA 4N21A 3OTFA 4X1YA 1DGSA 3IGAC 4FLVA 4L8JA 1FFXA 3K9SA 3VOUA 5ITZB 4F6RB 4Z1VA 2ZXWB 2BOBC 4JI3O 3BVOA 2BTQA 2R9RB 3WB2A 1ZSPA 4O2AA 1K3EA 3HKEA 4MVQA 3PJSK 3GVMA 2Q73A 2XASA 1IBMB 2W6JG 5BMVB 5EC1C 1XI1A 4PHZA 3CCJV 4PA6A 5IT9N 4X1YB 1QNMA 4DO2A 3K04A 4DR3B 4TSFG 5LHGA 2IBZH 2AXTZ 5LMUO 4NXMO 1OCOB 2OCHA 4FIPC 2Q5ZA 5LYJA 1M93A 3KCXA 3OTOB 4JAUA 5J2TA 2EINC 4J11A 4DV7O 1GRJA 4GKKO 2XT9A 4W4LA 4JI7O 3A0RA 1K73W 3RYFA 1R3JC 4TWKA 2Q6AA 5EBLC 1XMQB 2WLMA 4UV8A 3K0DA 4ZKIA 3CC4V 3LUTB 1F51A 1PL0A 2VS0A 1CEZA 2K1EA 3OW2U 4AI8A 3RFRA 2VQFO 2N05A 2DYSC 2ITDC 2AZ0A 3CRRA 5H9CA 1K92A 3K9AA 1H38A 1RFYA 1SS3A 4JGSA 2N04A 4X64B 4GKJB 4UUJC 1EN6A 3CS5A 3H1KH 4UCRA 4MW8A 4WFHA 2CH7A 3E22A 4DV1B 4DV0O 1WN7A 2ZIMA 2E76B 1AILA 4ICGA 5EIBC 1G6UA 4GCZA 4NB5A 4DV6B 5L3DA 1D5NA 1OV9A 3A0BZ 3E89A 1QR9A 2GSMB 3SPCA 3K0GA 4MTGA 4I55A 1SZXA 1XBLA 2VQEO 2MK3A 4FLXA 4ZOLB 4JI3B 1BQ0A 2CH7B 1EZJA 3OMNB 5KMGA 3P3NA 2QR4A 4ZHQA 3DGEA 4BW5A 3L72H 2G38A 2PF4E 3JATA 2BSKB 1XQ8A 3ABMB 3OEHG 4H13B 4K0KO 3K3WA 1L0LH 2QGNA 1P7BA 2QM8A 4Z1MG 3LDDA 5D5QA 4UCUA 3ZMZA 3ICXA 5LGNA 3OT7A 1SQGA 4LF5O 1TGOA 3JD4A 2ZNIA 3AG2C 1XOUA 1NVPB 2NLJC 3F7YC 2AHZA 3OR7C 4WF9V 2N74A 2IW5A 2ILMA 3E8HA 3CMEV 4NXNO 3Q4HA 4JASA 4GUNA 4DV7B 1ZUQA 1PL4A 1K34A 2Y0IA 4GKKB 4KP4A 5KA6A 1VF7A 1ROPA 2ZNJA 2P6JA 5LOVA 3G71V 3ZS8C 2UXBB 1Z5WA 3WG7C 1K7DA 3G6EV 3I56V 2DQ3A 4LF8O 1EM1A 3OR6C 3VQXA 1N32O 2LW1A 4LP8A 4JI2O 1GMGA 2VQFB 3ASNB 3RW0A 3JCUZ 1YJWV 1KC8W 3MDSA 1H2SB 4DK0A 5J2UB 4NKGB 1FD9A 2E3CA 1RM1B 3OMAB 3FKSG 5FNVB 1XL4A 5LOVB 2CTRA 1H2MA 3X2QB 2QKSA 2Z5UA 3QNEA 2Y4TA 3BA8A 5BXZA 4DV0B 2UU9O 4YIOA 4QPJA 5CA0B 4ZI7A 4YHHO 5J9PC 1WP7A 1JR9A 5EC2C 3C3TA 2A06H 4DR6O 4FPPA 4TV9B 2PYJA 1P4RA 2XUMA 4U7OA 3OUFA 5LMNB 1S5JA 4MS2A 2ZIOA 4U3FH 2X6AA 1Q82W 4RQFA 3B09A 1Y4MA 2DN9A 5LL6Y 2DWEC 3N2KA 3K06A 4JI5B 4R50A 3KG2A 5HFMA 4K3AA 4WFBV 4B3SO 2YIBA 1MSWD 2ZM6O 1YEWA 1V55B 1AR5A 3UQ8A 1OCRC 4KXRA 1AJNA 3K5LA 3BAAA 3JD0A 4H44B 3M99B 3N2GB 1I94B 4BIUA 4LNUA 1M57C 2YICA 1WPXA 3G6BA 4LF5B 1KKDA 1ZWIC 3L70H 3JAKB 2DQ0A 3N2KB 3KZIZ 5GONB 2YI9A 1FXKA 4IHJB 1Q7YW 1NS1A 2F66C 1NTZH 4NXNB 1FXKC 1P7GA 5LBQA 4LR3A 3T4DA 4O4HA 4I9QA 4XBFA 3SYAA 2DWDC 4X65B 4DR2O 3SPIA 2XOKG 1SQBH 1XHXA 1NKDA 4I0XA 5LXTB 3APOA 4P30A 4IIJA 3SJQC 5KUKA 2OWOA 3CCEV 2PUSA 4X1KA 5B66Z 1BHBA 1QLNA 4QIWF 3STLC 1N32B 2RMKB 2X6CA 4JI2B 1OJHA 5EBMC 1M56B 1V54C 4O4LA 4PD4F 2OT5A 5IYCO 4B3TO 1PNKA 4FM1A 2YXYA 2W0FC 5IJ9B 4H37A 3U10A 4HAMA 1KBHA 3AEIA 1G1XB 4R7CA 4I0XB 1QHTA 1EN5A 1IZ3A 4NTXA 2R72A 2EIKB 4U7NA 4JYBA 4MVUA 3E86A 4UXNA 2QA4V 2WWWA 2YEVB 4JTAB 2XAGA 1LNQA 1JCHA 1N0JA 1K5QA 1U96A 4WFGA 3FFQA 3SYQA 4K35A 3CWBH 4DR6B 4X88A 3JARA 1ZAUA 1O9HA 1VQPV 1AJQA 1OCZB 3U0ZA 4CS3A 1N8RW 3A0HZ 3HKDA 2OIEA 1B3QA 2LO1A 3TCUA 4R8CA 3P32A 2ADPA 2IJKA 5F2VO 3RYHB 4B3SB 3A8TA 5B1AB 3O9OA 1O9GA 2DE0X 1NVPD 2OYQA 2QDOA 3DXRA 2ZINA 2IJJA 3CCQV 3E35A 4I50B 2IU0A 1I5YA 2NR5A 2BOCC 4YJ2B 3W7SA 5DEDA 3T1HO 2EILB 5KAIZ 2ETNA 4X20B 4DV2O 5IYZB 1GK9A 2Q69A 4CC5A 2VRZA 2IH3C 4TOIA 4DUZB 1BGYH 1ZLZA 3SGIA 3HKBB 1Y74B 3RYCB 3ABLB 4X62O 5IWAO 3QF7A 2Q0AA 5B1BB 5L3FA 2FMLA 5IYBO 4GLXA 4ZIBA 2HJDA 1TVKA 1W59A 1SF9A 4FFBA 1R6NA 2P4VA 1JMKC 1HNXO 3T1CA 4TV8A 2XAFA 2GDSA 4J9ZB 1LUWA 2LP7A 4XDJA 1BL8A 5LA6B 2AZ2A 4O4JB 1JVMA 3CRMA 4DR4O 5K1PA 2ZR3A 4KHPO 2H94A 3ETGA 5LP6B 1GN6A 1QVGU 4AQYO 4JYAO 2JEXA 1I08A 1IXBA 2CE4A 4FZ1A 5CA1A 2QWOB 1BT8A 1FAFA 4HYOA 1YSCA 3GWKC 1L0NH 3JASA 1W0JG 5GTIZ 2ZE7A 2LFRA 4PA7A 2XAQA 4HBNA 2RQ6A 2JIZG 4OGQB 3JALB 3JD1A 1KQSU 4DRXA 3CX5F 4KL1A 1L8DA 1BMFG 3ZHUA 4DYLA 2WPDG 4CH6A 3IAYA 3AG1C 4NR1A 3B40A 3LDEA 1Q86W 1J5EO 3THOA 1K4CC 1XNRO 3RVYA 5EZYA 4K8ZA 4GX1A 1PD3A 3APQA 3JSNA 1ZL8A 4JI8O 2KSDA 2CUGA 2EJRA 4MVRA 1BCCH 4DV4B 1JJ2U 1SERA 3ZRWA 1N34O 2YS8A 3JCZA 5K1XA 2HJFC 4PA3A 1VQ6V 1HW7A 1XNQB 1WPBA 2EIJC 1PNLA 3CXHF 4BWAA 3H1JH 5JVDA 1BQZA 4DV2B 1QLEC 1VQ9V 5KAFZ 4D6TH 2FL4A 1TUBB 3ABUA 5IJ0A 1VMGA 2R9AA 4CBCA 2B9ZA 1SQPH 1S5LZ 2OCCB 3H1IH 4TUYB 4YY3B 1H8HG 3OAAG 2B1GA 3NXSA 2B1IA 1IBKB 3BABA 3PN1A 3FB5C 1UPGA 2ARHA 1HNZO 2KQXA 2A9HA 4FLTA 1YJNV 2V4DA 3ZHVA 1FFTB 3G4SV 1HNWB 1JFFA 1FFXB 2D3OW 4AHCA 1HNXB 3QO5A 3ABKB 1KB9F 2F93B 1TUEB 5HFLA 3H9VA 2BTQB 3E8BA 4CH3A 2PI4A 4QNHB 1AR4A 3ZRXA 4L87A 3SYPA 4O2AB 3HKEB 4JI4O 1QCEA 5DM6V 2VWJA 4LH6A 4KHPB 1JA8A 2YXLA 3CCMV 2P90A 1YHQV 3K03A 4O2BA 1S77D 4J7KA 1S5HC 3OGCC 4DUYO 2HHHB 2EIMC 4BW9A 5JQGA 2DYRB 1BS3A 5FPRA 2L6LA 2WSSG 1KD1W 3CCUV 1XREA 2QWPB 4LF7O 4LF6O 2FB5A 2F4VB 1GH6A 1Q3EA 3BEHA 4UVAA 3CRAA 2A7WA 2EINB 2R9IA 5LYJB 4JI0B 2CGNA 4UVBA 4DR7O 5J2TB 1TAEA 2E74B 4MTOA 3G67A 2OTJV 1US6A 1VARA 3RYFB 1S3JA 3UO3A 1J5EB 3HR0A 4FFKA 2F43G 1SRYA 2JS3A 4PI0A 2WLJA 4HZ3A 3TXSA 3K5NA 1N33B 2DYSB 4JI8B 2QWNB 2R70A 1IVSA 5B1OA 4QGPA 3E8GA 2Y69C 1E1RG 2JJ2G 4DV5O 1GAXA 2E5LO 1Y6XA 2B5UA 5JCOA 2YSUB 1K8AW 1W2BU 1Q90D 1GM8A 1XEQA 1S76D 5JCOC 5LGTA 1FXHA 2F1MA 4TQFA 2JGDA 1N0NA 3E22B 3RGBA 3AG4C 3SPGA 1FS0G 1EZVH 3JAWA 3K08A 3SJCC 2CTWA 3ZN0A 4JV5O 3F7VC 2MW2B 2Y4UA 5IY5C 2XHBA 3L74H 2XNDG 4I55B 4H33A 2H8PC 2NNUA 1OCCC 2KB1A 1B06A 5LMUB 5JWPA 4NXMB 3BCCH 1IDSA 5KMGB 2YXHA 1WA8A 4EB6A 4ZHQB 4DW1A 4EFEA 1GM9A 1P84F 3BA9A 1KU9A 5KHHA 3JATB 4JI4B 4D7SA 5LHIA 4JI7B 2QEXV 1JPXA 4J7ZA 4DUYB 1H2GA 1TA8A 1QQCA 3T4ZA 1RSOA 3MAQA 1E79G 4F6EA 2PI5A 2HR3A 1WP8A 2CDYA 3AG2B 5A9GA 4QJFB 1EN4A 2IU3A 4DV3O 2HVKC 3OFNG 3UT5A 3JAMN 1HWYA 2M7WA 4LF4O 3ZMSA 2OIGA 1KYOF 3MHSC 3Q4HB 1RPRA 2EULA 4CZZA 2Q7EA 2KG7A 1URFA 4D7TA 2C2AA 1F4MA 5GTHZ 3S3WA 1NZ6A 3X2QC 1XMOO 3WG7B 4AILC 1LUVA 3BPZA 1XILA 3UT5B 5CBHA 1I5XA 1SC5B 5KHJA 5A2QN 3H01A 2RN9A 2FTKA 2QE7G 4J41A 1AI7A 1MSDA 1LR1A 3CRQA 4DV5B 2QJ1A 1R3IC 4PDVA 5DECA 4P2ZA 1AB3A 4JPRA 2QSAA 4CC6A 3E83A 5EBWC 4FMTA 2VQEB 3ZMVA 4LFCO 2ATKC 3ZIAG 1VEWA 1N36O 1YITV 2IJHA 4ZI7B 5JJNB 2YC0A 1QBZA 3T1YO 4JV5B 4K0KB 4MVOA 4WBNA 2FYUH 5L3BA 4RO2A 1JQ0A 1G8MA 2ZQMA 5TISZ 2ZKOA 4B3RO 4LWSA 4PA4A 3GB7C 2ZR2A 4B08A 3ASOC 1WNSA 5CBFA 4QE9A 2P06A 3HKCA 3CPWU 1K5SA 3KCYA 4MVZA 1MZFA 3OM3B 1NU1H 1OCRB 1NT2B 5KLVH 1G4YB 1Q5OA 5CBGA 3N27A 2CTPA 2P22C 4YJ3A 3FYEB 1NJIW 2Q7GA 1M57B 1GM7A 4NYKA 4LNUB 4I5SA 3QTCA 3M8AA 3RWRD 3IFXA 4LF8B 1COWG 2DOSA 2EX3A 1YZBA 3IC7A 1FXKB 2W6IG 3TXQA 4LF4B 1VQ7V 5D5PA 4UVCA 3CJHA 2A79B 1F4NA 4BIZA 2ZE8A 4IT5A 4O4HB 1L1FA 3CCLV 3H1LH 1SQVH 2EIKC 3LDCA 4NTYA 5C93A 1Q6UA 4PV1B 4IIJB 4X1KB 1K33A 2UU9B 5EYPA 4CS2A 4B7EA 1ZTEA 4PDMA 4YHHB 1V54B 4UFZA 3BY6A 1V9PA 4PELA 3J81N 2D2CB 4O4LB 3CJHB 5KUMA 1MOFA 4FM0A 4YIPA 5EIBD 4P9OA 5L3EA 2WLIA 2QWQB 2UXCO 4LF9O 4I7ZB 4CS4A 4JAAA 1MA1A 3AG3C 2ZD9A 4LFCB 2XTAA 3UCSC 5LHHA 1CP9A 1SZTA 2JS5A 1PV0A 4EEQA 5C8YA 3B77A 4DR5O 3IC9A 2ZM6B 3T1YB 3TETA 3GWOA 4OX9O 3JARB 1R6TA 1GKFA 3FAVA 5E79Z 3CCSV 4HNAA 1M5IA 3HKDB 3LNNA 3MHHC 2LFSA 4PA9A 1M1KW 2HG5C 3VQVA 1PP9H 1VQ5V 4G27B 1N4CA 3WU2Z 1QR8A 2JJ1G 2EZOA 1U97A 2P4KA 2WLLA 3UKMA 4W4KA 3K59A 4FLYA 1AI5A 2GBOA 1VQ4V 1PNMA 4MT8A 3CCVV 2QWRB 4DR2B 3DXRB 1B6QA 2WLHA 5B3SC 4TT3G 2X7RB 1YTFB 5JJEB 4IYIA 1AI4A 1Y76A 1M9NA 3ZX6A 4BR6A 4Q20A 3ZHRA 5CN0A 3FYIB 1IBMO 1Q43A 1BHAA 4JI1O 2Q4PA 2YDEA 4B3TB 3W7XA 4CH5A 1S72V 4WFEA 3K5OA 4DR3O 4FM2A 4QE7A 4I4TA 1VQNV 2A3QA 1KECA 2FKXA 2JRIA 1HP8A 1H8EG 4FZ0A 4X89A 5KHGA 4FK5C 3VQYA 1TVKB 4WFFA 4RUFA 4FFBB 3LSSA 1AVMA 4A5UB 1VF5B 4DR1O 4TV8B 4GT1A 1NH2B 5KHIA 3S3XA 5EK0A 4X1IA 1KP3A 1SA0A 3D3IA 3OTOO 5CA3A 1YJ9V 2UUAO 4G2KA 5LGUA 2E75B 3LSQA 1R3KC 4G28B 5JH7A 4LF9B 1SKVA 3OE7G 2YIDA 1XMQO 1YIJV 5FLXN 5B5EZ 5CA1B 1NI8A 1DF4A 2UXDO 5KX5A 1X4TA 3D3QA 2V1DA 5DN6G 3RVZA 3JASB 5KHKA 4DR5B 1UFIA 3B8MA 2YUAA 2QKCA 4R6ZA 1SQFA 1X59A 4MVMA 4GKJO 5ITZA 4MSWC 4F6RA 1YI2V 2BCCH 1OZ0A 4DRXB 3ZHSA 2IH1C 1PPJH 3AG1B 2ZXWC 2YIBD 2WAMA 3UO2A 2AGAA 3T1HB 3W7TA 4LFBO 4Z2WA 1NTMH 4DV6O 4H0LB 5EZYB 5BMVA 5E1AC 2HP8A 1FJGO 3J80N 1ZL8B 2DW4A 2RNBA 1F7YA 3ZRWB 4X62B 2YI8A 3QG5A 5IWAB 2UUBO 2ZT9B 4EKWA 2EIJB 4JI6O 4LFAO 3ABKC 4GZRB 4K8XA 1OCOC 1QLEB 3G80A 5JVDB 4GX0A 2Q9LA 2UXXA 1RPOA 3STZC 1XHZA 4JI1B 2V7QG 5IJ0B 1WJZA 4JYCA 4E4EA 4J9YB 3HPLC 4DR4B 1SESA 3EVKA 4LCUC 4RWUA 1D5AA 4GYCB 1YDXA 2DYRC 4AQYB 4JYAB 4PDRA 3K58A 3EHBB 2LJ2A 1JFFB 1Q6HA 4DR1B 2RJZA 2KKWA 1AP5A 2UUAB 3OEEG 1XL6A 1VQ8V 3RBZA 3JSLA 4MTXA 4C7UA 3K79A 5BY1A 3ZEDA 2P67A 3FX7A 3ZMUA
chains in the Genus database with same CATH topology
1AI6A 3X2QC 4R7CA 2X6BA 4JAVA 2EIMB 4OXSA 3OUSA 5B1NA 3ZMTA 2EIKB 3UM7A 1NR7A 1K4DC 4U7NA 4JYBA 3WG7B 4MVUA 3E86A 4UXNA 2QA4V 2WWWA 2YEVB 1THZA 4GX5A 4JTAB 3TK1A 1Q81W 2XAGA 3I55V 1LNQA 1JCHA 3ML0A 1K5QA 3CC7V 5CBHA 1K97A 1F23A 4WFGA 3SYQA 1I5XA 1OHHG 3H01A 1DF5A 2AHYA 2FTKA 4PDLA 4X88A 4E2LA 2QE7G 1AI7A 1VQPV 1AJQA 1OCZB 1R3IC 2IJIA 4PDVA 1N8RW 3FB6C 4P2ZA 3EFFK 2EBOA 1EBOA 4JPRA 4RQEA 3JYCA 2UXNA 3E83A 2HFEC 4FMTA 5EBWC 1AR1B 3ZMVA 3TCUA 4UV9A 2ATKC 1QVFU 4R8CA 3QO8A 3ZIAG 3P32A 1YITV 2CK3G 3FB7C 1FXVA 4ZBMA 3SPJA 1CPYA 2IJKA 1NBMG 2IJHA 4RUEA 5L3CA 1K9MW 1YTFD 2OCCC 3ABMC 1QBZA 1R6KA 5IDJA 4JTDB 1NR1A 3JD2A 5B1AB 3ABTA 2Y69B 1NVPD 4MVOA 5GW7A 4F4LA 5BZBA 5L3BA 4N21A 2IJJA 3IGAC 3CCQV 4RO2A 4X8AA 1JQ0A 3E35A 1G8MA 2IU0A 1I5YA 2ZQMA 2ITCC 3VOUA 2BOCC 1SETA 4MTFA 4PA4A 3W7UA 3GB7C 3P30A 3W7SA 2ZXWB 4QPKA 2BOBC 2EILB 1VQKV 2ZR2A 2R9RB 3ASOC 5CBFA 4QE9A 3SPHA 1NQTA 1GK9A 3AG4B 2Q69A 3CPWU 1K3EA 1K5SA 4MVZA 4MVQA 3PJSK 2Q68A 3QO7A 2XASA 2IH3C 2Q67A 3OM3B 2W6JG 1OCRB 4WCEV 2HLDG 1G4YB 5CBGA 5EC1C 3ABLB 3JD3A 3CCJV 4PA6A 5B1BB 1NH2D 5L3FA 5IY5B 1AROP 3ZCCA 4DO2A 3FYEB 3K04A 5IYBO 1NJIW 4TSFG 5LHGA 1M57B 1GM7A 2XAHA 1R6NA 4I5SA 1OCCB 3T1CA 1OCOB 2XAFA 4J9ZB 3IFXA 1COWG 4FIPC 3ASNC 3IC7A 2LP7A 1FXKB 2W6IG 4XDJA 1BL8A 1VQ7V 4UVCA 4GX2A 1MG1A 1JVMA 2A79B 4JAUA 1F4NA 2EINC 4BIZA 2ZR3A 2H94A 1S0VA 3ETGA 3A0RA 1L1FA 3CCLV 1RM1C 1K73W 1QVGU 3WFVA 1R3JC 1UJWB 4TWKA 2EIKC 2JEXA 3LDCA 4WFAV 2Q6AA 5C93A 5EBLC 2WLKA 2WLMA 4N23A 4UV8A 4HYOA 3K0DA 1YSCA 4ZKIA 3LUTB 1F51A 3CC4V 1AJPA 1PL0A 5CMUA 1W0JG 1CEZA 1K33A 2K1EA 3OW2U 2LFRA 4PA7A 2XAQA 1R3LC 4PDMA 1V54B 2DYSC 3BY6A 4PELA 2ITDC 2JIZG 5KUMA 1MOFA 5H9CA 1K92A 3K9AA 3JD1A 1KQSU 1H38A 4P9OA 5L3EA 2WLIA 4JGSA 4UUJC 1BMFG 2WPDG 3AG1C 3LDEA 3MD0A 4MW8A 1Q86W 4WFHA 3AG3C 2ZD9A 1K4CC 5LHHA 3RVYA 1CP9A 1SZTA 4GCZA 4GX1A 1PD3A 3B77A 1MABG 1KP2A 1VQLV 5L3DA 1V55C 2EJRA 4MVRA 5KA5A 3TETA 3E89A 5FL7G 1JJ2U 1QR9A 1SERA 2XAJA 3ZRWA 3JCZA 4XDKA 2HJFC 2GSMB 1R73A 3SPCA 4BAYA 3GWOA 3K0GA 4MTGA 4PA3A 4YXWG 1VQ6V 1GKFA 3CCSV 2EIJC 2MK3A 1PNLA 3CYOA 3ZN1A 3MHHC 2LFSA 1M90W 3OMNB 4DXWA 1QLEC 4PA9A 1VQ9V 2OTLV 1DTOA 3DGEA 4BW5A 1M1KW 2HG5C 1VQ5V 4G27B 3ABUA 1QR8A 4CBCA 2JJ1G 2EZOA 4MVSA 3R65A 2OCCB 2WLLA 3UKMA 3ABMB 3OEHG 1H8HG 3OAAG 3ZJZA 2B1GA 3K3WA 3NXSA 5H6QA 2B1IA 1AI5A 1P7BA 2QM8A 5H6RA 1VQ4V 3FB5C 1PNMA 4Z1MG 4MT8A 3CCVV 3LDDA 2Z3YA 2GHYA 2A9HA 3ZMZA 1DLBA 1B6QA 2WLHA 5B3SC 1YJNV 5LGNA 4TT3G 2X7RB 1YTFB 1FFTB 3G4SV 1ENVA 1GO3F 3JD4A 2D3OW 1AI4A 3AG2C 3QO5A 3ASOB 3ABKB 1M9NA 1TUEB 1WLEA 2WLNA 5HFLA 1NVPB 2NLJC 3F7YC 2AHZA 3OR7C 3E8BA 4Q20A 5L3GA 1VQMV 4QNHB 5CN0A 4WF9V 2PI4A 3ZRXA 3FYIB 2IW5A 1M56C 3CMEV 3E8HA 4L87A 3SYPA 1BHAA 4JASA 1QCEA 5DM6V 3W7XA 1K34A 3CP1A 3CCMV 2P90A 4KP4A 5KA6A 3K03A 1YHQV 1S72V 1S77D 4WFEA 3F5WC 1ROPA 1S5HC 3OGCC 1PKXA 3CD6V 2P6JA 4QE7A 3G71V 1VQOV 3T2MA 2EIMC 1VQNV 1KECA 2DYRB 2YEVA 2WSSG 3WG7C 1KD1W 1K7DA 3G6EV 3CCUV 2QM7A 1H8EG 3I56V 4X89A 4FK5C 2DQ3A 4WFFA 3OR6C 4RUFA 3VBBA 3LSSA 3SYCA 4LP8A 1GMGA 1NH2B 4GT1A 3ASNB 3RW0A 5EK0A 1E1QG 1KP3A 3BEHA 3D3IA 4UVAA 5CA3A 1YJ9V 1YJWV 4G2KA 5LGUA 1KC8W 4RAIA 2EINB 2R9IA 3LSQA 1JX9A 1R3KC 4UVBA 1OCZC 3FB8C 4G28B 4MTOA 1RM1B 3OMAB 3FKSG 3HB3B 1J95A 1XL4A 2OTJV 3OE7G 4JF3A 4MW3A 3X2QB 2QKSA 1YIJV 2Z5UA 1S3JA 3QNEA 4KFMA 1DF4A 4KUMA 4QPJA 2F43G 2HKOA 1SRYA 2V1DA 5DN6G 3RVZA 2WLJA 5J9PC 4HZ3A 2HVJC 3B8MA 2DYSB 5EC2C 3E2EA 5B1OA 4FPPA 2P7TC 4R6ZA 1P4RA 5B1AC 3E8GA 4U7OA 2Y69C 4FJCC 3OUFA 1E1RG 2JJ2G 4MVMA 2B5UA 4MS2A 4MSWC 1YI2V 1OZ0A 2X6AA 2YSUB 3CCRV 1Q82W 4RQFA 1K8AW 1W2BU 2WLIB 1S76D 1GM8A 2IH1C 3AG1B 1Y4MA 3ETEA 2ZXWC 5LGTA 2DWEC 2WAMA 1FXHA 2EILC 2JK5C 3AG3B 4ASUG 3W7TA 1IXMA 3K06A 4R50A 2QTOA 4P9PA 2JDIG 3E8FA 2A0LA 3AG4C 3KG2A 1W0KG 5HFMA 3SPGA 1FS0G 3LNMB 4WFBV 1MSWD 5E1AC 1V55B 1OCRC 3K08A 2ZDIA 1AJNA 3CMAV 3ZN0A 3OMIB 2DW4A 3F7VC 2ZDIC 3ABLC 3JD0A 3ZRWB 5B1BC 5IY5C 3DTUB 3M99B 4BIUA 2XNDG 3ZRSA 4EKWA 1M57C 2EIJB 1WPXA 3ABKC 4H33A 2H8PC 2JEUA 1KKDA 4I9WA 4XDLA 1ZWIC 2NNUA 1OCCC 1OCOC 1QLEB 2KB1A 2DQ0A 1FXKA 1Q7YW 4GX0A 3B8NA 1ORQC 2UXXA 1RPOA 3STZC 5IYDO 1FXKC 1GM9A 3ETDA 1GTOA 2X0LA 5LBQA 3T4DA 2V7QG 1EFRG 4JYCA 2WLLB 4XBFA 4J9YB 5LHIA 3HPLC 4LC1A 3SYAA 2DWDC 1SESA 3SPIA 2XOKG 1NKDA 4LCUC 2QEXV 1JPXA 2Y48A 1H2GA 5B3SB 1JOYA 2DYRC 4P30A 5KUKA 3SJQC 3T4ZA 3ZRVA 4PDRA 1E79G 2PI5A 3CCEV 2HR3A 3D36A 1BHBA 3AG2B 3EHBB 4QIWF 1QLNA 4QJFB 3STLC 2IU3A 2HVKC 3OFNG 3CXCU 2X6CA 3W7WA 1HWYA 5EBMC 1M56B 1V54C 2M7WA 4LBEC 3SYOA 2OT5A 3OEEG 5IYCO 3ZMSA 1PNKA 1Y66A 1XL6A 3MHSC 2W0FC 1VQ8V 4JTCB 3RBZA 1RPRA 4MTXA 3K79A 4CZZA 2P67A 4H37A 4HAMA 2C2AA 2EZPA 1F4MA 3CC2V 1EZJA 3AEIA 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QBZ A;  5HFL A;  1QR9 A;  4JGS A;  2EZO A;  4FJC C;  3B8N A;  4JF3 A;  4N23 A;  5CN0 A;  4FK5 C;  3GWO A;  2EBO A;  1EBO A;  4JPR A;  4N21 A;  5CMU A;  4FIP C;  1K33 A;  1JQ0 A;  2LP7 A;  1DF4 A;  2M7W A;  1I5Y A;  1Y4M A;  1QCE A;  2OT5 A;  3M99 B;  1MG1 A;  1K34 A;  2MK3 A;  3CP1 A;  1Y66 A;  3CYO A;  1DLB A;  3MHS C;  3P30 A;  4G2K A;  1SZT A;  1F23 A;  5KA6 A;  3MHH C;  2X7R B;  1I5X A;  3B8M A;  1JPX A;  3B77 A;  1DF5 A;  3H01 A;  1ENV A;  1MOF A;  2P6J A;  5H9C A;  3WFV A;  4E2L A;  3K9A A;  2EZP A;  5HFM A;  5KA5 A;  1QR8 A; 
#chains in the Genus database with same CATH topology
 1AI6 A;  2X6B A;  4JAV A;  2EIM B;  4O2B B;  2Y0P A;  3ZMT A;  3ETQ A;  3UM7 A;  1K4D C;  2CTQ A;  2GUZ A;  1Q6I A;  2ZCE A;  2UXD B;  5JQG B;  3U11 A;  3SJA C;  1THZ A;  4GX5 A;  3I55 V;  1MZE A;  1XNR B;  3ML0 A;  1F23 A;  1CXZ B;  1OHH G;  1DF5 A;  3C3S A;  3OD4 A;  3CEI A;  1N34 B;  2W0X A;  2IJI A;  3FB6 C;  4IYH A;  2PZS A;  1P49 A;  2NN4 A;  4ZOL A;  2EBO A;  1WB7 A;  4RQE A;  1NTK H;  3AG7 A;  1Z5V A;  3JYC A;  3A2F A;  2UXN A;  2LGQ A;  2HFE C;  3RT3 C;  1AR1 B;  2GTA A;  2GUZ B;  4LFB B;  2BSK A;  2UXB O;  2CK3 G;  1IX9 A;  1FXV A;  4ZBM A;  3NR7 A;  1CPY A;  2DJV A;  3SR2 C;  3B2E E;  4RUE A;  5L3C A;  1AP6 A;  1YTF D;  1FJG B;  3ABM C;  4EFB A;  1R6K A;  5IDJ A;  3LSU A;  4JTD B;  5LMN O;  1YCI A;  3DC6 A;  2Y69 B;  5GW7 A;  3KKY A;  4X8A A;  1BZK A;  1KKC A;  2RCV A;  2ITC C;  1HNZ B;  2UUB B;  3CRC A;  3CB2 A;  4TQD A;  1SET A;  1WB8 A;  4MTF A;  3W7U A;  3P30 A;  4JI6 B;  4QPK A;  4LFA B;  1VQK V;  3L9D A;  4FVM A;  4JI5 O;  1B04 A;  3SPH A;  1NQT A;  3AG4 B;  4NTW A;  2JGD B;  2Q68 A;  3QO7 A;  2Q67 A;  2ZE5 A;  4WCE V;  2HLD G;  3JAW B;  3P3P A;  4B3M O;  3JD3 A;  1NH2 D;  5IY5 B;  1ARO P;  1I94 O;  3ZCC A;  4UCT A;  1T5E A;  4OPA A;  2XAH A;  2WA3 A;  4UCS A;  1OCC B;  2Q0O C;  4LF7 B;  3L71 H;  4LF6 B;  2LQT A;  3BFR A;  1KMI Z;  3ASN C;  3VQW A;  5J2U A;  3J7A U;  4GX2 A;  4FLW A;  1MG1 A;  1WA8 B;  4EB6 B;  1IBL O;  2CAZ C;  4X65 O;  5FNV A;  1S0V A;  1RM1 C;  3CSX A;  3WFV A;  4DR7 B;  1UJW B;  2IM9 A;  4WFA V;  1YVW A;  3FD9 A;  1WAZ A;  5CA0 A;  2WLK A;  3IJ4 A;  4N23 A;  2AW9 A;  1RSO B;  1AJP A;  5CMU A;  2UUC O;  4DW0 A;  1R3L C;  1BE3 H;  4TV9 A;  2RDC A;  1PM9 A;  1H2K A;  2E5L B;  4IL6 Z;  2KG7 B;  3M7M X;  1HR0 O;  5JJJ B;  3MD0 A;  4PI2 A;  2O57 A;  3F5T A;  3AK3 A;  4ABM A;  4JZ2 A;  2ZE6 A;  5BR8 O;  1MAB G;  1KP2 A;  1VQL V;  1V55 C;  5KA5 A;  5FL7 G;  2XAJ A;  1Y67 A;  4XDK A;  3N2G A;  1R73 A;  4BAY A;  3SJB C;  4YXW G;  2Q7H A;  4U3J A;  4PJ0 Z;  3CYO A;  3JAK A;  2EJ7 A;  5GON A;  1FPO A;  4IHJ A;  3ZN1 A;  2HEP A;  1KUQ A;  1M90 W;  5AG2 A;  4DXW A;  2LW7 A;  2OTL V;  1DTO A;  3DC5 A;  1I7F A;  3K57 A;  4MVS A;  3R65 A;  3TGU H;  2QKA A;  4IGG A;  3ZJZ A;  5H6Q A;  3I5D A;  5H6R A;  4B3M B;  5LXT A;  1FYJ A;  2Z3Y A;  2GHY A;  3TJT A;  4WBN B;  1DLB A;  4FLU A;  2BE3 A;  1QU7 A;  1R1B A;  2F95 B;  2Q8V A;  3ZHT A;  1ENV A;  1GO3 F;  4U3J B;  4LWS B;  2PGG A;  3ASO B;  3AK1 A;  1WLE A;  2WLN A;  1H2L A;  4DK1 A;  5L3G A;  4DV3 B;  1VQM V;  1M56 C;  5H2F Z;  5IJ9 A;  4DUZ O;  1XUQ A;  3HKC B;  2QM4 A;  1IBL B;  1YF2 A;  3CP1 A;  3L73 H;  3BRC A;  1Z2G A;  3RYI A;  1YXB A;  4JYY A;  2GTS A;  3F5W C;  1PKX A;  3CD6 V;  1VQO V;  3T2M A;  4YJ3 B;  2YEV A;  1SQX H;  2QM7 A;  1XMO B;  3VBB A;  2PY5 A;  3SYC A;  2UUC B;  3QVN A;  2Z0A A;  1MNG A;  3WB1 A;  1BSM A;  2ODM A;  1E1Q G;  2YIA A;  4LH7 A;  4RAI A;  4J7J A;  1JX9 A;  2PYL A;  2CGO A;  4O4I A;  1OCZ C;  3FB8 C;  3RYI B;  2ADQ B;  2M6Y A;  3HB3 B;  1J95 A;  4JZG A;  4JF3 A;  4MW3 A;  1HR0 B;  4KFM A;  4X9Q A;  1I0H A;  2QTS A;  4KUM A;  3RYH A;  2HKO A;  5FPO A;  2DMX A;  2HVJ C;  3CHX A;  1N36 B;  3O65 A;  5BR8 B;  4J10 A;  5EYP B;  2WA4 A;  2H3O A;  3E2E A;  3K5M A;  2P7T C;  1IUR A;  5B1A C;  4I50 A;  4FJC C;  4O4I B;  3H1H H;  2L35 A;  4YJ2 A;  1M4U A;  3WB0 A;  5CB4 A;  1VF6 A;  3CCR V;  2WLI B;  4X20 A;  3ETE A;  4B3R B;  4UB8 Z;  3C90 A;  3AG3 B;  1VF6 C;  2EIL C;  2JK5 C;  4UCV A;  2GV9 A;  5IYZ A;  4ASU G;  1IXM A;  4NVP A;  2QTO A;  4P9P A;  2JDI G;  3E8F A;  2A0L A;  1W0K G;  3LNM B;  3EXA A;  4X66 O;  5IE9 A;  4DV4 O;  3HKB A;  5C8Y B;  1Y74 A;  1VIB A;  3RYC A;  2ZDI A;  3CMA V;  3OMI B;  1Q8I A;  2ZDI C;  3ABL C;  2F23 A;  5B1B C;  2JVD A;  1XNQ O;  1RP3 B;  3DTU B;  5CB4 B;  3ZRS A;  4BIO A;  3FAV B;  2JEU A;  4UCO A;  4I9W A;  4XDL A;  4HNA B;  3R66 A;  2K9P A;  3B8N A;  1ORQ C;  5LA6 A;  1VP7 A;  4O4J A;  4YY3 O;  5IYD O;  3ETD A;  1GTO A;  2X0L A;  2BTO A;  1EFR G;  4UB6 Z;  1IBK O;  3OGI B;  5LP6 A;  1H2N A;  1XDC A;  2WLL B;  1FKA O;  4LC1 A;  5LP6 C;  3L75 H;  1SQQ H;  3ZBH A;  2Y48 A;  5B3S B;  3BHP A;  1GN4 A;  1JOY A;  1HNW O;  3ZRV A;  3D36 A;  3DSQ A;  2LGW A;  1JJO A;  3D36 C;  3CXC U;  1Y76 B;  3W7W A;  4LBE C;  3RN4 A;  3SYO A;  3JAL A;  2P5O A;  3AK2 A;  4CH4 A;  1Y66 A;  4OPH A;  1GN2 A;  4JTC B;  1DK1 A;  4J42 A;  3CE2 A;  4Q6G A;  1MMM A;  4FLZ A;  2EZP A;  2HHH O;  3CC2 V;  2UXC B;  4OXS A;  3OUS A;  5B1N A;  1NR7 A;  1ZX3 A;  4I4T B;  3D8C A;  2F4V O;  1GN3 A;  1Q81 W;  3TK1 A;  3CC7 V;  4B7K A;  1K97 A;  3ZHQ A;  2AHY A;  4J80 A;  4PDL A;  4E2L A;  4JI0 O;  4X1I B;  1SA0 B;  2PTM A;  4X64 O;  4OX9 B;  3EFF K;  1EBO A;  3SDL A;  5JH7 B;  1HDJ A;  1D2D A;  2VWK A;  4UV9 A;  4DV1 O;  1QVF U;  1TUB A;  3QO8 A;  1A32 A;  5H5N A;  3FB7 C;  3SPJ A;  3B4S A;  1N33 O;  1NBM G;  4TUY A;  5KX5 B;  4X66 B;  1K9M W;  2OCC C;  1NR1 A;  3JD2 A;  2JGU A;  3ABT A;  5BZB A;  4F4L A;  4N21 A;  3OTF A;  4X1Y A;  1DGS A;  3IGA C;  4FLV A;  4L8J A;  1FFX A;  3K9S A;  3VOU A;  5ITZ B;  4F6R B;  4Z1V A;  2ZXW B;  2BOB C;  4JI3 O;  3BVO A;  2BTQ A;  2R9R B;  3WB2 A;  1ZSP A;  4O2A A;  1K3E A;  3HKE A;  4MVQ A;  3PJS K;  3GVM A;  2Q73 A;  2XAS A;  1IBM B;  2W6J G;  5BMV B;  5EC1 C;  1XI1 A;  4PHZ A;  3CCJ V;  4PA6 A;  5IT9 N;  4X1Y B;  1QNM A;  4DO2 A;  3K04 A;  4DR3 B;  4TSF G;  5LHG A;  2IBZ H;  2AXT Z;  5LMU O;  4NXM O;  1OCO B;  2OCH A;  4FIP C;  2Q5Z A;  5LYJ A;  1M93 A;  3KCX A;  3OTO B;  4JAU A;  5J2T A;  2EIN C;  4J11 A;  4DV7 O;  1GRJ A;  4GKK O;  2XT9 A;  4W4L A;  4JI7 O;  3A0R A;  1K73 W;  3RYF A;  1R3J C;  4TWK A;  2Q6A A;  5EBL C;  1XMQ B;  2WLM A;  4UV8 A;  3K0D A;  4ZKI A;  3CC4 V;  3LUT B;  1F51 A;  1PL0 A;  2VS0 A;  1CEZ A;  2K1E A;  3OW2 U;  4AI8 A;  3RFR A;  2VQF O;  2N05 A;  2DYS C;  2ITD C;  2AZ0 A;  3CRR A;  5H9C A;  1K92 A;  3K9A A;  1H38 A;  1RFY A;  1SS3 A;  4JGS A;  2N04 A;  4X64 B;  4GKJ B;  4UUJ C;  1EN6 A;  3CS5 A;  3H1K H;  4UCR A;  4MW8 A;  4WFH A;  2CH7 A;  3E22 A;  4DV1 B;  4DV0 O;  1WN7 A;  2ZIM A;  2E76 B;  1AIL A;  4ICG A;  5EIB C;  1G6U A;  4GCZ A;  4NB5 A;  4DV6 B;  5L3D A;  1D5N A;  1OV9 A;  3A0B Z;  3E89 A;  1QR9 A;  2GSM B;  3SPC A;  3K0G A;  4MTG A;  4I55 A;  1SZX A;  1XBL A;  2VQE O;  2MK3 A;  4FLX A;  4ZOL B;  4JI3 B;  1BQ0 A;  2CH7 B;  1EZJ A;  3OMN B;  5KMG A;  3P3N A;  2QR4 A;  4ZHQ A;  3DGE A;  4BW5 A;  3L72 H;  2G38 A;  2PF4 E;  3JAT A;  2BSK B;  1XQ8 A;  3ABM B;  3OEH G;  4H13 B;  4K0K O;  3K3W A;  1L0L H;  2QGN A;  1P7B A;  2QM8 A;  4Z1M G;  3LDD A;  5D5Q A;  4UCU A;  3ZMZ A;  3ICX A;  5LGN A;  3OT7 A;  1SQG A;  4LF5 O;  1TGO A;  3JD4 A;  2ZNI A;  3AG2 C;  1XOU A;  1NVP B;  2NLJ C;  3F7Y C;  2AHZ A;  3OR7 C;  4WF9 V;  2N74 A;  2IW5 A;  2ILM A;  3E8H A;  3CME V;  4NXN O;  3Q4H A;  4JAS A;  4GUN A;  4DV7 B;  1ZUQ A;  1PL4 A;  1K34 A;  2Y0I A;  4GKK B;  4KP4 A;  5KA6 A;  1VF7 A;  1ROP A;  2ZNJ A;  2P6J A;  5LOV A;  3G71 V;  3ZS8 C;  2UXB B;  1Z5W A;  3WG7 C;  1K7D A;  3G6E V;  3I56 V;  2DQ3 A;  4LF8 O;  1EM1 A;  3OR6 C;  3VQX A;  1N32 O;  2LW1 A;  4LP8 A;  4JI2 O;  1GMG A;  2VQF B;  3ASN B;  3RW0 A;  3JCU Z;  1YJW V;  1KC8 W;  3MDS A;  1H2S B;  4DK0 A;  5J2U B;  4NKG B;  1FD9 A;  2E3C A;  1RM1 B;  3OMA B;  3FKS G;  5FNV B;  1XL4 A;  5LOV B;  2CTR A;  1H2M A;  3X2Q B;  2QKS A;  2Z5U A;  3QNE A;  2Y4T A;  3BA8 A;  5BXZ A;  4DV0 B;  2UU9 O;  4YIO A;  4QPJ A;  5CA0 B;  4ZI7 A;  4YHH O;  5J9P C;  1WP7 A;  1JR9 A;  5EC2 C;  3C3T A;  2A06 H;  4DR6 O;  4FPP A;  4TV9 B;  2PYJ A;  1P4R A;  2XUM A;  4U7O A;  3OUF A;  5LMN B;  1S5J A;  4MS2 A;  2ZIO A;  4U3F H;  2X6A A;  1Q82 W;  4RQF A;  3B09 A;  1Y4M A;  2DN9 A;  5LL6 Y;  2DWE C;  3N2K A;  3K06 A;  4JI5 B;  4R50 A;  3KG2 A;  5HFM A;  4K3A A;  4WFB V;  4B3S O;  2YIB A;  1MSW D;  2ZM6 O;  1YEW A;  1V55 B;  1AR5 A;  3UQ8 A;  1OCR C;  4KXR A;  1AJN A;  3K5L A;  3BAA A;  3JD0 A;  4H44 B;  3M99 B;  3N2G B;  1I94 B;  4BIU A;  4LNU A;  1M57 C;  2YIC A;  1WPX A;  3G6B A;  4LF5 B;  1KKD A;  1ZWI C;  3L70 H;  3JAK B;  2DQ0 A;  3N2K B;  3KZI Z;  5GON B;  2YI9 A;  1FXK A;  4IHJ B;  1Q7Y W;  1NS1 A;  2F66 C;  1NTZ H;  4NXN B;  1FXK C;  1P7G A;  5LBQ A;  4LR3 A;  3T4D A;  4O4H A;  4I9Q A;  4XBF A;  3SYA A;  2DWD C;  4X65 B;  4DR2 O;  3SPI A;  2XOK G;  1SQB H;  1XHX A;  1NKD A;  4I0X A;  5LXT B;  3APO A;  4P30 A;  4IIJ A;  3SJQ C;  5KUK A;  2OWO A;  3CCE V;  2PUS A;  4X1K A;  5B66 Z;  1BHB A;  1QLN A;  4QIW F;  3STL C;  1N32 B;  2RMK B;  2X6C A;  4JI2 B;  1OJH A;  5EBM C;  1M56 B;  1V54 C;  4O4L A;  4PD4 F;  2OT5 A;  5IYC O;  4B3T O;  1PNK A;  4FM1 A;  2YXY A;  2W0F C;  5IJ9 B;  4H37 A;  3U10 A;  4HAM A;  1KBH A;  3AEI A;  1G1X B;  4R7C A;  4I0X B;  1QHT A;  1EN5 A;  1IZ3 A;  4NTX A;  2R72 A;  2EIK B;  4U7N A;  4JYB A;  4MVU A;  3E86 A;  4UXN A;  2QA4 V;  2WWW A;  2YEV B;  4JTA B;  2XAG A;  1LNQ A;  1JCH A;  1N0J A;  1K5Q A;  1U96 A;  4WFG A;  3FFQ A;  3SYQ A;  4K35 A;  3CWB H;  4DR6 B;  4X88 A;  3JAR A;  1ZAU A;  1O9H A;  1VQP V;  1AJQ A;  1OCZ B;  3U0Z A;  4CS3 A;  1N8R W;  3A0H Z;  3HKD A;  2OIE A;  1B3Q A;  2LO1 A;  3TCU A;  4R8C A;  3P32 A;  2ADP A;  2IJK A;  5F2V O;  3RYH B;  4B3S B;  3A8T A;  5B1A B;  3O9O A;  1O9G A;  2DE0 X;  1NVP D;  2OYQ A;  2QDO A;  3DXR A;  2ZIN A;  2IJJ A;  3CCQ V;  3E35 A;  4I50 B;  2IU0 A;  1I5Y A;  2NR5 A;  2BOC C;  4YJ2 B;  3W7S A;  5DED A;  3T1H O;  2EIL B;  5KAI Z;  2ETN A;  4X20 B;  4DV2 O;  5IYZ B;  1GK9 A;  2Q69 A;  4CC5 A;  2VRZ A;  2IH3 C;  4TOI A;  4DUZ B;  1BGY H;  1ZLZ A;  3SGI A;  3HKB B;  1Y74 B;  3RYC B;  3ABL B;  4X62 O;  5IWA O;  3QF7 A;  2Q0A A;  5B1B B;  5L3F A;  2FML A;  5IYB O;  4GLX A;  4ZIB A;  2HJD A;  1TVK A;  1W59 A;  1SF9 A;  4FFB A;  1R6N A;  2P4V A;  1JMK C;  1HNX O;  3T1C A;  4TV8 A;  2XAF A;  2GDS A;  4J9Z B;  1LUW A;  2LP7 A;  4XDJ A;  1BL8 A;  5LA6 B;  2AZ2 A;  4O4J B;  1JVM A;  3CRM A;  4DR4 O;  5K1P A;  2ZR3 A;  4KHP O;  2H94 A;  3ETG A;  5LP6 B;  1GN6 A;  1QVG U;  4AQY O;  4JYA O;  2JEX A;  1I08 A;  1IXB A;  2CE4 A;  4FZ1 A;  5CA1 A;  2QWO B;  1BT8 A;  1FAF A;  4HYO A;  1YSC A;  3GWK C;  1L0N H;  3JAS A;  1W0J G;  5GTI Z;  2ZE7 A;  2LFR A;  4PA7 A;  2XAQ A;  4HBN A;  2RQ6 A;  2JIZ G;  4OGQ B;  3JAL B;  3JD1 A;  1KQS U;  4DRX A;  3CX5 F;  4KL1 A;  1L8D A;  1BMF G;  3ZHU A;  4DYL A;  2WPD G;  4CH6 A;  3IAY A;  3AG1 C;  4NR1 A;  3B40 A;  3LDE A;  1Q86 W;  1J5E O;  3THO A;  1K4C C;  1XNR O;  3RVY A;  5EZY A;  4K8Z A;  4GX1 A;  1PD3 A;  3APQ A;  3JSN A;  1ZL8 A;  4JI8 O;  2KSD A;  2CUG A;  2EJR A;  4MVR A;  1BCC H;  4DV4 B;  1JJ2 U;  1SER A;  3ZRW A;  1N34 O;  2YS8 A;  3JCZ A;  5K1X A;  2HJF C;  4PA3 A;  1VQ6 V;  1HW7 A;  1XNQ B;  1WPB A;  2EIJ C;  1PNL A;  3CXH F;  4BWA A;  3H1J H;  5JVD A;  1BQZ A;  4DV2 B;  1QLE C;  1VQ9 V;  5KAF Z;  4D6T H;  2FL4 A;  1TUB B;  3ABU A;  5IJ0 A;  1VMG A;  2R9A A;  4CBC A;  2B9Z A;  1SQP H;  1S5L Z;  2OCC B;  3H1I H;  4TUY B;  4YY3 B;  1H8H G;  3OAA G;  2B1G A;  3NXS A;  2B1I A;  1IBK B;  3BAB A;  3PN1 A;  3FB5 C;  1UPG A;  2ARH A;  1HNZ O;  2KQX A;  2A9H A;  4FLT A;  1YJN V;  2V4D A;  3ZHV A;  1FFT B;  3G4S V;  1HNW B;  1JFF A;  1FFX B;  2D3O W;  4AHC A;  1HNX B;  3QO5 A;  3ABK B;  1KB9 F;  2F93 B;  1TUE B;  5HFL A;  3H9V A;  2BTQ B;  3E8B A;  4CH3 A;  2PI4 A;  4QNH B;  1AR4 A;  3ZRX A;  4L87 A;  3SYP A;  4O2A B;  3HKE B;  4JI4 O;  1QCE A;  5DM6 V;  2VWJ A;  4LH6 A;  4KHP B;  1JA8 A;  2YXL A;  3CCM V;  2P90 A;  1YHQ V;  3K03 A;  4O2B A;  1S77 D;  4J7K A;  1S5H C;  3OGC C;  4DUY O;  2HHH B;  2EIM C;  4BW9 A;  5JQG A;  2DYR B;  1BS3 A;  5FPR A;  2L6L A;  2WSS G;  1KD1 W;  3CCU V;  1XRE A;  2QWP B;  4LF7 O;  4LF6 O;  2FB5 A;  2F4V B;  1GH6 A;  1Q3E A;  3BEH A;  4UVA A;  3CRA A;  2A7W A;  2EIN B;  2R9I A;  5LYJ B;  4JI0 B;  2CGN A;  4UVB A;  4DR7 O;  5J2T B;  1TAE A;  2E74 B;  4MTO A;  3G67 A;  2OTJ V;  1US6 A;  1VAR A;  3RYF B;  1S3J A;  3UO3 A;  1J5E B;  3HR0 A;  4FFK A;  2F43 G;  1SRY A;  2JS3 A;  4PI0 A;  2WLJ A;  4HZ3 A;  3TXS A;  3K5N A;  1N33 B;  2DYS B;  4JI8 B;  2QWN B;  2R70 A;  1IVS A;  5B1O A;  4QGP A;  3E8G A;  2Y69 C;  1E1R G;  2JJ2 G;  4DV5 O;  1GAX A;  2E5L O;  1Y6X A;  2B5U A;  5JCO A;  2YSU B;  1K8A W;  1W2B U;  1Q90 D;  1GM8 A;  1XEQ A;  1S76 D;  5JCO C;  5LGT A;  1FXH A;  2F1M A;  4TQF A;  2JGD A;  1N0N A;  3E22 B;  3RGB A;  3AG4 C;  3SPG A;  1FS0 G;  1EZV H;  3JAW A;  3K08 A;  3SJC C;  2CTW A;  3ZN0 A;  4JV5 O;  3F7V C;  2MW2 B;  2Y4U A;  5IY5 C;  2XHB A;  3L74 H;  2XND G;  4I55 B;  4H33 A;  2H8P C;  2NNU A;  1OCC C;  2KB1 A;  1B06 A;  5LMU B;  5JWP A;  4NXM B;  3BCC H;  1IDS A;  5KMG B;  2YXH A;  1WA8 A;  4EB6 A;  4ZHQ B;  4DW1 A;  4EFE A;  1GM9 A;  1P84 F;  3BA9 A;  1KU9 A;  5KHH A;  3JAT B;  4JI4 B;  4D7S A;  5LHI A;  4JI7 B;  2QEX V;  1JPX A;  4J7Z A;  4DUY B;  1H2G A;  1TA8 A;  1QQC A;  3T4Z A;  1RSO A;  3MAQ A;  1E79 G;  4F6E A;  2PI5 A;  2HR3 A;  1WP8 A;  2CDY A;  3AG2 B;  5A9G A;  4QJF B;  1EN4 A;  2IU3 A;  4DV3 O;  2HVK C;  3OFN G;  3UT5 A;  3JAM N;  1HWY A;  2M7W A;  4LF4 O;  3ZMS A;  2OIG A;  1KYO F;  3MHS C;  3Q4H B;  1RPR A;  2EUL A;  4CZZ A;  2Q7E A;  2KG7 A;  1URF A;  4D7T A;  2C2A A;  1F4M A;  5GTH Z;  3S3W A;  1NZ6 A;  3X2Q C;  1XMO O;  3WG7 B;  4AIL C;  1LUV A;  3BPZ A;  1XIL A;  3UT5 B;  5CBH A;  1I5X A;  1SC5 B;  5KHJ A;  5A2Q N;  3H01 A;  2RN9 A;  2FTK A;  2QE7 G;  4J41 A;  1AI7 A;  1MSD A;  1LR1 A;  3CRQ A;  4DV5 B;  2QJ1 A;  1R3I C;  4PDV A;  5DEC A;  4P2Z A;  1AB3 A;  4JPR A;  2QSA A;  4CC6 A;  3E83 A;  5EBW C;  4FMT A;  2VQE B;  3ZMV A;  4LFC O;  2ATK C;  3ZIA G;  1VEW A;  1N36 O;  1YIT V;  2IJH A;  4ZI7 B;  5JJN B;  2YC0 A;  1QBZ A;  3T1Y O;  4JV5 B;  4K0K B;  4MVO A;  4WBN A;  2FYU H;  5L3B A;  4RO2 A;  1JQ0 A;  1G8M A;  2ZQM A;  5TIS Z;  2ZKO A;  4B3R O;  4LWS A;  4PA4 A;  3GB7 C;  2ZR2 A;  4B08 A;  3ASO C;  1WNS A;  5CBF A;  4QE9 A;  2P06 A;  3HKC A;  3CPW U;  1K5S A;  3KCY A;  4MVZ A;  1MZF A;  3OM3 B;  1NU1 H;  1OCR B;  1NT2 B;  5KLV H;  1G4Y B;  1Q5O A;  5CBG A;  3N27 A;  2CTP A;  2P22 C;  4YJ3 A;  3FYE B;  1NJI W;  2Q7G A;  1M57 B;  1GM7 A;  4NYK A;  4LNU B;  4I5S A;  3QTC A;  3M8A A;  3RWR D;  3IFX A;  4LF8 B;  1COW G;  2DOS A;  2EX3 A;  1YZB A;  3IC7 A;  1FXK B;  2W6I G;  3TXQ A;  4LF4 B;  1VQ7 V;  5D5P A;  4UVC A;  3CJH A;  2A79 B;  1F4N A;  4BIZ A;  2ZE8 A;  4IT5 A;  4O4H B;  1L1F A;  3CCL V;  3H1L H;  1SQV H;  2EIK C;  3LDC A;  4NTY A;  5C93 A;  1Q6U A;  4PV1 B;  4IIJ B;  4X1K B;  1K33 A;  2UU9 B;  5EYP A;  4CS2 A;  4B7E A;  1ZTE A;  4PDM A;  4YHH B;  1V54 B;  4UFZ A;  3BY6 A;  1V9P A;  4PEL A;  3J81 N;  2D2C B;  4O4L B;  3CJH B;  5KUM A;  1MOF A;  4FM0 A;  4YIP A;  5EIB D;  4P9O A;  5L3E A;  2WLI A;  2QWQ B;  2UXC O;  4LF9 O;  4I7Z B;  4CS4 A;  4JAA A;  1MA1 A;  3AG3 C;  2ZD9 A;  4LFC B;  2XTA A;  3UCS C;  5LHH A;  1CP9 A;  1SZT A;  2JS5 A;  1PV0 A;  4EEQ A;  5C8Y A;  3B77 A;  4DR5 O;  3IC9 A;  2ZM6 B;  3T1Y B;  3TET A;  3GWO A;  4OX9 O;  3JAR B;  1R6T A;  1GKF A;  3FAV A;  5E79 Z;  3CCS V;  4HNA A;  1M5I A;  3HKD B;  3LNN A;  3MHH C;  2LFS A;  4PA9 A;  1M1K W;  2HG5 C;  3VQV A;  1PP9 H;  1VQ5 V;  4G27 B;  1N4C A;  3WU2 Z;  1QR8 A;  2JJ1 G;  2EZO A;  1U97 A;  2P4K A;  2WLL A;  3UKM A;  4W4K A;  3K59 A;  4FLY A;  1AI5 A;  2GBO A;  1VQ4 V;  1PNM A;  4MT8 A;  3CCV V;  2QWR B;  4DR2 B;  3DXR B;  1B6Q A;  2WLH A;  5B3S C;  4TT3 G;  2X7R B;  1YTF B;  5JJE B;  4IYI A;  1AI4 A;  1Y76 A;  1M9N A;  3ZX6 A;  4BR6 A;  4Q20 A;  3ZHR A;  5CN0 A;  3FYI B;  1IBM O;  1Q43 A;  1BHA A;  4JI1 O;  2Q4P A;  2YDE A;  4B3T B;  3W7X A;  4CH5 A;  1S72 V;  4WFE A;  3K5O A;  4DR3 O;  4FM2 A;  4QE7 A;  4I4T A;  1VQN V;  2A3Q A;  1KEC A;  2FKX A;  2JRI A;  1HP8 A;  1H8E G;  4FZ0 A;  4X89 A;  5KHG A;  4FK5 C;  3VQY A;  1TVK B;  4WFF A;  4RUF A;  4FFB B;  3LSS A;  1AVM A;  4A5U B;  1VF5 B;  4DR1 O;  4TV8 B;  4GT1 A;  1NH2 B;  5KHI A;  3S3X A;  5EK0 A;  4X1I A;  1KP3 A;  1SA0 A;  3D3I A;  3OTO O;  5CA3 A;  1YJ9 V;  2UUA O;  4G2K A;  5LGU A;  2E75 B;  3LSQ A;  1R3K C;  4G28 B;  5JH7 A;  4LF9 B;  1SKV A;  3OE7 G;  2YID A;  1XMQ O;  1YIJ V;  5FLX N;  5B5E Z;  5CA1 B;  1NI8 A;  1DF4 A;  2UXD O;  5KX5 A;  1X4T A;  3D3Q A;  2V1D A;  5DN6 G;  3RVZ A;  3JAS B;  5KHK A;  4DR5 B;  1UFI A;  3B8M A;  2YUA A;  2QKC A;  4R6Z A;  1SQF A;  1X59 A;  4MVM A;  4GKJ O;  5ITZ A;  4MSW C;  4F6R A;  1YI2 V;  2BCC H;  1OZ0 A;  4DRX B;  3ZHS A;  2IH1 C;  1PPJ H;  3AG1 B;  2ZXW C;  2YIB D;  2WAM A;  3UO2 A;  2AGA A;  3T1H B;  3W7T A;  4LFB O;  4Z2W A;  1NTM H;  4DV6 O;  4H0L B;  5EZY B;  5BMV A;  5E1A C;  2HP8 A;  1FJG O;  3J80 N;  1ZL8 B;  2DW4 A;  2RNB A;  1F7Y A;  3ZRW B;  4X62 B;  2YI8 A;  3QG5 A;  5IWA B;  2UUB O;  2ZT9 B;  4EKW A;  2EIJ B;  4JI6 O;  4LFA O;  3ABK C;  4GZR B;  4K8X A;  1OCO C;  1QLE B;  3G80 A;  5JVD B;  4GX0 A;  2Q9L A;  2UXX A;  1RPO A;  3STZ C;  1XHZ A;  4JI1 B;  2V7Q G;  5IJ0 B;  1WJZ A;  4JYC A;  4E4E A;  4J9Y B;  3HPL C;  4DR4 B;  1SES A;  3EVK A;  4LCU C;  4RWU A;  1D5A A;  4GYC B;  1YDX A;  2DYR C;  4AQY B;  4JYA B;  4PDR A;  3K58 A;  3EHB B;  2LJ2 A;  1JFF B;  1Q6H A;  4DR1 B;  2RJZ A;  2KKW A;  1AP5 A;  2UUA B;  3OEE G;  1XL6 A;  1VQ8 V;  3RBZ A;  3JSL A;  4MTX A;  4C7U A;  3K79 A;  5BY1 A;  3ZED A;  2P67 A;  3FX7 A;  3ZMU A; 
#chains in the Genus database with same CATH homology
 1AI6 A;  3X2Q C;  4R7C A;  2X6B A;  4JAV A;  2EIM B;  4OXS A;  3OUS A;  5B1N A;  3ZMT A;  2EIK B;  3UM7 A;  1NR7 A;  1K4D C;  4U7N A;  4JYB A;  3WG7 B;  4MVU A;  3E86 A;  4UXN A;  2QA4 V;  2WWW A;  2YEV B;  1THZ A;  4GX5 A;  4JTA B;  3TK1 A;  1Q81 W;  2XAG A;  3I55 V;  1LNQ A;  1JCH A;  3ML0 A;  1K5Q A;  3CC7 V;  5CBH A;  1K97 A;  1F23 A;  4WFG A;  3SYQ A;  1I5X A;  1OHH G;  3H01 A;  1DF5 A;  2AHY A;  2FTK A;  4PDL A;  4X88 A;  4E2L A;  2QE7 G;  1AI7 A;  1VQP V;  1AJQ A;  1OCZ B;  1R3I C;  2IJI A;  4PDV A;  1N8R W;  3FB6 C;  4P2Z A;  3EFF K;  2EBO A;  1EBO A;  4JPR A;  4RQE A;  3JYC A;  2UXN A;  3E83 A;  2HFE C;  4FMT A;  5EBW C;  1AR1 B;  3ZMV A;  3TCU A;  4UV9 A;  2ATK C;  1QVF U;  4R8C A;  3QO8 A;  3ZIA G;  3P32 A;  1YIT V;  2CK3 G;  3FB7 C;  1FXV A;  4ZBM A;  3SPJ A;  1CPY A;  2IJK A;  1NBM G;  2IJH A;  4RUE A;  5L3C A;  1K9M W;  1YTF D;  2OCC C;  3ABM C;  1QBZ A;  1R6K A;  5IDJ A;  4JTD B;  1NR1 A;  3JD2 A;  5B1A B;  3ABT A;  2Y69 B;  1NVP D;  4MVO A;  5GW7 A;  4F4L A;  5BZB A;  5L3B A;  4N21 A;  2IJJ A;  3IGA C;  3CCQ V;  4RO2 A;  4X8A A;  1JQ0 A;  3E35 A;  1G8M A;  2IU0 A;  1I5Y A;  2ZQM A;  2ITC C;  3VOU A;  2BOC C;  1SET A;  4MTF A;  4PA4 A;  3W7U A;  3GB7 C;  3P30 A;  3W7S A;  2ZXW B;  4QPK A;  2BOB C;  2EIL B;  1VQK V;  2ZR2 A;  2R9R B;  3ASO C;  5CBF A;  4QE9 A;  3SPH A;  1NQT A;  1GK9 A;  3AG4 B;  2Q69 A;  3CPW U;  1K3E A;  1K5S A;  4MVZ A;  4MVQ A;  3PJS K;  2Q68 A;  3QO7 A;  2XAS A;  2IH3 C;  2Q67 A;  3OM3 B;  2W6J G;  1OCR B;  4WCE V;  2HLD G;  1G4Y B;  5CBG A;  5EC1 C;  3ABL B;  3JD3 A;  3CCJ V;  4PA6 A;  5B1B B;  1NH2 D;  5L3F A;  5IY5 B;  1ARO P;  3ZCC A;  4DO2 A;  3FYE B;  3K04 A;  5IYB O;  1NJI W;  4TSF G;  5LHG A;  1M57 B;  1GM7 A;  2XAH A;  1R6N A;  4I5S A;  1OCC B;  3T1C A;  1OCO B;  2XAF A;  4J9Z B;  3IFX A;  1COW G;  4FIP C;  3ASN C;  3IC7 A;  2LP7 A;  1FXK B;  2W6I G;  4XDJ A;  1BL8 A;  1VQ7 V;  4UVC A;  4GX2 A;  1MG1 A;  1JVM A;  2A79 B;  4JAU A;  1F4N A;  2EIN C;  4BIZ A;  2ZR3 A;  2H94 A;  1S0V A;  3ETG A;  3A0R A;  1L1F A;  3CCL V;  1RM1 C;  1K73 W;  1QVG U;  3WFV A;  1R3J C;  1UJW B;  4TWK A;  2EIK C;  2JEX A;  3LDC A;  4WFA V;  2Q6A A;  5C93 A;  5EBL C;  2WLK A;  2WLM A;  4N23 A;  4UV8 A;  4HYO A;  3K0D A;  1YSC A;  4ZKI A;  3LUT B;  1F51 A;  3CC4 V;  1AJP A;  1PL0 A;  5CMU A;  1W0J G;  1CEZ A;  1K33 A;  2K1E A;  3OW2 U;  2LFR A;  4PA7 A;  2XAQ A;  1R3L C;  4PDM A;  1V54 B;  2DYS C;  3BY6 A;  4PEL A;  2ITD C;  2JIZ G;  5KUM A;  1MOF A;  5H9C A;  1K92 A;  3K9A A;  3JD1 A;  1KQS U;  1H38 A;  4P9O A;  5L3E A;  2WLI A;  4JGS A;  4UUJ C;  1BMF G;  2WPD G;  3AG1 C;  3LDE A;  3MD0 A;  4MW8 A;  1Q86 W;  4WFH A;  3AG3 C;  2ZD9 A;  1K4C C;  5LHH A;  3RVY A;  1CP9 A;  1SZT A;  4GCZ A;  4GX1 A;  1PD3 A;  3B77 A;  1MAB G;  1KP2 A;  1VQL V;  5L3D A;  1V55 C;  2EJR A;  4MVR A;  5KA5 A;  3TET A;  3E89 A;  5FL7 G;  1JJ2 U;  1QR9 A;  1SER A;  2XAJ A;  3ZRW A;  3JCZ A;  4XDK A;  2HJF C;  2GSM B;  1R73 A;  3SPC A;  4BAY A;  3GWO A;  3K0G A;  4MTG A;  4PA3 A;  4YXW G;  1VQ6 V;  1GKF A;  3CCS V;  2EIJ C;  2MK3 A;  1PNL A;  3CYO A;  3ZN1 A;  3MHH C;  2LFS A;  1M90 W;  3OMN B;  4DXW A;  1QLE C;  4PA9 A;  1VQ9 V;  2OTL V;  1DTO A;  3DGE A;  4BW5 A;  1M1K W;  2HG5 C;  1VQ5 V;  4G27 B;  3ABU A;  1QR8 A;  4CBC A;  2JJ1 G;  2EZO A;  4MVS A;  3R65 A;  2OCC B;  2WLL A;  3UKM A;  3ABM B;  3OEH G;  1H8H G;  3OAA G;  3ZJZ A;  2B1G A;  3K3W A;  3NXS A;  5H6Q A;  2B1I A;  1AI5 A;  1P7B A;  2QM8 A;  5H6R A;  1VQ4 V;  3FB5 C;  1PNM A;  4Z1M G;  4MT8 A;  3CCV V;  3LDD A;  2Z3Y A;  2GHY A;  2A9H A;  3ZMZ A;  1DLB A;  1B6Q A;  2WLH A;  5B3S C;  1YJN V;  5LGN A;  4TT3 G;  2X7R B;  1YTF B;  1FFT B;  3G4S V;  1ENV A;  1GO3 F;  3JD4 A;  2D3O W;  1AI4 A;  3AG2 C;  3QO5 A;  3ASO B;  3ABK B;  1M9N A;  1TUE B;  1WLE A;  2WLN A;  5HFL A;  1NVP B;  2NLJ C;  3F7Y C;  2AHZ A;  3OR7 C;  3E8B A;  4Q20 A;  5L3G A;  1VQM V;  4QNH B;  5CN0 A;  4WF9 V;  2PI4 A;  3ZRX A;  3FYI B;  2IW5 A;  1M56 C;  3CME V;  3E8H A;  4L87 A;  3SYP A;  1BHA A;  4JAS A;  1QCE A;  5DM6 V;  3W7X A;  1K34 A;  3CP1 A;  3CCM V;  2P90 A;  4KP4 A;  5KA6 A;  3K03 A;  1YHQ V;  1S72 V;  1S77 D;  4WFE A;  3F5W C;  1ROP A;  1S5H C;  3OGC C;  1PKX A;  3CD6 V;  2P6J A;  4QE7 A;  3G71 V;  1VQO V;  3T2M A;  2EIM C;  1VQN V;  1KEC A;  2DYR B;  2YEV A;  2WSS G;  3WG7 C;  1KD1 W;  1K7D A;  3G6E V;  3CCU V;  2QM7 A;  1H8E G;  3I56 V;  4X89 A;  4FK5 C;  2DQ3 A;  4WFF A;  3OR6 C;  4RUF A;  3VBB A;  3LSS A;  3SYC A;  4LP8 A;  1GMG A;  1NH2 B;  4GT1 A;  3ASN B;  3RW0 A;  5EK0 A;  1E1Q G;  1KP3 A;  3BEH A;  3D3I A;  4UVA A;  5CA3 A;  1YJ9 V;  1YJW V;  4G2K A;  5LGU A;  1KC8 W;  4RAI A;  2EIN B;  2R9I A;  3LSQ A;  1JX9 A;  1R3K C;  4UVB A;  1OCZ C;  3FB8 C;  4G28 B;  4MTO A;  1RM1 B;  3OMA B;  3FKS G;  3HB3 B;  1J95 A;  1XL4 A;  2OTJ V;  3OE7 G;  4JF3 A;  4MW3 A;  3X2Q B;  2QKS A;  1YIJ V;  2Z5U A;  1S3J A;  3QNE A;  4KFM A;  1DF4 A;  4KUM A;  4QPJ A;  2F43 G;  2HKO A;  1SRY A;  2V1D A;  5DN6 G;  3RVZ A;  2WLJ A;  5J9P C;  4HZ3 A;  2HVJ C;  3B8M A;  2DYS B;  5EC2 C;  3E2E A;  5B1O A;  4FPP A;  2P7T C;  4R6Z A;  1P4R A;  5B1A C;  3E8G A;  4U7O A;  2Y69 C;  4FJC C;  3OUF A;  1E1R G;  2JJ2 G;  4MVM A;  2B5U A;  4MS2 A;  4MSW C;  1YI2 V;  1OZ0 A;  2X6A A;  2YSU B;  3CCR V;  1Q82 W;  4RQF A;  1K8A W;  1W2B U;  2WLI B;  1S76 D;  1GM8 A;  2IH1 C;  3AG1 B;  1Y4M A;  3ETE A;  2ZXW C;  5LGT A;  2DWE C;  2WAM A;  1FXH A;  2EIL C;  2JK5 C;  3AG3 B;  4ASU G;  3W7T A;  1IXM A;  3K06 A;  4R50 A;  2QTO A;  4P9P A;  2JDI G;  3E8F A;  2A0L A;  3AG4 C;  3KG2 A;  1W0K G;  5HFM A;  3SPG A;  1FS0 G;  3LNM B;  4WFB V;  1MSW D;  5E1A C;  1V55 B;  1OCR C;  3K08 A;  2ZDI A;  1AJN A;  3CMA V;  3ZN0 A;  3OMI B;  2DW4 A;  3F7V C;  2ZDI C;  3ABL C;  3JD0 A;  3ZRW B;  5B1B C;  5IY5 C;  3DTU B;  3M99 B;  4BIU A;  2XND G;  3ZRS A;  4EKW A;  1M57 C;  2EIJ B;  1WPX A;  3ABK C;  4H33 A;  2H8P C;  2JEU A;  1KKD A;  4I9W A;  4XDL A;  1ZWI C;  2NNU A;  1OCC C;  1OCO C;  1QLE B;  2KB1 A;  2DQ0 A;  1FXK A;  1Q7Y W;  4GX0 A;  3B8N A;  1ORQ C;  2UXX A;  1RPO A;  3STZ C;  5IYD O;  1FXK C;  1GM9 A;  3ETD A;  1GTO A;  2X0L A;  5LBQ A;  3T4D A;  2V7Q G;  1EFR G;  4JYC A;  2WLL B;  4XBF A;  4J9Y B;  5LHI A;  3HPL C;  4LC1 A;  3SYA A;  2DWD C;  1SES A;  3SPI A;  2XOK G;  1NKD A;  4LCU C;  2QEX V;  1JPX A;  2Y48 A;  1H2G A;  5B3S B;  1JOY A;  2DYR C;  4P30 A;  5KUK A;  3SJQ C;  3T4Z A;  3ZRV A;  4PDR A;  1E79 G;  2PI5 A;  3CCE V;  2HR3 A;  3D36 A;  1BHB A;  3AG2 B;  3EHB B;  4QIW F;  1QLN A;  4QJF B;  3STL C;  2IU3 A;  2HVK C;  3OFN G;  3CXC U;  2X6C A;  3W7W A;  1HWY A;  5EBM C;  1M56 B;  1V54 C;  2M7W A;  4LBE C;  3SYO A;  2OT5 A;  3OEE G;  5IYC O;  3ZMS A;  1PNK A;  1Y66 A;  1XL6 A;  3MHS C;  2W0F C;  1VQ8 V;  4JTC B;  3RBZ A;  1RPR A;  4MTX A;  3K79 A;  4CZZ A;  2P67 A;  4H37 A;  4HAM A;  2C2A A;  2EZP A;  1F4M A;  3CC2 V;  1EZJ A;  3AEI A;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...