3D8CA

Factor inhibiting hif-1 alpha d201g mutant in complex with zn(ii), alpha-ketoglutarate and hif-1 alpha 19mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYGEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3d8cA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d8cA01
1H2MA 2CGOA 2Y0IA 4JAAA 5JWPA 2CGNA 4Z2WA 2W0XA 2WA4A 3KCYA 2XUMA 1H2NA 1H2KA 3OD4A 1MZEA 2WA3A 4B7KA 4BIOA 3KCXA 1IZ3A 4Z1VA 1H2LA 2ILMA 2YC0A 3P3NA 4AI8A 2YDEA 1MZFA 4B7EA 4QU2A 1YCIA 3D8CA 4NR1A 3P3PA
chains in the Genus database with same CATH superfamily
3M3EA 1EPWA 4CDQB 1GQPA 1LOFA 1AR82 1V00A 4AEDA 4GYCB 1HV1A 4PIYA 5K7PA 1FFXA 2FQPA 4N7IA 3SMHA 1W6QA 3M3CA 2VMGA 3IAYA 5LYJA 2ZHMA 5JOWA 3LDKA 2BTOA 1YO8A 4XFCA 5E8AA 1SQBH 4HAMA 4FI9A 3OR6C 4BPZA 3CPWU 4AZZA 2RJLA 2K9ZA 1JHJA 4QAWA 3FB6C 4UB6Z 3OMIB 4I0AA 3H8XA 1Z0HA 2QQJA 2NLRA 1JHNA 5B1NA 1Y7BA 2RS53 4MG2A 2WLIA 4MO3M 4BLJA 5IT9N 3O1OA 3VBOC 1VBD3 1BS3A 5LK5A 2EBOA 4F3JA 4Q1RA 2QM7A 3GALA 1OA4A 2EXKA 1XYOA 1PK6A 4EQVA 4ZS3A 3KT7A 2ZM6B 5FPXA 3E5QA 3RG0A 3ZMTA 3B77A 5GLWA 3AKSA 4OHVA 1MMMA 2Y4TA 3N2KA 2PUSA 4BWOA 3E6CC 4QIWF 4BW5A 3T2OA 1JPXA 4TN7A 1RXFA 4FXKB 4PJYA 3L70H 3X29B 2P4EA 3UL2A 4NWVA 3WCRA 1Q8VA 2KG7B 3AMQA 4RYDA 3JZVA 5GLTA 1IBLB 4BA6A 1AR62 4XDPA 4DUYB 2DYSC 2A71A 2CWMA 4PF1A 3ABTA 4QXHA 1A8MA 1YZBA 2A1XA 2HWB1 3WP3A 3H1HH 2WQ8A 2YSUB 2RJ2A 2CGOA 3VB9A 4R9BA 3RVYA 3ZYPA 4I55A 1N34O 1J95A 2BBAA 4HKOA 1QJEA 5A3NA 2LW7A 3AEIA 1RUI3 4JYYA 2R062 1CZVA 2RR13 1PO13 3HQXA 4J42A 1VAKA 5DUXA 4OMDA 2R7EB 4IE6A 3ZYGA 3ZN0A 1BXHA 3T1MA 1GN6A 4J1WA 5FYSA 1AX2A 2G19A 5C3OA 1KS5A 4XBQA 2WFF1 3SEEA 2WS91 5C5UA 5CA1A 5FZGA 1JUIA 2DCKA 3AG1C 1F4AA 2NM1A 4ES8A 5BMVB 1ULOA 1NLSA 3LSQA 3K08A 3UYJA 2DCYA 2O0OA 2ZAAA 3NKTA 3CF6E 4LBQD 1NUKA 2BPA2 4PIZA 3KCCA 4N43A 1MSDA 4FPYA 3RMYA 1H8HG 3CJIC 2ZXQA 4QX0A 2ZEXA 4I30A 1AVBA 1C4RA 1RJ8A 3WHUA 1VP7A 1PMIA 2Q1MA 3IM0A 1LHVA 2CGPA 2V73A 1JZ3A 4IEXA 3Q8FA 5HFMA 2XJSA 3D0SA 3WZ1A 4KMQA 4AFMA 5FP3A 2WNUC 2IJKA 2YUAA 1KDMA 4P9OA 4AGRA 2C24A 3ZYRA 3HQUA 1SLBA 2JS5A 4UBHA 4X66B 4TV8B 4WM7C 2UURA 1BHAA 1GTOA 5A32A 2GNDA 2Q4SA 1N3PA 2VXJA 1G8MA 3H8UA 5B3SC 1DBNA 2VY0A 1CAWB 3AG4B 4HT1T 1YQCA 2E74B 2LS6A 4DXZA 3AG3B 4LP8A 3J26N 3BI3A 3JBG2 4PDVA 4LO4B 4GX5A 3CC7V 4D6TH 4LE4A 3IWZA 2OW4A 2R0HA 5A7QA 1R1BA 2EIKB 5BNOC 1AP6A 3BN6A 1WB8A 3UO2A 3LA3A 1G9CA 4UB8Z 4KU8A 1V55C 4FOVA 4D7TA 1FAFA 5DG2A 1SHWB 4PLOA 4NTYA 3W5MA 3WVJA 4XABA 4CVUA 2G38A 3RMXA 3H9VA 2A6XA 2BQPA 3J4UH 4QKFA 3PIJA 3WB2A 4FFHA 2W1SA 4CH6A 4W4LA 3VBFC 4AFDA 3ZXFA 3P30A 4WBBA 1WCSA 1LHOA 2W2IA 2RS12 2GN7A 1K7DA 3NMBA 1HXS2 1SLAA 5J1XA 2WNVB 1NVPD 2CSGA 4X1YA 1VBE2 4XF3A 2HEWF 4E8CA 3IZOA 2ITCC 3ZIXA 5IT6A 2VW2A 1MG1A 2ENRA 4Z1VA 1JYIA 1HRV3 2L6LA 1ND3C 1OPOA 3C3VA 3RSJA 4Q4X3 1KYOF 4UFHA 4AR2A 1UOFA 3RYKA 3MBWA 3TETA 1RXGA 2J7MA 3HMYA 1V6OA 4JZ2A 3ES4A 3CXCU 5FRAA 3B7MA 2YC0A 2PYLA 3OE7G 3A23A 4PELA 2QWRB 1FMD3 1OCOC 1G9FA 2WLLA 2EIEA 1NQDA 2RDRA 3GCXA 3KCXA 4JI6O 3CYOA 3ACIA 2KXLA 1NU1H 2R073 4HG6B 2LJ2A 1Y9GA 1Y4WA 4DV2O 1WW5A 3L9JT 5L3CA 5FUPA 1VP6A 1XU1A 4LOSA 4RR3A 5J3UA 1WA8A 3BA8A 4AHZA 2EJ7A 4Y1ZA 2ZT9B 4CDWA 2F93B 3AP7A 2JVDA 1BK1A 3RJRA 2QE7G 3ZO0B 2DUOA 1UIJA 5DZFA 1ZM1A 2WO1A 5AC91 1PO23 5FLHA 4QKBA 4V2WA 3PVOA 2Y33A 5IVBA 1YWKA 2W52A 3ROUA 2W6IG 4IV3C 3AYEA 3NV2A 3ZDVA 1OFNA 1CPYA 4FPEA 5JDBA 4JKMA 4JI4O 4ZHQB 1YUDA 5FZIA 1Q81W 1HRI3 4UCSA 5FAXA 2KM2A 3A4UA 4QM9A 5J09A 1AYN1 5KA6A 2XAHA 4N53C 1QJX2 4DNYA 2XAJA 1VMHA 3ASOB 5DXDA 4DB5A 2BNMA 1C8M3 1D0HA 3RNSA 2PHXA 2DTYA 4JVAA 5F2SA 1FOD3 3UKMA 2BEOA 2VOTA 4YGDA 3WF0A 4ISRA 2WO2A 1RUG3 2AGSA 3AMNA 3W58A 5HXVA 3SPGA 4FPCA 3AP9A 2Q8CA 1ENSA 5JJNB 2JECA 4IW3A 3KF5A 3JALA 2OQ6A 1KGYA 3HIFA 3WDXA 1V54C 3CS5A 1UPGA 4CH4A 1HX6A 1RUH2 4DEQA 2UXBB 5FPLA 3M7AA 1OKQA 2DURA 2HWB3 4EN7B 5KMGB 3MIEA 3WDVA 4Z82A 1UX7A 2ARAA 5FYIA 5JR2A 2HBTA 4R6ZA 5IVFA 4OFGA 4N23A 4X64B 2XGXA 4AI3A 3BA9A 2BVVA 3GWKC 2PHWA 5GALA 2Z5UA 2D44A 4XZUG 2SBAA 2RDQA 2VTXA 4XUNA 1GQHA 2XL9A 2WFPA 3NWKA 3RFRA 2TBVA 2WWSA 3OUJA 3D0JA 5C4WC 1AR61 1N47A 3UGFA 3BHPA 4XDJA 4IV1A 1GM7A 3IJ4A 1G6NA 3U07A 2R30A 3VBSA 3V65A 4I02A 4B7KA 3NNMA 1CZSA 4TUYB 1JYTA 3ZFGA 4PD4F 3NAPC 3VZNA 5FJHA 1IS3A 4DUXA 4O2AA 2R061 4FO9A 4XFHA 5JMOA 1DFQA 1R1A2 2JENA 2VC9A 4K0KB 3ZSMA 1TMF3 5D8AC 1LR5A 1MZ5A 4Q4Y2 2PAMA 3BTZA 3R05A 1XOYA 1NZCA 1E79G 2CNAA 4DV6B 1OF3A 3WNXA 4AVVA 4YM2A 5BNNA 2NR5A 4K8XA 3LFIA 3KHBA 4LF4B 3ETDA 1QR8A 4DUWA 2B1GA 4CDQA 5FNVB 2ZX4A 3OPWA 2PHRA 3LSUA 2HR3A 1WPBA 1FXVA 4JI7B 3ZIAG 4RGAA 3ZXEA 1KECA 2ZE5A 1YCIA 2VM9A 3ABMB 2AC1A 4U2AA 4X62B 2P4KA 3VOUA 3ZXKA 4P02B 3OTOO 2A79B 2XWJB 2MEV3 4D6RA 2QTSA 4E27A 2VUCA 2W94A 4ZY9A 4YVSB 2IXHA 2LM3A 2UYAA 1Q43A 2QM4A 1PGW2 3MIFA 2QKCA 3B02A 3EHBB 4J11A 4LFBB 1FKAO 1S2EA 5CFDA 2QNKA 1W2UA 3GGLA 2NMNA 4NPRA 3BCCH 3WNNA 1SBDA 1W06A 3PNAA 3WLUA 5H2FZ 3ELNA 4DR3B 1M06G 4HK8A 1IS6A 2XKOA 2P90A 2FMLA 4XURA 2WAMA 1RPOA 4SLIA 4GKJB 5L9RA 1UPIA 5LZ6A 1MA1A 1UIKA 4CS3A 1K33A 5C8WA 4GULA 2PLV3 4FCAA 1O3RA 4LT5A 3NJXA 1TVKB 2KG7A 4CUBA 2YROA 2QJVA 3KV4A 3QACA 1S5LZ 1QQCA 2UU9O 2X5IB 2QWQB 1O6UA 2ZACA 1AXZA 1I94B 2O8OA 1N1VA 5BXXA 2RS11 2XR4A 4K35A 1RUF2 5DAWA 4GH4C 3C90A 3SPCA 2Z3YA 4CEYA 3ZFFC 2YPJA 5T55A 1K5JA 1VBE1 1G8WA 4COVA 3CCQV 4AVCA 1F9KA 2VW1A 2PMWB 3I4IA 1F15A 3CEWA 3AVRA 5H6QA 5CBGA 1MS1A 3JD2A 2UU8A 4D7YA 4FVVA 5I8SA 5KHGA 4AVAA 4ZOLA 1O8PA 2BFUS 1PL0A 1C5HA 5BMVA 5DAPA 4URAA 2PA7A 2PXJA 2TEPA 4JGZA 4UVAA 1ASJ3 1UYZA 1ULCA 5FPAA 1PNKA 4QHBA 3WG4A 3O65A 1YSCA 1G6UA 4HL0A 5BNPC 1K5MB 4OQ8A 1WP8A 1W8ZA 2NN4A 2GC1A 1P4RA 1U5ZA 3CEIA 2ZE7A 3RW0A 4E4SA 1N32B 3A22A 3H01A 2H6BA 3OY8B 5D5PA 4FLTA 2BTQB 1RMU2 4ONUA 2CK3G 1BMV2 2XOKG 4Q5OA 2DQ3A 3ABZA 5KXDA 4JTAB 1YC61 5GZDA 5CG9A 1DG6A 3T30A 3V64A 1MS4A 2VMDA 1AR83 5LA2A 3D36A 5L3BA 4JC1A 4PDLA 3GJBA 2IJJA 4ATEA 3QVNA 3DXUA 1ZA4A 5BR8B 1CX1A 5T5JA 5T50A 2BE3A 2Z0AA 1SFPA 4BQ2A 2WYFA 3J80N 5FMOL 1V6NA 4BHPA 3M8LA 3H8OA 2JDYA 1MZFA 4F83A 2QBXA 5FZAA 5HV4A 1UOGA 2ZHLA 4GKKB 2W0XA 3PTYA 2R042 4JQTA 3S57A 3DXTA 2FDGA 4CXXA 2JICA 2HYXA 1UMIA 3JCUZ 2D2CB 3IPVB 3LOIA 1M1KW 3FZ3A 1M57B 4UV9A 5AVAA 5DZEA 3N7LA 3FB7C 1AL22 1AI6A 3GB7C 4OXSA 4CZSA 4R8CA 3LA7A 4JV5B 4LHSA 4NROA 2F4VB 3J9SA 2J22A 3U78A 4YNIA 2P4VA 3ZN1A 4DV7B 2BTVC 4FLWA 4FXGB 3S5QA 1NAEA 4NIHA 5B1AB 4UXNA 2WNVA 1TUBB 3VDAA 4PQQA 4W50A 2Q7HA 3LQCA 4KHPO 3RWRD 3DXRA 4CC6A 3FYIB 1AR63 5DM6V 4GALA 2OPWA 1EN6A 1RUH1 3N35A 5FXWA 4FOWA 1CIYA 4OPAA 1KD1W 3CRMA 3D3IA 2J42A 4X6QB 1U5YA 2AEZA 2OXBA 4H7LA 1JOPA 2QSAA 5LXTB 3O1VA 4U3FH 1W9YA 4LF7B 3ZYBA 1QHDA 4JI3O 1M4UA 5H6RA 2CHHA 5FZ4A 3Q8CA 2R063 2A3WA 2WC2A 1W90A 3HAGA 1R1ZA 3ZHUA 3RZJA 2ZGUA 4FT8A 2FMYA 1GAXA 1K34A 3ZOIA 1RTVA 5E1RA 3P6BA 3ACLA 2DU1A 3AKQA 2PF4E 2VR4A 4IDZA 1JQ0A 1PK6C 3AFKA 3ASIA 5LRSA 2BBVA 5FZLA 1A3KA 3I2OA 2FCVA 1OKOA 3AZVA 1RVF2 1DQ6A 5FPZA 4LFAB 1NCRB 3NV3A 4UFZA 1FAYA 1GNYA 3KV6A 1ULEA 5B1BB 3CC2V 1XDCA 5TISZ 5FZ3A 3JQXA 3W20A 4XJ8A 3CNAA 1MVQA 1HB4A 3MFAA 1V0AA 4PA3A 1X59A 1XMOO 5H9PA 4TOIA 1QDCA 1HNWO 1V70A 5H9QA 1WCDJ 3SLIA 1BYHA 1A6CA 3NSTA 2XLFA 5IDJA 3FHIB 1SZBA 1R1A1 1K92A 4L9BA 4MHUA 2QDRA 2OZ6A 3T4DA 2SLIA 1PZ9A 4NHLA 3SISA 3HKCB 3JSNA 1DZQA 2AXTZ 4MYEA 1I3HA 3HN1A 2RS31 4Q4Y1 1ULGA 4LWSB 4JYAO 3OTFA 2Q30A 2BGCA 3V0AB 2FDKA 1MR5A 3LPFA 3EB7A 1OUXA 3JBG3 3GHMA 4XBFA 4Y3OA 3AKRA 5FZOA 3CL1A 4DXTA 1NLRA 2ZOEB 3POGA 2VQFO 4ZKIA 4Q4V2 2X10A 3TNPB 4DV1O 4LE3A 4LNUB 4WZFA 2QQMA 1RUNA 2EZPA 2GH2A 5GZCA 4FTEA 2H0BA 4Q4W3 3S7IA 3WB0A 1CPMA 2YEVA 1RL3A 1MS0A 1T6BX 3S7EA 4N43C 1ZAUA 5FBJA 1WUVA 1V6JA 4C90A 4JI8B 1T5EA 3SCFA 3LOBA 3DEMA 4QPIA 1QQP2 1F4HA 3OSDA 1SBFA 3THCA 2MNGA 2LW8A 1PGL2 1NT2B 1R3JC 1TAEA 4JHZA 3U75A 1UJWB 1PGW1 2Q7GA 1MQTA 1OCRB 5BNQA 1HXS3 2ILMA 4GWNA 4IE0A 4H7MA 4ZXEA 3HR0A 1FD9A 3ZRSA 1YITV 1PZ7A 4AQSA 3Q8EA 2YBPA 2VPVA 1GZCA 1BZWA 4DIQA 2W87A 2A75A 4BIUA 3AP5A 1GO3F 4LK7A 3H1YA 2GC3A 1FX5A 3AK2A 1RUD2 4IGPA 4KWKA 1RIRA 1R73A 5GTHZ 5J2TB 1SLTA 4XMIA 2P17A 1JS9A 1N8RW 1NOVA 1HWYA 1N0JA 3OEBA 4QB1A 5C7GA 1YVWA 4MVUA 5JI7A 5DAVA 3G67A 3N7KA 1PKXA 1WMXA 4UT5A 1L3JA 3N9NA 3E22B 3LWCA 4MXWB 3T09A 4QJFB 3FUQA 4P5YA 2E31A 1U5XA 1YXWA 3OUIA 5FKBA 2JG9A 3BKZA 1YIFA 1NS1A 3GYDA 1NKGA 2DCTA 4QPYA 4DUVA 5F3EA 5EC2C 4YIOA 1M56C 3WW4A 1B35B 1HN0A 2WT1A 1HJFA 3VD4A 3G4SV 3H7YA 3T08A 2OIEA 3MZHA 1YJKA 3JARA 2VVFA 1NH2B 4JAVA 4ZU4A 5GZFA 3POFA 1G9AA 4B3SB 2DYRC 2GALA 1WMDA 5C9AB 1ZVFA 4I9WA 2WWJA 3M3QA 1SDDB 4HVRA 3APOA 5DEDA 4EWEA 3F5WC 3R4DB 3OAAG 1S0VA 3RJ2X 3K9SA 1QLEB 5J7MA 5K1XA 4LHLA 2QQPA 2ZHKA 2W46A 3OGCC 5DECA 2ID4A 1ENXA 2QVSB 2PQQA 1POV3 2ZX0A 2J1AA 3ZJZA 3R4UA 4KWUA 4W4ZA 1XMQO 4AYUA 5CA6A 3VKFC 3PDQA 4I0BA 3O5SA 2VTXJ 3EBRA 4JPRA 5IFPA 1BMV1 5H5NA 4UW3A 3J7MA 4LF8O 2JDIG 5CB7A 4KQ7A 2VNOA 2BGPA 2YHJA 4K3UA 3T1HO 3UNPA 2ZKOA 1QJX3 2VUAA 2XAQA 2A6YA 3LEIA 2FL4A 3UT5B 4DW1A 1OUSA 4DUZB 2ES3A 3BUCA 1UKRA 2WL1A 2D40A 3C8XA 3DN7A 1VF7A 4BDVB 4JI1B 4J80A 2XJVA 4B29A 4H13B 4YVSA 3OM3B 2ORXA 1WNSA 2FDJA 2YFUA 5LL6Y 5L3FA 4J1XA 5KXBA 3HR9A 3POSA 3SYPA 3ZEDA 3AM2A 3CJXA 2FTKA 4BQ1A 3APQA 5IJRA 4PDWB 1NY72 2P1BA 1D0GA 1XL4A 4LTAA 1ZZ7A 2O57A 3E1F1 1IQDC 4HETA 5KBFA 5EWSA 2Z5WA 2UUAB 3RZZA 3K77A 3M3OA 3THTA 1LOBA 1XXNA 1UY4A 2UWBA 1EP0A 4XIOA 1H2MA 4JAAA 1W6NB 1PIV2 1Q8SA 3MV11 3IDCB 1X9PA 2ZDIA 1RHI2 2B45X 4BQYA 1TVKA 4HN0A 4KG8A 2ZM6O 5A7WB 4P9LA 4R7CA 4ZKTB 4XUQA 2VMHA 1DYPA 2X5IA 3I2KA 1YFUA 2Q8OA 1WA4A 4G27B 2ZEWA 4DXWA 2VECA 1UL9A 1VQMV 4CDXC 2JK5C 5FYZA 1LEDA 4ES9A 1SQFA 3BU7A 5I93A 1ZBA2 2ZA9A 1DCSA 5FY8A 3CZJA 1DGLA 1IS5A 2VUDA 4DUYO 3RI8A 4BU2A 4CCKA 4QU2A 1SCSA 4CRQA 3B09A 3AZYA 1L0NH 2NQYA 4JRAA 4I9QA 3G71V 4QWNA 3I2FA 4BQ5A 4FP3A 1JN2P 1J1LA 2Y4UA 4XFAA 2FDFA 5JCTA 1QBZA 1W0JG 3ZMVA 3PJYA 5FZDA 4F6EA 2HYKA 1J58A 3ZXDA 1K5MA 3KQ4B 2C5DA 3OFNG 2L35A 5LY1A 3JATB 3WY6A 3ZSKA 4NXMO 3OY8A 1RVF1 3MD0A 2IZWA 3BIEA 1WZXA 3AG2C 1ZZ9A 4H14A 1FXKA 2W1QA 2QZ2A 1VB2A 5BYNA 5I8TA 4WM8A 3E89A 1BLZA 4IEVA 1COWG 2EIJC 1NA1A 4ZZ8A 4CBCA 1VQ5V 3B5LB 1LNSA 1CAXA 1AR1B 2BV4A 4P9XA 2ET7A 4RQFA 4GCZA 1VQLV 1VQ6V 1XNTA 4QPJA 3CSXA 3ZCCA 4IV1C 3H42B 1XU2A 5J36A 4DR2B 3POJA 2E32A 5A6XA 3SPHA 4AHWA 2DDUA 1DLBA 1NR1A 4P9GA 1OA3A 3WSOA 2EXJA 3DPRA 4Q20A 3ZVXA 2C26A 4PLMA 1OZ0A 4B3MB 1GFF2 1QEXA 1TME2 2ARBA 1H4GA 4GKYA 1O4TA 3TNQA 3IPVA 2R70A 1XL6A 4RO2A 1QXPA 1VMFA 4QX2A 4NHMA 4MVZA 1P7BA 1XNRB 4RUFA 2Y0IA 4EYUA 3WUCA 3JD73 4AOCA 3D3QA 4Q4V1 3G6BA 4HLTA 2Y64A 3PTRB 2NYYA 3VDCA 3MEPA 1YQ5A 2VBDA 3PVNA 5T5OA 2Q7EA 3WFVA 3KT1A 1KDKA 3PJQA 4JZRA 3K5MA 4QPWA 2B42B 2EZOA 3KG2A 4UW6A 2JDPA 5CBHA 3USSA 3RZHA 2GUZB 4M01A 4PBOA 5FR3A 2ZXWB 2JG8C 2B5UA 3H1LH 3EXAA 1QJU2 3WHTA 4EE2A 2QKDA 5CKNA 2X09A 1QQP1 1TUBA 1UX6A 1MS5A 4IYIA 2WABA 3CRCA 1XOUA 1MS8A 3HKDB 3BEHA 2WSSG 3STLC 4JYCA 1VLNA 3K0GA 2JIGA 3RWNA 4PI2A 1RUF3 4MH0E 1W8WA 2QQWA 2AGAA 4IETA 2DF7A 4ZS2A 4J10A 1DLCA 3DGTA 4Q0UA 1S5JA 4LKEA 4LA3A 1GOHA 1U0AA 1B3QA 4RGGA 3B01A 2RS52 2HLDG 4FPLA 3MO4A 4QQOA 4DR5O 3P3NA 1VBD2 4R9AA 1R3KC 4HBNA 4IT5A 4FJCC 2BCCH 3PU8A 2WZR2 4UVBA 3I2GA 1VAMA 4F7ZA 4MSWC 1J59A 3WQBA 5CFDC 4W6YA 4CP9B 3J7LA 2XLGA 3E2EA 4FSJA 1ZREA 3KQRA 2IXIA 3UKVA 3C7EA 1GMGA 5FP9A 1N0NA 1K3IA 3S30A 5CISA 1NCRA 4EROA 5FWJA 1AR92 3KS7A 4GT1A 1OLME 3VBHA 1DQ1A 4TLGA 5FLIA 1VMGA 1WCUA 3JCIA 1AP5A 4BXSV 2XNDG 2ZGQA 4CU9A 1K45A 1AJNA 1RMU3 3JAMN 4H0LB 5T52A 4E4HA 2E5LO 1JXNA 3FB5C 1SETA 5FZEA 5FLXN 2VRZA 4QNHB 1D2QA 1UY0A 2ARHA 3RYHA 5KAIZ 4QPGA 1OVSA 1NCQC 4FFGA 3PUAA 4HSJA 5HFLA 2ZHNA 2PTMA 2Q73A 2EVXA 2VXRA 5JSRA 1NE4A 4FQZA 4QPKA 4CEYC 3ZHRA 1VMJA 5C6CA 3QH6A 5L7OC 5FZKA 4LWSA 1ZX5A 4JV4A 1D5AA 3RYCB 1KS4A 1Z7S1 2A3QA 1ZRCA 4A7KA 3V0AA 1PO12 5C8YB 4KBZA 5FYMA 3LDRA 4DMIA 1WLTA 3O1SA 3JAWB 5FIXA 5LWBA 1FPOA 1H8TA 4FIPC 4QGLA 2R043 3VKMA 1WBLA 2JXAA 5J98B 4LNUA 1A34A 3GZAA 2Q0OC 3B9CA 4O9EA 5H9SA 2LRPA 1MNGA 2J1RA 1R3IC 2JDKA 4XBLA 4JGZC 5LP6C 4DRVA 4MT8A 4XVHA 4ET7A 2HWF2 4CYDA 4MGIE 2Y6JA 5ABJA 1AL23 2VQAA 2Y69C 2FZ1A 1GANA 2Q5TA 4AFBA 1IHMA 3ZFEB 3ZKUA 4IHJB 2CDPA 4OQ9A 1XJAA 2E9QA 1T6GC 4CPBD 2WA4A 1MEC1 3IKWA 1KP2A 1EAH2 2ORZA 1AF9A 1W05A 1GH6A 3K58A 5C8CC 2AZ2A 5JOXA 2WWUA 2WRAA 5SV5A 1VRH2 2W68A 4FLZA 3FUOA 1XRUA 5DMYA 3KV5A 3VBRC 4PBPA 3JD0A 4P2ZA 3VUOA 1M90W 3D36C 3PJSK 5KAFZ 1SLCA 4K7JA 2P67A 1REEA 2XBO2 3MYXA 3BIWE 2UXBO 4BIFA 1OSGA 3ILFA 3EHKA 1SACA 1NTZH 3GVMA 1PIV1 1AX0A 2I07B 3VN4A 1KQRA 2LQTA 1RUC3 4DEVA 4JKLA 4WBNA 3CC4V 2HHHB 4DXRA 1OLMA 1OHFA 4K1YA 1ENQA 3TJTA 1PX4A 3A0BZ 3ECQA 3R0RA 3G7DA 5JVVA 3VBOB 1QKQA 4OVEA 3O14A 1S76D 2XHKA 4GWJA 2JGDB 4X64O 2F4PA 1YDXA 4MXWA 4C1XA 1KFUL 1KC8W 3MLKA 2F66C 3L9DA 1CAUB 5JXGA 3KZIZ 1EV12 5ACA1 4CS2A 3HNYM 5EBMC 1PMJX 1RVF3 1ZNPA 4I09A 4I7ZB 4JGYA 2HWD2 1B35A 2X0LA 2AR6A 1N1YA 1F4MA 2ZBJA 3NVCA 4WVMB 3ETEA 1NBMG 3E5UA 5CB4A 2XPJA 4FFFA 1DGSA 2OS2A 3MLLA 3I2HA 1S3JA 4Y20B 4M0HA 4LBOA 3K0DA 1ZX3A 4R9DA 4PJ0Z 1YTFB 1XNDA 2IVIB 3OF1A 1W8HA 2X6CA 1SLLA 1G1XB 1J1TA 2A5ZA 3O7OA 1S55A 3PU3A 5JOYA 3K3NA 2MW2B 4XZPA 2DYSB 3MHZA 5E16A 4X1IB 1FI2A 2CTPA 2W39A 4MTFA 1OXCA 4K0KO 2UUCB 4GMP3 1QHTA 5E1AC 2YIDA 4EN9B 3U10A 2JDUA 4FZ0A 3TEXA 1P84F 2FBEA 2HH9A 4D7SA 2OQ7A 2YIAA 3NJYA 3LB9A 3E83A 1FYJA 1GM8A 5LBCA 5A3LA 2LFRA 3VBUB 4Q4V3 4E2GA 5JZGA 5FPRA 1I5XA 3GZTB 4DV6O 3IAPA 3EFFK 3TCUA 4I0XB 1VQKV 2RMU1 4LF4O 5CYYA 3AG1B 4Y4YA 2RM22 3UESA 1UU4A 1F4NA 1ZTEA 2X6BA 2WIIB 1DZRA 2R072 1CWPA 1UZZA 3LEMA 1HNZB 3SPJA 2XMLA 4JI7O 1OA2A 2ZJCA 2UXDB 3CJIB 4G9SB 1R091 1ZUQA 3HVDA 1QQP3 4X62O 2ZGLA 2B5HA 4UUJC 1WW4A 3JYCA 4PDWA 1W9TA 2D5FA 1OCCC 5EK0A 3UJOA 1IVSA 2D6KA 2GNTA 3B40A 2ZEZA 2ZTNA 2PHDA 4OULA 3IDEA 4QQHA 4JI2O 5APAA 1PO22 2XB6C 1I6XA 1O59A 4B3TB 3Q8AA 1LGCA 1IGOA 5IK8A 2WNUB 3GBGA 1GKFA 2UWCA 2A70A 4UW4A 5JPNB 3ASNC 4LC1A 3H3ZA 1ZLZA 4ITCA 1LGBA 4PLNA 4QXBA 1LECA 3OJBA 3B3QE 4FOYA 3R6SA 3MDPA 1BQPA 4CCLA 3STZC 5FZ8A 4BIZA 4WM7B 3NNGA 4DR3O 5DN6G 3IBMA 3HJRA 5B3SB 2ZGNA 5JWPA 2QWPB 3K3WA 2NP0A 1RUD3 4QQLA 5L3GA 1HRI2 4GKJO 3VZKA 1W28A 4MVTA 2QDOA 3CDZB 3C3SA 3E35A 3THOA 5JJEB 1H2GA 3CB2A 5FPVA 4DO0A 2F1MA 5DUWA 4G2KA 3T3YA 5BNOB 3WG1A 3O1MA 1H0BA 1DTOA 1V55B 2VWKA 2ZR3A 5I0SA 1R6NA 4DY3A 1I94O 4QX5A 5JCOA 1SESA 1TEIA 5EHDA 4YY3B 2RS51 5IYCO 4CE8A 5LA6B 1AHSA 4AVSA 1VBD1 5IWFA 1Y6XA 3VBFB 2IU3A 2VAUA 5JXJA 1H2SB 2KB1A 4Q0VA 4AK3A 1MQTC 5DUUA 4LF5B 2GMPA 1MACA 4AW7A 3IC7A 1IKPA 1M93A 4DV4B 5A7SA 3OR7C 1LJ7A 1LHWA 3CWBH 4FLVA 1QNWA 2JDMA 1GKBA 3JATA 1T2XA 3I7DA 4ZPIA 4JYBA 3VQXA 3GJAA 2H6CA 1FFTB 2GC2A 5IVEA 4XOGA 4DV5B 5LHHA 3D6EA 2QCSB 4HK9A 3JD4A 1C1LA 2W91A 2MHFA 1ND3B 2BOBC 1JOJA 3NR7A 2IXJA 1DHKB 2C1FA 3FX3A 1H8VA 3FLTA 3FHQA 4JTNA 2R0FA 1N32O 1ZL8B 4MHRA 1N3QA 3DF0A 4LIVA 2YDEA 5LB6A 3Q8BA 3OGJA 5DABA 1OCOB 2JG9C 4UF0B 5KC6A 4LULA 4GUNA 4TV9A 2JE7A 1J3QA 4YPJA 3RZMA 3JQWA 3DECA 1JZ2A 3P1IA 1PO11 5BR8O 1GZWA 2WR9A 2BGOA 2AACA 2VCBA 1WB7A 3ABLC 5FP8A 2WN2A 3LDCA 1WAZA 1IURA 3O9OA 2XT9A 4NO4A 2V1DA 5B2GB 5JIUA 4AQ2A 4F4LA 5DZGA 1UN1A 3ZN4A 2YY1A 5L9VA 4GKKO 3ZHTA 5CA3A 2CGNA 4P00B 2XUEA 3OPZA 4QGMA 3S5AA 1OURA 4Q27A 4I01A 1W59A 2YS8A 1AVMA 3MPPG 1RHI3 4NIIA 1JOYA 5E88A 4IV3B 2DBIA 1MS3A 1VBB2 2BERA 4LBLA 1DK1A 1COV2 4O2BA 4O4HB 1EAH1 3W21A 1Y74B 4CEWC 3E8GA 4JV5O 2BSKB 1X7NA 4B7EA 4HONA 4YGBA 5IYYA 3JASB 1VPHA 2Q67A 3W59A 3FKSG 3TXQA 1QMJA 4IEPA 4N53B 2ZS6B 1VBA2 1H2KA 4QX8A 2F95B 4PQ9A 4LO5B 3ALQA 3A0KA 4I3GA 1BVVA 1ZBA3 4QKNA 3WOGA 1G7YA 2XJUA 4Z1MG 2VQTA 5FY4A 2V72A 1ZBE2 2VMCA 4NHKA 4IE4A 1IPSA 4OHWA 3OPTA 1H2LA 5FY5A 4GZRB 1VR3A 1N1TA 3MF9A 2RQ6A 1Y67A 1V54B 5IVJA 4LF7O 4MXVA 4KP4A 2UXCB 2YIBD 3UGHA 3OBTA 3OYWA 3IDAA 4QM8A 1NVPB 2Q1ZB 1SMVA 3LIGA 5GLVA 4U7NA 1VF6A 4CU6A 1YNAA 1ROPA 5IJ9B 2BDRA 1AXKA 2HWD1 4DR4B 3TN93 2JB4A 4LFAO 1NQJA 2GP5A 3CCVV 1KD7A 2BOJA 4GZ9A 4EJRA 2JD9A 1K3EA 4JKKA 1NTKH 4PIXA 1HNXB 1XEQA 2ODMA 4YVWA 5A1FA 4GX0A 1CONA 2Y6LA 5B66Z 3ZSJA 2YXLA 3K4AA 5C4WB 2IU0A 5CU1A 3L75H 3I55V 4BWAA 3NKGA 1BT8A 4P9IA 5CA0B 4XIKA 5C8YA 5JJJB 3TOJA 4J25A 2X53S 3AMMA 3USUB 4JX0A 3HBZA 2XAGA 1HRV1 1ULDA 3CCUV 5A1AA 4Q4X1 3SC7X 1B06A 1TME3 5C3PA 2DVGA 5HCBA 3NAPB 2IVJA 2A7AA 3B93A 2W9XA 5D21A 4XFBA 2J1EA 5KLVH 2DFBA 4AQYB 4Z07A 1FMD1 3INAA 3D4KA 4QQ2A 1DGRN 3IMMA 1X36A 3ZFEA 1RFYA 1V9U2 5D8AB 1G4YB 2I2SA 3KCYA 3K59A 2XUMA 2RM21 3NNFA 4J9YB 4GQ7A 4XTMA 1C8NA 4Q0SA 2R071 1OHHG 5BZBA 3OGIB 1VQNV 3TYJA 1FXKC 3ITQA 4FLXA 1G9DA 4DINB 5IYZB 1QJU3 1WMEA 2DOSA 4WM8C 3T0BA 2M6YA 1BVP1 3THDA 4JI8O 5A2QN 1JX9A 5FV3A 4WCEV 3ZYHA 4MW8A 1XQNA 1PO21 4QX3A 4DV2B 3P3PA 1LGNA 3KGLA 2JJ1G 1AXYA 5A33B 4UW5A 1W2AX 3VKLA 3N7JA 1RM1C 4RS5C 2G9FA 3BB6A 1US3A 2DUPA 2ZNIA 1QH7A 4X20B 4MLOA 4JASA 3RVZA 3POYA 5F2VO 4JI0O 5JVDB 3HOBA 3DPRC 4XDQA 2P7TC 2VNGA 3FBYA 3PVEA 3VBOA 1SERA 2WZR3 2JGDA 2QQLA 5FPBA 1HRI1 3WF2A 1JYWA 4LK6A 2VBPA 2PAKA 5EIYB 3GWOA 3CKHA 1X9TA 4MSVA 3RYFB 4KWJA 1C8M1 2J1TA 2H0VA 4I5SA 2ETNA 3WW1A 1AR93 1JODA 1FOD1 4JI4B 5BXZA 5IFTA 1UU6A 2CDYA 5CBFA 4X89A 1N33O 1RUG1 3W9AA 1VBC2 5LA0A 4AE2A 2W47A 4L8QA 4Y20A 4QHOA 5AFBA 2HWE2 1SA0B 2A7WA 1GWKA 4AEMA 5F7UA 1HB2A 1I08A 2AUYA 3N9PA 1GR3A 4HKLA 4LKSA 2LFSA 1BCXA 4FPKA 5GLZA 1Q6HA 2E7TA 4CP1A 3HQRA 4HVOA 5FOJB 4HPKB 4IEYA 4X1IA 2VL4A 2BOCC 4KL1A 1DU3D 4LKFA 4OI0A 5DPNA 4BIOA 2A3YA 1UU5A 1SQPH 1OC1A 4GH4B 2BVBA 1W6MB 3ZFFB 3J8F3 3S3XA 1GRJA 4H44B 2QTWB 2RHPA 3ILNA 3LDBA 1O7FA 3VBUC 5FL7G 5KXEA 3AYCA 2Z2SB 1NKDA 1AI4A 3T1YO 1Q6IA 2DWDC 1XC6A 1AI7A 1F8VA 5C3RA 4ASLA 2WUHA 4BXFA 2OKXA 2W92A 4YFZA 5JPMB 4YW5A 1D2SA 1BMFG 4UFLA 1KU9A 3FWEA 1WA6X 3B00A 2C0ZA 2HWF3 4IIJB 4Y5TA 4NR1A 3VBHC 3DYPA 1GV9A 2OTJV 5BNPB 1O4YA 3I2JA 3DTUB 4OI1A 1SRYA 5L3DA 1EAH3 2UUBB 1AYM2 2ZAHA 4CXWA 4JI1O 5EJ3A 2GH8A 4OHZA 4Z92B 1NXD1 1VRH3 1W9SA 4ABMA 3L71H 2VQEB 5IK5A 1V6IA 4QPGC 3NRUA 2WNUA 1Q56A 2YUEA 3F7VC 4D69A 5T54A 1TMF1 3A0RA 4RFRB 2JJ6A 1HJGA 4ZIBA 1GZ9A 2XBO3 4WM7A 5K4LA 3B94A 1S2KA 1VE0A 5ITZB 2GV9A 3VZOA 1N36B 4Q8KA 4E4DX 3RYPA 3F5TA 2UUAO 5A6YA 1VQ4V 3UGGA 3PUIA 1EYBA 4NIGA 1S0IA 1ND2C 1H8TC 1WBFA 4Q4W2 4M3CF 1URFA 5BNOA 1APNA 3FAVB 4PA9A 4L0PA 1GNHA 4N90A 2BNNA 3WP4A 4AGGA 1EV13 2MEV1 1Z5WA 5CIRA 1K42A 4GX1A 2HWD3 4JDNA 1VBA1 3WNKA 3ZLIA 4A6OA 4BH9A 1PL4A 3VD5A 2C4XA 1MOFA 3VDDC 1DQ0A 2ZMKA 2D93A 3LA2A 4Y1XA 5LBBA 1LOAA 1ZBE1 2FKXA 4HFSA 4S2DA 2YBKA 3OTOB 3H3LA 3H1WA 4ZU7A 4FM2A 3OCPA 4NHYA 4YGEA 3G80A 2R72A 4DXSA 1O4ZA 4MV2A 5FK7A 2RVAA 4B4QA 1C28A 2YPDA 2WLMA 2OCHA 4QMAA 5IWAB 1FFXB 1W6QB 4JDOA 5L3EA 3PVBB 2DBNA 3SEPA 5LYJB 3FLRA 1JYNA 1LOCA 2BWCA 2PLV1 4XF0A 5FMBA 3FC0A 3VKOA 2W1UA 1ND3A 2NMOA 4YW1A 4B1MA 4PA6A 2AYHA 1U97A 2DMXA 2VQUA 1OMIA 1ZL8A 3TK1A 3ME2A 4MADA 3A21A 5FPUA 2HKXA 3ZXJA 1J83A 3VQVA 4RQPA 2DQ0A 1SQGA 4GIQA 3IT8A 5CFCC 3E8HA 4TT3G 3HT2A 1PK6B 3OGSA 3F7YC 2RM23 2YI8A 4UF0A 1BBT2 2EAKA 4LBQA 1NI8A 4LBKA 1VIBA 3WR0A 1H8EG 4AQTA 1GUIA 3JAKA 3B2EE 4LEJA 1Q3EA 1KB9F 4FVMA 2K0GA 1H9WA 3OW2U 5LATA 3P32A 3EO6A 4ZI7B 2YYOA 2FD8A 4Y1YA 5ERLA 2GSYA 1Z5VA 1KXGA 4EN0A 4QD2A 3CE2A 1OQDA 2Q9LA 5GONA 2W6JG 1Q82W 1ASJ1 3OBRA 1SDWA 1SKVA 3MHHC 4B3MO 2HWC2 2OIGA 2Q69A 3SJQC 4KGGA 3FE5A 4CDUA 3C7HA 4K8RB 4IV3A 1XNRO 1K4CC 4EFBA 4I55B 3ZS8C 5FZ6A 5C5TA 4K6BA 1JZ8A 4O4HA 2HEPA 3VHNA 4DR6B 2IC1A 2QQOA 1KMIZ 2BJSA 3UV9A 3VZJA 1YXBA 2BSKA 4JRLA 5F32A 4NJ4A 4YZ3A 1RINA 1XPWA 3LNNA 1AR81 5JZGC 3DSQA 2WT2A 5FQ0B 2WPDG 4I4TB 1HW7A 2RG4A 1UD1A 1WWYA 3HWJA 2DTWA 2WZEA 3KVBA 1UYXA 2WLHA 2Y6GA 2PY5A 5LRRA 4WVZA 1UMZA 4J7JA 2JDHA 5FFOC 3IFXA 1H30A 4N43B 2AHZA 2ZGTA 1QVFU 3IIIA 4JI5B 1Q5OA 2C6SA 3N3HA 5FP7A 5LK7B 1YIPA 5A6QA 1S72V 3SKJE 2R16A 2VULA 2OA2A 4XHXA 1B04A 3VQWA 4Z2WA 5FMOS 4KI5M 1RUJ2 1XBLA 4V1PA 1OOPC 3GCWA 2P6CA 4CU7A 1JZ5A 3I56V 4RFT0 4LR3A 4BM8A 1J3PA 2B1IA 2OYZA 4IERA 4CP0A 2XVGA 4YW6A 1WMFA 2A0LA 3JXSA 1GICA 2ZIOA 5C71A 5A32B 4Q1PA 2IFWA 1E5HA 2JIZG 1VBC1 3ICXA 3T4HB 2D97A 2ZX2A 5SV8A 3ZRWA 3EYPA 1UZ0A 1POQA 1LESA 3KF3A 2HP8A 2Q68A 2XOMA 1G9BA 1UY1A 4S2FA 4UV8A 4MX3A 1QJFA 4UFJA 4BQ3A 2JEXA 1ZZ8A 1QNYA 3BALA 1OH4A 4YJ3B 1PVC2 1QOOA 1S0JA 4XDOA 4KFMA 2HJFC 1HLCA 4XPVA 1US6A 4XJUA 5GJ6A 4M4RA 1IQAA 2R32A 3SGIA 3POEA 4IE7A 5CMUA 3WXPA 3LZZA 4KHPB 1L7LA 4DRRA 2GSMB 4MOAA 4ARXA 4X8AA 1M56B 1WLCA 1SG3A 1R082 2IXKA 2WLJA 1JBCA 5C70A 1RP3B 3T1CA 1KITA 2OPKA 4FTSA 3W5NA 4BJ0A 2DYRB 3RT3C 3ABKC 4QB6A 3RVHA 4KXRA 4JI3B 5FBZA 4YG3A 1YI2V 4BB3A 4LQRA 5D8AA 4YW3A 1OD5A 3B9IA 4X1YB 2FCTA 1DDLA 3K04A 1GWLA 1S0EA 2XL7A 5A70A 4O4LB 3ZMZA 4X88A 1NZ6A 3QTCA 2R1DA 4BR6A 5IYZA 4E2SA 2DVBA 4W6XA 1VBB3 4W6WA 3HBKA 1R3LC 1COV3 4ICGA 3DCQA 2GTAA 4J7KA 4XUOA 4XJZA 1AZDA 2WFF2 4IGOA 2WS92 4C1WA 4LMFA 5LBQA 3H1KH 3UCSC 3ACGA 4COYA 3K5NA 1W3XA 2D3SA 1REDA 4M00A 3TB0A 5A33A 1D7PM 2ATKC 1VQOV 2PI4A 5BY5A 1TGOA 1VBA3 2OUHA 4E8DA 3SDLA 4GLXA 5E89A 1NR7A 4XDLA 1EZJA 4Y22B 1HNWB 2LP7A 5IYBO 4X20A 2ZE6A 1ZBE3 1QR9A 4GAZA 1WN7A 5I0DA 4HN1A 1URXA 5FJKA 4LF9B 4PDRA 4JQRA 3JBG1 3SJCC 1QF3A 3TBDA 3PHMA 1Q86W 4LPLA 1NJIW 2JS3A 4F8AA 3JD72 3WG7C 1S0BA 2B4KA 2N05A 1W8OA 1XE0A 2ZABA 3J81N 4K8ZA 2TUNA 4CDWB 1UYYA 3TWIA 1PD3A 4H3WA 4Q4W1 3E5XA 4DV3O 4V2VA 3AL5A 2HHHO 5CKMA 2CE4A 2FMDA 3TRSB 2G1MA 3JU9A 5IUQA 1SQXH 2DW4A 1K73W 2N74A 1ZA7A 4YSFA 4J9ZB 2PYTA 4XXAA 3BYWA 1XNQB 1VEWA 2H8PC 2GP3A 4DV1B 1QXRA 2V09A 5JR7B 2PFWA 4GB33 4CA9A 2N04A 1UYPA 5B1OA 1VJ2A 4B1LA 3AJYA 5I0RA 1ODNA 5EZYB 2HJIA 5DAQA 3H8RA 4HPKA 1HXS1 3FFQA 1SPPB 4OUEA 5F9TA 2D6PA 3F2ZA 3LDEA 4MVOA 1PNFA 4P08A 2ERFA 1W6MA 4CDXB 3HPLC 2DFCA 4Q6GA 1QJZA 4OHYA 3QNEA 2WLPA 3LFMA 3CU7A 5K0UC 2CYFA 1JTZX 1E1QG 5EYPB 2R9IA 4PDMA 1AUYA 2B8MA 1R6TA 5G04L 4P5HA 2JKBA 3WQ1A 3GZUC 4A45A 2A6VA 2UY9A 4R4XA 2XASA 1CR7A 3M8AA 2EIGA 4KG0A 3JALB 1Q7YW 2UUCO 2YU2A 2JE8A 2CAZC 1S0FA 1NTMH 3ZDSA 2ZZQA 1XYPA 4YG6A 4IIJA 2R6QA 1PPJH 2OCCC 4AEKA 1X50A 2H3OA 4UCTA 5BNPA 1V9U3 2UYBA 3H1IH 1AROP 3RYIB 3CMGA 4XFFA 2VMFA 4BOWA 2Y34A 2PYJA 3JB4C 4OCTA 3E97A 3AG2B 4J6GA 1H1AA 3PIGA 3EXUA 4C8DA 1MZEA 4H2AA 2XJPA 1VQ9V 1L0LH 3X2QC 1JZ6A 5LMUB 1STMA 2DVFA 2UXDO 4JZGA 4TV8A 2EIJB 4QXKA 3VDBA 2IXCA 4B8EA 1W9FA 4YVWC 1CAWA 4MTXA 1TG7A 2VU9A 1XB9A 2YFZA 4A44A 3CCRV 5ITZA 5EJ1B 5A6ZA 5A3OA 1LOGA 5EYYA 1XE7A 2XJRA 2VNRA 2VQ0A 3PUQA 4QGPA 4PA4A 1XHZA 4IV1B 1POV1 3I3EA 3CCLV 3ENRA 3OEAA 3DUIA 2Y60A 3GDBA 2VD7A 2OX0A 3AMPA 5F5IA 1W8NA 1LB2A 1Q6UA 3K03A 4O2AB 5DQ0A 1QJX1 4XHBA 2ZGOA 1N3OA 3DYMA 4YZ4A 3AK1A 1GQGA 3LIHA 1XMQB 3WNLA 4QXCA 4DK1A 4NPMA 3SR2C 1S4CA 1XBFA 3LD8A 4FLYA 2LROA 4LITA 4BLIA 3OGVA 1UPSA 1VBC3 2Y38A 3T1HB 4GWIA 4RD7A 3CRQA 1IZ3A 1QDOA 4HOOA 2HWE3 5IAVA 2JG8B 3MW3A 1W9WA 4E2QA 2LGQA 1LOFC 2QWOB 2JWPA 4AEDC 2Q1FA 2W95A 2RN9A 4K21A 4LFCO 3OB8A 4ZBMA 5IY5C 2AZ5A 2OYQA 4BQXA 3N7MA 1RUJ1 2RV9A 1GMMA 4EWDA 4YY3O 5KHHA 1AJKA 3KVAA 2JDNA 3OBZA 3N36A 2XONA 5HXMA 1K12A 1PM4A 1MPXA 4YLZA 4NMIA 2GMEA 3AK3A 3MIBA 5LMNB 1PM9A 4NXNB 4LF5O 2ET1A 1UFIA 1RUC2 4DV4O 5B5EZ 2GDSA 1E57A 4Y5Z0 1O3SA 3E8FA 1UKGA 3RRDA 3MICA 1O8SA 4CSWA 1ENVA 2ZMNA 5LCWL 4XJWA 2XH6A 5KWRA 2BWAA 1C5IA 2XQXA 2HEYF 4QDSA 1RUE3 5FYCA 4DV5O 1UCXA 4YARA 2H94A 1D4M3 1I9RA 5FY9A 5CFDB 4EEQA 1YRZA 1QIQA 4UXAA 4H33A 4BZ4A 2ADPA 2VUJA 3QG5A 1BQ0A 1F35A 5JUVA 4TWKA 4PHZA 2RCVA 1ONAA 2E33A 3J7AU 4Y33A 1PVC1 3ZMOA 3BVOA 3OGRA 4JDMA 5HV0A 2P37A 4LBMA 5KHKA 4FK5C 2YU1A 2EINC 1AYM3 4ZI7A 2QM8A 3W7XA 1KJRA 4XFGA 1OV9A 1IDSA 4Y1UA 3O0WA 4UOJA 1IBMB 2E26A 5FYVA 2WSVA 1R081 3S0MA 4HZ3A 3KZ4C 2AW9A 1NYWA 2VMEA 4IL6Z 1WW6A 4C91A 1QCEA 1NCQB 1YJLA 3MFCA 4CCCA 4F6RB 3P5BA 2XG3A 3HEIA 1BSMA 1XI1A 2QQIA 4JTDB 1OI6A 1N1SA 2IM9A 4KGQA 5B4XA 4CEYB 4ZHQA 4NRPA 1GBGA 5L7OB 5JIAA 1AR72 5GZGA 3WUDA 2WSUA 4R9CA 3PN1A 3WW2A 4DK0A 5CG8A 4AI9A 3OUHA 1PHMA 1WLWA 4CUCA 5FQ0A 4I4TA 3FYEB 4NXMB 1CIWA 1DLLA 4ZOLB 5AVPA 2WLKA 4TXWA 4DV0B 5L36A 1CJDA 1E5SA 1CZTA 4WVVA 3IIAA 5EZWA 3GXUA 3N27A 1DF0A 3AK0A 4JGZB 5LP6B 1X8EA 3JD3A 3O0VA 5A3WA 4DOUA 1ZZBA 4CCJA 2Y69B 3ETGA 3ZRVA 4DY5A 1MZ6A 4YWAA 3SH3A 5KMGA 2WA3A 4NB5A 1XQ8A 3G6JB 4W4KA 1J5EB 2TNFA 4AGVA 2IBZH 1ZZCA 4ZU5A 4LR4A 3K4DA 1X82A 5C8CB 2X8KA 4XJ9A 2EIMC 1FPN2 1TZOA 1ZRRA 3JD71 5EIBD 1YJNV 5JMCA 1OBNA 3C7FA 3VBRB 2VG9A 3T2TA 2DCZA 3OD4A 2EILC 1SZTA 3NV1A 3EJKA 4BQWA 4MTGA 4L97A 3HKBB 3H7JA 4A3ZA 3B69A 1KKDA 2UXCO 4CU8A 1L7RA 4A3XA 5LEKA 5JXIA 3AKPA 3T2MA 1V6KA 3IMNA 5LGTA 2OVUA 3M3IA 4WZCA 4LXLA 4LO8A 4UI9L 2CH7B 3IGAC 5DDJ2 4GD4A 3RI9A 1IBKB 4NUBA 4RQEA 3T4ZA 1H1MA 3VBBA 2HFEC 1HR0O 4DR7B 5JQGB 4YJ3A 3F95A 4DR4O 5FO8B 4LHNA 4M4PA 1RUF1 4M3CB 1UZVA 4UCOA 4TUYA 1BBT3 1E1RG 3B4SA 4K8FA 2PZSA 4YJ2B 4MVSA 3VQYA 1HNXO 5JI9A 1GYKA 1MVEA 3KHCA 3K5OA 5HPOA 2FDIA 4IE5A 1ORQC 3SYQA 2AEYA 3QCWA 2IJHA 5LY2A 1WCQA 1W0PA 3O12A 1A32A 1VB4A 3TGUH 4CH5A 4A7ZA 5A80A 5IYDO 3IN9A 3A2FA 3DXRB 5HBAA 2XKPA 2HWC3 4DR5B 2VNVA 3OEHG 4O4LA 5GW7A 5FMDA 4FZ1A 1RITA 2B9ZA 5A3PA 1Q8OA 2XDVA 4COUA 3KM5A 3WEZA 5F5QA 5L9BA 3LCPA 1KUQA 4YW4A 5FNVA 4AQYO 3QO5A 1RMU1 1WLEA 2GNMA 1ACCA 4BK5A 2ADEA 2UXXA 3U0ZA 4QDRA 2NPIA 4YYOA 5KUMA 5CBLA 4FAHA 1TE1B 3T0DA 4U3JB 4TWTA 3OUSA 4CCNA 1Q8PA 3RQ0A 1SQVH 4YHHB 4RQPC 1KBHA 4K20A 3DL3A 1F51A 2PELA 1VALA 2VZVA 3BABA 4P9YA 5ISLA 1HDJA 1JW6A 4Y22A 1DGWA 2K1EA 2E5LB 4XJAA 1N4CA 3THPA 2WQZC 2EAAA 1BEV2 3E6BA 5J2UB 4RR3C 4XAAA 5IATA 3CZUA 4BYYA 2E6VA 1Q90D 4KWLA 1O3QA 1XUQA 4CDWC 3SITA 1FJGB 3ORJA 1AJPA 4FFBB 1Y43B 1IKQA 2R1BA 2R041 2ZZJA 2C2AA 4I3PA 1OCCB 5M0TA 1ULPA 5FP4A 3K48A 1RUJ3 5FZHA 1M4WA 1ALYA 1HN1A 1F23A 5EIBC 3N9OA 4DRXB 4ORFA 1GM9A 1CESA 2ZEYA 2X7RB 4L87A 1OPMA 4FMTA 1AL21 3LKJA 3QD6A 1UQXA 3ASNB 1WGPA 3GZEA 4D8MA 2FHRA 3AKTA 4NOTA 4CDUC 1W99A 4E2LA 3O1TA 2PHLA 2E7QA 1XHXA 2V7QG 5EZYA 1EPZA 2ZKNA 1M5IA 4QT6A 3N4MA 3WDTA 1SPPA 4HNAB 2QTOA 4FM0A 3WP5A 4JHTA 5IVCA 2VOKA 5FZOB 3ZYFA 3OOXA 1C57A 4CDXA 2VCCA 5J9PC 3HNMA 4WFEA 5A3MA 3BAAA 1KP3A 4JTCB 1IBLO 3VHPA 1PVC3 2ETEA 3CCJV 5IJ0B 2B39A 4FM1A 5EYPA 3L2HA 2YEVB 4LH6A 3GBWA 2A6ZA 1SCRA 4CXYA 3SYAA 2AHYA 3WNMA 1RUC1 3BCWA 4QPIB 1R083 1OCZC 1JVMA 1KJLA 4DR1B 3HPNA 1L7QA 3FN9A 1GWMA 1AB3A 4QKDA 4XC9A 1MQTB 2QKSA 4OI4A 4M0NA 5C3SA 2F43G 1QH6A 2VZSA 3RYIA 1JYVA 2BTQA 3FMGA 1XNKA 3LEKA 1O5LA 4B3RB 2JKXA 1UWWA 2GHYA 3HKEB 1RJ7A 4WV8A 4NVPA 4HMZA 2JDZA 5JOZA 3TN92 2DWEC 4HYOA 5FZ9A 2XLAA 2ADQB 4C0HA 2RJZA 3KT4A 4R52A 2CAVA 4A5UB 1CX4A 4EB6B 2WFF3 2WS93 1B6QA 1NX9A 5JAXA 4CS4A 1EM1A 3I3MA 5FLJA 3AG7A 5FYYA 1W6OB 2UUBO 4NWWA 3W7UA 1EBOA 2R49A 4IQPA 3VBSC 4CP2A 2VQEO 1S5HC 1UZWA 1H4HA 1O9HA 3L73H 4G3YC 2DWRA 4GMP1 5KX5B 3IAQA 3ZFGC 1UY3A 1SFNA 2JG9B 5F5AA 4X66O 1W0OA 3OT7A 3WW3A 1FV3A 5HCFA 1REFA 1AL0G 1AR71 2P5BA 2GTSA 2R9AA 4AHXA 2Q4PA 3DGEA 2XAFA 3JARB 4UFIA 3I97A 4AI0A 3ABLB 1N36O 4JF3A 3IB3A 1I5PA 3UJQA 1R6KA 3BU0A 2V4VA 4IEOA 1I7FA 4IGGA 1YFYA 3K57A 4XUPA 4XTPA 3KSCA 4MGTA 1ZZ6A 3I3QA 4UVCA 1QY4A 2RS32 4W65A 1WCKA 3WF3A 2VOWA 4DZGA 1OH3A 5BNNC 3ZMSA 2JG8A 3AZXA 3FHAA 2YMZA 3SHRA 3S3WA 4CDQC 4UCRA 2JEMA 2QFEA 2P3IA 1PGL1 5T5PA 3WDYA 3OD0A 3I2DA 1THZA 4AEJA 1EUUA 2EJRA 2QQVA 4UYBA 2OUJA 4CEWB 5LXTA 1FPN1 4FTBA 2J1VA 4TQDA 3BTYA 3ZN5A 1JZ4A 1L1FA 1YEWA 1M9NA 3M2MA 2Q8EA 1V6MA 3JB8A 3KLSA 2RNBA 5LGUA 4QB2A 2E3CA 4JI2B 1OT5A 1RUD1 1JOBA 3WF1A 5LOVB 1CN1A 5FMCA 5IWAO 2ZGPA 2ZX3A 2RJKA 5KUKA 4X9QA 4RWUA 2Y26A 3WU2Z 3OMNB 4Q8LA 3NV4A 5DDJ1 1DYKA 3I2IA 2NZ9A 4OX9B 1UO9A 4PV1B 1HKDA 4XE9A 2J1UA 1XNAA 3R4SA 1X4TA 4YM0A 2A73B 5KXCA 1WD3A 3UKNA 2ZMLA 5FREA 3ZSEA 2VGDA 1YI9A 2VCAA 1GSLA 1ZRIA 1F2NA 3B8NA 1H6XA 1ZRFA 4M3CE 3SKVA 2YZ4A 4FPGA 3UETA 1GP5A 1PNMA 3RN4A 5LHIA 2GNBA 4FPPA 3HKCA 1NCQA 3N9LA 4F6RA 3DYOA 5G05L 1UZYA 4FPOB 3WD5A 4J41A 2EXHA 5F3IA 3SNMA 4O4JB 3MW4A 1TVGA 5FCCA 3J8F2 4WFGA 1CQ9A 5L7OA 5FZFA 1UW8A 5F37A 3D8CA 1DP0A 4WFAV 4MS2A 5GZEA 3DV8A 2EF6A 5FPOA 5FK8A 2D3RA 1LEMA 4XYXA 2XVLA 4YW7A 2O8QA 3BTXA 4H37A 2WYSA 1U96A 4EN8B 2BYVE 2DYCA 5FYBA 1IPKA 4INDA 5GKAC 2QQNA 5AC93 1PMHX 4DR6O 1VARA 5LP6A 5CADA 3IC9A 1HDKA 2CDOA 3CCSV 3MIDA 4X8NA 3ZBHA 4SBVA 2VCMA 2VWJA 3FD9A 1BEV1 3BTAA 4LO6B 3ZR6A 3JSLA 1TNFA 2VBBA 3NNJA 1GN4A 1FXKB 5C8CA 4KBBA 4RA0A 1NY71 1IG0A 1RUOA 5H9CA 5FY1A 3VL9A 4XXPA 3SPIA 1AYN3 4WM8B 1RSOB 3VBRA 4BMBA 4XCBA 4JI5O 1NA1B 4MGQA 2CTQA 3HKBA 1X33A 3OEEG 5CEHA 2WINB 3AG4C 1CAXB 3SQOA 3ZR5A 1S2BA 2KR2A 3W7TA 4QX7A 3D82A 3AG3C 2KKWA 5J2TA 1DF5A 1RHI1 1RM1B 4RS5B 4DFSA 2BRTA 4CCOA 2CH7A 3LSDA 2M7WA 4O61A 4G28B 5GM0A 1ENRA 2EIKC 5EYXA 1K8AW 5FOBB 2WNOA 3LPGA 3DPRB 5A7NA 1JR9A 3E22A 2WBKA 4WFHA 5JQGA 3ZMUA 2ZNJA 4XF1A 1JUHA 2JE9A 4LF6B 2BOIA 4M3CA 1W2BU 2GAUA 4I50B 3S6PA 3MV01 3GHNA 2V4AA 2E63A 1E5RA 1QOTA 3J7NA 2AZ0A 4YJ2A 1ZBA1 1IG3A 1AJQA 2NN8A 3BOWA 5FZCA 1IXBA 2OZJA 2W08A 4H55A 3E86A 3ZXAC 3APBA 2IH1C 5LHGA 2W1WA 3KKYA 1QLNA 1Y4MA 1W8TA 5C9AA 1DGRA 4G4FA 1LENA 2WNVC 5A3UA 2YICA 2EICA 3VZMA 4PT6A 1UMHA 3MUZ1 3UQ8A 2CV6A 2VZOA 4YZ5A 1RPRA 2GZWA 2ZE8A 1WD4A 1O91A 3K51A 5FKCA 1AJOA 1QJY2 1HV0A 3HD8B 2VZPA 2P3YA 3NL1A 2D6LX 4R50A 4N9IA 2QQUA 2FDHA 2QDNA 4R8HA 1VQPV 1AR73 2DUQA 5A7OA 4AWDA 3AB0A 4B4PA 1Y3TA 5F3CA 3SXWA 3ACFA 3TN91 1JU3A 3WV6A 1TA8A 3H0OA 5EQUA 1YYNA 2HKOA 4U3JA 4X65B 1IS4A 3UT5A 4YM3A 2J1SA 1W2NA 4LLOA 4XF4A 1W6PB 5FY0A 4NRMA 3RZLA 1GU3A 1FT9A 4OUMA 3T2QA 3ETPA 2Q8VA 4OUSA 5FZ7A 5J2UA 2JEUA 1JFFB 3VL8A 4HVQA 3FJSA 4XW3A 3JCZA 2YXSA 1W04A 2YXYA 3VBHB 3VKNA 3BY6A 4FFBA 5HCAA 3EQEA 4CPBA 5JSPA 5ANQA 1YHQV 1BZKA 1TME1 2WJSA 4XETA 5BPXA 3SJAC 3WQ7A 4C0BA 3E6DA 1BHGA 5J96B 5KHIA 1P7GA 5FUNA 1B09A 1FPN3 1P8JA 4DRXA 2ZGRA 1W6NA 1BQZA 4LF9O 4B08A 3RYHB 4QPGB 5AFEA 4LFBO 3ZXLA 1A78A 3NQHA 4NN0A 2X6AA 5A7WA 2FYUH 2KD7A 1C1FA 5T3NA 1IX9A 2ZCEA 1YJ9V 2D6MA 5E79Z 3WINE 1XYNA 3N2GB 1CVNA 1SQQH 2WZPP 2C9KA 4FPHA 4RUEA 2GBOA 1QJU1 4LKDA 4HNAA 2CU5A 4BMEA 5I0UA 5DDJ3 5FWEA 2FZ2A 3VZLA 3IDBB 3HT1A 2VZ1A 1XNQO 3ZX6A 1YQ8A 3ASOC 4X1KB 4LA2A 2NLJC 2LUWA 1ND2B 1H8TB 2D98A 3B8MA 1I5ZA 1RB8G 2P6HA 5IJ0A 2ATFA 2B9VA 1NLQA 3C7OA 3U4SA 1QU7A 3MF6A 3Q4HB 4P30A 4QPIC 5DG1A 1HB1A 2W0FC 2VVEA 5ABJB 2AREA 3H50A 1S77D 5F6KA 5DAXA 3ZHQA 1BE3H 1UOJA 3VDDB 1DQ4A 4QQPA 1LKNA 1G86A 5LGNA 1TQ5A 2WZR1 4AG4A 1D5NA 1CGPA 4MZUA 3OGGA 4BK4A 4QGNA 2AH2A 4AVBA 1DYOA 2RS13 4RHV2 4BISA 2VE1A 3GM8A 2IJIA 1AR5A 1FV2A 3ST7A 4MTOA 2QQKA 3EMRA 1GOGA 2LTNA 1ODMA 3OMAB 4URTA 4ASKA 1XSQA 1VBE3 4JI0B 1X8MA 1AR91 3HKEA 4UCVA 4Q2FA 2Y6KA 2GC0A 2UWAA 4GX2A 2Y6HA 5FYTA 4LIUA 2BFUL 1OFSA 3JUUA 4HZFA 3UM7A 4Y4RA 4EB6A 3WX5A 4ASUG 1K4DC 4UBGA 2A06H 2YBSA 3AVSA 5J48A 1W8UA 4GJYA 3VD3A 1QXJA 1S0GA 5EBLC 4WBNB 3GNEA 1W6OA 4Y1VA 3T0AA 3DKQA 1N33B 4KU7A 1UAIA 1UOBA 2LW1A 1YQ6A 5FZ1A 3ES1A 2QKAA 2W5FA 5CFCB 3J7HA 1POV0 3ZHVA 1OJHA 5KX5A 5LMUO 4YGCA 1BEV3 4IEQA 3J8F1 5FZBA 2YXHA 1HQLA 2Y8KA 4JGYB 1LTEA 2HG5C 4NIAA 2F23A 5AG2A 2VZUA 2DE0X 3CCMV 2K2SA 4FFKA 5I8YA 1V9PA 5CB4B 1N34B 2ZGSA 2VS0A 4IXLA 4A4AA 5IK4A 1F31A 1W0NA 4NRQA 5EP9A 2K46A 2Z4FA 4L99A 2HWF1 4Z8BA 2GUZA 2PGGA 3T1YB 1Z7S2 2ZD9A 3GBFA 1Y76B 3K2OA 4O4IB 3MW2A 4P9JA 3LGRA 5E6HA 5LEJA 1ZWIC 3CRRA 2Z42A 4XAEA 3HKDA 2KSDA 2V5DA 5A7PA 1KKCA 2WO3A 3MIGA 2E7AA 3VV1A 4CH3A 1VF5B 1VRH1 4NYKA 2F4VO 3ABMC 2Q0AA 4CEWA 4DV7O 1QOSA 4NTWA 1W03A 5F8PA 2RMKB 1A8DA 2HEVF 4K9SA 5JZGB 4P9PA 3K06A 3DC5A 1Q8QA 4KUMA 4YVSC 2F6BA 4BW9A 3ZM8A 2XBO1 1GNZA 3QH7A 2D3OW 3ZRXA 5FYHA 1MEC2 4KNCA 3OUFA 5LOVA 2JD4A 2Z69A 4CP9A 3ML0A 3KGZA 4AL9A 1O9GA 3CIHA 3RWKX 1ZRDA 1MS9A 5LMNO 4NXNO 4S2GA 2PHFA 1RUH3 1MSWD 1F5JA 1OOPB 2ARCA 5J37A 2IW5A 1LCLA 4RGKA 2YC2A 1J3RA 1EV11 1HQWA 5IAXA 2QE3A 2PHUA 2ZDIC 1U12A 2VZTA 3BPZA 1LR1A 5CZKA 4GB32 1TNRA 2FCUA 4XQDA 2P3JA 1YFXA 2OIIA 4X8PA 2X5IC 1NXMA 3ZSLA 4O7XA 1JCHA 2XTAA 3CJHB 3WNOA 4U7OA 1I0HA 3BGAA 2R9RB 2JGUA 3WT3A 3ZKYA 2IUWA 3WG3A 4O4JA 1DQ5A 3RYCA 4A6SA 5ACA2 3QF7A 2ZGKA 1DZTA 4D6SA 1IBMO 4UWDA 5A3TA 3JAWA 3ZHSA 5L19A 1QJY1 4NAOA 4B4RA 4HANA 3VD9A 3L74H 3A7QA 3U37A 4TSFG 4YW2A 3VHOA 2JJ2G 2ZIMA 3NJVA 3G6EV 2G9GA 3CMAV 4YG0A 2XHNA 3UT0A 2ZKLA 1XE8A 1Z78A 1CXZB 2B7YA 3ATGA 4N21A 3QLQA 1LHUA 1SC5B 2D5HA 2XVKA 1R1A3 1PNGA 3CO2A 4TQFA 1K5MC 2BZDA 1BL8A 3ABKB 4IHJA 3CMEV 5TSWA 3NW4A 1EZVH 2P2KA 4AXOA 2RS33 4RAIA 4HKWA 3AZWA 4Q4Y3 1Q8IA 1L8DA 4FQ4A 3L2YA 1IOAA 3WDWA 4DV0O 3PMEA 3A0NA 4BAYA 1SEFA 1DF4A 4GJZA 2Q6AA 3WB1A 4XF9A 3AYDA 3O0XA 2BU9A 3QBQA 2CTWA 1NA1C 1RSOA 2N7GA 4K40A 4LBJA 4LBEC 4JI6B 2IXLA 5LBEA 4CCDA 2RMU2 2CTVA 1W39A 1HW5A 3R66A 3UO3A 1J5EO 3LAGA 5FXVA 1BHBA 2LALA 5D1IA 2VO5A 3O1RA 2G4IA 2WQ4A 1BGYH 1K5SA 4RS5A 2D6OX 4AI2A 1R092 4HXCA 4L11A 3WG2A 5EXOA 4PA7A 3LE0A 4HSLA 4BE3A 1UXXX 1SQ4A 2YV8A 3ACHA 4TV9B 4N9HA 4Y26A 4I0WB 5KHJA 2OT7A 3RS6A 2GMMA 1M57C 4NKGB 3RPQA 3AXDA 1GZWB 2P6JA 1CAUA 1J84A 3ETQA 2QA4V 5KC5A 3FL7A 4I50A 2CTRA 1EY2A 1K9MW 3VGIA 4AAXA 3WG7B 4YZ1A 1S0CA 2G9ZA 5DUVA 2YIBA 4E4ZA 4DS0A 4XEZA 4WVMA 5ANNA 3I59B 3M99B 5LA9A 4AILC 1IBKO 3LSSA 1BJQA 5GLUA 2Y6FA 4J7ZA 1XNBA 1FYUA 4OZOA 2VOXA 4DR7O 5BV6A 3H3UA 1ZYBA 4ARYA 1LODA 5HI0A 2WWWA 2HJDA 1W3VA 5B1AC 5K8SA 1ST8A 2ARXA 2XJTA 2WLQA 1GP4A 4Q0QA 5JH7B 3TEYA 4P14A 1UF2C 2VMIA 1IPJA 2OWOA 3ZYJB 1OQEA 4O2BB 3RYRA 3MPBA 2V5YA 4AFCA 1LUVA 5B4NA 3BFRA 1NT0A 5HCHA 1NZIA 1VRBA 4B3SO 3NNLA 1EUTA 1FXZA 4RHV1 3U4XA 3FX7A 3MDSA 2WKKA 3K4ZA 1ULFA 2QR4A 4EWAA 2WO7A 4COZA 4D6QA 3V0BB 5K9YA 1JI6A 4AI1A 2ZQMA 4NIDA 4R4ZA 1LU1A 3I49A 5EV7A 4LLFA 1F7YA 2EXIA 2EA7A 4NAMA 3VBUA 4EN6B 5K0UB 3SH4A 3MGUA 3VD7A 4DO2A 2RE9A 2I74A 2ADDA 2W3JA 4LOTA 1RUE2 2HVJC 4OYUA 1W6PA 2VZ3A 3AP4A 4I0XA 5LW9A 1D4M2 1XREA 2VZRA 2E51A 1FNYA 4P9WA 1NCRC 3TXSA 5IVVA 4XQWA 3LNMB 5B1BC 4ZZ5A 3CJIA 1JFFA 1W0KG 3OYWB 3TAYA 1TUEB 5IE9A 3BVCA 2OCCB 1NH2D 4DUZO 4YHHO 1NG0A 2JIJA 3T4VA 3AFGA 5I91A 2JB8A 1AR4A 3EVKA 1O3TA 2ZR2A 3K79A 5CN0A 1NQTA 1QGLA 3BOPA 2DN9A 1GK9A 2VVDA 3M7MX 3GF6A 2VTFA 1JMKC 3L72H 3CX5F 3PUSA 4Q26A 1UXZA 1YHFA 3X2QB 3K75B 4FP2A 4YFWA 3I5DA 1CPNA 5D2AA 3U1XA 3WDUA 1FJGO 1SF9A 1YFWA 4YVWB 3C2UA 4LUKA 1V6LA 3UK9A 5EBWC 2GN3A 2B46X 1RUI2 3N2GA 3N9QA 4IYHA 2RR12 4JAUA 4A7YA 4XQ4A 2HBUA 1VBB1 2Y0OA 1YJWV 4TZDA 3HB3B 1COV1 3M1HA 2WDBA 1K97A 4XILA 1PVXA 5L73A 4LJHA 3N9MA 4X1KA 5K1PA 3AC0A 1ND2A 1K5QA 3KWVA 3ILRA 1CAVB 5FTTC 3ZN6B 2QJ1A 4N8MA 2GDFA 3ZYIB 3SH5A 1OLRA 4TYSA 5EPAA 4AF9A 1PZ8A 3D5OA 5ABJC 3Q4HA 1RC6A 3CD6V 2WNEA 5C93A 2QZ3A 1BK0A 3FLPA 1LUWA 2CWSA 3AXEA 1HQNA 5LA6A 3SYCA 1YI7A 2RDCA 1PX3A 1H38A 1FXHA 3M4FA 4OZXA 3VBFA 3VDDA 2DVDA 3QO8A 1VQ8V 3T2PA 1LRHA 1OCRC 2X05A 4U36A 3CP1A 2A9HA 4OGQB 4QE9A 2C9AA 4Y5SA 4MVRA 3RDIA 4AEDB 1DQ2A 4LO7A 4FPFA 4MVMA 5IY5B 4FOQA 5KR7A 1GZTA 4JCKA 1QJY3 2P06A 4TSVA 1MABG 5LBFA 4DR1O 5BY1A 2E76B 4FAGA 3SCHA 4IEZA 2PAEA 5EC1C 1Y66A 4OLLA 1LAJA 3CCEV 3AYAA 3K46A 2QUOA 4L2NA 5C33A 4GB31 4XCAA 5F1RA 4TTGA 3K3OA 4DPNA 4QX1A 1JJOA 4DV3B 2WLIB 4XFIA 3TEWA 4Y24A 1OVPA 2WN3A 1QVGU 2KA3A 4B3RO 2WT0A 2XXZA 3ZPYA 3H1JH 1Z2GA 1KFXL 3MI8A 3FB8C 3RZGA 4Z2AA 1H2NA 1JH5A 4MUVA 5CFCA 4ISQA 3WQ0A 3AX4A 4GMP0 3ZIWA 5D5QA 4JGYC 1B35C 1DIWA 1AILA 4QE7A 2UU9B 2ZCWA 4XACA 2Q5ZA 3N2KB 4FFIA 1CD3G 3BPSA 3UKTA 3LUTB 1H1IA 4XBNA 1W2TA 4O65A 4L8JA 3LSEA 1HIXA 5C9AC 3LF7A 1JYCA 4DR2O 4BQ4A 1LU2A 2EINB 4WVWA 2P22C 4DYLA 4MGZE 3SYOA 4JTOA 5CVRA 4FLUA 1XNCA 3AMHA 1QLEC 4RSUA 2CUGA 2EALA 2P34A 4D94A 4UCUA 2QGNA 1OF4A 3ABUA 4CTEA 4D3WA 1Y76A 1AX1A 1E5IA 1V9U1 4O4IA 4GKXA 4D0QA 2VOVA 2KQXA 1U5IA 1GP6A 1HRV2 3WP6A 2WZ8A 4Q4X2 3OG2A 1JJ2U 1Y74A 4LBNA 3CQOA 1PP9H 4LUMA 3LEGA 3A8TA 4CZZA 4OMCA 3DKWA 3JASA 4ZXKA 4EKWA 3Q9OA 4N53A 1XILA 1SS3A 3SJBC 3R65A 4GWMA 3MUY1 5JXHA 4Q29A 5CA1B 1FMD2 1BCCH 3KB5A 2DVAA 3MHSC 4QU1A 2LO1A 2VZQA 1AI5A 2Z79A 4MGKE 3O1PA 2HLEA 5T5LA 4EFEA 3TEZA 1KQSU 4LCUC 4IESA 4CCEA 4ATFA 4PDWC 4RL7A 1LULA 4QDQA 3HNBM 5FZ0A 2EIDA 2DCJA 2PHTA 1YIJV 1Y9MA 1US2A 3PUHA 4PF5A 4AHYA 5F6LB 1OOPA 4RHV3 5H9RA 2EIMB 2Q8DA 3CLPA 2A3XA 2ZGMA 5IJ9A 2PI5A 4A42A 1SFYA 2BUKA 1JA8A 2B9UA 5BUVA 5FDBA 3AL6A 2EILB 5IVYA 5KA5A 3AP6A 1OQ1A 2K9PA 4AI8A 1UY2A 3QOPA 3I54A 4OX9O 3ZX7A 4I2OA 1PNLA 2IH3C 4KH9A 3CJHA 3CHXA 3SCGA 2X29A 3AJZA 2PN5A 2BNOA 1LHNA 2I45A 5LA1A 1CJPA 2HWE1 1WLDA 2VH9A 3W7SA 4LNVA 1CP9A 4UFKA 1I5YA 4GXLA 2O14A 2NNUA 3URFA 3AZZA 4O9GA 5C4WA 4TLFA 3POBA 3FFZA 2E75B 5CA0A 1C8M2 2UY8A 4A2UA 4NTXA 1BKZA 3USUA 1FOD2 2F4LA 4ASMB 2YGLA 1WPXA 1RUG2 2FB5A 3O1UA 5JCOC 3KV9A 4JGSA 3PL0A 5I0TA 4AQ6A 2XQRA 3NAPA 3PURA 5EFUA 1JZ7A 4LFCB 2XJQA 3K5LA 2Y48A 4Q0PA 5CNAA 2XWBB 1O5UA 2WLNA 2GU9A 1QNMA 2JX9A 1WKYA 2HWB2 1PM7A 3POWA 4LORA 4YM1A 4S2HA 4XDKA 4K3AA 1RUE1 2P5OA 2OTLV 1D4M1 1GOFA 2OT5A 1LOEA 4GA9A 1DGWX 1H6YA 5EJZB 5F39A 4ZHNA 1KRIA 1F5FA 4OI2A 3D3AA 1Z7S3 2BP6A 3ZPOA 1ZSPA 4LH7A 4OPHA 3DC6A 2EIBA 3PMSA 4FBFA 4META 3NJZA 4MVQA 4WFBV 1AYM1 1CEZA 5CAZA 1PV0A 4IEWA 4AAPA 3I8TA 2BW8A 5CKQA 2P3KA 2F17A 4YXWG 1H9PA 1FS0G 2AENA 3QO7A 3WNPA 4WFFA 5A9GA 5A1LA 4CUGA 1LNQA 4L92A 1SBEA 1D4VB 1XMOB 3BODA 1RGSA 2ZPXA 3C7GA 4RQPB 3ZXGA 2WLLB 3PLQA 4E4EA 1OD3A 5JVDA 5DN2A 3M70A 4ZONA 3U14A 4CC5A 4WF9V 1MEC3 4LBQB 4COWA 1RUI1 4RR3B 3KD4A 2RR11 3JAKB 1WA8B 4UFMA 1VIWB 3RYFA 3RZKA 1WJZA 2ITDC 4AHCA 2QWNB 1HP8A 4JYAB 4XUTA 2WAOA 5FO7B 2D7FA 2DV9A 1TMF2 1EN4A 5FXZA 4NHXA 4RN5A 3H9AA 3I59A 2ZX1A 2IFRA 1QU0A 4IGQA 5GONB 3JD1A 2IWGB 3VLBB 2VQFB 2CL2A 1YLLA 2ZXWC 3RBZA 1SA0A 2UXNA 1PIV3 4LF6O 2JDAA 5F2WA 1JU4A 1HB3A 4MW3A 4CDUB 4QHZA 5IW0A 4LHKA 5JH7A 2L9LA 2LGWA 3CBNA 3NO8A 4YIPA 4X6RB 4W8JA 4B3NA 2D6NA 3ON7A 3RGBA 5FO9B 4GH4A 1KEXA 4YRDA 1P49A 3ZFFA 5ACA3 3V0BA 2MEV2 4MGYE 4C7UA 4YZ2A 4CUAA 1JYXA 1JMUB 4MGSA 1VQ7V 3MAQA 2CY6A 4FPJA 5FXXA 3CRAA 5K0UA 1S0DA 4AVTA 1I1EA 2JRIA 2RDSA 2V4DA 5FY7A 3KMHA 4E9KA 2YGMA 1UNBA 2YI9A 1PGSA 4IUGA 1OCZB 1GLHA 1SZXA 3ZMNA 5JLVA 2EX3A 3A0HZ 4EV0A 4NE9A 5GTIZ 2XHBA 4K1ZA 3MIHA 1D2DA 4X65O 3V56A 1W8FA 1VF6C 3W7WA 4DW0A 1BBT1 3LDDA 1SLIA 2DU0A 3H1MA 2Y0PA 2PLV2 3E8BA 2WAAA 1YTFD 5IHRA 4IEUA 1HR0B 1IXMA 4BCUA 2D3PA 1HNZO 1YQ2A 1WP7A 5F3GA 2VJXA 3MLJA 4XMAA 4NPLA 4A41A 2A6WA 1VAVA 3WCSA 3CXHF 3FBMA 4PI0A 3ZRWB 2D43A 3I3BA 2MK3A 2RMU3 3NXSA 2HVKC 4EZHA 1W2OA 2HWC1 4N7UA 5JSOA 5IK7A 1OLQA 1R64A 4B3TO 1XSRA 2CAUA 4UAPA 3VHRA 1S1AA 3VBSB 1R093 5FYUA 5LASA 2YB7A 2VW0A 2YC4A 3T1LA 2DJVA 2O1QA 3POIA 2MPFA 2ZINA 3FAVA 1Y9QA 3I3DA 3ZFGB 1C3HA 1YF2A 1CAVA 3ZN6A 2PQSA 5AC92 2EULA 5F5CA 2YG0A 3OBAA 1ASJ2 4AFAA 5C3QA 1FATA 3WF4A 2QEXV 4PCRA 1GN2A 1NE6A 3ZFEC 5FUIA 1RYYA 4LF8B 5FZMA 4EZ4A 4CCMA 1EFRG 3K9AA 1GN3A 1WW7A 1EN5A 3BRCA 4DQAA 2E53A 3U11A 3HN3A 1FNZA 2RDNA 4IL7A 5BNNB 1QWRA 1AYN2 4OHXA 3C3TA
chains in the Genus database with same CATH topology
3M3EA 1EPWA 1Y3TA 4CDQB 1LOFA 2HYKA 1J58A 1AR82 3ZXDA 3SXWA 1H30A 1K5MA 1V00A 3TN91 2C5DA 4AEDA 1HV1A 3WV6A 3H0OA 1YYNA 4N43B 4PIYA 5K7PA 2ZGTA 2FQPA 4N7IA 3SMHA 1W6QA 3WY6A 1Q5OA 3M3CA 1IS4A 3ZSKA 2VMGA 4YM3A 3OY8A 3N3HA 4LLOA 4XF4A 5LK7B 4M2IA 1RVF1 2IZWA 2ZHMA 5JOWA 2OG7A 1W6PB 1YIPA 1ZZ9A 1YO8A 4H14A 4XFCA 5E8AA 2R16A 2VULA 2OA2A 2QZ2A 4XHXA 4BPZA 4Z2WA 1VB2A 5FMOS 2RJLA 2K9ZA 1RUJ2 5BYNA 4V1PA 1FT9A 1OOPC 4OUMA 4WM8A 5I8TA 4I0AA 4OUSA 4IEVA 4RFT0 1Z0HA 4BM8A 1NA1A 1J3PA 1JHNA 1Y7BA 2NLRA 2RS53 3VL8A 4HVQA 4BLJA 3FJSA 4XW3A 3B5LB 3VBOC 1VBD3 2YXSA 2OYZA 1CAXA 4M2GA 4P9XA 4IERA 2ET7A 5LK5A 4F3JA 3VBHB 4Q1RA 4CP0A 3VKNA 2XVGA 3GALA 1OA4A 1WMFA 5HCAA 2EXKA 1XYOA 3EQEA 1PK6A 1GICA 5JSPA 1TME1 2WJSA 4XETA 3KT7A 5BPXA 5A32B 4Q1PA 3WQ7A 4IV1C 2IFWA 5FPXA 3E5QA 4C0BA 3E6DA 3RG0A 1XU2A 5J96B 5KHIA 5J36A 1VBC1 5GLWA 3AKSA 1B09A 4M2CA 1FPN3 4AHWA 2D97A 2ZX2A 4OHVA 5SV8A 4P9GA 1LESA 2ZGRA 1W6NA 1OA3A 1G9BA 4S2FA 2EXJA 3DPRA 4QPGB 3ZVXA 5AFEA 3ZXLA 4BWOA 1A78A 3E6CC 4PLMA 1GFF2 1TME2 4MX3A 2ARBA 1H4GA 4GKYA 4NN0A 1O4TA 3TNQA 1ZZ8A 1QNYA 3BALA 3IPVA 1C1FA 1QXPA 5T3NA 4NHMA 4FXKB 4PJYA 3X29B 3UL2A 2Y0IA 4NWVA 3WUCA 4C8RA 3JD73 1PVC2 3WCRA 1Q8VA 2D6MA 4Q4V1 1QOOA 3AMQA 4HLTA 3WINE 1XYNA 2NYYA 1S0JA 3MEPA 3JZVA 5GLTA 3PVNA 1CVNA 4BA6A 1HLCA 5T5OA 2WZPP 4XPVA 4FPHA 4XJUA 1AR62 3KT1A 5GJ6A 1QJU1 1IQAA 2R32A 1KDKA 3PJQA 2A71A 2CWMA 2B42B 3LZZA 3WXPA 4BMEA 1A8MA 5I0UA 4DRRA 5DDJ3 2HWB1 2FZ2A 3WP3A 3VZLA 3IDBB 1WLCA 3HT1A 4UW6A 2CGOA 3N6WA 4LA2A 4R9BA 1R082 2IXKA 2LUWA 3USSA 3ZYPA 1ND2B 1H8TB 1JBCA 2D98A 4M01A 1I5ZA 1RB8G 4PBOA 1KITA 2OPKA 2JG8C 4HKOA 4FTSA 1QJU2 3WHTA 2QKDA 1QQP1 2ATFA 1UX6A 1MS5A 1RUI3 2R062 2RR13 1MS8A 1PO13 3MF6A 3HQXA 5FBZA 4YG3A 1VAKA 5DUXA 4QPIC 5D8AA 5DG1A 4YW3A 1OD5A 3ZYGA 1BXHA 1VLNA 3B9IA 3T1MA 2VVEA 3EATX 5ABJB 4J1WA 2AREA 3H50A 1DDLA 3RWNA 1AX2A 5F6KA 1S0EA 2XL7A 1RUF3 1KS5A 4MH0E 4XBQA 2WFF1 2WS91 1JUIA 4IETA 2DF7A 3VDDB 1DQ4A 1OS7A 4QQPA 1LKNA 3DGTA 2DCKA 2R1DA 1G86A 4Q0UA 4E2SA 2NM1A 1TQ5A 2DVBA 2WZR1 4W6XA 4LA3A 4AG4A 4ES8A 1NLSA 1VBB3 4W6WA 1CGPA 4MZUA 3OGGA 1U0AA 2DCYA 2O0OA 2ZAAA 4QGNA 3NKTA 3CF6E 4RGGA 4LBQD 2BPA2 3B01A 1COV3 2AH2A 4AVBA 2RS13 4PIZA 2RS52 3KCCA 4N43A 4RHV2 4FPLA 4FPYA 3RMYA 1FV2A 3CJIC 4QQOA 3ST7A 3P3NA 1VBD2 1AZDA 4R9AA 4XJZA 2WFF2 4HBNA 2WS92 4C1WA 2LTNA 4URTA 3V15A <