2EIMB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eimB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eimB02
1PNCA 3ASOB 2BW5A 2YAOA 2YQBA 3NSCA 2IAAC 5AKRA 3SBPA 3X1BA 2HX9A 3X2QB 4JKNA 3DKHA 3FU7A 2VN3A 4DPAX 5I5IA 1AR1B 4DPCX 2YXVA 2WSDA 3EHBB 1BQKA 2HRHA 2X88A 3JT2A 1OF0A 1UATA 3FU8A 3RYMA 1X9RA 1AZBA 1ET7A 5B7MA 1IBYA 3QPKA 5E9NA 3OD3A 3CVCA 4P5SA 1N70A 4KO7A 9PCYA 2UX6A 5I5JA 4DP0X 5AZUA 2YAMA 2BWDA 3FU7B 2VM3A 1SFDA 3L45A 1JZFA 1AG0A 2EIJB 1NWPA 2XV3A 3MX0B 2XVBA 1W6LA 4MFHA 4E9RA 3OQRA 4GP4B 5LDUA 2IWEA 3EF4A 3NSYA 2A3TA 2UXTA 1TKWA 8PAZA 1AOZA 3NT0A 3KW8A 3QQXA 3NP4A 2UXGA 3UAAA 2JXMA 3AG3B 2I85A 1R1CA 3NJLA 4AI7A 5I6NA 3ZX1A 4E9WA 1OE1A 1ASOA 1I53A 2I7SA 2R7EA 2BO0A 3H4FA 3ZBMA 5B1JA 2ZONA 2BZ7A 4KO6A 1AS7A 1A4BA 4W1TA 1MZYA 3ZDWA 3NSDA 1BYPA 4G70B 1CYXA 1ZPUA 1URIA 1A4AA 4RH4A 3AG4B 4A2FA 1BXUA 3TBCA 2YEVB 3FT0A 3ZIYA 2CJ3A 3ABGA 3NJKA 1HAWA 2MTAA 3FQ1A 2IDSA 3PAVA 1XB3A 2DWTA 1AAJA 1A65A 4TXVB 1DZ0A 1OCOB 3FYEB 4KO5A 2FQEA 2LLNA 1NPJA 2VM4A 4HCIA 4E9XA 1JVOA 1FA4A 2X87A 2H47C 4KOCA 2TSBA 3IN0A 2GHZA 3ABKB 1IUZA 3S8GB 1BEXA 1JXGA 2W88A 2HRGA 2CUAA 2XXGA 1AIZA 3CZUB 3FSAA 4N8UA 3UABA 2EIMB 5B1BB 1PLBA 3D12B 4KNUA 1DYZA 1XB8A 1ID2A 4BDVB 4YSCA 3T6VA 2VSKB 2YAEA 2HZHA 3FQ2A 2UX7A 3PCYA 4YL4A 2J57A 4YSEA 2QPEB 4F7KA 1ASQA 3V9CA 2IWKA 1L9QA 3NJJA 2YAPA 1OE2A 2ZOOA 4UF7C 4WKXA 3WKPA 2IDFA 3X1FA 3IBOA 1OCCB 1WS8A 4L0PB 3WNIA 4FA7B 3PLYA 1QLEB 2QT6A 2RACA 1ZV2A 1RKRA 2YAFA 1MG3C 3IN2A 5I6KA 3T71A 1ILUA 2DV6A 2XV2A 5B1AB 4BWTA 4EF3A 5B7EA 2J5WA 1EZLA 2HX8A 1OOWA 1AZNA 3CVBA 3N2JA 1JXDA 2VMJA 3HEIB 3V9EA 3FPYA 2EINB 3AZUA 4NB7A 1KBWA 6PAZA 2UXFA 1YLBB 2IDQA 1V54B 3TBBA 3TASA 1SFHA 2CCWA 1AZCA 4E9QA 3IEAA 4BWWA 1AZUA 4W9ZA 2H3XC 1V10A 3QJVB 1ZIAA 1J9RA 1E5ZA 2TSAA 2FT7A 4HAKA 1SF5A 3WIAA 4Q89A 1J9QA 4A2EA 3WI9A 1GS6X 2IDTA 1AQ8A 1TU2A 3AG1B 1AANA 3JTBA 5AFAA 3GYRA 2UXVA 2AVFA 3UGEA 4KNTA 1X9UA 3CDZA 3WNJA 4GXFA 2AANA 2ZWNA 1WS7A 1ZIBA 4KO9A 2GBAA 3TA4D 3S3BB 2JFCA 1J9TA 5I26A 2IWFA 1KV7A 2AZAA 4E9YA 4DP8X 4GP8B 3DIVA 4DP5X 4UANA 2YARA 1BQRA 3FSVA 3CDZB 5B3SB 3NSFA 2CAKA 4G7QB 2GSMB 5FC9A 2BWIA 1NTDA 3DTUB 2XV0A 3GDCA 2XWZA 2DY2A 2FNWA 1XMEB 3AW5A 2IH9A 1IKOP 2DWSA 2CALA 1HFUA 2FT6A 1A4CA 4YVUA 5I5MA 1CC3A 1AACA 2YAQA 4A68A 3BQVA 2BHFA 2GB2A 4HCGA 1ET8A 4YSTA 5D4HA 1QNIA 4M4RB 3CVDA 1JXFA 1PLAA 2PP9A 4G72B 4BXVA 1XB6A 1FWXA 4A67A 2P80A 1TEFA 2PP7A 3NJFA 2B08A 3NP3A 5F7BA 2YXWA 4K9JA 1AS8A 2W8CA 4BDVA 4KOBA 1L9RA 3NJGA 1RZPA 1NIBA 1JERA 1PCSA 2OV0A 1OCZB 1GS8A 1RZQA 4G7SB 4HIPA 4HALA 4P5RA 1IBZA 3PAUA 3BVDB 1L9SA 2VW4A 4X4KA 5IY5B 4YSOA 2XX1A 2XX0A 1GR7A 3X1GA 1E30A 4DPBX 4E9SA 5I28A 5A7EA 2DYSB 4JHUA 5B1JC 1BAWA 2B3IA 4G7RB 1CUOA 1ETJA 1L9OA 1NIDA 1ET5A 2GC7C 2FJSA 1PAZA 1JVLA 1ILSA 3AY2A 2XUWA 1PZCA 2GI0A 3CG8A 3TU6A 4AKQA 2EILB 2DYRB 2BP0A 4DP9X 5F7AA 3OMAB 2VSMB 1GW0A 4N4YB 5TK2A 5ANHA 3FSZA 4DP2X 2J55A 1E5YA 2FQFA 2EIKB 1EHKB 1GSKA 1SDDA 4F2FA 1MZZA 1PZBA 3OMIB 2CBPA 3FQYA 3FSWA 5I6LA 1KDJA 3ERXA 1PMYA 1PLCA 1A8ZA 4HHGA 2BP0B 2J56A 4AKPA 1L9TA 1JOIA 2QDWA 3QJUB 4YSQA 3T6XA 1WA1X 1SJMA 4DP6X 1WA0X 4HCFA 7PCYA 4A2DA 3T9WA 3EH5B 3H4HA 1CYWA 4YSDA 1SDDB 2AZUA 2PCFA 1A3ZA 3QJQB 1GYCA 3OM3B 4YSRA 4CSPA 2IDUA 1M9WA 3S3CB 3SQRA 2Y1AA 3NJNA 1OE3A 1W6WA 2XXFA 4A66A 4QLWA 3S8FB 1V55B 1WAEA 4A2HA 3UAEA 4F2EA 4DP1X 1ZDQA 3FS9A 1TEGA 1B3IA 1PZAA 4M3HA 1MG2C 1AS6A 1JZGA 3SBQA 4YSAA 5EHFA 3T6ZA 3H56A 2P80D 1JZEA 2Q9OA 4CSZA 4NAJA 3EH4B 4A2GA 1J9SA 2PPDA 3MBWB 4G71B 2JKWA 3WKQA 1OV8A 3X1EA 2OJ1A 1WA2X 1GS7A 1OCRB 2Y69B 2MRYA 2YAHA 4BK5C 4E9TA 2WO3B 3IE9A 4AKOA 1SHWA 5I6PA 1PNDA 2PPCA 3U25A 2BZCA 4DP7X 1T5KA 4ZK8A 1GY2A 2HXAA 1CURA 1KCBA 1NIEA 2IH8A 1W8EA 1ADWA 1NICA 3NJHA 1JZHA 2BW4A 2FT8A 1MDAA 1F56A 1SNRA 5I6OA 3OMNB 3NYKA 1VLXA 1SF3A 2Q5BA 1E65A 2HLEB 2PCYA 4UAHA 3S3DB 1NPNA 4HHWA 3UADA 3EH3B 4YSSA 1M57B 4QKTA 4PCYA 2WO2B 3PPSA 1JZJA 2XLLA 3GXUB 4E9VA 3WG7B 1KDIA 2I7OA 1NDTA 4DP4X 3G5WA 5TK4A 7PAZA 1AG6A 1BYOA 4YSPA 3QJRB 1SHXA 1RCYA 1IC0A 2PPFA 2R7EB 3AG2B 1JZIA 4YSUA 2BP8A 1QHQA 1BXAA 3KW7A 2N0MA 2FWLB 4NERA 1NIAA 3N55A 1L9PA 4WTQA 6PCYA 3ABLB 3C75A 2VW6A 2AFNA 2VW7A 4GY4A 2NRDA 3ASNB 4FAAB 3T6WA 2XYBA 1KGYE 1M56B 2FQDA 3PXLA 4GYBA 2PLTA 2XU9A 2BP8B 4HZ1A 3PAZA 2QDVA 2FQGA 4ENZA 4Q8BA 1N68A 2E86A 1KCWA 3ABMB 1KYAA 1J5DA 5B1KA 3NJIA 1BQ5A 4JHVA 5D4JA 1ZDSA 3HB3B 3UACA 2ZXWB 1NINA 4YVNA 5I6MA 1ASPA 5D4IA 3FPXA 4BXSV 1FFTB 4KNSA 1E67A 3X1NA 2GIMA 4AX3A 3SBRA 5B7FA 3FYIB 2PPAA 2PPEA 1GY1A 3QJTB 1NZRA 2H5UA 5PCYA 2OCCB 3QJSB 3NJMA 1AZRA 5PAZA 4PAZA 1J5CA 2GC4C 1NIFA 2HX7A 1PY0A 1HAUA 1PF3A 2PP8A 3FU9A 1NWOA 2FTAA 1BXVA 4AZUA 4BWUA 2QPDB 4GP5B 1KBVA
chains in the Genus database with same CATH superfamily
5I1DA 1KCSH 1RPKA 4AI8A 2XBDA 3X14A 5AKRA 5KVEH 3Q7JA 1FRGH 5E6ZA 4PG9B 1THZA 3CHOA 4AIZB 1UXWA 2DYPB 3VXRB 3OKYA 2V2TB 1XF5B 3F85A 2GAZB 1FG2B 4HS8L 3E22B 3KWTA 5HI3D 5EEVA 4KRLB 2EXSA 4MB3A 2ZKXA 3KG2A 3NAAL 3WU2Z 2EIBA 2Q1EA 2VM9A 5F7WC 5IJKC 2WSDA 1QABA 2XG4B 5DMIL 2E27H 3U83A 4B3EA 5FFGA 4RQFA 2YN5A 1DBKH 4U1JB 1JZ2A 4G5AA 5DEFA 3NJXA 1LJMA 3PWLA 5HI5C 1FVEA 3O41A 2EKJA 2A6KA 2KS0A 3VFUA 1G7HB 3KYOA 1P4BH 3K3WA 4PTUA 3V5DB 1PG7H 1ZLEA 5AW1B 3L45A 4RGMB 3Q6GL 1NGQL 3KLLA 4L8JA 3QZOA 2NR6A 3BH8A 4U6VL 3OHMB 2X4PA 4WW2B 1P69B 4J3SA 3LVTA 3CZJA 2VLRA 3FONA 4ZDHA 3T0AA 1XL4A 1QLFB 1KPRA 4HKJA 2IJKA 4KTDH 2FIKA 3GSWB 5M95B 2O26U 5GSRA 2K0RA 5L6YH 5DJYA 4JMNA 3UZQB 3I9GH 2JCCB 4U6HA 3VFPB 5DS1A 5TISZ 1K5NA 4DO6A 3D08A 3ZE2B 3FB6A 4JM4L 1ZEAL 3TYFB 2CKBB 1FL6A 2NTSP 2ADYA 4FQCL 4AM0Q 4Y4HB 2ZKOA 2JKIS 3SD2A 5DLML 2QTVA 3H4FA 4UCVA 1A6PA 4M7LL 4YL9A 1P9MA 4JI8B 3H2QA 5F6HJ 4X6DF 5MENB 1A4BA 5ESQA 4CH5A 1N2RA 2WWMD 2A74B 1BMFG 5GJSL 3RZCB 2VAJA 5K1NA 4Z7VB 4UT6A 4NN6B 1NC2B 2OBGA 3T1HB 5AW9B 4Y16C 4YXLL 3ATEA 2Y3NA 5D6CB 4LF4B 1U8CA 2CSPA 2V0AA 3SOBL 4XCEA 5AYTA 2QKIC 1K2DA 3E35A 3BN9C 3DV6A 5CILL 1EUUA 1M7DA 2K3TA 3MLSL 2A4CA 5C0BE 2F18A 3PJSK 2AJ3B 2P42B 3S5YA 2E76B 4XBGB 4X7FC 3RNQA 4KMLB 1IBHA 2F93B 1TITA 1HH9B 3BGFB 2XT1B 4Z77A 2A73B 3O45A 1ZLDA 1ZSHA 2C34A 1RZ8A 2BIMA 3OAZH 3U0TB 1R6KA 2JGUA 3H85A 4FPPA 4EPSA 4FFYL 1BDYA 2X12A 1FVDB 4CC6A 3PWNA 3MNZB 4YDVB 2L04A 1AIZA 1KB9J 2WNXA 3DETD 3QDGE 1GXEA 4GXVH 1CDGA 1E90A 1M71B 4JQVC 4YDMA 3N44F 3OLGA 3K58A 4YPGA 4HW6A 5JHLL 2X53A 2YAEA 3ZHSA 3FQ2A 2WCGA 3IM1A 1WAZA 4H8VA 2CKBL 5DJ0B 3RWDB 3PCYA 2KG7B 5EZLB 3VGGA 1HL5A 4WJ5A 2ZOWA 2D7TL 3ZL1A 4AYGA 1ASQA 3QDME 1G7LB 4N1CA 3KCYA 1X4YA 2ZT9C 3HE7A 4CAGA 4L3AA 2QJ1A 1OE2A 4OV5B 4JB9H 2ZOOA 4UF7C 5JIHA 5C08B 3L72H 1WWWX 4N2OA 3CCLV 2XOKG 4L0PB 2ZWLT 3VWKC 4YFDB 1XH0A 2VJXA 2R4RH 4AIZA 4MB4A 5B3JF 1KGJA 1PSKL 2EE0A 2V2TA 1XF5A 1B4JL 1JGVH 3ZRWB 3FCSA 5HVFB 3R8BB 3T71A 2YC1A 1S3RA 3VRIB 4QRSB 4H2CA 4XBPB 5C0GA 5DLMH 5IEKB 1C9SA 3N3EA 4UNUA 4MSWA 4O2FA 2VMJA 4LCUA 5FGBA 1FYJA 2IIJA 4PJ8C 5JPNC 2ZJSH 5J2TB 3GRWH 2CLVB 1QSFA 2YQ3A 2Q0OC 1QR4A 1WFMA 3IXTB 4JFFB 3WJJC 4WDIB 3U4KA 3KPSE 4YXLH 3V5DA 4QAMB 4JGMA 1XV8A 3TASA 5CFAA 3HHSB 3N2GA 1R47A 1WC7B 4CVZA 4W9ZA 1SHMA 1W2KT 4PA3A 43CAA 2NNFA 2FATH 2N7BA 2ZUQB 1UOVA 2BY2A 2NLJA 2P5EB 1K34A 2X41A 4JQIL 2YXHA 5H2FZ 3UERA 1KCRL 3QI9B 5HHQA 5L2KD 4YE4H 1R6NA 4IDLA 4UIKL 4AE0A 2CGOA 2P8MB 2VXUL 3II2A 1I8AA 4FFYH 4M7JL 3BUPA 4NUMA 1DQML 2JCCA 3DGGA 4ZFQA 4WFGA 3C5XA 4Y2DB 3UGEA 1IAKA 1I8UA 1LR1A 4JTDB 3WNJA 4MTOA 2AANA 5EU3A 1DN0B 1UVQA 4J8RB 3CBRA 2DWYA 1BHAA 3W0WA 3ZTCC 1KXQE 5KAFZ 4I18C 4IBYA 2NXZD 2JIZG 5MENA 3BT2H 1BF5A 3RX8A 5CJQH 2AZAA 1IGIH 5D7JB 2F7OA 2H94A 2R2BB 1IGML 3RZCA 2WYHA 2IU0A 1I7RA 1PX3A 1VZIA 5C0FB 3U9UA 2MOQA 4G7QB 5FC9A 4IU3B 4C56E 3DSQA 2X9YA 3QA3B 2IAMD 3FB5A 3GDCA 5TPWH 4EEQA 1OAQL 4YHYB 2XWRA 1S8DB 1PSKH 1WITA 2DWSA 4CMMB 3TURA 4ELKA 1R3LA 4LCCA 5LO7A 3EFFB 1GMEA 4Z7QB 2NX5E 1YMMB 1L6XA 1AXTH 1HS6A 3CE1A 3AG3C 1MJJA 2Y36L 2GTWB 4OT1H 4YSTA 2DQ3A 2G5BA 3N9GH 3KD4A 1QNIA 4XE5B 3BQUC 3L3HB 1N3NA 1DSWA 5HHXL 4G72B 1DVUA 1OW0C 2P90A 4J3WA 4XCNB 2X4SB 1UJ3C 3P1VA 3BVUA 4JFWA 1GK9A 1FFQA 1TEFA 3AM8A 1Z5LA 4AQZA 3KDPB 4HUXA 4UCFA 5EA0H 3X11B 2AJZA 4LF9B 2KT6A 4HF5L 4JO1L 4BQBA 2P22C 4KX8A 2Z7UA 1WBZB 3BUYB 3GMRA 4XPTL 3H1LH 2A83A 4GXUM 4JFEB 2KG7A 5AUMB 3MUGA 1BVKA 1VEMA 4OLUH 1I7FA 3VYPA 4NVPA 3TJEH 2VB5A 2VW4A 4X4KA 1BJMA 1ZRUA 5EUOB 3QQDB 1KCRH 2B9AA 2CK0L 3PWJB 3ZKSD 4DYLA 5I28A 4OV5A 4UIKH 8CGTA 4M8RA 2BCKA 1NFDB 1IJ9A 2B3IA 2XY2A 1J8HD 1JV2A 3LCYA 1ZL8B 1UKQA 4M29A 4U1GB 1M05A 4PDLA 4LLAA 2GUZA 1L9OA 2JI3A 3H55A 3B5TA 2DIJA 4LKCB 1Q94B 1GC1C 1E6JH 3OAYK 2BE3A 3DXAB 4HX1A 5C0CB 1PJ9A 1BHGA 5IB5A 2Z64C 5FYKL 5I18H 1T7VA 3CG8A 4AKQA 3WN6A 2R4SH 5F3BA 3C6SB 5AB2A 4DP9X 1ETZA 1RIVH 3MRFB 3WIIL 4DUYB 5C7XH 4B9CA 1C7TA 3DROB 4QYOB 4YDJA 1YUHB 5J2TA 2CBMA 3BUBA 3AU1A 3FSZA 3LRSB 3GEFA 1IURA 3CFDA 3WD5H 4HWUA 3WIHL 2FQFA 3WE6A 3BWUF 3KYKL 2WGXA 1KXHA 3RKDD 3L3DB 3NFNA 1KB5B 2H2PD 4G8FB 1LO0H 3N06B 4MCZB 1OAQH 1Y76A 4KVCL 1J1PL 2EDOA 1DQIA 5C93A 2XNDG 3UO1L 2ZE6A 1KTLA 3MOBL 2VZVA 1T2QL 3ARED 2ZYRA 4OGQC 3GSNB 1G7JA 1GJWA 1S7VB 4IBZA 5DZPA 3LZRA 3H0TB 4FLOA 4P23B 5EOCL 4BW5A 4K3EH 2FCBA 4NQEB 4DV0B 1GYCA 3ZYOA 5CCKH 4LSSH 5I0ZA 3PHAA 3OF6D 4Y8AA 5HHXH 5IOKA 3APQA 1SRDA 4X6CE 3WO3B 1F6AB 2NSQA 4HF5H 4JO1H 4J8RA 1KP2A 3FB7B 3QK0A 2DM7A 4OUUA 3P0YH 5G2NA 4DP1X 1TEGA 4ZQKB 3D34A 3SE6A 4YLCA 1CFMA 3JWDC 4MNQB 3DPBB 2AJXL 4WGKA 1PKQA 2DQEL 1BZ7B 3T6ZA 3H56A 3C3TA 3GSUA 4JM0A 5DHYA 1BIIB 5CEZH 1KENH 4ABQA 4AQ8C 1CI3M 1WP6A 3MD0A 3ARGD 3ARRA 2X5PA 1A6ZB 3UJIH 5CCHE 4XMPL 3CX5J 1G1KA 4I48A 4WWNA 5CZVH 1QI3A 3TN0B 4E36A 4UWQB 1KPUA 2QE7G 1S4IA 3O9WB 4GT7A 2CK3G 1KB5L 2WLJA 1FIEA 4HWNA 1YMMA 5DK0B 4PJDF 4QHLB 5HY9A 5FYKH 1IBLO 1LO4L 2OK0H 4DW1A 1UYWH 3OVUB 3B34A 2JJ1G 4I87A 3DVGB 3GSNL 1UT2A 1MI5B 4F7CB 2BNQD 4JDTL 2AQ3A 3IDYC 1HZHH 4KMTL 2MJWA 1X7QB 1CLZL 1XSJA 1D2DA 2JVUA 2Q8AL 4NKMA 4H0HB 3KYKH 3OC8A 4GB9A 3CCMV 3HFML 5C07E 4ELMB 2VC2B 2RMNA 2VMDA 2HFGH 4FNLL 4KI5C 4LOVA 3BUYA 4PJEE 3ZUCA 2R0WL 2VH5H 4KVCH 2FEDC 1V27A 4Z8FL 3UO1H 1FNEB 3LKQB 5D55A 1T2QH 3L7EB 4KJQC 5JPMB 1OHZA 4QY8B 3U7YH 4G27B 1HNWB 4HUMB 2OI9C 3QQDA 5ES4B 3PWJA 1YJNV 1I8KA 3MMEB 5FO7A 2DMCA 3HBQA 4NXMB 3VGBA 1GTNA 1IC5L 1FN4B 3VCLB 3WV0A 1QHTA 5HI5D 4OAWB 3PN1A 4X8GA 3SJVE 2MIZA 4LQFH 4EN3C 1S3KH 3A3YB 3QJRB 3DXAA 1KBKA 2Z31C 3LJ3A 1JZIA 5FCUH 4AQ1A 3RN4A 5BNXD 1I9JL 4I4WA 4POZC 4ACTA 4WK4B 2C9XA 4Y4FA 3EO0A 4ZD3L 1T66C 4J8QA 1EEYA 3I9PA 3N55A 4Y5XB 4QYOA 3M1CA 4WV1C 1W59A 4JW3A 3DX8B 5FUOL 4FCAA 3OQ3B 1FORL 2X3CA 1XF2A 3K4ZA 3SDDD 1P5VB 3F2LA 3CEIA 5KHHA 1ED3B 3DRTA 3P0VH 2ITEA 4RAUB 3RVXD 3DIDA 2X4TB 2A6DB 3VXUE 2Q0ZX 4UTAA 4IBVA 2R69H 4PJ9C 3Q2WA 1K4DC 1DFXA 2MPAL 4YO0B 3E1ZA 3RWJA 2OMVB 4ODBD 2VC2L 4PIRF 4JHVA 1S7VA 2GJ6A 3Q1SL 1D6EB 3N1MC 3O8XB 3LKPB 3ARZA 4DGVL 1LO4H 1TVDA 4K7PL 2Y2TA 4L1DA 3SZ6A 2JEXA 2VXSL 5D4IA 1UGKA 2F54D 3SDCC 4XZUA 4MVBC 3E7JA 3D36A 1TQUA 2WTRB 4LLUB 2QV4A 4ODTH 4KMTH 3VVVA 4KNSA 1ZKAA 1J5IA 3X1NA 2NUTB 1XGUB 5T3ZD 3SBRA 3BVNA 4Y16D 4ZOCA 3NZ8B 4KRPD 1RD6A 1THCA 4GRWF 1WYJA 5PAZA 2WNGA 1XSOA 3QWOB 4NEHB 4N2IA 4PDVA 4Z8FH 4ZUTA 3DXRB 2VWEC 3GS4A 3PQYB 3NIGB 3VG9B 4HCRH 4IDJH 1A3LH 4FMTA 4KROC 4DKEH 4FLSA 3HE6B 2ILLA 4F6RB 4BIOA 3NPSB 2B1GA 2E75C 4RWUA 2JIXB 3SBPA 2Y72A 1E4WH 2N56A 3LPOA 2E7LC 3EGXB 2GSIA 3ARVA 3U6RA 3SR2C 1T1XB 1BD2B 3KLAB 2ZWZA 1A8JH 3B1UA 4N6QA 5C8JA 4PW9A 4PD4J 2FJHB 4OCSL 3T4AB 3VX0A 1I82A 1AR1B 2COVD 5DK0A 4QHLA 1FJ1B 3WL9A 4QJ5B 1N4CA 1JGLL 2HRHA 1A4JB 4IMKA 1XGTA 1T2XA 1TGOA 2OT5A 1MI5A 4F7CA 2EYRA 4UAOC 2QR4A 5B7MA 1SUHA 1UA3A 3B2XA 5FUOH 4NPYB 3PL6B 1RK1B 3WB1A 4YFLF 1RUAH 1U93A 4ICXA 5BMVA 5AZUA 2YAMA 1MOFA 5GS1C 1DO5A 1WGOA 2OR8A 1QEXA 4UOZA 3CCUV 3ARBA 2OR7A 3QEHB 3VWKD 4MJIE 1G7QB 4V2BA 5H8DA 5I66B 2YMXH 1CLCA 4OI9A 5IMLB 4PI2A 1PZ5A 4JDVB 5GS3A 1Z1WA 4LSRH 2NZIA 4M62L 1M9SA 3ZUNC 3LKQA 4GKLA 2EEDA 1W80A 2WQSA 4OCWL 3D2UB 4QY8A 5JPMA 1A02N 3BWSA 2MQ0A 5HDBF 3AADB 3DJ9A 4MB1A 4K7PH 2APFA 1B2WH 2GG1A 1S77D 3BVTA 2RN9A 3E8BA 1D5IL 3GIVA 4PJ8D 4KK9D 4QT5B 3B1TA 1TF4A 4KBPA 1D7DA 1Z0NA 4Y1AB 1IQDA 4NYLA 4NYKA 3II3A 4XC3L 2BO0A 4Y89A 2YRZA 4YIQB 3CFQA 3SDXB 2GSGB 2F7PA 1HCVA 3HZMA 1Z5VA 3MJ8A 1MZYA 1BYPA 2OYMA 3U79A 1T7ZA 4IHJA 2FYYB 2O5XH 2HFEC 4X7CC 4Z0XB 3FT0A 4JE0A 2CJ3A 1HAWA 1V8HA 2X7LA 2IPUG 3FQ1A 4N1EA 3QWRA 3EJZC 4RGNB 5KBKA 3MGAA 4PS7A 2A7BA 4IOIB 2W0KA 3KLQA 2WCPA 4CSSA 1Y07A 2VISB 4KQ3L 5D1QC 2K45A 4MNGB 4U1HB 2APBA 1NUNB 4IL6Z 2ZPKL 2WWNA 3U0PA 3T2QA 1D6EA 4R4FL 5J6SA 2H3OA 3V2AR 3LKPA 3SJAC 2FUTA 5D2NC 5T1MA 1ZTEA 5E79Z 32C2B 1JGLH 2Q68A 4O2AA 1BHBA 3ZMZA 1CK0H 2WTRA 4UT7H 2IPTL 2R0LH 3CZUB 5IK3B 3WEXA 5C0BA 4GG6E 1RUML 4JO3H 1MZEA 1GKEA 3UIYA 3F7LA 2HZHA 3K6IA 2WXJA 1E28A 4GSRA 4HIJA 3QWOA 4OIIL 3ZHDA 1FV1B 2F15A 1NGYB 2CUIA 2UWEB 3PGFH 4RISH 3GXPA 3MRPB 3T0EE 3S35L 3T09A 1EXGA 3DX9A 4JKPL 1R73A 2AXGA 3LEYH 3LN4B 4BCXA 2UY7A 3QDGA 2WNKA 4H37A 3O0RL 4J6IA 4WHTB 4I8DA 1WEJL 1KJMB 3WNMA 4F6RA 5JXEC 3X1FA 1PU0A 5H4ZA 1NKRA 1U8KA 2ZAIA 4GW4A 1D5IH 3EGXA 3P73B 4S1QH 3SIKA 1BD2A 3KLAA 3TNNB 3MFGB 5F88B 2XTAA 2QPUA 1XNQB 1J05A 2PO6C 3SKJL 3ULUC 4AMKL 2XV2A 1IL1A 3K4DA 4LL4A 1JD9A 3H7BB 4FXLA 4XC3H 2CJUH 5MEOA 2EADA 2ZYHA 5HYFA 1M6OB 1OOWA 1C7SA 1SOQA 5A2IH 1L0QA 1QUNB 1HHKA 3T1CA 1A0QL 4CBZA 1ZA3A 3CC7V 4DV6O 4J3UA 5GGUB 1YEWA 1OT1A 1PS3A 4DEWA 1ZHBB 4B7KA 1G7PA 3KMDA 3PL6A 4PA6A 1RK1A 2X28A 1A7PL 3ZDZF 4YDLB 1CXHA 4M8QB 1SFHA 2KZ1B 1T89C 1Q9OA 5IMLA 4KQ3H 2GCYA 3FU3A 4FEMA 3RDTB 3SDYL 1AYOA 3LQAL 1HXYA 1AO7B 1RVFH 1OPGL 1WWAX 2WQAA 4Q89A 1IVTA 1LHZA 3L3OB 2H6OA 1NBMG 4ZO8A 1WBXB 3JWOH 3G08B 2D7NA 2YFNA 1AANA 5AFAA 1F3DH 2EC9U 4WK0B 3COOA 5E2TH 3ZO9A 1YHQV 3KPPA 1X9UA 3APMA 1RUMH 1ZOXA 3MRDA 1HHIB 1F3DJ 5C7ZA 3PWPB 1MVYA 4Z3IA 3DHUA 3EJCA 1SGKA 2MNJB 2NYYD 2ZCKH 4X0KA 2DQJH 1BAGA 4P9HC 3U2IA 5BS0A 5IF0A 1GZPA 1EAJA 2OJZL 4LCIH 4EIGB 1MFVA 3S35H 2DJSA 1MPAL 4JKPH 2WVVA 4HZ3A 2F61A 4F57H 4TVPH 2WMPA 5FL7G 2FYYA 5F7HA 3O0RH 3NUKA 4Z0XA 1WEJH 4DO2A 3OTTA 3DNKA 3MLTA 4MTMA 3CVIL 3F58L 1L0YA 3DC6A 5JHDE 1KXQA 4RSVA 2K4AA 5ITFB 5FYKU 3VD9A 5IT2H 4OLYL 2XWJA 1AR2A 2ED8A 4U1HA 4OLWL 2Q9LA 5AG2A 3IFNL 3NA9L 4RMQA 3VQXA 2W6JG 2Y7MA 1AQKH 5FW6A 3BEWB 3W39A 3P9LA 3PY9A 2Y2YA 4PS4H 2K7QA 1IGFL 1J5EO 4F2ME 4L0YA 4UU9B 2E8YA 4B27A 4X65B 2E3CA 4P2RE 2ZUXA 4B3MB 1SM3L 1KP3A 1XR9B 1PAMA 4YIPA 2B08A 4NM4L 4DR4B 4HC1H 4U1SB 4FLTA 1G0DA 5EIIB 3NSJA 3TEXA 2NX5A 3CU7A 5T8IA 3NA4A 1AI4A 1G8MA 2VABB 1RZPA 3H9SD 3NJGA 3HI6L 3K06A 4I77H 4JFTA 1FV1A 2UWEA 4NQCE 1FLRH 4NUPA 3M8AA 4BAYA 1AE6L 1ROCA 3APNA 3DX6A 3GTTA 4G7SB 1MRFH 3LQAH 4OZGF 4X5XB 2H3NB 4FCHA 2Z0AA 4YSOA 1PZ3A 4EAEA 2J5LB 3STBA 3VFSA 2WPDG 3STLC 1XBLA 2D8KA 2PCPB 4WHTA 1YA5A 4YHOL 1KJMA 5GRYA 5TQ2L 4JHUA 2NN4A 3DDFA 5DZVA 3TCTA 4X1KA 3CFMA 3GPSA 3M8OL 3OG4B 4P4RB 4F7PB 5GRWA 4LF6O 1A6WH 4EFEA 4DQOL 3IU3A 3TNNA 2O5YH 4PJCB 5JIPA 5T1JA 3DC0A 3NOIA 4YJ2A 1RHFA 2P7TB 4FNUA 4AH2A 2OSYA 4AYEC 2LFEA 4B50A 1U8PA 2ZQMA 3RJDA 2LQRA 4WFFD 2FEDD 1MCQA 2R56L 5AAMC 1MCWM 1K5QA 2VSMB 3GSVA 2ENQA 4QI3A 4TQHA 2K9UA 3ZMVA 1RLWA 3OAYH 2NXYC 3CMOL 4LKXA 1CQKA 3LIZL 4P2YA 5T5NF 3Q8BA 4XMXA 3S48A 4P2QB 1A7RH 4M8QA 1T5EA 4PJGE 1MJUL 1KDJA 4PB0H 5D71L 3DHJA 1Z66A 4ZTPL 5EBWC 1HU8A 1U2HA 1HEJC 1L8DA 1NBCA 1T0PB 3RDTA 3QF7A 4APQC 4EN3D 4KV5E 2JKLA 4V1DD 4M7ZB 2K4WA 3ET9F 3IFNH 3NA9H 3S5LG 3EOTL 4PG2A 4CA4A 2EVJA 2JGDA 3IMUA 4POUB 4POZD 1I0HA 2CDYA 5EC1C 4FM0A 4HIQA 1PD1A 4K8RC 3UPRA 3LQZA 2YS8A 3NJNA 2GJJA 1FE8L 1SM3H 4TOYL 5DRZB 4MJJA 4NM4H 1HHIA 4WJKB 3TXQA 3DUUB 4IKIA 4PJFB 2OXHA 3D3IA 2CHXA 3O2WL 3BXNB 3TCLB 3GUTB 1I5XA 4O58L 2LOEA 3R7RA 3QG6A 3IVKB 1AE6H 1DTUA 4I0PA 3F7YB 1S7XA 4MAYC 4NAJA 2R9HC 3ZJZA 2AXWA 3ZT6A 4CH3A 4BFBD 5LMNO 3MXWL 2Q67A 3L16A 4NNXA 4XGZA 4NZUL 1D5BB 5TQ2H 4YJZL 2BDNL 2V5RA 5HHOE 3VQ2C 4UMGA 4LVHC 4C59B 4LF5O 5DECA 2X6CA 5LL6Y 3K80A 2DQCL 4IJ3B 2ZNWA 4MDJA 2W38A 3WENA 3APFA 4CL7A 3BKJL 5CMAB 1MCCA 1SHWA 3BUTA 1KZQA 3ZBHA 2HVKB 2EO9A 5E7FA 1X4XA 4AILC 4DP7X 1QO3A 3KPRB 4QGYA 2HXAA 5K5YA 3O2DA 4JRXB 2ENPA 2CZNA 1HWGB 1NCHA 3KLSA 2LE9A 1NDGB 1O7SA 4WI7A 1XR9A 2WYTA 3ESMA 3CMOH 4KROD 3CBJB 4W4OA 1P7QB 5CLZA 4FP8H 3B2EE 1YAZA 2J8UB 4K4KA 3AG7A 3O6FC 1SF3A 4WAFA 3WEAA 1OJHA 2F4VB 3ARFC 2F19L 5E9DD 2HLEB 5L7XL 1JPFB 1KELL 4ODHL 4F91B 1CG9B 2C8NA 2CTQA 2F5AH 3SE8L 5A6LA 4B53A 3MV9D 4X9FA 2H3NA 4DN4H 3GEWB 1ZMYA 2C9PA 3BSZL 2VN4A 3VD0A 3VNZA 3S4SG 2FX9L 1M57B 4LQ1A 1TENA 2HVJC 1F4XL 2LP7A 4XO4A 1AD9A 4LAQL 1XWVA 3L8QA 4LOEA 3PS6A 2O5NA 3MODL 5EN3A 3L9DA 2NPLX 2I7OA 4OSUL 1NDTA 4X9HA 3VXPB 4DP4X 5L0QB 1BZ8A 3BP4B 3IJEA 1HQRB 4PJCA 4Y2OA 3UBXI 3ULVE 3KR3H 3IXAB 3LTVA 1RJZB 2VLJB 3CFIC 3U9WA 5L9DH 1RCYA 4UB0L 3FFCD 1TG8A 3AG2B 3QZNA 2OMZA 3VYNA 3OHXA 5K59E 1EQWA 2EDTA 4O58H 4R4BA 3VACA 4O02B 2NSXA 4OD3H 3SHSA 3R7QA 2DQMA 1DE4B 3FUIA 5DXWA 4L3EB 2Y07L 3SYPA 5H35B 5J4MA 1QWNA 2DD8L 4JUSA 1OCOC 2EP6A 4U2ZA 1WA8A 1ZLZA 4MRBA 2P4VA 2VZSA 2WP3O 2XYBA 2P45B 3OKDA 4P2QA 2WPGA 4S0TD 4MKMA 2W91A 3G6JB 5SX4H 5ABAA 1NUDA 4NRXA 1NOLA 4MDRA 3RYFA 2DQCH 3B9DA 4WUKL 4XAWL 5AVYB 4MD4B 2WY3B 3LZFH 3MRNB 5A6MA 4TTDC 1ZDSA 3MBXH 2PF4E 2CE4A 5KSBE 3PGDA 4HS3A 1TAEA 2V7QG 1MCFA 2QSCH 1ZLVK 4M43L 3KYNA 1NEZB 1D9KC 3GI9H 3FPXA 2ZX6A 1A3QA 4Q6IC 3T2PA 3U46B 1SKVA 1KCVH 4LNRA 3FT2B 2BS8A 5DRZA 3BGMB 3ZY7A 1Y0LA 2GK2A 4P3WA 2MWCA 2Q8BH 3WS3A 3KPTA 3MQIA 2K6YA 1BWMA 4PJFA 3AS3A 3K3QA 1I9EA 5PCYA 3CLEH 5BRPA 3GUTA 2F19H 5DUBB 5L7XH 5J6HA 4ODHH 5KW9H 1J5CA 1UT9A 2ZAHA 4ZAKD 1IAII 1PY0A 2B7DT 2GV9A 3CN0A 5C0AD 1AVMA 4F27A 3RTQD 4K5MA 2PTUA 2B2XH 3B7TA 4N9OB 2DB8A 4O02L 1XQ8A 4GP5B 2P5WB 1PNCA 1R6VA 4H8PA 2RQ6A 2P5PA 3UTSD 1T4KB 1VP7A 3LZOA 4LXFA 5DK2A 1FYHB 3FBKA 1RFYA 5E1AB 1DN2A 5JCOA 2GDSA 1HTYA 3MLWL 3KLHD 3A2FA 4UFZA 1JV5B 3L5IA 3S96B 4PV8B 5C2UB 5DUML 5CLWA 2B59B 2ZUWA 4FQ1H 1NVPD 3FZUC 5IEHB 4YEEA 1QBZA 1OF0A 1QTYT 4XX1E 1EGJA 1N0NA 2Z92B 1RZ7H 2HG5B 4DV3B 2XETA 1KJ2H 1ET7A 2Y07H 1SVZA 1K92A 4U7SA 5BRZD 2R2HA 2ZE7A 3DUHA 2WKGA 1S2EA 3F7VA 2D7OA 3QO1A 2J8UA 3GSQA 3FNKA 5JXED 2CPCA 2W9DL 4OB5L 2AAAA 1K72A 1JZFA 1AG0A 4LH7A 1R24B 4HSQA 1WZMA 5K9KA 2A9CA 2Q3AA 4ADJA 3FW6A 1SXCA 4ZPVA 3FCGA 3OX8B 3IGFA 1KQSU 1YDPB 1LTXA 2PO6D 2BVEA 3ULUD 1ROWA 1DVFD 1QBMH 3K2UL 4JFYA 3KPOA 2UXGA 2KQXA 3LNNA 3CN3A 3T0BA 2VDQH 5HGGS 3KXFE 4PYHA 4MQXC 1JCHA 4Q14A 1TJMA 4WUUE 4ZUSA 3CK0H 1N8ZB 2G60L 4UILL 1EJOH 4JY4B 3WKML 5CIPB 2R72A 3F5TA 1S72V 3WMQA 5JLZA 1H3XA 1R3KA 2Z5UA 3SGKA 2WBKA 5A1AA 2FEJA 4AITA 4U3HA 1A25A 5FUZH 1AI5A 3PF2A 2W07A 4XNXH 4Y4KB 2QKAA 3F5WA 3IYLW 4W4KA 4KXAA 4FG4A 4OM0L 3UEQA 2HN7A 3H9VA 1BCIA 5BXFB 1LK2B 4Z78B 4L9LB 5DR5L 2Q7HA 3CYOA 3ZIYA 1I85A 1TZGH 1KN4L 1CR9H 1ZTXH 3L48A 5C92A 4JLRB 4BFGA 4P46B 1MNGA 4TNEA 4W70A 2ICWI 3RVVC 1BZ9A 3RFZC 1B9KA 5JIMA 6FABL 2VMEA 1JQ0A 5DUMH 2WQRA 3W38A 3U0WL 3L4YA 1WUNT 4RDQG 5LBGA 5HGDA 3V6ZA 1JVOA 3RWGB 2F58H 3S4SA 4XP9L 3S8WA 2ID5A 2AJVL 4MCMA 2DQFB 4HIEA 3REVA 2LGWA 1NEZA 1OF2A 2GHZA 2TRHA 3CFTA 4MXQC 3B9VA 1WISA 1UQSB 2AXTZ 3PWUA 1JXGA 5I1KL 4JRYA 4A7SA 5B1BB 3KWWB 4HK3N 1PLBA 4I3RH 4JEGB 1TCRA 5TGBB 1SETA 4H26A 1XEQA 3SCMA 2XNAB 3U10A 1OGAA 3V4VB 5DWPA 1ID2A 2NY4B 5EU5A 4OB5H 4L3FA 4YSCA 4QXGL 2PR4H 2BSTB 2VKWA 4PJ0Z 1TTRA 4H0GA 3P3RA 5EZIL 2WLNA 4BZ2L 2A9NL 1RZGB 4KXCA 2CBQA 5TDNA 4H33A 5I1AA 1I1RA 5E2WH 4JZOB 4Y2NA 3VFWB 1FAIH 5LXTB 4TQDA 2UZPA 4XI5C 2EUZA 1YXBA 3A67H 5EZYB 4JFSA 2XPGB 1UZ8B 2A1WL 3AUWB 3O6KH 3LS5H 5KWYC 3MRLB 5DO8A 3PLYA 2OZ4H 3T2MA 4NDMB 4PJDB 2RACA 4UILH 4X5QA 3K04A 1JV5A 1KC8W 1MG3C 2OA9A 4LOUC 3S96A 3IFOB 1BOYA 2DQHL 3EDJA 3LNHA 1VGKB 5B1AB 4DK0A 2ZX9A 2IH3B 1GYVA 4HEME 5B7EA 4D9RD 5DD0L 3WTXA 3MRKA 2A0LC 1JXDA 2XN9E 4MS8C 1UWGH 1IC4L 2Z92A 1R33A 4B3SB 4XNYL 3D0VA 5DJXA 1QHPA 2L35A 1AP2B 4HIIB 4XNZC 5IFJA 3H1IH 2IDQA 1Z2GA 3HA0A 1MW1A 4GMSH 2R29L 4GS7C 3SQBA 2AEIT 3EGDB 3X3GL 1CD0A 3SQOH 1BZQK 4XCFL 1BVLB 4QRQA 4PM1A 5AW2B 3V4VL 4KITB 4AV0A 5BRQA 1IZJA 3D33A 6FABH 1P5UB 1QW8A 3UO3A 3DVNB 3LB6D 5DFVC 4XMKL 5J9PB 2DS4A 1SF5A 3HPLB 1WNSA 5IFHL 4LEXH 1X6NA 1KLUB 3G04B 2EJRA 1IRAY 3FT1A 1GS6X 4NIKB 3VB8A 4YAQA 3UM7A 4FFZL 4HAGA 1N8ZA 1EZSA 1QASA 5F0LB 5T1KA 4AHCA 3Q06A 4PJAB 2RCVA 1OQXA 2EDFA 4BUHA 1J88A 4HGMA 3RIFF 1IVSA 3BIBX 5JQGB 3WN5A 3W7WA 2HJFC 4QXGH 3RVZA 2F53D 1TZHB 3PDGA 4Y4KA 5EZIH 4APQD 3D39B 3SKNB 2BRRL 1DDHB 1BX2B 4HJEA 2EX3A 3I6GB 1WHPA 2AKRA 5E8EA 1FPTH 4KHXH 4Z78A 4J41A 2X0LA 4L9LA 5C86A 4RGMC 1RURH 3S3SA 4JANB 5H37H 5HHVL 4NCC2 1H5BA 4JLRA 4K8RD 1HKLH 5B22A 3CCHA 4PRNB 1V7MH 1FG9C 2DY2A 3HVDA 2DWEA 4NKIL 4WW2C 2CHDA 1YEDB 5FYLD 2XN0A 4ZMNA 2KZBA 3SKMB 1F1AA 1YNTA 3PP3K 3VSUA 1Q86W 2R27A 5LCVA 2ADJB 5JOFB 4XN4A 3BQVA 4Y9FA 4DR3O 4GAFB 3BABA 2YA0A 2X0VA 4MMYB 2ZP9A 5JHDA 4GRWB 5EBMC 2ZD9A 2H1PL 4XNYH 2R9HD 5E8PB 4X6EA 1XREA 4YDIH 3KWWA 4OZIE 4Y4HC 1GM8A 4Q56A 4QRRE 4R7LA 2GBUA 3SBWA 1JS4A 4EZMA 3BH9A 3KWXA 1RXLA 1JZ7A 4QXVA 2R29H 1NTZH 4I9WD 4LSVL 4ZZFA 3WLBA 4BJLA 1JERA 2A74C 1FNAA 4CS3A 1JK9A 2E74B 4FFTA 4L4TA 3RZCC 4B3RO 4F2MA 4YBLB 1RZGA 1UKSA 4ODUB 3RU8H 4NN6C 3BVDB 4P2RA 4X6CF 4BFIB 1MCBA 2M1KA 5IFHH 4B3TB 2J21A 4NXSA 5MP6H 4Q9RL 5CHNB 1IM9D 1T1YA 1B0RA 1UEYA 2QEJA 3MZGB 5GISL 2WZ6A 5CBEB 1MWAH 3AQYA 2NNAA 1YNLH 3DUSB 1NJIW 4NDMA 3UFIA 2E76C 2A9BA 4X9QA 1BMGA 1GCYA 2ODHA 4LF3A 4EB6A 3MNMA 1NIDA 5IHHA 3BGFC 4LRNL 4ZS7L 5MEPA 5E8NB 1VGKA 4LIQL 3IJ7A 4NGHH 3O6FD 3AY2A 4QRUA 5JNYA 1JXKA 1RULL 1MFDL 3D85B 2AQNA 1DZBA 1ZS2A 1ZTMA 5FX3A 3NEOA 3L5WA 4JRFA 2BSEA 1UD2A 1GW0A 5I75C 2V37A 1DQLL 3EYUH 3QFDA 2BIIA 4G8IB 4X64O 5FHBH 4HIIA 2J55A 2VXVL 3J7HA 3EDEA 1FYTD 4JO2L 1TDQA 4I3GA 4F2FA 5HHVH 3VJ6A 1MZZA 2A9MH 4OIBA 4GKZB 3EGDA 1PLCA 1CGTA 1A8ZA 4RWYL 5EEWA 2JDIG 3NIDE 2EUXA 4WCYH 2JS3A 2F5BH 2WK2A 3KNBA 4BELD 5H94A 3H54A 4RFOL 4P48A 1S76D 1CIUA 4G28B 3GKWL 4GFTB 5HGAB 2UVEA 4G43B 3T9WA 1NBZB 4L05A 3H4HA 3ULSA 3WFBL 3CUPA 2N05A 2JKXA 4XRCA 4X8JA 1GTOA 4PJEF 4CSPA 4UYPA 3GB7B 2H1PH 4PV9A 2XTJE 1EVTC 2DRUA 1PZ2A 4N6RB 3VU2A 5C0JB 4U6XB 2AV7A 2XT9A 3TIEA 2BC4B 2G3NA 3GS0A 4A2HA 2A99A 3AUVA 1URFA 4QRFA 2F0CA 4LSVH 2O5ZL 1N0LA 3RHWF 4KKNA 2OPCA 5L88H 1XFPA 1DDHA 3QUXB 1X5KA 4J2XA 4TTDD 4XX1G 5GZNC 1ZE3C 3I6GA 3TO4B 3IGUA 4DZ8B 2IALB 4P59H 2F7IA 2OTWA 2AP2A 3F6IA 2GY5A 3ZT5A 2HFTA 1OSYA 1P1VA 4JANA 2B4CH 3PNWA 5K33A 3T0VA 5IQ9B 4OF0A 5FR3A 5M7QA 4U4BA 3UAJA 5I1JH 2ZUQC 2YAHA 1BXXA 5JMOC 1RZKH 2GITB 3MGOB 4RQQA 5KHJA 3QI9C 1QW9A 3L9RB 5JOFA 1MCRA 5GTIZ 1RULH 3WHXA 1RY7B 1XIWB 4MMYA 5F96H 1TSRA 1NIEA 3AAZA 3EJJX 4Y2DC 1QSEB 5KVDH 3MRIA 3NJHA 3CFBA 2YDEA 4RO2A 4X89A 1DQLH 1JZHA 1ORQA 5E8PA 4JHZA 3ZGHA 1MDAA 3WNKA 4NZRL 1NCDL 3HHRB 3BSGA 2VXVH 4RZKA 2V9RA 2Z8WC 2AF2A 3RL1B 4AEHH 2YO3A 4AZ8B 4AJWA 3QUYD 1AC0A 3GM0A 5I6OA 2BX5A 4GRWH 1ZLSL 2O72A 4J4PC 5LGKA 3LPPA 4JJ5A 3A6BH 4RWYH 4EI5B 5D7JC 3B4SA 3M99B 2QHLA 4PSRA 1XAUA 1Q4NX 3QGVA 4JPRA 3OAUL 3QYNA 1HZLA 1IKFH 1IGCL 4RGOH 4UT6H 4HJUA 3EH3B 4X5PA 4BRJA 3MRHB 1DJSA 1AGDB 1A3RL 2B8OT 4TQEH 5CUSH 1IO4C 1RUKH 2AABL 2HKHL 2IPKA 3PPSA 3DMMA 1MRCL 3QDAA 2VDNL 1H8EG 2WSKA 3BH4A 4PH8A 3RZWA 4XVSL 4YHYC 1MF2H 5D5PA 2Q76A 2WP3T 3UJJH 5IIEB 4XDJA 4IKNA 1FDLL 1ICTA 4B96A 1X5GA 1AG6A 3CC1A 1U8HA 2DQGL 4DK3A 5E8NA 3LRLA 5LHDA 1QHQA 1UT1A 1YYLL 3AC0A 5F0JB 3ZTJG 4UM9D 4LBEA 3D85A 1QYGL 2QQKL 3HBZA 3MA9H 2EJ7A 5F1OB 1H6EA 1MNUH 4ZKIA 1U8IB 3ARSA 1H8OA 4G8IA 3C75A 1LK3H 2W9EL 4PLJC 5FOBA 5BOPA 1QPKA 1OAUL 2JKTM 4UB8Z 2IAND 2ZXCA 4MX7B 5DRWB 5F7NC 2JJTA 4J3OC 1N33O 5DEDA 4DTGH 2XU9A 4MQXD 4YJ3A 3P9MB 2XWCA 2BP8B 1OM3L 5IWAB 5D8JH 4U3SB 3B3BA 3TV8A 5AOJA 5G4MA 3S3XA 2FGZA 1PPIA 1Y7VA 2UXBO 2F7RA 1KYAA 4PGDB 4D9QE 3U30B 3I5DA 4FJCC 1AMXA 3R06A 3U1SL 5IHLB 4NN5B 2TRYA 1LP9E 1X5IA 4F4LA 2F8IA 4LLWB 4GKKO 3REWA 4W9JC 2Q20A 4MVMA 4JG5A 3I6LD 1CF8H 2XWDA 2X3AA 2E5LB 4PBDA 1KNOA 4U1GC 1G6RA 3QQ3B 4K0KB 3OKMB 4FTVB 5JH7B 5F3HB 4TLTA 3S34H 4FXKB 3QORA 5B7FA 3LDDA 3C8KA 1JI1A 1JYVA 3QXTA 3ZTDC 3C5SA 1BMZA 2BC4A 3QUZB 2X2HA 4JV5B 2CGRH 4W6WB 3WEBA 4D0BA 3T1FB 5KSBA 3UBXB 4HNAB 2YPKB 5CSZA 3FL7A 4BQ8A 1OB1B 5T5FA 2Q86B 2W0PA 3OAUH 1G6VK 1ZAGA 1F45A 3QDJA 3V5HA 1WGVA 1D3CA 3JWNG 4BFOA 3U4EB 1NWOA 3G4SV 1LD9A 1U8OB 2XG5A 1ZHKA 2XVLA 3ECVA 2BINA 2ZUSA 3IF1A 3WAKA 2YAOA 5KYWA 4MXQD 5D1ZA 2VDNH 3LX9A 2CGNA 4XVSH 3SJCC 2V7NA 3EOAA 1NMBH 1FDLH 4JY6B 2M83A 2R1WB 4U1LB 1E27A 1H8NA 1AQMA 3MGOA 1JPSL 4G1MA 1CYGA 2W95A 1KBBA 4L2LA 4P23C 1TPXB 4Y2LA 1ZWIB 3A5VA 4KRMB 1JWMA 5I1CL 1YYLH 4QRPB 3VRJA 2HPOA 1D5ZB 3FMGL 3TYGL 2PTTA 2MOGA 3FU8A 4PY8J 1XCTB 1Z3GH 4QXUH 2TAAA 4AYFA 5J1SC 4NI6A 2DBJA 3FUNA 4MA7H 1T83A 2HJLA 1M93A 1IBYA 4B5ZA 3Q05A 2WLIA 1VQKV 4ANVA 3FB7C 4K0OA 3QEQD 2Y7QA 1KN2H 2J6WA 1FHNA 5HJ3B 2Q7EA 4XNQB 3T0WA 3BCFA 3RVTC 3UZEC 4IOSD 4EI5A 2Y2WA 2XV3A 3OUFA 4UNIA 2VQ1B 3MX0B 3O4LB 2GTSA 5KX5B 4MD0B 3PP4L 4ZMPA 2XVBA 1NMCB 4LOUD 4E9RA 2I27N 3IJYA 3R19A 2Y24A 1GM7A 4MMXB 3U1SH 3EF4A 4GG6F 2FDBP 2A2QT 2XVGA 3OAAG 3MRHA 3OPZH 3NP4A 5C2BL 4X4MA 1WRFA 3L9BA 3TV3H 4P2OD 3TTSA 4JM2F 4MS8D 3TN0C 2AK4B 5K39B 6TAAA 4PHZA 3O9WC 4FLWA 2MHAA 4KKQA 4QHKJ 2F68X 3C60B 3DVFA 1UD3A 4UDTB 5ISZA 4OCYL 5DYOA 5CO1A 1IEHA 4TVSa 4G9FB 4L18A 2NZ1A 1INEL 4NQDD 4R5TA 3LSSA 3V5KB 2ITCB 2Z34A 4G42B 4YQXH 3VFVB 3R66A 4LGSB 3JAMN 3KXFA 4Y19B 5D5MB 3AQXA 1UFIA 4U0QB 4PW3A 3WS6A 5DFVD 2F9BT 1JWSB 2CLZB 4Z9KB 3FB8B 4AQOA 4MX7A 5DRWA 1D2PA 4M61B 1LNUA 3NJKA 5C8YA 1MSDA 1OLLA 2I5YH 5CP7B 4KXDA 5DD1L 3SE3C 3B37A 3ZE0B 2DYPD 1NC4A 3VXRD 3PXJA 1IXBA 3MA7A 4BEIA 5CLTA 3WNPA 2HKFH 3N42B 4PRPE 2EDBA 4KQ4H 2PYFB 1G9MC 3F7PC 4X99A 3MRBA 2FKXA 4HCIA 4QGTA 5DF0A 3L7FB 3RIFK 2WWOA 2P49B 4PBWD 3FMGH 2GBVA 1T6VN 1DVZA 3HUJB 4KOCA 3P3YA 4WFHA 3C5ZB 4Y0GA 1GN3A 1KG0B 3KPLA 2MTPA 3UTTE 4C8XA 4KC3B 3FSAA 2BNRB 3VE0B 1HP8A 2YPLB 1IAIL 2ED7A 3GMPA 4TQFA 3BMWA 3EO9H 3Q3GA 3QXWA 3ZDYE 3QUZA 3LV3B 4ZMTA 1Q6IA 1HILB 1PL3A 4PVMA 4KK6C 3ARYA 2UX7A 4MLIA 2NY7L 5F7LB 4Y5XC 2Z4QB 3CDGA 4DETA 1V7NL 1K8IB 2Y25A 5I1IH 1J0JA 2Z7YA 5CP3A 5EOQL 1TJGH 2VJ0A 2I07A 5DZLA 1K3ZA 5TE4H 3WYRA 1UKTA 3G9AB 4N5EC 4HWZA 1XH1A 5CJOH 3E8UL 2QR0B 4HETA 4D9LL 4HT1L 4DV2B 4Y4HD 1YNTF 3IN2A 3QHFH 4JY6A 4OCYH 5E2JA 5EU4B 1OTSC 3O8XC 1S9XB 4PIBA 3NIFE 2EIKC 2WSSG 4NUQA 1JPTL 2WBXA 2ICWB 4JS7A 1SQPH 4NNYB 4GCZA 3EDDA 4QRPA 2J72A 4DR2B 1SC5B 1EIBA 4QHUA 1TYRA 1SQGA 4GX1A 2YQ2A 3FN3A 4K3JH 1N5YL 2Y5TB 2FX7H 1N26A 4PA7A 1DJXA 1J12A 1OIOA 4KKLC 4PWIA 4BK5A 5HYJB 1NU1H 4JE4B 2V8LA 5JZ7D 1HSBA 3UO2A 3VW3L 3CFUA 2EDEA 4UV4H 5HJ3A 4ZO6A 3QO0B 4HEMA 4U6YB 5GRVK 4F9LA 3ESPA 1N9PA 5JOPD 4AK2A 2XFGB 1MCSA 1N59B 3BKCH 3MX0A 3VG9C 4AK1A 4FNSA 4A5UB 4M6MH 3H1KH 4UV9A 1E40A 2J1KA 4FHKA 5GGSA 4AJ0A 4AYSA 1XT5A 1J9RA 1E5ZA 1A4KB 2XA8L 4EOWH 2FT7A 4HAKA 3HE6C 3NPSC 3AJ7A 3WJMB 2YKKA 4X66B 2V7HB 4CADA 5FB8A 2GT9B 4M6OH 5GS0L 3WMPA 2V3FA 2YPVA 3DRQB 2R1XA 4N0UE 1U8MB 4F7EB 3MRJB 3QCUL 1YQVH 1YZZA 2ICCA 4WFAV 1UM5H 3D3VD 4YWGH 1TUBB 3T4AC 5BY1A 1AR1C 4G8GD 3D18B 4N2NA 1FFNB 3ZDXE 1NCIA 2WA4A 1S5HA 3SGDH 4G42A 5AKSA 1KV7A 3HNTL 2C4FU 1YHPA 5E6IB 1V7NH 1P2CB 5IHBA 3PL6C 1BQZA 3CXDL 2XN2A 2V5YA 5F93C 5HYSB 4WEBL 5C08D 4OFYA 3FSVA 5T3XH 2CAKA 4IEFB 3U2SB 2WXNA 4KZDL 2EECA 3QHTC 5CP7A 4DERA 2YUVA 4ZTOL 5B39B 3TEWA 5MEQB 2CTPA 1OAXL 1QA9A 1YEJH 1NCCH 2R1YB 5HVGB 3T0DA 1GHFL 3HOGA 3T3PF 2PYFA 3FOMA 1MG1A 4Z7UB 2J12B 5EOCJ 4Y9GA 1A4CA 3KJ6L 4LVOB 2AK1L 1Q90A 1YEHH 3C8DA 3QNXB 4XP5L 5CN1A 5DHEA 3KM1A 3OFNG 4PJGF 3MRGB 4OZFB 4JFFD 4JZJB 2NY3B 3BRCA 4BKSC 2DWDB 3CFJA 1KWKA 1ZA6B 5D7LB 4HULB 1YJ9V 4K9JA 4EZKA 3LV3A 5DVNA 2BSKB 2AW2A 5GGTL 5TDPA 3VD2A 5IYZB 1G1CA 2OL3A 3DLQR 1U92B 3CNKA 1ZJBA 5LN8A 3QUML 1K8IA 2P5ED 3QISA 1CVSC 1GYWA 3LHAA 4IGBA 4A38A 1ZV5A 5ILTL 5C0IB 3QI9D 3L5JA 5D72H 4L4VE 1UWYA 1HR0O 4OZIA 4WU7A 2RGSA 4QRRA 4N26A 4XBFA 4RGNC 3DO7A 4E4EA 1Y67A 1OVZA 3FN0L 4S10A 5GS0H 4IS6A 1VADA 2J6EL 5MHSD 3GJFA 3K59A 3BAWA 4TSCH 4GMTH 3OKNB 4I3SL 1UD5A 3B56A 4N2MA 4AW4A 3CJHB 2EE6A 4P4KB 1LMKA 5KAIZ 4NNYA 4HK0A 1MKFA 2ENJA 3QFGA 4ABWA 3C9NB 5D7JD 2IV9A 4U0RB 5JHMA 2ZM6B 4OLXL 4LFAB 1XGPB 3HG1E 5F2FA 1F4NA 5KYUA 3CXDH 2F8XC 4ZQTA 2H9GA 3GBNH 3LXBA 4JPQA 4WEBH 1ADQA 1E5YA 5HYJA 2AQTA 3QULB 5ITZB 3LQAC 4O2EB 2H6PB 4DV1B 2G3ZA 4A6YA 3T1WA 5FYKD 4ZTOH 1AGBB 2RH0A 5F1IB 1E4XI 1F3JA 2X05A 1XMQB 4HHGA 1FNGB 4RAVB 3W2DL 1RZIA 4B95C 1RIUH 4QOKE 1P4IL 3KDMB 3OXRA 5SWZE 1BOGB 1NCAH 4PWEA 4ZW6A 2HTLD 5CR8A 2ATKA 2GTQA 3IMRA 1WA1X 3RKPA 3EDFA 4BCZA 4LNUB 2AK1H 4NP4H 2PW1A 3TBSA 1SXBA 2WIIB 1GO3F 3D69B 3MSPA 3QDMB 3O6LH 3P69A 3QT2A 4YSRA 1RHHB 1ONQA 2GT9A 2IDUA 3K6NA 1OP3K 4B97A 4LCYA 1IX2A 3ZQXA 3RYIA 3QZLA 5E5LA 4MDIA 1OL0A 4PLJD 2CD0A 1TUBA 3LKRA 1LEIB 1SQMA 4LC1A 4WWKB 2XXFA 5EUKA 3D18A 1FFNA 5GRJL 2C9AA 1Q43A 4JFED 4P2ZA 1XO8A 4XPHH 4ORZC 1RJYA 4PJ7B 1NBVL 1S5IL 5E6IA 3QUMH 4JR9L 5EHFA 3SPVB 4EKXA 4Q0XH 5CEZE 3I3BA 2CUGA 2XWEA 3E6FA 3T4DA 1RZFH 2GYSA 2RAMA 4YDLC 2I25N 3ZS8C 2ERJB 2CIKA 1KFAL 4DEPB 4CMHB 3QXDA 5B39A 3P3UA 5IESL 3RDTC 1KECA 3AB0B 1GS7A 2IMNA 1ROPA 4XN5A 5D6DC 2R1YA 5C0CD 3MV01 1C8QA 4OGZA 3IAGC 4JNXA 4I3SH 2VR9A 2WO3B 5H6QA 5J1AA 3G5ZB 4AKOA 1ZS8A 2WXKA 2WBJB 3FTVA 3L74H 3L3OC 5TFSL 1KMGA 4I5BA 3VM5A 1UOLA 4XB7A 5E95B 3UDWC 5KS9B 4Z1VA 1L3WA 2GHWB 2X4OB 4JFZH 3VXSD 3VNYA 4TUYB 1T1ZA 4GQRA 4OZFA 2QTOA 4RZCB 3LPGA 2XFXB 1OAYL 3QXVA 2C9QA 4HWBL 4XHJC 1IBKB 3BFRA 5DGQA 4FQJL 5BPPA 3F3HA 3OMNB 4HBQA 3FUFA 5FUCC 1Z2KA 5KSBF 1JHLL 4K8XA 1XNRO 3K5RA 5J3HD 3G6AB 5HDQH 2HP8A 5AVXB 2YZ1A 1U92A 2ZZUT 3W2DH 5E2UL 2YK1L 5C0IA 5KSAA 4NBXB 2WTOA 4OCMC 2QQNL 3K2IA 2YD2A 1BQHG 4PRIE 2J1YA 2JJSC 2VT0A 3WUWG 4TRPH 5IFAL 1J5OL 3MZTA 3CFCL 3O2VL 3QDHA 4NFDA 2YEZB 2HG0A 3I50H 5IR1B 2BCCH 1A47A 2H32A 2E47A 3DTXB 4C56B 4H7VA 3VXMD 4P5MB 4CKQA 5JXAH 4YSPA 3ZJAA 3LEXA 2Y1YA 4JG0H 2X6UA 1JN6B 1NOAA 4MNQD 4Q2ZA 2JKRM 5FS5A 5E8OB 5C9JB 4UCOA 3MI6A 2YD3A 2I69A 4HJ0C 2V6HA 2XHBA 2EEAA 1Q9KA 1S5IH 3UTZA 1L7IL 4WHYG 1QG3A 4KX7A 1ZHLB 3ABLB 2QV2A 4GKSA 3LMJH 4QAWA 4QUOA 3JARB 5C71A 1HHGA 1AI1H 5ITZA 1I1YB 4JPIB 1B04A 1NFAA 4O2EA 3IWUA 2H6PA 2IDCA 4JCMA 3JAWA 4RRPM 4Y5YC 4AQEB 5L2KB 1IC7H 2NDFA 3OR7A 4I55B 2RHEA 4M3JA 2YBRB 5A7BA 1L0NH 5IESH 3LS4L 1JHKL 1BREA 3JVGC 4NNPL 4RFEB 4N1HB 5AW3B 3BVXA 1J5DA 1G94A 1AHWB 1BQ5A 1KYDA 2J5LC 3LH9A 4ICGA 1QPXA 4CJ1A 5I6MA 1N6VA 2WIIA 3D69A 2XZQL 2NXZB 4YBQC 5T1DL 1RHHA 3LN5A 4LLQB 5LNDA 3TF4A 1TR7A 4PJHB 1REIA 4X88A 1E67A 2F74A 1OAYH 2UUBO 5F9WB 4OKVB 1E1QG 2P7TC 1BE3H 3MGTB 1LEIA 2VCOA 1VFUA 1HSAA 2C1OA 1XL6A 4I85A 2H5UA 4X7TA 3IC9A 1LP9A 1KLGA 1RFDH 1JHLH 2PCXA 4FQLH 2IAMB 4BR6A 1H3VA 4HHAB 2MW2B 3LD8B 2ZR3A 3DBXB 4DWHA 2AEQH 2JLPA 2UYLA 3P0GB 3ZHLA 5FO8B 3ZPDA 1BXVA 2QQNH 4HIXL 3SKOB 3RWIA 3MLYH 5FKPB 3PREA 2BW5A 1XHHA 1J5OH 5CGBA 2BVOB 3O2VH 1H2NA 2YUZA 2VIRB 2F1MA 4YHHB 1JFFA 2WXPA 3TZVD 1MCLA 3L3GB 5FPOA 1QLRB 2NR5A 1ZHNA 3D09A 4M7ZC 2OMUB 3ECBA 3L75H 2Z6FA 4O9HH 4QXTA 4DRXB 5ADOH 1HDMA 2D03H 1KV3A 5H6RA 4MQ7A 4DPCX 4PJBA 3S88H 3MAWA 2CGYA 5KS9A 2X88A 1CDCA 3OKLA 4NJ9L 3P11H 1QWUA 2F1BA 3I75B 4RZCA 5I8KH 4TUOA 2G4GA 2A4ZA 4JI3O 1N70A 2HTKC 2ADIB 4PJ5E 1OGTA 1ZLWK 5I5JA 4BH7A 3BFOA 4CNIA 5KTEH 3EXLA 3HPJB 3SOTA 2Z91A 1ES0B 5CN3A 2WXIA 3QQ4B 4HKXA 3JD0A 1T22A 1YI2V 2CRIA 1WT5A 3UTQA 1BFOB 3HKBA 1J8HB 3G6AA 2I60L 1KYOK 3F7YC 4DUXA 5DWUL 3EFOB 1OTSD 3O8XD 4AGQA 2IWEA 4FQXB 1DP0A 4F7EA 4WQOA 5F7EH 4DGYH 1KIRB 1PW3A 3N0AA 4X9GA 2OWOA 1RIHL 3R4RA 1WCQA 3NJLA 4IJ3C 5FLUA 1XAKA 4JASA 1IEBA 3DTXA 1ZK9A 3GWKC 4FERA 1M3IA 2DBLH 1UM4H 1YPZA 2HVKC 1Q38A 5DI8A 3RNKB 2X4NB 3MOAL 4PRAB 3U6XS 2W65B 1JN6A 2QHRL 2FL5B 2VDPH 2CH8A 1QZNA 1AROP 4NHUB 2BZ7A 1X5YA 3PQYD 4JN1H 1XMOB 3WB0A 4F8TA 4W9FC 2UU9B 5A2CA 2CK2A 1H6FA 1AIFB 3UZVB 2UXDO 3X13B 3HE6D 4B0MB 3FTSA 3AREB 2A5UA 2H0FA 2FECI 1M4UA 4Y5YB 5IHZB 3MRCA 3ABGA 1J8KA 4HD9A 4U4IA 2IDSA 2VLKE 1DANT 3EF7A 1F6LL 1I1FB 2WLHA 2CGZA 4TXVB 4YHLH 3FYEB 3F12A 4LFCB 1AR1D 3IC7A 1SBSH 4NOBA 2LLNA 1L1FA 3ZE1E 1I3GL 1M57C 1NPJA 2BNUA 1R3IH 2FE0A 3EKCA 4WTZA 1BQHA 2VAAB 3VMPA 4PW4A 2JB5L 3E8VA 3OV6A 3WUWA 1S3JA 4LESA 4X8CA 1GAFH 5DRNB 5HBBA 3JUYA 2Q0AA 4FNTA 3UG3A 5L0QC 3T5WA 3ZHFA 3A21A 4N8UA 4AWJC 4KDTC 4YUEH 4AJYV 1MDTA 4FNRA 3E8FA 4KNUA 1H9DA 3AG2C 3IDGB 4PI0A 1Y6KR 1JG9A 4Z7NF 3CWGA 3VFGL 3ARGB 3HFFA 1FL5A 3Q6FB 1GKFA 5H5NA 3SJVB 4PWFA 4K71B 4JI4O 2IAMA 2QWPB 2EULA 2KZKA 2I60H 3EUUA 3ALPA 2Y6SC 5DWUH 1X59A 3OE7G 2QPEB 3V9CA 1PQZB 2IWKA 3EZJB 3ISRA 1FF5A 1S9WB 2PMZA 4MWFA 5DYFA 4O4HA 4WI2A 3TFBA 1QFWI 1U3ZA 3EYSH 3MV7E 4KHTH 2EXWC 4WU5A 2XDHA 1MEXH 4HFWB 2ZCLL 3E3QC 4Q6KA 4TL4A 1QLRA 2BNQB 1G4MA 5ESVB 2VZOA 2YAFA 4EIZC 4QRBA 3GO1L 3VXUB 2DV6A 1SLXA 2QELA 3MOAH 4XPGL 2LVEA 4CJ0A 5ITBL 1TVBB 1YSOA 1LUVA 4ZW3A 1HCYA 1RPRA 4N8VB 2HX8A 1QI5A 1P53A 3UIZA 5B1CA 2DIAA 4D6TH 3GVMA 1XF4B 2EDXA 2WBWB 5JW4M 5TJWK 2DJVA 3CC5A 2CMRL 1YLBB 1IB5A 4KI5E 3QZWB 3MROB 4RGND 3GXDA 3EAKA 1LXMA 3FO1B 4OXSA 1BFOA 1YNKH 4IBTA 3WJLC 2H3XC 3V7AG 2B1IA 4F20A 2EDDA 2HPTA 4Z1PA 4X83A 4LSQH 4PRBB 2PGGA 4ES9A 1N64L 4OZIF 3NFSL 5F9OL 1AQDB 4XPAL 1K8DB 2JB5H 5BW7A 3SE9H 3N27A 1HXMB 5E1AC 2ETWA 3AG1B 2M7WA 1OSEA 2HLFC 2O6PA 1N8OE 2X10A 2JI1A 3F00A 2UXVA 4XP1L 5FYJE 3KLDA 3E80A 4PTTA 3OKOA 4JYBA 4OCRH 2ZE5A 5DQJA 3RNKA 1IIIA 3PJNA 1IAOA 1MHHB 3SDDB 3BKML 1NFKA 3LRHA 3H9ZA 3VFGH 3IGAB 3HRZB 3RWCA 5E5MB 1XCQA 4FDWA 2HG5C 1JMZA 3RGVB 5EIBD 1O7VA 4TVPE 3BPZA 1OCRC 1XBDA 3A6CL 1R4XA 4NQQA 1HJBC 1DSFL 1SZNA 1XVSA 4KK8C 4DV5B 3AREA 1BQRA 2XIIA 3MCKB 4LEOB 3UGXA 1CXKA 4Z3JA 4RNRB 2KQMA 5B38G 5JVDB 5F7FA 3BI9X 1X9LA 1JSYA 3SY0B 1TTGA 2E7BA 1I1FA 1NJ9B 4TUUA 3OF6A 1E9QB 1Y6XA 5KLVH 1NBYB 3CXHF 2NY6D 1OQOA 3KPMB 3CIQA 1U30A 4MJIB 4PJIE 3ZKMC 5I73B 4FLHA 1Q1PA 1QFUH 4G6JL 3IJHB 3MHZA 5FDWA 5D1XE 4KRPB 3CV5A 1R46A 4KTEL 5BV7H 1S7UB 1R34A 2BZDA 3MJ9A 1FWXA 3J27A 4A67A 5KN5B 5AZEH 1MFCH 4LCWD 2XV6B 2CMRH 2WINA 1SLVA 5DD5L 5BZWA 1GIGH 1E4KC 3HMWL 3KEHA 4L5FE 4N9GB 4BD4A 4F92B 3T0XA 5AD0A 5LOVB 3ARGA 2CR0A 4CVXB 5AVWB 4Y4KC 15C8L 2J1ZA 4ODSL 4FA8A 1AO7D 1FO0B 1O9ZA 2RD0A 4JZNB 2G38A 3BEVA 1PQZA 1TZOA 5F7DB 4L9LC 1MNNA 1VF6C 2QKSA 2SEBB 5F9OH 4FQIH 1EK3A 4P46C 4NRYB 4FXGB 2VKXA 4O4JA 3G5VB 4PRHE 1I8MA 2CG9X 4B3VA 1U8JA 4HFWA 5AZ2H 2Q7NA 4G7RB 1WWBX 5E56A 3PWPD 4BFJA 1YG9A 2G9HB 4P5TA 2XSKA 1V3JA 2HRPH 2LGNA 1XDCA 4G1EA 4PWKA 1CFNB 1S7WB 2A4EA 4WFEE 1RUQL 2OTLV 2H41A 3DK2A 2EILB 4M1GL 2IOOA 3FRPG 2BP0A 2QVKA 3MBED 2J25A 4N90D 4OVVA 3WLWC 2VUKA 4HDIA 5BMFL 2YSSB 5B1BC 2VDRH 1N18A 4KRNA 4H0LB 3RFRA 1CD8A 1KB3A 1EHKB 2NY4C 2RNBA 4HMEA 4KQ0A 2VLLB 4QHMB 5IJKA 1J5HA 1NAMB 5E0FA 3FSWA 2O1AA 4Z7OE 4GG6B 1XOUA 5EULV 4OLZL 3N41F 4K23H 2OSWA 4AIOA 1D5MA 3D51A 1FGVL 4P3DB 3V7MA 4AUUA 2GTAA 2A9HA 3T0EB 1AQDA 2DH2A 1K8DA 3MNWB 3FTGB 4YSDA 1FO0L 4HJ0D 3AXLB 1EX0A 3FAXA 4KY1L 2CO3A 1ORSB 4C58B 3SQRA 5IJCC 3AMLA 3FQUB 1IM3A 1FFPB 1HCFX 4N22A 5B1AC 5DD5H 3HZYA 2IH3C 4HV8B 1VFBB 3HMWH 5IBTL 5I30H 1WAEA 3T04D 2AERT 4M8VA 1RM1B 5HJBA 1OP3H 1BEYL 1YN7B 15C8H 1EGJH 4OZHF 1MJ7H 4XN2A 4JI0O 1O5PA 3ARDD 3VH8G 4POYA 1OAKH 1I4FA 1F2QA 3QUHA 2F23A 4LEOA 3L4ZA 2VR4A 2FWOB 4FZEL 1FFOB 5GSVB 1OV8A 3BZ4B 2VR3A 1UM6L 2Z7ZA 3DGCR 5JVDA 5I0YA 5D1QE 2F54A 1P5UC 2DQDL 4LF8B 4DEUA 1NJ9A 3C08L 5IE9A 3CPLA 5J9PC 2Q7GA 3KPMA 4XR8C 3HPLC 4D7BA 3FO0L 3IE9A 1JPGB 1FH5H 4ZG1A 5D2NE 3U25A 2HHHO 4Y16A 2Q7YB 2WXOA 1P4RA 2YKLH 1RUQH 3HKFA 2QKIA 2V4LA 4JHAH 2OMXA 1KCUL 1W8EA 4NKGB 5F7UA 2CDGA 5CWSB 4YHML 2IJJA 4GAYA 1UB6B 4HJGB 1F56A 4CN6A 2JJUA 5DHMC 5CM1A 2QLVB 5CD3A 4N9GA 4IBLT 5JW5B 1JJUA 1NCWL 3IDIA 1LP9F 4IOFC 4NO3B 4R90H 5LOVA 2QVMA 3LH2H 4M7KL 2Z35A 4TULH 5TQ0H 3TC9A 4HQQL 3OMZA 4QNPE 2E6JA 2YRLA 4J7JA 4GW1A 4OLZH 2Q8VA 3P3PA 5AW7B 1OP5K 1PNMA 1VPOL 1UJ3B 2W80C 5DEGA 3U48A 2ESVE 3ZZLA 3H42L 4OJYA 4XXCC 4JQVA 1N36B 1A9BA 4FKEA 3ETTA 1NCTA 4R7CA 1Q9LB 3FUDA 1DEEB 3Q0HA 4LMQE 3TT3L 1MW2A 2WQVA 5B38A 4ZNEE 4KY1H 5IVZB 3UAJC 3OXSB 4I88A 5IMMA 2H26B 2ZYIA 3F8UB 4JFQB 3S37H 2RQ8A 3GGWB 4OVUA 4BK8A 2ZOKA 1G9NC 4EDXB 2M26A 3V4PA 4U1KA 4M56A 5ANMB 4PJBF 1MLCA 4ONFL 4X4YA 1RSOA 1S7WA 4F24A 1MVUA 1ETA1 1O6TA 4CH4A 4N2FA 5FA4B 1DVXA 4OF7A 4PDRA 4YGVB 1U21A 4AQAB 4APXA 4HOWA 3VWKA 4PR5B 3KEDA 1NIAA 1E4XL 4Z5RB 4MTGA 2YSSA 1INDH 5CBFA 1NGWB 1UHVA 1B6QA 3NRQA 3NZHH 2PXYB 2HCZX 5DHVA 4UV8A 5ALBL 4P9ML 5HGBB 2IQAA 3PXLA 2BWQA 4FZEH 2FO8A 1NAMA 5IM7A 2CIIB 1UM6H 2ED6A 1VSCA 1H3PL 2WM0A 4IRZA 3GJEA 2FQGA 1KGUA 2E74C 4YBLC 1GVIA 5D96B 1Q1JL 4PJ8A 5JPNA 4QJFB 1DF5A 3CVHB 3BCDA 1SYVA 3FO0H 3CJJA 2LAGB 3KPRD 4UQIM 3QFJE 4NQCB 4P3DA 5F7MC 2O4EA 1XF1A 1ZAUA 1Q0YL 2LU5A 4E42A 1AHMA 3RWHA 3G6BA 1RZJH 4JFDE 4BSVB 1EXUA 4JRXD 4JFPA 1JHTA 4TWKA 4YXKL 1O6SB 2D31A 4NC0B 1ORSA 5K1VA 2LV4A 3RURA 4ANWA 4YHMH 2ADFH 3IJSA 2ZINA 3GK8L 5LXGH 1WIUA 1YPZF 2D4FA 3E6HB 3ZMTA 3QPXH 1B6UA 4AL8H 4M7KH 3HLAB 1VRSA 4XO8A 3FRPA 2GJZB 4UM8B 4EI0A 1W91A 2HX7A 3P4OA 3T08A 1VKXA 1H2KA 4MQSB 3MREA 3ICXA 4DVBA 3OLIA 5FECA 5I1GL 2JJTC 4L3CA 4P3CH 2ZXDA 4FRWA 5CCGE 1T21A 5GSVA 5HHMD 3ASOB 3MUZ1 3QNYB 4I18A 4G7VL 3BZ4A 3LKNA 1XQ4A 4HBCH 4I1PA 3QXAB 4HGWB 3OT7A 4JFHE 5AW5B 3X1BA 4P2CG 1TQWA 2FJFA 1O9VA 2EUVA 3MUUA 1AGFB 4MNHB 4OM1L 3RB7A 2I9LA 1VACB 2XWBA 1TYJA 4QD2E 4FA6A 3KS0H 2CDFA 2NT0A 2LVCA 3DOSA 2FLMA 3VA6A 3N1PC 3O6ML 1IC1A 2Z0UA 2PR9A 1X6LA 3W9EA 1BQKA 3CVHL 4L3ED 2YSUB 4FJYA 3GB7C 3H9SB 1JGDA 3WY1A 3BPOB 5IQ7L 1JZDC 4HG4K 4F7MB 1AZBA 2AJSL 5AW4B 1E5AA 5IJDC 5EO0A 4KO7A 2YA2A 1A1NA 1BBJB 3J7AU 3FU7B 4N3TA 4UNVA 1KB9F 1DJGA 1KEMH 1MCPL 5EU6E 4Z3EA 4GH7B 3N04A 2QTEA 1DBBL 2ODMA 3UBGA 2XRAL 1X5MA 3BIKB 1S78D 3BQUA 5KZCB 3QUXC 5IYDO 4LU5H 5I6XB 3DBSA 1LEKA 2Z3YA 3HKCA 3VH8A 1GZHC 2WZ5A 3TO4C 4BFNA 1UJ3A 5TDOA 1ZLWH 3SSGA 1TLKA 1CFQA 3NH7L 2UUCB 4EUPG 1AOZA 2KL6A 4DUYO 2UZYA 4R26L 1KGCD 3ZDYF 1Y18A 4HUVB 3VI4E 1JZ5A 5IVZA 4IIQB 5I6NA 5D7KD 2PYEB 1OARL 4LPUA 1C5DB 2J4WL 2EO1A 2MPVA 3GK8H 3K0WA 1XR8A 5HHOB 1KYOJ 5LCVH 1X7TA 1ACXA 2EXYC 4D3CH 5HYQB 4XWGL 1XIWC 1F00I 4XVTL 4JKMA 1SYSB 4AQAA 3OG6B 1AS7A 3ILPB 2WYIA 1T83C 4MS2A 1CDUA 5FO9A 1S9VB 4GBXB 2ZNIA 4X20A 3FTYA 1DQTA 2QGBA 2P8PB 1D5RA 2P5WD 4G9DB 2ISDA 3AG4B 1ZTXE 4ALAL 3LZNA 5HGBA 1FS0G 2YEVB 2ZIMA 5LNGA 4J1UA 5GS2H 2CIIA 3QNZA 4B7LA 3MJWA 3QJHA 1CGSL 1KBGH 3KL0A 1AAJA 5LDSA 4CVUA 4DKFL 1C08B 3KAAA 3DV4A 3VFMA 3GJFK 5EZOL 12E8L 1HHHA 3H2PA 4ONGH 3AK2A 1XF3B 3OKKA 3QJZA 3O6MH 2A77L 2J2ZB 3S36H 3PIQB 3HZVB 5AALA 3A8TA 5TE7H 4S1SL 2FSEB 2ETNA 5ICXB 2XXGA 2DJMA 2VLKA 4PV1B 2XAHA 5J2UA 3QE5A 2DTMH 3FTWA 1B4RA 5CBHA 4QF1A 4KK8D 4KZCA 2ORBH 4ONHA 3UYOD 4LL9A 4FQQB 4OJEH 3CN2A 5GZOC 3U7WH 1XHXA 4MXWL 3BP6B 4QR7A 1FAKT 2YOCA 2HT3D 1YO4A 1UCBL 1DBBH 4IIZA 4UM8A 4MD5B 3O3BA 2QL1A 2B39A 3BAEL 1U8QB 3RUGA 2FR4A 2Y5EA 3H3BC 1OP9A 3PABB 4F6EA 1W0YT 2HLAB 4FZ8L 4PUBL 3MR9A 5JQ6L 1JWUA 3F7KA 1A6UL 2NQ3A 3PRZA 1TFPA 1GKOA 4GW5B 3ZDXF 3UYRL 2GBTA 2NTFB 2FUQA 2QT6A 2R0KL 3MUHL 4PVBA 1NMAL 5KG9A 1BAFL 3U30C 1VACA 1TMCB 3CFKB 3M45A 4NN5C 3TWCL 5FF6A 3A0RA 3ZU8A 4JY5L 4KROB 4AQ8A 2COQA 1CF1A 4ZO7A 5LHHA 1UZGA 3CVBA 1DJWA 3WUZA 4DW2L 5BZDB 5INCB 3H9SA 1QRNE 3HEIB 1AMYA 4FXKC 3VVWA 3NCBB 3OB0K 2CO2A 2XYCA 5ETUA 2E59A 4R0LB 3MV9B 3W7UA 3QUZC 3VU1A 4BFEA 3K2MC 5DDHA 3HAEG 4FOMA 2G0LA 5ID1B 1AZCA 1SJHA 1Z5HA 4BWWA 1JDAA 5K9QI 1S9KC 4X1YB 1U8NA 4C57C 2HKOA 3IDJB 2OP4L 3CPUA 4LSUL 1I7UB 2F2HA 3K9AA 1FQ9C 3I74A 3P54A 3RWEA 3ULVL 4LVNB 3MYJB 1AJPA 3V8OA 2BSCA 2DLHA 4FM1A 3U9PH 3WLWD 3CIAA 3ZZQA 4ADIA 2KPNA 3DX3A 5F97E 4WFFA 5IKCA 5HHNB 1H3UA 1VFOA 1DUYB 2G0KA 4HPOH 4JJOA 1JXJA 4LPWA 5EU7C 1YIJV 3CDZA 3RA7L 3LNGA 1TPXC 2NY4D 1ZWIC 5JYLA 1DTOA 1SA0B 4PCKA 4Z95H 4HS6B 3L13A 5HYQA 2FECL 3OWRA 3P30A 1C1EL 4LARL 4E41E 1TJHL 3K71B 2ZKHH 2IWFA 3VQWA 5G5DA 2K6ZA 3LSOA 2IFFL 3DK0A 1IBGH 1EZVH 1S9VA 3UKMA 4K7FB 3CZFB 3SKUD 3ULAB 4EXPX 3SO3B 1E79G 4EN3A 1TJIL 3MV8D 1SMOA 1PLGL 4V1DA 3VFNB 2VWKA 1A6UH 1AJQA 5B3SB 2Z31A 5E6SB 3GSOA 4LLMA 3JSNA 4XVUC 5LGJA 1QBBA 2V17H 4L29B 4M4RA 2EH8H 2IW5A 5IOPB 3TH2T 1YUKB 1NMCC 1NMAH 4UZUA 1C08A 4OQ1A 4MMXC 4OJAA 4KUZH 2CALA 4FJ6A 3TWCH 4JY5H 4EUPA 1KMIZ 1D6VL 5GONA 4R7NA 2VQFB 3TNMB 2ZSWB 4H13B 3TONA 3C60C 2ENYA 1JXFA 2FSEA 2WB7A 4PJ9A 3VM7A 3V4UL 1K4DA 3UCSC 4ZAKB 3NVQA 4EVNB 1SEBB 2OMNA 1MVFA 4P05A 3P4MA 4WUUB 1BG1A 3NJFA 5C0AB 1S7QB 4GEJA 3RTQB 4K9EL 5E6UB 2ITCC 4XCYA 4WI4A 5IB2B 3TBVA 2QM7A 5DA4A 3SDCA 3FT4B 4H88L 3UTSB 5L2JB 4WNJA 4MD5A 3CMEV 4R50A 3B40A 2OV0A 3EOBA 4AYDC 1T0NA 2OP4H 2EEFA 2VZ1A 4LSUH 3HNSL 2HLAA 5KSVB 3FB8C 1QQDB 2E5EA 1M53A 2XX0A 1MH5B 1PEWA 2IXQB 5IMOB 4OPHA 1CLOH 4GW5A 5GRUL 5B1JC 2YLKA 2AEPL 1NVPB 4Y88A 3RTLA 4DV4O 1GRJA 4RIRB 1UENA 1NTMH 5LGUA 4XTRC 1MFBL 4LHUB 4X80L 2WLLA 3ZR6A 3L70H