3D8CA

Factor inhibiting hif-1 alpha d201g mutant in complex with zn(ii), alpha-ketoglutarate and hif-1 alpha 19mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
b'VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYGEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3d8cA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d8cA01
4Z1VA 3P3NA 2XUMA 3KCXA 2WA4A 3P3PA 2YDEA 2W0XA 3D8CA 1MZFA 2WA3A 4NR1A 5JWPA 3KCYA 1H2KA 4Z2WA 2ILMA 2YC0A 1YCIA 4JAAA 2CGNA 2Y0IA 4BIOA 2CGOA 4AI8A 1H2MA 4B7KA 1H2LA 1H2NA 1IZ3A 3OD4A 4B7EA 1MZEA 4QU2A
chains in the Genus database with same CATH superfamily
5EBMC 4CDWA 1EUTA 3MW4A 2XXZA 1K4DC 1XREA 1GZ9A 4LCUC 1TE1B 1BBT2 3FHQA 2BWAA 1YWKA 1CIWA 4Q0SA 2IFRA 2ZCWA 5FZHA 5FOBB 4XACA 4LOSA 2BP6A 1BHGA 4R9CA 5FAXA 2D3OW 3AKSA 4GAZA 4X9QA 4UFHA 4TQDA 1JS9A 2HH9A 2W47A 4HN1A 3P30A 1GN2A 1PM9A 2JDKA 3THDA 1GP5A 1PIV1 3KZ4C 5KXCA 4LBLA 5A80A 3B00A 2UXDB 3O12A 3J26N 4X6RB 3LAGA 2P3IA 1IXMA 1HV1A 4JI1B 1PO11 4O4IA 5LBCA 1XE0A 3NQHA 4HKWA 1N32B 4CE8A 3OR6C 1RFYA 1TZOA 2XOKG 4RL7A 4DUZB 4F4LA 2F4VO 3GWOA 1PHMA 4JI8B 4SLIA 3P3PA 3ORJA 3QF7A 4KL1A 2ZMKA 1UZZA 3JD3A 4OMCA 1H2MA 2BTQB 1SQ4A 4NB5A 5IVYA 3WDXA 4EJRA 1GNZA 1VLNA 5CG8A 2WN2A 1YEWA 3CEIA 1SF9A 4IXLA 1B35A 1V54B 1BZKA 2Y6LA 1FPN1 1AI7A 2H6CA 2IXLA 2CH7A 2KG7A 5EHDA 4P02B 4BQ3A 2DFCA 1DCSA 1YHFA 3HB3B 5FP3A 4FTSA 3RYIB 4JV5B 1GM7A 3UGGA 4MLOA 3USUB 4AILC 3OMNB 2UWBA 1GO3F 1DFQA 5APAA 5BNNB 1AILA 3E89A 3MI8A 1K97A 2P17A 4K40A 4DQAA 4IL6Z 1W8NA 1XYPA 1RM1B 1FJGO 5JSPA 2VD7A 3TOJA 3LA7A 4H33A 4KG0A 4BQ4A 2AZ5A 4A7YA 1OHFA 2BTOA 3MICA 4D7YA 4PIXA 1LEMA 1H1IA 1C5IA 2W39A 3BFRA 1K7DA 4KFMA 5LA1A 5FZIA 2RM22 5E16A 5IK5A 2JVDA 3RBZA 2P90A 3T1HB 2WRAA 4HANA 3CCJV 1ENVA 1K73W 2VQEO 4P5YA 2GAUA 3H1HH 1RUF1 4NWVA 1HB1A 4QKBA 3O5SA 4B3RB 4E2QA 5J37A 4UB8Z 4JI0O 5CB7A 4XF3A 3MEPA 2Y6JA 1XU2A 2GBOA 1D2QA 1CQ9A 3U37A 1YTFB 4BJ0A 3A0HZ 1VQPV 1K92A 3AZYA 2Y34A 1WW6A 5LMUO 4YY3B 5DDJ1 1I08A 4HSLA 4GX5A 4DV5B 4LF7B 4LQRA 4IHJB 1N36B 4LF5O 1IQDC 3I2GA 4C7UA 2ZX3A 1SZXA 3PJQA 4QPKA 3WEZA 2P6JA 3ST7A 4PA6A 2Y6FA 3BABA 3SISA 5BMVB 1MZ5A 5KWRA 3ZVXA 2JDYA 2QQNA 3T2TA 2KR2A 3E5QA 2LO1A 5BY1A 4YVWB 4NR1A 1ALYA 1J3RA 3ZN5A 4IEWA 1US2A 3GALA 3K3NA 1U5YA 3MW2A 4P30A 4X62B 3NAPC 2ID4A 1JOYA 1BEV2 1NT0A 3ZLIA 3AZVA 4E27A 4DR6B 4LITA 4RR3A 4DR3B 5KHKA 2VQAA 2AXTZ 4X89A 1XOUA 5F5CA 5L73A 4I9QA 2GMEA 2W3JA 4J42A 2P3KA 3C3SA 3I3MA 1G1XB 2C0ZA 3KSCA 2VG9A 1OXCA 1X8EA 4J7JA 2LROA 2WC2A 4KNCA 2DDUA 3EO6A 1X4TA 2EBOA 2YC0A 4MT8A 4QPWA 3ZFGC 3WUCA 5KUKA 4G3YC 4UVCA 1V00A 4UXNA 1U12A 2X6CA 4B3MO 4XXAA 2IZWA 4BQ5A 1BVP1 3K51A 1Z7S1 2E33A 2VCBA 1Y43B 4K6BA 4KU8A 5C3OA 4JAVA 1LNQA 1H2LA 4M4RA 3OGIB 1THZA 2QEXV 5FXXA 1SCSA 3KD4A 3GZEA 1GM9A 4IE4A 2YU2A 1KJLA 5IATA 4LJHA 4W6YA 4DV0B 4CS4A 2H3OA 3G67A 4AWDA 2F93B 4A42A 2Z42A 1TMF2 1Q6IA 4EKWA 2J1UA 5A3MA 1QOSA 1VF6C 3TRSB 4P2ZA 4RSUA 3K48A 4ASLA 1URFA 2ZMLA 3DF0A 1VBD3 4QPGB 5JI9A 3VDCA 1RB8G 4YVSB 2XNDG 2ZGQA 1G6NA 1WLEA 1AP5A 4TT3G 5AC92 4NROA 2UXCO 3I4IA 4LO5B 2XVGA 1SRYA 1AR4A 2K1EA 4QDQA 2HWD2 1AJNA 2WLQA 3D0SA 3R05A 2GDFA 4MGKE 4LHLA 2BVVA 1PVXA 1XNBA 1AR1B 2WFF3 4LKFA 1Q81W 1Q6HA 2JB8A 3ZIXA 3D3QA 4WF9V 3B94A 3OD4A 1GP4A 2RS12 5CBGA 5F9TA 4GH4A 4OPHA 4HT1T 1NLRA 3UGHA 5BY5A 4OQ8A 1W05A 3CZUA 2ILMA 2LM3A 5CFCC 1ULDA 1ZLZA 1W6PB 4DV2O 2R042 3RZJA 1WCDJ 4PHZA 1H4HA 2ZABA 3T0AA 1DHKB 5GZEA 3RVYA 3ZFGB 4MVZA 3SH4A 4CCOA 1R083 2BOIA 2Y6GA 4ZS2A 4ZXEA 1VAKA 4RUFA 3T1YO 2MPFA 4MUVA 1RUNA 2ZZJA 1LUVA 2B8MA 3MDSA 3K04A 4N21A 3ZDVA 4L8QA 1PD3A 5FYCA 1J58A 2PA7A 2WZR3 5IK8A 4RN5A 1RUH2 2BE3A 1EAH1 1BT8A 4Y5TA 1XL4A 4YM0A 3THTA 4BQWA 4WM8C 4BCUA 1OSGA 1GLHA 5BR8B 4XTPA 3CL1A 3EBRA 4L0PA 4QXCA 3I2KA 3OGJA 1OC1A 1VBE1 2QDNA 4K8XA 4ZHQB 4AOCA 4FOYA 1H8HG 4DR1O 4JI7O 2ERFA 4ZS3A 5LGUA 1NG0A 1MACA 4J10A 1AUYA 1JCHA 3AZZA 1Z78A 4QKNA 4FPLA 3L73H 1OLRA 1G6UA 1AL21 1J3PA 1AB3A 1UY0A 3GXUA 2QM4A 3LDEA 3CXCU 1RUG2 5KC5A 4OHXA 4S2HA 1VBB2 2YXYA 1XNQB 1N3OA 4O9GA 3KT1A 1QMJA 5HCBA 4ATFA 4DUVA 5KAFZ 2HEVF 1S77D 4N9IA 2WNVA 4QPIB 3IN9A 2A79B 5CFCB 3K3OA 3RRDA 1HRV2 2A7WA 4U2AA 1RUOA 4R4ZA 1NY72 2VWJA 2ATFA 4EEQA 2WLIB 1NA1C 1NCRB 4IGGA 1WWYA 2GC1A 4EB6B 4CEYB 4L8JA 1JR9A 1RHI1 4E4DX 3RMXA 2Y64A 1GTOA 1ZSPA 2XLGA 4TV9A 5C70A 2PF4E 3URFA 1S0BA 4Q1PA 1C1LA 1W8HA 4B8EA 3A0BZ 1W2AX 3QCWA 4P9XA 3BODA 3OOXA 4I7ZB 1MOFA 4OFGA 4W6WA 3USSA 2Q0OC 3ASNC 4ATEA 1SBFA 1UKRA 3I2OA 5A9GA 4I30A 4LULA 4ASUG 1F8VA 3AP7A 2CGPA 3OF1A 1YQ6A 1H4GA 2EULA 1V55B 2CAZC 1Q8QA 4AHYA 5I0SA 3IMMA 5FZ9A 4I9WA 1MS0A 2VBDA 3ZYJB 1KXGA 2PFWA 1UAIA 4O9EA 4FOVA 2A6ZA 5B66Z 1VQKV 1Q8IA 5LGNA 3APOA 2D6NA 1UQXA 2GC3A 5JMOA 3RZLA 1OD3A 3K5NA 5FZCA 3WDWA 2J22A 4YGEA 1PX3A 3AJYA 3NJZA 4E4ZA 1LR1A 3DL3A 1WMEA 1NZCA 1E79G 4U7OA 2WLJA 5LHHA 1PGW1 2F6BA 4FOQA 3W9AA 1X36A 4GZRB 2YC4A 1NXD1 2JGUA 4YWAA 4XFBA 1RUC3 2DWRA 3DCQA 4DY5A 1HV0A 2WAMA 2XKPA 1W9YA 2BUKA 1OQ1A 4CDQB 4I0BA 4BWOA 2ZACA 4LF4O 2NMOA 5A3TA 1YJKA 5JVDB 3CNAA 4XFGA 4UBGA 1JZ2A 1TME3 5A33B 1W9SA 4J1XA 2HWB3 1GWLA 3ZDSA 1FMD1 2A6YA 3BVOA 5LXTB 3C7EA 5GALA 2OCHA 2A3WA 5EJ3A 3N7JA 3L74H 1S0GA 3GBGA 3VBUC 2HHHB 3BA8A 2YIAA 1ZTEA 4YJ2B 2ZHNA 4JGYA 5EYPA 2R071 4B4QA 2BU9A 4BDVB 3MBWA 1N1VA 1NQTA 3B8MA 4K0KB 3PTRB 1AYM3 1C4RA 3WG7B 5KC6A 1AJQA 1WW4A 5GLUA 5K0UA 2WNUA 3H9VA 3W7SA 1OF4A 5ISLA 3DXTA 2YPDA 3H3ZA 3P5BA 2QFEA 3E86A 1RVF1 5FFOC 2DUOA 5G04L 4BIOA 3S3XA 2DV9A 2KM2A 4JZGA 4DV6O 1KRIA 3JASA 5FY8A 4XFIA 1WB8A 1NT2B 4PDLA 4W65A 2O57A 4AF9A 2Y33A 4EN6B 4CU6A 3SHRA 2BFUL 2UWAA 5CA3A 2CTQA 3RS6A 5C8YA 4COZA 4CH5A 3BVCA 4IE0A 1IBKB 1VIWB 1JFFB 4MO3M 1FYUA 3NR7A 1QH6A 2WO3A 2GP3A 2A06H 3JU9A 3ZXKA 1FT9A 3CP1A 4KMQA 2I2SA 2Y4UA 2DYCA 4XETA 3A8TA 3WQ7A 3ZHTA 4PDWA 1F4MA 2LJ2A 4GQ7A 3CJIA 3Q8BA 1A8MA 1BHBA 1K9MW 4LF8O 3M2MA 3HKBA 4KHPB 3PU8A 4YG6A 2Q8CA 2CNAA 1TUEB 3ZYBA 2JEXA 3WNNA 3ZHUA 1KDKA 1QXJA 4GWIA 3HR9A 3ZYGA 5GONA 4COVA 3PURA 3KVAA 3RN4A 2Y69B 3EMRA 3SKVA 1YZBA 1Y76B 1L7LA 3P6BA 3ZFEB 2IXIA 1RXFA 3ZYHA 2NN8A 2VZUA 2W9XA 4UW6A 2NYYA 3JB4C 1NBMG 1A78A 2XJPA 3JBG2 1VBC1 4U3FH 5DUWA 5IWAO 1CP9A 5LB6A 2TBVA 1O5LA 2VZQA 2PLV1 4XJZA 3QO8A 3N27A 1O6UA 1JX9A 4I4TB 1D4M3 5DMYA 3DYMA 2ZAAA 4MGIE 2ZT9B 3WW3A 5CBFA 4Q4V2 4H44B 4R8CA 4ZI7A 2EZOA 4UVAA 2BBVA 4A3XA 4JRAA 5DZEA 1AR72 2IXHA 1M90W 3T1LA 4PA7A 1ZBE2 1VQ6V 3IB3A 2IXCA 2WYFA 4UAPA 3L2HA 3J8F2 3VBRA 1YLLA 4TYSA 1HNWO 2VAUA 1HLCA 1LHNA 4OX9O 4UFJA 1AR73 2VRZA 2HBTA 1I5PA 5B1OA 1QY4A 2WLMA 1ZBE3 3AMNA 3T2QA 2XR4A 1S0EA 5FNVA 2EIEA 2E6VA 2V72A 1QKQA 3FLPA 1C28A 3HKCA 1QJY1 4R52A 2Q0AA 5IAXA 3DPRB 2OTLV 3IM0A 4WZCA 3EFFK 1KFUL 3WX5A 2WS92 1S0IA 2Q7GA 1ND2B 1W0JG 4AVSA 3D3IA 5F2VO 4Q5OA 2C26A 2DYSB 2PHFA 2VECA 4LBJA 4NIGA 1OBNA 2VMIA 2WS93 1LB2A 1J59A 1VRH1 1BQPA 4AI8A 4XJAA 3M3IA 4COYA 1SQBH 3F7VC 5KXDA 4HPKB 3VDDC 1JUIA 3BTZA 1CAUB 3JUUA 2DTWA 2HEWF 4CC6A 5M0TA 1V6JA 1XQ8A 4LKDA 1HRI3 2QE7G 4UF0B 1Z5WA 5C3PA 5IYDO 4OMDA 2LGWA 4LWSB 1YJWV 4Y1ZA 5L7OB 4NHMA 4XDQA 1XSQA 3KGZA 3K3WA 5FCCA 3I49A 5FYBA 3T09A 2YMZA 1WUVA 3UV9A 2X5IA 1L1FA 1HQNA 1YO8A 4LO4B 5JZGB 2YI8A 4Q4W3 1XYOA 3UETA 1QXPA 5JMCA 3V0AB 5A7PA 1YXWA 2GZWA 5D8AC 1AVMA 1BBT1 1O5UA 3WHTA 1ODNA 2W6IG 4FPOB 4META 4MGTA 2E7TA 1KMIZ 5A6ZA 2PUSA 2Q73A 4M3CA 1S76D 1K5MB 1AI4A 3ACLA 2OS2A 3WP3A 1GN6A 3VKLA 2HWC2 2VCMA 4CU9A 5HCHA 3PN1A 2QSAA 3T2OA 1FPOA 3VBSC 2Q1MA 1GR3A 1WCKA 3NO8A 1FS0G 1I94B 3CJXA 4BISA 3G80A 3ZN1A 3HAGA 1IPKA 1XNDA 1RUD2 4GA9A 3E8BA 2ARBA 4J7ZA 4JKLA 2OX0A 3H7JA 2K9PA 3AK3A 4JDNA 2NP0A 3H8XA 1MQTA 1VBA2 3CC7V 2YBKA 2CGOA 1VAMA 1NTZH 1JH5A 2CDPA 3AG1B 4B7EA 2CK3G 5A32A 4FCAA 4UT5A 4PELA 2RJZA 3OYWB 1YVWA 1JYWA 5A3NA 5IY5C 2V4DA 4UFIA 1HNXB 4AFDA 3ZRVA 1IBLO 3E2EA 1JI6A 2RMU2 2EAKA 1PK6A 4IEUA 2ORXA 4Y5SA 2ZD9A 3JD0A 4WCEV 3CMGA 5LA6A 4F83A 1B3QA 3WF2A 3W21A 1JYVA 3MHZA 3M3OA 4DV4B 4DRRA 3JXSA 1S3JA 4DRVA 2WDBA 5T5LA 1OOPA 4DUWA 5CN0A 4Q4X3 2X0LA 3GNEA 3W20A 3PTYA 4BW5A 1K8AW 1IDSA 3I7DA 2HWF3 4GMP0 2DVFA 2BGOA 1Y74A 1NXMA 2F43G 2XHNA 4HVOA 4CPBA 2FDHA 1QVFU 4FVVA 2XAGA 3QTCA 4QD2A 1TVKA 2PMWB 2W94A 4F6EA 1CESA 2RM21 3KWVA 4AI9A 3H1IH 2HYKA 4HFSA 1YQ2A 4Q29A 3ABLC 5CA1B 2CWMA 1EPWA 3POGA 3B77A 3IAPA 1JMKC 3WT3A 1O4ZA 3GB7C 3ZMVA 2XAHA 5FR3A 3GZAA 1JZ3A 4XBQA 1XMQO 3AP9A 4GULA 4NRMA 2Q68A 2VUAA 1KQRA 2AHYA 3PHMA 5IFTA 1ZZ8A 4IV3A 2AREA 1A6CA 5GKAC 2R062 2UXNA 1YFYA 3VLBB 3VBFB 1OVSA 1JMUB 3ALQA 5DAWA 3VBOC 4FFBB 3RYIA 3J7LA 1IG0A 3USUA 2R063 1ULGA 1CX4A 1PM4A 3HNYM 4CEWA 5GTIZ 2Z69A 1QLNA 3WVJA 4QQLA 3WU2Z 4CA9A 3MHHC 1COV3 2X05A 5FWEA 3W7UA 2UXDO 4P9YA 3E97A 3JALA 3L72H 5EQUA 5I91A 1GICA 4QQHA 5L9VA 4LUKA 2ZXQA 4JI1O 2HYXA 2A0LA 3N35A 5FZ4A 2HEYF 3PMEA 1N32O 3MFCA 1HJGA 3ZSLA 5FMBA 3H8OA 2VMGA 3LEIA 4DUZO 4JI8O 2PYJA 5KXEA 4O4HB 5IJ0A 5FZLA 4UCUA 4ZOLB 5LWBA 1BEV1 1QJU2 3ZHRA 2JDIG 1XBFA 1YJNV 1ENRA 3ITQA 2R49A 1AI5A 1HNZB 4GT1A 2CTVA 4Q0VA 1UPSA 2AENA 2D3RA 2QZ2A 4WBBA 2WR9A 4JGZB 2EZPA 3TN92 4FLVA 4JV5O 4HETA 2J1SA 3BTAA 2G19A 1YTFD 1W8UA 1GOFA 4RFRB 2OIIA 1F35A 4XJ8A 4JHZA 3DGTA 2OT5A 4A6SA 3AXDA 4XAEA 3VBOB 4AQTA 2ZEYA 4QU2A 4LO6B 4TUYA 5H9CA 2BQPA 4UFLA 3NW4A 3U4SA 5DAXA 5FPRA 4AI1A 4P9WA 4YZ1A 4KU7A 4AAXA 3T1HO 1KDMA 1TMF1 1W90A 1JYNA 4LA3A 1ASJ3 1W04A 4XHBA 4LBMA 5FDBA 1SLCA 5EPAA 1A8DA 4RHV2 5IVBA 4A41A 3L9DA 4B3RO 4NRPA 3ZOIA 3EXAA 5F32A 4X64B 5AC91 2BNOA 2ODMA 2HWD1 3WF4A 4ASKA 1CIYA 2E5LB 2VVDA 3RYHB 4N23A 1NR1A 3RYCA 3F7YC 1MZ6A 3WW2A 1FV3A 4X65B 1O4TA 4FXGB 1FJGB 3E8HA 4YY3O 1LNSA 3SYAA 4PA9A 4BYYA 2RS11 4LF7O 4DV5O 2IBZH 2BSKB 1PO23 1N36O 1H2SB 2ZR2A 4FFKA 2C6SA 1OKOA 2R041 3WLUA 5E8AA 1JTZX 2DQ3A 5ABJB 3WINE 2WBKA 1NX9A 4UCVA 4YZ2A 3JARB 2WN3A 5FLHA 3IDCB 5LW9A 5B4XA 4I50A 1Y67A 2PQQA 5JXJA 2AC1A 4IW3A 4YJ3B 3EXUA 4FPKA 1PVC3 2C24A 1CONA 5LYJA 4X62O 1MS1A 3CJHB 1ST8A 4MVOA 4HKOA 4QPGA 3NV3A 4BLIA 5JQGA 2OCCB 1DGWX 1RUH1 3DXRB 1JZ4A 4DR6O 1VMJA 4DR3O 3NL1A 1I5ZA 1PMJX 1N8RW 1SLLA 1HWYA 5JH7A 2ZNIA 2VVEA 2Q67A 3CRRA 4Z07A 5CFDB 1MNGA 5LZ6A 3NAPA 4QE7A 2D44A 2Y0OA 5DG1A 1YIFA 4DO0A 1AP6A 1LGCA 4LE4A 2D97A 2ZEZA 5LHGA 3TK1A 2DCKA 5C8CB 1PIV3 1OMIA 4HYOA 5JDBA 4M3CF 5FMOS 1RUG1 1B6QA 3BPSA 5B1AB 1VBB1 2JECA 3HNMA 3ON7A 5FYIA 3UT5A 3ZFGA 3M3CA 1PO13 2R16A 1ZA7A 2WSSG 1JN2P 1ZNPA 4I01A 3VZLA 2P1BA 4D6QA 3ML0A 1W06A 1NI8A 2ETNA 4DV0O 4DV7B 1HRV1 4JAAA 4CC5A 3UQ8A 4CDXB 1NY71 3INAA 4K1YA 2A71A 3NNFA 3KT4A 2G9FA 4XW3A 2ZZQA 4Z1VA 4BZ4A 4C91A 5FZKA 5HXMA 1QVGU 2GHYA 2AGAA 3NJVA 2D7FA 4XUTA 4I0XA 4KI5M 4NTYA 4AVBA 1FPN3 1VMFA 1M57B 2W0FC 1VF6A 4DRXB 3LZZA 3CQOA 1SCRA 2ARXA 1NYWA 2WNEA 3VZMA 2I45A 4XURA 1S5JA 3LFMA 2VVFA 1QLEC 4XHXA 1W9WA 2XKOA 1TQ5A 4BXSV 1LR5A 3WB2A 1S5HC 3SH5A 4D69A 4GX1A 4G2KA 2JD4A 3S5QA 4GJZA 5LK5A 2IW5A 4RUEA 3CHXA 1QJEA 4QXBA 4HSJA 3SPHA 3UGFA 3ZIAG 4PD4F 1Q82W 5FLIA 2ZE5A 1EUUA 2PI4A 2HLDG 3OEAA 5CFCA 1WLCA 3L71H 2KA3A 4XQ4A 3LSDA 4FO9A 3SPCA 1ULCA 4FOWA 1QJFA 4RS5C 3V65A 1RUF3 3ASOC 1SQPH 2H6BA 1QWRA 4BHPA 3ZHSA 4AE2A 3MAQA 4H55A 2LQTA 4TLFA 4H13B 2RN9A 1W99A 1DP0A 4XTMA 4NIAA 3BB6A 3K9AA 5HCFA 2UURA 4DY3A 5BR8O 4WBNA 4TV8B 3HPNA 4XFHA 3BU0A 1ZUQA 1W9TA 3NNLA 3HVDA 2DU1A 1PNKA 5DG2A 1UJWB 3A21A 3EHKA 4AQ2A 1TNFA 5FZ7A 5DDJ3 5C9AB 2TUNA 4WM8A 4OPAA 4TXWA 3AG3C 2KQXA 1VPHA 1S0VA 2WA3A 3SCFA 1UY3A 3CMAV 4XCBA 2JG8C 1R1BA 3ETDA 1XNQO 4LFCB 2XAFA 4DEQA 2CYFA 2ZGKA 2K2SA 3RZMA 5GLWA 2W2IA 1GQHA 1K3IA 1AYN2 2VW0A 1AR82 1RUI2 4QGMA 4QX2A 1FX5A 3B02A 1FNZA 1YFWA 2OPKA 3WHUA 1UO9A 5K7PA 1RTVA 3O1UA 1XNTA 5FYVA 3VBHB 3TEWA 3RYFB 3JAWB 2W92A 2Q4PA 2QQLA 4AVCA 4B3NA 3D3AA 2UUBB 3ZFFB 3PIGA 5LL6Y 1GUIA 4HVQA 3DC5A 4XIKA 3CCMV 4DO2A 3AL5A 4XDKA 3ATGA 5H5NA 2QM7A 3CSXA 1NH2D 1GYKA 3T2PA 2BGCA 4D0QA 5JVDA 5FYZA 1SERA 3Q8EA 2HJDA 1NCQB 4Q8KA 3ZN6B 4FM2A 1NA1A 5LXTA 2ZJCA 5JJEB 4AVVA 3WNKA 3Q8AA 4XUPA 5EIBC 1ROPA 3QH7A 1QOTA 2W52A 2P2KA 3E6CC 1ZRIA 3CCUV 4EN0A 3WNMA 1SA0B 4YJ2A 2QQIA 3FKSG 1H9WA 1Z7S3 4M0HA 3JZVA 2ORZA 3HT1A 2IH1C 1X9PA 3VV1A 4OHWA 1EN5A 3B40A 4FPPA 2D2CB 4JYAB 3OT7A 3LEGA 3ZSEA 2B42B 2ZX2A 2VBPA 3GBFA 3CIHA 4BLJA 1OFNA 3K08A 4X1KB 3J81N 2JG9C 1DDLA 1YNAA 4WVZA 1LKNA 3GGLA 3H0OA 5F3IA 4BA6A 2FMYA 1LHWA 2FZ1A 1XC6A 1ZZCA 3SJBC 3JBG1 5KA6A 1ND3C 5K9YA 1SS3A 1QEXA 4JYYA 2BTVC 1Q90D 5DECA 4NIHA 2JIJA 1REFA 3JATA 1E5RA 3ROUA 1HW5A 3I3DA 2ADDA 3LSUA 4Q4V1 4GB32 3QG5A 3CX5F 4CDUB 1ZRFA 2PAKA 1VJ2A 3RT3C 3AYCA 3I56V 3T3YA 1NVPD 1BXHA 1IZ3A 5EJZB 5JXGA 2Q30A 2A5ZA 4NPRA 3B9IA 3LA3A 2YYOA 2VZ3A 4B4RA 1F4AA 4IEQA 1U0AA 3LDKA 2B9VA 3J8F1 3GWKC 3QD6A 4B7KA 1RYYA 4FAGA 3HJRA 1F15A 5IVJA 2ETEA 4K0KO 5C5UA 1M56C 3HKDA 3X29B 4QHBA 1XOYA 5FMCA 2KKWA 3SJCC 1PV0A 3OMAB 2WLKA 1Y3TA 4QM8A 2JGDB 1DF0A 1GH6A 3VBUA 2J1TA 3LSQA 1ZL8B 2LFSA 4UYBA 2R0FA 4RQPC 1PZ9A 3WOGA 3VDBA 2DFBA 3CCEV 2PTMA 1EAH2 4KUMA 1W8OA 2Q69A 1EPZA 1XJAA 1CAVA 1SFNA 4I02A 3FLRA 4GWNA 4L9BA 4CSWA 4LP8A 3UKMA 5DM6V 2GH2A 4Y20B 2DF7A 1H8TB 3OY8B 3NKGA 1GMMA 1VBE2 2C9AA 1EAH3 3LPFA 3RQ0A 1UD1A 1I9RA 3CCQV 5FLXN 3LE0A 4K1ZA 3ETEA 3HIFA 4LF6B 3HR0A 1VBE3 1R3LC 1IBKO 5I8YA 3WP5A 1AL22 2QTSA 1UCXA 1SQGA 4K20A 3WD5A 4RWUA 3JYCA 1URXA 1XNCA 2XHBA 1RMU2 2RDRA 2R1BA 1Y9MA 4J7KA 1O9GA 1AL23 1KGYA 2Q5ZA 4YW1A 3GHMA 1N4CA 1YQ5A 3OEBA 3LEMA 3Q4HB 4MVQA 4RA0A 4KHPO 1OLMA 3T4HB 1W2NA 2YU1A 2WO1A 1MS9A 3MIHA 5KX5B 3ABKB 2ZKOA 2RR12 3JAKB 4DV6B 1WA6X 5HV4A 1MMMA 2Y60A 3SLIA 5JUVA 5L9RA 1SDDB 4QHZA 2HWC1 1Z5VA 4AI3A 1WP7A 4Z8BA 4B29A 2QNKA 4CCEA 4PQQA 1RHI2 2XLAA 4NHXA 1WNSA 3A23A 3MGUA 4GUNA 1N1TA 1UOBA 1RUD1 2FYUH 3O1PA 2CAVA 2ZXWB 5KUMA 3N2GB 3KHCA 3UNPA 1RHI3 2GTSA 1WGPA 1DLLA 3S7EA 1OA4A 2EINC 5KA5A 1ZYBA 5E89A 3KQRA 4QDSA 1VBA1 3K79A 2QQMA 3FB5C 4S2FA 1BL8A 3OB8A 3HKEA 4UF0A 1XPWA 4CUAA 2A1XA 1BQZA 1SEFA 2ZIMA 3NNJA 1QDCA 2A75A 2E51A 1Q43A 2YBSA 2Q8OA 1W8FA 3AG4B 2EA7A 1QJX2 2YC2A 3POSA 3IC7A 2RMU1 3GHNA 3H50A 3VL8A 4HNAB 5CISA 1SFPA 2BV4A 2IC1A 2D93A 5FJKA 1U97A 4Q1RA 3WDVA 4WM7B 3K5MA 3BGAA 4KWLA 2ZE8A 2EVXA 5JOWA 3ZX7A 3PUQA 4CPBD 3P3NA 2F95B 1PGW2 3DTUB 4UBHA 4J9ZB 5A3OA 4S2GA 1ORQC 1MZFA 1EN4A 3BYWA 4UXAA 5GM0A 5HI0A 3THPA 3O7OA 1VB4A 4PA3A 3UJOA 4QNHB 1VP6A 2UU8A 2V5YA 2JDPA 2QWNB 4YRDA 3FB8C 3VQYA 2YDEA 4LORA 2UXXA 4QKFA 4LUMA 1FMD2 4BIZA 5B1BC 4XCAA 4G4FA 3TBDA 2FDGA 2XJVA 4E8CA 4YLZA 5KXBA 1FMD3 2WWJA 4AEDC 3TEYA 4JCKA 4CP9A 1HNWB 3JCUZ 2MW2B 5EZYB 4RQEA 1HDKA 2YGMA 2B9UA 3OYWA 3VDDA 3P1IA 1K33A 3FBYA 1Y7BA 4Y33A 2R073 4DXWA 4WFEA 4L11A 4WVMA 1XRUA 4X66B 5A70A 1I1EA 2EILC 2VZPA 4MS2A 4QPJA 3IIIA 3WDTA 3JQWA 1XHXA 1RPRA 1KEXA 1VQ8V 2WQZC 1LCLA 4I0AA 4QX5A 1RVF2 1KS5A 3U78A 1DYOA 4NIIA 2WPDG 1BK1A 5EBLC 1F4HA 4FTBA 3L70H 5JSRA 4DXZA 1BGYH 4BK4A 5D8AA 1RVF3 4N53B 1SETA 1CPYA 3FX7A 2V4AA 2ZM6B 1I94O 2JDUA 4MX3A 3WY6A 1VR3A 4BIUA 2ZGNA 1LHUA 1FNYA 3I3EA 1X8MA 1AR62 4ASMB 4CRQA 5KHIA 1WCSA 5JPMB 2EXJA 3VBSA 3DN7A 2ZE6A 2XH6A 5CA1A 3JAMN 2PHUA 4EZHA 3QO7A 3JD72 2ZQMA 1WMDA 2ZDIC 3KZIZ 4RGKA 1QJU1 5JJJB 3AEIA 4OLLA 2LRPA 3TGUH 1HNXO 5F3EA 1LJ7A 2K9ZA 2PHLA 1B04A 5EFUA 4AEDB 2BOCC 2XWBB 2JICA 1CVNA 2RJKA 3OR7C 3TN91 4TOIA 4O4LB 5LATA 2F17A 3BOWA 3UO2A 2YEVA 4BOWA 4DV4O 2G38A 4LR3A 4JDOA 1HXS2 1GU3A 4LPLA 1VQLV 4B1MA 4PV1B 2ZMNA 1XUQA 2VNRA 1P7GA 2DVGA 3OBRA 3LQCA 4QU1A 2ATKC 3CRAA 2E53A 1HN1A 3RWKX 1MABG 1LU2A 2PLV2 2MK3A 4R7CA 4Y1UA 3AZXA 5KLVH 4CDWB 2XAQA 2ET1A 2B5HA 1POV1 4I09A 4JKKA 1YI7A 2BZDA 2FCTA 1UIKA 3I8TA 2LW1A 5JOXA 1ZZBA 2CDOA 2PLV3 3GBWA 1VP7A 4E2SA 1D2SA 3EB7A 3S0MA 1Y9GA 1DLCA 5SV5A 3WNXA 4D3WA 2WJSA 5J36A 1WLWA 3A0NA 3MV01 3NJXA 5F39A 3WG2A 5T3NA 3JSLA 1SZTA 4RHV1 4ONUA 3N9MA 2ZE7A 2JIZG 3OEHG 2PQSA 2RDNA 2Z2SB 4XOGA 1UOFA 5FPOA 4B08A 5C4WC 2ZPXA 2JIGA 2DYRB 4A44A 2X7RB 3G6JB 3AMQA 5IJ9A 4O4IB 3T4ZA 5GLTA 3PUSA 1W6MA 3PVNA 2BOBC 4B3SB 3A0KA 3QLQA 3CRQA 2YUEA 4JX0A 2QQKA 1LU1A 1QU0A 2X8KA 1QJY3 2DBNA 5AG2A 1M1KW 4CXWA 2ZINA 5D5QA 2W91A 1YITV 1N3PA 1UOJA 2ARCA 4NRQA 2WNOA 2WT1A 3DC6A 2OKXA 3VBOA 2RG4A 5FLJA 5KHGA 2QQWA 2CH7B 3HWJA 5GTHZ 1V54C 1VRH3 2GMMA 3H9AA 4TSFG 4EFBA 1DK1A 2KG7B 4MTFA 1XE7A 3POEA 4BH9A 2V1DA 4XEZA 2O8OA 5GLZA 3VHOA 4JYCA 1QQP1 2XT9A 2XJRA 5KR7A 1HW7A 3VQWA 1JZ7A 2QDOA 4M0NA 4S2DA 4N9HA 4U3JA 5LOVA 4A45A 2FL4A 1G7YA 4H14A 4OHZA 1SESA 5BNNC 4FAHA 4LH6A 1VAVA 1N1SA 2FQPA 1BJQA 1RM1C 2VQFB 3ZYFA 2BFUS 3HQRA 4QAWA 2VZVA 4DXSA 1HNZO 4LBQD 5LEKA 4PF1A 1BBT3 2EIMC 4KH9A 1ONAA 2Y6KA 1FYJA 5KBFA 1OCRB 2HFEC 3FFQA 4UI9L 3LNNA 3OBZA 5C4WB 1QHTA 1XEQA 1WKYA 5JI7A 3ABMB 3BIWE 4P9OA 2I07B 4A3ZA 1NE6A 1Q8PA 4AFAA 1FD9A 2H0VA 3DKQA 4YM3A 2JE7A 1LOGA 3ZSMA 2XUMA 5CKNA 2CSGA 5F5IA 3ACFA 2RQ6A 4WFAV 5J48A 5A7NA 3HQUA 1IBMB 2X29A 3WR0A 2B7YA 2GTAA 2A3QA 1SLAA 1UPGA 1VE0A 3AK1A 4IV1C 5F2WA 1WP8A 4WFHA 4LKEA 1W59A 3T1MA 5KHHA 4ARXA 2ZBJA 4IIJB 3ACGA 3AX4A 2W95A 5FXWA 3ZRWA 2RS32 4H0LB 3MLJA 3U10A 2XGXA 5EJ1B 3TAYA 1GZCA 1EZJA 3V64A 4DPNA 2Y38A 4U36A 4X64O 1FAFA 2WWUA 4LT5A 1J1LA 4ZU4A 4V1PA 2DE0X 5T52A 2NNUA 1T6GC 1V6IA 4RGAA 5AVPA 4YW2A 2E5LO 5FZDA 1VIBA 5GZFA 5FQ0A 4MG2A 4X65O 3RFRA 4BM8A 2OA2A 2P7TC 4YVWC 4LK6A 3T2MA 4X8NA 1ULPA 4NIDA 1Q8VA 4KBBA 5FZOA 2D5FA 4HKLA 3PIJA 2EIMB 1BS3A 4LBOA 3KV6A 2RE9A 3OPTA 5FZAA 4RR3B 1N47A 1KP3A 3CCLV 1OA3A 2VM9A 3RZKA 3AJZA 1QIQA 4LTAA 3S7IA 4QQ2A 2VQUA 1YC61 4DR4O 2FCUA 2RM23 4X88A 3FUQA 1H1MA 3OM3B 1XU1A 4ZZ8A 4K8RB 4DINB 4DV1B 4AQYB 4XDLA 3ZR5A 1KITA 4A4AA 3H1YA 4QB1A 2G1MA 2VMCA 3CCRV 3RNSA 2WINB 2UY8A 2WZEA 2UYBA 1UY4A 3AKTA 4HMZA 3KV4A 3A4UA 1YHQV 4IEVA 1AXYA 4EE2A 1L3JA 1OCCB 4NHYA 3VZJA 4IV1B 2GNBA 3KS7A 4FFHA 4FI9A 1Q3EA 5EV7A 3WW4A 3WG1A 4GWJA 5J2UB 4BMEA 1V6LA 2AZ0A 4JI4B 3RSJA 4YG3A 2HJFC 4LFAB 2R72A 4NO4A 4I55B 4IGOA 3LPGA 4P9JA 2LS6A 1ZREA 3JCIA 5LBEA 5FKBA 4GJYA 4QT6A 3CYOA 4QPGC 4XFCA 2YROA 2XVKA 4X20A 2FMDA 4Q27A 4YVSC 3M4FA 4IYIA 1QDOA 1I5XA 4AEMA 4JPRA 2J42A 1SQQH 1W39A 1AYN1 2DVAA 3QVNA 3U11A 3IDBB 2EXIA 5HFMA 1IPJA 1AR81 3ZKUA 3IAQA 1RUI1 3IFXA 2XJUA 4DV7O 5B3SB 4P9GA 3KB5A 1RUJ2 4Y1YA 2Q7HA 5E79Z 5J2TA 2GDSA 1S72V 1BEV3 2H8PC 2O1QA 1C5HA 5F5QA 3N7MA 2ENRA 4CCJA 1PKXA 1OQDA 5L3BA 4QX0A 2PYTA 2VW1A 4FMTA 2LW7A 4F3JA 4H7MA 4KGGA 4TV8A 1GN3A 2RDSA 2ADEA 2QVSB 4BIFA 1DG6A 3RW0A 2FCVA 1ZVFA 2P6HA 1SPPA 1BSMA 4QMAA 1KU9A 4AGRA 3GVMA 4CCCA 1P49A 1C3HA 4EWEA 1MS4A 2RJLA 1SMVA 4V2WA 2OYZA 1GBGA 2G4IA 2XL7A 5F6LB 1J83A 2ET7A 5FO9B 1ZRDA 2YXSA 2XVLA 4MW3A 2YBPA 1MA1A 3N4MA 5J1XA 3IPVA 3AYEA 3NV1A 1R3IC 2E3CA 5J9PC 4ZIBA 3T08A 4XBNA 2UY9A 1Q86W 5CKMA 1TMF3 1XL6A 3K0GA 1O9HA 2A6VA 3I59A 2EJRA 3H3LA 5JPNB 4ICGA 3D36C 3WP4A 4FLTA 2YB7A 2LALA 5FPBA 3G4SV 1TNRA 3RZHA 2PY5A 1UMZA 3H42B 2R30A 1Y9QA 3EVKA 4MV2A 5AC93 4E4HA 1AI6A 1J84A 1TAEA 1G8MA 2A73B 2HWD3 1IGOA 4OCTA 4GB31 1WB7A 4OHVA 4BK5A 2WNVB 4RS5A 4QGNA 5E88A 4EN8B 4QPIC 2WABA 2RHPA 3KGLA 2OIGA 4XMAA 1BHAA 5ANNA 5CADA 4MSVA 2XG3A 4DW1A 1UXZA 3WDYA 2RS13 4C90A 4QXHA 2BOJA 4DUYB 1WA4A 1NCRC 1OH4A 2JRIA 1F5FA 3BHPA 2R043 2W1QA 4O2BA 2GP5A 2XHKA 4CEYC 3O1TA 5JSOA 5IE9A 4H37A 5FL7G 2WQ4A 1PM7A 3VD9A 1R092 4LFCO 1FOD2 2X09A 1H6XA 2ZX4A 1WLDA 5TISZ 2Q1ZB 3O1SA 1TUBB 4UCOA 3W5MA 3V0BB 3AZWA 2QKSA 3STLC 4FFFA 5T5PA 2ZGSA 1S0DA 5BNQA 2JG8A 2RMKB 3LSEA 2E63A 1V55C 2D98A 4UW4A 1OUXA 4PBPA 3C7OA 2DWDC 4X1IB 2L6LA 3K03A 2M6YA 2UUBO 3OUFA 1NU1H 2WLLA 4AVAA 2QJ1A 3CCSV 1RUH3 1W28A 3G7DA 1I0HA 3STZC 3GDBA 1ZX5A 1FXHA 3E1F1 4GCZA 4LBKA 3BI3A 5FZ6A 3B93A 4F6RA 4O4JA 1YQCA 3O0XA 3FZ3A 2CGNA 2R9IA 4LHKA 5I0UA 4D7TA 1BKZA 1RMU1 2FTKA 4CXYA 3C2UA 2IM9A 3LGRA 2HJIA 4A7ZA 3FAVA 2NQYA 1UMHA 3ZXJA 3UKNA 2XLFA 5B5EZ 1C8M2 3C8XA 1CN1A 5IVEA 5LY2A 1ENQA 2R6QA 2VE1A 4XXPA 4CS2A 1RUG3 3UCSC 3UYJA 3F95A 1A32A 2BCCH 1VBB3 4Q4Y2 4B3TB 4CDQC 4LIVA 4JYAO 3DYPA 4FPJA 4XBLA 5JR2A 3O1RA 5B2GB 5IVVA 4PJ0Z 2NPIA 2RR11 2RS51 5A6YA 4O2AB 3KCYA 4UB6Z 3CC4V 2JWPA 2VXJA 5FWJA 2P4VA 3WQBA 3R4UA 3LEKA 3RYKA 5LA0A 4JTAB 3NJYA 2DBIA 1HRV3 5ANQA 2B9ZA 1MSWD 1S2EA 3MYXA 1IOAA 5BNOC 2DTYA 1UU6A 5L36A 4JGYB 1NLQA 3OG2A 2DJVA 5DUUA 5FZEA 1H8EG 1V70A 1IURA 2QQOA 3RMYA 4EQVA 3WG7C 1UFIA 5K0UB 3BALA 1XBLA 2JG9A 5A7SA 3FHAA 1KQSU 1AXKA 2R9RB 1PPJH 3AVSA 5D5PA 2QWOB 1P8JA 2EF6A 2ZGRA 3UKVA 1ND3A 5A7OA 1L8DA 2UU9B 1PNMA 5GZCA 5L3GA 3HMYA 3I2FA 4KWJA 1ENXA 1QJX1 3MLLA 3ETQA 3MIGA 3A2FA 3ZXDA 2DN9A 3AKPA 5FO8B 3LDDA 4IT5A 3WP6A 3LFIA 3PUIA 2W46A 4ITCA 1AR91 4OZOA 4JAUA 1V6NA 2ZAHA 5EC1C 4FPGA 2V5DA 3PUAA 5L3DA 1CZTA 4FJCC 4MTOA 4MVUA 4ZBMA 1RGSA 5FK7A 4OXSA 5C8YB 5KHJA 4FSJA 1DQ6A 2Z3YA 1F31A 1UX6A 4NPLA 2ZEWA 1JZ6A 4EROA 2B4KA 2ZGLA 2TNFA 3J80N 2ZGTA 1NH2B 1UY2A 1S2KA 1BK0A 1AZDA 5ERLA 3PVEA 3ME2A 3CU7A 4DK0A 3KCXA 2JKXA 3OUJA 5A3UA 3D8CA 4PDWB 1G9FA 1K3EA 3O9OA 1NS1A 3HKBB 3KLSA 3S30A 1XDCA 3VD3A 2UUAB 4YW3A 3J4UH 1AF9A 3KT7A 4RQPA 4TWTA 5GONB 1AXZA 1RUE2 4JI6B 1VQOV 4LF6O 1GWKA 5BNOB 3ABUA 4UUJC 3CDZB 2Y69C 1EV11 1W6NA 1H2NA 4UFKA 2HLEA 3O14A 2ADQB 2AGSA 3ZFEC 5FMDA 3M8LA 3OAAG 1REEA 5DABA 2RJ2A 2P67A 3N9PA 2YV8A 4IEZA 5I0RA 4LA2A 4KG8A 1V9U2 2V4VA 2C1FA 3ZHVA 4K8FA 4PF5A 1GQPA 3R4DB 5C7GA 5L3EA 4QJFB 2IJJA 3MF6A 2GV9A 5LBBA 3O0VA 3VHPA 2OW4A 2QR4A 1R64A 4L2NA 2UUCB 5EWSA 3OD0A 4YGDA 3N3HA 5A7QA 5J3UA 2A6WA 4ZI7B 1W6OA 2E9QA 3H8RA 3BRCA 2DW4A 5IK7A 1YQ8A 1GV9A 4CU7A 1PZ8A 1QR8A 2YIBD 5DUVA 3VBRB 4JDMA 5JR7B 1YXBA 1NVPB 1UY1A 1O8PA 1HB4A 1YFUA 4GD4A 2OWOA 3Q9OA 2ITCC 2MEV2 1AR61 5FNVB 2MNGA 3N2KB 1VF5B 2EIKB 3ZN0A 4FLYA 1PGL2 4LO7A 1R1A2 3JD71 2ZIOA 1YSCA 1SDWA 3DPRC 1U96A 5EZYA 2VUCA 4I0WB 3VZKA 1V6OA 2NLJC 1ND2C 2YUAA 1BYHA 2GC2A 3UJQA 1NR7A 4HBNA 1KYOF 2DYSC 4JTOA 2GH8A 2J1EA 3BTYA 3C90A 5FYYA 1M93A 4GYCB 3CMEV 5CA0A 1DF5A 5FREA 3EQEA 1LAJA 3MF9A 4ORFA 5BZBA 4UW3A 2B45X 1V9PA 5GW7A 2G9ZA 1IS4A 4TLGA 4MVRA 3AP6A 1HXS1 1TG7A 1WBFA 1CZSA 1WPXA 2AEZA 3IMNA 4BB3A 2PHDA 5L7OC 3ABTA 3AG2C 3RJ2X 3KHBA 1D0GA 5F8PA 5JZGC 2JS3A 3JBG3 4YW6A 4JASA 2D3SA 5ITZA 4GLXA 4FPYA 3VDAA 4X1YA 3H1JH 1D5NA 3QOPA 2GNTA 1NKGA 3S3WA 4M3CE 3HT2A 4FLWA 5FY9A 3TEZA 5ACA2 1L7QA 4M3CB 1W6QB 4R6ZA 2EIJB 3BAAA 4Q4V3 1US3A 3OW2U 2WSVA 1W2TA 1K5MC 3A7QA 4X8PA 1ZBA2 5HXVA 3L9JT 4QDRA 3M99B 4FLXA 4UWDA 3B69A 2NN4A 3QO5A 3J8F3 3U1XA 4DYLA 1ZZ6A 4P9LA 4CXXA 2B5UA 3KF3A 4AEDA 4X66O 1EN6A 2W08A 2YXHA 3WZ1A 3PVOA 1KFXL 2B39A 5FV3A 4UFMA 3R66A 1MQTB 5KAIZ 3LIHA 4Q8LA 2WWSA 2CHHA 4XAAA 2WKKA 4TTGA 5LY1A 4CUBA 3POIA 3ICXA 1N34B 1SACA 3AL6A 3VBBA 5A32B 5H6RA 3O65A 1DGRA 3AG1C 4JI5B 4AHCA 1ULFA 5A7WA 3AKRA 2ZM6O 1RC6A 3VKFC 1PK6B 4CH4A 2ZKNA 4A6OA 3ZYPA 2C9KA 2EICA 3SMHA 2HVKC 1ZAUA 3R0RA 5CZKA 1K12A 1POV0 4KBZA 1C1FA 5LA6B 3AG2B 1KS4A 2YFZA 1SBDA 1M06G 2K46A 1WA8B 1GZWA 2W1UA 3CO2A 1IPSA 3GCWA 4OULA 2IVJA 1OOPB 4LF9B 4YHHB 4GMP1 1UYPA 3BCCH 1RITA 5KMGA 1SQVH 2IU3A 4RD7A 1LODA 5CMUA 4XILA 2QQJA 4GX0A 4NXMB 1TA8A 4W8JA 1Y74B 3A22A 5LMNB 2JS5A 4D94A 3OJBA 3SEPA 1LTEA 4GKXA 2FDIA 4AW7A 1NJIW 2N74A 1TVKB 2BBAA 3K06A 4E2LA 3G71V 5FPZA 5K1XA 2UWCA 2ZDIA 5FBJA 4JI3B 3BPZA 5F7UA 1DZQA 1RSOA 4HK8A 2VMEA 1UWWA 2E32A 3PLQA 3JQXA 1X59A 4LXLA 5LGTA 3FB7C 3VKNA 2HWC3 5CA6A 4FPCA 3ZO0B 3POJA 1BE3H 4QPYA 2ZGMA 5IYZA 3FBMA 3U14A 2PYLA 1T6BX 5AFBA 4NVPA 2F23A 4R9BA 3HPLC 4DZGA 1KUQA 4GX2A 1VEWA 4IV3B 1MS5A 1RUD3 2X6AA 1EY2A 2CAUA 1LOFC 3H8UA 3KV5A 3JB8A 4FLZA 3DUIA 2SLIA 2VJXA 2DURA 3VBFC 3AB0A 2AHZA 5F5AA 3SYPA 3I2IA 3MIDA 2JKBA 2G9GA 1VBA3 1Z2GA 4LLFA 3VQXA 4CEWB 2Z0AA 2YGLA 5JCOC 4Y5Z0 2Z5UA 1XB9A 4XYXA 3C7HA 4JKMA 2RS31 3JALB 3OUHA 2RMU3 1SQXH 4DNYA 4LNVA 3H3UA 1F5JA 2DOSA 2E75B 4B3SO 2QKCA 4AQ6A 2Y26A 3LA2A 1ZZ7A 5B4NA 3RJRA 1DYPA 4E8DA 1GNHA 2Y8KA 3L75H 5H9RA 2EIGA 3HQXA 5C4WA 3K9SA 5IJ0B 3SNMA 4FLUA 1DYKA 3AK2A 1SQFA 5FKCA 2IXKA 5A3PA 3E6DA 1GWMA 4XC9A 5FZ0A 4JRLA 1QBZA 3AK0A 1HB2A 4R9AA 1W8WA 4XUOA 5IVFA 5FTTC 1QOOA 3CC2V 3KF5A 1JW6A 1DBNA 1Q6UA 3T0BA 3H1LH 3K4DA 2UXBB 3D0JA 4JGZC 1GOGA 4JZ2A 5F6KA 2BTQA 4I3GA 1ZRRA 2NZ9A 2H0BA 1F51A 1QJZA 2XASA 1K4CC 4XUQA 5EYYA 4HN0A 3ASIA 2B1IA 1QQCA 5EBWC 4B4PA 2BWCA 2BERA 3LOBA 2ZHLA 4COUA 1KB9F 1R73A 4IIJA 1EFRG 4FK5C 5LP6C 1LOAA 3IAYA 3O1MA 1L7RA 5JWPA 2PAEA 3D4KA 4TUYB 2VQFO 2X53S 2BPA2 2XJSA 3MV11 3T30A 1S1AA 3GM8A 4MTXA 2OQ6A 3PL0A 3MD0A 5BNNA 1T5EA 1REDA 2CL2A 3ZRSA 3VGIA 3NNMA 1FXKC 1U5IA 2B46X 3K75B 5FP9A 2RNBA 5I0TA 1M4WA 2XAJA 5FY0A 5IW0A 2J7MA 1JQ0A 3ZSKA 1GSLA 2X10A 3SYQA 1OF3A 2LUWA 2R0HA 4XQWA 2EX3A 3IDAA 4QX1A 1O91A 3DECA 3ZBHA 4WVWA 5AFEA 1KKCA 4BWAA 1CZVA 2A3YA 4IGPA 4IQPA 5EP9A 3IJ4A 3RYCB 3JD1A 5E1RA 1E1QG 1AHSA 5B1NA 2DCJA 1IBMO 1GQGA 3HEIA 4YZ4A 2VBBA 3AC0A 4HVRA 4AEJA 1ENSA 3TJTA 1RUJ1 3J7NA 4ZY9A 2PELA 3ZMZA 1QJU3 1UYZA 4V2VA 1EP0A 4FTEA 3KG2A 2BVBA 3ZHQA 2WZ8A 2W6JG 2YZ4A 5ABJC 4XJ9A 3RWNA 1OPMA 2VUJA 2VU9A 4IV1A 3OBTA 2VQTA 3E6BA 5FZ8A 1BMV2 4NHKA 2W0XA 3APQA 5J2UA 3TN93 2VZTA 1H6YA 2O14A 3AMHA 2BNMA 1OD5A 3RVZA 4JI2B 4IHJA 2ZCEA 2JX9A 4QQPA 1VBD2 4I50B 1S55A 3HN1A 5LP6B 1US6A 2E7AA 2PAMA 4MVMA 4IEYA 1V0AA 2BYVE 4BR6A 4I55A 5LYJB 4LNUB 1J5EB 2ZS6B 5JQGB 4CBCA 5BMVA 2EAAA 4XZUG 2OCCC 4LFBB 1FXKB 2WFF2 1POV3 3ENRA 4YVWA 5JH7B 5BV6A 4FP2A 1LENA 2GSMB 1P7BA 2IJIA 4NXNB 3NAPB 4HG6B 4IESA 5CFDC 2Q8VA 4JYBA 3CXHF 4DV1O 4AQYO 4KWUA 4LBQB 2GNDA 2IUWA 4JC1A 2CE4A 1VMGA 2XTAA 2VH9A 1A3KA 1UYXA 1R082 4RHV3 4QE9A 3IWZA 3M7AA 5C8CC 3VUOA 2LTNA 4BMBA 1G9CA 2AZ2A 1UX7A 4XABA 3AFKA 1HQWA 4XFAA 2NR5A 1MZEA 5B1AC 3UT5B 5D21A 2RCVA 1YUDA 1K5JA 1X7NA 3MZHA 2D6KA 2D40A 2P06A 3AMMA 4Z2WA 4AHXA 4JI4O 2AYHA 5IT6A 4AYUA 4LFAO 3ILNA 4DIQA 2WZR2 3AYAA 3R6SA 1OUSA 3K5LA 1GFF2 4EN9B 4QB6A 4CDXC 1AVBA 4DR2B 4HAMA 4PIZA 4DR4B 3POFA 3FYIB 1H2GA 2DVDA 4CZZA 4E4EA 4LMFA 4I0XB 2R9AA 1QQP2 3NVCA 4DXTA 1LECA 1R091 2VL4A 4NMIA 1FFXB 3MW3A 2QKAA 1QCEA 3WNLA 1FOD1 1OH3A 4H2AA 5LBFA 4Q26A 4E4SA 5IWFA 3I54A 4R9DA 1OFSA 1HKDA 3J7MA 1M57C 4RGGA 3LWCA 2YHJA 3DSQA 1QQP3 4JTNA 1LULA 4IEXA 4Z2AA 3FX3A 3WF3A 4NHLA 4ZZ5A 1JYXA 1D2DA 5FP4A 1HN0A 1YDXA 5GZDA 2HWE1 1SZBA 4YVSA 5BXZA 5FY5A 2VTFA 2ZNJA 4BPZA 4FFGA 4HXCA 2Q1FA 3CEWA 2XBO1 5CAZA 4XE9A 5FY4A 1LGBA 3KMHA 3CF6E 4P00B 4P9PA 3I5DA 3G6BA 1EZVH 3WQ0A 3TEXA 1DQ0A 2C5DA 2XWJB 1QNMA 4C0HA 1XMOB 4OYUA 1JPXA 4UCSA 5IK4A 5HCAA 1W6PA 2FHRA 2QKDA 1Q56A 1SFYA 1JYTA 5EIBD 2CV6A 5FYMA 4K3AA 4QIWF 2WFPA 1O3QA 1OLQA 2P3YA 1VRBA 2NMNA 4H3WA 4R8HA 5BYNA 1C8M1 5A6QA 3CD6V 3K4ZA 4XF4A 1CR7A 4W4ZA 1B06A 4Q4Y1 1JJ2U 4Q2FA 3PJYA 2KSDA 4ZU7A 2ZHKA 4WBNB 3E22B 1T2XA 4GKKB 4AR2A 1TUBA 3FJSA 4PCRA 2V09A 1SLTA 3EYPA 4P14A 3F5WC 3V0BA 2HR3A 4IYHA 3KV9A 3THOA 4WV8A 3MPBA 3PUHA 1IS3A 2F1MA 5CIRA 4OVEA 4IEPA 1RJ7A 4WM8B 1S0JA 5C9AC 3RI8A 5CB4B 1K5QA 3ZMSA 1OCZC 2OPWA 1QGLA 5H6QA 4I2OA 1AJPA 1IHMA 5FBZA 1E5HA 4MOAA 4JF3A 4LOTA 4X1IA 1VQMV 1R6TA 4ET7A 3JSNA 4YZ5A 4FFIA 3AXEA 2VQ0A 4ZHQA 4FT8A 2JDMA 2QBXA 4D6SA 1M5IA 4DR7B 3I97A 3LIGA 2AUYA 3ZXGA 3ABZA 1C8NA 1ZA4A 3WB0A 3ZKYA 1PX4A 3D36A 1IVSA 1RUC2 2F4PA 1AX2A 5CBLA 2D3PA 3LCPA 2P34A 2J1AA 4ZHNA 2VC9A 2P5OA 5F3CA 1UMIA 5H2FZ 1DQ5A 4XMIA 4AVTA 3VBHC 4DUYO 1R6NA 3CBNA 1TME2 3K57A 3DEMA 3NNGA 5C3SA 2HWB2 2GNMA 3ZFFC 4OI0A 4GZ9A 3VL9A 1WCQA 4QPIA 3VB9A 4AG4A 2V7QG 2EALA 1W2UA 2DCYA 3RZGA 2CUGA 4CP0A 2QUOA 2LW8A 4BAYA 1NA1B 2XQXA 1NCQC 4O2AA 2R1DA 2WLIA 1NCRA 3B9CA 4FIPC 4UCTA 4EB6A 4CEYA 1AYM2 4L97A 4XDJA 4QX3A 2E76B 1IS5A 2B1GA 3VKOA 3POYA 4WFGA 1CPNA 3SXWA 3OTOB 3ASNB 4FM0A 2Q8DA 5DPNA 4DXRA 3RVHA 1ODMA 1RUE1 4J9YB 4MYEA 4JTDB 2JDAA 1YRZA 2JEUA 3SPJA 4MADA 1OCZB 2VNVA 1O8SA 4J41A 1NQJA 2HKOA 1GZTA 3MPPG 2DWEC 1GANA 1W3VA 3CE2A 3HBKA 1XSRA 1UPIA 4EWDA 3GZUC 5T54A 4XJUA 2OT7A 4UV8A 1VQ5V 4PDRA 1V9U1 3MIBA 4Q20A 1CJDA 1LUWA 4YM1A 1XNKA 3MO4A 2Y0IA 3LB9A 3FYEB 3JATB 1Y4MA 4B3TO 1BLZA 4DUXA 2AW9A 4MXWB 4CVUA 5FZFA 4P5HA 3R4SA 1AYN3 2J1VA 3OUIA 1AR83 4CDUC 1RUI3 4KWKA 1SLIA 3BKZA 2VOKA 1G9BA 2GUZB 2GN3A 3UESA 4CDQA 3PU3A 2C4XA 5A1FA 4W6XA 4OI4A 2Y0PA 5FRAA 5A33A 4AFBA 3ES1A 3ZN4A 5J7MA 1BVVA 2ZA9A 3HKDB 2VMHA 2MEV1 2BNNA 2D6OX 1JHNA 2ZGOA 2HP8A 3SCHA 1GRJA 1K5SA 4JHTA 3N9LA 4FPFA 1PMIA 3VBUB 5BNOA 3QH6A 1PGL1 1AL0G 1R1A1 2DUPA 4JVAA 4Z1MG 1OURA 2KXLA 1YI9A 2O0OA 3IGAC 3LDBA 5C71A 1WD4A 4FQZA 2UU9O 3VZOA 1VF7A 4LHSA 4GKYA 1CAVB 4XQDA 4DV3B 2VMFA 3LF7A 2JE8A 1D4M2 3FL7A 4IE7A 3WFVA 1SLBA 2ES3A 4IEOA 4HL0A 4PDVA 4P08A 5JXHA 1EBOA 1H8TC 1R3JC 3H7YA 3NMBA 1A34A 4ABMA 3H01A 4IL7A 3VN4A 5JXIA 4CUGA 1H1AA 1TEIA 4NWWA 5FZBA 1F4NA 3WG4A 4A5UB 3GYDA 3OBAA 1PNGA 3I3QA 1JZ8A 2ZR3A 5FUPA 1X50A 3AVRA 5DAQA 1JZ5A 1J95A 5LCWL 3M7MX 2WYSA 3Q8FA 1OLME 1J1TA 1ZX3A 5LEJA 4QM9A 3WXPA 1XNRB 3D82A 4ARYA 2L35A 2UUAO 3R65A 1JFFA 5DZGA 3J7HA 4AGGA 4YZ3A 5FIXA 3N2KA 5ACA1 4JI6O 1W3XA 1HQLA 4GB33 3ABKC 3F2ZA 3CCVV 1DF4A 2F4LA 4OHYA 3IKWA 3OE7G 1ZBA1 1GM8A 3ZJZA 3SYCA 4I3PA 3OGSA 1O4YA 3GJAA 4GKJB 2EIDA 2N04A 4TN7A 3X2QC 2HG5C 3RWRD 1FATA 5K4LA 1HRI2 1OA2A 4LR4A 2ZXWC 2WT2A 1ULOA 3FN9A 4YNIA 4NE9A 5CYYA 3ZXEA 1N33B 1MPXA 1DLBA 2WAAA 1Y76A 1EYBA 1JOBA 3ZFEA 1SBEA 2UUCO 4NAOA 1W8ZA 1WZXA 2HKXA 4YGCA 4L87A 3HKEB 1B09A 2OQ7A 2W1WA 3SCGA 1YYNA 3WNPA 1NE4A 4Q4W2 2WLPA 1D0HA 1ZRCA 2VZOA 4AFMA 4Z82A 1H8VA 4F7ZA 3AG4C 2WO2A 3ZMNA 5J96B 3RYPA 2W1SA 4I4TA 1OZ0A 5I93A 1WMXA 4K9SA 3N9OA 2DMXA 4Y1XA 1STMA 4MHUA 1MSDA 5LRRA 1NKDA 4WM7C 3LDCA 1GAXA 3IC9A 5A3LA 3K5OA 4QWNA 4LIUA 3THCA 3WF1A 1UZVA 1W6QA 2W5FA 2OTJV 3RPQA 1MEC2 3B7MA 3B2EE 1KD7A 3BTXA 1K45A 3K4AA 1RMU3 1CAXB 1JBCA 3MHSC 1IQAA 3UKTA 1CGPA 2D6MA 1MEC3 2JJ1G 1UU4A 2A7AA 3MUZ1 5FPXA 1C57A 5H9PA 2RS52 3CB2A 2EXKA 3OFNG 3FHIB 3I2JA 3DPRA 1YFXA 2N7GA 3C7GA 5C5TA 4HLTA 1JOPA 2DVBA 4GALA 2P4KA 3E8FA 4N43C 2RDQA 5H9SA 1ND2A 2RR13 2RS53 3HN3A 2VR4A 3EHBB 1HR0B 4CP9B 3X2QB 2QCSB 4OI1A 3CLPA 5A3WA 3KVBA 1XE8A 2ZGUA 1F2NA 2QQVA 4UV9A 4FQ4A 2YIDA 3VDDB 2VZ1A 4NPMA 4DR5B 1AX1A 4MTGA 4HPKA 1XILA 2OIEA 4O65A 4OUMA 1CAUA 2XUEA 5JVVA 4MSWC 3M3EA 3W58A 1AJKA 1S4CA 4WVMB 5IHRA 4IE6A 4ZKTB 1OJHA 4Q4X2 3FD9A 4LWSA 2GALA 2VS0A 1WW7A 4ZU5A 5L7OA 5BNPC 1UZWA 1OV9A 3FB6C 1QNWA 2HWF2 3LDRA 1WA8A 2X6BA 2PHRA 3P32A 4PIYA 4YW4A 3MUY1 5JZGA 1AROP 1CD3G 1MVQA 2EJ7A 3RZZA 5D8AB 1ULEA 3V0AA 3VKMA 3U07A 1AR92 3I55V 4N53C 4YARA 1QJX3 3C3TA 1F9KA 4TSVA 5G05L 3ILFA 5IYYA 1AR93 4ZONA 3CRMA 4A2UA 1K5MA 1V6MA 3AP4A 4CCKA 3C7FA 4MZUA 3VBSB 1COWG 2FMLA 3M8AA 1LOEA 2CTRA 2PXJA 1G9DA 1N34O 3IZOA 3K58A 2SBAA 3ZCCA 4JI5O 3CS5A 2QQPA 1O3TA 4BU2A 3PJSK 3DXUA 4Y4RA 5FPAA 4N43B 1VMHA 2WUHA 5GZGA 4UVBA 2MHFA 1XYNA 3H1MA 4XF1A 1EV12 1DQ4A 4BQXA 3SITA 4RYDA 2YEVB 1COV2 5IY5B 4WFBV 3RG0A 4LF9O 4ZPIA 4YHHO 2N05A 4ES9A 1EV13 3QBQA 4X6QB 4NXMO 4NUBA 2VOWA 2PGGA 3CKHA 4BQ2A 4MGQA 1W8TA 5LMNO 4J25A 3ZRXA 4M4PA 5BNPB 5IJRA 4PI0A 4CDWC 3E83A 3UT0A 4Y26A 4XF0A 4YFWA 4CYDA 3TNPB 1UL9A 3VHRA 1UZYA 4JI3O 4DMIA 3RDIA 5K8SA 4PA4A 2WSUA 3UK9A 4M00A 4W50A 4Q0PA 1QF3A 2AEYA 1G86A 1VQNV 1MS8A 3ETGA 4N7UA 3BN6A 4G28B 3RGBA 5A1LA 5FPLA 3LSSA 2Z79A 2IJKA 4BQYA 3AG7A 1LGNA 2BW8A 3OGVA 3ABLB 1IG3A 2UYAA 4PLOA 1YIPA 3V56A 2DYRC 5C33A 3K46A 5IJ9B 1WN7A 3SPGA 3ILRA 1W6MB 3ETPA 1AR63 1GP6A 5IFPA 1N1YA 3PNAA 4Y22B 3SJQC 1S5LZ 2O8QA 2OUHA 4AFCA 5JAXA 1CAWB 4JQRA 1PGSA 4YXWG 1GOHA 3JD73 5L3FA 4CTEA 1LOFA 3K77A 2QTWB 4PLMA 4PJYA 3ZR6A 2EXHA 5CBHA 1P4RA 3OSDA 3TWIA 3VBFA 3MFAA 4PT6A 1OKQA 3LOIA 2Z4FA 4FFBA 1B35C 1H0BA 3IIAA 5HBAA 3AYDA 2F4VB 3CWBH 5T5JA 4ISRA 1XXNA 2VUDA 2BJSA 5FO7B 5JCOA 1BMV1 5TSWA 5C93A 1ASJ2 1UXXX 3O1OA 3AFGA 4URAA 4K3UA 3SPIA 3H1WA 4AZZA 1VBD1 2VY0A 3HNBM 1OVPA 2PHWA 5JOYA 4U3JB 3DGEA 2KD7A 1HXS3 4DW0A 4JQTA 5DQ0A 5LOVB 2GC0A 3ES4A 2JB4A 4CCNA 3T0DA 1JUHA 2RVAA 1VARA 2ADPA 3OUSA 3HD8B 1K34A 5IVCA 2P6CA 5D2AA 4EWAA 3E35A 2WFF1 5EIYB 4FP3A 5LA9A 2VW2A 1LHVA 2IH3C 1RXGA 4C1WA 3ZEDA 1DQ2A 2VMDA 2XB6C 4KGQA 4O4HA 4BXFA 4ZOLA 2WZPP 2UXBO 4QKDA 3GJBA 1NZ6A 1FXVA 1PO22 1DGSA 1OCRC 4KP4A 2DCTA 1KP2A 3E5UA 4UW5A 2YG0A 2AACA 4HZFA 2IU0A 2A70A 3LKJA 4DB5A 4A7KA 3WCSA 4LH7A 4MVSA 3ABMC 4EN7B 4LC1A 1YJ9V 2YI9A 1R081 4OUSA 4D6TH 1NTKH 3I2DA 1BMFG 3B5LB 5F37A 3ZS8C 5IYCO 4JGZA 5HFLA 1CEZA 3WSOA 4N8MA 4IGQA 4W4KA 2NLRA 1Q5OA 4OZXA 1R1ZA 3NRUA 2VQEB 1H38A 1PVC2 2QZ3A 2QJVA 1W2BU 3E8GA 3QNEA 2VWKA 1GKFA 5LP6A 4YIOA 2WZR1 3K59A 3IT8A 4LBNA 4CZSA 4ISQA 4JI0B 5GJ6A 4AQSA 5IDJA 1B35B 3U0ZA 3ZXFA 1I5YA 1S0FA 4LNUA 5F1RA 1RP3B 3TETA 4GXLA 2BGPA 4OGQB 3ZRWB 4OQ9A 1XI1A 1UU5A 2VNOA 3B09A 4FBFA 1IKPA 3B4SA 1DZRA 1FXKA 1GMGA 5LMUB 5J09A 2DU0A 3BEHA 2JJ2G 4IERA 1UN1A 1W9FA 2H94A 5FQ0B 2JXAA 4LF5B 4H7LA 1PIV2 1UOGA 1QNYA 4XPVA 4LBQA 1YCIA 4QGPA 4GMP3 2WQ8A 1MVEA 2CU5A 5FZOB 4WVVA 1E57A 1PO12 1E5IA 3SGIA 1RL3A 2K0GA 3M3QA 3U4XA 3TCUA 1W0OA 2HEPA 2M7WA 3N7LA 3KKYA 3RYHA 5IAVA 2HBUA 4RR3C 2A9HA 5DAVA 5K1PA 1M4UA 2FDJA 4COWA 5FYHA 4LBEC 1JJOA 2JE9A 3S6PA 3I2HA 2Q6AA 2GN7A 2XJTA 2BSKA 4JI2O 3BU7A 4UOJA 3CPWU 3ZMOA 4C0BA 1APNA 3CZJA 5DZFA 3D6EA 3SKJE 1J5EO 1TVGA 5ABJA 2FKXA 1FPN2 4QGLA 4XIOA 4YG0A 4Y1VA 3B3QE 3JARA 1K42A 1U5ZA 3W59A 2E7QA 2XL9A 1O3SA 4LFBO 1VQ4V 2JD9A 1OCCC 4FPEA 1CPMA 4CUCA 1NTMH 4MH0E 2JDZA 1GKBA 1LEDA 1FFXA 1OT5A 1RIRA 4YJ3A 4K35A 3SYOA 3FUOA 5C6CA 1S0CA 4NXNO 2FDFA 1FI2A 4WFFA 4JGSA 4BE3A 4B3MB 2PHTA 3CJHA 3E5XA 3ZXLA 3NV4A 1PL4A 3D5OA 4CCLA 3IBMA 4DEVA 3M70A 1NQDA 4FPHA 2QE3A 3DXRA 3WNOA 5FYTA 3WB1A 4CH6A 1Y4WA 2CDYA 4E2GA 2VTXJ 4YIPA 3W7WA 2IFWA 1NZIA 5CKQA 2RS33 4X20B 3N9NA 5JIAA 4Y4YA 5CFDA 1E5SA 3SEEA 1F7YA 3ACIA 1UW8A 1XQNA 4PQ9A 2QGNA 3CRCA 4CH3A 1POQA 4UFZA 3W7TA 3W7XA 1UNBA 1W0PA 1WAZA 4KQ7A 1RUF2 2WAOA 2Z5WA 3AP5A 2YPJA 5C8CA 1RUC1 3NV2A 4IUGA 2IWGB 4E9KA 5B3SC 2FBEA 4LKSA 5J2TB 4J80A 2UXCB 4DFSA 4GH4C 4YPJA 4DR2O 2YY1A 1TME1 4RO2A 4YM2A 2HWB1 5DN2A 1R3KC 5FY7A 3MIEA 1QU7A 2TEPA 2JENA 5I8SA 3VD7A 4MHRA 1GK9A 4QB2A 1JOJA 3E22A 5DDJ2 1LOBA 5LBQA 5BXXA 1BCCH 4CDXA 3T1CA 4LO8A 3GCXA 5CVRA 2VZRA 5FUIA 4DV2B 3OGRA 1UKGA 1AYM1 1SPPB 4K8ZA 1PMHX 4ZKIA 2QWRB 2OUJA 3VQVA 3FMGA 5CB4A 4QHOA 4EV0A 2R7EB 2KB1A 2P22C 3WUDA 2C2AA 4DRXA 3T1YB 5E1AC 1RPOA 4HONA 4JV4A 1FAYA 1QLEB 3UM7A 3IPVB 1PNLA 1XMOO 1WCUA 5CEHA 1I6XA 1E1RG 1DIWA 4GWMA 4R4XA 1OHHG 2FZ2A 2YS8A 4XJWA 1X9TA 1WLTA 3I59B 4LEJA 2ARAA 1WW5A 2HVJC 2YSUB 1X82A 5DUXA 4NAMA 4BQ1A 1IKQA 2JDNA 2I74A 4IE5A 3BCWA 4DR1B 2QWPB 4EFEA 4JI7B 4D6RA 4IDZA 3VOUA 2OYQA 4Y24A 4GKKO 4P9IA 2WL1A 2OVUA 3PDQA 4RS5B 4XZPA 3ASOB 4GH4B 4Q6GA 4DOUA 4K21A 5LA2A 2WNVC 4XDOA 2OXBA 1Q8OA 5I0DA 4JTCB 2IJHA 1UF2C 4LK7A 2VULA 4PBOA 1Z7S2 2P4EA 2DQ0A 4RQFA 3PVBB 2WO7A 1Q8SA 1RUJ3 1GNYA 2LFRA 3FLTA 3ACHA 3ZSJA 3OMIB 1WPBA 5DN6G 4C8DA 1NLSA 1KKDA 1I3HA 2RV9A 3O1VA 5JOZA 1JU4A 4OUEA 3NXSA 4O2BB 1ZM1A 4XUNA 3L2YA 2LP7A 1PZ7A 4DR7O 4N7IA 4SBVA 2V73A 3NWKA 5C9AA 3AG3B 1LRHA 2ZX0A 2WWWA 2JJ6A 1W0KG 3KQ4B 1QH7A 1OPOA 4RFT0 5FXVA 5D1IA 1DU3D 4DK1A 2JG8B 1D5AA 3VZNA 4RAIA 4IETA 2R32A 1DZTA 2PHXA 5A1AA 1D4M1 4FVMA 4PI2A 2WLNA 4YYOA 2XMLA 5FPVA 2WLLB 2IVIB 4M01A 3PMSA 4LLOA 2IXJA 4FZ0A 1KJRA 4EYUA 4TZDA 1MS3A 3ZXAC 2ZHMA 1PP9H 4MXWA 4F6RB 1MR5A 4O61A 3AKQA 4YFZA 5HPOA 3HBZA 3VBHA 3WDUA 3RYFA 1CJPA 4O4JB 3JAWA 4EZ4A 4F8AA 4AI0A 1YJLA 3ZFFA 4Y3OA 1AR71 5EK0A 4N90A 2WIIB 4R50A 2ITDC 1G9AA 2GUZA 1KBHA 1ZBE1 4XVHA 3FAVB 2EIBA 3UL2A 2HHHO 3S57A 1D7PM 4INDA 4YW5A 3FE5A 2BEOA 4U7NA 1NOVA 3LUTB 2XOMA 1AJOA 1YF2A 2E26A 5BUVA 1NCQA 3ZN6A 3OTOO 4NOTA 2WA4A 1HB3A 3BOPA 1LOCA 2D43A 1N3QA 5SV8A 1KECA 3ZMTA 3G6EV 2DUQA 3BIEA 1MG1A 1W2OA 1TGOA 3ZPOA 1SA0A 4J11A 4YGBA 2WS91 3ZMUA 4DS0A 4AEKA 5FZ3A 1BZWA 1HP8A 2CY6A 4NJ4A 4LF4B 3ZYIB 4TV9B 2P37A 2XDVA 3SJAC 3M1HA 4GIQA 3SR2C 4W4LA 4JGYC 3AMPA 2VGDA 1HRI1 5IUQA 3O0WA 5LRSA 5DXDA 3POWA 3QACA 3OTFA 2ZOEB 1R093 2JG9B 4XDPA 4X1KA 2E31A 1FOD3 5K0UC 2WNUC 5LASA 4MGSA 4CCDA 3WCRA 2HWE2 4Q0QA 4J1WA 4JZRA 1IS6A 4WZFA 1ND3B 4Q4W1 2Y6HA 3OPZA 2XBO2 2PZSA 2AH2A 3MIFA 2D5HA 2OZJA 3B01A 2HWE3 1N0NA 3ECQA 3RYRA 2OZ6A 3ZM8A 2VOVA 2XBO3 1ACCA 3HOBA 5DAPA 5LK7B 1WMFA 4QX8A 4CDUA 2JK5C 5FJHA 5C3QA 4K7JA 5I8TA 1DQ1A 1D4VB 1HX6A 2VNGA 3N36A 1MEC1 1OCOC 2P5BA 4URTA 1CX1A 1JU3A 4CS3A 4LE3A 4XFFA 1M56B 3K2OA 4NTWA 1O7FA 1W03A 1KD1W 5JJNB 2GMPA 3DKWA 3BUCA 5T50A 4DV3O 4FXKB 4PDWC 3CJIC 5FK8A 2J1RA 1C8M3 5FXZA 3OEEG 3OGCC 1SKVA 5FUNA 1VB2A 2Q4SA 2JGDA 2L9LA 1P84F 2VOXA 3OGGA 1ZL8A 4RQPB 4NN0A 2W87A 4Q4Y3 3SDLA 1S2BA 1SHWB 5EYXA 4FM1A 1F23A 4NTXA 1JYCA 3VD5A 2JDHA 3Q8CA 1NAEA 1W6NB 2GU9A 1VQ9V 1JA8A 5EYPB 4LF8B 1Q7YW 4Y20A 1H8TA 3OY8A 3JD4A 2VO5A 5C3RA 4Z92B 1I7FA 2QQUA 2WNUB 1FKAO 3BA9A 5E6HA 1XHZA 2A6XA 3TXSA 4QX7A 2XONA 1PNFA 1ZZ9A 4C1XA 1AX0A 3OPWA 1NUKA 1XNRO 4HOOA 4B1LA 3TXQA 1JODA 1IX9A 3WQ1A 1L0NH 4Q4X1 4AL9A 3FFZA 3ZX6A 2HWF1 1SC5B 1W6OB 3I3BA 3LNMB 3JASB 1DGRN 3DV8A 3POBA 3UO3A 5A2QN 4AI2A 1O59A 5IWAB 5BPXA 5FY1A 3JD2A 4Q0UA 2VPVA 3ZPYA 3Q4HA 1XNAA 1KC8W 4AHWA 2F66C 1HDJA 1CAXA 1CWPA 4HZ3A 2WLHA 5GLVA 5FP7A 4GKJO 1WBLA 1LHOA 3VBRC 5CNAA 5F2SA 5KX5A 3TB0A 1SG3A 3JAKA 1OCOB 1L0LH 1N33O 3OCPA 2BRTA 2GSYA 5DEDA 5C8WA 2EIKC 3TYJA 3CJIB 2FD8A 1X33A 2R072 1ZWIC 4PDMA 5F3GA 4OX9B 5FZ1A 1Y6XA 3N2GA 3TNQA 5AVAA 1FFTB 2EINB 2CTPA 4CCMA 2VOTA 2Q5TA 1U5XA 2R061 2XJQA 5CA0B 3FC0A 4YW7A 2ZKLA 3F5TA 2QA4V 1V6KA 4FZ1A 2Q7EA 2Y48A 2D6PA 1RUE3 2Y4TA 1COV1 1UIJA 3VD4A 5FYSA 1PL0A 4UCRA 3LD8A 3T4DA 4YSFA 2YFUA 2RDCA 3U75A 2YXLA 1WJZA 2LGQA 4HNAA 1AR5A 2X5IC 2Q9LA 4WM7A 2PI5A 4LHNA 3GF6A 5A6XA 2P3JA 1BCXA 2FB5A 1O3RA 1V9U3 3JCZA 5ITZB 5FZGA 4L92A 1JHJA 4X1YB 1J3QA 5CG9A 2VZSA 4TQFA 2YIBA 3VHNA 1IXBA 3MDPA 1FXZA 4CP2A 2EIJC 5IT9N 4G27B 4J6GA 2CWSA 1HR0O 1WD3A 2YICA 1JYIA 5FMOL 5B1BB 1EM1A 3K0DA 1M9NA 5L3CA 1R6KA 4DR5O 3T4VA 3H1KH 3C3VA 2ARHA 1GN4A 4N43A 4L99A 3HKCB 2XPJA 5CU1A 4AGVA 4MGZE 2R70A 2MEV3 1LESA 3MLKA 4O7XA 3SQOA 5LHIA 4NKGB 2QTOA 3B8NA 4QXKA 1MQTC 3ZYRA 1YIJV 4XF9A 1FV2A 5J98B 5IYBO 2D6LX 1R1A3 4I5SA 4HK9A 3EJKA 1VBC2 2ZGPA 1JXNA 4MGYE 3S5AA 2EILB 1RINA 2BDRA 2QM8A 2JEMA 3N7KA 5A7WB 1Y66A 4G9SB 1UYYA 4KXRA 5FOJB 1BQ0A 1OQEA 5BNPA 5JLVA 2XQRA 1N0JA 3WG3A 2FDKA 1VBC3 4MW8A 5L9BA 1H9PA 1PK6C 4AHZA 2VCAA 2Q8EA 1ASJ1 1DGLA 4CU8A 1QHDA 5JIUA 4MXVA 4OI2A 2NM1A 3AM2A 3N9QA 3SH3A 1GZWB 2X5IB 1H2KA 3WV6A 4N53A 4QQOA 1VQ7V 3SC7X 1QR9A 5KMGB 1OOPC 2DCZA 3DYOA 1IBLB 2VCCA 4PLNA 2QDRA 4BW9A 3WF0A 1W0NA 4CP1A 1G8WA 2ZX1A 2A3XA 2WT0A 4ES8A 3KCCA 1CXZB 4AXOA 1HIXA 2E74B 1QJY2 5JCTA 3W5NA 4D7SA 5FZMA 5H9QA 1PO21 4Y22A 1H30A 3J7AU 5ACA3 1RSOB 3FWEA 1UZ0A 2CTWA 5EZWA 5EXOA 2QWQB 1CAWA 2PN5A 5L19A 4AK3A 3J9SA 3ELNA 1YI2V 5EC2C 2ZEXA 4D8MA 5T55A 5IYZB 3WW1A 1VRH2 1ZBA3 3BY6A 4X8AA 4XBFA 1RJ8A 4O4LA 2VXRA 3NSTA 4NYKA 1HJFA 2AR6A 5FP8A 4IV3C 3APBA 4ZXKA 1DGWA 1DTOA 5FPUA 4TWKA 1JVMA 2W68A 3KM5A 1PVC1 3ZIWA 1OI6A 1QXRA 1Z0HA 1XMQB 1G4YB 5HV0A 3A0RA 2VTXA 3NKTA 5T5OA 3IDEA 3GZTB 3RI9A 4AAPA 5FYUA 1VALA 4MVTA 2ZTNA 4CEWC
chains in the Genus database with same CATH topology
4CDWA 1DGWX 4Z82A 3LSEA 1RUH1 1H8VA 3MW4A 2E63A 2D98A 4F7ZA 4UW4A 1GZ9A 4PBPA 3ZMNA 5J96B 1TE1B 1BBT2 3NL1A 1I5ZA 3RYPA 2BWAA 1YWKA 4AVAA 1RUH3 1SLLA 1CIWA 5I93A 3G7DA 4Q0SA 2IFRA 2ZCWA 4C5WA 2VVEA 4K9SA 5FOBB 4Y1XA 4R9CA 5FAXA 1ZX5A 3AKSA 4Z07A 4LBKA 5CFDB 5LRRA 3NAPA 2D44A 4WM7C 2Y0OA 5DG1A 3B93A 5A3LA 4HN1A 1YIFA 1W6QA 1LGCA 3O0XA 3FZ3A 2CGNA 4LE4A 2D97A 1PIV1 3KZ4C 4LHKA 5I0UA 5KXCA 3RPQA 4D7TA 1MEC2 3B7MA 4LBLA 1BKZA 1RMU1 1KD7A 3B00A 2DCKA 3C2UA 3O12A 5C8CB 3LGRA 1PIV3 3J26N 4X6RB 1OMIA 3LAGA 5JDBA 2OG7A 2HJIA 4M3CF 4A7ZA 1RMU3 2NQYA 5FMOS 3ZXJA 1CAXB 2P3IA 3UKNA 1JBCA 2XLFA 1RUG1 1HV1A 1IQAA 3UKTA 1PO11 1CGPA 1C8M2 1CN1A 2D6MA 1VBB1 2JECA 1ENQA 2R6QA 4XXPA 1MEC3 1RUG3 4HKWA 1UU4A 3ZFGA 3M3CA 2A7AA 1PO13 2R16A 5FPXA 1JN2P 1VBB3 1C57A 5H9PA 1ZNPA 4I01A 2RS52 4Q4Y2 3VZLA 4CDQC 4RL7A 2EXKA 3FHIB 4FPJA 3DPRA 4XBLA 1PHMA 1YFXA 2N7GA 4SLIA 5B2GB 3P3PA 4HLTA 2DVBA 2NPIA 2RR11 2RS51 4GALA 3KCYA 4KL1A 2ZMKA 1UZZA 4N43C 1HRV1 4JAAA 5H9SA 1ND2A 3R4UA 2RR13 2RS53 4CDXB 1H2MA 1SQ4A 3RYKA 1NY71 3INAA 3WDXA 4K1YA 2A71A 1HRV3 4EJRA 1GNZA 1VLNA 3KT4A 5CG8A 2G9FA 4XW3A 2ZZQA 4I2OA 2QCSB 4OI1A 4Z1VA 3CLPA 3MYXA 4BZ4A 1IOAA 4C91A 5BNOC 4IXLA 2DTYA 1UU6A 1XE8A 2ZGUA 1B35A 5L36A 1F2NA 4FQ4A 4JGYB 3VDDB 1FPN1 1OS7A 1AX1A 2H6CA 2D7FA 2IXLA 5DUUA 4HPKA 4OUMA 1CAUA 5JVVA 3M3EA 4AVBA 1FPN3 1V70A 2DFCA 3W58A 1AJKA 4WVMB 3RMYA 1YHFA 1OIJC 5K0UB 3BALA 4FTSA 2JG9A 4ZKTB 4MLOA 3USUB 1AXKA 3LZZA 4Q4X2 2UWBA 1DFQA 2GALA 1WW7A 4ZU5A 5L7OA 1SCRA 5BNPC 2ARXA 5BNNB 2EF6A 1QNWA 2HWF2 3MI8A 1NYWA 2ZGRA 2P17A 2WNEA 4K40A 3UKVA 2I45A 3VZMA 1ND3A 4DQAA 2PHRA 4PIYA 4YW4A 4XHXA 2VVFA 3W59A 5JZGA 2XKOA 5GZCA 1TQ5A 1XYPA 1CD3G 1MVQA 3HMYA 1LR5A 5JSPA 3RZZA 3SH5A 5D8AB 3TOJA 4KWJA 1ULEA 1ENXA 4D69A 3V0AA 1QJX1 3VKMA 3U07A 3MLLA 3ETQA 3LA7A 4KG0A 2JD4A 1AR92 3MIGA 2AZ5A 3ZXDA 1OHFA 4A7YA 4N53C 3MICA 3AKPA 5LK5A 4D7YA 4YARA 5FO8B 1QJX3 4PIXA 3WP6A 1LEMA 1H1IA 1C5IA 1F9KA 2W39A 4ITCA 1AR91 1V6NA 4TSVA 4HSJA 2ZAHA 4FPGA 2RM22 5E16A 5IK5A 3ILFA 1AR93 4A2UA 1K5MA 1RGSA 1V6MA 5FLIA 5KHJA 3AP4A 4HANA 4MZUA 1DQ6A 4FSJA 3VBSB 5CFCA 1F31A 1UX6A 1WLCA 2KA3A 4XQ4A 1VZ5A 2GAUA 4EROA 3LSDA 2ZGLA 2TNFA 1RUF1 2ZGTA 4FO9A 1LOEA 1S2KA 1ULCA 4NWVA 4FOWA 1AZDA 3O5SA 3PVEA 4RS5C 3ME2A 3V65A 1RUF3 4E2QA 1G9DA 5J37A 3CU7A 3KCXA 2H6BA 1QWRA 4BHPA 3D8CA 4PDWB 2SBAA 1G9FA