2EIMB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 60
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eimB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eimB02
4ENZA 4AKPA 1E67A 3NJMA 2BP8A 3FQ2A 3EHBB 1M57B 4HZ1A 2CJ3A 3CZUB 3PXLA 2PPFA 3SBPA 4YSAA 3MBWB 4G7SB 2XUWA 3AY2A 3UADA 1KBVA 2VW7A 1BQKA 1NIFA 2E86A 2DY2A 2Q5BA 4A67A 2YAQA 3AG2B 1GS6X 1RCYA 1JOIA 2QT6A 3PPSA 2UXFA 4F2EA 1OCCB 4KO6A 2GHZA 3UAAA 1M9WA 2FT8A 2XU9A 2IWKA 1MDAA 4HCFA 3NP3A 2PCYA 2R7EB 1JXGA 1HAWA 1NPNA 5D4IA 1V10A 4UANA 1PNCA 2BWIA 4Q89A 1ZDQA 3C75A 2HZHA 2J56A 2YAOA 5I26A 1HFUA 4DP6X 1VLXA 4G7RB 1SF5A 1L9OA 3NSCA 3ABLB 3FU8A 1ZIAA 3AG4B 1ILUA 3ABGA 2AANA 4BWTA 1AZRA 3CDZB 2DV6A 1JERA 5E9NA 3QJSB 3N55A 1CYWA 1JVOA 1WS7A 2VSMB 1OCOB 4MFHA 4G71B 4DP0X 1OOWA 4GP8B 2UX6A 3NJFA 2JFCA 2CBPA 2HX9A 4Q8BA 1IC0A 1IBYA 3OD3A 1JZFA 2XX0A 2YAHA 3DTUB 1QLEB 2I85A 2RACA 4YSDA 2UXGA 3FU9A 1SDDA 2VMJA 2XV3A 1PY0A 1XB3A 4NB7A 4YL4A 4A68A 3FYEB 5B1JC 1BAWA 2IDQA 4E9WA 3N2JA 2CAKA 2H47C 1KGYE 1RKRA 3AG1B 1JXDA 4YSSA 4BK5C 5D4JA 1IBZA 4A2FA 3TASA 3ZBMA 3NJLA 1WAEA 4BDVB 2X88A 2Y1AA 1M56B 1PMYA 3T6WA 2DYSB 4KOCA 4L0PB 1A8ZA 3UAEA 1SFDA 2FJSA 1NWOA 2YAEA 5B1AB 1ASQA 2WSDA 1JZIA 2BO0A 4M4RB 3OQRA 3T6ZA 1PLCA 5F7BA 3KW8A 1A3ZA 1NIBA 1L9PA 1ET7A 1URIA 5I6KA 1A4AA 1CYXA 3S8FB 2X87A 2FNWA 2OJ1A 3OMAB 4KNUA 1GYCA 4DP2X 2NRDA 1ET5A 5I5IA 3FU7A 3PCYA 1L9RA 2GC4C 3NT0A 4QLWA 2GBAA 1JVLA 2BW4A 1SJMA 3FSVA 3HEIB 4G72B 1BEXA 2A3TA 2XX1A 3PAUA 4KOBA 5I6MA 2PP7A 5IY5B 2MRYA 2GIMA 1DZ0A 1NWPA 2EILB 1YLBB 2YQBA 4HAKA 5B1BB 1J5CA 4GP5B 4DP5X 5EHFA 4AX3A 5B1JA 3SBQA 1PLBA 2IH8A 2HX8A 2HXAA 1L9TA 2AZAA 2VN3A 2YAFA 2FQFA 5PAZA 3WKPA 1BQ5A 4DP7X 3QJRB 3ZDWA 1J9SA 3DKHA 1NICA 3ERXA 4W1TA 2QPEB 4A2HA 2QPDB 2IDTA 2CALA 2XXFA 1KYAA 5LDUA 1ZDSA 2XXGA 1B3IA 3WKQA 2HRGA 3OMNB 4YSCA 2XLLA 3EH5B 2XYBA 1CUOA 2MTAA 3AG3B 3EH4B 4HCIA 4ZK8A 2YXVA 3WI9A 1EHKB 3JT2A 4DPAX 3QJUB 4E9TA 3H4FA 4F7KA 2VW4A 3ABKB 3GYRA 3MX0B 4AZUA 3FPYA 3NSDA 5I28A 3NJNA 5I5MA 2FWLB 5AZUA 3FU7B 1ID2A 3NP4A 2XV0A 3AW5A 1SFHA 1I53A 1XMEB 1DYZA 1WS8A 1KCWA 1OCZB 4K9JA 4HALA 2B3IA 3FSWA 4DP1X 3FT0A 4EF3A 4RH4A 3TU6A 1SHXA 2JXMA 2PPDA 1AS8A 2W8CA 1NIAA 4YSPA 2IDSA 2IDFA 1MZZA 2PP8A 3FS9A 4QKTA 3SBRA 2YEVB 4KNTA 2QDVA 1IUZA 1AOZA 1ASOA 4YSOA 2IWEA 2IWFA 1A65A 4WKXA 1TKWA 5AFAA 4NAJA 4P5RA 1PCSA 3FQ1A 3QJVB 1AG6A 3KW7A 6PAZA 6PCYA 1AS6A 5B3SB 1BYOA 2PLTA 1NTDA 2GB2A 1MG2C 3WNIA 2Q9OA 5TK2A 2BHFA 5B7MA 1SDDB 1JZJA 1CURA 2DWTA 2AVFA 1PNDA 4WTQA 3PAVA 3S3BB 3BVDB 3UACA 2AFNA 3QJTB 1ADWA 1PZCA 1J9RA 4HHGA 3FYIB 3X2QB 2UXVA 1R1CA 3H4HA 2GSMB 4BXSV 1CC3A 1L9SA 3OM3B 2GC7C 3DIVA 1WA1X 3GDCA 4YSRA 1KCBA 3U25A 1JZGA 1AAJA 8PAZA 3ASOB 5TK4A 4X4KA 3X1NA 4E9VA 3NYKA 1AQ8A 4KO5A 1OE1A 2FQEA 5AKRA 4A2EA 1SHWA 1X9UA 4G7QB 1BYPA 4CSZA 1L9QA 4JHUA 1KBWA 3ZIYA 1GW0A 2PCFA 2XWZA 3QPKA 3T71A 3IN0A 2BP0B 1TU2A 4N8UA 3NJIA 2HX7A 2IDUA 2CUAA 2VW6A 1AIZA 4HHWA 1ZIBA 4UAHA 2DYRB 4BWWA 2EIKB 3UGEA 2ZOOA 4CSPA 5I5JA 1MZYA 5A7EA 1PLAA 7PAZA 1W8EA 3TBBA 2VM4A 3IBOA 3ZX1A 4DP9X 1EZLA 3EF4A 2PPCA 3QQXA 3FSAA 2ZWNA 1AZUA 1NZRA 2B08A 4DP4X 2UX7A 2ZXWB 4NERA 1W6WA 1SNRA 4GYBA 5I6NA 4E9RA 2YAPA 4YSUA 2QDWA 1X9RA 1J9TA 4N4YB 2OCCB 1GR7A 1BQRA 2EIJB 2BP8B 4P5SA 3IE9A 1JZEA 1E65A 2VM3A 4YVUA 3CVDA 1GY1A 2N0MA 1RZQA 5B7EA 1ETJA 3FSZA 1ILSA 5B1KA 4A2GA 3NJGA 2FTAA 2FQDA 3NJKA 3CVCA 3NSYA 1N70A 1E5ZA 1PZAA 1A4BA 3CG8A 4JKNA 1BXAA 3H56A 2ZONA 1GY2A 3RYMA 1OCRB 4E9YA 1ASPA 2PPEA 2I7OA 1MG3C 3EH3B 3TA4D 2H3XC 2GI0A 2I7SA 2DWSA 1GSKA 3T6VA 2OV0A 5D4HA 1T5KA 4A2DA 5FC9A 2Y69B 1XB8A 3IEAA 3BQVA 3IN2A 4GP4B 3ABMB 2WO2B 1JXFA 2FQGA 1NINA 2VSKB 2P80A 3T6XA 1GS8A 4KNSA 2TSAA 4KO7A 3AZUA 4DPCX 4BDVA 1KDJA 4YSEA 2IH9A 2TSBA 4W9ZA 3OMIB 1AZNA 1NPJA 3X1BA 2R7EA 2YARA 4BXVA 3NSFA 4E9SA 1J9QA 2J5WA 5ANHA 4M3HA 2BW5A 2AZUA 1ET8A 3L45A 4UF7C 1ZV2A 2J57A 3ASNB 1N68A 1A4CA 1UATA 5F7AA 3V9CA 4YVNA 3UABA 1KV7A 1V55B 4F2FA 1AR1B 3FPXA 9PCYA 1BXVA 1NIDA 2BZ7A 5I6PA 4G70B 4BWUA 4PCYA 1AZBA 4E9QA 5I6OA 1JZHA 2EIMB 2CCWA 3V9EA 4AKQA 3SQRA 2LLNA 1GS7A 1AZCA 1ZPUA 3T9WA 3X1GA 1WA2X 1E30A 3S8GB 4YSQA 1KDIA 3CDZA 3NJJA 1J5DA 3QJQB 1XB6A 1AG0A 2YXWA 3X1FA 1TEFA 4GXFA 1OE3A 4A66A 3G5WA 4DPBX 3FQYA 3PLYA 1BXUA 4AI7A 4AKOA 2PPAA 5I6LA 1NIEA 4E9XA 2BWDA 3HB3B 4YSTA 1OE2A 1PAZA 2YAMA 1WA0X 4HIPA 7PCYA 1RZPA 3GXUB 1FFTB 3D12B 1FA4A 3WIAA 4DP8X 1PZBA 3X1EA 2BP0A 1QNIA 5PCYA 2XV2A 3S3DB 2WO3B 1TEGA 1AACA 3PAZA 4KO9A 2P80D 2BZCA 2HRHA 3TBCA 1AS7A 1F56A 1SF3A 4FA7B 4JHVA 4FAAB 3CVBA 4GY4A 1OV8A 3S3CB 1OF0A 1W6LA 2FT7A 2J55A 1HAUA 2IAAC 2W88A 1E5YA 1IKOP 1QHQA 2XVBA 5B7FA 2HLEB 1NDTA 2UXTA 1V54B 4HCGA 2PP9A 3WG7B 2FT6A 3WNJA 1FWXA 2JKWA 3NJHA 3JTBA 1PF3A 1AANA 4PAZA 4TXVB 2H5UA 2EINB
chains in the Genus database with same CATH superfamily
4WW2C 2WXKA 1E67A 5GS1B 4XE5B 2XBZA 4FG4A 1DJXA 4F8PA 1S9WB 3UPAA 5CD3B 2CKBL 3EO0A 4TUYB 3BUTA 3WFVA 3LAFA 2X9XA 4ZQKA 5IUSA 1G7PB 2W0FA 2JQZA 1QWHA 2HJFA 5LGHL 3OPUA 5C08A 1BVKA 3QHZH 5ACZB 2D31B 2XJKA 5K9QI 2J20A 4I4TB 4NZDA 2RFXA 1BD2E 5DD6B 3AG2B 3PPSA 5ADPL 1Y7VA 3MRCB 5C0DB 3L70H 2FX7H 5DS8A 2J12B 2XU9A 4IK6A 5C0CA 1KN4L 2ZCZA 3ATFA 3UTSB 2R7EB 5ESQB 1R3LB 3MA7B 5F1NB 2CH7A 5EBWC 2BS9A 4EIUA 1FZMB 1XGTA 2HLAB 2F0CA 4O58L 5GZND 5JIDA 1VPOH 3CN4A 4HA1A 5EZPA 5E4EC 3CFIC 2E6JA 4KDTC 15C8L 4X99A 5JHLL 3MCLH 1L9OA 2R1XB 1BA9A 1RZIA 4MHHG 3C5ZB 4IGBC 5EOQL 4GQ9H 4D94A 3NOIA 2XQYG 4I5BA 4FLVA 5D6DA 1L6ZA 3E2EA 4KKCC 3FAXA 2YEZA 4X4MA 3P9MB 1CS6A 3ILDA 3L3GB 2WKOF 1OANA 5IY5C 1QBBA 2VR8A 4ENED 2VSMB 2VMFA 2X4OB 3BVVA 4TUUA 1U8KB 1DE4B 3L5WB 3OC8A 4NN5B 5F21B 3ZL2A 1PYWB 1B04A 2GTZA 3LZNA 3QH3A 4MAYA 5CLWA 4L3EA 5HHPA 3ULAB 1X3DA 2AJ3A 1RK0B 5DCCA 1QLEB 4WGWB 1KCSL 5JW4M 4ZTOL 2WUCH 3PDGA 4NRXB 4N3UA 2J6WA 3VFNA 1LE5A 2YIBA 3OF6D 1XGPA 3RB5A 2H6OA 5C0NC 4YBLC 1BQHG 1DSFH 2WKLA 4ISVA 4RGOH 4U3XA 1V3LA 2HG0A 3ZRVA 4YAQB 1UM4L 5SWSA 2KZWA 3MYJA 5LXGL 3S4SB 2HTKD 1SLWA 3ZDXE 1WAAF 4KKLD 3U79A 3N9GL 1I94O 4CMHC 4I0CC 1NPUA 2ZKOA 3BPCB 5D71L 3C8DA 1XCTB 4AMXA 1OHHG 3QIBB 4OV5A 3QUXC 2Z93B 3TWYA 1L7TH 4TULL 2HVKC 3MV7A 2FECI 1NR1A 3AT0A 4OB5H 4MS8D 4FJYA 3DROB 1QSED 3RTQB 1YEEL 1SJHB 3HKFA 2EE2A 4YHHB 4F7EA 4L5FE 3JWNH 1S3RA 4G1MB 4PJ8B 4U1GB 3F8UB 2NR5A 4LDLB 3VI3A 5KG9A 4JZOA 1VADA 1TZGH 2NNRA 2F54E 4QGPA 4GX5A 2R29L 4FQLL 5CCJA 1CYXA 1OTSD 3OKDB 3LNEA 3QI9D 4LEEA 5E0FA 2FHFA 3U1PA 5CP3A 3T3PB 2HEPA 1YEIH 5CSZA 5GS0L 1DQML 1SLXA 5I5IA 3CDFA 4YJZL 3BD5A 1G0XA 1S9VB 3IGAC 1SJHA 3MJGX 1OP3K 1BQZA 4G72B 3SQOH 1CFNB 3OB8A 4OQ1A 4ZFQA 4A39A 4P2QE 4F93B 2NLJA 2K7PA 4QR7A 4S0TD 3LS5L 2Y69C 3MUZ1 3DPDA 2EDEA 1E27A 2BRRH 2X4NB 3LD8C 1J5CA 4HOXA 5FUZH 1Q9WA 4JI2O 3KJ6H 4M7ZB 2PTTB 3NIFF 4JN2B 1QR9A 1EFXD 2HJKA 3FFCE 5GRXG 5K9OA 5G5DB 2Y1ZA 3P9WB 5EEUA 2B1HH 5DF0A 2WKGA 3QULA 5FV1L 3MV8D 2NY2C 2OMUB 3O6KL 4CKVX 5I8EB 3ZE2F 1A6WL 3JWDC 3ZL4H 4FXGC 3EH5B 5AD0A 5FYJU 1NGQH 3FL7A 3RPKA 2JIXB 4DPAX 4ZX5A 3QWOA 4L1SA 3I55V 3U4EB 4F7KA 3RX9A 2VXSH 1IL1A 4NKOB 5HGAB 1A1MA 2ZG3A 4LFAB 4BH8B 1HHGA 2XTJD 1JNJA 1JV5A 3KLKA 4PJDE 2Y7QB 3FU7B 1E9QA 5GRUL 1U0QA 3NMEA 4NNPH 2DWEC 4KTDL 4DGYL 3RYHB 2F58L 1CE6A 4Z8FL 2OTUB 4XZ4A 1UYWL 4M6OH 2R0ZL 4K9JA 4BV1A 4MJJA 3HS0A 2YSSA 2CK0H 4AYDC 3FSWA 4MAYD 1DP0A 1XHXA 1VEPA 4M62H 4BZ2A 4Z7OE 1SHXA 4X9YA 3L7EB 5B1NA 1AS8A 3FUNA 3ICXA 3FQRB 4NQXB 3FS9A 1P2CA 2JB5H 2NQDA 2VABB 3GSNB 5KYYA 3DK2A 3WJMB 2F6AA 1WA8A 1QUPA 1HCYA 1ZS8A 3GIVB 4KJYB 4OFVA 3QUYB 1SRDA 1C7TA 3A21A 4HFUL 5AFAA 2ADJB 3OKKB 1KGIA 2ZE5A 3G9AB 1LMKA 3JVGC 3L4XA 3MACL 3EYQC 1EJOL 3Q8EA 3EHBD 4O2AB 3LZOA 4OF5A 4R5TA 2D7OA 1XTMA 4KK6C 1MHCA 3KXFB 1TJHL 1T6WA 3L81A 4P30A 2M2DA 3EFOB 5HHVH 2Y72A 3MV8E 4U1MB 4HWNA 2Q0OC 1JZJA 3WJMA 1BOGB 1IGJB 5A43C 3MKKA 1NC4A 3CEIA 5HDLA 3D33A 3GM0A 3R7QA 3INOA 4AGQA 5I74C 4GW1B 2TRHA 5E8OA 5FGSA 3MFGB 4PI0A 3L7FB 4MCZA 3V5KB 4H88L 1V3KA 2W0PA 5C2UB 4PPTA 1XEQA 1RI8A 3KWWB 3KLHD 5D70L 3EYOB 3HB3C 4XPFH 3A6BH 2YMXL 3CX5F 5DRZA 3RVWC 2F1BA 5DFVD 1HZLA 4JZGA 4E36A 2D0GA 4DN3L 1BQUA 1AO7D 1EFXB 4K55A 1G5GA 4UFZA 4WU7B 1Q0XH 4BAYA 4OSUH 3WIHH 3V4VA 1B6QA 3ARGD 4LSQL 1DBBH 4UQAA 3HBPA 5FUOH 2K70A 4Z6AT 1GW0A 1FGVL 2JK5B 3T0EC 3U36A 3PHQB 1Q43A 3HI1A 2PR4H 2YBRB 1OY3B 2RD0A 5JOPD 3LHPL 3V10A 5GS1C 4PRPB 4DVRL 4JI7B 2LFRA 4BINA 5J1SC 4PLNC 3R8BB 1NLBL 1JPFA 1QWUA 1EAPA 2NY5L 3BN9D 3MV9E 5DMGC 1RFDL 1YJNV 5CGYD 4A6YL 1SHSA 1C1EL 2CHXA 2NQ3A 4BFIA 3NSXA 3FOMA 3BDXA 1KZQA 3PNRB 3L75H 4GMTH 2F7OA 3U36B 7FABL 3U83A 2VC2H 4MVBC 4YFLI 3SKNA 1P2CB 5FUOL 2HVJB 2V2WA 4MB1A 4WGKA 4J3OF 3GZKA 1Q4NX 3R0NA 2FB4H 2BNQD 3BESR 3TN0D 4NERA 1LEIB 1HESA 1YHPA 1RPQA 4X7SL 1X4ZA 4AG4H 2CO4A 3ZW3A 2HJKB 1J9TA 4ZMLA 5DRNB 2Q86A 2EH7L 4J27A 4GRLD 1AR1D 1EGJA 4AIZB 1EMTH 2OCCC 4D9QE 4R7LA 3CC4V 5KYWA 2YIAA 4GKKB 2OIEA 3KPOB 1PS3A 4NP9A 3KDPB 3X13B 4BKLA 2EKJA 1ILSA 4Q9QL 2V4DA 4FQJH 4RAVB 4AM0Q 4R7CA 1N0XH 2WA4A 1EVTC 1QATA 2FWOA 2QVFB 1NLDL 3FONA 5F0JB 4HJUA 4M6MH 3CG8A 5D1XA 3BAAA 4MCZB 1EN5A 4N8CH 3WEXB 5DWPA 5C07B 4UOW0 5I1GL 4X4XB 5ALBL 1YNLH 1YYLL 2O5XH 2OPCA 3MRKA 1EXUB 1MI5B 4Y4FA 4YDMA 3RFZA 5C0FA 2I7SA 5F2VO 5B1OA 2CHNA 2X9YA 4N0FA 4XMXA 4H25A 1IKNC 2YFNA 2DOSA 3HNVH 4H8VA 3IXTA 4A7VA 1T5KA 3UFIA 4KAQL 5B1CA 1XB8A 4WJG3 1XQ4A 5CJ5A 4NQTA 1R5IA 2YIDA 3NCYP 4KKAD 1ZT7A 4IGGA 4QRUB 1QA9B 2VZUA 4DV0O 2YD3A 4O4YL 5FYJD 5KHJA 3MRNB 1F42A 1AH1A 2R1YB 1AJ7L 4G6FB 4P99A 1G9EA 5E2WH 3BPLB 3NSFA 4KUZH 4DZ8A 1OM3H 5I1DB 2X3AA 3GNML 2WLKA 4TUJB 1IC5H 3TYFA 4YHZL 1RV6X 3V0HA 2FDBP 4KJWC 2RCSH 4UOZA 2QFPA 2VMDA 2AJXH 2PGGA 4Z95L 3RA7L 1W2BU 3KMDA 4EIGB 3WFCL 1A64A 2YOCA 3I5DA 5EFIA 3ETBF 4IRZA 4G2KA 3CCRV 1BVLA 1QD0A 3CHOA 5ESVA 1KG0B 3P3PA 4PB0L 5KVGE 3TXAA 4WKZB 2DOCA 3LKRA 1DBKL 3HKZA 3RYCA 2NT0A 3JVFC 5I6OA 1ZGLB 2WP3O 3NAAL 4AKQA 5KEZA 5GSRB 4LCWA 3JT0A 3LS5H 2VC2B 2FSEB 2J6EH 4ADJA 5CCGE 5EF1A 4CS3A 4CILA 3HZMB 1CGWA 1R34A 2DLEA 4GT0A 3R65A 5BQ7A 1R0AH 1I5XA 1U8MA 3EJCA 1XV8A 1R46A 4B3EA 1I3UA 3QGVA 2F61A 3CDZA 3E22B 4OX9O 3BIBX 3QJQB 3IDJA 5SX5H 3X1FA 1VQ5V 3ASOC 3FQNB 1KOAA 1OE3A 1QHOA 1LP9B 1S7TA 3FCTB 4GRWB 1EJ6A 4PJFE 4ZPTA 2DMHA 3WFCH 3CV5A 3OKNB 4EVNA 2A4ZA 3T1FB 2EIZA 1FAIH 1PG7H 4JG9A 4LOFA 5DEJA 1WB8A 4CGTA 3HW7A 4PRIB 2X4SA 2Z5UA 2NY3D 4F37K 5HVHC 1CF1A 2B2XL 1PGRB 2QBWA 1BGYH 3HKCB 1AD9A 5KW9H 4LPXA 3MRJB 2OTWB 1UB5A 4X6EB 5BOPA 1OCCC 3EYVA 3PGFH 3QDGB 2W92A 4RGMB 4IYIA 3EO1A 3MXVL 1F00I 3SZ6A 2P90A 5H5NA 2WO3B 4ZXBA 4LIQE 1Z0MA 2PN5A 4YO0B 3BD4A 5TDOA 3B7RL 1PD6A 1SF3A 4PDVA 1TQCC 4X66B 3AG1C 2LFGA 3S3CB 4JMNA 3Q0HA 5LA6A 2X89A 3P30H 1Y1UA 5E6UB 1E5YA 2I26N 3LKPA 4NNYA 5CB4A 3UROR 1TAEA 1EK3A 1UVQB 5JNYB 1OAQH 3AY4A 3K6OA 4LLYA 4JS7A 1F4NA 4HV8A 1QTYT 3GEFA 4OCXL 2Z7WA 3L3DB 3HFMH 4I3RL 5J8OA 4IKJA 4OQTL 1BZQK 4XNZC 1X5XA 4HMCA 4IRSC 4KDTA 4E41B 4FFTA 5D2NE 4HX1B 5TDPB 5ABDE 1N4XL 4KVCL 1G4YB 5CN0A 4ZI7B 3QTCA 4G7SB 1Y6KR 3FF8A 3GXMA 3L1FA 4R0LC 3P30L 3U1QA 4D9RD 2P7TA 2EIDA 1RHFA 2JJTA 1S4IA 4JFFB 15C8H 5I73C 4A2LA 2DWDC 1C16B 3VX1A 2NY3B 1KTJA 1DBJL 4UXNA 1O6SA 3P73B 4H33A 4L9DA 5SWZB 1NJIW 4PGEA 1IDSA 1ZKAA 2G5BA 4KO6A 4LNVA 1AQHA 1NFIB 3PREA 3FB6C 3G7TA 2GBUA 3B9VA 5IYZB 1MDAA 4AVKA 2C1OA 1KTLB 5D4IA 5ICXB 4O2BB 4IOSA 3DXAB 5EBGA 4Z78B 3F58H 2UZXA 4XPBL 3HC0A 4L37A 5EZJA 4KQ0A 1RZIB 1I1FA 1ZDQA 4GXUN 5I1CL 1JNHA 2E5EA 3CXCU 3FB8B 4ONGH 2MW2B 4ZMQA 2ZPKL 3SD5A 1HYSC 4M9OA 1VGEH 3M1BB 1Q9LA 1XWVA 1HYSD 4LCWD 2JKNA 1G7IB 4KJQD 1K6QH 4MS2A 3DXAA 4WO4A 3GJFB 3SDCC 5I1DA 5E9NA 4KHTH 1BBJA 1LXMA 3W5NA 2NW2A 3I6KA 3AM8C 3FN0L 3EJPA 4D0DA 4JZJB 2DWYA 2HFFA 4J9ZB 4KI5E 1UOLA 5KZCD 5EIBC 4OUOA 5AZ2H 5F44A 4JHZA 2CBPA 5IROC 4YHOH 5CUSL 2YAHA 1Q9KA 3VXSB 4ZSOB 5ACZA 4Y5XC 5HYSG 1WHOA 3SDDD 3FU5A 2EQDA 3BAWA 2ZYIA 2G3MA 2BSKA 5ALBH 5I1AB 2QSVA 3C5JA 2WBKA 1P4LB 1U8NA 2W59A 2MCPH 1B2YA 4UV4H 4NQCA 2OP4L 5DJ6A 2H47C 1ZA3A 5EV7A 2IFGA 3T77B 1OHQA 4N6RA 3MV7B 5ICYB 3VQMA 1FD9A 4KITB 1WAEA 2OM5A 2X88A 1Z3GL 1M56B 4TL5A 1J9CT 2NX5E 3LQMA 4L0PB 5I1HL 4HWBL 2GUOB 2P7TB 3L17A 3LQZB 4JFFA 1WYJA 5CSBA 4BKTC 4P57A 2R8SH 2VERN 1N34O 1BFSA 2WSDA 4FVMA 2ZWZA 2F5AH 1ZV9A 2J5LC 1T5WB 2OL3B 4IIQC 4YEFA 2UWEE 5CZVL 1A5FH 4EI0A 4OR1A 4ANUA 3IJHA 4N3TA 2DL9A 3LH2L 1L9PA 3LEXA 2ADFH 5JHLH 4X9QA 5DN6G 1U3YA 4FHJA 3HPLB 5KN5A 1WV7T 5DHYA 2X9WA 3DX1A 3F5WA 4PRBB 3EOBB 4Y9EA 2EICA 3JWOL 3DRQB 4UDTB 3K5LA 1RUPH 1SXAA 4MAYB 4XX1E 2O6EA 4JQVA 2BW4A 1U8JA 1XR8B 3ARZA 2QGEA 1GVIA 2EYRB 4KRPD 1H8LA 2HN7A 3WLBB 2J7LA 3WY3A 3KPNB 1DJSA 3O2DA 1OAUH 4L4VB 4TSBH 3N27A 2BERA 2VDNH 5D1ZB 1Z9SA 2EILB 1HHJB 1KY7A 1VRSA 3E8VA 1OGAD 3H3PL 4M7KH 4BBWA 2NZIA 2W6JG 3A0OA 4V1DD 3ZYJA 1FORL 1HEJC 1CIUA 1NCIA 1QHTA 4QHLA 1II4E 2A73A 4PDRA 1BBJB 1VQ9V 3CNKA 1TSHA 2F8OA 5D72H 1FH5L 5PAZA 2KB1A 5ICZA 4B0MM 2VH5H 4P2CG 1TYJA 2D7PA 3DURA 5DJYB 5E7FA 4AG4L 1KYAA 4WW1A 1RHHB 3LKNA 3QDGE 2A0LC 1MFNA 2XXGA 2ZWSA 4YMPA 1LE9A 3QNXA 4R96A 4UQCA 2A73B 1IARB 1OZTG 1Q72L 3AG3B 2GTQA 2VQ1B 1K73W 4POUB 4F24A 1HHGB 4OIIH 1FQ9C 3UYPA 2DM2A 3NABH 4IM8A 2ENJA 4R2GC 1BFTA 4WFAV 1CPUA 4WI8A 1FXKA 5I5MA 1SETA 3LKNB 5DD0H 1KTCA 1G9HA 1MVUA 2IQAA 4XO8A 5CJXC 2Z8SA 1AYOA 1MRFH 3IRZA 1WHPA 1PZ5B 4NXMB 3EFFB 1JWUB 5ICXA 1W16A 4NZFA 1F2XK 5EWIL 1TOXA 3H9YA 5KTEH 1ZSPA 2BSRA 5EIIG 1FL5A 3VFVA 4QLRA 1U8HB 2JXMA 4HVBA 3F7VA 4OF8A 5E56A 3QXDB 2JGDA 2CM6A 2J4WL 5KYXB 1INEH 3F84A 2IQ9H 2P67A 2ADJA 1IBMB 2IOIA 2XTLA 3K72A 4I77L 3U4BL 4QAMB 1ASOA 1U33A 3TC9A 5I71B 3VFSA 3L9RA 1NMCB 4WKXA 2GKIA 3V6BR 4F2ME 4F7MB 2A6DB 5KYUB 1QFWH 3N41F 4OCSH 4C56A 1ZLEA 1QSFA 3HC4H 3QJVB 4CS2A 4QJ3B 1VF6C 1LO0L 2O30A 3EYSL 3V8OA 4OLVL 5C09A 3T0EA 4XVJL 1FSKC 1NTDA 3QXDA 3RGHA 2EIJC 1UM5L 2HKFH 4EQ2A 3WNIA 1AXTH 2HFGL 2BHFA 4EAEA 1LE5B 3CFJB 1FJGO 4LF9O 2AVFA 4OCLC 4TNVF 1DSFL 4WTQA 3T0BA 2ZP9A 1BCIA 4HH9A 5GGSY 3ZN1A 2CE4A 4KTYA 3HRZA 1GJWA 4PJHF 4I9XA 4YK4B 1IGFH 1T4WA 1R1CA 4ZOAA 3WN5C 3A2FA 4NAQA 4EI5A 3K2UH 4OZFB 3HPJA 1ADQH 5EPMB 1QR8A 1CL7H 1KJ2L 4JR9L 1R0AL 5FYLL 3T77A 3UBHA 1MJ7L 4F2MA 3CCSV 2D8KA 3MCKA 3QB7C 4S1QH 5F70A 5HI4D 3WMPA 1JZGA 4GSDH 4JGNA 5DD1H 1RFDH 4GUCA 4A6YH 4HJ1A 4N26A 5EO1B 2YWZA 4QKXB 1AQ8A 2JDIG 4ZTPL 1OZUA 3HI1B 5H35A 1NGPH 2E9IA 3MBEA 2W9LA 1HI6A 5DC2A 2MH4A 4P4KB 2AQ2A 5E2UH 1OJHA 5DU7A 4N2HA 4IBSA 2VZTA 3H85A 2RBLA 3ZDYB 1I7ZA 4GBXD 4M1GL 2GG1A 1LNUB 1ES0A 2V7HA 1E6JH 4POZC 1VQKV 3VXSE 3FAWA 2BVPA 4GEIA 3NJIA 1INQA 3HUJA 4PJEA 4OZGA 2QSCH 3OSKA 3RWFB 2HH0H 2ZM6O 5FDWB 3NCEB 2ESVD 3V0IA 4LSSL 4JFPB 4KK5C 1V9PA 1OK0A 4HJJH 3EFOA 1NGZB 3K4ZA 4X1IB 4XMZA 2XTAA 4JX0A 5HVWA 1G4RA 4BJLA 2LTQC 4OCMC 2GJ6D 4HOZA 3RWGB 3FN3A 1K3EA 2X40A 4FZ8L 3IBOA 5FYJL 2NW3A 4F7PA 4K8XA 4BZ1H 1E5UI 3Q6FA 5D96C 1HINL 3FSAA 3MROA 4LLAA 4JTDB 4DP4X 2CLRB 1M05B 3O6FD 3LEYH 3QISA 2Q7NA 1CVRA 4JFOB 1E79G 2BNRA 2EYTA 5FW8A 3O9OA 5I6NA 5C6TH 5KA6A 3VD3A 2B1HL 2QKIA 5AB2A 4NKDA 1Z5YD 3EYOA 3IU4L 1RMFH 3CX2A 5KYWB 1ZHNA 3GKZA 4EPSA 1BM3L 1HQRA 2L7EA 4H5SA 1SEBA 1RM1C 1I9RL 3C2SA 2WXIA 5CEZE 2XC8A 2Z35A 1IGIL 3UTPD 1IFRA 1MFUA 2BNRE 3FB8C 2NXZB 4D7BA 5JXEC 2MHAA 5AOMA 1NANI 3C87A 1N18A 4ZDHB 1GA2A 5GGSB 4DO2A 3V2AR 4ERSH 4JI8B 1XQ8A 4U1LB 1EAOA 5BO0D 1L0LH 1BP3B 2IPTH 5I1EL 1FG9C 2YSTA 2EP6A 3AS1A 2I25N 5GGRA 1YSCA 3WN6A 3Q4HA 2XFXA 3NA9L 5I18H 3VW3L 2DQFB 2K9PA 1TO5A 1A6TB 4N87A 3EOAA 3DO3A 2K3HA 2ZOLB 3F3HA 1VFUA 2X6BA 5EG6C 4DXWA 3VFPB 3RYHA 2IJKA 1AR4A 4OUUB 3TH4T 5LHGA 2E76B 1U3HD 2VDPB 3S37L 3UJJL 3BUBA 3C9NB 1JWUA 3CX5J 1A7PH 1N7MH 2NYKA 4M1CC 3CC2V 1NKRA 4XPHH 3BW9A 4Y5YA 4LLWB 1I7ZB 2CDYA 2WZ5A 3K04A 3VNYA 1LUVA 3VW3H 3LSOB 3HZYA 3GMMB 1OKEA 3VXUE 3QDMA 2KZ1B 2X6UA 2XKNA 1UFIA 3KVPA 3LN4A 2N7SA 4QYOA 4UCSA 3GMLA 1XIWC 4XODA 4WJ5A 1OB1A 4L0YA 4ZYKA 2YQGA 1WBZA 2OYKA 4WWKA 4O2FA 3FN0H 4E42A 3GQFA 4TLTA 1KCRH 4F2FA 3VD7A 2BHUA 3TEXA 1QLEC 2JLLA 1NC4B 4OFKA 5L88H 2EUWA 4CJ1A 4FZEH 4QO1A 4H40A 4EUPA 3U9UB 2DYPA 5IJCC 3SQRA 5KVGH 2WIMA 1UOWA 2PTVA 4NO3A 3DO7A 5F9JB 1TNMA 4PA4A 2FX9L 4QMEA 4PJGB 2EDKA 2VKWA 3L95B 4JRLA 4X4XA 3MC0A 4XPFL 2GSIB 5C08D 4OU3A 4G8AC 4IOIB 2OYQA 5DHVA 4FABL 1T2QL 2X4UA 5T3ZE 2HTKC 3J7AU 2VDLB 3MXVH 3P0VL 2H94A 4JQVC 4EDWL 1OT4A 3EAKA 2V1DA 4LHUA 4PJ7F 3QQ9D 3HHRB 5AOZA 2A6IB 4APXB 1ZUQA 3ML0A 2PPAA 1DLBA 3WJLC 1CQKA 2ZYRA 3RN4A 1FFNA 3E8GA 4U3JA 1RK7A 2AMUA 3LPOA 1KLUB 3H2QA 3U4BH 3MLTB 4I87A 1U3JA 1CICD 1TQBB 2W9EH 3WU1A 3ZEDA 1NGXB 3IJSB 1D5MB 3KHQA 4Y9FA 5IE9A 4XN5A 4DV7O 3G5ZA 3LZQA 2MNUA 3QYCA 4FNQA 4UQIM 4PY8I 1AILA 2LAGB 4Q52A 4P3CL 3X1EA 4PG2A 5A7BA 3E8BA 4LDOB 1C1EH 2BTOA 4Z3HA 5B4MD 3STZC 4MSWC 4JYCA 4X1KA 2J8UB 1U8CA 2C4FU 3GSOB 3D2UD 4YX2H 5B4MC 4LFCB 3CFEB 2I27N 4L8JA 2XWBB 5TPWH 3UJIL 2RQEA 1KEML 3BSZA 4Z7QF 3QIBC 3VYNA 2FEEI 1BZ9B 4ELMF 3GJFH 5HPOA 4HEPG 3WUWG 1S77D 4WI0A 1SA0B 3VVWA 4QUOA 2VZVA 4HUVA 3E3QE 1A32A 3DGEA 2ZKWA 4YHPB 1WAAA 2UXTA 1V54B 3N44F 4AMKL 5JWPA 4JFOA 5J6HA 3QDME 1MUJA 1GC1H 3V52H 5CJXA 3LOWA 3QQ9C 5ISZD 1B2WH 2GFBA 4X62O 1H2NA 4I2XB 2NY2B 3DRTA 3BO8A 2AKRA 3JWNG 3UPRB 5F0PB 3TBTB 2X4SB 3QQ4B 1QKZL 4GAAA 3ULUE 3BKJL 4QGYA 4DKFH 25C8L 4C83B 4DR2B 4H0LB 1FL6A 1G7HA 2I07B 5ECJE 1NMBL 2GCYA 1EM1A 3OXSA 4OGXH 2SODB 5BMFL 5AL0A 4DW1A 1HILB 1K3IA 2YAQA 2EINC 3EGXA 1UD4A 4RAHA 3QIUC 2Z8VC 3Q4HB 2XFXB 4J8QA 2WWKT 2VZOA 2BVEA 1P7GA 3VD9A 4G83A 4P2YA 3CC5B 1EHXA 1NBCA 4CUCA 5KA5A 3A67L 3QIBD 5F3BA 4RMSA 5FNVA 4FN0A 5H6RA 3AQYA 2CIIA 4MZ3A 4MTMA 4UUJB 2D3NA 1M9SA 1KBHA 1UB6A 2JSFA 2AAAA 1MRFL 4O4YH 2DQEH 4BHUI 1FFPA 1TITA 4WEBH 1QFWM 2E5LB 1S5IL 3LZRA 3LKOA 5B39A 4CL7A 2AJUL 5IT2H 5E6IB 4XZUA 1NMBH 5DD0L 1GJUA 2FZ3B 4E0RB 4M61B 1FRGH 5ENWA 2YXLA 4GQQA 2HP4A 1F90L 1ZIAA 2VR3A 2XN1A 3QC5X 1VSCA 2FECL 4NBZB 5JLZB 5KSAC 3LPWA 3QQNA 5F89A 5DK3A 1K85A 4AI8A 4C57C 1WUNT 3N55A 2G9HA 4NUJA 4Z7QB 1I0HA 1U8CB 4B3SB 4QTIH 1S9KC 1OOWA 2QR0B 2MPVA 4OZIB 3LKOB 1TQSA 3BP7A 3H3PH 1OB1B 4M7KL 4PCSA 1GGIL 1VQ6V 1U96A 4ORZC 4Z7WE 4P9PA 1SZNA 3UBFA 3OAYK 4X65O 2XX0A 3DTUB 1OTTD 1YEEH 1HE8A 2ZYSA 5A40E 3WFBL 3MRHA 5A16A 5IHHA 3MD0A 1E40A 1NCBL 1ODUA 3WIFA 3WFZA 4UB0L 3ULUC 3UTTB 4GKJO 2JELH 5I19H 5ICYA 4UOQA 3VCLA 4MJID 2F4VO 2BXZA 3LH2H 3NEEA 4YSSA 4EOWH 3BGMB 3TASA 1WTGT 5FPOA 3I9IA 4K7FB 4GUNA 1IE4A 3UTSD 4FNLL 4NRZA 3LTVA 5I15H 5JHAA 4JFYB 3T3MB 5LG6A 1IM3D 2AQPA 3FB7B 4HUXB 4Z7VE 3UTTA 4XB8A 1RZ7H 3UCQA 1ND0A 1C7SA 3O3AB 5HDOA 3GDBA 3DVFA 1PLCA 1HNZO 3G67A 2A9ML 4FQ2H 3QO0B 4RRPA 4U1KA 2IJIA 5D6CB 4LFBB 1S5HC 2Z65C 4XPTH 5LGKA 4JLRB 3NCBB 3DJZA 5T3XE 4KUCF 2WP3T 4XBPA 1U41A 5F3BB 1CE1H 3VFMA 3DVNA 3BT2L 5ISZA 2GC4C 2Y7SA 3GSXB 3QUXA 2GUZA 4KDVA 1CDBA 4MNGA 3VFNB 5E4IA 4UT9A 4X5RA 3VH8A 4CRPA 3F6IA 4G6JL 3NPSC 1FO0A 2H32A 2IW5A 2XBTA 5E24E 4P8QA 2ZUWA 5FK9B 3WHXB 4BQCA 1YJWV 1LGVA 1YRKA 2CK3G 3O2DL 1H8OA 2JKXA 3KBHE 4ODHH 5CHNA 3BY6A 4PGBB 2J6EA 2X1WL 4K9EC 1Z5VA 2KG7A 3H1LH 4EDXB 2YC0A 2AZAA 4NPJA 4X9BA 6FABH 2UUAB 1ROPA 4Y5YC 3LRMA 3L08A 1QKZH 4OD2A 1EDYA 4JANB 5JDSA 3ZHLA 1JFQH 4LSPL 5K1NA 4X7EC 1QYGL 3V4PB 2F95B 3CU1A 3VXRA 3DV4A 5J3HD 3I50H 5HGAA 2X10A 3DETD 1C8QA 4P48A 2WNWA 3GGWA 4B5ZA 1FI8C 2X2YA 1QACA 4FKHA 3VB8A 2XAHA 1DQMH 5D7HA 1EJ8A 4KKAC 2Y1VA 3OHXB 4HXBL 3BRFA 3A67H 2VUYA 5KHHA 4OLUH 2CHDA 3QORB 4Y4KD 3TO4B 3WFHB 4QHUA 5JA8B 5EOCJ 3D18A 1CFSA 4N2IA 1J8HA 1JYNA 3JCUZ 1TUEB 3B77A 3BFRA 3DECA 3ETSA 5EK0A 4WF7A 3L13A 5GONA 4FJ6A 1A2YA 3FRPG 4Q6IC 1QSEA 2E8ZA 2HN7B 2I32A 2VXUH 3L3HA 1CDYA 1OCZB 4G1EB 4UCUA 2B3IA 2OYMA 3VI3F 1PL4A 4NLAA 3P3YA 4CVUA 3C6LB 4DR3O 2OQJB 4GUPB 4S1DC 4UV7H 4BW5A 1MIML 4NUGL 1HS6A 1C9SA 4N2DA 1ND0B 1N5YH 4Q0XH 4UAOC 1F4HA 4DESA 5CMAA 4IRJA 5AAPA 2OX5A 4B60A 4AEIH 4YJ3B 4NHUB 4H0IA 4P2OD 1MWOA 3Q01A 4F15B 3PP4L 3W2DH 4LGPB 3QT2A 2P48B 1S9XA 1WJ3A 1CGSH 5IB5B 1F6LL 1GMIA 2WAQA 1S6NA 3C6LA 4GUPA 3BCDA 4HCRL 4CAGA 2Y6SD 3BPZA 1H5BA 4PRIE 2VERA 4GKSA 2YWYA 3KW7A 4PCKA 5BVJA 3RU8H 3TZVD 2R69H 4KK8D 5ETUB 3ZKQD 4WUKL 5JH7B 4HJSA 2ZWKA 4FG6D 5LGTA 3GTVA 5TK2A 2DWTA 1JRHH 5KVMC 1M4KA 2O5ZL 3R4DA 3VA2C 1F3DH 2WAHA 2AFNA 2IANA 2QKAA 2BE3A 1UGNA 1GH7A 3QUZD 4NQCB 1HH6B 4TVPE 1JGDB 3FYIB 3K5SA 2JJSC 2P24B 4YE4L 4MVQA 5AYQA 3P2BA 2GC7C 1CG9A 1NMAH 3NZSA 2CGYA 3GDCA 1KIPA 3DYMA 5T1LD 32C2B 3C8KA 3CLWA 1THZA 3JUZA 3JUYA 2PYEA 2UY6B 2DM7A 5JPMB 2F1MA 1VPOL 3ZT5A 3LXAA 2L6LA 2R2CA 4BELD 4QIRA 3CXHF 1OARL 2J2ZB 3SCMA 4LR3A 3IMRA 3N43B 4CC6A 1L9QA 4NRXA 1KUQA 4JO3H 4LAQH 2ZR3A 3T6QC 3B9KA 4YPGA 3M17A 3S5LA 5D2NB 1FZJA 3DJTA 3PGCA 2VIRA 1AIFA 1AQKH 2ZG2A 4JFPA 4M48H 3FO0H 3L5HA 1DVUA 1F6AB 1LK2A 2CO7A 2ZXDA 3P4OB 4J3XA 5JPMA 5K9OB 4ZOCA 1I8MA 3QDJA 2ZKXA 5TE6L 4TSCH 4C4UA 1EFQA 1JGEB 3TCLA 1QVOA 2CKBB 2DYRB 1IGMH 1T4KB 5KX5A 2K8QA 4K3JL 5AYTA 4U1IB 4M7JL 4D0BB 3IFLL 1B0WA 3ARBB 1H15A 4OZHA 5IW3A 4NQVA 1JV2A 1ZTXH 5SWZE 1NFDB 2V4LA 3OKOB 5FA3A 4NXMO 2PPCA 4L1DA 4YHMH 5CFHA 1PPIA 3BAKA 3BVNB 4NN7C 2WXFA 2DTSA 1S9XB 2G3NA 1AC6A 5LGUA 3OKEA 1SYSB 4PJ5D 1E8WA 3P1VA 1GCFA 3HLAB 1GW6A 4ODWB 4OZGE 3X13A 5LXGH 1F51A 4JTAB 3EFFK 1KIUB 1E43A 2CGOA 3Q6GL 4LL9A 3LRKA 3IE9A 4OJDH 4OT1L 4U6XB 2VLKD 2X7LB 1DJZA 3L1OH 4PRHB 1QG3A 1ZHBA 2H32H 3N1PC 1WCBA 2K4WA 1IJNA 4LLMB 1GZHC 1KFAL 3SYQA 3P9LA 1RZQA 5DFTA 1NT2B 2UYLB 4R3SA 5A2LH 3W7SA 1KIRA 3APCA 5IROA 1LP9F 1H6UA 1OQXA 5IQ9A 1M4UA 1CQYA 2Y7NA 3NJKA 2G2RB 4XVUC 4Z0BL 2YKKA 1A9EB 2DWDB 4XH2A 3I9GH 1HQ4A 1R47A 4F9LC 4X20B 2Q76B 1YNKH 1OALA 5TQ2L 1ZCRA 3GIVA 3ZTEA 3WNLA 4P2OA 4UTBL 3TT1L 1E1QG 1JXJA 3FAVB 5E2UL 1XNRO 3GRWL 5LN4A 4DKEL 5FDWA 1OF2A 3FOMB 2F1AA 2H26B 2DF3A 3UYRL 2DWSA 4PRPD 5BRZE 3NBNA 1A14H 2FX7L 1OAXH 2GHWB 4UT9H 1AKJD 4CJ0A 5HHQB 4LNUB 1CFVH 2Y69B 1QNZL 2ZDIC 3TPUA 4EN3B 1IEHA 2WO2B 5C0GA 3AK2A 1MJ7H 2GHYA 1X5IA 5EOCL 3UBXG 1Z9NA 2VSKB 2DYSC 3D07A 5T1LB 3CCJV 2CLRA 4P5TD 3W7TA 4TUKH 3I9GL 5IBLD 3JWDH 3T4YB 2BRQA 1G6RH 3MV7E 5IOPB 3RBZA 1KG0A 5KSBA 3HKBA 1S78D 2WAMA 2BNQB 4ZUVB 1HCFX 2A1WL 2WLIA 3KLDA 4PJFB 3QIWA 5GSRA 3BKYH 5LP6C 3TP4A 1UM5H 2HKFL 3P3SA 4H4NA 5T1LA 4H13C 1GGYA 1NEUA 3QHZL 4BM7A 1NFDA 4DRXA 9PCYA 1RUAL 3D3QA 1BXVA 3VGFA 2CTWA 4ZI8A 3LNNA 2FBJH 4RDQG 3APQA 2BY2A 3TVMA 1IGFL 1SVCP 2P22C 3SKUD 1WZ1L 5H9CA 2VDLL 4O51A 1S5HA 1B2WL 1DBMH 4N9GB 5B1BC 3ARRA 3X11B 4AL8C 3H7LA 4YSQA 2K1EA 4M7LH 1TETH 5FYKE 4XCNA 3E9TA 2JWYA 4QRAA 5CJOH 5I76A 1F4YL 1CXZB 2HMID 4RWUA 4XVUD 5E2WL 3A4DA 2IMMA 5FV2A 1HZHL 1GHFH 4WGVB 4C4KT 2RJMA 4E9XA 3B6SA 5D7SL 1KEMH 5FFOA 5JDJA 3OX8A 3ME0B 4HSAC 4U1MA 2Z0AA 4MS8C 3TK1A 5FGBA 4QNHB 3S48A 3BUDA 4KJQC 3UMNA 4UVCA 1FYHB 2DMBA 5HVHB 4RMVA 2BVOB 4JO8A 4OLZH 4WWID 2OW6A 4OD1H 4HC1A 1I8IB 5E9DA 2VDQL 5I30L 3PQYB 1MCWW 1T04B 2VXTL 3HPLC 3FQUA 5DI8B 4LCUC 4KXAA 3E8HA 5PCYA 2OSYA 2ADIB 3F6LA 3B6SB 2DBLL 4WKZA 1YCSA 2ZE8A 2YEVA 3ZRSA 4HCRA 5H37G 3IDGB 4FYQA 5CCKH 5AEAA 3MV9A 2AXJA 1GSMA 1HOCB 1ZS8B 5GZOD 1GM8A 3BRCA 4F3FB 1VF5C 3RAJL 3LNGA 3U1SL 1NC2B 3TFKD 4JM2B 5C08E 1R3HB 2E75B 1S7SB 3O4LB 2C7UB 2JI2A 3PXJA 3WEXA 3BQUB 5EU3B 3P4NB 2QLYA 3NJHA 4IRZH 1PF3A 1NCUA 1RIVL 3L72H 2H5UA 3UPRA 4FM1A 2VISB 3VTTA 1M3JA 1OGSA 3FJTA 3QJHB 2A77L 4L3CA 4GRMA 3K9AA 2ITCA 3GHEH 2PPFA 3MLXH 3ZQXA 4Y0GA 4YIQA 2FBRA 4IW4C 4YDVA 1T80A 3FMGH 4OPAA 3PHOB 3MCYA 3MRGA 2VR5A 3UADA 4Z76A 1A9VA 1HH9A 3U9WA 1BQKA 2DY2A 4PJHA 4PM1A 4K0KO 1X5ZA 3GMOA 5IYDO 4NNXA 1EFXA 1G9MH 5DWUH 4X88A 2NPLX 4XCNB 2PWFA 3RWDB 3SQOL 1QBAA 4PRNA 1BVNP 5F88A 5EF0A 1XXFC 2DLIA 3PHOA 4XE0A 4PEEA 1MH5B 3IF1B 1IM3B 3N0AA 3PIQB 3DHJA 1V10A 2PUSA 1YEKH 2DQ6A 2XIBA 1SQ2N 2B9ZA 1IIIA 4H0GA 4P5KB 3NFSH 4PJ8D 4R7DB 4D0CB 3CZKA 3D0VA 1T1ZB 4LLYB 1AJNA 1DTOA 1VLXA 5DHEA 4NYLA 1FNLA 1ED3B 1SF5A 2MJWA 2H3NA 5DS8B 3RPIA 1NAMH 3KCPA 4HZLB 4OIFA 4ZMYA 4YXLH 1KPVA 5DVPA 3SDXB 4PD4K 4Y7MA 4UI2A 3CDZB 2LHAA 2NY3C 3KCWA 3O3DB 4U1GC 2Q9LA 2E74C 2BVQB 4UYQA 1M2VB 2ENPA 5IBTH 4JY6A 3ZL4L 3RJDA 1KJVA 4MVBD 2AEQL 3W9EB 1BOGA 2W65B 3FTVA 3LXCA 4OBRA 4ENEC 4Q8BA 2J6EL 1MW2A 4K5MA 4JN1L 2VLJA 3CN2A 4P04A 1RUQH 4UZUA 1JZFA 4CU6A 5A1AA 3LNFA 1L5GB 1QVGU 4DO4A 1GTFA 4OGAD 1D9KC 4WI5A 2OYLA 2YZ8A 1D9KD 1PY0A 3HA0A 1TETL 4JCLA 1JD7A 2ICEA 1YEWA 3P4NA 5DK2A 4XVSL 4JFHD 4ZQTA 3QO8A 1A6ZB 3ZX6A 4XP6H 1FNFA 2IBZX 4GW5A 5IR1A 5J5EA 4L3EB 3U2SA 1KTDB 5JHBA 4AH2B 1BZEA 4WU7A 4XP9H 4J4PD 2XWTA 1G6RA 4I0XA 4XWGL 3CE1A 3PABA 5LBSA 2DLGA 2VQEO 2WC7A 1ZLVH 3RVZA 2ESVE 5L6YH 1N19A 3QCUH 2VDPL 2ZZUT 3IDUA 1HH9B 2LABA 4H8HA 1CDCA 3EG9A 3LKPB 3K2IA 1XAUA 2O72A 1OARH 4LEOB 1JNLL 4X7CC 3CHPA 1U92A 2UVFA 4Y19D 3B2VH 5I16A 1EAPB 1NIBA 3J27A 2BVOA 1IAKB 3FUIA 2GSGA 2VO5A 3P02A 1Y0LA 4ODVH 2OJEA 5T5FH 3ATDA 4FLHA 1P5VA 5LYJB 5L3DA 1Q9KB 2EDJA 5IHZA 2F08A 5A2JH 1XX9C 1F4MA 5CIPB 1DJGA 2GBAA 3QQDB 5H6QA 4YGAB 4LFHG 4QLWA 3TA3D 3W38A 4HZ3A 1UH4A 3ARXA 4IEFB 4PLJC 2A3QA 5KVFH 1KN2L 3FZUD 4MXVE 3VYOA 3WBDA 3SDXF 2X0LA 3VVVA 1D5XB 4B6ZA 4GAJH 4LESA 4F3FA 3T0ED 4S0SD 1BZ7B 5IBTL 2BX5A 3K80A 5ITZA 3ZE0B 4CVWA 1ZVSB 3LPFA 4KI5F 3RKDD 1GIGL 2BSED 4OJEH 3CRRA 3T1YO 3EYVB 4PRPE 4OFIA 1H9VA 5T1KD 5DMKB 2I5YH 4TVUA 1BQ5A 2R29H 2W0KA 1GAXA 3HHSB 3KYOB 3QJRB 4G6KH 4YXKH 5C0DA 1QLRB 4KZ0A 1TYEB 1QPPA 1D5XA 1PD1A 5AG2A 2QPDB 3LEYL 3BIKB 3DV6B 4G8GB 4L8SA 3SDDA 4OLWH 4XMPL 2HRGA 2V0AA 3OMNB 3FB7A 3O6LH 3CSYA 2CBOA 4HUWB 3AXLB 4PJAB 4AE0A 2I07A 2XYBA 3H3KA 2N01B 4OGXL 3ULVC 4I4WA 4GMSL 4HCIA 4KPHH 2ZXEB 4LCIH 3JT2A 1P4UA 4Q0XL 4K7PX 3UAJC 2IPKA 4O9HH 1GYWA 4E9TA 4WWKC 4XWGH 5HYJE 2A38A 4DZBA 2BOCA 3RVTC 3SE9H 3QRGL 3RYFB 2CCLA 1O7VA 5HDBB 2DIEA 2FH8A 2IH1B 2CUHA 1WISA 3WUZA 3BIKA 1UM6H 3DV6A 4L8SB 1NCWH 2CRZA 3SDCD 4CC4C 4U1SB 3C5ZA 4AE1A 2IAMD 5CZRA 4B41A 3FFCB 3KBEA 4PG9A 5FS5A 4CW1A 3ISYA 4R84A 4HX1A 4M1GH 4YBLB 4GKJB 4HALA 4ODUB 3UZVB 2VDOH 3QA3B 1I5YA 1ZK9A 4HJGB 4DTGH 4ES9A 5L8JB 4HGMA 1CF8H 2WJ5A 4KXZH 1TZ8A 2YIBD 3OF6A 3T4AC 5IOKA 1F6FB 4UNIA 3VACA 1M6UA 1WGVA 5L2KB 1MRCH 5EDSA 1H5BB 3CWGA 4GO6B 2AK4B 1GZQB 1A65A 3ARGC 1B90A 4RCAA 4N6RB 1P7HL 1X4XA 5IHZB 2UY7B 4X42A 4JI4B 5HYQB 3ZYIA 3CHXA 3GS0A 1VQPV 1I85A 3TXSA 5E70A 4P9ML 1T7YA 4LVOB 3U7WH 4JI6B 1SY6H 1DQDH 4LC1A 1A1NA 2VLJB 2KLSA 2NYYD 4XHJC 2LOEA 3PHSA 4I3SL 4M6ML 1CURA 2R2EB 3IU4H 3QZLA 2H8PC 3IVKB 1AHMA 4CH5A 2XG5A 3VM7A 1DEEB 1ORSA 2KKQA 5AAWC 5FX3A 3DSQA 2F5BL 5KTEL 5T3XH 1OTUC 3B09A 2C9AA 3SODB 4FNSA 3ARDB 3WJJA 2EULA 2YHGA 2IO5A 4UQEA 5HI5C 1ENVA 2E59A 3QEUB 2Q3ZA 4XO4A 1TZAA 1OP5H 4JE0A 4GW4A 2VQEB 4HOWA 5EZOL 3LN5A 3MREA 3VXTA 3CGTA 3EW3B 1PL0A 2D4DA 3FUDA 5CEZL 4ORGA 4EBQH 3TA3A 1G0YR 3NH7H 1YN7A 1X44A 1U58A 2APVA 3K72B 4GT1A 2UXDB 1VAHA 4EFEA 3MV8B 3QRLA 2XWZA 5KJRL 1RD6A 4JO5A 1NQTA 3RIFK 1LDSA 3V5DB 4QRPB 1FIGH 3MZGB 5IJ0A 4I2XE 4DUYB 4IOFD 4X9GA 5JXAL 5E1AA 4XNQA 3C6EA 3Q48A 3THMH 4QOKD 3JQOB 4OW6A 4F7PB 2GY7B 4WW1B 4MBOA 1PZ3A 2P5EB 3V4VB 2X4QB 3M8OH 3CYOA 5JH7A 3EFDL 2D9CA 3Q8FA 5D7IE 2NDFA 5H2BA 3ZZQA 1FO0B 1Y67A 1SC5B 2OR7A 1OTSC 2JK5A 3QI9C 5CS7A 5F3HA 5I6XB 4GG6F 1N33O 3NR7A 1TZHA 2GJJA 5GJTL 4GFTB 4WWKD 3MFFB 4ODHL 4D9LL 5KSUB 4ZW3A 3RVYA 2VDRH 4TPRL 2A74C 1RZJH 3N40F 3BPCA 1JMKC 5HJBA 3ULVD 1GMEA 1NGWB 5F7YC 1X7TA 3D2TA 3NTCH 2DI7A 3TBSA 5KUMA 3A47A 3HNSH 5BXZA 4ZXBD 3KJ4B 1CZ8L 3ZDZB 3TJHC 3QO1A 2C3VB 2Z7YA 3IXAB 5I0YA 5I1LA 5H35B 4ODBD 1LVEA 3RKPA 3GXFA 1S7QA 5ALCH 4XT1C 1IE5A 3T2OA 3T2MA 3L2MA 1X5HA 1UWYA 3SBWC 2WXOA 2ZE7A 1ROWA 2WTRB 1P4IH 2DQUL 5GS2D 4Q9RH 3LSUA 4NOFA 4OVUA 4PGJA 1WAZA 4LF8B 4WI3A 3L3GA 4L9LB 5HDWA 3RNQB 1TA8A 3KNBB 2CK0L 4CVZB 2H26A 2X4OA 5CJOL 5INDB 1FVDA 4BSJA 1GAFL 2BOLA 1PKQA 2UUBB 1BOYA 1CBJA 4P06A 3AUWB 3CQPA 4JG1L 5A2CA 2Q0AA 1XNQO 3V55A 3BEWB 2Z92A 1VZGA 2QGBA 3OZ9L 4PRID 1IJ9A 1L8DA 1S7VB 3ZQWA 2ARJQ 5FUCC 5JUEH 5L9DL 3G5VA 1N0LA 3L4WA 4XOAA 4FZ1A 4MTXA 3SKOB 3IN2A 3MROB 3JATA 3EDFA 2N7BA 5I1IH 1RM1B 4ZRGA 4O2AA 1NINA 3L4TA 3PWLA 3UERA 1MFEH 2P80A 3I74A 3T6XA 1KYDA 3QCTL 3V4UH 3IJYB 1KZYA 5KSVA 2A4EA 4NO0A 1KDJA 4TSAH 2EXYC 1CD0A 1FNGA 3G6JE 1ZJAA 4NZUL 4X89A 4YE0A 1A9BB 4WU5A 4KMQA 1MSWD 2WWMC 3AEIA 4NJAH 2P5EA 1UATA 1L0QA 3MO1B 4JL2A 4D7SA 3ZKNC 2W60A 1R19A 1W72A 4JFED 4NKOA 1H2LA 4XGZA 1RPRA 3UO1L 1XO8A 1GOHA 3MBEB 3CRQA 1IBDA 4KZDL 4FL4B 1IGML 2FO4B 2PO6B 4YDJB 4ELKB 4BIOA 1R6KA 2E75C 3D05A 3HR6A 4PQXA 1B0GA 3T4AA 2LLNA 2EVHA 1W80A 4GRLC 2IU3A 2BCKB 2C7FA 2M26A 3DMMB 1PW3A 5EZOH 4ECNA 1E30A 4PJEB 3EDKA 2BXYA 2Y6SC 1N33B 3MRRB 5D7JA 5ESVB 3RP1A 5T1KB 5AALA 1CVSC 1J5DA 3NJJA 1SY6A 1WJZA 4MDJA 3FTGB 3MZTA 1BREA 1FBIL 1FFRA 3GB7B 3TN0C 1JJUA 4A66A 1MCQA 2NMSA 2WZPD 4ODSL 3PFQA 5J9PC 2VABA 3GSNA 3LN5B 3MREB 3KCYA 4LSQH 5C0CD 5J1TC 1UZGA 4A1RA 1MLCB 1URLA 4UQ2B 3HN3A 3IJ9A 4I88A 4ZSOE 2WXRA 5I8KL 5BUPA 2B5UA 1IVTA 3LSOA 4L9LA 5JXED 1PAZA 1WDAA 2WMPA 1E4HA 3FQUB 2J3SA 1QNZH 4WIQA 3WEAA 3TYGL 1PX8A 3A24A 1X6NA 5KSBB 3FOLB 1PM9A 4UWQB 5EC1C 2FHBA 1LK2B 3TEZA 1UURA 3FX7A 2R4SL 5J11B 3FTYA 1QNIA 1QI3A 1S7VA 4KVCH 2HVKA 4OF7A 3HC3L 2D3OW 1YEDA 2B1OA 3PWUA 4R26H 1WB7A 1XSJA 4FNUA 2AZ0A 4BFFA 1AACA 2DS4A 3K79A 4WFHA 2BOBB 3D52A 4YHPA 3K2KA 2HRHA 5EUOB 5IZ7A 4X0NA 4KXZI 2ZCLL 3NCYS 1OD9A 4WI4A 3PJSA 1NUNB 4MJIB 3L73H 4LLQA 1M7DA 5EU3A 3ESNA 4KHXH 4OTXH 4U0RC 1R9FA 4L3ED 1U8LB 1JL8A 3KPOA 4JKKA 4NJ9H 3FCSB 3SY0B 4EN3D 1VP7A 1G9NL 3D3VB 3KLHC 1FWXA 1E6OL 4LF5O 1EZVX 5C2BL 4B5EA 5DZPA 4NQDA 4PJIA 5DZ9A 4FCAA 2ZD9A 3W39A 1P1VA 3VDCA 1ONQA 2MQCA 4PRAB 4CDGC 1LEKB 4J1UA 4NM8H 1XF3B 5LHIA 3O45A 3BP5A 3Q8CA 3VI3E 4Q74A 3MLTA 3TZVB 3CZUB 4YWGH 3FQXB 1AZZC 2KC0A 3WD5L 1D9KB 4YDJA 1INDH 1MCPH 4MSWB 2NY5C 1IXBA 4F92B 5MENB 2I9TB 4UNUA 1K6QL 4Z2WA 1NIFA 1X7QB 4HXAH 2NW3B 3DMMA 1PY4A 4S2SA 1XNRB 1KENL 1QTSA 3EJZC 4WDIB 2VSDA 3TWCL 1U95B 4Z7VF 3S37H 4M1DL 5A3ID 5JHDA 4AQYO 1T1XA 2WNKA 2WVTA 5M94B 1NMAL 4PTTA 4LFAO 4DV0B 1TCRB 5E6IA 4B96A 4PWFA 2HT2D 1UZ8A 5LBSL 4ZFOA 4IBUA 3U30C 2Y7OA 2PW2A 4Y88A 2J8OA 5ANMA 3FHQA 2BY1A 4WFHE 1US6A 1USQA 3LRHA 3NVQA 5D7LB 1IAIH 1WITA 4HS3B 1G7QA 2H8PA 2E27L 3NACL 4XPAH 5IHUL 3FK3A 1BVLB 1XH1A 1B9KA 2C7UA 4G7RB 1P6FA 4XNYL 2YI8A 1FXKC 3ULVE 3CIQA 5KBPA 3L3JA 4PJ9A 4O2BA 1BIIB 2VT0A 3OC5A 4CNIA 2EADA 5FOBB 5FECA 1MRDL 4X6DA 4A6YB 2XSKA 4LVNB 1G84A 4FNRA 1DFBL 1DLHB 2ZE0A 4TRPL 2UX6A 1AQMA 3MO1A 2JFCA 5C0RH 1H8EG 1XILA 3BFWA 4ACPA 4JGUA 3RX7A 4Q9QH 3OD3A 5GIRA 1Q9LB 3T0DA 3FKUS 3K59A 2E27H 5E6YA 3X12B 2CCVA 4QXVA 5LAXB 4IU2B 4GAFB 4XPBH 4ZNEE 5JVDB 3VXMA 1T2QH 1RIHL 3QEQD 5F93C 2R69L 2OMZB 1UPGA 4MMXA 5KVDL 1A7NH 5DUJA 3P0YH 1BAWA 5LNEA 4GQ9L 4DR5B 4HKBB 4WFBV 2QQKH 1Z7JA 1F41A 4LASL 3BUPA 1R6TA 4PRAA 3UCRA 4OFPA 4YUEH 3OEEG 4EZKA 1C8PA 2GITA 2XUMA 1FAIL 3R4RA 1WZKA 4JJ5A 4TRPH 1ZLVK 5D2LA 4G9FE 3BQUD 4U4BA 1KBGH 4DR6B 2Y1AA 4QJ5B 3EO1B 3JV0A 2EUXA 1S3KL 1PVHA 1QLFA 5DD3L 4TUJA 4L8BA 2ZCHL 1K34A 4MB4A 2DQIH 3AMKA 2DJUA 3QCVH 2FJSA 5A2AA 4RFEA 3HS9A 1N8ZB 2A0LD 2NY6D 1KGXA 3PV6A 2WNXA 4N0UE 3HUJB 3O3BB 3GXTA 4GXVH 4XMLH 1CI5A 2OWOA 5E6RB 4LOEA 4Z5RB 1JZ4A 3VXPA 3SY6A 2B4CL 1KPRB 4AUYA 4MX7A 1PG7W 1ET7A 3IC9A 4DV3B 1NTMH 5DQDH 1QOKA 2DB8A 3K6SA 2R1WB 4GKOA 4XMUA 1IBBA 5AVWB 3OMAB 4IU3A 4UBDD 2HSIA 4R4NC 4LF4O 1EPFA 3PCYA 1OAQL 4JGJA 4DTGL 4AL8H 1N0NA 4JQIH 5KVFE 2ATPA 3HEIB 3QZPA 3RGVD 4MNGE 1HOCA 1S9YA 1QVFU 5B3NA 4I18C 4KOBA 1JPSH 2ENYA 4L9LC 2FEDD 4IMLA 3IDXL 3FU6A 3FB6B 3FQWB 1AI1H 2QEJA 3J7HA 3MOBH 4AWJC 4HXBH 2AABH 4GRWH 3R1GH 4FF9A 2V2TA 3M1OA 3SBQA 4FZ8H 1TLKA 2EIZB 3DBXB 4OGYH 1A6ZA 4WTZA 2XZAL 3SKMA 3VGEA 4ELME 2YRBA 3QZWB 5JW5B 2FRGP 1WIOA 2HFTA 1BIHA 2AXWA 3GBML 4WTWA 3RGBA 3H9VA 4FQ2L 4FL4C 4L8CB 1B3IA 4IOSD 4N85A 4XMKH 2XN2A 5IJ9B 1VERA 2W38A 3HZKB 4JHAH 5B39B 2DM3A 5H94A 2P5WE 1HR0O 5BMVA 1CD8A 3AREB 1WEJL 4UT7L 4O02A 2DAVA 1LK3H 4QT5B 3GMOB 4V2CB 3KPTA 1MLBB 1TTCA 3VFMB 3Q3GA 3ABKB 3ARDC 3LX9A 3QDGD 3UAJD 1RJLB 4ONGL 5KAQG 2KZKA 3C3TA 3GMNB 4TN9A 4NFDA 3MJ6A 2HT4C 5CU5A 3RYIB 2Z31B 1I53A 2Y2WA 2NY1C 4APQB 4AK1A 4I8DA 1UVQA 1TJMA 4MGXA 5JNYA 4UTAA 1L9NA 1O5PA 3QUMA 3GI8H 3I6LE 3FO2B 5LQBH 3I9AA 3F6JA 4WQOA 5MEPB 3WOVA 1Q5OA 3ZKSD 3L3OB 5GZNC 4FYSA 1NCOA 1SMDA 2NY4C 5JIQA 3CFEA 4MA7L 3WSQH 1XR9A 3KE0A 5MI0B 1JVKA 3JALB 4DUXA 2IWEA 5DRXB 5TJWK 1BZ9A 5DYFA 3ARBD 1SKVA 4MXWH 4OKDA 2BVUA 4X8XA 1TKWA 5E23A 3MHZA 4OCRH 3TN0A 3TV3L 5FFLA 4F27A 1PCSA 4LCUA 4PJ6A 1N6VA 4CBZA 1Y6NR 3SYPA 2R9IA 4XBFA 1PZSA 3KPSD 2JXMB 3QXTA 4IIQB 3QI9B 2XG5B 1AD9B 4KROB 4I4WB 1QFUH 2VLKA 5C07D 2Q9OA 3O6FB 2P5PA 4E2OA 1TVBA 1OW0C 3OLDA 4OLWL 4XMPH 1KTLA 5EC1B 5CA0A 3VTAA 3PUUA 2H1LM 4IBLT 1PZCA 5D7LE 4J42A 4Z0XB 3X2QB 4NX0A 5BRZA 2XOTA 1TCMA 3GI9H 1J1XL 1LEGB 2FEDC 2QPSA 2XQYK 1AHWA 3QI9A 3TZVC 4J3WA 3UTPE 3ISWA 2VQUA 1ULVA 3U0TB 2ILMA 2GDSA 4PJXB 1U58B 4XNXL 5E8EB 1SXBA 4HIHB 2ADYA 2ADFL 4IS6B 4JZNA 1UM6L 5ACLA 3AK1A 3ASOB 4HC1L 2N05A 4DR7B 1MAMH 1G9NC 2P8PB 1CEZA 4XO3A 3T04D 2PWHA 4NSKA 4X8JB 2E7DA 2QQLH 1S5IH 3I2CL 2E3VA 1I1YB 2M8XA 3DX8A 4LQFH 4FLYA 1JGEA 1HNWO 4MMXC 1KBWA 1MI5D 2FE0A 3MRIB 3TCLB 5CHNB 1QU7A 1DQQA 2F4VB 1B9ZA 3ZTDC 5I2IA 5DO2C 2YJLA 2B77A 3DOSA 1X5FA 4X5XA 3W0WE 4P9OA 4CMHB 4U1JB 1T5XA 5K9JL 4GG6E 3C3SA 3RG1C 2C4FT 3EJYC 2BVTA 4LEBA 4OKVB 5C3TA 5L88L 1A1NB 1NCAL 4OGQC 5B22A 4E4EA 5KBMA 2MEJB 1XIWB 3RZWA 2YD9A 3VXSD 1UFUA 3I3DA 4OLYL 3S34H 5SWZA 3VMOA 1UKQA 1SLUA 4AYFA 2YXFA 4H37A 3D9AH 2K1MA 1ITBB 3WE1A 3HMWL 5IVZA 1E42A 4NGHL 4QPEA 3O2WL 3H9SE 3INUL 3JTTB 2P1YA 1ZE3H 2PXYD 3G6AB 4AIEA 5BO1L 3NFPA 3QUZB 1OAZH 5CBAB 4H26B 4DVRH 4LCUB 1VADB 2APWA 3UO1H 2ZCHH 5DJXA 1BSIA 5L2KD 3N41B 2IFFH 3QWRA 1BF5A 3VGDA 3CSBA 2X0VA 4OZFG 4X5QA 3GI9L 1U3NA 4PGCA 4AV0A 3EGXB 4LPYA 4JI4O 1TZGL 4JVPA 5B1KA 1A7BA 1IC5L 3AB0C 3U10A 1JA8A 1W0KG 2EYTB 3B2MA 4HK0A 5FYKH 1IM9A 4ZOEA 4FXKA 2JQMA 3I02A 1AY1L 4QD2E 1E28B 2BNUA 4TF4A 1PZAA 2IH1A 2O57A 2QDOA 1XTLA 4PW4A 5DJXB 4H5SB 3MODL 1DN0B 5C7ZA 3DTDA 3K6DA 1XCXA 1GGCL 4WEUD 1JR9A 3NIGF 1X9QA 4LKXA 4CW1B 3OKMB 5EN3A 3VJ6A 4FFBB 1NM9A 2VZ1A 1SLVA 2VLME 4FHBD 3AT9A 4PJBA 2WJ7A 3EJQA 1NEZB 4QOKB 4HK0B 4WUUA 3VRLF 2X41A 4ELMB 5I1AA 4GP4B 1CTNA 2E4TA 5SWSB 2FQGA 2XPGB 5FIEA 3QULB 5CN1A 1JPGB 3MLZL 3NRFA 3RTQD 2Q7YB 2V17H 4HS8L 5F89B 4X62B 1SYSA 2IOMA 5CZXD 2YD8A 3MNVA 2ZG1A 4W70A 5DJDA 1NGWA 4XX5A 3AZUA 5D5ME 5HGHA 3B3IB 1EJOH 1ZTEA 1NLDH 4XPGH 4ZUUB 2AK4A 2R7EA 2IBZH 2RNBA 4X0KA 5ESQA 3QNEA 3C2AL 4OZIA 3IAQA 3PJNA 5F1OB 4QHUB 4N90E 2UZYB 2ZPKH 3IB4A 1JGLL 2VL5A 4QWWD 2JCCB 5BOZG 3ARFC 5BXFA 1JX9A 2H9GA 2J21A 4XOCA 1WC7B 4KUMA 3CXFA 5ACMA 4BCZA 2XXMB 5JXAH 3CUPB 3UABA 3BA8A 5LGHH 1ERNA 4G8FA 1YF2A 2D3LA 4KMTL 2F68X 5T8IA 4KHTL 4PJBE 2BSSA 1E9OB 3L3HB 5LXVA 1UWFA 1J8RA 3B3IA 4ZUUA 5I6PA 2ZUSA 2DJVA 4PCYA 2OMVA 4YBHA 1JHTB 5AUMA 4R6ZA 2F5BH 2QA4V 3A4EA 4J3VA 1WO2A 5EIIA 4BFOA 4DO6A 4PJ5A 5I74B 3IDXH 5C8JB 4EN3C 1WFMA 4UVAA 2YSSB 4HIIB 1WTLA 4OIAA 1DDHB 5CA0B 1DFBH 2FATH 4HIEB 4KTDH 3E8FA 2X4RB 4ABUA 4DN3H 4YDNA 4MA3A 1CFNA 2VDRL 2BZDA 1A7NL 1R3JC 3BWUF 1PYWA 2GTZB 4X8CA 5HHPB 5JW4N 3CP1A 3QIUB 3P54A 4LHJB 4EUPG 3RY4A 5ERWB 3REWA 4PYHA 3GXNA 5E2TL 4BZ2L 2PXYB 3RHWK 2VXUL 4CC5A 1NIEA 1WG3A 5TTRA 1K5NA 2HMIC 9CGTA 1UD8A 4JKMA 2C3XA 2QWPB 1OW0A 4OQTH 3BKYL 2B39A 2Y7MA 3W82A 3S3JA 4HIPA 2DQIL 5EBWB 3V5DA 3L5XL 4DVBB 1Q0YL 3GBNH 1Y74A 3HE7B 4S1RH 3DYOA 3B2EE 1FFTB 1W59A 2ZP8A 4BSWA 2HT4D 4IKIA 1Z32X 4JAMA 1SXSA 4GUQA 3B8NA 2WLMA 3KPRE 5CM1A 1HHIB 5SWQB 3E0GA 5AVQB 1JNLH 3FFCD 3HR5B 1N4XH 4N90D 3R18A 1TTBA 5DVOA 2OCFD 2ID5A 2EIKC 2HKHL 5HJ3A 1ZV5A 3UCSC 1T22B 4I1NB 2OCJA 3MLUH 3CVBA 2COVD 1JV5B 3DXAE 4WFFA 1INDL 1CF8L 1VQMV 3KGRA 2BS8A 5IBUB 3JAWA 1KXVC 3FCUB 3OR7A 4YR6B 2MSPA 3J80N 1M9NA 1YEJH 2HJFB 2X3BA 4N6QA 2VM9A 4CBCA 2WLLA 5DFWH 2JKWA 2PZSA 5DO2D 3WENA 2R9HC 3OKLA 4ERSL 5IFHL 3B5GA 2PYLA 2XICA 1KWGA 4UU9B 4ZPVA 3N1FC 2CLVA 3IXAA 4Z7UE 3STZA 3VSUA 1FDLH 3HG0A 3V0VB 4ZMPA 4MA8H 4RZCB 1B3JA 1P69B 1BGXH 2VZ3A 2LFSA 1NUDA 4P9MH 3U7WL 1ORQC 3JAWB 2A5UA 3G6EV 2V7HB 1O0VA 1E8XA 1FGNL 3E89A 1FZMA 12E8H 3BA9A 1XMQB 1XGTB 2HPTA 3S3WA 3O65A 2PTTA 1CFSB 1LTXA 1OSPH 2R0LH 4K5OA 4P4KD 5FA3B 5IHUH 3T0AA 1XCQB 3ARTA 3HB3D 4MVOA 4KVPA 5D4QA 2QT6A 2UXFA 3DARA 4LLUA 2A0LA 3F7RA 3ML9A 4NUQA 4QRSB 2Z3YA 1M9WA 5IVXA 4TV9B 2B1GA 1YY8A 5F7HA 4DCQA 4CA4A 1FFQA 2QTOA 1O7DE 5AKSA 1D7FA 5IHBA 3RVXC 4OFQA 1FNEB 3NESA 4KQ4H 3AAZA 1Z5HA 4S1RL 1HXKA 3IRPX 5D2NA 3WDIA 2NTSP 4DGYH 3FB5A 4LLVA 3GSWB 3IFLH 4M00A 4Q89A 1G7LB 4ODVL 3X14B 2XG4A 4MQTB 2YAOA 4W9KC 1YTFB 3TH2T 1IO4C 3K71B 5F1IA 5J12C 2Y2TA 1KWKA 1M2VA 3QNYB 1JGLH 4O51B 4TV9A 1YY8B 1I3VA 4MWFB 2XWDA 2WA3A 1VB9A 5B8CA 3FU8A 4DK1A 3CC5A 2FJFB 1IX2A 3BWAB 1XUQA 1FJ1B 2ZIDA 3KPPA 4K94H 3NFNA 4X98A 5FLUA 1IGCL 3GFUA 1V3MA 3BEHA 1ACCA 1JF5A 4V1DA 5D8JL 4UTAH 2WSKA 5BJTA 2UWEB 2EXWD 1SJVA 3T2NH 4J1UB 3RY6A 3TF7C 3QFJA 1DBAL 5CLYA 4YJ2B 4PJGA 3GIZH 3MV11 2CG9X 5D1QC 1ZSDB 5T1MA 5FYKL 5I71C 1ZHKA 4E41D 3ML8A 4U3FH 1WD8A 2ROXA 3QPQC 1EV2E 4Y1AE 3OSVA 2J72A 1K9TA 4ZXBC 1MI5E 3EUUA 1DQVA 4L3AA 4OLUL 5B66Z 2Y23A 2X9ZA 3ILPB 3PS6A 4DKTA 3W56A 4HKBA 2DIJA 4O5LL 4P2AA 1SDDA 2VMJA 5I1GH 4GLRI 3RWDA 2V7NB 4NB7A 4P4KC 2FB5A 2WLLB 2C9XA 4ZO8A 2XASA 1KLUA 4R4BB 3EO9L 3MXWH 3KCXA 2PKDA 3QR0A 1AXIB 1FRGL 2CAKA 4QRRE 4IIJA 1MHCB 3DHMA 5IB2B 3ORJA 5LXTB 4LL1A 1AVAA 4LF6B 4HQQL 2P5WA 3WTWA 3ZMVA 4M62L 3SYAA 3RJOA 2BIPA 2W9DL 5FHBH 1MLCA 3APDA 1KLGA 4YDZA 2DYSB 1JS4A 3ROLA 3KLSA 2IFFL 4OZIE 2R9HD 2JJVA 4N0RA 2X7RB 5FO7B 5IEKA 1T0MB 5D5MA 3WN5A 5IT9N 5AW5B 2YAEA 5H37H 4I89A 3L3KB 1Y6MR 2H6PA 3P2TA 4AJWA 1HXYA 4B3TO 1RUQL 3ZDZE 2WINB 2FLRT 2XA3A 4MCNA 4Z7IA 4OCYL 1UXSB 4CADA 1Y74B 3HE7A 4KUZL 4UV4L 5J6GB 1P7QB 1DJWA 5FM4A 4NQVB 2NNAA 3CAFA 4GS7C 4W4OA 5EO9A 5L8KB 2WN3A 4HBCL 2KQXA 2PYED 1TQCB 1EJFA 3VI4F 3FB6A 3FQWA 3KPRD 1WNSA 5C0BB 3SCMC 1A4JB 4M8QB 5EF3A 4TQHA 4IBQA 3U6RB 3VFWA 3X12A 3JTSA 3RGVC 1ACYH 4TOIA 3PDDA 5C09E 5F7DB 1Q72H 3HFFA 1OP5K 2FJGB 4J6RH 4K73A 1LMIA 2B5IC 4OIIL 3NPZB 2CO2A 4Y2NA 1OPGH 2DQDH 3D4ZA 3K5RA 4MCYA 4MMYA 4R97B 1X5MA 4DRXB 3SE4C 2XRAL 5AVUB 3OGOE 3QUXB 3ZMZA 1E4XI 1T6BX 2YK1H 4O4IA 4KH9A 4DR2O 3IMBA 2QV4A 2NYYC 2VLJD 3QPXL 1BFOA 1YDXA 3CPLB 4YWGL 3ZDWA 4BCYA 4JPRA 5BMVB 2NY7H 4FQXC 4W1TA 3CPUA 4JF3A 1RZGB 1I8LC 5ESAA 3WKQA 4NGHH 4CN4A 3WB0A 2XLLA 3MDJA 4MCYB 3Q3GB 1VEWA 2R0KH 5DC0A 3GXIA 4TSBL 3OR7C 1AO7A 4L5FL 4DV4O 4WFFE 2HWZH 2PI4A 5L2KE 5E0QA 1KT2B 4OXSA 4JKWA 4RWYH 4JG0H 2O5NA 1VFAB 4N2BA 1VQ4V 3G5YB 1DQIA 6TAAA 2E5LO 1F8TH 3FTWA 2GJRA 4ZS7H 1XF5B 4GG6A 2Q7EA 4L8SC 5IB4B 4IIZA 3EZ8A 4FG2A 5KJRH 4NXNO 1D6VH 1Y1DA 2FTKA 1IAOA 1QBML 3QJHA 4PJ5E 2IAMC 3CE2A 1SPDA 2AEPL 1IBGL 1M57C 1FFOB 4LLVB 5MEQB 4RMWA 2E47A 3N0PB 1CFVL 3KXFA 3L48A 3U1SH 2PPDA 4YXHH 3QUKA 3UTOA 4YSPA 2XBDA 4O2CA 4PJIF 3SBRA 4Z77A 3GBLA 2LT9A 4XCYA 2YEVB 3CDCA 1U36A 1W9XA 4XMTA 3ZE2B 1DVFC 1GN2A 2WBJB 4QXWA 1VA9A 4NP4H 3RB7A 4JZJC 1A3QA 1ZAUA 5TQ0L 1UENA 1KGUA 4P5RA 1H0DA 2P4KA 2GCYB 3OXSB 1S7SA 1Z6JT 3AU1B 5JOPE 3RE0A 1WT5C 1MWAL 4FQQA 1M1XA 1MJUL 3NZ8A 5EC1A 3LRLA 5C3IA 2KQMA 2F53B 1HJCA 4WTXA 1J8SA 1BHAA 3WAKA 4L8DA 3P0YL 1BQSA 3H2PA 2UU9B 5MEND 3ILPA 4IRJC 5IF0B 1P84F 1YQ2A 5FCSH 4XC1H 1N5YL 1KJ3L 3UPCA 5FF6A 2DIAA 1H8HG 3H42H 1K8IB 3RZCD 1YSOA 1YUHA 3IPEA 1PCXA 1L9SA 3NZ8B 2IF7A 4P3DB 1N32B 1KB5L 2YUWA 4R5VA 4JJ5B 4D3CH 5B38G 5JIIA 5CB4B 2FGZA 5IQ9B 2BVQA 2PNDA 4C7UA 4X6BA 3MYJB 1AAJA 4WHYH 2AW9A 1NEPA 1KPUB 4PJCB 5MEOB 3D4YA 2HFFB 4WBNB 4YZWA 5LCVA 4WV1A 4DUVA 1KGWA 3FRPB 3PQYA 3MUJA 4TPRH 1UT2A 2LJ2A 1KT2A 2AQTA 3ATEA 4Y89A 2VDKH 3C5ZD 4L87A 1HWYA 4N8VB 3F7PC 2Q6AA 4DO5A 3T1HO 2QV2A 1OSEA 3DRTB 4A7QA 4NQCE 5J6GA 1GM9A 3ZSTA 1E4WH 4L23A 4YHOL 2HRPH 3MBXL 2DDQL 3RJQB 4LRIC 2AK4D 4DPRA 1N5AA 1U9KA 1VZIA 3MGOB 1PD3A 1XSOA 4G43A 2X1XR 4TTDC 3ATAA 1L6XA 3A0HZ 2F74A 1CFMA 2CLZB 2Y07L 1MZYA 4ZUWA 2N1TE 3WMSA 1K92A 1J7VR 1EZLA 2IPKB 2G4EA 1T2JA 1I8MB 3I6LD 4BW9A 1SNRA 1F3JB 2OW7A 3UJJH 1QLNA 1LO5A 5E1AC 2DQCH 4MNQE 4NPYB 1S5JA 1JE6A 3F7VC 1ZT4A 2DYPD 1A14L 4YO0A 2GSGB 1GR7A 3X3FL 3U0PA 2R8SL 3ROOB 3CPLA 4NIKB 3KJ4C 1LR1A 1LJMA 3CVDA 3JVGA 1U91B 4YC2B 3MRKB 3F5WB 5BW7C 1PLGL 2RMNA 3KWXA 4N2FA 3QUYD 5FA4B 3VWJD 4XBPB 2FATL 4J41A 4X80L 5FM8A 1F86A 5IF0A 1ZSHA 4OCYH 2A74A 3VFOA 2FJUB 1DN0A 5FHAH 1YIJV 1E9PB 4E5XG 4I0XB 3D30A 1AO7B 3QIUD 2GUZB 2QKSA 1EEQA 3PABB 3VFUB 4N5UA 1DVSA 1COBA 2JB6B 2X7LA 4MMZA 2QTVA 4TLUA 5E1QA 2CDGA 5GJTH 1H6EA 3JSNA 1XGQA 4QHMB 3UO8B 3QWOB 3RY5A 1IGTB 4MNHA 3TA4D 1OIOA 2ITCC 5KSBF 4AEIL 5EOTA 4ONHA 4GOSA 4K8RH 5LMUO 3IJYA 3L8QA 5F3FA 5HGDB 1KJ2B 4JM2D 2QVIA 4X7FC 1CICB 2E46A 2Q7YA 3P4LA 5B1AC 1RQ5A 5LAPA 4A2DA 4AGOA 1N59B 5FOJA 2X2JA 3MLYL 3BXNB 3FQTB 5EU5B 4ILDA 1EH9A 2R4SH 3ZZSA 3JZYA 4GKSB 3PGFL 3ZKND 3C60B 3DUSB 3BCFA 3ZRXA 2DQJL 1NFIA 3VU1A 3WLWC 1FVCA 3RU8L 1AFVH 4NWTL 2IOOA 2ARJA 1G0DA 3OMIB 1AZNA 4HJJL 2R23A 3BGMA 2RFXB 3LY6A 1U6AH 1ZANH 4DZBB 3RVWD 2RIKA 4B95C 4I85A 3CUPA 4M3HA 4CC1A 1IFHL 1UFGA 1YEGL 2FB4L 2HA1A 4WSGA 5KSAB 1ZV2A 4AEEA<