1PKXA

Crystal structure of human atic in complex with xmp
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
588
Chain Sequence
b'PGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structural Insights into the Human and Avian IMP Cyclohydrolase Mechanism via Crystal Structures with the Bound XMP Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
total genus 207
structure length 588
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pkxA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pkxA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA02
1EGHA 2X8WA 1PKXA 3ZZMA 1C30A 1M9NA 2YVQA 1A9XA 4A1OA 1S89A 1S8AA 1VMDA 1WO8A 2IU0A 1CS0A 1G8MA 1BXRA 1THZA 1B93A 1T36A 1ZCZA 4EHIA 2IU3A 1OZ0A 1PL0A 2XW6A 1P4RA 1JDBB 5H3LA 1KEEA 1CE8A 1C3OA 1IK4A 1M6VA 2B1GA 2B1IA
chains in the Genus database with same CATH superfamily
3L7BA 4QHYA 4OB7A 2WILA 2RN9A 1OCCC 2DSTA 4LSGA 3G1WA 1L3CA 4DW8A 2DR0A 1RPNA 3Q3JB 4J3NA 2R66A 1YVEI 2JANA 3EJWA 3SGLA 2C57A 1X86B 3B78A 5TQ2B 4NR0A 4DLZA 3MPOA 1V54B 3L40A 4KQMA 4N49A 5T4FA 3VAYA 3TZCA 1HDRA 3TIVA 1VSVA 4CS3A 1M5RA 3LDHA 2O8VA 2BJWA 3F9IA 2PD4A 1NFRA 1TVCA 1ACLA 2JAXA 2X1LA 4F5DA 1M67A 4LYEA 4O8YA 3B38A 3T0IA 4CJXA 4DHWA 1PUJA 3WLNA 3NV9A 2PGGA 4YJGB 3TSCA 2II6A 4PNHA 1FJHA 3R0VA 5FPSA 5MGBA 3EF0A 5LL6Y 3ROZA 3NW9A 3FCXA 1QF9A 1RHJA 1KYWA 4L8JA 1YVWA 3BGIA 2PO7A 4ZK6A 2PX4A 4H0CA 4B80A 3HG7A 3O8DA 5CUQA 4J11A 4YDQA 1QH8B 1QLHA 4P3NA 1JF8A 2V5VA 5EE1A 1RI2A 2V9PA 5BWBA 2OD9A 3SVLA 3D0KA 1Z0JA 5DTJA 1KFEB 4RVNA 2O8DB 2IS1A 1CUEA 4EITA 4TZKA 1JMVA 2A5DA 3IT0A 4YJKA 3JVDA 2VXBA 3M9WA 4JC5A 4NZZA 4BL5A 3ZWOA 1EM1A 4MR9B 2JGJA 2ACEA 1UX0A 2RGEA 3LQYA 1CVRA 2W2NA 4BGVA 3C1TA 4BLQA 5HYVA 2XYRA 1JIKA 3PWKA 3THYA 3AX6A 4CGZA 3OOWA 4V0MA 5JJIA 4PSDA 1H3NA 3DXYA 3K0KA 1TJ5A 3VGJA 2ZPAA 5KNDD 3WNCA 4BV9A 3SMVA 2E9SA 4PSVA 2VYFA 3ZLTA 1JG4A 2HOQA 2IBSA 5DNEA 1LZKA 3UENA 2WPDA 2C04A 3N6XA 4MVCA 4JJEA 4F4DA 4YLEA 3TZQA 4EEQA 1H69A 1FP1D 2ORWA 2OQIA 4RELA 5B57C 1N0HA 4MWZA 2BEUA 4X65O 5JPDA 3E4CA 1FZTA 1NQAO 3UJ3X 3ZI7A 1IHDA 4KIWA 1JJOA 4KFUA 1FXKA 2FFQA 3CYFA 5KHHA 4JI4B 1IRIA 3QF4A 1BMFD 4JJGA 2OFPA 4F93B 3CVYA 1DCMA 1H22A 4AKGA 2VAWA 4G0XA 1KVUA 1GKUB 4YJ3B 3AONB 1NVGA 5BXZA 3R76A 3EEFA 2IS4A 1Q6UA 5FBVB 1QTNA 3MRTA 2BEVB 4AJ2A 5CXXA 5EI5A 1SVWA 2AOVA 4AIIA 4AZVA 1N8TA 2ZATA 1Q74A 5T6BA 4REQA 3A2MA 1V5FA 3I1JA 2V7QG 4HB0A 4GG1A 2O3KA 2CCJA 1HOXA 1MVOA 5J2UF 1KL7A 1RHMA 3A9WA 5HILA 2R4QA 4BKMA 1US8B 3ETJA 4XDZA 4QPCA 2BGJA 3PF9A 3QW2A 4KXLA 1G4AE 3T3DA 3CCLV 3HZOA 4UVIA 1UMDB 1CS4C 4BY9E 4TZ6A 3F78A 2F8LA 5CHEA 3A9TA 3E0XA 3FX2A 4ZU6X 4QYIB 4F5WA 1OCCB 5BUZA 4JJ6A 5ALRA 2OAP1 1FPMA 3BTSA 5EE5B 4FM2A 3FYSA 4JT8A 5FL7G 1HLGA 4JYCA 2TYSB 1XPUA 3O1LA 3EG9A 5ITVA 3VR5H 4E5VA 5E6SB 5K05A 1KZYC 3TI7A 4AROA 4G5XA 1P75A 1D4AA 2LDBA 2RGRA 5C4GB 1N7HA 4ZRMA 1K0FA 2GTPA 3EVZA 1DBWA 4Q05A 5CDFE 3OQIB 3BBLA 2J48A 5ES3A 5HZKA 1NI5A 1F1BA 4JL8A 4A91A 6PFKA 3NC1C 2PKXA 3HR8A 3RSLA 1SKYB 3R3WA 3CLSC 5TJHA 4OYYA 3HEAA 2ZJZA 1CQZA 3TM4A 1Z5VA 2IEBA 1YZTA 1VEWA 1XB2A 4R40A 4DZTA 2YIBA 3T1HB 1VECA 3IKJA 3W5IA 4CR7A 2LWIA 2J6IA 1DAMA 1O1YA 4LRYA 4X92A 4D3SA 3CF0A 2PT7A 1ZBQA 2P3SA 3SK0A 2HLNA 2JCGA 2CHEA 3A1CA 4P80A 4XWOA 4M8LA 3QWHA 1LJUA 4HNVA 3ZZUA 4TQDA 3MXOA 4K3VA 2QI9C 2PEYA 3FYTA 3JQAA 2XNDA 3GNLA 4L5IA 1GN6A 2QRQA 3OTGA 2IOFK 4FBLA 3EVBA 5HZHA 1E2DA 2V96A 4E5UA 3QA3E 2X13A 4KXWA 3HYSA 4B32A 2IK8A 1D6NA 3AFMA 2W6OA 5HXAA 2YFKA 1DT5A 4A6EA 5CLFA 4GE3A 3FJOA 1LKZA 4C7OB 3JQ6A 2PZAA 3VJKA 1OCEA 1ZH2A 3E84A 2C7BA 1GA1A 1SR8A 2GBPA 1Y1QA 2YJNA 3QEOA 3JATB 4HYOA 2VDNB 4HZ3A 1RBYA 4RK1A 2WB4A 1VG0B 5C93A 1NBOA 1MH1A 2HJWA 4W63A 1JNXX 4JROA 3C6ZA 3PPWA 4CMIA 1GAWA 3V3TA 1BRTA 4WZ6A 1Y9EA 4YTEA 2OZLB 3LP6A 1NBHA 5FNZA 1ZI6A 3IUNA 3IIIA 1P1BA 4DADA 4JF3A 4B3SB 4R2LA 3KYDA 5G40A 5MN5A 3KL2A 3LUBA 4K8RB 1GZ6A 4WX2B 2FPRA 2VDKB 5EXXA 2ZAOA 2DOSA 4LCPA 2GBLA 4KXRA 4UE3S 1RJEA 2XMZA 3H1AA 1QCDA 5C1OA 4DQ0A 3IOBA 2X0NA 3D4NA 4CF5A 3IVAA 3S28A 3D2BA 1EZVH 4UM5A 5D85A 5GADl 1Q43A 3A31A 1HQCA 2AFRA 2PEZA 3W6NA 4QO7A 2IQ5A 5F21A 3K0EA 4YRPA 1FX1A 3R7DA 2HVKC 2OHFA 3BSFA 3AHGA 2VWHA 4I4IA 3DF7A 1WBBA 3FDIA 3KR0A 5HGXA 4MPTA 3A8TA 3UMBA 3FKSA 1D2EA 3TTSA 5TGZA 3CUWA 3ZKAA 4TTJA 2UZ0A 1B0ZA 1U8EA 1X7XA 1EFRD 2A84A 3MAGA 1JLHA 5EJAA 3PGKA 5H9VA 4UVEA 4EKYA 5LYJA 1ZOLA 2IEZA 2IXGA 2ZSFA 1XQ9A 4YAEA 4JXJA 5J1SB 2OG4A 3TQRA 5PNTA 1IDSA 2J3JA 4J75A 1CIJA 2QUAA 1E7QA 4DREA 2OHIA 2JGEA 3DBLA 5ESRA 4Q3DA 4G3MA 2Q21A 4CHTA 1Q6YA 3GCXA 3FCOA 4Z7QB 3CPWU 4QREA 5A0FA 4A8JA 3FLMA 3IDAA 1QQTA 5FFNA 4W5RA 2P6OA 3LKDA 1ECCA 1NC3A 1MORA 1XQ8A 1NF2A 2QZ4A 3L75H 2C5AA 1GSOA 1VMEA 1SVNA 3AJDA 3EHBB 2Y1GA 3BH6A 1WX1A 4BBPA 5KEIA 4GWGA 1I4TD 4Z9FA 5B1DA 2IXAA 1ZCBA 1Q1ZA 1OXUA 1Y6GA 1QC5A 2IDJA 3HVRA 2GM4A 1NM5A 4JLMA 2YN2A 5K9ZA 5D3ZA 3AIOA 4Q3EA 4RHUA 2O52A 3FWPA 2IODA 4EVIA 3IPXA 1JA0A 4IILA 1QIHA 5BSMA 3EGWA 4N3AA 5B53A 3RUAA 1YJCA 1BW9A 1Z0AA 4MYCA 4BN0A 4J0QA 2WICA 2VUHB 3TQQA 2JK1A 5FEMA 1TKCA 4R50A 4JYBA 1BKSB 3U7GA 2X42A 2IS6A 2ZG6A 3JU3A 3QOYA 3N2LA 4DLWA 3MUEA 1NLFA 4P58A 5EIAA 1MEOA 4YEDA 4FZ3A 1V3VA 4IIUA 5FWYB 3T7SA 2R8ZA 1SU4A 1WF6A 3KXPA 3FI0A 3TTTA 4KGVA 5AK3A 4CLXA 4GKBA 5H6RA 2AFHE 4C4OA 4HDRA 3MNFA 5JXHA 3VKUA 4PHFA 3K0CA 5EUQB 5F4ZA 3IQFA 4WFGA 2H3OA 1KQFA 3NDRA 3N07A 1R6KA 3VU3A 4TXNA 2HA2A 1DAIA 3KAQA 4MS1B 1NBMA 2R68A 3V4OA 3FETA 1HWYA 1ZNXA 3GIDA 3PZRA 4ML3A 4I7EA 1Y5RA 4G25A 3STVA 3LYLA 3HDGA 2QX4A 1F14A 1EVKA 4NOLA 3PNKA 1ZN7A 4YRBA 1RKUA 3S70A 3I1FA 1NTMH 5TPWB 1KS9A 2G17A 4ZXFA 4DO2A 1UDCA 4EF6A 1T3TA 2ZXWC 5BO5A 3QZUA 4U39A 3HJNA 2GXSA 3EFFK 3V9PA 1PHPA 3IUMA 2YQ4A 1I6LA 5CM8B 3AMVA 2R44A 1K8AW 1EP1B 1LJLA 2PVCA 2P0YA 1BXGB 1G6Q1 3EISA 3IT3A 2JGNA 3K53A 1XEQA 1I4OA 5IHXA 3U11A 1CC1S 5DNWA 4J43A 4Z9AA 1KFKB 5M59B 2QU7A 1GA6A 3CBGA 2HC9A 5L4LA 2XOXA 2VJCA 3ZMVA 4ZO4A 3PUXA 1VKNA 4NMHA 2VP0A 4WBNA 4WT7A 3SYTA 3OOYA 2J0EA 1KNQA 1MX9A 2EZ4A 5JO0A 1VE1A 2R4UA 1ZL0A 2R7LA 2NSJA 4UU8A 4KV7A 4HTAA 1KTVA 2ID7A 2IDMA 2NQ8A 3CINA 1O2DA 3AR7A 1SQ5A 4O33A 1H0SA 4EHNA 5BQ5A 3A1UA 3FOBA 1B16A 2IH4A 1Z17A 4J4TA 5THKA 4LCOA 3GLUA 4DPKA 3CONA 4Y9UA 2W2PA 4YY3B 2WM2A 4PO9A 3L8EA 4CV3A 2G83A 4HN9A 1HF3A 1FBTA 1L9XA 4OO3A 5DLEA 1DQPA 2NUAB 1NWCA 1QAOA 1N2XA 2F1JA 3OEED 2JGRA 3PHHA 2Q99A 4V0KA 4ICIA 5FB3A 2HIHA 2H1OA 2C9OA 4R2JA 3KOWA 2K7ZA 2EKDA 2Y2UA 4RTRA 4JOQA 3GEIA 1GUAA 2XJ4A 2IPXA 3DMTA 1DX9A 1X3SA 1JR9A 4UCVA 4DR4B 1IQPA 1MAUA 1XKTA 1JYSA 4UNSA 1K7EB 2CHUA 4JI5O 1U3VA 1T1SA 3RFVA 5BQPA 4J90A 1MGPA 5LNK6 4V1CI 5F33A 3WLFA 5AJVB 4UVGA 4QXMA 4RGYA 4JV5B 3D3QA 3E9CA 2LIPA 3O8BA 3WGLA 1RYYA 4IDQA 3WLKX 3LQ2A 1K0UA 3PNSA 4NLLA 4FIPC 5DX1A 2PRKA 2H1SA 1F7UA 4F3CA 3IHTA 1M56B 2H1VA 4Q7MB 3H42B 5KWSA 2IUYA 3NB0A 4FBMA 1P2GA 3A6HA 5MDHA 4AY5A 3CH5A 2VI5A 3R5JA 3IQEA 4PONA 1EUDA 3ISVA 3H3JA 2XUOA 4L4UA 5AG2A 4RHCA 4RWZA 4Z4HA 3C3AA 4FDAA 4IW3B 1E7SA 1ESMA 1B41A 1L5KA 4AKTA 5L3CA 3VTFA 3I2HA 5KTYA 5EGSA 3H99A 2CHFA 4BMYA 4MINA 3V4VB 4L0CA 4DUYB 1H2YA 2CGNA 4PGMA 4HQLA 1DCFA 1R73A 4S3MA 2QXTA 1T6YA 2G9QA 4Y2SA 2BGRA 3OPMA 4EGAA 2ZJYA 5KTNA 2ZXWB 4UVDA 2QLFA 3X2SA 2PV7A 1XRPA 2FMFA 2H1LA 2R00C 2CXNA 2JFXA 4XKJA 4BVBA 3W8NA 4LTNA 1UWZA 1SQVH 1OH8A 1GZ4A 2PYIA 5BUQA 2WDZA 1XYYA 2ZR7A 3FMOB 3DDUA 2XDAA 2GT1A 2PXXA 4ZDKA 3UO8B 4WPGA 2BF4A 2AG6A 1JMYA 1G4YB 1F3LA 5HS4A 4YPVA 3MRVA 1CUHA 4M37A 1LDGA 1SPXA 2G1JA 4BN4A 3CKLA 1FRFS 3CO5A 2C7QA 4RA9A 3VH2A 1HH4A 4D4KA 4BB6A 1F17A 2HDOA 2XB8A 4EHBA 1H8EA 4LDQA 5KTMA 2Q2OA 3DUFA 2NPIA 3TDMA 4CIBA 6REQB 3NLLA 2GCPA 4GUNA 2W6ZA 1V35A 4GKAA 4A2PA 4LRXA 3T7KA 3CKYA 1KEPA 1XZDA 1WZEA 4HRWA 2GJ9A 3I04M 5E9WA 4KR7A 4NTYA 1N8NA 2Q3DA 1P7PA 2DWOA 1X9IA 4BMOB 1FP7A 1IVNA 3HE3A 3THWA 3NUZA 4NCNA 3DBVO 3NHWA 4M54A 4HBGA 4FJ1A 1G9TA 3KYCB 4OQQA 4IDEA 5LQKA 1TUBB 1G291 4OK3A 5CLGA 3AVYA 1NDUA 4L2IB 1KJIA 3H7IA 2NP6A 3GEPA 1ADBA 3SSOA 3M9LA 3CRAA 4RY2A 3L92A 1N8KA 1HTWA 1XTUA 5KHKA 3R40A 4AMBA 1A1VA 2JFWA 3HJHA 4BWGA 2YW2A 3M7IA 5ECGC 1SRRA 4ETIA 3NDBB 4PYKA 4E2LA 3ZQ4A 4RETA 4X6UA 3RYIA 3F47A 3BFXA 3PRJA 3S55A 4TKVA 4KE6A 4N5NA 3SS7X 2XZTA 3JPYA 4ZICA 4AW9A 1HPLA 1ENPA 2ZKLA 1ZEJA 3GVIA 4GECA 4PLZA 3F96A 4MW6A 1LV8A 2DULA 4WDQA 4XGKA 1DAGA 3AOEC 2PZKA 1DTSA 1P49A 3TUJC 3LRXA 3P27A 5CX4A 3U0ZA 3SJBA 1Q0LA 3CUEF 2XNCA 4MX8A 3PQ2A 3GJZA 3LHSA 1J24A 1XCGB 2AOTA 2HBRA 4Y6QA 3KPUA 1TYDE 1T5IA 4HQRA 3P2EA 1RT9A 3KSUA 3VDMA 1N6RA 5HTKA 2P40A 2XAJA 3H1PA 4GLLA 2Q6OA 2EFHB 5ARCA 4EKWA 2JGMA 2XUPA 1M1KW 2JGFA 2QM7A 3A4IA 2P4VA 1E5LA 3LSQA 7REQB 3RADC 3D6JA 4WFHA 2PGOA 4GPD1 4XDKA 2HYIC 1D5WA 3EY4A 1RP7A 2DY0A 5ESDA 4LYJA 4EA8A 3TTXA 4IUBS 3LV8A 1Y7LA 2I4RA 4PYIA 2G8NA 2HTEA 1MIHA 2WF8A 3QEMA 1VF7A 1T1GA 1YZQA 4XA8A 2DBQA 2ZVQX 5DCWA 2F62A 4TMXA 1TTTA 2NZYA 4EF4A 1H2KA 1Y6FA 1E0SA 4RUKA 1EWRA 1L5OA 2V55B 1MXFA 3QU4A 3ZZ0A 4FHFA 4OBWA 5DKFA 4UOZA 4IXTA 1MBZA 2G9VA 4ASUD 3B4SA 1GA4A 3UFBA 1AUXA 1XDDA 2AFVA 1I33A 5A5GA 4O4IF 5IDQA 4Z49A 3I2IA 4KQKA 1YE5A 2R6DA 4WKBA 4C29A 4UBNA 3NHZA 4QDZA 3K71B 3OM1A 4ZJZA 1T36A 5ECWA 4ZHQF 4MQ6A 4EA9A 1ZJ6A 2VQSA 2DR2A 2JB9A 2X8WA 4JLBA 3CX3A 1J25A 3UAYA 2ZVPX 4ZJYA 1R9GA 1HYGA 2RAVA 5JT1A 4Z9YA 1IE3A 1JR3D 4URZR 1U5BA 5J2TF 1M2VA 1SAYA 3ASOC 3D8BA 3UYKA 1U7XA 1RJ9A 5I7SA 4Y6RA 2HSJA 3NPMA 3SR0A 2HT1A 3FDZB 4F97A 1VJ5A 2NUPB 3E9ZA 1KI8A 3IC5A 3O4JA 2J9YB 1E5TA 4FPXA 2N0SA 2BZ1A 2A9FA 2B0JA 3COPA 1PWEA 4PO1A 1JSZA 3O84A 3MJRA 2BFBA 2LV8A 3T94A 3P9SA 5B1NA 1HL7A 3LQQA 3V46A 1QR6A 3K09A 3DVRX 1XJ5A 4HD8A 1ZHFA 2P4UA 2PIDA 2TSYB 2YUTA 3AR6A 4CLRB 4ZQFA 3UUWA 1G19A 2IGBA 3DC7A 1O4VA 4MV1A 4QTYA 3PPXA 3JYNA 3PI7A 5K8CA 2PS1A 4D80A 2BFAA 1AO3A 4X41A 3S1LA 1EGHA 5FLEX 4AJLA 4P7GA 1IH8A 3LDCA 3SKYA 3QBJA 5DBGA 4CF6A 5EXPA 4B43A 1B43A 5K6TA 4IFBA 3TAXA 5KNDH 7MHTA 4ENSA 1P5RA 3K58A 3OZIA 3PDIB 5KQGA 4MGZR 2WAYA 3NHRA 3SJAC 1TPYA 4JSTA 4ZZIA 3X1YA 5DYGA 2X6BA 2XECA 1YCHA 1EGVB 2F90A 1NVPD 1X1EA 2RK4A 3QKWA 5DCAJ 1LCIA 4QECA 2EGUA 4K8OA 5PGMA 3D36A 3HKBA 2VAPA 3QBDA 1PV1A 3W1EA 5TF4A 1YUMA 4C0WA 3BXXA 4Z9BA 1YI1A 3RVYA 1N4CA 4DV0O 2V1DA 5CYPA 1A2OA 2CXTA 2YS7A 3ZPCA 5IJXA 5K1ZA 3C6KA 2W70A 1K4YA 2Q4BA 4DCSA 1YDHA 3ZWYA 4JDUA 3U7IA 4F4HA 3GLHA 3U10A 1KDTA 1KZ9A 1E2PA 1JBKA 1X8JA 1OX6A 5EWLB 3SE7A 4UOEA 2YZ2A 1MO6A 2BMJA 2FMTA 3FLEA 1Z38A 1IBLO 1AB3A 1LW6E 4YXFA 3IRUA 1Y8ZA 2O2SA 4Q1EA 1H42A 3U3OA 3IBCA 3IUPA 1EZ1A 2GZMA 5CMUA 2BTOA 3DE5X 3LQ1A 1MAWA 2A8NA 2NACA 3PQ4A 3P3NA 5ERGB 1R2QA 4OQDA 2FSGA 2X5XA 2WJJA 4K9PA 1A50B 3IV7A 2OLJA 4WBXC 2PMFA 3A2LA 1GT6A 2J9XB 1VPVA 3GR6A 2YNMA 4G5RA 3QLVA 4FYXA 2DY1A 4X1OA 4IO1A 4TLMB 3DAPA 4N40A 4AZ3B 4MRPA 3PR1A 3CV3A 4H6XA 2FMIA 3H3FA 4IGFA 2H59A 1N2SA 4HLQB 1NI4B 3K5LA 1T4BA 4UJ3A 4ZGWA 3RTCA 4C03A 3KZVA 4BFTA 5IP5A 2WMNB 1KERA 3C24A 1EFVB 1VPEA 3ZIAG 5B3JC 3AVPA 4HNUA 1HSZA 3M34A 3BMXA 5CHYA 3TFQA 3UTCA 1R37A 4RGVA 1QQBA 3ASOB 4LRWA 4LDJA 3ZHYA 1N5DA 1TYEB 2CDNA 5LGNA 1U1GA 4YROA 1F12A 2HA4A 3VBEA 4AWBA 4KXYA 1DEOA 2VNIA 1VCMA 3BJMA 3OY7A 4BRZA 1PL0A 2QL5A 3U3MA 3CZ5A 2O54A 1OZAA 3IH5A 4EJMA 3RJMA 2HQBA 1ZEMA 3TNLA 2B0CA 4AYWA 1T35A 2QORA 3QU5A 4Z4GA 4U7TB 3SYQA 1IUPA 1I4WA 1IBSA 1TAHA 1ZL8B 5LQRA 3VSBA 1HNZO 1FQJA 4EY6A 1UBCA 4EP1A 3O1HB 5LC1A 4HNSA 4LX0A 3EEIA 5C31A 1UODA 1WU7A 2YV2A 4KX5A 3H5TA 3A6DA 5HUHA 1J0AA 4YJFB 4EVQA 5CNJA 2I65A 3LQFA 1Z29A 5K3FA 3BL5A 1KETA 1I9CA 1M2OA 5IEJA 4CKXA 1XG5A 4TKMA 5C8ZA 3IDQA 2BUCA 1XT6A 4FMCB 4I9GA 3KTDA 2VN8A 4TKZA 5AJUA 4C89A 2W0SA 1W88A 4NVPA 4LWPA 3EGOA 3TR6A 5G4KB 3EQ9A 3MYRA 3CNNA 2RGCA 3T7CA 2H1IA 3BJEA 1SUEA 4RPGA 5BYJA 3Q0EA 5AH0A 5CX1B 3Q8XB 5CB4F 4MYUA 3D3WB 4I1SA 2FVXA 4WMLA 4BLVA 2N9UA 1O7JA 2B36A 5EZ5A 5E7JA 3OR7C 3USCS 1SQFA 3O8OB 5A02A 3B12A 4BPRA 1T6BY 4TV8F 4DLKA 1D5CA 2QTRA 2BM0A 3NCHA 4R54A 1WN6A 2H4XA 2O48X 5B36A 3R9KA 1UPAA 3DBIA 2XWJI 3ZX4A 3PGA1 5I9LA 1CEQA 4KWHA 4KBYA 3AOGA 4EB8A 3CE2A 3GJTA 1COWD 3QX9A 1QOQB 2R6FA 3ZQ6A 1LH0A 3G13A 5A06A 3G89A 3AERA 1BXZA 1HEUA 3KWFA 3EHEA 3CMEV 2PNFA 2NO5A 2C9CA 2G7MC 1QHEA 1SUCA 3LOPA 2WVHA 2WYWA 5BRAA 4D6PA 1OLSB 2YI8A 2UKDA 5TV2A 4HBNA 1LI4A 4RY9A 5ENDA 3DE0X 2ZE5A 5CIQA 5HSGA 1APBA 3OCQA 2NV6A 3B2QA 2NN3C 4Q3CA 2SCUB 4L9RA 4XVRA 1ZUQA 2GA9A 5LNK1 4I9NA 4RKEA 2H11A 3G2LA 3LPDA 2V6IA 2ZWVA 2Q8PA 5COBA 3UV7A 4JAUA 4E1BA 1EFCA 3KFVA 1OXKB 4A9AA 4X00A 5G1NA 4BOYA 2ZNRA 1QGYA 4R69A 5EY5B 3O4GA 2V7VA 3UJ6A 3W6UA 1EH5A 5ADHA 2HKIA 1CUWA 3EVNA 3VOTA 1DQSA 3OKPA 4FINA 3QUQA 2CFCA 3NHBA 1J0CA 4IWNA 3R5TA 2D1TA 1JHZA 2BL4A 4AN4A 2Y2VA 4IV0A 4DR2B 2XX3A 4G01B 5EHZA 4PCVA 4UEWA 3NU1A 1RR6A 3NAMA 4ECAA 2LIVA 1FY2A 4NYMR 4ROSA 1WD5A 1BRMA 2FMXA 3W8RA 3TIXB 4CZZA 4ZYTA 4W6QA 4QDXA 2WTAA 4Y7DA 1XNRB 1U6JA 1R3KC 4CR6A 1W96A 1JHRA 5LZ9A 4AC9A 4QE9A 2W6PA 1EXMA 3D6FA 5FUQA 3VPAA 3A4NA 3QOXA 4A1FA 2Z8XA 1I9GA 1GKKA 1UT6A 2E21A 4RL4A 4IVRA 1XMQO 1VPDA 2FZKA 4B46A 5JWPA 3IE1A 3C5CA 1RWKA 5BWCA 4D3ZA 5IM4F 5DXFA 4MLCA 5IUNC 4AF7A 3AFOA 3GZNB 4BVAA 1Z12A 1Z62A 5HS6A 1Z06A 2WZBA 4RF3A 2I3BA 5DEIA 3IQDB 3O3NB 3G5TA 2O0KA 5K0CA 2EBHX 5KYGA 1KO5A 3DZKA 2W6MA 3T61A 1F2TA 4MKZA 4YDSA 2XOKG 2NYUA 3IUQA 3ZY4A 3D1JA 2Q2VA 5A9SA 1Q1EA 1GLNA 1G1XB 3VNQA 3Q7RA 3RVDA 2CBZA 3HGMA 3HDJA 4F3YA 2XNJA 5FV4A 4RZSA 1O6GA 2BBOA 2BHNA 3IDOA 1NXVA 3RFXA 1Q5OA 3MGKA 3J80N 3NAQA 5GVSA 5ILQA 1CZLA 4MW4A 2IIQA 1V8FA 4OXRA 1R5TA 3HJCA 5I8PA 1Z0UA 4MV5A 3C0KA 1V54C 4MVXA 4DS3A 3E83A 2DF8A 4CLOB 2MWMA 2EF1A 2H00A 4O2BF 2FWPA 4XIIA 1PBNA 1ZXBA 2WWYA 1IY9A 1GILA 3DDNA 4Y6GB 1LQ2A 1LWOA 1ZCJA 1YQEA 4URWR 5H5JA 3ET5A 1T8PA 2UUAB 3KLNA 4Q7JB 3SS9X 2GUZB 3O26A 4GQAA 4EELA 1UBTS 4BNKA 1YCGA 1Y6JA 4CG1A 1PQ4A 5C4IA 2QJ1A 3QX7A 2BSAA 1E3WA 4DANA 1U8YA 1ACJA 3NVAA 3H6HA 3DTUB 3WLRA 2ONJA 2PKYX 1FVXA 4QVGA 4J9YB 1C0LA 4R3WA 2EP7A 4Q6WA 5GP1A 2XT9A 2IPNA 5EERA 1KY2A 4PAQA 3DGFC 1NUQA 5KSYA 1N92A 4U02A 3Q98A 4XWKA 1WLSA 4DA6A 4F0JA 5CEJA 2PI4A 5FBHA 3DGEC 4YASA 2HWXA 1NOKA 2C5LA 1QZXA 3D6VA 5AIBA 5FXMA 5FYDA 2BFDB 2QWPB 2VHUA 1OA1A 3GZ4A 3ZD8A 1TU4A 1XRNA 5DIZA 1SMKA 4CM9A 4QTTB 3JYPA 3EC1A 3T4UA 2WHPA 4FLTA 3R5SA 5FUXA 2ZB7A 3INTA 4ACAA 2HWUA 2PUEA 5BV2P 1YAHA 1S2OA 2JVIA 4RVUA 5HJ5A 3JSLA 3FPLA 3HYLA 2A9HA 4KRFA 3TPZA 5TSDA 1N32B 1E4YA 4DCVA 1EWYA 4MGKR 5CBGA 4IRUB 2PUTA 1OXSC 3U80A 3BHMA 5A5DA 4LSZA 5JJNB 3BFPA 4G4SP 4DSAA 1GK9A 4GYJA 1LQTA 3DXXA 3QH4A 1AK1A 2P75A 4HX2A 3STZC 2AZ4A 2WP8J 3S8EA 1FP4B 5DX8A 3HP4A 4DV7B 4K6KA 1PX2A 3P9QA 3L8CA 4YJ2F 3H3XA 3ODPA 2K1EA 3TINA 2ZIXB 3QKSA 3ZWCA 4B3RB 3SZUA 1YL5A 2HF9A 1WP4A 3LVRE 5B12A 3GNTA 5LHHA 4O8XB 3LE8A 4JAVC 3A26A 5TMEA 1HZZC 1XCPA 1X80A 3BTUA 3OU6A 3HL4A 2X6TA 4NQZA 1UOEA 4PFSA 3CEMA 1ZVMA 1PWYE 3CPEA 1TU3A 1YOBA 1C8KA 3USZA 3ANNA 1SBZA 4NBKA 1NNUA 3VH4A 3PICA 5E1MA 4QGFA 1IVYA 1E2KA 1SRYA 2WIBA 1TPZA 1DJLA 4JOBA 1S0VA 3HLYA 2GN4A 4JNCA 1E79D 2XDYA 2OILA 2P77A 1OLUB 4DWVA 3GAZA 1PS0A 4HAMA 5DV9A 3E48A 2G28A 4L4RA 4FIDA 3RS5A 1DG9A 1UJWB 2ZRHA 1ZD5A 1P2SA 3HA2A 1ZMOA 1KP9A 1DC7A 4PAGA 2IJKA 1UM9A 4X3OA 2OTCA 3D6HA 4CQLB 3TL3A 4MLZA 1GR1A 1J5XA 5JALA 2C42A 1KMQA 3OF5A 3KT8A 2QP3A 1XJQA 3CN9A 2ADMA 1ZIOA 1RS0A 1CDZA 1MRZA 3FGPA 3F6SA 4A4DA 5GY7A 5H80A 2OO3A 4NCKA 5D1NA 4KQIA 2P6NA 4ND3A 4YRJA 5EKUA 2ZR2A 4TTQA 1DEKA 3OCZA 1Q6HA 3TSAA 2QTOA 2UVPA 5L3EA 1KSGA 4BNZA 3HO8A 1YD7A 4MVJD 1RPZA 4LIPD 1MOFA 1YQWA 5JC8A 1HK7A 5DH9A 4R8CA 3BX1A 3HUEA 5AVXA 2WTNA 3MHPA 1M5IA 3PXGA 4PHZA 1PWHA 2WJGA 2R79A 3ZHRA 5CBHA 4H27A 3EZ9A 4KDFA 3TNJA 1FS0G 1EESA 2DXIA 1PM9A 1REQB 2B9EA 3AK1A 3HB1A 1H38A 3N6VA 3B3JA 2UUCB 4X54A 4L8YA 4Y2JA 4OLHA 3K96A 1S72V 3BCHA 5GGXA 4GOKA 3MT7A 3DLBA 4XRGA 3G68A 1MQ0A 1IUNA 1CRLA 1OTHA 2BCGY 5H4HA 4B09A 3SGIA 3N2KB 1XILA 2QRKA 2QAGC 2H8KA 3KVRA 4NECA 5C80A 1HDOA 1EP3B 3V4ZA 4QSHA 3QPVA 1NNI1 3M6MD 2AFIE 2R1UA 1KI6B 1DUIA 2C96A 3PHJA 5CPFA 3IRVA 4AMUA 1WF3A 2EV9A 1OBOA 4J0KA 3W0LB 5IYCO 5C1IA 4HYQA 3HKCA 1KZ7B 1SRQA 4G97A 3RFRA 3ZWMA 5L3QB 2Z1MA 3DD5A 2XH8A 2ZAMA 1JH9A 1NJ2A 2PMWB 3PXUA 1OLXB 4HY3A 4FZVA 4WFAV 5AVJA 5DU2A 2IWHA 3O8QB 2AXEA 3L1VA 3VMMA 4MSMA 4HLDA 4K6GA 3BZWA 4YO8A 4DXDA 2ZRBA 4W1PA 1YIJV 1C1YA 3CLKA 3G79A 4DDHA 1O94A 4BFCA 5EIXA 2H2FA 2O2HA 3EFHA 1L4LA 1U9ZA 1H2GA 4MRMB 1H6CA 3ZG6A 1BCSB 1U2TA 3T9DA 1M0EA 2Y0EA 1YL7A 2WQ7A 4Q9IA 3ZHUA 2XF2A 1MQ8B 1H0KA 5CM9C 4UQOA 3RLFA 3ECCA 4P6VF 1TUEA 2VA8A 2VZLA 1PR3A 3ZDXB 3SD7A 1P0IA 2I5PO 4C4AA 3JD1A 3IT2A 2WA3A 4L5CA 4NYJR 2WSSG 3V7WA 4WNAA 3PSHA 4RJ2A 4M55A 1C0IA 3UMGA 4FDMA 1KI7A 3GHHA 4RY8A 3FFQA 1YU6A 4UE2A 3OZUA 2FUCA 4IXMA 1QYDA 2GARA 2PQ2A 4JHLA 3W77A 2RQ6A 3UEOA 1S1MA 2O20A 4KPUB 4NU5A 4J91A 2EZ8A 2AH5A 2QW0X 2BSKA 1K5QA 1U4NA 3E8BA 2H52A 1RYMA 1T1EA 4NTWA 2YZKA 2ZB2A 1DIBA 2FB5A 1DTWA 4ND8A 2BTQB 3LYUA 1X0VA 4QATA 2VZ8A 1I8TA 3ZHZA 1A77A 3RREA 1T1RA 4IX9A 4O25A 4C2AA 4CKZA 1TZCA 1XDUA 3V1UA 1AF7A 3TZHA 3Q8MA 1PZXA 3LX5A 3P0RA 3GVMA 2W6NA 3NBAA 2PYDA 3R75A 4PHTA 3C6BA 1V6CA 5FPOA 1G3IA 2FLVA 2EJ7A 1LD3A 1DINA 1E59A 3PJFA 2IZ5A 1PPJH 4LF7B 4LFCO 1JHPA 2PWPA 5CA0B 5JSUA 5JE8A 1O89A 3QEBZ 3JAWA 1SHLA 1XK6A 1DX6A 3LT1A 4HGZA 4AKHA 4LYGA 2R48A 2RIPA 4GM1A 3D3KA 4D3XA 4UASA 2JI7A 4U9UA 4G8JA 2FETA 3WI7A 4M0KA 3B8FA 3EDCA 4LJ7A 2A1UA 4GPIB 1AN0A 2ALJA 2PZJA 4V03A 1I1HA 4ZV7A 5AVUA 1SZCA 3V48A 1M0TA 4KLAA 1IXKA 2QAGB 4ZFRA 3DZCA 4FILA 4XYGA 3OEHA 4HYYA 1R4MB 3SIPA 5MN4A 2QIOA 3C3BA 1BYUA 1WCIA 4ZC8A 2C07A 3G85A 3I2YX 3DBOB 4N8SA 4DIOA 1TTPB 3RRBA 3HJAA 2HJ9A 1THZA 2EWWA 1OT5A 3B1XA 2IF0A 2OCDA 1GLGA 3ZDRA 2D74A 4PLTA 5B1BC 5CBPA 4PG5A 4A5UB 3GMDA 1ULZA 4WZZA 3OCWA 4N23A 1MTZA 2ODBA 3P45A 5HRAA 3RB8A 5L7TA 3NWBA 1V6AA 1Y98A 3CPSA 3FOCA 3RVOA 3EAQA 3KSBC 5KDLA 1SKQA 4JL5A 1PAUA 4UUBA 4ZMBA 4BP1A 1ND6A 1WN5A 4BNJA 5AM4A 2HJFC 1MENA 2CDBA 4I4TF 1L4UA 2P3QA 2VP2A 4NJEB 5IKPA 2WEKA 1C9JA 4UCTA 1TCVA 1TGVA 2WLLB 4O4JB 2C4WA 1KBQA 4LBVA 1HLPA 3UXYA 1Z0KA 5JS8A 2HXVA 2C5GA 4C76A 4KWCA 1WHSA 5EEHA 2QTFA 3R6LA 2NT3A 2MTBA 3IAXA 4F1WA 4QUAA 4BNDB 1VIDA 5AHKA 2IX3A 1O03A 1RXYA 2IYXA 4RVDA 4TS4A 3PNPA 2XUHA 5ITZA 3FG9A 3KKOA 3PX7A 4EJSC 3F4LA 1S3SA 3SZ3A 4KHZA 4A1OA 1T13A 5CB0A 1QU2A 1AR1B 4ODIA 3P9YA 3HWSA 3DJYA 2Y6UA 2B1RA 2AIRA 2PTHA 1GTL1 3RF6A 5C8XA 3JTEA 1PJQA 4MW2A 3N5CA 2BFEA 3PKIA 3EN0A 3NBFA 1OWMA 2PMEA 5AW8A 4JT2A 2W2LA 3JQFC 3F90A 1ZP6A 3RRFA 4MKXA 4KXXA 4IUDS 4P22A 3SE0A 3OZFA 1CLUA 5COQA 3Q7IA 3JQ8A 1OBVA 5FAKA 4H1TA 4QASA 5EIWA 2AI3A 1BSMA 4KLNA 4MGYR 2Y66A 4DMKA 2YJ3A 1H05A 1JXAA 1K27A 3VX3A 1R00A 3OFNA 4MVQA 3I4LA 4PYRA 1OI0A 1G0NA 1NSFA 3MLEA 3PGMA 4ACBA 1OY1A 2CNWA 2YXEA 1YCIA 2ZUUA 4EMTA 1EHCA 1V8DA 3RS3A 2FEKA 4QPZA 4X62B 1QGZA 2PRIA 3GJRA 2ANCA 1HE2A 3UWPA 4EPTA 4WCDA 1TKAA 2A58A 2VS0A 1AKUA 3ZHCA 1KYOF 1RRMA 3KUDA 4UCFA 1LI5A 4F2GA 4MVJP 5FOVA 3TOVA 3OZBA 2B3DA 5SICE 1P0QA 4K0KO 1M56C 4B6QA 2F43A 3EPRA 1KYVA 3OO1A 4OJYA 1GTMA 1NXOA 1I5XA 1W4BA 1I4LD 3I1IA 4KQGA 2RDMA 2ZYAA 4C7VA 3F74A 2BONA 1G7CA 3D7NA 5L4NA 5FTJA 1VIBA 1MPXA 2B8JA 2W98A 1NVPB 1NXWA 3P0EA 3VBCA 5AW7A 1Z9BA 1ZCAA 2C99A 3UWDA 1DFGA 1YIAA 5AMXA 1LUWA 1Y74B 2GHTA 2J32A 1I3NA 5J4YA 5AKEA 4Z5XA 2G1KA 3T7IA 2X4GA 2B6NA 1X92A 1J22A 1CXZB 4LNUB 1CZHA 2P9YA 3FUXA 3GJ3A 2IYAA 3SHTA 4BYGA 4CV1A 1RRVA 2WIJA 3M49A 4ENPA 4MROA 3ONVA 1U0BB 2ZS7A 1XCOA 3Q2KA 4RTKA 4MSWC 2AS0A 3Q6IA 1ZJJA 3EBPA 3WGKA 3QNMA 4FNOA 4UCUA 4WZAA 4M0EA 1EJ2A 5B1BB 1SOAA 3O8NA 2VRBA 5LOVA 3PUYA 1E0KA 1YJAA 1Q1AA 2A88A 2WZCA 2AMJA 3ZXSA 2WJYA 1WZUA 2DMRA 3D2LA 1F6WA 1Q0HA 4L28A 2VTBA 3D0QA 5EHXA 3CPJB 2EBWA 4UDXX 2WB2A 1JYFA 4EVSA 3FYIB 1BJTA 1TNDA 3FNQA 3LK7A 1E3SA 2I80A 3UQZA 4PW0A 3VNVA 1A04A 1VQMV 4B3FX 4G0ZA 1RE0A 4V0RA 2I6GA 3G0CA 2J3KA 1HG0A 4WKGA 1JVSA 3G7SA 2QX7A 4YDRA 1EPUA 4IUYA 2PYZA 2R6GA 4KX3A 4OGWA 4IDNA 1CY8A 1M2FA 2OXIA 3F5DA 4EJSB 3EEYA 3VAZA 4J42A 4ED9A 3B60A 1P80A 1NGSA 2OWEA 1V11A 2LGJA 2WTXA 4AJPA 4I5FA 1JDVA 2HHHB 1KGDA 2R751 4IDOA 3AUTA 1EE2A 1P5JA 2AI1A 5DTQA 3A0BZ 3OMLA 2R5NA 4X6YA 2WJAA 1W0JG 4M21A 3W4JA 3BGVA 2R1VA 2BEWA 1XLTA 4Q3KA 2ZYWX 1IPEA 2ATCA 2RGNC 3K9WA 1B6QA 4PSUA 3LQ4A 5KBYA 1AXRA 1W46A 2HH9A 5LGUA 2QS9A 4F4LA 3TYXA 1BQ4A 5EEGA 2ODWA 3CNLA 2CK3A 3LKBA 3TH5A 4A15A 3I0NA 1GTG1 4G3XA 1FJGO 2XGMA 4D25A 2CSUA 4S1VA 4Q9NA 2QLNA 4V0ME 3RGGA 4W9RA 3NHUA 2R11A 4WVLA 4BJHB 1PFQA 3T12A 4EYSA 1E99A 3LDDA 4BV2A 1E4VA 4AG6A 4EUFA 1FJXA 1TM7E 4WXPA 1YUNA 5DM1A 1BOFA 5KTPA 1Z7GA 2IW3A 5SY6A 3KCYA 4M0LA 4QUGA 3H9QA 5TLSA 2YWDA 3OY2A 5EIEA 3RYCB 1C2TA 5T6MA 4GLOA 1U9YA 5TPZA 4CT0A 3DR5A 4JLSA 4KXMA 1BX3A 6GPBA 3PQ7A 3G0BA 1Z7EA 4AXXA 2VF4X 4WGGA 1IQ0A 2NZVG 3ND5A 1G42A 2YDYA 3ZTTA 3VHXA 1R0YA 5EJ8A 3SVTA 3N2GA 1KMHB 1X8LA 4L76A 3HU1A 4PJ0Z 2OFOA 4QGAA 1NFFA 5EESA 4N41A 4YYZA 2RIRA 4ISBA 5HQ3A 3PNOA 1TD9A 4C5AA 3AB3A 1Z8NA 2HLDD 3KJIA 5B2ZA 2EHDA 4PDMA 3VI3B 4X60A 4LRTB 4L16A 1TE2A 5DLPA 5KAPA 3JZAA 1LBEA 2ITDC 2H2HA 3AGPA 3LOUA 4ZQBA 3CFYA 4ZP1A 3USES 1L7DA 1K92A 4D92A 2JIDA 3MJSA 4O3MA 1UDXA 3A7DA 4LDNA 3OLQA 1I5OA 3B9QA 3R3SA 1Z26A 4RLSA 3JVEA 2YWGA 2OORA 1QQCA 2QTVA 4LF4B 1V5WA 3WG7C 3PQDA 2GHYA 1JSLA 4CEHA 2X1HA 4K26A 1N36B 4B3TB 1QCCA 4Q4HB 3DQZA 4XIYA 1UFVA 1F0PA 1KK1A 1HQKA 2F4NA 4E5YA 1N57A 3LFUA 2ASEA 4CEJB 3KQYA 1YJWV 2Z56A 4B75A 2F66C 4C0BA 2RG1A 1UAGA 1AA9A 1ZAKA 4FFPA 2BT4A 3ELWA 3NBZC 3L46A 4GMXA 1HZJA 4O4HF 3A1WA 3JQGB 2UXCB 1GZVA 2ZBPA 3MINA 2PZLA 1CTQA 1AROP 4AUEA 1R15A 4LFAO 3FVTA 1CZKA 3MGGA 1N77A 2QX6A 3MQ4A 1ZWLA 3ZBHA 5B6PA 1J49A 4ZGGA 4ZCMA 3QVUA 4R4JA 4O6VA 2PUCA 3S4YA 5JJEB 1YS4A 3WWYA 4NABA 1Y1KE 3K8YA 2ZCVA 5HJEA 1EAMA 3CEPB 3TO5A 1P9WA 3ZLUA 3ZHVA 1XL6A 2O0JA 4L3OA 3CZCA 2VBGA 4I19A 4FHZA 1UJNA 1GNQA 1CUYA 3DBRA 3VH3A 5TT0A 3J7AU 1DUVG 3CQ9A 3ZCXA 3HHPA 2WLIA 3OP1A 4QIHA 1ULUA 4RK4A 4PLWA 3RYTC 2GDJA 4XYMA 2YCBA 3NHLA 2O0LA 1F4VA 5L45A 1ZY2A 5CR9A 3FCYA 2ERXA 2GWRA 1COZA 1BHQ1 3CH6A 3REOA 4X66O 2CL6X 1DEHA 4Y67A 3UJAA 4BFXA 5CT6A 4PSCA 2XUJA 1ADJA 2R65A 3HSSA 2ATIA 2B8EA 1K97A 2NXNA 3OUZA 4GSLA 3FA2A 1GGEA 2Q4RA 1JDBB 5H3LA 2V7UA 3IMGA 4UAJA 3OR6C 3V1KA 5FOWA 4CM4A 1N3BA 3OZEA 4RM3A 1XSEA 1FUKA 3HVKA 5D7NA 3KQOA 3MTEA 1SHZA 1ML3A 3MBOA 4K2AA 1LNSA 3WQSB 5BNTA 4DC1A 2XYGA 1T9KA 3COZA 4PC3A 3T7JA 5IZ4A 4OA8A 3IA7A 3WXBA 2F9LA 3WMRA 1N5LA 4NAUA 4TT3G 3D0RA 5E0OA 5A04A 3MMNA 2IOFA 2FWRA 4J0EA 1LBSA 4M22A 1P62B 5E9JA 5AVSA 2V7PA 3PYXA 5JJCA 4RADA 4MDFA 3LGXA 2J3DA 3P5BA 1DO8A 4EKIA 1MB0A 5T4BA 4CF3A 2QENA 1AF2A 1XP8A 3WLPA 1FUEA 2QN3A 2J46A 2ATVA 3QQPA 4GSKA 1XZMA 3AK4A 4YUXA 2IV3A 4L08A 5LLSA 2J5QA 2QE7D 3W04A 2OC4A 1PDOA 1YC5A 3RRJA 2IYSA 1OE0A 3OEYA 4KE9A 5CURA 3T6KA 1OHHD 4HNTA 4LQLA 2PRZA 3ABUA 3ER9A 2D4HA 3WG7B 3OI7A 3K9CA 3BK2A 4KXFB 2WF9A 4BVJA 3UMFA 3NEJA 4BMNA 4TRJA 4N01A 4E08A 6NULA 2LP4Y 4LF6O 2GAFA 3NM6B 2ZYHA 5CH5A 3P0HA 5DSZA 1S7GA 1QV6A 2WFLB 2DUJA 2FFHA 4HBZA 5JDCC 4TTTS 3EH2A 2P7IA 2I2FA 4EARA 1YRLA 1CRQA 5LBQA 4I50F 1Q22A 1W9MA 3RNLA 3BCUA 4KXQA 3NC0C 3PC8C 3WLOA 3I64A 3WLTA 3A70A 4NFSA 4HUQB 1D4FA 1GAEO 1TVMA 2PF4E 1PX0A 4XB1A 3BILA 4BO7A 3BIJA 1EB9A 2PLRA 5GINE 1H66A 1CQIB 1FU4A 1DWQA 3H11B 2ZUSA 2NZWA 4N5DA 1ZXLA 2NZ2A 4Y2GA 1PLJA 3KXDA 3DLHA 3PTZA 3CZAA 4YRCA 2XQKA 2FN9A 3B2NA 4ZYLA 2EZTA 1ZK0A 3AVQA 3IFXA 1PR6A 2HG5C 1DJQA 3X43A 4KWIA 1E5DA 3SJUA 3WJ1A 4Y2RA 2GNOA 1K5HA 4B6GA 2I8LA 2XXBA 4NATA 3T3IA 4DTCA 1G20B 2GFIA 1AG9A 1R6XA 2QT0A 3ZWKA 2BW0A 5TGTA 3JYHA 1XF9A 1DO0A 4XPZA 4OQNA 2D3TA 4MVJH 8GPBA 3IUSA 4D8XA 2D3WA 9ATCA 3QXJA 1VIAA 5JEEA 3SR2C 1XVAA 1BVUA 4JYMA 3RWOA 4M0DA 3SHFA 4MWGA 2J7PA 2GCOA 3IP9A 5D5HA 2M2IA 1TCUA 3TNDA 3EZ7A 2IU0A 3FRHA 1XDGA 4DN6A 3STLC 1UPTA 3BE4A 4OUDB 4P86A 2JH3A 4FD3A 4HGYA 5EWMB 2FPPB 3L18A 4LA4A 3KOZA 1AI4A 2CT8A 3R41A 3KXIA 3I4FA 2ITCC 1H9AA 3LOQA 3AEQB 2WWRA 3NVKI 1R0ZA 2C7GA 2D2FA 3ZWXA 1RMYA 3WGGA 4LZZA 5AKKA 2XBMA 2XF8A 4KPFC 1M2JA 1MU0A 4HV4A 3OW2U 2B4RO 2XAGA 2CHQA 1BGVA 2Q5OA 5JSQA 3VSDA 1P7ZA 1WDKA 4H37A 3LUTB 4JYYA 5IBPA 4RBNA 1Q92A 3MWDB 1UL1X 4N54A 3K59A 3B20A 4I8XA 1ZO8A 3WLIA 5ED4A 3DXZA 4V0OA 1T8TA 1VE9A 2X5JO 2X9QA 2ZP1A 3JSXA 3JR7A 3AHJA 1JEDA 1NT2A 3MMZA 2EU8A 1NVKA 4YS6A 5KC9A 4H60A 3WMXA 5LN1A 2G88A 3GLVA 2F00A 2P4QA 1CR2A 1U7ZA 1SESA 2H1CA 1N2EA 2YRXA 2WU3A 2EVWX 2QPAA 4WDRA 3PG5A 1XK7A 2A9VA 3QWIA 4PXAA 1NX9A 2MYNA 4YR9A 2P91A 4N6GA 1ZW6A 1T9GR 3HLKA 1XEAA 1R5NA 1BZYA 3STUA 4GQBA 2AJBA 4AQYO 2XWSA 3QLUA 4YMUA 4C2BA 1G8JA 3HR0A 4YAFA 5LVAA 2EJCA 1EDBA 4GPAA 2GEDA 5LGTA 1ONBA 2DFNA 4ZEXA 2XSZA 4A5SA 1NFQA 1IAVA 3QLTA 3CT6A 3W2GA 4B3MB 1LWNA 3CUTA 4OHPA 1ZK1A 4R05A 1WIWA 4ZRDA 3R3YA 3T9CA 4JIMA 3O3OB 4FLFA 1GWNA 4AMVA 6ABPA 1A9XB 5E1AC 3BMNA 3AEUB 1K6EA 4QOGA 4XBFA 4N8EA 4B31A 4I0WB 4RPHA 1WA8B 3T4ZA 4DV6O 1UBLS 3AETB 4UTVA 1WP9A 5CJPA 4PYNA 5TRTA 1X7GA 2Q8QA 3NWJA 3EPLA 2BKLA 1JA1A 1OC4A 1A9PA 4Q4LA 1XREA 1U97A 1XO1A 2IDKA 3F6RA 3ITDA 2RARA 2XA2A 2P2LA 3QVXA 2BVNA 4TWAA 4FPPA 1QE3A 3E5MA 4CQMA 3U1TA 3ROEA 1SC1A 3U7JA 1PTJC 1UZAA 1QB7A 2BFNA 3RK1A 5EC8A 3O4VA 2FSHA 3L1HA 3HGQA 2DAPA 5ADVA 3V2UA 5I4CA 2RSLA 2Q1WA 5CA1F 1DF4A 1LSUA 1QH1A 3VRHA 3N3BC 2Y4OA 1JQ5A 5DWQA 5AM3A 3RN4A 3GLRA 1T8SA 5LMNB 2JAWA 1JAIA 1DP4A 1U3DA 3GP3A 1TEHA 3AW8A 5TS2A 4OAPA 3IKTA 1NDQA 4F91B 4AX8A 4K8ZA 2J59A 4AP5A 3HFJA 2QTWB 3QJ5A 5B3LA 1D2MA 1T9GS 3IKVA 2AZDA 1IZ8A 4RUEA 4GDMA 3WNZA 2QRVA 4G65A 2NVWA 5CMLA 5JAOA 3A4LA 1PWXA 1YITV 3FUWA 2JLCA 2VYND 4FDTA 5I4IA 4TYQA 2E4AA 1O9BA 2WF7A 2DECA 4Q3AA 2W2QA 5E9QA 2I6UA 2WR8A 1PZGA 1G59A 3OD1A 2FF7A 2AYXA 1D9ZA 5EXDA 1S2NA 2I99A 4WNYA 3KALA 3D4BA 3QF7A 4D0SA 4EKNB 4AMGA 4V0LA 5EZSA 2Q4PA 3LY5A 4EG5A 1B0PA 3R5HA 1SGWA 2ZUTA 4JBYA 3ABZA 1ZXXA 3UMMA 4CIDA 3SSMA 4XIFA 3PEWA 4J2OA 1Z6AA 1CULC 3GDHA 2OEPA 4OBXA 4G0YA 4OLFA 4EUHA 1CUZA 5KB3A 3Q7SA 4PG4A 4OI0A 2EWMA 3WNQA 1GM7A 2IXTA 3QSYA 4IHJF 4MWSA 4EFMA 4L3WA 2XBUA 5EK0A 3N0XA 1FRZA 1IBCA 1ZX3A 2CXQA 1NBIA 2DHDA 5K3CA 2M6LA 1UC8A 3G0IA 3FTDA 2WPNA 4ZTZB 1QH9A 3NBXX 3VKHA 3VQVA 3IAEA 3CS3A 5D5QA 1V8ZA 3OOJA 2L0XA 3LTEA 1UKCA 3TGWA 1Z4LA 1TT7A 4WFFA 1MA0A 2OCCC 3UPDA 4JS0A 2Y1XA 4IHQA 3V8MA 4BGDA 2DQ3A 1FFEA 3BHJA 4IZ6A 5BUCA 4DDWA 4GVLA 1V7PC 1RD4A 1H5QA 2ADOA 3CJRA 3H4VA 4HHEA 2PCLA 4K28A 3D3EA 4OI1A 4F84A 5IKXA 4O5AA 3W2TA 3FTEA 3RO7A 2P3OA 4Z1MG 3IC9A 121PA 5BQFA 3TUIC 5TARA 5MF6A 1O6FA 1HC7A 1YEWA 5IF9A 4L0MA 2C31A 2RGWA 4CIXA 3D4IA 2FWBA 5IH3A 2IGTA 4AJIA 1QZ3A 1GG8A 1U9CA 1JTFA 1KVRA 3EOAI 2P9CA 2BTEA 4F8JA 1RWPA 1ORVA 1QB8A 2G5GX 2JJMA 1S8OA 4Y2PA 3IQIX 4H35A 3H9VA 2YWEA 4YXWG 4LVOA 2C84A 4GYCB 4LDRA 2R8YA 1MG0A 4EB6B 2ZYSA 4QRHA 1YZHA 3ASNC 3OE7D 1X14A 3EQ6A 1G8GA 2QF7A 1WUTA 3IQWA 3M3PA 1YR9A 3WIBA 1ZH4A 2O8EA 4PTYA 4MUHA 3D4PA 3PKJA 3KZXA 3FZNA 1B06A 1HFWA 1JQAA 1XYVA 2DJVA 2WM9B 5JLAA 5FBQB 1YRYE 3E8SA 4M0CA 2E37A 5GTDA 4RSHA 1M34A 2VUIB 1B6GA 1WXHA 3G9XA 4HPJB 1GNSA 3PC3A 2HIMA 4DNQA 3MT0A 3FHLA 3SBDA 4DJ5X 2PK3A 2Q3EA 4QHSA 4J9VA 2Q0AA 1M75A 1N25A 4HDNB 4ZBMA 2EX0A 3ZKWA 5LXTB 1L7XA 3GFFA 3ERCA 1R0LA 3Q15C 2D5BA 5JECA 3ZGZA 2G9NA 1DUSA 1IWOA 2BGKA 2X9GA 1RPRA 3T4EA 4PY2A 4H18A 3FYEB 3E89A 2J41A 3U4MA 3Q2OA 3MM4A 5LZ5A 1LVUA 3CZPA 5EVJA 2JFYA 4B4KA 5KYWB 3CJHA 2J3MA 4PI0A 2O7VA 1NLUA 1GPLA 4CVNA 4CL8A 4CS2A 1ZUNA 1VJRA 4RX1A 2CNBA 4JLUA 1GNTA 1OFGA 3CB4A 2FSVC 2VEOA 2VDMB 1L4FA 2WMOB 3T7AA 2XKJE 4QIWF 2A5GA 5F7ZA 5J9PC 1JIVA 2C2KA 5A4KA 3E1KA 3DFFA 3BKXA 1ZSVA 2GX6A 2FPUA 4I1IA 2C4TA 1RAGA 1F5SA 1Z3CA 2NYRA 4HVLA 1WQ4A 2DSNA 1Z5ZA 1XU9A 3GZJA 1XL0A 3CNBA 5JH7A 2ZIFA 2XDWA 2FZVA 5K4HA 3TXXA 2JAPA 2QTZA 5JNVA 3F7NA 1XRSB 3OD5A 5KYYB 3O5AA 1QG2A 4C78A 3L8HA 3A3PA 3DV0B 3H1LH 3ICPA 3P32A 3LIIA 3WAGA 1LF5A 4Y2YA 1J1UA 1OWPA 4HH4A 1VP3A 5HRCA 2FX3A 3WG9A 2JFQA 3Q7PA 1P0FA 1PJ4A 2NLOA 1SS3A 5ALLA 4DJAA 5M52C 1FX0A 4D9EA 4DA9A 1VBFA 1CZNA 3SU8A 1NW5A 4UPVA 2Y1OA 1W19A 1M6VB 4TLBA 4EEZA 1U0RA 5BXYA 2Q0SA 2IJHA 4ZZ3A 5B1AC 2Q46A 1YZGA 4PQFA 4F6EA 2QK4A 2OCCB 1S6YA 4OQLA 3Q41A 2EKBA 4AJ4A 2R70A 5DN6D 2YW9A 3G9TA 2EGHA 3ZDAA 4WIAA 2OXTA 1D8TA 2B1IA 1E9BA 4HWKA 2Q3LA 4UM9D 3P0JA 2BOVA 1T9BA 1W75A 4PVDA 4LYDA 1WJGA 4DLRA 5JS7A 2VWQA 5D01A 3N2IA 5CDHA 3AQ4A 1GJRA 1RLIA 5CCDA 1IHUA 5IPFA 3V33A 4RD6A 3CUSA 2B69A 1P7VA 5KNCA 1HORA 3MOIA 4U1RA 5IZCA 4ZVQA 3TX6A 1UT8A 2J9GA 1IWPB 3A05A 1NVBA 1ROPA 3JRNA 3T7EA 4Q6BA 4I55A 1L3BA 2HMUA 1U1EA 3KXLA 2JAHA 3NKVA 3ASNB 4G85A 4QLOA 1I1QB 4Q4JA 3R8XA 5KSWB 4IJ6A 4M1QA 2N05A 1ZGCA 1JA9A 1R27A 3B53X 3M6VA 2V3VA 4BNGA 3N75A 4IEEA 2VTDA 1L5FA 1Z39A 3AB8A 4IFIA 3JWGA 2G84A 3TIIA 3P9PA 4S1PA 4JZYA 3ZZNA 3SNHA 1M2EA 5FUMA 1Y4UA 4RANA 2FU5C 3OTOO 2HZBA 3PQ8A 1L7NA 2WNHA 4RHXA 3ZCTA 3TJZA 4XPIB 4Z53A 1AOXA 1E2QA 2PHZA 2BFFB 1JLLA 2BZSA 3EF1A 3IEVA 3DUWA 5KZMB 1PV2A 1I32A 1JR4A 3RD5A 4RNDB 1V39A 2ZW9A 4RD4A 3GLHE 1WMFA 1NS1A 4NQRA 5AOVA 2PUWA 4TV9B 3RT7A 1SUPA 4HL6A 2OGSA 3S27A 2ZXEA 2POCA 1U2RA 4CKCA 3R5FA 1YTUA 2QRZA 2BFMA 3VVLA 3QKUA 1RACA 3A1NA 4IIXA 1L5HA 4CQJA 2MT9A 1TM5E 1UJCA 1CBUA 2ZPTX 1YDEA 1CEEA 2XIJA 3WQQA 4BCCA 1B2LA 2YOFA 4D97A 4DJJA 4O2AB 3BXOA 1T9AA 2R8OA 3WZMA 1L7OA 4BNTA 2V6MA 1BS3A 3N6RA 4FCCA 4X93A 5AYVA 4KJXA 1T5HX 3FD8A 1KYYA 2I03A 1PVVA 2AZTA 4U7GA 2C5EA 4RK6A 4F7OA 2JLRA 2VZ0A 3K6KA 4EPYA 2I4LA 3QE4A 1X74A 5FJJA 3IQXA 4RTPA 4WESA 4Q6GA 4YDHB 1YU9A 4E0QA 1XTZA 3I28A 1N2CB 4LV8B 2QZZA 3L1UA 1PZHA 3KYJB 2AUMA 1ESCA 3EZYA 1BE1A 3QUCA 3ROGA 2IDZA 3K9HA 4YMTA 4KODA 3LP5A 3NONA 5B1AB 1E6CA 2M6SA 2RCYA 4P32A 5FLXA 4JJFA 3INRA 5EYPB 4R98A 4RUFA 1D6SA 4KAFA 4IDPA 3C3PA 1J2TA 1HUQA 4IIGA 4P33A 4AURA 1CQWA 4AN0A 4I9QA 4KBFA 4BVHA 3X2QC 1AUQA 3VHLB 1IZ9A 4PCLA 4HNRA 2IH2A 5L3BA 2JFBA 4I1PA 1QUEA 1E3DA 3KQPA 4TWBA 3GRKA 4FW8A 1QTRA 5H83A 2UXXA 3ADCA 4ZEVA 2FQYA 4B4WA 4EYOA 2RE8A 3F7OA 1GFZA 2FEMA 1EVZA 3P7MA 2XGOA 1E64A 1QR8A 2JIZG 3N8DA 3JASA 4R5HA 2MSCB 1ZM9A 1QDEA 1I4EB 2HGZA 4IG4A 4JI6O 2G25A 3K9QO 3CC7V 3ABQB 2WG1A 3GCWA 4NOMA 4ZI2A 4P5PA 4RTMA 4EW6A 3EWIA 5CH3A 5A6SB 1VIVA 3BQ9A 4LY3A 2MMGA 5BV8A 1VGQA 2KJQA 1B2RA 1YZYA 4GPEA 5B4TA 3L7KA 4ZGBA 2MW2B 1UPXA 1T9DA 3W79A 4G1EB 1L7VC 3INGA 5H02A 4LYYA 1E1KA 5K6AC 4IP0A 3BAAA 4HX9A 5C35A 2QQGA 4W9NC 3HP1A 2O1WA 5BR7A 1K8RA 3CSUA 5BWLA 3PHGA 4RV5A 3KT3A 4RMIA 1L6IA 1TD1A 1PG5A 4KO4S 3MHSC 4IIJB 3RRXA 2D1FA 2VIIA 3IAS1 4YHHO 3CSDA 3IR6A 1DJMA 1Z6ZA 4HPXB 2XUZA 1ESNA 3RZVA 5FLKA 2FSIA 4M8KA 3DNPA 5JJLA 5C8VA 1GFIA 3B1JA 4NYMQ 1LI7A 3TFWA 2OZEA 1ZD4A 2BUBA 3ZU3A 3NASA 1XQWA 1M1ZA 2O1EA 2C4VA 4LV6A 2EZOA 1NE7A 2JGDA 2WWFA 3R0QA 3FPFA 2EJBA 4GYWA 1NN5A 1U1IA 3K1ZA 3U4HA 4R1PA 1TKRA 1D1QA 1I24A 5K3AA 4KI7A 3HB4X 3FWYA 3QXCA 3HRIA 1X59A 3ZDCA 3U61B 2C9YA 3NBYC 1QG4A 4FI3C 4EIWA 3QIVA 4QJ3A 3UT5B 1KMIY 3L7AA 1XQ1A 4DFDA 5JQGA 2P9HA 4PLFA 1XHXA 1YI2V 2H9AA 4G6ZA 4ALMA 1GL3A 4XFJA 3U3KA 3PXCX 2ZYTX 5B1YA 1ISIA 1AMOA 5K1XA 4EA7A 1P33A 1CUXA 1O95A 3MHHC 2CWDA 5JEDA 4C6TA 3HSKA 3ZMTA 3I39X 1U0OC 1VIMA 1WTAA 4MIKA 3QVVA 1HNNA 4Z4IA 3AUUA 2IHKA 3N0RA 4B6RA 2DQKA 1TQHA 4IVPA 2VPWA 4W1QA 5GW7A 2DH5A 1K5GA 1Q19A 3UWOA 3DXRA 3N8KA 3BMCB 4MKGA 1QLJA 3A0UA 2TMDA 1ITZA 1RLTA 2QMHA 3NT2A 4IL5A 2V03A 1P60A 3KJNA 3P2YA 2OD7A 4FHCA 5K0FA 2BUAA 3AHFA 4IIEA 3BTVA 4ZCQA 3BEHA 3X2QB 4BNVA 4LF8B 1KBZA 1YJNV 4D8YA 2OO5C 4IBOA 2UV8A 3D6NB 3PA6A 1J5EB 4LHVA 4D6XA 2AKAB 3UK1A 2B8WA 2X58A 5KTKA 3LUAA 1N7JA 2LCFA 4W8OA 3WHLA 3DULA 4GPTA 4YCMA 2W8ZA 3GD5A 3B40A 4B87A 5E1DA 2A9KA 3AJ9A 2B4TO 1QHYA 4FLZA 5DW3A 2CV2A 3PRHA 1TZJA 3CG4A 3BC1A 1F9EA 5ALMA 3TUZC 4DKXA 4I0XA 4IYRA 4EKGA 2OXCA 1RP3B 1XF1A 1EBBA 1T8UA 3DH1A 4NMWA 5KNLA 5JCOA 4JLPA 2UYHA 4ZPJA 3DTNA 1J07A 2PH1A 5I5EA 5C46F 2Y99A 2V45A 2XAHA 2GHQA 3HJGA 1J0DA 1L0NH 1VKOA 2KM1A 2J1LA 4H44B 4HRVA 3ETNA 4PZAA 3ZV6A 1CR1A 4KLCA 2CUTA 3AM1A 3B8MA 4ZO7A 1Y66A 1JV2B 1IZYA 3C87A 3UZUA 3LXXA 5AJYA 4BFWA 4FK5C 4NG5A 4P0PB 3V42A 3V8NA 2PD6A 1YCDA 1QHHB 4LD4A 2ARKA 3DYIA 5JXGA 1PL8A 3PLAE 4EYGA 1VHDA 1WPBA 1OYVA 4Q02A 3S44A 2V0GA 4CMGA 2C77A 3B3QA 1T10A 3DEZA 2Z30A 3OIVA 1S8FA 1WDMA 3A11A 2GNAA 4TL7A 3KOXA 2F8TA 2YEVB 3RVLA 1EBFA 4YGYA 4OXNA 4CL0A 1E4OA 1ZC4A 2GETA 3VV3A 3WGTA 1SELA 5EJ5A 3H2IA 3WWDA 3GCGA 3S3TA 3NYQA 4J3FA 1JAXA 1GAQA 2PH5A 3EPKA 2QRPA 1GO3F 3ZJUA 1ZKMA 5IDJA 3DOEA 2NNLD 4LF5O 1UWKA 2B3JA 2DBZA 5JVDF 5ALQA 4MV3A 4PWZA 5EQTA 4YNBA 4QWMA 4GUDA 4QGSA 4MQLA 4LY0A 4PPNA 2FK8A 2O2GA 4MAFA 4CTNA 4D3DA 4ZI7B 2Q6IA 1ZYUA 2XAAA 3HPQA 1HNZB 4HDMA 4FNMA 2FN3A 3R20A 4TUYB 3SI7A 4OJNA 2FN8A 3UH0A 1AILA 3D7KA 4B3DA 1YB7A 2QROA 4IIFA 3N58A 1NQ5A 4ITUA 2AUTA 4DIBA 2BP7B 2G06A 1KECA 2ILTA 4EHLA 2C9ZA 2VSOA 1YOVB 4ZIRA 3DZGA 3D1LA 3U4QA 5DRTA 1TA0A 1XWIA 4Q16A 2BJVA 5T67A 2JI9A 3KX2A 4ZCIA 2OBXA 2YZ7A 1CVIA 4EF5A 4NQLA 3FCAA 1QU7A 2FPIB 1EM8B 4Z4CA 3IA2A 2PZMA 4EHJA 4TKUA 2HRCA 4OCNA 5EZYB 3DKPA 1EJ0A 1MC4A 1MA3A 1XWFA 1GTZA 3TX2A 3ZIUA 2Z98A 2I9KA 5CJ2A 1J0BA 4KRGA 5AVZA 5CT9A 4RO2A 4Y0VA 3Q0IA 3DLTA 4U7JA 2UXBB 1LC3A 1B3BA 5AI6A 2FGKA 1LDNA 1NT4A 1Z5GA 5T3YA 2W42A 5DNDA 3FTPA 2XZPA 1JDTA 3GWZA 2QL9A 2PG3A 3WK4A 1F20A 2ZU6A 2G8LA 1P6UA 2CL0X 1VB3A 1FVHA 1I7QB 3TZBA 3I45A 3PJGA 2ZRJA 4EW1A 3LG2A 2HX1A 1O5OA 4D6YA 3UMCA 4WIGA 2OOSA 4XSVA 3TKYA 3JQDA 2FUNB 2JIRA 2WOJA 2Y4UA 2RH8A 3CZ4A 1N6LA 1JECA 4Y1RB 3B1WA 4C0JA 2RAPA 3D9QX 4DLYA 5DYTA 4UPDA 4CDNA 4IS3A 4CDGA 1KYTA 1OGIA 2JLWA 4FYWA 1PRYA 4B4DA 3KZMA 3O74A 2QR5A 2W0FC 1ZU4A 1CETA 3QYFA 4IO0A 3OAAD 2J3EA 3LUHA 3LNCA 4G5FA 3R3VA 4LWSA 3HI6A 5DYIA 1UOQA 3ORQA 3VR2A 1URPA 2BH9A 3M3DA 3I92A 3BRCA 1XZNA 3LHKA 5F7OA 2Q07A 2H1WA 1R10A 1QHNA 1PF7E 3EQ2A 2Y68A 3EY9A 4RSRA 3BMOA 1EQ2A 4HWRA 1K7CA 3GFRA 2IYVA 3GPDG 4LJAA 5EMHA 2I76A 3KEFA 3FTNA 1JTVA 2YV5A 4HMQA 4TLEA 1XVVA 1P2TA 5HZGA 1W0CA 4LW8A 4NK5A 4ENUA 3GFQA 1KEZA 3U7QB 1OH5A 1L5QA 4JQOA 3GVCA 4DR1O 3PFNA 2PJUA 2MSKA 4GI7A 1C4OA 4YRGA 4Y6LA 3PGLA 4TWJA 1GPNA 1NOJA 1NQUA 4ZO8A 5K09A 2KB1A 1B7GO 4HNAA 2JJ1D 3WO0A 2O57A 1X1TA 2WUWE 4YRAA 2Q5EA 1KIAA 5IMBA 4WI1A 3JAKA 3C6MA 3DWEX 1Q84A 3OWHA 4HQ6A 5H6QA 2J07A 4B6SA 3HXKA 2EW2A 1OKKA 1BQZA 1O77A 3SPJA 3LLSA 5FFFA 3DFKA 2O6LA 4A8TA 3EULA 3NS7A 1ZC3A 4KVZA 5LYJF 2JDID 4M88A 1N7GA 4NXMB 2QY6A 1G2QA 3WDSA 2CMKA 5BW8A 3U9LA 1IM5A 1II8A 4A0GA 1Y3IA 2ZYDA 2Y67A 5K20A 2EWVA 4RMNA 4YWJA 1RWOA 2DCUA 3KYIB 1CTUA 2PUFA 1VZ3A 3D8SA 4B4VA 4W8HA 4XSHA 1Q3TA 10MHA 3R74A 3WZLA 1SY7A 5BSGA 2HQRA 5KPDA 4YPOA 5JZBA 2C2GA 4BFVA 5B1OA 1QPBA 5E38A 3I56V 4Q20A 3TTYA 1J33A 1JDBC 2VWPA 2M6KA 4E88A 1C7JA 4NP6A 4INAA 3ZDZB 2JLXA 4CKEB 1ALNA 3FSRA 1KP3A 4EUNA 4NPAA 2OCKA 3LWNA 4IGAA 5KNBD 4MJ3A 3ZV4A 4FLYA 2FPWA 3H0KA 4Q12A 4HLCA 4H7DA 5B2EA 4OYHA 3T41A 2ECQA 5LQCA 2Y0IA 4WECA 2Y8EA 4URXR 2X19A 4QL3A 1FB5A 1A9QA 1WAMA 2JASA 3MF4A 3FHJA 3LI2A 3KQNA 5EE9A 2GS9A 5BT9A 4OXIA 2DCMA 2G5PA 4B6PA 4XQGA 4Y98A 2WE7A 1TC1A 2ZZKA 5GV7A 1WMDA 3ML1A 3RAEC 5I5GA 5CYOA 4UAVA 1AHPA 1FQOA 2XCQA 2ETVA 1MNGA 2QRNA 4XARA 1YL6A 2FQWA 1DOAA 1WXIA 4HC4A 1J2YA 3GEGA 1FUIA 1OGJA 3T4XA 4DGQA 5J23A 1B3QA 4W82A 1GPWB 5C8YB 4PG8A 4CMEC 2ZRFA 3QK7A 5KSZA 3QVGA 2QMEA 1YJQA 1IN8A 1GQYA 4PVCA 1YQ9A 4E5KA 2I91A 3RU2A 1GRQA 2YJTD 2ZSHA 1ODIA 3U4CA 1GGJA 1VQ5V 3UY4A 4OQFA 2DUWA 2W8BA 3K30A 1FE8A 2Y1CA 3R6DA 5K5EA 3B6JA 5C3MA 1V4VA 4ZO9A 3WFZA 4S2EA 3R7WA 5BMVB 1U11A 3GRZA 1A9RA 1I7NA 4YRLA 2XADA 1FAFA 5I9TA 1C9KA 4QYWA 1ZS9A 1D1PA 3L4JA 1CY7A 2QQFA 4P81A 1ZR4A 1O9HA 3DL7A 1XVTA 5CT8A 3IQGX 2VSQA 2ZYGA 1NLZA 3RV4A 4NHEA 1YH3A 2VQFO 2XUGA 1JPVA 3DE7X 4ZU3A 5JXIA 2IIPA 2NTYC 5DT9A 1VFNA 2GYYA 3FLBA 3IHWA 4ZQEA 3TETA 1A72A 3W5BA 2ZYIA 3V6MA 2QHXA 4RD3A 1IHPA 2QVZX 1P4GA 1W1IA 4Y1EA 1YKGA 3G9ZA 2PBZA 1ZMTA 2IITA 3TLGA 5A2GA 4PPYA 3Q3VA 4WBNF 3SF8B 4EO4A 2Q7DA 1A1SA 1QYRA 4MSJA 4FFRA 3OT7A 3G4SV 5LZ8A 4UFOA 1B8NA 3TTUA 3K0GA 1F9AA 1VDZA 1OI7A 2EDAA 2BOCC 2FG5A 1GADO 3C85A 3IB6A 4I2NA 4FYIA 3GNQA 1F2VA 4OGQB 3PVSA 1AQ6A 2VATA 2VYVA 4E21A 2Q27A 5JAZA 3SJCC 4FCTA 1MX1A 3CZQA 1K5PA 4ZALA 1Z6XA 2BF7A 4LBYA 4GKJB 4YC7A 4D02A 1U3CA 2VP4A 3RIHA 1MB3A 1XKXA 4W5HA 1QMGA 1ZI8A 3NUGA 3F5WC 1PQWA 4P2ZA 2Q5ZA 1GRNA 3LKVA 4QELA 2L42A 3N74A 4D98A 1X9HA 2C78A 1XNGA 3C70A 4NZNA 5M2QA 1H85A 4GR9A 4QFTA 3RSGA 1AM4D 2NU8A 2UVDA 1MABB 2GN1A 2DWPA 3HUDA 1VF6C 5JRZA 3IAHA 3VZDA 5AJWA 5KA6A 3A6JA 4LH7A 4OX9O 1PV4A 5D3MA 3BEDA 4J0JA 1S0UA 3JAMA 4I3FA 4KR9A 2REXB 2NXCA 3GJ6A 1U7OA 3ZDQA 4D7SA 3PRYA 1Z7BA 1BE3H 3NWPA 4AB1A 3HDQA 3NCTA 4QU8A 3H05A 5FAXA 5FT9A 2UVQA 5JJKA 4QPDA 1USKA 1NMZA 4JI1O 5KYXB 4C08A 4QULA 4Y1GA 4BVLA 2ZQYA 1XROA 3HYNA 3W8EA 2PX3A 1WKCA 3FFTA 1M1YA 1NPYA 2R0QC 2WUGA 2PY5A 2CB0A 4OH1A 3ABOB 3KXKA 3UMRA 3TXQA 3C3KA 1R0SA 4PLYA 4OCLA 4YCJA 4C4TA 1IZZA 3RW0A 1KEEA 1V1RA 1NWHA 2D13A 1D2RA 2Q5LA 3ZC3A 3E9YA 4RYLA 3BJZA 1ZDMA 2GYWA 2YX1A 1IJKA 2ZJBA 2NPFA 4ZOLA 2D1QA 3NOQA 3JVIA 1FS5A 3AYXB 1LR1A 2C97A 1NX6A 2CVHA 1EHIA 3ABMB 3FKJA 4GL4A 5KX5A 5J4HA 3X1DA 4J80A 3CXCU 3LSTA 4AUMA 4HQKA 1XDWA 1BTOA 1UXGA 3AY6A 2ZRPA 2ZQZA 3EA4A 3AT1A 1SVIA 2B3ZA 5E6UB 2WYUA 4WASA 3QV1A 4MIOA 3ORHA 5ALSA 3FWNA 3HKEB 4KH0A 4YUYA 4X1YB 3JRWA 4UM9B 3GU3A 3FMIA 3PENA 4JJIA 1IEWA 2I6XA 4H0LB 1M1NB 4RTQA 1L5RA 5CW2A 1XGKA 5CBFA 2QTBA 3L4SO 1UANA 5DI9A 2O0HA 4LRUA 2FLWA 5EJ4A 5KUKA 3IALA 3FIJA 4EWLA 1JFRA 2BKUA 1B8UA 1H1LA 3NORA 4X65B 3PPIA 5BPHA 3DTVA 3I9NA 3UGKA 1E3QA 4KAAA 4BATA 4F8YA 1AB5A 3ODGA 4OFXA 3K6SA 3P3PA 3GVHA 2HK9A 3ZEFB 1C3OA 3MMPA 2EZ9A 4LI3X 3SYOA 2R00A 3HN6A 3EAFA 1Q6IA 2NSDA 4IKEA 4IMJB 4XX0A 4AI6A 2FYTA 3URKA 5AKIA 3FAVA 3HDHA 2R62A 3U0VA 2PBLA 4QUEA 1K7DA 3PPYA 1PVOA 2QA5A 4XTRA 2HQSA 1SKVA 4IHKA 4NBSA 3WDLA 2PTGA 4FQ5A 5AW3A 2C29D 4PHCA 1WNTA 5GV8A 2VHYA 5CBKA 1F8YA 1NBME 1IJFA 4FZJA 4BB0A 4ZTUB 4NMXB 1QV7A 2XDQA 3FWZA 4TSFA 3WGVA 2EJWA 4XWYA 5U4XA 4NF2A 1A98A 4BDTA 2WABA 3TRHA 2EDCA 4OBEA 3UB4A 3ESXA 1YF3A 1AJQA 9ABPA 1U2GA 4WZAE 5CCEA 1KD1W 2HL6A 2Z5LA 2EC5A 3EGVA 5ITSA 3KKLA 2WWVD 2FWJA 4YPFA 2A0XA 3NM4A 1DMRA 2B5WA 1JILA 4KOAA 4ZAFA 2EX3A 1Z83A 5AXBA 4HH3C 4ZT4A 3X0DA 1KYIA 5DNUA 3BGDA 1ZNYA 3V4PB 2Q2NA 3NNSA 3NHSA 3GQBB 4EHDA 4O4LB 2QGZA 1UDBA 5BVHA 4LGYA 4C7MA 3WP0A 1EA5A 3RVMA 4ZRNA 3EDYA 1MIOB 2D1SA 4RAIA 2HXGA 4B48A 1KIFA 1ZUWA 5GONB 2ZCEA 3ZXUB 4LXUA 2HPHA 1VJ0A 3JS5A 4F6RA 4F6CA 3MAQA 1FYFA 1K3FA 2O8CB 5M29A 3F2IA 2C54A 1WE2A 4MYHA 1T2DA 1DTEA 1VBMA 2YMMA 1IOWA 4ZOEA 1EK0A 2H18A 1NUUA 3AVVA 1Z25A 5KSPA 1BX1A 1NA5A 3FB6C 2PQMA 2CLSA 1N0JA 1SO8A 4L5JA 3R77A 4TMWA 3A6EA 3T35A 1J2UA 2O2EA 1Q21A 2Z4TA 1O8CA 2NO9A 5JO9A 3IAS6 6AT1A 2E5FA 1JEYB 3V1YA 2ZSUA 2OLEA 3IR5A 3RFUA 1F6BA 2QZ9A 3JALA 1NVAA 3CE6A 3CRZA 4PGGA 2GTIA 3CR8A 4QD3A 1YASA 1A7AA 3V4LA 1YDGA 4J7KA 3ASVA 4LG1A 1WN7A 4DT1A 4KBGA 3AF6A 2VRCA 5B6JA 4I8IA 3FDFA 1ZRMA 1A9ZA 5JI3E 2A5FA 1CP9A 3F1LA 5LP6A 3AP1A 2H07A 1ORDA 1OI4A 2XXAB 2W6IG 3KVVA 1V1MA 3MT9A 3OH8A 4TQUS 4Y18A 3KQVA 5C1BA 1QCEA 1PGOA 2RHLA 5C1PA 2A9QA 4G8CA 1U9JA 3PEVA 5JAPA 5KOHB 3ELUA 1F4MA 2J9FA 4HDSB 4XJSA 1H6BA 4XQEA 3L9DA 2NTNA 2C1XA 4MI3A 1ZAYA 4XUEA 3GA5A 3VGPA 4JGGA 1Z4KA 5JBQA 2ZDIC 3JQEA 4M1OA 3WHIA 4BO6A 3S5JA 1RSOA 3GMTA 1XDZA 1PLKA 1NW6A 3BAFA 2CLDX 1ZM7A 3RV3A 1NNLA 2GJ8A 5JCZA 4C22A 2ST1A 5LQJA 1EINA 4GWLA 4ITVA 3AEKA 1JKIA 2I2DA 5ARBA 3J7TA 4HYTA 4MH0R 1CJTC 2AGAA 5IUKC 4E4EA 2WU4A 4H6VA 3QMWA 2DLDA 4CPDA 2XB9A 3DT8A 3IB3A 5LA6A 3S68A 1PL4A 1JWLA 4MSDA 1N0WA 4Y2XA 3NIFB 4P4SB 3RKRA 1CP3A 3Q2IA 5GAJA 2CZGA 4E7OA 1Y6XA 2YIMA 3IURA 3MPUA 2QLLA 2DLCX 1C7IA 1SVKA 2YYYA 1SBYA 3TSZA 4EMSA 4MS4B 3KU4A 4R1SA 4JI3O 4MV7A 3L7CA 4DLPA 3G8QA 1G55A 4TVOA 1IBRA 2RGYA 3UF0A 3LFTA 2JGLA 1NJ5A 2FDCA 3FB5C 2BR3A 3T99A 2YOHA 2D59A 3SC6A 5L9AA 1IZ7A 4QOSA 3DEKA 1SA0B 4O1MA 1U2PA 4A36A 2VJYA 1GZUA 3AHDA 1XRRA 4Q3LA 4WLNA 1RAFA 4LZWA 2IU6A 4WK0B 4FLMA 1BMFA 3M4ZA 3B6MA 3U4IA 2JKVA 1DXOA 2IH3C 3JPWA 1FF9A 3NIBA 3K72B 1G21A 3EOBI 3W3AD 3VC7A 3Q6MA 4W1RA 1U2EA 4BGUA 1NMYA 3K5HA 1HYHA 4YJHA 5BQOA 2BV3A 4NDNE 1QVGU 1QK3A 3OC0A 3LS2A 4A8HA 2LRHA 1PJ8A 2AEFA 5B66Z 3ZVRA 1M7BA 3N3AC 4R6XA 4X85A 1Y4ZA 5FWAA 3M7MX 2ZTMA 4PA6A 3SLKA 2GXQA 1T0UA 1PQUA 2Q7OE 1X1CA 1ZUHA 2OCBA 5LYYA 3OP4A 1J90A 1VC2A 2YIDA 2P4SA 3KAKA 3SJAA 2Z5UA 3THRA 2W4QA 4C1BA 5KUMA 2VXCA 5F98A 1RHRA 2WIGA 4ZFTA 2Q69A 4KUHA 3GGOA 1KC1A 1L0BA 1SQSA 2YZNA 5IDXA 4NX2A 1UJMA 2HHJA 2OWDA 2JK5C 5CCBA 2VLIA 4FHDA 4FUQA 1C3EA 2OM2A 3MK31 3OBBA 2J30A 1LRKA 2PZGA 4LZJA 2R2AA 5EFOA 1P6OA 5A3RA 1XTRA 3ZXIA 3HFSA 3B3FA 3HVHA 2O7SA 2POQX 1SWVA 4H3VA 3FNEA 2I7CA 1YB5A 1KRXA 3N2NA 3FDXA 2ZE6A 5WRFA 4R2IA 2WP0A 1JHUA 3P4XA 1CB0A 5BSRA 4C3VA 5E6RB 2ZBDA 4W5JA 5KOJA 4QOIA 2X2PA 2B4KA 1DXQA 2ZT5A 4K86A 4WCEV 3WKCA 3BE5A 1D1SA 4B44A 1NQOA 4AQ7A 5FCDA 5F4BA 2PR2A 3SQNA 3QELA 4GDFA 4XWAA 3PFIA 1SURA 4MLPA 1HNXO 4HF7A 3NTOA 1DWPA 1E1QD 4JGBA 3AG1C 4YREA 4MSQA 4CH3A 5I3ZA 3N59A 1CE8B 3AL0C 1HE3A 4TTPA 3EPPA 1T34A 1AE1A 3CWZA 5I7EA 1JEOA 1DCKA 4X1IA 1RU3A 3HJBA 3OBIA 1NJ6A 4KPYA 4TLDA 1HG1A 4XFKA 1XR3A 3WRXA 5H3HA 3GOHA 4X1KA 3HN2A 4H4DA 1S3GA 2QTSA 3PLRA 3RFFA 2ZVJA 1LPPA 3FB1A 3QNWA 1CERA 4MVRA 2H65A 4K6MA 3RJ9A 4OFBA 4QPJA 4ZOCA 1VL0A 5EPOA 3VKFA 1U7DA 4A6PA 3RS0A 2LCQA 3EW9A 2C2XA 5KHJA 5AKHA 2H1RA 4UV8A 4IV8A 4KQXA 3A32A 3RSZA 3FOWA 1PLLA 1U2DA 3NIWA 3L71H 1ONOA 4JC4A 1W5EA 4QNHB 5JSYA 2PSFA 4MKIA 4FR5A 4HLUC 3WHPA 1ZVQA 4ZA2A 2KPOA 3RQIA 5FNVB 5FADA 4N3BA 1TAUA 3ANLA 4F6LA 1X7YB 1RJWA