1PKXA

Crystal structure of human atic in complex with xmp
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
588
Chain Sequence
PGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structural Insights into the Human and Avian IMP Cyclohydrolase Mechanism via Crystal Structures with the Bound XMP Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
total genus 207
structure length 588
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pkxA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pkxA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA02
1A9XA 1PL0A 1OZ0A 2IU3A 2B1IA 1BXRA 1PKXA 2B1GA 1G8MA 1S8AA 1C3OA 1CE8A 1THZA 4A1OA 1WO8A 1T36A 1JDBB 1IK4A 1M6VA 4EHIA 1CS0A 1VMDA 1KEEA 1S89A 1P4RA 1B93A 1EGHA 2X8WA 2YVQA 1ZCZA 3ZZMA 5H3LA 1C30A 1M9NA 2XW6A 2IU0A
chains in the Genus database with same CATH superfamily
3M6MD 3TNDA 1AT1A 4BYMA 5AW8A 1YQDA 2E4ZA 4AZ3A 4BNUA 2GN1A 4D8XA 5IXJA 5NULA 2EIKB 4MW9A 1HWYA 4ITVA 3TR5A 3QFFA 4D9JA 2NWQA 1K6IA 2QAIA 1R1BA 2E4YA 1KVRA 1Y8RA 2XAUA 4BWFB 2NV0A 4CKYA 5HF8A 5EHQA 3MT7A 4JYBA 5LL6P 3DO5A 3RSHA 4X62O 5KTMA 1K75A 1L3CA 1H4QA 4KH0A 4EKGA 1NV8A 1HZZC 4P31A 5EJ8A 2COEA 4IIJA 1TM1E 1JIIA 4LF5B 2XJ9A 2CCJA 4GX2A 3C7KA 4DV6O 1BMQA 3LUJA 5ALMA 4UEJA 3PGJA 3HUTA 1Q0ZA 4KZPA 3WDMA 4X1KA 2CD9A 2FPPB 3QZUA 1L2TA 3WS7A 4P08A 3FGZA 1UKCA 2DE0X 3CP1A 1V16B 1AI4A 2FPGB 1PNOA 4XD7A 2P79A 1BMFD 1OAAA 4P81A 2O06A 3ZI7A 1RWKA 1NJFA 4WKGA 5IKEA 3NBFA 1NHGA 3UJ6A 3ONWA 4RL4A 2RDMA 3D8CA 4M7RA 1GU7A 1P9WA 4HI0E 1OXKB 1GFIA 3AUAA 1N0IA 4Z0NA 2R9AA 3ZZUA 5LYJB 1TYDE 4KWHA 3TLJA 4CKZA 2VA9A 4G86A 2N1MA 2W4IA 2PXAA 4B6FA 4WBNA 3ULKA 4PYQA 1JG4A 4OJNA 2QB5A 2OCPA 4DBZA 3TF5A 2XUKA 5AOCA 1KDPA 2DSTA 4K8ZA 3BXFA 3MWLA 1CYDA 5M2QA 1NLYA 2ATIA 1P0MA 3PJFA 2F1JA 1QGAA 4MUKA 2QSAA 2GPTA 2O2DA 2QWPB 4G8DA 2EKBA 1HSZA 2W6OA 4EUFA 3JZMA 2BFMA 4C0AC 4JHLA 1DT3A 2EIJB 3HB9A 2K5UA 4Z1VA 3I2HA 2OQIA 3JSAA 4G1EB 2CBZA 2XD4A 3ZRWA 1EH5A 3ILSA 2R6JA 1H69A 4KFTA 3O9OA 3VYUB 1RRVA 2N47A 4QAQA 3L84A 3L4EA 5JBIA 2D74A 3AM5A 1ODCA 4ZEMA 2GSDA 1E2LA 4D9FA 3DDOA 2A7XA 1YDMA 3BQ9A 1U2GC 1LBSA 1TAUA 3ZDYB 2MSKA 3NHBA 5C32A 3G6EV 1NMZA 4MYSA 1WBDA 2QL9A 2WZDA 3M6LA 2Q8QA 4YRKA 2QWXA 2VBIA 3SGLA 3TW4A 4IICA 3HG7A 4HBZA 4NOMA 1PNKA 4KDEA 4LOHA 3T3GA 5TMEA 1K2VN 4PICA 5HDQA 1J0AA 1P1KA 5K3BA 4EGFA 4EK9A 1UWCA 5LKAA 1V3QE 2I3GA 3FHLA 2PMCA 3V1NA 1NF8A 3C3XA 3PEUA 2IQ5A 2FZ5A 2O8VA 1ODLA 3SIWA 4RH0A 5IHXA 3CHYA 3PEVA 1V4BA 1T1EA 3ITEA 2QUBA 1DVRA 2G0TA 5IT5A 2NN4A 3H7AA 1LPOA 3GGGA 1M57C 1KQNA 3GNLA 1XAGA 2H3HA 2PU7A 4QAJA 4HC4A 3ZN1A 3MD0A 5BV8A 2Z3YA 4XWWA 3KCYA 1NVKA 3G5AA 2GETA 3HDYA 2XASA 3VC7A 4WZBE 1J8VA 3NKFA 3G02A 4CETA 2JZCA 3D0RA 4DHWA 1P33A 2IXFA 2PLFA 4F91B 1U9ZA 4KQGA 2P06A 1K9VF 1I14A 4MPTA 1MQ9A 3CURA 2WWGA 3K31A 3OR7C 1XNRB 3ZD7A 3GRYA 4M36A 1TYZA 1TK2A 5B3JA 4X00A 4KO2S 2VN8A 4KZKA 2IEYA 2YV3A 5G40A 3LP5A 2OUKA 1T0BA 3P4UA 3A9RA 1W85A 3FCOA 2EBWA 3BL5A 2WHRA 1FBNA 4EKYA 3CM0A 3HFJA 3PQ2A 1FD9A 3DW1X 4ZD5A 3E8FA 2IZ6A 1IXKA 1NX9A 1YJ5A 1EN6A 2LVBA 1TX4B 1ZHOA 4FGUA 5AO9A 4Z0TA 1U8ZA 2ZCVA 4B85A 3KS9A 4N39A 3SX4A 4XWKA 2EKPA 2BKVA 1PZNA 4I1IA 2H8PC 1T9BA 3DKPA 2Q3EA 2HK6A 1KJNA 2XV1A 3SYMA 4BLRA 2IHNA 2G8NA 4BRUA 4WZZA 1XYGA 3CZAA 4ZDJA 1WJZA 4HH3C 1FX0A 3IKJA 2WUGA 3UWPA 1AI5A 4UFZA 1O54A 1C9KA 1UPCA 1ULBA 1T1JA 2A9VA 2WM3A 5SY6A 3HN6A 3DOFA 3K6SA 2P7IA 4BO9A 5JT1A 4CQLB 3BICA 4KPUB 3BTVA 1QE5A 2C1XA 3N0TA 3C7AA 4JXEA 4C5AA 1W4AA 3LCVB 2VJOA 2YCLA 3ZJVA 4OQ4A 2AN3A 2BRUC 1R37A 4A6DA 4C29A 4DLYA 2XUZA 3B7WA 3WQSB 2DFDA 4ZOLF 3PC4A 2PEZA 1UQUA 4UV8A 2OMKA 1G5IA 5JRZA 3D6JA 3H3FA 3GPIA 5D3ZA 1DJNA 1VPWA 4CL8A 2FQXA 3AU9A 3ABKC 3MHSC 3QLVA 3E9ZA 3OMLA 4D8YA 1ZRSA 2H18A 4EECA 2PV7A 1F17A 2O0MA 3HNOA 1FAFA 5ALWA 3ZTTA 1DBSA 1NVAA 4O02B 2VEDA 2YZNA 3MD9A 4JQCA 4YAIA 5AVKA 5AVXA 5L6LB 1Z4KA 3WYGA 4KMOA 4C3ZA 4J0QA 3DM5A 2PTMA 2PJUA 1NL3A 1L7BA 5KHHA 3MGCA 1U65A 1VLHA 1T8RA 3RUFA 4E5VA 1WD7A 1Z74A 1Z5GA 4EJSA 4Z6KA 5DV9A 4NL4H 3EIEA 4ZYWA 2CUKA 3WGGA 5JANA 3I2KA 2DZDA 3EIQA 1ZLXA 4ZC1A 3EIFA 1R9NA 4E07A 4LI0A 2VSNA 3JV7A 3TR6A 1NR7A 1OLUA 4RHEA 4D6XA 1I9CA 4KBFA 1QCZA 1GRJA 3O2QB 1DBPA 1VG1A 2AL7A 1E3QA 5B7PA 3LO5A 3INGA 1EXMA 4P5PA 2ID4A 4LRTB 5EXXA 3W5UA 3B6KA 5E7QA 3GGOA 4DCGA 3SVZA 3NHPA 1MGPA 1V39A 3FLBA 2QUAA 1J00A 2H4YA 4YREA 3RGWS 3EODA 2VK4A 4RTMA 3JQ8B 1QPGA 1D3AA 3UGJA 2VATA 4L9RA 2VJYA 3E6AA 2WPDG 2YHBA 1XGKA 5CM8B 5IJ0B 4RVOA 1P1IA 4IF4A 4OG2A 5FUVA 1IQPA 3SE7A 3B9BA 3HDQA 3ANLA 1JPJA 4YUZA 1FW8A 4FHDA 3HMQA 3JQDA 4R9UC 3AVVA 2Y66A 2JJ2G 2ZAOA 4BNIA 1QWOA 2Q1SA 4C3OB 3IAHA 2A0XA 4Z3KA 5BYBA 2Z5FA 1R6AA 4OY3A 4F38A 4LFBO 2BGRA 2WQ6A 3WLRA 1FP7A 5KVVA 3F9IA 4K5QA 1IY2A 1OSNA 5J4HA 3H1KH 2WPNA 1AKTA 5I4CA 2GN8A 4WECA 5DEIA 2K7ZA 3ZBPA 2BGJA 4TT3D 3TLAA 2W4MA 1V2HE 5M7EA 4NIMA 2NU6A 1PR1A 4CMGA 4ZJPA 4MVSA 3ROGA 3D3WA 1ZK3A 1KJWA 1JGTA 4EFBA 4ZGBA 2CSUA 3AKEA 1SETA 4DABA 3A4IA 2Z95A 4WESA 3GAZA 2CK3D 2X8LA 4IIEA 1J33A 2ZP1A 4H31A 4GOMD 4XB6B 4P3XA 5DX0A 1VXRA 1M2HA 2GZMA 3DVSX 2V6GA 4XWTA 3AONB 2EFEB 4PYLA 4GX1A 1YIOA 5KHGA 2ZYTX 2D1RA 2JI8A 1PD3A 1P1BA 4A0RA 3GCWA 1GSAA 4H60A 3G1UA 3OWOA 4CZZA 4V3CA 1C4OA 4LH6A 1QYIA 4KYIB 5DNAA 2JKYA 2CFIA 1L5FA 3H1JH 1IBMB 5FORA 4CIBA 3UT0A 3THWB 3H0KA 4JBYA 2ZJBA 3VYWA 1RZRD 2D2FA 4LYEA 3MOSA 3BE8A 4GZ5A 3Q1LA 4KNYA 5F1YA 3HB4X 3G9QA 1PWEA 4TN1A 5FOXA 2CTPA 4QPJA 3WG7C 4FE7A 4R0VA 1P0IA 4LWQA 1FYEA 2A14A 5U4XA 2CB9A 5FL7G 3B8MA 3BRCA 4YLYA 2XUMA 1IZ7A 1RADA 1FJXA 4QOFA 3AHFA 1KMMA 2RI6A 1JUDA 5BN5A 1Q5PA 3QK7A 1ZOOA 4HDSB 2R8PA 3D4OA 1Z7EA 3EVCA 4IIFA 3VI4B 1PFGA 2CTQA 5CAEA 4P5EA 4HY3A 3PUWA 1L7QA 2ZFUA 2NUBA 5H82A 4PSCA 2FPUA 3FN4A 4JX8A 4IL5A 5FD8A 1QBZA 4HFJA 4DPLA 3U7HB 2AFHA 1N5KA 4BJ6A 4B4OA 3H13A 1T3ZA 4EFNA 4DS3A 4DR7B 4MICA 1W0KD 3N05A 4WCFC 3QNEA 2XYGA 2O8CB 3W7SA 4IYJA 3GLRA 3PQCA 4TZKA 4M1QA 3H5LA 2QRZA 5KSOA 1CIVA 1GL7A 3R3UA 3DE7X 2VF8A 4XH9B 2WUDA 4CV3A 4D10F 1BVYF 1FNBA 3FUCA 2HVWA 4XLZA 3UPTA 4DM4A 1Y7LA 2Q5OA 3DMNA 1T3HA 3E53A 5FWYB 1R6NA 4S1PA 1P0CA 1BXGB 2Y92A 3RFXA 5CJ2A 3VNRA 3TRHA 3IA7A 4YV7A 2Q1WA 3D6UA 1SBNE 5JDCA 4JI7O 4Z0PA 3JQ7B 1POWA 4JLNA 5GWXA 2M6SA 4W5RA 1GLGA 5A9SB 1GAJA 3CCJV 5BP7A 4FDMA 3EUAA 3CVVA 1Z6GA 2NPOA 5C53B 1XHXA 4L51A 2FWAA 3PYMA 4PLYA 2QWRB 2QKCA 1O9BA 1S5LZ 2PIDA 5D8DA 2QD3A 4IV8A 2EYQA 4IIXA 5FQOA 4I55F 1CRQA 2DWDC 1BVUA 4RTSA 3GEIA 5A3JA 3QX8A 5TMDA 1RXSA 1I51A 5ALDA 2Y0EA 4ZVPA 2WLJA 2B1JA 1XBTA 2GGSA 4FDUA 5BSVA 3K96A 2EJBA 2HCTA 4V1CB 2V7QA 3K2QA 3F1LA 1R5BA 3RBAA 2LFRA 5KYWA 5T3YA 3OT4A 3HDGA 5DGHA 4HAVA 4U3JB 4HP8A 3F5FA 1E61A 2Q0OC 3ABUA 1S76D 3FI9A 4WOPA 2RGCA 5K0CA 3ZIDA 1ZICA 4JAVA 4G5RA 3ZEIA 4RCYA 4DTCA 3MHHC 3ZZTA 2OFXA 4MVOA 3RK0A 4IDCA 4G37A 4HSEA 3MMZA 2JIZD 4DDTA 2L69A 2WU4A 3SJQC 5DISB 4IDQA 1R50A 4C7XA 1JI0A 1NF3A 4NHOA 4KXRA 3BRQA 1ZRMA 3L0DA 5B1SA 3ANTA 3MPUA 3ZV5A 2ATCA 3JQEA 3QYPA 2RJNA 4YC7A 4AULA 3O1JC 3CC7V 3KOUA 1J1UA 2APJA 3BHJA 1LW6E 2H1SA 2C3MA 3DJFA 3FAVA 2WB2A 2V96A 4NJOA 3IHKA 5EWMB 1FVHA 3VR5H 3TZQA 3NWPA 2X2OA 2HR1A 4L85A 4D8TA 2JB9A 5KOYA 1NG9A 4MQLA 4UUOA 1OC4A 3CUUA 1AZSC 1PT8A 2HYIC 3R0XA 1VFNA 3AM4A 1V7PC 3M6VA 2I03A 2CXXA 1NN1A 3BSSA 4FT4A 3R5FA 4E88A 3V4FA 4JP2A 2CL6X 1Y8ZA 2I6GA 3I8XA 4HNRA 1K5PA 3FKQA 4B3TB 4H4EA 5KQSA 4WZBB 5K8CA 2UXDO 1U7DA 4GDFA 4XUEA 1TRHA 2ZT7A 3IUSA 4FHCA 3FJYA 2ZPAA 5CBPB 5AM3A 1NZDA 2ZJ5A 3BGDA 3KQQA 3PXEA 3B1ZA 1N34O 4N40A 4PFJA 3B2NA 5D6NA 4GVPA 3TLYA 2H1HA 1U8UA 4CH4A 4DBLE 1JYFA 2RI1A 1H2SB 1KD1W 4HYEA 3PD1A 3OT1B 2IM9A 4NNPA 1W36B 1Z0AA 3C3TA 2YVLA 3MT9A 1IY8A 4PPYA 5JSFA 1H6DA 4IF6A 3EUWA 2IIPA 3MFYA 1UWZA 3DGFC 2LGJA 5G02A 1XPUA 1Z0FA 4X9QA 5AM0A 5JU6A 2NPFA 1A76A 2I80A 3C39A 5F9FA 4YS6A 1X8XA 4CG3A 3CIFA 1XMSA 2AE2A 4N8SA 3DFUA 2E21A 4J0DA 2VJAA 4ZFRA 3WGJA 3EVFA 3INNA 2HDHA 4AY3A 5LP6B 5HCNA 3KJNA 2J3QA 5H2FZ 1RI4A 4JJ8A 2XYVA 4YRDA 1T5LA 3FVRA 4HMQA 3MWGA 4C43A 1NUPA 2BFFA 4D4KA 4HEHA 3W8EA 2PUJA 2EKZA 4KXVA 2JCGA 4G5SA 3VU0A 1USUA 1L5HB 4KPEC 5ICEA 1C5KA 4Q16A 3TK1A 2GZ2A 4TQAA 3A28A 2Y1LA 4K9LA 1LPNA 2FMHA 3W8RA 4ZTUB 1VYTA 4FE3A 3I28A 4PSDA 1J7KA 4QUEA 2ENUA 2LGWA 3QY9A 1WTCA 4ETNA 4IOMA 3BJMA 2ZTSA 2ISCA 3MRTA 4M4SA 2QIOA 1DQSA 2QLLA 4F11A 1VHQA 3WZ2A 3LHDA 4GNRA 1YC2A 3LGSA 1H8EG 1CU1A 2JGFA 3N8KA 1IXRC 4B2LA 1BQ3A 2XMDA 2Q41A 1ZWIC 1ZH2A 3OUFA 4MO2A 3VOAA 1C2YA 1ZVVA 4OJKA 6REQA 1NI8A 3I92A 1X59A 2AOUA 3VR6H 5BSTA 4QREA 1GPBA 1QU7A 5K6AC 5A04A 3LSUA 2VXBA 5AK6A 1OLXA 1XAJA 1JEOA 1HL3A 3AHHA 1VQ5V 5IT9N 1NOKA 3MMNA 3GDWA 4JN6B 1SY7A 5GOTA 3QVLA 3WDSA 3OJ0A 3CCEV 3A6FA 2WINI 1TF5A 1G8HA 1NGSA 4I9FA 4KAJA 2EATA 1FLVA 4BBZA 5EIOA 3Q7TA 2P69A 5EKDA 3PXXA 1KMIY 4W1QA 3VNAA 4BIUA 1HDIA 5ER6A 2CLKB 1Y3DE 2CN1A 1UAAA 2HJDA 3KJFA 3HXLA 3OZVA 1C9MA 1AK2A 3HL0A 4AJEA 1MOZA 2JAUA 2EINB 1AJPA 4KPGA 3O8RA 4MXDA 5F7JA 2GYUA 4M22A 4PIVA 2QWNB 2DMXA 2D1TA 3B3AA 4AJOA 2P7HA 1R6VA 2P0AA 3KG2A 2HM7A 4OX9B 1L4KA 3QUCA 1PJTA 4EM6A 2BLLA 5KMGB 2O7SA 2OWDA 2TMGA 3W9YA 4RV9A 1E2FA 4CKBB 2Q69A 4F5DA 3H1TA 4O2AF 1EHCA 4ARBA 4EITA 1A7JA 3GNSA 3PFFA 2ZAGA 3OFVA 4RK0A 2KWIA 5AVZA 3W3AA 4TMVA 1FXKB 2W6JD 1T1IA 5J5VA 2ORVA 1ODKA 1INLA 3PS9A 4ENTA 1D7AA 3R24A 2I65A 2E4WA 3DBLB 2FQQA 1YFJA 2X5JO 3KB6A 4XWGA 4BTLA 3RFTA 3ET5A 2GM9A 2QJ1A 4R31A 4FI3F 1YB5A 2ECPA 4BO0A 1S3SA 4L5BA 1AA9A 1C1YA 1DWQA 2XNHA 3SKXA 4AT1A 2EXXA 3OP4A 2GK4A 2X6QA 3MCAA 4ZCQA 1AJNA 4FI3C 2EWWA 1E0AA 2A0FA 3JU3A 1RAAA 1IB6A 1IE3A 3KSMA 1VJGA 1EPUA 6LDHA 4G84A 1PZEA 4MV7A 2A9RA 1M0EA 3WGHA 2WWHA 2PLAA 4EAAA 2RHTA 2HQRA 1U4OA 3GJ4A 1VA5A 1L1QA 3I83A 1AV7A 3DEZA 4JI0O 3O65A 2BGWA 4QBGB 1JXOA 1M2FA 1DAHA 4HVTA 4HVLA 4NBRA 3MG9A 2QSJA 3VH1A 3IJ4A 3BXZA 1KPHA 4O3FA 3FCXA 3RUEA 2JFYA 5JYDA 4RDXA 4OBEA 1P1JA 3KR2A 3NO4A 2VJKA 1GLVA 4NBWA 1NJ2A 3B6IA 4TXJA 3RJZA 4NV0A 3GVIA 2YIVX 3EMBA 5ALGA 4GYKA 4YIPA 4BC0A 2H00A 1KK3A 4MRNA 1U04A 5G4LA 3QWAA 1LFAA 3NUZA 3B77A 2Y71A 2PSDA 2HA4A 2CLEB 3U44B 2CKMA 4QG3A 1ZH8A 3JSXA 4UBIA 1WB4A 3V1KA 2NLOA 1YFKA 4OUDA 4YMSA 4UQOA 4DYVA 2RDCA 1R88A 2D62A 3PFWO 1I10A 3D43A 3C3JA 2H0AA 5A71A 3N59A 4L4YA 2OGTA 1BCRB 3RVZA 5WRFA 1J22A 1OWNA 1SUEA 4U9UA 1OFTA 1SJ9A 3BN3A 5AXBA 1NOIA 5FPOA 4FR2A 1P4JA 2J67A 3K8QA 4G4IA 2BKUA 2O0JA 1PL6A 4B4WA 4FM1A 1KDTA 2QVCA 5GVSA 1GRNA 2B30A 2WDZA 2VP3A 1H8ED 1PUXA 4LH7A 1Z08A 1CLEA 2NVUA 1B6RA 4UHCA 3MN1A 3OGIB 1TZ2A 3H42B 3SZ3A 4N3GA 4C6TA 3VVCA 3PA8A 5BXZA 1QHSA 5JS8A 4RELA 3ASZA 3UFXA 2OKCA 1QYWA 1GPWB 1TOAA 2FE1A 3WXBA 3I9KA 4OWPB 3LYUA 5ADWA 1UL1X 3ROZA 3G0GA 3TO5A 3VHQA 5EJEA 1DQYA 1AKRA 5HOQA 2Q6TA 5BN1A 4AX8A 3FTDA 5F12A 4CDNA 3RH0A 1V5WA 1IDSA 2C83A 3QITA 1FMFA 4B79A 2ZS8A 3EZXA 1WU7A 5BMVF 2OXTA 4FMTA 3NVAA 4GLLA 2YQ4A 3MWDA 3PKZA 4ZO9A 4LDAA 5T4FA 4UBMA 1KRXA 4R40A 3K59A 2FTKE 2AQHA 4O1HA 2W2VA 4OQEA 3D36C 4JEUA 1KJZA 2BIFA 1EQ2A 1HT3A 2Q28A 1ADFA 1O89A 4F96A 3PQEA 5IPFA 3TCKA 4EHIA 2GM5A 3H86A 1QU2A 3V7UA 2X2PA 4JJIA 1HZJA 3BGVA 4MI9A 1UDAA 3P9ZA 2NM0A 4MR9B 3AUSA 2ODNA 5H68A 2PMEA 4O08A 1WAZA 1N5MA 4JF3A 4LFAB 1MR3F 3UPUA 4I43B 1A5ZA 1RHJA 2A7WA 3L40A 2ONYA 2DUNA 1TVCA 2COKA 3ZNPA 4FMDB 4N5HX 4ILGC 2IPNA 1AVMA 1UT5A 2C4WA 1W0JA 2YIBA 1QHEA 4A23A 1ZXXA 1U2SA 1V8FA 4C21A 3VM6A 3BK7A 1T43A 3NU1A 5DGDA 3IFSA 3OEED 1SUDA 5FA5A 1QO7A 4AN4A 1IOZA 1GA6A 3FTNA 5DYIA 4ZZ0A 2WR8A 3LNTA 1U6KA 2BE9A 1GMGA 4BEBA 3FXAA 5EZYF 2PH5A 1RJWA 2H1VA 4O4IA 3MOGA 1ILWA 3ZDEA 3H6KA 3H2ZA 5FO0A 3TW8A 2PMFA 3G4SV 3AVYA 3K0CA 4DL9A 2IYVA 4D4HA 3E1SA 1OU0A 4L22A 4QUJA 4XX1A 1BSVA 4QU9A 2HVVA 1U3DA 4HX9A 5FV4A 3H9JA 3TZBA 3KAPA 4PM4A 4Q9DA 5HIMA 4ON9A 5DBOA 3O2NA 5CX1A 2HFKA 2C7VA 1XZNA 3IOBA 1E1QD 3DV0B 1V3TA 4OL0A 2YIMA 4CIVA 5EXSA 4H59A 4HH4A 4YJHB 1A9XB 1VLQA 3TXAA 2PTGA 3H9UA 5AM1A 4RHXA 1FNNA 4IOJA 4Q3KA 2IXBA 3QELA 1Q20A 4JA2A 4XYGA 4QM7A 2RPZA 1FRNA 1NZ6A 3RK4A 3B20A 3CSSA 2NSLA 5DPMA 3VZQA 1Q1AA 1G42A 1UOOA 2KKSA 2Z9CA 2YVAA 1GSOA 3WYCA 3VR4A 4QLAA 2OG4A 4ISCA 3O4GA 3VJKA 4G0ZA 1V55C 1HTTA 1XVVA 4M1TA 4B6EA 2Q6AA 4UDXX 3U3MA 1S8AA 3RUHA 1ZITA 4LXHA 4GYWA 3A9TA 3W7BA 4EY8A 2JGIA 3V4OA 3KETA 4MW1A 3OCXA 4LZPA 3ASOC 3VKGA 1E6CA 2Y27A 3DLAA 5E1OA 1XDZA 2X22A 2RAUA 1NASA 4GYJA 4EIWA 3ICPA 4NV1A 1UADA 1NW9B 2R68A 4NBSA 5BN3A 3BX1A 3ZGXA 2FWIA 4KIFA 5A02A 1G7SA 1XI1A 5CB6A 3WLFA 1OT3A 1IBKO 4DXDA 3D3EA 4F93B 3CR3C 4LNUA 1H1LB 4C78A 5C7OO 4UTZA 2PUGA 2F3QA 2FDRA 4B9AA 1KAOA 5AI0A 4YJ2A 5CFNA 3CEJA 1ZD3A 1G66A 4UDNA 4Q7JB 4BB5A 1W8DA 3LLUA 1KQOA 2ZSEA 2WWFA 3B5EA 3VOUA 2QS9A 2HMSA 1RM3A 5A0TA 2YMPA 3DYIA 2B0JA 1R27A 3P0EA 4YXFA 1ISIA 4H13B 4Q21A 1EUCA 5IT9A 2HRQA 3AR6A 3K1AB 1YHYA 3UYKA 4KQXA 4KQ1A 2FHPA 4DZTA 3CUSA 4DR5O 1TC1A 1TUIA 2V7TA 1DPGA 2CJPA 1S8OA 2QAGA 2AE1A 3R09A 1B6SA 4MKFA 4KXXA 3M49A 1F9EA 1VLMA 3ZX6A 4QLOA 4K8XA 4G1FA 2EV9A 3HJUA 1EZVH 1R6KA 2XZDA 3N2ZB 4RVSA 3ESYA 1J0DA 3TRJA 3DKVA 5KDDA 3HR0A 2VWQA 2VJPA 1FW6A 3TZKA 3I72A 2IKSA 2JFVA 5FBVB 5JPIA 2PXCA 4GX0A 1YZQA 1W1UA 1S7CA 1GPNA 2H8GA 4E2FA 3AG2B 3F97A 3JVIA 4GVLA 4DFDA 3ZGNA 4CC5A 5J4VA 4QYSA 5L3QB 3CONA 2IV3A 1UJ2A 1XZBA 3A58B 4MRAA 5LDDC 3P9XA 4X8HA 4G5OA 5HPYB 3NXSA 1O5IA 1QGZA 5BWCA 1EM1A 1K5HA 1GPUA 5FUWA 4G0MA 2HLDG 3C14C 3T7TA 6GPBA 5KYKA 5HP4A 2B94A 4X1YA 1V54C 2GCPA 3U3DA 1X80B 2ZR3A 1R3UA 2JDID 3CKKA 1GAQA 1P31A 1K92A 3DFIA 3H0EA 1BMFG 4GFDA 4HQKA 4F3TA 1R0RE 4NYJR 1U1GA 3UMFA 1COZA 4D4JA 4H2DA 4Y0AA 4LC5A 4MVZA 3PFCA 1GFSA 3WVNA 3BJRA 3IQFA 1S2OA 1GT6A 4JLJA 4C0SA 1BOFA 3OCZA 1IURA 4FOLA 1DAGA 1M7BA 2JHGA 2Y3IA 1XMOB 1Q3EA 1IWBB 2PYZA 3FJ1A 3EQ9A 3EX7C 1AB3A 1Z6QA 1LLUA 3PF9A 5KHJA 2CVQA 3V48A 3K9SA 3N07A 3L73H 3O4IA 3I23A 5CFMA 4LK2A 4ZVLA 3I5DA 3KTDA 2QX6A 2UXCB 3CE6A 1QRRA 5K2OA 4PQFA 1M8FA 1WHTA 1KE1A 1GRRA 1YBMA 1CHNA 1SXHA 4IS3A 3WGVA 4GR9A 3V9AA 4N9QA 1G6UA 3LMKA 4MEAA 1A88A 1FF9A 3R1IA 3EEBA 4FILA 2AR9A 3ADCA 3LHSA 2Q7EA 2Q50A 4BJ1A 3FKSA 2FG6C 5I45A 3B09A 4ZVQA 2GPYA 4A2QA 5FHRA 3T3HA 5TMPA 4S1VA 4UBNA 3FSGA 3SXUB 2QTCA 4X3OA 1PG2A 1CLUA 4Y18A 5AOAA 3ZQJA 3ABMB 4LI3X 5IYZA 1SQGA 4Q47A 4LP8A 1JQBA 4ARUA 1G17A 4PIMA 2YV1A 4QX6A 1WMBA 5KOJB 1C2TA 2M9MA 5JOQA 4JZGA 4BMOB 4BPRA 2W42A 1CUWA 4ND8B 1Y6FA 4RFSB 1E5XA 1QV7A 1YRYE 4N5NA 5T57A 3FNGA 1XQVA 1U7HA 3RF6A 4BNKA 1IBSA 3GA0A 3A7DA 1K7FB 1UMDB 1GNRA 2ADPA 2NZUG 5BR4A 1BHJA 4I5EA 4Z2YA 1J90A 1MF7A 3PGXA 4XFDA 5TPZA 2PLNA 1C9NA 5TMBA 4NMMA 2IOHA 5CVDA 2HCRA 3E9NA 1SUIA 3R9XB 2DQYA 5DIFA 4OXRA 1KKCA 1UM8A 3L1JA 3TIGA 2GZSA 1W5EA 3P1JA 4OYHA 1N3LA 1NBAA 1U8YA 3AXTA 5TQ0A 3HVIA 3TZHA 4BIZA 2YWJA 1ZJYA 1ZSYA 4DA7A 4UMFA 4TS9A 1VKJA 3OIGA 4IIGA 3K58A 2GPNA 4IT5A 2J3HA 3MLBA 2UYOA 4L5JA 5A4DA 4JT2A 3F2VA 5B1IA 4NU0A 4EGSA 5DIZA 1O4WA 1TAEA 3AERB 3H2YA 3AIKA 1L1RA 3I1YA 4MQ4A 4EEXA 3GJ5A 5H5JA 2G1PA 2JK1A 2CY0A 1XR3A 1F51E 1R9JA 4UREA 4UU7A 2G77B 5B3SC 3J81k 4DREA 3OTHA 5FI5A 4IGEA 2ID7A 2A3QA 4DN6A 1EFPB 1C0KA 1K89A 3IDSA 2PLRA 4TWRA 3QMPA 3CN7A 1G9XA 1BAPA 2CH7A 4PGFA 1VP9A 4N7MA 5FAXA 5LHIA 4OK6A 1GTL1 1GGMA 2ECQA 1PR0A 3H2JA 1OX7A 2Z57A 1WB6A 3QVUA 5JNWA 3HA2A 2BUCA 4H17A 2ZSDA 4P3KA 2HLDD 3UJPA 4IDHA 4AS1A 4Y6OA 1PQWA 4AO7A 2D2VA 3RYHB 5FP0A 1JEYB 2P67A 2GPSA 3A4LA 3L05A 4B44A 3VHRA 4A8PA 3GG2A 1VCHA 2WMDA 2Z98A 4DK1A 3P0FA 2E9SA 4U5QA 3KOWA 2L18A 4QDOA 4UBKA 2EYUA 4Q39A 4A10A 4NJEA 5KOIA 2VP0A 3IX7A 4RY0A 3HCBA 3VAYA 2QN3A 2YCBA 2QMQA 5CU7A 3LI2A 3GCGA 1AQYA 3TFQA 4CQMA 4EW3A 3ZV6A 3JSNA 3CFYA 4CEHB 5GONB 5HZGA 4JNKA 4ZAWA 3IO3A 2C4KA 4IZHA 1C7FA 4JBIA 4N0MA 2VKQA 4ZHQF 3EPHA 2HV9A 3QX7A 2J5XA 4DV7B 2I4NA 2JFFA 1VTKA 3TW6A 5IAAA 2W0SA 4CLDA 2QTGA 1JR3E 3ZLUA 2ZIUB 4IDPA 5UKDA 3A1SA 4D9GA 3EISA 3GN1A 5TB5A 5G3YA 3EXEA 4YR7A 3BSYA 5E1BA 1RPOA 2B3TA 1TMKA 3ZBQA 3TGWA 1FSGA 2QPTA 3A05A 4LOIA 3EGDB 4G0QA 4AB1A 4QQRA 1PV0A 1O4VA 5IF9A 2BI8A 4P7GA 3MYYA 3ZC3A 1PX0A 2CE2X 5KQMA 4MWBA 2C20A 2YC2C 2MR5A 3O95A 3PQFA 1VMEA 3I09A 2OBYA 3TI9A 1TEZA 3VZPA 3TGLA 2C5FA 2XQIA 3N6RA 1Y7HA 5G0UA 2I22A 3UUWA 2FMIA 3NJ4A 2H29A 4ZQEA 3LRPA 2GB4A 4OXYA 1DF5A 5LD2C 2IHJA 3SF8B 5BUZA 3S5UA 1RHUA 4OPAA 3HU1A 4AG3A 1WY5A 2B4KA 5IHPA 9MHTA 5E4TA 5K3FB 3WA7A 1QS0B 4XGQA 2I29A 4RAOA 2B83A 2OUIA 5K3DA 1HGXA 2Q2OA 1KGDA 4YO7A 3K0KA 3L43A 3EBOA 3QM1A 1V26A 4N7BA 2SCUB 2JRCA 4CCYA 1E1CA 3BUSA 2LUOA 1RBQA 2GKGA 4NKGB 4BX3A 4AL4A 2ZSIA 3IAS1 3ZXYA 1SBYA 1D7OA 2R5FA 3OWHA 1FNSA 3IBFA 1PGOA 4C4YA 1SHTX 3FNIA 4P54A 4KU4A 3ER6A 5GM1A 2ZRDA 1S2LA 3K72B 3QBJA 4NDAA 2NU9B 2IP2A 2WF6A 1XCJA 5HYVA 1VKRA 1LLDA 2ZJFA 3K0FB 5A3QA 1PG0A 5AK3A 2UXXA 1FRVA 2XE8A 2RHHA 4KREA 3HO1A 3F5MA 4WHMA 1H05A 2PWPA 3FZYA 1FS6A 3MUNA 4IMJB 2V98A 3EUFA 3S40A 3CE2A 5TARA 1NQWA 1C0EA 3P20A 4QRHA 2LGQA 4BNWA 3PNYA 3C3DA 4BJHB 2PWAA 4KLAA 2AN5A 1DT5A 3F6EX 1UFRA 1WM1A 1O87A 4DRXB 1JKIA 1R73A 4Y0VA 4TT3G 2J3LA 2EIHA 4LCNA 5JI2E 3LCMA 2IYSA 3TLMA 4J9VA 3EMVA 2ZWAA 1FUUA 3GDOA 4DA6A 3AEXA 4E94A 1NTKH 1BCSA 3QMVA 5B6IA 4BXOB 2HU5A 1GZDA 1IJEA 4I66A 2JGJA 3M8AA 3BH7A 4N12A 2CK3G 4IIYA 1WN7A 4H4DA 2GJ8A 4G4SP 4YROA 1C8LA 1VSQA 1PV4A 4N54A 1F2TA 1EGMB 4YCBA 5CDTA 2R6HA 1XEAA 4XTRA 1OJLA 4WFQA 5TJ9A 5JJCA 2P30A 1JQEA 1KJ8A 2JATA 3CRCA 3DMYA 3IVAA 2PX4A 4DNPA 3PC6A 5LA6B 4J2OA 3SJZA 5B58T 1QR8A 1NT2B 3GIWA 3TD6A 1FTWA 1RI5A 2FNAA 1G3RA 2ZCUA 1AGPA 2CB0A 2V4ZA 4C2AA 5C4IA 3IT2A 3H19A 2CJFA 3IBYA 2Y6UA 1Y4ZA 5ALXA 5CA1A 4BMPB 3A14A 4MKXA 3ZWYA 5EIBD 1XTRA 1BJRE 2GN0A 2UZ0A 1E3DA 1P7VA 3FMGA 3LT5A 4MQ5A 3RIXA 4B2IA 2NNWB 4UZFA 4OHYA 3EG9A 1M2VB 3SBOA 3ZWNA 1J8MF 1QQAA 4IDOA 3VAAA 3NDJA 1OV4A 1SC3A 1E2HA 1XDBA 3PU6A 4EB0A 3FCEA 4GQAA 2QGZA 1JR2A 1Y5NA 4MQFA 1FL9A 5F64A 3W2EA 5JTTA 4J0HA 3FB7C 4DNXA 5A05A 5LN1A 3L8EA 2SICE 3D8HA 5KX5B 3O93A 1RI3A 4F7DA 4K9SA 1T5SA 4H7IA 1MPXA 4G67A 2A5DA 2CMGA 1QP8A 1YBVA 4J41A 4OFXA 5BY1A 4LBWA 2FOXA 4MT8A 3RVMA 4MZXA 1L7OA 4WRRA 2G17A 4L95C 4RYLA 1R00A 3VYVA 5EQTA 4IXTA 1G63A 2ZYIA 3ZE1B 2ZRPA 1W0KG 1CRWG 2KB0A 4C6HA 4RETA 3HRHA 5D86A 2QN9A 1PWXA 3M5WA 5F5LA 3RSCA 2EBHX 1IUOA 3WK5A 2W2MA 3U3XA 1ZNXA 5ITWA 1T6YA 1Z5ZA 2OHOA 3WZLA 2G9VA 3LQKA 1ZZEA 1N8SA 4C0LA 2VH1A 2YJZA 2UZ3A 4LOLA 2JGUA 4BS9A 1K8AW 1VL6A 5FJIA 2NU8A 4P53A 5DN6D 4OCLB 1XBLA 3CR7A 1QTRA 1SH7A 5JSHA 3BGWA 3WL6A 3WIBA 1SEVA 5AKEA 2QR4A 1Z2NX 3L7OA 3SCZA 4CS2A 3W6OA 5FWNA 3OOHA 5B7GA 3CX4A 3FFQA 3ND9A 5ADHA 2V7GA 4PZ9A 4QNRA 2RQ6A 5CTJA 1K8ZB 2QLFA 3NHLA 5A7HA 1RTTA 4MUEA 5LLSA 4IGGA 2IYFA 3ABRB 4XX0B 2V7BA 4OYLA 4LG1A 1U3GA 2AGAA 1TECE 3I55V 1F8GA 2C97A 2FRXA 5IX8A 3S29A 2FJ0A 2E37A 2AFIA 3UAYA 3OTGA 1X70A 3BMCA 4R4JA 5DNYB 2VTEA 1HNWO 1NOJA 4L5CA 1Q1QA 1Z82A 5K4AA 2RK6A 3NAMA 3ABZA 4Q7QA 1Z4LA 4O3MA 1FFEA 4GXRA 3JATA 1JAYA 4D3XA 2IBSA 4IHJB 1EDDA 2ZJ3A 3B6ZA 3AIOA 2O5EA 5GZ3A 3GFBA 1LLCA 1E8NA 5K03A 3FCAA 1P19A 2ZUWA 4DARA 4L57A 2XWBF 5IM4F 4LWPA 4CMAA 2JIZG 1WULS 1UAYA 1XA4A 2JHAA 2VHVA 3N5CA 4GBED 4RVUA 4XQ9A 4YP6A 4X6YA 3C24A 4YUWA 4AYWA 2QR5A 3LPAA 1SC4A 1V43A 2B8TA 4YP1A 3RC9A 3BRWA 4B09A 2W4QA 1NP6A 2OHXA 2V54A 2RAPA 1T6BY 4FNMA 1COWD 4HDMA 2IXGA 2HWWA 2Y69B 2PY5A 5ALRA 1ZM4A 4MRSA 1P4SA 1CJMA 4UD6A 2Y8EA 4IUBS 3EPJA 1Q7RA 3V34A 4FR0A 2IVFA 1VCOA 1JLKA 3KV3O 2OXFA 4F3RA 4HTFB 3K9BA 3A7EA 2OTJV 5ALUA 1DSSG 3TLGB 4WIFA 2UUPA 3E5MA 3CJTA 1PQYA 1XTBA 1OZFA 2HTFA 1Z4JA 2QM7A 2LDXA 2SHKA 1I5EA 1E60A 3T5GA 2D5LA 2RSLA 4LZNA 4L9WA 4DLRA 4J16A 4Q93A 4YALA 4DV3O 3VPSA 1NIPA 3EH1A 4TLDA 1ZFNA 3WKAA 2PUHA 1IXSB 3N8DA 3D6VA 2XTAA 2C2GA 1M6WA 1ZC3A 3ZGZA 5JNRA 3CVWA 5I9NA 3F1KA 5IXSA 3GZ4A 5C8YB 4UCWA 3DEAA 3WMWA 4HH0A 2VK1A 2RHBA 5JYBA 1J99A 3BAZA 3DAGA 1WQ4A 1KJYA 1CXZA 2JLRA 4F2HA 2CNNA 1EK5A 3ETEA 1R0XA 4ETIA 4GXTA 2NAFA 4JLPA 4TS3A 3NHAA 4YAWA 4BTEA 3AFIA 4AMGA 1YJBA 1XLTC 3QKRB 1M56B 2HQOA 1I0LA 4R05A 3BFKA 2IPLA 2VYVA 1U3CA 2NQ8A 1NNEA 4G0XA 3E70C 3C7DB 4YAFA 5CA0A 3O5AA 1K3UB 3HY6A 3U62A 4TYQA 3QWIA 4EFLA 4A36A 1P7ZA 4ZO6A 2Q4TA 4DLTA 3LO8A 1NFFA 1N0HA 1YB2A 2D5BA 4BECA 2EJRA 2PGGA 2VSFA 3F6SA 4KR3A 3NYRA 3ZWBA 3GH3A 5EIBC 3PC2A 1C7EA 5EP2A 4FYXA 4HDAA 3Q5DA 4G01B 3ZLJA 2OD7A 3NV7A 4HKTA 4I81A 4DQ0A 3QUAA 4B8ZA 4Y2SA 4UVBA 4HYQA 3MCVA 4KE6A 2ZWVA 4A6PA 4XGIA 1WG8A 1C3VA 5DWVA 5IC5A 3KZXA 2ZLBA 3P9CA 2Q3HA 4JEMA 4TVKA 4QPCA 1AXEA 1QH9A 4KYVA 4NZYA 1R4MA 3DFZA 4ZYLA 5JWRA 1MC8A 3ZX5A 1PJAA 1FUKA 3KFLA 2A30A 3B2QA 1JVMA 2F8MA 1H3EA 2FDCA 3ETLA 3MCUA 1Z2DA 3DVAA 1XFAA 1J42A 2EBFX 1XPJA 5C7IO 4TXLA 4YT2A 2CWWA 2D3OW 5C9ZA 3SM9A 1NW3A 2P5UA 1TD1A 3ZDQA 3I2GA 3C48A 3CNLA 2ILMA 4PD4F 1RVV1 2WD8A 2QX9A 3R23A 5JC1A 2OV1A 2FUG1 2JK5C 3VTAA 1Q1BA 2GFQA 1RC8A 2JI4A 4FJ2A 4F2WA 4BO8A 3WMEA 1LBHA 3WDLA 1T36A 1WRBA 5KKAA 4N01A 3SPHA 1HEUA 1P17A 1N0WA 2F1KA 2SKEA 3E9DA 1HOXA 2HA3A 3BMNA 4XWOA 1Z22A 2CV1A 2RCYA 4LDNA 4DV0O 4KVGA 4BVJA 4CLXA 3M7MX 4KOAA 2GEFA 2BDUA 4DXHA 3HA7A 4UE6A 2X3UA 2AN9A 1MEEA 2GKOA 4NMWA 4BIOA 3O6VA 2FWRA 4ZI7F 5EQJB 2YDYA 4INZA 2H54A 2O8DA 1DTWB 2AKEA 1H0KA 1BHSA 3CWZA 1BHO1 4ACAA 3MMXA 4Q5IA 2PF4E 4GMHA 3OZIA 4MS3A 5CGQB 4AZ3B 4JY7A 1HQYE 3K0DA 5J4YA 2IZ1A 4KXYA 1HT0A 4F5ZA 2C96A 1IX9A 2B8WA 5J2UB 2AMLA 3CVUA 3BHIA 2B3ZA 3OF3A 4B74A 1Y8RB 3OIDA 2Z6VA 5DYGA 1WB8A 1VMKA 2ZQZA 4TM7A 5HJEA 5J43A 4Y2HA 3IEPA 1VXOA 5JFTA 5MDHA 1DV1A 2AFHE 4UDYX 3TNJA 4MUGA 3EZ2A 2W4LA 3IXLA 2W6JG 5AK4A 4ZYTA 1BWRA 2XA9A 1BWSA 1K4CC 4Z4HA 1FMTA 1Z2EA 4J03A 4H37A 3BREA 4OHVA 1C14A 1TU0A 3A6ZA 2PYDA 3NM6B 3KWFA 4RX1A 4PFKA 1N2JA 4Y2YA 2BMVA 1KZ1A 2J8ZA 2ECFA 2F00A 1UBNA 2IY9A 4DNQA 4L4XA 2NXEA 4JCOA 3E83A 3SHWA 3QVVA 5ED4A 1BSMA 2IYWA 1QQCA 3B13B 3SVTA 4Q4JA 3DM9B 4RQUA 2WQ7A 3TTYA 1M5IA 1MNAA 3EXAA 4R81A 4OQPA 4A8TA 3KBBA 4HLUC 5LM3A 1DBQA 2BSAA 4BV3A 1QF7A 5B1DA 3L9DA 1ISHA 1JN0A 1OIXA 1RYBA 2B3DA 4B7CA 2VUIB 4R1MA 1V3UA 5BZBA 1K0UA 4F4JA 1VE7A 3JWEA 1XD8A 4IJQA 4Q9IA 4D9EA 4PFQA 4XM2A 2YASA 5EXPA 2WJ6A 3HACA 1XOUA 3A4NA 4JJEA 4G4SO 3O3NB 4HWRA 4JROA 2FOLA 3MB5A 3EGXA 3DZ8A 1VLJA 3LSQA 4J1NA 3V80A 4DC9A 4D6TH 1J0CA 1GV0A 1SVNA 4CNQA 4G1VA 4CH5A 1IG0A 4ZI3A 4TPKA 3D6FA 2AC2A 4F9FA 1YK0A 1GZSA 3ZRWB 1ZL0A 1QRAA 5J4LA 3L6EA 1YZTA 3NLLA 1UXKA 1GM8A 1KARA 4MS4B 4UM9B 2ZUCA 4IHAA 2YVQA 1LX7A 2IDJA 1RLTA 1XDSA 3V1TC 4M8LA 4DV2O 2Y2UA 2WWIA 1TM5E 3QLTA 4HDKB 2C3OA 1TM3E 5JEEA 1S4MA 3WJ1A 1TQHA 3DEYX 3N2KB 4JLUA 1XDUA 4QPDA 4OK5A 4GW3A 5CEEA 3VYSB 3JYPA 2ECKA 2J31A 4OCMA 3G2OA 1DRWA 3SKVA 4TSFD 2G08A 3F71A 2QTRA 4C88A 1BXRA 4O1MA 4X93A 3F8TA 4ARIA 2AFRA 4KWEA 4HLQB 1QXSA 1M54A 3V42A 1ICEA 4I4LA 1QZZA 5DT9A 1AUVA 2YFQA 1E2NA 1O5TA 2P2CA 1EUQA 4GCZA 5KNDA 2HU2A 4NEGA 2PK3A 2J5RA 3IE0A 4N9WA 5FBKA 1IU9A 4M8NE 4RESA 4E0BA 1EAYA 2VI5A 2DWCA 1P29A 3GVCA 3L6UA 4KIGA 1VYVA 5C1BA 5BQ5A 5BWNA 4M9XA 1TVEA 1SOAA 4BAGA 1AO3A 3HP4A 2C04A 1ZJ5A 4ALKA 2NO4A 2VSXA 3RDPA 3VNBA 3ZY6A 4HQFA 1BFDA 4NZNA 3U19A 1T2AA 3QFCA 2BEWA 3S2YA 5D1NA 1Y6JA 4CE6A 3KE8A 3T5MA 4DWWA 1HYGA 1LQUA 5PNTA 5EL0A 2PBZA 5D2CA 4RTPA 3LP8A 1ITZA 3SJUA 4OHMA 3AV0B 1P3DA 5DCLA 1AHIA 1POXA 2FVXA 3JX9A 2EW1A 1CEXA 1E2KA 5A03A 2DQ0A 4NHEA 2RMKA 1KI7A 3NWOA 3IHWA 3BF8A 5ALQA 2OO5A 1FFSA 1UOEA 3NTUA 2IHBA 3G7NA 4R8VA 2XKJE 3SAJA 2AKAB 6YASA 1UQRA 4OMCA 2IHVA 2O19A 2HMWA 1RKVA 3SHFA 1RPTA 1IB0A 3AP2A 3WMGA 4P7JA 5LZ5A 1NSTA 2OAEA 1WCIA 1T9GS 4JP5A 2GCEA 1NJGA 4CMHA 3GMDA 3ML0A 1RWXA 4RF3A 1W5SA 2JKVA 4UAUA 2CFCA 3R8XA 4AQDA 1CS0A 4Y6PA 3V7WA 3RE1A 3D6NB 1XZDA 4LYHA 3OEEG 5A4IS 2HFEC 2P1ZA 2RCNA 5FPRA 2V65A 2W22A 1N6LA 1GDDA 3EZ9A 1R5XA 2QLCA 2W8BB 1A50B 1A98A 1CDOA 4BVEA 4W99A 5JHHB 2PT5A 3G13A 3K5OA 4G1UC 1WMAA 3TJMA 1AHPA 5DTMA 4EFDA 1LBEA 1THGA 9LDBA 3HPQA 3C6BA 3UB2A 3U60B 5HOEA 1JXMA 2YZGA 1DRVA 4UOEA 4I3GA 4QSMA 1VGVA 5TPWA 5HRAA 2VJNA 1XLWA 4C4AA 3A70A 3IR5A 4E15A 2R9VA 4R6WA 4DIBA 2BTQA 3BGIA 4C2BA 1E1QG 3BOSA 2JH9A 3KZMA 3TOVA 5I9LA 3P5SA 3KT3A 2H7CA 2HO5A 3DLPX 3UQYS 3GUUA 3CRAA 4PQEA 4GGOA 2JCVA 3GFRA 1DUIA 3Q8KA 3NATA 2L6LA 1U7OA 5CDSA 4Z53A 1OV6A 4DW8A 2OBFA 3LY7A 5AI5A 5AJXA 2I4MA 1IOVA 4EB6B 2BYTA 4NCHA 1Q0LA 5J5CA 3CT4A 4IIDA 3HBAA 4HEJA 4RANA 1W44A 3G1WA 5KA6A 4IX1A 3L18A 4NMXB 4WFEA 3AO0B 3S7TA 3E15A 4JC8A 4Q3LA 5LSAA 4J91A 3VKWA 1WCV1 1VPVA 1U2DA 4EMBA 2GBLC 5ESWA 5JO0A 4PG8A 1CUYA 2GZ3A 3EX8A 4EA6A 2WFLA 4CTOA 4JZ2A 3NFRA 1RB7A 4TMWA 1AQ6A 1EUDB 4QZVA 4BQSA 5BOSB 5F98A 5G0TA 1SVUA 1OXMA 1OZGA 4EBFA 4Q34A 1D5NA 3EPPA 5CK5A 4BRZA 5D3KA 2CNWA 2HEIA 4HZ3A 3IRUA 5C51B 5D01A 4O63O 1QU3A 1WEHA 4CGYA 4NCNA 4Z5XA 4F6EA 2JZOA 1YVWA 2J9RA 1D4FA 1DBIA 3CVOA 1IAQA 3VSDA 5C3MA 2O8NA 4ZAYA 1SHLA 4KI0A 1DUSA 2OC4A 2BGTA 3TEMA 1YR2A 4Q00A 1UBKS 5BYKA 1H85A 2N75A 4YUAA 1QSGA 2IXDA 3MK31 5BV1A 1PFUA 1E18A 4M1YA 5CYFA 3COPA 4QPPA 1BD3A 1HKHA 5BMOA 4PHFA 3EQ6A 1C1XA 2A8NA 1E6WA 2A9OA 4MV8A 4BDSA 3QKUA 5JR3A 2OFPA 2Q7XA 3PC7A 4EUSA 1WCYA 2X3FA 3JAWA 1OAKA 4C1BA 4LE0A 4EQZA 2QWOB 2HPZA 1A9QA 2Y1WA 5GVRA 3GWZA 2LJ2A 1TU3A 4I9GA 4LF6O 4OREX 1OI2A 3VQVA 1MIOA 3O2SB 2Z6AA 1EWRA 1NN5A 3TQCA 1ZD8A 3KJHA 2WHEA 3C3EA 3G2IA 2R7KA 2IJHA 3SIRA 1GAWA 3LXXA 3L75H 5IYCO 3SMQA 2YBEA 5B1BB 3BFPA 1RMQA 5EUCA 4TROA 4WK4B 4LBEC 1M93A 3R3HA 4RVCA 1YHNA 1B8PA 3UG6A 3M6XA 4BATA 1ZLYA 3RANA 3X2QB 4JI3B 4N7JA 5LZ9A 1TT7A 4AKSA 5ICGA 2QD5A 3L0IB 3D0KA 4YCLA 2JDIG 4QE3A 4FMPA 3IODA 3BA6A 4ANFA 1MHTA 1QH8A 3OHMA 3FOEC 4CYMA 1ECCA 1W4CA 1SXJA 4X63A 4YCSA 2WPDA 4CM5A 3EBLA 1YUMA 4B3FX 4RQBA 2HVJC 4K1RA 2D4AA 3DL7A 1YZKA 3ROTA 1JQ5A 4I0WB 2Z0AA 4PRKA 1XTJA 2DQZA 4K2AA 4YHHB 5ALJA 1PJSA 3CEAA 1P7GA 4BBJA 4K6FA 2JJ2A 1RP7A 4N4AA 1JKXA 3DEFA 3GNTA 4S2EA 3N2GA 1C1DB 3L1UA 1JFLA 2AXQA 1WJGA 2W6ID 4ZVRA 4DC1A 3CUVA 2DBZA 2CL5A 1XVLA 3ZLVA 4H08A 4HRQA 1ZYUA 3ICEA 1M34A 2R65A 2ZUSA 2X15A 4BE4A 3ESBA 5FYQA 3OTFA 4MWEA 1TF7A 4A5OA 2AB0A 3ZWMA 4K6OA 4PPGA 4J8PA 3EXHB 2WG1A 2A1IA 4LHVA 2YMLA 5IZCA 3U4IA 1KA9H 5KJEA 4BQQA 3E1GA 1T24A 2B4AA 2PUAA 1JECA 1PL8A 2BKEA 4MTXA 1F5NA 4X8AA 3IKTA 5KA5A 3GPLA 5LKRA 2EF0A 1R6BX 4CMEC 2BMJA 4NBVA 3AHCA 5CAEB 5I4IA 1Z8DA 1OYWA 3OOSA 4ARZB 4NWIA 5M29A 4HFRA 2CXNA 5A4JA 3B6EA 2XMRA 1Q2XA 2FSFA 4EJMA 3TZEA 3TZLA 3COSA 2AFHB 2PKWA 1OX5A 4D46A 2C9DA 4TWBA 3OSZA 1Q5OA 3SYCA 3G0BA 2V6MA 4KFRA 1GKFA 3SYPA 6CHYA 2R48A 2HSZA 2PI5A 2QPAA 1VQPV 1G8KA 2R7LA 4B3RB 2XA2A 2KHZA 4Z86A 3EGIA 1UC9A 4OVKA 4ARVA 5DU2A 3Q87B 4I50F 1P62B 1W1IA 3BMOB 3T7JA 1YMUA 4PC6A 3MTGA 2YZMA 5DO9A 2F3PA 3U0BA 3MUEA 4EW2A 3PNMA 4ESVA 4PAGA 2WHYA 3LZDA 2ZRGA 4YP0A 1XPOA 1FPOA 3HM2A 3G8CA 4W8GA 3JCUZ 1ZIDA 4RABA 4GECA 2GEKA 1K97A 4X6XA 3DXZA 5FBZA 1FXWA 3EH2A 3N8IA 5FL7A 4HT3B 1GZHB 3LFHA 3VKVA 1VJ1A 3VDXA 1X1TA 5I4BA 2JBHA 4DK0A 1SNYA 3IKVA 1GUYA 1GQFA 1NMSA 1Z4MA 1YJXA 2QRVA 4RJLA 1WMEA 2GBIA 1LF0A 2PS9A 4U5XA 3DT6A 4C7MA 3ICVA 3DZBA 3AYXB 1F5SA 4EDHA 2P7TC 4JD5A 3JQAD 3WC4A 5KYWB 1XWFA 2QP9X 3H99A 5A5VA 3R5KA 1YACA 2G63A 4XR4A 1C29B 4C0QC 2QMZA 4G5XA 5FOUA 4ZD6A 5MHTA 1AN0A 3T1YO 3RTBA 2G0NA 2GMWA 1G4YB 4GM4A 4HX5A 3IUYA 2ZI9A 2A5GA 3NNSA 1O96A 1N92A 4Q3BA 5JCJA 3B7PA 2CNOA 4Z99A 5REQA 5ICSA 1XMQB 2N9UA 2DPHA 1PF7E 1R0CA 1UKAA 1XMVA 1U3UA 2I6XA 3H5NA 1CFJA 4EZEA 2KS6A 1U8XX 2FW0A 5ELMA 5BSMA 3MQ2A 3GB9A 4B1FA 1Z39A 2R1ZA 3FKJA 5FPPA 4K6MA 1PCXA 5F35A 3R7WB 5E4YA 3WRVA 1OI4A 2ZULA 3FDXA 3TYXA 1VF6C 4YMIA 2EP7A 4XB2A 1VJDA 4BAUA 1JMYA 1JWBB 3WRWA 3IP1A 3I9NA 3JD4A 1UJ6A 2Q5CA 4K8OA 3IPAA 1D6MA 3EASA 3WGNA 4OA8A 4YAJA 2LW1A 1TKCA 1GZ3A 4PHZA 2NLJC 3FAVB 2XGGA 2JEZA 3UV6A 1XTIA 4GZRB 1T9GR 1DOZA 2Z8ZA 4I1VA 4AG6A 1TVKA 1B16A 4GE0A 2JLVA 5LU9A 5GV7A 4J9YB 2IY7A 4XWYA 1NRXA 1K68A 4LWSA 4FFBB 3DT8A 5BSEA 4BQIA 2QVXX 3CLKA 2XNDD 5K8UA 4C30A 1QBGA 3WGUA 4FEYA 3WI7A 1HDJA 3KQHA 3C3PA 4UULA 3CMCO 2WM8A 1WWKA 1U8AA 1NXSA 3SOZA 4MW5A 4HQNA 4J1QA 4AO8A 5IRCD 1J7JA 3RRYA 1KI2A 4GOJA 2QRGA 2XUHA 3I2YX 5JD5A 1FTQA 2G5GX 3W77A 3F9RA 5HZHA 2ORED 1KJQA 1DOAA 2H4WA 4BJ3A 4OGKA 3L1IA 4L5AA 4BX2A 2V4DA 2EX4A 1WA8B 1DIBA 4OCNA 1AS3A 2IZ5A 4GYCB 3O1HB 2HPHA 4U2CA 4G2KA 3GVXA 4B4UA 3D7LA 3MINB 4PHCA 2VUUA 1U0HC 1AB6A 1SIBE 3DZDA 3K9GA 1ORHA 5HFMA 5JCOC 1KFEB 1WA5A 3UHOA 1PW7A 4CH6A 5DK6A 4PFSA 5LMZA 1LK5A 2I7XA 1J2RA 2R79A 3ILVA 3TE6A 4NAVA 5F3RA 3SJCA 4ZFNA 1AUOA 4HGNA 1Y5MA 4A8JA 3LRXA 2VJQA 3K6KA 4NU6A 4S24A 3ZQ6A 3RVYA 1MVLA 1XDCA 1DG9A 1FMCA 3TUIC 4O6VA 2P9YA 3BULA 4JJZA 2BLNA 2NPIA 3NHYA 5BO5A 3PHLA 4R6ZA 4PZ0A 5IXYA 1B73A 1TAQA 3KQYA 1PUIA 1H3FA 1GQYA 2V1XA 1WNTA 1ND5A 4TYPA 5HILA 2VNIA 4OHXA 3IP7A 4Q9JA 2BH2A 2DWPA 1P9NA 1R3JC 2JGDB 4E30A 5FKJA 3OCCA 4UVDA 4FLXA 1IN1A 1G64A 3ZZMA 3VRHA 2QMEA 3VQWA 1JU4A 2ZDHA 3DW3X 3STTA 1T2VA 1LPAB 3N7UA 1VB3A 1UPUA 1MJ5A 4K9NA 1XTSA 1C8VB 2P41A 3Q7EA 4QODA 1EGHA 4MV1A 2EJWA 1WVMA 5GINE 5FNVB 3QTCA 4BNVA 1SOWA 5DSXA 3TLKA 3QOWA 3VU3A 5B1EA 3BC1A 4QHTA 4TZ0A 1Q1EA 2O7NA 3ZWAA 3VBCA 6REQB 5KVQA 3EPLA 1G5QA 1XCBA 2OC9A 1I24A 2AHYA 2JEXA 1J5EB 2FRDC 2OLEA 4CGZA 1N3IA 1N1EA 2C9YA 3CUYA 5A4MS 3K06A 1CZLA 2AOUB 2CYBA 3OM1A 2C7RA 1GR0A 3T0GA 2WLSA 3G2JA 5CDHA 4JV5O 4E2WA 1GNVA 2ZTHA 1R0KA 2C0QA 4OUKX 1BS1A 2GCOB 3NDIA 1VPDA 2W37A 1UJ4A 3JRXA 1PJLA 1BX1A 2QW0X 4O4LA 2W7TA 1UJ5A 2DT8A 4GM1A 2UVQA 3D0QA 2QR2A 3BWCA 2BKLA 2WBLC 1AIPA 4WTOA 5KIAA 1T6XA 1IY0A 2G8LA 1ULTA 4MYHA 1JOYA 1W4LA 1XJWA 4PWZA 4MEBA 1NAIA 3UC5A 3DZFA 4RV5A 3RJMA 4HSGA 1UK9A 1WHSA 521PA 5H02A 2GSMB 1LC3A 1FTGA 4JAUA 3D7NA 2R44A 4CU5A 1J95A 3QXXA 1ZO8A 1D5WA 3H4IA 3HA5A 3PDWA 4Q6BA 3ADPA 2WKRA 4CJXA 2NNLD 1XVTA 5T5QA 1IM5A 1SZXA 1L0LH 2RGRA 4D97A 5ULLA 3MTJA 1M9NA 4GKBA 4FYMA 1R5JA 1RZUA 4ECAA 1IAVA 1N9GB 1JFSA 3OD5A 5C18A 4WIGA 2J3JA 3P2IA 4B7UA 3W2IA 3KXKA 4C6SA 3TCUA 3DXFA 5EJ5A 3E9CA 2JEOA 2ZJ6A 3OTWA 1EN5A 4GOLD 1WB7A 3ZPXA 1LLFA 2HXYA 3Q8WA 4MTOA 4MS1A 3K70B 4I6JA 3AY6A 3IMCA 5BVGA 1KORA 3FUUA 5G41A 4AP6A 3KFXA 3IBSA 3PNOA 3PZRA 3E8HA 1YS6A 2ZIZA 4ZA2A 1AQJA 4I0XB 1DC7A 3UN1A 4RTRA 1U63A 2FY8A 4AJHA 1E3WA 4I8IA 3THXB 2FW6A 2XBLA 3ISVA 3IGAC 4O4HF 4OI1A 5TVKA 2I8AA 2OHFA 5KSYA 4LJLA 1R12A 3AM1A 2JKZA 1QM5A 1K7CA 3KQOA 1FP4B 4BN4A 2AV6A 4UM8B 3PNLA 2D4HA 1PLJA 1YL5A 3CO5A 3HP1A 4DM7A 3DDZX 4DIEA 1X1SA 2I7CA 5DKFA 3LYHA 1DIGA 2WWRA 4JYMA 3K6RA 2WMOB 2UYQA 1F3LA 4D26A 1PHPA 1Z7BA 3TGUH 1PVVA 3FPAA 3QPWA 4RZHA 1JFVA 5AI8A 2AF4C 5CYPA 1IMJA 1NJ6A 4EQ6A 3ADBA 3CH7A 3NQ41 2VF2A 2DB3A 2QEXV 5FWXA 3CZMA 2A1TS 1BEZA 1UPAA 5JXHA 3AQIA 2PKEA 4NPCA 3HYTA 3JR3A 1JL3A 1HNZO 5DN6G 2XDQB 4FU0A 4BVGA 1ISMA 2ZZMA 1M8PA 1FXVA 3NRBA 1N2IA 1VIMA 4KH1A 2ZUTA 3KR1A 3CR8A 4XXHA 5F4BA 3HUFA 1X0XA 4KYUA 2OY0A 1SQ5A 2FZKA 3K32A 4FLWA 1W6UA 5HHTA 2R5NA 2CAZC 1UXOA 3SC2A 4DMLA 4P33A 2GRUA 2DJVA 2Z8YM 3FE2A 4Q05A 1T25A 3MLEA 4UU0A 4DGQA 5JQWA 2IZ7A 5TISZ 2YINC 1ZG3A 3G68A 2FWMX 3IP9A 5ED0A 4DMRA 5KHOC 4BFXA 1GKKA 1M67A 2EIXA 2NVUB 3QLUC 5F2VO 1AZLA 3JYQA 1YE3A 1CQWA 4HBGA 4L28A 3BD7A 3EGEA 4QELA 1MB0A 3L4BC 4C6TB 3I9V1 2QAJA 4ENWA 3CBQA 3UFXB 3DWEX 1H2WA 1NLFA 3KXLA 4URHA 4MW6A 1W35A 3GA5A 4NONA 1OCRC 1AKWA 3KB2A 1S3GA 5BRNA 4BNTA 2O7QA 5KNCA 1X1CA 1F8YA 3B70A 2DCMA 1GRVA 1PJZA 2FAXA 2B5OA 4G09A 4CG1A 4DMMA 3BHMA 4IUDS 1HLPA 3GV0A 1HYBA 1WDLA 1BC5A 4DWVA 1EINA 4PBSA 3KELA 1QB7A 4BP8A 2Q1YA 3UCEA 4WX2B 3F6RA 3VJRA 5TS3A 5KQRA 3KZIZ 1G6Q1 2VDOB 2CHUA 2G1JA 3OPVA 3G9ZA 2EULA 5AJYA 2QI9C 2YWBA 3EXFA 2Q3LA 1I7PA 2K2WA 2O8FB 3ENQA 2GXUA 1VL8A 1Z47A 4GBGA 1BO6A 4EL0A 2AG0A 2X9LA 4RHCA 5T67A 5CRIA 1UIMA 3UXHA 1IYZA 4FW8A 2OCLA 3HVHA 1COWG 1EGQA 1XEFA 4MW3A 1AKQA 3R0JA 3WL5A 1E6UA 3J80N 1B8UA 3Q12A 3VTKA 5AW9A 1VYHA 1CIJA 2XRZA 4MYUA 4QDXA 1FC0A 4F8JA 2KBEA 4JI4B 3H5OA 1QTQA 1PRYA 4NJMA 1NRIA 3RYCA 1HZZA 2XF2A 5JC8A 2Q67A 3UB3A 2J0UA 3SM3A 5JALA 4BVHA 2IH3C 5A3SA 5LPNA 3G7UA 3I62A 4QASA 2EKLA 4MB0A 4PZYA 3LVFO 4G26A 221PA 2P91A 5KU1A 2BEUB 3EDRA 1UFKA 2J48A 2J7PD 1E3IA 4JOSA 3TOXA 5KCZA 2ORIA 2NTJA 3U0ZA 1MO2A 1MO4A 1H3NA 3RVSA 1ZH4A 3M4JA 2C5BA 3WV4A 1H9CA 1NIJA 3ZU6A 3GUCA 5KYXA 4F7OA 2ST1A 3LLVA 3T4DA 2H0QA 2QRNA 4X45A 3B82A 1U2ZA 4YMWA 5K09A 4TXHA 4O4IB 4ZEXA 4BL5A 5CUQA 4RY9A 4KWTA 1U3WA 2JFOA 1YHQV 2AHRA 2YFHA 1G5FA 2VDWA 3OZGA 5HUJA 5CX1B 5FNZA 1RP3B 1G1XB 4M0LA 2I6TA 3G9XA 1PQPA 2A4KA 5H70A 3AVOA 3ROFA 2PBFA 2OCYC 4Z9YA 2DYSB 4MR8A 3IXQA 1K6MA 3RIMA 2ZIMA 3L0OA 2UUOA 1L7VC 3IE2A 2O3QA 1FA9A 4K6HA 4G0VA 2HW8A 2ZSJA 4FFDA 3HLYA 2XF8A 3QE3A 1IN8A 4AROA 3RG8A 1YQXA 3CZ9A 5LQCA 5CDFA 5FLYA 2FR8C 2Q0SA 4W9NA 3KU4A 1B4DA 4D3ZA 4J9UE 3KB8A 3LIPA 2X5KO 3IJPA 2HRRA 1D1TA 1YRWA 2FW1A 4DA0A 4HQLA 4AMVA 5L45A 1N2SA 1U2GA 3JQ9A 2R9RB 4UM7A 3ZWKA 1T2UA 2IJJA 1SIWA 4LXGA 1SHJA 3RBXA 1I4TD 3NBZC 3LFUA 1A2OA 3K16A 1XQ8A 3H1IH 3UQ8A 3T4UA 1K86A 1LK0A 1MAHA 4Z9XA 3L0YA 5BN3B 1KP9A 1CZHA 3L41A 1CVLA 2YJ6A 5F78A 2FPXA 4B7ZA 2YYZA 2ENWA 3D8RA 4Z1MG 5DM4A 4OMDA 1T4MA 4L8FA 2FUNB 1NM5A 4ZP1A 1Z63A 4UVCA 3TRIA 4BB0A 3ZUGA 3FTCA 1VQOV 4N0QA 3QV1A 1I7FA 3GR6A 4YJ2B 4E7OA 4QXPA 1K8XB 3F74A 3C3AA 2A6PA 3QHQA 3UTDA 5J1TB 2KSDA 3NORA 2O8EA 1F4VA 3EAFA 2EQBA 1Z73A 4ZIBA 1ZD9A 4BRSA 3R3VA 2QYOA 1DC8A 1EUCB 2ZJZA 4JP8A 5DBIA 4RWEA 1AI7A 3HL4A 3ELBA 2WZCA 4MITA 3CXRA 3THSA 5EZ5A 3M9LA 4HR7A 3QG5A 1MW8X 2QY9A 5CPBA 1CB7A 2JLZA 1WD5A 2QAGB 4BP9A 4ZT4A 4Y7DA 2PWBA 3L6DA 3UK7A 2FQWA 4KQHA 2BP7A 1U2RA 1KKLA 1ZN7A 4Y9RA 4PSKA 4Q3CA 4E03A 4B6GA 4MLZA 1YKFA 5FUYA 1K7DA 3D4PA 1JB1A 3I2JA 4GWGA 1WP7A 1Z83A 5KTOA 2P2YA 1KECA 2IZ0A 1M1NA 2B92A 5ITSA 3RSZA 5C1PA 3LKBA 2AG8A 3SZOA 1GXSA 1T0UA 3GVHA 2H2GA 3ZVNA 4L75A 1Q1ZA 3LPLA 1XRLA 1JHZA 2C0CA 2PUEA 2ZDIC 1ATZA 1QO0A 3MTQA 4AN0A 3CH4B 1MB4A 3R0IA 2VTDA 4B7KA 3FFXA 4Y9UA 2R5WA 4Z9FA 2FH5B 4KBYA 1ZH6A 1P73A 4Q1FA 2B7LA 3QFTA 1IQ0A 4QGSA 5LMNB 4NVRA 3K9WA 4GL4A 1NSFA 5KTNA 3N8NA 2O2JA 4NULA 1VQ9V 2EZTA 4D79A 4OYYA 3J7AC 3ACCA 5DYWA 3I1IA 2VDLB 2AUNA 1NUHA 4OP1A 2C5SA 3KAJA 1HRDA 2XGOA 4UDOA 3UXYA 2DLCX 4RPHA 4QUIA 1N3BA 1OYOA 1IVSA 4XUGB 5B58C 1NMQA 2DN9A 1U8TA 3T1HO 5ESRA 2OXEA 1BHAA 3M9WA 4FQ5A 3IHLA 4F0JA 1J25A 5AHWA 3ZHVA 1EHYA 4UPVA 3GYBA 1O9GA 2YOHA 1J5XA 5B55A 2AFIE 4INOA 3NHRA 4MKRA 4NOKA 4XCXA 3UIEA 3KVVA 4YACA 2XLCA 4RM2A 4ZOLA 1D0SA 1L4MA 4P4NA 4A73A 3OCUA 3THOA 1P74A 4HNSA 5FT9A 5ERYA 1FJGO 1HYHA 3S8EA 3M6WA 1X3SA 3K5IA 2BBTA 4MMZB 1T2DA 1U4SA 1HMPA 1R1DA 1I3CA 5T3UA 4G89A 2B20A 3DA8A 5A1JA 4HDQB 3MAJA 2VRZA 2HF9A 5IE9A 4HN9A 2R4TA 2IU6A 3OSUA 3ZKAA 3SNHA 1XHZA 4I4IA 3HJBA 4R1TA 3LX5A 1UFIA 2ES4A 4C14A 4CR8A 5FB3A 4Q20A 3WGTA 1MAVA 3QP9A 2CMHA 3KVNA 1J9ZA 3UH1A 2AVNA 1KJJA 4NBLA 1H2GA 1BMFA 1ZCBA 5FF9A 2UYHA 2A1TR 2JFQA 3NI2A 3PR3A 1RBYA 1BRTA 5IYZB 1P2UA 2XNSA 2F43G 5AVOA 1J1IA 1GZ7A 1VHTA 5LXTF 4TSFG 4KHPB 2TRSB 3KSDO 3M0EA 1FXHA 4GGPA 2GTPA 5I8WA 4H7FA 2I7DA 4DLXA 4JI6O 4RKYA 4BFYA 2QQEA 3EIOA 4L9AA 3U48A 2QG9A 3JRWA 4M1OA 3BFJA 2REXB 9ATCA 1OCEA 3W2GA 2B8JA 5AP9A 4NZZA 2WQZA 3ZGOA 3N28A 4DUZO 3P4YA 1HE2A 1E0KA 5A6SA 4PO9A 1XEWY 2GAJA 2QHXA 1UBLS 3IEMA 4K28A 4L74A 4C0BA 2AN4A 3WNZA 1G18A 3OPXA 3GPDG 4D3SA 2Q0HA 3FDZB 4H6VA 4Z1MD 7ADHA 4PN3A 4H0FA 2VF7A 4D82A 4OAOA 1BW9A 2MIIA 1DAOA 2XAJA 4GPIB 3F7NA 1CNFA 4NFYA 1RR6A 3L72H 3FY4A 4AUMA 3AW9A 3WWYA 3QKWA 1E6MA 3ZCUA 4KUGA 1ZI9A 1IK4A 1G8GA 4DTIA 4ZREA 1UKBA 3HWRA 4Y6RA 3AK1A 2EFYA 1LNQA 1T8SA 4RIEA 4OHRA 1UKYA 3P9QA 3THYA 1E4YA 1WXIA 5ICFA 2XODA 3GRRA 3BSFA 2Q7DA 3N8GA 2EGHA 2OB2A 3SN6A 3HUEA 2X0DA 4MB2A 2FX5A 2B9VA 4BIIA 4YH1A 2QQGA 3SLKA 4EEQA 4BEVA 3TEFA 3NGMA 1E20A 4KGZA 3ZDDA 5CFPA 2OYCA 3GLQA 4ZXFA 2WG2A 4URXR 4IOKA 2O2GA 3GJ3A 4DR2O 4DLLA 4A1FA 3EEIA 4C7BA 2D3WA 1LY1A 1XCOA 3KVOA 3VNSA 2D00A 1M6HA 1CUUA 5K8IA 2RBGA 3L8DA 2PRYA 3D7KA 2CH7B 4FTWA 3J80A 1JEQA 4C1NA 2HWXA 2FEWB 4G1BA 2OVBA 4HH1A 2VAWA 4IIJB 4KE7A 4F8YA 2REOA 2DUMA 4D0LB 1XZPA 3F49S 2YN4A 3M83A 2RGWA 3BWMA 4BEJA 5A4FS 4X1KB 4WV3A 5EMJA 3A2MA 5C1IA 4RTLA 4IBOA 4IRXA 1NJSA 4D7SA 1RFLA 4CTNA 2O7VA 1WUTA 1Z5OA 1ZCZA 2D5AA 2GWRA 3V6LA 4X64O 4NJEB 4OQYA 3CSXA 2GJKA 2WDPA 1HQDA 3FVTA 4OFWA 1TZBA 3CH5A 1ZK0A 3EHBB 2XY4A 4JUFA 1IBKB 1FZQA 1R4ZA 4WBNB 1QZUA 4F84A 5D3MA 2PNJA 3M81A 2FW8A 3MUOA 4A2CA 4WAUA 5K9ZA 1M7GA 3DWFA 4E22A 1SHUX 1YI1A 3WOHA 4X44A 1V25A 4EL5A 4GPAA 3T1OA 1RRCA 2HJVA 3ZWQA 2EJ7A 4MVWA 1J24A 3G89A 3WTCA 2F17A 1B3RA 5HK9A 2WWWA 1QYVA 1UPTA 1EP9A 2V5AA 3EXEB 4CC6A 2WABA 2NUPA 3FOZA 4IUYA 1CPYA 3R5HA 4NZMA 1EGAA 3IKLA 4P30A 3FUTA 2ZR0A 1D09A 4LGCA 5JWHA 2NV2B 2BDTA 3E7DA 2C95A 1ESDA 4Z7OB 2K2QB 4TLLB 3EF0A 4FNGA 4L0QA 5COAA 5DFAA 3VVLA 2ZVQX 3TQTA 1JTFA 3FSEA 4XZ3A 1D1SA 4Z4QA 2VQEO 3EWAA 3ST7A 3WDKA 1P3JA 5HCIA 4TYYA 1DKNA 3KR9A 2FFAA 3L3BA 1KI4A 2QZ9A 3NUGA 2MOKA 4J2HA 4QVKA 4OHWA 5EZ6B 4QFTA 4R68A 3TOSA 2YC4C 3ABLC 3UV3A 5AKZA 4PI2A 4OQFA 3R7FA 2ZSBA 1GL6A 4UZEA 1XVAA 3K4HA 3OT7A 2IWRA 1KBHA 3LP6A 2ICAA 2H1RA 2IJIA 2J6IA 4ENSA 3NH6A 3RSQA 1JJOA 1BN6A 3GB7C 3DWGA 4KVAA 1QF6A 1ZIOA 2VDNB 2PGXA 4BFLA 3PE6A 5C4MA 1D4AA 1Q1NA 3DNMA 4JQOA 3X1WA 4CCYB 5ETJA 2Z8YA 5DWDA 2A94A 1OT5A 4RQTA 4DJFC 4EY7A 1PK8A 3GD5A 3QLJA 2VEOA 2V1DA 1ZK1A 3KJZA 4BMXA 1AVTA 3Q2KA 3EDCA 4OQQA 3IXMA 1FS5A 4QGFA 2HMTA 3FW1A 3B12A 4UVAA 1D2DA 3VR5D 2VHUA 4G9BA 3M99B 2OEPA 1G291 1RSZA 4UCXA 1AMUA 3BZUA 4BQOA 1QRUA 5TT0A 2JGKA 4I55A 1JA1A 3FYUA 4F4DA 2YOGA 4C89A 2FPIA 1BGXT 4DOMA 3V1YA 1T9DA 1SULA 1FP2A 3DOHA 5DBEX 4R8KA 1W76A 4NESA 1VF7A 3A32A 4UPDA 4CM3A 2AC4A 3TGPA 1RPNA 4ETWA 3U17A 2OXRA 1UWVA 1W85B 4WASA 2F6RA 1ZX3A 5J2TF 3V2IA 4XKJA 3TD2A 1PVOA 2HUPA 2QRJA 4Z9BA 9LDTA 4H16A 3SS9X 2AHZA 1WKBA 3Q4HA 2B4RO 3GRUA 5B1OA 4FYYA 2I2XB 2IFTA 2H16A 1DXOA 1ESZA 5K05A 2Z9BA 4AY6A 3QYFA 3N7AA 4MGHA 4YRZA 4MYRA 4QFDA 4JYZA 4HB3A 3OOYA 3AFMA 3I9JA 2PRIA 5KYYA 4MGZR 5LR6A 3O0DA 4YRPA 5F21A 5DW3A 5BUCA 1E7MA 4WF9V 3E2EA 5LOVF 1RJFA 2NUAA 4RC9A 1FX0B 4BKPA 1MW9X 1XRSB 5K51A 3L6CA 1PQ4A 2C8JA 1CJCA 5CA1B 2PA3A 1TZJA 3WIUA 1J97A 2VH5R 4OLFA 3TZCA 3K6SB 4RPKA 2EKDA 2W6IG 1UBHS 2OENG 1VQ1A 2ID9A 4XVCA 4UVIA 2Q5QA 3MMSA 1BMTA 4LD2A 1D4OA 2MU1A 1IM2A 3GFFA 3G2PA 2EFCB 1N8KA 4JYCA 2P9EA 1ZUWA 1QV9A 2FXIA 4TT3A 3EYWA 2G9QA 3NIFB 2HWKA 1XVIA 1UBTS 4LE2A 5DHRA 5CP8A 4GI3A 3CGGA 4E32A 1E9VA 3Q9UA 4ENQA 1L5SA 3I58A 4HUTA 1W47A 1OXSC 1WE2A 3UV7A 5CLIA 3QTBA 2YOFA 2DY1A 2SBTA 5CTAA 3PXCX 5HKBA 2CK3A 4DR1O 2MR6A 3NCTA 2JF0A 3D0OA 2QG6A 1DOHA 3HEMA 4TTPA 2HF2A 2L17A 1KE2A 2B37A 5CW2A 2Z1NA 3VR6D 2Q5JA 2ZWMA 1N3YA 1TA4A 4FFLA 1NKVA 2CVFA 4HAUA 5DHUA 2Q2QA 2XT0A 3OMNB 1QNMA 4B2PA 4E4YA 3B5IA 3ZD8A 1AQUA 4DO2A 2DGDA 4ABYA 3G2NA 4HLDA 1BQ4A 5TXGA 4G81A 4EJSB 1VSUA 1E9DA 4MP3A 2DLDA 4BNXA 2QN1A 1OJHA 4HG2A 4FCTA 1M0SA 4AUEA 3HFSA 1XZCA 4B35A 5JYCA 3MMPA 1N9ZA 1RZRA 1YCDA 3SKYA 2QOEA 3C7TA 1KGSA 4X62B 2J5QA 2WU0A 2CXOA 1OLUB 3AR4A 3DAPA 5LLTA 2GHIA 4GICA 5SYMA 5ALHA 4L87A 1NW4A 3VDNB 4MHTA 1E7SA 3BXGA 4RIIA 5EN4A 1FRQA 4B6RA 1SPXA 1P1FA 1OTXA 3FH0A 3MWKA 4UNPA 2HSDA 1IC6A 4ZI2A 1PL7A 2ODMA 2F1IA 3V9PA 4DV6B 1SVOA 2H0RA 4OI4A 2MMGA 1FBTA 1GL9B 2QQFA 2FEOA 1Z25A 1F7UA 4B4KA 4WQMA 3TAHA 2IHYA 4PJ0Z 4J75A 3UEOA 1VJRA 2LBPA 3C90A 5AVJA 4DWJA 2ZVDA 2HRCA 3K1YA 3WMRA 1GCOA 5AQ1A 4KLZA 2RHDA 4OB7A 4JBXA 4RLQA 1Z28A 4MRRA 1JH9A 5JH7F 2C0PA 1R0BA 2ZWPA 3KLBA 1KHHA 5K6AA 5CLJA 2F62A 5IANA 4REQA 3C3KA 1ZPDA 5IKOA 1JXAA 1NNSA 5D7BA 1SR8A 2EQAA 3ZOKA 3R44A 3JATB 1J2YA 1YB4A 2XRFA 1W0KA 3KQSA 3P2MA 1WUKS 3E3LA 1QOZA 3OZWA 3ZMSA 1E62A 3OHPA 1FNCA 3LPDA 3HVRA 3AEYA 5GTHZ 2IDZA 1RLMA 1JV2B 5CNIA 3IMKA 4V0QA 5CLHA 3RBVA 3BH0A 1NR1A 3KP1A 4ZVOA 4EG4A 3COWA 5GMOA 3AF1A 1HSOA 1XP8A 2NU6B 3USZA 2PCJA 3WGIA 3K2BA 3R7DA 2DFVA 4JB8A 1ENZA 2VQSA 3D3WB 3ZJUA 5FOWA 2RHCA 5B2FA 3F3SA 1M5TA 3ZS8A 5C80A 1DX4A 1L7EA 1V9PA 4WESB 3ZHCA 4RVHA 3CJQA 3RN4A 4HDMB 2AJCA 1EFRD 3QF4A 3UJDA 4Q6GA 1XCPA 1GG2A 3PT5A 2VFAA 1VHWA 4CT5A 4G1CA 1KZ7B 3HXOA 1DBWA 2V8OA 1HFWA 3LG2A 4OU5A 3EZFA 1V1JA 4O2AA 3AFNA 4TV8F 4IV5A 2HBQA 2WJPA 1SC1A 3NBYC 3OZEA 1ZN2A 3KT0A 1QK4A 1M83A 2GF9A 1A04A 4R3UC 2XNDG 4DANA 1PTJC 1BGVA 1C8KA 4D96A 3F73A 4FFRA 4ZOEA 4BQEA 3W5VA 3B53X 5LIPA 2BY4A 2YYAA 3ND8A 1YR8A 2UU9O 4YMUA 4XASA 3LUKA 5BW6B 1O8BA 1TI7A 3RJ9A 3FPBA 1MLDA 1I7NA 2GPWA 2K4MA 3A37A 4F1KA 5TQJA 3M82A 2PX0A 2XOKD 3I9MA 1KYXA 4BKRA 3EIUA 1BFKA 3MERA 2C8VA 1C3JA 2FSSA 4UTXA 2B9EA 1UFQA 2JIZA 5IY5C 4CV1A 1ABBA 2AJDA 5JW6A 1FUEA 3KK0A 5L3VA 5BN5B 4MQEA 4CIWA 3PFHA 2XUAA 1CXZB 4IGKA 5KTYA 3G9TA 1NVVR 3KR0A 4HRXA 1ULHA 3C4QA 4NCAA 4JQZA 2VK2A 4RSHA 4JI8O 1NU8A 3UKJA 1ZA1A 4PINA 1YBAA 3DCNA 2A33A 3OFKA 2B0CA 4YP5A 3VX4A 2YYSA 1S0UA 4D5EA 3LWBA 3ACDA 5CA0B 5FL3A 3OJXA 5LIRA 2YRXA 1N9KA 5SY4A 3D6HA 3WNCA 5CT5A 1CNEA 1ZEMA 3N7TA 5D6OA 4FZJA 4AZVA 2D0OB 1CE8A 2PXXA 1LH0A 5DJ5A 4K03A 5HS6A 2IGTA 3JQFC 5JDIC 3C8UA 2QT0A 1Z2CA 3RYTC 2F23A 3ZCTA 3S2FA 5IUNC 1IRXA 5DNUA 5DBFA 2QF7A 3IJRA 1FRFS 2XI4A 4WT7A 1QANA 5GY7A 5L40A 3M6IA 3T1TA 1I0ZA 4F7WA 1JKMA 1YTFB 4GKKO 4ME6A 5J9FA 5EEHA 1RC1A 2OQRA 5EAIA 1JIKA 2XHEA 4D57A 4Q66C 1Q19A 2PT7A 1HKUA 1GPAA 4OP3A 1JG6A 4M60A 3T7SA 2OCBA 5EE1A 3E89A 1KWGA 1OBFO 4DMGA 5JADA 4Q9AA 3H2GA 2GS9A 4DZRA 3KEFA 5EP4A 3DVAB 3RFUA 2HQ1A 4MV5A 1RDFA 3GLGA 3PXBA 4YV1A 4NZPA 4L1KA 3IUPA 4RYDA 1EJ2A 4RA9A 4RAIA 3DFMA 3D6MA 4XGNA 5JMTA 1M2KA 2QVLA 4JUCA 4E2XA 1SXJE 3K6JA 4QDUA 3APQA 2XIQA 2AQKA 3EZNA 3VC3A 4YBZA 3SJAC 4Q12A 1W2BU 1K73W 2ACKA 5SZIA 5CLLA 4RKWA 1NH2D 2A58A 4YAEA 3BE5A 2HP8A 1CUIA 1L5ZA 3TIFA 3AJEA 1Y98A 3BMNB 1Z0ZA 2BMFA 1FP6A 4K88A 3ZZ0A 4L76A 2IV2X 5ARCA 3B51X 1FU8A 1PZMA 3T34A 4XYEA 1M1XB 1SF9A 1PJCA 4MKIA 1ZRHA 1M34E 1SU8A