5HFMA

Gp41-targeting hiv-1 fusion inhibitors with hook-like ile-asp-leu tail
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
77
Chain Sequence
AVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIGGRGGWEEWDKKIEEYTKKIEELIKKSQNQQIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Envelope glycoprotein gp160,gp41 CHR region
publication title Rational improvement of gp41-targeting HIV-1 fusion inhibitors: an innovatively designed Ile-Asp-Leu tail with alternative conformations
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 34
structure length 77
sequence length 79
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5hfmA00
1DF4A 1JQ0A 2M7WA 3H01A 1MG1A 5HFMA 3MHHC 1Y4MA 3B8MA 1I5YA 3GWOA 1I5XA 4G2KA 1DLBA 2LP7A 4JGSA 5H9CA 3WFVA 2EBOA 3MHSC 1QR9A 1DF5A 1MOFA 1Y66A 1JPXA 4JPRA 3CYOA 2MK3A 1QBZA 1ENVA 3CP1A 4FJCC 4FIPC 3M99B 5HFLA 4FK5C 3P30A 1F23A 4N21A 5KA5A 2EZPA 1EBOA 3B8NA 1QCEA 1SZTA 5CN0A 5CMUA 2P6JA 1K33A 2X7RB 3B77A 3K9AA 4N23A 1K34A 1QR8A 4JF3A 4E2LA 2EZOA 5KA6A 2OT5A
chains in the Genus database with same CATH superfamily
4H13B 2Y69C 3D36A 1SERA 1SA0B 2EINB 3GB7C 3L70H 2ITDC 1JPXA 1XBLA 4DR2O 2QKCA 4HNAA 4MW3A 4JTCB 1QQCA 1GM7A 1LUWA 2FKXA 1MSWD 2QM7A 1HNZO 4JI6O 2P22C 5L3GA 4JI1B 1E1QG 4H44B 3ASNB 4RUEA 1SQVH 2ZNIA 5J9PC 1I5YA 2JEUA 3LDEA 1K4DC 1G1XB 3JAWA 5IJ9B 2ZD9A 4X9QA 3G80A 4YJ2B 1S77D 1LUVA 3CYOA 2DWEC 1FXKC 2DQ3A 1JFFA 1Q82W 1TUEB 2AHZA 4J9ZB 2W0FC 3ETGA 3H1IH 2LW7A 4DV7O 1JOYA 3ZRWB 2GHYA 3OAAG 2Q0AA 3CC7V 4LP8A 3SJBC 4DW1A 2E76B 4I7ZB 1NS1A 1OCOB 3CX5F 4J9YB 4O4IA 3CCVV 4X8AA 1DTOA 4XBFA 4J7ZA 5BMVB 5B1AB 5J2UB 1P4RA 3DXRA 3JATA 5LOVB 3JD4A 1QHTA 2L6LA 4H37A 2EULA 2UUCB 3ZBHA 1YI2V 4W4LA 3WU2Z 2Y4UA 4TUYA 2LFSA 2YUAA 3K06A 2JJ1G 3APQA 4GLXA 3TJTA 1VQKV 3FB5C 2BTQB 1BMFG 2LO1A 4X88A 4O4LA 1BSMA 3TETA 4JI8B 4FLVA 2HVJC 2DW4A 2ETNA 4LFBO 1MABG 2WLNA 3JCZA 1P49A 4L8JA 4NXNO 3F5TA 2LW1A 1OV9A 4X62O 2BSKA 3P3PA 2NN4A 1YCIA 2Y0IA 2CDYA 4RWUA 2CTRA 2JGDA 2VRZA 1S5HC 4HNAB 4L87A 3RWRD 4YY3O 5AG2A 4WBNB 4DR3B 4FPPA 3OMAB 1VQ6V 5JVDA 3LDCA 3JCUZ 2Q6AA 1NQTA 1IXBA 4O4HB 4HAMA 3BABA 2HEPA 4AI8A 4KHPB 2K9PA 3JAWB 2QE7G 3J80N 5LHGA 2HHHO 4B08A 2D2CB 1QLEC 1L0NH 1YTFD 5BY1A 5KLVH 2WWWA 1JFFB 3CE2A 5L3BA 2PI5A 1US6A 2X0LA 5LGNA 1R1BA 3ZHSA 1M93A 4QGPA 3K5NA 4I50A 4XDJA 3LSUA 1NTMH 5C93A 1PM9A 5CBGA 5CBFA 1YJWV 4PA7A 3SJAC 4CZZA 2YSUB 4O4IB 5B5EZ 2DWDC 4LFAB 3FKSG 1AJQA 5J2TA 1GN6A 3CHXA 3RVYA 2RDCA 5IYCO 2YI8A 3DXRB 3JATB 4JI5B 3CCLV 2EZOA 4DUZO 5LMNO 3WG7B 4JYCA 5CB4A 3NXSA 4I0XB 5LL6Y 2IU0A 4TUYB 4DV4B 2F4VO 2BOCC 1K73W 3ZMTA 1ENVA 4GKKO 1YVWA 2DYRC 4LF7O 4O4LB 1NU1H 4LCUC 3QO7A 3C3SA 1PL4A 1THZA 1F51A 4UCTA 4LFCO 1KC8W 3T2MA 5LMUB 4DR4B 1S72V 2GUZA 2WPDG 2BSKB 4UVAA 1WNSA 4J7JA 4IYHA 1HNXB 4J7KA 2CH7A 3G6BA 1QVGU 2JGDB 1N34B 4UCOA 3JASA 3E89A 1YJ9V 4W4KA 3RYFA 2VWKA 3E8BA 2XAJA 5LBQA 2IH3C 1N0JA 1NZ6A 3ZN1A 2OTJV 4I9QA 4B3SO 3SGIA 1CXZB 5IYDO 3L71H 4TQDA 3ETQA 1HR0B 3QTCA 3AK3A 3F7VC 4RQEA 4ICGA 1K33A 3K9SA 1K34A 4NVPA 3CRAA 1ROPA 5LP6A 1YJNV 2EIJC 4PI2A 1JJ2U 2HVKC 2PZSA 1YITV 3KZIZ 5IWAO 2KKWA 4JV5O 4BW5A 4TT3G 4I50B 5GONA 4LWSA 4DR2B 4MVMA 3B77A 3ZHQA 5JQGA 4FM1A 2Q8VA 2UXCO 3G67A 4DR6O 3ETDA 1HNZB 1S76D 1VQOV 1ZLZA 2EILB 1XREA 4B7KA 1Q81W 3WFVA 1N32O 5J2TB 4DV5B 2BE3A 1B6QA 4OXSA 2JIZG 1YHQV 2Q4PA 5B3SC 1PKXA 4KUMA 2R72A 3K0DA 3ZMZA 5CB4B 4TV9B 4P9OA 4UVCA 1Y4MA 5E79Z 4I4TA 4X66O 4DV7B 2FTKA 5L3EA 3BY6A 3X2QC 4UXNA 5E1AC 2N04A 4Z1MG 1ZX3A 4UCUA 4DV0B 2B5UA 1SKVA 1Z5VA 3IC7A 4PELA 4U7NA 3BVOA 3BEHA 2EZPA 3AG4B 2XASA 4EB6A 2AZ0A 1R3IC 2GTSA 5LXTA 1BHAA 1VF7A 3U10A 4JI3O 3JD0A 2OCCB 2Q69A 3ZMUA 2GUZB 2RJZA 3JALA 3D8CA 2F43G 4CC5A 2CH7B 5KHKA 4MVUA 1OJHA 4DRXA 4KL1A 1KECA 3JASB 3IJ4A 3NR7A 3CCUV 2GBOA 2HFEC 1ZTEA 3ZMVA 1X4TA 3RYHA 4PV1B 1O9HA 2Z5UA 5IYZB 4FLYA 4X1YA 3SPCA 3TK1A 2ILMA 4JI7B 4PD4F 1DF5A 4NXNB 1GRJA 2YXLA 3T1HO 1EN5A 2JGUA 4DR7O 1N36O 3N2GA 4X62B 5D5QA 4B3TO 1XNRO 1YDXA 3HB3B 5LP6B 4BAYA 1S5LZ 2R9AA 4HYOA 1EN6A 1T5EA 1XNQO 4UFZA 3QNEA 3CCEV 5B1NA 3J7AU 4R8CA 3KCYA 2CAZC 1N4CA 4DV3O 1B06A 5GONB 4LWSB 5L3CA 2P67A 3SYCA 4DV2B 1IXMA 4YY3B 5JQGB 3E86A 4GKJO 1XL6A 1N0NA 4BIZA 1H2SB 3OUFA 5EK0A 1WLEA 4ZIBA 2BOBC 1XHXA 5EBWC 4BW9A 4JYAB 2YXYA 3JARA 3R65A 3AG3B 2HHHB 3KCXA 4CH3A 1AJNA 5GW7A 2KB1A 1OCZB 4PDVA 4YJ3A 1V55C 1OHHG 4R50A 4PA3A 2HJDA 4WFBV 1URFA 2A79B 3OT7A 4I4TB 1QNMA 1AI7A 2HG5C 3FX7A 4ZHQA 3H01A 3BHPA 1WA8A 2QKAA 2F23A 3K08A 4FFKA 2DJVA 1XDCA 4XDKA 3UCSC 4PA6A 4EB6B 2A3QA 3OR7C 1XMQO 4K35A 3AG1B 5LXTB 4CBCA 4GZRB 3OM3B 3QF7A 4WFAV 4WCEV 4MTOA 3JALB 2QWPB 3W7XA 1DF4A 3B4SA 2XAGA 4J41A 4DUZB 4DRXB 4EKWA 5H9CA 2A0LA 2YEVA 3LUTB 4G28B 2F4VB 5IT9N 2R9IA 3M7MX 3RYHB 4GKKB 2YI9A 1K92A 1WAZA 4ASUG 4LF7B 3ETEA 4D7TA 4FFBB 2HR3A 2YIDA 2RNBA 4K8XA 3STLC 5B1OA 4LFCB 1XQ8A 2ADPA 3F5WC 1OCCC 1BQZA 3TGUH 3N2KA 1CEZA 3N2GB 1FXVA 1IBKO 4X89A 1G8MA 2IU3A 3ABLC 3E2EA 3DTUB 4N21A 3H9VA 1NH2D 1IZ3A 1OCRC 2ZIOA 1VQMV 3ZN0A 1GH6A 5KHGA 4D6TH 1NH2B 5BR8O 4RAIA 1N33B 4JASA 3CRMA 1GN2A 2G38A 3OMNB 3GWOA 1GN3A 2LFRA 3AG2B 2DYSC 1AR5A 5DEDA 5K1PA 4HBNA 4B3SB 2WLHA 3K5LA 4PJ0Z 2UXDO 3OTOO 2FMLA 2EIKC 4MVRA 3JARB 4P30A 2V1DA 3H1LH 3SYOA 4O2AA 3IFXA 1V54C 1FS0G 4YJ3B 1RP3B 1W2BU 3RW0A 3ABMC 1KYOF 3S3XA 3APOA 2ZKOA 1XILA 1GAXA 4WFFA 5EIBC 2JRIA 1NR7A 2QWOB 5IWAB 1WB8A 1D5NA 1VQ4V 4LH6A 4JV5B 2E74B 3IGAC 1BL8A 1WA8B 2ZE6A 5CN0A 3S3WA 3FYEB 1JJOA 1YIJV 3T4ZA 4X64O 2QR4A 1KQSU 5KMGA 4LF4B 1GM8A 2UXCB 1HW7A 1H8EG 1NTZH 1AI4A 3VBBA 2E5LO 2RQ6A 2ZM6O 4JZ2A 3LNMB 2KQXA 1N32B 1SQQH 5CBHA 3VQYA 4ZOLA 2DQ0A 4YHHO 4UVBA 3RYIA 4P9PA 1R6KA 2YEVB 2VQEO 3A0RA 4FMTA 2FB5A 2WA4A 3DSQA 1VQ9V 4X66B 5LHHA 3AK2A 4H0LB 5JCOC 4CS3A 4D7SA 4FM0A 4FJCC 4B3RB 3ZRXA 1WPXA 1WB7A 2IBZH 4AQYO 1G6UA 1DGSA 4HZ3A 4JI3B 1SETA 2UUBO 1I7FA 5KHHA 5LGTA 2CGNA 3OW2U 4F6EA 2RMKB 3ICXA 4QE7A 3ASOB 2EIMB 1VEWA 1JCHA 3CC2V 2GSMB 1XHZA 3L74H 4GUNA 3CCMV 2PGGA 1HNWO 1ZL8A 4G2KA 2QKSA 4DV1O 3CCQV 1VIBA 2N05A 1GN4A 2XNDG 4TQFA 3M99B 1M57B 4K0KO 1D5AA 3T1HB 1FXKA 4JI0O 4O2AB 4DR7B 1N36B 1ZAUA 2PYLA 2HP8A 4B3TB 1XNRB 3HR0A 1RM1B 2CTWA 1I94O 1IURA 4PDRA 3ABKC 3DGEA 1WP8A 2OIEA 4CC6A 2ZXWC 2B1IA 4PI0A 2CUGA 1YTFB 3B40A 4JYBA 4EFEA 4OX9O 1QLNA 3OTFA 5KMGB 4GKJB 1QR8A 4NXMO 2CTQA 1FAFA 2CGOA 2OYQA 3T1YO 3ML0A 5C8YA 3CCJV 3MHSC 4MTFA 4ZOLB 3D3IA 3L73H 4J80A 1R6TA 1GMGA 4DV6B 4RUFA 1E79G 3RYIB 4TV8A 4GX1A 2R9RB 3E83A 4NTYA 1VQNV 4JI2O 1GTOA 5CA1A 2ADQB 4GX5A 1VF5B 3OEHG 5F2VO 4I9WA 4ZI7A 4TWKA 2X6BA 5IY5B 1M56C 4B3MO 1JR9A 2EBOA 1SZXA 1IDSA 2QTOA 2QGNA 2XT9A 3DC5A 3RGBA 2F93B 4LR3A 2UU9B 3RVZA 1PPJH 4X65O 1X59A 4UUJC 2ZDIC 3CSXA 1AI6A 4MVOA 4I5SA 2R70A 1M90W 2Y69B 1Q6UA 3PJSK 3P3NA 3HKCA 3TCUA 2X6CA 5LA6A 1NTKH 4LF5O 1XEQA 1KMIZ 3K5OA 2XOKG 4JPRA 3FB8C 2ITCC 2PUSA 5IJ0A 1G4YB 1SS3A 1P84F 1ZL8B 3O9OA 1XOUA 1N8RW 3VQWA 3K79A 3O65A 5EIBD 3UT5A 2VWJA 4JGSA 5IYBO 3J81N 5KAFZ 3CS5A 5JVDB 1Y76A 1L1FA 1BS3A 4MT8A 3CMEV 1FXKB 4FLXA 4BR6A 4NB5A 4LF9O 3OGIB 1H2LA 3OEEG 4LH7A 5BR8B 5B66Z 1PV0A 4JZGA 3SR2C 4WFHA 1H2NA 1RPRA 1AP6A 4IHJA 3RT3C 4FIPC 2P4KA 5JJJB 5A9GA 3L9DA 5EC1C 4F4LA 3OTOB 2OIGA 5ITZA 1KBHA 3JYCA 3C3TA 3JSNA 5DECA 5C8YB 4K3AA 4JI6B 3WB1A 3BRCA 4EEQA 1F7YA 1TVKA 3CRRA 4TV8B 3CP1A 1UPGA 5CA1B 2JS3A 5B1BC 3ZRSA 1EN4A 3UO2A 4F6RA 2FYUH 1BHBA 1J95A 3RFRA 3ZHVA 4ZI7B 3W7WA 5FLXN 4E2LA 2WLKA 3QO8A 1SF9A 2PI4A 3QG5A 4U3JA 1YSCA 5D5PA 3A8TA 4X64B 2YDEA 3WB0A 2LGWA 3F7YC 2E5LB 4MTXA 2EINC 1NKDA 1KUQA 2K1EA 4KFMA 1U96A 1VF6C 4GYCB 3HKCB 2ATKC 4LF8O 1YF2A 1AB3A 2GV9A 3CMAV 5LA6B 4YHHB 2JEXA 3T1CA 3OFNG 3ASNC 4OGQB 1I5XA 2VQEB 1MZEA 5FL7G 2Q7EA 1ZUQA 5IJ0B 1YZBA 3L75H 1ZWIC 1K7DA 1SZTA 2RCVA 3RYFB 4JI8O 1RPOA 3K9AA 3UT5B 2QA4V 3G4SV 5JH7A 2WSSG 3DC6A 2IJHA 5GTIZ 4AQYB 5FPRA 1QLEB 1Y76B 1GM9A 4LFBB 1MNGA 2UUBB 4FLTA 3FAVA 1OCOC 1Q86W 3Q4HA 3I55V 1GKFA 2OT5A 1YEWA 5B1AC 1GO3F 1GK9A 5HFMA 1EM1A 4IHJB 2LP7A 1KP2A 1HNWB 1CPYA 1Y67A 1Y66A 2QWQB 3JAKA 3KG2A 1R3KC 1E1RG 5FPOA 1H2KA 2B1GA 4BIUA 5ITZB 5KA5A 1FYJA 3LDDA 4LNUA 2PTMA 3THOA 3JD3A 2P7TC 1J5EO 2JVDA 4DR1O 3STZC 1PNLA 3A0HZ 2QEXV 1F4NA 1WP7A 4UB6Z 1TVKB 1I94B 1YXBA 3P32A 2C2AA 2ZE5A 4QPJA 3BPZA 5H6RA 1S3JA 4F6RB 2DYRB 2NR5A 4YIPA 3ABTA 1K97A 4CS2A 1R6NA 2YXHA 4WFEA 4A5UB 4U3JB 4OX9B 1MSDA 4CH6A 3D36C 3K5MA 1NJIW 4NXMB 2ZQMA 4JAUA 4IGGA 3T1YB 3FB7C 1VARA 4MVSA 2WLIA 1VQ8V 1MOFA 1OZ0A 1BCCH 4R7CA 4IYIA 1F23A 3RYCA 4WF9V 2CTPA 4UCVA 1NR1A 4JI5O 3TXSA 2IJKA 3OUSA 3R66A 1DK1A 1W0KG 2QWNB 3PN1A 3T4DA 1Z2GA 5CA3A 5EBMC 2ARHA 1SRYA 4O4JA 3H1JH 5LMNB 1MA1A 4B3MB 3N27A 4QNHB 3SPJA 2GDSA 3CC4V 2HLDG 1TAEA 3CPWU 1JMKC 3FYIB 5JH7B 4JAAA 1NVPD 4CH4A 4X65B 1CP9A 1M5IA 4X1YB 4FZ0A 4DR4O 1K9MW 3LSQA 1M1KW 5BMVA 1H2MA 2EIJB 5EBLC 5FNVA 3FAVB 4Q6GA 1HWYA 2OCHA 3A0BZ 4X20A 1QR9A 4DUYO 2QSAA 3MD0A 3TXQA 3Q4HB 1AILA 2IM9A 5IDJA 3OE7G 1FJGO 1K3EA 2XHBA 2DN9A 1AJPA 4BIOA 4DXWA 3MHHC 4OPHA 4QE9A 4FLWA 3QO5A 3WG7C 3JAKB 3H1KH 1R3JC 4GT1A 2YC0A 4FVMA 1HR0O 4LNUB 1EZVH 5A2QN 4FZ1A 1Q3EA 4MSWC 4PA4A 3FD9A 5EYPA 4LF9B 2WA3A 5BXZA 2GTAA 4NR1A 3U0ZA 2DE0X 3SYPA 4FLUA 3X2QB 1Q5OA 2E3CA 3UO3A 3E8FA 4PDLA 1VP7A 3G6EV 2QDOA 5GTHZ 4DK0A 4G27B 1FXHA 3M8AA 4WBNA 2HJFC 4IIJA 2ZT9B 4ZHQB 4O4HA 4QIWF 3SPHA 2UUAO 1UFIA 2ZINA 2WLIB 2QWRB 4DV5O 4DR6B 5KAIZ 4X1IA 2A06H 1KP3A 4ZKIA 1AVMA 3OD4A 2FL4A 3RYCB 2IH1C 3SJCC 1R3LC 2UXBO 3CXCU 2LGQA 4LF6O 4OPAA 1RFYA 4GX0A 4C7UA 4O4JB 4H33A 5LHIA 2MW2B 3BA8A 3EVKA 4PDMA 4LBEC 4DV0O 4IT5A 4O2BA 3W7TA 2AHYA 4ABMA 1IX9A 1XMOO 1H38A 2ODMA 3BCCH 3K59A 4UB8Z 3RBZA 2P06A 2AXTZ 2CE4A 1WN7A 3K58A 5DN6G 5FNVB 4PHZA 2BCCH 1ZSPA 4LF8B 3UKMA 2M7WA 2IW5A 2EJ7A 3SYQA 3WB2A 3N2KB 4X20B 2NNUA 3A2FA 1LNQA 2EILC 1L0LH 3ZEDA 4I0XA 4P2ZA 1K8AW 3SDLA 3CRCA 3JAMN 2Z3YA 2Q7HA 3SYAA 1I0HA 1JVMA 3SPGA 3UM7A 4JI4O 3E35A 1LR1A 3FFQA 4DR5O 2ZE7A 4GCZA 2YIBA 5KHIA 2WAMA 4JI7O 2AZ2A 4TOIA 1V55B 4J10A 2Q73A 2LJ2A 2O57A 5EYPB 2H94A 4KP4A 2VQFO 1K5QA 3E8GA 1SQBH 1Q6IA 3JSLA 4U7OA 4AILC 2RN9A 3AG4C 2P6JA 2UXNA 3E8HA 1BQ0A 1BGYH 1QU7A 1M9NA 4DK1A 2KG7A 2EJRA 2Q67A 4Q20A 1F4MA 3ZIAG 2OCCC 2PY5A 2KSDA 1XNQB 4NTXA 1RSOA 4AHCA 2Q9LA 4DV2O 2XAFA 1EFRG 4Z2WA 1B3QA 4IIJB 3U11A 3ABUA 2MK3A 1Q7YW 1Q8IA 4DV3B 4CH5A 3QVNA 2OWOA 1O9GA 4YXWG 4PA9A 4UCRA 5H6QA 4IL6Z 3W7UA 3CCSV 4JTDB 4JYAO 4JF3A 4X1IB 4FM2A 1KB9F 2W6JG 1J5EB 2QTSA 2DMXA 2HKOA 4DR1B 3D3QA 3K3WA 4TSFG 2ZE8A 5CA0A 5LYJA 2F1MA 4CS4A 2OTLV 1WJZA 1BT8A 5KUKA 2P5OA 5JCOA 3EHBB 2UXXA 1KU9A 3MDSA 3B8NA 2Z0AA 3IAYA 2X7RB 5IE9A 5LP6C 1HP8A 1TGOA 3K04A 3HKEA 4O2BB 1OCCB 1H2GA 1Y74A 5K1XA 2JJ2G 2VS0A 3ABLB 1SESA 2ZR3A 3OMIB 1OCRB 1IBLO 1XMQB 2ZR2A 1VQ7V 2W6IG 3CWBH 1VQPV 5KA6A 5JJNB 1QVFU 3OGCC 2Q7GA 4MVZA 4TV9A 2DYSB 3AG3C 4DYLA 1TUBA 4I55A 3E22A 2ZCEA 1OCZC 1K5SA 4Z1VA 4UCSA 2EIKB 2YIBD 1Q43A 2JDIG 5CMUA 5L3DA 3ZJZA 1IBMO 1P7BA 3KKYA 4MVQA 1S0VA 1V54B 1SQFA 3C90A 3BFRA 1PNKA 1W59A 3K0GA 3ABMB 2Y0PA 4J11A 1JA8A 4LC1A 3AG7A 1S5JA 4DW0A 4DUYB 4XDLA 1IBKB 2WLLA 3AG1C 1FJGB 2XTAA 1M4UA 3AK1A 1N33O 2KG7B 3VOUA 4J42A 3IC9A 1RSOB 2M6YA 2P4VA 5IYZA 3GVMA 1W0JG 5KHJA 2Y48A 1FFTB 1HDJA 5EC2C 4E4EA 2F66C 2PYJA 1KKCA 2NLJC 5KX5A 3H1HH 4JI1O 2UXDB 4EFBA 1JQ0A 5CA0B 4QPKA 5LYJB 1FFXA 5KUMA 1AR1B 1B04A 2P90A 3SPIA 2Q0OC 2E75B 5HFLA 1L8DA 1EZJA 2ZNJA 3HKEB 2W0XA 2Q68A 4U3FH 2ZDIA 4LF4O 2IJJA 3VQVA 3HKDA 2N74A 1Y74B 5DM6V 3B8MA 1ORQC 4UV9A 2UUAB 3W7SA 3ZHUA 3FB6C 1PD3A 3AG2C 2ZM6B 2JS5A 1AROP 1BE3H 1I08A 2L35A 1PNMA 2UXBB 4LF6B 2EX3A 3B09A 1NT2B 2AW9A 4NTWA 1TUBB 2AGAA 2UUCO 4I55B 3BA9A 3E22B 3LNNA 1BZKA 2YICA 3ZX6A 3HKBA 1DLBA 3ZMSA 3CEIA 4B3RO 1XI1A 1KD1W 3I5DA 1XMOB 2ZIMA 1WPBA 4YIOA 2WLMA 1QCEA 5LGUA 1XL4A 3ABKB 2ZXWB 2D3OW 1VQLV 4MS2A 5JJEB 3GWKC 2BTOA 2WLLB 2F95B 2QM4A 5EZYA 3VQXA 2XAQA 2Q5ZA 3B2EE 4RO2A 4JI4B 2IJIA 4WFGA 4X1KA 1SC5B 4FFBA 4DR5B 1IVSA 4JAVA 3EXAA 1SQXH 4DR3O 3CJHA 2H3OA 4DV1B 5H2FZ 1Y6XA 5KX5B 5L3FA 2VQFB 4KHPO 3UQ8A 1FFXB 4K0KB 1AP5A 4BWAA 1A32A 4JI0B 3SJQC 1JX9A 1VMGA 1M56B 1XUQA 3ZCCA 4NKGB 1KKDA 3HPLC 5BZBA 3RN4A 2B9ZA 4R6ZA 1SA0A 1VQ5V 4FLZA 3K57A 2WLJA 2A7WA 3HKDB 4QJFB 4MW8A 1VF6A 1SQPH 3JD2A 3ZHRA 3ASOC 2EIMC 2QJ1A 5TISZ 1PL0A 3ZRVA 3CXHF 4LFAO 1V9PA 4DV6O 1COWG 1SQGA 1AI5A 3CRQA 1Q6HA 4MTGA 5IJ9A 3G71V 3P30A 4YJ2A 4NYKA 1FPOA 1M57C 1EBOA 2V4DA 3ZS8C 4DO2A 1H8HG 4N23A 3I56V 1PP9H 1MMMA 3AEIA 4ZBMA 4JI2B 3HKBB 1MZFA 1D2DA 1RM1C 1NBMG 2H8PC 4DV4O 5H5NA 1NI8A 3ZHTA 2XAHA 3ZRWA 1FKAO 2Y4TA 2UU9O 4K8ZA 4UV8A 3JD1A 3LSSA 4B7EA 1K4CC 2PF4E 1Z5WA 3L72H 2CK3G 1P7GA 2JK5C 1IBLB 1NVPB 2QM8A 5LMUO 2LQTA 2YIAA 5J2UA 3CB2A 5LOVA 4LF5B 3CCRV 5EZYB 3MAQA 1HNXO 2V7QG 3CD6V 1R73A 1QBZA 2DOSA 5JWPA 4JYYA 4FK5C 2XUMA 1N34O 4X1KB 2A9HA 4JTAB 2YS8A 3BAAA 1IBMB 1AR4A 2X6AA 1MG1A 2BTQA 3CJHB 4KXRA 4GX2A 1TA8A 5IY5C 1UJWB 4RQFA 5B1BB 5B3SB 3EFFK 1Q90D 1U97A 3K03A 3OR6C 1FD9A
chains in the Genus database with same CATH topology
1M9NA 2Y69C 2EJRA 2Q67A 4Q20A 1F4MA 3ZIAG 3D36A 3QNEA 2OCCC 3CCEV 5B1NA 1SERA 4R8CA 4WFHA 2XAFA 2EINB 1RPRA 1EFRG 2P67A 3GB7C 3SYCA 5L3CA 2ITDC 1JPXA 3ABUA 2MK3A 1Q7YW 4FIPC 4MW3A 1IXMA 4JTCB 1GM7A 3E86A 1MSWD 4YXWG 4PA9A 2QM7A 1XL6A 5EC1C 4BIZA 5H6QA 3W7UA 4F4LA 3CCSV 4JTDB 3OUFA 5EK0A 1WLEA 4JF3A 5L3GA 3JYCA 2W6JG 1E1QG 2BOBC 5EBWC 3ASNB 2HKOA 3K3WA 4RUEA 3R65A 5J9PC 3AG3B 1I5YA 2JEUA 3LDEA 1K4DC 4TSFG 1AJNA 5GW7A 2ZD9A 2KB1A 1OCZB 2OTLV 4PDVA 1V55C 5KUKA 1S77D 3CYOA 3CP1A 1OHHG 2DWEC 1FXKC 2DQ3A 3EHBB 4R50A 4PA3A 2UXXA 5B1BC 3ZRSA 1Q82W 1TUEB 2AHZA 3B8NA 4WFBV 1BHBA 4J9ZB 2W0FC 1J95A 2A79B 2X7RB 3W7WA 4E2LA 2WLKA 3ETGA 1AI7A 3QO8A 2HG5C 2PI4A 3H01A 3K04A 1YSCA 1JOYA 1OCCB 3ZRWB 2GHYA 3OAAG 3CC7V 3F7YC 1H2GA 4LP8A 3K08A 4MTXA 4XDKA 2JJ2G 3ABLB 1OCOB 2EINC 1NKDA 3OR7C 4J9YB 1SESA 2ZR3A 4PA6A 2K1EA 3AG1B 4KFMA 3OMIB 1OCRB 4X8AA 4CBCA 1DTOA 3CCVV 3OM3B 2ZR2A 4XBFA 1VQ7V 4WFAV 2ATKC 4WCEV 4MTOA 3CMAV 2W6IG 5B1AB 1VQPV 5KA6A 3W7XA 1DF4A 1P4RA 2JEXA 1QVFU 3OGCC 3T1CA 3JD4A 2XAGA 3OFNG 4MVZA 4H37A 3ASNC 1I5XA 2DYSB 3AG3C 5H9CA 5FL7G 4EKWA 2A0LA 1YI2V 2YEVA 3LUTB 4G28B 1OCZC 1K5SA 2LFSA 2R9IA 3K06A 2JJ1G 2EIKB 1ZWIC 1K7DA 1SZTA 1K92A 4ASUG 1VQKV 2JDIG 3FB5C 5CMUA 5L3DA 3ETEA 3ZJZA 1RPOA 1BMFG 4X88A 1P7BA 3K9AA 4MVQA 1S0VA 2HR3A 2QA4V 3G4SV 3TETA 1V54B 3STLC 2WSSG 5B1OA 1PNKA 2HVJC 2DW4A 2IJHA 1QLEB 3K0GA 3ABMB 1MABG 1OCCC 3F5WC 2WLNA 1GM9A 3JCZA 1CEZA 4LC1A 1FXVA 4X89A 1G8MA 2IU3A 3ABLC 4XDLA 1OCOC 3E2EA 3DTUB 4N21A 1NH2D 1Q86W 2WLLA 3AG1C 1OCRC 1VQMV 3ZN0A 1NH2B 3I55V 3VOUA 1GKFA 2OT5A 4RAIA 5B1AC 1GO3F 1GK9A 4JASA 5HFMA 3OMNB 1S5HC 3GWOA 2LFRA 2LP7A 1KP2A 3AG2B 2DYSC 1W0JG 1CPYA 4L87A 1Y66A 2WLHA 2Y48A 1FFTB 4FPPA 3KG2A 3OMAB 1R3KC 1E1RG 1VQ6V 3LDCA 2Q6AA 2B1GA 1NQTA 4BIUA 5EC2C 5KA5A 3LDDA 2EIKC 4HAMA 4MVRA 3JD3A 2NLJC 2P7TC 2V1DA 4P30A 1JQ0A 3STZC 4QPKA 2QE7G 3SYOA 1PNLA 2QEXV 1F4NA 5KUMA 5LHGA 3IFXA 1V54C 1FS0G 1AR1B 1QLEC 3P32A 4QPJA 2C2AA 2P90A 3SPIA 1W2BU 3RW0A 3ABMC 1YTFD 5H6RA 2WWWA 1S3JA 4WFFA 5L3BA 1NR7A 2DYRB 2PI5A 1VQ4V 2X0LA 3ABTA 5HFLA 5LGNA 1K97A 3IGAC 1R6NA 1BL8A 4WFEA 5CN0A 1EZJA 3FYEB 2Q68A 2ZDIA 1YIJV 4XDJA 3T4ZA 2IJJA 1NJIW 1KQSU 1GM8A 2ZQMA 5DM6V 3B8MA 1H8EG 4JAUA 1AI4A 1ORQC 5C93A 3VBBA 4UV9A 5CBGA 5CBFA 1YJWV 4PA7A 4CZZA 2YSUB 3FB7C 3W7SA 3LNMB 4MVSA 2WLIA 2DWDC 1VQ8V 3FB6C 1PD3A 1MOFA 1AJQA 3FKSG 1OZ0A 3AG2C 4R7CA 5CBHA 3RVYA 1AROP 1F23A 4WF9V 1NR1A 5IYCO 1PNMA 2DQ0A 2IJKA 3OUSA 4UVBA 3CCLV 2EZOA 1W0KG 4P9PA 1R6KA 3T4DA 3WG7B 5CA3A 2YEVB 3A0RA 4FMTA 5EBMC 1SRYA 4JYCA 3NXSA 1DLBA 3ZMSA 2IU0A 1VQ9V 5LHHA 2BOCC 4QNHB 3SPJA 1K73W 3CC4V 1KD1W 2HLDG 3ZMTA 1ENVA 4FJCC 2DYRC 3ZRXA 1WPXA 3CPWU 3FYIB 2WLMA 1QCEA 1NVPD 4LCUC 3QO7A 1CP9A 1F51A 1THZA 5LGUA 1XL4A 1K9MW 3LSQA 1M1KW 4HZ3A 2EIJB 5EBLC 3T2MA 1KC8W 3ABKB 2ZXWB 1SETA 2D3OW 1VQLV 4MS2A 1S72V 1HWYA 1QR9A 5LGTA 3MD0A 2WPDG 2WLLB 3OW2U 4UVAA 5IDJA 3OE7G 1K3EA 1QVGU 2XAQA 4QE7A 3ASOB 2EIMB 3E89A 1AJPA 4RO2A 1YJ9V 1JCHA 4DXWA 2IJIA 4WFGA 3CC2V 2GSMB 3E8BA 2XAJA 3CCMV 3MHHC 4QE9A 2IH3C 5LBQA 3QO5A 3WG7C 4JAVA 3ZN1A 2OTJV 4G2KA 2QKSA 1R3JC 4GT1A 3CCQV 5IYDO 2XNDG 3M99B 1M57B 5L3FA 3F7VC 4MSWC 1FXKA 4PA4A 4RQEA 1K33A 1K34A 1RM1B 3SJQC 1ROPA 1JX9A 1YJNV 3SYPA 1M56B 3X2QB 2EIJC 3ZCCA 1JJ2U 2HVKC 4PDRA 3ABKC 1YITV 3DGEA 3E8FA 4PDLA 1KKDA 2ZXWC 2B1IA 3HPLC 5BZBA 3G6EV 1YTFB 4BW5A 4R6ZA 4JYBA 4TT3G 4G27B 1FXHA 1VQ5V 2HJFC 2WLJA 1QLNA 4MVMA 4QJFB 4MW8A 3B77A 3JD2A 1QR8A 3ASOC 2EIMC 3ETDA 4QIWF 1PL0A 3SPHA 1S76D 1VQOV 2WLIB 2EILB 3ZRVA 3ML0A 1Q81W 3WFVA 1KP3A 4ZKIA 3CCJV 3MHSC 1B6QA 4MTFA 4OXSA 2JIZG 1COWG 3D3IA 1YHQV 1AI5A 2IH1C 4MTGA 3G71V 1GMGA 3P30A 4RUFA 5B3SC 1R3LC 1E79G 3CXCU 1M57C 1EBOA 4GX1A 2R9RB 1PKXA 3E83A 4KUMA 1VQNV 4GX0A 1GTOA 4DO2A 1H8HG 4N23A 3K0DA 3ZMZA 3I56V 4GX5A 4H33A 3AEIA 4ZBMA 3OEHG 4P9OA 5LHIA 4UVCA 4I9WA 4TWKA 1Y4MA 1RM1C 2X6BA 4PDMA 5IY5B 1NBMG 4LBEC 1M56C 2H8PC 2FTKA 5L3EA 3BY6A 3X2QC 4UXNA 5E1AC 3W7TA 2EBOA 2XAHA 4Z1MG 2AHYA 2QTOA 3ZRWA 2B5UA 1H38A 4UV8A 3JD1A 3LSSA 3IC7A 4PELA 4U7NA 1K4CC 3BEHA 3RVZA 2EZPA 3AG4B 3RBZA 2ZDIC 4UUJC 1AI6A 4MVOA 2XASA 4I5SA 2CK3G 5DN6G 1R3IC 2JK5C 1NVPB 2QM8A 1M90W 2Y69B 1BHAA 3UKMA 2M7WA 3JD0A 3PJSK 2IW5A 2OCCB 3SYQA 2Q69A 3ZMUA 2NNUA 3TCUA 2X6CA 2F43G 1LNQA 2EILC 3CCRV 4P2ZA 2XOKG 1K8AW 2V7QG 4MVUA 4JPRA 3CD6V 1KECA 1QBZA 1R73A 3FB8C 2Z3YA 4FK5C 3SYAA 2ITCC 1JVMA 3SPGA 3CCUV 3UM7A 3E35A 1G4YB 2A9HA 2HFEC 3ZMVA 4JTAB 2Z5UA 4GCZA 2X6AA 1N8RW 1MG1A 3K79A 2WAMA 3SPCA 4GX2A 4JGSA 5IYBO 5IY5C 3TK1A 1V55B 1UJWB 1L1FA 1DF5A 4MT8A 3CMEV 1FXKB 4RQFA 2H94A 4KP4A 5B1BB 3EFFK 5B3SB 1K5QA 3E8GA 4U7OA 3HB3B 3K03A 3AG4C 2P6JA 2UXNA 3E8HA 4BAYA 3OR6C 3OEEG 4HYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF4 A;  1JQ0 A;  2M7W A;  3H01 A;  1MG1 A;  5HFM A;  3MHH C;  1Y4M A;  3B8M A;  1I5Y A;  3GWO A;  1I5X A;  4G2K A;  1DLB A;  2LP7 A;  4JGS A;  5H9C A;  3WFV A;  2EBO A;  3MHS C;  1QR9 A;  1DF5 A;  1MOF A;  1Y66 A;  1JPX A;  4JPR A;  3CYO A;  2MK3 A;  1QBZ A;  1ENV A;  3CP1 A;  4FJC C;  4FIP C;  3M99 B;  5HFL A;  4FK5 C;  3P30 A;  1F23 A;  4N21 A;  5KA5 A;  2EZP A;  1EBO A;  3B8N A;  1QCE A;  1SZT A;  5CN0 A;  5CMU A;  2P6J A;  1K33 A;  2X7R B;  3B77 A;  3K9A A;  4N23 A;  1K34 A;  1QR8 A;  4JF3 A;  4E2L A;  2EZO A;  5KA6 A;  2OT5 A; 
#chains in the Genus database with same CATH topology
 4H13 B;  2Y69 C;  3D36 A;  1SER A;  1SA0 B;  2EIN B;  3GB7 C;  3L70 H;  2ITD C;  1JPX A;  1XBL A;  4DR2 O;  2QKC A;  4HNA A;  4MW3 A;  4JTC B;  1QQC A;  1GM7 A;  1LUW A;  2FKX A;  1MSW D;  2QM7 A;  1HNZ O;  4JI6 O;  2P22 C;  5L3G A;  4JI1 B;  1E1Q G;  4H44 B;  3ASN B;  4RUE A;  1SQV H;  2ZNI A;  5J9P C;  1I5Y A;  2JEU A;  3LDE A;  1K4D C;  1G1X B;  3JAW A;  5IJ9 B;  2ZD9 A;  4X9Q A;  3G80 A;  4YJ2 B;  1S77 D;  1LUV A;  3CYO A;  2DWE C;  1FXK C;  2DQ3 A;  1JFF A;  1Q82 W;  1TUE B;  2AHZ A;  4J9Z B;  2W0F C;  3ETG A;  3H1I H;  2LW7 A;  4DV7 O;  1JOY A;  3ZRW B;  2GHY A;  3OAA G;  2Q0A A;  3CC7 V;  4LP8 A;  3SJB C;  4DW1 A;  2E76 B;  4I7Z B;  1NS1 A;  1OCO B;  3CX5 F;  4J9Y B;  4O4I A;  3CCV V;  4X8A A;  1DTO A;  4XBF A;  4J7Z A;  5BMV B;  5B1A B;  5J2U B;  1P4R A;  3DXR A;  3JAT A;  5LOV B;  3JD4 A;  1QHT A;  2L6L A;  4H37 A;  2EUL A;  2UUC B;  3ZBH A;  1YI2 V;  4W4L A;  3WU2 Z;  2Y4U A;  4TUY A;  2LFS A;  2YUA A;  3K06 A;  2JJ1 G;  3APQ A;  4GLX A;  3TJT A;  1VQK V;  3FB5 C;  2BTQ B;  1BMF G;  2LO1 A;  4X88 A;  4O4L A;  1BSM A;  3TET A;  4JI8 B;  4FLV A;  2HVJ C;  2DW4 A;  2ETN A;  4LFB O;  1MAB G;  2WLN A;  3JCZ A;  1P49 A;  4L8J A;  4NXN O;  3F5T A;  2LW1 A;  1OV9 A;  4X62 O;  2BSK A;  3P3P A;  2NN4 A;  1YCI A;  2Y0I A;  2CDY A;  4RWU A;  2CTR A;  2JGD A;  2VRZ A;  1S5H C;  4HNA B;  4L87 A;  3RWR D;  4YY3 O;  5AG2 A;  4WBN B;  4DR3 B;  4FPP A;  3OMA B;  1VQ6 V;  5JVD A;  3LDC A;  3JCU Z;  2Q6A A;  1NQT A;  1IXB A;  4O4H B;  4HAM A;  3BAB A;  2HEP A;  4AI8 A;  4KHP B;  2K9P A;  3JAW B;  2QE7 G;  3J80 N;  5LHG A;  2HHH O;  4B08 A;  2D2C B;  1QLE C;  1L0N H;  1YTF D;  5BY1 A;  5KLV H;  2WWW A;  1JFF B;  3CE2 A;  5L3B A;  2PI5 A;  1US6 A;  2X0L A;  5LGN A;  1R1B A;  3ZHS A;  1M93 A;  4QGP A;  3K5N A;  4I50 A;  4XDJ A;  3LSU A;  1NTM H;  5C93 A;  1PM9 A;  5CBG A;  5CBF A;  1YJW V;  4PA7 A;  3SJA C;  4CZZ A;  2YSU B;  4O4I B;  5B5E Z;  2DWD C;  4LFA B;  3FKS G;  1AJQ A;  5J2T A;  1GN6 A;  3CHX A;  3RVY A;  2RDC A;  5IYC O;  2YI8 A;  3DXR B;  3JAT B;  4JI5 B;  3CCL V;  2EZO A;  4DUZ O;  5LMN O;  3WG7 B;  4JYC A;  5CB4 A;  3NXS A;  4I0X B;  5LL6 Y;  2IU0 A;  4TUY B;  4DV4 B;  2F4V O;  2BOC C;  1K73 W;  3ZMT A;  1ENV A;  4GKK O;  1YVW A;  2DYR C;  4LF7 O;  4O4L B;  1NU1 H;  4LCU C;  3QO7 A;  3C3S A;  1PL4 A;  1THZ A;  1F51 A;  4UCT A;  4LFC O;  1KC8 W;  3T2M A;  5LMU B;  4DR4 B;  1S72 V;  2GUZ A;  2WPD G;  2BSK B;  4UVA A;  1WNS A;  4J7J A;  4IYH A;  1HNX B;  4J7K A;  2CH7 A;  3G6B A;  1QVG U;  2JGD B;  1N34 B;  4UCO A;  3JAS A;  3E89 A;  1YJ9 V;  4W4K A;  3RYF A;  2VWK A;  3E8B A;  2XAJ A;  5LBQ A;  2IH3 C;  1N0J A;  1NZ6 A;  3ZN1 A;  2OTJ V;  4I9Q A;  4B3S O;  3SGI A;  1CXZ B;  5IYD O;  3L71 H;  4TQD A;  3ETQ A;  1HR0 B;  3QTC A;  3AK3 A;  3F7V C;  4RQE A;  4ICG A;  1K33 A;  3K9S A;  1K34 A;  4NVP A;  3CRA A;  1ROP A;  5LP6 A;  1YJN V;  2EIJ C;  4PI2 A;  1JJ2 U;  2HVK C;  2PZS A;  1YIT V;  3KZI Z;  5IWA O;  2KKW A;  4JV5 O;  4BW5 A;  4TT3 G;  4I50 B;  5GON A;  4LWS A;  4DR2 B;  4MVM A;  3B77 A;  3ZHQ A;  5JQG A;  4FM1 A;  2Q8V A;  2UXC O;  3G67 A;  4DR6 O;  3ETD A;  1HNZ B;  1S76 D;  1VQO V;  1ZLZ A;  2EIL B;  1XRE A;  4B7K A;  1Q81 W;  3WFV A;  1N32 O;  5J2T B;  4DV5 B;  2BE3 A;  1B6Q A;  4OXS A;  2JIZ G;  1YHQ V;  2Q4P A;  5B3S C;  1PKX A;  4KUM A;  2R72 A;  3K0D A;  3ZMZ A;  5CB4 B;  4TV9 B;  4P9O A;  4UVC A;  1Y4M A;  5E79 Z;  4I4T A;  4X66 O;  4DV7 B;  2FTK A;  5L3E A;  3BY6 A;  3X2Q C;  4UXN A;  5E1A C;  2N04 A;  4Z1M G;  1ZX3 A;  4UCU A;  4DV0 B;  2B5U A;  1SKV A;  1Z5V A;  3IC7 A;  4PEL A;  4U7N A;  3BVO A;  3BEH A;  2EZP A;  3AG4 B;  2XAS A;  4EB6 A;  2AZ0 A;  1R3I C;  2GTS A;  5LXT A;  1BHA A;  1VF7 A;  3U10 A;  4JI3 O;  3JD0 A;  2OCC B;  2Q69 A;  3ZMU A;  2GUZ B;  2RJZ A;  3JAL A;  3D8C A;  2F43 G;  4CC5 A;  2CH7 B;  5KHK A;  4MVU A;  1OJH A;  4DRX A;  4KL1 A;  1KEC A;  3JAS B;  3IJ4 A;  3NR7 A;  3CCU V;  2GBO A;  2HFE C;  1ZTE A;  3ZMV A;  1X4T A;  3RYH A;  4PV1 B;  1O9H A;  2Z5U A;  5IYZ B;  4FLY A;  4X1Y A;  3SPC A;  3TK1 A;  2ILM A;  4JI7 B;  4PD4 F;  1DF5 A;  4NXN B;  1GRJ A;  2YXL A;  3T1H O;  1EN5 A;  2JGU A;  4DR7 O;  1N36 O;  3N2G A;  4X62 B;  5D5Q A;  4B3T O;  1XNR O;  1YDX A;  3HB3 B;  5LP6 B;  4BAY A;  1S5L Z;  2R9A A;  4HYO A;  1EN6 A;  1T5E A;  1XNQ O;  4UFZ A;  3QNE A;  3CCE V;  5B1N A;  3J7A U;  4R8C A;  3KCY A;  2CAZ C;  1N4C A;  4DV3 O;  1B06 A;  5GON B;  4LWS B;  5L3C A;  2P67 A;  3SYC A;  4DV2 B;  1IXM A;  4YY3 B;  5JQG B;  3E86 A;  4GKJ O;  1XL6 A;  1N0N A;  4BIZ A;  1H2S B;  3OUF A;  5EK0 A;  1WLE A;  4ZIB A;  2BOB C;  1XHX A;  5EBW C;  4BW9 A;  4JYA B;  2YXY A;  3JAR A;  3R65 A;  3AG3 B;  2HHH B;  3KCX A;  4CH3 A;  1AJN A;  5GW7 A;  2KB1 A;  1OCZ B;  4PDV A;  4YJ3 A;  1V55 C;  1OHH G;  4R50 A;  4PA3 A;  2HJD A;  4WFB V;  1URF A;  2A79 B;  3OT7 A;  4I4T B;  1QNM A;  1AI7 A;  2HG5 C;  3FX7 A;  4ZHQ A;  3H01 A;  3BHP A;  1WA8 A;  2QKA A;  2F23 A;  3K08 A;  4FFK A;  2DJV A;  1XDC A;  4XDK A;  3UCS C;  4PA6 A;  4EB6 B;  2A3Q A;  3OR7 C;  1XMQ O;  4K35 A;  3AG1 B;  5LXT B;  4CBC A;  4GZR B;  3OM3 B;  3QF7 A;  4WFA V;  4WCE V;  4MTO A;  3JAL B;  2QWP B;  3W7X A;  1DF4 A;  3B4S A;  2XAG A;  4J41 A;  4DUZ B;  4DRX B;  4EKW A;  5H9C A;  2A0L A;  2YEV A;  3LUT B;  4G28 B;  2F4V B;  5IT9 N;  2R9I A;  3M7M X;  3RYH B;  4GKK B;  2YI9 A;  1K92 A;  1WAZ A;  4ASU G;  4LF7 B;  3ETE A;  4D7T A;  4FFB B;  2HR3 A;  2YID A;  2RNB A;  4K8X A;  3STL C;  5B1O A;  4LFC B;  1XQ8 A;  2ADP A;  3F5W C;  1OCC C;  1BQZ A;  3TGU H;  3N2K A;  1CEZ A;  3N2G B;  1FXV A;  1IBK O;  4X89 A;  1G8M A;  2IU3 A;  3ABL C;  3E2E A;  3DTU B;  4N21 A;  3H9V A;  1NH2 D;  1IZ3 A;  1OCR C;  2ZIO A;  1VQM V;  3ZN0 A;  1GH6 A;  5KHG A;  4D6T H;  1NH2 B;  5BR8 O;  4RAI A;  1N33 B;  4JAS A;  3CRM A;  1GN2 A;  2G38 A;  3OMN B;  3GWO A;  1GN3 A;  2LFR A;  3AG2 B;  2DYS C;  1AR5 A;  5DED A;  5K1P A;  4HBN A;  4B3S B;  2WLH A;  3K5L A;  4PJ0 Z;  2UXD O;  3OTO O;  2FML A;  2EIK C;  4MVR A;  3JAR B;  4P30 A;  2V1D A;  3H1L H;  3SYO A;  4O2A A;  3IFX A;  1V54 C;  1FS0 G;  4YJ3 B;  1RP3 B;  1W2B U;  3RW0 A;  3ABM C;  1KYO F;  3S3X A;  3APO A;  2ZKO A;  1XIL A;  1GAX A;  4WFF A;  5EIB C;  2JRI A;  1NR7 A;  2QWO B;  5IWA B;  1WB8 A;  1D5N A;  1VQ4 V;  4LH6 A;  4JV5 B;  2E74 B;  3IGA C;  1BL8 A;  1WA8 B;  2ZE6 A;  5CN0 A;  3S3W A;  3FYE B;  1JJO A;  1YIJ V;  3T4Z A;  4X64 O;  2QR4 A;  1KQS U;  5KMG A;  4LF4 B;  1GM8 A;  2UXC B;  1HW7 A;  1H8E G;  1NTZ H;  1AI4 A;  3VBB A;  2E5L O;  2RQ6 A;  2ZM6 O;  4JZ2 A;  3LNM B;  2KQX A;  1N32 B;  1SQQ H;  5CBH A;  3VQY A;  4ZOL A;  2DQ0 A;  4YHH O;  4UVB A;  3RYI A;  4P9P A;  1R6K A;  2YEV B;  2VQE O;  3A0R A;  4FMT A;  2FB5 A;  2WA4 A;  3DSQ A;  1VQ9 V;  4X66 B;  5LHH A;  3AK2 A;  4H0L B;  5JCO C;  4CS3 A;  4D7S A;  4FM0 A;  4FJC C;  4B3R B;  3ZRX A;  1WPX A;  1WB7 A;  2IBZ H;  4AQY O;  1G6U A;  1DGS A;  4HZ3 A;  4JI3 B;  1SET A;  2UUB O;  1I7F A;  5KHH A;  5LGT A;  2CGN A;  3OW2 U;  4F6E A;  2RMK B;  3ICX A;  4QE7 A;  3ASO B;  2EIM B;  1VEW A;  1JCH A;  3CC2 V;  2GSM B;  1XHZ A;  3L74 H;  4GUN A;  3CCM V;  2PGG A;  1HNW O;  1ZL8 A;  4G2K A;  2QKS A;  4DV1 O;  3CCQ V;  1VIB A;  2N05 A;  1GN4 A;  2XND G;  4TQF A;  3M99 B;  1M57 B;  4K0K O;  1D5A A;  3T1H B;  1FXK A;  4JI0 O;  4O2A B;  4DR7 B;  1N36 B;  1ZAU A;  2PYL A;  2HP8 A;  4B3T B;  1XNR B;  3HR0 A;  1RM1 B;  2CTW A;  1I94 O;  1IUR A;  4PDR A;  3ABK C;  3DGE A;  1WP8 A;  2OIE A;  4CC6 A;  2ZXW C;  2B1I A;  4PI0 A;  2CUG A;  1YTF B;  3B40 A;  4JYB A;  4EFE A;  4OX9 O;  1QLN A;  3OTF A;  5KMG B;  4GKJ B;  1QR8 A;  4NXM O;  2CTQ A;  1FAF A;  2CGO A;  2OYQ A;  3T1Y O;  3ML0 A;  5C8Y A;  3CCJ V;  3MHS C;  4MTF A;  4ZOL B;  3D3I A;  3L73 H;  4J80 A;  1R6T A;  1GMG A;  4DV6 B;  4RUF A;  1E79 G;  3RYI B;  4TV8 A;  4GX1 A;  2R9R B;  3E83 A;  4NTY A;  1VQN V;  4JI2 O;  1GTO A;  5CA1 A;  2ADQ B;  4GX5 A;  1VF5 B;  3OEH G;  5F2V O;  4I9W A;  4ZI7 A;  4TWK A;  2X6B A;  5IY5 B;  1M56 C;  4B3M O;  1JR9 A;  2EBO A;  1SZX A;  1IDS A;  2QTO A;  2QGN A;  2XT9 A;  3DC5 A;  3RGB A;  2F93 B;  4LR3 A;  2UU9 B;  3RVZ A;  1PPJ H;  4X65 O;  1X59 A;  4UUJ C;  2ZDI C;  3CSX A;  1AI6 A;  4MVO A;  4I5S A;  2R70 A;  1M90 W;  2Y69 B;  1Q6U A;  3PJS K;  3P3N A;  3HKC A;  3TCU A;  2X6C A;  5LA6 A;  1NTK H;  4LF5 O;  1XEQ A;  1KMI Z;  3K5O A;  2XOK G;  4JPR A;  3FB8 C;  2ITC C;  2PUS A;  5IJ0 A;  1G4Y B;  1SS3 A;  1P84 F;  1ZL8 B;  3O9O A;  1XOU A;  1N8R W;  3VQW A;  3K79 A;  3O65 A;  5EIB D;  3UT5 A;  2VWJ A;  4JGS A;  5IYB O;  3J81 N;  5KAF Z;  3CS5 A;  5JVD B;  1Y76 A;  1L1F A;  1BS3 A;  4MT8 A;  3CME V;  1FXK B;  4FLX A;  4BR6 A;  4NB5 A;  4LF9 O;  3OGI B;  1H2L A;  3OEE G;  4LH7 A;  5BR8 B;  5B66 Z;  1PV0 A;  4JZG A;  3SR2 C;  4WFH A;  1H2N A;  1RPR A;  1AP6 A;  4IHJ A;  3RT3 C;  4FIP C;  2P4K A;  5JJJ B;  5A9G A;  3L9D A;  5EC1 C;  4F4L A;  3OTO B;  2OIG A;  5ITZ A;  1KBH A;  3JYC A;  3C3T A;  3JSN A;  5DEC A;  5C8Y B;  4K3A A;  4JI6 B;  3WB1 A;  3BRC A;  4EEQ A;  1F7Y A;  1TVK A;  3CRR A;  4TV8 B;  3CP1 A;  1UPG A;  5CA1 B;  2JS3 A;  5B1B C;  3ZRS A;  1EN4 A;  3UO2 A;  4F6R A;  2FYU H;  1BHB A;  1J95 A;  3RFR A;  3ZHV A;  4ZI7 B;  3W7W A;  5FLX N;  4E2L A;  2WLK A;  3QO8 A;  1SF9 A;  2PI4 A;  3QG5 A;  4U3J A;  1YSC A;  5D5P A;  3A8T A;  4X64 B;  2YDE A;  3WB0 A;  2LGW A;  3F7Y C;  2E5L B;  4MTX A;  2EIN C;  1NKD A;  1KUQ A;  2K1E A;  4KFM A;  1U96 A;  1VF6 C;  4GYC B;  3HKC B;  2ATK C;  4LF8 O;  1YF2 A;  1AB3 A;  2GV9 A;  3CMA V;  5LA6 B;  4YHH B;  2JEX A;  3T1C A;  3OFN G;  3ASN C;  4OGQ B;  1I5X A;  2VQE B;  1MZE A;  5FL7 G;  2Q7E A;  1ZUQ A;  5IJ0 B;  1YZB A;  3L75 H;  1ZWI C;  1K7D A;  1SZT A;  2RCV A;  3RYF B;  4JI8 O;  1RPO A;  3K9A A;  3UT5 B;  2QA4 V;  3G4S V;  5JH7 A;  2WSS G;  3DC6 A;  2IJH A;  5GTI Z;  4AQY B;  5FPR A;  1QLE B;  1Y76 B;  1GM9 A;  4LFB B;  1MNG A;  2UUB B;  4FLT A;  3FAV A;  1OCO C;  1Q86 W;  3Q4H A;  3I55 V;  1GKF A;  2OT5 A;  1YEW A;  5B1A C;  1GO3 F;  1GK9 A;  5HFM A;  1EM1 A;  4IHJ B;  2LP7 A;  1KP2 A;  1HNW B;  1CPY A;  1Y67 A;  1Y66 A;  2QWQ B;  3JAK A;  3KG2 A;  1R3K C;  1E1R G;  5FPO A;  1H2K A;  2B1G A;  4BIU A;  5ITZ B;  5KA5 A;  1FYJ A;  3LDD A;  4LNU A;  2PTM A;  3THO A;  3JD3 A;  2P7T C;  1J5E O;  2JVD A;  4DR1 O;  3STZ C;  1PNL A;  3A0H Z;  2QEX V;  1F4N A;  1WP7 A;  4UB6 Z;  1TVK B;  1I94 B;  1YXB A;  3P32 A;  2C2A A;  2ZE5 A;  4QPJ A;  3BPZ A;  5H6R A;  1S3J A;  4F6R B;  2DYR B;  2NR5 A;  4YIP A;  3ABT A;  1K97 A;  4CS2 A;  1R6N A;  2YXH A;  4WFE A;  4A5U B;  4U3J B;  4OX9 B;  1MSD A;  4CH6 A;  3D36 C;  3K5M A;  1NJI W;  4NXM B;  2ZQM A;  4JAU A;  4IGG A;  3T1Y B;  3FB7 C;  1VAR A;  4MVS A;  2WLI A;  1VQ8 V;  1MOF A;  1OZ0 A;  1BCC H;  4R7C A;  4IYI A;  1F23 A;  3RYC A;  4WF9 V;  2CTP A;  4UCV A;  1NR1 A;  4JI5 O;  3TXS A;  2IJK A;  3OUS A;  3R66 A;  1DK1 A;  1W0K G;  2QWN B;  3PN1 A;  3T4D A;  1Z2G A;  5CA3 A;  5EBM C;  2ARH A;  1SRY A;  4O4J A;  3H1J H;  5LMN B;  1MA1 A;  4B3M B;  3N27 A;  4QNH B;  3SPJ A;  2GDS A;  3CC4 V;  2HLD G;  1TAE A;  3CPW U;  1JMK C;  3FYI B;  5JH7 B;  4JAA A;  1NVP D;  4CH4 A;  4X65 B;  1CP9 A;  1M5I A;  4X1Y B;  4FZ0 A;  4DR4 O;  1K9M W;  3LSQ A;  1M1K W;  5BMV A;  1H2M A;  2EIJ B;  5EBL C;  5FNV A;  3FAV B;  4Q6G A;  1HWY A;  2OCH A;  3A0B Z;  4X20 A;  1QR9 A;  4DUY O;  2QSA A;  3MD0 A;  3TXQ A;  3Q4H B;  1AIL A;  2IM9 A;  5IDJ A;  3OE7 G;  1FJG O;  1K3E A;  2XHB A;  2DN9 A;  1AJP A;  4BIO A;  4DXW A;  3MHH C;  4OPH A;  4QE9 A;  4FLW A;  3QO5 A;  3WG7 C;  3JAK B;  3H1K H;  1R3J C;  4GT1 A;  2YC0 A;  4FVM A;  1HR0 O;  4LNU B;  1EZV H;  5A2Q N;  4FZ1 A;  1Q3E A;  4MSW C;  4PA4 A;  3FD9 A;  5EYP A;  4LF9 B;  2WA3 A;  5BXZ A;  2GTA A;  4NR1 A;  3U0Z A;  2DE0 X;  3SYP A;  4FLU A;  3X2Q B;  1Q5O A;  2E3C A;  3UO3 A;  3E8F A;  4PDL A;  1VP7 A;  3G6E V;  2QDO A;  5GTH Z;  4DK0 A;  4G27 B;  1FXH A;  3M8A A;  4WBN A;  2HJF C;  4IIJ A;  2ZT9 B;  4ZHQ B;  4O4H A;  4QIW F;  3SPH A;  2UUA O;  1UFI A;  2ZIN A;  2WLI B;  2QWR B;  4DV5 O;  4DR6 B;  5KAI Z;  4X1I A;  2A06 H;  1KP3 A;  4ZKI A;  1AVM A;  3OD4 A;  2FL4 A;  3RYC B;  2IH1 C;  3SJC C;  1R3L C;  2UXB O;  3CXC U;  2LGQ A;  4LF6 O;  4OPA A;  1RFY A;  4GX0 A;  4C7U A;  4O4J B;  4H33 A;  5LHI A;  2MW2 B;  3BA8 A;  3EVK A;  4PDM A;  4LBE C;  4DV0 O;  4IT5 A;  4O2B A;  3W7T A;  2AHY A;  4ABM A;  1IX9 A;  1XMO O;  1H38 A;  2ODM A;  3BCC H;  3K59 A;  4UB8 Z;  3RBZ A;  2P06 A;  2AXT Z;  2CE4 A;  1WN7 A;  3K58 A;  5DN6 G;  5FNV B;  4PHZ A;  2BCC H;  1ZSP A;  4LF8 B;  3UKM A;  2M7W A;  2IW5 A;  2EJ7 A;  3SYQ A;  3WB2 A;  3N2K B;  4X20 B;  2NNU A;  3A2F A;  1LNQ A;  2EIL C;  1L0L H;  3ZED A;  4I0X A;  4P2Z A;  1K8A W;  3SDL A;  3CRC A;  3JAM N;  2Z3Y A;  2Q7H A;  3SYA A;  1I0H A;  1JVM A;  3SPG A;  3UM7 A;  4JI4 O;  3E35 A;  1LR1 A;  3FFQ A;  4DR5 O;  2ZE7 A;  4GCZ A;  2YIB A;  5KHI A;  2WAM A;  4JI7 O;  2AZ2 A;  4TOI A;  1V55 B;  4J10 A;  2Q73 A;  2LJ2 A;  2O57 A;  5EYP B;  2H94 A;  4KP4 A;  2VQF O;  1K5Q A;  3E8G A;  1SQB H;  1Q6I A;  3JSL A;  4U7O A;  4AIL C;  2RN9 A;  3AG4 C;  2P6J A;  2UXN A;  3E8H A;  1BQ0 A;  1BGY H;  1QU7 A;  1M9N A;  4DK1 A;  2KG7 A;  2EJR A;  2Q67 A;  4Q20 A;  1F4M A;  3ZIA G;  2OCC C;  2PY5 A;  2KSD A;  1XNQ B;  4NTX A;  1RSO A;  4AHC A;  2Q9L A;  4DV2 O;  2XAF A;  1EFR G;  4Z2W A;  1B3Q A;  4IIJ B;  3U11 A;  3ABU A;  2MK3 A;  1Q7Y W;  1Q8I A;  4DV3 B;  4CH5 A;  3QVN A;  2OWO A;  1O9G A;  4YXW G;  4PA9 A;  4UCR A;  5H6Q A;  4IL6 Z;  3W7U A;  3CCS V;  4JTD B;  4JYA O;  4JF3 A;  4X1I B;  4FM2 A;  1KB9 F;  2W6J G;  1J5E B;  2QTS A;  2DMX A;  2HKO A;  4DR1 B;  3D3Q A;  3K3W A;  4TSF G;  2ZE8 A;  5CA0 A;  5LYJ A;  2F1M A;  4CS4 A;  2OTL V;  1WJZ A;  1BT8 A;  5KUK A;  2P5O A;  5JCO A;  3EHB B;  2UXX A;  1KU9 A;  3MDS A;  3B8N A;  2Z0A A;  3IAY A;  2X7R B;  5IE9 A;  5LP6 C;  1HP8 A;  1TGO A;  3K04 A;  3HKE A;  4O2B B;  1OCC B;  1H2G A;  1Y74 A;  5K1X A;  2JJ2 G;  2VS0 A;  3ABL B;  1SES A;  2ZR3 A;  3OMI B;  1OCR B;  1IBL O;  1XMQ B;  2ZR2 A;  1VQ7 V;  2W6I G;  3CWB H;  1VQP V;  5KA6 A;  5JJN B;  1QVF U;  3OGC C;  2Q7G A;  4MVZ A;  4TV9 A;  2DYS B;  3AG3 C;  4DYL A;  1TUB A;  4I55 A;  3E22 A;  2ZCE A;  1OCZ C;  1K5S A;  4Z1V A;  4UCS A;  2EIK B;  2YIB D;  1Q43 A;  2JDI G;  5CMU A;  5L3D A;  3ZJZ A;  1IBM O;  1P7B A;  3KKY A;  4MVQ A;  1S0V A;  1V54 B;  1SQF A;  3C90 A;  3BFR A;  1PNK A;  1W59 A;  3K0G A;  3ABM B;  2Y0P A;  4J11 A;  1JA8 A;  4LC1 A;  3AG7 A;  1S5J A;  4DW0 A;  4DUY B;  4XDL A;  1IBK B;  2WLL A;  3AG1 C;  1FJG B;  2XTA A;  1M4U A;  3AK1 A;  1N33 O;  2KG7 B;  3VOU A;  4J42 A;  3IC9 A;  1RSO B;  2M6Y A;  2P4V A;  5IYZ A;  3GVM A;  1W0J G;  5KHJ A;  2Y48 A;  1FFT B;  1HDJ A;  5EC2 C;  4E4E A;  2F66 C;  2PYJ A;  1KKC A;  2NLJ C;  5KX5 A;  3H1H H;  4JI1 O;  2UXD B;  4EFB A;  1JQ0 A;  5CA0 B;  4QPK A;  5LYJ B;  1FFX A;  5KUM A;  1AR1 B;  1B04 A;  2P90 A;  3SPI A;  2Q0O C;  2E75 B;  5HFL A;  1L8D A;  1EZJ A;  2ZNJ A;  3HKE B;  2W0X A;  2Q68 A;  4U3F H;  2ZDI A;  4LF4 O;  2IJJ A;  3VQV A;  3HKD A;  2N74 A;  1Y74 B;  5DM6 V;  3B8M A;  1ORQ C;  4UV9 A;  2UUA B;  3W7S A;  3ZHU A;  3FB6 C;  1PD3 A;  3AG2 C;  2ZM6 B;  2JS5 A;  1ARO P;  1BE3 H;  1I08 A;  2L35 A;  1PNM A;  2UXB B;  4LF6 B;  2EX3 A;  3B09 A;  1NT2 B;  2AW9 A;  4NTW A;  1TUB B;  2AGA A;  2UUC O;  4I55 B;  3BA9 A;  3E22 B;  3LNN A;  1BZK A;  2YIC A;  3ZX6 A;  3HKB A;  1DLB A;  3ZMS A;  3CEI A;  4B3R O;  1XI1 A;  1KD1 W;  3I5D A;  1XMO B;  2ZIM A;  1WPB A;  4YIO A;  2WLM A;  1QCE A;  5LGU A;  1XL4 A;  3ABK B;  2ZXW B;  2D3O W;  1VQL V;  4MS2 A;  5JJE B;  3GWK C;  2BTO A;  2WLL B;  2F95 B;  2QM4 A;  5EZY A;  3VQX A;  2XAQ A;  2Q5Z A;  3B2E E;  4RO2 A;  4JI4 B;  2IJI A;  4WFG A;  4X1K A;  1SC5 B;  4FFB A;  4DR5 B;  1IVS A;  4JAV A;  3EXA A;  1SQX H;  4DR3 O;  3CJH A;  2H3O A;  4DV1 B;  5H2F Z;  1Y6X A;  5KX5 B;  5L3F A;  2VQF B;  4KHP O;  3UQ8 A;  1FFX B;  4K0K B;  1AP5 A;  4BWA A;  1A32 A;  4JI0 B;  3SJQ C;  1JX9 A;  1VMG A;  1M56 B;  1XUQ A;  3ZCC A;  4NKG B;  1KKD A;  3HPL C;  5BZB A;  3RN4 A;  2B9Z A;  4R6Z A;  1SA0 A;  1VQ5 V;  4FLZ A;  3K57 A;  2WLJ A;  2A7W A;  3HKD B;  4QJF B;  4MW8 A;  1VF6 A;  1SQP H;  3JD2 A;  3ZHR A;  3ASO C;  2EIM C;  2QJ1 A;  5TIS Z;  1PL0 A;  3ZRV A;  3CXH F;  4LFA O;  1V9P A;  4DV6 O;  1COW G;  1SQG A;  1AI5 A;  3CRQ A;  1Q6H A;  4MTG A;  5IJ9 A;  3G71 V;  3P30 A;  4YJ2 A;  4NYK A;  1FPO A;  1M57 C;  1EBO A;  2V4D A;  3ZS8 C;  4DO2 A;  1H8H G;  4N23 A;  3I56 V;  1PP9 H;  1MMM A;  3AEI A;  4ZBM A;  4JI2 B;  3HKB B;  1MZF A;  1D2D A;  1RM1 C;  1NBM G;  2H8P C;  4DV4 O;  5H5N A;  1NI8 A;  3ZHT A;  2XAH A;  3ZRW A;  1FKA O;  2Y4T A;  2UU9 O;  4K8Z A;  4UV8 A;  3JD1 A;  3LSS A;  4B7E A;  1K4C C;  2PF4 E;  1Z5W A;  3L72 H;  2CK3 G;  1P7G A;  2JK5 C;  1IBL B;  1NVP B;  2QM8 A;  5LMU O;  2LQT A;  2YIA A;  5J2U A;  3CB2 A;  5LOV A;  4LF5 B;  3CCR V;  5EZY B;  3MAQ A;  1HNX O;  2V7Q G;  3CD6 V;  1R73 A;  1QBZ A;  2DOS A;  5JWP A;  4JYY A;  4FK5 C;  2XUM A;  1N34 O;  4X1K B;  2A9H A;  4JTA B;  2YS8 A;  3BAA A;  1IBM B;  1AR4 A;  2X6A A;  1MG1 A;  2BTQ A;  3CJH B;  4KXR A;  4GX2 A;  1TA8 A;  5IY5 C;  1UJW B;  4RQF A;  5B1B B;  5B3S B;  3EFF K;  1Q90 D;  1U97 A;  3K03 A;  3OR6 C;  1FD9 A; 
#chains in the Genus database with same CATH homology
 1M9N A;  2Y69 C;  2EJR A;  2Q67 A;  4Q20 A;  1F4M A;  3ZIA G;  3D36 A;  3QNE A;  2OCC C;  3CCE V;  5B1N A;  1SER A;  4R8C A;  4WFH A;  2XAF A;  2EIN B;  1RPR A;  1EFR G;  2P67 A;  3GB7 C;  3SYC A;  5L3C A;  2ITD C;  1JPX A;  3ABU A;  2MK3 A;  1Q7Y W;  4FIP C;  4MW3 A;  1IXM A;  4JTC B;  1GM7 A;  3E86 A;  1MSW D;  4YXW G;  4PA9 A;  2QM7 A;  1XL6 A;  5EC1 C;  4BIZ A;  5H6Q A;  3W7U A;  4F4L A;  3CCS V;  4JTD B;  3OUF A;  5EK0 A;  1WLE A;  4JF3 A;  5L3G A;  3JYC A;  2W6J G;  1E1Q G;  2BOB C;  5EBW C;  3ASN B;  2HKO A;  3K3W A;  4RUE A;  3R65 A;  5J9P C;  3AG3 B;  1I5Y A;  2JEU A;  3LDE A;  1K4D C;  4TSF G;  1AJN A;  5GW7 A;  2ZD9 A;  2KB1 A;  1OCZ B;  2OTL V;  4PDV A;  1V55 C;  5KUK A;  1S77 D;  3CYO A;  3CP1 A;  1OHH G;  2DWE C;  1FXK C;  2DQ3 A;  3EHB B;  4R50 A;  4PA3 A;  2UXX A;  5B1B C;  3ZRS A;  1Q82 W;  1TUE B;  2AHZ A;  3B8N A;  4WFB V;  1BHB A;  4J9Z B;  2W0F C;  1J95 A;  2A79 B;  2X7R B;  3W7W A;  4E2L A;  2WLK A;  3ETG A;  1AI7 A;  3QO8 A;  2HG5 C;  2PI4 A;  3H01 A;  3K04 A;  1YSC A;  1JOY A;  1OCC B;  3ZRW B;  2GHY A;  3OAA G;  3CC7 V;  3F7Y C;  1H2G A;  4LP8 A;  3K08 A;  4MTX A;  4XDK A;  2JJ2 G;  3ABL B;  1OCO B;  2EIN C;  1NKD A;  3OR7 C;  4J9Y B;  1SES A;  2ZR3 A;  4PA6 A;  2K1E A;  3AG1 B;  4KFM A;  3OMI B;  1OCR B;  4X8A A;  4CBC A;  1DTO A;  3CCV V;  3OM3 B;  2ZR2 A;  4XBF A;  1VQ7 V;  4WFA V;  2ATK C;  4WCE V;  4MTO A;  3CMA V;  2W6I G;  5B1A B;  1VQP V;  5KA6 A;  3W7X A;  1DF4 A;  1P4R A;  2JEX A;  1QVF U;  3OGC C;  3T1C A;  3JD4 A;  2XAG A;  3OFN G;  4MVZ A;  4H37 A;  3ASN C;  1I5X A;  2DYS B;  3AG3 C;  5H9C A;  5FL7 G;  4EKW A;  2A0L A;  1YI2 V;  2YEV A;  3LUT B;  4G28 B;  1OCZ C;  1K5S A;  2LFS A;  2R9I A;  3K06 A;  2JJ1 G;  2EIK B;  1ZWI C;  1K7D A;  1SZT A;  1K92 A;  4ASU G;  1VQK V;  2JDI G;  3FB5 C;  5CMU A;  5L3D A;  3ETE A;  3ZJZ A;  1RPO A;  1BMF G;  4X88 A;  1P7B A;  3K9A A;  4MVQ A;  1S0V A;  2HR3 A;  2QA4 V;  3G4S V;  3TET A;  1V54 B;  3STL C;  2WSS G;  5B1O A;  1PNK A;  2HVJ C;  2DW4 A;  2IJH A;  1QLE B;  3K0G A;  3ABM B;  1MAB G;  1OCC C;  3F5W C;  2WLN A;  1GM9 A;  3JCZ A;  1CEZ A;  4LC1 A;  1FXV A;  4X89 A;  1G8M A;  2IU3 A;  3ABL C;  4XDL A;  1OCO C;  3E2E A;  3DTU B;  4N21 A;  1NH2 D;  1Q86 W;  2WLL A;  3AG1 C;  1OCR C;  1VQM V;  3ZN0 A;  1NH2 B;  3I55 V;  3VOU A;  1GKF A;  2OT5 A;  4RAI A;  5B1A C;  1GO3 F;  1GK9 A;  4JAS A;  5HFM A;  3OMN B;  1S5H C;  3GWO A;  2LFR A;  2LP7 A;  1KP2 A;  3AG2 B;  2DYS C;  1W0J G;  1CPY A;  4L87 A;  1Y66 A;  2WLH A;  2Y48 A;  1FFT B;  4FPP A;  3KG2 A;  3OMA B;  1R3K C;  1E1R G;  1VQ6 V;  3LDC A;  2Q6A A;  2B1G A;  1NQT A;  4BIU A;  5EC2 C;  5KA5 A;  3LDD A;  2EIK C;  4HAM A;  4MVR A;  3JD3 A;  2NLJ C;  2P7T C;  2V1D A;  4P30 A;  1JQ0 A;  3STZ C;  4QPK A;  2QE7 G;  3SYO A;  1PNL A;  2QEX V;  1F4N A;  5KUM A;  5LHG A;  3IFX A;  1V54 C;  1FS0 G;  1AR1 B;  1QLE C;  3P32 A;  4QPJ A;  2C2A A;  2P90 A;  3SPI A;  1W2B U;  3RW0 A;  3ABM C;  1YTF D;  5H6R A;  2WWW A;  1S3J A;  4WFF A;  5L3B A;  1NR7 A;  2DYR B;  2PI5 A;  1VQ4 V;  2X0L A;  3ABT A;  5HFL A;  5LGN A;  1K97 A;  3IGA C;  1R6N A;  1BL8 A;  4WFE A;  5CN0 A;  1EZJ A;  3FYE B;  2Q68 A;  2ZDI A;  1YIJ V;  4XDJ A;  3T4Z A;  2IJJ A;  1NJI W;  1KQS U;  1GM8 A;  2ZQM A;  5DM6 V;  3B8M A;  1H8E G;  4JAU A;  1AI4 A;  1ORQ C;  5C93 A;  3VBB A;  4UV9 A;  5CBG A;  5CBF A;  1YJW V;  4PA7 A;  4CZZ A;  2YSU B;  3FB7 C;  3W7S A;  3LNM B;  4MVS A;  2WLI A;  2DWD C;  1VQ8 V;  3FB6 C;  1PD3 A;  1MOF A;  1AJQ A;  3FKS G;  1OZ0 A;  3AG2 C;  4R7C A;  5CBH A;  3RVY A;  1ARO P;  1F23 A;  4WF9 V;  1NR1 A;  5IYC O;  1PNM A;  2DQ0 A;  2IJK A;  3OUS A;  4UVB A;  3CCL V;  2EZO A;  1W0K G;  4P9P A;  1R6K A;  3T4D A;  3WG7 B;  5CA3 A;  2YEV B;  3A0R A;  4FMT A;  5EBM C;  1SRY A;  4JYC A;  3NXS A;  1DLB A;  3ZMS A;  2IU0 A;  1VQ9 V;  5LHH A;  2BOC C;  4QNH B;  3SPJ A;  1K73 W;  3CC4 V;  1KD1 W;  2HLD G;  3ZMT A;  1ENV A;  4FJC C;  2DYR C;  3ZRX A;  1WPX A;  3CPW U;  3FYI B;  2WLM A;  1QCE A;  1NVP D;  4LCU C;  3QO7 A;  1CP9 A;  1F51 A;  1THZ A;  5LGU A;  1XL4 A;  1K9M W;  3LSQ A;  1M1K W;  4HZ3 A;  2EIJ B;  5EBL C;  3T2M A;  1KC8 W;  3ABK B;  2ZXW B;  1SET A;  2D3O W;  1VQL V;  4MS2 A;  1S72 V;  1HWY A;  1QR9 A;  5LGT A;  3MD0 A;  2WPD G;  2WLL B;  3OW2 U;  4UVA A;  5IDJ A;  3OE7 G;  1K3E A;  1QVG U;  2XAQ A;  4QE7 A;  3ASO B;  2EIM B;  3E89 A;  1AJP A;  4RO2 A;  1YJ9 V;  1JCH A;  4DXW A;  2IJI A;  4WFG A;  3CC2 V;  2GSM B;  3E8B A;  2XAJ A;  3CCM V;  3MHH C;  4QE9 A;  2IH3 C;  5LBQ A;  3QO5 A;  3WG7 C;  4JAV A;  3ZN1 A;  2OTJ V;  4G2K A;  2QKS A;  1R3J C;  4GT1 A;  3CCQ V;  5IYD O;  2XND G;  3M99 B;  1M57 B;  5L3F A;  3F7V C;  4MSW C;  1FXK A;  4PA4 A;  4RQE A;  1K33 A;  1K34 A;  1RM1 B;  3SJQ C;  1ROP A;  1JX9 A;  1YJN V;  3SYP A;  1M56 B;  3X2Q B;  2EIJ C;  3ZCC A;  1JJ2 U;  2HVK C;  4PDR A;  3ABK C;  1YIT V;  3DGE A;  3E8F A;  4PDL A;  1KKD A;  2ZXW C;  2B1I A;  3HPL C;  5BZB A;  3G6E V;  1YTF B;  4BW5 A;  4R6Z A;  4JYB A;  4TT3 G;  4G27 B;  1FXH A;  1VQ5 V;  2HJF C;  2WLJ A;  1QLN A;  4MVM A;  4QJF B;  4MW8 A;  3B77 A;  3JD2 A;  1QR8 A;  3ASO C;  2EIM C;  3ETD A;  4QIW F;  1PL0 A;  3SPH A;  1S76 D;  1VQO V;  2WLI B;  2EIL B;  3ZRV A;  3ML0 A;  1Q81 W;  3WFV A;  1KP3 A;  4ZKI A;  3CCJ V;  3MHS C;  1B6Q A;  4MTF A;  4OXS A;  2JIZ G;  1COW G;  3D3I A;  1YHQ V;  1AI5 A;  2IH1 C;  4MTG A;  3G71 V;  1GMG A;  3P30 A;  4RUF A;  5B3S C;  1R3L C;  1E79 G;  3CXC U;  1M57 C;  1EBO A;  4GX1 A;  2R9R B;  1PKX A;  3E83 A;  4KUM A;  1VQN V;  4GX0 A;  1GTO A;  4DO2 A;  1H8H G;  4N23 A;  3K0D A;  3ZMZ A;  3I56 V;  4GX5 A;  4H33 A;  3AEI A;  4ZBM A;  3OEH G;  4P9O A;  5LHI A;  4UVC A;  4I9W A;  4TWK A;  1Y4M A;  1RM1 C;  2X6B A;  4PDM A;  5IY5 B;  1NBM G;  4LBE C;  1M56 C;  2H8P C;  2FTK A;  5L3E A;  3BY6 A;  3X2Q C;  4UXN A;  5E1A C;  3W7T A;  2EBO A;  2XAH A;  4Z1M G;  2AHY A;  2QTO A;  3ZRW A;  2B5U A;  1H38 A;  4UV8 A;  3JD1 A;  3LSS A;  3IC7 A;  4PEL A;  4U7N A;  1K4C C;  3BEH A;  3RVZ A;  2EZP A;  3AG4 B;  3RBZ A;  2ZDI C;  4UUJ C;  1AI6 A;  4MVO A;  2XAS A;  4I5S A;  2CK3 G;  5DN6 G;  1R3I C;  2JK5 C;  1NVP B;  2QM8 A;  1M90 W;  2Y69 B;  1BHA A;  3UKM A;  2M7W A;  3JD0 A;  3PJS K;  2IW5 A;  2OCC B;  3SYQ A;  2Q69 A;  3ZMU A;  2NNU A;  3TCU A;  2X6C A;  2F43 G;  1LNQ A;  2EIL C;  3CCR V;  4P2Z A;  2XOK G;  1K8A W;  2V7Q G;  4MVU A;  4JPR A;  3CD6 V;  1KEC A;  1QBZ A;  1R73 A;  3FB8 C;  2Z3Y A;  4FK5 C;  3SYA A;  2ITC C;  1JVM A;  3SPG A;  3CCU V;  3UM7 A;  3E35 A;  1G4Y B;  2A9H A;  2HFE C;  3ZMV A;  4JTA B;  2Z5U A;  4GCZ A;  2X6A A;  1N8R W;  1MG1 A;  3K79 A;  2WAM A;  3SPC A;  4GX2 A;  4JGS A;  5IYB O;  5IY5 C;  3TK1 A;  1V55 B;  1UJW B;  1L1F A;  1DF5 A;  4MT8 A;  3CME V;  1FXK B;  4RQF A;  2H94 A;  4KP4 A;  5B1B B;  3EFF K;  5B3S B;  1K5Q A;  3E8G A;  4U7O A;  3HB3 B;  3K03 A;  3AG4 C;  2P6J A;  2UXN A;  3E8H A;  4BAY A;  3OR6 C;  3OEE G;  4HYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...