3D8CA

Factor inhibiting hif-1 alpha d201g mutant in complex with zn(ii), alpha-ketoglutarate and hif-1 alpha 19mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYGEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3d8cA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d8cA01
1YCIA 3D8CA 2XUMA 2YDEA 2CGNA 1H2MA 5JWPA 4QU2A 3KCYA 4JAAA 3P3PA 1MZFA 4NR1A 2W0XA 2Y0IA 2YC0A 1IZ3A 4B7EA 4BIOA 3OD4A 1H2KA 2CGOA 3KCXA 1H2NA 2WA3A 4Z2WA 4AI8A 4B7KA 2ILMA 3P3NA 1H2LA 1MZEA 2WA4A 4Z1VA
chains in the Genus database with same CATH superfamily
3J7HA 3W7TA 4CCJA 1EN6A 2UXNA 5JR2A 1R1A1 4V1PA 2CAZC 2Q9LA 3SCGA 1OHFA 1TA8A 1HNZO 4AXOA 2AACA 4UOJA 3N9PA 4A44A 1GBGA 2F17A 2XG3A 4ORFA 4BHPA 4DV1O 1R64A 1QCEA 3V64A 3WZ1A 1UY4A 4LF9O 1RUJ2 1ZZCA 5HV0A 1OURA 2OA2A 2QDOA 2A70A 1UKRA 5C8CC 3KMHA 2VGDA 2WDBA 2OX0A 3FLTA 3HAGA 4UF0A 1P4RA 4WFAV 2A5ZA 1FS0G 3BCCH 1RXGA 1REEA 3OGJA 5FBJA 2FZ2A 2VQ0A 2Q8CA 3CZUA 1XB9A 2E74B 2B9ZA 2HKOA 2VECA 2LTNA 3ZYIB 1OF3A 3I3QA 2ZMKA 2VZVA 1H8TB 1ZRRA 4HMZA 1O7FA 5GLTA 4FXGB 1FXHA 3H3ZA 4I30A 3CRAA 1ZRIA 1PM9A 5AFEA 1S1AA 5EXOA 4YVWC 3MW3A 2EA7A 4QDQA 1RUH3 3VBFC 2JDPA 3WB1A 2WZEA 4JRLA 3GHNA 3WDUA 1WBLA 2Q7GA 1YQ2A 3U10A 2ARAA 2QQMA 3VBOB 1VQOV 1VBD3 1MEC2 1BQ0A 4FO9A 2YY1A 1RHI3 5FWEA 4XUPA 3AXEA 1C28A 4MO3M 1SLIA 4BW5A 1ASJ1 4BISA 3I49A 4LQRA 4DV2B 3PLQA 1WA6X 1LRHA 2RM21 3J7MA 5FPUA 3KF3A 2ARCA 5HCBA 2ARHA 1XOUA 1FNZA 3E6CC 4R4XA 1LEDA 4DXWA 3ELNA 2GC0A 5FUPA 5JQGB 4AW7A 3CZJA 4TTGA 5LMNB 5A1LA 2Y48A 4QPYA 5FZOA 4LR4A 4XE9A 1IVSA 3FAVA 4Z1VA 4CBCA 4DR1B 1IS4A 2V7QG 2X6CA 1SFNA 1PPJH 3QO7A 1YI9A 4KFMA 4YGEA 1C8M1 4LLOA 5FLHA 4GX0A 4O4LA 2QEXV 1XE0A 1JVMA 5GALA 1URFA 4Q27A 4R52A 3N27A 4M0HA 1DQ5A 5FP9A 2H6CA 5EZWA 5F2SA 2X5IA 4ARYA 2P2KA 1CAUA 3OBTA 1OKOA 2RQ6A 1RTVA 2ZKLA 4CCOA 2GN7A 3HKDB 5BNNC 3FB7C 4KWLA 4YHHB 3U4SA 2Y6FA 5BNOC 3VQVA 1K4DC 1VIBA 2GUZA 3BY6A 4JI7O 1TG7A 4MH0E 3OJBA 1VJ2A 4GKJB 2WT0A 5D2AA 2BW8A 4AHWA 3H1HH 3K9AA 5LASA 3FYEB 4EB6B 4I3GA 3ZDVA 4MSVA 1AB3A 3PIJA 4IXLA 1EBOA 1FNYA 4WM7C 2OUJA 4JTAB 3QBQA 1POV1 4X1YB 2BWAA 4XILA 5C33A 2DYRC 1DYPA 1OI6A 3NNLA 2WZR1 2XOKG 2ZNJA 1WD4A 3SPGA 1P84F 4LUKA 4IHJB 3D3QA 1LTEA 1SPPA 1ND3A 3B93A 3WUCA 4QHZA 4RGKA 4YGCA 1AR81 5JXJA 1SQFA 2HEWF 1E57A 3OGVA 3N2GB 3VKFC 4FTEA 5CG9A 1LUWA 1BK1A 1CAWB 4LLFA 4P5YA 4W8JA 4U7OA 1GMGA 1WLWA 3FBYA 4AL9A 3AYDA 4RQPC 2FTKA 2WNVB 1T6GC 3G6EV 5FLIA 2W3JA 5BYNA 1W39A 4RQEA 2ZDIA 3LNNA 1W04A 2RMU3 1S0GA 2OCHA 5C8YA 4YXWG 1QDOA 5E16A 4B08A 4C90A 2CGNA 3K2OA 1D7PM 2RVAA 2IXIA 4QKBA 1ULFA 1OLME 1FX5A 1SLCA 1ROPA 4QE9A 5EYPA 3CMAV 4UW6A 1GN3A 3VDDA 4UCUA 1HQNA 4P08A 5IJRA 4AI0A 1X82A 3ZSJA 2ZGNA 2XJUA 4CCLA 3UO3A 1W6NB 2XJQA 4JGYB 4DPNA 1G9BA 4XBNA 4XABA 1F5FA 4FVMA 5CFCA 3USUB 3AP6A 3JCIA 1UMIA 4TQDA 4R4ZA 1D2SA 3Q4HB 4XBQA 1P7GA 2W5FA 2ZGQA 3BUCA 3CKHA 1YJ9V 2OZ6A 4OVEA 1LOBA 3AL5A 4PLOA 4BQWA 5CZKA 3P6BA 4I55A 1TME2 2UUAB 5IJ9B 4OGQB 4QX2A 1DZQA 1W6PA 5AC93 3FHAA 4TN7A 4K1ZA 1HLCA 3AKSA 4N7IA 1V6LA 2G9ZA 1LEMA 3B3QE 4Y5Z0 5LBBA 4I0XB 4DR4O 1GWMA 4GB33 4JGZB 3ZOIA 3AKTA 3TN91 3SJCC 5FXVA 4QX0A 3WXPA 3JD0A 5F39A 4AFAA 4XJZA 1JW6A 3RN4A 1PK6C 3PMSA 3OY8A 1C1LA 1NI8A 3OG2A 3BAAA 4M3CA 2OS2A 3CRCA 5H9QA 4ASLA 1UN1A 4AK3A 4KL1A 4O4HB 4GKJO 1W2BU 1ZA4A 2O0OA 3FC0A 5KWRA 1N33B 5A7NA 2DJVA 3MDSA 3F2ZA 1G9FA 3BVOA 3OGSA 2NYYA 1PO23 2HHHO 3HIFA 1K3IA 4YGDA 1VRBA 2BEOA 2D2CB 1DGWX 1JMUB 4E2QA 2YBKA 4JKMA 3K75B 1MZ5A 1ZWIC 4CDWC 3K5NA 1HXS2 5FDBA 2C6SA 3RSJA 2JDKA 3WHUA 1OPMA 3IDBB 4QKNA 2YIBA 4AVTA 2XXZA 3JATA 2W1SA 2HEYF 3BA9A 1IBLO 2WFF1 2IBZH 1YFYA 5L7OA 4IEWA 1FATA 1ZBA2 1LECA 4EJRA 5DG2A 3KKYA 4DR3O 4FFGA 2VQFB 4XFFA 3ETDA 1CGPA 3U4XA 2VNGA 1O91A 3LZZA 4B29A 3PURA 4QQHA 4MXVA 2VUAA 5B4NA 4SBVA 2HVKC 1W6OA 2PAEA 2ZGRA 4M4PA 4OXSA 2JICA 2PZSA 4LEJA 4R9DA 1CPYA 2HWD2 3PJYA 1VBC3 1PM4A 2RV9A 4RN5A 1LNQA 1VBB2 5A3TA 5J7MA 1W3VA 2B9VA 3GWKC 1UZ0A 2Q1MA 2UXXA 2EBOA 3HQUA 4UXAA 1X9TA 3N4MA 4MTFA 1H6YA 3GZAA 4YPJA 2J1TA 3HOBA 3BTXA 5C3SA 2QA4V 1SKVA 2V4VA 3HPNA 1SQGA 3WCSA 2DVBA 2EINB 3SYAA 1YEWA 3DXUA 3N9QA 5K8SA 4M01A 4MZUA 1XJAA 2RNBA 5ITZA 4WM8C 3AZWA 5DPNA 3ZFGC 1JODA 1H2KA 4OYUA 2H6BA 2VUDA 4B3SO 1K42A 3KS7A 5BXXA 3ZJZA 4YY3B 2WYFA 2ET7A 3DPRA 4Y22A 4PBPA 4NPRA 4D69A 5A3LA 3MV11 5CISA 2R30A 2HFEC 3H1IH 1KJLA 2EIJB 1OFNA 1QNYA 3JXSA 1W8HA 2A3QA 1FPN3 1RP3B 2CAVA 1H2GA 1MQTB 5T52A 1W8TA 4XZUG 1C5IA 2D43A 1NCRA 2YC0A 1W3XA 4RR3B 4DK1A 3MIHA 3RDIA 1ODNA 4AQ2A 4BIOA 3OMNB 2BDRA 4DR5O 4GMP3 1XOYA 3JBG1 3L9JT 4U3JA 3ZBHA 3NQHA 5A7PA 5A2QN 3I59A 3WW4A 2WNUC 2XH6A 2ZS6B 1QJX1 3M99B 3RI8A 4YG6A 1H9PA 3R05A 5IFTA 3IC7A 3PVEA 4PD4F 3I2OA 3MBWA 5CKMA 2ZINA 4OX9O 4YZ1A 2VAUA 1LU1A 1Q6IA 5FY8A 1TNFA 1QQCA 3ZXEA 4J1WA 5DM6V 1T5EA 2JG9A 2CAUA 4CDQA 1ODMA 2PLV1 4LULA 2LW8A 2C5DA 4GUNA 5JVVA 2PXJA 5F37A 4RD7A 4UCRA 5CA0A 1U5ZA 5HFMA 1JYXA 1WMDA 1HDKA 2R072 3VBRB 3ZFFA 4DNYA 1VQ6V 5F3GA 3Q8EA 3BRCA 4FOQA 5FP8A 2Y0PA 5A3UA 3AJZA 1JOJA 1WCQA 5T5JA 4QPWA 2E63A 1U97A 5GZGA 2R063 1H30A 2FMYA 3MF9A 3WQ7A 2MEV1 4RGGA 3T2TA 1Q5OA 2LM3A 3AL6A 2Q5TA 5FZHA 3LGRA 3ZHVA 3ACIA 4JKLA 2A7WA 4GT1A 4L11A 1N32B 2PELA 5LA1A 2E7TA 4MUVA 3C8XA 5BPXA 1QWRA 1ZZ6A 4PV1B 5E88A 5H9SA 1SEFA 1YQ8A 1W8OA 1QOOA 1SLBA 4I0BA 1Q7YW 4MGYE 2CWSA 2X6BA 3JALA 2WQZC 3K9SA 1PNGA 5FIXA 5IVJA 5HBAA 4KWUA 1GSLA 3DUIA 2BTVC 3OTOO 2VW1A 4FAHA 4DMIA 2TNFA 3LF7A 2LFRA 3QH7A 1S0CA 3AG7A 4BXSV 4M3CF 1JHNA 1FFXB 2D97A 2YYOA 3HQRA 2VZPA 1ULPA 4DFSA 4QX3A 2G38A 5FMOS 4JTDB 4UFLA 2C1FA 2DFBA 3R66A 1US6A 4HAMA 2NP0A 4A3XA 1N4CA 4ASMB 3OUFA 4J7KA 1F7YA 3A0NA 1GOFA 2C4XA 3WP6A 3SCFA 1GLHA 3CB2A 2OUHA 2R49A 5GTHZ 1E1RG 4UBHA 1CAVA 4QXHA 1DGSA 1I94B 1COV2 5D21A 4JAAA 1GP5A 5FZIA 1I5XA 1JXNA 1PO13 3OEAA 1GZWA 2VR4A 1WCUA 1LOGA 1JYNA 5CA6A 1KECA 4RAIA 2HKXA 4Q1PA 4YW2A 4YVSB 3WR0A 3IC9A 3TNPB 3WDYA 1DQ2A 2FKXA 1RUD1 1S2EA 1RITA 2GNBA 1F4AA 5F8PA 4R9CA 3NKGA 1REDA 2WLLA 4XCBA 5EIYB 1G8WA 4XDPA 4E2GA 1A32A 2HWC2 1OT5A 2JJ6A 2R041 4CYDA 4X62O 1W59A 3RYHA 3T3YA 1E1QG 4OUMA 4A5UB 2YROA 4DRRA 1PVC1 3RWNA 3CJHB 3JD71 3O1OA 1UOJA 3B94A 1DYOA 1IDSA 3CYOA 1AR73 2ZAHA 4XOGA 1M4WA 4X65B 1P7BA 1X7NA 5L3GA 3HBZA 4ZOLA 1N1VA 2XBO2 4FAGA 4Y4RA 5FPLA 3VD4A 4D94A 1V70A 3DC6A 3JSNA 4NWVA 1LOCA 3DN7A 3RZZA 4BLIA 5IFPA 3IM0A 2VWKA 1HQLA 1VBA2 1UYXA 4YNIA 5JXIA 5ANNA 3BU0A 1EPZA 5JOZA 1WCSA 2R0HA 4YZ3A 4NIDA 4RHV1 2QR4A 4JV5B 3B09A 2ODMA 4KBZA 5D8AC 3AKPA 1XQ8A 4AVCA 4YVWB 1S0VA 2CY6A 1MZEA 5DXDA 3H1WA 3VBFB 5B3SB 1RUI1 5J2UB 5A7QA 2ZX2A 1QVFU 2VZQA 2NNUA 2VMHA 1ZYBA 2W1WA 3HB3B 2CTRA 2IWGB 2FCTA 2YXYA 2D6KA 2FDFA 4IL7A 2LFSA 3IDAA 3OAAG 1S4CA 4XPVA 4XQ4A 3ZYFA 4EN7B 2Z69A 3I8TA 2BFUS 4LHNA 4TOIA 3WDTA 2IC1A 1JJOA 2DV9A 2GALA 2RHPA 4LBLA 4QPGA 5LXTB 1D2QA 5JCOC 5IYZA 4RQFA 1W2TA 1FMD2 2VZOA 1ULDA 5C6CA 4B4QA 1VRH3 2E6VA 3BA8A 4CEWC 4X1KA 2Y6KA 2Z3YA 3ZRXA 3HMYA 5DZEA 1N34O 2CK3G 2VZ1A 4OULA 4O2AA 4Z2WA 1R3JC 2XWJB 1QQP1 4UFIA 3NKTA 2XL7A 3ZSMA 3WD5A 2A0LA 5H6QA 1R1A2 2WR9A 3BOPA 4JAVA 1GN6A 3H1LH 3C3TA 4CU6A 1UMHA 3WG7C 3SR2C 1GZTA 4TSFG 2PHUA 5FZFA 1AJQA 2B4KA 3LSUA 3BPZA 5T54A 3N35A 5JH7B 4WVVA 1UU6A 1RUE3 2WQ4A 5FQ0A 1NE6A 4JDNA 5DEDA 2PUSA 3AK3A 3RGBA 1XNBA 2GHYA 4XQDA 5BNNB 3B00A 4Q8LA 2P67A 2LP7A 5BNOB 3VKLA 2ARBA 4Q0VA 1GM7A 4LK7A 5K7PA 5FZ9A 4CUAA 2P4VA 4QPKA 1W8NA 1YFUA 1RINA 3ABTA 2PQSA 4DW0A 1YQ5A 1G8MA 1NTMH 4N21A 1Q56A 4QQPA 4A45A 3BFRA 2W68A 4CCKA 3WFVA 4I50B 2WRAA 1UFIA 5KBFA 4LF4B 2ET1A 1PVXA 3A0RA 3FZ3A 1RL3A 3C7HA 4UFMA 1R083 4ES9A 2DYRB 1H8TA 1YHQV 4E4DX 1MABG 1RUH2 3RJ2X 2P1BA 2VO5A 2XR4A 3AYEA 2CE4A 3CX5F 2MW2B 4DRVA 5J09A 5CB4B 2BCCH 5KHKA 5GLVA 2VQEB 2ZHNA 3WHTA 5FY4A 1VBD2 4K8FA 4R8CA 4TSVA 1YUDA 2IM9A 2QBXA 1RHI2 1PMHX 2VULA 4CDXC 3ZXLA 2UYAA 4K0KB 4PDWB 2CTQA 4NIIA 4LKDA 4MGKE 4JQTA 1QF3A 3KHBA 1I7FA 4EROA 3K46A 3RVYA 2JD9A 4DUYO 1LKNA 1TMF3 5I8SA 1SCSA 3K59A 5A3WA 2QTOA 1KYOF 2YIAA 5EV7A 3OFNG 4C0BA 2DTWA 1ZBE3 1ZREA 1NX9A 2VMGA 2BBVA 3HWJA 5CFDC 1LGNA 3JZVA 3LPGA 3LD8A 4AWDA 3P1IA 2H94A 4DQAA 3RS6A 4JHZA 3ZSEA 2C2AA 1RVF3 5KMGB 3AG4C 3E89A 1Q6HA 5KXDA 3VKNA 3OW2U 2PHTA 2XVKA 4KMQA 2AYHA 1B6QA 5EHDA 3EMRA 4NHXA 4DUZO 1HV1A 5LYJB 2Q7EA 2ZEYA 1S0IA 1DGRN 3D0SA 1AR63 5J48A 1YC61 2YBSA 5IVVA 5DDJ3 2Q8VA 1KDKA 1EZJA 1BYHA 3BOWA 3HKDA 3WW1A 3ACGA 4A41A 2JK5C 3ZYGA 5IK8A 1X59A 2QQIA 4I4TB 1OOPC 3OD0A 1RUC1 1QJY1 4YG3A 2WZR2 1YLLA 2ORZA 1R091 2RS13 1YXBA 3FUOA 1PK6B 1OVSA 4EB6A 1V6JA 2ZGUA 3QD6A 3UKTA 5LHHA 1JYTA 4QDSA 1GV9A 5AG2A 4F6RB 4AYUA 4L99A 4UCTA 4OQ9A 3B4SA 2IXJA 3AFGA 3TJTA 1DGRA 2BYVE 5FLJA 1UWWA 1XMQO 5F5AA 4IETA 1US2A 1NTKH 1Z0HA 3ZN6B 5JI9A 4AGRA 3VHNA 4FFKA 4G27B 3O1TA 1VQNV 3UJQA 2YDEA 3AG2C 3QACA 4XF4A 4NXMB 4LF4O 1ZVFA 4IHJA 4LFCO 2JDAA 2O14A 3N7LA 1VARA 4CDWB 2EIMC 3EO6A 2HBTA 3RYPA 1YI2V 3K4ZA 1NXD1 4FPYA 4DV7B 4FI9A 3N2GA 2R0FA 1QH7A 3VDCA 2X0LA 3ATGA 1KQSU 2RS33 2XLGA 2Y60A 3Q8CA 1UD1A 2K1EA 1OLMA 1RMU3 2WNVA 2WS91 3WQ1A 2HJFC 3CRQA 4IYIA 3W59A 4B3NA 4XDOA 2WSVA 2G9FA 2CU5A 3PN1A 4JI5B 1M56C 4OFGA 1OCCB 5E79Z 3KWVA 4FM2A 1DP0A 2CWMA 2VVDA 1RYYA 3CD6V 5SV8A 3B2EE 1HW5A 1UXZA 1PNLA 4DS0A 1G9AA 4JI3O 5LBCA 3G7DA 3ZYRA 2E76B 1FOD3 4JI6B 3T2OA 1GZCA 4P00B 1AR1B 1AX1A 5FYHA 4QHBA 5DUUA 4DO2A 3UYJA 2EXJA 4FLUA 2LALA 2VOKA 4JGYA 4Y1VA 4WFFA 2IU0A 3A4UA 1NT0A 4XF3A 3USUA 3VN4A 2VD7A 3RQ0A 1LCLA 4N9IA 3K3WA 5IYCO 1F15A 3Q4HA 3J7NA 2J22A 5K1XA 2HEVF 1K5QA 3TN92 3IT8A 2PHLA 1IBMB 4GKKB 5ACA1 4XF9A 3HD8B 3T2QA 5AC92 2QNKA 1NKGA 3ZFGB 1FYJA 2YMZA 2Q7HA 2AZ5A 4O65A 5E1RA 5IJ9A 3T1HO 5F3IA 1W6MB 2W39A 1JZ8A 3C90A 3E5XA 3B77A 1MSWD 1SF9A 2OIIA 3ASIA 2I74A 4JGZA 1OA2A 4L92A 2FDKA 2A9HA 1BBT1 3ZFEC 3VBUB 3UJOA 1FAFA 4Y1UA 3KCCA 4QQ2A 2Y4TA 2AC1A 1ZNPA 1BEV1 2QE3A 4CP9B 4Y33A 1AR93 5IW0A 2V4AA 4K20A 4ZU5A 1X8MA 2L6LA 4JYYA 5DECA 4AG4A 5ABJB 4D8MA 3SKJE 4O4HA 3NMBA 3DEMA 2WFF2 4X88A 2HWF3 3S57A 2HBUA 2WNUB 4H7MA 4GD4A 4YARA 2LGWA 4CE8A 1QHDA 4INDA 2P90A 3T2MA 4PI2A 2JDIG 2JEXA 1GH6A 1CESA 3O1SA 1CR7A 1ENSA 1QVGU 1UY0A 3CJIC 4DV3O 4G28B 2Z4FA 2YU2A 5JWPA 1KS5A 1NY72 4QXBA 4B4PA 1QJU1 3OT7A 3RYKA 1HNWO 3FWEA 3ABZA 4W4LA 4XJ9A 3MD0A 2PAMA 3CDZB 4COYA 2WT1A 2KG7B 3PHMA 4YM3A 3A21A 4XJAA 4EN8B 1MR5A 4IV3B 3NAPC 5C9AC 3WF1A 5IWFA 1G6NA 3PTYA 4PQ9A 3FHQA 3ACLA 5EJ1B 3PL0A 3E35A 3GBFA 4HNAB 2Y69C 1ZRDA 5B1BB 1F2NA 3CCVV 1I1EA 4JV4A 2FHRA 2DW4A 4Q4V1 2ES3A 2XAGA 1VP6A 5KUKA 3POSA 3CJXA 2RR13 3EHKA 5AVAA 3J81N 4UT5A 5T50A 4DEQA 1Q81W 3RJRA 4ZONA 3AP7A 3EBRA 1IQDC 3DECA 2HLEA 2P6HA 1UIJA 4NE9A 5FXWA 2KKWA 5GLUA 2RR11 4DUXA 2BUKA 1YIPA 4I9WA 2FDIA 5BMVB 3CCEV 5LMUB 4N23A 4JI0B 5BR8B 3M3EA 2ZD9A 3I2GA 3VKOA 3O1MA 4P5HA 1PIV3 1XE7A 1XUQA 1GU3A 1JUHA 3KCXA 1V6OA 1FPN2 2W92A 3JBG2 2NLRA 4ATFA 1JQ0A 1UZYA 3K06A 2GN3A 2P4EA 1POV0 1CQ9A 4IEYA 1S2BA 1QJX2 4Y5SA 2ZCWA 2FDJA 5KUMA 2YV8A 5FNVA 2BQPA 5TSWA 3RZHA 1WN7A 4J7JA 3VZNA 4EN9B 1GNHA 3VHRA 3FB6C 1A78A 2Y8KA 4Y4YA 3A0KA 4NXNO 1OCRC 5CVRA 2WWWA 5C93A 3D82A 5LBFA 5E6HA 2QQLA 5EC2C 1D2DA 5JMCA 1MEC3 3KCYA 3CNAA 1ZZ7A 3TETA 2QJ1A 4UAPA 4BZ4A 5DMYA 3HEIA 2BOJA 5FLXN 3URFA 2QQKA 4OHZA 1COWG 4HN0A 1W03A 1GOGA 4KHPO 3WF4A 2MEV2 1EYBA 4RS5C 3OUHA 1SA0B 3GCWA 3MYXA 2P3KA 4R9AA 4E4HA 1AP6A 4NTWA 2BBAA 3VBRA 2IJIA 3O1UA 4MYEA 4AQSA 4OI0A 1JUIA 4J41A 3DTUB 2JKBA 2R062 2Q4SA 2WSUA 2YXSA 5J1XA 2DCKA 2LROA 1KD1W 3OGGA 3ZLIA 5APAA 4BQ2A 4LBEC 5I0DA 1M93A 2VY0A 5FL7G 3VHPA 2ZGSA 1AILA 4BIFA 4LPLA 1WA8A 4X64O 5CIRA 1NG0A 4JYBA 3QF7A 3DXRA 1XPWA 1GNZA 4ZPIA 3IPVB 5IUQA 1Y9GA 3IGAC 3GM8A 4EN6B 5L9VA 4AAPA 3CC4V 1K5JA 1MS0A 1GK9A 1UX6A 2ZABA 5JJJB 3CSXA 5FZLA 5FO9B 1KS4A 1VF6A 4PDRA 2EXHA 2KD7A 3OF1A 4XFAA 3TBDA 2JGDB 2HWE3 4DXZA 2F23A 2FMDA 1FFXA 4DRXA 5J98B 1VQKV 3SYPA 2CDYA 4BQ1A 5FZKA 1H8EG 4O4JB 5BY5A 1CPNA 1HRI1 3TXQA 2DWDC 4OHWA 2VMFA 3WNPA 3CP1A 4N43A 4XXPA 2WZPP 1D0HA 3BYWA 4F8AA 3I7DA 4JPRA 5BNPB 4K3UA 3RWRD 1X36A 1RUD2 4PELA 2X29A 4MSWC 1Y76A 2NLJC 4RWUA 2W6JG 3ZMZA 4MS2A 5GTIZ 3ZHUA 1T6BX 2ZTNA 2R042 1KMIZ 1JU3A 3KB5A 4E4EA 1PVC2 2WT2A 4QGPA 3WG7B 3L9DA 4W6WA 3JD72 2ZM6O 1G4YB 4YVSA 1QLNA 1WNSA 3X2QC 4UI9L 1QXRA 4ATEA 1ZZ9A 1K7DA 1UAIA 1Z78A 3STLC 4YM2A 1Y4MA 4X89A 3HNBM 2PAKA 1O3RA 1RB8G 4GH4B 1PHMA 4F3JA 5BNQA 3L74H 4LWSB 4BK5A 1AR72 2JENA 3CJHA 4FTSA 3MIBA 4LJHA 2AXTZ 1R3KC 4BK4A 4H13B 2DTYA 4OI4A 5FAXA 3VKMA 3VLBB 4JI1B 4KG0A 1RUI2 3W7WA 4WVZA 1N3QA 3WG3A 3NRUA 2G9GA 1OHHG 1H6XA 3CBNA 1NA1B 2WLPA 1AVMA 4J9ZB 1HJFA 5JPNB 3UKNA 1X8EA 4L87A 1NZ6A 4PF5A 2VWJA 3AYCA 1HJGA 3FX3A 2XONA 5IVFA 3FLRA 5C4WC 1TME3 1F4HA 5DZFA 3VBFA 2YEVB 2JJ2G 5J2UA 1XHZA 3ZIXA 1KB9F 1CD3G 1H0BA 5B4XA 2ZQMA 4CP0A 1BZKA 1N0JA 4Q8KA 4PDMA 2EIKC 5B2GB 4MHRA 5G04L 4DV4B 1AR4A 4WBBA 2WIIB 4DXTA 3T4HB 1YIFA 4EZ4A 3WT3A 1SFPA 4CDXB 4FP2A 2WLMA 3L73H 4QPIB 1QQP2 2NPIA 3UGHA 3QLQA 4QM9A 1DQ0A 5CG8A 4LF7B 5BY1A 3SJBC 5F1RA 2F1MA 4TZDA 5FKCA 1VRH2 1POQA 1CIYA 5EP9A 5LXTA 2B9UA 1PP9H 3H8UA 1ND3C 4TUYB 2DYSC 5T5LA 3LDRA 4Y1ZA 5GONB 1OCOC 3I2DA 2LO1A 4IGQA 1A6CA 5LY1A 3JAWA 5LL6Y 3JD3A 1YSCA 2ZHLA 4DINB 4A4AA 4M3CE 4B3RB 4LHLA 5IK4A 4J10A 1HKDA 1SQPH 1PL0A 2NQYA 4GMP0 1JU4A 3J80N 4LO6B 4H33A 5LP6A 5D1IA 3FBMA 4CC5A 2QQPA 5EYYA 3AG4B 3EB7A 1MA1A 4B3MB 2ZJCA 1YO8A 2XOMA 1S77D 1LHWA 3HNYM 4MGTA 1YQ6A 4N8MA 5FY0A 1NS1A 1RUE2 2D6NA 2NZ9A 1K3EA 4C1XA 1ZLZA 1ZBA3 4CUCA 1XNTA 4PT6A 2DF7A 3ACHA 3TEXA 5JH7A 3APQA 2ZEXA 3NV3A 4LOSA 3ZRSA 3O1RA 1EN4A 3FFZA 1F9KA 5BNNA 1J84A 1KGYA 3VDDC 2KR2A 5L36A 5A33A 2RDNA 5BNOA 3ZMNA 2W0FC 2RE9A 3V0BB 3DC5A 2VZRA 1OOPB 2E7QA 4S2DA 2J1VA 1NJIW 5CFCC 2HWD3 1Q8QA 2JVDA 2WAOA 4HL0A 1LAJA 1F51A 3MPPG 3RZLA 1VBB3 4I50A 1F8VA 1N36O 2X6AA 4EFEA 2WABA 2ZA9A 1LULA 1K34A 4LF8O 4Q4X3 3D4KA 3VD3A 3PIGA 5IYDO 1K8AW 4RA0A 4TQFA 3JQXA 1UJWB 5C5UA 1V0AA 3UKVA 4AHYA 3I2HA 3I56V 4DR6B 4R7CA 3HKBB 3ZM8A 3ETPA 3AG2B 5CB7A 3E8FA 3K03A 2EAKA 3AJYA 3OUSA 1UPSA 4UUJC 1SLLA 2EIMB 4IIJB 2VPVA 5JOXA 1HDJA 2D93A 3LIGA 4ZBMA 1U5IA 5SV5A 2XT9A 2XL9A 1QR9A 1AJPA 3VL8A 3BALA 1NR1A 1VBE3 3PUAA 4CVUA 2FMLA 4K9SA 5J9PC 4PDWA 5LRSA 3FL7A 4AQYO 1B35A 1YJKA 3SXWA 3T09A 5LHIA 3VBBA 3ETGA 1EAH1 4JRAA 1IS6A 5JVDB 4DV5B 3D8CA 3L71H 2W52A 4L8JA 4DXSA 1JZ4A 3T1YB 3ZPYA 3VBHA 2ETEA 5A3PA 2R1DA 3BGAA 4CUBA 4KGGA 1M56B 5FK8A 4NPMA 3WNKA 1MACA 2QQVA 1R3IC 2QQWA 3B8NA 2F66C 2X7RB 4PA6A 1OBNA 2GH2A 1N1TA 4R9BA 2R6QA 1SQQH 3IAPA 1RVF2 3U11A 3L2HA 2Z5UA 3MW2A 4FOWA 4XF1A 3U37A 3MUZ1 3POYA 2WA4A 3D3IA 4JASA 2Z42A 1W99A 4DR2O 5FV3A 3EXUA 2GC3A 1AR62 2ZX0A 1W0OA 1O5LA 5DDJ2 4AFDA 2ADPA 5LYJA 3NJYA 1UMZA 2BV4A 3TK1A 1I08A 3AG3B 1XXNA 2JXAA 4B3MO 5LB6A 4YW5A 1EV11 1AUYA 3CHXA 2OQ6A 3E8HA 3TXSA 5EIBD 2AHYA 2J1AA 2IXHA 1CAXB 4Y26A 3R4DB 5F5IA 3BPSA 1JYWA 4QXKA 5EBLC 3CLPA 1HR0O 5F3CA 4DV0O 3THPA 2WLHA 3DGTA 5FMCA 4M0NA 5K0UC 2YC4A 2DWRA 2Q0AA 1KJRA 4FFIA 4LKEA 1JPXA 3CXCU 2CH7B 3IIIA 3DYMA 1PK6A 5M0TA 4AEMA 1NR7A 5GZFA 3V56A 3LCPA 1QGLA 1QBZA 3KQ4B 4XFHA 3WNOA 1ULEA 2XVGA 4QB6A 5FK7A 4F6RA 2UXCB 5GZDA 5FPOA 4JI4O 2HG5C 5AVPA 1AYM1 1WAZA 2M6YA 3WDXA 1AX0A 2VU9A 4FOYA 4WF9V 4PA7A 2FCUA 1VE0A 3ZN6A 1HV0A 2YI9A 2EX3A 4RFRB 3DPRC 1EZVH 5FOBB 1B06A 4BWAA 3ZYPA 5L9BA 5IHRA 2W1UA 4FOVA 5GM0A 1QLEC 2WS92 1MS5A 4CDWA 2Y0IA 1N1YA 4O61A 1IBKO 1WW4A 1WBFA 1SHWB 3USSA 2ZGLA 5JZGC 2K9ZA 2UU9B 3CJIB 4ZXEA 4LK6A 1CZVA 1NCRC 2LGQA 1RMU2 5KXCA 1SBFA 2AZ0A 4P9LA 2UXDB 2XWBB 3OTFA 2KQXA 1HWYA 4B3TB 5FPVA 4J1XA 3NXSA 3JSLA 3GALA 2XJSA 1PMIA 1RJ7A 5FP3A 1DU3D 3MLJA 1COV3 1GRJA 3IAQA 4EWEA 4KWKA 3NAPB 5C9AB 4LF5O 1LGCA 1N47A 1IZ3A 5IATA 2Y69B 4DOUA 4FK5C 4MVOA 1HNZB 4FPCA 3KLSA 2Y33A 1RUG3 4CDQC 3KQRA 1GP6A 3OBZA 2Q73A 1QDCA 2K2SA 4HT1T 4JI2O 5D5PA 1YIJV 4OQ8A 5ACA2 3RMYA 4DV1B 4FQZA 3VOUA 4LF9B 2ZBJA 3CS5A 2A3XA 3TNQA 3ZKYA 1E79G 2ZT9B 3ZRWB 4NMIA 3J8F1 3JASB 2FBEA 3O0VA 2HWC3 4Y24A 2VCMA 2UU8A 3ZFFC 1XRUA 3R0RA 1PKXA 2YUEA 3O1VA 1QR8A 1FAYA 3C7OA 2JE7A 3KSCA 3TRSB 3WSOA 3W20A 3ZO0B 3JCUZ 3WB2A 5FZMA 3C7GA 1TQ5A 2BP6A 4IEQA 4DO0A 3SEEA 4JDOA 4E9KA 5FMDA 2W47A 3K5MA 4PA4A 1JFFB 4JKKA 2WLIB 3ZFGA 4HKLA 4Q4Y3 3KV4A 4DV6O 5B1AC 3E5QA 5FY9A 2JS3A 3O5SA 5FYZA 2XBO3 2HJIA 2BJSA 1W6MA 3NW4A 2YPJA 5GZEA 5FP4A 2Y0OA 4PIXA 1RGSA 1DZRA 2OZJA 1VBA3 1AR92 1FYUA 1RJ8A 5FYUA 1H2LA 1DLCA 1H4HA 3VBUA 1BMV2 1Y6XA 4CP9A 3N9MA 2VUJA 1VALA 4QDRA 2Y64A 4XYXA 2OTLV 2B42B 4AFCA 2HWF2 5ABJA 5JI7A 5C3PA 3WNLA 2VNRA 4BXFA 3VV1A 4COZA 3L2YA 3MIFA 3LAGA 4NB5A 1ZA7A 1OCRB 5F6LB 3ZDSA 3AEIA 1C8NA 3UGGA 2N74A 1Q8SA 3FX7A 1RSOB 1PX4A 5F5CA 2YUAA 2BGCA 3K77A 3GHMA 5T3NA 1MMMA 3SYQA 4AI9A 4GWNA 2DVGA 1ENVA 1XNDA 2L35A 1WLCA 3T30A 1F35A 3T4DA 2F4VO 4IEVA 3BB6A 1S55A 4AI8A 3MLLA 1FMD3 3BKZA 1JZ6A 1WP7A 4RS5B 4OHVA 4A7YA 2Q4PA 2OQ7A 1VMGA 3EHBB 1PGL1 2RS51 5CBLA 3D0JA 3K48A 2W9XA 4Y1YA 3P3NA 3ES4A 1XREA 3APBA 4LFBO 2V09A 1NU1H 4IV3A 2YI8A 2UXDO 4HKWA 1R1A3 2JG8C 4CP2A 4XUTA 2ZIMA 1OFSA 4HNAA 2RR12 3LWCA 4DZGA 3SPCA 3C7FA 3M3OA 4JI7B 3SKVA 4LP8A 1ORQC 1ZL8B 4GX1A 4AVBA 3LNMB 2CL2A 3GZUC 1J5EO 1B09A 4JVAA 2ARXA 4Q0PA 1O4TA 4NVPA 2D40A 1PZ8A 5LK7B 1EM1A 5IT6A 3PJSK 1LR1A 1XMOO 2QKCA 4UF0B 1VLNA 4B1LA 5HI0A 3AMHA 4UFKA 4CS4A 3IBMA 4NOTA 2PMWB 3SPJA 1PIV2 1ONAA 5H9CA 3H1KH 5BMVA 4UFZA 3MUY1 2BRTA 2D3SA 1ND2A 4FPFA 1M06G 1IG0A 1RUJ1 4FLWA 4MW3A 3J4UH 2RJLA 4NHMA 2OKXA 3CCUV 2EVXA 1PL4A 1R6TA 3VBSC 4XBLA 1UCXA 2FD8A 3O12A 4GJYA 2FZ1A 4CRQA 3T4ZA 4LHSA 5F2VO 1XILA 4D7YA 1DCSA 1FV2A 3W7UA 3ST7A 2WWSA 1CP9A 3EQEA 3ZIAG 4DIQA 2LJ2A 1J58A 1M9NA 4BDVB 1ASJ3 3NV2A 1REFA 3T1CA 3I2FA 2WO7A 2RM23 4AI1A 2AEYA 3AZXA 3ABLB 4U36A 1AHSA 4E4SA 2A73B 1VQ7V 1VMJA 4OHYA 5CBGA 3D3AA 1WLTA 1I6XA 1SS3A 2HWB1 1GZ9A 2JDYA 3JD4A 1Z7S1 3WF3A 4XAAA 1Q86W 3GZEA 1C8M3 2PA7A 3AP5A 1V54C 3HPLC 2N7GA 4JTCB 2IXKA 2WINB 3WF0A 1OUSA 4AGGA 4LO5B 3SJQC 3THOA 1SA0A 1PGW2 4MVUA 1SMVA 3CRMA 1N1SA 4ZS3A 5IK5A 1GP4A 2C9KA 2VTFA 5CEHA 5F5QA 1LHUA 5ANQA 3ACFA 1HN0A 5FJKA 1XYNA 2EJRA 1Q3EA 3JD1A 1QHTA 3UV9A 2YSUB 4Z92B 2BOBC 2BSKB 2WO3A 1MSDA 1CJDA 4DR4B 1Y3TA 3VD5A 5FZ3A 4AR2A 2IXLA 1D4M1 3F95A 4J25A 5IYYA 4GZRB 1DIWA 4N9HA 3LSEA 3IPVA 1UYZA 5C4WB 2VM9A 5EC1C 4QX1A 3W5NA 2HWE2 2RDQA 5HXVA 4LIVA 2JEUA 2XTAA 2EIKB 1POV3 1UY3A 1W8UA 5KHHA 5DUWA 2WZR3 4G3YC 2DVFA 2WWJA 2HHHB 5GZCA 4JZRA 1WWYA 1L0LH 2VMIA 1H8TC 3G4SV 3OPWA 4ONUA 3PMEA 3T08A 2QE7G 1AR83 1OJHA 4CEYA 5DABA 1ZUQA 4O4JA 1OQEA 2DYSB 5FPRA 1ZM1A 4BCUA 1OCOB 5K9YA 4JI8O 1IBLB 3S7IA 2VCCA 2XMLA 1W8WA 3LEKA 1K5SA 4IEPA 1J3RA 4BQ5A 4YIOA 2A1XA 5BNPA 5D5QA 3POBA 5DAXA 4LO4B 2GMMA 4DR3B 1F5JA 2E26A 1FT9A 5C7GA 1DFQA 2EJ7A 2WO2A 1Y66A 3QTCA 4HPKA 1QMJA 1IXBA 3ILRA 3NL1A 3AVRA 3WDVA 2YG0A 1PGSA 3PUSA 4TYSA 2UYBA 1BVP1 3WVJA 4YJ2B 1T2XA 1PD3A 2HJDA 4IQPA 3LQCA 2QQJA 1LB2A 2PYJA 4X66O 5A6XA 4XVHA 1SBDA 3VDDB 4RL7A 4GH4A 4LF6O 2VBBA 1MNGA 4C91A 1MOFA 1IPJA 2PN5A 4LWSA 2EIGA 3N36A 1ZX3A 1Y9MA 2AZ2A 2VMCA 1JH5A 3JAKB 5FFOC 1LODA 5FZAA 2IH3C 1AI4A 2B5HA 1I5YA 2AR6A 1H1AA 3ASOC 4B1MA 3OBRA 4B3SB 3A8TA 2WFPA 4GX2A 4CU8A 2SBAA 1NA1A 1G9CA 5IT9N 2EICA 1OC1A 2ITDC 3TN93 2B39A 3UO2A 4X6RB 4NRMA 5KC6A 3JAMN 1C3HA 3MIDA 4DYLA 2BTQB 3JD2A 3RFRA 3KGZA 4PIYA 3P3PA 3UETA 1WMEA 4BE3A 2P37A 2YEVA 1Q8OA 4AI2A 3JUUA 3NNGA 1AYN1 2RJKA 4I2OA 1TUBB 4DR5B 4Q4W1 1VAMA 3RYCB 4OUEA 1Y67A 1BHGA 5C5TA 1SQVH 4J42A 4B8EA 3ZMUA 1S0JA 4CDXA 4QPIA 1NLRA 2Y6HA 4Q5OA 3E8GA 1SCRA 4AFBA 3DXTA 4OX9B 4YZ5A 3AZVA 1XU2A 5HPOA 4GXLA 1AJKA 5B1NA 1ULOA 1KITA 3KGLA 5LOVB 3QO8A 4W6XA 4D0QA 3STZC 2XUMA 4TUYA 4Q6GA 3ZN0A 5GONA 2WFF3 4HK8A 1A34A 1FXKA 1ENRA 2WAAA 3SYOA 1QU0A 1WGPA 4ZI7A 4A7KA 2DN9A 3WW3A 2JECA 3H7JA 4C7UA 1IXMA 3BTYA 2DFCA 1OV9A 3D36A 3PVBB 4N53C 2D5FA 2WNVC 3FKSG 2B8MA 1HXS1 5JAXA 3HN3A 4DR7O 3E86A 1NQTA 3H8XA 4NIAA 2XHNA 1K45A 4NRPA 2HEPA 1NCQC 3ZMOA 1GN2A 3WINE 4OUSA 4LA3A 1YJNV 4Q26A 3KV5A 4LIUA 1OH3A 1SACA 3PTRB 3KHCA 2PTMA 2P7TC 1S3JA 2X10A 5E8AA 5H5NA 3POIA 1XNRO 4Z1MG 1AP5A 4MGIE 4XIOA 3V0BA 3NV1A 5K0UB 5JUVA 1LHVA 1OOPA 2E53A 4HANA 5A7WB 3OTOB 3FFQA 3T0BA 3ZKUA 3EYPA 5LRRA 3NJXA 3MEPA 3H42B 3O7OA 4Q4X2 2MPFA 1W6QA 2QKDA 3AZYA 4LBQB 4C0HA 3LE0A 3K3OA 1KP3A 1QY4A 3FE5A 2EULA 4MLOA 5ITZB 2I45A 5E1AC 2ITCC 1RFYA 2QFEA 3VZJA 4MHUA 1TAEA 3DGEA 2GBOA 3U78A 4Y22B 3V65A 5T55A 1GQHA 2A7AA 1QXPA 5A6QA 2ZR3A 2EAAA 1DQ1A 2YC2A 1F23A 1QLEB 1HRV1 4GLXA 1QKQA 2J1SA 3WDWA 4JX0A 3IB3A 3JB8A 5LEJA 1CXZB 2DCYA 3RVHA 2Y26A 1VBE2 3OBAA 4WVMB 4UXNA 5FPZA 1AL21 5JZGB 1KEXA 3I3EA 3JBG3 3LDDA 5LBEA 1QJX3 2P34A 1N8RW 3KV6A 4NR1A 2J7MA 4LOTA 3THCA 2WSSG 2CNAA 3CEWA 4KGQA 5JVDA 3RRDA 2CSGA 2UWBA 2DCTA 2VC9A 3BODA 5FY5A 3IZOA 3KV9A 3LA7A 3RW0A 5JPMB 2PLV3 4X62B 1MS4A 2JGUA 1BCCH 5FUIA 1SZBA 4EKWA 4P02B 1DHKB 4L97A 3W58A 3BI3A 2YGMA 1W2UA 1Y4WA 2DYCA 2UXBO 2QTSA 1UO9A 4GKXA 4K7JA 2DUOA 1K92A 4NRQA 1ZRCA 3LKJA 4ZKTB 3R4UA 1UIKA 1R6KA 4Z07A 2VRZA 3QO5A 1V6NA 4TLFA 1JJ2U 4BYYA 4MGSA 2PHXA 2Q1ZB 5CNAA 3ZYHA 4FCAA 3LDCA 3UT0A 4H2AA 4UW4A 2MEV3 1DYKA 2EXKA 3GCXA 1OQ1A 5KXEA 4HYOA 1Z5VA 2DVAA 4WV8A 4L2NA 1MG1A 1AF9A 5B66Z 1MS9A 3NWKA 5KA6A 2P06A 3POWA 2R071 3NV4A 2V73A 2BPA2 1CAXA 4LCUC 1O9HA 2PI4A 3GF6A 3O14A 2JB4A 1EY2A 1MS8A 1H2NA 3JALB 5B5EZ 2UUCO 3THDA 4P9YA 3N9NA 3GGLA 1W0NA 2QM8A 4UV9A 4LBMA 4MVQA 4MXWB 4H44B 4DW1A 5E89A 5FY1A 4YW6A 3BCWA 2P6CA 3M3IA 3S0MA 3K4DA 3VHOA 3OB8A 4GWMA 4BMBA 2RDRA 4J11A 3V0AB 2OCCC 5KR7A 3M8LA 3KZIZ 1N34B 1BQZA 2OIEA 3RZGA 5H6RA 2EIJC 2UURA 4ZU7A 3MI8A 4G4FA 1AI5A 1IOAA 3EFFK 4AF9A 1QIQA 1I9RA 5FYVA 2VZSA 4K1YA 4QU2A 4LH7A 4IGOA 1QOTA 3B7MA 4ISRA 4WZFA 4ZIBA 1GO3F 5FKBA 4IGGA 5EFUA 4RSUA 3TWIA 4XQWA 4URTA 4V2WA 1SDWA 3U14A 3AC0A 2PHFA 1GZWB 4QXCA 1H1IA 1G1XB 3KT4A 1RUD3 3DKQA 3RI9A 2C26A 1NH2B 3AMQA 3E22A 1K5MB 1K97A 2I2SA 2VVEA 5FYYA 1RUG2 2OPKA 2IXCA 3NAPA 2R043 1W05A 2JG8B 3ZXJA 1JZ7A 4U2AA 3WY6A 1PVC3 1GTOA 2WNOA 3JD73 2A3WA 1G86A 4MGQA 4A2UA 1RUF1 3BN6A 1E5HA 3QOPA 3WP5A 1CPMA 1FV3A 1O6UA 4RFT0 3T1MA 3ZRWA 3JASA 3VL9A 2BNMA 2Y34A 5JR7B 4NHYA 3VBRC 4AAXA 4LFAB 5HV4A 1UU4A 4IE0A 4ZOLB 4CDUC 1YXWA 3CO2A 1U96A 3DCQA 3APOA 3K57A 5FXZA 4Q4Y2 5C8CB 4RHV3 2F4LA 1LOFA 3GBGA 3E1F1 5CA3A 2AUYA 1JFFA 4X6QB 5K4LA 2WLIA 3VD9A 4I0AA 4WFHA 2WKKA 2E3CA 1QNWA 4GJZA 1KU9A 1OKQA 1Q43A 2CTPA 4UCVA 1RUI3 4LXLA 2QVSB 2SLIA 3VBSB 2JS5A 1GICA 1V9U1 5GKAC 2VVFA 1AI7A 1WA4A 1BXHA 4NO4A 1DGLA 1JOBA 3GJBA 2DQ0A 1VF6C 1GQPA 4BJ0A 5EZYA 2XAQA 1P8JA 3NO8A 4NUBA 1AL0G 2A6WA 3CRRA 3SPIA 3N3HA 4O4IA 3FB8C 4AQ6A 2YIDA 3W7XA 1BGYH 1OXCA 4DUYB 1KKDA 5B1OA 2V5DA 1KD7A 3WNXA 4IESA 1EFRG 4F83A 1XL4A 2DCJA 2BNNA 4B7EA 1RSOA 4N43C 2PY5A 1QQP3 1S0BA 4MADA 3LFIA 2XJVA 2EIDA 3PNAA 2GDFA 3QG5A 1XYPA 4YM0A 5LW9A 2KB1A 4W6YA 1YI7A 1U12A 3KZ4C 2W91A 5IWAO 3AXDA 4DK0A 2JE8A 2BERA 4XFIA 2DBIA 4L9BA 2WLQA 1XNQO 4EWDA 4DUZB 2EALA 5I0TA 4RYDA 3WX5A 1NTZH 5FZGA 5KXBA 4QAWA 3VZOA 2XLAA 4Z82A 2ATKC 5KLVH 4XW3A 1CVNA 4TWTA 3UNPA 5JSOA 2W94A 4FSJA 2MHFA 1W8FA 1VIWB 2DU1A 4I02A 4UB8Z 1H1MA 3WQ0A 2VW0A 1AXYA 4MGZE 4LT5A 1ZL8A 4ZHNA 3IIAA 5CBFA 2DU0A 2IH1C 4K35A 2XJTA 3BU7A 3O0XA 4LBQD 4J80A 4LE3A 3WQBA 3S5QA 5IK7A 1XMQB 4OZXA 1QJEA 1S5LZ 1BJQA 3S6PA 3ZMSA 4LFAO 4QHOA 4LFCB 4WM7B 4GKYA 3IWZA 5KX5B 3FJSA 1IPSA 1UOBA 1XL6A 4KUMA 4O2BB 4XETA 4H0LB 4LNUB 4C8DA 4JCKA 3M1HA 3O0WA 4F4LA 1GWLA 3UK9A 5B3SC 4P9OA 5JDBA 5IVYA 4FPJA 5FZDA 2AREA 3ZX6A 1UOGA 4NWWA 4ICGA 3I3MA 1ASJ2 1FJGO 4LITA 4GCZA 2M7WA 1OUXA 1Y43B 2RM22 2CDPA 1OH4A 2HWB2 4XC9A 1Z7S2 4HSJA 5EJZB 1RUH1 4E8DA 1W9TA 1TVGA 3NNMA 1HNXO 5LA2A 4NKGB 3LA2A 4FVVA 2IVJA 3F5TA 3VBOA 3HT1A 2E31A 3A0HZ 1LHNA 1GR3A 4RQPB 5FPXA 1I5PA 3JB4C 1DGWA 3F7YC 3SHRA 2QWQB 5A32B 3B40A 2GDSA 1VBD1 2VCBA 1GFF2 5F32A 1C8M2 3UL2A 3P30A 3RT3C 4JI3B 1VQ8V 1RHI1 2C0ZA 2IJKA 4RUFA 2VH9A 1KKCA 2IFWA 4QNHB 3ZX7A 1ZZ8A 5JQGA 5J37A 3L72H 3ETEA 5GW7A 2Q67A 3LSQA 5LP6C 2ATFA 1EN5A 1VB4A 3RZKA 3K58A 4IEZA 4SLIA 1A8MA 2FDHA 4HN1A 5CKNA 1BS3A 4FM0A 5CADA 5F9TA 4K3AA 1D4M2 4B4RA 3M8AA 3I2KA 4YGBA 3H01A 4CSWA 4BH9A 3ASOB 2W08A 1AROP 1VAKA 2XASA 1WD3A 3RWKX 3T1HB 1UL9A 3N9LA 2R1BA 4J6GA 2QKAA 4BQYA 1VR3A 2BSKA 2F93B 1O4YA 3M70A 1RUC3 1QJY3 1KQRA 1FXVA 2C9AA 1R093 5FCCA 3CL1A 1DLBA 5C4WA 5GJ6A 5A3NA 2ZPXA 1H2MA 2IFRA 4IEOA 1PMJX 1TEIA 3B01A 3WCRA 5KA5A 2R70A 1APNA 3OEBA 1QU7A 3UGFA 2DCZA 2BU9A 4WZCA 3A23A 1AR82 3JARB 4LH6A 3JU9A 3K51A 4H55A 3KG2A 3AYAA 3DYPA 2N05A 1G7YA 1JOPA 1KP2A 4AILC 4X1YA 1J83A 4CPBD 4A6OA 3IMMA 3D5OA 1UXXX 5FXXA 4OPAA 3ZVXA 4Q0QA 5IDJA 4AEKA 4AZZA 4DV3B 1S2KA 4FIPC 1CWPA 2WLJA 1CX1A 3HQXA 1VB2A 1H38A 4UVBA 2JDMA 4IT5A 1S0EA 3N9OA 3TEWA 5HCFA 1HNWB 4Y20B 3VB9A 4NJ4A 3GXUA 2WS93 4BA6A 3OGIB 4PDWC 1NH2D 1B35C 4QGMA 4N53B 5A1FA 2VG9A 1CAWA 1XSQA 3FHIB 4QGLA 5DAPA 2QWOB 3VBHC 1DG6A 4MG2A 3MHSC 1FFTB 3SC7X 4YJ2A 4YG0A 1SERA 2Q6AA 4H37A 1NCQB 3IN9A 5FOJB 1NLSA 1NZIA 3NNJA 2YICA 3ICXA 4HG6B 2RMU1 4PA9A 2UWAA 4DV2O 3ZRVA 3ZXDA 3AP9A 4AVSA 4UCSA 1R6NA 1CONA 4AEDC 4OI1A 3M7AA 5LMNO 2RDSA 4TT3G 4D6TH 1HP8A 3JAKA 4E8CA 1CZSA 2C24A 5ACA3 2QZ2A 1W6NA 4DR1O 2ZGMA 3P5BA 3ZYJB 2HP8A 1JBCA 2F4PA 1HB3A 3K0DA 3NJVA 2VBDA 3CU7A 2ZMLA 2VOWA 2ZGOA 2A6VA 3LOBA 4EV0A 2ZHMA 5IAVA 4AE2A 5BXZA 2E75B 3MW4A 4QX8A 1AYN2 4O9EA 2F95B 1V9PA 2ZR2A 4Q4W2 2YXHA 2ZXWC 2WQ8A 2V72A 5FY7A 2RJ2A 1UW8A 4PA3A 3OUJA 4WM8B 1BBT3 4XCAA 2VBPA 1W0KG 4K6BA 1YFWA 1BEV3 2BTQA 1JZ2A 2BGOA 5AC91 4I0XA 4YHHO 2W87A 4DY3A 3M7MX 1D5AA 4COWA 1TUBA 4P30A 1PNFA 2H8PC 4GB31 3RYCA 3KD4A 2ZX1A 1GANA 1E5RA 1NLQA 4NXNB 4YJ3B 2QQNA 5IAXA 2A3YA 2WC2A 4KI5M 5FZCA 2QWNB 3BEHA 2VOVA 3OM3B 1HN1A 3AG1C 2FL4A 5K1PA 5LOVA 1AZDA 1RUOA 2RJZA 5IY5C 3ZHTA 4CU7A 2OXBA 3MGUA 1JZ5A 4KHPB 3CPWU 1PO21 1QJU3 1I5ZA 3BIWE 1UY1A 1KXGA 3W7SA 1JA8A 4Q29A 1SQBH 1L1FA 3ROUA 3VD7A 3UCSC 2ZE5A 4ZU4A 4OHXA 2VUCA 1LESA 1NKDA 1ENQA 4QD2A 2VTXA 3KF5A 2A6XA 4IV1C 2NMNA 2CGPA 4FZ0A 3FN9A 3B8MA 1OCCC 5CAZA 1ZRFA 3OUIA 1GUIA 4Q4V3 3RZMA 3RZJA 4FZ1A 3PU3A 1NY71 5LCWL 4X64B 2E5LB 4JYCA 2IZWA 3GDBA 4QB2A 3RBZA 4QKFA 1B04A 3SGIA 2HYKA 5FREA 1AXZA 3S3WA 2QWPB 3SNMA 2CUGA 1V6KA 5K0UA 5A9GA 2YHJA 5A7WA 4DEVA 4TXWA 4WCEV 4IERA 5BUVA 1VBC1 5BZBA 1Y74B 1HRV2 2RDCA 1VF7A 1UY2A 3M3QA 4LBQA 2J42A 2RMKB 3ABKC 2A79B 1AI6A 3HT2A 1UX7A 4PBOA 1AL22 2D3PA 3HBKA 3BIEA 3VDAA 4FM1A 3OE7G 3ZYBA 2OCCB 1GYKA 4KNCA 1K9MW 3Q8FA 5DN2A 5EPAA 4YW3A 4JAUA 3VBUC 2UUAO 4IE6A 2JIGA 3BTAA 5FNVB 2ZZJA 1TZOA 4WVMA 5JZGA 3A22A 4H14A 2FB5A 2GV9A 5ABJC 3OR7C 5IVCA 2BZDA 1MQTA 3ON7A 2ZM6B 1FPN1 2WLKA 1QJFA 4PLNA 2QGNA 2VNOA 3OPZA 4RR3A 4AVVA 3RYIB 2VE1A 3MO4A 4UB6Z 1W9WA 2XDVA 2XKPA 2PLV2 2Q5ZA 2GSYA 5F6KA 1DDLA 2G1MA 4NHLA 4E27A 1X33A 1N33O 4GMP1 4HK9A 3GBWA 1L8DA 3GB7C 3TCUA 1WP8A 1H8HG 2ENRA 3ZN5A 2I07B 1NXMA 4QJFB 1L3JA 3SH5A 2CYFA 3G6BA 5LEKA 1MS3A 1OLQA 5KAFZ 2ORXA 3TOJA 4YW1A 3G71V 4UVCA 5JSRA 4CXWA 2PI5A 4NAOA 3SPHA 4GWJA 3PUHA 4HVQA 1R73A 4YSFA 1XBLA 4CDUB 1MVEA 4FXKB 4IV3C 5FBZA 3K5LA 3POFA 2F43G 2VQFO 3Q9OA 3DYOA 5B1BC 3FUQA 5CU1A 3JCZA 1WB8A 5IVBA 2HR3A 1XBFA 2W46A 3SCHA 3WOGA 4FLXA 2YFZA 1WA8B 4CH4A 1OZ0A 3INAA 3DXRB 5GLWA 1K4CC 1NQJA 2OYQA 2R061 3UM7A 1XNCA 4PF1A 2Q0OC 1SLTA 1J59A 4R50A 2E5LO 5D8AB 1I0HA 5L3EA 5FO7B 1RM1C 3OMIB 1KRIA 1C57A 4KU7A 3OCPA 1G9DA 4MXWA 1WW5A 4CH3A 4P9IA 4BIZA 5T5PA 1ULGA 1Y9QA 4LO8A 4EWAA 2EIBA 1EUUA 3VZMA 1V55C 4DY5A 3H3UA 4CXYA 4DRXB 1C5HA 4A6SA 1HRI3 1ND2C 3WEZA 3ITQA 2DQ3A 4YZ2A 3V0AA 2NMOA 2AHZA 5DUXA 3ILFA 3TEZA 1LNSA 4N43B 2TUNA 4AFMA 3HNMA 1V6MA 3CEIA 5A7OA 1U5XA 2DURA 4CPBA 3ZXAC 4FPPA 1CEZA 4YY3O 4CEWB 4QMAA 1KBHA 1Y76B 2GTAA 2X8KA 2XPJA 5L3CA 3LUTB 1GAXA 5A6ZA 3WU2Z 2WBKA 1RUF2 2E9QA 4XURA 2PF4E 1J3QA 2J1EA 3MIEA 4I3PA 2G19A 3AB0A 2VZUA 2VNVA 1UZZA 1KFUL 5CN0A 2K9PA 1K5MA 2D44A 2XNDG 1YJLA 1U0AA 2VS0A 3OSDA 3MDPA 2JG8A 3IMNA 1OMIA 4CZSA 1PO11 4B7KA 4BOWA 3EXAA 1WPBA 3VGIA 1UYYA 3GWOA 4Q0SA 3H3LA 1UNBA 1DZTA 3MFCA 3OGCC 3E6DA 3AKRA 1YJWV 3RYRA 2WA3A 3H0OA 3MHZA 2X53S 1L7RA 2VJXA 1XEQA 1JOYA 5LHGA 1N36B 4NIGA 1J1TA 4P9PA 4RHV2 2J1RA 2R9RB 4FJCC 2RCVA 2ZEZA 4LF8B 3G80A 3LSDA 1V9U2 2ADDA 2D3RA 4FPLA 3I4IA 4XDKA 4EN0A 4MV2A 4GIQA 5C8CA 3TB0A 4EZHA 3C3VA 4FFBB 5HXMA 5A3OA 3EJKA 2X5IC 3ENRA 1AR71 3JQWA 2R9AA 3ES1A 2XQRA 4QE7A 3RG0A 4EYUA 4XUOA 2P5OA 5EIBC 2XQXA 4OZOA 1WW7A 3VBSA 1BL8A 3NR7A 3CMEV 4X20B 3ZMTA 4Q2FA 2ZEWA 2VTXJ 4YVWA 4UWDA 1N32O 4UBGA 5FWJA 3ZHQA 3I3DA 4AQYB 4M00A 2V5YA 3ZS8C 3K5OA 3FB5C 2B1GA 1YTFB 3UT5B 4W4ZA 1UQXA 5FZ1A 1M57C 2DMXA 4HZFA 3VQWA 4LO7A 5I93A 4CEYC 1OVPA 2A71A 1O3QA 2VXJA 5JIUA 4JTOA 4AOCA 3E5UA 2R9IA 3U1XA 2W1QA 2AGAA 2VOXA 3JAWB 4YIPA 4LUMA 5BNPC 5I8TA 2NR5A 1M5IA 1WCKA 1ENXA 1JS9A 4PDLA 5FYSA 3ZR5A 4IE5A 5IVEA 4XJUA 1VRH1 3M4FA 4DR2B 4HONA 3X29B 5LP6B 2B45X 2XUEA 5CFDB 5I0SA 2JKXA 5EBWC 1A3KA 2VQUA 4DB5A 1I94O 2FDGA 1VF5B 1LJ7A 2MK3A 1VQLV 3OEHG 4BM8A 1DBNA 3AFKA 1WJZA 3H9AA 4Y3OA 2ZDIC 3SMHA 4QWNA 4JZGA 2P6JA 1Q8IA 1SQXH 3OYWB 3T2PA 3R4SA 5CA1B 3SYCA 3LEMA 5IJ0B 1HR0B 4WVWA 4DV0B 4TLGA 3IFXA 3MAQA 3KM5A 5KHJA 4YFZA 3LA3A 2Q69A 4GH4C 5A33B 1HB4A 1XYOA 3KVBA 2VW2A 4ZHQB 1RUE1 4HFSA 3AK2A 1MVQA 4K21A 1JX9A 4BQ3A 1BSMA 1U5YA 2O57A 5HCAA 3LEIA 3F5WC 4JI4B 3N2KB 1UOFA 3CWBH 5KAIZ 5LA0A 4X1IB 1NBMG 3PDQA 4PI0A 2QWRB 1F31A 3PUIA 2GNMA 4X65O 1NA1C 4TV8B 5FRAA 4Y5TA 4WM7A 4FP3A 1K12A 1GQGA 5KX5A 3CF6E 3L70H 2BE3A 3AMMA 1IBKB 4NROA 4O2BA 1WUVA 4LNUA 5C71A 4HZ3A 4FT8A 1R081 1Q90D 4ASKA 2GNDA 5C3QA 2P4KA 3HKCB 5EK0A 4I9QA 4GX5A 1OCZC 4JV5O 1S0FA 4KQ7A 5CB4A 3OR6C 3C2UA 4EEQA 1CN1A 1M90W 3CCLV 4LTAA 1EAH3 3AX4A 3I5DA 5FR3A 1B35B 3ZPOA 4QPIC 1A8DA 1EPWA 1BHBA 1WKYA 3WG1A 4LF5B 3ETQA 1US3A 2ZAAA 4D6SA 4RQPA 4BR6A 3VBHB 4HKOA 2KSDA 4OMCA 3LIHA 5A32A 3VQYA 4YW7A 3BTZA 4JI2B 2YFUA 4BMEA 4ABMA 1FXKC 5CKQA 5HCHA 4XBFA 4F6EA 1H4GA 2Z5WA 4PIZA 1R3LC 5I0UA 4LBJA 2Y6LA 4FPEA 1ST8A 2E51A 4TWKA 1ZTEA 4BAYA 1D5NA 4AEDB 3D36C 1TMF1 2MNGA 1LENA 4QIWF 5L7OC 1SESA 4XFBA 4AHZA 2JB8A 5H9PA 1ZBE1 1X9PA 2ZHKA 4X8PA 3ZR6A 1BT8A 3H8OA 3ABMC 5KMGA 1EV13 2ID4A 4DV6B 4S2FA 4K8ZA 3MPBA 1RVF1 3WNMA 1RUC2 1QJY2 1ALYA 2HLDG 1YYNA 1R092 4QKDA 1LOEA 4WFGA 3M2MA 2ZXWB 1IS3A 5JIAA 2A06H 1LR5A 1WB7A 5DN6G 1S72V 1F4NA 1AR5A 2TEPA 1AR61 4QX7A 1YDXA 4S2GA 1LOAA 5JOYA 1JN2P 5DDJ1 4UFJA 3RYFB 2EZOA 3TAYA 4GZ9A 1VMHA 3DKWA 3Q8BA 2IJHA 2JDNA 4I4TA 3RPQA 4LR3A 4Z8BA 1AYM3 3ZFEB 1GNYA 3KT1A 4TV9B 3W21A 4FLVA 4ISQA 3SITA 1LUVA 4L8QA 3PUQA 2RS11 3JARA 3AVSA 4ARXA 1OF4A 2B5UA 2OYZA 2JDZA 3PVOA 1R1ZA 1IPKA 5FYMA 5FZ6A 3AG1B 5JSPA 1KDMA 1GKBA 3IJ4A 4M4RA 4UCOA 3LSSA 4META 4BLJA 4CUGA 2F4VB 5IY5B 2LS6A 3HN1A 3WW2A 4URAA 1O4ZA 4XTMA 1L7LA 4R8HA 3H9VA 4I7ZB 4Y20A 2QKSA 1BE3H 4EFBA 4XFCA 2RMU2 2VQEO 5J36A 4N53A 4LFBB 1GM8A 2AGSA 4IV1B 3IAYA 5F2WA 5A1AA 1XSRA 3NJZA 2V4DA 3UESA 4G2KA 3RMXA 4CCMA 2JDUA 1ZZBA 4K0KO 1I3HA 4ES8A 3AMNA 2RS31 1FKAO 4LKFA 1NCQA 4I01A 5T5OA 2WNEA 4DUVA 1RMU1 4BQ4A 1WLDA 3G67A 1W0PA 1BQPA 1QOSA 5C3RA 1J5EB 3AK0A 1W9SA 2XB6C 1E5IA 3QCWA 4H3WA 4XFGA 4MTXA 3J8F3 2JG9C 3J9SA 3DL3A 4D7SA 1W9YA 2ZMNA 4E4ZA 4R6ZA 2DUQA 4J9YB 1XMOB 2ZKNA 4QGNA 3SLIA 3ZSKA 4U3FH 3K79A 4CH5A 1RUNA 2GNTA 2FQPA 1FOD1 5LK5A 1YFXA 3OMAB 5EQUA 4GAZA 3THTA 4FPHA 3ABKB 3VZLA 2EILC 5L3DA 3AG3C 4OMDA 3WV6A 1H9WA 1BBT2 1J95A 1C1FA 3VUOA 1BEV2 4AHCA 4GB32 2Y6JA 4ZKIA 4WM8A 2OPWA 1BKZA 4UW5A 5J2TB 4ZS2A 4MX3A 1X4TA 1WCDJ 2R72A 1W28A 1V00A 4CCCA 1O59A 1YTFD 4DXRA 5JJNB 1NYWA 2YU1A 3LOIA 2GP3A 3MLKA 5JJEB 2DWEC 1PO22 3IDCB 4GA9A 4FPKA 2QJVA 4YJ3A 3T4VA 3GZTB 4CC6A 1AR91 4GYCB 1BMV1 1AVBA 5F3EA 1Q8PA 5KC5A 5TISZ 4D6RA 2WNUA 1DF5A 4RGAA 5LA6B 1QJU2 4XMIA 3ZHRA 4YW4A 2BOCC 2HWF1 5LY2A 4NAMA 3HKEB 3E6BA 3MF6A 4HVRA 2Y6GA 4NXMO 2Y4UA 3H1YA 1PNMA 2ZXQA 4BQXA 4HOOA 4KG8A 2VCAA 2RS53 2P17A 2WL1A 3B69A 1S5HC 1UPGA 3VDBA 1N3PA 2JDHA 1TVKB 4IL6Z 2LW7A 4CH6A 1HX6A 2JE9A 4DV7O 4W65A 4Q4V2 1M1KW 1JMKC 3ASNC 2LUWA 1FPOA 3QNEA 2PYLA 3I2JA 1VQ9V 1ACCA 2KG7A 2QM7A 1JHJA 1XC6A 2PYTA 3B02A 4WBNB 1VBC2 2K46A 4P2ZA 1CJPA 2BGPA 2WN3A 3S7EA 2OT7A 1NE4A 4P9GA 4JI5O 4XJWA 2VMDA 1GOHA 4JYAB 5ERLA 3I54A 2ILMA 1RPRA 4E2LA 1Q6UA 1JYIA 1AJNA 2GMEA 4LBOA 1XDCA 2WYSA 1RM1B 1UF2C 3SJAC 3POGA 4JI6O 4NHKA 4BIUA 5BV6A 4CCEA 1Y74A 1AJOA 4CXXA 4OI2A 2ZGKA 2ZCEA 5FYBA 1O3SA 1LOFC 3N7MA 3WF2A 1RUJ3 1ZAUA 1V55B 5CMUA 1K73W 2JIJA 1XNAA 2E33A 3AM2A 4A7ZA 4CZZA 1S5JA 2XJPA 1IHMA 1ND2B 3BVCA 4MVRA 1DQ4A 5FZBA 2B46X 3C3SA 1IS5A 1IBMO 1RPOA 4JI8B 4GKKO 4XDLA 1YNAA 3ZIWA 2UWCA 3ORJA 4ASUG 1AXKA 4HBNA 5C3OA 4JTNA 3D6EA 1KFXL 2Q8DA 2ZACA 1THZA 2PGGA 3O9OA 1IGOA 1H2SB 3ME2A 2N04A 1PIV1 1WLEA 5H2FZ 1VAVA 3E97A 1FXZA 1R1BA 1AX2A 4YWAA 1BLZA 3SDLA 2D6MA 3W9AA 1PV0A 3K08A 1W2OA 1P49A 4WFBV 4LBKA 2E32A 4XEZA 1BVVA 2VZ3A 4F7ZA 2CTVA 2HVJC 3MZHA 3J7LA 4A42A 5L3FA 5C8WA 3RYIA 2D7FA 1XE8A 5FZ4A 1Q82W 5F7UA 4IEUA 3GVMA 4GULA 2HWB3 2GP5A 4X8NA 3J26N 4GWIA 1Z7S3 2RG4A 4QPGC 4X66B 1JZ3A 4IE7A 4Q20A 3X2QB 4Q1RA 2LRPA 4QX5A 4W50A 4LF6B 4PHZA 2PHRA 3HVDA 2D6PA 1EUTA 3H8RA 2XJRA 5FZOB 3OOXA 4L0PA 4Z2AA 1MEC1 3FAVB 2YZ4A 2VMEA 4IDZA 1WW6A 4EQVA 2A6ZA 1X50A 2R16A 2ZX4A 2JWPA 4FBFA 3AP4A 1J3PA 1STMA 3FLPA 1NVPB 2TBVA 3LDBA 4O4LB 1QEXA 4LMFA 3MICA 3W5MA 4CDUA 4IUGA 2LQTA 5LGUA 1OD3A 2LW1A 2YXLA 2D6OX 1PX3A 1XNKA 5DG1A 2IJJA 1SZTA 3ZHSA 4IYHA 2X5IB 1IQAA 1CAUB 1D4M3 3WLUA 3A2FA 1XI1A 3WNNA 1PGW1 2FYUH 1QNMA 2PFWA 2D3OW 2ADEA 4P14A 4LC1A 1RC6A 4E2SA 2QTWB 4PJYA 2WAMA 3CCMV 3IKWA 1HB2A 2D98A 5DAWA 1JCHA 1VPHA 2Q8EA 2GUZB 1YCIA 5D8AA 3BHPA 5EWSA 2ZE7A 2XAJA 4JYAO 4JHTA 3TGUH 5FPAA 1HRI2 1WPXA 1GM9A 1VP7A 2DDUA 4LKSA 4BB3A 2P3YA 2EF6A 1M57B 2CV6A 4JDMA 2JGDA 3T0DA 5J96B 3DV8A 4IEXA 3NNFA 5LA9A 4CEYB 4NTXA 2ZE8A 5DUVA 4LORA 5ISLA 2F6BA 2HWE1 5L19A 5LMUO 4JI0O 2GU9A 5BR8O 1FD9A 4N90A 5JCTA 2XKOA 4LBNA 5JCOA 1KUQA 1K33A 1ND3B 1SPPB 2WO1A 4MOAA 2PHWA 1DQ6A 3I97A 2VXRA 4WFEA 4CEWA 4QT6A 4AQTA 4NIHA 3NVCA 1O5UA 1PO12 1BZWA 4I09A 5DAVA 4QU1A 4CU9A 1JI6A 1O3TA 3ILNA 4DR7B 2CHHA 4QB1A 4QQLA 3VBOC 3ABLC 3PVNA 3H7YA 4ITCA 1JYCA 2Y38A 4HPKB 4FPGA 1Y7BA 2ADQB 1LHOA 4QM8A 1HW7A 3CCRV 4FQ4A 4FLZA 2ZX3A 1JR9A 1VQMV 4MTGA 2Z79A 3ZXKA 2XLFA 3CXHF 1OA4A 2ZE6A 1YWKA 5C8YB 5LWBA 3OPTA 3AK1A 3ZMVA 4ET7A 4NYKA 1WMFA 3ZXGA 4O9GA 3C7EA 1XNRB 2P3IA 1W9FA 4GQ7A 1NZCA 3RVZA 1HB1A 5L3BA 1UZWA 2JEMA 1OD5A 2DBNA 5J3UA 5IYBO 2V1DA 1GMMA 2Q68A 1O8PA 5EYPB 4O7XA 5A6YA 4AI3A 2L9LA 2R32A 3A7QA 5JXGA 1WMXA 1LU2A 5CFCB 1RIRA 4UVAA 2P3JA 3B9CA 3SH3A 5FZ0A 5FMOL 1H8VA 1SFYA 4G9SB 2WPDG 5A70A 2PQQA 5L73A 4FFBA 2YS8A 5CYYA 2KM2A 1G6UA 4QPJA 1D0GA 3BABA 1NUKA 4NTYA 3K4AA 1WZXA 3NSTA 2ZGTA 4I55B 2BWCA 1VQPV 4CCDA 1YF2A 1YZBA 2OT5A 2OTJV 2DUPA 1W6PB 4ZZ5A 4BWOA 5DZGA 2Q8OA 2EIEA 1AYN3 4X20A 4Q4W3 4PCRA 2R7EB 4D7TA 5EJ3A 4YRDA 1OCZB 4H7LA 1MZ6A 1W2NA 3JYCA 3P32A 2RN9A 2GTSA 5I8YA 2W95A 3OY8B 1SLAA 2VQAA 2EXIA 3KT7A 2VOTA 1TME1 3HJRA 4M3CB 4P9JA 2H3OA 3UT5A 5FZ8A 1ULCA 4LE4A 5FYIA 1TNRA 1V6IA 3F7VC 4XHXA 4X8AA 2JIZG 1ZSPA 4QQOA 4XDQA 2X09A 3GYDA 4AHXA 2D5HA 4C1WA 2UXBB 2XAFA 5H9RA 3M3CA 1FXKB 1PZ7A 2A75A 1URXA 5JLVA 1FI2A 3LEGA 5FYTA 2QM4A 4ZI7B 2QDRA 1CX4A 1E5SA 4PDVA 3H1MA 4UYBA 4GALA 3ZN4A 3ZN1A 1TE1B 4JZ2A 2XAHA 3K0GA 4XIKA 3JATB 4AVAA 2IW5A 1HXS3 1SDDB 1LGBA 5L7OB 5CFDA 2WN2A 4MW8A 3POJA 1N0NA 1CZTA 2YGLA 2W0XA 4XHBA 5G05L 4XAEA 5KHGA 4JGSA 2YPDA 5GLZA 4MVMA 3ABMB 2FCVA 5JXHA 3PU8A 3SH4A 1OA3A 1HIXA 1NT2B 3ZCCA 2O1QA 1UYPA 1W6OB 2AW9A 3OYWA 5A80A 3E2EA 5CA1A 5IJ0A 5FJHA 1DK1A 4XZPA 1TUEB 3G6JB 1BK0A 5AFBA 1ZBA1 2UUCB 3WG2A 5FYCA 1IG3A 4ZHQA 2DE0X 2Z0AA 3QVNA 4HETA 5KHIA 1JYVA 3LDKA 3Q8AA 3CIHA 4XACA 4JGYC 3J7AU 2BFUL 4HLTA 3TYJA 3OGRA 2D6LX 4U7NA 5LBQA 2W2IA 1W6QB 1NAEA 3N2KA 4CS3A 4LHKA 3ECQA 1QH6A 2GC1A 2JD4A 1R082 2AENA 2BVBA 4PLMA 1VQ5V 3EVKA 4BW9A 2KXLA 4X1IA 5LGNA 2HWD1 3LPFA 1OSGA 5FUNA 3QH6A 1O8SA 2QZ3A 4TV8A 5C70A 4I0WB 1VBB1 1HRV3 4CS2A 4FTBA 4JC1A 3CQOA 2DVDA 4JI1O 4Q0UA 4K8XA 2NN8A 4KXRA 3DPRB 4Q4X1 1OPOA 1AL23 2BTOA 4OLLA 3HKBA 2W6IG 5IE9A 2ZNIA 4JGZC 4BPZA 3HKCA 1EAH2 2GH8A 3CC7V 2NM1A 4AEJA 4IIJA 4ZZ8A 2XHBA 2OWOA 2QCSB 2WJSA 4D3WA 3LFMA 3O1PA 2A6YA 4EE2A 3R65A 2Z2SB 4P9XA 3MIGA 1OQDA 3FD9A 5FZEA 5EYXA 1D4VB 1NCRB 1BCXA 2WUHA 1VQ4V 2P5BA 3TEYA 4OPHA 2GAUA 1W0JG 3ZXFA 5FTTC 1VBE1 4DV4O 4U3JB 1TMF2 4LNVA 3I59B 3VQXA 4FFFA 1Z5WA 3KVAA 1YITV 1XHXA 2GZWA 1ZBE2 2X05A 4LF7O 1L7QA 2J1UA 2KA3A 4XTPA 2NN4A 2AEZA 4CCNA 4HVOA 3K3NA 2JG9B 4RUEA 1JTZX 4CDQB 1IURA 3VZKA 2O8OA 1NVPD 2VZTA 2BOIA 4AEDA 3WB0A 4XUNA 1RXFA 1SBEA 3GNEA 1EV12 4JQRA 2JX9A 5CA0B 4B3RO 2P22C 4BU2A 3HR0A 3ZFFB 1DF0A 5FPBA 5FMBA 2EILB 2GSMB 2R073 4CP1A 1SQ4A 3AZZA 2AH2A 3U07A 5DAQA 1CIWA 1PNKA 4XDJA 3FYIB 2XGXA 5CBHA 2ZIOA 1IKQA 5JOWA 2YB7A 1SZXA 4XF0A 2RS12 2OVUA 5B1AB 2ERFA 2OW4A 2GMPA 2G4IA 3S30A 3LDEA 2B7YA 4D6QA 4J7ZA 2ZZQA 1MPXA 3A0BZ 3S3XA 1AYM2 3RYFA 1PZ9A 3SEPA 1XQNA 5I91A 3CCSV 3OD4A 2E7AA 1MS1A 3T1LA 1YHFA 3ZFEA 1QJZA 4TV9A 2CH7A 2Q30A 2UY9A 1MZFA 2EINC 4YZ4A 3U0ZA 2WZ8A 5A7SA 3SISA 3I3BA 3ABUA 3ALQA 2DOSA 4YM1A 2IVIB 1VEWA 5JMOA 4S2HA 1NQDA 4OCTA 2ZGPA 3WP4A 4IE4A 4AGVA 3CCJV 2QQOA 3IDEA 3AMPA 2UUBB 2VQTA 5IWAB 3E83A 4DR6O 2BNOA 5L9RA 4UW3A 1UKGA 1L0NH 2RS32 2WLNA 4NN0A 1XNQB 4KH9A 1O9GA 2BVVA 1C4RA 3AKQA 1DTOA 1CAVB 1MQTC 3CJIA 5FP7A 4YFWA 1NOVA 4RR3C 1EP0A 4HSLA 5FZ7A 3E22B 2ZOEB 4IV1A 1W06A 2H0VA 4DUWA 1IKPA 3ASNB 1SG3A 3E8BA 4MVSA 4KBBA 5LATA 3CE2A 4FMTA 1RUF3 4MVZA 1GWKA 2QQUA 1FOD2 1DLLA 4KWJA 1W8ZA 3J8F2 4PQQA 5C9AA 3R6SA 1GKFA 4I5SA 1IX9A 4DV5O 3O65A 1COV1 2WLLB 1W90A 3T1YO 3U75A 3MHHC 5LGTA 1YRZA 1KC8W 1SETA 2GC2A 3HR9A 3I55V 3RYHB 1UPIA 5A3MA 3POEA 4IGPA 3DSQA 2CDOA 1N3OA 1RUG1 5FO8B 4KP4A 1SRYA 4COUA 1Q8VA 3I2IA 4CTEA 4Y1XA 4MT8A 3B9IA 3PJQA 1ZX5A 4UFHA 5HFLA 5EBMC 1TGOA 2Q1FA 3DF0A 2HWC1 2JRIA 4ZY9A 5I0RA 3UQ8A 4XXAA 4MTOA 4MVTA 1V9U3 2HYXA 1Z2GA 3N7JA 4K40A 4FFHA 4K8RB 4FLYA 3S5AA 4COVA 5J2TA 2XHKA 1BMFG 1YQCA 1FJGB 3CC2V 4N7UA 4Q4Y1 2QUOA 3FMGA 1VMFA 4XMAA 2XBO1 3LB9A 1UZVA 5DQ0A 1S76D 4YYOA 4YLZA 5EZYB 1XU1A 1HNXB 2CGOA 1SC5B 3H50A 4UV8A 2H0BA 4FPOB 3MV01 1F4MA 1YVWA 1VBA1 2YBPA 4O4IB 3CMGA 1M4UA 3SQOA 3CCQV 2HH9A 1B3QA 2QDNA 3GJAA 2UXCO 2ETNA 4HXCA 4V2VA 4QPGB 1PM7A 4FLTA 2JJ1G 5LA6A 4JF3A 5IYZB 1S0DA 4XUQA 3L75H 4XJ8A 3RNSA 2O8QA 4A3ZA 2YIBD 4IW3A 2IUWA 1PGL2 2RS52 3N7KA 4X1KB 2B1IA 3HKEA 2XVLA 3WUDA 4W4KA 3ZEDA 1QXJA 4P9WA 1UU5A 1HQWA 2K0GA 4O2AB 2EZPA 3ML0A 3WP3A 2CTWA 2PHDA 2UY8A 2IU3A 4LA2A 1V54B 2OIGA 1GN4A 2UUBO 1OLRA 4CA9A 3ZSLA 1J1LA 3MFAA 1TVKA 4X9QA 2UU9O 4RS5A 1K5MC 5LZ6A 3UKMA 3T0AA 1FMD1 4PJ0Z 2ZKOA 4NPLA 2VL4A 1BHAA 3B5LB 2WWUA 4YVSC 3K04A 4B3TO 3H1JH 4WBNA 3WG4A 3OEEG 4KU8A 1W2AX 4ZXKA 4RO2A 2QSAA 5FQ0B 1DF4A
chains in the Genus database with same CATH topology
3KM5A 5KHJA 2PTMA 4YFZA 3LA3A 4JV4A 4GH4C 5A33B 2FHRA 4Q4V1 1R1A1 5E8AA 2ES3A 4V1PA 1XYOA 1VP6A 3SCGA 3POSA 1OHFA 3CJXA 2VW2A 2RR13 3EHKA 5AVAA 5T50A 4MGIE 4XIOA 3V0BA 1RUE1 4HFSA 4AXOA 1MVQA 3NV1A 4K21A 5K0UB 1LHVA 3RJRA 1OOPA 2E53A 3AP7A 4HANA 1GBGA 2XG3A 4ORFA 4BHPA 3EBRA 4BHFA 1U5YA 3V64A 3WZ1A 3FFQA 5HCAA 1RUJ2 1ZZCA 1UIJA 2OA2A 5LRRA 2A70A 1UKRA 3MEPA 5C8CC 3KMHA 3O7OA 2VGDA 5GLUA 4Q4X2 2MPFA 1W6QA 2RR11 2QKDA 3FLTA 3AZYA 3HAGA 2BUKA 4LBQB 4C0HA 1YIPA 2A5ZA 1F31A 1QY4A 3FE5A 2GNMA 1REEA 3OGJA 4MLOA 2FZ2A 2VQ0A 2I45A 1NA1C 3VZJA 2QFEA 3M3EA 2VECA 2LTNA 5FRAA 3ZYIB 3VKOA 4P5HA 1PIV3 1XE7A 4WM7A 2ZMKA 4FP3A 1H8TB 1GQGA 1ZRRA 4HMZA 1O7FA 4Y22B 5GLTA 4FXGB 3V65A 3CF6E 5T55A 1GQHA 1JUHA 2A7AA 3H3ZA 3KCXA 4I30A 1V6OA 1OIJC 3AMMA 1QXPA 1WUVA 2EAAA 1DQ1A 1FPN2 3JBG2 2NLRA 4ATFA 1HRV1 1UZYA 4FT8A 5AFEA 2GN3A 1S1AA 3WDWA 1QKQA 1R081 1POV0 5EXOA 4YVWC 3MW3A 2EA7A 2GNDA 1CQ9A 3JB8A 4IEYA 1S2BA 5LEJA 1QJX2 2DCYA 2ZCWA 2Y26A 1VBE2 1RUH3 1VZ5A 3VBFC 4WVMB 1S0FA 5FPZA 4KQ7A 4JRLA 1AL21 2YV8A 2BQPA 5JZGB 3GHNA 3C2UA 3WDUA 1CN1A 5TSWA 1WBLA 3JBG3 4LTAA 3VZNA 3U10A 1EAH3 4EN9B 3AX4A 1GNHA 3VHRA 1B35B 1QJX3 4QPIC 1A8DA 3VBOB 1EPWA 1A78A 2P34A 1VBD3 4NR1A 1MEC2 3WG1A 4FO9A 2CNAA 2YY1A 3ETQA 4Y4YA 2ZAAA 1RHI3 4RQPA 3CEWA 4KGQA 3AXEA 1C28A 4HKOA 3VBHB 3RRDA 3A0KA 1SLIA 2UWBA 5A32A 1ASJ1 5CVRA 2DCTA 3D82A 3BODA 3PLQA 2RM21 1LRHA 5HCBA 3LA7A 5JMCA 1MEC3 4BMEA 5JPMB 2PLV3 1MS4A 3KCYA 3CNAA 1FNZA 3E6CC 1ZZ7A 4R4XA 1DHKB 4L97A 1H4GA 1LEDA 3W58A 3ELNA 2Z5WA 4PIZA 2GC0A 2YGMA 4BZ4A 4AW7A 1W2UA 5I0UA 2DYCA 4LBJA 4QPYA 4FPEA 4LR4A 4GKXA 4XE9A 3URFA 2E51A 4K7JA 4OHZA 2DUOA 4Z1VA 4HN0A 1IS4A 1ZRCA 3LKJA 4AEDB 1SFNA 4ZKTB 2MNGA 1TMF1 3R4UA 1LENA 1YI9A 2MEV2 1EYBA 5L7OC 4RS5C 4XFBA 1UIKA 4Z07A 3MYXA 4YGEA 4BHIA 1C8M1 4LLOA 4AHZA 2P3KA 5FLHA 4R9AA 5H9PA 1V6NA 1ZBE1 4X8PA 2ZHKA 4TLFA 5GALA 4BYYA 3VBRA 2PHXA 2Q1ZB 4MYEA 5CNAA 4AQSA 4OI0A 1JUIA 4FCAA 4Q27A 4R52A 1EV13 2JKBA 2R062 4UW4A 2MEV3 4M0HA 1DYKA 2Q4SA 2WSUA 2YXSA 1DQ5A 4S2FA 2EXKA 3MPBA 1RVF1 2DCKA 2H6CA 5EZWA 3EATX 1OQ1A 5KXEA 2X5IA 1RUC2 1QJY2 3OGGA 1ALYA 2P2KA 1CAUA 2DVAA 3OBTA 4WV8A 4L2NA 1YYNA 1R092 5HSXA 1LOEA 1AF9A 3M2MA 1IS3A 1RTVA 2ZKLA 5JIAA 1MS9A 3NWKA 1LR5A 3POWA 2VY0A 2R071 3NV4A 2V73A 2BPA2 1CAXA 2GN7A 3VHPA 2ZGSA 5BNNC 3GF6A 4BIFA 3O14A 2TEPA 1AR61 4KWLA 1EY2A 5BNOC <