2EIMB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 60
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eimB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eimB02
3UABA 2HX7A 4TXVB 3JT2A 6PAZA 1JERA 4WKXA 3UAEA 3UACA 3ZIYA 2I7SA 2VN3A 2DWSA 4DP1X 1OCRB 3OM3B 4HCGA 1L9RA 1RZPA 2H47C 5AKRA 2IDFA 1V55B 1ILSA 1YLBB 3QJUB 2J5WA 1NZRA 2A3TA 4DP0X 1OOWA 1SF5A 1WS8A 5D4IA 1X9RA 2YEVB 2YQBA 3QJVB 4E9YA 1OCCB 1FWXA 3OD3A 3PAVA 1NTDA 4BXVA 1PLAA 1AG6A 5I28A 1AANA 3T6XA 3FPYA 4E9VA 1NIFA 3H56A 3FPXA 1SNRA 4DPBX 2BWIA 1PLBA 1ET5A 3SBQA 3EH4B 1A4AA 2XXGA 3QJRB 5I6PA 2UXFA 1KCWA 4M4RB 2XXFA 1AS8A 1IBZA 4AKPA 2PPDA 2XV3A 2YXWA 2YARA 1OE2A 4KNUA 2HXAA 2YAOA 3SBPA 3TBCA 1NIBA 2BW5A 1AZCA 1KV7A 2DY2A 2WO2B 5A7EA 2FT7A 3NJMA 2UXGA 1SF3A 2BP0A 1NPJA 3CDZA 4YSRA 2W88A 4YSQA 3UGEA 1FA4A 3T71A 1ZPUA 4X4KA 2VW4A 2EIMB 1CUOA 3ZBMA 2EIKB 2GC4C 5B7FA 3NJKA 2X88A 1MZYA 1E67A 2GI0A 1TEFA 3T6ZA 3S8GB 2WSDA 1KBVA 2IH9A 1NDTA 4E9RA 2YAMA 3MX0B 2PP8A 2XLLA 2HX8A 3GDCA 2HRGA 3ZX1A 3NJGA 4GP5B 5LDUA 1ADWA 3FSVA 3NP4A 2GIMA 1E30A 3NP3A 3PCYA 4GP8B 1AS7A 2UXVA 2BP8A 1JZGA 2DYSB 4NERA 3QJQB 1NIDA 3N2JA 4G7RB 2GHZA 1WAEA 4AI7A 4HCFA 1JZIA 1HFUA 1ETJA 3NSDA 2IDSA 1WA1X 2E86A 2OJ1A 3FSWA 3BVDB 2Q5BA 3S3CB 3QPKA 2XYBA 3FU9A 3MBWB 2VM4A 4M3HA 5D4HA 1RCYA 1M57B 1M56B 4YSSA 3QJTB 3TBBA 3FQYA 2PPAA 1BQRA 1PZAA 4UF7C 2YAQA 4NB7A 1V10A 2IWKA 3NJNA 3FYIB 1NICA 1ASPA 1B3IA 1BXVA 2Q9OA 2R7EB 4KO9A 5TK2A 4FA7B 3OMAB 5I6MA 1PZBA 2DV6A 2FQGA 2ZOOA 3ABGA 4JHUA 6PCYA 2PCFA 2YAHA 2VW6A 2UX6A 2RACA 3SBRA 2FQDA 2OCCB 1GS7A 4KO6A 4BDVA 4K9JA 4HHWA 2P80A 5F7AA 3CZUB 3RYMA 2YAFA 5I6OA 1BXAA 1XB3A 2YAPA 2HZHA 4FAAB 1FFTB 1XMEB 1T5KA 2UXTA 3FU8A 1W6LA 5B1JC 5B7MA 3NT0A 3AG3B 2VW7A 4Q89A 1WA2X 3EF4A 1EHKB 3CVDA 4DP6X 4A67A 1ILUA 3FSAA 3G5WA 4E9XA 2XVBA 4YSEA 1L9QA 4KO5A 3FU7B 2BZCA 3X2QB 4YSTA 2HX9A 3IN2A 4A2EA 1CC3A 1J5DA 3NSFA 1X9UA 4HAKA 2FQEA 3AG1B 2WO3B 2PLTA 4PAZA 3WKPA 4DPCX 3S3BB 4DP8X 7PCYA 2FNWA 4YL4A 1A8ZA 1OE3A 5F7BA 3CVBA 3HEIB 2B3IA 1PMYA 2HRHA 4MFHA 4F2FA 3TA4D 3WKQA 1BQKA 1TEGA 4HHGA 4ENZA 2JFCA 3V9EA 5PAZA 2PP9A 5B7EA 2YXVA 3CVCA 2IDQA 3QJSB 3L45A 3ASOB 3FT0A 2NRDA 2CALA 5I6KA 3T6VA 1OF0A 1ASQA 4DP5X 2TSBA 2CCWA 1JZEA 2W8CA 4F7KA 2B08A 1E5YA 1OCZB 4YSDA 2X87A 3FYEB 1ID2A 3KW7A 2QDVA 3GYRA 1A3ZA 4W1TA 1SDDB 1AIZA 2BW4A 1AZNA 1AR1B 1M9WA 1BYPA 2Y1AA 4AZUA 1IUZA 3ABMB 1W6WA 3PLYA 1GSKA 4A2GA 4DPAX 4HIPA 1IKOP 1PLCA 3X1NA 4KO7A 3AZUA 3FQ1A 2BWDA 5IY5B 2BHFA 3T6WA 3AG4B 4JKNA 2MTAA 1UATA 2GC7C 1SJMA 2I7OA 2JKWA 1AZBA 4G7SB 3WNJA 1QLEB 5FC9A 2FTAA 2PPEA 3OQRA 1ET7A 1KBWA 1SHWA 1J9SA 2VSMB 2J56A 5ANHA 1J5CA 1OE1A 4E9WA 1NWPA 2JXMA 3CG8A 1NIEA 4KOBA 1PF3A 1KYAA 4CSZA 1GR7A 1JZJA 1AOZA 2Y69B 2ZONA 4A2FA 2J55A 5PCYA 4N4YB 1PAZA 4F2EA 4G72B 2BZ7A 2VMJA 5E9NA 2XX0A 3C75A 1IBYA 5I5MA 1L9OA 1JZFA 1BAWA 4AKQA 4AX3A 2FWLB 1F56A 2XX1A 3D12B 3FSZA 1KDJA 5D4JA 3TU6A 4A2DA 3WG7B 2CBPA 3UAAA 1PNDA 3NJIA 3ABLB 2PPCA 2J57A 9PCYA 1HAWA 1CURA 3H4HA 3PAUA 1KDIA 2UX7A 1RZQA 2N0MA 1JXFA 1ZIBA 4BWTA 1J9TA 1JOIA 1GS6X 1AZUA 3KW8A 1PCSA 1KCBA 1VLXA 2H5UA 3SQRA 1DYZA 4JHVA 1GY2A 1N68A 1KGYE 3X1EA 3ZDWA 1ZV2A 4UAHA 4A2HA 2BP0B 2OV0A 3CDZB 1BYOA 4HALA 2ZWNA 2AZAA 1XB8A 1AS6A 1BEXA 2DYRB 1BXUA 4YSPA 5B1AB 1JZHA 5I6LA 2FT8A 4GP4B 4P5SA 2CAKA 4E9SA 4A66A 1RKRA 2EIJB 4YVNA 1W8EA 1CYXA 1QNIA 5TK4A 5AFAA 1CYWA 2ZXWB 8PAZA 1V54B 1NPNA 1A65A 3QQXA 1L9TA 3OMIB 3EHBB 5B1BB 4YSOA 2LLNA 3DKHA 4BK5C 3X1FA 2TSAA 4HZ1A 1SFDA 5B1JA 1GYCA 3NJHA 2BP8B 2QT6A 2R7EA 1AQ8A 2EINB 1NINA 3NJLA 1E5ZA 1JVOA 3GXUB 1MDAA 2CUAA 5EHFA 2XU9A 1DZ0A 3H4FA 3S8FB 3OMNB 1EZLA 1TU2A 5I26A 3WNIA 1OV8A 4BXSV 2EILB 3IN0A 3T9WA 1MZZA 3S3DB 4GYBA 3WI9A 5I5JA 2AVFA 4WTQA 4DP9X 1J9RA 4NAJA 1AACA 2YAEA 1AAJA 2H3XC 4KNSA 4YVUA 2QPDB 2IDUA 1AZRA 3NSYA 3NJFA 1N70A 3HB3B 4E9TA 1MG3C 3FS9A 1TKWA 4RH4A 3PPSA 3ASNB 4KOCA 2CJ3A 4G7QB 4DP4X 4P5RA 2AANA 2VSKB 7PAZA 1AG0A 1ET8A 1JXGA 3UADA 3FU7A 1PZCA 3X1BA 2FT6A 1PNCA 1OCOB 3TASA 4GXFA 3V9CA 4DP7X 3EH3B 4BDVB 5I6NA 1PY0A 1JVLA 3X1GA 4KNTA 1NIAA 2PCYA 3ABKB 1ASOA 3WIAA 2P80D 2GBAA 3IE9A 1SHXA 1QHQA 1GW0A 1E65A 2VM3A 2IDTA 4G71B 1XB6A 2DWTA 1NWOA 2AZUA 1L9SA 2XV2A 3EH5B 5B1KA 2IWFA 3IEAA 2GB2A 4YSAA 3FQ2A 1IC0A 1J9QA 4YSCA 1A4BA 4UANA 3U25A 3AG2B 2PP7A 3NSCA 4Q8BA 2QDWA 5I5IA 2FQFA 3PAZA 1ZIAA 4W9ZA 3DIVA 2MRYA 2IWEA 1WS7A 4DP2X 3ERXA 3NYKA 3IBOA 3AW5A 1I53A 2PPFA 1JXDA 3BQVA 2XUWA 3PXLA 3NJJA 1GS8A 4G70B 4QLWA 1A4CA 1URIA 2AFNA 1WA0X 3AY2A 1SFHA 2I85A 1ZDSA 4HCIA 5B3SB 4GY4A 1SDDA 5AZUA 2FJSA 4ZK8A 3DTUB 1GY1A 4EF3A 4AKOA 4BWWA 4E9QA 1L9PA 2IH8A 2XV0A 4PCYA 3N55A 2QPEB 2GSMB 4YSUA 4CSPA 2IAAC 4BWUA 1MG2C 1HAUA 4A68A 4L0PB 4QKTA 4N8UA 1R1CA 2HLEB 1BQ5A 1ZDQA 2XWZA 3JTBA 2BO0A
chains in the Genus database with same CATH superfamily
5ALCH 1JERA 1AB3A 3BISA 1RIVH 1KLFB 2DWSA 3MNVA 5D5MB 2VQ1B 4CS2A 4PRHE 1DE4A 4ZAKA 5IUSA 5IWLC 3HN5A 3QCUH 3TCLA 1G9NH 3DSFL 3L3DA 3KKYA 2OMZB 4XCEB 4EI6B 5JOFA 3I5DA 3IKCA 3NIDE 2QZQA 3GSWB 4HXAH 4ORZC 2ZUQB 4PS4L 3SDDB 1YJNV 3C6LC 3CCVV 1CU4L 4KTEL 4JPSA 4L1BA 2P8LB 2WXMA 3CP1A 2V8LA 5TDOB 1GMGA 1FWXA 4K7PX 3WO4B 3AM8A 4Z5RB 2X4UB 1E5BA 5EZJA 4P46A 4UT6L 2LVCA 4PYGA 5EG6C 2Z64C 1HL4A 2APBA 4QPJA 1R3IL 4X8JB 4ONFL 2UZXB 5F9OL 5C0EB 4L1LA 4LHUB 1E9OA 1ORQA 5FLXN 2JSFA 4DR7B 3QJRB 2GK0B 4OI9A 4XB3A 5E1HB 3R8BB 2FSEA 3ULUF 3OKMA 3T4AA 5EORH 1I8IB 5E4IA 3WEAA 1CD1A 3VDBA 4OV5A 2ZXGA 3RZCA 3ZDYE 1HI6B 4PJGA 2WTRA 4HFWB 2EXSA 1JFQH 3QIWA 2YARA 1DQIA 4XBEH 5GSVB 2JELH 4K7PL 3T2NH 1JPFA 3LD8C 2RD0A 1M5IA 2BW5A 4JI6O 1P69B 3TK1A 2DJUA 4HX1A 2A6DB 4D0BA 1HXKA 1HHJA 2NY5H 2RMKB 2BINA 3HBQA 4OLXH 3BPOC 3CMOL 5DYOB 5K9OB 2EH7H 4B0MB 4ALAC 1QSEE 1XI1A 1OHZA 3VD4A 4HGWB 5KYWA 4NQDE 4R4BA 2M26A 3C5XA 3K6NA 4YSQA 3VQXA 3BUYA 2Q7GA 2XKNA 3OKOA 1FA4A 3A21A 3BW9B 1ZKAA 4JFUA 1RHHB 1ZOXA 2JJUA 1KNOB 2VQUA 3H7LA 2O5XL 4I5SA 3PWLB 3G08B 1D7DA 2WNKA 3ETTA 2AEOA 4OM1H 3M8OH 3FUHA 1CD0A 2ATAA 2BIMA 4X5XA 3JV4A 4OLYH 3CSGA 4WEEA 2NZ9D 3UG3A 4E9RA 3LRGA 3OLGA 1UWXK 3P3YA 3FT3B 2P49B 3VD9A 2FJUB 4H4NA 2CM5A 1TA8A 5CHNA 3LS5H 1DBBH 1Y1DA 3BT2L 1VGKA 3GXPA 3Q5TA 2C5DC 1KGUA 5JQ6H 3S96B 1DUZA 1MLBB 4BH7B 1XF2B 4YDVB 4NXNB 4HUXB 2XQYG 1SZTA 5F6HI 2V5MA 4JEGB 4XNQB 4JYBA 1U8MB 2BC4B 1I1FB 1JMZA 4JPQA 1ETJA 1FDLH 5T3ZH 5L3GA 3QDGE 4RISL 1WA1X 4FXKA 5DD5H 2NZ9C 1GZPA 3KZIZ 4W4KA 5BUPA 5GW7A 2IAND 3GIZL 1D5BA 3UO8B 3L1GA 1HNZO 4J9YB 1VACA 4LT7A 4N0FA 4WHCA 1ZLUH 2E27L 1VQ9V 4NPYB 1L9MA 2CO6B 4NP4L 5ANMA 4WCYH 1A1NB 2G60H 1BZOA 2CTQA 1CF8H 2YAQA 3D4GA 3E83A 1SA0A 1A21A 3Q2VA 2B0SL 4JTCB 1D5ZB 5HVHC 4UU9A 3FYIB 1SLUA 5KMGB 4XXWA 4AIEA 2QSTA 1UXSA 3ARFD 3UG4A 5C9KA 2DMGA 3SGJA 2DV6A 3ELAT 3CWBH 1UJWB 1R3KA 2J4WH 4DK0A 2XVKA 3GMMB 3LH2H 4JM2B 3VRLF 2HMIC 2OTWA 3G5YA 4ZXBD 2OTPA 2NQDA 5IG7B 5K1NA 4NCC2 5I19H 4PJFA 4LLVB 3GMQB 5D70L 4LVOC 5HVGB 3VACA 3TT1H 3FUFA 4O4JB 1HQRB 5DU7A 4YUEL 3Q3GA 5F7EL 5D6DA 5MHSE 1M56C 5D72L 3UYOD 4HUCA 5J9PA 1E8YA 3MRRB 1PLGH 4ICGA 4OCYH 3D39E 2A77H 3C09B 1BJ8A 1ZRUA 2E75C 4FLOA 2PYFB 1RU9H 1PG7W 1P7BA 2QADB 3NT0A 3ARFC 4WI6A 2E7MA 3O9WA 3ZE2F 1KTLA 5T1DH 3VFPA 3L7FA 4XVJL 5CEZE 2QHRH 4X1IA 3R06A 4Q0XL 4N90E 4ZXBC 3FSAA 5SX5H 3QNXA 4OZHF 4X9FA 4YR6A 4YOKA 5TE6L 3F12A 3U0TB 2J8UA 2NY1B 5G55A 3S35X 4CMMB 4F8QA 3VFTB 5E70A 1CLZL 3ULAB 3WTXA 3O41A 1BVLA 3HUJB 4R7NA 3DJSA 2P6JA 4PA6A 3L16A 1E4KC 5ADPL 1OGAB 1F3RB 3MREA 1VP7A 1H8NA 2CDEA 3WIIL 3S3JA 2MPAH 1OE3A 4FTVD 3LS4H 5IZ7A 3CVBA 3POHA 3VBBA 4DV4O 1K85A 1CFBA 2SEBA 3WMPA 1WFUA 2CO4A 2XIDA 4JN1H 4N8CL 3OG6B 4EQ2A 1TEGA 3ARDD 2Q8BH 1H6FA 3H1ZA 3TVMD 1OHHG 1FVDB 4AVHA 3S35L 1AP5A 2H41A 2YXVA 5C92A 2HP4A 3HI6L 4HWBH 4UCVA 4GKKB 1CLYH 4L3CB 5ECJE 3ZHLA 2NR5A 2X9YA 1SDAB 3GBNL 1DGSA 2VO8A 4PVBA 4EZJA 2CALA 2PGGA 2AJUH 2YIAA 1WH0A 4JR9L 5TGBA 1IEAB 1VFAA 3KJ4B 3T6VA 2XWJA 3TBVA 4Q6IB 1FJGO 1TJIH 2D4DA 2XG5B 3ARDC 3KPSD 4J11A 3T2OA 4LBEA 5TFSL 3QFDB 1IXMA 3GMOB 2Q86B 2IALA 3UTSA 1LNUA 4AILC 1JPTL 4HEPA 4F6RA 2DQGH 4MA7L 1CICA 4AZ8A 1BGXL 2R1WA 5F44A 3DOSB 4X4ME 5B38G 5JQGA 3HHSA 1GSKA 4L1TA 4XCNB 3NEEA 5C3LD 2YEVA 3DUUB 1IC4L 5I0YA 1EX0A 3D2TA 4IBQA 4P4KD 3FUMA 1Q1JL 2AAAA 5FUCE 3OZLA 4J3OF 5CJOH 1KGXA 4PJ7E 4BBWA 1AI1L 5EU6E 3U36A 4OZIF 4LSRH 2Z91A 1UM6L 1YITV 3OB0K 5E23A 3QXDA 1KIPA 5E2WH 1OV9A 4EIGB 3CFJA 4PV1B 3LRLA 3HZVA 2Q8VA 3TL5A 3HIZA 2KLTA 3DHJA 1EV2E 2VXUH 1VZHA 1ET7A 2VSMB 2PZSA 3BYYA 4FD0A 4XPHL 3MLWL 5GIRB 2A74A 1AO7D 4QNPE 4M4RA 1QSFD 2BVQA 1OE1A 2A4EA 1WICA 1UXMA 3ZHKA 3CG8A 4X0KB 5IK3B 3TIEB 2XV6B 3PY9A 4P4KC 5FYJU 2P24A 1KYAA 2F54B 1NGXA 4JFWA 2FEDD 4UQ3B 3U0ZA 3HG1E 4NZUH 2BOBA 3W5NA 1H6UA 2NY2B 4ONGH 3THOA 3K2UL 1Q4NX 3LV3B 5FM5O 3S88L 3ZZ1A 1YEJH 2ODHA 3HS9A 4IEFA 3C75A 1RK1B 1J1PL 2AKRB 2GJZA 4EVNB 4IS6B 4TVUA 2Z1PA 1ML0A 1H5BA 3MRLA 4FG6D 5LYJA 4MCZB 2W0FC 4XVUD 3RTQB 4ZRGA 3VYPA 1NH6A 1N0LA 4Z18A 4EKXA 3HVDA 4X6FA 3IJYA 4DZ8A 4XOCA 1XR8B 1E40A 3AT0A 4UOZA 4AYGA 2FO4B 3LZRA 4I18A 4KKBD 4P9ML 1OD9A 1S7TB 1OY3B 43C9B 1R4XA 2FEDC 1JVKA 4XDKA 1GGIL 1UVQA 3I6GB 3H4HA 3EBIA 3IMSA 3QUYD 4GXVH 4HNAA 5HYQB 4TV8A 3WNOA 5GS0L 3CRAA 3NG5A 3FTSA 1Q94A 4BWTA 1RUKL 4IRJC 5F3HB 1COBA 1OD7A 2O6FA 2YRBA 1YMMA 2AQ2A 4ZHQA 1DYZA 4XVUC 2CRIA 1UM4L 3D48R 1FGNL 5IM7B 4JHAL 1YY8B 3X1EA 5IB4A 3ZDWA 1PYWB 4FNPA 4FERA 2XN9B 5JHDE 4LCYA 4KKBC 1BYOA 3LQAH 3ARVA 4XAWL 2W81C 4CVZB 1IKNC 2E0PA 1OT4A 2ZWNA 3MO1B 2VE6A 3WMSA 1CPYA 5CN3A 1AS6A 3QUYC 2J43A 4O4YH 4YZFE 2DYRB 4DGUA 2HWZL 1BXUA 3MRPB 5B1AB 3KPQA 2ALWA 3M07A 3O6MH 4YSPA 3FB5B 4WK0B 4EKJA 1HC1A 4GYCB 1MSDA 2Z31B 4PJHE 4A66A 1RKRA 2ZG1A 4M1GL 4QOKE 4YBQD 1W0VA 3QPQC 3EBGA 3OTFA 4DAGH 1SEBB 2BSKB 5JVDB 1GYWA 2FIKA 3MROA 5EBWB 4ERSL 1PZUB 2ZOWA 2AK1H 2NXZD 4N2FA 4CDGC 5KBDA 2HN7A 4FLYA 1CCZA 1GGBL 2JB6B 3W9EB 3WOVA 2EH8L 4G5ZL 3RVZA 1TJXA 2OMVB 1AXTL 3MRIA 3ECQA 3QW9A 1NINA 5IQNA 3EJJX 1IM9B 1RULH 1T7WA 3D85B 4Y4HB 4MS8D 1UD3A 2V2TA 4U6VH 2ZYRA 4YBQC 4C56D 1MZZA 4U49A 4QE9A 1KBGL 4YJ2A 1G7JB 1BJ1J 3S97C 4PP2B 4JFDA 4NS0A 3O0LA 1EFQA 3OQ3B 4NRXA 2NXZC 1FV1A 2JH2A 4QCIA 1R5WB 4P23D 4BGLA 5JH7B 1EAOA 1A7NH 1EFXD 2P4KA 2YJQA 4FM0A 1AZRA 1XT5A 3BQUC 5CBFA 2JJTA 2TRYA 4XNUH 1GAFL 3VXUB 4LO9A 1F8TH 3E22B 5CWSB 2MKWA 2WZ5A 5F7DB 3QEQB 3S3SA 3VH8A 3HFFA 4QHKJ 4Y9BA 3FK3A 1F18A 1DVFB 1JX9A 3BESR 3GTNA 2IQ9H 1P9MC 3GIVA 5FKPB 4XN7A 3MUGA 5I6NA 5IMKB 2ZX7A 3V0FA 3AS1A 2VUOA 4JGMA 3GMRB 3ABKB 2FATL 1HH6B 5BR8B 4I3RH 1SHXA 3UDWC 1AROP 4DKEH 4K8RH 4X5WB 1LO0L 5C7XH 5E8EA 2BIHA 2AJYH 4CAGA 4K7FB 1P4IL 3PP4H 3UO1L 5E8OB 1H15A 3O2WL 4U3HA 3E2HC 4HOZA 3DVNB 1LO5B 3L3OA 4MQTB 5D7HA 4BR6A 3RHWF 4ABQA 1Q9WB 3SDXB 1TZAA 1QI4A 2VUYA 4DUZO 4P2RA 4Y88A 4I0CC 2EVFA 4OGZA 4QHUA 2CJUH 4WWID 4ZUSB 4X7SL 5C1MB 2V9TA 3TH4T 4QPKA 3ZDXF 1WAAF 2YPLB 3ABZA 3NSJA 4OKVB 3GO1H 4NO3B 2G75A 3U1SH 4LBAA 3Q43A 2PF6A 2HT4D 1WA0X 3RYHB 1SFHA 4N22A 1CFVH 4NT6A 5BXFA 5LWYH 1FBIH 3OR6B 5A2AA 2VLMD 2ADFL 4OCXH 4LZKA 3EGSB 5IP4A 2KBGA 3R7QA 2FWSA 5F9DC 2XV0A 3D52A 3CS5A 2ZWSA 4TSAH 1X3DA 3BCDA 4JPIA 5SWSA 1ZEAL 4OR1A 1CLVA 1B4JH 3WFHB 5DHXB 1K73W 1QRNA 5GHWL 3MNZB 3EGXA 1KMGA 1KCRL 3OWRA 1BQ5A 1NMAL 3VGHA 1E3FA 5F88B 1AXSA 4HIXL 1INEL 4Z7VE 2HKHH 2HT2C 5BRZA 4H88H 5HDBE 2LV4A 2BJMH 2EXYD 4J1UA 4KAQH 3ZIAG 1EEUA 5DZLA 4APQA 5L2JB 1LK2B 4FTDA 2ICWB 2VN3A 3CXDL 4FCAA 4LNRB 5CSGA 1NOLA 3KCPB 1S7VB 1OCRB 3CXHJ 4ZIBA 3GXNA 1ZJBA 4LSQL 4OZGB 4YLCA 2HVKA 5AKSA 1OM9A 4P2QB 3PQYE 4HUKB 1XGQB 2IDFA 1V55B 2VXSL 2Y0SA 4LF6B 1F4XH 2NOYA 4FQ1L 2AI0L 1RP9A 4TF4A 3MBEB 3UTZA 4AQOA 3QO1B 1SF5A 4GCZA 1K72A 3GRBA 4KUCF 3DX4A 3VXMD 1KPRA 4KBPA 3SDDD 5IJBC 2DM4A 2QA4V 2RN9A 5GTHZ 2WZ6A 4YE4H 5AKTA 2QWPB 3IAYA 3F7YB 3BPLC 1JGUL 1K8DB 2AGJL 4K94L 5I30L 3ZQXA 4J5VA 4BIOA 3CCQV 1PLAA 4JY4A 2CKBH 5HY9B 5CLYA 4JY6A 2OBGA 1SJHB 1NDMB 2HKFL 2X2JA 1Q86W 3FU0A 1JFHA 4Z1VA 1SOSA 3QNYA 5HYJE 4X66O 1P7QB 1MNUH 5EN2A 2YD2A 3BUPA 4PRIB 1R19A 5IHUL 3LIZH 4PRBA 2ZUQC 3SDDC 1ACYL 2OMUB 4N5EC 3FN9A 2P45B 4MJ5B 3TA3A 2WINB 2QTVA 4PCKA 4Y1AB 3V0GA 3P0YL 1Y67A 3LKQB 5A2QN 4RMBA 3WO4C 3SBPA 5FL7G 2NY7H 3QZBA 5CBEB 1CO1A 1XF4B 4NO0B 1NGPH 2IJHA 2NLJB 2WO2B 2EDDA 5DHDA 1G9EA 3I3DA 3MRKA 4TUJA 4QE7A 2R0KH 5F6HJ 5BV7L 2ADGA 2LFGA 3FULA 1TUPA 1J8HE 3QNFA 4JDVB 2B3RA 2V7HB 3SDCD 1NPJA 4CH6A 4C57C 3G5VA 4KHTL 1SM3L 3CZKA 4Z7WB 1KTKE 3LRSB 3U9PL 4PJ9A 5CU9A 1OP5H 4FFTA 1QNZH 5ISZA 3T1FA 4HF5L 3KLQA 2Y4SA 3QJHA 3ZJZA 4TNFA 2J2ZB 3V4PH 1V9PA 1GW6A 2P67A 2EDKA 5IEHB 1R6TA 3S37X 4JFXA 1CG9A 2EDNA 5IFAL 2X6UA 4IOIA 2WXIA 4X4XB 5LGTA 3CHOA 5CZVL 2XQYA 4FP8L 1S3RA 1R3LA 3BO8B 4ZFFA 1XHZA 1BFVL 2CKBB 2D31A 4D9RD 5AB9A 1E30A 2RDCA 1MIML 3QZPA 3QSKB 3NFPA 2DYPD 1TSHA 1H2MA 3MJ8A 2O61A 4G1EA 4RQEA 4M6OH 3INOA 4E42B 1HHKB 1T1YB 2G38A 1BECA 3OFNG 1G9NC 3HR5A 3MRHA 4FNSA 1VEWA 1CDYA 4AL8L 2JJ2G 2V4DA 1GMIA 4AIXA 4HKZB 5H8DA 1X5ZA 1EFRG 4KZ0A 5CZXD 1A66A 5AOIA 4CADA 2CNYA 4DSYA 5EN3A 3MRGB 1E8WA 2VM4A 4WJKB 1I3GH 5J6HB 1HHHB 1EZVY 1MHPH 4K3AA 5AAMA 1JXKA 3VXNB 5IBUG 3L81A 4YSSA 1I94O 4JZ2A 4GKZB 2FNBA 4KJYB 1KJ2A 1TUEB 1XSIA 1DFBH 3VFOB 5KW9L 3K0WA 2WBWB 2RAMA 3SE3A 3B2EE 2R7EB 3DECA 4OGYH 4OJFH 5IBTL 3FTXA 4HPYL 6PCYA 2OT5A 3D3QA 4LF4B 4KK6C 4F92B 3RBZA 4GX2A 1ZHBB 4KK9D 1KC5H 1HILB 1M9NA 4FQPA 4JM2D 4QXVA 4TV3A 3V4PB 4PA9A 4FQIL 4DR5B 3SBRA 3EJRA 3N9GL 4GQPH 1S3KH 3RYMA 4L18A 2A9HA 2Y7MA 4ZOBA 3U0WL 3KH4A 1U8KB 2ZKMX 2YAPA 4X6CB 2NY5C 2VLRD 1FFTB 3K0DA 3OR7B 4FAAB 1IL1B 2R72A 1S9XA 5T5FA 1Q9KB 4FFYH 4HJUA 2Q4PA 3OWEA 5D1QB 4ZODA 4RRPM 4DK6A 4TULL 2VDLL 2QADD 3U6XS 3CH1B 5KN5B 3FNKA 3NA9H 2FH6A 1GN2A 3CVDA 4KK9C 5AOZA 3ZOAA 5JYMA 3G5WA 1AKJB 2LGWA 3CCLV 1WWBX 3PFQA 3QB7C 2J8UE 2Y2YA 4JM2C 2R2EB 4Z7OB 5IV2B 5E2JA 3LPOA 3X2QB 4G80A 1RM1B 5DSCB 1F1GA 3U9UB 2OSXA 5IBLD 1QNMA 4NQCB 4RMQA 3WKPA 4BKTC 1A3QA 1DO5A 2VRAA 4ODUA 1HHIA 5FW7A 5SWZB 5IYBO 1KT2B 5J3HC 1QWNA 2VN5A 3RIAF 1UHVA 2CIKA 4I4TB 5CMAA 5KYUB 2BFGA 1A6AB 2KZKA 5C0BA 3C09C 3RFZB 3S0PA 2HRHA 3V6FA 2CHWA 1F6FB 2QADC 4F2FA 3JUZA 2RCVA 4X6BA 1B06A 2P5PA 3PWNB 2E7LA 2X9XA 4YBLB 2RIKA 3VFUB 4I1PA 4UV4H 1ZLSL 3EYOB 4F37F 3WENA 4LL1A 4BV1A 4TUYA 4LSTL 3GSOA 2NY1C 1JI1A 1A3RH 3KXFA 5IBLC 4HULB 3AT8A 3D09A 3LQZA 3K5MA 1G7PB 1GPOL 1MREH 1R34A 1FPTH 2P47B 3AY4A 3MOAL 3WIHH 5KUKA 1GIGH 4D0CA 5FGCE 1QFWM 5I6KA 3U4EA 1J11A 1TQCB 3RVTD 5KVDH 3G04A 5CLXA 3WHXB 1T1XA 1Y74B 1FVEA 3DGDA 5B38A 4LLMB 4R5VA 4HG4J 3APFA 3MR9A 2X87A 3O11B 5C0DA 1M2OA 4FNQA 4WK4B 3UTSE 3VE0A 2HLAB 1SKVA 1OGSA 5IGXH 3AC0A 2Y36H 1J5OH 1DZBA 2V7NB 4J2XA 4GAYB 1Q8MA 4OBRA 5LJYH 4DW2L 2WQ8A 4NX0A 5ILTH 3WFDH 1TTUA 1FE8L 1NKDA 1I8UA 1AVAA 2UUAB 1SVCP 2DH2A 4Q2ZA 2BHFA 4MAUL 2ZX6A 3BVUA 4JKNA 2BSSB 4ZW3A 4FZEL 5LXGL 1TVBA 3RVTC 1MMMA 2C3WA 2WXRA 3HPJA 3ZHRA 3LKOA 4KMTH 3DIFB 3KJ4C 5D1XE 3U6RA 1OB0A 2MH4A 2YK1L 2E9JA 4Q6IC 1FN4B 5KJ7E 2PF4E 2UXNA 4J4PC 2NY4B 3IU3B 1J9SA 3GSVB 3ZYZA 4IOFD 2WBKA 5IB1A 3ZLQC 4XHJD 1YEDA 5HGHA 3L9BA 3C60B 2WHVA 3VM7A 3OHMB 1TO5A 4OH2A 1KJ2L 1U8IB 2BDNL 3JSSA 4ODVL 5I66A 3MRQB 4AYMC 2VJ8A 1JZJA 4WI4A 2XZQH 2WWOA 1JGVH 4G11A 1ZAUA 2MW2B 1BW8A 4KRPB 3PREA 1R47A 2FWOA 5ALBH 4CNIA 2NY2D 3HE6A 3ZT5A 4PV1C 2NTFA 4AV4A 1JYVA 2P5WB 1XCXA 4UIMB 1FRGH 4IOFC 5E7FA 1F56A 5F7MC 4OIAA 4Y4KB 1TDQA 3RTQD 2HG5A 2WMPA 2WTOA 3NSXA 4G8GB 3D07A 3BP7B 3O2VH 4JPVH 3FUKA 5DJ6B 3DI2B 5K9JL 3CX5J 2FJFB 3IMVA 1WWCA 1IAOB 2K4AA 4MJIE 1UH2A 5DS8A 4PR5A 4R84A 4WFBV 1PVHA 1RZQA 3VXRA 2Z7ZA 3LQMA 1MFAH 2X4SA 1YYLH 5C08B 1JGEA 3OV6A 3MXVH 2NY2C 2F5AL 3P4OA 2DQMA 3N42B 4LQFH 3CLFL 2CUGA 1YYMH 1JHLH 3L3HA 1CI5A 4JHVA 5D2LE 4KUMA 3JD3A 3BABA 3AGWA 5AW9B 3UP1A 3Q05A 3RTQC 4KI5E 3HKEB 2HVJA 4G42B 2VTFA 4TSCL 3ZR5A 1JBJA 3QS3A 3TYFA 3NIDF 3MHHC 2ADIB 3HTLX 4WJ5A 2BVOB 2XN9D 4XNDA 2LQTA 1LE5B 1C12A 1T83C 3NEXA 5BRPA 4JYCA 2CM6A 3TC9A 5IVXA 5AQ0A 1I7UA 4GB9A 5DDHA 2ZNXA 4K3JL 4GP4B 1G9MC 2XTJD 1R3JA 2Y7QA 4P57A 4WHYH 3VCLA 1QR1B 1X7SA 2W9LA 4FLSA 2NSXA 1UT2A 3DMMD 5INCB 5EIVA 2DEXX 4JB9L 1QTYT 5TE7H 1ADQH 1COWG 3CFIC 2R2HA 3BH8B 3TZVD 1G94A 5LMUB 1BG9A 2OTJV 2QT6A 2VLJA 3CDCA 2O5YL 3ZDYF 3SYQA 3U0PB 2ZSWA 4GI6A 5DI8A 4X7CC 1YUHA 2DYRC 5B1AC 2R29H 4IMLA 4JZOB 4M4PA 3FB5C 4S1SL 5D5QA 4XVTL 4N23A 2Z31C 3M1CA 1S7QB 1EO8L 5KSVA 2MNJB 4K0OA 2VZTA 4JFDE 4RGND 5C0CA 4L2LA 4AW7A 1H3VA 1HE8A 1R0AL 1MNNA 5AW1B 2K4WA 5EBWC 5L88L 4NNPL 4O58L 4FFBA 5CGYC 2NR6A 3ZHFA 3VXTA 1NUGA 4KNSA 1F7YA 1WSST 3T77B 4N0YH 2KC0A 2IDUA 3I6KB 4GMTL 1MVUB 3NQIA 3FCTB 4GAJL 3HR0A 4JFEE 4A37A 4I55A 3CMGA 1G7MA 5L8LB 3S5LG 5IW3A 1BLNB 4OLWH 4QRQA 4Y4HC 3GBDA 1KP3A 2W6IG 4U1NA 4UOQA 4MNQA 4AGNA 4H0GA 2H2PD 4LOFA 4PWIA 5CZRA 4C8XA 2K78A 1AJNA 2VR8A 1OAZL 3ULUH 1AH1A 3ALXA 4AJWA 3APOA 4HSQA 3N2KA 1OP4A 4OAWB 1OALA 3QNZA 35C8L 4WEBH 2B9ZA 2CLVA 1JWMB 2C1OB 4HAGA 4PWKA 1Q38A 3LPFA 3REWB 2GBAA 2N1KA 3QIBD 4B9KC 4AG4H 1GW0A 3ISYA 2RFXB 3WY4A 1D6EB 1PG7X 3O6FA 4M5ZL 1ODUA 3DX7A 2PWHA 5CILL 1TFHA 1NWOA 1OEZW 2B1OA 3OHXA 3DROB 3GKWL 3EH5B 1E42A 2QSQA 5IUCA 4A7QA 4PA3A 2CHXA 2GIYA 1J9QA 3UTPE 1A4BA 2H2PC 1BF5A 4H7VA 2VAJA 2YR3A 5T1KD 2R0ZL 3GQFA 3T0AA 1DVFC 2FAUA 2YIHA 4P2RE 4Z3TA 3ZO9A 4NQQA 1A7QL 1TJHH 5CN0A 3LZLA 3FOLA 4XVSL 5D2NA 5HGGS 4NZRH 2WQUA 3BP6A 3NCFB 4NHUA 4OGAD 2B8OT 2FEJA 4FFWD 1RERA 2WXLA 3MPCA 1MIEH 3ABKC 5C0RH 1YTFB 1GOGA 4NBXB 4DO2A 1Q9OA 2WQAA 4PJBB 1PG7L 5DK2A 3E8UL 4AHCA 4D7PA 1MCDA 3CC5A 1ZDSA 4G7YL 4B7LA 5B3SB 2F53A 3EG9B 2FJSA 4QTHB 1CT8B 3T2QA 3DTUB 1GY1A 4K3DH 4MDJA 5L2KA 5SWSE 1BZEA 4CGUB 2OZ4H 5G2NA 2IAAC 5EUKB 5DJXB 1MI5D 4LWSB 2DD8H 2MCAA 1HAUA 1QRNE 4IU3B 3RWFA 3EYSH 2CH8A 4OGAC 1A25A 2HLEB 2VUKA 3HFMH 1NPUA 2EAEA 4G9FA 1MW0A 5T3XL 4X6EA 2BHZA 4QXTB 2WLJA 3RUGA 3MRMB 1KFGA 3VSUA 2ZUUA 3S2AA 5J7CC 4TXVB 2LVEA 3HKCA 1IBFA 1ES0B 1MCEA 4WKXA 3VTMA 1PTZA 2DQUL 1P1VA 2J12B 3OR6C 1MRCL 1T1WA 2Q7NA 4NQEA 3B6SA 4NENA 5FDWA 1VF5B 2DQEH 4LQ1A 3FKSG 1KIQB 1L9RA 1RZPA 2BXZA 2CGRL 3FCSA 1DBKH 3IFOA 1NEUA 1PD3A 4FQXA 2ZUWA 3WLWD 2GJ6E 2A3TA 3II2A 2O6PA 1WS8A 4HD9A 4TQDA 4LSUL 5J6GB 2WBJA 2X4OA 3ES6A 4WI8A 3A4FA 3UAJA 2YQBA 1KXHA 4PBXA 3VJ6B 3BIKB 2OCJA 4OFYD 3EJQA 3UYRH 3CB2A 1WEJL 3Q8FA 4MB5A 5L3DA 3ECWA 4QRUB 1QSED 3G4SV 2ED6A 2VXQH 4BXVA 2Q0AA 4S1DD 5HDOA 3TF4A 4HIJB 3S8WA 1YN6A 3FQUA 5I28A 3U7WH 1F3DH 1LVEA 1KENL 1S5JA 2Y7LA 2ED7A 3CD4A 4IRSB 4TNWF 3PF2A 4Z7QB 5FEBA 5ICYA 3AK3A 1OCRC 1LHZA 2F58L 2UUBO 2XXGA 1EHLH 4YXHH 1IGTA 3DYMA 1V55C 2AJXH 1KCWA 4B9CA 3T0DA 4XNYL 4DR6B 3H1IH 3MBEC 3QS2A 5EC2B 4KL1A 2YXWA 3VW3H 1G8MA 4E41E 2Q9LA 1GGYA 4KNUA 3KZ8A 3Q6FB 4JFPA 2CQVA 3F7YC 5E8PB 1EDHA 3TBCA 1NVPD 4WDIB 1JHTA 3MFFB 3IDUA 3MRCA 3B9KD 2N05A 4NXSA 5LBSH 3T0ED 3ZRSA 3GJEA 5GRJL 3E86A 4PJXA 4JI1O 1JN6B 2QSCL 5HI5C 1KQSU 3CHXA 3L4TA 4ZPTB 4Y9FA 1MCCA 2P5EB 4Q9QH 5KBPA 2C4FU 4AEHH 5T5NG 4ZMVA 5HVWA 1R5IB 2KQNA 3FN3A 2AK4E 1M71A 3MV9A 4NTYA 3WUWA 3WNNA 3RWIA 3VFNA 4EQ3A 1UEYA 3BRGC 4F15B 1M2VA 1V8HA 4M9OA 4EI5D 3H6AA 2UUDK 3IGAA 3MRNB 2VZ1A 4PJ7F 4OI7A 3GNML 5I76A 4FQCL 3HC0A 2WSDA 1CE6A 5JPNA 3B9KC 2GTWB 1N5AB 4U2ZA 3EO0A 2ATPA 5J2TA 5IQ7H 3LKRB 2NLJC 3GDCA 3E6FB 5LHGA 1SPDA 5LDUA 2LFSA 4FFVD 4WWPA 4RGMB 5KBMA 1KPUA 2BRRL 3H0TB 4QNPF 4TLUA 2K70A 3BP5B 4QGTA 1U3HA 4YX2H 1E90A 5IROD 1N3NB 4RBPH 1DF5A 1KYOK 4UTBA 2B4CL 1A4JB 3JAKB 2R0WH 4EEQA 3A47A 3O4LA 4HUVA 3GJFH 3HZ3A 1WVZA 2NZ1A 1J05A 3OW2U 2X7LA 3GSNH 3ZKND 4GT0A 4WEMB 5B39B 4LAQL 4QO1A 5LBGA 2X3BA 3NFSL 4F2ME 3RWDA 3D39D 3MBWB 4WI5A 4PSRA 2X3AA 2WIIA 3T0VA 3V0DA 3NABH 4LCUA 4WWKA 2FB4H 5BS0A 4DV6O 4Y2OB 4J3OH 4JLRA 4F9PA 2P3YA 2XQ0A 1A7RH 2IQAA 3TBBA 3P54A 5IROC 3E7JA 1JPSH 5AUMB 2XUMA 2FX9L 1F97A 3NPZB 4NB7A 2IWKA 5HYFA 2IFFH 4QHPA 1ECYA 1WN7A 1CR9H 3X12A 4OF6A 1R1BA 3IGLA 3PWUA 1FG2B 3R7RA 4IRZH 3QT2A 4Y19E 2V37A 3ZKNC 5CLWA 3QUHA 4XP1H 4R7CA 4KGLA 4N24A 4KMQA 1CDIA 1NFAA 4UIKL 3F58L 4OM0H 4H2AA 4X62O 3QO5A 2OCCB 1KJVA 1XQ8A 3WCYA 2EZOA 2P80A 1I9RL 4M6MH 3V7AG 3FF7A 4KK5D 3PGFL 2EDWA 4NKQB 4H0LB 4WHDA 1MJJB 2EABA 3IRCA 4QF1A 3O6LL 3WO3B 2VDNH 1D9KB 3SOTA 3FC8A 1THCA 2CRZA 2YFNA 1YEHL 3AG3B 2V0AA 3ARGD 5D1QD 1H3PL 2CR0A 4YZFF 1ZHNB 5AVQB 1RIUL 4CC4A 1NFIA 3VWKD 5EEXA 5EIBD 2UXCB 3KLHD 4KKPA 1CGVA 1S76D 1VADB 3GJFB 1CXHA 4O2CA 4PJHF 4U3XA 1AKJD 3D4ZA 1KTDB 3GSNB 4GRMA 2L6LA 2DTMH 3Q8AA 1JNHB 2ZXBA 1U8PA 1D2DA 3UTOA 2YN5A 4AYBA 1HJBC 1FH5H 4NQCD 5GONA 5BJTA 5DJ0A 3OR7C 4IT5A 5F7BA 1ZD6A 4OZIB 1DLFL 1GTNA 2J44A 3BKYL 5D1QC 3DX1A 4KUZL 4RGOH 4AT6B 4P9HH 2MNUA 3NACL 1OARH 2JFCA 3WB2A 3V9EA 5ETUB 4N8VG 1DSWA 2ZP9A 3U2JA 2L8AA 2Z4QA 5EU6D 4YHKH 4APXB 3X2QC 2J6EL 3KDPB 3VRJA 1RM1C 2VISA 4LP8A 1SXSA 5F96H 2A6IA 3CVHA 4HJ1A 1NUNB 2YOCA 1RZIB 2PR4L 1VQMV 4HDIA 2QV4A 4HT1H 1DANT 4XX5A 1OF0A 1IJ9A 2KYIA 4UMSA 1QX1A 4BIUA 4DP5X 3RFZC 2B9BA 3ZL2A 3RVUC 3RDTD 2BTOA 4MSWA 4M93B 2VDNB 4K5NA 4W1TA 2J1KA 4HKBA 4YBLC 4GSRA 2WVUA 1AIZA 4K3EL 2APWA 3T0XA 4DN4L 4XTRC 4MWFA 2YC1B 3BIAX 2VL5A 4BZ2H 2OA9A 3BX7C 4OCSL 4WJG3 2ZOLA 4UTBL 3OJDA 3RDJA 5LA6B 1UATA 3WNJA 4AVIA 4OQTH 1TQCC 1YNTF 2JJWA 2NUPA 4OFKA 1YA5A 4XGZB 3VFVB 5C0GB 3RDTC 3MOBL 1BL8A 2X5PA 4G1MB 2FTAA 2NX5D 1SHWA 3AITA 3ZDZB 3QZWA 2NY4D 1WTGT 3T09A 3LSQA 3SIKA 4W9GC 4M1CD 1VGEH 3H9SB 3UBFA 3HI1A 1KCUL 1NIEA 5DECA 3EIFA 1MCNA 4GIPD 4X4YA 5C0JB 2NNCA 4HLEA 3U79A 5LBVA 3IAQA 4O2AA 1U33A 3QH3A 2OYPA 1PY4A 1OCOC 1LTXA 2QQNH 1F4YL 5BPPA 1CBVH 4UB0L 3KEHA 4KRPD 3SEPA 5E9NA 2XX0A 4Z95L 3NZ8A 1O9WA 2ZXEB 1E4XH 3VQVA 2DI8A 1L9OA 4OD2B 1XGPB 2P5WD 1Q9LA 4DR4O 2DIEA 2NY4C 3JBG7 4KY2A 5GISL 1IBLO 2E76B 2P42B 2F9BT 5DRZB 3VB8A 4AKQA 1B0GB 2RQ8A 1ZX3A 1P53A 5D7LA 4MW8A 3C9NB 4Y4KD 4M1CC 2XWTB 3C60C 5CN2A 3EFDL 3LZQA 4QOKD 3UROR 3SQBB 5C0NC 3NJIA 1T66C 2PPCA 4NAQA 3QDJB 2C34A 1F4WH 1IBKB 3SKOA 4PJ0Z 5T5FL 3VXRE 4Y1TA 1G7IB 4Z7VF 4NKIL 4Z6AT 1JD7A 5FCUH 5IKCB 5HDBF 1JOIA 3EJYC 4DV1O 4KRPC 5E5MA 3SKMB 1NFDA 2Q3AA 4LNUA 1NMCB 2HTLD 1RP3B 1XCTB 1FAIH 1LP9B 4P0DA 4XCCH 4GG8B 1PD0A 4KRMB 4X6DA 4RFEA 1T03L 5B1OA 3G6EV 4HEME 3V6ZA 4Y4KC 3SE9H 5TF1L 1AY1L 1XIWA 3SJVB 5MEQB 2HPTA 1ZVSB 3APDA 4PG9B 4R6ZA 1FC2D 3LIUA 4M43L 4Z0XB 1CLCA 5IVXE 3A4DA 2OR8A 1PD6A 1S5LZ 3OKLB 5AOMA 3QXAB 1FGVH 4HJIA 3CK0H 4TQIA 1HKLH 4NRZB 3UZEC 2HR3A 5IW6A 1CYXA 4JYYA 5KZCB 2CLZA 3W39A 1Q0XL 3BAWA 3D69B 1TZHA 3RWEA 5KANG 1P84J 3SPIA 4UUJB 3FFCD 3CVHL 2OZNA 3D25B 2VXTH 1GC1H 2JQZA 1BPVA 2LW1A 1N64L 1GYCA 2ZAIA 3P9MA 4OW6A 2VLJE 4XH2A 1WT5A 5KA5A 2UZYA 1E5ZA 3RVWD 5JHMA 3PAYA 4NXKA 4PLJC 1CD8A 2OW6A 4M8QB 1WBYA 4KTGA 2DQHH 5DEGB 5LG1A 5E1AB 2CNZA 2IIJA 1ENVA 4WFHD 3GSRA 5C0CE 4AXWB 4ELKB 1NA8A 3DJ9A 4OUOA 3OVUB 3S5LA 1T20B 4QUOA 4EXKA 4F1SA 4IGBB 2FHCA 1H8OA 4HS6A 3KJ6L 1MOEA 1O9GA 2A83A 1AAJA 3QULA 3HZKB 5EDXA 5EF0A 5CEXA 1PU0A 4K9EH 5F70A 1A6ZA 3MNWA 1I8MA 5DD0L 1ZGLA 3NJFA 4PGEA 3B8NA 2FJHA 1JHKH 5D1ZI 4XPBL 4FLQA 4LKXA 2ZF9A 4DKDC 3PPSA 3PDOA 4IIQB 1OF2A 4L4VA 4J7ZA 1CEZA 4HJ0C 4GRLB 4KC3B 4UM9D 5TTRA 1GRWA 3KPNA 4ZUUB 3FU7A 1YMHB 2WSPA 3OE7G 1AHKA 1DLHB 1M7DB 2JF1A 4YDKL 5EUOA 4HOWA 5I1GL 1NQBA 2ILLA 1JPGB 3KYMA 1QACA 1NFKA 4PJIB 4ZO7A 1VQLV 2IAMB 1IDSA 3EH3B 4NWTH 3S48A 1OAUL 1SZXA 5FFOA 1A6VH 3JYCA 4MKMA 4BCYA 1YG9A 3N44F 4HZLA 3VXSA 4PY7B 4ZMWA 5L3CA 2Z65C 1AKPA 5EU7E 5D1ZA 4ZZKA 1ZTXL 2DQTH 2DWTA 1T6BX 1WF5A 2WXHA 1PNLA 1H2LA 3FQXB 5K9KA 2I9LA 3IXAA 2AW2A 2QWNB 3FAXA 1RUAL 3BEVB 4J3BA 3BLBA 3TO4B 4PVNA 1MRDL 4X80H 1Q43A 2PP7A 1FL3B 5IT9N 1MRFH 2J21A 5I23A 4V1DD 3G9AB 4YJZL 5D7IB 5DT1L 5HGDA 4IHJA 4NKDA 1IKFL 1IRAY 2ESVA 1T5EA 5INDB 3E80A 4K23H 4TTGA 3J8F7 1E4HA 1YEFL 3ISRA 4KKCC 4P5MA 1KCKA 2PPFA 5B1NA 2AV7A 3ARBA 3D05A 3NJJA 4QLWA 2YSTA 5EEZA 2IBGA 2EP6A 5LGHH 3W57A 4GMSH 2Z3YA 3I9AA 2J1ZA 2FX8L 2VLKB 2I60H 3T4ZA 4MXQD 1MFBH 2I85A 3GMNB 5GJSL 3UP6A 1SDDA 2YMXH 5DD3L 5L2KE 2UUCO 3PXHA 1JWUA 1XXFC 1AVMA 1ZLEA 2QPEB 1E28B 1T1ZB 1HDMB 4YSUA 4NUGL 1N2RA 1CXIA 1QQDA 1WBZB 2MKLC 1TZ8A 2XRAL 4G6MH 4M56A 5DK0A 5DMGC 1JDDA 1ZXQA 3PGDB 1DR9A 1E8ZA 3VVVA 1TG8A 1ZHKB 2WLYA 4YFDB 3ARXA 4FHKA 1WTLA 2CLRA 2BY2A 2AJSH 1F3JB 1RY7B 5HYJD 4RMRA 2JRIA 5DFAA 5IJVB 3QQ3B 5J89A 4W9JC 1E2VA 1JUFB 4MXQC 3TS8A 1FORH 2QWRB 2DOCA 3GHBH 3UACA 5JW4Q 4NQEE 5B3SC 3BY6A 5BZWA 6CGTA 1NQTA 1L0LH 3OM3B 1XSOA 2R56L 3KPLA 5D7JA 1KGCD 5DFVD 5AWNL 4CBPA 2J8UF 2VXVL 4JN2B 4NUJB 4JFFD 1ZLWH 1OSZA 1S0VA 2OP4H 5MEPB 4TV9B 3ULUC 3LEVL 4MLIA 5E2VL 3C5ZA 4BZ1H 5D71L 1NCJA 4H5SA 1G7HA 2DWEB 3FTUA 2WOYA 3V52H 4O4HB 5LQBH 3GSXB 3ROLB 4L3FA 2JLLA 1XMQO 5MP6H 4ATWA 2DTSA 3HBGA 5I1AA 5DMIL 5DZNA 4PMEA 1Q0YH 1PKQA 4L4TA 4M8VA 2F5BL 4OUUA 5F1NA 3IU4L 4XODA 4WU7B 2H8PA 5CA0A 2YFOA 1JF1A 4NQVA 4GW1B 5ITBL 2IGTA 3IM1A 2H1PL 2XFXA 3AT9A 1NCWH 1VF5C 2O26U 3CN3A 3FH8A 5H37G 3CXFA 5IHZA 2ITDA 3EOBA 3PFUA 3VG0H 3MTRA 2IJJA 2EYTA 5GRWA 1QLRB 3LEYH 1BG1A 2ZYSA 5JDJA 1LO4H 2YRPA 3I50L 4IK7A 4AKPA 3ELQA 4WIQA 3QEHA 4YHPB 1N36O 1PQZA 3WN5B 4HWZA 1YEEH 5AW4B 8CGTA 3W38A 5JXEA 3GSUA 1SOQA 3DO3A 1KV7A 2ADQB 4XMWA 3GSQA 4PJAA 1M42A 4YAQA 4IRSC 1LEGA 1CXZB 2Z0UA 4Z3GA 3U4BL 1BBJA 1FNLA 3EYUH 3DXAE 1S9YA 2W88A 4CJ1A 1RFYA 1KBKA 3AXLB 5F7KC 1XREA 1TZGL 4G8FB 4ODWA 5FO2A 5KHKA 4RESB 4KP4A 4GAAA 3O9OA 4NC0B 2X05A 5LGYA 4AH2A 1Q90D 3F5TA 5EC2C 2ZUXA 4QRBA 1FL6A 5EU3A 5LNGA 3O45A 4LIQE 1U58A 4LGSB 1E67A 1N0XL 2XN2A 2C1PA 3D50A 3QI9B 5DWPA 3HNSL 3PWJA 3F05A 3KDMB 1WP7A 4JFOB 1QU7A 2QGNA 2P52A 2Y07H 4K2UH 4GUQA 1GHFL 2HX8A 3GI9L 5I17B 3ZX1A 1WGOA 2WUBH 2ZOKA 3I3EA 4M48H 4LPTA 5IJ0B 5CO1A 3N1PC 2UZPA 5IVZA 2X1WL 1DEEB 5FECB 1DTUA 4HUMB 2PYEB 5JMRA 3PE9A 5EO0A 1NT2B 4LF3B 4MQ7A 3X3FL 3ZYJA 3JWNH 3BGFB 3LRMA 4F80A 4L29A 1IGMH 3O4LE 5E4AA 4AI7A 4F15C 4JDZB 2DQDH 3H9VA 5IMMA 4WTWA 1FZOB 3WXWH 4CN1A 3QJFB 1DJIA 1N19A 4LDOB 2P9RA 3C5JB 4GW4B 4U1JB 2UU9O 2NSQA 5BS0E 5D4HA 3KLDA 4WW1A 1PJ9A 1B90A 3W2DL 4KHPO 3UTTD 1HXYA 1TYEB 4B9PA 4RGMC 5DJCA 3F62A 2PUSA 4MA8H 2X4PA 1HX0A 1O7DC 5FA3B 4TVPD 3GBLA 1QLEL 3OMAB 1LM8V 5JIKA 2PW2B 1S7WA 3MRFB 4LSSH 2VWJA 5E2TL 4AUJA 2YPVA 3QYMA 4ZS6C 2ZKHL 4TLSA 3ZTNH 4FKKA 3BSHA 1BJMA 1HINL 1D6VL 1DN2A 3I9IA 1TAEA 3UBXI 3VI4E 1NBMG 1IFRA 4DKTA 4B9IA 2FYVA 3JV6A 2Y5QA 4HHWA 3UZVB 4UM8A 3DA0A 1JV5A 1DDTA 4URTB 5D2LF 4RWYL 5C09A 2YD6A 2VJXA 3S4SG 1XB3A 2P48B 3VSQA 4KI5F 3N85H 5EZOH 1M7XA 1KTRL 4F7MB 3DBSA 4P2CG 4WUUB 2G9HA 4MYPA 4GKSA 2NQ3A 1YDXA 1NGWB 2Z6FA 4Q4EA 4KJPC 1DQQA 3FF8A 3DX8B 4NM8L 2ZCKH 1MAML 2XVBA 5IEKA 3UBXA 2MK3A 3QUXB 6FABL 3C3TA 3L5WA 4YY3O 2OCCC 1FAFA 2F19L 2ZX5A 4JQVC 4Y5YB 5LXVA 5IYDO 1E4JA 3AG1B 4WI0A 2PLTA 3CDYA 4WV1A 4JI8O 2DDQL 3ULSA 1PAMA 5F97E 2VKWA 4H0LC 4N8VA 2KMWA 3OJ2C 4MXWH 1ROPA 4Y5XA 5JIHA 3D9AH 3FAVB 5LAXB 4A04A 5ESVB 3TN0D 1KB9J 4HCRH 2VR5A 4OI8A 5H2FZ 4JPWL 1D9KC 3TT3L 5HJBA 3FONA 5TH2B 4KJQD 3AG3C 1X9LA 5LGJA 2QKAA 1WFNA 1UWFA 4RAUB 1NCDL 4WGWB 1ROCA 3V0VB 4FI8A 4NO5B 5KYYA 1XEQA 2WLNA 3L3KB 4XXDA 5EF2A 4LPXA 3REVA 2R70A 1K9MW 4I0PA 5D96B 4WK2B 4XNXH 3PWPA 2OX5A 3L45A 3QJSB 5D1XD 1BMZA 3UBHA 3TPUB 4PG2A 2W60A 4R26H 1Z7JA 1ETZA 1N59A 1WNSA 1XF1A 3DURB 2A0LC 3W0WA 3DIDA 4J3OC 1G1CA 5A1AA 3DETC 3EJPA 2VGLM 1VKXB 1JRHL 5EYPB 4KJQC 4QRPE 4I0XB 4M7JH 3Q2WA 5F1OB 3VGAB 3BFWA 1PD1A 4TRPL 2Q8AL 1BMFG 4J9ZB 3L5IA 4B3TB 5TQ0L 4WKZA 4QAMB 3SDAD 1BYPA 5CB4B 2OMXB 1DBMH 3FTYA 4FMVA 4Y7MA 5BVPH 2A9MH 2XG4B 1NCBL 4NC1E 5AW0B 2VDPH 2FYUH 5DJZB 3V79C 3HG3A 5IWAO 3P3TA 3KCYA 1GJWA 3AG4B 2CBQA 3LXAA 1EUTA 2BRQA 4D9QD 2MQGA 4ADJA 3BFRA 1MHEB 2CPCA 4U7SA 5IB3A 3WY1A 3EO9H 1OM3L 1XBRA 1H6EA 4M93C 1S5HB 4LU5H 1O9HA 2CXKA 1BFTA 4J42A 3KD4A 5JHLA 2QPSA 2VR6A 3LUTB 3FRUB 4WBNA 4PRHB 1J5CA 5ADOL 3HNVL 2JGDB 5HHPB 4YDJA 3P40A 2GPZA 3DYOA 3OL2A 3WJLA 4AYID 2K9UA 4MDRA 3EOTL 2YXHA 1M93A 1ZTXE 1G43A 5EEVA 1NOFA 3ESVF 4D8PA 1UA6H 4ECNA 3GS4A 1L0NH 5DVMA 2BNQB 1XNRO 4R9HA 4G72B 1HR0O 4QY8A 2ZF8A 2YPVL 3CSYA 1E9PA 1S4IA 1X5JA 3QEGL 4YXKH 3SKJH 3GMPA 3LDBB 4FYQA 2ZZUT 4HJJH 1BWMA 2XTAA 3OUSA 4U3JA 4P9HC 4DV2O 3TU6A 5E08H 1ETA1 1Z9MA 1W0WB 3IFNL 1Z2GA 1QVGU 3L48A 2KLSA 5L3BA 4P3DB 3IDIB 2IPKB 1WV7T 5D6CB 3NH7H 4A6YA 3TBYB 5KANI 3E8VA 2VDPB 3QDJD 4OVUA 2YJLA 1FNHA 2NY6B 4KPHH 4L8SA 4DV7B 4LEOB 3BSZH 3OTOO 1NFDE 1AI4A 1WPCA 2H6OA 3A24A 2LFRA 1AZUA 4E5XA 1X7TA 1WD9A 4GAFB 4JKPH 1HCVA 5EC1A 3CZSA 1KCBA 2KT6A 4GQ9H 1JZDC 5FUZL 1H9VA 2J20A 2MCMA 3RLSA 3N1GC 4X6DE 4I2XE 1HP8A 3B7TA 3AK2A 4AC2A 2I24N 3CSTA 4PJ5B 2E76C 2GJPA 3IWUA 4NLAA 3D2UB 5BQ7A 4HUUA 1S6NA 3V5KB 4O51A 4N9GB 2F8OA 4NPKA 5DZOA 3BVTA 4PB9L 4FXGA 4NQDB 4JI3O 4YHOL 5D4QA 3T5WA 3A67H 1HWYA 2G5RA 4N6QA 4I3SH 4XBGB 5DURB 4DUYO 1DL7L 1EJOL 5I8EB 1JZHA 4GLRH 1U2CA 2AERT 4HBNA 5FNVB 1KLGA 3WDHA 2LO1A 2L4OA 1NMCC 5AFAA 1PS3A 1CYWA 1AGDB 3PP3H 4G6AD 3BKCH 4GINA 3WIHA 2JQAA 2LLNA 4RO2A 4F7EA 3E2EA 1P4BH 2P26A 4FE9A 4FJYA 2BCKB 5DUBA 3X1FA 4O2BA 3L1EA 3FN0H 1C5DA 1YEGL 3HKDA 4MAYA 3B9VA 2EO1A 1UOLA 3K71B 1ZUQA 1QVOA 4MNHB 1M1XB 2QMJA 1AQ8A 1INQA 1R3HB 4Y4FB 3VFSA 1L6PA 5HI3D 3L13A 3Q9PA 3CCHB 3K79A 3SPJA 3L9EA 1Q82W 5L8KB 5C0FA 3DOIA 3QDGB 3QCTH 3WI9A 4CW1B 3EW3B 4BFNA 2MOQA 3RGVB 1IX2A 4G6AC 3HRZB 4JRXD 4DP9X 2IO5A 1NOAA 2WKGA 5E9DA 4U33A 4PMFA 4D7SA 3T1YB 4UUJC 1JTTA 4PV8B 3DC6A 3UTPD 4ODSL 5J1AA 4HWEH 3CHQA 4PDRA 3RAJL 4ELMA 2XOTA 5JLZA 4GBXB 2Q7YA 5HI3C 2BNUB 3ULVH 1U97A 1P2CB 4WW2F 1N0JA 5DRXA 5GJTL 3O3EB 1VQ8V 1VCBC 5E1AC 1TIUA 1C5CL 1XH0A 4DGIH 3QRGH 4FGMA 4JHWL 5JHLL 2GBTA 3FB8A 4R8WL 4ABVA 1NH2B 3IXTB 3TH3T 2HHHO 3TYGH 4DR7O 1PY0A 3OKKA 1RZFH 4M7LL 1FFNB 1WZ1H 2A06H 3KE0A 3L7EB 3PHOB 2NMSA 3PGCA 4IGBC 4KRNA 4X88A 2DJVA 3ZMUA 3SQOL 1JK8A 4NBYB 2VM3A 4HS3B 3JALA 1UB6B 2GK2A 4G71B 4XO5A 4Z3IA 1AE6L 3X3GH 5SWQA 1G6RH 3ZKQD 4KKLC 5HHXL 2BMKA 2VS0A 4O2EA 4P5KA 1BSMA 1DQML 4WSKA 2ZDIC 5EEUA 4NNYA 4J28A 4LRNL 4IIQC 2R27A 3FBKA 4N2BA 5B4MD 4KY1L 1TQBB 4GRLC 2X4TB 5CJBA 3ZHSA 3V0IA 1JMXA 2G3ZA 4DV5O 1OZUA 2IGFL 4JZNB 1REIA 2D7TH 2I07A 2C3HA 2RNBA 3PAZA 4H40A 2WWNA 1NBZB 2ESVE 4LPUA 5JW5A 2IAMC 1D7BA 4BSJA 5F0MB 4N86A 4NKOB 4L8DB 3ZK0A 3MLSL 1NC4D 2B20A 4FF9A 5JXAH 2AFNA 4A6YL 4X5QA 3GKZA 1GC1C 5L6YL 1IGJA 3RURA 1LK3H 5EBMA 1QFOA 3K6OA 2VLKD 4BHUI 4ZK8A 1IQDA 5FO7A 1FYTA 3MRDB 3DWTA 2VM9A 3TO4C 4JQIA 2XAQA 2ZXAA 4M6AA 5IQLA 4JS7A 3RVXD 1FLRH 2XWCA 4XN1A 4LCCA 4KROB 3TJTA 3IJ7A 2WNGA 1PM9A 2TRHA 5KX5B 4QKTA 2DBLH 3KG2A 4G2AA 2W9DL 3DVGB 2X70A 4TQEL 4UBDC 4RAVA 2A4CA 2VWEE 4BAYA 4JG0H 5A16A 5GRUH 1AFVH 3AAZA 4B9YA 1BMWA 3B1UA 4ZTPL 3EDEA 3D0VA 3KH3A 1KYUA 2DH3A 1NKGA 2PXYA 4FLZA 1HQ4A 2J73A 2YMTA 4K9EC 5CEYA 1JZ2A 2ICWJ 4BHUA 5ITZA 1MJUL 3A23A 3FQNB 4ES8A 32C2A 1GZQA 2X4RA 2R2BB 3M7FB 5I9QB 3RVXC 4ODHL 5F1SA 1ZLWK 3RYIB 2G30A 1PNKA 1HE7A 2R9HC 4JZGA 4FFZH 4E41D 5I1IL 2MJWA 3L4CA 3MRJA 4NKMB 2BVPB 1MF2L 2VDRL 1UM5L 3F6JA 3IFLH 3CC4V 3ATBA 3EF7A 4BZYA 1JJUA 1SVBA 2WVVA 5I1EH 3U7YH 2YEZA 4JY5L 5JIPA 4U3SA 3GHPA 4EB6B 3QIUB 3OKNA 5H37A 3EOAA 1PIFA 2F1BA 3LOWA 5GS1B 3ZGIA 2D73A 3TCUA 3KPMA 1YC8A 4NJ9L 2ZD9A 3LSUA 4P30A 3BLKA 3H56A 2AK4D 3L5JA 4Y16B 1JNLL 5B21A 1KYFA 2ZWZA 1YZBA 1DUYB 4XP5H 2VH5H 3NCXA 4AQ8C 3MA7A 3KAAA 2J3SA 5KVFE 3UGXA 4NWUL 3K1DA 4EUPG 2X53A 1AS8A 3O2DH 1DFXA 2X28A 2DWEC 1GOHA 1OE2A 3H1HH 4FN0A 4PQXA 4BFGA 3K5RA 1IM3B 1N7ML 5DHVA 3HG1B 3KBHE 2Y5TB 5KSUA 4F27A 3DSFH 4PJAE 3ZEDA 5H94B 1S7UA 1V7NL 3V0EA 4Y5VC 4UV9A 5FM8A 1A2YB 3MV8A 2NYYD 3QORD 4WWOA 4PS4H 4BFRA 5B3NA 5JOEA 3CDZA 4NVPA 2CA3A 1CU4H 2V4LA 4KTEH 1K97A 2OLDA 4HIEA 3K2MC 4QLRA 2JJSA 2EIMB 4LF8B 3WS6A 3FQTA 4TNEA 4FTVA 2B59B 1P5VA 3O8XD 1KY7A 1Z9NA 5DJAB 4UT6H 3WFZA 4AEFA 3FQ4A 1FNAA 3WN5C 5AYUL 1NDTA 2H3KA 2VQEB 1CGSL 4YNYB 5FK9A 2ODMA 1R3IH 5TPWL 4ONFH 5F9OH 3FX7A 3NJGA 4HOMA 3FSVA 3TVMA 4LMQE 1INDL 1ZHLA 2NYYC 4U1MB 4GKKO 3BA9A 1XOUA 3PIQA 3TPKA 1XEDA 4Y19D 1AIFA 2UXVA 3AREB 2DAVA 4XI5C 5TE4L 4JF3A 1E2WA 1QYGL 5IHLB 1NC2B 3IGFA 3ZTEA 2ZINA 5JHDB 3TLRA 1HHGA 4K7PH 4YLBA 3DPBB 2ZM6O 2LOEA 1N33B 3IDJA 1PZDA 1UCBL 4PA4A 4IBVA 4HK0B 3H9HA 3QI9C 1LQBC 3B3IB 2E86A 1U2HA 3UJIL 3HZMA 1C08A 2Q5ZA 2UZIL 3CMOH 1UZ8B 4JQIL 8FABB 4PJHB 5D9SB 1AGBA 2CBTA 4K3GA 4HBCL 4LOUC 1ZXKA 5BZZA 3BUTA 3CFEB 4IM8A 5HPMB 2O5XH 1BQRA 4M03A 2QQQA 2OYKA 1CK0L 4G7VL 4P4KA 3I75A 4QYOB 2EUZA 1NICA 3V7AE 3BGFC 4UVBA 1DBJL 1XV8A 4YHZL 4FIPC 2HJKB 3P2DA 3QDME 2IADA 3O3BA 1KXQA 4I0KA 1B4LA 3S4SA 3N41F 4HKJB 4ZZFA 4ENED 4B41A 1SMAA 4HU8A 1S9WB 2H6PB 2PW1B 2VLLB 3I2CL 5T1LD 3BT2H 3RB5A 4BKLA 5I5RA 4EN3B 3EFFB 5EO9B 2P8MA 3OGCA 1AO7A 1VQ7V 1BJ1H 3TBWA 4N2AA 1QSFA 3FB7A 2HFFB 4BUQA 3QRBA 5CFAA 3ABUA 2GJJA 4U31A 2AXGB 5CR1A 3CFMA 5JQHC 2G3NA 5FW8A 1BD2E 1UQSA 1H9DA 4PTUA 4UI2A 1B0IA 1SVZA 4RISH 4WUUD 5K39B 3QO0A 2VW7A 5IVXF 5LP6B 2CJTA 3U4KA 4N0UA 3GIZH 3JCZA 4A67A 1PDKA 1U8QA 5DD1L 4FQ2L 4JI7O 3RQ3A 2E27H 5F1KC 3GD1C 1RJLB 4M7LT 4LVNB 3RWCB 1D5NA 1OVZA 4NP4H 3ARZA 4A2EA 2FBJL 3I02B 5BZDA 3ZMTA 3BFQG 3CQPA 3BCCH 2BOCA 4U4IA 1QI3A 4N0CC 4NKGB 3VWJB 4MD4A 4OGQB 5KYNA 2B0SH 3U2SB 2JEXA 4YL4A 5IYZA 3KYOB 3OAWA 4OZHA 3ZRWA 4TUOB 4UDTB 2UXDB 3VGEA 1ZT4B 1BIHA 2HJLA 2V9UA 3BN9D 1T5XA 3L6FB 4N25A 3R8QA 1G7QA 1YDPB 5ABZA 4PP1D 2IXQB 1T0NA 2CG9X 3CFCL 3L3JB 3ZQ9A 1O0VA 5D70H 5HD8D 3II1A 4XPGL 3JWNC 1H3GA 3FB6A 3BE1L 4GKNB 4LF9B 3KYNA 3ZU8A 3RW0A 5MENB 5F7EH 4YUEH 3QUXC 3PWPE 4FLVA 3K91A 1U3YA 3QG6A 5D72H 3MYJB 5HDLA 3P9LB 3FOMA 2FLRT 4Y5YC 3IT8D 2VB5A 3NK3A 2W07A 4OZ4A 3AG1C 3SODB 4LH7A 1I7RB 1YEIL 1U6AL 5HHMB 3TNMB 1PCXA 1Y0LA 3G6DL 3HG0A 5BUAA 3BN9C 1D5IH 1W72A 1AJ7L 3OTTA 4W6XB 5HTSA 4XVJH 1YEKL 4Q0XH 2CCWA 1VMGA 2W8CA 3HE7D 5TE6H 3T6QC 5HD8C 3MA9L 4MVBC 5E8NB 5E94A 5IFJA 3M99B 2H2SC 3AGVA 4S2SA 2J5LB 1AZNA 1AR1B 1CLZH 1K2DB 1U3NA 1XF3B 4MTFA 1MFDL 1T5WA 2R9AA 2XACC 3GS7A 2RB8A 1GCYA 5D96C 4BA8A 1TT6A 5ADPH 5M94B 3HB3D 3WIIH 1Y76B 1XF5B 1IKOP 3SGIA 1WBXA 1U96A 5I16A 1JPEA 4WFGE 4Q4IA 1S9KC 1RZJL 5HP5A 2MTAA 2MHAB 4N8CH 4LC1A 2I7OA 5EZLB 4G7SB 4S0HA 4IK6A 4LPVA 4LVEA 4LARL 3STLA 4WFFD 3OSKA 3TEWA 5HDBB 3VTAA 1M53A 1A7PL 2PPEA 1P5UA 1QKZL 3NRQA 4XPFL 1KBWA 3S35H 4C56A 3HI6H 3VGAC 3MNVB 3IYLW 4NM4L 2QJ1A 3Q8EA 1DE4B 4ZAKB 4ZTOL 1UD6A 3TCLB 3T1CA 3GBNH 4CC6A 2AV1A 1C1EL 3L3DB 1KB5A 1BZ7A 2AEQH 3MLVL 3U83A 3GB7A 3IKCB 1QPPA 1NJ9A 4Z0BL 4JR9H 1SXNA 4P23A 1KXVA 2ZKXA 1M90W 3E6HA 1VZIA 4LCWE 3QO7A 3AG4C 3NTCL 5DJDA 1L5GA 4JI0B 4KH2A 2W0PA 2F66C 4GAGL 4F2EA 5TFSH 3PPEA 4EAEA 1HZLA 5EZJB 4P46B 1JPTH 3VOUA 2VZOA 4MA7H 3WL9A 1BGXH 3MLRL 1S5HC 5CD5D 5FHAL 3DJRA 2DN7A 5FM5M 5JYLA 1IC4H 2XHBA 3UJJL 4X64B 4JVUA 1Q1JH 1NDGA 4QHNA 1E9OB 1ORQB 4M5YL 1AI1H 2FSEB 1VF6C 5BR8O 3OKMB 4ZPVA 3T4AB 4OV5B 1UM6H 4OZFG 1CD1B 1XVSA 2QGDA 3RZCB 1Z2KA 3E35A 5E5RB 1ITCA 3QF7A 2WTRB 3PAUA 4PJGB 3V6BR 2N0MA 3QIWB 1JXFA 4DR1O 4L3EA 1G84A 1JPFB 1GS6X 4XPHH 3MLWH 4HX1B 2H5UA 1DVQA 3CCJV 3LX9A 3OZ9L 4D0BB 3HS8A 3E3QE 1HHJB 3LDBC 3SY0A 2QMKA 5CD5C 2BWQA 4R7DA 4ACTA 5IB2A 4XNMA 4Z3JA 1QVFU 2OV0A 5DRWA 2OMWA 2VDQL 3D2UD 5KYWB 4R4BB 4MNGA 3GMLA 4KTDL 5KBNC 1DK1A 2XKNB 2Y3AA 3BUYB 3OKOB 4PRAA 3G6JE 2EIZA 1XB8A 1A4KA 1XEUA 3K2UH 4IHOA 3QDHA 3S88H 3OC5A 4CSTA 1KBBA 2E3VA 2FT8A 2R0LL 1UJ3A 2CAKA 4LFCO 3CD6V 1J1PH 3BVNA 2NY6C 2EIJB 1XZ0A 4X5XB 3JV4B 2C7UA 1JF6A 4Z7NE 2D3VA 3WU1A 4HQQL 5ABAA 1F90L 3D3VA 4AQ1A 3LXBA 4JGJA 4BK5C 4P9MH 2KUTA 4NOFA 5CHNB 5KSAD 1VGKB 1AD9A 7FABL 4MVRA 5I6XB 4IYIA 1H3TA 1GGIH 4OT1L 2ZXCA 3CCEV 1HNXO 1DUZB 4LSPH 5AZ2L 1VFMA 4FQHA 5GS0H 3WKML 1W72L 1JVOA 2V2WA 4TSBL 1RUKH 2ENQA 3BRFA 2F0CA 4DEWA 4Y4FD 2ARJA 5AZEL 1ETB1 2WJ7A 3HBPA 3B7UX 4FXKB 1UM4H 3QHZL 1FGNH 1GZPB 1XMWA 4JHAH 4TNVF 4B3RB 5JJEB 4FRWA 3ZE0B 2WWMD 5F6IB 1D5BB 4F6EA 1KGIA 1XSJA 1VACB 1J9RA 4N0FB 2QE7G 1R6VA 2X9WA 4XAWH 4D3CL 5KSAC 2Y7NA 5ANMB 1V3JA 2QPDB 3CC1A 3IVKA 3RTLA 5I1LA 3STBA 5IESL 4ELME 2HWZH 1H2NA 3VXMA 3P69A 1SA0B 4ODBD 2AHZA 3CNKA 2EECA 5E99L 1U8NA 4Y4FC 4UU9B 4GBXD 3N43B 3HLAA 4M1GH 3ZMSA 2UY7A 2WVTA 1E79G 1UXSB 3ML8A 2PUQT 2EDMA 2ODIA 1R3KB 3WKNA 1PZCA 4ERSH 1WA8A 1C5BL 2OTWB 3G5YB 3V9CA 15C8L 3LKPA 4PJFB 1TQTA 4FJZA 3RGVC 1VARA 1GGBH 3HRZC 1KB5L 4Z7UE 2ZG2A 2EH8H 4NTWA 4G5ZH 4F33A 3M88A 4J41A 5BVJA 1AXTH 2ZYIA 3ZQWA 2BSED 3Q3GB 3DBXA 3ZUCA 1JR9A 3D06A 4OPAA 5ACZA 4C54A 5J9PB 4JI4B 3WEMA 2LP7A 3JASA 4K35A 3A6BL 2CWRA 3I6LE 4GBXC 2OSYA 4RNRB 2CE6A 1KBGH 1KB3A 3O9WB 4DIXA 3T8VA 1KTLB 1OLLA 3VFPB 4X1IB 3R06B 4N2EA 5GZND 5HBBA 3QNXB 4YR6B 4DR2B 5K93A 3F12B 4ZMAT 2J8UB 1JFFA 3CCMV 3HN3A 3SDCA 3AWFA 1MNGA 3O41B 4BJLA 1BVLB 4U7KA 3RY6A 2H3NA 4R7NB 2OJZL 2G0KA 1QATA 1GAFH 1Y7VA 4LLWA 3GBML 1GN3A 3MREB 4LLQA 2CDEB 4OB5L 3HOGA 4YO0A 5DHYA 3K4ZA 1TVHA 3BPCA 3FUDA 3NA4A 3X13A 2ICES 1H2SB 2YD3A 2DEWX 4HCIA 3ENEA 2SEBB 1MHCA 3OUFA 2PO6A 1WAAA 2B14A 4LFAB 4EF3A 4NDMA 1BVZA 1J1XL 1CS6A 1TQBC 2BIOA 4PWGA 5GZNC 5DMJB 3ULVD 4OVVA 3R1GL 3CQQA 3VI4F 1XAKA 4K71B 1MG2C 3JAWA 1BX2A 2FATH 4L0PB 3STZA 1F6LL 1NMBL 2DYPA 2OXHA 3V4UL 2E7CA 1QLNA 4IL6Z 5AG2A 2E7HA 1LO0H 2F1AA 4HK3J 4M5TA 1P4IH 3UO1H 3O2WH 2UXXA 2DL2A 1VFAB 2FK9A 3N1FC 4JRYA 2XWJB 4X98A 2FBOJ 3TBVB 4LF5B 4TWKA 1CJYA 4OBSA 1DJGA 4LBEB 2IANE 1A6TA 5BUGA 3ZKXB 3RA7L 3ULVC 2IALB 2X0WA 1LNUB 4WGKA 3UTSB 4JG1L 4X7SH 1UOVA 3B4SA 4F6RB 4JHBA 1CICB 4UCOA 4KROC 1CXLA 1SOKA 2R1WB 2I69A 5JQGB 1I9EA 3HHSB 1RZ8A 2YEVB 3K74B 2PWGA 1C7SA 1BHAA 4JBSA 2Y6TE 1AZZC 2JKNA 4GUPA 2RBLA 3CZGA 4EIZC 4GUCA 1NTDA 2QVMA 2XJKA 2ADFH 3CJJA 3U36B 2Z91B 1XWVA 3QXDB 1KIPB 1UYWL 2DWDA 5E7BA 2Z34A 3CFJB 4EUPA 1S2EA 1RSYA 2HFGL 1OW0C 4B53A 3HZVB 2CO1A 1QFWI 1ZVHA 1ZEAH 1SNRA 3UL4A 5I9QC 3BAAA 2XASA 3ZRVA 4LR3A 1K8AW 5GHWH 1SMDA 2P43B 5I6PA 4LLVA 2A74B 3SHSA 4HU2A 1NMAH 4M4RB 2BVQB 2OM5A 5CCKL 4HIXH 1INEH 1OPGL 1EJ6A 3DVFA 4UTAA 1PZ2A 3OAYH 1N32B 1BFSA 2VLRA 2C2AA 2P24B 4RUFA 4JFTA 3ETDA 4MTMA 3QIUC 4IIJA 1NGXB 1RK0A 2JQMA 3CXDH 1MCSA 5HYSG 2ALAA 3SCMD 5HI4D 3D0AA 2BOBB 2CK0L 2XN1A 3BOVA 1DCEA 3CPLA 5GS1C 4LSQH 3BZ4A 1B04A 4XDJA 4RWUA 4D94A 2D3JA 5K69A 1AD0A 1N4XL 4IEFB 4F1ZA 2E6PA 2VXSH 2GJZB 5DVOA 2AI0H 4Y16C 2NNRA 2D2CB 1H5BB 3MRLB 2IDCA 4PRPD 1N0LB 2CGZA 4UZUA 2V5SA 4X6FB 3IJYB 5GGTA 4B6ZA 4DZ8B 4CZZA 3MACL 1OQXA 4I18B 1JGUH 2AGJH 4TPRL 4K94H 5I30H 2WXNA 2X88A 2QVTA 4M7ZB 3VQWA 3BAIA 5EOQL 1UVQB 5HI4C 1NGQL 2GDSA 4HNAB 1DANU 4LASL 4TS6A 4TV8B 2HKFH 3MLYL 2EDLA 1B9ZA 1RUPL 1Q94B 3EH1A 3DARA 5C07D 4U6XA 5ERWA 2EZ0D 1YMMB 2A7WA 4HSCX 3M1OA 5IHUH 4ZHQB 1F3DJ 4JAMA 1J0ZA 1ACYH 2PABA 4IDJL 5HJGA 5IB4B 4N2MA 4P5TA 2BP8A 4ADGA 4JI5B 1I9JL 5LNDA 4J12A 2DYSB 3CRQA 1XR9A 2ADJA 2QBWA 1T3FA 3P0YH 4LCYB 2EIMC 4G7RB 2YIDA 1G9NL 5CJQL 2VE6B 2FLBT 3IJ4A 5F3BA 4OIBA 1FXVA 3GLDA 1NCOA 1I1AA 3KPQB 3KPSE 4UQCA 3ILPA 1IBMO 4JJHA 4QT5A 2NT0A 3M7OA 4RAHA 3BPZA 1W0VB 4KHTH 5GGRA 4QRSA 1SM3H 2R59A 3U9PH 2FIKB 3MROB 4LPCA 4YIOA 4HF5H 3FQYA 2BVYA 4X7EC 2N7SA 2UUAO 2HN7B 3AREC 2FUQA 3UJTL 3OX8A 3EYQC 4X1YA 2BCMA 2MFNA 3MRIB 5EB9A 3U82B 5FOJA 4RMSA 2PTVA 1ROWA 4CJ0A 5IFAH 1KXQE 2A99A 1IAMA 5DA0B 5CZVH 4FP8H 2V2TB 1BSIA 3N27A 4S10A 3RJOA 3VI3A 2AQ1A 4LLYA 1BFVH 2JDIG 3SJQC 4L8CA 4LEBA 5F1IA 2VAAA 1MIMH 1NFDF 5DHMC 1XBLA 5F9JA 1CPUA 4YJ2B 4K9JA 3K06A 3FCBA 4PUBL 1AO7E 1V5JA 4X6DF 1QSFE 4NRXB 1FV1B 4QCIB 1L0XA 5GIRA 4AL8H 3NRPA 4MVMA 4N2DA 2BIPA 2XVGA 4EBQL 3OMZA 5CCHE 3K46A 3VSTA 5B7MA 3MUJA 2DM7A 3IGUA 4W6WB 1ZSHA 4J6IA 4FI7A 3RPIA 4GS7B 4TOIA 1CBJA 1FIGL 2D0FA 2MEJB 3VH8B 4JI2B 2D9QB 4BFEA 4MX7A 4JFYA 4YSTA 1DCLA 2CCVA 3IDYB 4MHHG 4OF3A 2P1YA 5LHIA 4EN3C 3RYFA 3HMWL 2AW9A 1J5DA 4HAKA 4YEEA 2WO3B 2AEWA 3GIVB 1I85C 1R3IC 3MUGB 5KW9H 2WXQA 2FNWA 3VWJD 2IV9A 4UTAL 5IBTH 4N85A 2KZ1B 4HPYH 3ZTJG 4AIOA 1U0QA 5E8EB 1DBAL 4FQIH 5LP6C 4J3TA 1F23A 5HSFA 1H15B 3N9GH 1QFWL 1WISA 4UVCA 3L3OB 1OAYL 3QA3A 3U0WH 4LVNC 4PW4A 3HC3L 1FDLL 5HHOD 2Q87A 1EZUA 3PNRB 4P2RB 5GGTL 4PLOB 1I4FA 4QHUB 3VWJC 5T33L 4J23A 4OGQC 4TULH 43CAA 1A6UL 2VDLH 1ASQA 5HHMD 5EEYA 2G75B 3UBGA 5TD4A 3UCQA 3MAWA 2Q6WA 4U3CA 4AM0Q 5BXFB 1HZHL 4NT6B 1ID2A 3BXNA 2EDJA 3GYRA 4U0RB 1AR5A 1RIHL 4BRJA 3FHEA 2EEBA 5K1PA 4LGRB 5AEAA 2P8PA 4IBTA 4QKXB 5SWSB 4JPIB 1F0LA 3P4LA 3DMMA 4DPAX 5JHBA 2YPKA 3ZUNC 5JVDA 4BIZA 5LHHA 4KHXL 3A6CL 3G80A 1CB4A 2A3QA 3L9DA 1QRNB 3AZUA 3GM0A 3OSVA 4UV7L 1WCQA 3TZVA 4F8LA 1FC1A 3EGXB 4Z3HA 2ZAGA 3J7AU 3BAEH 1UG9A 2Y0IA 1AXSB 2P46B 2BNRD 4DV0O 2Z3FA 2WAHA 5BRZB 3TETA 5A2JH 3E8FA 4FNUA 1ZLSH 2JKLA 5DC4B 1T0MA 2WB1A 4APQB 1RUML 4LSTH 4C56E 3CCUV 4OCYL 2GBVA 3KPRD 5DK3A 3SGKC 5IHBA 3CXHK 2Y6SD 3F01A 2J5LC 2E6JA 1AR1C 3J27A 4RSYA 5FYKD 2HVKB 4PWHA 1GPOH 3MOAH 5CP3A 2J72A 5AOKA 1XILA 5LHDA 2WJ5A 4ISVA 4UZSA 3UTZB 4Y2DD 4QHMA 3LNGA 1Q81W 4PJ8D 5FOBA 1SYVA 2AXHA 1KPRB 4W4OA 2JI2A 4WO0A 1Z9SA 3GINA 4A2FA 3KGTA 4LSVL 2Z7WA 5I1CL 1GKFA 1LNQA 2K0RA 4P49A 4QDGA 1MCQA 2NXYB 2C9XA 2VDLB 1AGCA 2YIBD 4JY4B 4U7OA 1P6FA 4OZFA 3G71V 3CH8A 4JY6B 2DLTA 1F51A 1BLIA 2WO4A 4DW2H 3QFJD 4HPHA 5EO1A 3QNYB 3ZIMA 1FE8H 1G0YR 5GZOA 3QCVL 3CEIA 4NR1A 4MAUH 5D4JA 5EN2B 2V2XA 4FG4A 4FZEH 5LXGH 2QTSA 5I8KL