5HFMA

Gp41-targeting hiv-1 fusion inhibitors with hook-like ile-asp-leu tail
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
77
Chain Sequence
b'AVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIGGRGGWEEWDKKIEEYTKKIEELIKKSQNQQIDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein gp160,gp41 CHR region
publication title Rational improvement of gp41-targeting HIV-1 fusion inhibitors: an innovatively designed Ile-Asp-Leu tail with alternative conformations
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 77
sequence length 79
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5hfmA00
2X7RB 3M99B 3B8MA 2M7WA 3CP1A 1I5YA 3P30A 1DF5A 5HFMA 2MK3A 5KA6A 4FIPC 1Y4MA 1JQ0A 1QBZA 3B77A 3K9AA 1K34A 1JPXA 5KA5A 1ENVA 4JF3A 2OT5A 4FK5C 5H9CA 1F23A 4G2KA 2EBOA 1DLBA 1SZTA 2LP7A 3MHHC 1MOFA 1QR8A 3WFVA 2EZPA 5HFLA 4N21A 1QCEA 1EBOA 4JGSA 1DF4A 2P6JA 5CMUA 3GWOA 4JPRA 4N23A 1K33A 3CYOA 1Y66A 4E2LA 1MG1A 1QR9A 1I5XA 3H01A 5CN0A 4FJCC 2EZOA 3B8NA 3MHSC
chains in the Genus database with same CATH superfamily
4J7KA 1XREA 3OTOB 5CA0B 1FJGO 2WLHA 5GONB 3WB2A 1NH2B 1LUWA 2AHZA 1I0HA 3BHPA 1S3JA 3RW0A 3OMIB 1OCOB 3MD0A 3RYHA 3OTFA 2FKXA 3IAYA 3VQVA 2GDSA 3W7WA 2EIJC 5D5QA 1G1XB 5B1OA 3VBBA 5IYZA 1K7DA 1YCIA 4HNAB 2Q4PA 1FAFA 1OJHA 1COWG 3OTOO 4N21A 1S5JA 4FM1A 1VP7A 1XL6A 2QR4A 4FLUA 3CE2A 5FPRA 4X9QA 3ETQA 3IFXA 1FXVA 4X64B 1XQ8A 4LR3A 2YI9A 4DW1A 1AI6A 1H8EG 2KG7A 1AP6A 3N2GA 1AI4A 1K4DC 2JS5A 4O4LA 1H8HG 2WAMA 2Q68A 1OCZB 5CB4B 4PV1B 2DMXA 2ZDIA 3A0BZ 3ZMZA 4MTXA 2GUZA 5JJNB 3ZS8C 1N32B 1J95A 2E5LB 1B6QA 1ZTEA 1HDJA 1RSOB 4JF3A 4MVOA 5LGUA 1Q7YW 2YICA 4X64O 1WJZA 2P22C 1VEWA 1R3IC 3MHHC 1XBLA 1VF6C 2A79B 3CCSV 4UUJC 3HKEB 2XAQA 1NTMH 2YXHA 3U0ZA 2LFSA 4FMTA 4RWUA 3JSNA 4BIOA 3I56V 4CH4A 4DO2A 4PI0A 1H38A 5DECA 1N32O 4DR5B 5L3DA 4NVPA 2E5LO 4DR7B 2C2AA 3SYPA 1KUQA 2Z0AA 5B1NA 2PUSA 1TUBB 4LWSB 4WFAV 2ZT9B 2NNUA 5EZYB 3BABA 2AZ0A 2DQ0A 2N04A 3X2QB 2Q5ZA 3BCCH 5JCOA 3ZMTA 4NR1A 1E1QG 1MZEA 4TOIA 3TK1A 4JPRA 4I9WA 1FXKB 4DR5O 2WLMA 4DR7O 5KAFZ 3M99B 1V54B 4I50B 3JAKA 4QPJA 2PI5A 1GO3F 1G6UA 2WLIB 2QKAA 2HHHB 1E79G 3F5WC 4LF5B 3AG4B 1IURA 3UO3A 4HBNA 1NJIW 2IJIA 1B3QA 1Y67A 4LNUA 2GHYA 4I9QA 1Y76B 4ABMA 3ZHRA 3CSXA 2Q7HA 1QVGU 4L87A 2L6LA 3QVNA 4PDMA 2XTAA 2EIMC 1JJ2U 1FFXA 3DSQA 1M90W 3AK1A 1RM1C 2XAHA 1KKCA 2HHHO 2QA4V 3RYHB 1H2MA 3OUFA 1Y74A 3UCSC 4LF5O 4EB6A 3CYOA 2RDCA 2V1DA 2NLJC 3PN1A 1QLEB 2YIDA 3CRAA 4JI0B 5IYZB 3T1HB 1Q6HA 4JYAB 2F4VB 3E86A 3ZHVA 1GAXA 2QWQB 2HEPA 1PL4A 4X8AA 1GN6A 4OPAA 1H2GA 2CTPA 1G4YB 1Q81W 1YITV 5LHIA 3B8MA 3BRCA 5HFMA 3OEEG 4D6TH 2YUAA 1WP8A 2HVJC 1JPXA 2KG7B 4DUZB 3N2GB 1VF5B 3ICXA 4JI0O 3ABKC 4O4LB 5GTHZ 3T1HO 3HB3B 1BZKA 4JYAO 2F4VO 4KFMA 2DYSC 4BIUA 1CP9A 4JZGA 1M57C 2GUZB 4RUEA 3OE7G 4GUNA 1LNQA 4CS3A 1B06A 4B7KA 3E83A 4TQDA 3S3XA 3FKSG 2YS8A 5BZBA 1TVKA 4DUZO 2DE0X 2WLKA 2R72A 4JI6B 1HW7A 4CH3A 4DV4B 1PNMA 1OV9A 3P30A 2UUCB 3AG3C 4U3JA 1M4UA 1ZAUA 1AROP 1SZTA 4DK1A 2P67A 3JD0A 1H2NA 1XILA 3IGAC 3KKYA 5LP6C 4XDJA 4PD4F 4PA6A 1N33B 4WFEA 2JK5C 4BR6A 3ZJZA 4R50A 2JJ2G 4JI6O 2H3OA 4G27B 3ZRWA 1M1KW 1OZ0A 4DV4O 3T4ZA 4PDVA 1NVPB 2BOCC 1VQOV 2UUCO 4HAMA 2JIZG 2KB1A 5KHKA 5LA6A 1O9GA 1R6KA 3T1CA 2ZXWB 1EN4A 2RNBA 2PY5A 5IY5C 4TV9A 3AG2C 4QIWF 1Y66A 4CS2A 2EIKB 1KBHA 2B1IA 1WB7A 3JALA 3ABLB 3JAKB 2Q69A 5GTIZ 1N33O 4GX1A 4WCEV 2NN4A 4G28B 3SYQA 1WPXA 4UVCA 1VQMV 2CH7A 4NXNB 3E22A 3NXSA 2B5UA 4ASUG 4RQEA 2QWOB 4JYBA 2EX3A 3AG7A 4X88A 2OCCB 3LNNA 4JI2B 1I5XA 3STLC 4LNUB 3OD4A 1JX9A 1XL4A 1V55C 3LNMB 1DGSA 3J7AU 3AEIA 1OHHG 3LSUA 3QO5A 1U97A 2XUMA 5B1AB 1JQ0A 2RN9A 1MZFA 1FFXB 2R9AA 3K79A 4JTAB 2YSUB 1VQ7V 3GWOA 2LW1A 1DK1A 2W6JG 1ORQC 2PYLA 1YF2A 4NXNO 1Y74B 1L8DA 4EB6B 1WB8A 4YHHB 2P7TC 4JI2O 3T1YB 1S5LZ 1QLNA 1BMFG 3VQWA 1AVMA 2MW2B 3FAVA 5EK0A 2FYUH 1NH2D 4J41A 4J7ZA 3B09A 2E75B 2G38A 2QWRB 4X1KA 5LHGA 5BR8B 5EBMC 2X6AA 3K9SA 2JS3A 2XT9A 4YHHO 4X89A 1XDCA 1M5IA 4CS4A 3T1YO 2QWPB 2BOBC 4DXWA 3ZRVA 2Q67A 1ZLZA 2RCVA 1O9HA 1VQ4V 1MG1A 2E74B 4B08A 5TISZ 2GBOA 4MTFA 3JASA 3C90A 5BMVA 2F43G 2XAJA 4KP4A 4XDKA 5KLVH 2XHBA 1DTOA 5KAIZ 1IZ3A 1Y4MA 5KA5A 5H6QA 2JEXA 3WG7B 1JR9A 1SQFA 1R3LC 2Q9LA 1LUVA 5BR8O 3F7YC 1TVKB 1NI8A 3ZRXA 1L0LH 1MSDA 5B3SB 1VF6A 2PF4E 1H2KA 3RYFA 4CC5A 4WFBV 5KA6A 1UFIA 3LUTB 3AK2A 3E8GA 1S76D 5JQGA 5B1BC 2Z3YA 4U3JB 3G6BA 4GX5A 3FD9A 1CXZB 3KZIZ 4DRXA 4JYCA 3CPWU 3E8BA 3CD6V 4LFAB 3ZRWB 3DTUB 2CDYA 2WSSG 1RPOA 4UFZA 3OEHG 3AG1C 3ZMSA 2Y0IA 1VARA 5LA6B 1VIBA 1W0KG 3ABMC 4DUYB 3FB5C 2BCCH 4ICGA 4TV9B 5EBWC 3ZBHA 2EULA 1AI5A 2OIEA 1R3KC 4DW0A 1GM9A 3JALB 4LP8A 3H1IH 3CRCA 4X66B 3ZHQA 4QJFB 1HR0B 1KD1W 1SQVH 3CCQV 4DYLA 2CH7B 4LFAO 3E22B 3ZMUA 2QWNB 2HG5C 3DXRA 1AJQA 3GB7C 1X59A 1YTFB 1FYJA 2XAGA 1Q3EA 3K0DA 2JEUA 1M56C 3LDEA 2WA4A 1BQZA 2EINC 1SQGA 4DUYO 4XBFA 2EILB 2OCHA 1NR7A 2UXCB 2CTQA 3VOUA 2F95B 1L1FA 4PELA 4X66O 3CB2A 2VWKA 1SZXA 1HR0O 1EM1A 5J9PC 3W7XA 5FNVA 2LO1A 5J2UA 1K92A 1IXMA 1GTOA 3OR7C 1YEWA 2HR3A 1OCOC 1EZVH 3OMAB 1R73A 4GLXA 1GM7A 4GX2A 2EIJB 4UCOA 3L73H 1AR5A 1VQPV 1YJWV 5LGNA 1NR1A 3FAVB 2ARHA 2ZE6A 3JD1A 3ASOC 2UXCO 1ZSPA 1RPRA 4FLTA 2XNDG 1WA8A 4NTXA 1KU9A 3H1JH 1J5EB 3IJ4A 4DV2B 2YI8A 3SGIA 1EN5A 2RQ6A 1GKFA 4X1KB 3WB1A 5H9CA 4J9YB 1KQSU 1VQ8V 3ZHSA 4GCZA 3E2EA 2P6JA 1SC5B 2YXYA 1SA0A 1R6TA 3CMEV 4PJ0Z 3B2EE 1D5NA 1A32A 1F4MA 1FKAO 3MHSC 4CH6A 5KMGA 2AZ2A 3CP1A 1YJ9V 2YIAA 4FLVA 3QNEA 4D7TA 3JASB 3CXCU 5BMVB 2QM7A 1VQNV 5LGTA 4I55A 3C3TA 4EFBA 3Q4HA 4RQFA 3LSQA 1J5EO 2FB5A 1AP5A 1P49A 3G6EV 2YEVA 4DV2O 1LR1A 2JRIA 3JAMN 4X65B 4UB6Z 3QG5A 5LHHA 5BXZA 1VQ6V 1H2LA 3FX7A 2GSMB 3R65A 3FB6C 3EVKA 3RYFB 1GRJA 1XNRB 1K5SA 1NKDA 1BE3H 5JQGB 2CAZC 2OT5A 1JCHA 1XUQA 3SDLA 3ZHUA 4LH6A 1GN2A 2Y48A 3K57A 2ITCC 4I4TA 5KX5A 3T2MA 4DRXB 4ZKIA 4UB8Z 3G71V 5IT9N 4X65O 3PJSK 4J42A 1K3EA 4IT5A 3JD3A 3JATA 4RUFA 2ZR3A 3JD2A 4JTCB 3O65A 1XNRO 2VQEB 1DF4A 2AW9A 1Q8IA 1KP2A 2N05A 4TV8A 3CC4V 3BPZA 3LDCA 4XDLA 2R9IA 1YSCA 4LC1A 1S0VA 2A9HA 3ETEA 3SPHA 1PV0A 2ZIMA 3SYAA 4DV1B 1W0JG 2B1GA 2NR5A 4JI1B 4QE9A 3A2FA 1SERA 3OW2U 1ZL8A 2QE7G 3VQXA 1NQTA 1TAEA 3BA8A 3HKCA 5JWPA 1NVPD 1OCRB 3DXRB 2VQEO 2CTRA 2Q0OC 3CEIA 4JAAA 2ZE5A 4X20A 1BT8A 5IYDO 4DR3B 3P3NA 2VS0A 4DV1O 3ETDA 2QEXV 3D8CA 3EXAA 2EIMB 3H1KH 4FZ1A 4JI1O 4UV8A 1K33A 2V4DA 5FNVB 2WLJA 5GW7A 1RM1B 4FJCC 5J2UB 1XMOB 2QSAA 4BAYA 3EFFK 5D5PA 1SETA 1IVSA 2F1MA 1BHAA 2ADQB 1GM8A 2RJZA 3GVMA 5CA1A 3SPIA 4O4HA 4GZRB 4KXRA 1UJWB 2A0LA 1YXBA 2R9RB 3TJTA 1S5HC 3W7TA 4IYHA 4DV7B 1HP8A 3BA9A 1IDSA 1THZA 4DR3O 2W6IG 2P4VA 2V7QG 3DC6A 1WA8B 1FD9A 4MT8A 5EYPA 1XMOO 4GKKB 5L3CA 2P4KA 1ENVA 4O4IA 5ITZA 2XOKG 1BL8A 4H37A 1K8AW 5DEDA 2PGGA 1ROPA 3QO8A 5L3FA 1SF9A 2X6BA 1SA0B 1S77D 4C7UA 3ABKB 4K0KB 4PDLA 3K5MA 3CCRV 3TGUH 4DV7O 1VQKV 4X1YA 3EHBB 2XAFA 2W0XA 5C8YA 3F5TA 3JD4A 3OR6C 5KMGB 1T5EA 4UVBA 2F23A 4B3SB 2DYSB 4I55B 3A0HZ 4U7NA 3Q4HB 3CCVV 4MSWC 4E4EA 1M57B 2Y69C 1KECA 2YEVB 4P30A 4GKKO 2CTWA 4X62B 2QM8A 3NR7A 3ZMVA 2K9PA 3UKMA 2IJJA 3N2KA 3ABTA 4DV6B 4DK0A 2H94A 2P5OA 5KUMA 4K0KO 5IE9A 1Z5WA 1Q86W 1QR8A 4B3SO 5IYCO 3AG3B 3STZC 4B7EA 4I0XA 2LW7A 2O57A 4I4TB 2WPDG 5KX5B 3FYIB 4X62O 3OM3B 3ZX6A 4DV6O 1PD3A 3JATB 4A5UB 5C93A 2RMKB 2JDIG 2ZR2A 1FXHA 3ABUA 1OCCC 4UXNA 4K35A 1JOYA 2ZIOA 2L35A 1K97A 2ATKC 4TV8B 1VMGA 3ASNC 1DF5A 4LH7A 4LF8B 5IY5B 3AG2B 1QVFU 2ZQMA 4MVUA 3P3PA 5B66Z 4FLXA 3ZIAG 4NYKA 5KHHA 3L70H 2WLLA 2E3CA 2K1EA 1ZL8B 1BHBA 2X0LA 1XNQB 2DOSA 3HKCB 2CUGA 3H01A 2OTLV 4AILC 4BW5A 3HKDA 3CRMA 1I5YA 2YIBA 3KCXA 5LXTA 2Q7GA 2QDOA 2VRZA 1NZ6A 4ZIBA 3W7SA 4X20B 3GWKC 1V55B 2AXTZ 2QTOA 5BY1A 3KCYA 4LF8O 2Q0AA 3FB8C 1I94B 2Q7EA 3ETGA 1V9PA 2LGQA 3JCZA 4UV9A 5K1PA 4H44B 1XNQO 1U96A 2Q6AA 3L75H 3APQA 5KHGA 3I5DA 5DM6V 5CA1B 4O4HB 4P2ZA 2LGWA 4FLYA 4OXSA 4CH5A 4ZBMA 1I7FA 1I94O 1AR1B 4FFKA 2HVKC 3J80N 1RFYA 3J81N 4MVZA 1QHTA 5IDJA 1N0JA 5JVDA 5EYPB 2DW4A 3CWBH 4NB5A 3C3SA 5LOVA 3ZN0A 4O4IB 4UCSA 5ITZB 1FFTB 3D3QA 2UXBB 3JARA 4HYOA 4F6RA 1XI1A 4K8ZA 3N27A 2M7WA 2DN9A 4X1YB 3CJHA 5EC1C 5C8YB 1AILA 3QF7A 3SYCA 5JH7A 1WP7A 2A3QA 1P4RA 3DC5A 5LMNB 1SQPH 3K3WA 1BS3A 3WFVA 4MW8A 2UXXA 4DV5B 4WFGA 4LF9B 5CBHA 1F7YA 3BY6A 4TWKA 3I55V 1N4CA 5IYBO 1UPGA 3TXSA 3RVYA 1K9MW 2PI4A 2UXBO 4WFFA 1NU1H 3N2KB 4O2BA 1HNZB 1EN6A 5KHIA 2DQ3A 4DR1B 4JAVA 1Q5OA 5B1BB 4MTGA 3D3IA 3H9VA 3QTCA 5LMNO 4I0XB 2WLNA 4JI3B 4JI4B 4GKJB 4Z2WA 3L72H 1FS0G 4B3MB 3O9OA 1BCCH 3CHXA 4DV5O 1N34B 5KHJA 2ZM6B 4LF9O 1W2BU 2MK3A 5A2QN 1XMQB 2EJRA 4NTYA 4X1IA 3K9AA 1NTZH 4JI8B 3BEHA 2EBOA 1HNZO 4W4KA 4FPPA 3OT7A 4TUYA 1Y6XA 3E35A 4DR1O 3HKBA 4ZI7A 3WB0A 2VQFB 2F66C 1QNMA 4TT3G 3ABMB 1GMGA 4JI3O 4JI4O 4GKJO 1Q90D 1GN3A 3RFRA 3RBZA 3ZN1A 4B3MO 1N34O 2LJ2A 2ZM6O 2JVDA 1XMQO 2WLLB 4JI8O 1SS3A 4PA7A 3K08A 4UCTA 4MS2A 4F6EA 3RYCA 3HKDB 1R1BA 1ZUQA 1S72V 5LXTB 2VQFO 3CCEV 2ZINA 2GV9A 4IIJA 1M56B 2DYRC 4OGQB 2EINB 2JGUA 1JVMA 1GK9A 3B40A 2PYJA 2GTSA 4NXMB 1PKXA 2OWOA 1GN4A 2DWEC 2X6CA 4WFHA 4R8CA 5B5EZ 1X4TA 3SPCA 1M93A 2BSKA 1YHQV 2F93B 4RO2A 4FLWA 1XHZA 2Y4TA 1RP3B 4O2AA 3T4DA 5J2TA 2R70A 2QM4A 4LCUC 2CGNA 4MW3A 3RT3C 4FM0A 2ZKOA 3ASOB 4NXMO 4LFBB 3K5NA 3F7VC 4PA3A 2HJFC 4PA9A 4QGPA 4QNHB 3AK3A 5JVDB 3U10A 1NS1A 3THOA 1Q82W 5LOVB 1YJNV 1AR4A 1PP9H 1TA8A 4JZ2A 4P9OA 4DR6B 3JARB 4F6RB 4Z1MG 2CK3G 1WLEA 4NTWA 4AHCA 3B4SA 5IJ9A 3TETA 2IU3A 4B3RB 1MNGA 2BTQA 3CJHB 3L71H 5JH7B 4L8JA 1WNSA 1HNXB 2UXNA 1OCZC 2CE4A 4LFBO 1MOFA 3KG2A 2CGOA 3L9DA 2YDEA 5CMUA 1P7BA 2IM9A 2UUBB 4BWAA 1JFFA 2ZD9A 4KUMA 1YZBA 4JV5B 2QKSA 2DWDC 2DJVA 4DR6O 2ZE8A 2BTOA 3IC9A 4O2BB 2IH3C 1MABG 2IJHA 4DR4B 3B77A 1L0NH 4DR2B 3UQ8A 1P84F 2W0FC 3R66A 4B3RO 3L74H 1MMMA 4JGSA 4TSFG 1HNXO 1YIJV 1KP3A 4IYIA 2ADPA 1IX9A 4R7CA 5LP6A 4FFBA 1VQ5V 2UUBO 2ETNA 1EZJA 4JV5O 1JJOA 3S3WA 4X1IB 4FK5C 1CEZA 4HZ3A 1PM9A 4DR4O 3E8FA 4YXWG 1MSWD 1Z5VA 4DR2O 3LDDA 4TUYB 1KMIZ 3HKBB 4ZI7B 1Q43A 3X2QC 2IU0A 2KKWA 3B8NA 1B04A 3VQYA 3CCJV 4DV3B 4YJ2A 4MVQA 1E1RG 5LYJA 4J9ZB 3G80A 1YI2V 4WBNA 3W7UA 2YXLA 5IWAB 1K34A 4AQYB 4F4LA 4G2KA 4LF6B 1FXKC 4IL6Z 1HWYA 1XHXA 1V54C 5LMUB 3K03A 1JMKC 3D36C 5DN6G 1NTKH 3CCMV 3UM7A 2ZNJA 2VWJA 5CBFA 4MVMA 1P7GA 1AJNA 3RYCB 4QE7A 3AG4C 2IBZH 4CBCA 4GYCB 5E1AC 5H6RA 4DV3O 3IC7A 3FB7C 1R6NA 1OCRC 3CC2V 4IIJB 3H1HH 3SPGA 5IWAO 3UT5A 4AQYO 1R3JC 2A7WA 3OFNG 4LF6O 4PI2A 5JJJB 1HNWB 1W59A 1KB9F 3SJBC 5LMUO 3LSSA 2BSKB 3RVZA 1TGOA 1SQXH 3JSLA 1AB3A 5L3EA 3WU2Z 5J2TB 4O2AB 1QLEC 4ZOLA 5FLXN 4OX9B 2OYQA 1WAZA 2HFEC 4K8XA 4MVSA 3H1LH 4I5SA 5EBLC 1F4NA 4LFCB 4FIPC 3QO7A 2ILMA 1HNWO 4JAUA 4J80A 2FTKA 5EC2C 1GH6A 3SJQC 1EBOA 4H13B 3ML0A 3A8TA 4N23A 2ZNIA 4PHZA 2IJKA 3A0RA 1NBMG 4OX9O 4EKWA 1PPJH 4KHPB 1AI7A 3K0GA 1K4CC 1URFA 4UVAA 3DGEA 5IJ9B 2BTQB 4R6ZA 4TQFA 4U3FH 3SPJA 3G67A 3M7MX 4OPHA 4LFCO 4PA4A 2WA3A 4ZHQA 2ZDIC 4Q6GA 2Y69B 1JFFB 2GTAA 5CN0A 1N36B 1D2DA 3CCUV 2IH1C 1VF7A 3MAQA 3K5LA 3CRRA 4O4JA 1KC8W 3RWRD 5E79Z 3OAAG 2KQXA 4KHPO 2LP7A 2FL4A 2ITDC 3M8AA 2QTSA 5LBQA 2QKCA 4J11A 5CA3A 2H8PC 4JTDB 3OGIB 3BVOA 5EIBD 1IBKB 2EJ7A 1QR9A 1SKVA 2D3OW 5H2FZ 4IHJA 1FPOA 3ZEDA 5LP6B 4FFBB 4CZZA 1N36O 1PNKA 1M9NA 2IW5A 5AG2A 2UU9B 2E76B 4BIZA 3CMAV 3CC7V 1ZX3A 1YVWA 1OCCB 4MTOA 1VQLV 1YDXA 3CCLV 2PZSA 1JA8A 3MDSA 4YJ2B 5JCOC 1NT2B 3ZCCA 1IBKO 5LYJB 5FPOA 5CBGA 3BAAA 2ZCEA 1QBZA 4WBNB 1XOUA 2ZXWC 3ASNB 3K59A 4YJ3A 3RGBA 1IBMB 5LL6Y 2EIKC 2JJ1G 3ABLC 4YIPA 1F51A 5IJ0A 4DV0B 3RYIA 4E2LA 2UU9O 1VQ9V 4JYYA 2X7RB 2Y4UA 2XASA 2Z5UA 4LF7B 4H33A 2FMLA 3K5OA 1BSMA 3FFQA 3RN4A 2OCCC 1SRYA 2LQTA 5HFLA 4RAIA 2AGAA 1SESA 2JGDA 1D5AA 3UT5B 1N0NA 3JAWA 1IBMO 4EEQA 4WF9V 2BE3A 5B1AC 2LFRA 4QPKA 1PL0A 4LF4B 4Q20A 3JYCA 5CA0A 2Q8VA 5GONA 4DV0O 1I08A 2AHYA 3E89A 4FM2A 1IXBA 4LF7O 2HLDG 2ODMA 3JCUZ 1YTFD 1DLBA 3CXHF 4D7SA 2YIBD 5JJEB 2QJ1A 1Q6IA 4ZOLB 3ZRSA 4Z1VA 4BW9A 3SYOA 2EZOA 3SJCC 5L3BA 4KL1A 3P32A 4HNAA 3FYEB 5K1XA 2ZE7A 4LF4O 3E8HA 3SR2C 1QCEA 3TXQA 4PDRA 3APOA 1PNLA 3K04A 4GX0A 1AJPA 2HKOA 3OMNB 4I7ZB 4UCRA 2Y0PA 5F2VO 4JI7B 4W4LA 4GT1A 4JASA 4U7OA 2EZPA 2P06A 1TUEB 1KKDA 3CS5A 2UXDB 5CB4A 4B3TB 4FZ0A 4ZHQB 3ZHTA 2Q73A 1K73W 2QGNA 4P9PA 5L3GA 5EIBC 3WG7C 1SQBH 3UO2A 1QQCA 3CRQA 1RSOA 3G4SV 4O4JB 3TCUA 4JI5B 5B3SC 5FL7G 4JI7O 2N74A 2WWWA 1US6A 2M6YA 1K5QA 1ZWIC 3HPLC 3HKEA 1EFRG 2UXDO 1SQQH 2B9ZA 4B3TO 4IHJB 4IGGA 4H0LB 4K3AA 2HJDA 3SJAC 4YY3B 2OTJV 3K06A 1G8MA 2KSDA 1IBLB 3K58A 2UUAB 3BFRA 4UCUA 1TUBA 4LWSA 4JI5O 2A06H 5EZYA 1QU7A 3AG1B 3HR0A 4AI8A 3CX5F 2P90A 5A9GA 1BQ0A 1CPYA 2D2CB 3U11A 1F23A 4YJ3B 1XEQA 4FLZA 4YY3O 1WPBA 4MVRA 2OIGA 1FXKA 4EFEA 4J7JA 1Q6UA 4LBEC 1IBLO 4I50A 3OGCC 5IJ0B 1FJGB 4NKGB 3RYIB 2UUAO 3D36A 1H2SB 5H5NA 2PTMA 4FVMA 5KUKA 1KYOF 2WLIA 4YIOA 3OUSA 4UCVA 1MA1A 1WN7A 4CC6A 2HP8A 1N8RW 2YC0A 1Z2GA 4J10A 2DYRB 1Y76A 2JGDB 1BGYH 3JAWB 2EILC
chains in the Genus database with same CATH topology
4MVQA 1E1RG 4J9ZB 1YI2V 2H94A 3W7UA 5KUMA 2WLHA 5LHGA 1NH2B 2AHZA 1K34A 5EBMC 2X6AA 4F4LA 4G2KA 1Q86W 1FXKC 1S3JA 4X89A 3OMIB 3RW0A 1OCOB 1HWYA 1QR8A 3MD0A 5IYCO 3AG3B 3STZC 1V54C 2BOBC 4DXWA 3ZRVA 2Q67A 3K03A 5DN6G 3CCMV 3UM7A 3W7WA 1MG1A 1VQ4V 2WPDG 2EIJC 5B1OA 3FYIB 3VBBA 4MTFA 5CBFA 4MVMA 1K7DA 2F43G 1AJNA 2XAJA 3OM3B 4KP4A 4XDKA 1DTOA 4QE7A 3AG4C 4CBCA 1Y4MA 5E1AC 5H6RA 1PD3A 5KA5A 5H6QA 2JEXA 3IC7A 3WG7B 3FB7C 5C93A 1R6NA 1OCRC 3CC2V 1R3LC 1COWG 2JDIG 3SPGA 4N21A 2ZR2A 1FXHA 3ABUA 1OCCC 1R3JC 1XL6A 3F7YC 3OFNG 3ZRXA 4UXNA 5B3SB 1JOYA 1K97A 2ATKC 3IFXA 1FXVA 4WFBV 3ASNC 1DF5A 5IY5B 5KA6A 3AG2B 3LUTB 3E8GA 1AI6A 3LSSA 1S76D 1QVFU 1H8EG 2ZQMA 5B1BC 2Z3YA 3RVZA 4GX5A 1AI4A 4MVUA 1K4DC 3ZIAG 5L3EA 1H8HG 1QLEC 2WAMA 2WLLA 2Q68A 1OCZB 1BHBA 2K1EA 2X0LA 4JYCA 2HFEC 3H01A 3CPWU 4MVSA 2ZDIA 2OTLV 3ZMZA 4BW5A 4MTXA 1I5YA 3E8BA 3CD6V 4I5SA 5EBLC 1J95A 1F4NA 3W7SA 4FIPC 3QO7A 1B6QA 3ZRWB 1V55B 2QTOA 3DTUB 4JAUA 4JF3A 4MVOA 5LGUA 2WSSG 2FTKA 1Q7YW 5EC2C 3MHHC 1R3IC 1RPOA 3OEHG 3SJQC 3AG1C 3ZMSA 1EBOA 3FB8C 3ML0A 2A79B 3ETGA 4N23A 1W0KG 3ABMC 3CCSV 2IJKA 3A0RA 4UUJC 3FB5C 5EBWC 1NBMG 1AI5A 3JCZA 2XAQA 4UV9A 1R3KC 4EKWA 1GM9A 1AI7A 2Q6AA 3K0GA 1K4CC 2LFSA 4FMTA 4LP8A 4UVAA 3DGEA 4R6ZA 3I56V 3SPJA 4QJFB 4DO2A 5DM6V 1KD1W 4P2ZA 1H38A 3CCQV 5L3DA 4OXSA 4PA4A 2C2AA 3SYPA 3ZMUA 2ZDIC 5B1NA 2HG5C 2Y69B 4ZBMA 4WFAV 1AJQA 3GB7C 5CN0A 2NNUA 3CCUV 1AR1B 1YTFB 2XAGA 2HVKC 3K0DA 2DQ0A 2JEUA 1M56C 2IH1C 3LDEA 4MVZA 2EINC 4XBFA 3X2QB 5IDJA 2EILB 1KC8W 2DW4A 3OAAG 3ZMTA 1NR7A 2LP7A 3VOUA 3ZN0A 2ITDC 1L1FA 1FFTB 5LBQA 4PELA 1E1QG 5CA3A 2H8PC 4HYOA 3TK1A 4JPRA 4JTDB 5J9PC 4I9WA 3W7XA 1FXKB 1K92A 1QR9A 1IXMA 1GTOA 2WLMA 3OR7C 2HR3A 1V54B 3M99B 2D3OW 4QPJA 2PI5A 2M7WA 1GO3F 1OCOC 3OMAB 1R73A 5EC1C 3SYCA 1GM7A 4GX2A 2WLIB 4CZZA 2EIJB 1PNKA 1M9NA 1P4RA 1E79G 3F5WC 2IW5A 3K3WA 1VQPV 3AG4B 3WFVA 4MW8A 1YJWV 5LGNA 2UXXA 1NR1A 1NJIW 2IJIA 4WFGA 3JD1A 4BIZA 3ASOC 5CBHA 3CMAV 1RPRA 2GHYA 2XNDG 3CC7V 3BY6A 4TWKA 3I55V 1OCCB 4MTOA 5IYBO 3RVYA 1VQLV 1K9MW 2PI4A 4WFFA 3CCLV 1QVGU 3ZCCA 5CBGA 4L87A 4PDMA 1QBZA 2EIMC 2DQ3A 1GKFA 2ZXWC 1JJ2U 3ASNB 5H9CA 4J9YB 1M90W 1KQSU 1VQ8V 4GCZA 2EIKC 4JAVA 1RM1C 2XAHA 5B1BB 3E2EA 2P6JA 4MTGA 3D3IA 2QA4V 2JJ1G 3ABLC 2WLNA 1F51A 3OUFA 3CMEV 3CYOA 4E2LA 1F4MA 2V1DA 1VQ9V 2NLJC 1QLEB 3MHSC 2X7RB 1FS0G 3CP1A 2XASA 2Z5UA 1YJ9V 4H33A 3QNEA 2MK3A 1W2BU 3CXCU 2QM7A 1VQNV 5LGTA 2EJRA 4RQFA 3LSQA 3K9AA 3G6EV 2OCCC 3BEHA 2EBOA 3E86A 2YEVA 1SRYA 4FPPA 5HFLA 4RAIA 3E35A 1SESA 4X8AA 5LHHA 1H2GA 1VQ6V 4WF9V 5B1AC 1G4YB 2LFRA 1Q81W 4QPKA 1PL0A 1YITV 5LHIA 2GSMB 3B8MA 3R65A 4Q20A 4TT3G 3JYCA 5HFMA 3ABMB 1GMGA 3FB6C 3OEEG 2AHYA 3E89A 1K5SA 2HVJC 1NKDA 1JPXA 3RBZA 3ZN1A 2OT5A 1JCHA 2HLDG 1YTFD 1DLBA 3ABKC 3HB3B 2Y48A 2WLLB 3ZRSA 2ITCC 3T2MA 4PA7A 4KFMA 3SYOA 4ZKIA 2EZOA 3G71V 3K08A 2DYSC 4BIUA 1CP9A 5L3BA 3PJSK 4MS2A 3P32A 1M57C 1K3EA 3FYEB 1S72V 4RUEA 3JD3A 3CCEV 4RUFA 3OE7G 2ZR3A 3E8HA 3JD2A 1M56B 4JTCB 1LNQA 2DYRC 2EINB 1JVMA 1GK9A 3E83A 3FKSG 1QCEA 5BZBA 1DF4A 4PDRA 1PNLA 2WLKA 1PKXA 1KP2A 3K04A 4GX0A 1AJPA 2HKOA 1PNMA 3OMNB 3CC4V 3LDCA 2DWEC 2X6CA 4WFHA 2R9IA 4R8CA 3P30A 1YSCA 4XDLA 4LC1A 1S0VA 2A9HA 3ETEA 3SPHA 3SPCA 3SYAA 1YHQV 4GT1A 4RO2A 3AG3C 4JASA 1W0JG 2B1GA 4U7OA 1AROP 4QE9A 1SZTA 3T4DA 2P67A 3JD0A 2EZPA 1SERA 3OW2U 1TUEB 1KKDA 3IGAC 2QE7G 1NVPD 1NQTA 4LCUC 4XDJA 4MW3A 1OCRB 4PA6A 4WFEA 1K73W 4P9PA 2JK5C 5L3GA 3ZJZA 4R50A 3WG7C 3ASOB 2JJ2G 4G27B 3F7VC 4PA3A 3ZRWA 1M1KW 1OZ0A 2HJFC 3T4ZA 4PA9A 4PDVA 1NVPB 5IYDO 2BOCC 4QNHB 3G4SV 3TCUA 1VQOV 1Q82W 4HAMA 5B3SC 5FL7G 2JIZG 2KB1A 3ETDA 1YJNV 2QEXV 2WWWA 2EIMB 1R6KA 3T1CA 2ZXWB 1K5QA 1ZWIC 3HPLC 4P9OA 4UV8A 5IY5C 3AG2C 4QIWF 1K33A 1Y66A 4Z1MG 2EIKB 2WLJA 5GW7A 1EFRG 1RM1B 4FJCC 2B1IA 2CK3G 1WLEA 3ABLB 3EFFK 4BAYA 1SETA 3TETA 2IU3A 2Q69A 1BHAA 1GM8A 4GX1A 4WCEV 2OTJV 3K06A 4G28B 3SPIA 3B8NA 2UXNA 3SYQA 1OCZC 1G8MA 1UJWB 1WPXA 2A0LA 4UVCA 1VQMV 1MOFA 3KG2A 3NXSA 4ASUG 2B5UA 2R9RB 4RQEA 1S5HC 3W7TA 5CMUA 1P7BA 4JYBA 4X88A 2OCCB 2ZD9A 4KUMA 1THZA 1I5XA 2W6IG 3STLC 3AG1B 2V7QG 2QKSA 1JX9A 1XL4A 4MT8A 1V55C 2DWDC 3LNMB 3AEIA 1OHHG 3QO5A 2P90A 2IH3C 1MABG 2IJHA 5B1AB 1JQ0A 3B77A 1CPYA 5L3CA 1ENVA 1F23A 2W0FC 2XOKG 1BL8A 4H37A 3K79A 4JTAB 1K8AW 4JGSA 4TSFG 2YSUB 4MVRA 1ROPA 3QO8A 1FXKA 3GWOA 1VQ7V 1YIJV 1KP3A 2W6JG 5L3FA 1ORQC 2X6BA 1S77D 4LBEC 3OGCC 3ABKB 4PDLA 3CCRV 1VQKV 3EHBB 3D36A 2XAFA 1VQ5V 4R7CA 5KUKA 3JD4A 3OR6C 2P7TC 2WLIA 4UVBA 1EZJA 2DYSB 1QLNA 4U7NA 4FK5C 3CCVV 3CCJV 4MSWC 1BMFG 1M57B 2Y69C 3OUSA 1CEZA 1KECA 4HZ3A 2YEVB 4P30A 3E8FA 4YXWG 5EK0A 1MSWD 1N8RW 1NH2D 2QM8A 3LDDA 2DYRB 3ZMVA 3UKMA 3X2QC 2IJJA 2IU0A 3ABTA 2EILC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7R B;  3M99 B;  3B8M A;  2M7W A;  3CP1 A;  1I5Y A;  3P30 A;  1DF5 A;  5HFM A;  2MK3 A;  5KA6 A;  4FIP C;  1Y4M A;  1JQ0 A;  1QBZ A;  3B77 A;  3K9A A;  1K34 A;  1JPX A;  5KA5 A;  1ENV A;  4JF3 A;  2OT5 A;  4FK5 C;  5H9C A;  1F23 A;  4G2K A;  2EBO A;  1DLB A;  1SZT A;  2LP7 A;  3MHH C;  1MOF A;  1QR8 A;  3WFV A;  2EZP A;  5HFL A;  4N21 A;  1QCE A;  1EBO A;  4JGS A;  1DF4 A;  2P6J A;  5CMU A;  3GWO A;  4JPR A;  4N23 A;  1K33 A;  3CYO A;  1Y66 A;  4E2L A;  1MG1 A;  1QR9 A;  1I5X A;  3H01 A;  5CN0 A;  4FJC C;  2EZO A;  3B8N A;  3MHS C; 
#chains in the Genus database with same CATH topology
 4J7K A;  1XRE A;  3OTO B;  5CA0 B;  1FJG O;  2WLH A;  5GON B;  3WB2 A;  1NH2 B;  1LUW A;  2AHZ A;  1I0H A;  3BHP A;  1S3J A;  3RW0 A;  3OMI B;  1OCO B;  3MD0 A;  3RYH A;  3OTF A;  2FKX A;  3IAY A;  3VQV A;  2GDS A;  3W7W A;  2EIJ C;  5D5Q A;  1G1X B;  5B1O A;  3VBB A;  5IYZ A;  1K7D A;  1YCI A;  4HNA B;  2Q4P A;  1FAF A;  1OJH A;  1COW G;  3OTO O;  4N21 A;  1S5J A;  4FM1 A;  1VP7 A;  1XL6 A;  2QR4 A;  4FLU A;  3CE2 A;  5FPR A;  4X9Q A;  3ETQ A;  3IFX A;  1FXV A;  4X64 B;  1XQ8 A;  4LR3 A;  2YI9 A;  4DW1 A;  1AI6 A;  1H8E G;  2KG7 A;  1AP6 A;  3N2G A;  1AI4 A;  1K4D C;  2JS5 A;  4O4L A;  1H8H G;  2WAM A;  2Q68 A;  1OCZ B;  5CB4 B;  4PV1 B;  2DMX A;  2ZDI A;  3A0B Z;  3ZMZ A;  4MTX A;  2GUZ A;  5JJN B;  3ZS8 C;  1N32 B;  1J95 A;  2E5L B;  1B6Q A;  1ZTE A;  1HDJ A;  1RSO B;  4JF3 A;  4MVO A;  5LGU A;  1Q7Y W;  2YIC A;  4X64 O;  1WJZ A;  2P22 C;  1VEW A;  1R3I C;  3MHH C;  1XBL A;  1VF6 C;  2A79 B;  3CCS V;  4UUJ C;  3HKE B;  2XAQ A;  1NTM H;  2YXH A;  3U0Z A;  2LFS A;  4FMT A;  4RWU A;  3JSN A;  4BIO A;  3I56 V;  4CH4 A;  4DO2 A;  4PI0 A;  1H38 A;  5DEC A;  1N32 O;  4DR5 B;  5L3D A;  4NVP A;  2E5L O;  4DR7 B;  2C2A A;  3SYP A;  1KUQ A;  2Z0A A;  5B1N A;  2PUS A;  1TUB B;  4LWS B;  4WFA V;  2ZT9 B;  2NNU A;  5EZY B;  3BAB A;  2AZ0 A;  2DQ0 A;  2N04 A;  3X2Q B;  2Q5Z A;  3BCC H;  5JCO A;  3ZMT A;  4NR1 A;  1E1Q G;  1MZE A;  4TOI A;  3TK1 A;  4JPR A;  4I9W A;  1FXK B;  4DR5 O;  2WLM A;  4DR7 O;  5KAF Z;  3M99 B;  1V54 B;  4I50 B;  3JAK A;  4QPJ A;  2PI5 A;  1GO3 F;  1G6U A;  2WLI B;  2QKA A;  2HHH B;  1E79 G;  3F5W C;  4LF5 B;  3AG4 B;  1IUR A;  3UO3 A;  4HBN A;  1NJI W;  2IJI A;  1B3Q A;  1Y67 A;  4LNU A;  2GHY A;  4I9Q A;  1Y76 B;  4ABM A;  3ZHR A;  3CSX A;  2Q7H A;  1QVG U;  4L87 A;  2L6L A;  3QVN A;  4PDM A;  2XTA A;  2EIM C;  1JJ2 U;  1FFX A;  3DSQ A;  1M90 W;  3AK1 A;  1RM1 C;  2XAH A;  1KKC A;  2HHH O;  2QA4 V;  3RYH B;  1H2M A;  3OUF A;  1Y74 A;  3UCS C;  4LF5 O;  4EB6 A;  3CYO A;  2RDC A;  2V1D A;  2NLJ C;  3PN1 A;  1QLE B;  2YID A;  3CRA A;  4JI0 B;  5IYZ B;  3T1H B;  1Q6H A;  4JYA B;  2F4V B;  3E86 A;  3ZHV A;  1GAX A;  2QWQ B;  2HEP A;  1PL4 A;  4X8A A;  1GN6 A;  4OPA A;  1H2G A;  2CTP A;  1G4Y B;  1Q81 W;  1YIT V;  5LHI A;  3B8M A;  3BRC A;  5HFM A;  3OEE G;  4D6T H;  2YUA A;  1WP8 A;  2HVJ C;  1JPX A;  2KG7 B;  4DUZ B;  3N2G B;  1VF5 B;  3ICX A;  4JI0 O;  3ABK C;  4O4L B;  5GTH Z;  3T1H O;  3HB3 B;  1BZK A;  4JYA O;  2F4V O;  4KFM A;  2DYS C;  4BIU A;  1CP9 A;  4JZG A;  1M57 C;  2GUZ B;  4RUE A;  3OE7 G;  4GUN A;  1LNQ A;  4CS3 A;  1B06 A;  4B7K A;  3E83 A;  4TQD A;  3S3X A;  3FKS G;  2YS8 A;  5BZB A;  1TVK A;  4DUZ O;  2DE0 X;  2WLK A;  2R72 A;  4JI6 B;  1HW7 A;  4CH3 A;  4DV4 B;  1PNM A;  1OV9 A;  3P30 A;  2UUC B;  3AG3 C;  4U3J A;  1M4U A;  1ZAU A;  1ARO P;  1SZT A;  4DK1 A;  2P67 A;  3JD0 A;  1H2N A;  1XIL A;  3IGA C;  3KKY A;  5LP6 C;  4XDJ A;  4PD4 F;  4PA6 A;  1N33 B;  4WFE A;  2JK5 C;  4BR6 A;  3ZJZ A;  4R50 A;  2JJ2 G;  4JI6 O;  2H3O A;  4G27 B;  3ZRW A;  1M1K W;  1OZ0 A;  4DV4 O;  3T4Z A;  4PDV A;  1NVP B;  2BOC C;  1VQO V;  2UUC O;  4HAM A;  2JIZ G;  2KB1 A;  5KHK A;  5LA6 A;  1O9G A;  1R6K A;  3T1C A;  2ZXW B;  1EN4 A;  2RNB A;  2PY5 A;  5IY5 C;  4TV9 A;  3AG2 C;  4QIW F;  1Y66 A;  4CS2 A;  2EIK B;  1KBH A;  2B1I A;  1WB7 A;  3JAL A;  3ABL B;  3JAK B;  2Q69 A;  5GTI Z;  1N33 O;  4GX1 A;  4WCE V;  2NN4 A;  4G28 B;  3SYQ A;  1WPX A;  4UVC A;  1VQM V;  2CH7 A;  4NXN B;  3E22 A;  3NXS A;  2B5U A;  4ASU G;  4RQE A;  2QWO B;  4JYB A;  2EX3 A;  3AG7 A;  4X88 A;  2OCC B;  3LNN A;  4JI2 B;  1I5X A;  3STL C;  4LNU B;  3OD4 A;  1JX9 A;  1XL4 A;  1V55 C;  3LNM B;  1DGS A;  3J7A U;  3AEI A;  1OHH G;  3LSU A;  3QO5 A;  1U97 A;  2XUM A;  5B1A B;  1JQ0 A;  2RN9 A;  1MZF A;  1FFX B;  2R9A A;  3K79 A;  4JTA B;  2YSU B;  1VQ7 V;  3GWO A;  2LW1 A;  1DK1 A;  2W6J G;  1ORQ C;  2PYL A;  1YF2 A;  4NXN O;  1Y74 B;  1L8D A;  4EB6 B;  1WB8 A;  4YHH B;  2P7T C;  4JI2 O;  3T1Y B;  1S5L Z;  1QLN A;  1BMF G;  3VQW A;  1AVM A;  2MW2 B;  3FAV A;  5EK0 A;  2FYU H;  1NH2 D;  4J41 A;  4J7Z A;  3B09 A;  2E75 B;  2G38 A;  2QWR B;  4X1K A;  5LHG A;  5BR8 B;  5EBM C;  2X6A A;  3K9S A;  2JS3 A;  2XT9 A;  4YHH O;  4X89 A;  1XDC A;  1M5I A;  4CS4 A;  3T1Y O;  2QWP B;  2BOB C;  4DXW A;  3ZRV A;  2Q67 A;  1ZLZ A;  2RCV A;  1O9H A;  1VQ4 V;  1MG1 A;  2E74 B;  4B08 A;  5TIS Z;  2GBO A;  4MTF A;  3JAS A;  3C90 A;  5BMV A;  2F43 G;  2XAJ A;  4KP4 A;  4XDK A;  5KLV H;  2XHB A;  1DTO A;  5KAI Z;  1IZ3 A;  1Y4M A;  5KA5 A;  5H6Q A;  2JEX A;  3WG7 B;  1JR9 A;  1SQF A;  1R3L C;  2Q9L A;  1LUV A;  5BR8 O;  3F7Y C;  1TVK B;  1NI8 A;  3ZRX A;  1L0L H;  1MSD A;  5B3S B;  1VF6 A;  2PF4 E;  1H2K A;  3RYF A;  4CC5 A;  4WFB V;  5KA6 A;  1UFI A;  3LUT B;  3AK2 A;  3E8G A;  1S76 D;  5JQG A;  5B1B C;  2Z3Y A;  4U3J B;  3G6B A;  4GX5 A;  3FD9 A;  1CXZ B;  3KZI Z;  4DRX A;  4JYC A;  3CPW U;  3E8B A;  3CD6 V;  4LFA B;  3ZRW B;  3DTU B;  2CDY A;  2WSS G;  1RPO A;  4UFZ A;  3OEH G;  3AG1 C;  3ZMS A;  2Y0I A;  1VAR A;  5LA6 B;  1VIB A;  1W0K G;  3ABM C;  4DUY B;  3FB5 C;  2BCC H;  4ICG A;  4TV9 B;  5EBW C;  3ZBH A;  2EUL A;  1AI5 A;  2OIE A;  1R3K C;  4DW0 A;  1GM9 A;  3JAL B;  4LP8 A;  3H1I H;  3CRC A;  4X66 B;  3ZHQ A;  4QJF B;  1HR0 B;  1KD1 W;  1SQV H;  3CCQ V;  4DYL A;  2CH7 B;  4LFA O;  3E22 B;  3ZMU A;  2QWN B;  2HG5 C;  3DXR A;  1AJQ A;  3GB7 C;  1X59 A;  1YTF B;  1FYJ A;  2XAG A;  1Q3E A;  3K0D A;  2JEU A;  1M56 C;  3LDE A;  2WA4 A;  1BQZ A;  2EIN C;  1SQG A;  4DUY O;  4XBF A;  2EIL B;  2OCH A;  1NR7 A;  2UXC B;  2CTQ A;  3VOU A;  2F95 B;  1L1F A;  4PEL A;  4X66 O;  3CB2 A;  2VWK A;  1SZX A;  1HR0 O;  1EM1 A;  5J9P C;  3W7X A;  5FNV A;  2LO1 A;  5J2U A;  1K92 A;  1IXM A;  1GTO A;  3OR7 C;  1YEW A;  2HR3 A;  1OCO C;  1EZV H;  3OMA B;  1R73 A;  4GLX A;  1GM7 A;  4GX2 A;  2EIJ B;  4UCO A;  3L73 H;  1AR5 A;  1VQP V;  1YJW V;  5LGN A;  1NR1 A;  3FAV B;  2ARH A;  2ZE6 A;  3JD1 A;  3ASO C;  2UXC O;  1ZSP A;  1RPR A;  4FLT A;  2XND G;  1WA8 A;  4NTX A;  1KU9 A;  3H1J H;  1J5E B;  3IJ4 A;  4DV2 B;  2YI8 A;  3SGI A;  1EN5 A;  2RQ6 A;  1GKF A;  4X1K B;  3WB1 A;  5H9C A;  4J9Y B;  1KQS U;  1VQ8 V;  3ZHS A;  4GCZ A;  3E2E A;  2P6J A;  1SC5 B;  2YXY A;  1SA0 A;  1R6T A;  3CME V;  4PJ0 Z;  3B2E E;  1D5N A;  1A32 A;  1F4M A;  1FKA O;  3MHS C;  4CH6 A;  5KMG A;  2AZ2 A;  3CP1 A;  1YJ9 V;  2YIA A;  4FLV A;  3QNE A;  4D7T A;  3JAS B;  3CXC U;  5BMV B;  2QM7 A;  1VQN V;  5LGT A;  4I55 A;  3C3T A;  4EFB A;  3Q4H A;  4RQF A;  3LSQ A;  1J5E O;  2FB5 A;  1AP5 A;  1P49 A;  3G6E V;  2YEV A;  4DV2 O;  1LR1 A;  2JRI A;  3JAM N;  4X65 B;  4UB6 Z;  3QG5 A;  5LHH A;  5BXZ A;  1VQ6 V;  1H2L A;  3FX7 A;  2GSM B;  3R65 A;  3FB6 C;  3EVK A;  3RYF B;  1GRJ A;  1XNR B;  1K5S A;  1NKD A;  1BE3 H;  5JQG B;  2CAZ C;  2OT5 A;  1JCH A;  1XUQ A;  3SDL A;  3ZHU A;  4LH6 A;  1GN2 A;  2Y48 A;  3K57 A;  2ITC C;  4I4T A;  5KX5 A;  3T2M A;  4DRX B;  4ZKI A;  4UB8 Z;  3G71 V;  5IT9 N;  4X65 O;  3PJS K;  4J42 A;  1K3E A;  4IT5 A;  3JD3 A;  3JAT A;  4RUF A;  2ZR3 A;  3JD2 A;  4JTC B;  3O65 A;  1XNR O;  2VQE B;  1DF4 A;  2AW9 A;  1Q8I A;  1KP2 A;  2N05 A;  4TV8 A;  3CC4 V;  3BPZ A;  3LDC A;  4XDL A;  2R9I A;  1YSC A;  4LC1 A;  1S0V A;  2A9H A;  3ETE A;  3SPH A;  1PV0 A;  2ZIM A;  3SYA A;  4DV1 B;  1W0J G;  2B1G A;  2NR5 A;  4JI1 B;  4QE9 A;  3A2F A;  1SER A;  3OW2 U;  1ZL8 A;  2QE7 G;  3VQX A;  1NQT A;  1TAE A;  3BA8 A;  3HKC A;  5JWP A;  1NVP D;  1OCR B;  3DXR B;  2VQE O;  2CTR A;  2Q0O C;  3CEI A;  4JAA A;  2ZE5 A;  4X20 A;  1BT8 A;  5IYD O;  4DR3 B;  3P3N A;  2VS0 A;  4DV1 O;  3ETD A;  2QEX V;  3D8C A;  3EXA A;  2EIM B;  3H1K H;  4FZ1 A;  4JI1 O;  4UV8 A;  1K33 A;  2V4D A;  5FNV B;  2WLJ A;  5GW7 A;  1RM1 B;  4FJC C;  5J2U B;  1XMO B;  2QSA A;  4BAY A;  3EFF K;  5D5P A;  1SET A;  1IVS A;  2F1M A;  1BHA A;  2ADQ B;  1GM8 A;  2RJZ A;  3GVM A;  5CA1 A;  3SPI A;  4O4H A;  4GZR B;  4KXR A;  1UJW B;  2A0L A;  1YXB A;  2R9R B;  3TJT A;  1S5H C;  3W7T A;  4IYH A;  4DV7 B;  1HP8 A;  3BA9 A;  1IDS A;  1THZ A;  4DR3 O;  2W6I G;  2P4V A;  2V7Q G;  3DC6 A;  1WA8 B;  1FD9 A;  4MT8 A;  5EYP A;  1XMO O;  4GKK B;  5L3C A;  2P4K A;  1ENV A;  4O4I A;  5ITZ A;  2XOK G;  1BL8 A;  4H37 A;  1K8A W;  5DED A;  2PGG A;  1ROP A;  3QO8 A;  5L3F A;  1SF9 A;  2X6B A;  1SA0 B;  1S77 D;  4C7U A;  3ABK B;  4K0K B;  4PDL A;  3K5M A;  3CCR V;  3TGU H;  4DV7 O;  1VQK V;  4X1Y A;  3EHB B;  2XAF A;  2W0X A;  5C8Y A;  3F5T A;  3JD4 A;  3OR6 C;  5KMG B;  1T5E A;  4UVB A;  2F23 A;  4B3S B;  2DYS B;  4I55 B;  3A0H Z;  4U7N A;  3Q4H B;  3CCV V;  4MSW C;  4E4E A;  1M57 B;  2Y69 C;  1KEC A;  2YEV B;  4P30 A;  4GKK O;  2CTW A;  4X62 B;  2QM8 A;  3NR7 A;  3ZMV A;  2K9P A;  3UKM A;  2IJJ A;  3N2K A;  3ABT A;  4DV6 B;  4DK0 A;  2H94 A;  2P5O A;  5KUM A;  4K0K O;  5IE9 A;  1Z5W A;  1Q86 W;  1QR8 A;  4B3S O;  5IYC O;  3AG3 B;  3STZ C;  4B7E A;  4I0X A;  2LW7 A;  2O57 A;  4I4T B;  2WPD G;  5KX5 B;  3FYI B;  4X62 O;  3OM3 B;  3ZX6 A;  4DV6 O;  1PD3 A;  3JAT B;  4A5U B;  5C93 A;  2RMK B;  2JDI G;  2ZR2 A;  1FXH A;  3ABU A;  1OCC C;  4UXN A;  4K35 A;  1JOY A;  2ZIO A;  2L35 A;  1K97 A;  2ATK C;  4TV8 B;  1VMG A;  3ASN C;  1DF5 A;  4LH7 A;  4LF8 B;  5IY5 B;  3AG2 B;  1QVF U;  2ZQM A;  4MVU A;  3P3P A;  5B66 Z;  4FLX A;  3ZIA G;  4NYK A;  5KHH A;  3L70 H;  2WLL A;  2E3C A;  2K1E A;  1ZL8 B;  1BHB A;  2X0L A;  1XNQ B;  2DOS A;  3HKC B;  2CUG A;  3H01 A;  2OTL V;  4AIL C;  4BW5 A;  3HKD A;  3CRM A;  1I5Y A;  2YIB A;  3KCX A;  5LXT A;  2Q7G A;  2QDO A;  2VRZ A;  1NZ6 A;  4ZIB A;  3W7S A;  4X20 B;  3GWK C;  1V55 B;  2AXT Z;  2QTO A;  5BY1 A;  3KCY A;  4LF8 O;  2Q0A A;  3FB8 C;  1I94 B;  2Q7E A;  3ETG A;  1V9P A;  2LGQ A;  3JCZ A;  4UV9 A;  5K1P A;  4H44 B;  1XNQ O;  1U96 A;  2Q6A A;  3L75 H;  3APQ A;  5KHG A;  3I5D A;  5DM6 V;  5CA1 B;  4O4H B;  4P2Z A;  2LGW A;  4FLY A;  4OXS A;  4CH5 A;  4ZBM A;  1I7F A;  1I94 O;  1AR1 B;  4FFK A;  2HVK C;  3J80 N;  1RFY A;  3J81 N;  4MVZ A;  1QHT A;  5IDJ A;  1N0J A;  5JVD A;  5EYP B;  2DW4 A;  3CWB H;  4NB5 A;  3C3S A;  5LOV A;  3ZN0 A;  4O4I B;  4UCS A;  5ITZ B;  1FFT B;  3D3Q A;  2UXB B;  3JAR A;  4HYO A;  4F6R A;  1XI1 A;  4K8Z A;  3N27 A;  2M7W A;  2DN9 A;  4X1Y B;  3CJH A;  5EC1 C;  5C8Y B;  1AIL A;  3QF7 A;  3SYC A;  5JH7 A;  1WP7 A;  2A3Q A;  1P4R A;  3DC5 A;  5LMN B;  1SQP H;  3K3W A;  1BS3 A;  3WFV A;  4MW8 A;  2UXX A;  4DV5 B;  4WFG A;  4LF9 B;  5CBH A;  1F7Y A;  3BY6 A;  4TWK A;  3I55 V;  1N4C A;  5IYB O;  1UPG A;  3TXS A;  3RVY A;  1K9M W;  2PI4 A;  2UXB O;  4WFF A;  1NU1 H;  3N2K B;  4O2B A;  1HNZ B;  1EN6 A;  5KHI A;  2DQ3 A;  4DR1 B;  4JAV A;  1Q5O A;  5B1B B;  4MTG A;  3D3I A;  3H9V A;  3QTC A;  5LMN O;  4I0X B;  2WLN A;  4JI3 B;  4JI4 B;  4GKJ B;  4Z2W A;  3L72 H;  1FS0 G;  4B3M B;  3O9O A;  1BCC H;  3CHX A;  4DV5 O;  1N34 B;  5KHJ A;  2ZM6 B;  4LF9 O;  1W2B U;  2MK3 A;  5A2Q N;  1XMQ B;  2EJR A;  4NTY A;  4X1I A;  3K9A A;  1NTZ H;  4JI8 B;  3BEH A;  2EBO A;  1HNZ O;  4W4K A;  4FPP A;  3OT7 A;  4TUY A;  1Y6X A;  3E35 A;  4DR1 O;  3HKB A;  4ZI7 A;  3WB0 A;  2VQF B;  2F66 C;  1QNM A;  4TT3 G;  3ABM B;  1GMG A;  4JI3 O;  4JI4 O;  4GKJ O;  1Q90 D;  1GN3 A;  3RFR A;  3RBZ A;  3ZN1 A;  4B3M O;  1N34 O;  2LJ2 A;  2ZM6 O;  2JVD A;  1XMQ O;  2WLL B;  4JI8 O;  1SS3 A;  4PA7 A;  3K08 A;  4UCT A;  4MS2 A;  4F6E A;  3RYC A;  3HKD B;  1R1B A;  1ZUQ A;  1S72 V;  5LXT B;  2VQF O;  3CCE V;  2ZIN A;  2GV9 A;  4IIJ A;  1M56 B;  2DYR C;  4OGQ B;  2EIN B;  2JGU A;  1JVM A;  1GK9 A;  3B40 A;  2PYJ A;  2GTS A;  4NXM B;  1PKX A;  2OWO A;  1GN4 A;  2DWE C;  2X6C A;  4WFH A;  4R8C A;  5B5E Z;  1X4T A;  3SPC A;  1M93 A;  2BSK A;  1YHQ V;  2F93 B;  4RO2 A;  4FLW A;  1XHZ A;  2Y4T A;  1RP3 B;  4O2A A;  3T4D A;  5J2T A;  2R70 A;  2QM4 A;  4LCU C;  2CGN A;  4MW3 A;  3RT3 C;  4FM0 A;  2ZKO A;  3ASO B;  4NXM O;  4LFB B;  3K5N A;  3F7V C;  4PA3 A;  2HJF C;  4PA9 A;  4QGP A;  4QNH B;  3AK3 A;  5JVD B;  3U10 A;  1NS1 A;  3THO A;  1Q82 W;  5LOV B;  1YJN V;  1AR4 A;  1PP9 H;  1TA8 A;  4JZ2 A;  4P9O A;  4DR6 B;  3JAR B;  4F6R B;  4Z1M G;  2CK3 G;  1WLE A;  4NTW A;  4AHC A;  3B4S A;  5IJ9 A;  3TET A;  2IU3 A;  4B3R B;  1MNG A;  2BTQ A;  3CJH B;  3L71 H;  5JH7 B;  4L8J A;  1WNS A;  1HNX B;  2UXN A;  1OCZ C;  2CE4 A;  4LFB O;  1MOF A;  3KG2 A;  2CGO A;  3L9D A;  2YDE A;  5CMU A;  1P7B A;  2IM9 A;  2UUB B;  4BWA A;  1JFF A;  2ZD9 A;  4KUM A;  1YZB A;  4JV5 B;  2QKS A;  2DWD C;  2DJV A;  4DR6 O;  2ZE8 A;  2BTO A;  3IC9 A;  4O2B B;  2IH3 C;  1MAB G;  2IJH A;  4DR4 B;  3B77 A;  1L0N H;  4DR2 B;  3UQ8 A;  1P84 F;  2W0F C;  3R66 A;  4B3R O;  3L74 H;  1MMM A;  4JGS A;  4TSF G;  1HNX O;  1YIJ V;  1KP3 A;  4IYI A;  2ADP A;  1IX9 A;  4R7C A;  5LP6 A;  4FFB A;  1VQ5 V;  2UUB O;  2ETN A;  1EZJ A;  4JV5 O;  1JJO A;  3S3W A;  4X1I B;  4FK5 C;  1CEZ A;  4HZ3 A;  1PM9 A;  4DR4 O;  3E8F A;  4YXW G;  1MSW D;  1Z5V A;  4DR2 O;  3LDD A;  4TUY B;  1KMI Z;  3HKB B;  4ZI7 B;  1Q43 A;  3X2Q C;  2IU0 A;  2KKW A;  3B8N A;  1B04 A;  3VQY A;  3CCJ V;  4DV3 B;  4YJ2 A;  4MVQ A;  1E1R G;  5LYJ A;  4J9Z B;  3G80 A;  1YI2 V;  4WBN A;  3W7U A;  2YXL A;  5IWA B;  1K34 A;  4AQY B;  4F4L A;  4G2K A;  4LF6 B;  1FXK C;  4IL6 Z;  1HWY A;  1XHX A;  1V54 C;  5LMU B;  3K03 A;  1JMK C;  3D36 C;  5DN6 G;  1NTK H;  3CCM V;  3UM7 A;  2ZNJ A;  2VWJ A;  5CBF A;  4MVM A;  1P7G A;  1AJN A;  3RYC B;  4QE7 A;  3AG4 C;  2IBZ H;  4CBC A;  4GYC B;  5E1A C;  5H6R A;  4DV3 O;  3IC7 A;  3FB7 C;  1R6N A;  1OCR C;  3CC2 V;  4IIJ B;  3H1H H;  3SPG A;  5IWA O;  3UT5 A;  4AQY O;  1R3J C;  2A7W A;  3OFN G;  4LF6 O;  4PI2 A;  5JJJ B;  1HNW B;  1W59 A;  1KB9 F;  3SJB C;  5LMU O;  3LSS A;  2BSK B;  3RVZ A;  1TGO A;  1SQX H;  3JSL A;  1AB3 A;  5L3E A;  3WU2 Z;  5J2T B;  4O2A B;  1QLE C;  4ZOL A;  5FLX N;  4OX9 B;  2OYQ A;  1WAZ A;  2HFE C;  4K8X A;  4MVS A;  3H1L H;  4I5S A;  5EBL C;  1F4N A;  4LFC B;  4FIP C;  3QO7 A;  2ILM A;  1HNW O;  4JAU A;  4J80 A;  2FTK A;  5EC2 C;  1GH6 A;  3SJQ C;  1EBO A;  4H13 B;  3ML0 A;  3A8T A;  4N23 A;  2ZNI A;  4PHZ A;  2IJK A;  3A0R A;  1NBM G;  4OX9 O;  4EKW A;  1PPJ H;  4KHP B;  1AI7 A;  3K0G A;  1K4C C;  1URF A;  4UVA A;  3DGE A;  5IJ9 B;  2BTQ B;  4R6Z A;  4TQF A;  4U3F H;  3SPJ A;  3G67 A;  3M7M X;  4OPH A;  4LFC O;  4PA4 A;  2WA3 A;  4ZHQ A;  2ZDI C;  4Q6G A;  2Y69 B;  1JFF B;  2GTA A;  5CN0 A;  1N36 B;  1D2D A;  3CCU V;  2IH1 C;  1VF7 A;  3MAQ A;  3K5L A;  3CRR A;  4O4J A;  1KC8 W;  3RWR D;  5E79 Z;  3OAA G;  2KQX A;  4KHP O;  2LP7 A;  2FL4 A;  2ITD C;  3M8A A;  2QTS A;  5LBQ A;  2QKC A;  4J11 A;  5CA3 A;  2H8P C;  4JTD B;  3OGI B;  3BVO A;  5EIB D;  1IBK B;  2EJ7 A;  1QR9 A;  1SKV A;  2D3O W;  5H2F Z;  4IHJ A;  1FPO A;  3ZED A;  5LP6 B;  4FFB B;  4CZZ A;  1N36 O;  1PNK A;  1M9N A;  2IW5 A;  5AG2 A;  2UU9 B;  2E76 B;  4BIZ A;  3CMA V;  3CC7 V;  1ZX3 A;  1YVW A;  1OCC B;  4MTO A;  1VQL V;  1YDX A;  3CCL V;  2PZS A;  1JA8 A;  3MDS A;  4YJ2 B;  5JCO C;  1NT2 B;  3ZCC A;  1IBK O;  5LYJ B;  5FPO A;  5CBG A;  3BAA A;  2ZCE A;  1QBZ A;  4WBN B;  1XOU A;  2ZXW C;  3ASN B;  3K59 A;  4YJ3 A;  3RGB A;  1IBM B;  5LL6 Y;  2EIK C;  2JJ1 G;  3ABL C;  4YIP A;  1F51 A;  5IJ0 A;  4DV0 B;  3RYI A;  4E2L A;  2UU9 O;  1VQ9 V;  4JYY A;  2X7R B;  2Y4U A;  2XAS A;  2Z5U A;  4LF7 B;  4H33 A;  2FML A;  3K5O A;  1BSM A;  3FFQ A;  3RN4 A;  2OCC C;  1SRY A;  2LQT A;  5HFL A;  4RAI A;  2AGA A;  1SES A;  2JGD A;  1D5A A;  3UT5 B;  1N0N A;  3JAW A;  1IBM O;  4EEQ A;  4WF9 V;  2BE3 A;  5B1A C;  2LFR A;  4QPK A;  1PL0 A;  4LF4 B;  4Q20 A;  3JYC A;  5CA0 A;  2Q8V A;  5GON A;  4DV0 O;  1I08 A;  2AHY A;  3E89 A;  4FM2 A;  1IXB A;  4LF7 O;  2HLD G;  2ODM A;  3JCU Z;  1YTF D;  1DLB A;  3CXH F;  4D7S A;  2YIB D;  5JJE B;  2QJ1 A;  1Q6I A;  4ZOL B;  3ZRS A;  4Z1V A;  4BW9 A;  3SYO A;  2EZO A;  3SJC C;  5L3B A;  4KL1 A;  3P32 A;  4HNA A;  3FYE B;  5K1X A;  2ZE7 A;  4LF4 O;  3E8H A;  3SR2 C;  1QCE A;  3TXQ A;  4PDR A;  3APO A;  1PNL A;  3K04 A;  4GX0 A;  1AJP A;  2HKO A;  3OMN B;  4I7Z B;  4UCR A;  2Y0P A;  5F2V O;  4JI7 B;  4W4L A;  4GT1 A;  4JAS A;  4U7O A;  2EZP A;  2P06 A;  1TUE B;  1KKD A;  3CS5 A;  2UXD B;  5CB4 A;  4B3T B;  4FZ0 A;  4ZHQ B;  3ZHT A;  2Q73 A;  1K73 W;  2QGN A;  4P9P A;  5L3G A;  5EIB C;  3WG7 C;  1SQB H;  3UO2 A;  1QQC A;  3CRQ A;  1RSO A;  3G4S V;  4O4J B;  3TCU A;  4JI5 B;  5B3S C;  5FL7 G;  4JI7 O;  2N74 A;  2WWW A;  1US6 A;  2M6Y A;  1K5Q A;  1ZWI C;  3HPL C;  3HKE A;  1EFR G;  2UXD O;  1SQQ H;  2B9Z A;  4B3T O;  4IHJ B;  4IGG A;  4H0L B;  4K3A A;  2HJD A;  3SJA C;  4YY3 B;  2OTJ V;  3K06 A;  1G8M A;  2KSD A;  1IBL B;  3K58 A;  2UUA B;  3BFR A;  4UCU A;  1TUB A;  4LWS A;  4JI5 O;  2A06 H;  5EZY A;  1QU7 A;  3AG1 B;  3HR0 A;  4AI8 A;  3CX5 F;  2P90 A;  5A9G A;  1BQ0 A;  1CPY A;  2D2C B;  3U11 A;  1F23 A;  4YJ3 B;  1XEQ A;  4FLZ A;  4YY3 O;  1WPB A;  4MVR A;  2OIG A;  1FXK A;  4EFE A;  4J7J A;  1Q6U A;  4LBE C;  1IBL O;  4I50 A;  3OGC C;  5IJ0 B;  1FJG B;  4NKG B;  3RYI B;  2UUA O;  3D36 A;  1H2S B;  5H5N A;  2PTM A;  4FVM A;  5KUK A;  1KYO F;  2WLI A;  4YIO A;  3OUS A;  4UCV A;  1MA1 A;  1WN7 A;  4CC6 A;  2HP8 A;  1N8R W;  2YC0 A;  1Z2G A;  4J10 A;  2DYR B;  1Y76 A;  2JGD B;  1BGY H;  3JAW B;  2EIL C; 
#chains in the Genus database with same CATH homology
 4MVQ A;  1E1R G;  4J9Z B;  1YI2 V;  2H94 A;  3W7U A;  5KUM A;  2WLH A;  5LHG A;  1NH2 B;  2AHZ A;  1K34 A;  5EBM C;  2X6A A;  4F4L A;  4G2K A;  1Q86 W;  1FXK C;  1S3J A;  4X89 A;  3OMI B;  3RW0 A;  1OCO B;  1HWY A;  1QR8 A;  3MD0 A;  5IYC O;  3AG3 B;  3STZ C;  1V54 C;  2BOB C;  4DXW A;  3ZRV A;  2Q67 A;  3K03 A;  5DN6 G;  3CCM V;  3UM7 A;  3W7W A;  1MG1 A;  1VQ4 V;  2WPD G;  2EIJ C;  5B1O A;  3FYI B;  3VBB A;  4MTF A;  5CBF A;  4MVM A;  1K7D A;  2F43 G;  1AJN A;  2XAJ A;  3OM3 B;  4KP4 A;  4XDK A;  1DTO A;  4QE7 A;  3AG4 C;  4CBC A;  1Y4M A;  5E1A C;  5H6R A;  1PD3 A;  5KA5 A;  5H6Q A;  2JEX A;  3IC7 A;  3WG7 B;  3FB7 C;  5C93 A;  1R6N A;  1OCR C;  3CC2 V;  1R3L C;  1COW G;  2JDI G;  3SPG A;  4N21 A;  2ZR2 A;  1FXH A;  3ABU A;  1OCC C;  1R3J C;  1XL6 A;  3F7Y C;  3OFN G;  3ZRX A;  4UXN A;  5B3S B;  1JOY A;  1K97 A;  2ATK C;  3IFX A;  1FXV A;  4WFB V;  3ASN C;  1DF5 A;  5IY5 B;  5KA6 A;  3AG2 B;  3LUT B;  3E8G A;  1AI6 A;  3LSS A;  1S76 D;  1QVF U;  1H8E G;  2ZQM A;  5B1B C;  2Z3Y A;  3RVZ A;  4GX5 A;  1AI4 A;  4MVU A;  1K4D C;  3ZIA G;  5L3E A;  1H8H G;  1QLE C;  2WAM A;  2WLL A;  2Q68 A;  1OCZ B;  1BHB A;  2K1E A;  2X0L A;  4JYC A;  2HFE C;  3H01 A;  3CPW U;  4MVS A;  2ZDI A;  2OTL V;  3ZMZ A;  4BW5 A;  4MTX A;  1I5Y A;  3E8B A;  3CD6 V;  4I5S A;  5EBL C;  1J95 A;  1F4N A;  3W7S A;  4FIP C;  3QO7 A;  1B6Q A;  3ZRW B;  1V55 B;  2QTO A;  3DTU B;  4JAU A;  4JF3 A;  4MVO A;  5LGU A;  2WSS G;  2FTK A;  1Q7Y W;  5EC2 C;  3MHH C;  1R3I C;  1RPO A;  3OEH G;  3SJQ C;  3AG1 C;  3ZMS A;  1EBO A;  3FB8 C;  3ML0 A;  2A79 B;  3ETG A;  4N23 A;  1W0K G;  3ABM C;  3CCS V;  2IJK A;  3A0R A;  4UUJ C;  3FB5 C;  5EBW C;  1NBM G;  1AI5 A;  3JCZ A;  2XAQ A;  4UV9 A;  1R3K C;  4EKW A;  1GM9 A;  1AI7 A;  2Q6A A;  3K0G A;  1K4C C;  2LFS A;  4FMT A;  4LP8 A;  4UVA A;  3DGE A;  4R6Z A;  3I56 V;  3SPJ A;  4QJF B;  4DO2 A;  5DM6 V;  1KD1 W;  4P2Z A;  1H38 A;  3CCQ V;  5L3D A;  4OXS A;  4PA4 A;  2C2A A;  3SYP A;  3ZMU A;  2ZDI C;  5B1N A;  2HG5 C;  2Y69 B;  4ZBM A;  4WFA V;  1AJQ A;  3GB7 C;  5CN0 A;  2NNU A;  3CCU V;  1AR1 B;  1YTF B;  2XAG A;  2HVK C;  3K0D A;  2DQ0 A;  2JEU A;  1M56 C;  2IH1 C;  3LDE A;  4MVZ A;  2EIN C;  4XBF A;  3X2Q B;  5IDJ A;  2EIL B;  1KC8 W;  2DW4 A;  3OAA G;  3ZMT A;  1NR7 A;  2LP7 A;  3VOU A;  3ZN0 A;  2ITD C;  1L1F A;  1FFT B;  5LBQ A;  4PEL A;  1E1Q G;  5CA3 A;  2H8P C;  4HYO A;  3TK1 A;  4JPR A;  4JTD B;  5J9P C;  4I9W A;  3W7X A;  1FXK B;  1K92 A;  1QR9 A;  1IXM A;  1GTO A;  2WLM A;  3OR7 C;  2HR3 A;  1V54 B;  3M99 B;  2D3O W;  4QPJ A;  2PI5 A;  2M7W A;  1GO3 F;  1OCO C;  3OMA B;  1R73 A;  5EC1 C;  3SYC A;  1GM7 A;  4GX2 A;  2WLI B;  4CZZ A;  2EIJ B;  1PNK A;  1M9N A;  1P4R A;  1E79 G;  3F5W C;  2IW5 A;  3K3W A;  1VQP V;  3AG4 B;  3WFV A;  4MW8 A;  1YJW V;  5LGN A;  2UXX A;  1NR1 A;  1NJI W;  2IJI A;  4WFG A;  3JD1 A;  4BIZ A;  3ASO C;  5CBH A;  3CMA V;  1RPR A;  2GHY A;  2XND G;  3CC7 V;  3BY6 A;  4TWK A;  3I55 V;  1OCC B;  4MTO A;  5IYB O;  3RVY A;  1VQL V;  1K9M W;  2PI4 A;  4WFF A;  3CCL V;  1QVG U;  3ZCC A;  5CBG A;  4L87 A;  4PDM A;  1QBZ A;  2EIM C;  2DQ3 A;  1GKF A;  2ZXW C;  1JJ2 U;  3ASN B;  5H9C A;  4J9Y B;  1M90 W;  1KQS U;  1VQ8 V;  4GCZ A;  2EIK C;  4JAV A;  1RM1 C;  2XAH A;  5B1B B;  3E2E A;  2P6J A;  4MTG A;  3D3I A;  2QA4 V;  2JJ1 G;  3ABL C;  2WLN A;  1F51 A;  3OUF A;  3CME V;  3CYO A;  4E2L A;  1F4M A;  2V1D A;  1VQ9 V;  2NLJ C;  1QLE B;  3MHS C;  2X7R B;  1FS0 G;  3CP1 A;  2XAS A;  2Z5U A;  1YJ9 V;  4H33 A;  3QNE A;  2MK3 A;  1W2B U;  3CXC U;  2QM7 A;  1VQN V;  5LGT A;  2EJR A;  4RQF A;  3LSQ A;  3K9A A;  3G6E V;  2OCC C;  3BEH A;  2EBO A;  3E86 A;  2YEV A;  1SRY A;  4FPP A;  5HFL A;  4RAI A;  3E35 A;  1SES A;  4X8A A;  5LHH A;  1H2G A;  1VQ6 V;  4WF9 V;  5B1A C;  1G4Y B;  2LFR A;  1Q81 W;  4QPK A;  1PL0 A;  1YIT V;  5LHI A;  2GSM B;  3B8M A;  3R65 A;  4Q20 A;  4TT3 G;  3JYC A;  5HFM A;  3ABM B;  1GMG A;  3FB6 C;  3OEE G;  2AHY A;  3E89 A;  1K5S A;  2HVJ C;  1NKD A;  1JPX A;  3RBZ A;  3ZN1 A;  2OT5 A;  1JCH A;  2HLD G;  1YTF D;  1DLB A;  3ABK C;  3HB3 B;  2Y48 A;  2WLL B;  3ZRS A;  2ITC C;  3T2M A;  4PA7 A;  4KFM A;  3SYO A;  4ZKI A;  2EZO A;  3G71 V;  3K08 A;  2DYS C;  4BIU A;  1CP9 A;  5L3B A;  3PJS K;  4MS2 A;  3P32 A;  1M57 C;  1K3E A;  3FYE B;  1S72 V;  4RUE A;  3JD3 A;  3CCE V;  4RUF A;  3OE7 G;  2ZR3 A;  3E8H A;  3JD2 A;  1M56 B;  4JTC B;  1LNQ A;  2DYR C;  2EIN B;  1JVM A;  1GK9 A;  3E83 A;  3FKS G;  1QCE A;  5BZB A;  1DF4 A;  4PDR A;  1PNL A;  2WLK A;  1PKX A;  1KP2 A;  3K04 A;  4GX0 A;  1AJP A;  2HKO A;  1PNM A;  3OMN B;  3CC4 V;  3LDC A;  2DWE C;  2X6C A;  4WFH A;  2R9I A;  4R8C A;  3P30 A;  1YSC A;  4XDL A;  4LC1 A;  1S0V A;  2A9H A;  3ETE A;  3SPH A;  3SPC A;  3SYA A;  1YHQ V;  4GT1 A;  4RO2 A;  3AG3 C;  4JAS A;  1W0J G;  2B1G A;  4U7O A;  1ARO P;  4QE9 A;  1SZT A;  3T4D A;  2P67 A;  3JD0 A;  2EZP A;  1SER A;  3OW2 U;  1TUE B;  1KKD A;  3IGA C;  2QE7 G;  1NVP D;  1NQT A;  4LCU C;  4XDJ A;  4MW3 A;  1OCR B;  4PA6 A;  4WFE A;  1K73 W;  4P9P A;  2JK5 C;  5L3G A;  3ZJZ A;  4R50 A;  3WG7 C;  3ASO B;  2JJ2 G;  4G27 B;  3F7V C;  4PA3 A;  3ZRW A;  1M1K W;  1OZ0 A;  2HJF C;  3T4Z A;  4PA9 A;  4PDV A;  1NVP B;  5IYD O;  2BOC C;  4QNH B;  3G4S V;  3TCU A;  1VQO V;  1Q82 W;  4HAM A;  5B3S C;  5FL7 G;  2JIZ G;  2KB1 A;  3ETD A;  1YJN V;  2QEX V;  2WWW A;  2EIM B;  1R6K A;  3T1C A;  2ZXW B;  1K5Q A;  1ZWI C;  3HPL C;  4P9O A;  4UV8 A;  5IY5 C;  3AG2 C;  4QIW F;  1K33 A;  1Y66 A;  4Z1M G;  2EIK B;  2WLJ A;  5GW7 A;  1EFR G;  1RM1 B;  4FJC C;  2B1I A;  2CK3 G;  1WLE A;  3ABL B;  3EFF K;  4BAY A;  1SET A;  3TET A;  2IU3 A;  2Q69 A;  1BHA A;  1GM8 A;  4GX1 A;  4WCE V;  2OTJ V;  3K06 A;  4G28 B;  3SPI A;  3B8N A;  2UXN A;  3SYQ A;  1OCZ C;  1G8M A;  1UJW B;  1WPX A;  2A0L A;  4UVC A;  1VQM V;  1MOF A;  3KG2 A;  3NXS A;  4ASU G;  2B5U A;  2R9R B;  4RQE A;  1S5H C;  3W7T A;  5CMU A;  1P7B A;  4JYB A;  4X88 A;  2OCC B;  2ZD9 A;  4KUM A;  1THZ A;  1I5X A;  2W6I G;  3STL C;  3AG1 B;  2V7Q G;  2QKS A;  1JX9 A;  1XL4 A;  4MT8 A;  1V55 C;  2DWD C;  3LNM B;  3AEI A;  1OHH G;  3QO5 A;  2P90 A;  2IH3 C;  1MAB G;  2IJH A;  5B1A B;  1JQ0 A;  3B77 A;  1CPY A;  5L3C A;  1ENV A;  1F23 A;  2W0F C;  2XOK G;  1BL8 A;  4H37 A;  3K79 A;  4JTA B;  1K8A W;  4JGS A;  4TSF G;  2YSU B;  4MVR A;  1ROP A;  3QO8 A;  1FXK A;  3GWO A;  1VQ7 V;  1YIJ V;  1KP3 A;  2W6J G;  5L3F A;  1ORQ C;  2X6B A;  1S77 D;  4LBE C;  3OGC C;  3ABK B;  4PDL A;  3CCR V;  1VQK V;  3EHB B;  3D36 A;  2XAF A;  1VQ5 V;  4R7C A;  5KUK A;  3JD4 A;  3OR6 C;  2P7T C;  2WLI A;  4UVB A;  1EZJ A;  2DYS B;  1QLN A;  4U7N A;  4FK5 C;  3CCV V;  3CCJ V;  4MSW C;  1BMF G;  1M57 B;  2Y69 C;  3OUS A;  1CEZ A;  1KEC A;  4HZ3 A;  2YEV B;  4P30 A;  3E8F A;  4YXW G;  5EK0 A;  1MSW D;  1N8R W;  1NH2 D;  2QM8 A;  3LDD A;  2DYR B;  3ZMV A;  3UKM A;  3X2Q C;  2IJJ A;  2IU0 A;  3ABT A;  2EIL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...