3D8CA

Factor inhibiting hif-1 alpha d201g mutant in complex with zn(ii), alpha-ketoglutarate and hif-1 alpha 19mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYGEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
total genus 100
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3d8cA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d8cA01
4B7EA 4QU2A 1IZ3A 3KCYA 1H2MA 4B7KA 2CGOA 5JWPA 2W0XA 3P3PA 1H2KA 4AI8A 2XUMA 2CGNA 1YCIA 2Y0IA 1H2LA 2ILMA 3D8CA 1H2NA 3OD4A 4Z2WA 1MZFA 1MZEA 2WA4A 4JAAA 4NR1A 2YDEA 3KCXA 4Z1VA 2YC0A 4BIOA 2WA3A 3P3NA
chains in the Genus database with same CATH superfamily
1UZYA 3TN92 3THOA 2UUBB 3NW4A 4AQ2A 3G6EV 2D6KA 1US6A 4X1IA 3SPGA 1YO8A 1H6XA 1RUH1 2ZGSA 3LF7A 5GZDA 2XOKG 5A6ZA 3RYHA 2VOWA 3T2TA 1K5SA 2DU1A 2ZE5A 1ZRIA 1UYYA 4MVSA 4Q8LA 1HW5A 1GMGA 4MGYE 2JE7A 4CDQA 1KD1W 3OEEG 4H3WA 4LLOA 1M9NA 1Y9GA 1LHNA 1NKGA 4D8MA 2XUMA 1ZBE3 1AP5A 2PHDA 5C7GA 2IVJA 3VD5A 2EBOA 2WLLA 4UW6A 3G6BA 4FFKA 3H9VA 1BZKA 1R093 5FZ9A 5IVVA 2EIJB 1MOFA 1IBKB 2E33A 4A3ZA 4GLXA 3ZXGA 3HNMA 1F5JA 2YGMA 3O1MA 3VDDC 3SISA 4BCUA 2A70A 4F3JA 1BMV1 1OQ1A 4LE4A 3WG2A 1GM9A 3NNLA 3WF0A 4BW9A 5I0UA 1IVSA 1DLLA 4X1KB 2FZ2A 1RMU1 1MG1A 2HWB3 1GQGA 4MLOA 3APQA 1F4MA 1E79G 4PDWC 5FBJA 3ETEA 1Q5OA 3T1HO 3UGHA 4ZU7A 3EVKA 2OKXA 4E2GA 1GBGA 5CA1A 4IEZA 2OVUA 2OCCC 1RJ8A 3HN1A 5C3SA 4IE6A 5F3EA 4GJZA 4JGSA 3V0AB 4BMEA 3ZN6A 1NXMA 4W8JA 4P08A 4XFFA 4NROA 2RS12 5H9SA 1HV0A 4PHZA 1YHQV 2K9PA 2X6CA 4AEDC 4MXVA 1BS3A 1BHAA 2ZGRA 4QXCA 1W2BU 3AVSA 5KHKA 4OYUA 3UT0A 1FXKB 1US3A 3BCCH 4H44B 4D6RA 1SLAA 3Q8BA 4BLJA 2ZTNA 1TMF1 5KHGA 1SEFA 4WFFA 1HR0B 1KS4A 3IT8A 4MHRA 1GZWA 5BNPA 4Q6GA 1XNQO 1NZ6A 1BT8A 3CRRA 3L9JT 1ZBA1 4NTWA 3HVDA 4B3RB 2CU5A 1N0JA 5IJ9A 5K1PA 4AEJA 1OD3A 3LQCA 4OULA 2W2IA 2VQ0A 4RL7A 4FLVA 2A3YA 3JXSA 1KMIZ 1BVVA 1BSMA 4ZS2A 5F3IA 4X66B 1WLEA 1XNRB 4B7EA 5JZGC 3JASB 4CDWB 2YXSA 2E32A 4FMTA 3CP1A 1UZ0A 1O59A 1K5MC 1RP3B 3JD3A 1RHI2 2W1QA 3VBHC 3AMNA 3D3AA 1N36B 3P1IA 1HDKA 3ML0A 2BSKB 3VN4A 4D6TH 1H9PA 3K0DA 1ODMA 5EP9A 1WUVA 5FNVA 1KITA 3POWA 4H7LA 1SZXA 2OCHA 3WDUA 3INAA 2QE3A 2EIKB 5JLVA 4X1YB 2Q7GA 4JGZA 2OCCB 1EBOA 2QKCA 2ZXWC 1F4HA 1AVBA 5FRAA 1Z5WA 2GV9A 2R0HA 1W2UA 2NZ9A 3GDBA 3T1MA 1N0NA 4XBLA 4O4LB 2KQXA 4DMIA 3W7XA 2P6CA 1ULEA 1S76D 2QJVA 4J80A 3J7LA 2C9AA 2F23A 3VBOC 2WLPA 2XHBA 5C8YA 3ZHTA 2J1AA 3MPPG 2DTWA 2GZWA 2QUOA 3CWBH 4L8QA 2EILB 5KA6A 4SLIA 3VL8A 4K8RB 1WPXA 4NUBA 4Z92B 5HFLA 2VCMA 3FBYA 2XPJA 2ADDA 4AE2A 1NS1A 4PQ9A 3WLUA 5LMNB 4Z2AA 4YW2A 1UYPA 5FDBA 5IAVA 2CL2A 3T2MA 4NHYA 4K9SA 2JEUA 2QJ1A 2Q1ZB 4P9XA 5JXGA 3MF9A 2X8KA 3FHAA 5DG2A 4YW6A 1QBZA 2UXXA 5FK8A 4X20A 4QPWA 4B8EA 5IDJA 2R30A 4UF0A 1YQ5A 3RWRD 2VQEO 1PK6A 4QKNA 2Y6LA 5L9BA 3K0GA 4FM0A 1G9AA 4QQLA 2VQFB 2WA3A 1EZVH 2VS0A 4LKDA 2JDHA 4Q26A 3ASOC 2R041 1UZWA 3I2HA 3ABMC 1NH2D 2JG8B 3FLPA 5J9PC 1H4HA 1UW8A 4OQ9A 4K8ZA 2BGOA 1BK0A 1GWLA 3OD0A 2RJLA 3ZN5A 1LRHA 4ZS3A 4FOVA 1F35A 5FY7A 1UY3A 1N1YA 1M06G 4TYSA 2XXZA 1HWYA 3WQ7A 4CZZA 3RN4A 1KJRA 4RAIA 4A7ZA 5C4WB 5GW7A 1QWRA 3B9IA 1AR73 3ZSEA 1RUC3 1WCKA 1D5NA 2LFRA 1RXGA 2Q8OA 1MEC2 1ODNA 3UKNA 3C3VA 4XBQA 2VQUA 1AI6A 3RVYA 1MPXA 4YZ3A 3CCVV 3SCFA 3KGLA 4IT5A 5A3NA 3IDAA 5BUVA 5IWFA 2Q5ZA 3ZSMA 1LOCA 3H1JH 1CPMA 2HWD2 1GR3A 4LFAO 3N9OA 2LW8A 1YDXA 1C8NA 2WT2A 4FCAA 2BWCA 4DEQA 1XQNA 1GP5A 3OUJA 3ZR5A 4YVWC 4RR3B 1Z78A 4IYIA 2VZTA 2VM9A 2EJRA 3JATB 2UWAA 1AX0A 1K34A 5LHHA 3GWOA 4P2ZA 2BP6A 4XTMA 4IHJB 5T5LA 5LZ6A 4COYA 1RC6A 4JX0A 3BIEA 4D69A 4AYUA 1AP6A 5IATA 2YYOA 2WLLB 3W21A 4WM7B 2JDAA 5C33A 1LULA 2PY5A 2HWD1 2VJXA 2GSMB 3G80A 1HRI2 1IQAA 1EPZA 2VW1A 1J5EB 2ZEZA 1PM7A 3UKMA 4RGAA 1OVPA 5EYYA 3DECA 1Q6UA 3KCCA 4AOCA 4CEWB 1LJ7A 3K4ZA 2I2SA 3SPJA 3WP5A 4XFBA 5C8CA 1PM9A 1BLZA 2ZEYA 4DV1B 3HEIA 4JYAO 4DV0O 1H8TC 1J3PA 3H50A 4LFBO 1W2AX 5DAQA 3LKJA 3UESA 4OGQB 2WLIA 5G04L 3N2GB 4BQ3A 3UT5B 1ULPA 2FCTA 2ZDIC 5ABJB 2IXJA 1AXZA 5BR8B 1JUIA 1STMA 3USSA 1COWG 5HBAA 4HAMA 1YFYA 2DYRC 1YNAA 3F7YC 4RGKA 4PCRA 3BEHA 1VBA1 1X59A 3ASNC 2QWOB 2EXJA 3U11A 3ABKB 1W3XA 3HKBA 3ATGA 4DPNA 3FYEB 4G9SB 2AENA 3EJKA 2E75B 5JZGA 1SC5B 4GMP0 1DDLA 3ZMNA 5ANNA 2AYHA 3I55V 1OPMA 1RVF3 1OA4A 1JI6A 2VMDA 5A7NA 1K5JA 4CC6A 1W6OA 1YSCA 1LGBA 5FUIA 2Q1FA 4YW7A 3FFQA 1T6BX 2VZQA 4XF0A 2HHHB 4N9IA 5T5JA 2CWMA 1W6MA 4UI9L 4PA3A 3LDBA 1VBB3 4BK4A 1W6MB 5D5QA 4R9AA 3ZMUA 4DV3O 1YIJV 4YGCA 1ZVFA 1AJQA 1OFSA 3AP9A 4GT1A 3TB0A 5FYIA 2XWBB 1K33A 1JQ0A 1QIQA 5E88A 4DNYA 2A6WA 3WY6A 3ZYIB 2YBKA 4UB8Z 1SG3A 2PELA 3GM8A 4P9YA 1YJ9V 5BNOB 3CIHA 2V4DA 4UXNA 2Q0OC 3VQWA 1PO22 1SHWB 2JX9A 5C3QA 4A45A 4DQAA 1GKBA 4IEXA 3L9DA 3OD4A 4XXPA 2ZMNA 2KA3A 5EWSA 1LODA 3H0OA 4OHXA 4ET7A 5C9AB 2GC0A 1FFTB 5F5IA 2QDOA 2CH7A 1UZZA 3QO8A 2ZGOA 5FREA 2EICA 2QQVA 1PV0A 4FAGA 2NLRA 2E7AA 4AGGA 1WA8B 1AR63 1BEV3 4TZDA 1WB8A 4EN7B 3HMYA 5F5AA 1C57A 1R1ZA 1ZRDA 1KS5A 1XUQA 3JAWB 3HNYM 2ZA9A 3F5TA 4OZOA 1OH4A 2B7YA 5FZIA 5T55A 4BHPA 4KHPO 3K58A 4MYEA 4PI0A 5EC2C 5K0UC 2GP3A 1G8MA 1XOYA 4YZ4A 3G6JB 4ISRA 1YUDA 4AVCA 3ALQA 3WF1A 2E5LO 2OTLV 3ZN0A 4LA2A 3C3TA 4X20B 1P84F 1OQDA 2ILMA 2WQZC 2OQ7A 1ND3A 3VBSA 4UVBA 5EQUA 1IS5A 3LOBA 4KNCA 4NHXA 3ETDA 4LHSA 2X5IB 4RQPC 1N3QA 2DUQA 1EAH2 5FPVA 1RM1B 1F31A 3AG3B 1UYXA 4HLTA 2GH2A 1DCSA 4CCCA 4X65B 2BW8A 3K9SA 4N9HA 4MV2A 3IZOA 3QF7A 5LBBA 1D2SA 1X8MA 1M56B 3CYOA 5IVYA 1P7BA 3KMHA 2YI9A 2A7AA 3WD5A 1KDMA 1H2LA 1PK6B 4KWLA 1URXA 3JARB 3PUIA 5F9TA 3Q9OA 5FIXA 4RGGA 5A32B 5JVDB 1K8AW 2A06H 1AL21 4YIOA 4CEYC 4NIHA 2JE8A 4AHWA 4WM7C 5CG8A 2CDPA 4DK0A 4GAZA 5LP6C 4BQ5A 1ONAA 1LOBA 5FXXA 2EALA 3AKSA 1UKRA 4OMCA 5HCBA 4LQRA 3LSEA 5L3DA 3C7OA 3QG5A 1O4YA 2RM22 4GUNA 1E5IA 5LHGA 3MIEA 3OPZA 1G7YA 1OCRC 2G9GA 1AR82 4C8DA 1Y67A 1N8RW 2IU3A 2UU9O 3OPTA 3HT2A 5CA6A 4QX0A 3LOIA 3WG7C 2ADEA 3CMEV 3RZHA 4IEOA 4UF0B 3KLSA 3WEZA 4XAAA 4MVUA 5L3GA 5FPBA 1PMIA 2R071 2LUWA 5C8CC 4PA9A 3A4UA 4L0PA 4RWUA 2RDQA 5LA6A 2WNVB 4I0AA 2BVVA 2PGGA 2F95B 4LHNA 1JOJA 1EZJA 2VBPA 1RUI3 3UJQA 4UV9A 3UCSC 3ZDVA 3ZR6A 1U5ZA 3NO8A 1XNRO 1KP2A 1RMU3 3MIDA 2QNKA 1RUC2 3KZIZ 4K20A 5EPAA 3B5LB 5ACA2 1DQ6A 2YBPA 5LOVA 3LE0A 3F95A 2EIKC 4WV8A 1SS3A 4IIJA 4JASA 1D0GA 3PJYA 1I3HA 2WSSG 1VEWA 4GKJB 1AR1B 1SBDA 4R8CA 1FNZA 3DXRB 1AR83 2CDOA 4EZHA 3HKDA 4OVEA 4EN0A 3AMPA 1JYTA 4CEWA 2XJTA 4JYAB 1H6YA 4OPAA 2Z5WA 3OUHA 5DAWA 5LBQA 1VBE1 4AFMA 4Q4X2 1EY2A 4AWDA 1XBFA 2TEPA 2BOIA 5EFUA 5D5PA 3SEPA 4CDXC 3QACA 3LUTB 5FMCA 1KFXL 3ABMB 3WZ1A 3BTXA 3VBRB 4JGYB 1RITA 4I50B 2QQKA 5C4WC 4QGPA 5FR3A 4BYYA 4O2AA 1PO13 1ZRCA 2LFSA 4NKGB 4B3MB 4QPIC 1ZNPA 2UUAB 4GZRB 3R4DB 2E51A 4C91A 5IK8A 4M01A 4LNVA 2ZKLA 1JYVA 5T5OA 2YPDA 4FZ0A 2XAGA 4P14A 4LUKA 5L9RA 2RS31 1W8TA 1JX9A 1AVMA 4JI1B 4M0NA 3J7NA 4QMAA 4PJYA 3I3DA 3ZFEA 1U5YA 4FM2A 4FFHA 3J8F3 3BPSA 2HLDG 2IXIA 4L11A 3OBTA 1ZTEA 4QX8A 3GJAA 5CG9A 4KWKA 2WWWA 4O4JB 1UD1A 1SQ4A 3O9OA 4A7YA 1RUG1 4BMBA 3KB5A 3WW4A 4YNIA 1RUJ3 4P5YA 3LSSA 1Q8QA 4CP1A 4Y5TA 5IJ0B 5CZKA 3L74H 3AKRA 5FZLA 1PHMA 4NRPA 1R082 2W52A 2HWB2 1XL4A 4DV5B 4GH4A 4HVOA 3WNLA 3OAAG 3IJ4A 3JCZA 3Q8FA 4HKOA 1H8EG 3C2UA 1AL0G 4WM8A 5IFTA 2DURA 4N53B 5CA1B 3A22A 1NZCA 1YZBA 4CP9B 4GALA 3L70H 2ARBA 1CIYA 5DQ0A 4FFGA 4NR1A 2FDFA 3K48A 4U7NA 2V4VA 2QQUA 3AZYA 2ZJCA 1NYWA 4ASUG 2GC1A 4LO6B 3E35A 1S1AA 4MG2A 3LSDA 1WCQA 2QKAA 2O1QA 3ZXAC 4XVHA 3MO4A 4W6XA 1XNTA 1MZEA 3RJRA 2YU2A 1XXNA 4OI1A 3VBSC 4JI7O 4ZHNA 4OQ8A 1FD9A 1ORQC 5FJKA 4B29A 3ZPOA 5DDJ1 2E31A 4BWOA 3STZC 4GWIA 4A3XA 1V9U1 2IUWA 1VAMA 5LWBA 5GLVA 3T3YA 3POSA 1X36A 3O1RA 4EEQA 1UIJA 2OUJA 4JDMA 4IEUA 1OHHG 1W0PA 1NU1H 4E8CA 4YW4A 3NR7A 1H2GA 2NYYA 2J1TA 1W0NA 4BIZA 3ZHRA 2RMKB 1YIPA 5BNNC 2VPVA 2P7TC 2I07B 2C0ZA 3SHRA 1RPOA 4EWEA 1MQTC 5EJZB 5FY0A 1DGRA 3WSOA 1LAJA 4Q0UA 4UFZA 3HR0A 2EX3A 2P3IA 2YZ4A 4TTGA 2G19A 3MV01 2XDVA 5F2WA 1PIV3 1OI6A 4F4LA 3MICA 2ARAA 2EVXA 4LBKA 3JU9A 1P8JA 4LR4A 2OZ6A 1XOUA 2E76B 1YI9A 4C1XA 3LA7A 3EB7A 3GJBA 3OMIB 3LEIA 5B1BB 4ZHQB 1RUF3 3RI8A 1QLEB 4UVAA 3A0HZ 3PURA 4DY3A 2DUOA 4C0BA 4K6BA 2JGDA 1OPOA 1VBB2 3ZYHA 3M1HA 4YFZA 4XIOA 1OA3A 3ABTA 2J7MA 5EV7A 5KHIA 4B3TO 5I0TA 3J4UH 3AMQA 3MLLA 2PYTA 2RHPA 1RPRA 5FMDA 2RM23 5FPOA 1PX3A 4WFAV 5HCFA 3SCGA 2RR11 4FFBA 2IC1A 5CAZA 1I5YA 4K3UA 1RINA 4JZGA 5L3CA 1X4TA 3MDPA 5DDJ3 4Y1ZA 1DQ5A 1DIWA 4E4HA 2Q1MA 4DEVA 3IC9A 3AG7A 5DN6G 1FNYA 2IFRA 2VD7A 3MAQA 5CFCB 3K79A 1Q8PA 1OD5A 3RZZA 4LBJA 3D0JA 4DUZB 2FHRA 3VBSB 4PA6A 3L72H 4YG3A 3H1HH 4DR7B 4XJAA 1H0BA 3VBBA 1JOBA 1OXCA 5I8TA 2UUCB 4XCBA 5K0UB 1G4YB 3SJBC 4DR3O 3KHBA 3T1CA 3LWCA 3N4MA 3USUA 4IE7A 1X33A 3UJOA 1CAVA 1XE7A 3OG2A 2ZR2A 2C1FA 5JPNB 1K7DA 3ZMSA 4YIPA 4YJ3B 1SQPH 3ES4A 2AC1A 2DCYA 4FOQA 5LY1A 3AP5A 3KVBA 4JGZB 4YSFA 5FCCA 3CRAA 5I8YA 4TV9A 3MHSC 3H3UA 3M3QA 2ZS6B 4MS2A 3FWEA 3JYCA 2LQTA 3SYQA 1V6LA 1Q8SA 2MHFA 3OGCC 4CS2A 3T1YB 2RDRA 2WZ8A 1ULGA 4FOYA 3GZTB 4CDQC 4ASKA 1CVNA 1B04A 3AMHA 4DY5A 2F17A 4P9WA 1WP8A 4HNAB 3RYHB 4NRMA 4XOGA 2CUGA 3LAGA 3HR9A 2JS3A 4DV4B 3AP4A 4XF9A 4COZA 1YITV 1PX4A 2P4KA 3JD72 4QHZA 1WW4A 4OFGA 1IPJA 1HRV3 1ZWIC 4FPYA 3FYIB 1XNCA 3CRQA 1ND2B 3THTA 1JH5A 3POBA 3AG3C 3NV4A 3QOPA 5CN0A 3PIJA 4MGZE 4LULA 4XTPA 1G9DA 4AW7A 4Y4RA 2QWPB 1WGPA 3MHHC 3TBDA 2QFEA 4E4ZA 4Z1VA 1REDA 2EAKA 1ZUQA 1NZIA 4W4ZA 5A6QA 3AG4C 3I7DA 2ZPXA 4O7XA 4DRVA 2AEYA 1VQPV 2D93A 5DN2A 4META 1ASJ3 4PLMA 1XHXA 4S2DA 3RBZA 3ZLIA 2VVDA 4HNAA 4OHVA 4XILA 4AG4A 4UFIA 3BIWE 2RMU3 4COVA 4JTOA 1RUE3 4AI3A 3PMEA 1AI4A 2QCSB 1HP8A 2JE9A 2JWPA 4WFHA 4IETA 1V6NA 3QH7A 1FMD2 1GN4A 4LBOA 4BA6A 2DFCA 4Y22B 1W0JG 3OE7G 1UU4A 4MADA 5JI7A 5LXTB 2B39A 1OLQA 3JAMN 5L7OB 4GYCB 2UU8A 3MPBA 3POEA 3T2PA 1Q43A 2ZZJA 5FYUA 3NAPC 5H9PA 2EINC 2X10A 3U4XA 2YMZA 4QX1A 1XMOB 2Y34A 1SFPA 2VUCA 5CA0A 4IUGA 4BK5A 4CCMA 1LENA 4FLXA 5FO9B 4RR3C 4AQYB 5FPZA 2IM9A 4B3MO 2BV4A 3CCEV 4A42A 1MS4A 1WP7A 2WO7A 2XT9A 2WO3A 1AL23 2HP8A 1MQTB 2XKPA 1I1EA 3LDEA 2FDIA 1N32B 2ZGTA 1JFFB 1H2KA 2FYUH 4JTCB 3SH4A 5HCAA 3RYIA 2B46X 2VL4A 4X6RB 4D3WA 3LEMA 1GU3A 3VKMA 2GTSA 4BXFA 1IBKO 4ISQA 1DGLA 3AG4B 4P5HA 5FWJA 1JYWA 3ZFFC 3Q4HA 1SKVA 2XJVA 1B09A 4M0HA 2HWE1 1Y9QA 1YLLA 1ND3C 1BJQA 2DYRB 1UY2A 1I08A 3N7LA 3WW1A 5F1RA 3GALA 1HNZO 4Y1YA 2VOXA 2KM2A 2RJZA 1JTZX 2QSAA 1XHZA 4CUAA 5AVAA 2CNAA 2FQPA 1VRH1 5FP9A 5FZHA 3DV8A 2QQNA 4LF5B 2E5LB 2FCVA 1CEZA 1TME1 1D4M2 1U97A 2XASA 2UXBO 5CA3A 4CDUB 3LPGA 2R1DA 3L2HA 2ITDC 1CX1A 1BMFG 1QQP2 2AZ2A 1NCRC 4FPLA 1RUE1 3MYXA 2XJSA 1GOHA 4NIDA 2I45A 1UY0A 1XNBA 3FX7A 2QQMA 4ASLA 4HMZA 4AEMA 2DCZA 2PUSA 3O1UA 3SYAA 1W0OA 3MIHA 5FXVA 1TME2 3ZYPA 1D4M1 4IE4A 1HXS1 4ZHQA 1ALYA 3OR7C 4Q5OA 1UOJA 4NIIA 4AI2A 1RUJ2 4KXRA 3RZKA 1H2MA 3PU3A 4GKYA 2A3QA 2MEV3 1LESA 1H1IA 3NNMA 5CB4A 1DF0A 2RS53 4QX7A 3GB7C 1OT5A 4ZY9A 1SETA 4QB6A 1H8HG 1Q6IA 4L2NA 5FP7A 1ZBE2 1QU7A 3B01A 1AYN2 1NA1B 1FPOA 3BODA 5L3BA 5GZCA 3ZMTA 3NSTA 4K8FA 5AC91 1O3TA 5DECA 2XH6A 1QLNA 5A3TA 4LPLA 5C3PA 1WD4A 1D0HA 4LO4B 1QJY2 3DYMA 2DWDC 1JZ5A 1H38A 1RXFA 2PQSA 5LASA 5BNPC 2DCTA 3UM7A 1WCDJ 5FXZA 3WP4A 1RUH2 1M57C 5FZFA 1VBC2 4TN7A 3G67A 3JD0A 3E97A 1XILA 1R64A 4NJ4A 1TMF3 2PF4E 1N4CA 4CP2A 4UW4A 2W9XA 2JDMA 3WOGA 2VW2A 4G2KA 5A1FA 3B02A 1JS9A 4IGOA 3AFKA 2JECA 3BI3A 2Y26A 3I3BA 4LF8B 4FPEA 4YM1A 4ORFA 4TXWA 1FX5A 2CHHA 1V9U3 2YC4A 2CWSA 3KD4A 1MEC1 5F8PA 1JBCA 1V6IA 4DR7O 4YM2A 2JB8A 1VQ4V 2CGPA 1PO11 1O4ZA 4I4TA 1ENRA 1BE3H 2VRZA 4O4JA 1QH7A 4NMIA 1UMHA 2A6XA 1MS9A 4Q0PA 3PVOA 3ZX7A 5KXDA 5CBGA 2HG5C 1FAYA 3OM3B 4AILC 4RYDA 5EIBC 4NXNO 3J7MA 3ABZA 2P22C 2MPFA 1GSLA 2YXYA 4I9WA 5LRRA 2MEV1 3WT3A 4C1WA 2ZCWA 3BY6A 1CJPA 4MH0E 2D6OX 4JI6B 1GWMA 4N53A 4Y1UA 2ERFA 2R9IA 2Y8KA 4OHWA 3OYWA 4ZXKA 2XLAA 1IDSA 3C3SA 3GBFA 1S77D 4TQFA 1HN0A 4YVSA 4GB31 1IPSA 3V0BB 1RM1C 3ZSKA 4RQEA 1EV11 3CZUA 3IAPA 4IW3A 3H01A 4O61A 5LA9A 2BWAA 4WFEA 5DZGA 1RUF1 4S2FA 1NQTA 5A3WA 2HWF2 5E79Z 1QJX2 5A7PA 5L3EA 1YC61 2ARHA 1IBLO 1ZREA 1VQOV 2QQOA 3E86A 4LKEA 3ZYFA 2ITCC 2YY1A 5DZFA 2YIBA 4FVVA 2QZ2A 3N36A 4LO7A 4JTDB 4EROA 1Y6XA 4NB5A 4CEWC 3HJRA 1FS0G 3OT7A 4GB32 4XQDA 4BIFA 2DCKA 4S2HA 4DV2B 4XAEA 2DTYA 2DQ3A 4OUMA 3VHOA 5FYZA 2V5YA 4FAHA 5FUPA 2CY6A 2M7WA 3URFA 3WQBA 4HKWA 5LP6A 4N7UA 5IYDO 5IYYA 1B35C 3BAAA 2CTWA 3C7EA 3EYPA 2FMYA 2X6BA 3WG4A 1H1AA 3WQ0A 3K04A 1Y4WA 3H1IH 3MLKA 2JGUA 3SJAC 1I5ZA 3HKCA 1AROP 1Q3EA 4BIUA 1HNXB 2PYJA 5FKBA 5TISZ 4QE7A 4JZ2A 5FLXN 1UOGA 3JAKB 1XEQA 4LWSA 3I59B 3ZIAG 5J1XA 4JV5O 5T52A 4LBNA 2WNUB 4DXWA 1NY72 4YWAA 1LOEA 1YXWA 1PIV2 4ZZ5A 2FDJA 1K92A 4AHXA 1VARA 4FPHA 3I2IA 1RUH3 1J58A 2GUZA 4DUVA 3ZKUA 1V6KA 4CCDA 3NRUA 3WR0A 5JR7B 3VBUA 4XXAA 3AYDA 4IE5A 5DMYA 4LFBB 1VALA 1FJGO 2BEOA 2EIGA 2Z5UA 4R8HA 2P4VA 4I0WB 1W9WA 1HNXO 3JCIA 5IVFA 1IKQA 5FZEA 1J1TA 3O1TA 3H3LA 1CPNA 4W4LA 2ZAAA 3ZS8C 1TGOA 5LA0A 1CXZB 2PMWB 4O4HB 3TJTA 5L7OA 3ME2A 4IDZA 3W5MA 2WT0A 4PIXA 5A1LA 4BAYA 3K57A 4KGQA 1EN5A 3DCQA 2XMLA 2KSDA 3PVNA 4XDQA 1C28A 1OV9A 2Q7EA 5JOYA 1VF7A 1MS0A 2WINB 4E4DX 1L1FA 2FKXA 4J1XA 1W6PA 4DR2O 2VCAA 1O3RA 3JZVA 4Q4V2 3WHUA 2YSUB 1AZDA 2Q7HA 4LK6A 4NTYA 3FHQA 4YG0A 3TRSB 2HLEA 5FP3A 5C9AC 1UXZA 4L92A 3IAYA 4DR5O 3A0KA 2V5DA 3ZDSA 4HN1A 4BQ2A 2DVBA 2YPJA 3R05A 1JZ3A 3AZVA 4LF6B 2XKOA 5JQGA 2Q4SA 5EYXA 1HQNA 4CXXA 3RYCA 4LOTA 2HJIA 4AHCA 5CBHA 1S0BA 1OCCC 4NWVA 4PDWB 1C4RA 3P6BA 3VBHB 2WQ8A 1JXNA 5KXCA 5JI9A 2IJHA 1MEC3 1XYNA 2QVSB 4QPGA 3V0BA 2JDPA 2ZX2A 4NHMA 2QM7A 1AX2A 4JV4A 4NIGA 4NPMA 1SQXH 4EN9B 5FZ3A 1PNFA 2YUEA 2EJ7A 4IGPA 4MTXA 4AXOA 3VDAA 4JDNA 1QOSA 1HJGA 2EIMB 1QR8A 2GMPA 2YIDA 4AQTA 4XDPA 2JRIA 3ZFEC 4JI3B 1NA1C 1ZLZA 3MUZ1 2BERA 5I0DA 3ZO0B 5D8AB 2O0OA 3HAGA 1MS3A 2JJ6A 1OZ0A 4L9BA 3CCMV 1NCQB 3T0AA 4P9PA 3J7AU 1QR9A 2P37A 1RUG3 4DR6B 5FPAA 1WB7A 3VZNA 3P3PA 4B3RO 1QY4A 1AL22 4JV5B 4MX3A 1AJKA 1CR7A 1IKPA 4XDKA 2WLIB 3LDCA 3BU0A 2A73B 4AVAA 4FZ1A 3H8XA 1ROPA 2JG9C 3OW2U 2PFWA 3VD7A 4CU9A 4BM8A 2ATKC 2OYQA 3OTOB 4IV3A 4CCKA 2QE7G 2F4VO 2Y60A 1NT2B 3O5SA 2XAQA 1POV0 1NG0A 4W50A 1U0AA 1A8MA 3M3CA 4N53C 4P9GA 1VB4A 4QQPA 3WB1A 1DGWA 4W4KA 4MHUA 4Q2FA 4WVWA 3RYIB 1E5HA 5JUVA 2ZCEA 1F4AA 2AR6A 1ACCA 2W87A 2ADPA 4Q0QA 3L71H 2WWSA 4RQFA 4QXBA 1QU0A 2M6YA 1J5EO 4ASMB 1K5MB 3T4HB 4CUGA 1QQCA 3VKLA 3NV2A 1VRH3 3DGTA 2J1RA 2WRAA 4M4RA 1GWKA 3K51A 2YICA 2IH1C 3D8CA 4XPVA 2F4VB 1WCUA 4TLGA 1KJLA 2Z2SB 3OGIB 2ZINA 4LOSA 3RZMA 2YUAA 1DLCA 2ZXQA 3AG1C 4MVMA 4X89A 1PGSA 3GNEA 2QTSA 2SBAA 3ZVXA 3VB9A 2Q9LA 4NOTA 4O4HA 2Z42A 5B1OA 1AI7A 2R70A 2WO2A 3ZXEA 4RQPB 1N1VA 4A5UB 4FLYA 5B4XA 1HN1A 2LTNA 4MTFA 1CAXB 4WVMA 3E8HA 3O65A 2WPDG 1KKDA 1LOGA 3EXUA 4W65A 5GALA 1DHKB 5CMUA 3BA8A 4RHV2 1VBA2 4PV1B 1XJAA 3O1PA 4TSFG 3CKHA 1M56C 1WLDA 1JZ7A 4OXSA 4Q4W2 2SLIA 1BZWA 3SPIA 2L35A 1S55A 1V00A 1XB9A 2LP7A 3RGBA 2Y64A 4XC9A 5I0RA 2C9KA 4ZIBA 3FJSA 5FZ4A 3ZJZA 2ZZQA 4KHPB 1DU3D 3JALA 3ABKC 1VJ2A 3SH3A 1CONA 2ZEWA 5CFDB 2VMIA 1S0GA 4HT1T 5FP8A 4GZ9A 5K1XA 5B5EZ 5CB4B 3DEMA 4J11A 3SJQC 4K0KO 5ABJC 1H8VA 4LA3A 2Z69A 5A1AA 3VD3A 3LDKA 3A2FA 3U07A 2R061 4EKWA 2H6CA 3MZHA 3K2OA 3ZEDA 4DZGA 4D94A 3NAPA 4DRXA 1OCOC 4IEVA 3B8MA 2LROA 5KHHA 1PVC3 1POV1 3AG1B 1SLBA 4IHJA 1Z5VA 1LEMA 2VMHA 1ZL8B 3QD6A 3N35A 4F6RB 1HB4A 3VHRA 3H1KH 4Y1VA 5BNOC 2OA2A 3AFGA 4BDVB 3MIFA 3JARA 1W9SA 4WM7A 4N90A 4QPYA 4AVBA 1TQ5A 1DZQA 5A70A 4XFCA 5ISLA 4JI1O 2QA4V 4Y3OA 1G86A 2R062 4JI5O 1PO21 4JDOA 3LFMA 5EK0A 2NMOA 5IE9A 4UOJA 2HKOA 4XFHA 2DWRA 5G05L 1DBNA 5FJHA 1GMMA 2AGAA 4OCTA 4LF4O 5FZBA 1WZXA 2XWJB 1JU3A 3WNNA 3CNAA 3LNMB 2AZ5A 4FPGA 2CDYA 2WBKA 4DR1O 3VBOB 4CTEA 4NXMB 1OLMA 4MGQA 1S0EA 5BMVA 2V09A 4CUCA 3H8OA 2C2AA 2VZRA 5JAXA 2WABA 2OIIA 1EAH3 2CTVA 4LMFA 1VP6A 5GKAC 1S0FA 3VDCA 4UCOA 4QQHA 1PGL1 4DV6O 4DB5A 1JMKC 2WFPA 5IWAO 1V6JA 2HBUA 1S4CA 2ZHMA 2P34A 2VMGA 2WA4A 2N7GA 2XTAA 4EN8B 3K5OA 2JDIG 4YLZA 3ACHA 3WDWA 5EXOA 4X66O 4QU1A 1P4RA 1K4CC 2VG9A 3AB0A 3ZXKA 2Y0PA 4BZ4A 2WAAA 2W08A 2PTMA 5IVCA 4WFGA 2BBAA 5KXEA 4WBNA 4DV4O 5EBWC 2YI8A 1R6NA 4RUEA 5FYCA 4MT8A 3ZX6A 3QNEA 3ASIA 3Q8AA 2JG9A 2HVKC 2ZNIA 2ZNJA 4DV6B 1JYXA 2R043 3CJIB 2FMDA 3GBWA 5C6CA 4ITCA 2XOMA 4JKLA 3JBG1 2ZDIA 4BR6A 3NVCA 3THPA 4QB1A 3CC7V 3Q8CA 3TYJA 2VBBA 4LBQB 4BW5A 4RS5B 1FXZA 3CCLV 1UQXA 1XC6A 1AR61 1QMJA 2OIGA 5FZOB 1NCQC 2VUDA 2RS13 2F66C 3H7JA 4R52A 4AK3A 3BKZA 4UUJC 5C93A 5JH7A 2Q8CA 1XQ8A 1AF9A 4FOWA 3ZYRA 3TN93 2B5HA 1YQ2A 4EWDA 4FPCA 2O14A 2GMMA 1M4UA 1S0CA 1BK1A 3LDDA 4QX3A 4IEWA 2BRTA 4BWAA 3SKVA 2E9QA 3ZFEB 2J42A 4KBZA 4OHZA 4YJ2B 1WKYA 2WLNA 5EJ3A 2K9ZA 2ZHNA 3NV3A 1VBB1 2JDZA 4F7ZA 2CTRA 3FD9A 2R072 1TUEB 4LF9O 2PHLA 3WVJA 4DR4B 2BOJA 4RR3A 4LKFA 1QJEA 1UX6A 3VD4A 4I2OA 3H8UA 2ZXWB 2JXAA 2WZR3 3KGZA 4DFSA 1RVF2 3AXDA 2C5DA 3KSCA 3PVEA 3HPLC 5LGTA 3EBRA 1W03A 2A3XA 3ICXA 4XUQA 1HRV1 1W6OB 2ZHLA 4TV8A 1MACA 4N23A 4QKDA 5E1RA 3OUIA 1MZ6A 3FUQA 2ET7A 1EN6A 1O6UA 3W20A 1LHOA 2XONA 1IPKA 1ND3B 3BPZA 2WLMA 5L19A 4AFDA 5KX5B 3KCYA 3A0NA 4QWNA 4JYCA 2ZD9A 5GZFA 4K8XA 4YYOA 1OA2A 2R063 2VXRA 2HWE3 3PTRB 4JI3O 4R50A 5K9YA 4A4AA 4JI0B 3RS6A 1EUTA 3MD0A 1R3JC 3FB7C 3R4SA 4E8DA 2ORXA 2YS8A 2Y4UA 1N36O 2QQIA 3ZCCA 5FPUA 2LS6A 4ONUA 4FPPA 3W7TA 4AVTA 5JOZA 2R49A 2XAFA 5BNNA 1MVQA 1NT0A 3H42B 2RJ2A 4O9EA 3CXHF 2UWCA 4CCLA 2WS92 1WLCA 2BGCA 4QPIA 4I0XB 5JVDA 5A32A 3RG0A 1JOYA 2DU0A 1SERA 4XUPA 3D3QA 4PBPA 2W68A 1CX4A 1A78A 5IT9N 3JUUA 2R9AA 1VP7A 1E5SA 1BEV2 4YRDA 3BYWA 3S5QA 1M1KW 1XNDA 4XYXA 1KEXA 1UX7A 5IFPA 3WV6A 1UY4A 2CK3G 4CUBA 5DM6V 5FZGA 5GZGA 1QCEA 4P9LA 4YZ1A 4FPJA 4I02A 1UAIA 1K97A 4GA9A 1HR0O 2BFUS 4LHKA 1D4M3 2BFUL 3I2FA 3S3WA 1J95A 2OZJA 2B42B 3BRCA 2R32A 4FJCC 2JKBA 1IX9A 3UGFA 5KR7A 1SLLA 1NE4A 2CAVA 1UIKA 3TEZA 3OOXA 3E8FA 3WX5A 4RHV3 2DYSC 4YGEA 4DW1A 1ZYBA 1QHTA 1DFQA 2PLV2 4FP3A 5D8AA 1RUG2 3CC2V 1L7QA 2PHXA 1W8UA 2NPIA 2YEVB 3LDRA 3WNPA 4HZ3A 2VMEA 3KT4A 1J84A 1UF2C 3AJYA 2MW2B 2VR4A 4UT5A 1R081 1QVFU 1OH3A 2VNVA 5JZGB 2W46A 3K3NA 3RNSA 1QXPA 1Q8VA 2CGOA 2XHKA 3N9LA 1NE6A 5CADA 1J3RA 2OPKA 3X2QC 4GJYA 4LK7A 4U7OA 4TT3G 4QQOA 3CS5A 1W06A 2N05A 1V70A 2A6YA 4D6SA 1KECA 2FDKA 2BNNA 2RE9A 4R4ZA 5IK4A 3JAWA 1OOPC 1QJU3 1O5LA 3TNPB 2BOCC 3WUDA 1TVKA 1CD3G 3HPNA 4ARXA 5B4NA 3S3XA 4XDJA 1GN3A 3WB0A 1TAEA 4LCUC 4LTAA 1KXGA 3VBFA 4BQYA 4HK9A 3VDDB 4TUYB 4B3TB 5BXXA 2PLV3 1REEA 1MA1A 1O9GA 5CFCC 5FTTC 5JXJA 4R4XA 4B4QA 1MS8A 2VZUA 2A5ZA 4UV8A 2OXBA 1WW5A 5FY8A 4LBMA 4Z8BA 1CZVA 1IURA 2V73A 5J37A 4H13B 3RYFA 2QTOA 3U1XA 2P67A 1SZBA 4DR1B 4HSJA 2F6BA 5FLHA 2D5HA 3J81N 5EC1C 1K12A 2QDRA 2XBO2 4A6SA 4AFAA 1LNSA 4AGRA 1O9HA 1W8ZA 3ZIWA 4O4IB 5JVVA 1UYZA 1W2OA 2IZWA 2VTFA 4M3CF 5C3RA 5CA0B 5J2TB 3I2KA 3ZXLA 1NTZH 1TA8A 1KQSU 4NWWA 3O14A 4XW3A 2VAUA 2Y38A 1W2TA 2HWE2 1KQRA 3PTYA 2X5IC 5A3PA 1JUHA 2DE0X 1ZSPA 4X6QB 5H2FZ 2WQ4A 4UCSA 1PK6C 4YGBA 5SV5A 4NXMO 5B1BC 5JSOA 5KWRA 1MMMA 5IY5C 2WJSA 1ZBA3 4P30A 4MVTA 1DG6A 1PD3A 2AW9A 4CH4A 2DF7A 1HB1A 2D6PA 3AK3A 1UPIA 1K5MA 1OFNA 1UOBA 3Q4HB 5KX5A 3MDSA 1GN2A 1F4NA 4XMIA 3JQWA 3DGEA 1QQP1 4ZBMA 2EILC 1NTMH 2D3OW 2Q69A 4PJ0Z 4Q4Y1 4XUOA 4TWKA 4JI8O 1BBT3 3FB8C 1W05A 5EYPA 5FYMA 3EMRA 3BOWA 4FI9A 4NPRA 3FLRA 5KBFA 5GTHZ 4OI4A 2HVJC 1NBMG 4MVZA 2BBVA 2XB6C 4J7ZA 4AF9A 4DUYB 2JIJA 2YC2A 3SC7X 1IS6A 4YJ2A 4F8AA 3TN91 4GKJO 4IYHA 4CVUA 3FB6C 3DPRA 2YGLA 3WF4A 1A3KA 4GX0A 4WVVA 1XL6A 2EIBA 3ACLA 3E2EA 4X88A 4PA7A 1Y74A 1AYN1 1O3QA 2VNOA 1GV9A 1FATA 2VQFO 4RA0A 4QX2A 1IBMO 3WW3A 3FFZA 2WNUA 3TWIA 2A0LA 1GZTA 5BNOA 4BLIA 1F9KA 4PLNA 5FO7B 5C71A 5FZDA 3KCXA 5EYPB 1QJY1 5ANQA 4JI2O 4V1PA 4XZPA 4P00B 1D2DA 4LBQA 1GICA 4YG6A 2H94A 5IYCO 1YEWA 4YHHO 1C1LA 3G71V 3DXRA 4KFMA 4Z2WA 1VBC1 5A3LA 1XSRA 3O1VA 4JQTA 2BCCH 2PHFA 4PDWA 2VWJA 3NAPB 1XMQB 2X05A 3ZFFB 3K9AA 1PM4A 5K8SA 1ZM1A 3MW4A 3VQXA 3ZRSA 1PL4A 4IXLA 1KBHA 1AHSA 3MGUA 4CCOA 1S5JA 5ERLA 3G4SV 5FMBA 1RSOB 2FDGA 1OUXA 3IDEA 1R1BA 1RMU2 1LU1A 4GMP1 5FZ7A 5FY5A 4OI2A 1FYJA 2XLGA 3ACIA 4FK5C 4O9GA 3ABLC 3JSLA 4H33A 3UGGA 5C9AA 3SYCA 1SLCA 4FFIA 3ITQA 2YXLA 3VBFB 1SQBH 1PZ8A 2YG0A 2UUCO 4AHYA 2ETNA 1YQ8A 4HL0A 4N21A 1MS1A 3VQYA 2EZPA 1MZ5A 4FQ4A 4J6GA 3NJVA 2GC2A 1TE1B 3MHZA 5IAXA 2RS11 1TME3 4PIZA 4PI2A 1A32A 2IXHA 3JAKA 4LWSB 3I59A 4GH4C 4IQPA 5EZYB 3WXPA 1RUF2 2D5FA 2ADQB 5H9CA 5K4LA 5GLUA 1OOPA 2WZPP 4XFGA 1W8NA 1ENVA 1CESA 1I5PA 1TVGA 4HBNA 3E5UA 1OQEA 3K77A 3T2QA 2C24A 4LNUA 1CQ9A 1H30A 1BGYH 4GULA 4H14A 5JXIA 1LHUA 2HR3A 3ZXDA 1FMD1 2R9RB 1OKQA 3WNXA 4H0LB 3VKNA 3LA3A 4ICGA 3AC0A 1HB2A 1Q82W 1K5QA 5FZCA 4O2BA 1AR92 5FV3A 5LK5A 1C3HA 1Y3TA 3KT7A 1F2NA 1B06A 4KU7A 1N3OA 2XNDG 4FVMA 1Q8OA 2QM8A 5FOJB 3LIGA 3VKFC 4KG8A 3PIGA 4IV1C 2JJ1G 2Y0OA 5KMGB 3AK2A 2QM4A 2ZIOA 3K5NA 4RQPA 3J80N 2W91A 3BABA 5SV8A 1PNLA 1UWWA 4EYUA 3S57A 1V6MA 5AG2A 1VQKV 3D3IA 3RDIA 5C4WA 3H9AA 5C5TA 4J42A 4MZUA 4XZUG 5DAVA 3BHPA 1S0DA 5HXVA 4K40A 2JDKA 4JVAA 2NR5A 2DJVA 3KQ4B 2VTXJ 4TSVA 3OF1A 2JG8C 3WCRA 4CXWA 4Q0VA 1NY71 1VBA3 2YROA 4X64B 3WG7B 2CE4A 2ZGMA 2Y6HA 3DKQA 3BUCA 4Z07A 1UN1A 2Y6JA 3CQOA 4XJUA 2ZT9B 1R3IC 1Y76B 3I97A 2Y6FA 3ZN4A 2DQ0A 5A6XA 1HDJA 5K7PA 1SRYA 4CDWC 1JU4A 3MIGA 1GP4A 1NR1A 1KC8W 1UU6A 3KF3A 3UKTA 4JPRA 1ZRFA 5LBEA 3I54A 4TWTA 4PA4A 4QX5A 2B4KA 5B3SC 4RD7A 5GONB 3TXQA 4GX5A 4I0XA 4HETA 3RZGA 1MSDA 1Q56A 5DG1A 4UCUA 5GONA 1UOFA 4QNHB 5F6LB 4B3SO 1W6QA 3E5XA 4R7CA 3K3OA 4D0QA 2WFF2 2ZM6B 4YM3A 4QB2A 4LITA 3IIIA 3M8AA 5IVBA 4U3JB 2ZX4A 2BSKA 4QKBA 3CE2A 5D1IA 4TV8B 2WO1A 5C5UA 5JPMB 4E4SA 1VF6A 4DV5O 1CAWA 5JOXA 3THCA 5FZOA 2VQEB 2ZE8A 2XBO3 4WZCA 3WHTA 3RWNA 4K1YA 2A7WA 5LOVB 4Q4V1 1KGYA 1QF3A 2TNFA 2BTVC 1RUJ1 5CVRA 1LHWA 5CFDC 1QJFA 1TNRA 2Y6KA 1R083 5A7WB 5IJ0A 1GH6A 1ZA4A 5FP4A 2HEYF 1TG7A 2EXIA 1QJZA 2DUPA 3T1YO 5KUMA 3QLQA 4W6WA 4V2WA 2VNGA 3K5MA 5A6YA 3HKBB 4XDLA 3JD73 3MLJA 4MW8A 2BZDA 5H5NA 2OPWA 3CBNA 3N9MA 1RUNA 3AYAA 3DXTA 3J8F2 2GALA 1T2XA 1B6QA 3HB3B 1W0KG 4Y5SA 4U3FH 3G7DA 2G9ZA 2OQ6A 3AL6A 1F23A 2GNMA 1REFA 1CPYA 2VU9A 5JSRA 1PP9H 4B4PA 4MOAA 2VOVA 2L9LA 1QXJA 4NHKA 2RN9A 4HSLA 3ACFA 3V65A 1EUUA 1Z7S3 1OLRA 4PQQA 4PDVA 1W28A 5FLIA 3ZHVA 4PBOA 2WUHA 3X29B 2Y48A 5FMOS 3B94A 1WLTA 3GHNA 3CHXA 2Q73A 2LM3A 2QWQB 4GWJA 3J8F1 4JYBA 2R042 3B93A 1C5HA 5KUKA 3GZEA 3O7OA 1E1RG 4UFMA 1L0NH 2HHHO 1PO12 1O5UA 2VZOA 1QDCA 2X09A 3RWKX 2WYSA 2LGQA 3AM2A 3C90A 2JDUA 3ES1A 3LZZA 3DN7A 2Q5TA 3W7UA 2C4XA 2F1MA 1WA6X 2B8MA 4CDUA 1RFYA 3JASA 1JFFA 4QM9A 1POQA 1AILA 5JQGB 2GN3A 3E8BA 4XDOA 4A44A 3O1SA 4R9CA 1RUI1 1X9TA 4Q4X3 5I0SA 3ZSJA 3NKGA 3ILRA 3APBA 1D2QA 4ZOLB 3AL5A 3T09A 3TEXA 3VUOA 2F93B 3F2ZA 5GLWA 2XJRA 2MEV2 2WIIB 5T50A 3WP6A 3CCQV 3JB4C 3W7WA 3TETA 1F8VA 3AKPA 3RZJA 5AC93 4YVWA 3BTAA 5IY5B 2ARXA 1BKZA 2LALA 1KDKA 4L87A 3M7AA 1RUI2 2XR4A 2R72A 4JAAA 1L8DA 2DDUA 1QJX1 2D6NA 1AJOA 1RUD1 3ILFA 4BPZA 2HWC3 3H1YA 4Y33A 1RGSA 1B3QA 2D2CB 2H0BA 5BV6A 3AYEA 1X50A 1H9WA 2HJDA 2P90A 1O7FA 4CBCA 2C26A 5C8WA 4AEDA 2HYKA 1QH6A 2PI5A 2EA7A 4DO0A 1LOFC 4UBHA 3LIHA 3JALB 4GKXA 1EFRG 3ZMVA 4M3CE 5IVEA 2OIEA 4W6YA 2XL9A 2LJ2A 1RUD2 4HANA 2Z79A 4E9KA 3CL1A 2RCVA 1W9TA 1AX1A 3OB8A 3AG2C 1WW7A 1AR71 4ATFA 2G9FA 5A7OA 1YHFA 3RZLA 1KD7A 1XREA 1PMJX 5FUNA 1OHFA 5TSWA 1LECA 4O4LA 1N34O 1D7PM 1W8HA 2G4IA 2VQTA 4O65A 1H4GA 1SACA 3I3MA 2UY8A 2UU9B 1OCRB 1M5IA 5JJEB 4XUNA 2UYAA 3AMMA 3IM0A 1QVGU 2WLQA 5C8YB 4JI4O 2VVFA 4HPKA 2B9UA 3CC4V 3VLBB 4DR4O 1ENQA 4L8JA 1F15A 1PNGA 2K46A 1AR72 4TQDA 3PUHA 1Q6HA 2X5IA 3CCSV 4P9OA 3IKWA 3JD2A 1DK1A 2QEXV 3SJCC 4EFBA 1J1LA 1XPWA 3NQHA 3BVOA 1PNMA 3OMNB 5EZYA 3D36C 2ATFA 2W39A 3OGGA 4Y4YA 3HWJA 2HKXA 4X8AA 1ULCA 3NWKA 3DC5A 3T4ZA 4XABA 3R65A 4BOWA 4YXWG 4U2AA 1WBLA 1TUBB 1E57A 1UPSA 2IBZH 1NLQA 4CE8A 2VXJA 1PPJH 3SLIA 5FKCA 1HJFA 2GBOA 4MVRA 3HBKA 4X62O 1LCLA 1CJDA 3S30A 5CNAA 2Z0AA 2PAEA 2OWOA 1B35A 2ZMLA 4HONA 3E6DA 1BXHA 4E2LA 3LPFA 4QAWA 3WFVA 3ZFGC 4DR6O 1ENXA 2PAKA 2W0FC 1PVXA 4ZPIA 2WLJA 3HN3A 3RYPA 1UNBA 4JHTA 3JATA 2YV8A 3ZYJB 1JZ6A 3H3ZA 1NCRB 5L36A 1YTFB 5FBZA 4YW1A 5F3GA 3QCWA 1OOPB 1X9PA 3I2JA 4IIJB 1FPN2 3DSQA 3RSJA 3UETA 1JHNA 5CYYA 1GTOA 4LF5O 1GZWB 4CU8A 3UK9A 3N3HA 2ZOEB 3A0BZ 2V72A 2YIAA 4GIQA 4GQ7A 4LF7O 5JIUA 4NHLA 1B35B 1SLTA 2D3RA 1THZA 1PGL2 5H9RA 4I5SA 5KAIZ 4MUVA 3CRMA 1N1TA 1RUOA 4I4TB 4IV3B 3SQOA 2PAMA 5DZEA 4ZI7B 3IPVB 3LB9A 3I2DA 4CS4A 1FPN1 1XRUA 2EF6A 5I8SA 1JZ2A 4IEPA 2WN2A 2ODMA 4YW3A 4CZSA 2ID4A 2GMEA 2WT1A 4QDQA 1ZZ8A 1IS4A 4ZOLA 5J2UA 4FXKB 1IHMA 3CJIA 4GH4B 1N32O 1LGCA 4CEYB 1F5FA 3WDXA 2XGXA 4IL6Z 2PI4A 4A6OA 4N8MA 5B2GB 5FZ0A 1LUVA 4XF3A 4Y5Z0 4PT6A 4CDXB 1R091 1TUBA 2VZSA 2EULA 1HKDA 3O0WA 2ZQMA 5J09A 3ELNA 1NUKA 1NQDA 2AUYA 3JBG2 4GWNA 1XE8A 4BXSV 3OGSA 3CDZB 3UQ8A 4DIQA 3TK1A 5IYZB 2D97A 4AVSA 4DO2A 2F43G 2IJIA 4HG6B 5FYVA 2GC3A 2JEXA 2VH9A 2EIDA 4HK8A 4JI8B 4LBQD 3DYOA 1YQ6A 1H2NA 3NNFA 3U10A 4GKKB 1ASJ1 4CEYA 2ZKOA 1VB2A 3ZMZA 2IH3C 3WG1A 3BCWA 3AEIA 2RV9A 3GZAA 3VZKA 3WF3A 5LW9A 4DW0A 2XVLA 1RUC1 4CDUC 1APNA 3NXSA 1WA4A 2KR2A 3IIAA 4FSJA 4EN6B 4OZXA 4DUWA 3AP6A 3VHNA 4YFWA 1OCZC 2W6IG 3ASNB 2R1BA 2H8PC 4EB6A 2GU9A 4I3PA 4MXWB 5C8CB 3CX5F 1CWPA 2JD9A 2IXKA 4LC1A 1MZFA 4E4EA 4NE9A 1HLCA 1AR81 3W5NA 4H2AA 4DR3B 2ZX3A 5J96B 2W6JG 1W8OA 5JSPA 4Q4X1 1XYOA 2BTQA 2CH7B 3I3EA 3VD9A 5KAFZ 4ES9A 1SESA 3GBGA 3F7VC 4Q4W3 1QJU2 4QKFA 3DPRB 1OLME 3UNPA 1XNAA 3PUSA 2IW5A 1W6QB 2WFF3 5BZBA 1O8PA 2VULA 5FPXA 2TBVA 2W94A 3B7MA 1FXVA 1PGW1 4NXNB 3SDLA 2XJQA 4EV0A 3OTOO 3V64A 1GN6A 2ZGLA 4XURA 5FOBB 3ZSLA 4Q4W1 4MTGA 1T6GC 1BQPA 5LEKA 5J98B 1LU2A 4AQSA 5ACA1 3FMGA 5LA1A 1FT9A 1YFXA 1O91A 5FPLA 5L73A 1QJU1 3AZWA 4MXWA 2AHYA 1HQWA 1WMEA 1WLWA 1AJNA 2HWC1 2ET1A 1IBLB 5BNPB 4HVRA 3D4KA 3BU7A 2JIGA 2W0XA 4URAA 5D2AA 2O8QA 3FB5C 1FI2A 4ZONA 1I6XA 1VBE3 2KB1A 4O2BB 1VBD1 4FIPC 2DN9A 1IBMB 2UWBA 3IAQA 1WD3A 4XQWA 2OTJV 2P17A 1H8TA 1FXHA 4LEJA 5A33A 3WUCA 4ZU4A 3E89A 1LOAA 2ZEXA 1G9FA 3CCJV 3R66A 3CCRV 3ZMOA 1DQ1A 1VMHA 4JTAB 1U5XA 2HWB1 1NLRA 2GUZB 1VQ5V 4RS5C 5GJ6A 3S5AA 5IK7A 4DYLA 1GOGA 3TCUA 2B1GA 1GNZA 2IJKA 3M3EA 1I94B 2IJJA 2DMXA 2RG4A 4BIOA 3IN9A 2PHRA 4CDXA 5HFMA 2PZSA 1N3PA 5GTIZ 3PDQA 5BXZA 5E8AA 4PDRA 4CCNA 2RS32 4LE3A 1G8WA 4MO3M 2H3OA 2X0LA 4AGVA 1E5RA 4X65O 2Y0IA 3POGA 1ENSA 4XQ4A 1QKQA 5DEDA 1EN4A 4YPJA 4COUA 1US2A 1XBLA 2DVAA 1I0HA 4P9IA 2JG9B 4TUYA 3VZLA 4X64O 3IC7A 2F4PA 1JOPA 4JI7B 3ZBHA 4I55B 4INDA 1OKOA 4DV7B 4PIYA 4RSUA 1LKNA 1W8WA 3BOPA 1VF6C 4N43C 2CTQA 4A41A 4WFBV 4X8NA 2ZE7A 2RMU2 3K59A 3KM5A 4QGNA 3L75H 4J1WA 5DUVA 4RS5A 3WDTA 1BVP1 2WWUA 5EJ1B 4CCJA 4DXZA 1KYOF 4J7KA 1G6NA 4YZ5A 2VWKA 4B4RA 4X1KA 3SKJE 2XJPA 2Q4PA 4DV3B 1G9CA 4MGSA 2WAMA 2VZ1A 3D36A 3FAVA 1MSWD 2JDYA 1MS5A 4N43A 4DUYO 1D4VB 4WBBA 4Q0SA 2D98A 2JB4A 1NAEA 3F5WC 2UURA 4LH7A 3T2OA 2K2SA 4GMP3 4GXLA 2RMU1 3SITA 1SMVA 5DPNA 3X2QB 2BYVE 2VTXA 5FYBA 3OMAB 4BJ0A 2EINB 4UFHA 2AH2A 2TUNA 5EBMC 3SYOA 5FAXA 1WBFA 2VC9A 4FFBB 5CU1A 4EQVA 3WINE 2QKSA 1GK9A 1YF2A 1YQCA 5A9GA 1AJPA 5EIYB 3U75A 4O2AB 4CYDA 1FPN3 3PVBB 4QE9A 3H8RA 1FFXB 1DTOA 2P6JA 2GTAA 1IOAA 1CAVB 2GNTA 2RDNA 2VOKA 3D5OA 2B1IA 4AQYO 1FXKA 1W6NA 4M3CB 2PHWA 5C70A 1LEDA 3KT1A 3DL3A 4NO4A 1JN2P 2QQPA 3JSNA 4LLFA 2UXBB 1N33O 4KH9A 2PHUA 5FYTA 1SDWA 4BH9A 5ABJA 5JCOA 1M4WA 1CP9A 1Y9MA 2IVIB 2EZOA 1Z0HA 1R1A1 1T5EA 4XBFA 3SH5A 1VMGA 2AREA 3LNNA 2N74A 1OUSA 5JJJB 2XHNA 4QQ2A 5APAA 3PJSK 1XU1A 1U5IA 5IYBO 1DQ4A 3E22A 3CXCU 3L2YA 4L99A 3KG2A 5FK7A 3V0AA 2JKXA 2JEMA 2K0GA 3L73H 4Q4Y2 4NAOA 2IXCA 1FOD1 1JYCA 4I50A 3M3OA 1BCCH 4H55A 1XE0A 5JXHA 3O0VA 3I4IA 5CIRA 3K3WA 3VKOA 1R1A2 3ZIXA 1ST8A 4DR2B 3K75B 3N9PA 4C0HA 1GANA 4CC5A 3RYFB 3WP3A 5K0UA 2DVFA 1JR9A 1VPHA 3QH6A 4XFIA 2W95A 5FO8B 1YFWA 2JGDB 1MABG 1FOD3 3JB8A 4PDMA 1AYM1 2FCUA 1VMFA 4B3NA 2A71A 3RRDA 1C8M3 1WW6A 2OYZA 2Q8VA 2JICA 4JI5B 3OY8A 3ZYGA 2DBNA 3BGAA 3RVHA 3T4DA 3QO5A 1HV1A 1TZOA 2JG8A 4XCAA 3MW3A 5CBFA 2VZPA 3K03A 1VBD3 1Y7BA 1GKFA 2Y33A 4Y1XA 4PDLA 3C8XA 2OS2A 1ULDA 2GP5A 4AFBA 4KI5M 3OGVA 4WBNB 1FAFA 5J36A 3GVMA 4Q8KA 1OF4A 2NNUA 1WWYA 3LCPA 5FY4A 2CSGA 4JKMA 5DAPA 3B3QE 3QVNA 4IEQA 4WVMB 1XU2A 5LB6A 2EXKA 1QNWA 3NJZA 1Y4MA 4OI0A 3HQRA 3OJBA 5B1NA 5IWAB 2QZ3A 2W1SA 2UUBO 4CP0A 5KC5A 4CSWA 1A6CA 4QHBA 3AVRA 4XFAA 3DKWA 5CB7A 1HIXA 1Q81W 1DGWX 4GKKO 5LATA 4XACA 3KV6A 1LHVA 2ZHKA 3ECQA 4WCEV 2A6VA 2XJUA 1AXYA 3O1OA 3CJXA 5H6RA 3KZ4C 5T3NA 4JGZC 1ZZ9A 3E1F1 1URFA 1CAWB 3VZJA 5DUUA 3K46A 3POJA 2Z4FA 1TVKB 1F51A 4DV0B 1M90W 3NV1A 3IMMA 1PZ7A 3ZPYA 1QLEC 2QQJA 1DYPA 5JR2A 4COWA 2W5FA 2JENA 1C1FA 3T0BA 5LGNA 1H2SB 4BQXA 1W59A 3WG3A 4NIAA 3QTCA 2AHZA 1I9RA 4CRQA 4Z1MG 4YVSC 4QT6A 4MW3A 1Q86W 5DABA 5FQ0A 3U14A 4NVPA 1ZRRA 2UXDO 2VGDA 4Q27A 1DYKA 3JD71 3JBG3 3ZRWB 4JI2B 3FL7A 1L3JA 3ETQA 1CZSA 3O12A 4E27A 2E7TA 4IV1A 2J1VA 4MTOA 1UKGA 1RJ7A 5DXDA 2E63A 1R3KC 4XETA 3WNMA 2VO5A 1EM1A 1SCRA 4YHHB 4ZKIA 1YWKA 3N9NA 2E74B 4MGTA 5LGUA 1AR93 3A21A 1IGOA 1UL9A 2BDRA 4BQWA 1GRJA 3AZXA 3MFAA 1UU5A 3HNBM 4YY3O 3KKYA 5FY1A 1C5IA 4HPKB 3OR6C 3A7QA 1NH2B 3FE5A 3C7GA 2VBDA 1ZX3A 2FDHA 2QWRB 2Y69C 5M0TA 4YZ2A 5FNVB 4QDRA 5BNNB 3OBAA 5L7OC 2Q30A 1A34A 1JZ4A 2FMLA 3E6CC 1EYBA 1AR91 1QNYA 4BU2A 4JYYA 5FYSA 3ZRWA 1RSOA 1OBNA 3QO7A 1HRI3 3E83A 1KRIA 3FLTA 1YRZA 2W1WA 4BISA 5HXMA 4QXKA 1OCZB 3B4SA 4GB33 4DRRA 4B7KA 1VIBA 1AR4A 3CMGA 1HNZB 4KBBA 2QTWB 4DXSA 2VQAA 2P5OA 5LY2A 4IV1B 3J26N 3CMAV 1K73W 4LH6A 5FY9A 3VQVA 1UZVA 4EE2A 3T30A 3HT1A 1TEIA 1AXKA 4NAMA 1VQ8V 2Q68A 2P4EA 1COV2 4LIUA 1OCOB 1CAXA 4QGMA 5LP6B 2XG3A 4AL9A 1VRH2 1BYHA 1OVSA 2B5UA 4EFEA 2DVDA 3OEHG 2XLFA 1ZAUA 3PU8A 2YBSA 5ACA3 4NPLA 1UPGA 5IVJA 2WL1A 4D7TA 2OUHA 4JGYA 3B69A 1NLSA 1SFNA 2CAUA 2HBTA 5DUXA 1LUWA 1VE0A 4OX9O 4LF6O 2D40A 4FO9A 2X6AA 2QQWA 2F4LA 1J83A 2Q8DA 3WNOA 1GO3F 3DTUB 3IDBB 5L9VA 3E5QA 5J2UB 1ZZ7A 3M4FA 3RQ0A 4X1IB 1JJOA 1ZZCA 3TXSA 3EQEA 1W3VA 1GQHA 2RR13 1JPXA 1Y43B 3U0ZA 1JJ2U 4E2SA 3CLPA 4DUXA 1V55C 3JCUZ 1S3JA 5DUWA 3ON7A 3IWZA 3EFFK 1HXS3 1MNGA 3LSUA 5KLVH 1KU9A 1O3SA 4UVCA 2EIJC 1G6UA 2ZGKA 2RVAA 1N33B 2WLHA 1ND2A 4CDQB 3CRCA 1DF4A 4ZI7A 2Q0AA 4AEKA 2A1XA 2JS5A 1RYYA 1L0LH 3I49A 1BQ0A 3O0XA 1EPWA 4MGIE 3AKQA 2WS93 3S7IA 3ZKYA 4S2GA 1Q7YW 4F83A 4FT8A 1XNQB 1YVWA 4X8PA 4JQRA 3KWVA 2VMCA 4OPHA 5LYJB 1I7FA 3ETGA 4XBNA 1RUE2 3FX3A 3SEEA 2R16A 4AAXA 3SR2C 2XQXA 1WJZA 2VCCA 5JMOA 4K0KB 2FZ1A 3OYWB 4LT5A 4LR3A 4MSWC 3MIBA 4URTA 3UKVA 3VBUB 2W3JA 1HXS2 1M57B 2YDEA 1MR5A 1K3IA 5LRSA 3DUIA 1E1QG 4UB6Z 5FMOL 4GCZA 2W1UA 3HQXA 3GZUC 1DF5A 2VUAA 1ZZ6A 4EZ4A 2PXJA 4DV2O 1SA0B 5H6QA 3H7YA 1ZBE1 2V1DA 1QEXA 1PMHX 4KGGA 1BL8A 5CKMA 3MFCA 2GH8A 2GDFA 3UYJA 3PHMA 4UWDA 4XIKA 3ZN6B 4CH3A 4YARA 4TLFA 3BFRA 4JZRA 5FL7G 2HEWF 2EAAA 1Z2GA 4V2VA 5J3UA 5JDBA 2UY9A 1S5HC 4PF1A 4K35A 2I74A 1IS3A 3RMXA 1BBT1 2CGNA 2LGWA 2D3PA 4FPKA 3EHBB 4XJWA 3TOJA 3ROUA 3BN6A 3HKEA 2BU9A 5F7UA 1GNYA 4IGGA 2EXHA 3AKTA 5KXBA 1NQJA 4PF5A 3RW0A 4QU2A 2HJFC 1IG3A 2Z3YA 3SCHA 2VUJA 2BTQB 2EIMC 3RYCB 1NCQA 5H9QA 5E6HA 1VQ9V 3OUSA 2AXTZ 2D6LX 3R0RA 3PUQA 2P5BA 3BTYA 1PL0A 1H1MA 4ZXEA 3P3NA 2VZVA 2ZBJA 2HWF1 1FKAO 1L7RA 1BMV2 5ITZA 1BBT2 3AP7A 1LOFA 2NMNA 3OCPA 2XL7A 1HX6A 4AQ6A 4R9BA 2Q8EA 1DP0A 5D8AC 1SBEA 3T1HB 1K42A 1U12A 4JC1A 1JW6A 4BQ1A 1O8SA 3H1MA 1HRI1 2UXCB 4B1LA 1JZ8A 2AEZA 3IGAC 4B08A 4CA9A 2ZKNA 4OUSA 1DYOA 1SPPA 1KB9F 1VQNV 4Y20B 4N7IA 3FN9A 2YEVA 3PNAA 5FZMA 4KL1A 2QBXA 4NYKA 2QDNA 4B3SB 1Z7S2 2YXHA 5BYNA 2BJSA 3EXAA 2PN5A 1UJWB 4DOUA 1N47A 2A79B 3GGLA 2BVBA 5BNQA 2KKWA 3TNQA 4J25A 4YJ3A 2VY0A 3NL1A 4LP8A 3NJYA 1DGSA 2AZ0A 3UL2A 1W8FA 4AI8A 2UXNA 1KFUL 1WMFA 1EV12 3JD4A 1H8TB 1M93A 4ATEA 3B2EE 3IB3A 4KQ7A 2YU1A 1EP0A 4KWUA 4DINB 1W9FA 3K06A 1TMF2 1XYPA 4DS0A 3MI8A 2ZGUA 1Z7S1 5A3MA 1NOVA 3SPHA 1ZBA2 4DRXB 1OF3A 3H1WA 3VDDA 4WVZA 1YI7A 3BB6A 4J7JA 2CTPA 2Y6GA 4A2UA 3WB2A 3OTFA 4Q29A 1DLBA 4D6QA 5FZ1A 3KHCA 3ASOB 1WMXA 3M99B 1JODA 2GN7A 3KF5A 2A75A 1IQDC 1XNKA 1IG0A 4NN0A 2P3JA 4I30A 2P3KA 4RN5A 4YVWB 5CISA 1RHI1 3T0DA 3DC6A 1SF9A 4IL7A 1JYNA 2EIEA 2D43A 3T1LA 3VZMA 3EO6A 1LTEA 1F7YA 2VOTA 2BTOA 3ZXFA 4LF4B 1MQTA 1QXRA 1UXXX 4BQ4A 2AACA 2WKKA 4PD4F 1YFUA 3R4UA 2HEPA 3VOUA 2IFWA 3CEWA 5BMVB 5HPOA 4HKLA 5CKQA 3VBRA 5F3CA 3OGRA 1PIV1 2GSYA 1W99A 2WFF1 2NQYA 1PKXA 4M4PA 4G4FA 1XDCA 5GZEA 1KKCA 3SMHA 1K4DC 3FZ3A 1W9YA 5FYYA 1VR3A 3MF6A 5FQ0B 4FPFA 5E89A 1R1A3 5AFEA 5T5PA 2DYSB 5BY1A 3FAVB 1RTVA 1UO9A 1J3QA 1KUQA 2X7RB 1POV3 3N2KB 4IE0A 1YJLA 4JAVA 3OSDA 1JYIA 2D3SA 1GLHA 1GZCA 4PELA 3OBRA 4YW5A 1NX9A 3THDA 3VV1A 5GM0A 4ZKTB 3M7MX 3LGRA 4BE3A 5B3SB 4XE9A 4I3GA 2RS52 2ZX1A 4M00A 3A0RA 3RI9A 2DWEC 4I09A 1OSGA 4UBGA 1BHGA 1G1XB 4RUFA 2XQRA 5F2SA 4TV9B 5A2QN 4AR2A 2NP0A 3N7KA 2OT7A 5L3FA 3SYPA 3LEKA 1SPPB 3RJ2X 1U96A 1A8DA 2RNBA 1R6TA 4FLUA 1GNHA 2E6VA 1RL3A 1YIFA 1W6NB 4M3CA 4JCKA 4JRLA 1Y74B 2G38A 5A7SA 4FXGB 1UMZA 2RS51 2OX0A 2GNBA 4JTNA 1BCXA 2NLJC 4P02B 2E53A 5J48A 2R6QA 1TNFA 3I56V 2ZGNA 4FP2A 1R73A 4K1ZA 4QPGB 3UO3A 1N34B 2W47A 3WF2A 2O8OA 1V9PA 4G3YC 4YY3B 1W90A 3RT3C 2UXCO 2WSVA 2DW4A 4LBLA 3TEYA 3E22B 5A7QA 3P5BA 1JCHA 3OPWA 2PA7A 1RB8G 1ZL8A 5F5CA 1FV2A 3ACGA 1S5LZ 4LO5B 4CXYA 3ZOIA 3ILNA 3U78A 4AVVA 2A3WA 3HOBA 2QQLA 2VW0A 4Q4V3 3ZXJA 4UFKA 2DVGA 4Y22A 2E7QA 2WN3A 2RM21 4RO2A 3HD8B 4XHBA 3WDVA 3OBZA 1HB3A 4J9ZB 1SDDB 1VQMV 1W04A 5A3UA 3A8TA 1FFXA 1ZX5A 2XAJA 1V55B 4LBEC 3I8TA 4QDSA 4L97A 3U37A 4JHZA 3AK0A 2RDSA 2HEVF 1AYM3 1SFYA 1K9MW 3PL0A 1NTKH 3C7HA 1QNMA 3B77A 2ZIMA 3ZN1A 2ETEA 3IPVA 1NA1A 2RS33 4KU8A 2UUAO 1MVEA 3VBHA 4IESA 2A6ZA 2HYXA 5FPRA 1CIWA 5CBLA 2GAUA 3GXUA 3I3QA 4OLLA 5HCHA 2BGPA 3M3IA 4WF9V 2VNRA 2ZM6O 5I91A 4R9DA 1QHDA 1J59A 1L7LA 2D7FA 3WDYA 3I2OA 2HWF3 5GLTA 4JKKA 5FXWA 4DK1A 1NVPB 4QXHA 5HI0A 3HIFA 5FZ6A 3ZRVA 5JMCA 5F5QA 2W92A 4ARYA 2KXLA 1SCSA 3CJHB 4EB6B 2PYLA 5LBFA 4AI9A 4F6RA 5LL6Y 5LHIA 3SNMA 4Z82A 4IV3C 1NCRA 2OW4A 2ZE6A 3OEBA 3V56A 1XI1A 2RJKA 2NN8A 3APOA 2WAOA 4XJ9A 2GHYA 1GYKA 5I93A 1Y76A 1OCCB 1XSQA 1S0VA 4LKSA 1LNQA 3HKCB 3SGIA 3VBOA 2BPA2 4LJHA 1D5AA 4CPBA 2VVEA 4DV7O 2FBEA 2JD4A 4PLOA 4QPJA 3OY8B 5JCOC 3MV11 5LMNO 1X7NA 2L6LA 1LGNA 4J9YB 3ZHSA 3GWKC 3GCXA 4LF7B 4AEDB 1CN1A 4G27B 1GP6A 2PHTA 2B45X 3LFIA 5CKNA 4RHV1 3MUY1 2FL4A 1VAKA 1VLNA 1VBD2 5FZKA 1Y66A 2KG7A 4WM8C 3UV9A 5LA2A 2R0FA 3AK1A 2ZX0A 2ZACA 5KC6A 3STLC 3RMYA 4Y20A 3VDBA 4AFCA 5T54A 5CFCA 2J22A 2IXLA 2HWD3 4AZZA 4UW5A 3BTZA 2ES3A 4KWJA 2XAHA 2WNUC 4X62B 3IMNA 1UFIA 2VZ3A 1ULFA 1X8EA 4JI6O 5LEJA 4JI0O 5B1AC 1S2KA 4IEYA 5EHDA 4AAPA 3KS7A 2FD8A 3WU2Z 3SXWA 1AUYA 4FLZA 5LCWL 2VE1A 3AYCA 1V0AA 2DFBA 3RYRA 1Q8IA 2G1MA 1FV3A 3AJZA 2QKDA 1I94O 5IJRA 1GZ9A 1GAXA 1C8M1 5FZ8A 5IK5A 3IBMA 3OEAA 3LEGA 3CB2A 3K08A 1YJKA 2IWGB 3LA2A 4U3JA 1ZA7A 4UXAA 2QR4A 1LB2A 1YTFD 1BQZA 1GUIA 3CZJA 3T4VA 4D7SA 3DF0A 4GX1A 2WNVA 2PQQA 2WZEA 5C3OA 3P30A 1NVPD 3PN1A 3DXUA 4LXLA 3BALA 2J1EA 3DYPA 3ORJA 1QJY3 1UY1A 2XUEA 1X82A 3WCSA 4QJFB 4ABMA 1C8M2 4CH5A 4Q1RA 4KP4A 3TAYA 3CD6V 2A9HA 3LD8A 2ZMKA 3ZYBA 2JK5C 1VQLV 3KVAA 3I2GA 1CGPA 3VBUC 1EV13 1YI2V 4AI0A 2BUKA 3M8LA 2D44A 3J9SA 2VCBA 3NMBA 1FXKC 2RDCA 3M2MA 2VMFA 1EAH1 4K3AA 3GHMA 5DDJ2 3CSXA 1ND2C 2DYCA 1WAZA 4OUEA 4KUMA 4UW3A 4GWMA 2WWJA 3FBMA 3VBRC 3ZFGA 1AR62 2V4AA 4LHLA 3AZZA 3CEIA 3WNKA 2GNDA 4Q1PA 3EHKA 5D21A 3ZHQA 3UT5A 2ZR3A 1VAVA 1R092 2P6HA 4HVQA 4C7UA 2JVDA 4G28B 3U4SA 2WYFA 1SLIA 5LMUB 2UXDB 3W9AA 4IGQA 1R3LC 3GYDA 3KV9A 1FJGB 4U36A 4ES8A 1QDOA 5JCTA 3CO2A 4XMAA 1QGLA 5E1AC 5J2TA 4DXTA 1CZTA 4CH6A 4CS3A 4TOIA 4FQZA 1GM8A 1WPBA 4NRQA 2BNOA 3J7HA 1NJIW 4X9QA 3Q8EA 1RVF1 2H6BA 4K21A 1WCSA 4QM8A 3RFRA 1GQPA 4HN0A 1JA8A 2K1EA 4I55A 1ASJ2 2ORZA 5BR8O 4DXRA 4MVQA 3K4DA 2V7QG 2QWNB 2ARCA 2YIBD 4XJ8A 1HRV2 3N7JA 2ZAHA 1AYN3 3ZM8A 3ZHUA 5BY5A 3H1LH 4QPKA 2BE3A 1DZTA 1IXBA 1SQGA 5CFDA 4XHXA 3FHIB 3GCWA 2ENRA 1SQQH 3OGJA 3RPQA 5JH7B 1OMIA 3D0SA 3FUOA 3TEWA 4NTXA 3ETPA 4N43B 5FYHA 4O4IA 3PJQA 2JDNA 1R6KA 3KV4A 5IHRA 2Q6AA 3I5DA 1VBC3 5GLZA 2WC2A 3NKTA 4RFT0 4H37A 4FFFA 4ZZ8A 1W6PB 2J1SA 1I5XA 5AVPA 2WLKA 2H0VA 4LF8O 2BOBC 3DPRC 2ZGQA 1SQVH 4HOOA 5LYJA 1OURA 3N2GA 2LO1A 1AYM2 4I9QA 2BNMA 5A3OA 4KG0A 4F6EA 1NXD1 1QQP3 4I0BA 3CJHA 4Y24A 3PUAA 4Q4Y3 4LO8A 3NJXA 3VL9A 2GDSA 1PGW2 3R6SA 3ZFGB 3S6PA 5CEHA 1VQ6V 3AX4A 3HKEB 4JGYC 4RFRB 4LIVA 1V54C 4J10A 5LBCA 3C7FA 4I01A 1PNKA 4DR5B 2MK3A 2P06A 1BEV1 4HZFA 4OMDA 1VBE2 4YGDA 4A7KA 2Y4TA 4UFLA 1PVC1 2ZABA 3SPCA 3JD1A 2YB7A 4LF9B 3HBZA 4BB3A 5JJNB 4UYBA 4YM0A 4MGKE 2HWC2 2JIZG 1S0IA 3FKSG 2YFUA 4DV1O 2N04A 2WR9A 1VRBA 4QIWF 2HFEC 5IYZA 3K4AA 5EBLC 3KV5A 4JRAA 3TGUH 3B00A 1HW7A 2IU0A 1PZ9A 1LR1A 1Q90D 2Y69B 4UFJA 3IDCB 3IFXA 1PVC2 4EWAA 3S0MA 5E16A 1HQLA 1P49A 3ENRA 1YJWV 1CAUB 1AR5A 2XVKA 1S2BA 4QPGC 1V6OA 2KD7A 2R073 2WNVC 3W7SA 5FZAA 2WS91 1W2NA 3N9QA 2E3CA 3ST7A 5F37A 2WNOA 4MSVA 1VQ7V 1YCIA 5IUQA 2J1UA 2O57A 4CU6A 2DCJA 5FFOC 1ZZBA 2YFZA 3HQUA 2YC0A 2D6MA 4CU7A 3CPWU 3A23A 3B8NA 5LK7B 4WM8B 3WW2A 1FMD3 3S7EA 4FTEA 3CF6E 4UCRA 5J7MA 3WQ1A 1V54B 1W39A 5EIBD 1QJX3 1S0JA 3OFNG 3NNJA 1OJHA 3UO2A 1YXBA 4YVSB 1K45A 4XJZA 3N2KA 1GOFA 2MNGA 1OC1A 2P2KA 5LMUO 3ABUA 4FTSA 1QOTA 2CAZC 2YHJA 1SZTA 4QD2A 4B1MA 4K7JA 1WA8A 4JAUA 3MBWA 4E2QA 5A80A 2WDBA 4XEZA 3ABLB 5KMGA 2NN4A 3W58A 3ZFFA 2AGSA 1DGRN 4QHOA 4UCVA 5FWEA 4HXCA 2JJ2G 4AHZA 2PLV1 5ITZB 5F2VO 4IERA 2VECA 1YJNV 5JWPA 4FPOB 2Q67A 4HFSA 4C90A 3USUB 1PO23 4SBVA 1GM7A 2KG7B 3AXEA 4LFCB 1YYNA 5EZWA 4XF1A 1O4TA 4CP9A 2UYBA 3B40A 2R7EB 3LSQA 2LRPA 2WSUA 5IT6A 3VZOA 2DV9A 1NR7A 5IW0A 2FTKA 4D7YA 5KA5A 4JF3A 3E6BA 2HH9A 1S72V 5F39A 4OHYA 3POYA 5F6KA 4LFAB 1ULOA 2WNEA 5LA6B 3GF6A 2B9ZA 5DAXA 2LW1A 2ZGPA 1DQ2A 1KP3A 1V9U2 1SA0A 1JMUB 3ZRXA 4WZFA 4ZU5A 2DBIA 3PMSA 4GD4A 3B9CA 4I7ZB 5AFBA 3N7MA 1IZ3A 4UCTA 1SQFA 4GX2A 2CYFA 5B66Z 1COV1 3W59A 4XF4A 4P9JA 3RVZA 1DQ0A 3BVCA 5A33B 4R6ZA 4X1YA 1NI8A 4DUZO 4OX9B 1XMQO 1G9BA 4CDWA 4CCEA 1K3EA 1QOOA 4J41A 1HNWO 4LUMA 5HV0A 3B09A 3FC0A 2P3YA 1UCXA 2WZR1 3K5LA 1S2EA 4UAPA 4EJRA 1VIWB 5HV4A 5F32A 3VBFC 3JQXA 2OT5A 3P32A 2XBO1 1P7GA 1WN7A 1JHJA 3CCUV 4AI1A 1GFF2 3KQRA 2LW7A 2DOSA 3BA9A 1UMIA 3VGIA 1AB3A 1FYUA 5FLJA 4QGLA 3E8GA 5KHJA 1RUD3 4FTBA 2WZR2 1RIRA 3POIA 3M70A 5JIAA 3T08A 2XVGA 4MVOA 4QPIB 2RQ6A 1FOD2 3AG2B 3RYKA 4HYOA 1HNWB 3D82A 2B9VA 1SBFA 3MW2A 3CJIC 2E26A 1N1SA 2BQPA 4LNUB 3QBQA 4Y26A 2X29A 5JOWA 4H7MA 2RR12 1VF5B 4FM1A 3CU7A 1VMJA 2P1BA 3OUFA 5LXTA 4CPBD 1XMOO 2C6SA 3NNGA 4FLWA 3PLQA 1JVMA 5BPXA 1IXMA 5B1AB 5IJ9B 3D6EA 2QGNA 4JI4B 3POFA 1DZRA 3N27A 1WMDA 4FLTA 1WNSA 4LORA 1BHBA 2FB5A 1CAUA 4FBFA 3HKDB 5AC92 1AI5A 4LFCO 4KMQA 4XUTA 2NM1A 2X53S 4Q20A 3MEPA 1COV3 2CV6A 3VHPA 1RHI3 1NKDA 1LR5A 5A7WA
chains in the Genus database with same CATH topology
2YMZA 1UZYA 3FLTA 3TN92 1YRZA 4V1PA 4XZPA 4LBQA 1GICA 4QXKA 4GB33 4YG6A 4DRRA 3NW4A 4B7KA 1C1LA 1LENA 4AQ2A 4M25A 5FO9B 4KBBA 2D6KA 4RR3C 5FPZA 2VQAA 1YO8A 1RUH1 2ZGSA 4Z2WA 1VBC1 5GZDA 5A3LA 4IV1B 1MS4A 3J26N 1GVGA 2VOWA 3T2TA 1AL23 3HT1A 1MQTB 2XKPA 2PHFA 1I1EA 1TEIA 1AXKA 2DU1A 4PDWA 3NAPB 2ZGTA 4BHGA 1H2KA 1COV2 1CAXA 4Q8LA 3SH4A 5HCAA 4QGMA 1HW5A 2XG3A 2B46X 3ZFFB 1VRH2 4X6RB 1BYHA 4MGYE 4D3WA 5K8SA 2DVDA 2JE7A 3VKMA 4CDQA 1ZM1A 3MW4A 4ISQA 1DGLA 2XLFA 4P5HA 3ZFFC 4H3WA 2XJVA 5ACA3 4Y0EA 4IXLA 4LLOA 2WL1A 1B09A 4D7TA 2OUHA 4JGYA 4M0HA 1LHNA 1AHSA 3B69A 3MGUA 3EATX 2HWE1 1NLSA 1SFNA 2CAUA 1Y9QA 1YLLA 1ND3C 5DUXA 2XUMA 1BJQA 1ZBE3 2D40A 4FO9A 2PHDA 3N7LA 3WW1A 5F1RA 3GALA 4Y1YA 3IDBB 2VOXA 3IDEA 2KM2A 1RMU2 3E5QA 1LU1A 1JTZX 4UW6A 4GMP1 1ZZ7A 3M4FA 4OI2A 3RQ0A 2XLGA 1R093 1ZZCA 3EQEA 4O9GA 1GQHA 5AVAA 2RR13 2CNAA 2FQPA 1VRH1 3DV8A 1Y43B 3U0ZA 5C9AA 3ZXGA 1F5JA 1SLCA 2YGMA 1TME1 1D4M2 4E2SA 3VBFB 3CLPA 4CDUB 3VDDC 3SISA 4BCUA 2R1DA 2A70A 3L2HA 4F3JA 1PZ8A 5DUWA 1QQP2 3IWZA 1OQ1A 1Y0ZA 4LE4A 4AHYA 1BMV1 1NCRC 1HXS3 4FPLA 4HL0A 1MS1A 3WG2A 1O3SA 1MZ5A 4FQ4A 4J6GA 1RUE1 5I0UA 1DLLA 2GC2A 2ZGKA 3MYXA 2FZ2A 1RMU1 2HWB3 1DRTA 1TE1B 2XJSA 1GQGA 4MLOA 2RS11 1ND2A 2I45A 4CDQB 4PDWC 1XNBA 4ASLA 2Q0AA 1TME3 4HMZA 4AEKA 1OIJB 4PIZA 4AEMA 2DCZA 1Q5OA 3O0XA 1EPWA 4MGIE 3AKQA 2IXHA 1W0OA 2WS93 3S7IA 3I59A 4GH4C 4IQPA 3MIHA 1TME2 3ZYPA 4S2GA 1D4M1 4ZU7A 1HXS1 1ALYA 3WXPA 4E2GA 1RUF2 2D5FA 1GBGA 4AI2A 4F83A 4FT8A 1RUJ2 4IEZA 2OVUA 4X8PA 4JQRA 5GLUA 1H2MA 1OOPA 4GKYA 1RJ8A 2WZPP 3HN1A 2MEV3 1LESA 4XFGA 1H1IA 1DF0A 2RS53 1CESA 4XBNA 4HBNA 3E5UA 1OQEA 1RUE2 3V0AB 3FX3A 4BMEA 3ZN6A 1NXMA 1CQ9A 1H30A 4L2NA 4GULA 2R16A 4XFFA 4H14A 1ZBE2 5H9SA 2RS12 3B01A 1LHUA 3ZXDA 1HV0A 1AYN2 1FMD1 1NA1B 3BODA 4AEDC 4MXVA 5GZCA 1OKQA 2FZ1A 3NSTA 4K8FA 3WNXA 3OYWB 3LA3A 3VKNA 5AC91 1O3TA 2ZGRA 4LT5A 3MIBA 2XH6A 4URTA 5KHKA 3UKVA 1AR92 1WD4A 5LK5A 1D0HA 4LO4B 3VBUB 1HXS2 1SLAA 1QJY2 2YDEA 1C3HA 1Y3TA 3KT7A 1F2NA 4BLJA 1MR5A 2ZTNA 5LRSA 3DUIA 4KU7A 1N3OA 1TMF1 5KHGA 1SEFA 5BNPC 1Q8OA 1KS4A 5FMOL 3IT8A 2DCTA 4KG8A 3VKFC 5FOJB 3HQXA 1GZWA 3GZUC 5BNPA 1WCDJ 4IV1C 2Y0OA 2VUAA 3L9JT 1ZZ6A 1ZBA1 3WP4A 1RUH2 1VBC2 4RQPA 3H7YA 5SV8A 1ZBE1 4KGGA 3MFCA 1V6MA 4AEJA 2GH8A 3E97A 3RDIA 2GDFA 3PHMA 5C4WA 3H9AA 4OULA 4XIKA 1TMF3 4MZUA 3ZN6B 4CP2A 1S0DA 4UW4A