1PKXA

Crystal structure of human atic in complex with xmp
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
588
Chain Sequence
PGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Human and Avian IMP Cyclohydrolase Mechanism via Crystal Structures with the Bound XMP Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 207
structure length 588
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pkxA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pkxA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pkxA02
1BXRA 1JDBB 1A9XA 1CS0A 4EHIA 1M6VA 1G8MA 1ZCZA 1IK4A 1KEEA 1WO8A 3ZZMA 1OZ0A 1PKXA 4A1OA 1B93A 2IU0A 1P4RA 1S8AA 1THZA 5H3LA 1PL0A 2XW6A 1C30A 1M9NA 1C3OA 2X8WA 2B1GA 2YVQA 1CE8A 1S89A 2IU3A 1EGHA 2B1IA 1VMDA 1T36A
chains in the Genus database with same CATH superfamily
2OXRA 1SZDA 2FN3A 2P4QA 2PZGA 1NVPB 2V9PA 3PX2A 4H7PA 2VUTA 1OX6A 4QE3A 3K6SB 1BOFA 2Z2JA 2DQKA 1VQ5V 1G2OA 2RGAA 2AXQA 2D2VA 4KWTA 1BU8A 2A5YB 3UWDA 3D3QA 4GPAA 4NC9A 2EC5A 5F76A 3L8ZA 6LDHA 3DDUA 3ROGA 2BI8A 2Q2NA 4CZZA 3KZXA 4UM5A 3X43A 5FTLA 2I4NA 4LDAA 2DWDC 4F97A 2PUEA 4M46A 1SCKA 2GF0A 3VNUA 5LDHA 2CK3A 3CZ9A 3UW1A 4BZXA 3U7FB 2A5JA 5JUWA 1O6BA 1N9GB 3DCNA 2R97A 3D6VA 2QWNB 3I12A 4KITC 3T95A 1JALA 1XDCA 1EBBA 1BHSA 4LCOA 3B5JA 2PYZA 1SC3A 2IV7A 3SIRA 3VC1A 5BURA 2QTHA 3ORFA 3K57A 1DBVO 1Q50A 2ZR7A 2A0LA 3DHWC 4KIWA 5GV8A 3DCIA 2EOAA 3Q2OA 1XL4A 5J2TA 2HQRA 2YFYA 1PLLA 3EMVA 5AI4A 4BO4A 3EVNA 3M1AA 3IA7A 1U96A 3OOWA 4FHEA 1R9MA 2Q1XA 5TISZ 3V6MA 2XMCA 1JT9A 1ZM7A 2OBNA 4FNOA 1E79A 5JD3A 2CV1A 5EZSA 1Y5LA 4YMUA 3SMQA 3TOCA 1RAGA 3DDHA 2XCOA 3LX8A 2FWNA 2B37A 2DUNA 2JGRA 4Q4DA 2UVPA 2HADA 1Z16A 2DWOA 2B5WA 2CXSA 5HVNA 5F3WB 1ZIOA 3MMPA 3T1NA 3U7QB 1P61B 1KVTA 3GLGB 2C31A 2JCYA 4PX2A 4TGLA 2Q68A 2F4VO 3DHNA 4K2HA 5K3FB 421PA 1BKYA 1CTTA 2JIMA 3EPPA 1IK6A 3A6FA 5BSFA 2VRZA 3I6ZA 3MS4A 4BNLA 4YRZA 1S8AA 2QZJA 1GZ6A 3ANMA 2P78A 3D36C 2QM0A 1EFPB 5E1BA 3KPJA 4G85A 2O7RA 3G2OA 1RSZA 3HN2A 4BV3A 1OXSC 4IH4A 5DI3B 1QO0D 1IUNA 4I6JA 5DXJA 1IY2A 1HSOA 2UUAB 2CLDX 3RU3A 4RPGA 3W7TA 3LI2A 3VHRA 3AB7A 3L4JA 2J07A 1KJJA 4NMXB 5CVDA 3PLNA 4L75A 1ZR2A 2X2FA 3H1PA 1ISPA 2JH3A 3KLPX 4IR7A 4LKOA 3ZWWA 1N75A 4BBAA 4Z9FA 1H2RS 5GIPE 4BCDA 4QBHA 2HVJC 2ZB3A 1E5QA 2PSEA 1SXJE 1L3BA 1OQAA 4ASUG 1USIA 2JI7A 3DOFA 4PSVA 4W9NC 3WHKA 2AW5A 2G77B 4R8LA 4BIIA 4CUJA 3OLXA 1L4EA 1ADYA 4IDHA 3HKDB 3P0IA 1OGJA 1XTPA 3F9RA 1D4FA 1SB8A 3FBWA 4XW2A 2NUTB 3L4KA 1CT9A 3UICA 2WJ6A 4RPCA 1PQUA 4MHOA 1YR9A 1U7TA 3JWHA 3VR6A 7YASA 3H0KA 1H4QA 1J42A 1REQA 3K2EA 1RXUA 4HDKB 2IJIA 4PS1A 5BWNA 1L7MA 4B4UA 2IYQA 5F33A 1PJSA 1CRQA 4IQ0A 3JD1A 2REQB 5LQNA 3FMIA 2DQ3A 4EOGA 2X9VA 4PLCA 5LZ8A 5DCAJ 2ZVJA 1E77A 3BAFA 3EOZA 2E1PA 1PGPA 2PRYA 3G49A 2GXSA 3GLIE 1SVNA 2W00A 1GVHA 1YWGO 5CRIA 5JW6A 2A4MA 1QVAA 3KAPA 4KE6A 2XQGA 2ZRHA 1L6RA 3ICPA 1GFSA 4MIKA 5KX5A 4K9PA 4QVIA 1EEXB 3GN2A 2IYEA 1RDFA 5DSXA 2O0KA 3KWJA 1XMJA 3JQGA 4JK3A 1QNLA 5IT9A 5DWDA 1YTUA 4BKOA 3VO2A 1Q19A 4S2EA 3K5WA 2CMKA 5FTJA 3GP8A 1WMSA 5JCJD 3U4DA 3SGLA 3O73A 4L22A 4DWWA 1KJ8A 3GUVA 5KDOA 1JA8A 3P9RA 4WNIA 4H0FA 5HOEA 5ILOA 1LGYA 1QYVA 4HYYA 4M1WA 1G8KA 4P83A 1XD2B 5TMDA 4CMIA 5CFPA 1RM3A 1C41A 4X62O 3ES9A 1U99A 4FGJA 2EDAA 3RKUA 2JEUA 3K72B 1I6KA 1HURA 3KC2A 4NESA 3SBOA 4DRZA 3LZCA 2G0NA 1SOMA 4O1HA 4TVKA 3U44A 2QRVB 1IUKA 4E15A 2FPSA 1G64A 2RHJA 1EDZA 2W2PA 2B9VA 2W90A 3F5MA 4KXWA 4M0DA 2BZSA 5E6UB 3W79A 4HXFB 3A6ZA 4BLUA 3TNDA 5FWXB 5I4CA 3E9ZA 4HUQA 2RGNA 2PX0A 1L2TA 4TM7A 3S8EA 3QEKA 3FTFA 3B82A 4KRFA 3A4LA 5CFRA 1W2GA 4G5YA 3AK4A 4MWCA 1NKDA 1Z75A 5J2UB 5E4YA 4DLXA 3TRFA 4JBGA 3QPVA 3H99A 4CLOA 2V5VA 4LF6O 3ZZUA 1UMDA 1QP4A 1IEXA 3MGCA 1UFQA 3TKLA 1HQCA 4BWFB 2I66A 2JEYA 4NOMA 2HMTA 4LJLA 3U6KA 4MYTA 1YZGA 3DB1A 1CUUA 1AZSC 2YFKA 3KVVA 4LJ6A 3ZHOA 1W49A 3GU3A 2FEOA 2P4EA 1XRRA 4E5YA 1SO8A 2XNDD 2B9ZA 2QP9X 5MN6A 4LFCO 1JDZA 2ZJ6A 3ZI0A 2E75B 2EJCA 3HH8A 2WNHA 3G5AA 1PR0A 2H1CA 3D3WB 4MI3A 4XM0A 5LQJA 1L4GA 1C7FA 3FSGD 1NZDA 2YV4A 3EAQA 1ENPA 1V55B 3LH5A 1S2LA 1GZ7A 1NI4A 1U1EA 4MKRA 1C30A 4L08A 2IW1A 2XXAA 1LZLA 1YNOA 1XBTA 4O4JB 2F95B 1NM5A 2HHCA 1FVFA 2AI2A 4JP1A 1GNQA 4WFJA 4ITUA 4HBNA 1E18A 3RABA 5HUHA 3GEPA 4ZZ3A 3G5UA 3JQAD 3B51X 1X9IA 3GUZA 2Y4NA 3QEMA 4O25A 3DFIA 3GLTA 1M1UA 1MB9A 1WUTA 1KKDA 3FMGA 4J91A 4PINA 4R2IA 3OY2A 1Y48E 1L5KA 3K1ZA 4MMYB 1GKYA 3SNHA 4M1EA 4BYMA 4DR7B 2P8RA 2DYSB 2C3YA 4ZYYA 1ISIA 3K0BA 3BTSA 2D2FA 4FXOA 1GZ3A 1M2VA 1PG5A 1QLWA 1U3VA 2ZIWB 3HZRA 3RLIA 4BJ3A 2MSNA 2F1IA 1I10A 1NVFA 2Q6IA 3NONA 4YRQA 2AZ0A 1NXXA 1UKCA 4ZQGA 3F8WA 2OHHA 3N6XA 2YOHA 1Z26A 1ADJA 1Y6ZA 2VDJA 6YASA 3PQFA 1Q3EA 3O91A 4BP8A 1MUUA 2FPPA 3L0ZA 3OZCA 3FWHA 2HJRA 4IGEA 4I99A 4MT8A 5F4BA 2ZSUA 3K2IA 5JLAA 4P6VF 4PG7A 3K0GA 5B1DA 4G0WA 1JGTA 3RK4A 1YNSA 5CAEB 1PFVA 3KTAA 5KQRA 2JKZA 2F1HA 4F4UA 5DASA 4PZ9A 3FDFA 2J6HA 1EDBA 2LQTA 1JJ2U 1A88A 2FE4A 1Y3FE 3OT7A 2B7CA 5AK4A 4MUHA 2E74B 1DL5A 1W44A 1J20A 4A6EA 3VX8A 2B4AA 3HA2A 1BZKA 3N07A 1WLYA 2EF1A 1J0AA 4TM8A 3OG9A 4JEMA 3QVUA 2C5GA 3H4TA 1ORWA 1FY2A 3OFJA 3QOFA 4G8CA 3O8RA 4DL9A 3VYTB 3DDSA 1FS5A 4ARZA 3K5PA 2ZNIA 3DJFA 2B8JA 2E2WA 4IG9A 5AVYA 3QJ5A 2UXBB 2DHDA 4BAUA 1ODSA 1UJ2A 4N65A 4JR1A 1E7WA 4BVEA 3FHTA 2EGGA 3TAHA 3Q3GE 1OBCA 4GM1A 3R7DA 3FNGA 1H3NA 1LPOA 3PPYA 3TDKA 3A3PA 3TLGA 3UUFA 1D07A 3R0ZA 2EQ5A 1PWEA 3L8YA 4HT3B 1KQPA 3REQB 3S1LA 2Z30A 4G4SO 1W88A 3Q5DA 4FONA 1VHTA 4DXWA 5IC6A 2I7XA 2YV5A 4MKHA 3VO1A 2G1KA 5CXSA 1ECFA 1L7EA 3L0PA 3LF1A 4ZYTA 1K86A 4EFBA 1W0JA 2WU3A 3IFSA 4GBMA 1OHHG 4JUCA 5AJYA 5TMEA 4RK6A 1M0WA 3QUAA 4XVRA 2E7ZA 5DULA 3L5KA 2HKOA 4A0FA 5LMCA 3EIOA 1GG9A 2GRAA 2GBLA 1EX9A 2ZE5A 2HBYA 1E6UA 5LL6Y 1L7OA 2A86A 1CZNA 1IL0A 4OGFA 1T8SA 5HHTA 1KI4A 5TXGA 2FZCA 1EK2A 4EENA 1RWBA 1W46A 2WU0A 2ZI7A 1XKLA 3DC2A 4P31A 4ARZB 4CR8A 4YJ2B 2CGEA 5L40A 1E8DA 1FUYB 2E82A 5U4XA 5H68A 1G2PA 3VNQA 2EQAA 4XWGA 3OIVA 1YRLA 3F5DA 4LH7A 2J9FA 2ZLBA 2XHBA 1TMYA 1JN0A 4PAMA 3TIGA 2YYSA 3ZCTA 2Q4RA 4X3OA 3M1YA 5LMZA 1KQSU 5ED4A 3IQZA 2QEQA 3FUTA 5BMOA 1T9BA 1G2IA 3UK6A 3ORSA 2XEDA 3HCFA 1E2EA 5BPFA 1B0ZA 1BU5A 2MYTA 4FEGA 5EWLB 3ZHZA 4A27A 3WZLA 2F59A 2ZBQA 1ZL8A 1YKSA 2OCBA 1YB2A 2Y8EA 3D6JA 3A9TA 3CR7A 3DQZA 3IKJA 2HF9A 3DE6X 1NVPD 4TMWA 3BIWA 5TT1A 5K6AA 5BVGB 1F1JA 2WZCA 3N3AC 1WXDA 4HYEA 4PGFA 1CETA 1FTWA 3P20A 5A7HA 1UT5A 4IHQA 4Q7JB 3TJMA 2QQGA 3PFFA 2I4MA 1JHMA 3AERA 3QKUA 1EBUA 2HYDA 4HQRA 1N7IA 4WNAA 3LWDA 5J4YA 2FG6C 2QW1A 2XUZA 3HL4A 4QVGA 4BVBA 1H65A 3UANA 3KZMA 1R3LC 4Q93A 2XWQA 1LC0A 1SBZA 3C3WA 3OESA 4KZKA 4C3ZA 1S1CA 1HYBA 3TW4A 3MYYA 2ZR3A 4BQNA 5AVWA 1RP3B 4DV0O 2EKBA 1Q8IA 3O92A 3R3WA 1XMPA 5LHGA 2IX9A 3L6CA 2DT5A 2BKAA 4OB8A 2B83A 4V0MA 5F1OA 1Q16A 1TVKB 2FCRA 2FQQA 3AEYA 2EHJA 1WHTA 4KP4A 1DTOA 2CK3G 2H0QA 4NARA 2HHAA 5DBOA 4E5PA 2FKAA 4XWKA 1K4DC 3AK2A 4RAOA 3FGPA 3IOBA 3PFIA 1XTVA 1PLJA 2QTLA 1II0A 2ZXUA 1K3EA 3PD0A 3CF6R 3H11A 2GJ4A 4RIHA 1EU1A 2JG3A 3ZH2A 3DSRA 1ZABA 4CFZA 2OXTA 2YXEA 4FFMA 3QO5A 3STTA 5JSHA 1TK2A 2YIMA 3UG7A 4DC0A 1FVXA 4H1UA 5DNAA 4GKVA 4EKNB 2CXRA 4S35A 4X71A 4COOA 5IFLA 1H42A 4BRZA 5C81A 1YT5A 4FDMA 2B82A 2HCFA 1TZKA 5T4EA 1COWG 5CGQB 5F2KA 3NV9A 1YGYA 3CLKA 2GF9A 4NBTA 2BMJA 4QO8A 1G38A 4RA9A 1V11A 5LBQA 4HNSA 4BVFA 4CHTA 4DVGA 1N5JA 1U1GA 1WF6A 1LBTA 3WHPA 4BQRA 2XCSB 3E53A 4DUGA 2L2QA 1VQNV 4UCRA 1F4NA 2WVAA 1WZIA 4G0YA 3PGXA 5FBKA 4AIIA 1QK4A 2PY6A 4ZZ1A 4AO8A 2KB1A 1GPYA 1PT5A 2FRXA 4MVUA 1N3LA 3DKIA 4OSOA 4RU1A 5EN4A 4BO5A 3ZDYB 5JDIC 3LJKA 1HG1A 1EVJA 3M2TA 3WP1B 4YX9A 4B47A 4GI7A 3BBLA 5HWSA 3PWSA 1R8SA 3CUWA 3O31A 4GVPA 4TWJA 3K5LA 4JXXA 4TLDA 4MO9A 5D01A 4OQZA 2ZRIA 3T4XA 3VH3A 3TPFA 3VPAA 4FZJA 4D9IA 4EKWA 1CF4A 4OTZA 3DZKA 4DLWA 3UYKA 1LUWA 1FS6A 4ZJZA 4DR4O 2VK2A 1NYQA 4HKTA 1JIXA 5BQOA 1L8QA 3TH5A 1V4VA 1XELA 1Z82A 2HHJA 4QYMA 5DISB 5A0VA 1Y6QA 1GR1A 5AK5A 4J7KA 2ZCEA 4I8XA 4D92A 2J0EA 3NOXA 3O82A 4FYVA 1NV8A 2BONA 3EGWA 4QO7A 3WG9A 2JJ1A 4BEVA 2J59A 4IH1A 1GK9A 3BEOA 3ZJTA 2OO5A 2G9ZA 1ZA1A 3UT6A 2IL1A 3VJMA 1FUIA 2COUA 2V3WA 3L06A 1GCUA 3QVGA 4MIEA 1LS1A 1WRBA 3CQ9A 3I2JA 5E6SA 2WDPA 1MVNA 1Q12A 2NXEA 1HNXB 4RLFA 2FI1A 1F2UB 1IQPA 1UX1A 3AF6A 2J0UA 3DT8A 1H69A 3PUYA 4J0CA 1H2SB 4XDHA 4Z3KA 3SXJA 3ZBTA 2Y4OA 1JNXX 1MQ9A 3EZ7A 3D43A 3OJWA 4J7XA 1A2OA 5CT4A 3NJ8A 1G5IA 3DBVO 5FUYA 4XJSA 3R6LA 5HJ2A 4HVTA 2G6VA 4B3HA 4IIHA 1SB9A 2PUSA 1Q43A 1CUIA 1UCFA 4FX5A 3BMNA 2AFIA 4DS3A 1MV5A 4EGCB 3QE9Y 1SXGA 1UWVA 4C20A 4V0LA 3INTA 4DYHA 2X0IA 2HY7A 4X7BA 4X64B 2RI0A 1PDWA 3PFHA 4PZYA 2FB9A 3FOCA 3NEAA 3NAGA 3SZOA 1OWLA 4JJGA 2D0PB 3U4MA 3UATA 3LWNA 5BN5A 5ADWA 3GJXC 3IHTA 3SQLA 3FCYA 2AN9A 3D0KA 4P92A 1UK7A 2B2NA 3I2KA 3DMHA 5CA1A 3LHIA 2GM3A 3WAJA 3OMNB 2DLCX 3GJ3A 4CG0A 2CDNA 4A0QA 3NTXA 1QZTA 4DY4A 2JKYA 3ZLUA 1YA6A 3KL4A 1KO4A 3OEED 4R0VA 1ZITA 4BKUA 4OHKA 1GNRA 3MMSA 3KYDB 2YHIA 3D4IA 3OUSA 1R6NA 4ZOAA 1XCGB 4CM4B 3ND8A 3AG1B 2YJ4A 2ESRA 4MWGA 4F8YA 4GPTA 1WOMA 2G9RA 4QYIA 3EH1A 5HCNA 2WLLA 1N5MA 3B9QA 5LP6B 4UJ3A 1B43A 3T7DA 3W8DA 3G8QA 1V95A 1E0SA 4N0QA 4H31A 5CG2A 3NTRA 4JEUA 4LVUA 4R8VA 1UWLA 5I4BA 4H3VA 4FYJA 1BGWA 5CD1A 2NN4A 2IA5A 4BJ5A 2FR0A 4MV4A 2YYAA 3HXTA 1RYMA 3FB7C 4JEIA 3TLBA 1MZFA 3P9CA 2OVFA 4LF8O 1FQJA 1OU0A 2IIPA 2ZSEA 4IZ6A 2EFHB 5EXXA 4EECA 4NZ9A 4CMAA 3U31A 4CS4A 5BYKA 4KV7A 2QAIA 4PC3A 3NC1C 1CRPA 5F2OA 2FF5A 3RYFA 1WXQA 1DQSA 3EVBA 4J1SA 1MC8A 1BMDA 2MTBA 4U8HA 1ESEA 3VZQA 3WO1A 3DAOA 5BOVA 4MGKR 3AESB 3CPWU 4AMYA 3PUIA 3T3DA 4DW8A 1AHHA 1DAFA 3H3XA 1JAZA 1Y67A 1X77A 4LHVA 1V8OA 4QQFA 1VLJA 1K27A 3WGOA 3BWYA 4EG0A 1ZFNA 1PG0A 5ILGA 4OHRA 4O2BA 5H83A 5HTOA 1TAQA 2DW4A 4GAEA 2JF0A 3ECCA 3FETA 3L6UA 1GGJA 3P2KA 1EFCA 1F0PA 2BFFB 3CRW1 4NS4A 5AI5A 1NMSA 2B6NA 2P6OA 3FPLA 1GV1A 4B3MO 4A9AA 2ROQA 4BJ6A 5K5EA 4DV5B 2AOUA 4KVFA 1WXXA 4Q9JA 1QPBA 3TZKA 1M8PA 1I0IA 1QGUA 2OK8A 2CLOB 2GUZB 2YZGA 5DI3A 3MTQA 1JDTA 4PYMA 2RCVA 2CXHA 4MK4A 4CF3A 5BUCA 3IJ5A 4FNGA 4ZARA 2WU1A 1V3VA 4R69A 3I5AA 5CM8B 3FDIA 2PMDA 3EB9A 3ZWYA 2WTMA 4YLGA 4D6PA 3HVHA 1XU9A 4BLSA 4C01A 4BP1A 1X13A 3TD9A 4UVDA 4A91A 1LV7A 3GGDA 1V47A 1JAHA 4Z4HA 3G8DA 3JQ6A 5BN4B 4QLOA 2V6BA 2ZQZA 4XWTA 2VC2B 1NDHA 3EZLA 3P0EA 4J3JA 2HRZA 4URXR 1D4OA 4GR5A 1WTAA 2FFAA 1F0YA 3QU9A 4JVSB 4YQYA 1HE1C 2KMLA 2NNLD 2W6IA 2QUZA 3ASZA 3IAM6 3L4BC 3OQHA 1OCEA 16PKA 3EBOA 2P3OA 2VH5R 3IDZA 4NIMA 1SIBE 2F17A 3U61B 3E22A 1OFUX 3KPWA 3OAAA 3UWKA 1JMVA 3HJFA 2I7CA 2H3OA 2Z3VA 2OCGA 4WZAE 4IJQA 3EC7A 2SKEA 4EGFA 5TIIA 4B8ZA 2R1VA 3I23A 1KSJA 1YQTA 1TYEB 2FMFA 2WEKA 1QO9A 3FKSA 1K89A 3NYRA 3QHPA 2X5JO 5ICFA 4URZR 4B3XA 1RSOA 1BA3A 3BQNB 2PXCA 4BMOB 4J7AA 3DFKA 1SUDA 1B2RA 1TIPA 2YYYA 4LOLA 2WPDG 3WGZA 4DIEA 3R5FA 1N0NA 2NV2B 2XGGA 3OJCA 3RC2A 3FJYA 3FNEA 4BX8A 1BXGA 2D5NA 1ZRNA 5L3QA 3UMJA 2VDRB 4RNDB 4EHAA 4TRNA 5DEDA 1I6WA 4I14A 1KJZA 1ND6A 4XJTA 4W1RA 1FCJA 3S29A 1VL2A 2APJA 2J7PA 4YCLA 3Q0TA 3C3SA 3GBVA 5FF9A 4RDXA 2YOGA 2ONCA 1KC3A 1SFRA 2IDJA 2H2IA 4GNRA 2OENG 3V2GA 2WIGA 3AUXA 5IE9A 1VTKA 1QTRA 3VTZA 1JEYA 2DQ4A 2OTJV 1VPLA 3EMDA 1E2NA 5BZBA 3UMBA 3ZWBA 5JXHA 2XBLA 3K9NA 4P3XA 4JAAA 3HCCA 4OPMA 1ZC4A 6AT1A 3OQOA 3IT1A 4BXOA 4MVWA 4DV6B 3F7NA 1Q5PA 3T35A 1RE1A 3B6ZA 3KXIA 3O9OA 2H31A 4UDYX 2NPFA 1W52X 2C2XA 2ONKA 1RHRA 2H16A 4KXNA 5DB4A 5G3YA 3SMVA 3L07A 2XUIA 4GYYA 3KQPA 1RR6A 1VKJA 2A8NA 1WQ1R 4JL6A 3CEJA 1UOEA 3NWPA 2V6JA 5H4GA 1ZY2A 1PPJH 3C3MA 4KE9A 2XYQA 1D5AA 3HRIA 2CVFA 3L84A 1ZHHA 2NMVA 5EPEA 2BR4A 1QH1B 2IT1A 1C80A 3EPRA 4B76A 4B8WA 1SZPA 3L77A 2QY6A 4G1CA 3N2EA 1Z62A 3LW7A 2ZR2A 3TEMA 4OFWA 3P26A 3RHFA 1P0CA 2C2KA 4ALIA 4B0OA 4DNPA 1WKQA 2GFHA 1U98A 1V7ZA 5IDJA 1ATIA 1W581 1WQ3A 2G08A 2O7VA 3QTTA 4I5EA 4M88A 1IBMB 1QKIA 1SQ5A 1H22A 2OPBA 3AUTA 3SC6A 1WP9A 3ZWDA 1HQYE 5AD1A 5K0CA 4X6YA 1CUCA 3A4YA 2VWGA 4NYMR 4Q82A 3WLFA 2YVKA 3N0WA 3WGMA 1GCAA 1M2GA 2ID9A 3QPCA 3CV3A 3L7CA 3Q3JB 5IYZA 4BFCA 3CURA 4G5SA 4MS1B 1IQ0A 3JRNA 4OI2A 2QYSA 3LLCA 3R6DA 4MQLA 3DR3A 2GAJA 2VNHA 4KUEA 1AQNA 4I9WA 1RHKA 1YQEA 3CX6A 3CLSD 4JH0A 4QFCA 3S2FA 4I1OA 4MQUA 1DKNA 2SECE 3D2LA 3GGPA 1VJ1A 4AN1A 2QDXA 1QDEA 1ZX1A 4G0XA 3GRAA 5A5VA 1PJ3A 1JOYA 2AFIB 1EQ2A 2X15A 2ZYSA 4U02A 1KH2A 2KSQA 4ICIA 1XRNA 2VRWA 3SX0A 3U80A 5AUNB 5DRTA 3UV6A 2X6BA 3LLMA 4CKEA 8ADHA 5IZCC 4RKWA 4KGXA 4TQ9A 1ECBA 1V1JA 1CZOA 3GDHA 4M9ZA 5CX4A 1E2GA 1VG0B 1XZNA 2QM3A 4O2BF 1K33A 4EGSA 5LKAA 3QBEA 5B1AC 1BYUA 1Q22A 4LHEA 1JG6A 1K3TA 4RTJA 5KHJA 5K0SA 5LA6F 5TVKA 1QMGA 1A5TA 3VV2A 3HYCA 1NMQA 2ZSFA 4CM7A 3UO8B 3WWZA 1ZAYA 1QAMA 1HBJA 2QTGA 2WABA 3TINA 2BM9A 1Q1AA 2QENA 3A3YA 3H65A 3OCYA 4H6VA 4DLUA 1HW7A 1YGPA 2QWQB 1YBVA 3TVDA 3A1SA 4A23A 2XUFA 4Z8XA 5BORA 3PUXA 1QVGU 4H9GA 1FFGA 3DC5A 3FA2A 4XFDA 1VF6A 1AKNA 2P2DA 2I2WA 3QEOA 2JFVA 4KR6A 2A9OA 3TRJA 2YXBA 3CZAA 4HWKA 4PZLA 2OSVA 5K09A 5DM70 2QTBA 4ZMSA 3ADPA 2WWGA 1NJIW 2CNLA 1HTWA 2FZGA 4GVLA 3IBFA 2EJBA 3CNQS 1XVVA 2VPYA 3OHMA 1K5SA 4MV8A 3SN6A 5HFJA 4ZFRA 4B81A 2QW8A 3QWHA 4GZ6A 1JB9A 1SKVA 2ZM6O 2GJSA 1VP7A 2OSBA 1Y4MA 3ROEA 3SLRA 2DH5A 4LZZA 4YJ3F 4ZVOA 3RRMA 4EUNA 2Y1LA 2PQ6A 2RAUA 1GGVA 1E4OA 2V0NA 5BSEA 2Z3GA 2QAGB 1EN4A 2CJYA 4ZCLA 5K45A 1SVLA 4P7JA 1B6TA 1NL3A 2ZETA 4X85A 4O2BB 4RTKA 2H8GA 4A6DA 1FNBA 5E7IA 5EJFA 3S1AB 621PA 1DBWA 4J9VA 2D3TA 3VGPA 5ILQA 2R6JA 1IC6A 3HFRA 4D0GA 3TK1A 5EBLC 4B40A 2FQWA 1IB0A 1BCSB 2P9BA 5A5GA 3X2QB 3KQVA 1GA1A 2I1QA 1C2TA 4KR7A 2HSDA 4ZVQA 3COVA 4CL3A 1DX6A 2BGLA 2W98A 1YC2A 3FNQA 4YRGA 2WTUA 1V5FA 3OTIA 2PX5A 3NATA 3E8BA 4D41A 1QV7A 1AO3A 2FSPA 4P84A 3W1WA 3CP1A 2VH2A 4W4LA 1MAHA 2HLDA 4JR2A 3WGUA 1P1IA 2GN6A 3CT6A 3F4BA 4BOYA 4R81A 3IUMA 1EQUA 1ZINA 4TQAA 4XKJA 1Y0BA 1R0XA 5AUQA 2XTNA 4A16A 1OCRC 3LFHA 2YIDA 4LMPA 2QOEA 3K9HA 1RAFA 4EG2A 1N5OX 3IEUA 6PFKA 3PEYA 2QVCA 2KE5A 2YZNA 2O8DA 1UMKA 2NU7A 3UJ8A 1OI0A 4DLBA 4H27A 1FXUA 2VBCA 3BA1A 5AFSA 2FH5B 2YN0A 5B55A 4RVHA 3IDSA 1QORA 1Z4JA 2A30A 2NVBA 3EHEA 2V7BA 1P1KA 2I2CA 4M9UA 4MPJA 5AUPB 4JELA 3R5KA 1S1MA 3NKFA 3WGIA 1E32A 5B64A 1OFGA 3SHQA 5FQOA 1YB5A 3AI2A 1KEZA 2HA3A 5DLPA 2WFLA 4IIDA 4L0MA 3TWOA 7REQA 1VQOV 2ZBFA 4D56A 3R6TA 1D2HA 4NV1A 3SE7A 5FI3A 4UMVA 4L95C 1H9CA 4LC5A 4PFJA 1DEAA 4QOHA 5LOVF 1EZ1A 3OOHA 3VZBA 1CRLA 4CNBA 2EERA 4EMBA 1FL9A 1R0SA 1HQKA 1SK9A 3FWPA 4HATA 4OHMA 4RD0A 3KR2A 1KP2A 4IYHA 2AXTZ 1KH3A 3IKTA 5C37A 3EXAA 3A70A 2WUDA 1SG9A 4XDGA 3RVBA 5CVTA 4D6YA 4FE3A 1KPIA 5BVHB 3D36A 1UFOA 1TT5B 2W6PA 2FSSA 4GNKA 1NIJA 2G04A 4OQLA 4EMUA 1CQWA 4OX9Y 1IZ7A 4UV8A 1U2ZA 4KO3S 3RF7A 4JZKA 4ZGBA 4BKRA 3ZVKA 4BAZA 1Y5IA 3OPVA 4PYJA 3B6MA 4AJLA 4AHCA 2J5RA 1VA4A 4M60A 1KRHA 5J63A 1RLMA 1JAXA 3E89A 1XZ8A 3EJ6A 3Q2IA 1Z6QA 1ZJYA 3ZW9A 2C07A 1LRLA 4IEIA 3UK2A 3PX7A 1NATA 1I80A 3M33A 4X8HA 2ZSKA 1RJGA 3WIBA 4JUFA 2RGRA 4RZUA 4BNMA 1R1BA 1FFYA 3FGNA 4OCNB 3PQDA 1CPYA 3TTXA 3HSKA 3BQ9A 4UNQA 1DDIA 1NW4A 3S2SA 1CUZA 1J56A 4J16C 5K1XA 2C97A 5AKKA 1CUAA 1KEEA 2I67A 4LBZA 1H2AS 2D4AA 3LQ2A 1YQWA 2X9LA 5HKOA 4P9PA 1DSSG 3KZVA 5HPYB 1J8MF 4FK8A 5FFMA 1WAMA 1M0EA 1L4HA 1R16A 2EFCB 3HI6A 3R7LA 1NNSA 3L7AA 2Q46A 2QTVA 4NK4A 1W88B 3WSVA 1BRMA 6Q21A 3FSRA 3SYCA 4B3SO 3A6LA 5LQRA 4PHTA 4QEDA 2HJHA 3ZN2A 1KO5A 5AM1A 1PD1A 4DN6A 4KH0A 3KLOA 1X1TA 3N70A 4QU5A 1H8EA 3ZQUA 4MTXA 4YBZA 3C39A 2A8YA 1D0VA 2YJZA 3F3YA 3HP4A 1TA8A 3AG2B 1UBHS 2RAFA 1GRCA 5DI9A 2D5CA 5HF5A 4BFSA 1M93A 3INNA 4V0SA 1AUOA 3NHPA 2HKIA 1SGWA 4UVEA 3ABLC 3TTVA 2DBVO 5JRDS 4L78A 3PEWA 5F52A 2E4UA 3RYTC 5TMPA 2ZIOA 3FHOA 2Z4TA 1W36D 3BH1A 2QNBA 4OA8A 1P2VA 2QYHA 4UCUA 1YJ8A 5DOVA 3W5SA 2DKOA 2W7TA 4QODA 5I7VA 3DLHA 4X8MA 1N8NA 1NFQA 2QL9A 5B1BB 2ANBA 3K9LA 3AIMA 3CX3A 3PE4A 5E9AA 2O96A 1PGQA 1O4VA 4YCMA 4NTYA 3U1TA 2QM8A 3KPYA 4XIYA 4R1LA 1JG4A 2ZIAA 3STUA 3OZTA 1J8FA 1UBEA 4ACAA 3OZ7A 4S1PA 2IDMA 2PWPA 3MS7A 2R7KA 3SJUA 3V2UA 2BGWA 4BKQA 5I9NA 4DBLC 3KETA 2ZCJA 3WNBA 1N6IA 1GAQA 1PZNA 5FL7A 3QOWA 4JAVA 3FKQA 1SD5A 4KQWA 3NBAA 5A1JA 4HQNA 5GOZA 2ZXFA 3O0DA 4RFSA 1MH9A 4JYAO 2AE1A 3AYZB 1TT5A 2I8CA 2PT7A 3IIJA 4MV3A 2PUFA 3KUUA 2O2SA 5H7XA 4K8OA 1CP3A 3CRRA 4F4LA 1LBIA 1GTZA 1W93A 2I8LA 1EWKA 2QLMA 1QCCA 4KFRA 3ELDA 4NBSA 2VHEA 4P33A 3BFJA 1A7JA 1DDGA 4R6WA 8ATCA 2LFSA 2NR5A 2FZWA 1R5XA 1MAWA 1SETA 4B7CA 2HCJB 4KWHA 2EJWA 2J7KA 5JCZA 2X13A 2B98A 3PJFA 1T6YA 2A9QA 3QBVA 2RH8A 1P1CA 2J5QA 2X1LA 2QSZA 4US0R 3FCEA 3V1NA 2YEVA 1LJUA 1LW6E 2ZT7A 5DK6A 4C7BA 5J58A 5FEUA 4YXWG 1C9NA 1VGVA 4LHZA 4LQDA 3SZLA 4ZU6X 2QT9A 3MS2A 4FP9A 1JZTA 3V6LA 2FEPA 4L57A 4XIIA 1QC5A 1HA3A 1DRWA 1CX9B 1E3LA 1I0ZA 2XUJA 2ZSDA 5LUBA 1O5OA 1U80A 2CLEB 2YV2A 2X6CA 3OMLA 4YMGA 1BS1A 1M34B 4XM2A 3A9WA 2YN2A 2OYCA 2O6HA 3TFOA 2GM5A 3TB6A 4BQOA 2IYXA 3ZGXA 2BFDA 3S1AA 3F4KA 4PNEA 3OAAG 2I71A 3F7MA 3H9GA 4AL4A 5JQWA 3PFBA 4CTJA 3LPCA 2J0UB 3L7NA 3N8NA 1N32B 2BFEA 3NZEA 5TV2A 1D4AA 3LO5A 4RJJA 3ZX4A 2NN3C 4DMUB 3I5XA 4ZOLA 1UZUA 2FPKA 1X87A 2PI5A 3EC1A 4N8DA 1DWOA 2ORED 1J21A 1ZLXA 4KAJA 3C24A 3OHPA 3R4VA 3LT2A 1L0NH 4BHTA 2C4TA 3WK9A 3WLAA 1YCIA 4IY1A 4R16A 4CIXA 3LXUX 3WDMA 1X1DA 3N53A 4OP1A 4G5XA 2AIRA 4CLRB 4JI7B 4Y3UA 4M7RA 4G3MA 1KXJA 3LUTB 4OEHA 1UAYA 2H4XA 2WSSG 3BA9A 1NQXA 1NXWA 3TD6A 9MHTA 2H9YA 4ROTA 5IC4A 3KCXA 5IZ4A 2YQ5A 3H9EO 3U44B 2AOXA 4B7EA 2NO9A 4O4LB 3GB9A 5AVJA 5EIBC 5JPDA 1L7RA 2HP8A 2P0AA 3D8CA 4XD2A 3EAGA 4AYTA 5IH3A 4U1RA 4I2VA 3WGQA 2YHSA 4FS3A 4B6SA 1TF2A 3U4GA 1SC1A 4A6XA 3GFSA 3NHLA 4NB5A 2PM8A 5JZOA 2CLSA 2LP4Y 1AXRA 4X7RA 3H1EA 1HUQA 3FYIB 4MV7A 4CCAA 4MAFA 2BMEA 4FI3C 1PSDA 3UQ8A 3ZWOA 2DTDA 4HQ0A 5KOIA 2QYOA 1PZGA 4FMBB 2ECPA 1M34E 2IEIA 3LDGA 3O1JC 5L6MB 5FPHA 4BZZA 3WMGA 4OAQA 3STLC 4YONB 3FCXA 4RJ2A 1FFTB 2PEZA 1UEIA 4FUQA 1LRJA 3ZD6A 2CJWA 3ETCA 3CUEF 3DLPX 3LY5A 4N82A 1AURA 4PQFA 5AHWA 1UJCA 1YXMA 2PRKA 2ZIVB 4E5NA 2H1RA 3C3XA 4ZEWA 1MW9X 3A06A 2WHPA 2JK1A 2GPJA 3CXUA 3DF9A 3M6LA 5TEWA 4CG1A 4D9FA 1SXJA 2B4RO 3BOSA 2OFPA 4JT9A 4E13A 1F2UA 2E4AA 4E70A 4EI7A 1RZRD 4RYLA 1XAHA 1X39A 3G2NA 1T4CA 2I0FA 1HFWA 2FLKA 3OPQA 2V7PA 1ALNA 4F38A 2EZOA 1JILA 3EDCA 3HB1A 5K3BA 3ZCQA 4MVSA 5SYAA 1CY6A 3LTNC 2QZ9A 2NTJA 1TM5E 2GA9A 3PFWO 3SYMA 3IV6A 5JDCC 2CLMB 2X6RA 4H18A 4DTIA 1WB7A 4BASA 1FS4A 3WGHA 3OCXA 5CVUA 1OD6A 5DN6G 3Q98A 4K03A 2B8EA 4U39A 5JU6A 3UJ7A 1KZ7B 1YB1A 3DL7A 1S3FA 2ZR0A 3ND5A 5LJLA 1LLDA 1JDVA 2JZNA 4GOXA 4P08A 3UGKA 1YD7A 4DWJA 1JEOA 1TO2E 1FOEB 5ESWA 4OREX 1M57B 3SQOA 3EXFA 4ZFNA 3DEAA 2CDAA 3BHMA 1XU4A 4N3NA 5EHZA 1OX7A 1K7EB 2QKYA 3OMIB 3H11B 5GY7A 4ADSG 3X1YA 1L4FA 1JU9A 3HUEA 4X90A 5IBPA 3QXCA 2EHDA 3LD9A 2EIMB 3L0DA 3QY0A 5EQTA 3T3IA 2D1RA 5GJWC 1I4WA 1T5TA 1TL7C 2O6LA 2WLSA 3NHJA 3EF1A 1HEUA 4ZHQB 1KQOA 2E4XA 4RH3A 4ZZ2A 3VNRA 2ZJOA 5IM5A 1N92A 5EWMA 4KIJA 3U7HB 1VGQA 5AKZA 4JZ2A 1M0SA 4M8LA 1P4RA 5FO1A 4YIOA 4WWHA 3U3RA 4KRYA 4GLBA 4K3UA 3CX8A 4BNWA 3PUZA 3DTNA 3BB3A 3WIOA 1YHNA 1PEAA 4PX9A 3ANNA 4LF6B 4V1CB 4DV7O 1JEYB 3H1JH 2XBUA 3M6VA 4C89A 3UC5A 1GA6A 3HPQA 4U5QA 2OB1A 3OFND 3IULA 4CLDA 3L8MA 1ZD2P 2G4LA 4BMPB 2A57A 1SCNE 2BFPA 3RC1A 4KPYA 3DM5A 3EIWA 4LF4O 3F4LA 4Q02A 1I7DA 4BX0A 2M2IA 2M6LA 3T9AA 2YWBA 1NVMB 5A2GA 5AM3A 1J9GA 3C5HA 3JS5A 1V54C 1IOLA 3WBBA 2HR3A 2I6UA 3FFWA 4I9NA 1UXHA 4CM9D 4DV3B 4EPXA 3QO8A 1TMOA 3BWMA 3QLVC 3ZHTA 2VSFA 5CB8A 1VQPV 2V03A 5IY5C 2P4SA 1U0SY 2IOYA 4C4RA 3HLYA 3ZS8A 4G1UC 4BMNA 2F1KA 3OJLA 1G20E 2QGZA 5C9ZA 3FPEA 2OWOA 4N3AA 3D5QA 1CQZA 1AZWA 1KMQA 1W4LA 5JH7A 1G4UR 3C5WP 3L93A 3ZGLA 3LNMB 3MJTA 1G8YA 1PR1A 1Z2CA 3AHHA 4RZ2A 5IH7A 1VMEA 3QFTA 5BWCA 3DVRX 3AKYA 2H8PC 5LMUO 1T8YA 2R6GA 1Z2AA 1ULUA 2FXIA 2OV3A 3D6NB 3MJSA 3II6X 5TQJA 1LKZA 1K8AW 1U7UA 4WN3A 1MABA 3I92A 1SVMA 2A9VA 4EKGA 1F6WA 1TM1E 1LPPA 4WGGA 1G7CA 3MERA 1E6CA 3O7WA 4JJIA 2YASA 4N8EA 1YIJV 1FLDA 5EOVA 3TIFA 3AUJB 2GCOA 2QN7A 2WD7B 1JKXA 1MLDA 1G98A 4OKSA 3CLUC 5CNIA 5BW6B 5SYNA 3WRWA 4N3CA 5GJCA 1I3OA 2PYLA 1QZUA 2CNNA 4EQ6B 1Z0SA 2HTEA 1PK8A 1RFYA 2WSMA 2YMLA 3C0KA 3BIFA 2I6XA 3RTAA 2A84A 1QSGA 4TTTS 5HIIA 2VJAA 4PIMA 2NU8A 3RC3A 3EASA 3MWGA 5KO2A 1M1YB 4YRLA 2ZWOA 3NEPX 3L05A 1E2FA 3C6MA 1KTIA 2C9CA 4MA5A 2Z08A 1QPZA 4QU0A 1L7PA 2I34A 5ENZA 1NBME 1NN3A 1ZOSA 4KJXA 1XWIA 1IHPA 3LLSA 4DAOA 1PK9A 2QMUA 1KNQA 5F5XA 4AY4A 1S7GA 2QZPA 2Q9CA 1OPRA 3GLHE 5DHPA 3KRTA 1T5DX 721PA 1BFKA 2PLRA 4RPHA 3PENA 3AM1A 3RKRA 5IT9N 3KKPA 4MVQA 1T25A 1XMSA 3EQ7A 1G42A 1REQB 1Y89A 1KMIY 4QRHA 2P40A 4P36A 3G68A 2C42A 1RJEA 1XCMA 2Q0HA 4ZCSA 1IONA 1OTXA 4LI0A 1X7YB 3MB8A 1J06A 3NDJA 4C0WA 4RIEA 4KWIA 3DHVA 2X9NA 1YRAA 4DR1B 3TB4A 4MS4B 2R9AA 4GQAA 4QHTA 2GMWA 4DXAA 4URVR 5AXCA 2F4NA 2D2EA 4KTVE 1T5BA 2VHCA 4DCCA 2NVOA 4HQKA 3VFDA 2IY9A 3NWOA 2JGIA 1KDOA 1SZTA 4U2CA 2GZ3A 4L0DA 4DF3A 1XPUA 1JQ5A 1AK9A 1WSDA 2ACVA 3D1VA 3IAFA 3R0QA 4QNNA 5DVZA 5FHQA 5AM2A 3PIRA 1MG0A 3JSAA 1B76A 2OGWA 5CIWA 4HAMA 3EQ9A 2G4CA 2UYOA 3V4VB 1U2SA 1MOSA 2CV2A 4F5EA 1NLFA 1GQYA 3I1FA 3KT6A 3T4PA 4H7IA 2JLUA 2FN4A 1H6BA 4FFLA 2FSVA 1DLBA 1T5EA 2TS1A 4QECA 4UM9B 4IRXA 1DWPA 2C2YA 5F64A 3IHKA 5BWLA 2C82A 4D6TH 3L40A 2PQ0A 4Q20A 3ZRVA 1PBNA 3M7IA 3GUUA 3TLXA 4DCOA 5E79Z 4HMOA 2VXBA 1QHNA 5CJJA 1A9SA 5E3IA 4J9ZB 4JJKA 2RAPA 4TLBA 3RFXA 3OKFA 4KR2A 3LIPA 4OGQB 4E6PA 5KOJB 3RVJA 5FAKA 2IBSA 3NMUF 5JFTA 4KLCA 2X14A 1GN4A 3UAGA 2O9JA 3A36A 2ZVDA 5FBLB 1F9EA 2C9BA 4JBNA 4BIUA 1PZMA 1H5NA 3VQXA 3IAXA 1Y7HA 4BQIA 3WJ1A 1Z07A 4TWIA 4U63A 2OGZA 4DR2O 4KEAA 3ZRWB 1DKPA 3ZDQA 3H7AA 1G8SA 4AKSA 5U9CA 4RIFA 1Q91A 2X58A 1Y5NA 2MSEB 1U0FA 1DJOA 4X8AA 1EVQA 3AEQA 3OJOA 2PMCA 2QTMA 3CF4A 2X23A 3C8ZA 3JPYA 4HH3C 4WKPA 4X3PA 3N2KB 3IBGA 1VECA 2PGDA 1DVRA 3UKOA 2JLZA 2BP7A 2RHHA 4RSGA 2ATKC 2JKVA 1GITA 1Z36A 2ZBRA 1FLAA 5FUVA 5FOQA 3NTLA 2ZUUA 3H5IA 2UU9O 5JSFA 4ZXPA 3ZK7A 1C8VB 2EFYA 3BD6A 4YWHA 4MS1A 2CZCA 2GKOA 2AX4A 4XGKA 2PSJA 3FB8C 1VMGA 3ZE2B 2NAPA 3UAVA 3E81A 3KQTA 1BQ4A 1XIVA 3LKVA 4F4HA 2H4ZA 4H0CA 5HFLA 5B1AB 1ZD5A 2A1TR 3QLJA 4UEOA 1RRKA 3CVUA 1W34A 1W29A 4Y2YA 1S4MA 2VYND 2Q6KA 4K9DA 5HF6A 3HJAA 3W6NA 5HZKA 3FSGA 2HW8A 3UKDA 1VCIA 4LSMA 1R6TA 1GN8A 4XCXA 5JAQA 1YR6A 1DOZA 3ADCA 2EP5A 2Z04A 2QVYX 4KPUB 3L6OO 5FOSA 1DG3A 4XWWA 1CY2A 2NVUA 4F84A 1Z88A 4K8ZA 1TEVA 4AZSA 1CTQA 4AQYB 4I50F 1VQ1A 5G3ZA 2B2XA 2VJBA 4G4IA 1FJ2A 2Y92A 3BJRA 4MKZA 1P2UA 5ECGC 5BR1A 3OQNA 3ABZA 3O74A 1T9KA 1SCUA 2ZGVA 2GK3A 2LKCA 1RM1B 2FHPA 1R0RE 1FK8A 3Q7PA 3OX4A 4RMNA 4YDRA 3R9IA 1YKFA 2EG9A 2G3YA 3JWJA 3HDTA 5CGZA 5HW0A 1EFUA 3IAM1 4Z1VA 1YCGA 4ER0A 2LDXA 2W2NA 1YMQA 3YASA 3SJAA 1KZYC 2PSDA 1WNFA 5J3JA 4UNNA 1HNXO 2B7BA 2VPIA 4B7KA 1WW3A 1TA4A 1Y8AA 1JI0A 3A58B 3GJ7A 4PG4A 3RPEA 3VBBA 4L8JA 4ONEA 5IDQA 4B84A 1RYNA 4MQ5A 5B7GA 3U60B 2YZMA 4OOFA 1CNEA 2BH2A 4C7OB 1ABEA 1XZBA 1G4HA 1AKMA 2DY1A 3E83A 3BZBA 1Z4PX 3WJ2A 3IDAA 4B0PA 3RS4A 3FVRA 4D45A 1CXZB 5DNUA 3D3JA 3ILSA 1C7ZA 2FSUA 1X7WA 4S0ZA 4LGYA 1R0BA 2LWIA 4WZBB 4DSUA 3CWBH 4B6QA 1T2CA 2MU1A 1NZFA 3KR9A 1JKIA 2H4JA 1FB5A 1TRHA 1PK7A 2X5NA 4CKBB 1C3OA 2HK9A 3CIOA 3MQ2A 1ICEA 4HWTA 3IAUA 4M1OA 5BYJA 4OIFA 1JJIA 1VYHA 4WUVA 1P6XA 4HDCA 4JKYA 2UZ0A 3ZWKA 2AKAB 2XKJE 1KYWA 4ZBMA 1I33A 1MABB 1SM4A 2J0VA 4OQQA 5AVZA 1ONNA 2Q67A 3FB6C 1NSTA 1R6VA 3LOQA 4ERXA 4YV2A 1K75A 5ICGA 4YHHO 1IBLB 2R1ZA 3GELA 4KO8A 1J99A 4OHCA 2P1DA 3WAKA 3FD9A 4D9CA 1GOTA 2FWBA 5EJGA 1RE0A 4DA8A 1YFJA 1K6XA 3QLUC 5A4JA 1JRLA 5GONB 4MUAA 2K9PA 4AECA 1JVNA 4W1SA 4AYWA 1S3SA 3P9PA 2BEUA 4C29A 3DVQX 1ZNZA 4EB0A 3O4JA 2A06H 1IPEA 3QKRB 4IILA 2PBRA 2X41A 4ER3A 3VR3A 4BW5A 2A0WA 1LUVA 2GXQA 2H2FA 2VDWA 3IAHA 4UAJA 1OCZC 2RHCA 4HNAA 4G63A 4K6FA 3T61A 3GNTA 4B74A 1Q95A 4HFJA 3ED1A 3GVMA 3PUWA 5CBFA 3NC4A 3F5QA 4IGKA 1FTSA 4R2JA 1JR3E 4GKKB 2HRDA 5LZ7A 4FC6A 3CKYA 4TV8A 1RRFA 3WIUA 5L4NA 2G71A 5J2UA 2IITA 1H2MA 1ADFA 1SUFA 1UOPA 1D2EA 1PD0A 2BGMA 1VHDA 1CUBA 4R2XA 4AJOA 1BMFD 2ECQA 2WLIB 1ARZA 1V41E 3F7VC 1S8NA 2DFTA 4AUMA 5CITA 4C2UA 5T6MA 5KNBA 4PHFA 3U5TA 4DQ0A 1E1DA 4TXJA 4A5OA 1PT8A 4WESB 4IV5A 4DY6A 1U0EA 3V46A 1YB4A 2XPCA 4WZAB 5DX1A 1GY8A 1NUTA 3SYPA 2QWPB 1IOVA 3QHAA 4KQ2A 2QBYB 2HLNA 4NMLA 2YS6A 3V4SA 2YMPA 3S8MA 2O1EA 1NYLA 1PSZA 1YR3A 2RK3A 3LV8A 2V9ZA 2F8LA 1R5JA 4HQLA 2I9KA 2VWHA 3K03A 1X1CA 2XBMA 3NYIA 5B37A 3COWA 1E3IA 3QUSA 4JB3A 2F9LA 1I4EB 2DYSC 2YHAA 3VX4A 1VRCA 5DW3A 3D8SA 4Z0PA 4BFXA 4CG2A 2CB9A 3VNBA 2QGFA 1J9EA 3ENVA 4CW7A 3IEPA 2R7NA 1B6QA 3R7BA 4OQEA 3AI1A 3RREA 2XMPA 4A15A 4YQZA 1P73A 4EO9A 4LJYA 2PV7A 3W5UA 2KG7A 3OKAA 1NBHA 3E82A 1VJ0A 2PZLA 4I8IA 3GH1A 4RDIA 5G4LA 5A6SB 3RWBA 4D4LA 4J4BA 3ROXA 1BWPA 4Q66C 4YCSA 3RSOA 4OQDA 3RUDA 1LY1A 2IH1C 1B6SA 3NIFB 4N7BA 4OXNA 3ZV3A 3TIIA 2W8ZA 2OCKA 1S0VA 1Z6XA 3DLAA 2XCTB 1I0LA 4C05A 2ZE6A 1SVOA 2WF7A 2R65A 3QPDA 4IO1A 2VS1A 3SR4A 1R9NA 3BB1A 4UUOA 1SBCA 4LCBA 3HDQA 5CFOA 1Q77A 2D1QA 3IFXA 1WZUA 3VSDA 5LXTF 4JXEA 4X9QA 1G6Q1 1QGZA 4MGIR 3DLTA 2GFQA 1N3IA 1XYGA 5IKPA 3DVAB 2VYVD 3FOEC 1KKCA 1DUIA 1ST3A 1C1HA 4J42A 5BN1A 2IDKA 1SCAA 2IELA 4KDCA 4NYJR 3DF7A 4DBZA 1WABA 1ZJ4A 3RT1A 2V1XA 2UYHA 4MV9A 2VPXA 3PIDA 2ZJ3A 2UU9B 2EZ4A 3A6GA 3PJRA 3Q7IA 1DUVG 5CB4A 2FJ0A 2JD2A 2W0FC 5SY6A 5LMNB 3VOAA 1R64A 4J1QA 4XQGA 3RGWS 2P77A 4TQDA 4TLLB 3W2EA 3EIUA 2HYIC 1F9AA 1H1TA 1S9HA 2HA2A 3Q9UA 3RYFB 4Q6GA 1FKAO 3LS2A 3WLRA 2ZIUB 3HY6A 1B41A 1CS0A 1T0UA 5AG2A 3A2MA 1P6UA 2WLMA 3HKCA 1A8UA 1DMRA 1N1DA 2J09A 4HNHA 1A8SA 2P2GA 4Y6LA 3W4IA 5B5SA 2BEVA 2W0XA 5AXDA 5FPKA 3SYKA 2BKXA 4KI7A 1KK0A 5EJ6A 2PBZA 2W43A 1U5CA 5BNZA 1AIPA 1P5FA 4RWZA 1I2BA 1FPQA 3RGGA 3EQ8A 3P5SA 5G4KB 1ZUNB 4L4UA 4P5PA 2ZYRA 3RIXA 1NQ5A 3A4NA 4J49A 2A9FA 5FUWA 1P4AA 5BV8A 5EAIA 2BHRA 4BNIA 3I9KA 1PGJA 4D02A 4FXPA 5KWIA 1NC1A 4H3SA 4X65O 1JV2B 5CDFA 3BF7A 4IG4A 1DCTA 5L3SB 3FR7A 1PJTA 1KBQA 4PPQA 2CNKA 2JEOA 1KJIA 4XD7A 1Z0FA 2XYHA 3VYWA 4EFLA 3QWFA 1VPDA 2YVUA 3DLCA 3ITEA 4M2LA 1F2VA 4KQ6A 5F21A 1EM8B 1TTHA 2DUUA 1A32A 1L1RA 1YQQA 2HIMA 3FF1A 3QU5A 5AKIA 4AI8A 2FMTA 4Z7NB 4OK6A 3K5NA 2OL4A 4DCVA 5JCPA 3PUHA 1MZEA 5AVRA 2SICE 1DKRA 1K88A 2JIDA 5A4DA 1PNKA 1DP4A 2ALJA 1RYFA 2IVZA 3FB1A 2BBOA 1XN4A 4RY8A 4X24A 4BYGA 2OY0A 2P7HA 2PLNA 2Q7XA 2RCYA 1GDHA 3QIAA 3ASOB 1Z3AA 4KFCA 3KM0A 3U1VA 2HLDD 2OO5C 3GOQA 4LGMA 5L4LA 1JIIA 4OQYA 4LWPA 1T35A 5IX8A 3SBEA 1CUFA 1NXPA 3UJDA 2KYRA 4KNYA 3KNZA 1BD3A 1JU4A 2GZHA 3HXMA 1J22A 5KYGA 1JFSA 4OCMA 4A2CA 2B35A 4CEIA 2R1VB 5JQGB 3HN7A 4IWNA 2C0CA 1Q90D 1R0CA 1TAHA 3HVJA 4UTNA 1EN5A 3MDSA 2WM8A 2QDOA 3PHIA 1ENZA 2L69A 4YMHA 4UFZA 5DFAA 3E22B 5KS2A 4EYSA 1XNJA 2IZZA 1DRJA 2VP3A 3MTGA 4UHEA 4XWAA 1WR8A 1J00A 1YDGA 3KDSE 1EM8A 5CDTA 4MUGA 1JYEA 1DCKA 1L5ZA 2XRYA 4PSKA 3DE4X 1WUHS 2QAGC 3GXOA 3R77A 1EUCB 2JJ2D 2PRJA 1QO7A 5EMNA 1H0RA 2QX8A 4UFPA 1WAZA 3EISA 1B0UA 2VVTA 3KAKA 4QBFA 1JZSA 5TPWB 2IRWA 4PYLA 2AJ8A 4FJ2A 4ZJUA 4D7TA 2HRRA 3A6KA 5F7JA 4FB5A 2BM1A 4X1KB 2GD0A 2CMGA 3F1LA 5DM4A 1G5TA 2Q8VA 1ACJA 4TTVA 4UCTA 1EFRG 2X6QA 2ZU6A 3HBLA 4BMYA 5BPHA 5HRCA 3QJGA 4S04A 2EJRA 1H8HD 5HF8A 1I24A 1XYVA 1ZIXA 1JIQA 2BGKA 5HQTA 4ZU1X 3JAKA 2VI5A 4JLDA 2O05A 4PCAA 3HKCB 4ZU3A 1ZKDA 3AG2C 2WU8A 1RXSA 3RT3C 2IYPA 4Q3LA 5IJ0A 1YITV 4QAJA 1MC1A 4LV8B 5CR9A 1VA5A 2IOFK 1CQIA 1XTKA 1Y42X 2VDLB 2Z57A 2R79A 3E9RA 3M5CA 1DC8A 4L4XA 4Q7LA 4V2IA 4QLBA 4RPIA 4TWKA 5AJUA 1Q2XA 1ZU4A 2EYUA 1Z0KA 3PQ5A 2Y1DA 3O03A 3HZHA 1IZYA 4D9NA 1KRWA 2WA1A 1YJWV 5T64A 4BIOA 3R0JA 1NI5A 1QIIA 2JLAA 3BSWA 1GLVA 3T0IA 3AVYA 1QFJA 4P9DA 3CMMA 2MOKA 2YS7A 3GVXA 4Z2YA 4GRAA 1AUPA 4NJMA 4DM7A 1G20B 2XUGA 1J39A 3HYNA 3X1JA 1P72A 5E1MA 3H0EA 4ND8B 1VSUA 1Z4KA 2BL4A 3P7MA 2DFPA 4GGOA 5LB4A 2YDEA 2ZIEA 2HZ7A 3M6XA 4JGIA 4QTTB 3EPHA 3QKIA 4HN4B 1FZQA 2I4RA 4JCCA 4O33A 1NN5A 1ZM3A 3PR3A 5C3UA 4E5UA 1UQRA 3LBIA 3F8TA 1WLEA 4HAIA 3H2YA 1CTUA 1G4YB 1PEYA 2CUKA 3D3NA 2H1OA 4OU4A 3DDOA 2RFLA 2C2BA 5JJEB 2BR5A 3QHQA 4QPCA 5A62A 2QDKA 3IQFA 4P38A 3OM9A 2R85A 4YP5A 5EKTA 4MVMA 1XQ6A 3VSAA 2XCIA 3LRTA 3UA4A 4EG7A 2QZ4A 3GN1A 1UT6A 2H5JA 4G0QA 1YTLA 2KQXA 1PJ2A 2Z8YM 3ZHXA 4YIHA 3I39X 4FHGA 3TW8A 1KOJA 4M7PA 1E6KA 3T7IA 4MW5A 4NCJA 1Z15A 4H7JA 2IJKA 4DBVO 2RONA 4CCWA 1DFGA 3N7AA 3BMCA 1F23A 1YUMA 1N6KA 1HXHA 2AFRA 2XHEA 3QOYA 2AOTB 3P3PA 1J7KA 1TGYA 1UP4A 2VR1A 3IEXA 3JRXA 3ICOA 5GQSA 3RJ9A 2WIFA 1PNLA 2O0MA 3BZUA 1CY8A 1QU7A 1QE3A 1IWOA 1B3RA 1XJQA 1VMIA 2GCIA 4RPJA 2P2SA 3AXSA 3UQZA 1YJ9V 5DTQA 4CCYA 3CEPB 3V48A 2GZSA 1AB5A 2PLWA 3L0YA 4YRNA 2XVZA 3STZC 2I3GA 4RQEA 1AUXA 2PYDA 4RQFA 3M6UA 4EJMA 2W5UA 4X61A 3NR7A 4EHHA 5ALXA 5T7BA 2X8JB 4EITA 5LDDC 1N33O 2VRCD 2Z9DA 5FAXA 3H1HH 1JVSA 1P3DA 5FPTA 3DUFB 1XNQO 3GJYA 4MVYA 3VAYA 3WGGA 1B93A 1Q6IA 1EVIA 1HE3A 1ECCA 2PX2A 3L01A 5REQB 1LX6A 1I2CA 5H8WA 2EINC 3E1UA 3A27A 8OHMA 2G1AA 1ISRA 1YA4A 4WJKB 3GO4A 2NUTA 4UUNA 1L4YA 5B3SC 2WKPA 2BGJA 4LN1A 4OL0A 4RKYA 3TZEA 2CKMA 2VZ9A 3EOBI 4Q01A 5LYYA 1ABFA 4Z6KA 1QYDA 2D54A 2Y0PA 3SFVA 1NW9B 4W8HA 4X20B 3HZZA 5IAGA 4OCLA 2NAFA 4N7RA 4U3JA 1TK9A 2P6NA 1NF9A 1UFRA 2UV8A 4Z3DA 3KX2A 2PNJA 4R0NA 4ZAYA 4L1KA 5H3CA 1VHQA 2JS5A 5D6NA 1ZTEA 1TVMA 4P82A 1NTMH 2RHRA 3AETB 1JXAA 4QJ3A 1IX9A 1N2JA 5IULC 1X7DA 3EUEA 3LP6A 3LUGA 2GAIA 2OAGA 4LIPD 1O89A 2WD8A 1JPXA 4RKQA 3AQ4A 3OZDA 3FAZA 3PFNA 3CVXA 1Y9JA 1NW6A 4BEWA 3EMBA 2OA0A 1E5DA 2AMVA 3CPSA 1OCCB 4F6RB 4DV2O 1QH0A 1YCHA 3DO6A 3EXHC 3I6MA 4H17A 3GUCA 2C9YA 1GKKA 1SBIA 1GPJA 3LPLA 3NO4A 1B42A 3APOA 4GQIA 2Q3EA 5AKXA 1X80B 3IVAA 1L9XA 1QR9A 3IESA 2Q0XA 3E70C 1QQAA 1VF5B 1V9LA 2QX6A 2ZYVX 1KBOA 2W0SA 3HHPA 4IOJA 1SOAA 2I5PO 4U0JA 5JY6A 5GJBA 4GD3Q 2ZTUA 2P2CA 3HC7A 1S5PA 2C9OA 4X20A 4MS3B 2IYRA 5K3DA 1MN6A 4U3JB 3OLQA 3UJAA 4Z7OB 5B6IA 5FI1B 3GLVA 1K7XB 4F85A 1YTFD 5CM9C 4TYQA 2AYYA 4LRUA 1DRUA 4ZVVA 3GCDA 1VE9A 1GXSB 1FW6A 5J59A 4I5DA 1S5JA 1C9YA 3AV0B 1XRMA 3B2QA 3DGFC 3H16A 1ANKA 4GPZA 4OHVA 2F9FA 4P9NA 4YDHB 2AOUB 1BJKA 4ZEXA 1M2OA 4Q1DA 3U6BA 1Z73A 3IEVA 4QFTA 4JHXA 4B33A 4U7WA 5J4HA 2Z6AA 3MWKA 5EMKA 4NV3A 3OBIA 2NO6A 1NKVA 2N74A 2BT4A 4AWBA 3HVRA 2WF8A 1JH9A 3U11A 2YUIA 1L0BA 1ZN2A 1A5AB 1OX4A 4G81A 2RMKB 4FFBA 2PGGA 1JTEA 1X4TA 3BD8A 4IXDA 4R9VA 2ZBVA 3CZRA 3OTGA 3M83A 1O08A 1SUEA 4NAVA 2AKEA 4YFVA 3CF0A 1I4OA 1VE1A 3GBPA 1MO2A 4FCVA 2X9QA 3GG2A 1Y7LA 5CPFA 4JNKA 3GEGA 3KSZO 2Z3IA 4WX2B 1HI9A 3F46A 3WFJA 3IE1A 3VR2A 1ZD3A 4F4CA 4MYHA 4ZT3A 4TS9A 3QE4A 4W1QA 3BAZA 1LDYA 5DNVA 2WG2A 3VOTA 2A14A 2Y69C 3AF4A 3GLFA 1NC3A 4CCSA 1JTVA 1CP9A 2QD2A 3E7DA 4JUIA 4WFQA 4A8TA 3PA8A 3ROQA 3BK2A 3PVZA 4EHBA 4TXMA 3NX4A 4X63A 5BN3B 1TIBA 1WETA 1U4OA 1CJTC 4MZDA 1QG4A 4QYSA 5D3MA 1O96A 1P91A 2Z8YA 4TSFA 1AGYA 2K2QB 2XGJA 4HR7A 4WZBA 1YJXA 1VJCA 5IARA 4DSNA 1G6OA 3OZWA 4FD2A 5J5VA 4NXNB 2C20A 4WOPA 1CNMA 2RBGA 1RVDA 4M37A 3L8GA 4C78A 2REQA 1MAVA 2GX6A 1K8RA 3N0XA 3AEKA 3D31A 4RS3A 5EP4A 1E3EA 5I7UA 2L18A 4NJOA 4P81A 2QA5A 5HEKA 1R37A 2D5IA 4OWPB 1VMAA 2P9EA 4LCJA 1ZAUA 3CVJA 4INJA 4OLBA 2ATCA 3RRXA 5B7QA 5CA1B 2VXYA 4KL1A 1O03A 1WDLA 2XE7A 3UK7A 3C8HA 2JFXA 3VDNB 3UG6A 1SC6A 1G8MA 1P33A 1X7ZA 4PZCA 1H94A 2WJ4A 4EZBA 3HB4X 4ML3A 5IFKA 1SA0B 1IRIA 1J2JA 1MQ8B 1TCCA 3PV0A 4BO6A 3Q4HB 4CLEA 3TXAA 3HJGA 3O38A 5CYOA 1MAUA 5KYWA 1WY5A 5KLVH 3LY9A 4HCJA 1X8JA 2YIBD 4TQUS 5CLJA 3ERCA 4DQDA 5GWXA 3SPCA 2JGJA 3BGWA 3U62A 2CYBA 2P3QA 1QGYA 3S2EA 5LIPA 5FOWA 2VHQA 4KZPA 1FRVA 2ZJFA 1MJHA 2I2DA 4II7A 2MJLA 3MXOA 4KQ1A 1F1BA 4O2RA 1K06A 2GKGA 5T8KC 3K96A 1EHCA 2PCLA 3R7WB 3OFSA 5SY9A 1Q1EA 3EWSA 1V9PA 3HDGA 4LK3A 4CRWB 2VJOA 4OCZA 4ARCA 4ZAFA 3DEIA 4PDVA 1BX0A 1KYIA 2A67A 1HE5A 1LI5A 2FVXA 2XDQB 2FTKE 3V8VA 3BM5A 4PAOA 4KFTA 3GRPA 1EGMB 1P3Y1 1L5FA 4ABTA 3HR7A 4WOCA 4DDKA 4E51A 3L9DA 3CH6A 4BTLA 5I9SA 1KVRA 3DOJA 2WK1A 3EGIA 5EK0A 1C7QA 3COYA 2J85A 3ZQ6A 1NT4A 5FBQB 3R9WA 1NJGA 1UPXA 4UEQA 3Q8LA 1JI3A 1XZKA 5B1BC 1ZKMA 5K4GA 2BOCC 4L16A 4FLWA 1CWUA 4G8JA 4RKFA 5FTMA 4YP9A 1RZRA 5C1OA 4WY5A 3NG1A 4DV0B 3C3EA 4QDTA 5FYDA 3GPBA 4EP1A 1TFUA 4B3JA 4XJVA 2BBSA 1QVRA 3CZPA 4XYMA 3RVOA 3UEOA 4HVCA 3G82C 1AI5A 1TZMA 4R7TA 4UHBA 1ESNA 5L3EA 1R10A 1NNUA 2YIBA 4OB6A 3RH0A 2PX8A 2XOXA 4XWYA 1OYVA 1VSTA 2LZ0A 3OM0A 4WXMA 5E0KB 3HXOA 4B7ZA 1LD3A 2QWRB 1X8XA 1NF3A 1PQWA 3QOXA 3RUPA 3W78A 1X8KA 2ANCA 2BMDA 4IUDS 2BFAA 2Y9MB 3FMOB 3ZXIA 1Y6XA 3GG9A 2JFNA 3OJ0A 1C7RA 3TPZA 3TLMA 1P0IA 1N32O 4LSGA 4QDJA 2B1GA 1XQXA 3WL7A 1TQ4A 5A03A 1M2NA 3OTQA 5FNVA 3BTUA 1ML4A 3ICVA 3FPBA 2LCQA 4ENUA 2DERA 1O3YA 3BE4A 1OWOA 4HGNA 3OEYA 5FA8A 1E1CA 2I3DA 2IEDA 5F5NA 4I3HA 3SS9X 3TQHA 3ZC3A 1Z25A 4BZPA 5HR5A 5L7WA 1P4SA 1O95C 1ORRA 3C48A 1J5EB 3RW9A 1AQ6A 2Q6LA 2NTYC 2ZRGA 1JFTA 4A3SA 1SBYA 1WN5A 4CF5A 2QKAA 3VHXA 2QZZA 3IJPA 1UADA 5EHIA 4F7WA 3HZOA 1QNFA 1G6UA 4L2IA 5JYCA 3LP8A 3BJZA 1WZEA 5LLTA 2I2FA 4NKRA 3CLTC 1G9XA 1C3OB 4G4SP 4K8XA 4RETA 1ZHFA 3BABA 3K73O 4P93A 4FMDF 4LNAA 3B5EA 3SKXA 3W06A 2BWJA 1UP6A 4BP9A 5KYUB 5ALFA 5JT1A 2XX3A 2QU8A 2W6OA 1TXGA 1FRNA 3VQVA 3EHBB 5L3DA 2N47A 2EINB 2V9CA 3NHMA 3ZZ1A 2G0AA 5DN9A 5LJIA 1EVLA 5C4GB 1RI1A 1ZH2A 1E2PA 2V45A 2IZ0A 4HRAA 2IP1A 5AESA 1L7VC 4G0MA 1KYZA 3SBGA 3ZVMA 1ZWKA 1IJBA 3QG1A 4C6TB 4OHYA 2ZE8A 3PNOA 4MB6A 4X1OA 4X1IA 2BHLA 2GD2A 1H5QA 2V7QG 4MEBA 4Y0NA 1JBEA 1G8PA 1R5OA 1V16A 2JBHA 2PT9A 2H4FA 2H7VA 3K1JA 4GWKA 1GCGA 2Q29A 3EGOA 3KBBA 5K3FA 3A0RA 1I7PA 2LPMA 2Q07A 3HQ4O 3HYRA 1TMKA 3ZE1B 2EU8A 4JPRA 4P3NA 1DKQA 2CCKA 1UJ6A 2ZJYA 1I13A 4DWOA 4JS0A 3CKMA 1L5VA 1XZDA 2IJGX 1BH2A 2FMIA 1AB6A 1MJGA 1PAUA 4JXZA 3OPMA 2EZTA 3ZCSA 5DHTA 1E59A 4EW1A 4TV8B 3G1UA 4ZQFA 4ZTBA 1ULHA 2BKEA 2RHLA 3JTEA 4Z49A 1H3EA 2V7VA 4PN3A 4AFNA 2MINB 5GTDA 1L8OA 4WEQA 3L0BA 2X86A 3I2FA 4KBYA 5ISMA 3KEGA 3LUAA 1ZMOA 1TZBA 1XXHB 2QLJA 3GRKA 2WJJA 1RW4A 1KS9A 2QD3A 3EARA 3JQPA 4K1LA 5LC1A 3AHIA 4AKGA 2OQ2A 2ZWMA 4PZZA 3LVQE 5TY0A 3N27A 4A1OA 3MCWA 3S3XA 2WAOA 4FBGA 1V35A 5T41A 1FPOA 2JIOA 2J6IA 4Z4CA 3ZDBA 1ZC3A 4IOMA 4J07A 4AJ1A 3IJEB 3IAS1 4MGYR 1EVYA 3LBAA 2R6R1 2QUJA 3ND6A 4RMIA 2KCQA 4E5VA 1U0GA 4LX0A 4KK3A 5ER6A 1VLLA 5KYVA 3B20A 3BCRA 1GRVA 4KQIA 5JI3E 2R0QC 1RU3A 1NOJA 2HZBA 4PW0A 2WHYA 3KHSA 1QCZA 4NBKA 1R73A 4WZZA 1TJPB 3TPCA 1RI5A 3NHRA 2UUBB 1H2BA 4F45A 3SLGA 3GQBA 4CKCA 1JWAB 1PUIA 3THOA 1VPEA 3L1HA 3OWXA 4L4RA 2VP4A 1C7IA 3AVTA 4AICA 1DQPA 1AGNA 1MRSA 3E3OA 1GAWA 5C5IA 3D5EA 3KU4A 1WY7A 1YSDA 4FFVA 1J8YF 3W2GA 1RM0A 2G76A 5A3SA 1NMEA 1L3IA 3CN7A 1ZVVA 3B38A 5B3JA 3DMNA 1UZNA 3WI7A 3OEHA 3VGJA 3DD5A 3G9ZA 1ODTC 2JI6A 1GQRA 1H1LB 4KLRA 2R00A 3PWZA 4BU1A 1VB3A 3DC7A 2I62A 2Y6VA 1Z06A 3LTEA 4QYWA 3ZKWA 4UUJC 1YONA 3BXZA 3ZU6A 2IKQA 3BCCH 2PX3A 3N05A 4IX9A 3TL3A 1AR5A 1IBCA 2I4IA 4NATA 2HQOA 2XT0A 1R4MB 4PRLA 2DMRA 1BMQA 1ZW1A 4KXRA 2H52A 2OAQ1 5CCDA 4B5KA 2JATA 1NR7A 2RC5A 5TQVA 3TZLA 4PPFA 3AU9A 4MKXA 2V8OA 1JR2A 3ZHUA 1T29A 4L8VA 4MW2A 2COKA 4RCYA 3RG8A 2QJ1A 4AP9A 1HX7A 1RRPA 2X3FA 5DECA 3O8BA 4IAOA 4AKTA 2AJTA 2M98A 1X7ZB 3VUFA 4M9RA 3ADDA 3NTQA 4BKPA 3O9ZA 2WP0A 1WUYA 1CQIB 1OWNA 3URMA 4QUEA 1JEQB 2OHGA 3ZQKA 2DFLA 2D4HA 2F4VB 2CN1A 3ANXA 3V80A 3ZWVA 4XD7D 4Y1GA 1ZGHA 2WUGA 2IUSA 4AULA 1J33A 3CCUV 1STOA 4G3XA 1NAIA 4ZRDA 3G0OA 4Y7DA 1RYBA 1P1HA 1GYRA 3QIVA 3WBFA 3LHDA 3Q7SA 1QUEA 3ELBA 5JNSA 1S8OA 1FU4A 3CB4A 1M2VB 3ZCVA 5KOJA 3F78A 4JI0O 4MJ7A 4GKJO 4HAXA 3OOSA 4YALA 2XT9A 1LFAA 1C3EA 2J32A 3K1AA 4PZDA 1E1CB 2CEKA 2OZLB 1OCZB 3AUFA 1PNOA 3EVGA 2XAGA 2XECA 3N8GA 4QOSA 4XPIA 3FY4A 2Q7DA 2WTXA 4CM4A 4F4FA 4ETWA 4ENRA 3TNLA 2G6TA 1H9AA 2FSIA 3CTPA 2NPIA 2PMKA 5HIJA 3Q9NA 3WRYC 2VTDA 3B8FA 3GK3A 5ADHA 5ALPA 2HO4A 3TE6A 3LT5A 5DYWA 4D4HA 3PP8A 3C15C 3U39A 5G0WA 2HPAA 2IZ1A 2X0EA 2F8TA 2A5GA 1KFBB 3F9CA 3FGZA 4EO4A 4BUJA 1NSYA 3GAFA 3LPNA 3U3OA 1NJ6A 2BP7B 5JSZA 1K5HA 3HGTA 4BLOA 3P9ZA 3QMPA 3HEBA 4EW3A 2Z83A 4FE4A 1XL1A 2VDPB 2R7LA 1XEQA 3H2SA 3V7UA 5BUZA 4CEJA 4OBBA 4QIWF 1M1XB 2AHRA 4ARIA 4A03A 1YZKA 3UB4A 2ADOA 1JSZA 4NDAA 4QOFA 4ENTA 5ADUS 3SG0A 2YJ3A 5LHIA 3HB9A 3OIYA 3T7SA 4FLFA 3F7YC 3WOHA 1Z5VA 1TCVA 4Z7QB 2QN1A 4RANA 1UKVY 3K94A 4RQTA 1XJWA 2Q21A 4DUYO 1NH2B 1BG6A 2BFCB 2Q3JA 4WI1A 5K99A 1ILWA 7GPBA 1U2DC 3QX9A 1E4VA 1Q6UA 2JEZA 4H7FA 4YJHA 1NDUA 1N2EA 1NVBA 1PW7A 1MOZA 2W6NA 3UJPA 1JWLA 4JJFA 1MH1A 1QX4A 4KPUA 4DJFC 1E3SA 4PCUA 2XQVA 1ZNQO 5T57A 4CKWA 3A1WA 5DTJA 1FXHA 1AQIA 2BCEA 3MD0A 4ANFA 2F93B 1P7VA 4WRRA 4BDTA 3SF0A 3C2QA 4B3RB 3DV9A 4R2LA 2Y2VA 3IVCA 5ALYA 4AQ7A 3USES 3A3OA 3Q11A 3WK8A 1RYHA 1DC7A 3FDZA 3LBHA 3IR5A 2IS2A 3G9UA 1X0VA 1F2DA 2WR8A 3C7DB 2ZDQA 3R9XA 1I01A 2OM6A 1GTL1 2QL5A 2R2GA 2VP6A 4G01B 3C5VA 1A9TA 4C9BA 3DW1X 2JGDA 1ZLYA 3PX3A 3RJZA 1K73W 2B6HA 1QRAA 4D8XA 5L3GA 4PDLA 3OF2A 3Q72A 2FGKA 2R96A 1BVHA 1IMJA 2H4HA 1ZJWA 2PTHA 1EUCA 1GN2A 2AUNA 5HE8A 2V58A 3IP1A 3O26A 3E2PA 2X9GA 4HVAA 2WRZA 2MHCA 3AR6A 5DP1A 2XVXA 4GKBA 4LYDA 5B2ZA 3T9EA 5B3KA 4LZPA 1K66A 4PG6A 1YFZA 1Z39A 3ODPA 2PJUA 2CMHA 5KNDH 3LVRE 2IS4A 1XZPA 3ENQA 3NR2A 2XQFA 4N6OA 2IPOA 4YRDA 4FLMA 1CQJA 2GDZA 4FZRA 2C4VA 2ENWA 4ED9A 2HQSA 1ZZGA 2QLTA 3FZQA 4YREA 2MSKA 2XQKA 3TAXA 1N78A 3V8PA 1MQ0A 5DGXA 4GBJA 3PJGA 2GH1A 3QWIA 1RAIA 4PHHA 2PK3A 3B3AA 4V38A 1COWA 1F6BA 2PKQO 3JD4A 5KC9A 3ZX6A 1NW5A 1ELOA 2PRIA 3MWEB 5IAJA 2ZWIA 1QJCA 2QJWA 4OHFA 2OYRA 4B35A 4HLDA 2Q2VA 4N41A 1UBOS 3FDJA 5A9RA 3TOXA 4MCIA 1JXOA 3NH6A 3L49A 3RGBA 3V1YA 3ZN1A 1X1BA 1QR8A 3PC8C 4P2GA 4YECA 4JROA 1VJ5A 3B12A 3NJRA 3LVBA 3VOSA 2I3AA 1V37A 4A10A 4EL5A 3FVTA 4CN8A 3PXXA 1ULTA 5GZ3A 2D1FA 5K8IA 2BE3A 2QVBA 1SC5B 1BL8A 4FMTA 1GRRA 1E7SA 1LVGA 2QSJA 3D2CA 2C95A 3X3HA 4DUZO 4JQYA 1Z35A 2H6EA 5L3SA 4FSHA 3UCXA 4Q4JA 3ZUPA 4E1VA 1QG6A 1JR4A 2N05A 1NHGA 1K4CC 3K06A 1BH6A 1QH8A 1TJNA 3AY0A 3BH0A 1DEOA 3G1WA 3BMQA 3L6RA 3Q5EA 3W6UA 1ID8A 1Z5OA 1W76A 4PA6A 2E6KA 3HWRA 4CC5A 3G0GA 3GVCA 1T6XA 4HXEB 4RX1A 5TQ2B 4F6LA 3BDAA 5IKMA 1YDMA 3AR9A 3UF0A 5LL6P 2QLCA 4MYUA 2O07A 2P9HA 3R74A 3SDBA 4ZREA 1V2GA 1GZ5A 3E2MA 1ZJ6A 2IH2A 1CF2O 2PGLA 2PKWA 4LFAO 2VDUE 1R88A 1CY1A 3PRYA 4J0KA 1XF1A 4UVAA 1BVRA 2TMGA 3PRJA 2A0FA 1MMMA 3EF0A 2YVLA 5K0NA 3WYEA 2V1DA 3QVOA 2ZRNA 3TZCA 4W9RA 2NU6A 4NCAA 4DB4A 5CBKA 1QGOA 2BDEA 2G7ZA 2H2GA 4BCBA 3A3NA 4H3KB 1GR0A 4EF5A 1GUYA 1MOQA 1Y3DE 1F0NA 3OX3A 4IKPA 4RD3A 1KMCA 4MWZA 1W2HA 4MA0A 4EVSA 1K9SA 1Z6ZA 3I37X 4O3FA 1QZ3A 4MW9A 1Q1BA 2KLHA 3AOEC 2CVHA 3K0AB 4XPZA 1F38A 3FB4A 3LL4A 5FB3A 4BO8A 3LA8A 4R01A 3WYDA 1COZA 4NDZA 4ILGC 1N1EA 3T1TA 4DG9A 1OZAA 4J7UA 1GPH1 5E3JA 3FYEB 4CM3A 4Q6WA 2O1XA 3GF4A 1T9HA 4ZT5A 2OFFA 3A7DA 3VH1A 5JADA 4YJ2A 2IHYA 4MSWC 4R1QA 4A92A 1UXKA 3IP7A 3NWBA 3OJXA 1QONA 5EJAA 4JLUA 2I29A 1KKMA 2BGTA 3HUTA 2DPMA 2BTEA 1JDSA 4I4CA 1ETUA 2AG0A 2NQ8A 2D5LA 1AGXA 1SQ0A 1AF7A 1D0IA 1XWFA 5KHLB 2C3MA 1P1BA 3KJZA 1NUHA 4KMRA 5BY2A 1D0SA 2NP7A 2W48A 1R66A 1C0LA 4YWJA 5ITZB 1U65A 2BFMA 4OXSA 3A32A 4NSNA 4B83A 4UAGA 3BWXA 2Z8XA 2HRCA 3NBUA 5SY4A 4KVGA 1GL9B 1ZJJA 1EUYA 1Q1ZA 2C2WA 3HSYA 4IIJA 2WPDD 2XV1A 4KIFA 2DPXA 4CQLB 1U7PA 5AVSA 1DJMA 2IHTA 1PUXA 1A9XB 3DTVB 4K9LA 1TRKA 1RQ2A 2Q8PA 1WCXA 4RGQA 4PTYA 1C9DB 4FLEA 3G2KA 3I1JA 2ODNA 3NXKA 1R0LA 2FMKA 3NYQA 1TF5A 4WNAB 4C4AA 3QTBA 3W9UA 4C2TA 5ERXA 3CA8A 1M34A 1UJ5A 2BGIA 3F5FA 3IPYA 1WPGA 3UMSA 3HU5A 4WFGA 5JBNA 3PR1A 5PGMA 5DLQC 4GXQA 3G3EA 3RZVA 2QE7D 1JQAA 4CM6A 3R3HA 4NECA 1KSHA 2PAFA 4IDAA 2XWSA 3CSDA 3I1YA 1U4SA 2W2QA 1XX6A 4RZQA 5IPFA 4F4IA 1YBFA 2DWQA 5EERA 1AP5A 1IM5A 1Z33A 5F1KA 4EYEA 1ZN9A 3B2NA 4GZMA 1SF9A 1A0OA 3TVTA 3M82A 5TEVA 4NYIQ 4IIVA 2DZDA 1QTIA 4ZAGA 3RJMA 4BMXA 2BY4A 2P0EA 1NLYA 2PT6A 3IJRA 1Y3BE 2ZRCA 4QU9A 1SUPA 3QQPA 3QUCA 3SYLA 4R1NA 5KYTA 2IVFA 1K6JA 4Q9KA 1XQVA 3K0HA 2O8NA 1JDJA 4LOJA 1UAAA 3LYUA 4CQLA 2GCEA 3RC9A 3TMKA 3CNLA 1DBSA 5DOZA 3BIXA 1DHTA 1N0HA 3QFFA 1AJEA 1ZOPA 4Z8YA 4ES6A 2RHDA 4MUXA 4YXWA 3DDZX 5KKCA 3R8FA 1U9ZA 5E6SB 3QNUA 3TBFA 4B17A 3SPIA 3W8RA 1MJFA 2HGSA 5TARA 1A2KC 3UMVA 3G6WA 2CXTA 4C4XA 1K98A 2GWRA 5KTRA 1VSBA 1PL4A 1LI4A 4N0DA 2XSZD 2AOTA 2IPMA 2XMBA 5D3KA 1H2FA 3T1YB 3GEMA 1VP3A 4HWSA 4D10F 2O5RA 3Q8MA 3EZ6A 4WLEA 3DKVA 4ESEA 1KEPA 2H00A 2I2BA 3L43A 3ZGOA 4QGPA 4J11A 1ADBA 3F49S 4D4IA 4KVAA 5AMXA 1SEPA 2O8EB 4MVJE 2YRFA 4N6GA 2RIRA 5CT5A 5H80A 1AKRA 5F5LA 5CLQA 2UYYA 4MTCA 4PZAA 1YZLA 4OI0A 4DR6B 2CXQA 3MSXA 1KAGA 4HLQB 4DJEC 1UBGA 2ZT8A 4P34A 1FFAA 4NU6A 2B5OA 3T1VA 3JX9A 5LIRA 3TL2A 2FWRA 4OUKX 1DEXA 1HH4A 3PGJA 2ZXWB 4UNRA 5KJEA 2KBEA 3S2GA 3TLYA 4QE9A 3D4PA 2X5OA 2ADMA 2VZ0A 4MDYA 3GRCA 5DGTA 1NQWA 1M8KA 4LI3X 3Q6NA 4IOKA 5KHIA 1VJDA 2QT1A 3BXXA 4HGOA 1ODCA 5JQGA 3P2YA 2EILB 1LA2A 5ESDA 1KE2A 1MZVA 5JZBA 2ZB4A 5DCYA 5BSHA 5CB6A 5EPOA 3CCFA 4MRNA 1UIRA 3BN3A 2EX0A 1QO0A 4M6WB 4NFSA 1HFJA 1UPAA 2AH5A 4BQQA 4HMPA 5EP2A 3EA4A 3CEMA 1GARA 1P9NA 3SE0A 5JHGB 1DDOA 1YC5A 3OQIB 2O4UX 3SKYA 1DOAA 3CH4B 1GGMA 2H18A 3P2EA 4YACA 2A1IA 3WWYA 2GYWA 4O59O 5AWFC 4TYMA 2VHVA 5JC8A 1G1XB 5GP1A 3HU2A 5HDBB 1O8CA 1I94O 1L8LA 2R1UA 4D8UA 2WB2A 1DQRA 4J2TA 1JHRA 4WD3A 4U9HS 2BTOA 5BQ3A 3S40A 4F86A 3DVAA 1AKEA 1CQPA 4ID3A 1GPWB 4ALNA 3G5MA 4UE6A 3HUDA 1FNNA 1E4EB 4HDMB 5EZYF 2NZVG 5BT9A 1NQOA 2I7VA 4DA0A 5IMSA 4FHDA 3QBDA 2PWBA 1NU1H 3LQ4A 5LQSA 4FMCF 4O1MA 4RSMA 2Z8ZA 2QX7A 1HT1E 5AKJA 2VHZA 4KFSA 1TO6A 5H2FZ 2R5FA 2HLPA 2Z95A 5DMXA 2Q4EA 3OD5A 4J2OA 1I5YA 4I46A 4O8XA 4GPBA 4UU7A 2H3HA 3SWWA 4BEBA 1L5RA 4KAFA 3CLTD 4WAUA 4NMHA</