1PKXA

Crystal structure of human atic in complex with xmp
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
588
Chain Sequence
PGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Human and Avian IMP Cyclohydrolase Mechanism via Crystal Structures with the Bound XMP Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 207
structure length 588
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pkxA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pkxA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA02
1PL0A 3ZZMA 1T36A 1P4RA 1PKXA 2IU3A 1B93A 1A9XA 1KEEA 1IK4A 1S8AA 1G8MA 1S89A 1ZCZA 4EHIA 1JDBB 1EGHA 4A1OA 1CE8A 2IU0A 2YVQA 2B1GA 1WO8A 1M9NA 2B1IA 1VMDA 1THZA 1C30A 1C3OA 1M6VA 1OZ0A 1BXRA 5H3LA 2XW6A 1CS0A 2X8WA
chains in the Genus database with same CATH superfamily
2AGVA 4RZ2A 4BNMA 1Y3IA 5EG5A 4DG8A 1I4DD 1XNQO 3M6LA 3MLBA 2RPZA 3GEPA 3ZN1A 4X7RA 1IOZA 1GQYA 1J0XO 4B0PA 3MUNA 1X7YA 2O8CA 4JQOA 3MWEA 4R71A 5DX8A 5L3QA 2I67A 1KSJA 1HRKA 2OWDA 1XTVA 5CH5A 2Z2IA 1SN7A 4IEIA 2YVAA 1ZWLA 4CIYA 2BGKA 4D82A 4D7AA 5I45A 1UINA 3H5IA 5E9WA 4KBGA 3DBVO 4FN5A 1G7RA 1UBTS 5EYPA 4CH4A 4XDJA 2FTKA 4HAMA 1AS0A 1H6AA 1TRKA 2YHIB 4ZIBA 2Z98A 3K96A 4BVEA 2YKGA 3AEQB 4EGCB 4MGKR 2EIHA 2C58A 2HX1A 2ID9A 4ZK2A 1K7SN 3UJAA 2J67A 1Y5IA 4N8EA 5FQOA 4CW7A 1AGPA 3DOEA 5EUBA 1XXHE 3C3CA 2AXPA 3K8OE 4PYRA 3U62A 5JS7A 2CDRA 2XDQA 2VAVA 3LLUA 3I1JA 1J8FA 1QC5B 5C8DA 3INGA 3CLSC 2YHSA 2EULA 3CZ5A 4I55F 1C9NA 1NQ5A 4QFCA 3RV4A 4F4UA 1T9GR 5AESA 1EGHA 1BH2A 4YT2A 3C3EA 1W2WB 3AVOA 4G9EA 4QGAA 5K9ZA 3NHZA 3QG1A 3OCJA 1OC2A 3LBYA 2JARA 2R8OA 3KEGA 3N7UA 3PTZA 1QH8B 3BE6A 3BVPA 4JI0O 1DX6A 1PX2A 4ZYTA 5FWNA 1WKVA 3JARB 2GNOA 3D8UA 2E3CA 3NHBA 3KKNA 4OK3A 1MJ5A 4OYHA 1U31A 1OCRC 1VLQA 3KVVA 3TPZA 4X20A 3UUEA 1NW7A 3I2GA 5B1IA 3ZQ6A 2ZAOA 1YS1X 4OH7A 1PR3A 2WF5A 4CBVA 2N3ZA 4BNTA 2NT3A 3QTCA 1JIVA 5FQNA 4F1JA 4PIPA 2XKKA 1S2LA 3ZCTA 1JHPA 3K4PA 3CEHA 3F96A 1Z62A 4MLZA 4XE5A 1GPH1 2AMYA 1OOEA 5IFLA 2Q6AA 2DB3A 1CNFA 3IP7A 2HM7A 2ZAMA 4ZAYA 2FW0A 3DP7A 2NO0A 4CR6A 5LGNA 3EMBA 2Z5GA 1QAOA 2ZVQX 3C85A 2HMUA 4HJXA 4L5YA 2CNWD 3MINA 1XJQA 5LWHA 1F6BA 3FNRA 5ALNA 1DS6A 4GP9A 1H65A 4DMMA 1U3VA 3TXAA 3Q88A 4E5SA 4LE1A 2NQ2C 3FLAA 3H18A 3TLEA 4ZI2A 4ZD4A 1NV8A 1FX0A 4DTIA 4BVGA 1BTOA 5GJBA 4V02A 1NG9A 4DREA 5I4KA 2FVXA 4P9CA 1T9KA 1Q6UA 1JXOA 3BHJA 3OOSA 4ZO4A 1CUHA 1NJ5A 1E3DA 4DILA 3BQ9A 3K03A 3L0ZA 2G83A 3DOIA 3CX7A 3G8DA 5HFMA 4IFBA 4Q4LA 5E0OA 1ZD2P 3LA8A 2DECA 5SZKB 2DYKA 2RGWA 2OR3A 4TGLA 3W04A 4DMGA 2DG2A 4UE2A 1D7AA 4FLVA 4C4SA 1OZAA 3JYLA 4PAOA 1QX3A 4EHFA 3Q7IA 4XSHA 2CHFA 2ZRJA 1ZNWA 4PPFA 5FNVB 1ZIXA 3FDXA 4G0OA 5DLYA 3W1WA 2LGJA 3HACA 3HB1A 4JJFA 4DLUA 5AI6A 3SC2A 1PUIA 4HSEA 2HMSA 3GDOA 5A5GA 3KJIA 3LC7O 4TLCA 3TLJA 1O9BA 4NZYA 1DKMA 4EVSA 2CCGA 4L4UA 1A9OA 5GADl 1QVGU 1W4BA 5DN9A 3MQFA 1FBTA 4WLUA 3UXEA 2ZYGA 4RV9A 3VDNB 5IARA 4A0SA 1PQYA 4ZVSA 1FP1D 2LIPA 5J5AA 2NP6A 1FXVA 3NRBA 2O57A 4H3VA 1ZIOA 4RD1A 3EIHA 3FJOA 1SKBA 4N6GA 3CU5A 3D6HA 2VZ0A 1L5YA 4A6PA 2Q8VA 4IL6Z 4B3MB 1XBLA 1WA8A 1RP7A 2HK6A 1CUZA 1JIKA 2HY7A 3JZMA 3OE1A 2PYZA 3PC2A 2ZTHA 3IP9A 2QGFA 2E4XA 4CU2A 2ZKLA 3DKVA 2GWHA 1B0UA 3C3WA 1SD2A 4MVMA 1TIBA 1GSOA 2IK8A 1RXYA 4UAVA 1HQYE 2BH9A 2GAFA 3O8BA 4W8GA 4BJ5A 5KEIA 2X8WA 3Q87B 5TQ0B 4GH5A 4MRSA 2QORA 1JEQB 3BQMB 4PYMA 4BZPA 2Y4TA 3EXHA 5DHAA 5JCOA 1J22A 5KHJA 4CM9D 2QNBA 2QSUA 3A1EA 1Z4LA 1QYRA 3H1LH 5ADWA 1ZGBA 2WV7A 3AI1A 5ALXA 3ZBUA 3H7IA 1NH2D 2X0FA 1Z4KA 5K8IA 2C4NA 3U0ZA 3REQA 1K86A 4FZVA 3WGQA 3EFFK 1SUBA 5CURA 4KWCA 5HIMA 1HFKA 1JAIA 4DB2A 3I56V 1Z0IA 3PD1A 5B30A 4YAUA 1MG5A 2XECA 3OCCA 2XKAA 2NLOA 5LU9A 5C5DA 1O97C 1Y81A 2P8RA 2QVBA 1DGSA 4TMWA 1TLLA 1POWA 5KCZA 5BVGA 1HG0A 2D8MA 5ALKA 4GVXA 3UV7A 4WBNF 2D7JA 4YJ3F 4KPEC 1S3IA 5IY5B 2M1XA 3ZVLA 1TKBA 3FPEA 2ZUSA 5DHTA 1VCHA 3IE1A 2P22C 4IDNA 4IDPA 3NM6B 1DG3A 2JH8A 1GUFA 3H5VA 5I01A 2XBMA 2ANCA 5GV8A 2P2GA 2YDYA 2FPOA 4IGEA 4MYTA 1EYZA 1VLVA 5T4FA 4DVJA 2LIVA 1Z7BA 2QTHA 3VO2A 3K9GA 3TLZA 2ILMA 3IYLW 4NENB 3EAFA 2DJIA 1AUVA 3IDAA 1RKVA 3PVSA 1G1XB 2AHOA 3JYHA 4HNQA 2ARKA 2MCFA 2DHDA 1V5EA 4O0MA 4ON9A 4UUOA 3E2EA 4HEQA 1E89A 1QIKA 3F6EX 3LPDA 3VXKA 1GG2A 3ZRXA 1EKXA 1U2GA 1YJ5A 3CNOA 2CJPA 2A88A 2ZQYA 3K6KA 5DNUA 4E33A 2WKRA 4LYYA 3VDQA 5E1BA 3D3QA 1JKXA 1DKPA 2RKBA 3EFHA 3VVCA 2A78A 4U63A 2GCOA 3ZZNA 2FPKA 3CN9A 4C7VA 4DGQA 4MA0A 1EWTA 3AETB 2P9YA 3AZOA 1CD5A 3SX0A 4TUYB 5LYJB 1XPUA 1MF7A 1SKAA 1N2ZA 1FJHA 2VEDA 4WBXC 4Z1OA 1JUDA 4XWYA 1CJUC 1KOJA 1I36A 5FUBA 4UVCA 4RSGA 4YI3A 2WB2A 1FXKC 4GVPA 1TIPA 3PQDA 1K08A 3BBLA 3BRWD 4PE5B 3E5RA 5DRYA 1MENA 2BHLA 4ID9A 2HPHA 1P74A 1KBZA 3HCWA 5KDDA 3WL3A 2GEBA 2D5AA 2NAPA 1N5KA 1BXGA 1HL3A 1QLHA 1RJ9B 3GCWA 4LZNA 2OCCC 1YD7A 2OCLA 2REOA 4A6EA 1SUFA 3LYHA 4CM1A 5KNDH 1NMXA 4MLDA 4H27A 2VC2B 1BC5A 4II7A 3SBXA 3DZHA 3F2IA 3W2EA 5DN6G 4ER3A 2YH2A 5M59B 1YQXA 2QIOA 2G76A 2Q6IA 1KZ1A 5FLXN 1NXPA 4GGPA 2GNPA 1DV1A 3D4NA 4M2LA 2OCPA 3SC2B 1KI6A 3CX8A 3T5GA 5KDOA 5L53A 4NF2A 4WXHA 5F9MA 2NU9A 2OO5C 3AL3A 1XBTA 1K7XB 2JIDA 4G65A 3RSGA 5TISZ 1P9NA 2NO4A 4NK4A 1W8DA 4OM7A 3LDCA 1V7ZA 4RVNA 3VR2D 1IYZA 2J6HA 3QTTA 5KTSA 3MGAA 4DO2A 4JJKA 1C7ZA 4X1KB 4CV0A 3C3PA 2Q3EA 2B0JA 3EC1A 4V38A 4XJSA 4TWIA 1J0CA 2EP7A 3ZZTA 2H08A 2DR2A 3OE7G 1KDOA 2PUJA 3JAWA 3E3NA 3OLCX 4HUJA 3TBHA 1G8YA 3UKDA 4DDTA 1Q7BA 4PDRA 4GSKA 2HXVA 5K0EA 2GM3A 2HEIA 1U11A 1ZAUA 1E2FA 1URFA 1MRZA 3P2YA 1CHDA 1KDTA 1NNLA 2QEXV 3I2FA 4N01A 3HMKA 4NZMA 5GVSA 3KS9A 1I7QB 4RVDA 2FMLA 1WHTA 1FDVA 4DK0A 3EGOA 2AOUA 2YJTD 4P3YA 4DRXB 2PYLA 2VQ6A 4NCAA 3WYGA 4NAVA 1YTLA 1TU3A 3KT8A 2YR0A 1AO0A 5FL3A 4M55A 4FDTA 1I6MA 3UENA 4H60A 3UZUA 2R6FA 1TO6A 1SUDA 4TLMB 4CEIB 4LDPA 4OSEA 5KAMA 1K8XB 3JQAD 4BN0A 3LC0A 4WFBV 4DM4A 2R47A 3QUBA 4UXJA 5EQFA 1G21E 1QOQB 1F4VA 3BYZA 3D9QX 3RTAA 2FG7C 4MQ4A 1U0FA 4KV7A 1Z2EA 2MJLA 5K1ZA 1DTSA 3EOBI 3I8OA 1U5CA 5K4GA 1A1VA 2J45A 2F9LA 1B04A 1FSZA 2DCMA 3KWLA 2XZOA 5EE9A 3H9EO 1R3JC 4OSOA 4A0GA 2O8EA 4V0RA 1WY7A 5LOVA 3FFQA 2UUCB 5GONA 2V3CC 1KVUA 5F7JA 4K6CA 2X4GA 3DNMA 1SBIA 2JGUA 3DC5A 2X6RA 4OXRA 5DM70 4P3KA 2KHZA 4JI6O 3CHYA 3H5TA 1ND6A 4UBIA 3VOAA 2VBFA 3OEHG 5DBEX 3TL2A 2VNJA 2HSWA 5EIBC 2H18A 3LHKA 3ODPA 4JLOA 3NX4A 4YJGA 2FETA 4JLDA 2QWOB 4FFLA 1IEQA 3EK2A 3PEFA 4DYHA 2JCSA 5C7LO 4EI2A 4ZYYA 4Z4EA 2VSFA 1JV2B 4UCFA 2IX3A 1Y3HA 3MJRA 1N2CE 2WILA 3OTIA 3C5EA 4ZDJA 1IZ7A 3Q7EA 5I47A 4EKNB 2G5PA 3AVVA 1UQUA 2WIJA 3P8ZA 3H5AA 4ZODA 2PCLA 1EEXB 3EZ6A 3EUAA 4EBBA 4D0SA 3O8RA 3AKZA 4JD5A 2EV9A 2VNIA 4UUBA 1TJNA 1R9MA 5DYIA 3GIDA 3G4SV 4DA9A 1XMQB 3F9CA 4ERXA 1B93A 1I6KA 3HJHA 5K51A 3LI2A 1ZUIA 1A82A 1QHXA 2GCOB 4PPNA 3WKEA 4DR2B 3SYCA 1UC9A 2WABA 1HDJA 5CBPA 2W6JA 1M2VB 5HOQA 2C7PA 3L7AA 3ICWA 4RL4A 4NDNE 4U9IS 3T3HA 4ZCTA 4G4IA 3B3FA 1GXSA 1YRWA 3R3XA 4HQ6A 3W5DA 5HRUA 1KVSA 2BKVA 2BM8A 4MRPA 3WFJA 2XCRB 3R6GA 4INPA 2QP3A 3T7SA 4C22A 1NNEA 3KELA 3NZEA 4DGSA 1I4EB 5T64A 1HDIA 3MWKA 1DB3A 5EY5B 3ST7A 3TRDA 3UA4A 4LJ5A 1RPNA 4Q5IA 3AG3B 1V9CA 4B79A 3PUIA 3KZMA 4ESHA 2FUKA 5FHQA 4A2QA 1OWLA 2FU5C 121PA 4A03A 2QJTA 1O8BA 2ATVA 3KSZO 4WNYA 1NZ6A 3SC4A 5KLVH 1SD1A 5ALDA 5IBPA 4JKIA 4YMTA 4YC7A 1OHHG 2VWPA 2ONZA 1NBIA 3OTOO 1F5NA 1TDJA 4MS1B 2DFPA 1GA4A 2WIAA 3E9EA 3JWPA 1OFVA 1W87A 2XWPA 3AHDA 3NP7A 3HJFA 1XFAA 5EKXA 3E1GA 2JGEA 1CQIA 1PJTA 1V2GA 4HDSA 2C9MA 1JDPA 4M21A 5BSUA 3U49A 3AF5A 2DETA 3G2KA 4QARA 1SIWA 1PM9A 2CEAA 3NEYA 2JD0A 4ENWA 1OH8A 1WXIA 1KE1A 3HJGA 1O0BA 1I4WA 1SR8A 4LYGA 3DMFA 3STXA 4B1FA 2RHHA 3NC0C 1JTVA 3EZ9A 3QUSA 3PXBA 2Y99A 1C4WA 1TYBE 3A70A 5HIAA 1T35A 1TLFA 4AO7A 4PO9A 3BZWA 1D8TA 2JBAA 3HBAA 3NT4A 1GCUA 2ILVA 4YQYA 3M4XA 4YV1A 2EZUA 3OIWA 2VNKA 2I7XA 2GEDA 4NH4A 4B8ZA 4QQ8A 3L6DA 1W0KA 4ZOAA 4J16C 2WWHA 5FBQB 1N8KA 2E18A 4NC9A 5CJJA 4NTXA 1SMKA 5THKA 2L6LA 2PU7A 1MUUA 2PFKA 1O57A 3TL6A 3TIXB 5DO9A 3FKSG 3LCCA 1T10A 2J9FB 3CNLA 4Q9IA 4HWOA 3RI3A 5MFZA 5TMEA 4P5DA 2CJWA 1NTMH 1NQUA 1XTBA 3SJCA 1Z6XA 1WMAA 4B6EA 5B1AB 4KDFA 1CLUA 4JASA 2YDEA 1SVUA 3PUYA 4DV2O 3LC1O 2ZIMA 3PNMA 4M98A 1YQEA 4RNDB 5SY4A 5I6DA 3H3XA 5JO9A 5DX1A 1HP8A 1QMPA 3ZQ4A 4D43A 5IAJA 1CRQA 3RLFA 2V6BA 3GNLA 3ROMA 2PMEA 3HB3B 3EC2A 3ELBA 3OLXA 1GEEA 1MRSA 2FAXA 3DGFC 4R2WA 2C96A 4I7EA 3A7EA 4NTZA 4EUNA 2NNWB 1JQ3A 1DTOA 1VECA 3OC0A 5KSPA 3DO6A 1L0LH 5EUCA 2E4UA 3H1HH 3HJRA 3RFUA 3AFOA 1DP4A 4M86A 1YR1A 5ITSA 1JWBB 1XJ0A 4RY9A 5JC8A 1EUYA 4Z53A 4Y6LA 3A14A 3ND5A 5E6UB 2H2AA 2B4RO 4X44A 3CXRA 5BN5A 5DCWA 3OJWA 3LP8A 1KMNA 4YB8A 5BRJA 3BGOS 1UK7A 2H7YA 4LH7A 3RBAA 3CVXA 1X92A 3SHQA 4UEWA 4Y1RA 5E6RA 3ZWOA 3VO9A 4QPCA 4RPKA 2IA5A 3GOHA 1ZUNB 1T3LA 2IBZH 1J0BA 1T1SA 1YRAA 2YXDA 1YL5A 4RC9A 5JRJA 3F90A 1KY3A 2FR1A 3EMVA 2W58A 2PA3A 3GX1A 1QWSA 4B2YA 1DJQA 3TPFA 1PU2A 4LSWA 4PA9A 2AN1A 2Z2XA 4F91B 5KZMB 3G5MA 4BRWA 3RK0A 1SIBE 4J3JA 4LJYA 1WOYA 3H17A 4DV0O 3O3NB 3B8NA 1E7RA 1GCGA 3JQGA 3PSHA 5LA6F 2ZUEA 3QEOA 2GK7A 2WIBA 2YN4A 4QBGB 4CWAA 4DQKA 3DDHA 3NH9A 2O7QA 3VDMA 1Z9BA 5BN4A 4J0JA 2W22A 3N8KA 4Q3DA 1UP6A 4D42A 1YZHA 1UC8A 3E83A 4QIWF 3K9FC 4UEOA 2X6CA 1GGJA 2NACA 2ETNA 4OGQB 2I9PA 8OHMA 2ZB7A 4XVHA 4Q7QA 3OFJA 3HYNA 2GPYA 4LJ4A 4PC7A 1UBSB 2D54A 1CUBA 1EXWA 4G5QA 2F64A 3TXQA 3D43A 1GZ7A 3P2IA 4BU1A 1JEEA 2PWAA 1WCIA 2WU8A 4OY3A 3K9QO 2DBVO 2XRFA 1XEXA 2Q6LA 4DJAA 1PR6A 2CNOA 2WLMA 4LXHA 1QG2A 3SHWA 3GMDA 4HDKB 1Q90D 1H05A 2E4ZA 3ENZA 1PNVA 4EJMA 1F7VA 1VE7A 2BUCA 1Z4IA 3E58A 4N0EA 3S44A 1WZ2A 5K8TA 3IAM1 1GDTA 2HO4A 4RTSA 2EX1A 1VG8A 4EQ6B 3UAWA 5LHHA 2HOQA 4HX5A 3L3BA 1RLTA 1NLUA 2HXGA 2DHCA 2CYAA 3K6JA 1M10A 1TUEA 3WL7A 5JEEA 1Z2PX 2LP7A 3QOWA 3HYRA 3IPLA 2BFFA 5JDIC 3E8GA 1I32A 1OXSC 5DX0A 1ZKDA 1FVXA 5JPDA 3B9PA 1CZKA 2FE1A 2V3VA 1AZWA 3TIFA 3EA0A 4DJFC 2FX2A 1EJBA 5KYXA 3CB4A 5DKFA 1V6CA 3H87A 4F6LA 5CUQA 5DNYB 1KFEB 5HRCA 3BD7A 5G4KB 2Z58A 3LDEA 4CC6A 4OHMA 1HYHA 1KEZA 4RDXA 2C7GA 4OSPA 1ESZA 4NFHA 2OYRA 1N8NA 1DKOA 2G9RA 4R81A 4KUMA 1E0AA 2GYUA 2BPOA 3IGFA 3K20A 3OZRA 2EILC 4IJQA 4LDNA 4YLYA 2IP2A 4JA0A 2ZT9B 4FTWA 1CTTA 1OBVA 1YSCA 1N1EA 1UOOA 1E2LA 4QYTA 4XIFA 5AW1A 4PHCA 4ZV9A 3DAOA 3HCRA 1YJNV 3X2QC 1VI2A 3OPYA 1CY2A 1Q0ZA 2FN3A 1DADA 4MVOA 1Y4UA 1PUJA 2OMKA 3N8GA 1M2WA 3NKFA 3SZRA 2HHCA 1VDMA 3O91A 4F56A 3H9GA 4CH6A 1LPAB 2Q2VA 3GZNB 3KXIA 3VMFA 1RYFA 5JH7F 3LLVA 4JB0A 2RGCA 3I1IA 3I01A 4KI0A 1SBHA 3OCYA 5H3HA 1E99A 3WLFA 4CMIB 4X8OA 3U26A 4CLRB 2ZNVA 1J0AA 1JLLA 1PPJH 1PFGA 2X23A 3AXTA 3U1TA 4BYGA 4D9KA 1SEVA 1KWGA 1KK0A 3ZVNA 1TYDE 2E37A 2DUUA 1Q6YA 4IZHA 3E8HA 4KYIB 5A0TA 1W2GA 2FZ5A 2J3QA 3EBPA 1Q12A 2EERA 3FX2A 1TU4A 2E5FA 4KE8A 4K9DA 5GGXA 1PO7A 4DB4A 3FTQA 1F6WA 2YHIA 2BTQB 5F7XA 1RXEA 1U8UA 3ZRWA 4B4OA 3IFSA 3NUGA 5EJMA 4C1BA 4DYLA 1C4OA 4LZOA 1C1DB 5KTRA 4DUYO 2OP1A 1BX0A 2O2SA 3F1KA 4PQRA 4YWHA 2PQ6A 3A2FA 4DT1A 4YJFA 4D9CA 4DNOA 5HK9A 2OV8A 2DPXA 2P7TC 3RYHA 3S2GA 2ENWA 4UE3S 1LBQA 3EEYA 1JPJA 4PA4A 3WIDA 1V8FA 1F1BA 1KO8A 3BDAA 2XQJA 2EG9A 3B8MA 1XA0A 2VTEA 2H0RA 3N2EA 1CUSA 3GAFA 3D7MA 3LPLA 1U8EA 1J4AA 1NQAO 3NDJA 1OXMA 4ZDWA 4EWLA 3WZMA 2Y69C 2JGDA 5JAHA 4D9FA 1GUBA 4BVHA 1EJ2A 1A71A 3IT0A 4Q39A 1MNGA 1G6Q1 4NEQA 1UX0A 2QYTA 4ZHQB 4F92B 2F1MA 3AM5A 2KX7A 4AD8A 3BPSA 4QFBA 3Q8MA 4Y0AA 4W8HA 4RJKA 3H2YA 5AJHA 4UHCA 1XZEA 3NTOA 1JECA 3QV2A 4BLQA 1RWMA 3L02A 4N3NA 1G66A 2W7TA 1SY7A 4ZIRB 1QHHB 2AT1A 4DCSA 4CF5A 3LX8A 4NJOA 2FB9A 3BAZA 1AE1A 3I9MA 5EPUA 1P5ZB 3NHFA 1JQ0A 1WTCA 1ZOLA 2A5FA 2I6FA 2JJ2D 2TS1A 3GRAA 1O6FA 2W2KA 3T7EA 4BNKA 9MHTA 2OZEA 5GJVC 3LZ6A 4KQ2A 2O8NA 4BX0A 1CTQA 4GBED 4YJ3B 1H4VB 4GWGA 3DQPA 4CUZA 4AZWA 1LBSA 4X24A 3N8HA 3W7VA 4G4SO 4OFZA 4RH3A 1ZMBA 2JFQA 2O5RA 1KL7A 3V1NA 4KXYA 3SS7X 2OGZA 2FSSA 2WE8A 2DZDA 2X15A 1TD1A 3H1TA 2ZSAA 3D6UA 4NAHA 1WAMA 4MPDA 3BWVA 3P9XA 4WESA 1L5HB 1F20A 2Q62A 1FDRA 2R6AA 3LPAA 2CZCA 4MV1A 4PQEA 5AI0A 5LR6A 5EC1C 2LJ2A 1ZCBA 4EUFA 3AJEA 1G21B 4R6WA 3RIXA 2ZUVA 2ZJBA 1GKKA 4D8VA 1W76A 3AUYA 5LQMA 3FCXA 1SUSA 2CC2A 3BWMA 5DGHA 3KDPA 3TOCA 5B4TA 1NT2B 1IJBA 1XX6A 4OBEA 4WFKA 5CIWA 2BM1A 4JH0A 3KHKA 1DQRA 1I94O 4GMKA 4JLAA 1ZOIA 1I6LA 3NCHA 5JNUA 1E1NA 1WDMA 2V8BA 1J5EB 1D03A 3WY9A 3QLVC 3RRZA 5GIPE 1FRFS 3VZQA 4AY4A 2QUAA 3OETA 3Q41A 5ISMA 3MELA 3V1KA 2JZCA 2C7VA 2CUZA 2O3UA 2GHTA 1J00A 3FKQA 4MEBA 1FIUA 3ZMVA 5JXIA 4E12A 1I01A 1JIQA 4X93A 2C4VA 5ES4B 4M60A 2JFZA 4DEVA 3BXZA 1B00A 1W19A 4LXUA 4IZIA 5ITWA 4ND2A 4MP6A 3HFRA 1KFJB 5JNVA 3SJAC 2EVWX 2WJJA 3FRHA 3V1MA 2ZT6A 2NUBA 5T6BA 3W90A 3WB0A 4I50A 1AY0A 4G97A 3ZHUA 3K0HA 4F3CA 1L3BA 3UHAA 5ICEA 1H4QA 4NARA 4B6FA 8GPBA 2IY8A 5FRDA 3J81k 1CTUA 4XBFA 4JR0A 3EHEA 4Q4DA 4NR0A 2ODNA 3OLWA 1MAUA 2IYTA 4F4IA 2JGRA 1NU8A 1WXWA 2C7BA 2GB4A 3FPLA 3LNCA 4G4SP 1OU4A 3H2ZA 5CW1A 3YASA 5CFQA 2ZTLA 4MQEB 2W4LA 5D7NA 1GT91 3SMQA 1E3TA 3T4PA 3TTXA 4RTPA 3LBIA 2P4UA 3NW9A 3NWBA 1YTFB 4GGOA 3G59A 3L0DA 3WBFA 2ZDIC 2EFYA 3WWPA 4QDUA 1O6CA 4HGYA 2Y68A 2WK1A 4QU5A 1YQQA 3OX4A 3A4IA 1XRNA 2GKOA 4RMNA 3ASNC 4K1LA 4Y8VA 5JT1A 5IT0A 1PKEA 1TTQB 4MRAA 4WJLA 3A9TA 3REQB 4MQLA 1SELA 3I04A 3ZRWB 3DFFA 4KXWA 5ALHA 4BQIA 3WGIA 3W9SA 3RN4A 3UKMA 1WEKA 1AJPA 2OKCA 3EDYA 2WNSA 5LJLA 1U2QA 4UHJA 5T7BA 4HLUA 2J3EA 3IKJA 4UCQA 2NPOA 3FGOA 4IIJA 2CMKA 4UNIA 4ZCSA 3LHSA 3WNZA 3PNBA 1E8NA 3R1IA 1DC8A 3VO1A 1GAQA 2ZRDA 2XUFA 3VR6H 2BDTA 3CMEV 2EWVA 3CJQA 1MN6A 2FW1A 3WBBA 4CE6A 3AHFA 4KZKA 4XYMA 3TFWA 3TIVA 4F8YA 2G0AA 3IO3A 4D8TA 2H07A 1WVMA 3HCNA 1JR6A 2X3UA 4M1WA 4UUNA 1I0ZA 2OFPA 4LV8B 3FTFA 4E3WA 2ACVA 4DCOA 2WVGA 2CLFB 1ESNA 1JT2A 3P7MA 3P0HA 3CLHA 4U2BA 3SQOA 4DF3A 5KTOA 3KKLA 3AV3A 1QMGA 4O6VA 1PRYA 1G8HA 4RJJA 4V2IA 1MB3A 3RM3A 4EI7A 3ZWDA 4HWSA 5IPFA 1M1ZA 3IBGA 5JJEB 2YIBD 3CRQA 1X86B 4FKMA 4JI6B 1X39A 1QDUA 4CLXA 3IOEA 4CTJA 1UPXA 3M7IA 4N54A 5C8ZA 1OX7A 1OE0A 2RC5A 2H8KA 5F7ZA 1KETA 4DR5O 4BTEA 1NW9B 1VXRA 2ERXA 1T8TA 3X1JA 2WLJA 1Q7RA 2IEGA 2PRJA 4C6TB 2OD2A 1NBEA 4QRHA 4KLZA 5BSHA 1GUDA 1SPXA 4LF7B 1KFBB 1ZS9A 2RHBA 1FRVA 3M6MD 1Q5PA 2V7BA 1NW8A 1XMJA 3WBKA 3AETA 1GOTA 2JLRA 2O2YA 3ANYB 3DMPA 1XVUA 1MEOA 1TVMA 3GNTA 4GEGA 4HLUC 5T8KA 3KQPA 4LBEC 3RFVA 3SJBA 1AKYA 5HKBA 1TYAE 4WOBA 4LCEA 3OQNA 4TV8B 3SI7A 1L3IA 2DQ3A 2BGNA 1BGXT 4RVCA 4ZCRA 2ACWA 2AHRA 3PGJA 1ZGGA 1JYFA 4QGHA 4JBIA 1CDEA 1FDWA 1M73E 1PNMA 2E21A 2AW5A 4CMAA 3C7TA 1WW8A 3IOMA 4OKNA 4H1VA 3SVZA 5FDFA 2R2AA 4G9GA 2DR3A 1ZINA 2YUAA 1PFYA 3ID6C 1FS6A 1V55C 2WSYB 4BNIA 2RH9B 2ST1A 1JLSA 1UDBA 3AEZA 3WJ7A 4BATA 4LCBA 4F5YA 4ZGGA 1UBFA 2W6MA 4YCDA 2X8JA 3RRNA 1D9XA 3F6YA 4NYIQ 4NOMA 5D5HA 5F12A 3RTEA 1FFCA 1MV5A 3KT0A 3QLTA 1H9CA 3MUEA 4HTAA 4DOMA 2PUGA 4A16A 1MJFA 3SBGA 3OI7A 3FDZA 3WRWA 2XB8A 1SUPA 1K7FB 3RANA 1YIOA 3AERA 4AMGA 1Z74A 2RHGB 1M2OB 2GVZC 1NTZH 3GEEA 2HJFC 4ZAFA 3U81A 1Y1LA 5LQNA 2XWJI 2H1OA 4XSVA 5FUWA 3WLQA 4OHXA 3T54A 3SXUB 4INAA 2AG6A 3LNNA 1IEVA 1R27A 2XNCA 4IILA 1PR1A 3C7DB 3QYFA 4GOJA 1LWNA 2M6KA 1T5IA 4PANA 4ADSG 4B47A 2Q3BA 3COWA 3H6GA 3AEKB 3ILVA 3ZU2A 1EHCA 3MJVA 5E6SA 2ANBA 5HKAA 5LZ4A 3J80A 1BCSB 3ASUA 3FZGA 4M1EA 1QFYA 3W6OA 2LXNA 3SS9X 5JNTA 2VDRB 5BSEA 3QW4B 2QTOA 3ZHBA 4AMZA 5JQGA 4BNNA 1TKCA 1AHNA 4MLPA 4OHFA 5T4BA 1EEHA 2OBXA 3GJ3A 3LGAA 4JYMA 4P86A 3T5DA 3F6BX 4C0JA 5EHXA 3Q0IA 1Z83A 1MW9X 4HXFB 1WNTA 4JHLA 4MDYA 3MPUA 3RC3A 3LVBA 4X7PA 1Q7GA 1P29A 1W4LA 2YS7A 4TYPA 3W5BA 3LFTA 1XCPA 2FV8A 2QN6A 1L1FA 4XIGS 4X64O 1BHJA 3HJNA 3I34X 4K9NA 4U2CA 5LC1A 3Q8WA 3NYRA 1ISGA 2GPJA 2O20A 1OPRA 3E1SA 1OYOA 1JBKA 2CMFA 3I01M 5EL0A 3UGQA 1QOPB 4KXFB 3I9OA 2RGBA 1JAHA 2MMGA 3UOGA 2VPYA 4PAWA 2G72A 2ILTA 4PIVA 5ENVA 4HHEA 4QNRA 2BFCA 3WXMA 5BXYA 3ZPCA 2YVLA 3B5IA 2XODA 1U28A 3OAAG 3OP4A 3R6WA 4XDZA 1BW9B 2PVSA 3AZPA 3HVKA 2LTAA 3KJXA 2XTNA 3OW2U 1KQSU 2ESRA 1OT3A 3OT5A 3LSSA 4LHEA 3ZS9A 1GRJA 2QV0A 3UWPA 2AQIA 1I7DA 1Z28A 2DSTA 3ANNA 3O84A 4DRYA 3EBOA 2QMUA 3WDLA 2JCVA 4CM9A 2PZFA 1B3BA 2E5LB 1ZNYA 5D84A 3KWMA 1ZJWA 4WLNA 4KPUB 3TRFA 1EDZA 3BVOA 3L01A 3MB8A 3QU5A 3LSYA 5JAOA 2CDCA 2IBSA 1O6GA 4EENA 3B77A 1B06A 3LSQA 3FROA 1CJSA 2WFMA 1Z08A 3JZDA 2A5JA 2WKWA 3LUBA 5DULA 2CJYA 3AKEA 1YBMA 2JIPA 2NU6A 3AIOA 3UICA 2PTGA 4I4LA 3ZY2A 5DYGA 4BB5A 5A9SB 2ZKIA 1NIJA 3IEKA 1EHIA 3VOBA 4FZ3A 3GFTA 4NONA 1YQWA 3Q7TA 4TRRA 2EZPA 3T3DA 4QYXA 4RTJA 3OJXA 2CLMB 3N28A 5REQA 5BV8A 2CN1A 2IGTA 3PNPA 3EA4A 4G1CA 1G63A 3BEDA 5G40A 1B0AA 2VHCA 2W11A 2X9VA 5G4KA 2HADA 7YASA 4TKZA 5E79Z 1JWAB 3DM9B 5TC4A 1QX4A 1WUTA 4B3GA 1U8TA 1V48A 1YI8A 2CJXA 3D7KA 3KFLA 4EHLA 2VUUA 5B1EA 2BISA 1PX0A 1IZ0A 5C9ZA 4LK3A 4O63O 5B5SA 5I4BA 4RH0A 4WNAA 4L28A 3UVEA 1OI4A 3CSSA 5JRDS 2HT6A 2QKSA 1CEXA 2UZ1B 3GPIA 2XAAA 1M6WA 3D54D 3VUFA 2V7QD 4I3HA 1L4UA 1UOEA 2QZZA 4WASA 3A4YA 4GMGA 4YAKA 5LP6F 1O1YA 4IIUA 3JAMA 4TM7A 3TH5A 1FSFA 2N05A 1RHKA 1RXSA 4KIWA 4Y6PA 4QSHA 2OCKA 3PE4A 5HEKA 4H4DA 2BHTA 3LFUA 1N8TA 3RWOA 1U1GA 3SEFA 3V00A 4V2UA 3IIEA 4KRGA 4B4VA 4E11A 4JQSA 4DHWA 3CF4A 1KEKA 4OFXA 5ALEA 4K0KB 2EKBA 4R51A 1NPDA 4QHYA 5AW5A 3KVYA 2A0LA 3IHLA 3KQNA 3L8ZA 3JALB 2H9IA 2J5XA 2ZPAA 3R3YA 2Y2VA 5JRZA 1Z6YA 4MR8A 2G84A 4RQUA 1SKMA 1E1RD 5H3LA 4XGQA 2R6GA 2NXJA 3IQEA 1G5RA 1W0KG 2AG1A 4TYQA 1YR2A 3K04A 1NU6A 4TYMA 5EZYB 2R2GA 2WKQA 2XXAB 1YOBA 1Z6ZA 2D2XA 2GJSA 5KYVA 1AI5A 3NDBB 4EJ2A 4KNWA 2IS6A 1BZYA 2SKEA 3DE2X 1C4KA 3OOJA 4XYBA 3ZLTA 1YZQA 3VHRA 4BNHA 1U0NA 2FWPA 1ZU4A 3KVOA 1B15A 4RE6A 5H83A 3AILA 4X92A 4NESA 4XIIA 2PI4A 3AJAA 3HCBA 3M81A 5JCZA 2K87A 1RKXA 2OT3B 3B60A 1XZFA 4G5SA 4LRUA 4P4NA 3AG4B 3IQHX 4MGYR 4WXMA 3RAGA 1YDFA 3AL0C 2XAQA 1UXHA 5K05A 3K31A 4DYDA 2BFWA 3WDKA 3OJEA 4FT4A 2ZDIA 2W0SA 3DXRA 3TM5A 1ONBA 3TUZC 1OZFA 3RTBA 4EI8A 1BMFD 2VK4A 3F5TA 2XWSA 3LHFA 1G9XA 2Y0PA 1LI7A 3OESA 1VBNA 3QENA 4HX9A 4K9KA 1A50B 3RFTA 3GLRA 2HB6A 4KU4A 3RVDA 3ZE0B 3OJ6A 3PRHA 4FXPA 5CVJA 3TZBA 1F6DA 3N8NA 4C7UA 4URZR 1T6ZA 3RVZA 1JG1A 1FEZA 1AXEA 2A0KA 2N42A 2HG5C 4G1MB 4JVSB 3VZBA 3ZDAA 3IB6A 5A6SA 1PHRA 4B40A 2MR6A 3K59A 2J87A 5EJ6A 4LOIA 1SXPA 3IDOA 4DBLC 3O4FA 1I1OA 3OX3A 3EJ6A 1XRSB 621PA 3GRFA 4U2KA 3TNJA 5BUZA 1GVNB 2FOLA 3AQ4A 2PNFA 2Y92A 3CTPA 3HDHA 4BGDA 3BEHA 2HRRA 4UMFA 2O0KA 3B48A 4O8YA 1LRLA 3D6JA 4DQLA 4Z49A 4YT8A 1FP2A 3TW4A 1VQLV 2ADMA 4PYKA 1D4ZA 3IULA 1C2YA 3AEUA 3HRHA 5K0FA 2OZPA 5DNEA 1I7PA 1SXIA 1TM3E 2CVOA 1SQQH 1KPIA 2PH5A 2G06A 2FK7A 3EVDA 4GP6A 4MW0A 4W9NC 4D9GA 1XQWA 3U40A 5DN6D 1M5IA 1DELA 3CA8A 3AUUA 4IVQA 4PC6A 821PA 4ABTA 4H77A 3R0QA 1VQPV 2IW5A 2QX7A 2Z4SA 3WI7A 1USWA 3GJ0A 1AK1A 3G2LA 4BWAA 3GLGE 1LSSA 2QTCA 1BDIA 3G0OA 3R7LA 3OF3A 2WWFA 1C0LA 4QDXA 2CTPA 5J58A 2V0GA 2EJCA 2WE7A 1XI2A 2J7PD 4H7DA 1M6VA 3DMGA 4LOKA 4NYIR 1V54C 4JKOA 3ESXA 1EBOA 2CAZC 1OFHA 4LH6A 3ZLVA 3ULKA 2HNAA 4RD4A 1BOFA 5B1YA 5IU6A 4O1IA 4W1PA 4X6LA 1G1AA 1N0WA 1B6QA 3K58A 2OEPA 1GNLA 1KS2A 1YQ9A 2WSMA 4F4LA 3I0NA 4KB5A 4UM7A 2FOIA 5HKOA 4ALNA 2R70A 3H1FA 3A4VA 3GP3A 2P3QA 4I9NA 4R8KA 2H65A 4DXWA 3BZUA 1YJAA 5EPOA 1I7NA 4FI3C 3N0VA 5FL7D 2UXBO 2BCCH 1CFJA 2H29A 3HO6A 1KMIY 3RJZA 4FHCA 5LP1A 1Q2XA 2XI4A 2C0CA 4OX9B 1GFSA 3P0JA 2P5SA 3C97A 3GLHE 1ZX3A 1P1JA 4HWGA 1J24A 2ZRFA 5DEOA 5I7WA 1QP0A 1VKHA 4OO3A 2D3OW 2G63A 4F1KA 3T7RA 4YUZA 1W5TA 1MP0A 4PXSA 4J76A 4QOHA 1MSDA 3B4SA 2GTHA 2PX4A 4G5OA 5HS6A 5C4IA 3I23A 2Y27A 2ZE8A 3ILHA 3U39A 2PTHA 3P0IA 1KAOA 1SCUA 3M1IA 3OMWA 3COJA 4IJMA 1HLGA 3FPBA 1IZ8A 1R9JA 2EL9A 4I5FA 2CL7X 4X1KA 1P31A 2DUJA 2VYVA 2DQ0A 1IUNA 4WF9V 1EBUA 1Q11A 2WTEA 4K9RA 2YOFA 5NULA 2HDHA 3L7YA 1X15A 5KI6A 1U81A 1GCIA 4AIRA 4I5DA 3IUPA 3PEWA 1M2GA 2HCTA 3JVIA 4N03A 1Z4PX 1E0DA 4EYSA 5F76A 1KY5A 3CO5A 1WD7A 3IHTA 2VPWA 4UNPA 4XCVA 3ROPA 3WYNA 1UAAA 1RC8A 3M6VA 1O94D 2VYFA 4G5GA 1NVGA 3T41A 4D3ZA 5BPFA 2CLDX 4WN9A 4NFLA 1JEYB 6LDHA 1BQEA 4MR7A 5U9CA 3GAMA 3N2KB 4W99A 2V8OA 4WOKA 4B2LA 5TQ2A 4J42A 2WLHA 1WA5A 1I5YA 2AOUB 1M2FA 1YI0A 4NVRA 3WB9A 6Q21A 1F0NA 2IQIA 4NKGB 2HF9A 1I24A 2IYPA 4DC0A 5JBQA 3VU8A 1YZFA 1JU3A 2ZVDA 2W2QA 1VHQA 4G2TA 5IJ9A 3G2NA 4XIYA 3L1UA 4DJJA 2FN4A 3TZEA 2Z5FA 4AMUA 1U4NA 3M6IA 4GLOA 3KLOA 4QECA 3DXRB 3ZV3A 4DCUA 2LP4Y 1RVDA 1JJVA 1BJTA 1UJBA 4KXNA 1XCBA 4ZKDA 3U19A 3O0TA 1WOMA 4U0JA 4YRJA 1K3UB 5B6IA 2WD7A 3ZEDA 4X88A 4B3TB 1EFVA 5JH7A 3ROGA 1SK8A 4RXTA 2XHEA 1Q1AA 3K5IA 3BXHA 4YROA 2PBLA 3L0SA 4GYWA 4U7JA 1R6VA 2R48A 1N5DA 5K45A 2XMGA 2BTOA 1RRFA 3CRNA 3QSGA 3DAHA 3PDIA 1SVSA 3HFJA 3NBAA 4I3GA 4WIAA 5D00A 4ZPJA 1GLVA 4NZNA 2Q8NA 4R8CA 2WFLA 3CLVA 2O2EA 4XB6B 4O08A 1VL2A 4RM3A 1B76A 4EAAA 2VZLA 3IH5A 5JSZB 4HSGA 1GKYA 2C03A 5DYWA 2VTBB 2HK8A 5HGXA 4Q1BA 2P1ZA 1T1JA 5KAFZ 3PVCA 1XTPA 5CB8A 4XM1A 3A1NA 4TOIA 1A2QA 3RVQA 1SU4A 3I9LA 3WLSA 1FUYB 3LBHA 1T24A 3O8OB 2HGZA 4N5DA 4Q3BA 1Z0UA 5ED4A 1Z35A 5JJJB 3AY3A 3CMCO 5AJYA 3ZIDA 2GKGA 4HFMA 3AEUB 3NWJA 1U0LA 1RPOA 5AXAA 2OXFA 1KE2A 4DQUA 4EJSC 4JI3O 4LD4A 1PSWA 1MJGA 2UDPA 4WXPA 3ZCUA 2ZR3A 3OHMA 3QP9A 3LZDA 4WKNA 1S4QA 2AVNA 3WGKA 4N40A 4BQEA 2WAMA 1J2JA 3M9XA 1DI0A 5DDIP 3U31A 1Q1NA 1QFJA 4TXLA 2E2WA 3UQ8A 1O2DA 2IYQA 4YH1A 3QNUA 4L3WA 3ZWQA 1ND5A 4PR0A 2GFIA 3MTAA 3NAMA 3PE6A 2Z6AA 4MUYA 4FYWA 2ZS9A 4QHSA 2RHDA 1FVFA 2ZPTX 1KKMA 1AROP 3HR4A 3UCEA 3F73A 2F3PA 1D0VA 3PHJA 5DTRA 2Q73A 4KN6A 1L3CA 4C20A 1NIPA 3RHFA 1NVUQ 2BL4A 3IEUA 3CIOA 3IAFA 2UUPA 4IL5A 4GOND 5E0KB 1EU1A 3HCFA 3PHGA 4EGQA 3EPHA 1HFWA 3RB8A 3GXOA 4CKYA 1Z4MA 3LT4A 4QPJA 1I2ZA 1L8QA 1P2DA 3MGCA 5CCDA 4TSFD 3CWBH 5JASA 4E14A 3QMWA 3R6DA 4HRVA 4RO2A 1TKAA 5BQFA 1DJPA 1DIGA 1KGDA 1AGXA 1OKKD 4TN1A 2FZEA 1L9XA 5K0CA 4BWVA 4YP9A 4ETIA 5J4LA 2R6R1 4JI4O 3E89A 1K4MA 1Z2DA 3KSMA 4I4TA 4JT9A 3TI7A 3AHHA 3QNWA 5L4SA 2C5EA 2Q50A 3BBPA 1ISPA 5CAEB 4OHZA 1VFPA 2QNIA 4XYLA 5FH9A 1BJRE 2LW1A 3MLAA 3GUVA 2CFIA 4ROTA 1N5JA 2ZB4A 3IVRA 4UAGA 2CDBA 4L08A 3UG7A 1X1DA 2J31A 2I34A 4WXYB 2G25A 2OOKA 5AVOA 2HHHB 5FCDA 3DUFB 1GPMA 1NT2A 1TVCA 4A4DA 1HOXA 2ZBPA 5L3BA 1L7XA 7REQA 3CBQA 4YJHB 1R0XA 3A6JA 3ES9A 6GPBA 2I55A 4WNCA 5TPWA 3VYTB 1JZTA 4Q1EA 4MUHA 4DBZA 3NJRA 1WMFA 2BGRA 4YJ2F 1Z2AA 3CEAA 5CX4A 5E2BA 3IEVA 1EM1A 1G8GA 4FI3F 4GX2A 1UBHS 2QRVB 2QRHA 3L0YA 3FWHA 4G2KA 5CGZA 1PD0A 3GNQA 1KP9A 3VAAA 4ACBA 4PCUA 2D2CB 2I3AA 2J3DA 2NSHA 2PWYA 3G89A 3GD5A 4HH4A 4JJGA 4LSMA 1P0CA 4OCNA 5C34B 5ER6A 4UZEA 3E2PA 4WN9B 5LYJA 2AR0A 3PNOA 5C52B 4ZT5A 3RTDA 3U3JA 3WJ2A 5CTAA 4EARA 3T38A 1G5FA 2Z1DA 2WMNB 4W5OA 3P19A 4JUBA 3LVRE 2F4NA 1TYEB 1IMOA 1FRNA 1UBOS 3BK1A 1SKYE 3SY8A 3WGMA 2LQTA 1K7DA 2R5WA 1N5LA 3AG6A 3AF2A 1B16A 1XWFA 2XUGA 3QWIA 4E5DA 5HIIA 1YDHA 2C4UA 3CRVA 3O5AA 2PFSA 1JE1A 3T1CA 2QYOA 3IS3A 2ATXA 3Q5EA 4YGYA 2HSDA 5C37A 3Q3VA 4RV5A 3TQHA 4IJUA 2A0UA 1DF4A 2Q6OA 2JANA 2ZBUA 3QOYA 4IDBA 3KEFA 1PE0A 3S2EA 5FBVB 5IY5C 4HNUA 1Z2NX 2HKOA 3NHAA 5CJPA 1HO3A 3PB3A 4L51A 3MOSA 1AQIA 4OTZA 1F48A 3DBRB 3TDKA 5BYJA 4PONA 4IDQA 4AU1A 2DEUA 1WG8A 4PFKA 1AKRA 4DJTA 5JS2A 5AVTA 2CGOA 2O50A 1CRZA 1QR2A 2ZJ2A 3NVMB 4IS3A 4HTFB 5E4FA 1RQRA 5E2IA 4Z0HO 3ETJA 1YC2A 1Q0PA 1VKJA 3X1XA 4OHYA 4EHNA 2GCPA 1RE1A 3G9XA 1JZQA 1KZGB 4RDHA 4V0KA 4N39A 1MRNA 4HWKA 4LF6O 2BEWB 1PEDA 3O6VA 4HDMA 4G0VA 4RCYA 3UAOA 1KXZA 3NIBA 1HDCA 2DWUA 3D1LA 3HB4X 1I08A 4QG7A 1ADFA 3AKCA 2N46A 4D0NA 1U8ZA 3TVYA 4LXGA 2Z6QA 4MHTA 3CKMA 3PCRB 3OZDA 5IVIA 1GGNA 3R66A 3QVVA 2FVYA 2QY6A 1EFDN 3O0DA 2W5UA 2GPBA 5DFAA 4CMHA 1CUWA 2C98A 4B3SB 1T1RA 1DBSA 2BR5A 4JIMA 3CWZA 5BN1A 2G36A 1MHPA 4G5XA 5FPOA 2WU3A 1EZJA 1RKQA 3BCRA 4AG6A 1J0DA 3D0OA 3THWA 2PRZA 2LRHA 1UM9B 4D97A 5JARA 1YBAA 2C94A 3I73A 1UJ2A 2M2IA 4R9NA 4H6VA 3K5OA 1TM4E 1YZTA 3TX2A 1XZDA 3BCCH 1DC5A 4UTPA 1E77A 2VP5A 3BMNB 3E9CA 3O65A 4MSMA 3VQVA 1ATIA 1AR1B 1E6CA 2VZ9A 1I0HA 3STZC 3AIIA 3L6CA 1PZFA 1L7DA 3TG8A 5KNLA 3TLBA 1LNSA 4JY7A 5THQA 4MGZR 5IAEA 1U1IA 1RHQA 1M34A 2CNWA 1R4ZA 4LJ7A 4P92A 4UUAA 2P27A 4CQLB 3ICCA 2J0QA 3PR2B 3BDVA 3RYIB 5KB3A 1B8UA 1B8NA 1STOA 3ZZMA 3QF4A 3CCJV 3KDSE 4YFYA 2FR0A 3UMRA 1ST2A 3I5AA 1R9GA 4RH1A 2R8YA 3FNBA 1O9HA 1H2AS 5LNK6 4KQMA 4C5BA 5HR5A 3O9MA 2YWHA 3L8CA 3LRXA 3MAQA 2QTRA 2XUHA 1MOSA 5AVRA 1ORRA 4OM8A 3QNMA 4A8PA 3WLMA 3FOBA 3KIPA 1K4DC 3V4OA 5JD5A 4UM5A 3VZDA 2IZ7A 2BRUC 4AF7A 1R6XA 3LPCA 1Y6JA 3L05A 4RKEA 5FNVA 3G0CA 2HR3A 3D36A 2XZPA 4DPMA 2A8NA 4CLOA 4AZSA 3IAS1 4L2IA 1YV9A 4O1MA 3PWTA 3KK0A 3LUCA 4MYCA 5AVKA 3C3AA 1JN0A 3K9AA 4P0TA 3VU1A 4BMCA 3PG5A 5JXGA 1MHTA 3AJDA 2YNMC 4REMA 1HYQA 5I3ZA 1SVWA 1N7GA 4GLXA 3L49A 4UJ3A 4KITB 1NUAA 2DTEA 3EAQA 5JFGA 4BE7B 2B6NA 3KFVA 1OI0A 4ZO9A 1A9TA 1YOVA 3R6TA 4LR3A 2DGDA 4RA6B 1GPAA 3LBAA 3Q0TA 4R8MA 4CCYA 1P5JA 1P2VA 1SG0A 3I45A 2ECKA 4EG7A 1DAIA 1ORTA 3LU1A 3DH0A 2J30A 5CA1A 1ZSYA 2ZJ6A 1OLXA 1QG0A 3DCIA 4MYUA 4OYRA 3DW3X 2VRWA 4CGYA 4D9HA 1GQQA 1W8IA 2LDBA 1HUQA 1THGA 3ITNA 4I0WB 3MCAA 4OHWA 3FWNA 3NC4A 4V1CI 5KYUB 5HQTA 3T1HB 1QF7A 3OPMA 1ZYUA 4D80A 2R6ZA 1H2BA 4JB8A 3N9IA 2PN1A 2DLNA 3OGCC 2ALJA 2QD5A 3C0KA 3GZNA 1EK6A 4BMPB 9LDTA 1FS5A 4ZV7A 4I6GA 4F2GA 3VAYA 1BGVA 3I3OA 5EGSA 1FZTA 1PVVA 4KFSA 1ZO8A 4LC5A 1UJMA 1Q43A 3GQVA 4Z54A 4N8DA 2HEPA 3RCBA 2QS9A 3C5CA 2HJDA 1ZJJA 2O3JA 3EVAA 3RSQA 2RD2A 1JG2A 3EQ8A 2WP0A 1QYIA 1BQ3A 5DCLA 3WMGA 3FUWA 2IHNA 3DLBA 1G2QA 2ATCA 2KQUA 3A2NA 1FJGB 1VG9B 4DMKA 1X7GA 1LK7A 5IP5A 1ZONA 1TJ5A 2BONA 2VXBA 3EISA 5F77A 3L72H 1TGVA 5AO9A 3K15A 3HKEA 1D2GA 3JSLA 2FHSA 3N2GA 2XJ9A 2GM5A 4QQNA 4RX1A 2E75B 2CH7A 2FN7A 5EZYF 4R1MA 2OXIA 4W5TA 4LNAA 4NEHB 5KPJA 4FDMA 1CVIA 2FG5A 5JS6A 1YS6A 4I1OA 4XUEA 4AJHA 3K5PA 1L4MA 2IUTA 2XTJA 5BV2P 3UBMA 2NYUA 1F0PA 4V0SA 4FMBB 5H5JA 5KWVA 2X7RB 3KJHA 1A7JA 1P49A 1MKYA 2J09A 3PNYA 1LR1A 4K6FA 3KPWA 3HLYA 6CHYA 4QU8A 4UM9B 4J03A 3NIFB 4LBYA 3UANA 3IEMA 3FUVA 4E22A 2ZR7A 2IV2X 2HSEA 4O4JA 3FRIA 3R65A 3F8WA 3O1LA 2G7MC 5L4LA 2CFOA 2R6CA 4M8KA 5LPNA 1CY4A 3FSRA 1TD9A 3GUCA 1DX9A 3E9NA 3OOHA 4DYVA 4YMHA 2CV2A 4KR6A 1RQ7A 3VSAA 4ZIRA 3GMSA 4FX2A 2X0LA 1DAOA 3FWZA 4ZMSA 2EBWA 1KA9H 4MQFB 1FSSA 4C0BA 4KFTA 1WV0A 5EXPA 3RREA 3UUWA 2EJUA 1HNXB 2MSLA 1CC1S 3QHQA 1W4ZA 1Y7LA 2HCFA 4UBKA 4DLBA 4Z5XA 1U94A 4E5UA 4GT1A 1NUTA 2ZI4A 5FL7A 2O59A 3FCYA 2Q9LA 3FI0A 4ZQCB 3CZ4A 4RK0A 4TLLB 2MHCA 3L4BA 2EIMB 3FFAA 5L3SB 3B1JA 4WBNA 4YHHB 4AB1A 3VU9B 3P9IA 4JLNA 4UQPA 4BO6A 2ACEA 4UNSA 1CS0B 2NT4A 4WZ6A 1C1HA 1JSZA 4XFDA 4H44B 2QE7A 4DV6B 1YWGO 3EGDA 5G3ZA 1QZTA 1NVAA 4I99A 3UO2A 1FE8A 1U0JA 1WDKA 2Y1CA 2I9KA 3KKPA 4C89A 3RRYA 3DZDA 3GVPA 3WKAA 4JL6A 1PAUA 5IZ4A 3OJOA 4ZQGA 2W93A 4GNKA 4JQZA 5JIBA 3KXPA 3A3KA 3ABKB 3L8YA 4IDAA 1BQZA 3UM9A 5IZCA 3UAYA 2J6CA 3O4GA 4NTYA 1XQ1A 4Z99A 2D1TA 3SZMA 4L6AA 2A9VA 2RH8A 2ISQA 3CUYA 2P69A 5F52A 1YK0A 1FDIA 4II2A 4B87A 4BGDC 4HI0E 5AVYA 1XD2A 1CVLA 3BWBA 3KE8A 2VK1A 3HUUA 3EFOB 3QBJA 2NU9B 3DFIA 4OOEA 5EIBD 4IVNA 4A0HA 1WUIS 1GM8A 1ECGA 2ZXEA 2OGTA 1U3CA 3P9QA 4OL9A 1SWVA 2JFOA 2PD3A 3HEBA 5IWAO 4MQBA 4TKMA 4B3DA 3EA5A 3VKWA 4NZZA 1E2QA 1GL9B 3PJGA 4GI3A 4YMSA 5H1YA 4E4RA 1CKEA 1JHYA 1W2HA 2DR0A 3PNSA 4GEKA 3ZNPA 1Z2OX 4NKRA 1KARA 3EZNA 3JATB 1C8VB 4GPAA 2Q5JA 1OV9A 4JEHA 4A5SA 2IHJA 4ZDIA 1K6MA 3RR2A 4MV0A 4IIGA 3CVJA 1RNLA 1CQJA 2IBMA 3RUAA 1GTMA 4P7KA 1IB6A 1XIVA 3IVGA 3U3XA 3QXCA 1XEXB 1T8RA 2WUVA 4V1CA 3WMFA 2H5EA 2P1RA 4FW9A 4PZLA 5DJ5A 1P0IA 2ONYA 3HP7A 3EGXB 3NEAA 5SY9A 4BVBA 4D44A 4O3MA 2DFDA 1SU6A 2W2TA 4X7BA 2RKWA 4YCSA 3FHLA 4HC4A 1XHZA 1WWRA 2WU4A 5EUQB 4MSJA 3FMIA 4UQOA 3M83A 1ULTA 2X9GA 2B4QA 1UWKA 1KYQA 5BOSB 2PMDA 3HSKA 3KO8A 4HX2A 1MA3A 2Y9MB 3VNAA 3LXXA 4E7PA 2BC9A 4JZGA 4DR2O 1VKNA 1EZZA 2XXBA 1GWNA 2YVQA 3QELA 3V8MA 2WOJA 2HDWA 2IKSA 1P5RA 4YJKA 2I4OA 4H1HA 4HS9A 4IY1A 5G0UA 4A7PA 5SYAA 5H5NA 2JGAA 4HNHA 4IQGA 3PYXA 5CGQB 1N2CB 4OQFA 2LV8A 2PV7A 3LX5A 4MROA 2ZCVA 4TSFG 2HIAA 4B6OA 1SVNA 4IZOA 3JQFA 1IRXA 3EPPA 5SV2A 3ZRSA 2HFEC 3IQDB 2C61A 3B3QA 3Q3IA 4QTZA 3SKXA 5K01A 4LJ6A 2NVUA 2AYZA 1KYXA 4QYWA 4QOGA 3TS1A 2VNHA 3LUHA 2P3SA 1QRDA 3WLTA 5CDFE 4XW2A 2RJZA 5HF8A 3O92A 1Q7YW 3OFVA 4P4GA 2J3IA 3AJ8A 3MTEA 2WYOA 3ZYZA 3W5UA 5IF3A 1VJTA 3DAYA 4O4JB 3ENNA 5IXSA 1T6XA 3O47A 5AICA 2OQVA 2VYCA 1W59A 2XEXA 4LCJA 2J5RA 5T8KC 2FPIB 1MIOB 1XL4A 4WFEA 5LGUA 1QHNA 2IY9A 2WNIA 3AR5A 3ETCA 4M9QA 3JQ7B 1MB9A 3USZA 3IVMA 1S8OA 3PHBE 1EZ4A 3ZD8A 1XCJA 4IWNA 3CKKA 5CPBA 1KZYC 1YR3A 2C97A 1RKUA 3MN1A 3O74A 1OZ0A 2VJDA 4DSOA 4XR9A 3K09C 4OPHA 1KU6A 5ALIA 5LQDA 1D6NA 1HDGO 1RI4A 2YIAA 3RE1A 3VHXA 1S02A 2PG3A 3HDJA 3TVTA 4I6JA 2ECQA 2BF4A 3SSAA 3WK8A 4CMEA 1GYPA 1PV1A 3DE7X 4GU5A 4KNVA 4PN3A 4TQFA 3LUDA 1J39A 4D4GA 2O96A 2ZE6A 2ZYWX 2HJVA 3LHDA 3U80A 3W5SA 5EP1A 3H3JA 5AVQA 1LH0A 1EB9A 2IXFA 4UFOA 3ANTA 3RK4A 4OHKA 2JJ1G 2J9YB 1XGKA 2ZZMA 5BP7A 1KC3A 2VJOA 4TYYA 3SAJA 3RYHB 2QPTA 2VYQA 2Q4BA 3ZWCA 2II6A 4BFXA 1CEYA 5ALTA 1R3UA 1V8OA 3ZZUA 4EHJA 4Q82A 4ZJZA 5EWMB 5ARCA 1QU2A 2A5LA 4UBNA 4AQ7A 2A59A 3H8SA 1UPFA 2FLWA 3WDMA 5JFTA 3PQ6A 4LFCB 2XB9A 1SHJA 4PYNA 4TLDA 4MSDA 1G8FA 3HADA 2WJVA 4LWOA 3A0HZ 4IUCS 4S0ZA 2ZUDA 3U3RA 5KTMA 4P0PB 5FYDA 1DOHA 3AV0B 3F1LA 1OZGA 1EHYA 2X8AA 4FWTA 1GY8A 3WV5A 4DV0B 4ZYZA 1ZSNA 3L06A 5DNWA 3S70A 1Z8HA 2I3BA 4AX4A 2VJAA 1UBUS 2HVJC 2P5OA 4CV3A 1HXHA 3U4CA 3NTQA 3WQSB 1CQIB 3BJEA 1NONA 1T4BA 1N32B 1ZD1A 2XUQA 5DZSA 1XMPA 2IZ1A 3DTTA 4X6XA 4EG2A 2ONKA 2UXBB 1MXFA 2QMQA 1WXDA 3EOAI 3HJAA 4R1UA 3MNFA 3PITA 4X90A 5BRNA 6YASA 3Q5DA 2CZGA 4XQEA 3F4BA 1YJ9V 1N9KA 3E4CA 3WLNA 3WQHA 3V4VB 2NYTA 5KUKA 3VR4D 1T5EA 4J1TC 3JATA 1EN4A 1ZH8A 4WVLA 1JT9A 4PZZA 5JAQA 1RAFA 1P60A 5AI8A 1MO6A 2I03A 3TETA 2QM4A 1ARZA 4OI1A 1WCYA 3GJ8A 4ZU6X 5I51A 4MS7A 4CN8A 4JJAA 3CLRD 4YP1A 2GRUA 2P77A 3UMVA 4P3NA 3VRHA 1CWUA 1L8OA 1Y8CA 5KSWB 1XQ8A 2IH3C 1TECE 3IC7A 5ETJA 2JIRA 4BKMA 3A7DA 2Z4RA 3VNRA 3I2YX 1NASA 1NUHA 1XKXA 2WJIA 3JQBA 1RWQA 3D02A 1KERA 4P3XA 4BDTA 4Q4CA 4PELA 2OHFA 2XCUA 4PLFA 3TW0A 4JYBA 1HSOA 1II8A 4C7BA 1Q22A 2CJFA 2P6UA 3JSXA 3PU6A 4GKBA 4KIJA 1R8QA 2GN8A 4YAJA 1KY4A 2F90A 2JIBA 3BD8A 3HU3A 5GZ6A 1HTBA 1U0SY 3QIAA 2NVWA 2YVUA 3AI2A 3ZPXA 1SC4A 2AXEA 1YJQA 2DUNA 1U28C 2PXAA 4NG4A 3W8DA 1CJKC 1M2HA 2BWJA 1V8BA 4GBGA 4MSWC 1DVRA 1U9JA 4Y9RA 2QVLA 1EG7A 1Q57A 4G6ZA 3LDGA 4IGGA 2Y4OA 4J41A 2YIJA 5DTMA 1CQZA 4I8IA 3I39X 4HAIA 5FI1B 2O0JA 3CFYA 4JGGA 4Q3LA 3V48A 2AN3A 3PPXA 2H7XA 4X00A 3R76A 3WMEA 3I9NA 1VB5A 3DMNA 1XV5A 1ZQ9A 1DEXA 2J7PA 1LD3A 2VF2A 3GFQA 3L7BA 3MWLA 2QLNA 5BURA 1J21A 4IG4A 4MDHA 4YYZA 4ESVA 2MR5A 4TTRA 2BM0A 1K4CC 2CE2X 1QE0A 2H5LA 3QGMA 1K8AW 2DY1A 2Z8ZA 2RC6A 1Q3TA 2EW2A 3OFNA 4LX8A 5F2OA 1KOLA 1HFEL 3BXOA 3CG4A 4TL6A 3WGNA 2FSVC 3DSQA 2H16A 1Y7TA 2I66A 4QTTB 4CIBA 1XHLA 1LTKA 1YCHA 3AP1A 3B2QA 1VF6A 4P08A 4XM2A 3WRXC 4XGRA 1WHTB 3RTGA 1N6HA 3H2JA 4QU0A 2QBYA 2Z9CA 2QP4A 3X2SA 1G59A 2X6QA 4ZI3A 1FW8A 2BMWA 5J9PC 1C9YA 2IXGA 4TTQA 5C46F 3KTDA 1MXHA 1T3GA 5KNCD 4HQOA 1YBHA 1WKQA 3Q7PA 4RFSA 1UZAA 1VMIA 3QVSA 2ZT8A 3DFMA 3IQFA 3Q7QA 3EUWA 1XN4A 4Q7JB 2OQRA 4O4IA 2PMKA 4NY1A 2CT8A 2KPOA 4IIHA 2AFHE 4TZKA 5EBLC 4O8CA 1GTOA 3HPQA 4LWSB 3GAAA 3G67A 3LQKA 3KV3O 3PUVA 2I6SA 1BS2A 1OTYA 3U4QB 5CEEA 3WSTA 2EEZA 5EIWA 4O2BB 2I2XB 2YIVX 3FTNA 1EP1B 1TQ2A 3I5YA 2JJ2A 1LNQA 1A5SB 3S40A 2QTVA 1G4YB 3DULA 2D3WA 1H0HA 4M1ZA 5BR8B 3O95A 3HA2A 2GCNA 1I94B 4MOWA 3C8DA 5ICFA 3S2UA 4X6YA 1QHFA 3L6RA 3D8HA 2F9MA 1WE2A 4MUMA 1AVTA 1HPLA 4AW9A 2H4XA 1VPTA 1N1MA 2J59A 3LHIA 4ZTUB 3PEYA 5JSHA 3IA7A 3V4LA 4R83A 5EWLA 5B37A 3R9WA 3F49S 1NY5A 5EZ6B 3UHOA 3DTUB 4MTXA 2RMKA 1DSSG 3CINA 3SIPA 2VJBA 3GGCA 1V3QE 4H6WA 5JC1A 1GRCA 3HLKA 3K72B 1IZYA 1Y89A 1ZQ1A 2VO1A 3D8SA 2AEFA 2Y05A 2AYYA 3I52A 2GEUA 4I8DA 3WLHA 1BYIA 3BXXA 4UHEA 4YIPA 2HZ7A 5GOZA 1L7OA 4W63A 1EVIA 2WSIA 2X22A 2X4IA 3ZDQA 4MVQA 2ZJ3A 3HVUA 2EINC 2I7VA 3MG9A 5M52C 3TOZA 4KXRA 1IBRA 3IHWA 2LGQA 3EPKA 4Y67A 3EN0A 3TYXA 4DM7A 2V5UA 5MN5A 1XMOB 1L4NA 1CUEA 1UPTA 4PYIA 3GB7C 1F2UB 4MR8B 4R0MA 4AY2A 2AEJA 3VR4A 2E82A 1JSCA 2H4WA 4KDCA 3HP4A 4BGVA 3VX8A 5IUNC 2QRVA 4BE4A 1YJCA 4HNSA 1X8LA 3DE6X 1UFVA 3U44B 5DHQA 4O5AA 5TDHA 1YE5A 5IC5A 4ZT7A 3E22B 1IHDA 3KBBA 3PUKA 4L22A 3L8MA 5JSYA 1USIA 3SBDA 3HL4A 4JJEA 4KHPO 1YTFD 1DL5A 1URPA 4JXJA 1OI7A 1Z2GA 2QE6A 5KIAA 3ZVMA 2XNDA 4BPRA 2JVKA 3BIWA 4PAGA 4Z9XA 4N7BA 4QYMA 3L4BC 2A0XA 3C1AA 5JCJD 1KWKA 3E23A 1QR9A 4TWBA 3OIYA 3PJEA 2EILB 3GN1A 3P96A 4N8SA 4BC0A 1G60A 1QCDA 1YE8A 3HMQA 4NECA 4BNDA 3JX9A 2PCJA 1VBKA 4KJXA 1P6UA 1K7YA 1Z68A 2I6TA 3C48A 1MABA 4OU4A 4F2HA 5LYYA 3QMPA 1M7HA 2D30A 5ITZA 2D62A 1RPTA 3BHNA 3DE4X 3F8SA 1KR5A 4LWQA 4UD6A 4Z86A 1L5QA 5AK5A 4CTKA 4MVJD 3V34A 1ZUD1 4BFYA 1HNZO 1TC2A 1DRKA 4RTKA 1CT9A 2Q5LA 1UJ4A 3LXRA 2IHYA 1AH2A 3GLKA 2BGLA 1E2NA 3K0FA 3VZRA 3KUXA 1YVEI 5EJ7A 3B70A 4CTMA 1U2PA 3KYDB 1ONOA 1P2SA 3OPYI 1OBFO 7MDHA 1SVOA 2C9ZA 4BFVA 4L87A 5CEJA 1ADCA 1A9SA 2OZLA 3QVMA 3DAPA 4HGRA 4KH1A 5A1JA 5IVKA 4QNHB 4YEDA 4AWBA 1Q1EA 4IYJA 1OCZB 5H0IA 3HNOA 1ACLA 4KODA 4MPPA 4B85A 2DFNA 1XB2A 4HDMB 1WJZA 4AQYO 1DJLA 4AILC 4N12A 4UULA 3SQNA 2P9FA 2DJVA 2QAGA 2PM8A 3HWWA 2GUZA 1X7XB 2AR9A 1NJ8A 1PJAA 3R2NA 3PRJA 5DXAA 3NPAA 2J6IA 3IBFA 1IPEA 4LZAA 4FM0A 4X1OA 3W8EA 4IAOA 4AUEA 2BLNA 1ODKA 1Z7GA 2OPHA 4XOUA 1J8DA 2OSVA 1H2XA 5HTKA 4JLMA 4IW3B 4D4IA 3V3TA 1DC3A 3CXUA 2B37A 4RMIA 2XWBF 3RVLA 3UJ7A 1H2ZA 4LMPA 4TTTS 2UYOA 5JYDA 2RI0A 5BW5A 1VRWA 2GZSA 3M0EA 4XQCA 5AR1A 2QVZX 4FM9A 2OWOA 1VJRA 3MILA 1HZZC 2B2CA 4WT7A 3NDRA 2R9VA 5JE8A 3ZV6A 1IL0A 4CF3A 1RYBA 1OTHA 2P8SA 4DSTA 5KYYA 5IS2A 2AFIA 2IQ5A 2V4MA 3OZTA 4J9UE 3SZLA 3V9PA 3VPXA 4KNYA 3AF1A 2VPIA 2WM3A 3W7XA 3CEJA 1WZNA 2EGGA 2QTVB 3PXDA 4IV8A 4UCWA 2RK6A 5LOVF 1NH2B 1ZSVA 4XFJA 3RPEA 4ZCIA 2D74A 3WU2Z 2CV0A 3OWHA 3UK6A 1ISSA 2JI9A 4M1MA 2FMUA 5FADA 4JVNA 4XUCA 4NBVA 4DSZA 2AQKA 3JAKA 1N7JA 3THXA 1ZVQA 1IVYA 1NN0A 1ZIPA 3HP1A 4E94A 1LVUA 1X0XA 4EGFA 5AJUA 4P3PA 1PDOA 1PTJA 2VYND 3BE8A 3AHJA 1MBZA 4MIOA 4MHOA 1QGOA 2ZZNA 1WNFA 1CXZA 3Q3EA 1X1BA 4RBNA 1TYCA 1N2HA 4EGJA 3LE8A 2I1LA 5IC6A 1IDOA 4PN7A 1UZLA 2PXHA 3Q6NA 5HE9A 3U3DA 4DPLA 1G3IA 2ZCJA 3EXIB 4OXQA 3AOGA 4FT2A 4CLOB 2H0AA 2PUSA 1EUCB 1RIIA 2ZIOA 1XREA 1OCEA 4PAQA 4BASA 1ZNZA 221PA 3A3OA 4D98A 2F7SA 3DLPX 2QWQB 5KYWB 1S3FA 3EEIA 2EGHA 4PQFA 4WEOA 2QLJA 1QV9A 1U1FA 3UCFA 3IUYA 1TE2A 1Z4OA 4BNWA 5IYCO 3WWOA 2A9FA 5EBMC 1F2DA 3KQUA 1I5XA 1SRQA 3OA2A 2OVBA 3GFFA 4G86A 4BUCA 3D2LA 3SKVA 4EPYA 4US0R 5SICE 3GUYA 1OBOA 5JDCC 3DH1A 3DHVA 1F38A 3LC2O 3OQPA 4PQGA 4C04A 2OB1A 4FJ1A 4AECA 1AF2A 1EVLA 3HXPA 4QKQA 1VKRA 2O2DA 3RF7A 3WNQA 2IL1A 2H5JA 2KW5A 4RQEA 3BULA 4IMJB 1I51A 1N7HA 1F23A 1ZWKA 4QNNA 4UOQA 1QONA 2X6AA 1ACJA 3KOWA 3R23A 3WK5A 4TMYA 1V26A 1WJGA 5LKAA 2JFWA 2W8BB 4M8LA 2B7BA 3WP1B 2OYQA 3GMIA 4BV3A 3OCQA 1I2BA 1OX4B 1PWXA 1XEQA 1NF9A 4UPDA 4QGSA 1MMFB 1I2MA 1WXFA 4YI5A 2CXSA 4COOA 2NIPA 3FVWA 1VCNA 3OF2A 3P45A 1W25A 1BN7A 1DWOA 3OZIA 3OAAD 2EX4A 5EMHA 1F3LA 1CJCA 4J0GA 1NQTA 4IUDS 4R2JA 1B0PA 3SHOA 4LYHA 2BBOA 1BH6A 4RIEA 4DM3A 2P9BA 4OWPB 2AOXA 3L71H 1LF5A 2DPHA 2I99A 2JKYA 3GEBA 3KHSA 4G8CA 3PDIB 1Q5OA 1DXHA 3HCEA 5KHIA 4M36A 3CC7V 1ENOA 1LRKA 1JGTA 2QVCA 4IMRA 3WHKA 2G9UA 4JI4B 1GG9A 3G1WA 4L15A 4P9NA 2BJWA 3N86A 3R5SA 3UJ3X 4NE2A 5H59A 3KKYA 1CK4A 2PRKA 3QYJA 4EECA 1Z17A 4F04A 4KPYA 1S4MA 3IEIA 3OOWA 2FSGA 3IOYA 4MVCA 5TS2A 2D0PB 1C30B 3HYLA 3R5HA 2GF0A 4MQUA 4AZ0A 3FI9A 4MUKA 2GBFA 2R8XA 4XYEA 5LLTA 4WK4B 4DV5O 1QIGA 3AM1A 1L4FA 3A6EA 1JKFA 3DO5A 3WIOA 4R1LA 4YPVA 1UK9A 3ND7A 3ZW8A 5FA6A 3K9NA 3VKGA 2XBLA 1QZZA 2B7CA 1XNRB 1U2DC 3SHFA 1KH1A 2PTMA 4OYYA 4V3BA 5BSGA 5DTQA 2ZM5A 1TUGA 1O0CA 4P84A 3IUEA 2IHKA 3DXFA 2H92A 2VHTA 3MDSA 2NAFA 2CNDA 2LCQA 3KB6A 1RZ3A 4I0XA 3C3YA 1GK9A 3I9KA 4PZCA 4H37A 4F71A 4EG8A 1YHYA 2A9KA 3E3MA 3UAGA 5LD2C 3DA8A 4JZKA 2IF2A 4KOAA 3CJHA 1CJVC 1DMRA 4YX9A 1JPVA 4DIKA 2I65A 1TEXA 1DRUA 5F1PA 1KAQA 4JPRA 4DV4B 1WSBA 2FPGB 2QW1A 3K9SA 3SNKA 2BGTA 2FQWA 5J1SB 3HLTA 3C39A 3O2NA 4JCCA 1ZD5A 1O95D 2HCBA 5LVAA 3G13A 4ME6A 4AP5A 3RSLA 1MC5A 4OHUA 1H69A 4LF5O 3AWDA 3RUIA 3NEJA 1N5MA 3IJ4A 4RM2A 1ULAA 4AS2A 1R66A 4NK5A 2R9AA 2BEVA 5AM1A 5KA6A 2O48X 3AR2A 3FWYA 1X1SA 1Z73A 1TEZA 3Q6IA 4JX8A 1BMQA 1J25A 1NLFA 4JA2A 4ZJPA 2F93B 1A0OA 3I0ZA 1M8GA 2CVZA 2WD9A 4NU0A 2AC2A 1KKUA 1II9A 4UNQA 2JGMA 3A4NA 3C41J 4WZAB 1T2AA 3OM0A 1EM8A 3PGLA 4XOIA 3IAHA 1IZ9A 1OIXA 2QI9F 3A28A 1REQA 2Q6KA 1UZNA 3H75A 4U3JB 2IXTA 3OQ1A 5AJTA 4O4HA 3EH2A 3WFVA 4ZOBA 4JI2B 4RKRA 1P7CA 1GZ5A 1AR5A 3DUFA 4Q7KA 3ZGVA 3ECSA 5T41A 3W7SA 3EFOA 3SVTA 2Z6UA 3SQWA 3TWOA 2FZWA 3IUBA 3T7KA 3RGWS 3ZJUA 3RZUA 2C5SA 4LF9O 2NSDA 1EFPB 5D6NA 3GWGA 4ZQFA 1FQKA 1P72A 2QRKA 1JG3A 3M5WA 4B6GA 4K0KO 2RGUA 3ACBA 2PX3A 4HEJA 3U60B 3EWIA 4C6SA 2OUIA 1FYJA 1I3OA 2WWTA 2QSYA 4AKHA 2ZJ7A 1GUAA 1KK2A 1UMDB 4F7DA 3VQWA 1PR4A 4I5SA 1Q0RA 2Z0AA 3WYAA 4MQ6A 4MR9B 4Z4IA 3ZDXB 4HH3C 3KRTA 1WQ3A 3GBSA 1PQ4A 3VC7A 3KT6A 3PD0A 3THOA 6PFKA 1XMVA 1IIBA 3BSWA 2J4DA 3DBOB 3L0IB 3OQMA 3TK1A 5PNTA 1J56A 3K5WA 3OAAA 4O1HA 2VNAA 1AHPA 1INLA 2GXQA 4GOLD 5E3IA 4HWPA 1TMOA 3ONVA 4UU7A 3SLGA 3AHIA 3JARA 1KVTA 1KYZA 4LPKA 4Q9DA 2ZB8A 5I7FA 2CMHA 4ZKIA 1C0KA 2VDJA 5KOJA 2FA9A 3EDMA 4ALJA 4BQNA 1SUAA 5DBGA 4P2BA 3DEZA 4JI0B 2JEOA 2XGSA 3NNDA 4H0FA 1IBKO 4L5BA 2LKCA 1FMCA 3A37A 3M6FA 3T2MA 3GG2A 4DPKA 3BSSA 3QRWA 1GD1O 1PT7A 5EIFA 4KKVA 3IJRA 1SRRA 5EPEA 2I80A 2XGOA 5AXDA 3F5WC 3VISA 1GGVA 2CD7A 3ML0A 1OFUX 2CTRA 1G55A 4NR1A 3H2KA 3BXEA 5IYBO 3K4QA 4RF4A 5JQWA 1HE2A 3DZJA 5LFAA 2UXCB 3JYOA 3UB2A 3VOTA 2JLYA 4P58A 3OM8A 5FUYA 1IONA 1KJ8A 2ZIAA 3SU8A 1OZHA 3UB3A 3UJBA 2HLDA 2GF2A 5JVDA 4CR7A 1KZ7B 1L9KA 2JA1A 1X7ZB 4TRMA 4UW9A 1TB4A 3PLNA 4ODIA 2QAGC 2Q3FA 4NB5A 1TZCA 1Z4JA 1LV7A 4CIXA 2GBLA 3C4QA 4LF9B 2ZIGA 4CM7A 3OUUA 1UPBA 1SQXH 2XMBA 2GETA 3AGQA 3QUAA 3RYCB 1L6RA 3DE0X 1TVKB 1DCKA 5CH8A 5FLKA 1TAUA 2YQ4A 3ZW9A 1EDOA 1JF8A 1T9CA 3AX6A 2X42A 3D0KA 4O59O 5H81A 1ELOA 1HMPA 2FFHA 5I4CA 3THYB 2PWZA 2ZXUA 3R40A 2IXBA 1VIVA 4IXTA 3SQDA 3TDNA 2DCUA 2IJHA 1RTTA 4L3OA 3TQSA 4B71A 1DZ3A 1H8EG 2CB0A 2A4MA 4EY4A 2AJDA 4WE3A 4ESOA 3THWB 3DEAA 3K53A 1PK8A 4B44A 4LYAA 3WLKX 4AT1A 5LBIA 5AW6A 3AP3A 3Q4HB 5EMLA 4B76A 3SYMA 5K8CA 2C7OA 2B3JA 1EX7A 4C0AC 3GT7A 2GTSA 5FWYA 4LFCO 3D31A 2XSZA 1QPZA 1YQDA 2O1SA 4JYAO 1ZA2A 3JQFC 4LZZA 3W5CA 1AKMA 3ND9A 2EARA 8AT1A 1AX9A 3FUTA 1I3MA 5GPBA 3AOEA 2BFMA 3BWYA 4FYJA 3DFZA 3L79A 4G1FA 5DW3A 4CH5A 1QIJA 3VOUA 3CS5A 2OTJV 2P1DA 1U02A 3HNPA 1B2RA 1TZJA 1VJ5A 3FZEA 1NFRA 2XQVA 2ZCEA 2VPQA 2HFKA 3KTOA 1F8UA 1X8JA 1MB0A 3CVWA 2OBFA 1YDEA 4ZAXA 5BW4A 3GVMA 1J42A 1D6SA 1XE3A 4HDAA 4UHDA 5A4KA 4K28A 1ISIA 2ROQA 2E87A 2PKYX 3H5RA 1LVHA 3NTRA 1QHEA 1TJYA 2ZBFA 4MIKA 1VHJA 4P53A 3C4VA 3MFYA 5IEBA 3VKVA 2GA8A 3CZAA 1QC5A 4CDNA 3JD4A 4U2GA 2GD1O 3R5FA 4JFAA 5LGTA 1T2EA 2E6KA 2GZDA 3K8YA 5JHGB 3DLIA 1TEHA 1ZL8B 2VF4X 3KQOA 1WU8A 4LX0A 1M5UA 1ZLXA 2OPBA 1USKA 2OG1A 4UVDA 1RJEA 1Y8ZA 3JZFA 1KD1W 4U3JA 3Q0EA 4ZC8A 1MFZA 2XMDA 3WLRA 1H4TA 4JP2A 3HXKA 3M6AA 5HXAA 2DWEC 4KX5A 3A2MA 4LC1A 4YQFA 2HF8A 4GKKB 3VPSA 3M1AA 1U90A 4MW3A 2IOQA 1GSIA 1CY1A 3E18A 5JZSA 1WSWA 3L9XA 3S2YA 1VEWA 2W71A 3SX2A 4LQ4A 1E2PA 2KI5A 4N47A 3IC9A 4FNMA 4RUEA 13PKA 2JJ1A 4TXHA 1GKLA 4C0WA 4UREA 3P5SA 4CCSA 1EK2A 2M98A 1BVUA 3SYAA 2HJ9A 3OOYA 1PNOA 3C24A 2BEUB 1EFAA 2IGBA 3ZIUA 4S1TA 5DCAJ 5T3YA 3WLOA 4RZIA 2A57A 1UIRA 3GRPA 4WJKB 5K0LA 4ED9A 1G20E 4FMCB 5EQDA 3W7BA 2DSNA 2C83A 3JTMA 3L70H 4DADA 2QLCA 3CUSA 3HYCA 1C1YA 3W7TA 1JJBA 4P38A 1XAJA 3RU9A 3BT7A 3WJAA 4S12A 2D5NA 5HK8A 3PZRA 5JV5A 1NNUA 3EEFA 2PKRA 3EODA 5A04A 1QIMA 4PRKA 1NBOA 3AIMA 3P5BA 1COWD 3CF6R 4LBZA 2R7AA 1QQ5A 4HDKA 1X2EA 2CGEA 5FV7A 3RO7A 3UPUA 2BW0A 1W73A 1YKGA 1A3CA 3NGLA 2A1TR 2WY2D 4L16A 3DDUA 2E7ZA 4KL1A 1JDTA 5D2CA 1E59A 2X0JA 1AF7A 1RYNA 1DDGA 5BSFA 1W35A 2ODWA 4OQDA 4YHHO 1NSTA 1LDNA 3AK3A 2CXQA 2X1HA 3OU6A 4MV5A 4N5LA 4KP7A 4Y30A 5D3ZA 3RS3A 1VA4A 4YXWD 3SFTA 3TKYA 5IT9A 2W9XA 5AVXA 1TZBA 4TL8A 2IV7A 5I7HA 1TM1E 4NZ9A 1W52X 3V8PA 5AVWA 4CF7A 4U6SA 1ZNXA 4CFSA 3AG1C 3MPOA 3MYYA 3Q9LA 1DHTA 2XVMA 4FS3A 1FP4B 1CNMA 1U65A 1PZNA 3NPMA 2J48A 4FNGA 4W82A 2X19A 5DH9A 3VH3A 4ZT3A 4TS3A 2Z9DA 1N33B 1LDGA 4MINA 3EDQA 1ABBA 1BMFA 2XYQA 2V58A 3KLPX 5J1TB 3TQRA 4CM3A 4LYDA 1DAMA 2XOKA 2IFTA 3CR8A 3D3WA 1NYLA 2AZMA 4FFBB 3GARA 4PX9A 4B6RA 2EQ5A 2BIFA 2ZP1A 3FSEA 1W5EA 3O21A 4I50F 4A10A 1GGKA 4DANA 3EULA 2HHHO 1TGYA 2P0AA 2Z8YM 4PRLA 1AA9A 1LEHA 1JPNA 4B3FX 1M8KA 1YK1A 2AI3A 1NF3A 1NWHA 3EY9A 1Q7CA 3GVIA 3MEQA 4OP1A 4C2TA 3D8RA 2ZJ4A 2G8LA 1G8JA 1RBQA 3WGHA 4ND8B 1T0UA 1RLJA 2QN3A 5FOQA 4U2DA 4KV9A 4O4LF 4ZZ1A 3TFOA 2INGX 4C7OA 5KX5A 2ZE7A 4FM2A 1TPYA 4IUYA 4OHOA 5NLLA 3TR5A 1LJ8A 4M7WA 3AR9A 3UQZA 3LNMB 5LL6P 4LKOA 1PS0A 3M2TA 1KEPA 2AQHA 2CNBA 4J29A 5MN6A 1UBEA 3QJYA 4N9WA 2J07A 2FSUA 1PR2A 5SYMA 6ADHA 1JEAA 3CCEV 2PL5A 4DTCA 2AZ4A 1P6OA 1B6TA 5I5GA 5KHLB 3G0HA 2Q99A 1WR8A 4U4AA 3IERA 2F4VO 1DHRA 5DLDA 5G4LA 1NVKA 1EE1A 3AEYA 2Y67A 3BXGA 4DS3A 3CPJB 5COQA 1FX1A 4Q4AB 3ZKAA 5JMPA 3BTVA 4JKYA 1ZM2A 3B53X 1QO9A 2Y6UA 3G68A 3SJQC 2AC4A 1VHLA 4PW0A 1SOUA 2OCIA 1FTSA 1RW4A 2PX6A 2VIIA 3PKZA 3BH6A 4IIJF 4RD3A 2Q0SA 1HR0B 2P6OA 1K98A 3C43A 3ICPA 3QI2A 3QK7A 4BB9A 3WQRA 1KI2A 3DHNA 3DZBA 4NQLA 1LPPA 4JYPA 3UPTA 3L84A 4LOHA 4BBJA 3DBLA 5I9IA 1TJPB 1UJWB 3KG2A 2HA3A 2R65A 3I30X 1ECPA 1NGSA 3QPBA</