1PKXA

Crystal structure of human atic in complex with xmp
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
588
Chain Sequence
PGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structural Insights into the Human and Avian IMP Cyclohydrolase Mechanism via Crystal Structures with the Bound XMP Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
total genus 207
structure length 588
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pkxA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pkxA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA02
5H3LA 4EHIA 1S8AA 1PL0A 1ZCZA 1KEEA 1B93A 1VMDA 1EGHA 1C3OA 1IK4A 1THZA 2B1GA 1CE8A 2IU3A 2IU0A 2X8WA 3ZZMA 1S89A 1OZ0A 1P4RA 2YVQA 1M6VA 4A1OA 1T36A 1A9XA 1JDBB 1PKXA 1BXRA 1WO8A 2XW6A 1C30A 1G8MA 2B1IA 1CS0A 1M9NA
chains in the Genus database with same CATH superfamily
3ISVA 2I4RA 1PYDA 1TKRA 4GPBA 5MF6A 1F2UB 5HMMA 5BN3B 4E5UA 3COWA 4KFCA 2J31A 2YWXA 3LHSA 2VAVA 1CUVA 3PHCA 1JU9A 1TYDE 4DLUA 4DXHA 1T8RA 3Q2KA 1DKUA 4XUCA 3TZKA 3U17A 1LUAA 2O8CA 2ROQA 2VJOA 5KQSA 3OPQA 3WXMA 5GWXA 5I9LA 1UOOA 2H08A 3W8FA 3FHOA 4L9AA 2XWPA 2GEFA 3OEWA 4DREA 1BEEA 3F9IA 2AIRA 3LW8A 2FRDC 4EFKA 5ALRA 1U7UA 1GKFA 4RX1A 3SGIA 3RAPR 4N01A 1X1CA 4WXRA 1XVTA 4LHYA 5FYQA 3LBHA 3DCYA 2SNIE 3S5UA 5FQNA 3WLLA 4RKYA 5IS2A 3NBQA 1H6BA 4R16A 1Y6XA 1CNFA 1EVJA 3BDAA 3F5QA 3R3VA 1TZMA 4PZ0A 4PU0A 2CL7X 3MUOA 5IAOA 2UYCA 4CQMB 2MU1A 4OHVA 2Z2JA 3KFLA 5K8JB 3TGPA 4M8NE 1SM4A 2XMPA 3I9JA 3GLVA 3ZWKA 4PQRA 3UV6A 1ZGBA 2DCUA 4H3VA 3V3TA 3RFTA 4RORA 5L3ZA 4DVGA 1FS0G 3BL8A 3TCNA 2GD0A 1JJVA 3KWMA 4DR5O 4Q4JA 3BD6A 1IU9A 2A7QA 3SYOA 1ROPA 1DJQA 3QVUA 4F3KA 3NJRA 4I9WA 1J07A 3LY7A 4FNGA 1KDRA 1HYQA 3Q0EA 4YJGA 1N3IA 5HF8A 3I56V 2FMTA 1SVOA 1X7XB 1MAUA 2JFUA 5LMNB 5TISZ 4AURA 1BXRB 2M6SA 3IVCA 1A82A 2PD4A 1SURA 1QLEB 2DU8A 2VHTA 5CH5A 1CY1A 2VA8A 1GQYA 4NMXB 3S3XA 3RFCA 5IRCD 5JS7A 5DNEA 1JEYA 4I8XA 4Y1FA 4NBWA 2GYUA 2OEPA 2ZYVX 3BWVA 1JBQA 1X3LA 3RH0A 3HNPA 5E6RB 3UMFA 3V55A 1SO8A 1JPJA 3GLQA 2ZQYA 1QYWA 1WMSA 4H3HB 3ILXA 2IOYA 2VCHA 2GSWA 3EOBI 1STOA 1YFJA 1GAQA 1K98A 4EG1A 1WB7A 1QCCA 5EKTA 2VZLA 3QU7A 4JJEA 3A37A 3K1JA 3H8VA 4QE9A 3P9YA 3ET5A 3I1JA 8AT1A 1E2GA 3LX8A 1YHQV 3JYQA 2YZ2A 1VARA 4IYHA 2JC3A 1E8DA 1Q81W 5LLDA 1AB3A 4LFAO 5JVDB 5J5AA 3TR5A 4M60A 1QIMA 3SYCA 2MK3A 2RQ6A 2I71A 5T6BA 2YJ6A 3KPWA 3SKVA 2R00C 3WWPA 1IK4A 2VTEA 1ZITA 5DMXA 3O3MB 3HVJA 3L0SA 1WP4A 5B6JA 1AQUA 3CJHA 3ILHA 1C8KA 1DC4A 1PT7A 4LJSA 3OMLA 2XKBA 1G8HA 3SN6A 3OQNA 1FS4A 3M6FA 2G4CA 5K3OA 2PX3A 4FX5A 1MAWA 1RC8A 2BEJA 1P81A 3ETDA 4L1KA 2PUVA 2FGKA 4WF9V 1G9TA 2KX7A 4II7A 3S3TA 3P0RA 2SBTA 4ZYWA 1G2PA 1LNZA 1NLYA 1Q3KA 1R1BA 4B09A 4CL0A 3H9GA 4D41A 5JCPA 1E2FA 1G0OA 3RVLA 1RQXA 4UVEA 4ZCRA 1XF1A 1TT7A 5TJHA 2WFAA 4BJ6A 2FMKA 4OP1A 4ZIRA 4CQJA 3MJEA 2Q1SA 3D0KA 1UXKA 2QLCA 2CDNA 4KFRA 3EZGA 4RY2A 4ZJZA 1D2NA 3D43A 1XTSA 1ES9A 3GLIB 1ZXLA 5EERA 1A96A 3TE7A 1E9FA 1CVLA 3AR6A 1T3HA 3EOAI 5I7OA 2ILMA 3MJDA 3PPWA 1RQGA 5BW6B 1XZQA 5A6SB 2WWHA 3GRRA 2R6CA 4HXFB 4ISCA 1Q82W 1U4NA 1HOXA 3A2MA 4H6PA 2JEOA 1DTEA 4LNUB 1AKTA 4WXHA 3L18A 4QJ4A 1Z6ZA 3URMA 4Z9XA 5HE9A 9MHTA 1QXSA 3GBPA 3AOGA 1B26A 2A06H 3B3GA 3TR0A 3OAAA 1U5BB 2A1TR 4E1AA 2EBOA 2R7LA 1VMIA 5IXSA 3BFJA 2BDUA 5LGNA 1J0DA 1GUFA 5H9VA 5IABA 2XBLA 1MEJA 1XAHA 1YZKA 3KL2A 3GLKA 4M9XA 1FXVA 1K4DC 2IEZA 3PDWA 5EXSA 1TZJA 3GBSA 3ZIAG 2A0UA 5H70A 3K4PA 3Q3GE 4DV6O 3FTQA 3U1VA 2B5WA 3SLRA 4J7KA 2YHSA 2D2FA 2ISSD 3BKXA 3FYSA 3UKJA 1HDCA 2Z5LA 5CX4A 3U3JA 4EY6A 1AXGA 1ZVKA 5KVVA 1T4CA 4PSVA 1P4JA 3QQ5A 4NOLA 1E20A 3HB3B 3A4MA 1P80A 2VJDA 4MVJG 1SXGA 2DWUA 3MAQA 3KS9A 1IHUA 2X5OA 3STZC 4J7ZA 3N58A 1U2EA 3T4PA 1W2BU 3CRZA 3G0OA 1YRYE 4KDEA 1DIAA 2GHIA 1Z7WA 4F4UA 2I3AA 4C6RA 1UF9A 1CHNA 4LYEA 4EB6A 4MHSA 1OAAA 1YMQA 3KCQA 2C04A 5FFNA 1OFGA 5KUKA 3C6YA 3IHLA 4RQAA 1LWNA 5GTDA 2XZTA 1UIRA 2PJDA 2ZCJA 5HKAA 2H1RA 3FYTA 3D31A 3QEMA 2HH9A 4B3XA 1X7YB 1CR2A 4IDAA 1O5TA 4QIHA 3TPCA 1GRVA 2PRKA 5HF5A 3VZCA 2V6GA 2L42A 10MHA 3OQ1A 2A5JA 2C2HA 3J81N 4D42A 4C7VA 4HNRA 4OQQA 4QOJA 4IW3B 4PZYA 3UB3A 4LKOA 3AKYA 1EM8B 3CZQA 1TJ5A 3IJ5A 1TMKA 1SBQA 4XCXA 4ZCMA 3GJRA 1Y6RA 1W5TA 3C97A 4BEVA 3RARA 1F06A 1FFAA 5TPZA 1JDBB 4BO3A 1NX9A 2UUCB 4IJUA 2O8BB 3C98A 2X6CA 4FT4A 3BULA 3ZJYA 3IQGX 5FP0A 4I9HA 3ZDQA 4ZOBA 3CF6R 2QU7A 3P9NA 1QV7A 3GUCA 3ZDDA 1COWA 4F0JA 1QFJA 4AK9A 1N0VC 4B82A 3EA5A 4U2GA 3UO3A 4WJZA 4FCWA 3WLJA 3PQ2A 3RS3A 1PWEA 3ZCSA 4QXRA 1UKBA 2WU8A 4YNBA 1EK6A 3WR5A 1T6BY 2CVZA 3OCWA 5KTPA 2Z8XA 1M2WA 1PGPA 3G5MA 3UMGA 4J1SA 1OHHG 4CEIA 2HN9A 5AKHA 1U6IA 3LDGA 1H0RA 2W2OA 1XHZA 2IU4A 2QM8A 1JR3A 1SVSA 4BQQA 4DSAA 3TLBA 2XA1A 4ZIBA 4K8XA 2GYYA 3REQB 1IC6A 2NU6B 4AZVA 1MORA 5I8ZA 4DW8A 4HN9A 1U5CA 3LNTA 9GPBA 2R7AA 3ZKWB 5KQLA 4ZVLA 4RIFA 1W4RA 4WNYA 5CEJA 4PDLA 4WKNA 1Z83A 1PJZA 1AR4A 4DKJA 1EI9A 2ACWA 4EG6A 1SUIA 1W0CA 1ZWKA 5CB4B 4DLBA 4PZEA 2ZYHA 4AHCA 5REQA 3ZHOA 5IEJA 4YGYA 4HDMA 2VBIA 1BH2A 1JQDA 1Z74A 1T1RA 3EG9A 4NE2A 3I05A 2DX7A 3JY6A 1I2ZA 1B0PA 3KLBA 1U7TA 3CRW1 4JYCA 1WP9A 5KSWB 2FNAA 2R66A 4LFBO 4ZAVA 1H6CA 4OP3A 3CZRA 2XCSB 3WGUA 4IUBS 4NMWA 4J0GA 1Y8ZA 1IFXA 1VXOA 5GV7A 3N6RA 1XZDA 1VMGA 3CCUV 2G04A 1M54A 3GZJA 2XTJA 3V4VB 4JFAA 1MG5A 3EGVA 4PRZA 3GJQA 2NTVA 4J0HA 1FXKA 4LOKA 2O19A 3FNQA 4Q93A 3O83A 5DJ5A 2HFJA 4L76A 2QN3A 7YASA 2OY0A 4G8JA 3WQQA 1VF6A 3KEMA 4QVIA 4PRKA 4L0MA 4FJ2A 7REQB 3RC8A 3Q12A 3MJSA 3W79A 5LPNA 4I1UA 2VL7A 1VSVA 2IP1A 4X8HA 2RCVA 3QKRA 1D2RA 5KHIA 4QYIA 3RS8A 4NXMO 5JFOA 2HGZA 2O0LA 4D9BA 1N8NA 2QKAA 3CM0A 4NBKA 1AT1A 4Z53A 1Z45A 3EXHC 1T9KA 4EPWA 2DBYA 4KE6A 4H1TA 3UOWA 3D4NA 2JDIA 1MJHA 3HYLA 3NHFA 1FPMA 1BL8A 3ABUA 1DBSA 4BGIA 2RGNA 4FZ5A 4RM3A 1U1DA 1NOIA 3CLHA 1FMCA 1H2LA 3ZX6A 1M4UA 1TO6A 5KCMA 1UPTA 4WEQA 4JP1A 3SYLA 3K72B 3UHFA 4MUHA 5DX1A 4K6GA 3KWFA 4DUGA 3SX0A 1N7JA 3M4XA 1I5YA 1BKSB 3D0OA 1VCMA 4A73A 2EWVA 3CYOA 3NWEA 5JDCA 4K3VA 1TADA 4HPWA 4BO4A 3HB0A 1G7CA 3WYFA 5KC8A 2RHMA 3O8OA 1M34E 4LI3X 2F8SA 3DWEX 1N78A 4IVQA 4B48A 1JALA 1WZ2A 1RAAA 1FSFA 1TQHA 4AILC 4JGSA 1Y74A 1N36O 3OT5A 5AVTA 3OR6C 3NHBA 3LCVB 3EDYA 2HKOA 2A67A 4A36A 2DWCA 2J3QA 1WDWB 1EZVH 1Y6ZA 2AUNA 4KHZA 4MZDA 3FDZB 1KI6B 4C1BA 1MOZA 1EFVA 2XVMA 4GGMX 1U0SY 1P7BA 2GFQA 1YIOA 4PA6A 4QREA 2FFHA 5KHHA 5G1NA 4FMDB 1X7HA 4X1KB 1U3CA 4Q3AA 2HADA 5KTOA 5IYZF 1JH9A 4B74A 5KBYA 1IL0A 5DOVA 4G2NA 4MK4A 3D7MA 3B1YA 4OJNA 3ZNPA 1JHDA 5KYGA 1DXQA 5AVYA 1VPDA 4IOKA 1AP6A 3R2NA 1VJCA 5B53A 4F6LA 3M6XA 2G4VA 3RW9A 4XJTA 2VBCA 5B6PA 3RVQA 7ABPA 4KQIA 4WXPA 2ATXA 3IT2A 4YK7A 4TYMA 4IMJB 3IA2A 1P1HA 2B7BA 4YXWG 5BYKA 2PT5A 1XP5A 1S89A 4BFWA 4LYDA 3C1AA 2XRZA 1FFHA 3QPWA 3T1CA 4ZYZA 1EWKA 1KL7A 3H8SA 2DECA 2XMBA 3MM4A 1D9ZA 2QN6A 5LHGA 4NZNA 4DBLE 3I3SR 1RM3A 2IPXA 3CS5A 5K0JA 1NKVA 1RPRA 1JJAA 2JIDA 4AZSA 2QSAA 3KYCB 3GJ3A 5H5NA 4AY5A 1QPGA 2AC2A 1UFVA 3LLVA 4J7UA 3OFNA 3QU2A 3MOIA 1AJEA 4N03A 1KSGA 1M1NA 3CCVV 3HB7A 1YMVA 3ZS9A 4P4SA 2VQSA 1TT5A 1XMPA 5JCJA 4QBHA 2JH8A 5TT1A 1PZHA 1L9XA 2PU5A 3VSCA 3G6BA 1E3EA 3RJZA 1RHUA 5A9SA 2BCCH 3VJMA 4URWR 4TMFA 5B2FA 2QA5A 1SS3A 4B2LA 4H7DA 1EKXA 2QR5A 2AEMA 5AW6A 1K27A 1HLGA 1EVKA 1YSBA 2AEEA 3AR5A 2OG1A 5JWPA 4P4NA 5B3SB 4L15A 2W8BB 2Q4EA 1N2XA 1ZGCA 1QF6A 1IZZA 1Y1TA 3DHEA 2XWQA 3L8ZA 2FI1A 2YY7A 2WU3A 2I2BA 3E58A 5K6TA 3GFRA 4DXDA 2OENG 4C2TA 3I62A 1Q0UA 1AF4A 1CEYA 4MW6A 5JYEA 1WTAA 2AJDA 5D7BA 5AIBA 1YZYA 3W6PA 5I7EA 3HUDA 3INTA 3EFFK 2QRGA 2D7DA 3E8HA 2CK3G 4PGGA 4YGXB 1SCBA 1FFWA 1L4MA 4PSKA 1BN6A 3CRMA 1XRJA 5KSYA 3BFRA 2P91A 1I7QB 2CMGA 3ROMA 5L4SA 2IXEA 2P5UA 4BFYA 1PGOA 4LOJA 3ONDA 2AN1A 1ZVMA 3SD7A 1I2AA 1XEQA 4FB4A 2O5VA 4YRKA 3IMCA 1RLIA 1VKRA 3MIZA 2JRIA 4DCMA 5EMHA 3GAAA 2WIAA 2FW6A 1RI5A 1GA4A 5A9GA 2Y9PB 3K0SA 3WGQA 3IE2A 2XNSA 3QX3A 4UCQA 3G9XA 5IJAA 4F45A 2QBYA 1D5AA 3DF9A 2XNDD 1N25A 3TRKA 1UADA 1HDYA 4UUOA 3OOYA 5CA0B 4ND3A 4REOA 5FPSA 4MMXB 2V9ZA 5KTRA 2WPNA 1R8YA 2X42A 2PV7A 4LBWA 4M0EA 4MWOA 5AM4A 1U8EA 1Z07A 1RAGA 1CUFA 4MROA 4MUXA 2QQ0A 4YYEA 4TV8B 1K2WA 3ET4A 3KVYA 4HS4A 3M1IA 4F8YA 2HPZA 2V6IA 3KEFA 1OBVA 1QHEA 3JV7A 1YQ9A 3AKCA 2V6FA 3BXOA 1Q0RA 3O4GA 2CEAA 2NU9B 1EUZA 5F1KA 1T2NA 1KS2A 1SOUA 1D2GA 2XTNA 4FCTA 1UKCA 3ILVA 4DTCA 2WZBA 5ED0A 1H2SB 4LSWA 1OLUA 2Z4TA 3L74H 4ZWNA 3WGNA 3A3OA 3HKDB 3DXXA 1E58A 1YI1A 2OAEA 1ZYUA 3S99A 1ORHA 1U0JA 2P6NA 2QRHA 1F2TB 4M0MA 5ALPA 1ZJ5A 2QVLA 2GD1O 2X6AA 3BC1A 1WUKS 5DNCA 2VQEB 3ZV4A 1QO0A 3TUJC 4BMYA 4MUBA 3UBTA 3U3ZA 3IQZA 5JNLA 2JLCA 5BSKA 5GAJA 1UBRS 3T0IA 3NVAA 2QUAA 5LDGA 1PV4A 5CB4F 4JYZA 4RKEA 4ZCTA 3R3SA 2V7UA 4MCJA 3TCKA 4MTOA 1LBQA 5U4QA 4BO7A 3GPBA 2WPDD 4MR7A 2ZIXB 5EVCA 4O8YB 2MSLA 4R51A 3X1MA 1VRWA 2ZUSA 5DKFA 1SB9A 5L3QB 3HZRA 3ZV7A 3I12A 4MCHA 4LBVA 2VDOB 4YJ3B 4EJ2A 4GXRA 3H0CA 1DLIA 5J2UA 4HQKA 1S9HA 1DF4A 2M7WA 3HHEA 2PKYX 4NCKA 2O8EA 5CT9A 3MAJA 3KE9A 4B3RO 2QNIA 5KYXB 2GMWA 2VP3A 4Y1RA 4OIMA 4QYWA 4HH1A 1Z0FA 4GMHA 2XQGA 2Y4OA 2CB9A 2JBAA 3R20A 3ANSA 5B1AB 3LRPA 4HI0E 4XLTA 4EECA 1ZHOA 1RRKA 3ZV6A 4IFIA 4X65B 1JKMA 4PFKA 4TMXA 1DEOA 3TCUA 5AI4A 2VSOA 4PA9A 4QQFA 1I2CA 3H6KA 2EP7A 2ALJA 4KDRA 5CXSA 1E6KA 1PAUA 1TFRA 2YICA 1FMJA 4Z9FA 1CZKA 2BBSA 4HPJB 3GOQA 3PI7A 1KMHA 3TQCA 1QRSA 5KC9A 4RQFA 4X90A 5JZOA 4BTLA 4K6CA 4P2ZA 3KM0A 4HC4A 1ZC3A 4TUYB 2EBHX 1FX0B 3GJ0A 4R9VA 3I28A 4NFHA 4AG5A 2HBRA 1H94A 5BT8A 4CMGA 1NGSA 3EX8A 2BP7A 4W7SA 2EATA 3D8BA 1AKQA 5KZMB 3HACA 4MYUA 3KYDA 2XCRB 3DKPA 4ZREA 1BCRB 4ETWA 1ZIYA 4WNIA 4Z86A 1CEZA 1HL7A 3P2YA 3IAUA 4DDWA 5ENVA 1XD9A 4Q05A 4MQEB 2IHUA 4WFBV 1BO6A 1LFAA 3PGA1 3KOUA 2LDXA 2XBMA 3ZBTA 1M7GA 2F6RA 2CE2X 5IJXA 3Q9SA 3NHPA 4MR9B 3EJWA 4LQDA 1GITA 1HC7A 4B71A 5KPDA 4B34A 4MDEA 3OU7A 3B6EA 1TM7E 3WP1B 4N7BA 3AFHA 4NLLA 3ZHXA 3WTBA 5DNUA 3NAZA 2PIAA 4IEEA 1R3LC 3D3EA 2QWPB 3NQ41 1OH8A 1CRZA 1BYIA 3RYIA 4XASA 3M7IA 1Z7YA 3FLBA 4O4HF 5BQFA 3TTTA 4ZKIA 3FI9A 4RDCA 5LIPA 4KFUA 1VC2A 2ERXA 4J0JA 1DAKA 4RFSB 3ABZA 1E1LA 2ORVA 4R3NA 2ETNA 4PC7A 5LQMA 3EGEA 4JLMA 3HSKA 5I6DA 1JLHA 5ARBA 1L5HB 4CLOB 1QHHA 1UAYA 4BC0A 1I3KA 4UHFA 4C07A 2FOLA 2V97A 4OHBA 5DNWA 1AM4D 2JF0A 2WTMA 3I5XA 4OPHA 1KE2A 1FTYA 5F78A 1RHJA 4EM6A 1G291 3SC6A 1T36A 1INLA 3K0BA 4DV5B 3EGXB 1T3TA 4WJLA 5AJXA 4UUMA 2JI8A 3J81k 3EGWA 4LJ5A 5JROA 3K0CA 1C0PA 4DSNA 5F4BA 3ASNB 1J22A 2GEVA 2CLIB 4P4TA 1AQIA 2F9FA 4YROA 3TNLA 2YXDA 3UJ3X 2Z8YA 1XLUA 3BAFA 3WGHA 1MX9A 1XKQA 1PVOA 1N0WA 4MV5A 1LBHA 2PTMA 3GF4A 1TAHA 3DGEC 3AEQA 4QPPA 1O4VA 2CCKA 3PGJA 3WWYA 4UUJC 2I7CA 3WLOA 16PKA 3NONA 3ETNA 5T41A 2A9JA 4EITA 4ZOLF 5LLTA 3ABKC 1DCKA 2IPLA 3DDSA 1QR6A 4UUPA 4WAUA 4UCWA 1E1RD 1XWIA 4FGKA 1P2BA 5CLGA 2VQFB 4Q12A 1PG0A 2FW7A 5DV9A 4S1WA 3HY6A 4HG2A 2QZJA 4DQKA 4ZJUA 1YV9A 4Y30A 4ZEOA 4W7HA 1NZDA 4JV5B 2HVKC 3K3WA 2W2LD 1JI3A 4RD4A 3PFGA 4JBIA 4ZMSA 3AETB 3JYCA 2D30A 4R1QA 4QPNA 1PCXA 4R6XA 5F4ZA 2JFXA 1N2SA 2G5CA 3E18A 2FWRA 2XT6A 4MYCA 1PFGA 1XD2B 2OD2A 3SCZA 3DUFA 3PC4A 2VJYA 4ZO4A 5K0ZA 1U0FA 2ZT9B 1GGMA 1P4AA 2GZAA 3S2IA 4YRPA 3UWKA 3EY9A 1PUJA 4R2IA 4CIWA 2Y1EA 2QVCA 1OASA 2XNJA 3BXPA 1CRPA 4QTUB 2C2ZA 1UJ5A 2V8BA 4Z8XA 5LQKA 1L7PA 1BJKA 3TWOA 1F38A 1A5BB 3UOGA 1DVRA 1SY7A 5DBEX 3PFFA 4DQ0A 2H92A 2ECKA 4J7JA 1WA5A 1VQ9V 1AK9A 3OKPA 1Z13A 1D5CA 2XD9A 1Q86W 2OOKA 3DAFA 4GRAA 4Z0TA 2BUCA 3P0JA 3HK2A 3QBTA 3EEQA 2BMAA 3STHA 3ZBUA 4B6RA 1Y8CA 3OMNB 2YZ7A 1OCZB 1MC1A 2DPHA 3E70C 3OZUA 3Q7EA 4OHUA 4G63A 3JVDA 1P45A 4O2BB 1QQTA 1SCDA 3DLBA 2ISCA 1S2IA 4I6GA 4UDOA 3QKSB 5CA0F 2HKIA 1Z6AA 1NBIA 3N87A 4DBLC 3ZQKA 4AG3A 4DYDA 1XELA 2IXGA 4QU8A 3O92A 1B8VA 2R0QC 4R6WA 4RK7A 2NO1A 2E87A 5HOQA 4L27A 3DD1A 2E4XA 3WNVA 1UQRA 2WOJA 3IAS6 3FDJA 4X54A 1EGHA 2HPHA 3HFJA 5FX2A 5IY5B 2NZYA 4LCUC 1EA5A 4WW0A 2B0JA 4R8VA 4ZYLA 1NF8A 1KZ1A 3CURA 2BM0A 4AJLA 1HR0B 1J0EA 2GN0A 1Q3TA 2QE6A 3OWOA 4U00A 5CVUA 3H9UA 4H16A 2R3SA 3T3IA 2WUDA 2E55A 1E7MA 4WY5A 4NFYA 3F7YC 3VKWA 3DKVA 3HNRA 2P4EA 3QX7A 1U0RA 4UFZA 4NNPA 1VA4A 4RNDB 4HL6A 3G71V 1QG4A 1LZKA 4F84A 1GZ6A 2IJIA 1SFRA 4R1SA 3ZY4A 2BE3A 2Z9CA 5IT9N 2H54A 2P30A 1ZONA 3SQDA 1JG4A 1DWPA 1OFTA 2EJTA 3U7GA 3CYFA 4UC0A 1CLUA 2ANCA 2X7HA 5TS2A 1OC4A 3ESRA 5CVEA 4WK4B 2Q3MA 4UFNA 3OZGA 5JPDA 2JHPA 4MR8B 4O1HA 3WFVA 1PZMA 4C7MA 3E3MA 4R0VA 2DH5A 4ZQGA 4YJ3F 4OYLA 4JX8A 1WXXA 2YHAA 2JGUA 4E09A 1MQ8B 4E14A 1RYNA 3G2IA 5L9AA 2OCLA 1TM4E 5JALA 1JQ3A 4I9NA 1YB6A 2JZNA 3M7MX 2QE7A 1FTGA 2YIMA 1C30A 2P67A 4HKTA 3R77A 1KI9A 2Z2ZA 2Q5JA 2B8TA 5IWAB 2OSVA 4HFJA 5BO5A 2DBQA 3SFVA 4QFCA 3DBRB 1V1JA 4XX1A 2IEYA 3HUEA 2VJMA 2IXDA 1J9GA 2C7PA 3IAS1 1ZRNA 4MVSA 3PD0A 2VT2A 2HMSA 3QLVC 1K63A 3U7QB 4LC1A 4L3OA 4IDGA 1YWGO 2JLXA 2CH7B 2GEKA 1H69A 4KV7A 2JANA 3CONA 2QQEA 2G84A 4R68A 1G3QA 5AJHA 3QH4A 4C76A 3CZ9A 4I9QA 1VHWA 2R7MA 4G5GA 5B12A 4TV9F 3A28A 4HAUA 1UOEA 4DVJA 1WV0A 2O0KA 1JEJA 1P3JA 4ZI3A 2GN4A 2JFHA 3DVLA 5ETJA 2FPUA 3RIXA 1S4MA 3B3AA 3EJ6A 4J07A 2HJ9A 4JLSA 3H8WA 3BTSA 1WEKA 2DZDA 2XR1A 4D9HA 4XDKA 2DSNA 4HGZA 3V4FA 4HDNB 3ZJTA 5FPHA 1UFOA 3LTEA 4KFMA 4EAQA 2BMVA 3K0AA 2EHJA 3VZRA 4AKHA 1WETA 1QF7A 2FFJA 2W22A 1NS1A 2UXCO 1YUMA 2FUEA 1LPSA 1M1UA 2YHIB 1CEEA 1IY8A 4HY3A 3S1AA 1IOZA 1TEZA 3PZBA 2HDNB 2WC1A 4Q4CA 4R0NA 3BVOA 1GYPA 3LUCA 4ZRDA 1J8FA 3GEIA 4KYTA 2Q69A 3MD9A 4BFTA 4C87A 2BLLA 1DTSA 4CM4A 3CCMV 5I8WA 2NXJA 3U6KA 3RIGA 3RAGA 1QR9A 3F73A 3BWMA 2I54A 1EFPA 3HA7A 5G4KA 2CYCA 5A2GA 1Z4JA 4XFKA 3WNZA 4C30A 1WV1A 1Z0ZA 1EK1A 3EZ9A 4QM7A 1Z39A 1KR2A 2PKQO 3WGKA 4OX9O 3OZEA 1ZD5A 3II6X 1Q16A 3U60B 2VF4X 4UTOA 3U0VA 1QVWA 1ZUQA 2DULA 4R1MA 4KWEA 1I2MA 1LH0A 4P5EA 3FOCA 4ND5A 2W8ZA 2NUAB 2R7NA 1I1NA 4B4UA 2QZPA 2O8DB 3UWMA 1LRKA 3TZEA 4EI7A 1M6VA 3OZIA 2XUQA 2RJ3A 1JP7A 1ZOIA 5EKDA 4OA8A 4AY2A 2FPIA 3L7LA 1YA6A 2VYND 2A6PA 4KGZA 3S7TA 5KNBD 2JJ1A 4W1SA 1GKKA 1WXFA 2PQ2A 4QTZA 3SYMA 4HZUB 3QTCA 3QW4B 2AZ2A 1RWVA 3GUVA 5T8KA 3DEYX 4HHEA 5CM9C 2EZUA 2W5UA 3H05A 1GCAA 3EWIA 4BWVA 4M7PA 1NRJB 1QHFA 4RO2A 4UMVA 3KCXA 3MN1A 3NWJA 2UZ0A 1Z5WA 4X62B 4AECA 5FQOA 2IL1A 3FOEC 3T9DA 3HPRA 4RGBA 2HF2A 4F4CA 2QAIA 3T7EA 4DC0A 5D87A 1EGAA 1U97A 1EVZA 1KC3A 2JAXA 2ZSAA 1H0HA 2IE8A 3U7IA 4BV9A 4MV6A 2O5RA 1TF2A 3PDUA 3OX4A 1VL5A 3KEQA 4PLGA 1WWRA 4H3KB 4ZI7F 3NHMA 2FYUH 3RV3A 1OCRB 4MKXA 4KCGA 4QXPA 3VNBA 2YN4A 3NMUF 3HCPA 2EXXA 4QPDA 1V1RA 4C7OA 4IVNA 1M5UA 5EXEA 2R751 5JH7A 3PP8A 1XZJA 3T7TA 1X77A 3UWPA 1L5MA 1WMBA 2E7ZA 3K5HA 1L8DA 4D26A 2VCEA 3OT7A 4B3HA 5EPUA 2X8JB 1K4MA 3WK4A 4BNKA 3U7RA 4BB0A 3Q3IA 3H1EA 4DOMA 1SZPA 1JNYA 2JI9A 3GX1A 1Q6YA 3E22A 4JOCA 2DKNA 1J5EO 4R05A 3R5HA 3TLJA 1V8FA 4RA6B 4JLNA 3FFAA 5BW5A 2IEBA 3MQFA 1I3NA 1FY2A 5LQCA 4CG0A 2PMDA 4V38A 1ST2A 3E9DA 2ZM6O 2O2SA 3ETEA 3OY2A 4NEGA 2PGGA 1D0IA 2R25B 4PLTA 2KB0A 3PXBA 5BQ3A 4OG2A 3ZW9A 4ZAXA 5LYJB 5HXAA 3ZGNA 2HYIC 4IILA 2VNKA 4IKEA 1UAGA 3S0JA 5JXGA 2HMYB 3I58A 4DV0O 3F98A 1W0KA 3RYHA 3LU1A 1QVVA 4YDRA 2DBRA 4BATA 3D5QA 5L8VA 3WXBA 2Y93A 1Q1NA 4U2DA 4A1OA 3UW1A 2CL6X 3CBQA 1BKDR 5T64A 4MMZB 4LJYA 3FSGD 4KN9S 1W4LA 4ADSG 4GKVA 1ZUD1 1Q0HA 3E3LA 3Q7IA 3I2HA 2FH5B 2OVFA 4HWPA 1Z4QA 1JYSA 2OM6A 1WWKA 1DB3A 2RAFA 2WSBA 4F7WA 5JEEA 4HDAA 4EWLA 1ZH8A 3IQIX 1U98A 3JZDA 1TB4A 5A03A 3H2ZA 4Q03A 3FN4A 3H7IA 4EYOA 1MB4A 1TVMA 2BFBA 1XLTC 2JFWA 1QZXA 1ZL8B 3IILA 2UVPA 2FVXA 4IVRA 3W4KA 2VQ3A 1L0NH 5FBWB 2IBSA 1OXUA 1KKMA 3PRHA 1TF7A 1NJ2A 1HNZO 3OTGA 1UPGA 4ONEA 4XGQA 1UCFA 2YV5A 2EJ7A 2FFBA 3T7DA 4MA0A 2EGHA 1QIHA 3JU3A 1DELA 5HRUA 2JZCA 1X80B 4Z1VA 1QUEA 3OKFA 3M6MD 4F3YA 2AC7A 2FSPA 1QUFA 1UPAA 3AG7A 3OJCA 1OZAA 4NBRA 1E7SA 1ZL0A 1CZOA 1YULA 4JVLA 4PDVA 3TEFA 3VU1A 2FUCA 2XKKA 3GL9A 4X85A 3KQSA 5HK9A 5F64A 3Q3EA 1T5HX 4EAAA 2R47A 3KOWA 1RP1A 1M0EA 2ZZKA 3UK6A 2IQIA 1BWQA 2ZBFA 1ZM3A 4ZRMA 3LT2A 4GZ5A 1DMRA 4V0RA 5K3FA 1GFIA 1XT6A 5ISMA 1MW8X 1PJSA 1F5SA 4TLDA 5ENDA 5B3LA 3H5OA 2VSNA 1EUYA 1GPYA 3LY5A 5DYIA 3QLUC 4PG6A 4J1QA 5EWMA 1Z17A 3GY0A 4UNIA 3VSEA 1U4SA 1WPXA 1E1QD 3JQFA 3FRJA 3PWKA 4FK8A 2RCYA 4Z3OA 2TYSB 3IBSA 4EZIA 1TRKA 2FUNB 2LZ0A 2OIGA 2HHAA 2O4CA 2QZSA 3RWBA 4CG2A 2GERA 2VWKA 3LX6A 1AGPA 1RRPA 3KE8A 2YZNA 2A79B 4PZZA 1DBWA 3WVNA 4IHQA 1P6UA 1ZCAA 2HGSA 3AV0B 4E4EA 2X58A 2HBYA 3RVRA 3B3QA 4DMMA 3QG1A 4UE3S 1UEXC 2GBPA 1JV2B 2ASEA 2AOVA 5BNZA 1FUYB 2AJBA 2LTAA 2R8XA 4PIVA 5H9WA 3QSGA 2C5FA 3T3MB 4OQDA 2RKOA 1SBCA 5IANA 3RUFA 3DLTA 4HDRB 4CODB 2UXNA 1BCSA 2H4XA 5DI3A 3JYHA 2HK8A 2DC1A 5KYNA 1FDWA 2C3MA 2O0MA 3P9RA 4AXXA 1L5QA 3TVDA 1EXWA 3K9HA 2ZUWA 5LGUA 3N59A 5BNFA 3ETJA 3BXHA 4RPCA 5TX7A 4HNVA 1KMQA 1M57B 3RFFA 2JJ2D 2J3IA 3DXFA 2IVZA 4IWXA 4MA5A 1XCJA 1T5EA 1M0WA 2Y9MB 1B8UA 3DEKA 2H18A 2HJDA 2AEJA 4B84A 1XMXA 4YRCA 4C2BA 1E96A 5I7WA 4YECA 4NYJQ 3FZEA 3OQ6A 1AUPA 5ADWA 2P0AA 3AG3C 2WSIA 1OVGA 3L0PA 5CBGA 3A4IA 1JIIA 1K75A 5TE9A 3TINA 2UUAB 5HFAA 4LQ4A 4RHXA 1G8SA 2EYQA 3TKLA 3K1ZA 2IKSA 3UK0A 1GK9A 5JD3A 2ZWOA 2D2EA 1D1QA 3PVSA 5EA2A 1Q92A 1AZWA 1M2NA 4WE3A 2YFYA 7GPBA 3ENVA 2RKWA 3MLBA 4BYMA 1G5TA 1HDRA 1R6UA 3E89A 5BSEA 4ZGGA 2I3ZA 3OQBA 3GCZA 3HU2A 4LF7O 1YC5A 3NOOA 3B5JA 1U7XA 2XASA 1EEHA 5EWLB 1H2KA 2BKLA 4EJSB 1WCYA 1QBZA 1GZSA 5H4HA 5JXWA 2XNDG 3F6CA 4PRYA 2RPZA 2XUKA 1BROA 3FUXA 4J4BA 1JLRA 4MPDA 2DQSA 3L7OA 1VTKA 3ONNA 5IF3A 5IYZB 1C2YA 3USES 3RVJA 1YJBA 4PX3A 2XGMA 4HH3C 2CHGA 5BYJA 5K8TA 2Q28A 1J2EA 2XHBA 4TQDA 4ND1A 3B9QA 4WZBA 4X9XA 3EPHA 4FDVA 1E2KA 2QUZA 3JYLA 3LT1A 3PHHA 2CFCA 3C5EA 1GXSB 3P2KA 4LDPA 1T8PA 2RMKA 4DIFA 1B6RA 3JATA 3RUAA 4NS4A 2P9FA 3LUBA 4R83A 5HZKA 1T9HA 5T4HA 2AOTA 1S8OA 3AUFA 1V54B 3G68A 3ZN1A 2PGAA 3VR0A 1XMQO 5LL6Y 4IQFA 5I7UA 4PG8A 4BX8A 2GK7A 4C0JA 1T3ZA 3HKEA 4N3CA 2H2IA 1E3IA 3GFGA 2JGEA 4GRDA 1SUDA 1EWVA 3TNFA 1RM1B 5C1PA 3TIIA 3U7EB 2C2WA 2EZ8A 3OQIA 4EZEA 2N05A 3QUCA 3PC6A 2WPDG 2W6CX 3WYCA 1V96A 4UU0A 2PZEA 4QSHA 3WRVA 3M6WA 1CG6A 5D01A 1JJOA 4LZNA 1M2OA 3PTLA 3C3SA 3TVYA 3WNCA 5IHXA 1KYTA 3TOZA 2CUZA 4BLPA 3H87A 1PW7A 2WB4A 3M6IA 2O0JA 1K68A 3NHWA 1YASA 3WLTA 2R86A 4YREA 2K5UA 5ITZB 1ZG3A 2Q3DA 4XWYA 3W3AA 2ZCEA 1JA9A 3UATA 5ALIA 3VBEA 3ZPXA 5F3RA 3DC6A 3VYWA 4MSWC 1CZLA 1Y7HA 4L28A 3QE0A 5CH3A 1QOQB 5B5SA 3KSRA 4YBZA 4CCYA 4RQEA 4TROA 1I4EB 3K73O 1H2WA 1A71A 3PIRA 1SXPA 2L17A 4HNQA 1ZCFA 2DM6A 2D7JA 1KZGB 3ZMVA 5DLPA 4RL6A 2H4FA 4S0XA 5DM60 4NCJA 1CQIA 4X1YA 1SOAA 2ZIEA 4EHLA 2Q50A 4JCCA 4IDOA 3ZHTA 4IMRA 2CXRA 5ITSA 2PGLA 3ICWA 5E3JA 1ZW6A 4RYLA 1UJMA 4I55A 1MNGA 2IYSA 5EBMC 1VJ0A 5HGJA 4QARA 3DT6A 1K7XB 5DNAA 3IJ4A 1K7EB 3F5WC 1E0JA 4QPJC 5LYJF 2MSKA 1NXXA 3O73A 4FI3C 1PKXA 4IOMA 1D2MA 3GA7A 5GAOA 1KH3A 1GR1A 1XIVA 3AK2A 4FUQA 4EBFA 4IH1A 3RS5A 3VUFA 4NQZA 4NBNA 1Q57A 4PLYA 4EL5A 3NWBA 5TPWA 1JEQA 4BNLA 3IXLA 1U96A 1X87A 1EFAA 4CLEA 2IRWA 1WXDA 3BRSA 1MHTA 2X0DA 2WHQA 2J4FA 2PD3A 3HPQA 1VLHA 4LRXA 3GAZA 1YZFA 4JFRA 1ND6A 3NC4A 2VUIB 5H3HA 3CH4B 4EKNB 2AMVA 4JAVA 2BJVA 4G26A 2MYTA 2C00A 1G2IA 4LRQA 3OA2A 4AS1A 1X6VA 5L7YA 1KIMA 1XTRA 3QUTA 5M29A 2GN1A 3K5NA 3ZGXA 1FJGO 2PTGA 5AVKA 2SCUB 2ZKOA 3OT4A 3FBGA 2Q68A 4GI1A 4QGPA 5K8CA 2VT7A 1H2GA 1VFNA 1NKSA 1V11B 5CDSA 3H1FA 3OM9A 3S70A 3B9RA 3IXQA 2PFKA 3LDAA 3TX2A 1R5JA 4NS1A 2NNWB 3HJNA 4POOA 5DBHX 4ZRNA 2FZEA 5E8JA 1CUIA 4LRYA 3ESZA 1YR2A 1H9AA 1QR8A 3KJFA 5HQ3B 4E11A 3WQHA 2PRSA 2V7EA 1IN5A 1A9ZA 1ZK3A 3COSA 3B1ZA 4HWSA 1PPJH 4CEJB 1T1GA 4UVGA 5IULC 3O65A 4NU8X 2CDYA 1GGEA 5EXPA 3BTVA 4CDGA 3Q11A 4IEIA 1X7GA 1EP3B 5ICGA 3S55A 1A9PA 3AXSA 2R8RA 1E9EA 4MDFA 5C34B 1C9DB 4GPD1 4BGDA 2EWMA 5EZ6B 2FPKA 5E2AA 1WU8A 1RLTA 1JSZA 2DPGA 2A14A 3BZUA 2ZD9A 4BIMA 3G79A 4JB2A 3HU3A 4BV8A 4M9SA 4HAZA 4JHLA 4KG7A 1XK7A 3ZLVA 3WYNA 1E1RG 3MVEA 1A0OA 3PUWA 4A9AA 2EX3A 2DWQA 2TS1A 2JRCA 4TMVA 1U3UA 4NARA 5LHIA 2C8LA 4E08A 2AH5A 5FI0B 3UPDA 1BDHA 3AESA 1R0WA 1E94E 2NTYC 4P08A 1JX9A 2XQIA 1KQNA 1F8FA 4JNCA 4E7OA 4RTSA 3TOVA 5ARDA 3KU1A 1JKJA 3LGXA 4QVKA 3IAFA 3B9BA 4GXQA 1KTVA 3TGWA 2OL4A 2H1FA 1Q11A 2OAP1 2BM1A 4D4IA 2F1IA 5FV7A 1BE6A 1JXOA 2ZRCA 3FJOA 5EJ8A 4BFSA 2Q99A 5J47A 4JROA 3WY9A 3C8MA 4KJZA 2PLWA 3HDJA 3LBAA 3CR3C 1KQFA 4UNSA 1C3XA 1A2OA 2XAGA 2QT1A 4L73A 5LJLA 2DJ5A 1PZGA 4QUGA 3BMQB 3GNQA 3E86A 1MXFA 2WJZB 2ZUEA 3UAWA 3HFGA 3PNBA 1ISMA 2J9FA 2H0QA 2J3EA 4A4DA 3I1YA 3VC7A 5JAQA 4JOSA 3EGOA 1JQKA 4XX0A 4O4HB 2QRNA 1OR8A 1OVMA 3GGOA 2HJGA 2JNWA 4HWGA 1QYIA 2FPMA 1R5BA 3RUIA 2QVXX 4YHBA 4B44A 4V02A 2H8GA 2GTHA 4CH3A 3T5GA 4LWSA 1NLFA 1WZIA 4ARVA 1L4EA 4P98A 3MUFA 5HQTA 1DDIA 5LBTA 1HI9A 3QOFA 4C0XA 4L51A 4GDFA 1Q0LA 4GR5A 2VK4A 3N7TA 4BGUA 4D6XA 3SIRA 3KQTA 2ATVA 3G8BA 4YJDA 3FZQA 1PFYA 3RAFC 4TL7A 3RG8A 1DRUA 2Z08A 1L7AA 4GD3Q 2LD4A 1MB9A 2PZ8A 4TXHA 4BASA 2YJ5A 1U8AA 4ZIRB 4UJ3A 4FJ1A 4C0AC 5DHQA 1C3OB 3K03A 1V1MA 3B5EA 3PT5A 4RJTA 4ZBMA 2G6TA 1TLTA 1UT6A 3EXFB 2GRJA 4DA6A 3OKAA 3CE9A 2Y1WA 2VZ8A 3TZCA 3KKLA 4X62O 1TK9A 2JAQA 3DMYA 4QGGA 4DMHA 3VNSA 2P2YA 2P2CA 4KIWA 2IP2A 4Y2GA 3REOA 4GWKA 1NJFA 4BV2A 2I1WA 4UM7A 1NOJA 1TAEA 4F72A 1MABA 4ZOLB 1MZEA 2RHJA 2KG7A 1UWZA 3BXGA 3L6UA 3ZHQA 1B14A 2EIKB 1E9AA 4FOOA 3U4GA 3DMPA 3KU4A 4MS3B 1ACLA 5A4AA 5HNKA 1G5FA 2DQ3A 2YINC 1OGJA 2QRKA 3DR5A 5EZ5A 3KJHA 4E07A 3C3XA 3OUFA 1CU1A 5L3BA 4AJOA 2EJRA 2W0MA 4PLCA 4FD2A 3C85A 1V5FA 3RABA 3D02A 2CKMA 5FOUA 2JEZA 3KKZA 4M53A 1EHYA 2HMUA 4RHFA 2GSDA 1IXRC 1O9GA 5CA3A 3LWDA 3ZDBA 1WB6A 4Q9KA 4LA4A 1SU7A 3W1VA 1CIVA 1QK4A 2D5CA 1SCQA 3DPSA 2UDPA 2OYCA 4JENA 3UH0A 5AKGA 2OCCB 2VQ6A 3N8IA 2Y0PA 1O87A 4GZLA 4ECEA 1ZISA 3ER9A 1ABFA 2IUYA 3FPKA 2O1WA 3FKSA 2CNNA 1E2UA 2ZIMA 2H94A 4GP6A 5AYVA 2NTJA 1ZINA 3AY7A 3QFHA 2KYRA 4CL2A 4BNFA 2E4UA 2X2OA 4NFSA 4P3KA 3OBBA 4LPKA 3DCJA 1AGNA 4HB2A 1XNJA 1FVHA 1HNXB 2NR5A 3IUEA 2EFEB 4S0ZA 2VDVE 3JQRA 1K2VN 3HR4A 4PHTA 1OU0A 3QEMB 5B1SA 4B3SB 1HE1C 4TTPA 1MO2A 4UBIA 1GO3F 1R6TA 1NTOA 1YVEI 2GUGA 2PZBA 3RKSA 4EYGA 3KALA 4LVOA 2NO4A 2QMZA 3B8HA 3ZOKA 3I3OA 3RS2A 4C89A 1NN1A 4AO6A 1SPBS 2X77A 4OQLA 2YCBA 1TEXA 2BUBA 4Q1FA 1OKKD 2AMJA 4JLBA 3N75A 4TYYA 2EZ4A 1XU4A 1AS3A 2OP0A 3R8CA 1UKVY 1YSDA 4WBNF 5KJ6A 3LLSA 1Q7TA 4YMVA 1T9GR 3GWGA 3A1FA 4LF9B 1CUYA 2AG6A 2W6IA 1NPYA 3VDNB 3GP8A 1MZFA 1BHO1 2X14A 5A4MS 3UM7A 4DR3B 3EC2A 2ZIGA 2QVZX 3DDUA 3VYRB 3F78A 2VPXA 3AFGA 1BZKA 3DDZX 5KYWA 3K6SB 2N0SA 1U1EA 1B74A 1II8A 2POCA 2VC2B 2Y4UA 1BCCH 2GESA 3O7WA 1A4XA 3NM5A 3ZGZA 2I3GA 2WE7A 3AY6A 4I0WB 1GLVA 3DE4X 4CW7A 2QW1A 2DGDA 4PRLA 4B7ZA 5DPMA 1TKBA 3NKLA 3UK7A 4PYIA 2WYVA 1C9YA 1YMUA 3T9BA 3KWJA 2X9VA 2ZWPA 1AC5A 3F8TA 4Q6GA 4WKOA 2FTKE 5CRIA 4OGQB 1ZESA 5JCOC 3L70H 5I51A 1IN8A 5C2JB 4D57A 4H0NA 1KDOA 2QG4A 3L9XA 5FUXA 3EG9B 1R6KA 5TNXA 2XADA 2PUGA 2NU8A 1N2JA 1B04A 4BMOB 4U9UA 3A25A 1RJDA 2ATCA 2AFHA 3ZHRA 5IUKC 1WOYA 1VBNA 2Q3LA 5AXBA 4CDNA 2H4JA 1R6VA 5LMNO 5ALNA 3KD2A 3EPLA 1QHNA 1ZS9A 1I5OA 2ZATA 1KQPA 1QHTA 4N82A 4CYMA 5BR8B 4MRNA 4QDKA 3ANYB 3AERB 1D4AA 4NV0A 3CE2A 2I7TA 1CFJA 1NPDA 4PAGA 3UT0A 4V2UA 3F7TA 4D8WA 1KSJA 4ABMA 4ESHA 3HZOA 1GN8A 4C7JA 3EUFA 3CVWA 5EIAA 4ZV4A 1F1JA 4I8DA 1I9CA 4RIEA 5KHOC 4OXQA 1TUEB 4CCWA 3PHIA 5GOZA 1T1JA 4NIMA 3WE7A 4TV9B 2B1QA 3A4VA 4RE6A 3I45A 3V9AA 4KQGA 4G28B 1MV8A 4EKYA 4AKEA 2LQTA 1B6QA 2UV8A 3AUAA 1RYMA 5AHKA 5TMBA 3KKOA 4HXGA 2FPLA 5H82A 4L72A 5AK0A 1E9CA 4WLEA 3WQRA 1AJQA 1F8XA 4EFNA 3OETA 3KOMA 2WSSA 2WV7A 5JBIA 1FRNA 1L8OA 4ED9A 5JDIA 1GN9A 1YBMA 3SBEA 1H2XA 2BTQB 2NADA 3HRIA 1JHRA 4PQFA 5IKMA 3ZE7A 4IBOA 2JI7A 5EL0A 3EVKA 1BGVA 2QORA 4DSUA 3MWDA 3UF0A 1WB9A 1YI0A 4N8SA 4LMAA 2DYRB 1WE2A 1GHTA 3MQ2A 2WNIA 2P9BA 4BZZA 2DPMA 5EWJA 3CIFA 1KEVA 3G2JA 1EN5A 3OG9A 4DQUA 2ADFA 4BWAA 1PBTA 1TLLA 1EJ2A 4R2KA 2EQ5A 5DO9A 1JE0A 3QJYA 2EC5A 3RYTC 4V03A 4ND8B 3CCRV 4GEGA 2QV7A 2OT5A 3LSUA 1JEEA 3CN7A 2M1XA 1GPMA 1X7ZA 4XB6B 1C7RA 4AMYA 4BUZA 3Q87B 1N4DA 4PW0A 3ZMSA 2CLKB 4GUAA 1NAHA 4LGMA 1E0SA 2HU5A 4YAUA 3MCTA 1MSDA 1V5EA 1LJUA 1QQ6A 1KEEA 5DHTA 5JANA 2PU7A 2X5XA 2ZITA 4UCTA 2C84A 5CDFA 2ZS9A 3AEYA 1WRBA 2NTNA 4E2YA 5L7WA 1Y74B 1CJSA 4JYAB 2QRLA 4NAUA 2AN3A 3UJHA 4WASA 3A6GA 3KHUA 2V7WA 2PZLA 2ZYGA 4CBCA 4ENQA 1VDMA 1C3JA 5EN4A 4A1FA 3SVLA 3R9XA 3TD2A 1NFFA 3ESCA 1QE3A 2CZCA 1I2BA 1PV0A 4IKOA 1JKXA 4Q1EA 5FUBA 2RGGA 3PLAE 4QOHA 2CTPA 2HV9A 1IB6A 1M83A 1YDGA 3FETA 5LC1A 4XSHA 4J6FA 3PFKA 5HFMA 2W7TA 3L4JA 3BA8A 2WD7A 4XVCA 1YKSA 4D5EA 2CJPA 2LCIA 1YCGA 5C7IO 3CS3A 2C97A 4IP0A 3TL6A 2JFGA 3QVOA 1HG0A 1IUPA 3RRFA 3BGWA 3QKUA 2FZGA 5BV8A 2XOKD 3I52A 1YXMA 4W1QA 1TQDA 3ED5A 2ZAOA 4DSTA 3QOXA 3WYAA 2XODA 4G85A 3BSYA 2GPYA 4BX2A 3ON5A 1Z2PX 3FLMA 3FYUA 4HATA 4V0QA 2QSZA 5LB2A 3B8FA 4I4TB 3M3DA 3TAUA 5CFQA 3B6MA 5EBLC 3DMHA 4ZI7B 5BSHA 5EJMA 4PYKA 5JYBA 4EYQA 4D02A 3ER8A 3RREA 3MMPA 4FHZA 1ESNA 1LLQA 3ZS8A 3EIEA 4DC1A 4EY8A 2FSGA 2RSLA 1Z0DA 4U7JA 4HNHA 1P4RA 2YHUA 3VQXA 3RVMA 4GX5A 4EH1A 1PL7A 2P2GA 2P2LA 1E1QG 3Q15C 4P9DA 1GZ5A 2QWXA 3HFRA 3L4BA 2PIDA 1EWYA 2WTBA 3RIHA 3PTAA 2M32A 5JMTA 3IHKA 4IJQA 5A4KA 5HWSA 2C2MA 1URPA 1ZK2A 4PYRA 1QE0A 5A9SB 4RTMA 1GFZA 2OMEA 3MXTA 1XWFA 4J4TA 1X1RA 4L08A 1U9JA 1E1MA 2PQMA 4V0ME 3HWRA 3TLKA 4EGFA 1RE0A 2HHHB 2FR8C 2JD0A 1MZPA 1OSNA 1TVEA 2W98A 4D43A 4WY2A 2QXTA 4AZ0A 3LC1O 1WUHS 4W4LA 1M33A 3CC8A 5FV4A 3ZWXA 3NT5A 4U8HA 3EASA 2W2XA 3LO8A 1QGAA 4BJHB 4Z7QB 4JSTA 1OWNA 4DT1A 2W6JA 5EEGA 1ZI6A 2HDOA 2JFOA 3L79A 1U0LA 1DLBA 5E6SA 4YIOA 4QJFB 4L5JA 1R3KC 1TK3A 5H3LA 1YRAA 1P0QA 1K6MA 4MQFB 3RT9A 1R9JA 2ZR8A 2UUCO 1SG6A 1CPYA 2JJ2G 1ZNQO 2NPFA 3SVZA 1EBFA 1E1CA 1PJRA 2XUAA 3NTQA 3GPIA 3ABIA 3E15A 1KBZA 4NF2A 5EJAA 1ZAYA 2WYWA 3H84A 3IBYA 1W36D 1YQXA 2NT3A 2CN1A 4Q48A 5IVKA 3ISTA 3WQSB 3H42B 4JB3A 3T5DA 1SHLA 3FCEA 3T12A 5FOTA 4YACA 2MW2B 5FI3A 1Q22A 3QOYA 1SAYA 4FZ3A 3MWJA 4M9ZA 1HEUA 4M1OA 4G1BA 2DJVA 1ADGA 3B82A 4IT5A 3L05A 4ZANA 3X43A 4MV1A 3GJZA 4CIVA 4YAKA 1BHSA 3U7JA 2Q7OE 5HA5A 4MPPA 3G2QA 4KMOA 4X20A 3UB4A 1T5IA 1MIHA 3WX0A 1ABBA 2IH1C 2P22C 4C21A 1XZEA 3TTYA 2VOJA 1Z5OA 4L4RA 3H5RA 4E5KA 2G1KA 2B36A 3V2UA 1HV8A 1XUOA 4XA8A 2FMFA 3S1LA 2GJAA 4P7KA 3ANNA 5K4HA 4URZR 1GTZA 5KTKA 1L7EA 5DOZA 5K0TA 1OXKB 1KYVA 3AUXA 2JLZA 1Z8FA 3T3GA 3S29A 4YQEA 4EF6A 1YS4A 1W76A 4ZZ1A 1N6KA 3H18A 1T26A 1T9GS 3DVAA 3AR3A 1E98A 4C0KA 3NW9A 4G1UC 5JE8A 4EABA 1VSQA 4M1ZA 3PE4A 4PPNA 1VDZA 1C4XA 3FYHA 2ZRDA 3S2YA 1PYOA 2W11A 4GOKA 4JD5A 4N7JA 3L6BA 3K79A 3OTQA 3I09A 3T2MA 2CLHB 2B98A 1CQJB 3VPFA 3CCBA 2O8EB 3J80N 4TKZA 2R1TB 5EIBD 2AOWA 1YZGA 3NXKA 1EX6A 2P5TB 3D3QA 4U9HS 3CLTC 2XGSA 1R0SA 4FGJA 3M4NA 1JTVA 1W36C 2QTNA 5A05A 2YXEA 3FUTA 4M55A 4UM5A 2F67A 2OWOA 4HUTA 2FRVA 2TRSB 2ZEJA 821PA 1OQAA 4UV8A 2B5VA 2GILA 2HU7A 2QRVA 4Q7QA 2M6RA 3KKKA 3HI6A 4F71A 1DTOA 4HLQB 4WMLA 5AKYA 4ICGA 1U2SA 3EZFA 1KP9A 4D6YA 3U7FB 5LU9A 4YV7A 3VI4B 3VZDA 3TJTA 1U94A 4XJXA 3DE3X 2DG2A 2L6LA 5JISA 2H2AA 1ZMBA 3AHDA 4I46A 4AMGA 4XXHA 5CM8B 1YE8A 5F9FA 3I2JA 3PLNA 2JIOA 2D4AA 3LQYA 4OK5A 2MMGA 3QHQA 1ITZA 1QRDA 3RCBA 1UAAA 2O0HA 4F6RA 3DWIA 3TE6A 3FVRA 2PLNA 3DEJA 3OGCC 2O2CA 1W7AA 5I4IA 2C7RA 2YV2A 3UC9A 4Z99A 1SZDA 2XCIA 3BA9A 1VPWA 4Z9YA 2ICAA 2HQBA 1BEUB 1OWMA 3MMSA 1JIQA 5FPRA 2B34A 3M9LA 3ASOB 4CM1A 3LUAA 2QTRA 3AZQA 4CRWB 1JTKA 3ZGVA 1QLWA 1OXXK 5E3HA 3NWPA 1XRRA 4GLJA 4YDSA 1SKYB 3CV3A 4UOZA 2YWHA 4O0LA 1YZTA 4H4DA 4E3WA 5EKSA 4LY3A 4FDUA 5JSZA 3W1WA 4MW2A 2OYQA 3VTKA 1QWSA 2W6NA 4JI8B 3P52A 6REQB 1OF1A 1W47A 3T38A 5BPHA 2JLUA 1AKRA 1DJOA 5FNZA 4AI6A 2M1ZA 4P7FA 1JWAB 2Q3FA 2ZE7A 1E3QA 2QX4A 3ZCQA 4DRZA 4KE8A 4NENA 1FP6A 4BVHA 3A31A 3OPMA 4YJFA 4GP7A 1AA6A 5EIBC 2ON6A 2Q07A 2YNMA 1OLSB 2IUTA 3GR6A 1N2HA 3ECAA 3HJHA 3DOCA 1CDEA 1BHBA 5FB3A 3KWLA 3T4EA 1XLVA 3QVTA 5DK6A 1EXDA 4RTOA 3GVHA 2WJ6A 2ZSIA 2DY1A 1KBHA 4IG4A 2CB0A 1Y98A 2AN4A 3PX2A 4QTYA 3B1VA 5C7LO 1Q7RA 4L4XA 3WNDA 1IWOA 4UM9B 4RKWA 4CMEC 4AYTA 1FC0A 3ETHA 2NYUA 5EZYB 4DY4A 4M36A 1MT0A 4MSUA 4QXAA 3TDKA 1ISGA 4I1VA 3N76A 2OCAA 4IIUA 2B1IA 2OD9A 5KNCA 4LF4B 4OTZA 4CM5A 3EULA 1O77A 3EVZA 4IX9A 3ADDA 1YGYA 3ZN0A 4ZO9A 1P7ZA 3MEQA 1R6NA 4I4TF 1N5LA 2MSDB 5M2QA 1Q7BA 4MS1A 4Q9AA 4GSLA 3Q4HA 5IT5A 2YHBA 4E1BA 1Q3HA 1SQQH 1KO4A 3AEQB 3A26A 5IYDO 4EHNA 4OLHA 1UKEA 2Q8VA 2P4VA 1CR6A 5C3MA 3EVBA 5DLDA 3PLRA 5F7JA 2J41A 1EK5A 2GKGA 2Q8QA 3CEIA 3HZZA 1JSXA 3R7SA 3VR2D 1CK4A 3UJBA 1ZLYA 2GPBA 5GTIZ 4X7MA 3C43A 2WUVA 4MRRA 1QGUA 3KQUA 3GWKC 3CRRA 3I32A 4XUDA 4H7JA 4Y8VA 3E5NA 3MTQA 3UMMA 5KDLA 2DWDC 4B5LA 3K70D 1RADA 4D25A 3G0GA 4NI5A 4E2ZA 2HLDD 3C4JA 1DC8A 1NLMA 2B9EA 4LEIA 3PHLA 3QP9A 3WWCA 4GLLA 1D1TA 4EK9A 2P0EA 5AW1A 1Q0TA 5CP8A 5A9RA 1NWCA 2WAOA 3PIDA 4G0ZA 5C51B 3GGJA 1SZXA 1IXSB 1RBZA 2R44A 2WWWA 1VEWA 2Z95A 3W34A 5J43A 2ZVPX 3RUDA 4JHXA 3AEUB 4L9WA 4N3BA 1F0YA 4UNNA 5AI8A 3I4CA 3HG7A 4PDMA 3MRSA 5AT1A 2OZKA 1V4NA 3PKZA 4PI0A 3EF3A 2J87A 2QIOA 3O5AA 5I48A 1B6GA 1F0PA 1WMDA 2G9NA 3UT6A 1AQLA 3QK7A 4MKGA 1CY7A 2WLIA 1P5RA 1YBHA 2IXFA 3PR2B 2QROA 2K87A 2J6IA 3ZLJA 3PEUA 1GDHA 2BGUA 4PY2A 2YYSA 2OK7A 1OBHA 4LAFA 4DEVA 2WSYB 3JR7A 3KR0A 3PPXA 3T99A 3D7SA 4NU5A 2WYIA 3FAKA 1UANA 4OFXA 1V8ZA 2BZ0A 1SVLA 1KO7A 3IPLA 2YFHA 4OK6A 5DT2A 2QX7A 4K9OA 3NUQA 2FJPA 4GU5A 4GVPA 1WN7A 1G66A 4EQ6A 3I5YA 1FBNA 1QR2A 2OC9A 3N28A 2F66C 3L1UA 2ZSFA 4D9CA 1JWBB 2WF6A 1J5XA 1W52X 3K70C 1LX6A 2VQEO 3L04A 5F5NA 2W4IA 5TIIA 1RI1A 5CU7A 1MRSA 4J94A 3DO6A 4MGKR 4JZKA 4Q3EA 4FYKA 2GHYA 1XZBA 2ZSKA 4K9LA 2C96A 2B4AA 3ZRWB 4O59O 2O8FB 2PGJA 3KUKA 4LJ9A 1FYVA 4ER6A 5BN1A 4RESA 1CP9A 2A92A 3DBVO 2H17A 3T4ZA 2RK3A 2UYQA 3L0OA 1MOQA 4FOPA 2YVAA 2BDEA 1Y6JA 2W2PA 5HFLA 3PS9A 2JFPA 4P4LA 3F0TA 1YRHA 3PUIA 2GN8A 4TWIA 5TR9A 4ZPXA 1MJ5A 1KO8A 1I13A 4QLAA 1KWGA 1H23A 3NKVA 1EDOA 4AO7A 3RVSA 1XL1A 3L4SO 2ZVQX 4YPFA 3HVRA 621PA 2IW1A 2Q8PA 1ZH6A 2P11A 1GYRA 3ONWA 4S1TA 2NPIA 5IJZA 3R9KA 4X65O 5HTKA 2JW5A 1KK1A 1UBGA 2D1RA 1SCUA 2D7CA 4IS2A 3SLKA 1X38A 2BF4A 2CVFA 4U2FA 2QTWB 5CAEB 2OZLA 3D36C 1FJHA 4RJ2A 2VDPB 4BPRA 4K6MA 4QLBA 3R6GA 1HDZA 4N49A 4Z1MD 4RIHA 5CA1B 3QTTA 2WJYA 4COOA 1QS0B 4OHMA 3ZI7A 1C0IA 2CGNA 4DUPA 4MS4A 4J43A 1NBMA 4EVQA 5G02A 1NQWA 5DTIA 4B7EA 3WB0A 3TETA 1BMFD 2OO5C 2AG5A 2BFAA 3NEPX 3QVWA 3BE8A 3MJVA 1JGTA 2YVKA 4MTLA 4LXUA 2PLAA 2YIVX 3IUYA 4CS3A 3RI3A 1V6AA 4GM4A 3ONFA 5FUYA 1Y5RA 1JA0A 2FXVA 5HBGA 4JUIA 1H66A 5IVPA 4GR4A 5JZBA 2EKBA 5AW5A 1LSJA 2EX4A 2GA9A 3CKKA 4PSUA 4CWAA 2ENWA 1GPH1 1XRQA 5IBQA 3TLAA 5CK5A 4LQCA 4W1PA 3RWMB 2ZUBA 5AW4A 4FQ5A 5EJEA 4DMUB 3I9KA 1SHZA 4QOFA 5SZHB 3BFPA 5KWJA 3F7MA 1QFXA 1G59A 4I3HA 3SHVA 3K0AB 3WKAA 3OKCA 4X8OA 3B09A 3WIVA 1ECPA 3TECE 4QJIA 5KB3A 2Y48A 3ZJUA 1RSOB 4E30A 1DAFA 3BS4A 4IHJA 2VS1A 2PGXA 3E3OA 1CS0A 2I8CA 4KQ1A 1JX6A 1H22A 4B3IA 1I94B 2XUOA 1JH8A 2DY0A 2JLSA 3KLOA 3MTGA 2Z0AA 3KJEA 4PVDA 5JAOA 1YZHA 2RC5A 5ES3A 1LDNA 4D4KA 3MHPA 1YJXA 3V4SA 3W7AA 3E61A 2LNDA 3CJRA 4ABTA 1EFPB 1RWOA 5G4KB 2K6GA 2XUHA 5BMOA 4RCVA 1MA3A 1FVXA 3NT2A 2Q4PA 4A0QA 2ONKA 3R9IA 4BFCA 1U9IC 1Y7TA 4ZCQA 2EW2A 1HUQA 2W43A 3IEIA 2W37A 2V4DA 4PC2A 1CDZA 4ZZ3A 1VGQA 2JFBA 4R98A 1BA3A 3W0LB 3SJBC 3PG5A 4UFOA 2FR5A 4RH0A 3MIIA 5HCIA 1WUJS 5A0FA 2WKPA 4DV5O 3AGPA 3GJ7A 1Y89A 5C18A 4DV1B 2R65A 4K7JA 3G85A 4PCVA 1Y1KE 1WNTA 3HXOA 1JS1X 5AW3A 5KOYA 1P9WA 2PUCA 3R65A 5DXFA 2GUWA 3O0TA 1NSFA 5JCXA 3N8KA 1I36A 4Q37A 1PJLA 1NJ6A 1KRWA 4L9SA 1UX1A 4L85A 1GQRA 3CF2A 2D3TA 2FPIB 4K2AA 5J4YA 1USVA 5EZYF 1TRHA 2Q1WA 2J07A 1GD1O 4I08A 3UUEA 2RNBA 2HK9A 3HR7A 4OHYA 1ZD1A 4Z49A 3AVWA 4PBTA 2VQFO 3RFVA 4FMBB 2Q6KA 3WLIA 2PMKA 1JAZA 3EOZA 5EBWC 2X2PA 1W96A 1SD2A 3LVRE 1PK9A 2X5JO 1TJ3A 4OXYA 4RIIA 4TN5A 4JV5O 2EZTA 2VRNA 1OAOA 1GO2A 2R5NA 4WZAE 2WHXA 5TDHA 1OBFO 6CHYA 4CXMA 4E5DA 2XVXA 1TA8A 5K7SA 1ZJ4A 1WAZA 3LCJA 5A62A 1E2NA 5BVHB 4DADA 4PLZA 3DSQA 2CSUA 3PK0A 4UUQA 4X41A 1NC3A 3KKQA 3TSAA 5DLEA 3A06A 4RS4A 3E6AA 4BW5A 2A1IA 1U8YA 2H4YA 4HGPA 2KKWA 1GEGA 2AC4A 3EF0A 1XVAA 5JSFA 2E0IA 3OEYA 4R1UA 3F7NA 1CRWG 2CMDA 1UP7A 3SR2C 3AJAA 1ZVVA 3ZHYA 2IH2A 2F1RA 4RTQA 1I1QB 5TEVA 3NG1A 1JG7A 3A14A 2O52A 1T15A 1QIDA 3G89A 4L78A 4RY8A 1G2QA 5IFKA 1B3QA 1L4LA 3E22B 3QVMA 2OPHA 1ZD9A 5DYWA 3PX7A 4NCHA 4C3OB 4BFUA 3WGOA 4JMPA 2QENA 2I34A 3DTVD 4M88A 1XI2A 2IOFA 3WOVA 4ZAWA 1X8XA 2WG2A 4Q1BA 1XCLA 1APBA 3BHPA 2F43G 2FKNA 2A3QA 3U26A 4DCCA 3PYXA 2VBFA 5BY2A 1CB0A 4C1NA 3S1SA 3THYA 4ZCLA 3ODPA 1P9OA 3N74A 2BSKA 4HVTA 4OL9A 3KB1A 1U28A 4OI4A 3F6PA 1U1GA 3R9WA 3GCGA 5JJIA 3X0DA 1AZTA 5FLXN 1POWA 4Y0NA 4X8AA 4WBNB 5IPFA 5C8ZA 3HJRA 2XMZA 4J1NA 4YEDA 1HG1A 2DWOA 2C61A 5DM70 3QIVA 4RUKA 2UZ1A 3D6JA 2G0AA 3PIIA 2J7PD 3NCHA 1L1QA 1BX3A 2GCIA 3QOWA 1BQ4A 1HR0O 2OV3A 4LC5A 3L8MA 3KSMA 1AI6A 1R64A 4OHPA 4UBJA 1KO1A 4K81B 3LY8A 3MYYA 2EILC 4EG3A 1BE0A 2O8VA 3BAAA 3U0BA 1A2QA 2OUIA 3CZMA 4A6EA 4M1EA 2ID7A 1CERA 1UMDA 3JSAA 1XKTA 4H1WA 2O8CB 1PDWA 4G0VA 5JO0A 1O03A 3U3KA 2MSCB 4JC0A 3LL4A 2O3QA 5KWEA 1LS1A 2QK4A 3TQFA 4IRXA 1Y3IA 1RZVA 2CTQA 4FM0A 4R7CA 4GUNA 3RC1A 2XHZA 4XVHA 3G5TA 4PYLA 2VFAA 4D0NA 1Z4OA 2IJKA 5BYBA 1QCZA 2O2YA 3HL4A 4QU0A 2IYWA 2YIDA 3NYWA 2FDCA 2Z6VA 5CLQA 1PG5A 1K7DA 1J95A 5CMLA 5H2FZ 3EB9A 3BA1A 4N6GA 3UIEA 3UNXA 3W5JA 2E3JA 5KCZA 2VJKA 2IEAA 3ZU5A 4WLUA 3L8DA 1KRHA 4BWGA 3WGMA 4BMZA 2AFIE 2OCPA 1YITV 1C8LA 3DOHA 2I99A 4RPGA 4YMSA 3OWXA 4OQXA 2OCIA 3U5TA 3KV3O 2CBGA 1U8TA 4GECA 3B8EA 5AUOB 3WAGA 3F97A 5HKKD 1IULA 4BNIA 3GYBA 2ZNJA 3CMEV 1PJ4A 3WSTA 5JTTA 1W6RA 4MUMA 1QCEA 2XOKG 5IWAO 2JVDA 2LE0A 2GK3A 4MPRA 5T4EA 3E9EA 1FFCA 3AM5A 4H13B 4Q4JB 3EFEA 4KQ9A 2BH2A 1UPXA 2I4IA 4EA7A 3DAHA 3EX7C 2R6GA 4MRMA 2HSWA 3F5TA 4HAOA 3PGLA 3O8RA 2Q4OA 1LUVA 4YJGB 5G1PA 1AUOA 3SYPA 5CYPA 1YTFD 1L1RA 3D6FA 1HXHA 2XZLA 3HV0A 5HS4A 2YKGA 4UTPA 4HNGA 2D62A 3F96A 1Y6FA 1E1NA 4JQOA 1DJMA 4EPVA 5CA1F 4P5PA 1N3LA 1GZHB 3DH0A 3CSDA 3A1DA 4XLZA 4A8JC 2PI5A 3BRWA 1JEYB 4L74A 5I9IA 2BHNA 3ZW7A 4EHKA 3GD5A 2MT9A 4NYMR 1RWNA 1BCSB 4KI0A 5TMEA 2EIJB 2EULA 1KUQA 2VH2A 4P81A 4MAMA 5AW9A 4F1JA 1USKA 3K2QA 1VQ1A 1V6SA 3EEOA 3ZHSA 2XE7A 2IXBA 2FQYA 3GYGA 2BFDA 3LYUA 1DZIA 1N1EA 3BY6A 1ARZA 3GWOA 1J8MF 3HP1A 3GRUA 5JSQA 4OCMA 3L82B 5KTMA 3LYLA 2EINB 5D5HA 1SC9A 1AVMA 1DIGA 2XGOA 2XRYA 1QTRA 1Z7EA 4G65A 1C7ZA 3MGAA 2NYTA 4A91A 1V4VA 5B7QA 2Z56A 3UPTA 1XYYA 1CUHA 4B2IA 2HTFA 4DV4B 1BMTA 4AMUA 4UEQA 4S12A 3CJHB 3HO8A 2JVKA 4MUKA 2C4WA 4EMBA 1L7DA 2D00A 1RWKA 4MIKA 5H6RA 2FN4A 2R8ZA 4HZIA 2NU7A 3DAGA 3UV7A 3HBMA 3HXKA 2AJCA 4OI0A 1OCOB 3GUHA 1GNSA 3PE3A 1EBBA 2WHEA 1NW6A 2LVBA 5BNTA 3STLC 5KAMA 4QVGA 1K5SA 3V7FA 1W44A 1MT3A 2FZWA 4RZ3A 3PKJA 5CK4A 2FSIA 3R66A 2ZKIA 3O1JC 3BF8A 4BRWA 3BH1A 3IODA 3H1TA 1XAIA 3F6YA 1J23A 2NSDA 1KXJA 3TAXA 1JPXA 1KMNA 3CCSV 1R50A 3VOTA 1T0PA 1C7IA 3NGMA 4KE9A 3RTGA 4LVNA 3KHSA 4Y67A 1NQUA 2IE0A 3ME5A 3VVCA 3VDRA 4MRVA 2M6LA 1XAGA 4JJZA 3RK0A 2QQ5A 3FJYA 2C4HA 1P8AA 3PR3A 3FHTA 3SHOA 1QAMA 4KQMA 4NTYA 2PD6A 3NKFA 2IODA 5IH3A 4Q4DA 1PJBA 4B87A 4EMUA 3CN9A 3R4CA 3HJFA 2AOTB 4G4JA 2KW5A 3USCS 2Y99A 3RVZA 4DILA 3DBHA 3IQWA 4UMFA 1F51A 1QZUA 1MVOA 1E4YA 4D3FA 3K9NA 4J3NA 4J0QA 2IU0A 3LHIA 1UDXA 2ST1A 4MJ3A 3IQEA 2XMDA 2DFVA 3CZ5A 1KU6A 4XGKA 5L53A 5ALEA 4L8LA 3H5IA 4DYLA 1AS0A 1EFCA 3CVJA 5DHPA 2Q62A 1RI2A 4BCDA 5K09A 1D1SA 5IVDA 4WFHA 4A2QA 4BEBA 3NC0C 1QH1A 3H1PA 1XTQA 1C3VA 3B7GA 2OZEA 5GIPE 3C6ZA 2BSAA 4F5YA 3BJEA 3H3FA 1JKFA 4PCUA 2BCJQ 3IAAA 3A58B 3C3EA 4GSYA 5JH7F 1NVFA 4DW0A 4ZC1A 1TA9A 4DG8A 1T4CB 4B5KA 4FFRA 4U8GA 4NXNB 3V2HA 1U99A 4BNGA 3G59A 3I9FA 3JD0A 1DKOA 1P1BA 3QUAA 1Y5NA 3SEQA 1PX2A 4F3NA 4PPGA 4JELA 2OXFA 2GVZC 4Y9DA 1LPMA 3TXXA 2EF0A 2AD1A 4R7TA 4YRSA 1CX9B 1ESMA 3IPYA 3ROEA 5AVWA 1KY5A 2OHXA 3CO5A 5FNVA 4BN4A 5K8UA 3CRNA 4RELA 4EB6B 3OMIB 4CR8A 2E4YA 5T3UA 3OEHA 3PEWA 3K20A 4G1EB 1IX9A 1JSLA 4N21A 3EUEA 3GXOA 1RMQA 1MJNA 4YT2A 2AXPA 2HY7A 1XZFA 1M1YE 1N0NA 2I65A 4PM4A 4GX2A 2VHUA 4DRYA 4CM8A 5BP7A 5JXJA 4TMKA 4QG7A 3ADOA 4ETIA 4YPOA 4FGWA 3A6KA 1Z7GA 1EYZA 5LMUB 3M70A 4CKBA 3LO5A 5H6QA 2Q2QA 3NBZC 4R2JA 4JAUA 1BD4A 1XILA 3KD3A 4RMIA 4YP0A 4Q3KA 1CNEA 3OHMA 1U2QA 5JMOA 4ID3A 1N8SA 3DLCA 2CHEA 1JEQB 5KNLA 5E0KB 2F3SA 3LPLA 1V95A 2GN9A 5SYMA 4LK3A 3JWIA 3VPBA 2DSTA 3NBXX 3LWNA 3PXEA 3PJDA 4FWBA 5JWHA 5A7HA 5ALMA 4JZ2A 1QX4A 4BX9A 3ZD8A 4EG4A 2Q6OA 5L7TA 1XA4A 3H9CA 2HMVA 4CEIB 1VYTA 4A7PA 1A7AA 1KZ9A 2H7CA 3NTVA 4P7GA 1N75A 2X0EA 1YI2V 4YAEA 1VLVA 3KIPA 2W70A 1J42A 4WESA 4X8LA 2HA5A 3I9NA 1KPIA 4HLUC 3E7FA 2LKDA 3FW1A 3H17A 2V7XA 1WAMA 5AJTA 3L1HA 5AIAA 4OYHA 1F9AA 3K92A 3Q7RA 3DZIA 4CDMA 4OCZA 5K1XA 1DTWA 4Q7MB 4ND4A 3OCCA 1THTA 4FONA 3PL5A 4JC8A 3CT4A 1TYAE 4G5RA 5REQB 1B93A 4HDMB 3QBVA 2H4HA 2GS9A 3H5WA 4OXNA 4ZU6X 3EZXA 4EYSA 4G0MA 2ESRA 2Q46A 4RAQA 2RJZA 3LQQA 1LC0A 3CLUD 5A5EA 2I6QA 1QX3A 1GZUA 1C1DA 1G1MA 2QTAA 2RI1A 2FP4A 3HJGA 3VC3A 1FU4A 4P53A 2GO7A 3H7AA 3AK1A 1RYBA 2OFPA 1LLDA 4US2R 1XDUA 1MJGM 2FFRA 3G0HA 3O03A 3AF2A 3JVUA 2IX3A 1ATZA 2X2EA 1RZRD 5J3JA 1YSCA 1H4TA 4B6PA 1TK2A 4QX6A 4K3UA 1FXKB 1VP7A 3INRA 4AT1A 3WK5A 3WGTA 3IP8A 4X1IA 2IQ5A 1T6XA 3QF4A 4V1CA 5BWNA 5E2BA 1GGVA 2XRFA 4KAJA 2XE6A 4FKMA 1LF0A 1GLGA 5EE5B 3X1ZA 4RK0A 5FKJA 4QGBA 3QKRB 1UJNA 3F5MA 3P9SA 4QYIB 5GJCA 1OFUA 2PT6A 4CM9D 3AESB 4NZMA 3AO0B 4F56A 4HRAA 1DP4A 1CTTA 4Y1EA 4GIBA 3U3DA 4MWTA 5AM2A 1D07A 3LZDA 3NALA 2CE7A 1JKJB 3LXRA 1CNMA 3FZNA 3G02A 5DGIA 4FINA 3W6NA 1ZNZA 2HLDG 2O3KA 2GLUA 2A9QA 2Z0MA 2UUAO 1T4MA 5FR1A 2JVJA 1QH9A 2ZRFA 3LKVA 4L3WA 4UBNA 4WA7A 1P4SA 1GDTA 1WZUA 3EIQA 2E75B 1MIOA 3N6XA 4NDZA 1RAHA 5AO9A 5U1PA 3UBMA 3QEOA 2FPPA 3ZG6A 4H7PA 2I7XA 2GDJA 1HT2E 2XF2A 1IRXA 3SIPA 2QT9A 4C03A 4B47A 1GL3A 4KWCA 1I3CA 2JGJA 4OM7A 1XRSB 1ZO8A 4LDJA 3NIGB 3O84A 2XSZD 3O8OB 2YJGA 3CLUC 4MUGA 1MGOA 4HJRA 1GYQA 2FKXA 4XX0B 3DONA 4NK5A 1A7JA 1EGVB 1K7YA 2H1HA 1XJWA 4FM9A 5CBHA 3BICA 3OE7A 3UMSA 4YP9A 2X8AA 1ENOA 1EFVB 4KR7A 4U1RA 1VBFA 4H60A 1VRVA 1GT6A 2R6JA 5F3DA 2QWRB 2J9YB 2ZXFA 1H4SA 4JYPA 3UA3A 5HW0A 3LPAA 2Q7HA 3DFKA 2HNAA 4MLPA 5LJIA 3EEYA 3W8NA 2XB4A 1UFIA 2CDRA 5HVNA 5AKKA 3D2BA 2K2QB 3ZXUB 4EUSA 1K4YA 1CEXA 4P38A 2BKXA 3E4DA 4FFWA 1JDBC 1RJWA 4G89A 4HTFA 3TFQA 2AZMA 3FNRA 2QLMA 4K86A 4KXYA 2WDZA 5ALZA 1DT3A 4NCBA 3HA5A 3FGNA 3HBFA 1WKVA 1Y1QA 1VL1A 3P2EA 3W9UA 4NEHB 3FB7C 3OLVA 4GI7A 5D3QA 2R79A 1N92A 4HDQB 2BYTA 4L0DA 3WO1A 1BVUA 2OESA 3UOAB 3U2QA 4G23A 4JGBA 2ZUDA 4ZVMA 3RC9A 4HB3A 4RVUA 2RHHA 4CH6A 4GE3A 4AW9A 4LH6A 1UPUA 3O94A 4MKFA 1EFRD 5F7ZA 2C7VA 1VQOV 1G21A 2V3CC 1XMSA 4MTCA 2CXQA 3GLHA 1Y81A 4U0KA 3OJ0A 1VCOA 1M1NB 2OGWA 1EJ0A 4P4SB 2H1LA 4W5WA 4WN9A 4UOQA 4RJLA 2O7QA 1TT5B 1U7OA 4PCAA 4UVCA 3C7TA 1L0BA 4BP8A 1N5DA 5JATA 3VU3A 3NI2A 1SVIA 4LSZA 3FTPA 3JARA 4OCNA 5DGHA 5AI6A 1USGA 3LUJA 4BLWA 4CLRA 3V1LA 1GKIA 3T9AA 4M1YA 3RS0A 1GPBA 2H06A 1U0BB 4ZT7A 4FR2A 4KVAA 1FXWA 4Z1MG 5JBNA 2CV2A 4CC5A 3FNEA 2HF9A 3EQ8A 5AHRA 4KTVE 3JWGA 1W73A 1XMJA 1Z68A 2YYAA 3PDHA 2WUGA 1YA8A 5K0BA 1BMFG 4PYQA 4YRGA 3IIKA 2AI2A 1N1MA 3M1AA 2YIBD 3ZDCA 5FUVA 2PAAA 1HYHA 4RHTA 1Z3AA 4I55F 3ICPA 4NOMA 3CXRA 2JVIA 3NXSA 3ZVMA 2M2IA 1PR9A 1M6YA 3OEED 4HGNA 1DX4A 1SXJA 1H2YA 4RE5A 4PWYA 3M99B 6LDHA 2AKYA 1W75A 2AE1A 3HCBA 4KOEC 4B4OA 1ULSA 2AA3A 2N42A 3PC8A 2YIAA 2H5JA 4Y2SA 2VRBA 3CLTD 1MLDA 2IZOA 5CNJA 3TQTA 2YJNA 5FL7D 3TQQA 1YU6A 3DXYA 1NR5A 2FE4A 2QBYB 1E6EA 1S5HC 4ITRC 4MNTA 1AOXA 3IPXA 2JJYA 4Q82A 3DTUB 1P7CA 1AG9A 4PSCA 3FSEA 2EGUA 3MCZA 3HYSA 4FYIA 4S1NA 2Y1XA 1WPBA 1JHOA 1Y9DA 2ZB4A 3QJGA 4H44B 1NRIA 2A0WA 3A2LA 4ZVPA 2J3JA 4QGSA 4W4KA 2PX4A 3NHJA 2V03A 4RV5A 2ZNIA 4GPAA 4DIOA 3EIUA 3T6KA 3FG9A 4FBGA 4ZN6A 4GFDA 6AT1A 1ZEMA 3VKGA 3FSJX 2AG0A 3RGWS 2FWIA 3QV2A 1CKEA 4F7OA 5E4FA 1D5NA 3RU3A 3C3TA 3PF9A 4AUKA 3DMNA 1E0AA 5KYWB 1G3UA 3VR3A 4ZT5A 2VUUA 3KXIA 3R7DA 1OLUB 1OY1A 1EP2B 3IDZA 4FWIB 1KO5A 1D0VA 3VR6A 4GL4A 4YMHA 4KH0A 4M8KA 1NHWA 4DIEA 3PZRA 3SJAC 4MINA 3PT9A 4UU1A 2OB1A 1OJ7A 1KTIA 4D7SA 1ORVA 4L6CA 1E8MA 2QTOA 3JQBA 1JDNA 3BABA 7ADHA 2X7JA 1BZYA 4MR7B 2WVAA 2I3DA 1FA9A 3RW0A 2EKDA 2OORA 3CLRC 2HK6A 4KP7A 1FMLA 5FDFA 2IBMA 5DWVA 4RTLA 1UR5A 1V45E 3O8CA 1IEWA 4AROA 3IP3A 2D2XA 4PO3X 2ZUTA 3PSAA 4MQUA 4N5DA 2VK2A 2GZRA 3JAKA 5J2UB 1WDMA 2JFVA 2NU8B 2YJ3A 3IHTA 3H5VA 2RAUA 3GI1A 4Y9TA 2QA4V 3PENA 1DF5A 1NMQA 4UASA 2L0XA 4R8RA 4YRNA 2AFHB 4MO2A 3BBPA 2QJOA 4Y1RB 3H13A 1JAYA 3CTPA 2ABWA 2RGUA 3U13A 4BNUA 4UHJA 5CX1A 3A6EA 4RZIA 1G8MA 1FFDA 3ERCA 1KMIZ 2YY5A 4K8OA 4ZQIA 4MVQA 1VIBA 3RTEA 3ZHCA 3CQ9A 2PR7A 2O3RA 4BQFA 3QEBZ 2JBAB 2QAGA 1L7BA 3ZI4A 1D7OA 1Q2UA 3L6DA 2WQ7A 2Y27A 4U4AA 3P96A 5IAEA 2Q9AA 4FR5A 4F97A 4MUFA 1B73A 3LM8A 4I1RA 2JD2A 3K8OE 4QAJA 4GZMA 2ZYUX 4V2IA 5LOVA 2LP7A 4UTRA 3VMMA 3KDSE 5KIAA 4NYMQ 4TL8A 3V97A 2X5KO 2K2WA 4RZ2A 2VPWA 1KMHB 3BK7A 5KAIZ 5DGTA 2FLKA 4JMLA 3GT3A 3P19A 2G8NA 5FPQA 2QD5A 1NNLA 1WZCA 3R7AA 4OGKA 1VQMV 2YOHA 3SJQC 1PDOA 3K1AA 1O3YA 3BDVA 4PGFA 1OV4A 2OBFA 4MV4A 4D4HA 3G0BA 3T1HB 1UWCA 2BP7B 1ZABA 3X1WA 4UZSA 3M0EA 2PBLA 1S01A 3AY0A 1F14A 3KYDB 3CFYA 2KLHA 4W5QA 1GWNA 1P60A 2EG9A 4KAXA 4H0LB 4OSEA 4HQLA 1E79A 4FZVA 3OD4A 1E2EA 5CFZA 3MWDB 1UOPA 4MH0R 5B3SC 4PPQA 1IPFA 2A9FA 2G1AA 5G0SA 4AYWA 4F4HA 5JI2E 3QPBA 2H7YA 4TKVA 2GM3A 3C6XA 4TXMA 3RO7A 2G38A 1UJCA 3AI7A 3OO0A 1Z7BA 4UOEA 4X94A 1IN7A 3V3KA 4IIJA 1Z6GA 3IGAC 1QP8A 3KOOA 3CXHF 4PEVA 2IDKA 1X7ZB 4E4RA 3RYIB 3WO0A 3QFRA 1OXTA 2Z6UA 1GNPA 1O8CA 1ORQC 4YR9A 2X6TA 3D5EA