The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
207
|
sequence length |
590
|
structure length |
588
|
Chain Sequence |
PGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Bifunctional purine biosynthesis protein PURH
|
publication title |
Structural Insights into the Human and Avian IMP Cyclohydrolase Mechanism via Crystal Structures with the Bound XMP Inhibitor.
pubmed doi rcsb |
source organism |
Homo sapiens
|
molecule tags |
Transferase, hydrolase
|
total genus |
207
|
structure length |
588
|
sequence length |
590
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase. |
pdb deposition date | 2003-06-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01808 | AICARFT_IMPCHas | AICARFT/IMPCHase bienzyme |
A | PF02142 | MGS | MGS-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix Hairpins | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Methylglyoxal synthase-like domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Cytidine Deaminase; domain 2 | Cytidine Deaminase; domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Cytidine Deaminase; domain 2 | Cytidine Deaminase; domain 2 |