1PKXA

Crystal structure of human atic in complex with xmp
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
588
Chain Sequence
PGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structural Insights into the Human and Avian IMP Cyclohydrolase Mechanism via Crystal Structures with the Bound XMP Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 207
structure length 588
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pkxA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pkxA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA02
1P4RA 1PKXA 1S8AA 1T36A 2X8WA 4EHIA 1CS0A 1G8MA 1S89A 1ZCZA 1C30A 1JDBB 1BXRA 5H3LA 1A9XA 2XW6A 1PL0A 2B1IA 1KEEA 1WO8A 2YVQA 1VMDA 2IU3A 1IK4A 1C3OA 2IU0A 1B93A 4A1OA 3ZZMA 1M9NA 1EGHA 1OZ0A 1THZA 1M6VA 2B1GA 1CE8A
chains in the Genus database with same CATH superfamily
2H1IA 3OICA 3CFYA 3U2QA 2PYDA 4BJHB 1GAXA 4L50A 1QWSA 2PH5A 2GN6A 4RUKA 5AW1A 1F0NA 4LZPA 1YITV 3HDVA 1F06A 4K2HA 5BWNA 5AVRA 1SCNE 1WIWA 3ZD9A 4ZJUA 1DELA 4A0FA 5LOVF 1JF8A 2Z4RA 1C1DA 4UASA 1XQ9A 5AW3A 2O3SA 3WZLA 1EJ2A 1A77A 3LAWA 2AXNA 1VIDA 2NUAA 3LUGA 3IUJA 4M8NE 4MT8A 5J5AA 1VXRA 4RTJA 1HE1C 1O5OA 2VWQA 2GK4A 4YRQA 5CFMA 3RW0A 1G3IA 2PZEA 4OHYA 3CONA 3MAGA 3SK0A 4PLPA 2Y0BA 1GAQA 4F97A 3GP8A 1N5LA 1RWWA 5FFFA 4JLSA 4Y2GA 1PJZA 3B9QA 5GIPE 5ARBA 1H6BA 4QQNA 1O57A 2NXEA 3REGA 1EFCA 2MYNA 5DYTA 1E9CA 2B78A 3T15A 2Z5LA 2GVZC 4DRXA 4Q6BA 3RUCA 1R4ZA 4D9BA 4ENWA 4HFNA 2JFBA 4LRSB 3K0FB 2XNDA 2FMFA 1JIUA 5INTA 4IQ4A 1L8LA 4N18A 3K71B 2W2XA 3T3OA 5C80A 4TMXA 2EILB 4F3KA 3UQZA 1O95C 3PRJA 4XWAA 2WY2D 1R5BA 1VF7A 4EBFA 2ODAA 4AZTA 1LTQA 2V5VA 4FVTA 3BSFA 4DUZO 3QJGA 4NV3A 5FLXA 1NOIA 3TEJA 1JHQA 4UVGA 2R8BA 3VTZA 1IBRA 2A3RA 4I4TF 5AK0A 1WN5A 2H1RA 5CCBA 2JGDB 3PK0A 1LC3A 2BZ0A 4IP0A 1JZTA 1RXIA 4EL0A 4P81A 1SHTX 1I4OA 4AKTA 3QUTA 4EG2A 2EW8A 3NBQA 3HSYA 2IW1A 1EWVA 3CZPA 1T0IA 1FUYB 4XPZA 1O94A 4NENB 1QS0A 4B48A 2ZB2A 4IOLA 1TT7A 2A2ZA 1RP7A 4K1XA 2DYSB 2O1EA 3LLMA 3ESDA 3TPFA 2P7HA 4A6PA 1UWLA 4HH3C 2XBMA 1L1QA 5CM2Z 4BX8A 3EXG2 2RH5A 3PNYA 4IIVA 2PU7A 5A9GA 2P22C 1U99A 4J43A 2Y69C 1T34A 3SBDA 3LA6A 3V6LA 1I7FA 4IYRA 4X9QA 4ZYUA 5EFZA 2HJGA 4EB3A 4EYOA 4HV4A 3ZPXA 2EWMA 4YRFA 5F5LA 1UBKS 1T6YA 3T5MA 3ZY5A 2IUTA 3IPLA 2GAJA 1Y5NA 2PGDA 3UV7A 4E46A 1SURA 1I2DA 2OUIA 1MDBA 3EFOB 1PFKA 2VTDA 1M6WA 3ZCSA 4DUGA 3DOJA 4DL9A 1RWBA 3DAHA 3AHFA 4LCOA 2B6HA 3L1KA 2WQZA 5HKOA 4F04A 3CLTC 3EAQA 4BMSA 4BNLA 2NUPA 1FFWA 4M0DA 4XGNA 1A82A 2LQTA 5T8KA 3DZIA 3PRKE 3SOZA 1XC7A 5DBIA 5AVZA 2FQWA 4UPEA 1KVRA 3SZOA 2QL6A 4MW0A 1R8QA 1KYIA 1L8DA 3SJUA 5BVGB 3SYRA 3TO5A 2D2XA 4E1AA 1CTQA 4E4TA 3BXPA 3CNNA 3ZV5A 4BBJA 1YK0A 3GIDA 4Q9NA 1FFXB 4Q9AA 3PRHA 1M72A 1B3BA 1Z5NA 2BFDA 3AF6A 5CA3A 1PK7A 2WT9A 2HREA 3RI3A 5FTKA 4OHPA 1BD4A 1GH6A 1TVKA 4CEIA 2Z6AA 2O20A 2ZIOA 3O1IC 3PR2B 4XIJA 3AQ4A 3WB1A 3ICOA 4L8VA 2JARA 3EUEA 1SZPA 1XXHB 4HGNA 3K0CA 1NUQA 2A79B 1OJLA 3LHKA 2DJVA 1OPXA 1YTLA 3HUUA 1TA0A 2W8ZA 2PQ0A 1JOYA 1ZOOA 4DXHA 4EMSA 1GPWB 1AB5A 3WIEA 3G8BA 4BNFA 2XMZA 5BSHA 3VKHA 4Q4AA 3H9GA 1QHXA 3I39X 1A7JA 4C0XA 2Q5HA 4D9GA 1NBOA 1JRLA 4QEDA 5IKMA 1K8XB 4S35A 2Z30A 3VR6H 3DYBA 4YT2A 1PG2A 3LXUX 4OHXA 1I7QB 3I2KA 5ALSA 4AKGA 1QIKA 1X7DA 2Y1FA 1UDAA 1L5MA 3PJRA 4XW2A 5DWVA 4MR9A 2NU9B 3N39C 3RANA 5AR1A 1Z12A 2F3PA 2YJNA 3LQQA 5H4HA 1W88A 1GXSB 3GEDA 2UUOA 2ZTSA 3K9HA 1W1IA 5ER6A 4TV8B 1BQ4A 4LNUB 2CCGA 2H0RA 4ANFA 5EJ4A 1SUCA 3ZKAA 4L5JA 4BN4A 2NZVG 2Q68A 4OQXA 3TFWA 2BI7A 4X64O 2GF0A 5B1YA 4PAGA 4PBTA 4KXWA 2H3OA 2IUUA 2P0YA 3ZRXA 5JJEB 5EFOA 2B7BA 2FRDA 3DE1X 1E5VA 2AV6A 4DLRA 3MOIA 3MT0A 2JCSA 3D3WB 5LZ4A 2H6EA 2EJCA 4R2JA 3EWNA 4LDRA 2QN6A 3IMEA 2XE6A 4NEQA 3UPTA 1XLVA 2JVIA 4RO2A 2X4LA 1RBZA 2JLWA 3STVA 4DABA 1TB4A 5A4JA 4CM8B 4G3MA 3GBVA 3QE3A 1YB7A 4GDMA 1W59A 3N7UA 4G0PA 1QU2A 5CW2A 5JFTA 4Q4HB 1E9BA 4RHTA 1TAUA 1G60A 2V4MA 3KAPA 2DPGA 2HPAA 1QRTA 1PLKA 1K4KA 1OXMA 3T9FA 2C78A 3WWCA 5HF5A 1GNVA 1KI6A 1UP7A 1Z2GA 13PKA 4BYMA 2VWHA 3FUVA 4DT1B 3A9CA 1PFYA 1ANKA 5CMUA 3B77A 3DMRA 4ESVA 4M1ZA 1OZFA 1NVKA 1U3CA 3VMMA 2EEZA 1E58A 3IV6A 4GXNA 4G5SA 3AINA 1ZD2P 3ZRWA 1OIXA 3TGWA 4RK4A 3THYB 3SCZA 4TMVA 1GR0A 3U0VA 1IN1A 3TOCA 3PQ6A 4JKOA 3OAAD 3T1OA 2FPIB 3F0TA 4ND7A 2XSZA 1YU9A 1QKKA 2V45A 3O31A 4UVIA 1KKDA 4TTIA 1N77A 3E2IA 4DV3B 5TEWA 2YFQA 1V9CA 3W5HA 2POCA 3NWOA 1OI2A 1S8AA 1T24A 3CF2A 3I6IA 5DLPA 5B6JA 4BUCA 1KJJA 2RCVA 3LBFA 2RK3A 3GJ3A 4B7AA 4YIKA 1D6JA 1QCYA 1Z47A 5BQ3A 4EIWA 3KZCA 2HJRA 5IANA 3K5WA 3WI7A 3LLVA 1TCUA 2IF2A 2IW3A 3I2GA 3VR5A 1NWHA 1P0IA 1XZKA 1TL7C 3O8RA 3ER6A 1IEQA 3D3EA 3H2IA 3CJHB 1FVOA 2D5AA 1U0SY 3WLPA 2SECE 4DGQA 3B1JA 1HI9A 2VNSA 3B09A 3ADBA 3IAHA 2EIMC 4PZ9A 1AGPA 3IEUA 3H3XA 4UNSA 1W85A 4NAUA 4UB8Z 2WA3A 4PWYA 3QNEA 3K0GA 2WDPA 4GOLD 2IYWA 1DUIA 3RVLA 2R1ZA 2PZAA 4E31A 3QFTA 1P2VA 1W4CA 1TYBE 5K51A 4FS3A 2GSDA 2EHJA 3BERA 4UZFA 1N5DA 4M6WA 3M5WA 3LLUA 2VQFB 4WI1A 4MQUA 3OSUA 3TSCA 1JLHA 3U39A 1V9PA 3BA1A 3ASVA 5IT5A 2E75B 1F20A 4JX9A 1C1DB 4TWZA 3I6YA 1PBTA 2H5IA 4NCAA 4ZYTA 2ONJA 4CH6A 5F1YA 3IMFA 4NMWA 1D5CA 2NUAB 1TVCA 3OQJA 1X7XA 3M3PA 3FB5C 5D6OA 1IM8A 5HBGA 1SUAA 3G2HA 1N7GA 3GYBA 2F43G 3ASOB 2WJHA 4ZCPA 2Q8PA 2ZULA 4J0CA 5IKOA 4B6QA 3A9VA 3OOEA 2GN8A 3MQ2A 4UEKA 1OZHA 2HNAA 3N2KA 1FFYA 1RM0A 2OK7A 4H2DA 3PEWA 4IW3B 2ZDQA 3O8LA 5BV2P 3U4HA 2Y6UA 3GN2A 4KQMA 3PDJA 3HWWA 2IX3A 3E84A 1MJGM 5K9ZA 3KKZA 2PNFA 1L4LA 1CR6A 2W6IA 3A7EA 1IN6A 3UW3A 1JG7A 3DOIA 3SJBA 2NN4A 2QZSA 4UNNA 1MDFA 2DFPA 2EWWA 2V03A 3TNLA 3AY3A 2ECPA 1QK3A 2RSLA 5EHIA 2B61A 3OPMA 3LXXA 5IDQA 3SS8A 3H1GA 2YN2A 5J43A 3MIIA 3CGWA 3INYA 4OI4A 2PUEA 3IUSA 1F17A 2C2KA 3NCHA 4B8WA 4DBZA 1XIVA 4J4HA 2F62A 2W71A 2ZWAA 2HA2A 4JN6B 4ZO7A 2QRJA 2E18A 5CEFA 3MOSA 3DL4A 4D6PA 4Y2YA 2JGNA 3GU3A 1MRNA 1NW7A 4MWCA 2ZJ2A 3RFUA 2P35A 3GZ4A 1FTGA 1K5DA 1QS0B 1MV5A 4BP9A 3MRXA 4GR5A 2QJWA 1BEZA 3CH6A 3TQQA 3BZWA 2V9CA 1T29A 4YK7A 5DTRA 2HQSA 3KCYA 1QAQA 2XCOA 4MGYR 2WHQA 1T9AA 2ZOSA 2WLTA 3LT0A 1NI3A 4RY0A 4CKZA 3U81A 1OKKA 2ECOA 4MLCA 8ABPA 4LK2A 3DWEX 2WPDD 2DHDA 2H59A 3R9WA 1N4CA 5L40A 3I6MA 4IV0A 3TW4A 2EKDA 4KDEA 1VSBA 1KJ8A 2VAVA 2ZYTX 3TX6A 3BHJA 1M8JA 4Q3AA 1U4OA 2GBFA 3JZFA 2FCRA 2B8EA 4ACBA 4MHSA 4QYSA 2AD1A 4PDRA 5KNDA 3QO5A 3P27A 5M34A 1GTG1 2ZS7A 5KWEA 4HVLA 3F6SA 2J0EA 2F1IA 1JHRA 2PUJA 2IA5A 5CURA 2NUPB 4ITVA 1V6CA 1TKCA 4R1TA 4F8JA 2DQZA 1YZLA 1GGHA 2GX6A 1KRWA 1E1QD 1V4VA 4WOPA 2G1PA 3C8MA 3AONB 3ET4A 5JJLA 4IOJA 3ICPA 3TB6A 3AHIA 4PSDA 1AV7A 5DN6A 1UK7A 4O2BA 1T1SA 2JDIA 1ID8A 1ZVQA 4TQDA 4A15A 4FSDA 3AZOA 4IR7A 3SHWA 3I52A 2C5FA 1CJCA 3LQFA 2R48A 5CJJA 3LPNA 4NE9A 2Q3MA 4ZDJA 2DSTA 2DQSA 4TKMA 2FKNA 1PGJA 4Z4IA 2E87A 2BFDB 4GXRA 1IUKA 4HSGA 4EI8A 1M2JA 4KHZA 1ZA1A 2DFNA 1IHXA 4RMIA 5G40A 3MBOA 3NAGA 2V8BA 3QSYA 2ID4A 5EN4A 3ZWOA 1LI4A 1UMDA 3IEVA 1TVKB 4DDKA 4CEIB 3BKXA 4ER5A 2XVAA 4K5QA 1K9VF 3L4BC 2P9HA 3TE6A 1KKCA 4LC1A 1F2DA 1PK8A 2QY6A 1IXYA 4UCVA 4P35A 3Q40A 3UOAB 5HQJA 1N36O 4A6XA 3RGGA 4UM8B 4D42A 2J3HA 4KQKA 4PLZA 3RREA 4MROA 2K9PA 2GF9A 4G6ZA 4ZVLA 3BA6A 4PAMA 1KI4A 1XB2A 4JB0A 2OO3A 3SZMA 2QRGA 4Q4AB 3GWGA 1G8GA 1AMNA 5CD1A 3KL2A 1QFZA 4Y1FA 3UGTA 1TJ5A 3WG7C 5TRTA 2B98A 5C4GB 1WCV1 4ENRA 1AH2A 1J99A 2QM7A 2GWHA 3LQ2A 3VHXA 2AG0A 2YJ6A 3Q8WA 4OX9O 4IDAA 3NZEA 3UB2A 3NM4A 4URVR 3CEMA 4PSAA 1N5RA 4KQFA 3I92A 5B36A 4FCWA 1P0MA 1BE8A 1G5TA 2AGAA 4O4LF 4MR9B 3NTXA 1SH7A 2HSEA 3SGLA 4ALJA 2UXBB 1W88B 3WG9A 1JJIA 3BUSA 3BJIC 1PQWA 3ETGA 2JCXA 2PRJA 3O82A 2QTNA 1QP8A 4P0PB 3Q7TA 3H6KA 4F92B 4B71A 2I0FA 5JMOA 2G28A 1IRIA 5MDHA 4O4HF 2JD2A 1GKUB 1HLDA 5IDWA 1ZNZA 1LRKA 3ZYZA 3HBFA 1T2NA 2LZ0A 5EQDA 4LGVA 2PSEA 3DHEA 4ZN6A 3UPDA 3CF0A 4TMTA 2IU3A 1YXMA 3PBKA 2RIPA 1E79A 1P7VA 4WKCA 2IBSA 1P61B 3A6HA 3KTFA 4TXHA 1L7RA 1JA8A 4PC3A 2JAWA 2GBPA 3O8CA 3JQEA 3L8EA 5FTJA 3F1LA 1YOBA 3U49A 4U39A 1FDIA 1P2DA 1CX9B 1TOAA 3HJRA 5DASA 4BFLA 3ADPA 3N2ZB 1OBFO 3FLMA 3GCGA 4DLBA 4WTOA 5CK4A 3EW7A 3KBOA 4LZZA 1XDUA 2XCSB 2QX9A 4WE3A 5BN1A 1XF9A 4YLGA 1NJFA 3LSYA 1K0UA 2OBYA 2HO5A 4S0ZA 2PANA 3RRYA 2FZCA 4UKDA 1PEDA 4KYVA 1I2ZA 3U0BA 5C7LO 1DCTA 3KWMA 3EG5A 2YW2A 5JRJA 1KI6B 4AF7A 4MVOA 5CIQA 3R77A 3ZCVA 3KSDO 2R7MA 1CUGA 4N5MA 1EMDA 2Q0OC 4D26A 3BA9A 1PGNA 4O33A 5A2QN 2HA5A 4TUYF 1EWTA 1AF4A 1KH2A 3CRCA 1JLMA 3Q5DA 2GK6A 1TPZA 4S1PA 1EQ2A 2V3WA 3CUKA 4QOJA 4EYSA 2A1UA 2GTHA 4S24A 4I8IA 5LMUO 5F9HA 4DJTA 4H13B 2YC0A 1OPRA 1K0FA 5TVKA 1Q77A 2XAAA 2J3LA 4KR6A 2ZLBA 2ZYRA 4RDIA 4WKGA 4JTAB 1TF7A 1GKYA 4DXAA 5EESA 4JB3A 1OIWA 4H6VA 4QU9A 2FP3A 1L4BA 2R9RB 4NAHA 1KQNA 2ZSIA 1R6NA 1Y4DE 5DCWA 1N6RA 3BL8A 5A71A 3DWIA 2FPMA 2YN4A 3QHAA 2X1MA 4GVXA 4PRLA 1XP8A 1JSCA 4CMEA 1Q2XA 1I94B 2GD1O 3WMXA 4EW3A 1W85B 1NYLA 5DHQA 4AJNA 2AOUA 3LBYA 1EN5A 4IDOA 1KOGA 4RU1A 1CFZA 5JNWA 4MHTA 1IJKA 4F9GA 2ZJYA 5EE3A 3N27A 2IHYA 3T5AA 2RB4A 3CYFA 3LIPA 2PKWA 5JMTA 2VDJA 5KU7A 1PFGA 1LNSA 4ZRNA 4CG1A 1X94A 3JQ6A 3F47A 2PRIA 2P4EA 3K1YA 4Y3UA 3NX4A 5E4FA 2XKJE 1U0NA 1EUZA 1Y1TA 2XF2A 3WGJA 4WH0A 4CJXA 3SQOA 4JROA 4Z2AA 2R1UA 2F9FA 1YOVA 2HADA 2CLDX 1RI5A 3EMVA 4BJ1A 1QHYA 3M4YA 4JEIA 5HJ2A 3FXAA 2GZ2A 1MO5A 4MW9A 2QKAA 1W5FA 4KQEA 5CB4B 1NXOA 3SJQC 3G49A 2DC1A 3IQFA 2C20A 1X7XB 2VZ0A 3GD5A 1S2GA 3OLCX 1KSGA 4HEHA 3UAXA 4PN7A 3CWZA 1D6MA 3LM8A 4P36A 2NPOA 5EOVA 2ZI4A 1NBMA 1P7GA 4UVBA 3WXMA 2BKEA 2YJZA 5CFNA 3A06A 1AIPA 2EILC 1CZUA 1JT9A 4FB5A 2O48X 1QE5A 5CX1A 3N2KB 2QN8A 3BIJA 1J8MF 2BFWA 2RK4A 4H6PA 4FE7A 4Q34A 3TQIA 3SMVA 1YK1A 1WP8A 1AKWA 1L3IA 2O8FA 1Q6UA 2BFAA 2C58A 4ILKA 1SQ5A 1NP3A 4XVHA 4LV8B 3NC4A 1QQAA 3C8ZA 3MUFA 5ANRB 5EJ8A 4N5NA 2ONYA 2G09A 2I4RA 4EB6A 1S96A 2YL2A 2BV3A 2ZZMA 4QUKA 1E1KA 1HYBA 1SB9A 1CJKC 1NV8A 1PS0A 1FSSA 2NM0A 5J40A 4FQ7A 3S27A 1SKBA 1FL9A 4M0FA 5CIWA 2YWDA 3LY7A 3E9RA 3PCTA 2DYSC 2Q4TA 5ED4A 2PJRA 1IUOA 4BNHA 4D02A 3FDXA 5JSQA 3OQMA 2HHAA 3O5AA 4IIYA 1XSEA 2AFIA 2ID7A 4KL1A 2PBFA 4M49A 1ORRA 4ZVUA 3F5SA 2IH3C 2GUWA 3TRJA 4F1KA 3AH8A 1ZCAA 4EZEA 2OD2A 1PQUA 4BQIA 4MLDA 4I2NA 3FFQA 3V1YA 4WDQA 3QM1A 5EKDA 5JFGA 3INGA 5HZHA 5LQNA 2XGMA 5NLLA 5K1PA 4GX5A 3CVVA 4QYWA 3L84A 4MHOA 5TPWA 2P0AA 3AG6A 4MLZA 2C04A 5BW4A 4UHDA 2J41A 5CAEB 5ELMA 4FMDB 4LVCA 2NGRA 1JEJA 3SQWA 1OWPA 4WADA 1ZESA 1E1DA 4EG6A 1H2ZA 1XRQA 3BDAA 4YUZA 2H4JA 1Q1AA 5ALWA 2IYSA 4IG4A 3LTNC 5ALZA 1F4MA 2HJ9A 1L4GA 1U0BB 1UJNA 2LXNA 3W4IA 1HTWA 3ZE9A 2XMGA 4I81A 3TIVA 1J95A 3U7EB 3FBGA 3VZBA 2QSUA 1XFDA 3PD7A 3AHJA 4G09A 4TKVA 4LF8O 1ZZGA 1UPAA 1W94A 4NBNA 2HXSA 3HDQA 2O7QA 4KN9S 1F6WA 4UEWA 2JFUA 5E1AC 4GWLA 1PEYA 3TJRA 2JF0A 3D6TB 4O2BB 3SVTA 2DPMA 2P9YA 3F6RA 1YL7A 2GCNA 3NBAA 4X65O 1M57B 1N32B 2R6CA 3MJDA 4XD7A 4ENPA 4XQEA 1XPOA 1Z0FA 2IDZA 3MBKA 1Z2AA 2PE5A 1XXHE 2AEEA 1X2EA 4Y2UA 2PH1A 2X0DA 1Y6FA 2E0IA 1JIVA 2Q3FA 2BGGA 2EX3A 3NG1A 4IXNA 4YVFA 3FJOA 3B7WA 3VR3D 5EJIA 2ZITA 3MCUA 2OG4A 1Q90D 4PZPA 1EVYA 3PXUA 2QE7D 1YB2A 2DX7A 2Q0SA 3K0EA 2ZXWC 2Q0HA 4ZGGA 5DGIA 3VYUB 2NIPA 3DBVO 1DTWA 3G17A 4CF6A 1J07A 3ER8A 1S77D 1G5PA 2CLSA 2FZ5A 3REFA 1HYEA 1O97D 4Q00A 1DAMA 4KYTA 1Z15A 1ZD5A 4Y6LA 3NM5A 4P34A 2JLAA 3FOEC 1IHDA 5KOHA 3MUNA 4CL2A 4M0CA 3PC3A 4MVJF 1NKTA 5AVTA 3K57A 5K0NA 3BD7A 2Y8EA 5J23A 4FZJA 5KNCD 1Y8QA 2FI1A 1T0BA 3QYAA 1Z6AA 1LGYA 1QANA 3QJ5A 3VHXB 1WJGA 4V3CA 4IOKA 1I2CA 3P4YA 2BSQA 3LMKA 6NULA 4KK3A 3VKFA 2C8KA 1H8EG 3EZLA 3GJRA 2FPSA 3G2LA 3T94A 1MQ0A 1DF4A 1XK6A 3VTAA 5CVUA 4MH0R 2Y05A 2MHCA 4MEBA 1EFPB 1T0HB 4HJRA 3W4KA 1KYZA 3HK2A 3PU6A 5EXDA 2AMFA 1OYYA 3F9RA 4FNAA 4ARZA 2GGSA 1ZH0A 1GZ4A 1NUHA 1CS4C 2ZJ8A 1YHNA 2C0CA 3OLWA 3IJPA 3A1WA 4JITA 1KDPA 4EF4A 3ZZTA 1XTSA 3O74A 5BSWA 3NMUF 2Z4TA 3KTDA 2O4CA 1SETA 3AUSA 3AF4A 4DNFA 3F8WA 4P86A 1H3FA 3WIOA 1KHTA 3D3JA 4O2AA 3HJUA 1QB8A 3KKNA 3KWFA 3MW8A 3OUTA 3SYPA 2DR0A 3H0KA 1BRTA 1DBPA 3W7BA 3B7PA 5AP9A 5LGTA 2Z83A 4PAQA 1JU3A 3K73O 3LRTA 1CQIB 2ILVA 3H87A 2OKCA 4FGJA 4YRAA 4BLTA 1B6TA 4LJ4A 4HAOA 3PL5A 3HXMA 1HEYA 3OCZA 4YV0A 4GVPA 3IVMA 1YRAA 4YH1A 4QECA 4MV4A 4OQYA 4GECA 3MHTA 2G40A 2XUMA 2J0UB 4LX8A 3VPCA 4MV8A 4ZICA 3PT5A 5EE0A 4BAGA 1SKUA 1SD2A 3ZR4B 4OF4A 1GYPA 1GM5A 3EHBB 2CGNA 2D1QA 4RD3A 1UBLS 2PI5A 2K5UA 3RRNA 5IYZA 4ZP1A 1DIRA 1O8CA 2N42A 5TC4A 5KSOA 3G7UA 1R00A 2O7RA 2H85A 4ZVSA 1MR3F 2O0HA 2Q69A 3QLVC 1HZJA 5IT0A 4DV5B 6PFKA 3ICCA 3KR2A 1DAGA 3FWYA 1H23A 2JGUA 2HBRA 1IZ3A 4BMDA 5HWSA 4I1OA 3T1VA 4JI4O 3CJRA 2OG2A 2G4VA 3ZJ5A 4Q39A 5H8WA 4EUKA 4KZKA 3EZXA 1GO3F 3CE6A 4KWIA 2A1UB 4Z86A 1P49A 2OQVA 1CBUA 3I55V 2WG1A 4JI8B 1BS9A 1ZM4A 5AJHA 5A5EA 5HDQA 4UTPA 4XB6B 3MJHA 1U9CA 4IEEA 2A30A 2Q0XA 1XP5A 4BB6A 2YIMA 1L7AA 4O2LA 2QWOB 4MKGA 4J07A 1G1AA 1NIJA 2Q3LA 3L93A 1FLAA 3L0DA 3S3TA 3H16A 2WHRA 1A2OA 2Y0EA 1OFUX 3DP7A 2E55A 3R7AA 1ND5A 2C88A 1OWLA 2AWOA 3HNPA 2BHRA 3DMFA 4NESA 5ULLA 3QXJA 1WAMA 1N33B 5KKAA 4YX9A 3KQLA 1Q1GA 2QZPA 3H9EO 2GH1A 4P2BA 4FOPA 2ZXEA 4UPDA 2QAGA 5FFNA 1IIRA 2FWPA 5F2EA 1FEZA 4EJFA 5G0UA 2IDMA 1TCBA 2BDEA 2AOUB 4KQ1A 2UKDA 5L53A 3ICWA 5I9SA 2GOYA 2O2HA 1L4MA 3GFTA 1WN7A 3H5OA 3KU4A 3UB4A 4P3NA 2NOAA 3P52A 4P08A 3QVOA 4A8HA 2VF7A 3ZBHA 2HU8A 3FZNA 1UH5A 1Y7HA 4TS3A 1JHPA 5DWDA 4BV2A 3IEMA 1QE3A 4WIAA 3UIEA 4ARCA 3M3DA 1J8FA 4A82A 3P9KA 1YOVB 3EIXA 3PHLA 2JIZA 3HCFA 4OI1A 5DX0A 5FJIA 2RAUA 4WBNF 4UFNA 4D9IA 2APJA 5JNRA 1RYHA 1OH8A 3B3JA 5KWJA 3N2EA 1S1MA 3NETA 4CG2A 4RNDB 4Q3LA 3U7FB 4K9MA 4D9MA 1EN6A 2M6SA 3TNFA 3HXKA 2CB0A 4RZ3A 3BG5A 2C8VA 3KD2A 4QFDA 4PHTA 4BB9A 2BKVA 1NBEA 4PONA 2WJWA 1SXJA 2ZNVA 5SZJA 4DV4B 3N28A 2X0LA 2QAJA 4FMCB 5CX1B 3RTDA 1Z3CA 1MT0A 4ASUG 3QWBA 4MI3A 1A8QA 1THTA 3HBNA 1Z26A 2HD4A 2O8FB 3KX2A 2F00A 1PW5A 1CC1S 4R1OA 3QNUA 1S5JA 1H1TA 1CQPA 3QKIA 4I55F 4O1IA 4ENTA 4HNSA 3IXQA 2WZQA 4D0SA 4FMBB 4EPTA 4EB6B 4I66A 2AC4A 5AKXA 4YHHB 4BZWA 2XVMA 1GWNA 3X43A 4IJMA 2HPVA 1E6UA 3AL2A 4IX9A 3ZIAA 1X74A 1FZQA 3WSWA 4OFXA 1O94C 4PYRA 4QELA 5JHGB 5LUAA 3HY3A 4GSKA 1Z6XA 5GINE 4PXYA 2LFSA 2FHSA 4MO2A 3UQYS 1QLEC 3HA3A 3P71T 4B87A 3CCBA 4FM9A 5ALIA 3AEKA 4EG5A 1VLMA 2AJDA 4QU5A 3ZQKA 2AFIB 2BGTA 4MP3A 3L04A 3QLTA 1SU6A 1GAEO 5CLGA 3IQIX 2LGQA 4JP5A 2Z8XA 4R7CA 4DUYO 2H3EA 4BIUA 1LBQA 1XJ5A 1XEAA 1DQRA 2O4UX 2H7CA 2CJFA 1PD0A 1AQ6A 1CDOA 4EKYA 2HLDA 2HQRA 3GJ6A 5BOSA 2OV6A 1KZ6A 4JVOA 5TPWB 1J5EB 2BMAA 1N92A 5BXZA 2YDEA 2W6QA 2O0JA 1TMGE 2A06H 1Q92A 3MF4A 2W58A 4BRUA 4XQGA 3HJHA 1CR1A 1J39A 4RS4A 1EFLA 1YBMA 5A5DA 3VU8A 4Q7QA 3FPKA 2GZ3A 4ZO4A 4MGZR 4ZBMA 8LDHA 4HG2A 3DL0A 3A7DA 2HQBA 3I9NA 1T6NA 2ZUCA 5E1OA 2AD5A 3NTVA 1J9ZA 5DMHA 3SNKA 4R1QA 2H17A 5ETJA 3N9IA 2GQ0A 1ZSVA 3CCMV 4TKVB 5EXSA 1DNPA 1PSWA 4JUFA 4N3CA 2XRMA 1WXEA 1JQLB 5DEDA 2DN9A 4R2IA 1MH9A 5KUTA 1ODFA 4W7IA 2TS1A 2BEJA 1GR1A 2ZAOA 3GA7A 2CZCA 1E9AA 2OCCB 1N6LA 3UTCA 2BAGA 4KP4A 1CS0A 1SN7A 3CLTD 2JK5C 2FRXA 2ZVDA 4CKWA 5HRUA 4MUBA 2PKRA 5ITSA 4L1KA 3K0CC 3WWDA 1XTRA 3KJEA 4KPEC 3DNPA 1G8HA 1N2IA 2B83A 1PIWA 2F1OA 4RSRA 1YRLA 4LQLA 4NDAA 3C85A 1ZH6A 4FM1A 3WRWA 1C8BA 4J0JA 3RARA 1YZBA 4OKNA 1OXKB 1UT8A 4Z4GA 3RIMA 1FDOA 1C3LA 1DTWB 2GTIA 3JY6A 1I3NA 3CC2V 4BUJA 5EVJA 1NVWQ 2FWJA 3R6WA 1E96A 3UUGA 4F4FA 1SEPA 1G6UA 4BO0A 5KOHB 1JKJA 4JC8A 1AKNA 2H11A 2NX8A 1CNFA 1TUEA 4BMZA 1LDYA 4LA4A 4PBSA 4CWAA 5L3RA 1UKZA 1RRPA 1XTZA 2F4VO 3Q3HA 1Y8QB 2OT3B 2G1AA 4CTMA 4OD0A 3KQQA 2C92A 4X20A 1KYTA 1BWPA 4RCZA 5IVKA 2F3RA 1GDHA 5C34B 3EY4A 4LF7O 4JSYA 2X5OA 4KO4S 2ZCJA 4K40A 5AW0A 2VL7A 3WGMA 4YP0A 3EVDA 3KCXA 4PDLA 3E7FA 3QVNA 4TTSA 4I4CA 3NBUA 1JWAB 3BZBA 5K8IA 4B3RO 2H9IA 2GR9A 5B1BC 3DB1A 1KEWA 2WLHA 2DFKB 4JV5O 4L3OA 4G37A 1UBOS 1VCMA 1FNSA 4FHCA 5FBZA 3ID6C 1Y3FE 4EUNA 5B12A 4ARZB 1K5HA 4X5OA 1NXSA 1I1QB 3BCCH 4KP7A 3NW9A 3RVZA 3T0FA 1HE8B 4EVIA 3VQTA 3C3DA 4BFVA 4X94A 5BR8O 4DDWA 1LDMA 3L8ZA 1SUDA 2FWMX 3R7NA 5GY7A 2PTHA 4RXMA 1XNJA 3GWOA 3CT4A 2UUBB 4O2AB 1PI3A 2RAVA 4UCQA 2IF0A 1MH1A 2CLIB 2XDYA 3FN4A 2HA6A 1M0EA 5EJ9A 1ZIPA 1D07A 1KF0A 3O75A 4QXMA 2SBTA 4O1MA 1BIFA 3BS4A 2EQ5A 5I7RA 4XWTA 521PA 4R1LA 3KTOA 2EATA 3QKUA 4MTFA 3RSGA 4PYOA 3MWEA 1NN1A 3HCPA 1L7MA 3CG0A 3JAMN 1BHJA 1IYZA 4YRMA 5CB0A 4NH0A 1N3BA 4HSEA 4NBRA 3F5MA 4BOYA 3CLSD 3ASNC 2HCFA 3ZOZA 4LWQA 1NKVA 2QUBA 2DWOA 5EZQA 1QIFA 4IIXA 4OSOA 5IYZB 5AK3A 3UT0A 3IP6A 1LNZA 1D5NA 3PVZA 1HP8A 1PGQA 3ZK8A 4Q6WA 4Z1OA 3I8OA 3VKWA 2ZT9B 2XODA 5JG7A 2DBZA 3WNBA 3CRMA 3Q6IA 1NNUA 4C6TA 2I3ZA 5FPTA 3N2GA 1GP2A 5CYOA 1MUUA 3OE5A 3ZGYA 2RGXA 2ZE6A 4W1SA 1L5KA 3NUQA 1L0BA 2GV9A 2OHXA 1ML4A 3EF3A 1LPMA 3AHGA 2J7PD 3OM3B 3H3JA 3JD3A 2IYYA 4IT5A 1V4NA 1ZG3A 3AK2A 4EABA 3PUXA 1ODKA 2ONZA 2RC5A 1WAZA 3QENA 2CYBA 5D5QA 4NH4A 4GEGA 2AR9A 2XUIA 3B6EA 3UWSA 3Q8LA 2YVLA 2VR1A 4MRSA 4YXFA 2ZR0A 2G9VA 4RV5A 4DXDA 3JVEA 3DVLA 4GI3A 3HDHA 3SYCA 2ECKA 2AG5A 1IXBA 4AMGA 3EA5A 1IG3A 2ETVA 1WKQA 1RPRA 4P9EA 3K0KA 4C3ZA 1GV0A 2R6FA 4W6QA 2IIQA 1ZCFA 4UE6A 1NH2B 4D9NA 1IVNA 5DNYB 2I29A 2O3QA 1QNLA 2LCFA 2EP8A 3I9V1 3ZYCA 3MYYA 2J0SA 1OHHA 3HFGA 2QAGB 3BEOA 4UHBA 1A2KC 3MA0A 4YDQA 3KOZA 2P9ZA 3CC8A 1DPGA 1VYUA 3QYFA 1QAOA 1J5XA 2O6HA 2J07A 3MGCA 3EZ7A 4Q1VA 4BGUA 3OU2A 2ID9A 4E1BA 1QQCA 4AJLA 4R1UA 1G3UA 3KAJA 3I2YX 3GJYA 1R6AA 4DC9A 1GYQA 1Y9EA 4TROA 2HR1A 3GDFA 1SQFA 3OX4A 1BEUB 3L0IB 4J4BA 2ISSD 1P73A 4NOKA 1RVV1 3EQ8A 2LPMA 4DSOA 3FYEB 3ASZA 1EZ4A 5EXPA 4CZZA 2OVBA 4E30A 1RJFA 2FQ1A 2IP4A 4YMIA 4LWZA 3RBXA 3H0EA 4GQBA 3PITA 1B04A 3KQVA 1V35A 4ZREA 3CW2A 1WUIS 5CGQB 2OWEA 1N6KA 3SJBC 4RMJA 3EBPA 3LW8A 3ESRA 5CT8A 1SXJB 2OY0A 5LP1A 3HI6A 5J4LA 2GD0A 3AJAA 4KQIA 1K73W 2OCKA 1GV1A 3KXIA 3VI3B 1R0BA 821PA 1NURA 1OTXA 1C3OA 1C7FA 3Q1KA 2QLBA 1LH0A 3PN1A 2N47A 1CVIA 4BVAA 4MV6A 1FP4B 2TMDA 4MJLA 3W8EA 3IUMA 1JEQB 2XI4A 4YCAA 1C1XA 5KSWB 4JOBA 2FPGA 3H2HA 4JODA 4JQZA 3GT3A 3IUNA 3LECA 1IBMO 1NRXA 1NJGA 4IQGA 1POWA 1IXSB 1HORA 4D4IA 1JBKA 2CK3A 2PWAA 4NYMQ 4EFEA 5IJXA 2RDMA 5FJJA 5H5JA 2W4MA 3DQZA 4J3FA 3UJNA 3QMMA 4KLCA 3ZXUB 3AEKB 3RLIA 4JH0A 2PSSA 4QZVA 1NVGA 5DISB 1WG8A 1ORVA 4G63A 2R8OA 5K6TA 4UBIA 3B1ZA 1J4AA 3LHFA 1M6YA 4DEYA 3OF3A 2Q5IA 3PNVA 1YKFA 2R66A 4B7ZA 4KAFA 1L4YA 1D4OA 1GQ2A 5FORA 4X84A 3FNFA 1UX1A 2XX3A 2W9XA 3L1HA 4E15A 3D1LA 1YTFB 4X7RA 2XZTA 3VR4D 4E11A 5BOSB 3LKDA 3H17A 4DWJA 4FINA 3QPDA 1AUXA 3T9AA 1G4HA 3FOAA 1NVVQ 1ZNWA 4DILA 2FEKA 2NYUA 5DIZA 2EX0A 1ZVJA 1KEKA 2NTVA 1VL5A 2DUMA 1F51A 3DDSA 1MX3A 2AYYA 5CHEA 1SZJG 4CC6A 2CXUA 2IIVA 3UG7A 4OLFA 3NHAA 3I1FA 2WV9A 1XCPA 5EG5A 1EFRG 2ZAYA 3N05A 4HZIA 2IOFA 3IT2A 3G2JA 4A2PA 1E9VA 4B3TB 1XD2A 4J76A 1L7QA 3PQ7A 4DLSA 1FXHA 1GA4A 1H4VB 5HKLA 2EX4A 3LUBA 3E70C 3KXPA 4B83A 1XTUA 4BLSA 4FR2A 4YCLA 1ZOPA 2E4XA 3FTPA 2UUAO 3U4DA 1JQKA 2H16A 2PZMA 4F7OA 3KO8A 4ZTZB 4DA0A 5JWPA 4DG5A 1CETA 4U6QA 5JCPA 1PJCA 2BYTA 2GTPA 4ZVQA 4K8XA 3P19A 5FWDA 1CS0B 2DU8A 3EJ6A 5FL7G 4LDQA 3C98A 2VPQA 5CB4A 3DT9A 3WNDA 4BNKA 1Q0UA 3EY9A 4CKWB 1AN9A 1TMOA 1DC6A 2J4CA 5CM8B 2QTTA 1I36A 4PS1A 1UFRA 3PX7A 3CEPB 2H92A 1U1CA 1U2TA 4I1RA 1TQHA 4FIDA 2CNWA 5LP6F 2BKUA 4NX2A 4PQGA 3ZX5A 3QYJA 3V55A 2N46A 1TUBA 5ILGA 1GNPA 2V3VA 2IZ5A 4PVDA 1KNQA 1VCHA 2GZSA 1BOFA 2OV2A 2WJZB 3OMIB 4PPYA 3DQQA 2WWFA 4U7PB 3D2CA 4B73A 5BURA 1JKJB 4JI2B 4QTYA 4MB0A 5EPOA 3WADA 1CZKA 2MWMA 5I8PA 1TUEB 1Z63A 4Q3BA 4A92A 1IY9A 2FEMA 2AXQA 1V3VA 4LF4B 2GHIA 2F2TA 3WL5A 2IP1A 1NTOA 4Y30A 5HZGA 3RKSA 4B82A 1R18A 4X20B 721PA 4H0FA 3HLTA 4K9OA 4RIIA 1FW6A 3BGWA 4DMFA 3R3XA 3QE2A 3WGKA 2BC9A 2J3KA 4C4PA 3WFVA 4GZ3A 3BH7A 4WCFA 5BORA 2ZR2A 5BY1A 3GG9A 4BXOA 3OE4A 3F6YA 5DX8A 1YASA 4BVHA 4JI0O 4B2IA 3BTVA 3MCWA 1Q81W 3G8CA 2ZUUA 3L8CA 4NHOA 2QJ1A 5D6NA 4EJSC 2AA3A 5DZSA 1I6LA 3IP9A 3DAYA 4CMHA 2W4IA 1P2UA 4XVCA 2YWGA 1V54B 2VNHA 1Q0LA 4WKPA 4BQFA 4R83A 4IH9A 1S8NA 4PAWA 2JLUA 1VFNA 4HYEA 3RSLA 4B40A 2A14A 4BO3A 1GRJA 3BEDA 5CAEA 2D74A 1XCGB 1T8RA 3DF7A 1D3AA 3FWHA 5EPUA 4ZQHA 3DP9A 4DAOA 4RH1A 4IIHA 2IX9A 1D7OA 1WVGA 3ABRB 2EZ8A 4DAEA 4YRTA 3FTQA 1M6VA 3UW1A 5D7NA 3QU4A 3BE4A 1FTNA 5KTOA 2PUSA 1ZVKA 1EDDA 4I6GA 3FR7A 4UDXX 1EXMA 4IDHA 5BNFA 1MB0A 4LJAA 4ER7A 3MWEB 3BB4A 3WDLA 1P60A 2F8LA 4AO8A 3CZQA 4AZWA 4JLWA 3ZCTA 4KN8A 4DA4A 2FR0A 4KLRA 3DD1A 1W30A 2DR3A 5FULA 1KERA 1M56B 1JSXA 3OUSA 4BIZA 2CXHA 3GJ0A 2FPUA 5IZCA 5KOIA 3BABA 1PZEA 1AGXA 2G77B 1HLPA 3GNSA 3EVKA 3JYOA 1S9DA 5JQGA 2IEIA 3RGBA 3EVEA 4WUVA 2J0VA 3HCDA 2ZDIC 4JWKA 1PQ4A 4C6TB 3TXSA 2QN7A 2YIAA 3VR2D 3N2GB 1B26A 3ROEA 4ZJZA 3FDIA 4WZAB 1PWZA 1ZK4A 3TFOA 1FP6A 1YJ9V 7ABPA 4BZPA 1Z4NA 4I4LA 3U6BA 4DPMA 4P3XA 2W0FC 4UJ5A 3PJEA 4Q18A 2I5PO 5B6PA 1A4UA 3RNOA 2POQX 1O6ZA 1GZ7A 3SZLA 3JQ8A 4C0SA 1QBZA 3D4LA 2BEVA 1Z2OX 1QR2A 1FP1D 2QG9A 3CR7A 4I6JA 2G36A 1M2KA 1OF1A 3VYRB 4CMEC 4D8YA 3VC1A 3C3TA 1EUQA 2GETA 1Z5OA 4FGWA 3TBHA 1Q57A 1HY3A 1A7KA 5JASA 4LBVA 3H5RA 1VJ1A 3X1MA 2FOIA 5K8JB 2PVCA 3GLFA 5EJGA 4KIUA 3ZY4A 1JWBB 1G8MA 4IH4A 4M8LA 1M2WA 3AQIA 3OEYA 4OAOA 4QAQA 1DBRA 4Q1CA 1W36D 3AK1A 5U9CA 3NTUA 3K5PA 3LQYA 4HZUA 4RL6A 2QTGA 4CW7A 2QKCA 1JHUA 1MO4A 4DMUB 2ZAGA 5F7OA 2G9ZA 2YIVX 1EFPA 4M9UA 4FFMA 4W9RA 3AVQA 1RMTA 4TZ6A 1BFDA 4TLMB 1B6SA 1GAJA 1HRKA 2X22A 2GTAA 4JQCA 1NBME 4YAGA 1MG1A 3V8QA 1T9HA 2IXDA 2VVTA 4LZOA 1U04A 1R0SA 1M90W 1XG5A 3QTBA 4TKLA 4FHGA 1MJFA 4QNHB 3LY9A 3NIDB 2JFVA 4AIIA 1SQQH 4IV8A 1RXCA 4YV2A 3IT0A 4YRKA 1ADCA 3KSMA 2P9TA 3OOYA 4TS1A 2QRUA 4RESA 2UAGA 3P9CA 1VCNA 3TL2A 2XMRA 4HRQA 1GU0A 4P0TA 5IEBA 2AG1A 1JJ7A 1CQIA 1X0VA 2QX4A 1JIIA 4N9QA 3RT9A 3JQRA 1WXFA 2F9LA 4DC0A 3BXZA 1U2SA 5JJIA 1Q5PA 3BFKA 1EG7A 4XX1A 1C3OB 4MW1A 5EMJA 1OAOC 2J0UA 4LX0A 4LJ6A 5KCZA 3PXCX 4B5LA 1T0PA 2VYVD 5LMZA 2Q3JA 1T5DX 3HG7A 3G7SA 4FJ2A 4CFYA 3FF4A 5BRJA 3CRZA 3NHMA 3A0HZ 1G1MA 4FFOA 2AFIE 3UJAA 1C1XB 2PY5A 2AH5A 1BH6A 2FPGB 4UM9D 2HU2A 4N4AA 4II3A 4HNGA 2AQ8A 3IHWA 4JOQA 5HKAA 4U7GA 4IUYA 1P9OA 3SE7A 5DGDA 1KZHA 1VM6A 4PG6A 1WEKA 2ZWPA 1TK3A 2YIBD 1WVIA 4RHYA 4IINA 2QZ9A 3H0CA 3NYQA 5FPHA 4RVSA 4NBVA 2VG8A 1FXUA 4PPQA 3ZV3A 5ADHA 3RFTA 5G1PA 3L7CA 3B40A 3Q9LA 2ZUBA 1EFTA 3GT0A 4DQLA 4J0FA 3PIRA 4OHKA 2HX1A 5LJLA 2OAEA 1P6XA 3F8TA 1QX4A 4PV7A 3HCOA 4NXMB 2VP5A 3UHPA 1U2ZA 3Q5EA 1WR8A 4RKWA 1X9GA 1IX9A 4AJEA 3FR8A 2R4TA 1GSAA 1VSUA 4JB8A 1G8JA 2H07A 1QIEA 2CFSA 2E6UX 4ONEA 3GJZA 4J0DA 1G55A 4QPJA 2EINB 3FPCA 2WAMA 5KSZA 2XXAA 1XNQB 3P9IA 4YP1A 2Q27A 5L3FA 4DJ5X 3ZLJA 1SVKA 1S0UA 2J5KA 1NC3A 2XD4A 3MFYA 1Q43A 3VAZA 1R9MA 1IBLB 3KYBA 4JUIA 4DMGA 5LBTA 1CUSA 1N6PA 1WD7A 4F93B 2JW5A 2EJ7A 4ZVPA 4KFRA 2CGEA 1XD2B 5DB4A 3IURA 2OCCC 1MD9A 5AVOA 1QK4A 4K9RA 1RWOA 4I1YA 2C5AA 1H22A 2GM4A 3KUDA 4CV0A 3Q9NA 5LGUA 1YZ3A 2OBXA 3DZFA 3K5IA 3F9CA 3LVFO 4D99A 2YWBA 4PA3A 4JIGA 4JNCA 1TKRA 3OZWA 4B35A 3JQFA 3IVRA 1KFJB 2OAQ1 3C5EA 4KFCA 4A26A 5E4TA 1VL6A 1QQ5A 3AUUA 3AIMA 2DWPA 1MB4A 2IJJA 2HNKA 3I3OA 1Z07A 1FC0A 2NZWA 2PAAA 3LLSA 3KUCA 4L0CA 3WGLA 2XAGA 4CMAA 3EHDA 1VHJA 3KYJB 2AEJA 4Z4EA 3RUHA 1YVRA 2KKSA 2C7BA 3LL7A 4RIHA 5LYJB 2XUAA 4EW6A 1L9XA 1ZHHA 3TTSA 2ZI7A 3KPYA 4YAEA 3AFMA 4F4DA 1P1RA 1WCXA 4HYOA 1I7LA 3FVVA 5AK6A 4FB4A 4YP6A 1TUBB 4FFPA 1GTVA 1VQ1A 4QGAA 4ENSA 2Y1EA 2HJSA 1ISGA 2OECA 1Y8RA 1QGUA 1OT3A 4YPFA 4Y2JA 1P7CA 4C4OA 2GJ9A 5KHLB 1PFVA 5K3DA 1ZLYA 4K88A 3IJ5A 3M5PA 1W9HA 1BXZA 4BMOB 1IWBB 3LQ1A 4JX8A 2XWPA 3GCWA 3K1AB 1TXGA 2DE0X 3HXOA 3PNKA 2P75A 2NU7A 2QVZX 1VIMA 4YXWD 3ZQ4A 2JI6A 3I04M 1RZUA 4MSMA 1TJ4A 5HIAA 4J0HA 2OYQA 2P2CA 4PA6A 4V0SA 2B7LA 4WBXC 5D01A 4D46A 4L87A 4LJSA 1JX9A 4CDNA 3MSXA 3DLTA 2UZIR 1V37A 5LVAA 2ZETA 1G3QA 4L02A 5JVDF 3FCSB 3PEVA 4DV6O 5A6VA 3TFQA 4EVQA 4RACA 4WCFB 2YASA 1ENZA 4P32A 5JQWA 3AM1A 3SYOA 2HTFA 4BXOB 5LNK1 3G1WA 4LGYA 2R96A 1WA5A 4OQPA 2ZKLA 3CQ9A 3NORA 4M8KA 3I64A 3T9EA 1SC1A 2AOTA 1G6OA 2JZCA 1U96A 2E74B 4LTMA 3ZY6A 4ERXA 1R64A 3PHHA 1M5RA 3MTGA 3E48A 2LE0A 3E3OA 3TEMA 1GCIA 1K6EA 1TZ2A 5JPDA 1OASA 3C7CB 1N8KA 2F43A 3WHKA 2WWXA 2PMWB 5JBNA 1ADFA 3TINA 1YU6A 2FB5A 2QXYA 3B89A 4MW8A 4MUIA 5LA6A 2QVCA 3FKQA 2UYCA 1XN4A 4HDKA 2CHFA 1APBA 3NBZC 3Q9SA 1CY4A 5AI0A 3S29A 3WL7A 5A06A 3A4VA 4CMGA 4M76B 3UN1A 3KZKA 1DB3A 2BY4A 3TN7A 1M6VB 4RZUA 4RF3A 2QA4V 1KO1A 2UYQA 1BS3A 1E0AA 4U2BA 4ZWNA 3CX3A 2G1UA 4IIJF 2YYZA 1PR0A 3BC1A 3EX8A 3KWJA 4YI5A 2O95A 2AK3A 3JV7A 4RPKA 3LDHA 1KJQA 4FMTA 4U8GA 2I99A 1I33A 4Z1MG 1S4MA 1G8PA 3RC2A 3RHTA 3BA8A 2F3QA 1P91A 2L69A 4ZMRA 4F5ZA 4L2IA 1JHMA 1LW6E 3N86A 1OX7A 1X15A 3A36A 3ZEFB 5IM4F 1HNWB 1B6QA 1MA0A 2IHBA 1Q0PA 4O59O 5JQGB 4KI0A 4NYMR 3KFLA 4B3SB 1QLHA 4JI7O 3AK4A 4QC2A 1UBCA 2ARKA 1RBMA 3ZK9A 5EJAA 4C7MA 4N82A 2ZR9A 4OJMX 1SO8A 2QYSA 3H2SA 3ZK7A 1MRZA 2GEUA 5BNZA 4D25A 5DXFA 2R8RA 4PRZA 4ARBA 4CM5A 3HR8A 3LC1O 2WKRA 4DDMA 2OBNA 2XAUA 4IJVA 3KKMA 3JQ8B 4J7XA 3WNZA 1ODSA 2MYTA 2CAZC 2BEVB 3JU3A 4L73A 2DYRB 2PWBA 1S3SA 2W2VA 3FYTA 3W3ZB 1NVVR 4P4GA 2WU4A 1SOWA 4PYJA 2JEYA 3CCCA 1ZI8A 3FUUA 3DFKA 2RGCA 2L42A 1WP9A 1Z4KA 3R41A 4P3OA 2Y0DA 3OFSA 4XASA 5I9TA 1UK9A 4NCBA 4NABA 3T1YO 1SELA 3ZBTA 2QD1A 5EQTA 3MT9A 3MRTA 3DEZA 4WSOA 4EEKA 3VOAA 3GLFB 1PFUA 1UMCA 3PGA1 4LSZA 1J2UA 2M2IA 5CA1F 5KQSA 3RS8A 4OH7A 2OORA 2HPZA 3T3MB 3ETDA 4IFBA 3NXKA 3C1TA 3K0BA 2X3FA 4AMYA 3IV7A 2WD9A 2QV0A 2PSJA 1E94E 3OEHD 2XNHA 4HZUB 4NICA 4IM7A 3QIVA 2OFXA 1GVNB 2HTEA 2FW9A 4YLEA 4FFLA 1VCIA 4UV9A 1I6KA 3CTPA 4N7MA 1QHSA 3KU1A 3R20A 2ON6A 1A96A 4FUTA 5AM2A 4DIBA 1R3DA 3VAYA 4K8RB 9LDBA 2FVXA 4BO5A 1KBHA 1I9GA 2HC9A 1SQXH 3V1TC 1ULUA 4BJ5A 5H68A 4CEJA 2ZSKA 1Q17A 3KDSE 1V7CA 1UAQA 1YZGA 3EDCA 2XWSA 4U9HS 4CS2A 4J7KA 3PPWA 2H0QA 4GPTA 4X91A 1DRKA 1SXJE 2RGGA 3DZDA 4MVCA 2OXEA 2VFAA 1WMBA 4OGQB 3ROMA 3FAVA 1SXJC 5H9WA 3EQ6A 5E2AA 3A4YA 3FUCA 1Z73A 2XMPA 1RJEA 1LV7A 4UDYX 3JCZA 1MEJA 1ST2A 4PHCA 1VIBA 1TFRA 2HGZA 1XYVA 1PF7E 1X19A 4QJBA 3P9PA 3IAYA 5M52C 2NVUA 4W5QA 2K7ZA 2PMBA 3VU1A 4TMWA 3GZNA 2Q1SA 3UKJA 5MN5A 4ZT5A 1D2RA 1Q84A 3BREA 3VXKA 3OE7G 3GZJA 4IUBS 1X1RA 3U0ZA 3BDVA 3U56A 3D6JA 5H16A 5AKEA 4C01A 4C03A 1NZDA 1PAUA 3C5CA 1QNMA 4NDNE 2QUKA 1NLZA 3HYNA 4CYMA 3I0ZA 4G36A 4GWKA 3AUJB 5KTSA 2CCKA 4O3MA 4G0MA 2V6BA 1L7XA 4RDXA 2ADPA 1SRQA 2X40A 2R6R1 3TIGA 3H1LH 4YTEA 2G67A 5KDOA 1TYCA 1H9CA 2P6OA 5IXSA 3NBKA 5EGSA 1NJ2A 5TIIA 3WV4A 1EFDN 3WYGA 3AB3A 4ND2A 1FLVA 2V7EA 1PVOA 3MT7A 4TM8A 2XYPA 4GKKB 1Y3HA 4YS6A 1TK9A 4YCDA 2CGOA 3IAS1 3A3YA 2GT1A 1O2DA 1NKDA 4IFEA 2Z43A 3L18A 3NDRA 3M7MX 2MJLA 1UK6A 4MW3A 2XXAB 4GXTA 3PS9A 3X1KA 5AG2A 1GRNA 3G5LA 3L0YA 4JQOA 4RWEA 2QLTA 5ALQA 1DKRA 2WMOB 3FYDA 1WKBA 1YZNA 2O54A 3V5NA 3SQNA 3CS3A 5AOVA 3VKGA 1VBMA 3FSRA 1BCCH 2UVQA 5ICCA 2NZXA 4F2GA 1VJRA 3L0OA 5IAJA 1GZSA 3E3MA 2V58A 2MTBA 4I50F 2N9UA 1VBNA 4MKFA 3IBSA 2I4OA 5FR1A 2QRKA 2R5WA 4FX5A 2XQGA 4WCEV 3T2MA 4KREA 3GJ7A 1CV2A 1C0PA 2Y1XA 3IIMA 2BE7A 2E49A 1BW9A 4RK1A 3L8MA 1YVDA 1R5TA 3QITA 3QVJA 3ASOC 1ESZA 3SFVA 3UWKA 2YZKA 3P9ZA 5SYAA 2M1XA 2PD4A 4CT0A 2CEKA 1A27A 4KXLA 2QNIA 4V0LA 3IIKA 2HHLA 5AJYA 2F95B 1DJPA 5FKJA 4G0XA 4JLUA 1WABA 3DTVD 4EKGA 1DCKA 3ED5A 3ZWWA 1P2SA 2JFXA 1X87A 4YRSA 1J0DA 3KQKA 1SUWA 1L0LH 3PHBE 1B1AA 4GMHA 2Q6OA 4CHGA 1D8TA 4AY6A 1ZK3A 3E61A 4RTMA 4BO1A 4DW0A 4G1BA 1NU6A 1ZM7A 1SXPA 1Y8RB 4KITB 3HV2A 1QGUB 2HIGA 2AOXA 3GUVA 2PR7A 5KI6A 4AX4A 1P9NA 1YJ8A 1T1GA 1U0RA 4KGZA 4MIOA 3D36A 3S2YA 2GCIA 2HRRA 3O0DA 1MABG 3DEYX 4XM1A 1BNCA 1G2PA 1TGVA 2RGAA 4B74A 1DC7A 1FP4A 5KJEA 1W34A 3MN1A 2NU7B 1AHHA 1JEQA 1KRHA 2J5QA 4AG6A 2B5VA 2PUHA 4IDDA 5H83A 4CG0A 3QH4A 5G3YA 2SHKA 4ZO6A 3HB9A 2JAUA 2PL3A 4X6XA 1Z34A 5P21A 4LJRA 1PGPA 3RAEC 5A1JA 4JFAA 2PYZA 1EJ6A 4XM0A 1P4RA 3DLHA 4D4LA 5TMBA 3WGYA 1QMPA 2O2EA 4G0OA 4EO7A 5ARCA 4LYAA 1YUNA 5FCDA 3H9QA 4FEGA 3W6PA 2HDOA 2PI4A 1WXWA 1G6HA 4N0PA 3QEOA 1R73A 4N0DA 4JA0A 4UQOA 1O95D 2R6GA 1D09A 4DADA 1IH8A 4CQNA 2AOTB 2JB9A 1H0KA 2FJPA 3KT8A 1QBGA 1W93A 2FPOA 1T25A 1DKPA 4IGGA 3B6JA 1AS0A 1GHTA 3NM6B 3SDSA 4RXUA 5FBLB 2F43B 4J49A 421PA 3MMNA 1K2WA 2FFQA 1J56A 4PTYA 5LA6B 4ZYWA 4JTCB 3DBIA 3K6JA 2BE9A 3E22A 4TLBA 3AFOA 1XHXA 2PGJA 2VBCA 2HG5C 3OOWA 4HDKB 3TIFA 3VUFA 1C50A 5T8KC 1PJSA 1XRMA 2YINC 2W2PA 4V0ME 1MIHA 4EECA 2AMYA 2PLAA 2XNCA 1T3HA 1XD9A 3NNSA 5F7JA 3TTWA 4RZQA 3W8FA 1SULA 2HWKA 3TVTA 2CV1A 2B21A 4JIMA 2YS8A 3KCQA 3LDDA 1UZUA 4ERNA 5F51A 2A7XA 3M4XA 3R40A 4L57A 3EAFA 1X38A 1AXEA 3CVWA 5IAEA 3A1EA 4YV1A 2ZUSA 2IP2A 1JE0A 4Z9BA 3L7LA 3BQMB 4M55A 1NAHA 5JADA 3L72H 3HZOA 3WGOA 2QM8A 4WZAE 1WB6A 4IO0A 4B6SA 4Y2QA 3URKA 5I3ZA 1CP9A 4L2IB 4ZT2A 5IVHA 4PVCA 4MS4A 2PY6A 3R0JA 4CLRA 3B3AA 1GKKA 2CL6X 3FYIB 1SHUX 2HV8A 4MS7A 5JDIA 1U3WA 2DPLA 4JP1A 1TC2A 1XEWX 3L7NA 1FFBA 3QE9Y 3AU8A 1V8DA 1BAPA 2GI4A 3FMGA 2ZVPX 5TR9A 3ZWQA 2R7AA 4KW7A 2QKYA 3C7KA 2AJ8A 3JTEA 4IWXA 4AROA 3ZE1B 3SD7A 1W2WB 3RIEA 3BBPA 3JSNA 4CI0B 2C3PA 4E5UA 1BHSA 5BT9A 1BMQA 4FU0A 2IM9A 4RXTA 5ALEA 1G66A 5CT9A 5CA0F 1I5RA 5EI5A 5AVYA 3LF1A 3BTOA 3UMBA 1ZN7A 1DJMA 4DR3B 3W8NA 3HA5A 4X8LA 2J45A 1JEEA 2J9FA 3DR3A 1NT4A 1DKNA 1WDKA 2GEFA 1PS8A 2ZI5A 1IY8A 3AG4B 2FZVA 1RWKA 3BXFA 2XHEA 4E33A 1UMCB 4X8HA 3N74A 5DM6V 5BN4A 5LXTF 4M1OA 4B7EA 4D0LB 1N0HA 5HM6A 1OX4A 4RS3A 5K4AA 3AT1A 3Q3EA 2BDUA 3DDOA 4G84A 4HEA6 1UKYA 5DMXA 4L08A 5KHJA 1DBQA 4Q7MB 5ALGA 2PX5A 4KR7A 3I9FA 5BQXA 3EMKA 4KI7A 2XXJA 1AURA 2AI2A 2QJFA 1LFDB 1UXIA 1JR9A 4R41A 3WYNA 3KALA 1FXVA 2PGLA 3F7TA 4F3TA 2FRDC 4CEJB 4DR6O 3IP3A 4A3SA 4D10F 3NC1C 4CKXA 3NHBA 2D3TA 3ZTTA 3UHFA 2X2OA 3KELA 3U16A 2H1VA 1HNZO 2YJ3A 3OFNG 4RVCA 3UC5A 1AJPA 3QWIA 1NW8A 3CCFA 1RYFA 3FAVB 4K35A 3AGPA 1HT0A 4G8DA 2HJHA 4YO8A 1QV6A 1YA8A 5C5CA 1PYDA 3P20A 3DLPX 2NO5A 4EMTA 1DAHA 2M6RA 5JALA 4ZOCA 3STLC 4M4SA 2V97A 2LKCA 2D2CB 2IBMA 4EW2A 1F8GA 3A3OA 3VO9A 3OG9A 2NVUB 1CTTA 3GWKC 3L7BA 3GZNB 4AJ9A 3D7NA 3DFMA 4JLOA 3ZG6A 4KQJA 3GDGA 3WP1B 1Z5WA 1DO8A 1GM7A 2QNBA 3TETA 5D3QA 3UHJA 4V0MA 1YQTA 4JBXA 2CE4A 4C3VA 1Q95A 1TQDA 3EOBI 4B08A 4IIUA 3LVQE 3WRYA 5D87A 1UCFA 3BJZA 4XUGB 3R24A 3VR1A 1ACJA 3BAAA 3ZTYA 1CJSA 1H8EA 2HT1A 3UMGA 3QVUA 4FKMA 4BKRA 3NDBB 1VJGA 4GSLA 2J9GA 4E2WA 4P9OA 1FPQA 3NUGA 3G9QA 3PZBA 4X7MA 2AZ2A 2A3QA 1C4KA 2VP4A 1MO6A 3PUKA 1P0PA 3W4JA 5CB8A 4MGKR 2P3SA 2C84A 3F7OA 4KV7A 4K6OA 1QYXA 4WZAA 4MW5A 2HMUA 1KIAA 4BFTA 4LXIA 1U4SA 4DV7B 3RFCA 2EZUA 1IEVA 1D0IA 2AI3A 2OGTA 1ZK1A 3H99A 2IC5A 3FG9A 3K4QA 2F23A 4TKUA 4OXQA 3AEIA 2GBGA 3EXIA 5LZ5A 2H48A 1VQ7V 3SQXA 1QQTA 4OAPA 2VP0A 1QJ4A 1TQ8A 3UHOA 1JNYA 2QD5A 3Q3JB 1F51E 1PVDA 1FSGA 4OUDA 5TF0A 3BIOA 2W6ZA 3RU3A 1WZEA 4P82A 4K9KA 3L1UA 3ZRVA 2YMPA 5E0KB 3M82A 1DC3A 1ZGHA 2JS5A 2Z98A 5E9WA 5KKNB 1EXWA 5HE9A 1HR0B 3JZAA 2LGJA 2HEGA 1Q5OA 2YWCA 1U0HC 1BN7A 4KKVA 3WGUA 3BOSA 2QEQA 4HWPA 5AHXA 4YRBA 1GTZA 1N2JA 2J08A 4QPPA 3L8GA 4FGZA 1G8AA 3L9XA 2AZTA 4DUPA 1DLJA 2BRUA 2W2TA 2EZ9A 1GZ3A 5KHAA 1C29B 1A9XB 1AJNA 1LRJA 4UHKA 3UK0A 3BFJA 3RJ9A 5C8ZA 3W3AH 2QX7A 5B58T 1QFYA 2QLLA 4MUEA 5BV0A 2NPIA 4DR1O 3EULA 3C1AA 3RVQA 4ZCSA 1VQ5V 2WLIA 3VOBA 4F6EA 2AXEA 2QWXA 4PELA 1MNGA 4UB6Z 1BW9B 4MMZB 4AUMA 4F60A 1Q0QA 4OXXA 1IBKO 3WXBA 4KLZA 2Q4BA 2IYEA 5CNMA 1E2GA 5HMMA 5JWOA 2XZOA 2BGRA 2MT9A 2RHDA 1UKAA 1Z4JA 3V80A 1R0YA 5TGZA 2GXSA 1Q7EA 2PDAA 5DRTA 3PI6A 2JJ2D 2DUWA 1ECJA 2B4QA 1GPH1 4QDUA 4PHZA 4PE5B 1GRRA 4FYMA 3FAZA 1P5RA 4P9CA 4RM2A 5HCNA 4CMCA 4OKSA 4WBSA 3FA2A 3FTDA 3UF0A 5HKBA 4E5PA 1ESCA 3E0QA 4KIJA 4AY5A 1AF2A 3L07A 2XTMA 3H11A 4M1SA 1DP4A 1GM8A 5J4VA 2N1MA 3DBOB 1H0SA 1CRLA 4E5SA 1WOMA 3GVIA 3WDMA 1K9MW 2ZCUA 2GZDA 2H3HA 2ZTMA 3KQSA 2OIEA 3B1VA 4PQRA 1DFIA 5JCJA 5B5SA 2J5BA 2PS1A 1WQ4A 1EP3B 3OOSA 4R8SA 1L8QA 4I7EA 2BR5A 2FSIA 1KQSU 3F7MA 4K6FA 1KZGB 2IZ7A 3BD8A 3FB6C 3HTXA 2CDYA 1E3MA 1VTKA 2O9JA 2C4UA 3QY9A 3S7ZA 4WCFC 3K9NA 4MTOA 2WHXA 3OCQA 3LU1A 3CCJV 4RFLA 4Y6OA 4M99A 4UTNA 3QEJA 3TI9A 1F4PA 5E6UB 5HG0A 2JLVA 2I7XA 1OYWA 2O07A 4FC6A 3INTA 1EX6A 2QTBA 3O4RA 3LGAA 5CT4A 4TRNA 4B0PA 2HEPA 1E7QA 3WE7A 3TX2A 2O5RA 3ZE7A 2R7LA 3G1UA 1MJGA 1EJ0A 1NFFA 4FVMA 5IJAA 2BTQA 1U11A 2H4YA 3F4BA 2IHZA 2XUHA 3I0NA 1O8BA 3ZW9A 1RTTA 5ICEA 1XPUA 3W0LB 1R9JA 4H6WA 3G2QA 4KPUB 2RJNA 1E1NA 2QI9F 1PNVA 2OZKA 3AM4A 3H18A 4MUYA 4G0VA 5JD4A 5DP2A 4TTVA 1GNSA 2B4KA 4E07A 4I9GA 1N8TA 5HIIA 4MTCA 5AI8A 4IVRA 3E22B 3TXAA 5E7JA 1FUEA 1G64A 4ND3A 3IH5A 3ABSB 1DC4A 5I9BA 4ASUA 4F9EA 4Y2XA 1WXIA 4FSXA 4DIMA 4JJAA 3DD5A 3AR5A 1O6FA 3W8RA 2HPHA 3OD5A 1Q1BA 3DO6A 4W5NA 4RD2A 1EVKA 1N5JA 2DFLA 4UUAA 3VPHA 2WU3A 2IQ5A 5C7YA 4MPJA 3ED1A 4YB8A 2BSXA 1M57C 2QDKA 3TXYA 1JR3A 3LUAA 1VSQA 1UBJS 2LO1A 4LBYA 2H1CA 4A7PA 3OY2A 2AGVA 3KB8A 1E77A 3BFPA 1RDFA 3OIFA 2FYUH 3CINA 2C00A 2GEDA 3WO0A 1UPBA 4TL9A 4YJ2A 1T1IA 1YQXA 5CXSA 3H6HA 3EGIA 4MS4B 4CLRB 3AF3A 3H5WA 1RU3A 2JVJA 1T5OA 4ESEA 3P2IA 3BGIA 5DWQA 4TXLA 2I6GA 4FGKA 1UFVA 4HRXA 4KNYA 3GFFA 5LYJA 1DTOA 4ACAA 3NASA 2HGSA 2ZKOA 3BX1A 1RLTA 3VI4B 1PV4A 1OIVA 1GN4A 3FZEA 1N7IA 4PY2A 3HVJA 3PDIB 4Z7QB 3WMEA 1L1EA 1CJTC 1X1SA 4DN6A 2FR6A 4W4KA 3HABA 1II8A 3K08A 2Z2KA 3G88A 5KAIZ 3K2EA 4G9EA 5JBIA 3GLFE 2V54A 3PVSA 1QGZA 2IBTA 3VH2A 3A28A 5GONF 3DVAA 4RHEA 5EUBA 4GGOA 3B3FA 1QQBA 4PLGA 3VC2A 1FFDA 4YNBA 2YXYA 2C07A 2Z9BA 5IWAO 2B9EA 1ZSYA 2I2CA 1QBKC 3ER9A 1C4XA 1TJ3A 3SY8A 1I08A 3K1AA 4Q21A 5J59A 1CYDA 1GUYA 3T41A 2Q7DA 2J9FB 1KA9H 1JIKA 4D4HA 4R9NA 1XCJA 3G9UA 3H4VA 5TLSA 3WK7A 3MJ4A 1E2QA 2VSFA 1ALNA 3OHPA 4PQEA 4BEJA 2OEPA 2FW8A 2G8LA 5BN4B 2M6LA 2FPKA 1OX4B 5BW8A 4DLTA 1LJ8A 2IV2X 5IASA 3TTTA 2YDXA 4PLFA 2G5CA 4C2UA 5DX1A 1H42A 4F1JA 1R0ZA 4Q3NA 4GVLA 1ZISA 1XBTA 5EVCA 3CYOA 4R5MA 4NATA 1Q44A 3GG2A 5CNJA 4OY3A 4F4JA 5K20A 3DE5X 4HAWA 4D9FA 2C1ZA 4F4UA 2PSDA 1SOVA 3D6UA 4JLJA 3WQQA 1PNRA 5KYTA 2VF2A 1RPTA 4C0JA 4JFRA 4ZAFA 1ZJZA 2BMDA 2X7HA 4ZI7F 3F67A 2YN0A 4S1TA 3RUIA 4WY5A 3AOGA 5TARA 4R9SA 1E5LA 2DH6A 1EH5A 5ICSA 2VHYA 2OE2A 2WJ4A 5F77A 4CMKA 2PYIA 5A2GA 2W98A 3GFRA 1Z08A 3AY6A 3K8QA 5AXDA 2Q2WA 4A0GA 4LJ7A 3PQEA 1HG0A 4RW0A 4ER6A 3NXSA 5JRZA 2V7QD 2J9YB 2O5CA 1NVMB 4KMMA 4BZXA 1Y4AE 3QHPA 5TDHA 4XUDA 5K45A 5D00A 2ZIMA 1TQ6A 1PT5A 4L0DA 4NVPA 3ZZMA 2R6JA 2I6QA 3F97A 1T9ZA 3DPUA 5BQFA 1Y1PA 1AS2A 3A6KA 3BVPA 5IKXA 2GHQA 2BSKA 5C32A 3LNCA 1NMZA 4HVAA 1SCJA 3B3QA 1WY7A 3BHNA 2OESA 4PDMA 2P27A 4QT4A 5JAZA 1AQUA 1UJWB 4K81B 1PJRA 5KVAA 2QLCA 2VZEA 3LT4A 3N0RA 4M1YA 2C95A 1BKDR 1UM9A 3I01M 4HN4B 1OCOB 4FOTA 3I0MA 2B8WA 1K3FA 3IMGA 1XZFA 2AQKA 3TXQA 1J1UA 3DL2A 4YT5A 2H2IA 2E1RA 1KDRA 3C0KA 2BMJA 5AVXA 3RQIA 1ZHOA 2OR3A 4PBRA 4EY6A 1JA9A 4QPJC 1QMGA 4TKUB 3EXIB 4X45A 4TT3D 4JJGA 4B31A 1QB7A 2HXGA 3DXYA 1MCZA 4PLHA 4OUDB 4P7BA 1RB7A 4M88A 1KKUA 1BTOA 2XHZA 3H6GA 4PX5A 4EFLA 1JDZA 3SJAA 1H8HG 2FPWA 2WI8A 3K9AA 3RRFA 4YWHA 4ON9A 2Q1YA 1YO6A 3ZQUA 1Z56C 2QRHA 3VNVA 1Q3TA 4URWR 3PICA 5IFLA 5HKKD 4IHKA 2GTSA 1XFAA 2PUVA 1Q0SA 5CNIA 1K6MA 4TQAA 3D6VA 5BQ5A 2WJPA 2VF4X 3JQFC 2FSVA 4MQFA 3V97A 4PU0A 3O4FA 1Q1NA 4B46A 4TTJA 3FIUA 1YR2A 4R7ZA 1SF9A 1U6IA 3LYLA 3B2QA 2WLIB 4UCUA 3FX7A 3D43A 2ZS9A 1NYTA 3BD9A 4PG5A 4A73A 1CEQA 3GO4A 3AFIA 3F3SA 4M9RA 3WC4A 4NZYA 1EVZA 4ROSA 2JD0A 3E9QA 2ADOA 3HL0A 3FB8C 2W2LD 1NOJA 2WOOA 4LCPA 1CRQA 3U09A 3WKEA 3QBVA 4C0KA 2ZYSA 4N3GA 5AWFC 1V8ZA 4YQYA 4M54A 3UKOA 1SPBS 1S2DA 1RWQA 4QQRA 3PNBA 4F8EA 1HPLA 2GCOA 1DWOA 1MU0A 1T8SA 2VUTA 1C1YA 2FFRA 2PT7A 4LJ9A 1QDEA 4G01B 4AQDA 1C30A 4CLOA 4S12A 2P06A 2SCUA 4AX8A 1UZNA 3H11B 2KLHA 2ZTVA 4NFLA 1EX7A 3EZ9A 4OQLA 4H35A 3LE8A 1XF1A 4MQ4A 3BHPA 2C9YA 3V1UA 1ABFA 3DEKA 3RKRA 1P2GA 1FS5A 2QLNA 1KZ9A 3GVXA 3W7XA 3IPRA 3LXMA 1E6WA 3SI7A 3DEJA 1E2JA 4XWKA 2NO0A 2OGWA 3G80A 2XMSA 5B3LA 2JGKA 4FYHA 3NI2A 4WFAV 3S7TA 4M7WA 4H7EA 4UTZA 1MENA 2BF4A 5TMDA 1A04A 2PTGA 6ADHA 2FQQA 1Y5MA 4UUQA 2D1RA 3DW1X 2NR5A 4YQFA 4B81A 4C6HA 1QCZA 2XXBA 3JSLA 5IAGA 2GN2A 4X1OA 4EYQA 5TPZD 4ZYLA 3VJKA 1F14A 3BE8A 1X77A 4Y2VA 4MVSA 3DOEA 3AXSA 3AG3B 3N3BC 5E7MA 3RYIA 1X8LA 2BTQB 4BVJA 1GPUA 3C70A 4YMHA 4L5YA 4HADA 2WKPA 3M6UA 2QPOA 4JI3B 3KQOA 1XRLA 4WAUA 3PNMA 5KUKA 4O0LA 2GSWA 2GEVA 3ONNA 4DR7O 2D7DA 3W9YA 4XYEA 1XL4A 3GJQA 3ISTA 4I5SA 1RCTE 1H2YA 3DL7A 2FKXA 1I0IA 2O5VA 3LGXA 2I6SA 1XZ8A 3B8NA 4YI3A 4M7RA 1TTQB 4YASA 3GNLA 4OMDA 2XDWA 2QD4A 2DPXA 2IEDA 1GG9A 3HCRA 1ZH4A 2ZJ3A 1RIIA 4CH5A 3VR6D 4C0WA 1FPOA 5FLKA 4CM4A 1E7SA 3DE0X 1I6MA 4LC5A 4QULA 2EJVA 2HA7A 5FV7A 3GB7C 4IZ6A 3GJ5A 4OTZA 5DEIA 2Q50A 3G6KA 2OCPA 2HLHA 3CC4V 3E8SA 2O7NA 2JS3A 3AV3A 3IPCA 1QSGA 2BOBC 2MSLA 4CF5A 4DC1A 3LY5A 2Y1DA 3U19A 4B17A 1BHAA 4DY4A 1EDEA 1H6CA 3KZOA 4DRYA 3RM3A 2KSDA 2IV3A 4YJ2B 5ALDA 1C7IA 1VJCA 2VK8A 1USUA 3SS7X 2UZ0A 1H1LA 1F7VA 1FRVA 3OIYA 4JQSA 4YJ3A 1JFSA 2OFFA 5FNVA 1EPUA 2I54A 1PP9H 4R6ZA 1OYVA 3TZ6A 4HBNA 1P0CA 1Y5LA 3EOAI 1EK5A 3SEZA 1OB5A 4AKSA 3LP8A 2DQ4A 1ACMA 3HXPA 2YXBA 3HYLA 2CD7A 1II8B 1XV5A 5AW8A 3L01A 4ZV7A 4I3FA 3G79A 2WSBA 3BKWA 3TRDA 1RAEA 3C3AA 3AG4C 1PWYE 1WCYA 4KTTE 3DVAB 2R2GA 1NUTA 3FKSD 3FCAA 2E5LO 1WV1A 4GMGA 4FYYA 1GPLA 3EK2A 4FDLA 4KR0A 2MINA 1M1YA 4E2XA 2OORC 4MV9A 1EFRA 1CNEA 3UM9A 3R1IA 4PYKA 1G8YA 4XVRA 3U80A 3KDPA 1AE1A 4P38A 4KVAA 5TMEA 3IHTA 1L4UA 3ILXA 1XDZA 3WIUA 3I42A 4AF6A 2XVYA 5LWHA 2Q9BA 1Z5GA 1P45A 1J49A 4ND5A 2PPVA 1ISHA 4KCGA 1WW8A 2WSSG 2ZWOA 1DUSA 4OCNA 1D9XA 3K3WA 1WSAA 3WV5A 1IEXA 2FQYA 4OV6B 4MRVA 3A6GA 1VG1A 3SN6A 1DKUA 2G1JA 2X4IA 1ODTC 5B55A 5FL7A 4KUEA 1YULA 4PI2A 4MYSA 1WB7A 2GUZA 3ACDA 2ZW9A 1PD3A 4KWCA 3C97A 3O7MA 2XJ9A 1J8VA 3OY7A 1G38A 3S8YA 1FP7A 3ZE6A 1R6KA 1OXBB 4BFYA 4C20A 5IZ4A 4BLQA 1Y42X 3QO7A 4U63A 1BMFD 4E5YA 3EASA 3CKMA 1X59A 1R0LA 5KDLA 4D97A 2OFOA 1JMYA 5JJNB 3A4TA 4M0PA 1VL8A 2VCHA 2X4GA 3K32A 2C31A 4AQYO 2NSYA 2P65A 5BNWA 2OVFA 1V1MA 3K0DA 2B4YA 5AVSA 2WMNB 1IC6A 1GPJA 1XROA 2GXUA 2BBOA 1NU8A 3LBHA 5AVJA 4MKRA 4DE5A 1YMUA 1KI9A 5MN4A 4DJDC 4K0KB 4LF9O 4JB2A 4KE8A 4BEBA 2C5LA 5IC6A 3LS2A 2BVNA 2Z6VA 3G0IA 1QG4A 1ZGCA 4IKOA 5M3BA 3UVEA 4PHHA 2GA9A 2ZBFA 5D7BA 2YKGA 3SMQA 3IFSA 1B93A 1MC8A 2BSKB 2A94A 4MJ7A 2VT6A 1IU9A 1LVUA 4CL0A 1N3LA 4KDCA 2VXYA 1NF2A 3GVMA 4W8HA 5AYVA 4WLUA 3VDMA 2COKA 4YRGA 3B9PA 3HXLA 1IOZA 4CGZA 4GI7A 2VDQB 3EGXA 4MW7A 2C2WA 2TMKA 2WAYA 3FVRA 4A16A 4B76A 3TBKA 2OV8A 5EIWA 4LCEA 1EA7A 1F7YA 2Y71A 1UBFA 1DZ3A 3T4XA 3E4DA 5H9CA 1BX3A 4Z2YA 1TA8A 3IT3A 1H6AA 2CHQA 4ENQA 2YOFA 3ZZ0A 1UM9B 5CT6A 2FVYA 2YZMA 5H9VA 1QHGA 1T0JB 1SR8A 1I4DD 3ND6A 1NQAO 1OT5A 3L46A 1VF5B 5JNTA 2Q7HA 1N25A 3R5TA 1VHDA 4Q05A 5HPYB 1THMA 2R47A 2O8VA 2DAPA 1XVTA 2RHCA 1DT5A 3SYKA 1GGVA 2P3QA 3T3NA 5K0SA 3CZ5A 1QAMA 3ZMTA 3N5KA 4CKYA 4OJTA 4MA5A 2QAGC 3K3PA 2VT2A 1ISIA 3MTJA 5DTQA 3QI7A 1GZVA 3AC0A 3GT4A 1PGOA 4N12A 5LBIA 4PO3X 4UXJA 3R7LA 4M86A 1HFWA 5K3AA 2PT5A 4HGQA 2Z56A 2VATA 1H94A 1M6NA 3N58A 1I9CA 4BFXA 4JUCA 3ZDAA 4V38A 4FLYA 1UC4B 2P9JA 4LKOA 3MS2A 3WLIA 4UNQA 4FS8A 4L5BA 1KY3A 3OJLA 4GW3A 1QC5A 1CUCA 3T3HA 4MKXA 1FQWA 2BF7A 4RKYA 1UZLA 3DDWA 4MARA 1G4YB 3OESA 5T41A 1U0EA 3KC2A 4MQFB 1LBSA 5JCOA 2XEXA 3EZYA 4TWAA 4I9UA 3IQXA 4XIGS 1OI0A 1D2GA 4BTEA 3WQBA 3HP1A 1XZMA 4LGCA 2P2SA 2QPAA 2CZGA 1JEOA 4TQ9A 3HACA 3UT6A 4DFDA 2B5UA 3E83A 3E8GA 5GZ6A 1UEJA 2FSGA 5B1HA 2ZANA 2FWNA 4BGDA 2GAOA 1DMSA 3N2NA 1HNNA 3KVNA 5ARDA 1XVIA 1RQ2A 4O4JA 4HL6A 3MELA 4Y2TA 3QVMA 4TX1A 4YBZA 5T6BA 1KAOA 4DNPA 3WU2Z 5JH7F 3CPWU 4H7DA 3GK3A 1UODA 5L3DA 1V3UA 5F3WB 4QUGA 2YQZA 1KETA 3JD0A 2CVHA 1HFKA 2GCOB 4FT2A 4IVQA 3U48A 3OO1A 4A8PA 3JYCA 2BHSA 2VPTA 3CKYA 3W3AA 3D36C 3U3XA 2WLJA 4NIMA 1E5QA 4XYLA 5A03A 2ODNA 1NVXQ 1C30B 1XCLA 3DXRA 4CLOB 2SCUB 1TMKA 4RH0A 3DDNA 3UJPA 2X7RB 3OLYA 3R76A 5LSAA 4JYPA 1P39A 1XD8A 2GPWA 3S28A 3LI2A 1TAEA 2XA9A 4JZKA 3PE6A 4WZBA 2C5SA 1AA9A 4ZKIA 1IOLA 4DR2O 4L5AA 1QYCA 1R0XA 2C3UA 1QRAA 4U2GA 3VZPA 3DR5A 4XIFA 2DFTA 2X8LA 3HNOA 2XMDA 1M5IA 4YYEA 4I3GA 1IM5A 2D5CA 2XNDD 1N0JA 2VO1A 5IN5A 4OAQA 4LTDA 4S0XA 2WP0A 6ABPA 1VECA 3F3MA 3OMLA 4Q1FA 1YB5A 2H5JA 2B1RA 3WLFA 1JJVA 2CNKA 4IO1A 2R9IA 2EBUA 4GXQA 4TYPA 5L3VA 5ELLA 3STHA 5FNZA 2GNPA 1TM1E 2C4WA 3RYIB 5H3LA 5LFAA 2UYGA 2B6NA 1DBVO 1NPTO 2WAOA 4A5OA 1Q7TA 4FI3F 1O94D 3P3PA 3IJRA 4R1SA 3VNSA 1HT3A 2P5YA 4MVXA 2ZUWA 1KJWA 3LYAA 3L75H 2JJMA 1JLKA 3MJFA 3O9OA 3PPIA 1M1NA 1EESA 2R25B 5EIBC 2Q4EA 3ZNPA 3LD9A 2PNJA 2REOA 4MEJA 1BX1A 5MGBA 2PYJA 5C37A 5K03A 1OQAA 3JCUZ 1ML3A 3JW8A 4FFVA 4RETA 5K8UA 1GPAA 4MR7A 1KR2A 3PFKA 3T7DA 3GLIA 1GQQA 4KAAA 1X9IA 1CLUA 5KS2A 1A9XA 4NZNA 1GYRA 2CLCX 4CM4B 3NS7A 4RQUA 3QNWA 1UKCA 1CUXA 4FLZA 2GNAA 4RHUA 1FK8A 3A6LA 1YDHA 4DANA 1NDUA 1U6JA 3ZPGA 1CUAA 4QWMA 4DUGD 5FTNA 4PSUA 4YGYA 9MHTA 1QO9A 4US0R 2RMKB 3GFVA 5FI3A 2ARHA 3RJZA 3UMRA 1SUPA 2JFWA 5JDIC 1FXWA 1Z9BA 4EJ2A 4Q9HA 1DIAA 1E7WA 4EBBA 4LI0A 1E3LA 1DVRA 4OLAA 3CCLV 5CW1A 1M6EX 2XAFA 5H3CA 2ZJ4A 1X92A 3BXGA 4UPVA 3L8FA 4OM8A 3GEMA 1Y1RA 4AILC 1SMKA 2W90A 3H01A 2DB3A 5G4KA 2V3CC 4Q48A 1CUDA 3MIZA 4KB5A 1H1LB 3RF6A 4Z5XA 5T3UA 4YJ3B 3A70A 3ZCXA 5FNVB 1PN3A 4RDCA 1EE1A 2A58A 4KXRA 3KHSA 2ODBA 4HLUA 1P1HA 3FPLA 2O8CA 1RYZA 5JAUA 3W6NA 2L35A 3OTOO 1U90A 4YA6A 2JVDA 1NF3A 4EHLA 5AM4A 4JR0A 3GIWA 2JBWA 5JMWA 4G5OA 1T43A 4R1PA 1HW7A 4RF2A 2ZTUA 3MLEA 3V8RA 2ADQB 2VTBA 3ENVA 5G3ZA 1RXWA 2AX3A 2OCLA 3BWEA 2VYNA 4N54A 4K03A 4DSUA 2MINB 1M1YB 3L0ZA 5IJ0B 5CVDA 3LC7O 2XOXA 4R8KA 1Z82A 4Q4JA 7AT1A 5IT9N 1YFZA 1ZITA 3SBGA 4G1VA 2X4DA 3AZPA 3EPPA 3EUWA 3QO8A 3IHLA 1PR6A 4O4IA 3DS8A 2Q1TA 1M2FA 1GG2A 1L3BA 4XDKA 2VNKA 4GU5A 2Z3VA 3HVIA