3D8CA

Factor inhibiting hif-1 alpha d201g mutant in complex with zn(ii), alpha-ketoglutarate and hif-1 alpha 19mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYGEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3d8cA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d8cA01
2XUMA 4B7KA 1H2NA 1H2MA 2WA4A 2WA3A 4BIOA 2CGNA 4JAAA 2Y0IA 4Z2WA 2YC0A 2YDEA 3P3NA 3P3PA 1H2LA 4QU2A 1IZ3A 3OD4A 1YCIA 2W0XA 1H2KA 3D8CA 2ILMA 1MZFA 4AI8A 2CGOA 3KCYA 4NR1A 4Z1VA 1MZEA 4B7EA 5JWPA 3KCXA
chains in the Genus database with same CATH superfamily
1GNZA 3WX5A 3W7XA 2QTWB 2WLLA 2CDPA 4PDVA 2EXJA 5AC91 2Z79A 3S0MA 2E7TA 1VE0A 4FXKB 3WLUA 3WSOA 2WNUC 1HV1A 1JUIA 1SQXH 4LKEA 4JI7B 2D5HA 2NLJC 4Q4X1 1XNTA 3OJBA 1GOFA 4MW3A 4K8ZA 3UKMA 1QU7A 3CEIA 5LHIA 2ORXA 3RJ2X 4LE4A 2QVSB 3HPNA 1QXRA 1FFXA 4KU8A 1JZ3A 4I5SA 2AZ5A 3FLRA 1AR73 2NLRA 2Y38A 1MEC1 4TLFA 1WUVA 4OHZA 3GNEA 3C7FA 3H8RA 5FZGA 3THPA 5FUPA 3WP5A 4IIJA 3BHPA 5EC2C 1VB2A 5F8PA 1RJ8A 4NO4A 5FJHA 2XNDG 4QPKA 4AL9A 4Q0UA 3ZHUA 2IJKA 2JDUA 4K6BA 1AVBA 1YFXA 1EV13 2W1SA 3NNJA 4OUEA 4ZU4A 1J1TA 2Q1ZB 4M3CF 2ZGQA 5LRSA 2K0GA 3RJRA 4PIXA 1VPHA 5I8TA 1I9RA 5CA1A 4FVVA 1NI8A 4LBJA 1ULGA 2WWWA 4B3RO 5C3PA 2V1DA 2XJRA 4GMP0 3LSUA 3GWOA 3Q4HA 5T55A 3C90A 5CBHA 4TQDA 1S2BA 3MBWA 3L2HA 1J59A 4MV2A 1XNQO 3RZLA 4X1KB 3N2KA 1NJIW 5J2UA 3HMYA 1M93A 5C4WB 1GZ9A 2E32A 4R6ZA 2XLAA 2W92A 4X8AA 1UFIA 5L3CA 2QDNA 5GZGA 2W68A 1COWG 3EHKA 5T54A 5E16A 2XWBB 4XFIA 4D8MA 5B1OA 1RUH1 4QPIA 1DDLA 1AR4A 3WB2A 2VZ1A 1MG1A 4GLXA 1PMHX 2VVEA 3DL3A 3MICA 2XB6C 3I8TA 2FDFA 2IM9A 3ZJZA 4C90A 4YHHO 3NV3A 2GH2A 1NX9A 3PNAA 4NE9A 2E63A 2XXZA 1RMU2 3JB4C 2ET7A 2VNOA 5D2AA 5CMUA 1BEV2 5IYCO 3PUAA 3K5NA 2OT7A 3JD4A 1O59A 3H1HH 1SA0A 1IBKB 3OEEG 5I91A 3CB2A 1SERA 2ILMA 4EN0A 4D7SA 3S3WA 2NM1A 1ND2C 4FLVA 4QMAA 2Z3YA 5FZKA 3OTFA 2TEPA 2WQ8A 4LO8A 3RYCA 5FY5A 1JN2P 1RP3B 4DV1O 3U78A 5KA5A 3AG4C 3LNNA 2CV6A 4IXLA 3VBRA 2PHDA 1VQLV 2X6AA 5APAA 1ULPA 1UPSA 4JI2O 4JAVA 4JDMA 5FYYA 1XB9A 2QJVA 2PTMA 2VCAA 1DGRA 4AQYO 3JAKA 1VBA3 4OPAA 3I55V 4H2AA 4E2LA 1FYUA 4K20A 4P14A 1LR1A 2YIAA 5C8YA 3PTYA 3K48A 2YGMA 4NIGA 3VBFA 3JBG2 5FYBA 4MGSA 3FN9A 4AI0A 1RL3A 5B3SC 1V6NA 4X6QB 4LFAO 1WBLA 5K0UC 1JYIA 2E26A 3VKFC 1VBC2 4X1YB 4DRXB 5K7PA 1CZVA 2OPWA 4LF5B 1H6XA 3EXUA 5J48A 1YQ5A 3P30A 1W0JG 1RMU3 1DZRA 4MGZE 1IDSA 4RFT0 5FLIA 5A3MA 3G80A 4CXWA 1BEV3 2EIMC 1PX4A 3MGUA 5EIBD 2VQAA 2HWC1 3IB3A 4I30A 2KG7A 4V2VA 5IT9N 2WR9A 4IEVA 2X09A 1H8EG 3CJIA 5A32A 1OD3A 4OZOA 1N0NA 3MO4A 5JMOA 3ICXA 4GQ7A 2JENA 2PHRA 1K3EA 4XF9A 2W0XA 5KXEA 4UXAA 4IEQA 1AR91 2VWKA 3KD4A 2A75A 2R0FA 4O4LB 4GX2A 2XUEA 4QQPA 4NROA 1NCQC 1R3JC 3WCRA 3ZX6A 4ZKIA 3IMNA 5FP7A 1LHUA 3FHAA 3SEPA 3JAMN 1F4MA 1V54B 5FKCA 4FAHA 1KUQA 4WM8A 3WNPA 2HEPA 4ES8A 5LZ6A 3IIIA 4HANA 3WF3A 4LC1A 4LBMA 5FY8A 3KZIZ 1DLBA 1Y9MA 4CEWC 4RHV1 1TUEB 4LCUC 1IHMA 2B1GA 3N36A 2A6XA 1Y4WA 1HN0A 4OHVA 1ZTEA 3K03A 5HCBA 5FV3A 2IH1C 2OTLV 1VBC3 4CDQA 4IEOA 1CPYA 1NKDA 2R16A 4LPLA 3WNXA 5JSOA 3OCPA 3MW4A 2VVFA 4OMDA 1NY72 1WNSA 5JPNB 3JD0A 4BQ2A 3N2GB 1AR61 3A0BZ 4GT1A 1K5MC 2BUKA 1SDWA 2VW0A 2RDQA 3JATA 3OPWA 4TZDA 2Q68A 3M7AA 4JZ2A 4A3ZA 3NRUA 2X53S 2JG9C 1IS6A 4CCOA 5LA2A 4DNYA 1PNLA 4AOCA 3VKOA 3POJA 5FYTA 1D0HA 1YITV 5A6QA 4LQRA 3H01A 1VQNV 2XR4A 4LMFA 1NQTA 4CH6A 1W6NB 2ZMNA 5LHHA 4DUVA 5BZBA 4CCCA 3E5UA 1R1BA 5FZ3A 2MEV1 2HJIA 4U7OA 3RQ0A 4QE7A 2WLPA 2IJJA 5A6XA 1SQFA 1W2OA 2A6YA 4HPKA 1MMMA 4AEDB 3HN1A 3K5OA 5IYBO 2AENA 3DECA 4ORFA 3LWCA 4OHXA 1V9U2 1GSLA 1PVC1 4YG3A 1RIRA 1DLLA 2ZE8A 2E5LB 2G9ZA 1W90A 2IXKA 3I2KA 4XQDA 5CBGA 4KBZA 5A3LA 1SLLA 3TAYA 1QXJA 3LDEA 4QU1A 4XUNA 2VZQA 3V0AB 5C4WA 5DUVA 5CKNA 2UXDB 4Q4Y1 4WVMB 1S72V 4AI9A 3I2GA 4DW0A 3Q8FA 4NHXA 1YIPA 1B35A 4TYSA 4P5YA 2V72A 4CS2A 4AF9A 4M0NA 1O5LA 1RVF2 4IEYA 3RYPA 3WW2A 3K3NA 4LF6O 2TUNA 3MAQA 3CE2A 4IETA 3GBWA 3VZOA 4DV4B 1WCQA 4R8CA 2UY9A 4IW3A 2ZPXA 2ARHA 2GC3A 1YJNV 5IYDO 3FKSG 3CCLV 3QACA 2LTNA 4PA9A 4Y3OA 3AYCA 1UXZA 1DF4A 5C8WA 5B5EZ 3HJRA 3OBRA 5JH7B 4B3SO 4DUXA 1QJX1 4S2FA 5CB4B 3E8BA 4L2NA 4CDUC 3CXHF 1XUQA 2Y64A 1MSWD 1BXHA 3ZXLA 1LHOA 4HNAB 3M3EA 4GKJO 1V9U3 2OVUA 3H3LA 4F6EA 4QDRA 2VECA 3MPBA 2HWE1 5JQGA 3D4KA 4CU6A 1GTOA 4DB5A 4GUNA 3ASNB 2C9AA 4AHCA 4NYKA 1KKCA 1QIQA 1E5RA 3VBSA 3BALA 3I5DA 2FL4A 1AR81 4RS5B 2AW9A 3KGLA 2UUCO 3UGGA 5ABJC 1FPN2 4MGQA 2AC1A 4Y5TA 4XUQA 4ZOLB 1K7DA 1AR5A 1NVPD 2ADEA 3VHNA 2BOIA 3VOUA 1RVF3 4FQZA 4ZY9A 1H8VA 2KQXA 3ZFFB 2C26A 4HSJA 2QCSB 5L19A 1W6OB 2W47A 4DRXA 3ZRWA 1Y67A 1IBMB 2ZGRA 1CONA 2QQUA 4Q20A 5A33B 3UESA 2XOMA 1R6NA 3NL1A 5HV4A 4EROA 1U0AA 3APQA 4C7UA 2VO5A 2FDGA 1AYN2 2BWCA 3HEIA 4BM8A 4MADA 3UL2A 3VBUB 4BK5A 3M4FA 1PO12 2ZKOA 3CJHB 4YVWB 2FCTA 1YJ9V 1O3RA 1S0GA 4ZS3A 1X8EA 4HETA 1DQ0A 4GMP3 1SF9A 2VPVA 4FPLA 2RR12 2PUSA 4NAOA 4FPPA 5BMVA 5H2FZ 1OUXA 2XJSA 1CR7A 3ZN5A 4Q0PA 5FYMA 3CC4V 3I3DA 1OKOA 4W65A 2VQUA 4R9AA 1IG0A 2D3RA 1PO21 4KXRA 2RV9A 1FPN3 3FMGA 1GUIA 4X62B 4JHTA 4FT8A 4XUPA 1XU2A 4FPJA 3FD9A 3QNEA 1S0CA 4NKGB 4AVVA 3JD1A 3HD8B 1ZX3A 3W7WA 4JI5B 5LYJB 2ZGOA 4EN9B 3O0WA 3VKLA 3ST7A 1CWPA 3OEHG 3AMMA 1UMIA 2Y33A 4IEZA 2FZ2A 1RM1C 5EP9A 2UUAB 2VAUA 2OS2A 2FZ1A 1WCSA 3HB3B 1S2EA 3H7YA 1POV0 4JYYA 2R072 2Y6HA 1WA4A 3T0BA 4YY3B 1AYN3 3H1KH 4M01A 4J7KA 4H14A 1PGW2 3R66A 1PO13 1OCZC 1IQDC 4WBNA 5CN0A 2DN9A 1NCRA 4AI1A 4B4QA 2RJ2A 1RUE1 2PAEA 2P34A 2NQYA 2QDRA 3B3QE 3AZVA 2NR5A 3H1LH 2RR13 4JI4O 3C7OA 1SCSA 3K51A 2FMLA 2ZR3A 3OB8A 3SLIA 1UZWA 2Y4TA 4JTDB 5C9AC 3N7LA 5FYIA 5JMCA 5DAVA 3WT3A 5GKAC 5CZKA 1YQ2A 5FAXA 1LU2A 4K8FA 1EUUA 2EIBA 5T3NA 2P22C 2W95A 1LOFC 4LF8B 3NXSA 5FZ1A 1XMOO 1XDCA 2JE8A 5IK5A 4XMIA 3NO8A 2WNVB 4I0BA 2BOJA 2WRAA 5DPNA 3ZMUA 2ZAHA 4LO5B 3MEPA 1COV2 5F9TA 3P5BA 1GH6A 1JYCA 4ASUG 4WVMA 1IS3A 3HNYM 4LJHA 1L7QA 1M06G 1FX5A 5LHGA 2R073 4XJUA 3WHUA 3M7MX 4CPBD 1WB8A 1YCIA 2PF4E 3SYQA 4P02B 2W6JG 5ACA3 4TV9A 5KBFA 1G9BA 1H2MA 3CMAV 3T4HB 2YXLA 3DPRC 4KHPB 1VB4A 4KBBA 4YWAA 1J83A 3VZNA 3W59A 5A7QA 1N34B 1W8WA 4GX0A 2GV9A 1W9FA 5EZYA 3SITA 4EKWA 2ZNJA 1PK6B 2Z0AA 1KP3A 1UIJA 4XF3A 3KV6A 3JD3A 5C3SA 3CYOA 4YZ5A 4QD2A 3VDBA 1FD9A 3BVCA 3AEIA 4NXNB 2O14A 1QQP1 2DOSA 1VBD1 1S0IA 5JVVA 1FXHA 3TNQA 3SPCA 4HNAA 1O9GA 3HIFA 4FZ1A 1FXKC 3AM2A 3SKJE 5T5PA 1O3QA 3ALQA 5D5PA 2J7MA 4KWKA 4Z82A 3OEAA 3N9MA 1X8MA 1JYWA 2P37A 3R4SA 4YVSC 2ZKNA 1XBLA 1LHNA 4GKYA 3C8XA 4JKMA 1PL4A 1COV3 4YW3A 1EAH2 4QPYA 2AGSA 2IFRA 3JASB 3UYJA 3R0RA 3AP4A 2LGQA 1Y9GA 2GALA 4UBHA 2KM2A 4RD7A 4ZOLA 1Q3EA 1O4TA 3UQ8A 1IBLB 3OMNB 4CUGA 1M90W 4TUYA 1M9NA 1GANA 1FOD1 3J7MA 2RE9A 3POGA 1YFWA 2VUCA 4XHXA 4I4TA 2ZHKA 2VTXJ 3T08A 4GH4C 3PHMA 4URTA 4GJZA 4OI1A 5H9PA 3VDDB 4DR3O 4OULA 3K08A 3UO2A 2ET1A 5D8AB 2EILB 2HYKA 2JGUA 3ES4A 5I0SA 3F7VC 1V55B 3VD4A 1TMF2 2VMEA 3AMHA 3KVAA 2EINC 4LF7B 2C6SA 4XETA 3VBUA 2XAJA 4K0KB 1CAXA 4S2GA 1G6NA 2H8PC 1KD7A 4KFMA 5FPAA 2A1XA 3N7KA 2YXYA 4CP9A 1BK0A 1GWMA 4YM1A 1S2KA 2BSKB 1I94B 4QKDA 3LNMB 3DGTA 1ZL8A 5L36A 1RUG3 1EAH3 3RVYA 5IYZB 3T1MA 3S3XA 1WMFA 1QCEA 4JI8O 3JD2A 4FPFA 3SPJA 2G4IA 5JZGB 4JGZB 2DVGA 2ZGPA 3ZKYA 1GO3F 2R063 5FY0A 1HXS1 4IV1B 5IHRA 3R05A 2FMYA 1EFRG 3NAPB 1ULCA 4DR5B 2YIBD 4YGDA 4AQ6A 4IGPA 1RUJ1 1JZ5A 2VVDA 1SQVH 4UFLA 1GM9A 3WXPA 3A8TA 4AVSA 1UO9A 4UV8A 1UPGA 1W04A 4GIQA 4URAA 1JYNA 3R65A 3K57A 1GKBA 4FM0A 4ARXA 1LUVA 1AP5A 2JKBA 1UW8A 1SESA 2VMHA 4J25A 1TMF3 1JS9A 5E6HA 4K35A 1X4TA 5FQ0B 4YSFA 3RYHA 3JAWA 3QOPA 3H3UA 2EX3A 1EV11 4IEUA 5I8YA 2QWOB 2YB7A 4LIUA 5GLTA 5EJ1B 4UVBA 2PY5A 1US2A 5L7OB 2IVIB 2LW1A 4Q4W2 3IPVB 3AMPA 3LSQA 4ZS2A 3MLLA 2PAKA 3RRDA 1O7FA 4YW5A 3B7MA 5EC1C 1FNYA 2LRPA 5CFCA 3B8NA 2F93B 2DWRA 2KR2A 4WV8A 5DUXA 4D7YA 2X6BA 4E4SA 5CEHA 1VF5B 5KHKA 5FDBA 2PGGA 2ZMLA 1IS4A 3FHIB 2D6NA 2ZXWC 3ZYFA 2WQZC 4TN7A 4FXGB 4IEWA 4RUFA 5F3IA 4PLMA 1SLAA 3K3WA 3P3NA 2RS33 2VM9A 4JI3O 4HXCA 5EBLC 1JZ7A 4QGPA 4Q0QA 2WNVA 4C8DA 4BMBA 2ZT9B 2VS0A 5A7OA 4UW5A 5IVFA 2Y48A 3QH6A 2GH8A 2WNEA 3QCWA 2DMXA 1PGL1 4S2DA 2XHKA 3CCUV 3U0ZA 4PELA 3WDTA 4DFSA 2CSGA 2RS52 3UKVA 2Q8DA 4XVHA 2RM21 2NNUA 5A70A 2JRIA 2VQFO 4F6RA 4XUOA 2WAMA 4Q4W3 2YU2A 3LB9A 1N33B 1SQ4A 4PQQA 4O9EA 1PL0A 2DW4A 2BTQB 5FP3A 1ULEA 5IYYA 4DINB 2VZUA 4FPCA 5ERLA 4B3MB 3AZXA 1OUSA 1R092 1GYKA 2C9KA 3IBMA 5IVCA 4AQ2A 4ZXEA 3T4VA 1G8MA 2ZD9A 4FK5C 1F31A 4OI4A 3VQXA 5BR8O 4CCJA 4B4PA 2YYOA 1NU1H 3AP5A 4DR7O 4LH7A 4NTXA 3QO5A 5FIXA 4JX0A 5BY1A 1VBA1 1KS4A 1TME2 5J09A 3JUUA 2A6ZA 1KGYA 1RUI2 1DYOA 2Y6GA 1NVPB 3AC0A 1YDXA 4FFFA 1DP0A 3JB8A 4E8CA 3D3IA 2VU9A 4OHYA 3DXTA 3RVHA 1OI6A 5FPOA 3M99B 4I50B 4H3WA 1FXVA 2XKOA 4DXZA 4RL7A 1BBT1 4WM7C 2EJRA 5JWPA 4RQPC 5DUWA 1CVNA 1POV3 3CRQA 1N36B 5GLZA 4L0PA 4IL7A 2QNKA 1EYBA 1VJ2A 5CVRA 4BQ5A 5LP6C 1UQXA 2RS53 1MVQA 4IV3C 1RJ7A 4Q6GA 1GAXA 1ZBE2 5LMNO 4COWA 3IZOA 4LULA 1UKGA 5B1BC 4XJAA 3MHHC 1U5XA 4MXVA 5FLHA 2LW7A 3RZKA 1W2NA 1ACCA 3CMGA 5D8AA 5I0TA 4Y20B 3BN6A 2DYSC 1R1A2 2K1EA 2JDNA 2B8MA 2FB5A 2WDBA 5FYCA 2QE3A 1SQGA 1XPWA 4LFBO 2BZDA 5FZOB 4DV2B 4YIPA 3CCQV 2W52A 4CU8A 5HI0A 5BNOC 3FFQA 3CMEV 1OOPC 2SLIA 4G4FA 5GM0A 5A3PA 1TME3 1OCOC 1VQPV 3EJKA 3H8XA 1FMD3 3ABTA 4GAZA 1YSCA 4O2AB 2WWUA 2WFPA 4GD4A 2BSKA 4AQTA 1RUI3 1WCUA 2Q5ZA 1US6A 2W1UA 3PU3A 3S7IA 2YEVA 2DDUA 5DAWA 2ZS6B 3VZKA 1ULOA 5IYZA 2LP7A 2FDKA 3PL0A 2VOVA 5JZGA 4ES9A 4JGZA 1CZSA 2VQEB 1C8M3 5EV7A 2IZWA 4MTGA 1W8UA 4IV1A 2D6OX 1Y7BA 5FZCA 3NAPA 1WLWA 5A9GA 5EXOA 3B8MA 5SV8A 2CGOA 2VNRA 5KXCA 3ZSKA 2NP0A 1ZBE3 2WUHA 1VF7A 3WNNA 4YZ3A 2WZR1 5L9RA 1W39A 1YLLA 4CP1A 1JYXA 2Y4UA 1IVSA 1Q8SA 3CRMA 1BL8A 1QJY1 2P2KA 1RUC2 2O57A 1OH3A 4GXLA 1GR3A 4N43C 1NZIA 1R1A3 4PA3A 3ABMC 1W2BU 2I74A 2R1DA 2DQ0A 3CBNA 1X9PA 3PIJA 2QUOA 1MS0A 5FQ0A 3AG1C 1G9FA 5ITZB 1LGNA 4X8PA 3SJAC 5E8AA 2O0OA 3OTOB 3GCXA 3QG5A 2YC4A 1GLHA 5H9CA 1BS3A 2ADQB 5KAIZ 5JI9A 3T1YB 2HWF2 2ZOEB 4UFHA 4O2BB 1D5NA 5FKBA 4J42A 4LUMA 1EN5A 3HR9A 2BU9A 4Y22B 3E35A 2A5ZA 2Q0OC 1R081 4RA0A 4BW9A 3ORJA 1I5XA 5LGUA 2BYVE 2CTWA 3IIAA 4JCKA 4OGQB 3SC7X 2VE1A 4EN7B 4EEQA 3ZMVA 3LEIA 1ASJ1 2PZSA 1M56C 2EA7A 1UX6A 3RG0A 2ZDIA 1U5IA 2GC0A 3DGEA 3UT0A 4QX0A 3RYFB 1JOPA 1IXBA 4YZ2A 1GZTA 4DV5O 1AB3A 3E6BA 3U75A 3CCSV 4HZ3A 5FYUA 1VMHA 1S5HC 2G1MA 2HG5C 1J3RA 2W6IG 3O1OA 3MI8A 3P32A 1CJPA 4LR4A 4FFIA 1RUC3 2FYUH 3J7LA 2M7WA 5GONB 5JOXA 4EZ4A 1FPOA 3ZYJB 3ZFEA 4DR2B 4QB2A 4XOGA 4GB32 2DWEC 2Y8KA 3C3SA 2ETNA 2D6LX 2EXHA 2QTOA 1K9MW 4DXWA 4P9PA 4JI0B 5LY1A 1KC8W 1W9WA 2R042 1KJLA 3OUSA 2HBTA 1YIJV 4J11A 1KECA 4PIYA 2X5IC 4LK6A 4HFSA 2PHTA 1CN1A 5J3UA 4HG6B 2HWF3 2WO3A 5IJRA 1HNXO 2K2SA 5JXHA 5BNPB 2WT0A 3ZN6A 2GNDA 2H0BA 4XE9A 3CL1A 1ZRIA 5IVEA 4NXMB 1TG7A 4BXSV 1SFYA 4O4HB 4UCVA 2HKXA 2DTWA 1SETA 2A3XA 2WO7A 4DO0A 1QEXA 2BBVA 4DUYO 4K40A 1N8RW 2F66C 2IJHA 4CCNA 4I55B 3CZJA 4LFCO 4CDXA 2GC1A 5FREA 1H8TB 3K0DA 3M1HA 2XBO2 4DO2A 2V5DA 2ADDA 2OUJA 4AR2A 4JI6B 4BK4A 1DQ2A 1SZBA 3USUB 4AEJA 3K06A 1FAFA 1ZA7A 3GF6A 4ATFA 1HB1A 3WDUA 1MABG 2UXBO 1RFYA 3H3ZA 3RS6A 4DV7B 1R1ZA 1XNBA 3S7EA 4GB33 5JCOA 4I50A 1KDMA 1KFUL 1Q6IA 4J1XA 1W59A 5CADA 4LHNA 3WNKA 1T6BX 1SCRA 3DKQA 5JCTA 1IG3A 2D7FA 4YFZA 4UFJA 5JXJA 2I2SA 1IPJA 2R043 3ZSEA 1RSOB 3QF7A 2GP3A 4QXHA 1Q5OA 1YI2V 3OMAB 5GZEA 5FPLA 4PDLA 1ZBA2 1AP6A 5JOWA 4IYIA 4DV6O 4AQSA 2VUAA 3OAAG 3H1JH 5A7WA 1HNWO 4UB8Z 4LORA 4Z1VA 1WMDA 5FZMA 1UYXA 4MH0E 4RR3B 5ANQA 2XWJB 1JMKC 3ZFGA 5BXXA 4YIOA 1DZQA 3KV9A 4J10A 1KXGA 2OW4A 2PELA 3BTYA 2D97A 3PUQA 2VMFA 2L35A 4PDRA 5C93A 3B77A 2XBO3 1MQTB 5IAXA 4N53B 1ZNPA 4PCRA 3DSQA 4OUMA 5BY5A 4LF4O 2Q8CA 2ZEYA 4IGGA 1JFFB 5F5QA 3JCUZ 1MNGA 5L9VA 2PHLA 1JQ0A 4RWUA 3WG1A 1KB9F 2DVFA 1I6XA 3TXSA 3LA2A 4CC6A 1XL4A 3WG2A 4YG0A 5ANNA 1D2DA 4OX9O 3WP6A 3I49A 1UY4A 3WY6A 3TRSB 2G38A 3E6DA 2YZ4A 4W4ZA 5IFTA 3C7EA 2LQTA 3STZC 4Y1UA 1UMHA 2UWAA 3CIHA 4JI7O 3ZHRA 4NRQA 3SJCC 1ZBA3 2DCJA 4UCSA 5FPZA 4XAEA 3W58A 4Q4V2 3JD72 2R49A 1H1IA 1WLTA 4BWOA 5C6CA 1RUOA 2YMZA 1SZTA 1AZDA 2Q1MA 4A4AA 4EWDA 3L75H 5T5OA 1SMVA 4CCDA 1JR9A 2WS91 4I0AA 3BAAA 2BQPA 5KC6A 1Y76B 3ZR6A 4BQ4A 2JICA 3WQBA 1JI6A 1LOCA 1NLRA 5A1FA 1NT2B 1SLBA 5DAXA 5FYVA 5C8CB 4LLOA 1W8TA 1A34A 1BQ0A 4DR4B 4A5UB 3BB6A 3CHXA 4IUGA 1R6KA 4NWVA 4P9IA 4CS4A 3KCXA 2F4LA 3HOBA 4HKWA 4Y26A 5FZEA 1S5JA 2Z5WA 1NA1A 4D0QA 3LFMA 2JS3A 4AEKA 1PZ9A 3UT5A 4EFEA 2W5FA 4FM1A 3G6EV 1FYJA 4RFRB 5H6QA 4OFGA 1XNQB 1BVP1 2GAUA 2UYAA 5KHHA 4G27B 4J80A 3ENRA 3H42B 3WOGA 4CDWB 3CCRV 4AK3A 2VNGA 1IXMA 1L7LA 3ABKB 5ACA1 3CRCA 3BRCA 2CAUA 2D44A 1ZZCA 1BE3H 1KMIZ 4MYEA 2WPDG 1MS1A 4A7KA 5KC5A 1NAEA 5FZDA 4Q4V3 3JD73 1HV0A 4PDMA 2ZE5A 3AKPA 1YTFD 3UK9A 1H2KA 3I2JA 4I01A 3SKVA 3IAQA 3KB5A 1NKGA 5KLVH 4U7NA 3ZN4A 4YHHB 2WNOA 5KHIA 4YPJA 2CAZC 4LKFA 5B1AB 4R9CA 2JB4A 3ZRXA 4MUVA 4ASKA 3JARB 4R4ZA 4N7IA 5DDJ2 1F4NA 3D36C 3MYXA 2PHXA 5GALA 5IJ0B 1EN4A 2XVKA 3S30A 3J8F2 2FBEA 3T2PA 2YUEA 3I2OA 4QNHB 4JYBA 4AXOA 3J7HA 1IBKO 1SPPB 3B09A 3VD5A 5L3FA 2K9ZA 2K46A 4AZZA 1QH6A 1URFA 1WKYA 3NNGA 4N9IA 4AG4A 2BW8A 1JA8A 2CY6A 4ZPIA 3T3YA 4Z8BA 1E57A 3NV4A 1XC6A 5F39A 2PAMA 3A0HZ 4U2AA 3OGIB 5A6YA 4TWTA 3A4UA 1SLCA 2WO2A 3BPZA 1H8TA 3L73H 1V54C 4K8RB 5FO7B 4LK7A 3F7YC 1KRIA 1QLEB 3A0RA 4FFBB 3AG7A 4COYA 3R4UA 1MPXA 3OYWB 2NMNA 3AVSA 3AP7A 4GKKB 3EBRA 5FOJB 4EE2A 1M4WA 5M0TA 4LFAB 1F23A 3WUDA 2QQMA 3PJYA 3I56V 3VL9A 1L7RA 2CTPA 1YWKA 1HLCA 3M2MA 1OCRB 1XMQB 3CRAA 1A3KA 1HRI2 3ACIA 4NIAA 3EFFK 5DDJ3 2XQXA 4XPVA 4AGGA 2GTAA 4PJ0Z 4AFCA 2MW2B 4K9SA 3J8F3 4O61A 3TBDA 5KUKA 2CK3G 1J3PA 3EMRA 1SRYA 3IM0A 3UV9A 1LNQA 1CIYA 2A79B 4Q8KA 3R6SA 4RYDA 4NMIA 3PTRB 5CA6A 3TN91 3K4ZA 5CFDB 1PIV2 1RHI3 4YARA 1ND3A 2HVKC 1ND2B 3L74H 1PD3A 4RR3A 3WW3A 5BNQA 4R52A 3U10A 2EIGA 4K3AA 1RUG1 3VB9A 3I2IA 3OY8B 2ZCWA 1ZZ7A 5AFBA 3T30A 5LWBA 3S5AA 2PLV1 3O65A 4NTYA 2Q7GA 2ARBA 4PDWB 1B3QA 3PUIA 2Q8OA 3I3QA 5LK5A 2R061 1EZVH 4INDA 4XDOA 3QBQA 3TEYA 1VF6C 3SYPA 2R7EB 4AEDC 2DE0X 2GTSA 3TNPB 1HB2A 1W28A 2WLIA 5DN6G 4XC9A 1G8WA 1TZOA 1W6PB 1OA4A 3BGAA 2ZGTA 5FZLA 4LT5A 2QQNA 2AGAA 5B3SB 2HJFC 1BHGA 4E4ZA 1G9DA 3OPZA 3N4MA 2D98A 4QQHA 4N7UA 2W46A 2YG0A 1DF5A 5FXXA 4JGYA 4NIIA 3KSCA 3AX4A 5KR7A 1QJU1 3FYIB 2EIMB 1S55A 2BWAA 4N9HA 4IESA 1BZWA 1P4RA 4DK0A 3LAGA 2MHFA 5FMDA 3FHQA 1JMUB 1F9KA 1GNHA 2VOKA 1GQHA 4A7YA 1HP8A 2JKXA 1PIV3 4JAUA 5A3TA 4YJ3A 4LE3A 3MFCA 1DZTA 3HPLC 3VBHA 2JDZA 2P90A 4UCRA 4BQXA 3A21A 4ZU7A 4LEJA 3BTZA 3VLBB 3G67A 2Z69A 4B8EA 4G2KA 5J7MA 3BIEA 2V4DA 2Y34A 2VRZA 5FZIA 2EIJB 1GWLA 4CH4A 3PVNA 1PX3A 5FMOL 2P6CA 2RS31 1MS8A 1FFXB 3DXRA 2JJ1G 2TNFA 3ASNC 3G4SV 2E5LO 3K04A 2JD4A 3KCYA 1X50A 2OQ6A 1K5SA 3ZMNA 2AUYA 4IIJB 2P06A 1X7NA 4IGQA 2XGXA 3MIBA 4ICGA 1WPBA 2WO1A 4WFEA 5LB6A 5FO9B 4RS5C 1H9WA 2JGDA 4Z1MG 2R70A 4CDWA 2WYSA 4V1PA 2UXDO 3OF1A 3E8FA 3ES1A 2WNUA 5IDJA 3RYIA 1OF3A 5IK4A 3K75B 1K5MB 1H4HA 1EPWA 1YQ8A 1YEWA 4X6RB 1TNRA 4QQLA 2I07B 2W39A 4AVTA 3E8GA 3B5LB 4AHZA 1UZZA 3S57A 1S1AA 3UKTA 5HBAA 2E76B 5CA1B 1R3LC 4WBBA 3ZFFC 5FPRA 1OQDA 5K9YA 2ITCC 2JG9B 2PHWA 2VZOA 3FE5A 3WB1A 1REDA 3Q4HB 4H33A 4DV4O 3SXWA 1RITA 1QDCA 3TCUA 4K1ZA 3AP6A 3JARA 2NPIA 4QDSA 3G6JB 5FPXA 1J1LA 2OYZA 4GX1A 5IJ0A 1MZFA 4FCAA 4BISA 4P9OA 1VBB2 1D4M2 1QY4A 3ZS8C 3WEZA 2R9RB 5A2QN 1SPPA 3RN4A 2DUPA 4YVWC 2VH9A 3GZEA 1UX7A 3FUOA 3CEWA 3KS7A 1K8AW 1OCCB 1AL21 2RS11 3ZYIB 1T6GC 2H94A 5FXZA 3GB7C 2GN7A 2XVLA 5IE9A 4F4LA 2AEYA 4X1IB 3O12A 5FYSA 4AFAA 1ONAA 3AKSA 1QMJA 1Q8IA 3J9SA 4FLXA 2UUCB 1RYYA 2Q6AA 3NVCA 1VBE3 4RSUA 1DLCA 4EWEA 1ZX5A 4XFAA 5IY5B 1Q8VA 2FMDA 4XUTA 3X29B 3CJXA 1H6YA 4UFKA 2BGOA 5B4XA 5FNVA 3V65A 3HN3A 3AMQA 3RYCB 3AXDA 3LUTB 2AR6A 2CDOA 5AVPA 3VBRB 2EVXA 4CH3A 2PYLA 3S5QA 5BNNC 4SLIA 1HQWA 3E83A 1IBMO 3FL7A 5FP4A 1WGPA 4CA9A 1FFTB 3LA7A 1FJGO 1O3SA 4K1YA 5AC92 4FP2A 4FSJA 1VBB3 2DU0A 4BZ4A 2EIKB 1LOBA 1RUD3 3KMHA 1D4M3 3JAKB 1H2LA 5L3GA 5DZFA 3B02A 2ADPA 1ENSA 3LGRA 1OHFA 1X82A 4Q4X2 3ABLB 1FMD1 5CFDA 3WG3A 1W8HA 2VBDA 3VBFB 1UF2C 4NPRA 3PDQA 2GDFA 1ND2A 1WCKA 4UW4A 1CZTA 2EAKA 3Q8AA 5KXDA 2XQRA 4XW3A 3OY8A 3WG7B 1Z7S3 3MHZA 1MEC2 4FPKA 2PXJA 5LMUB 4D6RA 4TV8B 2P5BA 2BNNA 4TT3G 5FBZA 1I5ZA 3KG2A 1C8M1 1GU3A 5CNAA 1T2XA 2BOCC 3MHSC 3OMIB 1VQ9V 1ZA4A 3EQEA 4FIPC 2A6VA 5JR2A 2KG7B 4XBQA 4COUA 2CAVA 3ZHTA 4RGKA 4QGNA 4QKFA 4X62O 1Q81W 1EBOA 2RJKA 3BIWE 1YIFA 4AFDA 3UGHA 5LOVA 4H7LA 3WQ0A 3LDBA 4JTNA 3ME2A 3POIA 3BUCA 3ACLA 5BUVA 3FLPA 3NV1A 3EVKA 3KCCA 4XJWA 4CP2A 3EHBB 2HLDG 2B7YA 4P00B 4CRQA 5K0UA 4BWAA 4YNIA 4NR1A 4WVWA 1LESA 2QKAA 2O1QA 1ZREA 5HCFA 3O1UA 1W8FA 5F37A 5AC93 2IC1A 3K3OA 2XJPA 1BYHA 5JDBA 1AROP 4WZCA 4M4RA 2ZTNA 2XLFA 4Q4X3 3ZKUA 3O0VA 1WBFA 2GZWA 4QKNA 2DUQA 4YM3A 1AJPA 4BXFA 1MS9A 2WABA 4I2OA 3AMNA 1RUH2 3CLPA 1Q90D 4BHPA 1CIWA 1PK6C 2WAOA 5FY4A 1ODNA 5DG2A 4CDQB 1MEC3 3RW0A 1BSMA 2PQQA 1UYYA 3PURA 4BDVB 1XNRB 1QLNA 3HQXA 1APNA 4DEQA 1MZ6A 2KB1A 1SHWB 3NJXA 3ZEDA 4HKLA 3STLC 1GOGA 3JATB 1EZJA 3U1XA 1GWKA 1QGLA 5JOZA 1W2TA 4LIVA 1GMMA 3P6BA 1BLZA 4J1WA 4JF3A 4CEWA 2ZGUA 2WZEA 4KG0A 4LF8O 4MS2A 5CBFA 3U4XA 1QOOA 2HWD1 2WLJA 3B9CA 4XYXA 2HWB1 1YTFB 4XJ9A 4JV5B 4O4JA 4JHZA 2Z5UA 3VD7A 3M8LA 1SLIA 1QQCA 3UCSC 1XHXA 2BDRA 3WZ1A 1GN3A 1K5MA 5CA0A 3QO7A 2L9LA 2XJVA 4F7ZA 4HPKB 2HH9A 3TXQA 3T1HB 5EIBC 5EPAA 1H8HG 1UWWA 2E51A 4PD4F 3WQ7A 2EALA 4MTOA 2JG9A 5A7SA 1V6LA 4Y1XA 1RUH3 2Y0OA 5FUNA 3VDDC 1N34O 1NQJA 1RUF1 1XE0A 5LBQA 1LB2A 4HVQA 4H7MA 4QU2A 1ULFA 2EILC 1RXFA 2CGPA 3ETPA 1V55C 1GOHA 4EQVA 1SQPH 2DF7A 4GA9A 4DZGA 3NNMA 1OLQA 4ZHQA 1B35B 4NXNO 4DXTA 4MVSA 2LJ2A 3MF9A 3AG2C 3POEA 3O1MA 2OZJA 2HWC2 1Q8OA 4MT8A 4DXRA 2GBOA 2L6LA 4F3JA 1KU9A 3AYAA 3H0OA 1JOJA 1WW4A 2LGWA 1B04A 1HNZB 3TK1A 2FD8A 4X1IA 2Q1FA 1LOEA 5LL6Y 2B46X 2X7RB 1AR92 3WP3A 5LA6A 4X66O 2BGPA 2IXCA 4XIKA 2Q8VA 2V7QG 4P5HA 4JGZC 1WW6A 4HKOA 1UL9A 1RPRA 1ZSPA 4L99A 1NXMA 4UAPA 4DUZB 3NAPC 4FPGA 3BI3A 3H1WA 5CYYA 5GZFA 3HKCB 4FVMA 5FPVA 4LLFA 3LSDA 5JQGB 3PUSA 4RHV2 4XFCA 1VMGA 3F95A 5D21A 3SISA 4N8MA 4DR3B 4HVOA 1Y4MA 2J1SA 4PBPA 1BKZA 3VBSB 4GULA 5I8SA 2XKPA 3CP1A 5JSRA 3I3BA 1QJZA 2WT1A 1Q8QA 3AG3B 4AWDA 4I9WA 3WU2Z 4NPMA 4E4HA 5LGNA 2W91A 3N9NA 1AR62 3ROUA 4AW7A 4CDUA 4TXWA 4FLTA 2CU5A 2HWC3 4A44A 4LF7O 1L8DA 2VTXA 5L7OC 2XAGA 1J84A 1OZ0A 4GWNA 4K21A 3VBOC 4JYAB 2X0LA 4TLGA 1Z78A 2P7TC 4IERA 3ZRWB 1I94O 5JXIA 1DGLA 4YYOA 4TV8A 1AR93 1HDKA 4JI8B 4XILA 1OVPA 4LBEC 1S0BA 2E3CA 3LIHA 1PP9H 2EIDA 1WLCA 1AXZA 1OKQA 3FX7A 2P3YA 2MEV2 5B2GB 1CD3G 3LDCA 1LU1A 3H8UA 5ABJA 4ZONA 1PM9A 5IAVA 1LKNA 3JQWA 5CU1A 4DR5O 4OCTA 2RMKB 3AZZA 4Z2WA 1OMIA 4KL1A 3VZJA 4KGGA 1ENRA 1TGOA 4IHJB 4SBVA 4RHV3 4X64O 1PVC2 1K42A 5FZ0A 2R9AA 3GGLA 4Y33A 5KX5A 3RFRA 5JSPA 5BMVB 1KQRA 2D3PA 3AKTA 2JG8B 4XXAA 4CXXA 2WN2A 2DYRC 3NJZA 2XHNA 1VAMA 2Q5TA 1MS5A 3K2OA 2PQSA 4Q4Y2 1V6KA 4D6SA 4AYUA 1W0KG 1U5YA 2HR3A 1WP7A 1GKFA 1AR63 3ZOIA 2N74A 1RTVA 3GBGA 2JDYA 3NV2A 1GZWA 4X65B 5DXDA 1TVKB 3JBG3 4BA6A 3CC2V 1DK1A 1UZ0A 3RWNA 3ATGA 1WZXA 3LSEA 2EZOA 1DGSA 2ATFA 3LOIA 3SCHA 4GALA 2G9FA 4HL0A 1VMFA 3WNLA 1I7FA 3U07A 5GW7A 2QQWA 3MDPA 3JYCA 1RUNA 5LK7B 3OGRA 1VRH1 4O4IA 2MEV3 2YGLA 5F32A 2CTRA 1N1VA 4CEYC 1QJX2 2EXKA 2DCYA 1T5EA 2ZEXA 4WBNB 2ID4A 1LCLA 2MNGA 1NCRB 4N90A 3AL5A 4FFHA 3K9AA 2D6PA 3ZBHA 4MVUA 3AXEA 1PVC3 3E22A 4XJZA 1GN4A 3T0AA 1W9YA 2HWE2 4OLLA 3MV01 1UU6A 2AHYA 5H9SA 5GLVA 3ZPYA 2ARXA 4IEPA 4ISQA 3VD3A 3FC0A 1SZXA 3ZSMA 3L9DA 4MTXA 4Q4Y3 1DGWX 1AR82 4B1LA 2D40A 3LDDA 1LNSA 2HEVF 5KMGA 1CAUB 2VQFB 1H1AA 2ZNIA 3M3CA 1Z2GA 5K1PA 2D3SA 3NQHA 2OCCB 1MACA 4RGAA 1W0OA 5G04L 5FOBB 2Y6JA 3ZXJA 1W99A 4QXBA 1UOBA 2YBSA 2QDOA 1N3PA 3GALA 1XNAA 1C1FA 5A6ZA 2VWJA 4B3MO 2C2AA 4HBNA 4FPYA 4QHBA 1W6MB 1N47A 4E9KA 4DR6B 2R72A 5C9AA 4IDZA 2MK3A 2A3QA 2Q69A 3D8CA 2ZX1A 3GM8A 4UVAA 4B1MA 4TV9B 1QJX3 4EN8B 1GN2A 4MTFA 4P30A 1WLDA 4KNCA 2RJLA 3MZHA 3MD0A 4PHZA 4FP3A 2XMLA 3OE7G 4GZ9A 2D6KA 3CCMV 5EBMC 4PBOA 1W9TA 1LOFA 3H9AA 2WZ8A 3LEMA 3C7HA 1GP4A 5EHDA 5EZYB 1CESA 2HWE3 1QNYA 2Q4SA 4I0XA 5HXMA 4A42A 4Q8LA 2XTAA 4LOTA 1QR9A 1SFNA 1N32O 4MVOA 4RO2A 2H6BA 2JVDA 2ZA9A 2OYQA 3WDWA 4XCAA 1AR83 1N36O 1PO22 1JZ8A 2HYXA 4IGOA 2JDPA 1XJAA 4O9GA 2XUMA 3HKCA 1J58A 4L8JA 4XF4A 3DC5A 1ALYA 2E9QA 2UURA 1OFNA 4MOAA 3RNSA 3AKRA 1BQZA 3DPRA 4KMQA 4E4DX 1RHI1 2HHHB 1WA8A 2RHPA 1Q86W 2J1VA 2UXCB 3FLTA 3MIDA 4MGKE 1W8ZA 3OG2A 5EZWA 3H8OA 1ZRDA 2Y6FA 2GN3A 3SCGA 4MLOA 4JDOA 4XF0A 2WFF1 3WVJA 2JIJA 1SC5B 1LHWA 3E8HA 2YUAA 2A73B 2DBNA 2E7AA 3PU8A 3INAA 5LBEA 4GYCB 1NE6A 3EYPA 2QKCA 4I02A 4NRMA 5FUIA 5IWAB 1KD1W 4CBCA 4H55A 3T1LA 1FXKA 4TUYB 2OPKA 1MR5A 1NTKH 4YZ4A 2HP8A 3SEEA 1SQQH 1QR8A 4JKKA 3KHBA 3I59B 3ZIAG 3NKGA 4I4TB 2JEUA 2W2IA 1BMV1 2P4VA 1KDKA 4YVSA 3LEGA 1RUE2 1XILA 4N23A 4W8JA 4CUCA 4ITCA 4PI2A 1BT8A 3KWVA 1NLQA 3F5WC 3E97A 2JS5A 1ZRCA 2ENRA 4FOYA 2QA4V 5DUUA 3X2QB 3QLQA 4KWJA 2VQEO 1PO23 3KV4A 4W6YA 1CAXB 3ZN0A 1YVWA 4BLIA 4K8XA 2A7AA 4IV3B 4CP9B 2JDHA 2QQIA 4IHJA 1ENVA 4QX8A 3O9OA 4D7TA 3ABUA 1N1SA 3O1VA 3OUHA 4J7ZA 2CH7A 2P3IA 4GH4A 2RCVA 1ZL8B 2JG8A 2QQOA 1BVVA 4UW3A 4BIFA 5FLJA 3SJBC 3ACHA 1UN1A 4O65A 3POBA 2JE9A 5CAZA 2RDCA 2BE3A 4XZUG 4UXNA 4JI1B 1K12A 3AKQA 4QPGC 3I2DA 3GZAA 2OTJV 1W03A 1K34A 3FYEB 1TVKA 4WFAV 3CDZB 1JTZX 2QQKA 5DAPA 1QXPA 5BNPC 1JCHA 2QBXA 3T1YO 1ULDA 1RUE3 1E5IA 3ZXDA 2GSMB 4DEVA 1PKXA 1TAEA 2BTOA 2IW5A 4UB6Z 3CWBH 2J1RA 4FFGA 3ZXKA 2DCZA 4XQ4A 3G71V 3HKBA 2EJ7A 4FM2A 5DZGA 3OGGA 2YC0A 3RYHB 3JAWB 2I45A 2ZGNA 3GZTB 1QQP2 2OCHA 5LATA 1VBD2 4HVRA 1XQ8A 3N9LA 3SPIA 1UU5A 3LQCA 1H2NA 2X29A 4LR3A 1DIWA 3ASOB 3DTUB 5K8SA 4LO6B 1AI6A 3JCZA 2RQ6A 3OGJA 1BMFG 1YJKA 2CWSA 5CFCB 1HRV1 2NN8A 5IVVA 5KXBA 4XACA 3CD6V 3MFAA 2XASA 1AXYA 1H30A 3T1CA 1UXXX 2ZM6B 3MUZ1 4JI0O 1CAUA 4XJ8A 5CG9A 1CGPA 3KHCA 5C3RA 4LBQA 2VUDA 4UI9L 1ZRRA 3KF5A 1YNAA 3IDAA 4MG2A 4COVA 2WSSG 1FOD2 3RZMA 2HVJC 3VZLA 1UCXA 3SDLA 2QQJA 1W6QA 1UNBA 1GM8A 1OFSA 3ZDSA 1W6MA 4CYDA 5FPUA 4NXMO 4YZ1A 1WJZA 3V0BA 1O3TA 1W0NA 4DUYB 3VQWA 4XDKA 2JXAA 5AG2A 1RINA 2P1BA 1O6UA 2EZPA 4LFCB 1VBE1 3A0NA 2LFSA 3OGCC 4X9QA 4WFGA 1MQTC 1QQP3 2WYFA 2XL9A 2HBUA 4N53C 4MSVA 2AH2A 5FJKA 4F6RB 1X9TA 5FXWA 1TUBB 4OYUA 3AFGA 2UXBB 3I3MA 4META 4LH6A 5H5NA 4XIOA 1G86A 4H13B 2WC2A 4I09A 4UUJC 1G4YB 5FK7A 5JOYA 3SCFA 2ZE7A 2DVDA 2ZMKA 4Z07A 3NWKA 3RYRA 1RUD1 4CE8A 2Q0AA 2QZ2A 2EULA 1HXS2 3CU7A 4A6SA 1ZRFA 3M3IA 2A0LA 1ENQA 5EWSA 2DBIA 3H1MA 2UY8A 1RUJ2 1XYPA 1REFA 4AFBA 2Q67A 4JC1A 1FOD3 3BA8A 1AYM1 2Q30A 3BCCH 3F5TA 1Z7S1 5JVDA 1M4UA 5FL7G 5I93A 1E1QG 1OV9A 4AVAA 4X88A 1YQCA 3RZZA 5L73A 1STMA 5B1NA 4UCTA 3ZYGA 5C8CC 2GMEA 1HB3A 3WUCA 2ITDC 4UF0A 4MGYE 1SG3A 4PJYA 1EV12 1Q6HA 1QNWA 3I59A 1L0NH 5JI7A 3OT7A 4LF4B 1AUYA 2Q73A 1ZM1A 1YXWA 3E5QA 1O5UA 1Q82W 5C5UA 4EFBA 2VZ3A 2DCTA 4LBKA 5FY7A 4C91A 1YI9A 3D3QA 4XFHA 2QM4A 4V2WA 3RYKA 4FLWA 5FZ8A 4PLOA 4WM7A 1EUTA 4RQPA 3NW4A 2O8QA 4CDWC 1QHTA 3ZXFA 2RMU1 2YDEA 3ABKC 4B3TB 3W5MA 5LP6A 1ZZBA 3OGSA 1HXS3 1N3OA 3ZMOA 1PNKA 4IV3A 2WKKA 1J5EB 5H9RA 4EJRA 1C57A 1RUJ3 4QIWF 3SH3A 2NYYA 2G9GA 2YPJA 4NWWA 4FO9A 2YEVB 4I3GA 2OIEA 1D4VB 4LHKA 4X20A 4ET7A 1HW7A 4KG8A 1KKDA 4OZXA 3UKNA 5J2TA 2N04A 5FZ6A 2YXHA 2UUBB 5B1AC 2ZJCA 3OSDA 3V56A 4EWAA 1WB7A 3ZRVA 1PGL2 1Q56A 3D0JA 3FAVB 1S3JA 2J1AA 2GSYA 5BNOA 1MZEA 4QB1A 1S77D 3KM5A 1OOPA 2GP5A 4RQEA 1OA3A 4DR4O 1O4ZA 2WLMA 5CKQA 3LDKA 2RM22 3THTA 5C70A 2R30A 1AR71 3ZDVA 3HBKA 2D43A 2XAHA 1HN1A 1KS5A 1VRBA 1YO8A 3POWA 4ZHNA 4BMEA 3MLKA 1PMJX 4XBFA 3HBZA 2B9ZA 3OBZA 4YLZA 4XURA 2YPDA 4YW6A 3OPTA 4RAIA 1ZWIC 1BJQA 4Q1RA 2B39A 2Y6KA 2EF6A 3BU7A 5FYHA 1GICA 5EFUA 1XE8A 1YQ6A 3PMSA 4GWIA 1EN6A 1NG0A 4P9GA 1QLEC 4CXYA 5EYPA 3PIGA 2WINB 1VBA2 2VG9A 5F2WA 3WV6A 2E74B 4WCEV 4FOVA 2E7QA 2VC9A 3TEWA 2E33A 2R32A 3O1TA 2QZ3A 4N43A 3WDXA 1OCRC 1E79G 3MIHA 5JIUA 1A6CA 1RGSA 2F4PA 1LJ7A 4D94A 1A32A 4DV0B 1BBT2 1HB4A 3J26N 3UJOA 1FV3A 3OD0A 3FJSA 3BODA 2RM23 2XL7A 5CFDC 4P2ZA 2UYBA 4QX1A 4UBGA 3OR6C 5IK7A 2QKSA 4XQWA 1W8OA 4QHZA 1F7YA 3L72H 4JRLA 3O1RA 2X10A 3SMHA 3ZFEB 1WW5A 3T2MA 1SDDB 1UOJA 4QKBA 2F95B 3JALA 5FBJA 1LECA 2GNMA 2ZX2A 2DVBA 4PDWC 1JZ2A 2Q9LA 4H0LB 1ZUQA 2QM7A 2XJQA 1V0AA 3OR7C 2J42A 1F2NA 5J1XA 3O5SA 3FB8C 1C8NA 4AGRA 2P6JA 4AGVA 1TUBA 4LKSA 1VP6A 2VNVA 4Y5Z0 2WT2A 2RN9A 4N21A 3WP4A 2ZGSA 3G6BA 3JCIA 2GHYA 4E8DA 3RZGA 2R9IA 1VMJA 3ZN6B 4GKKO 4M3CA 1R6TA 3POFA 3NJYA 3C7GA 1NXD1 5C3OA 4R9DA 3HWJA 1ZZ9A 1GZCA 1DQ1A 1NS1A 2XAQA 5LRRA 4JRAA 1KJRA 1BBT3 4YJ2B 1XMQO 2GNBA 4CDXB 3OOXA 1XEQA 2DVAA 4LHLA 1XI1A 2X5IA 2ZABA 4ONUA 4G3YC 4AE2A 2ZX4A 4ZI7B 1LR5A 1K3IA 4RQFA 1KP2A 3SR2C 4KI5M 3KLSA 2WZR2 2E75B 3O1SA 1B09A 1QJY2 2ZCEA 4XEZA 1YI7A 3FBMA 2KSDA 1RMU1 3NNLA 3LEKA 2Q8EA 1BEV1 3LZZA 4QDQA 3IDBB 2ZHLA 4YGBA 4UOJA 4C1WA 4YXWG 3VHRA 2WLKA 4LF9B 2EIJC 3PN1A 1ZZ8A 5B66Z 1YHFA 5KWRA 3CCVV 4CZSA 2EAAA 4BLJA 4JZRA 4WF9V 1YUDA 5KAFZ 3PJSK 3S6PA 4R9BA 5A7WB 1R093 1OLRA 4KGQA 5FMCA 4KH9A 5DECA 1F8VA 4EZHA 2WBKA 3TEZA 1R082 3ZFGB 3KT4A 5FZAA 3Q8EA 1H38A 1PZ7A 3IAYA 2JECA 1HR0O 3CX5F 1WCDJ 4LBOA 1V6IA 2DUOA 3A22A 4HONA 1ASJ2 1DYKA 2X8KA 5IWFA 1CX1A 3HR0A 5IW0A 4Y1ZA 1QWRA 3JBG1 3BVOA 2HKOA 3LFIA 3FB6C 5FO8B 2WLHA 1IURA 5H9QA 1CX4A 1GN6A 3WFVA 2OX0A 2WZR3 4BQ1A 5IFPA 3J80N 3K5MA 2PYTA 1VBC1 4QGMA 1Z0HA 3N9OA 1QJY3 1WD4A 5FPBA 3VDAA 2EIEA 1LEMA 4CVUA 2WQ4A 2BNOA 3W7TA 3IGAC 1K33A 2H6CA 3U14A 2JE7A 3FAVA 2JX9A 2CTVA 2ORZA 4DV3B 5K1XA 2VW2A 3PLQA 3SQOA 4UFMA 3IC9A 3LF7A 1OJHA 1YC61 4BIUA 4QPIC 2YFUA 4X8NA 5C3QA 1Y3TA 3WNOA 1OCCC 4KWUA 1YJLA 1PV0A 5FLXN 5LA0A 1OPOA 5IVBA 4QX2A 2Y0IA 4FLZA 2BP6A 4M4PA 1R083 3B40A 3JXSA 2HJDA 2QE7G 3GJBA 4X1KA 1NH2D 4MVTA 2P4KA 5EK0A 1UOFA 3WG4A 1NR1A 2Q4PA 4DR1B 4W4LA 4J9YB 1ASJ3 2XG3A 2F23A 5FP9A 5IY5C 1FAYA 2YV8A 4OI2A 5F6KA 3CO2A 1P49A 4C0HA 2M6YA 1NA1B 2UU8A 1K4CC 3UT5B 2ZIMA 4NN0A 2P3KA 2CGNA 3DCQA 2V4AA 1C5HA 4FBFA 1OT5A 4L87A 3IDEA 3VBRC 3WW4A 4EB6B 3LPGA 2VZVA 1NY71 3TEXA 2VQ0A 3JZVA 2F4VB 1Q43A 2D93A 1F4AA 4JTOA 4P9YA 2EIKC 4ARYA 2DTYA 2B42B 4MW8A 3IJ4A 1QDOA 1FKAO 3RI8A 3ABLC 3HAGA 2JDKA 1SFPA 1S0JA 5BPXA 4B08A 4Y1VA 2JJ6A 4YW2A 1RXGA 3VBFC 4Q0VA 2P4EA 4DS0A 1L0LH 1C3HA 3VN4A 2DWDC 3ILRA 3BTXA 3WG7C 3USSA 3WD5A 1IQAA 1OC1A 2ZEZA 1UY1A 5A3NA 3IN9A 3AYDA 1MOFA 1LGBA 1I5PA 4M00A 2A3WA 5E1AC 4NJ4A 5LXTB 2QFEA 2BERA 2PFWA 1V9U1 3IMMA 1U97A 2Y69B 4J6GA 3VGIA 5F1RA 4UV9A 1S0DA 3CJIC 2EBOA 4GWMA 4CCLA 1AXKA 2XPJA 4UVCA 3WINE 3B00A 5F3CA 1NT0A 1L3JA 4BYYA 1DYPA 3CQOA 2YI8A 4Y4YA 3VZMA 1FATA 4X1YA 4B7KA 3U11A 1UYPA 5HV0A 4YJ2A 3T4DA 1FJGB 1SBFA 2FCVA 4AFMA 3D36A 3T4ZA 2OUHA 1XOYA 4WM8C 1F15A 4ABMA 4QAWA 2XLGA 2F17A 1RVF1 2IXJA 4ZI7A 1S76D 2VMCA 3HKDB 1O9HA 3TJTA 2CTQA 2WZPP 4GX5A 1MZ5A 1FV2A 4O7XA 4CDQC 4O4LA 3ZM8A 2MPFA 1JOBA 4JKLA 3OW2U 4AI2A 3GJAA 3THCA 2O8OA 5LMUO 2WS92 1I0HA 4R7CA 4LA2A 4LUKA 2UU9O 4H44B 3EXAA 4UT5A 1VEWA 4QHOA 4MHUA 2CNAA 5T50A 1UY3A 2OXBA 4DMIA 3LE0A 4FLYA 4PIZA 4QQ2A 3ZRSA 1HJGA 1LRHA 2TBVA 4AILC 1LUWA 1OHHG 4GMP1 3RI9A 1ND3B 4ASLA 1ORQC 5CB7A 1QF3A 5CISA 5F3EA 1N0JA 1K45A 4DUWA 4QWNA 1N4CA 1Z5WA 1HKDA 2ZAAA 2YIDA 1VALA 1JHJA 2ZR2A 5A1LA 3OUFA 1AL0G 1FPN1 1YFYA 3AJZA 5BNNB 3N2GA 3KVBA 5GTHZ 1F35A 4EN6B 5BYNA 4NHKA 3ZMTA 4X89A 4RGGA 2WLIB 5ACA2 3CXCU 2W87A 2PMWB 3N35A 4LHSA 1K4DC 4LBNA 1JU4A 5FK8A 3H1YA 3E89A 1PNMA 3J4UH 4LTAA 5C4WC 2W1WA 4XXPA 3DF0A 4ZU5A 1W6NA 4TWKA 2J1TA 2UWCA 5DG1A 4CUBA 1D0GA 2VCMA 3AK0A 3T2QA 4L9BA 3B69A 3FFZA 5JAXA 2WS93 1UYZA 1RB8G 4JGYB 1XNRO 1CEZA 2VOTA 1B35C 1AYN1 1UD1A 3KQRA 1R3IC 2WA3A 3U4SA 1CXZB 3QH7A 2LROA 1VQ6V 1PO11 2F43G 1VF6A 1V6OA 2VMDA 3HQUA 4AEDA 1EY2A 1M57B 4TSVA 2YSUB 3B93A 5L3EA 3QTCA 4XDLA 4PV1B 1W2AX 4BJ0A 4JV4A 4YJ3B 2QSAA 1JJOA 1S5LZ 3VBHB 2WLNA 2DJVA 1PMIA 2RR11 2E53A 5HCHA 1ZVFA 1SQBH 1C1LA 5DN2A 1ROPA 3WNMA 3RSJA 1ENXA 3ASIA 4Y4RA 3V0AA 3N27A 1I3HA 3M3QA 3WCSA 3H50A 4M3CE 4CCMA 3PVEA 1SLTA 2D2CB 4JV5O 5I0RA 2VBPA 5IUQA 2Z42A 3ZHSA 1A8MA 3W9AA 3WB0A 3EB7A 4FOQA 4QX7A 5LBBA 5CKMA 1G9AA 1Y43B 4A2UA 4CCKA 3ZSLA 4HYOA 3T1HO 4B3RB 3OM3B 2YROA 2ZE6A 3DXRB 3FB5C 3WF1A 4PA4A 1PHMA 3B2EE 3A2FA 3MPPG 5FRAA 5TSWA 4EB6A 3IWZA 3O0XA 2NN4A 1YRZA 4NHYA 3CCJV 3VBSC 4QT6A 5LCWL 3GCWA 1BQPA 2ZINA 2R071 3FZ3A 5G05L 2V73A 2JGDB 5LY2A 2QQLA 3AG3C 1DGWA 2WNUB 2CE4A 3RT3C 3ETQA 1I5YA 2GMMA 5DEDA 3RYIB 5JH7A 3UGFA 1UPIA 2CWMA 1FXZA 5CB4A 1PGW1 2VD7A 1N3QA 1V00A 4W6WA 5JJEB 1G9CA 3ZCCA 1QHDA 5J9PC 3E2EA 1IPKA 3KF3A 3TN92 2Q7HA 5IK8A 3R4DB 2VL4A 2XAFA 1XNCA 5JR7B 2JEXA 3RWKX 1L1FA 1HNZO 4X66B 1RUG2 4D6TH 2ZACA 3NKTA 3DYMA 1BK1A 4RS5A 2PLV2 5LXTA 4A3XA 2C4XA 2V4VA 1AILA 3MLJA 1WW7A 1H0BA 2R062 1QH7A 1AJQA 4FPOB 2YBPA 4DUZO 4ZXKA 1N1TA 4LO4B 4LNVA 4Q0SA 4Z92B 5FFOC 2RJZA 2OQ7A 2OA2A 3ZFFA 4DV1B 1PM7A 1COV1 3AYEA 4L92A 1W6OA 1OBNA 1POQA 2BVVA 4BPZA 2JG8C 3WDYA 2HEWF 4CU7A 4JI2B 3VHOA 3UETA 1QU0A 1JHNA 5A33A 2YY1A 3VQVA 2AYHA 1JYVA 4AQYB 2BEOA 1W0PA 3AZWA 3K58A 4HLTA 5LGTA 2XH6A 1IS5A 4ZKTB 2JJ2G 3HKDA 1QJU2 1EM1A 1BHBA 3AG2B 1OD5A 3CJHA 4YVWA 3ZSJA 3OFNG 4BB3A 3WHTA 3K4DA 4FZ0A 3K4AA 5FNVB 1OQ1A 3OEBA 2V5YA 3TN93 4BR6A 4GKXA 4BCUA 3HKEB 4JYAO 3Q8BA 3O1PA 5GZDA 4QB6A 4LXLA 4A6OA 4NIHA 4MGIE 4LF5O 3TYJA 2VR4A 5F5AA 4TQFA 4Q1PA 1OH4A 5GLUA 4HN1A 2PLV3 5C5TA 2Y26A 3VBBA 5LW9A 4OXSA 4XBLA 2OT5A 5DM6V 1D2SA 3HNMA 1NCRC 5ISLA 3OGVA 2PI5A 4WVVA 1CP9A 4GZRB 2PI4A 1LTEA 5LYJA 3Q9OA 2CHHA 4X64B 2RS32 5DQ0A 2XJUA 4I9QA 4MZUA 2R6QA 1EAH1 4FI9A 1GBGA 3AZYA 1P84F 3AB0A 2OIGA 3AG4B 1QOTA 2IJIA 3FB7C 5D1IA 3BPSA 4NPLA 3LPFA 3SPGA 5BNNA 1SS3A 3D3AA 4GWJA 5C7GA 2ZGMA 3HT2A 1VR3A 1IKQA 2ZBJA 3VHPA 1OQEA 1NUKA 1AF9A 5J36A 1QJU3 3SYCA 4L97A 2OCCC 5LOVB 3ZIXA 1PZ8A 4X65O 2RNBA 3KT7A 4Y1YA 5B4NA 2BFUS 1W3XA 3W7UA 4S2HA 3VBOB 2W3JA 1BCXA 5K0UB 1RC6A 2A71A 1ZAUA 3J81N 2OWOA 2LFRA 3I4IA 1TMF1 1HRI3 2ARCA 2ZX3A 4D3WA 3I3EA 1PVXA 2GUZB 1K5JA 2BRTA 4MVQA 3NJVA 3JSNA 1NH2B 2P67A 4AI3A 4Y5SA 2GNTA 1M1KW 3GXUA 4ISRA 2ZXQA 4IE5A 4R8HA 1SACA 1GP6A 3U37A 1B06A 1OA2A 2BCCH 3WQ1A 3BY6A 3SYOA 2ODMA 1DU3D 5GLWA 3MV11 1AL22 2RS12 2A3YA 2P5OA 2F1MA 5JJNB 1WAZA 4P9JA 3MIGA 4I7ZB 3W7SA 4LOSA 1R3KC 2N05A 1NCQB 3WF2A 2QM8A 1O8SA 3RDIA 1GNYA 2DYRB 3JU9A 1AX2A 3FWEA 3SJQC 5FZ9A 4DXSA 1AR1B 3A23A 2WWSA 1Y74B 1VQ5V 3ZXAC 3H9VA 3BA9A 4XMAA 2CYFA 3WF0A 1LEDA 4PA7A 4FOWA 4CEWB 1XYNA 4OUSA 3L9JT 3W21A 1IZ3A 3I2FA 3UO3A 3IT8A 3SNMA 2AREA 5C33A 4XBNA 3GDBA 2QQPA 4DOUA 4B7EA 2Z4FA 3RPQA 2VOWA 3ACFA 5FY9A 1PK6A 1UZVA 4WFHA 4R4XA 1LOAA 1JBCA 5F3GA 4O4JB 1TVGA 2JEMA 1H4GA 3A0KA 1ZLZA 4BAYA 1H2GA 2IH3C 4DR6O 5CA0B 1VQ7V 4MVZA 2ZHNA 3ZHVA 5JUVA 2AZ2A 4C0BA 4Q4W1 4LF6B 1Q6UA 4MXWB 4CEYB 2VXJA 2A7WA 2R0HA 3DC6A 4FQ4A 1FMD2 5HFMA 3ZLIA 4QJFB 3K9SA 1UZYA 5TISZ 4BQYA 4HK9A 1DCSA 4NHMA 1OVSA 1AL23 2RS13 3CCEV 4MVMA 2VTFA 1S0VA 3WR0A 4XDPA 3LCPA 3BCWA 3PMEA 1N32B 3JASA 4B3SB 1MSDA 4LBQD 4IL6Z 4ZHQB 3X2QC 2F6BA 2Y60A 1C8M2 3VBUC 5EBWC 1VQKV 4OQ8A 4GKJB 1JUHA 5A7PA 3ZYRA 5LBCA 1UOGA 2IBZH 1AJOA 1P7BA 2IXIA 2WWJA 1VLNA 2QTSA 3V64A 1Q8PA 3ILFA 4U36A 5L9BA 4OQ9A 2BPA2 1KITA 1F5JA 4MSWC 2HHHO 4JTAB 2EXIA 1D5AA 5BV6A 2UXCO 3VDDA 5LA6B 5IT6A 1POV1 2KD7A 1O4YA 2BGCA 2JWPA 1PGSA 2VCBA 1F51A 2LW8A 2RS51 4OPHA 1GFF2 1SEFA 2QWNB 2VZSA 2YU1A 1US3A 3B01A 4DQAA 4HZFA 4Q27A 4PF5A 5IWAO 1CAWB 3NMBA 4IE0A 5GTIZ 3SH4A 1QNMA 1NZ6A 3THOA 3HKEA 3ZMZA 1OURA 3BFRA 1YZBA 1R091 5FMBA 5J37A 4YGEA 1NE4A 1OLMA 1ZZ6A 3K46A 3L70H 3BABA 4DPNA 3D82A 1F5FA 4OMCA 3OBTA 4W50A 5JJJB 4IEXA 5GZCA 1VARA 1WLEA 3CS5A 3LDRA 1TME1 3HVDA 2IU3A 1REEA 1NR7A 2SBAA 2PA7A 5A3WA 4OI0A 3B9IA 4CDUB 2IWGB 1RUI1 3K77A 1EP0A 4FAGA 2QGNA 3ASOC 4QGLA 3J7NA 2UXXA 1M5IA 2C24A 3APOA 4QPJA 5JIAA 2JDIG 2OKXA 5CFCC 2HLEA 4J7JA 4NTWA 1VQMV 2HWD2 3RZHA 2HWB2 2E31A 2BFUL 1XRUA 1JODA 1VAVA 3ZMSA 4DY3A 1UU4A 4JI1O 1GK9A 5ABJB 4CSWA 1ZBE1 1YXBA 4BQ3A 3QVNA 1BZKA 3N7MA 5GJ6A 3VKNA 1XNDA 3N7JA 4HMZA 5L7OA 2FDIA 4COZA 4PI0A 2BNMA 4JI5O 2WNVC 3IPVA 3VBOA 2XONA 1X36A 3PVOA 3L2YA 4UFZA 5KX5B 3SHRA 1R1A1 3ON7A 2GU9A 1GP5A 2UUAO 1YJWV 5IATA 3PVBB 4QX3A 2YICA 1RUF2 4XDQA 3D5OA 3DYOA 4XCBA 2WL1A 2GUZA 4LITA 1ODMA 1TEIA 2W1QA 4YW1A 5FZ4A 1QJEA 5A3UA 4MGTA 4YY3O 1KEXA 4FPHA 4IE7A 1GZWB 1DGRN 1PM4A 2DURA 4JGSA 1P8JA 1OPMA 1C28A 1QVFU 1LULA 2C5DA 2LM3A 3ZN1A 1XL6A 4HOOA 1VQ4V 3NNFA 4JI4B 3GHNA 4A41A 2WSUA 4LP8A 4MO3M 3QO8A 2XHBA 1DFQA 1NCQA 1OF4A 2ZHMA 1H2SB 5CG8A 1WWYA 2FCUA 2HWD3 2ERFA 1WMXA 3DKWA 2HWB3 4BU2A 3ML0A 1XYOA 4O4IB 2JDAA 4Q29A 1VIBA 1Y74A 1TQ5A 1VP7A 2FQPA 2DU1A 4QPGB 4XAAA 3MIEA 2ZM6O 4TSFG 2C1FA 3K59A 1IX9A 1BCCH 4EV0A 1XMOB 4HSLA 5EJ3A 4CCEA 4LBLA 2VY0A 1RUC1 2W0FC 5FCCA 3E22B 4J9ZB 5J98B 3L71H 2BTQA 4YRDA 3K5LA 3G7DA 3ILNA 3ZYBA 3MF6A 5CA3A 1RM1B 1RUF3 4GCZA 3AJYA 1F4HA 4UWDA 3MUY1 3MW3A 2ZGKA 2BJSA 3C3VA 5I0UA 4HAMA 3GVMA 3JSLA 3DV8A 4ATEA 1QBZA 1S0FA 4XABA 3IKWA 1S4CA 2CDYA 1MVEA 5KMGB 1V70A 4WFBV 4KP4A 4MXWA 5FWEA 4CEYA 2HWF1 4JPRA 1NZCA 1OCZB 2PHFA 4KHPO 3BOPA 4DRVA 1AI7A 2DFCA 1DQ6A 5F6LB 3CZUA 5D8AC 4LWSB 4AEMA 3DEMA 3UJQA 3HNBM 1JOYA 2QKDA 3AK3A 2VGDA 5C9AB 3BU0A 1LGCA 4NB5A 3KV5A 1RPOA 2XDVA 5A7NA 4WZFA 4DYLA 5KA6A 3TWIA 2PHUA 3SYAA 2UWBA 3C2UA 1AJKA 3ZYHA 3GZUC 3DYPA 2VJXA 1XQNA 2DQ3A 5BXZA 2GDSA 4F83A 2UXNA 3VUOA 2AZ0A 1XU1A 4GB31 4I0XB 1X59A 1O91A 4Y20A 5JZGC 3CNAA 3BKZA 4E2QA 5EYXA 1JH5A 1WMEA 5FXVA 2XJTA 2BTVC 4BIOA 4IV1C 5FZBA 2R041 3W20A 5FZOA 1JXNA 1K5QA 4CH5A 4IE6A 5HFLA 2IU0A 5T5JA 1IBLO 2K9PA 1CAWA 2ZZQA 4UFIA 3KQ4B 2QR4A 1JZ6A 1H9PA 4O2AA 1HWYA 4Q5OA 1URXA 4RN5A 3DPRB 1HDJA 5C71A 2GC2A 1WA8B 3WDVA 3GHMA 4FFKA 2XVGA 1ST8A 3K79A 3TOJA 1LAJA 2B9UA 5FY1A 4M0HA 4AVCA 1XHZA 1PNFA 4B3NA 4B4RA 3NSTA 1AJNA 2N7GA 3B4SA 5JLVA 3F2ZA 3RWRD 3WF4A 4TTGA 4U3JB 3ZXGA 2XBO1 3E5XA 2B5HA 1NTZH 2QEXV 1XXNA 2LS6A 1VRH2 4K0KO 1FXKB 4B3TO 1MS3A 4DRRA 1J5EO 3CKHA 1ZYBA 3OD4A 3D0SA 3T09A 2VMIA 3JQXA 4YVSB 3OUIA 4E2SA 4AAXA 2VBBA 1KYOF 4PQ9A 5T52A 4CS3A 3E1F1 2A70A 2DYCA 3SGIA 2EICA 2UUBO 2E6VA 2KA3A 5ITZA 3AK1A 2ZDIC 4CTEA 1QKQA 4IT5A 1UAIA 2IVJA 1ZBA1 1EPZA 4BH9A 4EYUA 5JPMB 2VUJA 4LA3A 1JU3A 1THZA 1U5ZA 2ZIOA 5E79Z 4XFFA 3MIFA 3VV1A 1B6QA 4O2BA 1D2QA 2RDSA 3ITQA 1Z5VA 1TNFA 5FZ7A 3C3TA 1WP8A 2CH7B 1JJ2U 3KZ4C 4GH4B 4Y22A 2NZ9A 3ZFEC 5SV5A 4XDJA 5FZHA 5E1RA 4FJCC 4HN0A 1JVMA 5FMOS 3AP9A 1DQ5A 5E88A 3BYWA 4CC5A 2EINB 2AACA 1VRH3 5T5LA 1CJDA 2V09A 2JB8A 4JDNA 4XHBA 3N9PA 4UCOA 1LHVA 3RYFA 4JVAA 1OXCA 4WFFA 4DW1A 1UMZA 4CPBA 2ZKLA 1XREA 4LO7A 2B45X 4XFGA 1JYTA 1VIWB 1IKPA 1NBMG 4XTMA 2B1IA 1GM7A 1I1EA 3LSSA 5K4LA 2H3OA 5IJ9B 5GONA 4Q26A 2ZEWA 3KKYA 1H1MA 2QWRB 2QJ1A 1S0EA 2OIIA 3I54A 3HKBB 1KBHA 1MS4A 4CDXC 5E89A 1Y6XA 4XF1A 4QPGA 4Y24A 1SBEA 4DV0O 1E5SA 1JW6A 1PNGA 4Q4V1 3I97A 3JD71 4JI3B 4UYBA 1Y66A 4FLUA 1J3QA 3PUHA 4MX3A 4FTSA 5H6RA 2RVAA 5LA1A 4QM8A 4P9WA 2WLQA 2BOBC 4XTPA 5BNPA 1RHI2 1E1RG 1DBNA 4OVEA 5JCOC 4C1XA 3GWKC 4O4HA 3TB0A 1UJWB 1G6UA 5LEJA 4WVZA 1V9PA 3AFKA 2WFF2 4BOWA 4CZZA 1MA1A 2B4KA 1OLME 5F2SA 4CP0A 4I55A 1DHKB 1YHQV 2C0ZA 3UNPA 1GQGA 4LBQB 5IVJA 3N9QA 2FDHA 3USUA 5DMYA 4JQRA 4GJYA 3ZPOA 1N33O 3SH5A 5CIRA 1DQ4A 2DCKA 1C4RA 4LWSA 5A3OA 3VQYA 1BMV2 4ZIBA 4Z2AA 1A8DA 2CUGA 1W6QB 2KKWA 2VZRA 3GBFA 4I3PA 4TOIA 4NRPA 3OUJA 5BR8B 5L3BA 3ZFGC 4KUMA 3V0BB 1AHSA 1AX0A 1C5IA 1O8PA 3K0GA 5HXVA 4DR7B 3AL6A 4E27A 5F5CA 4B29A 2YHJA 4BQWA 1V6JA 1RSOA 5FR3A 2ZXWB 1IOAA 3FBYA 4LNUB 3E6CC 3ELNA 2ATKC 1XNKA 3O14A 4IE4A 1YYNA 1K73W 1DF0A 4DK1A 4P9XA 3AVRA 1R64A 2KXLA 2IFWA 4PF1A 4K7JA 5DDJ1 5KHGA 2BV4A 1J95A 2WFF3 2X6CA 2RG4A 3J8F1 1HQNA 1QJFA 5EQUA 2A06H 2VMGA 4JQTA 4FMTA 5LMNB 4JTCB 1MQTA 1TA8A 4LF9O 2JIZG 4HK8A 1IPSA 4N53A 5LBFA 2AXTZ 3FUQA 4PT6A 2YI9A 1KFXL 2W08A 2XT9A 1VQOV 4Q2FA 5EIYB 4XFBA 2B9VA 1FS0G 2YIBA 3HT1A 4KU7A 3H7JA 3I2HA 1YF2A 1CPMA 1NQDA 1HIXA 1JFFA 4I0WB 3N3HA 2Y0PA 5JVDB 1GRJA 4W4KA 2IUWA 4LFBB 4FTEA 4QE9A 1E5HA 2DFBA 3CSXA 4K3UA 5LASA 4U3JA 1VQ8V 4UCUA 1CAVB 4PLNA 4YM0A 2Z2SB 1HR0B 4DV2O 5AVAA 3M8AA 2VXRA 3ETEA 3LD8A 3ZVXA 4UF0B 2D3OW 4XZPA 1LENA 1FI2A 2ARAA 4IQPA 3I7DA 5D5QA 1FT9A 4QXCA 4E2GA 4AI8A 2BVBA 3POYA 2ZZJA 1NA1C 2PYJA 2JIGA 3LKJA 3AK2A 2OZ6A 4AHWA 2G19A 1HQLA 3TETA 3POSA 3Q8CA 2P17A 1I08A 3SPHA 1HRI1 5JXGA 1Y76A 4WM7B 1HRV2 2WLLB 1VAKA 4RQPB 5FP8A 4QQOA 2JD9A 2FTKA 3MW2A 1UY0A 5FTTC 5F7UA 1AI5A 5FZFA 4JAAA 5LP6B 5C8CA 4YW7A 3ZXEA 3THDA 4JASA 4MVRA 4DV3O 2R1BA 1DTOA 1WA6X 1G7YA 2ZQMA 3CRRA 1PIV1 1YFUA 3ABZA 2LO1A 4NOTA 2B5UA 2YS8A 1D7PM 3QD6A 4P08A 4FTBA 3FX3A 3T0DA 1X33A 3ETDA 5B1BB 3IC7A 3RZJA 4X20B 4G9SB 1GMGA 5DAQA 2JDMA 1WD3A 5J2TB 1SBDA 1KQSU 5EYYA 2DYSB 1W3VA 2VW1A 3MDSA 5CBLA 5LEKA 2BBAA 4JZGA 4YG6A 2D6MA 1K92A 4AHYA 2VZTA 3O7OA 2LALA 3M70A 3B94A 2VCCA 1W2UA 4YGCA 4J41A 5F5IA 5A80A 3OTOO 1TE1B 5BNOB 4NIDA 2Y69C 5A1AA 3VD9A 4DR1O 1VBE2 1OOPB 1NOVA 1OCOB 2FDJA 2NMOA 3A7QA 4BW5A 3CPWU 1BHAA 5EJZB 4L11A 4ZZ8A 1IGOA 3VKMA 2RDNA 5IJ9A 4A45A 2QQVA 5I0DA 1BGYH 2DV9A 4QPWA 3RGBA 1NTMH 2WA4A 4R50A 4AAPA 1LODA 3KT1A 3ZIWA 3ZHQA 1HRV3 3EO6A 1JX9A 1WPXA 4YFWA 2J1EA 1H8TC 4NVPA 3N2KB 5J2UB 2QWQB 2A6WA 2HFEC 2RDRA 4NUBA 2F4VO 3BOWA 2AEZA 4DV5B 3PJQA 5LA9A 1XOUA 5EYPB 4JYCA 1RUD2 4QX5A 5L3DA 1K97A 5HPOA 3T2OA 4D69A 1AVMA 4NAMA 4L8QA 2WAAA 4FPEA 3DUIA 1R73A 4QPIB 1QVGU 2FKXA 4KWLA 1A78A 1P7GA 4ZBMA 1Q7YW 5DZEA 3VDCA 3WW1A 1DG6A 2YXSA 3M3OA 2ZX0A 4DR2O 1NYWA 4N43B 5KUMA 1AYM2 2WN3A 3ABMB 1Z7S2 3IDCB 1W05A 3CC7V 3CF6E 3AG1B 4LKDA 4KQ7A 2AHZA 3D6EA 1V6MA 4CU9A 4U3FH 1LOGA 1SA0B 5KHJA 3J7AU 1NLSA 2J1UA 4FFBA 1HNXB 3OYWA 3BTAA 2FHRA 2D5FA 4RUEA 1HX6A 4QM9A 5AFEA 2PN5A 4BE3A 1ND3C 1XBFA 3URFA 4E4EA 4OHWA 3RVZA 4RR3C 4YM2A 3H1IH 4YW4A 1U12A 1AX1A 3LOBA 3JALB 2HEYF 4W6XA 2YC2A 3W5NA 3DN7A 4H37A 1UKRA 4A7ZA 2H0VA 2QWPB 4ASMB 1PPJH 2VQTA 2P6HA 3ETGA 3ZO0B 1VBD3 1M56B 5J96B 3P1IA 1N1YA 2RMU2 4QXKA 3IFXA 2VULA 4LNUA 1XE7A 2VZPA 4D6QA 4JI6O 3UM7A 3DXUA 2J22A 2ETEA 2ES3A 5C8YB 3ZYPA 4BIZA 4M3CB 1W8NA 2WSVA 2X05A 4DIQA 3NR7A 2CL2A 4DV7O 4F8AA 4P9LA 3RMXA 5FWJA 3P3PA 2GMPA 1AYM3 2YFZA 5DABA 3LA3A 3ECQA 1XSQA 3APBA 1WN7A 2IXHA 4JGYC 4PDWA 1CPNA 4DY5A 1VBB1 2Y6LA 1D4M1 1HJFA 5IVYA 2UU9B 2W94A 1W06A 3VL8A 3LIGA 5HCAA 2X5IB 1M57C 1GV9A 2JK5C 2P3JA 1W9SA 4IYHA 4DV6B 1JZ4A 3ACGA 1XSRA 1OSGA 1HNWB 1UY2A 3IAPA 3VBHC 3RMYA 4UW6A 1W6PA 3CJIB 1SKVA 5A32B 1G1XB 1QOSA 1CQ9A 1AR72 2IXLA 4CUAA 5FYZA 3ZR5A 2WJSA 1HW5A 3TGUH 2LUWA 2VOXA 1CAVA 2XOKG 1UIKA 3E86A 4AHXA 3ZX7A 3RBZA 3KGZA 1AI4A 4AVBA 3HQRA 2Q7EA 2RMU3 2W9XA 3GYDA 4MHRA 4HT1T 2WIIB 4WM8B 4ZZ5A 1U96A 4G28B 3BEHA 1Y9QA 1FNZA 3OBAA 1GQPA 5F2VO 4OX9B 2YBKA 4PA6A 3T2TA 4NHLA 2ZGLA 1JPXA 2A9HA
chains in the Genus database with same CATH topology
1WLDA 2V5YA 2EA7A 4KNCA 1GNZA 3TN93 3WX5A 4GKXA 4BCUA 3SWTA 1UX6A 2RJLA 3MZHA 3RG0A 2EXJA 5AC91 1U5IA 2Z79A 2GC0A 3S0MA 2E7TA 4FXKB 3WLUA 4FP3A 2WNUC 1HV1A 2D6KA 5GZDA 1JUIA 4PBOA 1LOFA 4YZ2A 3H9AA 4MGIE 3E6BA 3TYJA 1CESA 2HWE3 2D5HA 4Q1PA 4Q4X1 1QNYA 2Q4SA 3OJBA 1J3RA 5GLUA 4HN1A 2PLV3 3MI8A 4Q8LA 1CJPA 4LR4A 1RUC3 2Y26A 1SFNA 3RJ2X 5JOXA 2H6BA 2ZA9A 4XBLA 3ZFEA 4XOGA 3ZYJB 4LE4A 3WDWA 2QVSB 4GB32 1D2SA 1QXRA 4KU8A 1AR83 2AZ5A 3FLRA 1NCRC 1AR73 2NLRA 1PO22 2Y38A 4WVVA 1MEC1 4TLFA 1WUVA 2D6LX 2EXHA 4OHZA 1LTEA 4O9GA 2XUMA 3GNEA 3Q9OA 3THPA 2RS32 3WP5A 2XJUA 1J58A 4XF4A 4MZUA 2R6QA 1VB2A 1EAH1 1ALYA 2E9QA 2R042 1GBGA 1KJLA 2UURA 1OFNA 1RJ8A 3AZYA 4NO4A 3RNSA 3AKRA 3AB0A 3DPRA 1QOTA 4PIYA 2X5IC 4E4DX 1RHI1 4Q0UA 5D1IA 2RHPA 4HFSA 4K6BA 2PHTA 1AVBA 1CN1A 5J3UA 1YFXA 3FLTA 1EV13 2HWF3 5BNNA 3MIDA 4MGKE 4ZU4A 2K2SA 5EZWA 1ZRDA 1J1TA 2GN3A 2ZGMA 3HT2A 2WT0A 3SCGA 4MLOA 5BNPB 2Q1ZB 4JDOA 4M3CF 1VR3A 2WFF1 4XF0A 3ZN6A 2ZGQA 3WVJA 1IKQA 1GQWA 2ZBJA 2GNDA 3VHPA 1OQEA 2H0BA 3CL1A 4XE9A 5LRSA 1LHWA 2K0GA 3RJRA 4PIXA 1AF9A 2A73B 2E7AA 1I9RA 5I8TA 4FVVA 1SFYA 3INAA 4LBJA 5J36A 1QJU3 1ULGA 2HKXA 2DTWA 4L97A 2A3XA 1NE6A 2XJRA 3ZIXA 1PZ8A 4GMP0 4I02A 3KT7A 4Y1YA 2BBVA 2BFUS 4K40A 5T55A 4H55A 3T1LA 1S2BA 2OPKA 1MR5A 3L2HA 1J59A 4S2HA 4YZ4A 4MV2A 4CDXA 2GC1A 3VBOB 5FREA 1BCXA 1H8TB 5K0UB 1RC6A 3HMYA 3M1HA 2A71A 3I59B 2XBO2 2OG5A 5C4WB 3NKGA 1GZ9A 2XLAA 3I4IA 1BMV1 2OUJA 1KDKA 1TMF1 1DQ2A 1HRI3 3USUB 4YVSA 2QDNA 2ZX3A 1RUE2 2W68A 4AEJA 5GZGA 3EHKA 3GF6A 4ATFA 4D3WA 3WDUA 5T54A 4ITCA 1PVXA 5E16A 3H3ZA 2XWBB 2WBOA 4XFIA 3RS6A 3E97A 1R1ZA 1XNBA 1ZRCA 3S7EA 1RUH1 4QPIA 2ENRA 4GB33 4AI3A 1DDLA 4FOYA 2GNTA 1KDMA 1KFUL 5DUUA 4J1XA 3QLQA 2VVEA 3DL3A 4KWJA 3MICA 2XB6C 1PO23 4ISRA 5CADA 4LHNA 4W6YA 4R8HA 3I8TA 1CAXB 1SACA 1SCRA 4C90A 5JCTA 4BLIA 1OA2A 2D7FA 4J5IA 3N6WA 3NV3A 3WQ1A 4YFZA 2I2SA 2A7AA 2GH2A 4IV3B 1IPJA 2R043 3ZSEA 1DU3D 3PNAA 2E63A 5GLWA 1Q5OA 1RMU2 3JB4C 4D7TA 1AL22 2RS12 2A3YA 2ET7A 1N1SA 2VNOA 5GZEA 1BEV2 4P9JA 3MIGA 1ZBA2 1NCQB 2P3IA 4GH4A 5JOWA 5I91A 2JG8A 1BVVA 3RDIA 4UW3A 4AQSA 4BIFA 5FLJA 2VUAA 1UN1A 2ILMA 3JU9A 1AX2A 3FWEA 4EN0A 2JE9A 4D7SA 5CAZA 4Z1VA 2WWSA 1WMDA 2NM1A 1ND2C 3AKQA 3ZXAC 4MH0E 4QMAA 4RR3B 4QPGC 3I2DA 4XMAA 2XWJB 3GZAA 3OTFA 2CYFA 2TEPA 4LO8A 1LEDA 1JN2P 3ZFGA 4FOWA 5BXXA 4CEWB 1XYNA 4OUSA 3L9JT