2EIMB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 60
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eimB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eimB02
1JERA 2YXVA 2OJ1A 3BQVA 2FQEA 2YAMA 2MTAA 2VW6A 3OD3A 1BAWA 5I6PA 4GY4A 1AZUA 4A67A 1JZEA 1L9RA 1AS7A 1UATA 2FT8A 3L45A 1TEFA 1WA2X 1CURA 3TASA 4FAAB 1AZNA 2JFCA 3QJQB 3UACA 1YLBB 1EHKB 2FNWA 3D12B 1ZIBA 4NB7A 2IH9A 4RH4A 3EH4B 2CALA 1A4CA 2YARA 3FSWA 5I5JA 3S8GB 2YAHA 4ZK8A 4G7QB 3NSCA 3ZDWA 1GS7A 2GHZA 2PCFA 4HAKA 1NIAA 3AY2A 3EH3B 3WKPA 1ASPA 1J9SA 4AX3A 4BK5C 1JZJA 5D4HA 3TBBA 3ZIYA 2HX9A 1ILUA 3FS9A 3V9EA 1X9UA 2OV0A 5I6OA 2VMJA 1QLEB 2UXGA 1XB6A 2YQBA 3G5WA 4BWTA 1AG0A 1XMEB 4F2FA 4DP6X 2EIMB 1IUZA 3PPSA 4DP4X 1PZAA 3NJLA 3NP4A 1AZCA 1CC3A 3QPKA 3WG7B 5F7BA 2WO2B 2H47C 4E9XA 4HCFA 3PAZA 2CAKA 3IN2A 2VSKB 3SBRA 4UAHA 2CBPA 3SBPA 2YXWA 3T6ZA 3OM3B 1T5KA 1EZLA 3WI9A 2IDFA 1PNCA 4GP4B 4DP7X 2BP0B 2BZCA 3NT0A 1E5YA 2BWDA 4G70B 3CZUB 1JZIA 3S3CB 3OMAB 3PAUA 2YAOA 3NJIA 2IWEA 1ASOA 2PPAA 4YVUA 4AKPA 1URIA 1ZDSA 2PLTA 1KDIA 1PCSA 3DIVA 1AR1B 5IY5B 4CSZA 2VN3A 1AZRA 1QHQA 3FSVA 4ENZA 2UXFA 2DWSA 2J5WA 1TEGA 2J55A 2UXTA 4YSCA 2IDQA 4N8UA 3DTUB 1IKOP 3ABGA 1GW0A 3EH5B 4UF7C 4YSDA 3FPXA 1ZDQA 4G7SB 1PLBA 4DP8X 1A4AA 3UABA 2AZAA 1MZZA 2XXFA 3EHBB 3TA4D 2I7SA 5FC9A 4NAJA 5B1JA 3FYEB 2FT6A 3FU7B 4WKXA 1GYCA 4K9JA 1ET7A 2BP8A 4KOCA 1J9QA 1V54B 2PP9A 1NIDA 4GP5B 1E65A 5AFAA 2AANA 2XU9A 3QJVB 1L9OA 2QDVA 3H56A 2CJ3A 1AANA 2W88A 4HHWA 4E9VA 5I6NA 1RKRA 1VLXA 5D4JA 3T6VA 1JZGA 1PMYA 4KOBA 1AS8A 2PP8A 3UGEA 1RZPA 1SFHA 2XYBA 5B1KA 2CUAA 1AG6A 1SNRA 2HRGA 2PPFA 5I6MA 4P5SA 1BQKA 3UAEA 3FU9A 2GSMB 3T9WA 4F2EA 1JZFA 4G7RB 1KYAA 2AVFA 1AAJA 3CG8A 4L0PB 5AZUA 4E9WA 2TSAA 2VW7A 5B1BB 1M56B 1W6WA 2FQFA 3SQRA 3FQ1A 1IBYA 9PCYA 1JXGA 4W9ZA 2P80D 4YSUA 4G72B 1E30A 2E86A 1KDJA 4PAZA 6PAZA 2Q5BA 5B7EA 2XV3A 4E9YA 3IEAA 4HZ1A 3WIAA 4W1TA 1WAEA 1CYWA 3NJMA 1NIEA 4BWWA 4P5RA 4E9RA 3NSDA 3ZBMA 1V55B 4A66A 4FA7B 2IDUA 3PXLA 5TK4A 5B7MA 3CVBA 2YAPA 1JXFA 2XX1A 3OMIB 1PAZA 2BWIA 4TXVB 4NERA 2GC4C 1WA0X 2R7EB 2B08A 2FTAA 3QJRB 1FA4A 2I7OA 2BHFA 4DP0X 2PPEA 1NPJA 1KCWA 1A3ZA 3CVCA 2BP0A 2RACA 3QJSB 3U25A 2XX0A 2Y69B 2J57A 4BXVA 1JVOA 4DPCX 4A2GA 1NIFA 4DPBX 1XB3A 1L9QA 3X1EA 2HX8A 1IBZA 1ID2A 1SJMA 1X9RA 1J5CA 1GR7A 1PNDA 1L9SA 2BP8B 2H3XC 2JKWA 3GYRA 1NZRA 1ILSA 3MX0B 4MFHA 4G71B 2FQDA 4KO6A 2A3TA 1HAWA 2X88A 4UANA 3T6XA 4YSOA 3NJJA 4QLWA 1NPNA 2P80A 4EF3A 1OCOB 5I6LA 3RYMA 2CCWA 2I85A 1AOZA 3WKQA 1PF3A 2QT6A 1JXDA 1HAUA 4KO7A 1J5DA 3TBCA 2HZHA 3FQ2A 4YSAA 1IC0A 5EHFA 3UADA 1OE1A 4X4KA 1CUOA 1SDDA 2IWKA 2TSBA 1V10A 4DP1X 4JHUA 4KO9A 3PCYA 3PLYA 2IWFA 4CSPA 1QNIA 1M57B 2BW4A 1GY1A 3NSYA 1GY2A 2IDTA 1L9TA 3QQXA 2VW4A 2XUWA 8PAZA 2ZXWB 1OV8A 1OF0A 3OMNB 2BO0A 2ZOOA 4KNSA 1W6LA 3IBOA 1B3IA 4GXFA 2QDWA 2Y1AA 2YAEA 1A8ZA 3NSFA 3ASOB 1ETJA 1W8EA 5B1AB 2B3IA 2GBAA 1J9TA 2XWZA 3AG3B 2HRHA 3ABLB 2FT7A 4E9TA 4DPAX 1PLCA 2EIJB 1ZV2A 2UX6A 3UAAA 4BXSV 1NINA 2H5UA 3HB3B 3FT0A 4HIPA 5I26A 5A7EA 1XB8A 2PPDA 5F7AA 4E9QA 2ZWNA 1NIBA 1AS6A 3N2JA 1MG2C 3NJGA 1SF3A 3NP3A 3EF4A 2VSMB 3IE9A 4AI7A 3V9CA 1ET5A 1BXUA 2DWTA 2OCCB 3JT2A 3S3BB 2HXAA 2GI0A 4YSEA 2QPDB 1WS7A 2ZONA 1OCCB 1R1CA 3FYIB 3X1GA 1NDTA 2JXMA 4A2DA 2IH8A 4E9SA 3ASNB 1MDAA 5B3SB 3X1NA 5I6KA 1JZHA 3H4HA 5ANHA 3T71A 2J56A 3S8FB 1AIZA 6PCYA 3CDZB 2XV2A 4BDVA 4GP8B 1JOIA 2Q9OA 4DP9X 3PAVA 1KBWA 3JTBA 2PP7A 3AW5A 5D4IA 1ZIAA 2BW5A 2UXVA 2QPEB 1KGYE 4DP5X 4BDVB 1ET8A 1OCZB 3CDZA 3GDCA 4HCGA 4WTQA 3ZX1A 7PAZA 1FFTB 3N55A 5I5IA 1RZQA 3KW8A 2DYRB 3H4FA 2GIMA 3X2QB 1NWPA 1WA1X 1OE2A 3OQRA 2IDSA 4M3HA 4Q8BA 1I53A 3FPYA 1NWOA 2FQGA 1PZCA 1SFDA 2NRDA 5AKRA 4A68A 1MG3C 1N70A 1WS8A 3QJTB 1BQ5A 2HLEB 3IN0A 4KNTA 1PLAA 3NJHA 3GXUB 2HX7A 3FSZA 2X87A 1OCRB 1PZBA 3NJKA 2AZUA 4YL4A 1KCBA 3HEIB 2R7EA 3MBWB 1N68A 2DY2A 2FJSA 2MRYA 1ADWA 2W8CA 3WNIA 1FWXA 3NYKA 2GB2A 1L9PA 4YVNA 2XLLA 1MZYA 2YAQA 1GS6X 3X1FA 4KNUA 5TK2A 2DV6A 1NICA 2VM4A 1GS8A 7PCYA 1NTDA 1KBVA 4N4YB 2XV0A 3DKHA 4YSSA 2WO3B 1BQRA 5PCYA 3FSAA 1BXVA 5PAZA 3SBQA 4M4RB 4PCYA 1BXAA 1OE3A 3WNJA 2EIKB 5I5MA 3S3DB 1AACA 3FU7A 3T6WA 3X1BA 4A2HA 4Q89A 5B1JC 2XVBA 4GYBA 2LLNA 1J9RA 4HCIA 4JHVA 1M9WA 2UX7A 3KW7A 2N0MA 4A2EA 1SDDB 2BZ7A 2IAAC 4JKNA 1JVLA 2GC7C 2DYSB 5LDUA 4QKTA 3AZUA 1AZBA 2PCYA 1ASQA 3QJUB 1F56A 1BYOA 1A65A 1DYZA 4YSQA 4KO5A 1BYPA 3AG1B 4AKOA 2EINB 3NJNA 1AQ8A 2EILB 1SHXA 5E9NA 1TU2A 3ERXA 3NJFA 1RCYA 4HHGA 1OOWA 1SF5A 4YSRA 3AG2B 1SHWA 3C75A 4BWUA 1TKWA 2VM3A 4HALA 4F7KA 4AZUA 2YAFA 1ZPUA 1E67A 3FQYA 2PPCA 3BVDB 2AFNA 5B7FA 1HFUA 3ABMB 4YSTA 3CVDA 3FU8A 2WSDA 2XXGA 4A2FA 3AG4B 4AKQA 1BEXA 2FWLB 3ABKB 4YSPA 2YEVB 3TU6A 4DP2X 1GSKA 1KV7A 1PY0A 5I28A 1DZ0A 1A4BA 1E5ZA 1CYXA
chains in the Genus database with same CATH superfamily
3C87A 2P26A 1M71A 2Z7YA 4HULB 3MODH 4ZMVA 3G5VA 4Z1VA 4NYLB 2YAMA 3MJ9L 3RT3C 5BPPA 1FYHB 4AVIA 1EHLH 3JZ7A 1A6ZB 1IBHA 1YEFL 1G7PB 5JPNA 4HYOA 1ADQA 1KBPA 4DO4A 1B0RB 1MXDA 3OKEB 4G42B 4BCXA 2VN7A 4YK4C 1IMHC 2Q8AH 1E40A 1NFIA 4FAAB 4AQAB 2UZIL 3L3OB 2VR4A 1YLBB 4NZRL 4A6YA 3D12B 3B9AA 5LHDA 3VX0A 4L5FE 4LL1A 3TJTA 1KIUB 5BZDB 1ES0B 4XP1L 3VD2A 2BY2A 4I88A 3K7UA 5DHYA 3I9PA 2VS0A 1YXBA 2DD8H 3BDYL 4PEEA 1YUHA 1GS7A 4NPYA 4PJ5E 1D9KC 4PS8A 5ERWB 3K6FA 1EHAA 3ML8A 4WU7B 1TQCC 1XGTB 2ZAIA 3WKPA 3HBQA 2XA8H 1TQBB 2XWJA 5EOQH 2EUXA 1JGIA 4U1GB 4RZCB 1WAAE 1B6UA 3O9WB 4PW3A 4FKKA 1UA6L 2XZAL 4L1SA 1YDPA 1AG0A 4J3OH 4NKIH 4LNUB 4NWTL 1Y6KR 1A22B 1IC5L 3KWVA 5IB5B 1G0XA 3L1FA 2YIHA 3EADA 2W0PA 3PE9A 1SMOA 4MJHA 2IIJA 4HC1A 5ESAA 5FYJD 1NCNA 4X1YB 1GZHA 5TPWH 1ZVYA 2JJ2G 4E41D 5LGJB 3BO8A 1A9EA 2ETNA 4JFQB 2OKMA 4Z7VF 3CC1A 1M2OA 3JUYA 4LCCB 2G60L 3CVHA 3TBVA 2OIGA 3CV5A 1K9MW 1DVZA 4JREB 4J39A 2VSKB 3QI9D 3QDMB 2K1MA 3CUPB 5CZXD 2ODHA 5DXWA 4YHIB 1UXLA 3RIFK 2CAZC 2VUOA 4BQ8A 4AUJA 1NCAH 5ACLA 4HP5A 1MUJB 3DHPA 2J43A 4RIRA 4HV8B 4WCYL 2HFEB 3FMGL 1YHQV 1TLMA 3QXVA 4FM2A 4EO5A 5EN3A 1LMIA 1H9DA 5D5MA 4FNQA 3SCMA 3IFPA 3BKYL 2F58L 2FGWH 3UJTL 3O9WA 1AQDB 1YNKH 3SO3C 1AI1H 5LBGA 5ILTL 3QNZB 3CX5J 2H2SD 3TEYA 1MJ8H 4N8VB 4X5XB 1EGJH 1IKFH 1ROCA 4ZMTA 4YXHL 4PRHD 3MNWB 2R23B 4NQDA 1KBHA 4P05A 3NTCH 4P23A 1YN6B 5E5LA 4X8XA 3TLRA 1E7UA 3MZTA 3GJEA 5FO7A 1CCZA 3EDJA 1GW0A 3AU1B 3WEBA 3E83A 3RUGF 3GBML 3ZUNC 4DGVL 1BD2D 2DQMA 4HWZB 1MLCA 1A6WL 4FD0A 2NMSA 4QOKB 2I7SA 3TTSA 4NAJA 5D1ZC 3SDLA 4M56A 2NR6A 3WLWD 1ZGLP 3RGVB 4HFWA 3NUKA 4GNKB 5K9JH 3GKZA 3MCYA 3T1HB 1L3WA 5EZIH 5AFAA 1KEGH 4JN2B 4PI0A 2O6FA 1ADQL 4N2NA 2WV3A 2OMNA 3BXNB 2GJZB 1SYSA 1GMEA 3BO8B 3Q9PA 3L3KB 1F1AA 4PRDA 4YDLB 3QJHB 4UQIM 1EN4A 1JMKC 5B4MD 4CILA 4LL4A 3VI3A 4ZNEE 2HFFB 4JPQA 3QQ9D 3H9HA 3HZMA 1QR1A 4J2XA 1U6AL 4AENA 2BFVH 4WNSA 3OT7A 1WSST 1JZFA 1TQTA 3QZWA 1CLOL 4E9LA 4FFWC 4R0LC 3MRMB 5I75C 4ZTOL 3T4YA 1NTMH 3FUJA 3Q0HA 4N2HA 2J3SA 4NN7B 4B3EA 1P6AB 3QYNA 2VO8A 4QRPE 1MCEA 4K3HA 4I5BB 1OSEA 2V2TA 4OCYL 2E6QA 3CSGA 9PCYA 3BIKB 3PWPD 4QWWC 5D7KD 4BH8B 5D1XA 3QTCA 1X5AA 4OF8A 4CVUA 1BJMA 2XV3A 4MJ6B 4D8OA 3OKDA 2CJUL 4UV7L 2CSPA 4DKFL 4HKJA 2EKSA 5FFLA 4RGND 1MABG 3JAWA 4ZQKA 1OT1A 3DWTA 3E9UA 1SQMA 4QY8B 3G5ZA 2PO6D 3FW6A 3CVHL 5DJXB 1EZVX 4WV1C 1I1CA 1JFFA 3APOA 5E2VH 5A16B 3ZTCC 1JK8B 2H6UA 3CC5A 4QXUL 3I75A 1H5BA 2VWEC 4YHKH 3TA3C 4Z8FH 3GSQA 4UQ9A 4D8PA 3ZBHA 5H4ZA 4RRPM 4TSCH 2JF1A 2QGEA 4RGOH 2XOKG 4QRQA 4XNAA 2Y22A 3VXSE 3GSRA 1O7DE 4OAWB 5FYLL 1RD6A 1YZBA 2K8MA 2XOTA 3QFJE 3QJSB 5I8KH 4YLBA 1A0QL 2DQCH 1SS3A 1IVTA 1Z9OA 3H1LH 3RN4A 4JM2F 5F71A 3T0EB 1TLKA 3RWEB 1Q43A 1UB5A 2HVKA 3S5LG 5EEZA 4N0CD 3MRDB 1U8PA 3QZOA 4OM1H 5EOCJ 5JW4M 3ROLA 2YIBD 1LL1A 4MSWA 3MX0B 4XOBA 3BEVB 3M6DA 1FFRA 1I8KB 1X5FA 3GSRB 3VXME 1ZHKA 2WN2A 2OL3B 4FEMA 5L2KD 1UKTA 5GGTL 2WAMA 1T0MA 4RBPH 4ZS7L 2WTRA 3L6FB 2P80A 4F92B 5HYFA 1BQ0A 4PWIA 2X6BA 5L3BA 5J3HD 3K8LA 2ZR2A 3I75B 2OX5A 4W70A 4D9RD 4ETQA 4S1SL 1Z5WA 5LP6A 2UXNA 2F43G 2CLZA 1PF3A 1W8NA 3E35A 3PG2A 4EI5D 2F1BA 3ZHSA 1HXMB 3ZDZB 3M17A 4AH2A 5LGHL 4LASL 3L5IA 3VXTB 3D50A 1JXKA 1OP5H 3S6CA 4EDXB 3ZYIA 4ES8A 1N67A 2HZHA 1I3RB 4D2NA 4DO5A 5I6XB 1NBZB 1VAHA 1AQKL 4HFUL 4X7CC 3DDFA 2BXYA 3AB0B 4V11A 3WXWL 1KTDA 4O2AA 5F0PB 4F2MB 2NY1D 1MZEA 2Z8RA 2BSKB 3PN1A 4OJCA 1KTKE 5EZIL 1A3RH 4RFEB 1LDSA 4Y2NA 1AC6A 3NSYA 3TJHD 1NR1A 5FUOH 4UB6Z 5CA0A 1NGPL 4LF4B 2OI9B 3IDNB 4ELKA 1K3EA 2NYYD 5IVXB 3WLWC 3RVUD 3DK0A 1HZKA 3OKYA 4Y9FA 3RWEA 1KOAA 3S37L 1SYVB 1Y0LB 3FN9A 2XYCA 4Y2DD 3NCXA 4GRWB 2XAHA 1JNNL 1N59A 3L5XL 2Q87A 1J9TA 4WV1B 3L4VA 4I0KA 4M1GL 4QRTB 4PJ5A 1WCBB 4CDHA 4KJQD 5CAYB 4F57L 1Z9MA 4WFHD 3H9HB 3HZMB 4OQTA 1E4XH 2LQTA 4BXSV 3REWB 1VFMA 1DLHB 1LE5A 4MTOA 1VPOL 4A6YH 2DWXA 4URTB 4U33A 4HMDA 1U2HA 1WAAA 3DSNB 3KHQA 2B2XL 4DKFH 2QR4A 3MRCB 2EVJA 3PUCA 2VSMB 4JO2L 3RZCC 3BAWA 3VRIA 2R9RB 2CGOA 2WQVA 1KLFA 1R0AL 1AH1A 2ADGA 1G9NL 2MOQA 1KMIZ 1ZWIC 4IK6A 3CH8A 1FFXA 5FXCH 5F88B 3FYIB 1INDL 1WICA 4IU2B 1MLCB 1W9XA 1KLGA 3JWOL 3B2XA 5H2BB 1HEHC 5JHDE 5T3ZL 2X6AA 4HS8L 2D7TL 3AU1A 3ASNB 4FFYH 4TSCL 1LP9B 4J28A 4LCWE 4O4YH 1NMCC 2EVFA 4ZG1A 2L7EA 4RWYH 3OTOO 1JZHA 1R3HA 1W91A 3NEXA 4QHMB 5C2UB 3ZZ1A 2J7LA 1AYOA 2AF2A 2IPTL 2NTFB 4FJYA 4N9GA 4LLWB 5TE4H 6PCYA 4ZFGL 3WTWA 3CCRV 1B06A 5IYDO 2Q9OA 4IRSD 3DX7B 2LOEA 1ORSB 5KG9A 4KPHL 4TM9A 2BW5A 3WXVH 5LA6A 2F95B 3KVDD 2NUTA 3ULUF 3C09B 2WQSA 4XGZB 4OSUL 4BQ6A 3D3VD 4N6RB 1IQWL 3DIFA 4WTQA 4PJ8A 1XGQA 5FUZL 5ICYB 3HC4H 5E9AA 2COVD 4OM1L 1HH6B 1I08A 5DUBB 3BZ4A 4HIEA 2RJMA 5GGTA 1WB8A 3MV01 3M1BA 3MOBL 4TLUA 1NFAA 4NQDE 2X6MA 5GRJL 3RNKB 3RRQA 2CK3G 1DVXA 5CP7A 5FO9B 1UOKA 4XRCB 1S5HB 1W0VA 4OLYL 3BISA 5EO9B 1C1EH 5D7IB 3U83A 1XHZA 3R8BB 1GVIA 1N0JA 4P4KC 3EJSA 3OJDB 3AUVA 3LEYL 1JR9A 4F5CE 1LO3L 4GUOA 4NNPH 1PS3A 3JV6B 1XREA 1UM6H 1OCRB 1S3KH 3BAEL 1E9PB 3OZ9H 4Y19D 3OW2U 1J1XH 1EAPB 4H13B 3VQ1C 1EBOA 2GUYA 3EOBA 3E86A 4A7GA 4J3BA 1MHHB 5KUKA 1D6VL 1XH3B 2Y5TB 4I2XE 4R4FH 2N4IA 4ZS6D 4BFIB 1FVDA 4RZCA 4H5SA 4KNUA 2PTVA 5MEND 1F4YH 1DN0A 5C0AE 1TVDA 3TIEB 1DANT 5K9QG 2D9CA 3RDTC 3V5DA 3ZTNL 3G6JF 4WW2A 2BY0A 4H1LB 4RESB 3A3YB 3FUFA 3HS8A 4UT9H 1J1OH 3D7PA 4XDLA 4LCUA 2DQGL 4LCWD 1HNYA 1YUHB 3B9KD 4KTDL 4NPYB 5ERWA 1FXKB 5JOEA 1AI5A 2C3VA 3EW3B 4OQTL 2NY7L 4NUMA 5E08H 4M1GH 4FQPA 1XIWA 4WFGD 3FFCA 3QCUL 4QRPA 2DQ6A 4JZJC 2QKIC 4H8WC 3VQWA 3FTVA 3KG5A 1BM3L 5LQBH 2UX7A 3QUGA 4TF4A 4PY8J 3V0WH 4A2EA 4OCSL 3ZT5A 4NC0B 3ZRWA 4I89A 4K5OA 3ZIMA 2VDMH 4NSKA 1ZLDA 1CF1A 1TZAA 2BX5A 5KHIA 4I3RL 4XOCA 1US6A 5CCHE 3E22A 2UZXA 2X1WL 1OWWA 1BYOA 3LNEA 1A65A 1JPSH 1JV5B 4JFDD 4AK2A 3WD5H 1A7NH 2XN0A 4CN1A 1P4LA 5DS1A 2WB1A 4YC2B 4PJ7E 1KXTB 3HR6A 3CDYA 1RHFA 2APFA 5C0BE 2ZKYA 1UD8A 4D9LH 3J7AU 4JI8O 1AO7B 5F2VO 3B5HA 5BO1H 5K9KA 4V2BA 1A9BA 2MQCA 4J7JA 3OVUB 5K33A 4CC4C 3A0OA 5D70H 2V2WA 1DR9A 4B3SO 4HJUA 5B1NA 1CD1A 1H15A 2YI8A 4Y4FA 4YHNB 2X3CA 5GGRB 2QVFB 4HSAC 3RY6C 1QLRB 1OALA 3OV6A 3IMVA 4HS8H 3VXSA 5IMOB 1KTRL 3ZZSA 3O0RH 3QFJA 2UUCO 4NOBA 2QGNA 1NFKA 1R3KC 3MREB 1E3ZA 1H8NA 1QRNE 4LSSH 1FNEB 5ESQB 1A4BA 2P7TA 2MIZA 3HG4A 3EFFK 3G6JA 3BQVA 4TT3G 2NYYC 2ZCEA 1ZANL 3KD4A 4QO1B 3GXPA 4HX1B 2LV4A 1U21A 1TR7A 4PRIE 3FAVA 3QXWA 3HPJA 3KDPB 4A7TA 4UNVA 1LEKA 2IAMA 3N2KB 1NKGA 4Z3FA 4ZSOA 1XXFC 1P49A 2XKNB 4P04A 3RFZC 3TXAA 2H32A 5GRYA 1PP9H 1Z5YD 5I1HH 2OXGA 1NSNL 2XPGB 4G2AA 2UUAO 3PIQA 5FECA 1V5JA 4KUCF 4OJDH 4U1GC 3IT8D 2YPLA 1U8NA 2ZJSH 4AK1A 2DMGA 2D7MA 5CBFA 4EOWH 4QHKJ 2J1KA 1N6QL 1EEYB 2MNUA 4PGBA 4RGNB 2AEOA 3AY2A 2FJFA 2VDOL 3OKMB 3G9AB 3ZR6A 4UCSA 1P7QA 1XMWA 4DK3A 2F66C 1A7QH 5DK0A 4BFNA 3DJ9A 4TUYB 3NCWA 5IQ9A 4MT8A 3OTFA 4Y4KB 3WJLA 5JDJA 2APWA 2CQVA 2XY1A 1F90L 4WI2A 4RSVA 3QUZB 3JATA 4PLOB 4YDVA 4HH9B 2VMJA 4BWTA 2P5OA 3G5WA 1XF1A 4N2FA 1CLYH 4YK4B 4UCOA 1A6AB 5K39B 2JCCA 4AYGA 1L0QA 4DP4X 1T6VN 1HE8A 2EEFA 3VFRB 1CC3A 2CRZA 4E0RA 1YEEL 4PU2A 4XNZC 1JHKH 3JCUZ 2YOCA 4H8WH 4PG2A 4QF1B 1KJMA 2XTJE 4D0DA 3MRQB 3O3EB 1IZJA 3K9SA 5LCVL 4KI5E 4WI0B 5FW8A 3GSUB 3IJ9A 2OMZA 1MLBB 3C6LD 3UYOD 4XWOD 1QFUL 4NNPL 4N0UB 4GP4B 4RDBA 3DNKA 4P9HC 4GIAA 1F45A 1IGJB 1N0XL 4PJBA 5FGCB 1EJOL 3O9WC 5I8CB 2YAOA 5JMOC 1HHKB 5CJXA 1P5VB 2CR3A 1KIPA 1QSED 2G5BB 2KZBA 1C08B 4FG4A 3GVMA 3RIKA 2VN4A 2F74B 5DHMC 4NCC1 2BPBA 4HPYL 4JI2B 3L2LA 1TNNA 4NQEE 5FKPA 4AZ8A 5CN3A 2JKJA 4Z7UF 3F01A 3FSVA 5CP3H 1BVLA 5C0CD 2MKWA 4TNEA 3QDGD 2VDRB 4LCWA 5AAWC 4M5YL 3ZRVA 3KNBB 4UDUB 3U2IA 1A14L 4OLXH 1OZTG 2IDQA 5GRVK 3WUWG 3HC3L 5ENWB 1NMCB 3MV9D 5B1CA 2ED9A 3VYNA 2CR6A 4NO0A 5MEQA 4XX5A 3MV7A 4OFYA 1BBDL 5GW7A 1ZA6A 5B1JA 3C8KB 1UD4A 3EJJX 2WO4A 2RFXA 3U9PH 2ADJA 3V0WL 1U30A 2V5MA 4OCWH 1SN5A 2WHVA 3EGDA 4I0XA 3STLA 1J9QA 2DQ0A 1FC2D 2PXYC 3SGKC 5JIIA 3H1JH 2HJDA 5DD0H 4HJJH 3QJXA 4NQVB 3UPCA 3GM8A 4K94C 3B2DC 4H2CA 4IK7A 3UTTB 5F6HJ 3VFPA 1NAML 1XCQA 4P4RA 1OAZH 2H9GA 4GRMA 3IETA 2ZP9A 4X5LA 4DO2A 2LU4A 1J11A 2CXKA 3DO4A 4J2QA 4OZHE 3TPUA 5GRWA 1OAXH 1RZPA 2DD8L 1BIIA 4DVBB 2I25N 1MNUL 5B1KA 3ZW3A 3ARDD 2R9HC 1ZSHA 2PPFA 3C5JA 4EEQA 1RFDH 3IGAC 3BKJL 4F8NA 3GSXB 4DGWC 1DBAL 4GPVA 5C07A 4JV5O 3DETC 3EJTA 4HEPG 4KVPA 4YWGL 4BH7B 3LOWA 4DN3H 8FABA 2CK0L 4WF9V 1NSNH 4KFZC 2G4EA 4TVSa 3T0BA 1IO4C 2UUBO 2VKXA 1KEMH 4LH6A 4KRPC 4P4RB 2J8UB 3FX7A 1S5LZ 3QXDB 5IB4B 3H3PL 1RZ7L 1N33O 4YFLI 2FQFA 5MEPA 3SQRA 5EO9A 1S5HA 1W0VB 3VD4A 4MMZB 3SGEH 5C0AA 5CP7B 3KPPA 2BSCA 3RVWC 3AQZA 3OPZH 3I9GL 1IL1A 3QDJB 4N2IA 4K8RC 3QFGA 4LSSL 7FABL 5TE4L 4J7ZA 2Y7QA 4HLEA 5JTWA 1IEHA 1YPZE 4U1HB 2DQ3A 3U0TB 3ZMNA 4D3CL 4CSTA 2P8PB 4OT1L 2O57A 4ZUVA 4B9FA 2AW9A 4IRZH 3CN4A 5MEPB 4E9RA 1O6SA 3NSDA 1V55B 1DP0A 1SHMA 4OM0H 4ZPTB 3DIFB 5EC2A 2ZXQA 15C8L 5IESL 1KBKA 5JIPA 3H9SD 3ULUC 3NCYP 3FFCE 3CIAA 2YAPA 2J1WA 4Q9QL 2HVBA 5LCVH 4NM8L 5DQDL 4JLRA 2V0AA 4E5XB 1CF8H 1LK3H 3TFKC 1HEZB 5GZOA 4Z1MG 5DYFA 2WLIA 3GMLA 3HNVL 4N9GB 4XODA 1EQWA 4DR6B 3NCFB 2HG5C 5EORL 4NN5B 5IB2A 3MNZA 5IV2B 2OPCA 1RJZA 3FB7A 5EZYA 2I7OA 1JPFB 3L48A 1T5WA 4OI7A 2YXYA 4GW4B 4K23H 3L1OL 5HDLA 3V52L 2Y69B 4ZMQA 1QBAA 1TTBA 2K70A 3DMMA 4A2GA 5H37G 2OMTB 2ADGB 4HWBA 1G6VK 2N3JA 1IGTB 5C0BA 4NNXA 3X1EA 5C7XH 5E56A 4L3FA 4Z0BL 1DE4A 4W4OC 2IFFL 1JGLL 1QUPA 3Q6GL 1OM3H 1NCWH 1ZHBA 2CIKB 3MVSA 1SLXA 4HS3A 4JQXC 1MRFL 4TLTA 1XEUA 3MFFA 5HYJB 3DX3A 3H7BB 1KTLB 1BQHA 2YD9A 3MGTA 3QUML 2D7NA 1LEIA 4RUFA 5HFMA 3GF8A 4JAVA 3QQ4A 4PP2A 5TF1L 3L5WA 4G6FD 1JFQL 3NZ8A 1RPRA 1KYOJ 3ARQA 4LF3A 1XR9A 4I1NB 5EU4B 3HI5H 3RL1A 3RIAK 1GJWA 4XNXH 1AOZA 1WFOA 1K8IB 1VQ9V 2Q3AA 2EECA 5F1IB 1IXMA 7CGTA 3K03A 2P8LB 4JRYE 4S1QH 3L4ZA 4N20A 1W16A 3WNLA 3EF7A 1PX8A 4X4KA 3DMMC 4JB9L 1PDKA 1MHPH 1V10A 4NQQA 4G7VL 3AREC 5CNHA 2YXFA 4W68A 4G43B 3RPIB 9CGTA 2A06H 5IQ7H 5L3EA 4HCRH 1EJOH 4ODBD 2VR7A 4PREB 5B38B 4ZSOE 1CLOH 1GY1A 1HHGB 1ZMYA 3ABTA 2VW4A 8PAZA 3CXDH 1OF0A 1NCGA 3NGBB 5AWNH 1XF5B 2ZG1A 1HX0A 1AGFB 5HDWA 3GFUA 1TJIL 4R83A 1AOHA 4IW4C 5DZVA 1LTXA 1WA8B 1RY7B 2NR6C 2X3BA 1W8EA 3GLEA 4MKMA 3KJ4C 3O3EA 4LVNB 3IPEA 3VXTA 2B1GA 4HBCL 5SV4A 4PD4F 2HRHA 5BUAA 3KVPA 4AC4A 2B7DT 5GS1A 1X5HA 3EGSB 1OP4A 1KBGH 3VD5A 1OZ0A 1OQOA 4X6BB 3C3TA 3AGVA 5IMKA 1K3ZA 4ORGA 3AXIA 4GRLC 1NBYB 3BWUF 1JGEB 1JI1A 4PJGF 1FUNA 3IDIB 3INUL 1OGAB 3NCMA 4PJHB 4QXUH 1SF3A 5CEXB 2QWPB 3DRTA 2JCCE 4XC1L 2DJMA 4X20B 1K73W 1OCZC 3OKMA 1SXAA 4Y4FB 1E6OH 2FLMA 5FYLE 1YEHH 2QPDB 3KXFD 4B95C 1AGCB 5FW6A 1NFDE 3ES6B 4R6ZA 4YLQT 5F70A 2O5ZL 3P0VL 1PPIA 1UYWL 3W11D 3FT2A 5E2UL 1E0OB 5FA4A 2BNQB 2L7UA 3ZKMD 2J73A 3BZEA 4ZXBB 3F7YA 1NH2B 5EPMA 5BZZA 2C3XA 3P11H 1HHIB 4JR9H 5ID0A 3B5TA 1Y74B 3KLAA 3KM2A 1S5JA 1BOGA 3VB8A 3T71A 2J56A 2AJVL 3BAYA 3K0GA 4LCYB 4CC0A 3OE7G 1EJ8A 4WW1B 3ECBA 3I3EA 4PJBE 4FL4B 5DURB 4AL8C 3J80N 5GGSB 3VG0L 2FO1A 3HPJB 1NBMG 4HCGA 5GJTH 1XGYH 2EVHA 2IJKA 3P73A 1VQ5V 1UQSB 2KH2B 2XICA 7PAZA 2G75A 4LR3A 1HI6B 1HKFA 1C5BL 3D2UD 1WWAX 2AKRA 3QHFL 3QUYB 4NQEA 3E3QC 3NH7L 3I9GH 3QUMA 3CFQA 4IHOB 4V1DB 1DJHA 1NWPA 2Q4PA 1YMHB 3L81A 4E2LA 3JTSA 4HJ1A 4P2QD 3D52A 1TMCB 2CE6A 1IGTA 1SFDA 1E1QG 4QTHA 4DH2A 1XGPA 2KI6A 4KAQL 1OSPH 3AWGA 3EFDH 3WY2A 1YVLA 4LF6B 4XCCH 1EZVH 4YHNA 3IN0A 1WE5A 4ONGL 1XX9C 1RUQL 1AGDB 1OARH 2JKXA 2LW7A 2V2WB 3MV7E 2UWEF 3VRJB 3PHQA 2FBRA 1JFQH 3K5NA 1CF8L 1UD3A 1PZBA 1WT5A 4RZKA 1JZ5A 3LKRB 1PVHA 2GK2A 1YJDC 4RGMC 1S7TB 1W0KG 1KJVB 1HNFA 3OLGA 4JY6B 1RP9A 5JPMA 3VTTA 4HZLB 4EI6B 3QHZL 3IAQA 4B7IA 4D0BA 3K6DA 4GX5A 4O00A 2W60B 1SMDA 4FA8A 2RGSA 3V4PA 3WMPA 4KZDH 3ENEA 4GI9A 4K9EL 3WS6A 4WFED 1ZLSL 1HHHA 1JCVA 4YS4A 3QARA 3C6LB 3IDYB 4G3YL 5E7FA 2HVJC 2JJUA 3ATBA 5GRXG 5I1IH 2KERA 1JGLH 1TZ8A 1BXVA 3W11C 5L2KE 4KTEH 3CPLB 1OTSD 3KJ4B 2L35A 4LVNC 4C47A 2AHYA 1LO5B 1MW0A 5FHBH 5T1KA 4APXB 5I8OL 3VE0A 3TEZA 4Y16D 5ACMA 4MMXC 2E9IA 1A47A 4N3UA 3HG0A 4H13C 1FYJA 5ADOH 2WM0A 2CLRB 1AR1D 1ZV5A 2N0MA 1R3JC 1YN7B 4QYOB 4JG9A 5DQ9B 5KTEH 1GOGA 3ARGD 1JAEA 4YJ3B 2Z6FA 4WW2B 5J9PA 1HNWB 1YN6A 1ULVA 4UV9A 3MRRB 4LCIL 3M7FB 4ZMWA 5GS0L 1ASQA 2XZCH 3E8GA 2Z3YA 3L9RB 3QDGB 1E8WA 4JFFE 3RKDC 3L9DA 1X6LA 4AIOA 4U7NA 3LVEA 4M93B 5HVHB 2EILB 2QQNH 4Z7VB 1LUVA 4K35A 4K3EH 4CBPA 4RDQF 4FJZA 3LPOA 3IETB 1E9PA 1HDJA 5IJKA 5IWAO 1Z9LA 3HE6B 1FFXB 1SHWA 2H6PB 3JAKB 5E8PA 2Q5ZA 2V3EA 3RVTD 1M56C 4WK2B 1JPTH 1E9QB 1NQTA 3BX7C 3V4VL 3DOIA 1WD8A 2N7SA 2MPAH 5F7UA 1E67A 5I1EL 1SQQH 2J8HA 2MHAA 3C2AL 3EGDB 3STLB 4J3UA 3IJSB 5FFGA 5HGHB 3VGDA 1N5YH 4N8CH 4R97B 3U6XS 3ATAA 1MVUA 3CVDA 4OZGF 1L0PA 4JFFB 5JR1L 5KHJA 1UEYA 2CD0A 4N0UE 3UAFA 5CJ8A 3BPOB 4EI0A 4TTDC 1NANH 3U0WL 1NBVL 3UMNA 1MCOL 3L3HA 4PJAE 1JSYA 5IF0B 1T2QH 3HW7A 2A9ML 4CMMB 1YZZA 2K9PA 2EINC 2GUZB 5CD3B 4HKXB 2NUPA 2VIRA 5TPWL 4OPHA 2DJUA 1NCBH 2ZXBA 1S76D 2R29A 5KG9B 5KVEL 4K55A 1FI8C 3VD0A 4Q9RH 4DWHA 1K4CA 1B6QA 2E9JA 4WTWA 3GZKA 2C9UA 1KIPB 2G5BA 4HUNB 1R3HB 5KJ4A 4MVUA 1KYOF 3QO7A 3TASA 1A4KA 1ACXA 3OTOB 4CS4A 1PQZA 5DC0A 3AG4C 2EE2A 5E6SB 1A6PA 5BRPA 2WP3T 1JVMA 3NJVA 4M7KH 5FK9A 1ESOA 4UBDC 1P5UC 1CDYA 3N1MC 4A6YB 1SA0A 2VLLB 4JREC 3ZE1F 3GMPB 5GGQH 1AHMA 4WI0A 3V0JA 3EH3B 5ALCH 1M7UA 1T04B 1S3RA 4LIQH 1NCCH 4UTCA 3UBXB 5L6YH 2XAFA 3BEHA 1G7LA 4K94H 6TAAA 4E41B 1N0LB 5CILH 1Y76B 4WI3A 3T4AB 1AGBA 5I6OA 2A7BA 4ODSL 4EE2A 1F6AA 2VABA 1M1KW 3WO4C 3IGAB 4JGJA 4AQ1C 3FSOA 2DOSA 4KVCH 1T0MB 2EIMB 4YO0A 3GBDA 1MFVA 4YAQA 3SKNB 5HD8C 2XY2A 1ED3A 2V33A 4X99B 2WNGA 3MD0A 1RULL 3FU3A 4X6CE 3MRDA 1Y67A 2FJFB 4I18A 5DA0B 1AP2B 3ZQWA 4MCNA 4UU9A 4RAUB 5CJXC 3BSZH 3CNKA 1C16B 4Y16B 2ITDC 3CDCA 4CUCA 5T3XL 4GZRB 3BA9A 2XQYK 2OMYB 2M83A 3E8VA 1J48A 4GQZA 1T4WA 2AK4D 4JPSA 6CGTA 5L88H 1YECL 2BSKA 1TPXC 1U8MA 3G6BA 4R50A 2YBGA 4QRQB 3RJQB 1SQVH 2IWEA 3K2IA 3GWOA 2PLTA 2XWBA 2HJKB 2G5UA 3MSPA 5JMRA 3ULUH 4YHZL 4FQIL 4AYEC 2H3KA 4X62O 4NTWA 4NP9A 4OJYA 1N5AB 4LOUC 5C0AD 4QJ5B 5KVGE 1MAMH 5BZXA 4IKKA 1XBDA 4E41A 1JPTL 1OSYA 2YLKA 5DJXA 3MGOA 4R5VA 5CMAA 1ACCA 3W7WA 4ZW6A 3W9DA 5EZPA 2ADIB 3FAXA 3VXPB 3EH5B 2ORBH 3ZPDA 1ZDQA 5FK9B 4X89A 3AMKA 3SGDI 3OKDB 2B5IC 3Q01A 2VLKB 1EHNA 2IQAB 5LOVA 5A3IC 3TA4D 2NY3B 1W0YT 3FYEB 5DZJA 1IAMA 5CZKA 4F7EA 2PWEA 4OIBA 5IWLC 1BEYL 4MNQE 4PLJC 4D94A 3ZN0A 1OCOC 3HS0B 4N90E 4X5RA 2OJZH 4ZMAT 4IHBA 2WA3A 3G04B 3IGUA 3MPCA 3RWHB 1AHWC 2HT2D 2NCMA 4W9GC 5HHOA 3KLHC 4UU9B 4APQA 1WPCA 2UUBB 2QSCH 1OCWH 3D3VB 1P4RA 3IGLA 5DLMH 3F2LA 1OGSA 1KGIA 2R51A 4P2OB 3TA3D 3GRGA 1A9BB 1LO4H 2K9FB 2HPTA 5FPRA 1VLXA 4OAWA 4MJIE 4U6HA 2C9RA 4V33A 4PJGB 3MN8A 1OAQH 4KGLA 5AKTA 2ZUSA 2HWZH 3ZJAA 2C3WA 2BDNH 3JALB 2HFFA 4F33A 5IB1A 2GTWA 3ZDZF 2YR3A 1YYML 1AR1C 3QJHA 2IAMC 3KYOA 5DWUL 4X7TA 1YCIA 2VLJE 3G08A 4Y4KC 3E1F1 5BXZA 1JE6A 5CU5A 3SO5A 2TSAA 4I4TA 5IVZB 4NPKA 5E23A 3NEOA 1QLEC 4FFBB 3QUZC 2J88H 2Z4QB 3FMGH 5CFAA 1R24B 4TVPL 3TBWA 5EIIB 2WKGA 4CJ1A 4TV9B 4GKLA 4K94L 3FH5A 3RGVA 1O75A 5DVNA 5FYKH 2B39A 4JJOA 5FIEA 5C93A 1TSHA 5EU5B 3E2HC 5C08B 2F53D 1X3DA 1PQZB 1WAAF 5D1XB 1MEXL 5JW3L 5K9OA 2FIRT 3MRFA 3GJEB 1L5GB 3UBXG 4HH8A 4X9QA 4LOUD 3GLAA 4B9CA 4C7UA 3WUZA 5BRZD 1J12A 4IBSA 5IUSA 2JV6A 4X1KB 5ICXB 3AAZA 1K7DA 4ELMF 1TJHH 1NMAH 4B27A 1F3JB 1PJ9A 5H35B 1FNGA 1N0XH 4FI8A 4XBEH 4ZOAA 5DJ2A 4YJ3A 1BGXH 1CD8A 2X70A 2BP5M 1Z0NA 5EULV 3LDCA 5L3DA 1JUFA 3GK8L 1QR8A 4DKTA 5IFHL 2WMPA 2J21A 1UXMA 3SPHA 4ZUWB 3UGXA 2IBZX 1UB6B 2PPEA 4H8QA 1NC4D 1TXKA 4LHUB 4APXA 1O7DC 2N59A 2FWSA 1P1ZA 5GISH 4JFFA 1ZE3H 4YHIA 1ZL8B 1PD1A 2HT4D 4O5LH 3UERA 4HPOH 5I73B 3MRHB 1B0GA 2SEBA 1ZVSB 4XZUB 5DR5L 2DYRC 2I27N 1ILSA 1EIBA 4A5UB 3GSNL 3X3FH 4MB1A 3ECVA 5CJQL 2H3NB 1JZ2A 1T4KB 5DUBA 1MFEL 5KVDL 3WO3B 2K0RA 5IJVA 4KH2A 1QSEA 4ALAL 4FQLH 4RWUA 4TYUA 2B3RA 4YC2C 3L70H 3GS4A 4JFPB 3D85A 4MCYA 4OZHF 4RMRA 5F7LB 4F6EA 2ZOLB 5GHWH 3FTUA 4O4JA 2NY4B 5BQDA 1GA2A 3L9RA 1ORSA 2PYLA 4BJLA 1MHEB 2AEWA 3OHXA 1HAUA 3BP6A 1B9ZA 5KSBE 4RFNB 1OGTB 3TBCA 4GX2A 3MAQA 3T0ED 4M1DH 3R0NA 1T03H 4NZTH 4ONFL 5HI3D 3VMPA 1PZ3A 3WO4B 3C6LC 3RURA 2WGXA 4XPGH 5E2WH 3A6BH 2FL4A 2CLRA 2BHUA 3A6CH 1KLGB 3C5ZD 2Q8BH 2GAZA 4J23A 4UQCA 5E4OA 5KLVH 4JI1O 2ITEA 5DHYB 5AG9A 2W0FC 1F51A 5KYNA 1N3NA 4GEJA 2X2IA 2YQ3A 4P4KA 1XL6A 2ZOUA 4ZFFB 1IGYB 2ROXA 3HRZA 3CPLA 1PGRB 2ERJB 2K7QA 3K2UH 3P73B 3KWTA 1AR5A 2WUBH 5H9CA 4W6WB 4PV8A 1I7RB 4CVZB 5CN2A 7FABH 1OPGL 1KCVL 1A6ZA 2X9YA 2WK2A 1QUNA 5A2QN 2OS7A 1CPYA 4OCLC 4OSUH 1I9JL 3EYQC 2O30A 4X6DF 4Y5VB 4OZIA 4ZUWA 4MCZB 4C58B 1IBMB 1MH5A 1VQNV 1BV8A 4D0BB 2WVSA 2C26A 4QTIH 2PW1A 3QUHA 1R5WA 1DCEA 2FYYA 4LLVA 4MAYD 4MXVF 4PJGA 4TLSA 4CNIA 1P4IL 1E8YA 3FT0A 3BZFA 5FYKL 3MHHC 4A55A 1Z5LA 3PGCA 1CI5A 4QRRA 2ICEC 2RH0A 4YBHA 4Y5XC 4HC1H 1CICB 2EC9T 2GSIA 3QA3A 4LF7B 1NOAA 3CSFA 4TUKL 1F4HA 2XRAL 4F7MA 1ET5A 3VWKD 1I4FB 3ZHTA 3LNHA 3I55V 2BS71 4MVQA 1XGTA 1SQBH 3QUZD 4NKOA 3RWDB 2Z93A 3HN8A 3FO9B 2ILLA 5D7LE 2Q0ZX 5I73C 3T3PB 2AJUL 3KPRD 3JV0A 4L8CA 1MMMA 5L8LB 4K3DL 4XE5B 1NBYA 2N56A 4TULH 1CE1H 5EZLB 1YEWA 2BDNL 2E6PA 1U4EA 1NMAL 3CZKA 4S1SH 3GK8H 5IROA 1NC2A 3A67H 4NGHL 3QH3B 4POZC 3SY6A 5CMAB 3VXUE 1H8OA 2QV2A 4PBXA 3S8FB 3DVGA 1R3IH 2DQJL 2EH8L 2HFTA 3GS7A 4RMVA 2ZNJA 1UOLA 4YDNA 3MCKA 1Y6MR 3OAAG 4MVBC 2AC0A 2LVEA 1HINH 4GI6A 5TFSL 3WU1A 1E9OB 1EX0A 1HESA 2O1AA 4JFEE 1OCZB 2YD6A 3GSNA 5DEDA 5GISL 5SWZB 1N10A 3FQRA 3GLZA 2ESVB 3P0YL 4NRZA 4S11A 4UOJA 2VDLB 3ULAB 4DTGL 3GI8H 2B1HL 1WIOA 1K72A 3V4UH 3MLXH 4RRPG 4PVBA 4E41E 4WAFA 1BJ1H 2J1ZA 3KR3L 4JFDE 4KKNA 1IGMH 4FMKA 4LBEB 5J12C 2BK8A 1BAGA 5D55A 4XCEB 3FU0A 5E9DD 5C0JA 4EIBA 1QLEL 2WQXA 3HMWL 2HVKB 2ZCLH 2XKUA 1VQ6V 4PJCA 3ETSA 3G04A 3RWHA 3SY0A 5KVDE 1KYUA 4GS7C 2FO4B 1JYWA 1BAFH 3RZCD 3H01A 1B90A 2HN7B 1TJHL 4MTMA 4DERA 1JHLH 1RHHA 1EEUA 1O5DT 4RFNC 3M99B 3WENA 3MV9B 1OKEA 4L1BA 5CS7A 4YL4A 3T8XB 1S9KC 1KECA 4XC3L 4ORGB 4RAHA 3VFUB 4KROD 3BWSA 2MRYA 3DSQA 2BHZA 2VABB 2X0WA 1GAFL 1MCPH 2NX5D 1T1ZA 5D6CA 4YVNA 5IFJB 4WEBL 4NC1C 3RUGB 1JZDC 5E0FA 1NICA 4BV1A 3CHQA 4LBEC 5FDWA 5J12B 4YDJA 3BP4A 4ZQKB 3FT9A 5HGBB 1V27A 2F6AA 4R4BB 4H0LC 2Y06H 3S34H 4I50B 2PCFB 1SA0B 2GDSA 2R4RL 3PL6C 5K59E 1CDHA 2EJ7A 3PNRB 3T65A 1BXAA 4JRFA 2EIKB 2C4XA 4IEFB 4X4XA 2D4FA 5F21B 1U8MB 1LNQA 1Q81W 3LUTB 1UWGH 3X1BA 4LWSB 2LLNA 4DR5O 2P43B 1KCVH 4PJ7F 4Z78B 4ZFGH 3DC0A 3RPIA 3QUKB 3ZMVA 3S98A 4Y16A 3FB5A 1BF8A 2W9EL 2W65A 5IHWA 1TZGL 3WKNA 4JYAB 3H9ZA 4HD5A 4XO4A 2AEPH 3QYCA 3VYOA 1FRGL 4U2ZA 5E0QA 4ZW7A 2AJXL 4F6RA 4RISH 1AE6L 2GC7C 1LP9F 3JD3A 3KBHE 3MRMA 1A2YA 3ZL2A 2BVTA 4PDMA 2WXLA 1DVFD 4FYRA 3ULSA 1CL7L 5HHVL 1R3KB 1XR9B 2YLHA 1KCSH 1NGYA 2BZDA 3DBSA 3QIBD 3ZMRA 4Z5RB 5DS8B 4JR9L 1ORQB 3NJNA 2KL6A 3RYIA 5CD5D 3EAKA 2FB4L 3OGCA 3LDEA 4DKDC 1RCYA 1L0YA 3DHJA 4ZQTA 1MN4A 3B9EA 4PLNC 3QO1A 3CCVV 3D2UB 3ARRA 4B50A 1O0VA 4IRSA 5A2FA 3GEFA 1GZQB 2VXUH 4CADB 4WY7L 4P2YA 1P6WA 4OZGE 1KIQB 3V10A 3MQIA 4QHKI 4QNHB 4YIQB 1VARA 2ITCA 1CI3M 3BVDB 1WFTA 3DIDA 3KXFA 3P4OB 4M6NH 4NO2B 4JAUA 5E5MA 3ABMB 5AAPA 1I9JH 4WFEA 3V5KB 2CGRH 1J05B 5DT1H 1YYMH 1T5WB 4NXMO 4X5QA 3G5YA 4WJG3 4GI8A 1UJTA 1PY0A 4CKQA 3OXSB 1G7QA 2HVJA 4J6RH 5DCCA 4MW8A 1BREA 4TPRL 5SWQA 2R9AA 1FPTL 5ITZB 4JRLA 4NQCD 1JV2A 4MB5A 3PAYA 4FN0A 4TNWK 4W81A 4JKWA 4ZBJA 3J7HA 5DC2A 4IRJD 4TVPH 3QISA 1XNRO 1GGCL 5DRNA 4GUPA 2CGZA 2YFOA 2BSEA 3GI8L 2EZOA 4WI7A 3U79A 4A67A 1NAMA 1L9RA 2D0FA 4RGMB 5IB3A 4OV5A 5TE6H 1PIGA 2QADD 2YK1L 1FF5A 4WDIB 1EV2E 4ZUVB 3B77A 5IYCO 2B5IB 1MIEL 2JFCA 3HAEB 3LH8A 3VH8B 4ERSH 4PY7B 2YS4A 3H54A 4O2FA 1ZA6B 2X5PA 4N68A 5KSBA 2IH9A 1LGVA 2N7BA 3CBKB 3QR0A 2XA3A 3U46B 1CYGA 2ZR3A 2ZWLT 5I5JA 3LKSA 2A73B 3QW9A 4ZFZA 2R0LL 1AC0A 3F6IA 4YBLC 1NCIA 1A6WH 5K1VA 3F7LA 1Q86W 3ULUE 4WDIA 3CMGA 1ASPA 1S77D 3CXHK 1D5XA 3KL5A 4Y2OA 5D7JA 4LAQH 3NEEA 5D1ZA 2A4CA 5JH7B 3B9KA 2AK4B 3N0AA 2H6PA 1U3HB 2HX9A 3V9FA 1U36A 3ZIYA 1ILUA 3FTYA 1H5BC 1QNZL 3IFNL 5HFLA 3RWFA 5KTEL 2VKWA 1W72H 4XMKL 4OCNC 3B8NA 3CLEL 1DBKL 4NO5A 3LNDA 4Z9KB 3MJ7A 2B1HH 1P5VA 3PWLB 4RGNC 3PPSA 2E7LA 2R0KH 1FCGA 4JKPH 4XVTL 2KLRA 4JJ5B 4QXTA 3PHQB 4I1PA 3UTQA 4F9LA 3VI4E 1EFRG 2OSYA 3EBGA 3AACA 2QQKL 3LKPB 3SBRA 4JFYB 1WPBA 3CJHA 2K78A 2P5WE 4PJGE 3U1SL 1IGFL 1ZAUA 3FCUB 3OM3B 1T5KA 3U4BL 3BPZA 4D3CH 1RZFH 4QRRE 2W9EH 3ZO0A 4H20L 1IZ3A 1TZGH 2BZCA 2D2OA 4BFOA 4ZD3H 2ZWYA 4JI4B 3S8WA 1E5YA 2BIOA 3CZUB 5MEQB 2OK0L 1XQ4A 1UZGA 2TAAA 5DJAA 3U0PB 1Q0XL 3S96B 3EO9L 1KU9A 4DR2B 2Z8VC 2ZCKH 4PD4J 2FB5A 1RZKH 1WZ1L 4K7PH 5ANME 4JUSA 5AKSA 1BZKA 2LGWA 2Y24A 1TF4A 1MSDA 3FQWB 4MQ7A 1DZBA 1N5YL 5CHNA 3C2SA 2A9MH 2ALAA 1BVLB 3LQZB 1GO3F 2KDYA 4OLZL 5I1KL 1YRKA 5LNEA 1XOUA 2F74A 1VQKV 4S1DC 3TO2A 2J55A 4UOW0 3VXUA 1M5IA 5DQJA 2BNRD 3VD1A 1B9KA 3CCHA 1WZMA 1H0DA 1PLBA 2ARJB 4PP1C 1XQ8A 1A4AA 5KVEE 3MTRA 5CJOH 3WG7C 1WBYB 4L37A 1DANU 5FGSA 1S9XB 5GS0D 1W80A 4DUWA 1GYCA 1EBPA 5KA6A 2CGRL 4NP4H 3TNMA 1UACL 2JGDB 2JVDA 4E68A 2WD0A 1EFXA 4Q9RL 2PP9A 2J25A 4GQQA 2Y7MA 1L9OA 1GOHA 1MDTA 2QDVA 3N06B 4JI4O 1U8QA 3DYPA 4I1RA 3ZK0A 4JFDA 1KN4H 3V8OA 4D0DB 3ZMEA 2RJZA 1MQKH 3CVIH 3UAJD 2NY1C 2HCZX 1ZTXE 3U2SA 3LHPL 2DI9A 4QO1A 2OXHB 1JCKA 3S2CA 3IXTB 1CFSA 3OKLA 4DPRA 3D3VE 5JW5B 1AY1H 5GIRB 2FX7H 4JM4H 3D0AA 4NO0D 2XQYG 1IURA 5D7SH 3BMVA 2AVFA 3J27A 2ZUWA 1MCQA 4TN9A 3SKJH 2XWRA 5FKAA 5C09D 1BLIA 3FULA 4WHCA 3KLAB 4PJFA 2IH3C 1JXGA 3J07A 2MPVA 4YSUA 5CJ5A 1ZVNA 3TURA 2R0LH 5EPMB 4M5SA 1PZDA 3U9UB 1KULA 1U2YA 1KZQA 3FT2B 2Q6AA 4WWKC 1TTGA 4G43A 3F7VC 4QI3A 5EK0A 3VFOA 1DJXA 4FABL 3MODL 5AVSB 1V7NH 1UUNA 1H3PL 4NRZB 1J86A 3PP3K 3QF7A 3CN1A 4JKPL 3MA7B 4D0CB 1F4XL 5FUOL 4YHHB 1IFHL 3PXLA 3QXTA 4OGYH 5K59F 3DX9A 1ITCA 5FYKE 4LPYA 1HYRC 3CFTA 5C0RL 3CCJV 3T1YB 1GYWA 2I07A 4AJVA 2XNAA 1KB5H 1E90A 4B08A 3MBWA 2FTAA 4BR6A 3QJRB 3UDWA 1I8LC 3I5DA 5IQ7L 3SDAD 3ARDC 2KPNA 3T0EE 1L3NA 4JKMA 3L54A 2PR9A 5EOCH 4ELMB 3UG5A 1CLVA 1OTUD 5DC9B 5TE7H 1ICTA 3FZUD 1NAMH 2N01B 5IMOA 4BXVA 4KITB 2GSGB 2LGNA 3EJCA 5E9DB 2A6JA 2Q7AA 1ML0A 1L4IA 1R46A 4U7SA 1PEZA 3GGWA 4F15B 2RMKB 1I4FA 1R5IA 1S9YA 3JXAA 3QBTB 2AJVH 4W9DC 4HJ0D 3ZR5A 1QLNA 1D7DA 3Q2VA 4OZGA 3TA3B 4M48H 2E9GA 5TDPA 4XAWH 1CGTA 4FX5A 3KXFE 3FQXA 4EF3A 2WLIB 3GMLB 1OCOB 4QGTA 4MHHI 3HC0A 4G6JH 4MAUL 5I6LA 1R3IC 3SQBB 4WFEE 5T1LD 1R5VB 4PTTA 5H5NA 3AFLA 1U3JA 1WUZA 1CB4A 3PWJB 3CWBH 4Z3IA 1DBBH 2Q6WA 3SGJC 1RI8A 5JH7A 3TETA 2IVFC 5DD1H 3U4EA 3B9VA 3FQWA 1N8OE 4YHYC 5KYWA 5CB4B 3V79C 1IC0A 2X2HA 5AUMB 3ZRWB 4K5NA 3H3BC 2AQNA 3T3PE 5HXMA 1O9WA 4RA3A 4UDTA 4KPHH 2ZSVB 3HRZB 2HJLB 1OSPL 1W0JG 3RE0A 4ZS6C 3CX2A 4QHLB 3WN5C 4X7SH 1T2XA 1RZGB 3HAEA 4MQTB 3QUYD 2ZOOA 5IDJA 5GS0C 1GJIA 1S78D 1XXDC 1B3IA 3JTTA 4CL7A 3RQ3A 5D2NE 4JFYA 5ESVA 4L5FL 4Z18A 3RFRA 3O4OC 3LD8B 3LV3A 1AXSA 5T1LA 4MNGE 5D93B 1EO5A 4Q6IA 2IH1B 1V8HA 4QXTB 43CAB 3FU5A 5KSVA 3GZPA 3MUY1 4LLWA 2P8MB 1JV2B 1MG1A 4QGPA 3HG1D 25C8L 2UX6A 4K7PY 2H32H 4L2LA 1MHHA 1EVUA 3GIZL 3NCCB 4MNQD 4HS6B 1XGRA 3F3HA 1ONQB 1J05A 4WENB 2OM5A 5HJGA 3RU8H 4U1KB 4CAGA 1I94O 3L7FB 1HCZA 2QTVA 3HE7C 4ABVA 1U8IB 4XMZA 2C9AA 1FYTE 2SEBB 2EZPA 4HT1L 4PW9A 3AB0C 3O3DB 3WTSA 1MNNA 1UJ3A 1XSIA 3DOSA 3HBZA 1RURL 4FQCH 4U49A 2OYKA 3SCMD 3LIZH 3CSYB 2YMXL 1X5XA 3V7AG 3F83A 2VXVL 3UC2A 1S7XA 4ZFOA 2E9WA 4HK0B 3KPPB 3US9A 4MMZA 4PB0H 1S72V 4L4TA 3WIHL 1XZ0A 3RG1C 3N1GC 3MLVL 5BMVB 4Z7AA 2HTLD 1LO0L 2CZNA 2NR5A 3QIWA 1F1DA 3KPSB 4PJ9B 4G2KA 1MRCH 4IJTA 4EB6B 4DCQA 5H35A 1VACB 2JLLA 1GZPB 2P90A 4FNLL 3VDAA 4HIJB 4LO9A 1JTTA 3CN3A 3WHE0 2NTFA 3LRSA 3T0DA 3SE3A 3UCQA 43C9B 3QNYA 3BE1L 1XSJA 3SD2A 1HHKA 2YUVA 5T33H 3D39A 4Y16C 3B1UA 3V6OE 3PQYE 5ITBH 3RPBA 1J5EB 2OTUA 4B7LA 1PZ2A 4HMCA 2UY7B 4G80B 2KQNA 5FA3A 3O65A 2K6WA 5HHME 5A2CA 5CIPB 3K4AA 1MY7A 1NVPB 3IFOA 5BJTB 5I1DA 3CE1A 2VJ8A 3ZRXA 1TUBB 2FEDC 4KXCA 5EMYA 1PKOA 4WSJA 2F23A 3N41B 2X4PA 3FCSB 1DLFL 1DGSA 3FRPG 1NM9A 1B4RA 3LNIA 2VDQH 4K3JL 3EDFA 5D70L 3HG2A 3D36A 4HUWA 4KI5F 3ILQD 3BUQA 2DQIH 3DSNA 1XEQA 2NTSP 1HIML 3FCTA 5ALBH 4BYHA 2ICWA 4CA4A 5IFJA 1YVWA 4FLSA 4H0LB 3CHRA 3GQFA 3O9WD 3KGUA 4FLHA 1MIMH 4ZUUA 3CTTA 1KENL 1VZGA 1ZJAA 4FLWA 3IDMA 3TZVD 2C4FU 2P5ED 3GSWB 3E6HB 2MCMA 2G9HB 3X1FA 3MTXA 3CHSA 4U6HB 4Y88A 1JK9B 3BT0A 2CR0A 3KS0J 3WFCH 1WAZA 1CBVL 3G7TA 1A2YB 1YJDL 2E5EA 1WCQA 2E47A 2H1PL 2MEJB 3GMRA 3WE6A 4BM7A 4X83A 4KJYA 1K33A 1PSKH 5EIBD 3NIGB 4FLXA 4UCTA 2CK2A 3SPCA 2OQJA 3PP4L 1GPOH 1KB9K 3DVNA 2CDGB 1B3QA 3QUKA 4PUBL 4W9HC 3PV7A 1VF7A 4F7EB 1U8OB 1SOXA 2FECL 2YPLB 1CDGA 3I6SA 4XVUD 4GKKO 1OHZA 4FG0A 4HCIA 4UTBL 3SZ6A 4YXKH 1QFWM 3KW7A 5BUPA 1CG9A 1D5BA 4YBQC 2D7PA 2IPKB 5EU3A 1ORQC 3RTQA 4URKA 4HQQH 1JYVA 5DMYA 3IPBA 2ADIA 4LSTH 3VXPA 2FVNA 2QEXV 4GT1A 2F8IA 3D2TA 4N1CA 4Z0XB 4F9PC 4NJAH 4N85A 5I1JH 4A04A 1NMBH 2IGFH 2DAVA 2RCSH 5AD0B 3C60D 5JXAL 1AZBA 4BINA 4QTFA 3NIGE 1QTSA 2DQFB 3SSGA 2XIIA 4C57C 3N42B 5HVFB 3UPRA 3QG6B 4WWKB 3O41A 3B2PA 3VFGH 3KCYA 5HTSA 1VEWA 3LIZL 1BYPA 4LVEA 1DJGA 4WFFD 4JG0H 5K39A 4NGHH 1HYSD 3FC8A 3OG6B 2DF3A 2WTRB 3L6FA 2CNZA 4ODUB 5MERB 4HH9A 4HLZG 4Q97A 3AXLB 3UC0L 1LUWA 3DX2A 1T7WA 5CSZA 3CFMA 3W9EA 1NCJA 2J4WL 3MLSL 5IHLB 4L8CB 3C75A 3F62A 3EHBC 3LEVL 4PTUB 1U8QB 3MX0A 1KGUA 1P9MC 5HI5D 4POZD 4P3WA 2YMOA 4FXKC 1U91A 2EDNA 1Z0MA 1I8IA 1TYRA 3IDGB 4M5YH 4U6VH 1K4CC 1UKQA 3S48A 4LMQI 3TNMB 1UB5B 2X89A 5L6YL 2AFNA 2JS5A 2CBMA 4M93C 4PS7A 3GXNA 5L9DL 3CCLV 1M1SA 3E80A 2XXGA 4A2FA 4HHAA 4QRRB 4AKQA 4PG2C 1UFGA 1AY1L 4BA0A 3C6EA 5J1TC 1UKSA 2H4EA 2WXGA 1PPJH 1P5UB 5SWSE 1JYXA 4J3OD 1CYXA 4K5MA 1JERA 4WW2C 5AYTA 5JHLL 3NMEA 1J95A 4I0PC 4MA3A 2WSSG 4CC5A 1GL4B 1RAMA 2NT0A 4XN8A 3RU8L 4I85A 4DV1B 4Y19E 2VAAB 5JQ6H 1MZFA 4FFZA 1BAWA 5L0QC 1KG0B 1AIFB 3KJ6H 5E6IA 5HHQB 1XGUA 1T04A 2DRUA 4WUUA 3QH3A 3F00A 3ZX6A 1MCBA 5IKCB 2UXBO 4JFFD 4OD2A 2FNWA 3RVXD 4M5ZL 4O2CB 4H44B 1VQPV 2HKAA 1BDYA 2CALA 4KROC 2KQXA 1A4CA 2A83A 1URZA 3BWZA 3B7YA 4IGBC 4ZK8A 3PJNA 1NCOA 4GKZA 5F7HA 1ACZA 2WP3O 3KPNA 4P2OD 2YA0A 4PIBA 3G6DH 5GGRA 4C4BA 5GTHZ 1GRWA 4WUKH 4G6FB 5D4HA 3WFHA 2WBJA 4QHUB 3VFTB 2F1EA 3IFLL 3AVEA 3FN0H 2E7DA 2BNQD 1S4IA 1SBBA 2YIAA 5CBHA 2HKHL 3OPZL 4O51B 1M90W 4L9LC 2JLPA 1RPOA 1X9UA 2EDRA 4FQQB 1AI6A 2CGYA 2QGBA 5CLXA 5DWUH 3V0GA 2ZOLA 4DV4O 3VFVB 15C8H 4AENB 1DVSA 1OB1B 3DGDA 5KJRH 5F93C 1QSEB 4JO3H 3NPSC 4MNGA 1PZAA 2AEPL 1VCBC 4MMXA 4NRXA 1G1KA 3R4DA 1CPUA 4Y5VA 3CQPA 3UZEA 1UG9A 1MWOA 5D1XC 1D5XB 4E9XA 2IH1C 2CBTA 4I48A 2QWNB 4P9MH 4YWGH 2CAKA 4O2EA 4KNQA 3LDDA 2F8OA 3VCLB 1QCEA 4IGGA 3GXFA 4TOIA 3HNVH 4FQHB 3US0A 4LCUC 4X0NA 3V5HA 3OPUA 4HQQL 4LQFH 4N5ED 4QRPB 3I6KA 4ODVL 4DUZB 3KDMA 3WTTA 1RPUA 1WBZA 2E7HA 3VDBA 1M7IB 1HR0O 2TRHA 2VDPH 3NJIA 4GOSA 4IMLB 1ZDSA 5G4MA 1Z9PA 1GM7A 3EXAA 4JPWL 2A5UA 4A37A 1JHTB 3D25A 2V6HA 1PX3A 3RJDA 3ESMA 1K97A 5IY5B 3NFSL 4ICGA 3LDBC 2VSDA 4TRPH 4B96A 4NUPA 1QMUA 5GGVL 3NACH 2APSA 2ZM6O 2F4VB 3D8CA 1MRFH 1WC7B 2DLIA 4R90L 1JJ2U 4MX7B 3EFOB 2ITDA 4L4TE 2I26N 3Q5YA 1QI5A 1AD9B 2ED6A 1KB5B 1LK2B 3TIDA 3O2VL 5IGXH 2Q2LA 3KPQA 4H8VA 5DQ9A 1TO5A 5AVYB 3CQQA 3RAJH 4DP8X 4ZMNA 4ODTH 5JW4R 2X7RB 1FFPA 2BJMH 3O4LA 4LGRB 3VXOA 3HI5L 4UCVA 3SDDC 1KIUA 5IBUG 4U3JA 4JZGA 4HD9A 2QQLH 4YIQA 3MJ9A 3S35X 1PU0A 3HZYA 1KWKA 2AQQA 3TZVB 3D39E 2MCG1 3PQYA 5ABDE 4FFBA 3SKUD 1RLBA 4FFZL 2HP8A 1C8QA 2EYSA 3AABA 2KSDA 1A6UL 3MRIB 3QDGE 5F1NB 5HPMA 1Q82W 1A7NL 3T6VA 4XNMB 1LE5B 4JTAB 4Z0BH 4UTAH 3BCDA 1I7ZB 2VLRE 1N36O 5IUCA 2CUAA 1D9KB 1SNRA 1USZA 4HIXL 1XGQB 2BS9A 4ISVA 2X05A 4Z7WE 4QT5B 1YMME 1YDPB 4QHNB 1F86A 3KMDA 4U7KA 1FH5H 1VFAB 3FRPB 1RURH 2IAMD 5ITFA 1G9NH 3RNQB 2C9SA 2KZKA 3QNXA 4J11A 1H3XA 4GSDH 2PXYD 2OZ4L 1HS6A 3CFCL 2CH8A 5MI0B 3WY4A 4XNXL 5KSAB 3E8UL 4NUGL 5IVXA 4OLXL 3ZHKA 35C8L 3GHEH 3DYMA 3VG9B 5EBWA 1FG9C 1TVBA 4WBNA 3VFSA 4NC1E 2ZE7A 3U7YL 2XTJD 2UXDO 3P9LA 2JKRM 5B7EA 2Y72A 3WEAA 3IEAA 1DQQB 2QPUA 4HNAA 5BO0D 2LLGA 4W1TA 4ODUA 5F9DC 5IR1B 1KLFB 2QQQA 2EDMA 1TTUA 1XNQB 2XV6B 4A66A 2D7QA 1F42A 2WXRA 3UOAB 4DZBA 4GLRH 1XH0A 5C8YA 3LX9A 5E6ID 5DM6V 4DF9A 1OAZL 3H9SA 3T2NH 3I74A 4Z0XA 5F0MB 4M02A 3HKCA 3JARB 1KJ2L 2PR4H 2EIMC 1CXKA 2GC4C 4DQOL 2HG0A 2H0FA 4YH6A 2WZPA 5I17B 2XKSA 2E7CA 3UQ8A 1AVAA 1ZHKB 4KRPB 4QRUB 4ODVH 1FJGO 1KCWA 1X5IA 4HOXA 3CVCA 4KMLB 4WV1A 1Z1WA 2OMYA 3AS1A 3TCXA 1U8PB 1BVZA 2DIJA 1XO8A 3ZHVA 2VT0A 2R4SL 3SE9L 2YUWA 1XB3A 1RFYA 2V4DA 2L8AA 2VR9A 1SJMA 1JCHA 4I18B 1DJIA 3UT5B 2OW6A 4XMLH 4XPTL 1GIGH 2H3XC 4K8RH 3ASOC 3O6ML 3T04D 4J41A 3V6BR 1G4MA 4L4VA 1WNSA 1CFNA 1HKLH 1ND0B 4YAQB 3IDIA 4X7DC 1EK3A 4R4FL 3M1OA 5FOBA 2D03H 2JH2A 3GDBA 3WIIH 2WBXA 4X6DE 3BRCA 2HRPL 2DQJH 2EH8H 5B8CC 1RK7A 2ATKC 1QO3A 3DARA 3FNKA 2HUEA 3OKOA 5JO5A 3W9DB 1ZT4A 3TO4C 3GIVA 3APCA 3O11A 2B1AL 3UPRB 3IM1A 5CWSB 3WKQA 2DQGH 3D6GA 3GKWL 1RZIA 4F37K 1AP5A 2HJFA 5C0DB 4GT0A 5E8OB 5SWSA 1MRDL 2FGWL 3JAWB 3FQ2A 3I9IA 1CFBA 1YY8B 4N2LA 1SDDA 2TSBA 2QQLL 3DURA 2Q73A 3LZRA 1OAYH 1NR7A 1G9ML 4Y19A 5CIPA 2L7JA 2BOCC 1I8KA 4CSPA 5I15L 2OTUB 2C5DC 4NNYA 2LQRA 2JDIG 3ABZA 3D39B 4HXBL 4PGCA 4JY5L 5KSBF 2ATAA 1SZNA 4XXCA 3WBDA 2J72A 43C9A 3M86A 2F7IA 4J1UB 1R3IL 5DA4A 3NACL 3NA9H 1FBIH 2B3IA 2GBAA 1JI2A 4CH5A 5D96C 2VN6A 3TYFB 4EI5B 1C12B 5LP6C 4GG8A 2JCCF 1HE7A 4GMSH 3HVNA 4AQOA 1H8HG 3LZLA 2EIJB 4R26L 4KTDH 1IAIH 1QYGL 3SODB 4WTZG 4PP2B 5BCAA 4IMKC 5AVWB 1T66C 5IYZB 3DHUA 4CH6A 1FZKB 1XB8A 1Y7VA 3U7YH 3WV0A 3WELA 4JGSA 2GJZA 3BVNA 4KXDA 1AS6A 2Y6SC 3EYUH 4UQ3A 4ZI7A 1GGIL 3ETEA 1EBAA 1HT6A 4JHBA 4D9RE 1L6PA 1IXBA 4IS6B 2HYMA 1KC5H 2NR6D 4NNXB 5AVRB 1I1FA 1Z9NA 4DR7O 4KDWA 4RGOL 4X66O 5C3IA 1IKNC 2YMTA 2JELL 3STZC 2CMRH 3TJPA 4QOKA 2F1AA 2WINB 4I9QA 2CHNA 2UY7A 4G80A 3RX7A 4A2DA 1XGRB 2XZQL 3HR5B 2DYPD 4GAYA 1RJZB 1B2YA 5FO7B 4P48A 2ZP0T 4GFTB 4NDMB 4KHPO 2R2BB 2YGOA 1QRND 1P7KB 3CDZB 5JUEL 2XV2A 3HE6C 4UT6A 5LG1A 2OR7A 5KVGH 4HKBB 1NTZH 3MRRA 3OJVC 4JLRB 3JVGA 2Z0BA 1LHZA 3BPOC 1AXSB 3BUDA 1E27B 1I1AC 4JCMA 5T1LB 2ZYSA 5H37A 4G9FB 4GAFB 2WGNB 3K80A 2X4SB 5HDBE 3P30L 3QFJD 2W1NA 1KBGL 4N90D 2Q86B 5EBMB 3H4FA 5B39B 4XNMA 4TUJB 2LFEA 4PRDB 1JJOA 4GO9A 4M43H 4ACTA 3LN4B 4U0QB 3GO1H 2GK0A 4N8PA 3W0WA 5LHGA 1A7OH 1JN6B 3BDXA 4KI1A 4LPVA 1SM3H 1WS8A 3SKOB 2BCKA 3VGHA 1J88A 1E9QA 3O4LE 1J5IA 1CTMA 3QZPA 4JRYD 4NENB 4BSJA 1CXZB 2EVIA 3MRBA 3HE6A 2IOOA 1QU7A 4GKOA 2CBQA 2AZUA 4NTXA 2MWCA 2Z0AA 1DQKA 1DUYA 4WWOA 3GKWH 5E8EA 3KPQB 4HUMB 1EPFA 3PWPE 4WKZB 2NW2A 5GGUA 4AEEA 1A66A 3TA3A 4GFXA 1QVFU 3QDGA 4AEHH 1HWYA 2R23A 2M6YA 3FQUB 2PCXA 3MLRL 3O6LH 1YPZB 3LAFA 4EOWL 2YKKA 2EDYA 3GSOA 4XBPA 3SE9H 4WNQB 4N4YB 5D71H 4G1EA 4CJ0A 4W9CC 5BW7A 1YEJH 4FQ2H 4X4YB 1YMMA 2WO3B 4MJIB 4GKZB 5PAZA 3T2LA 1K8DA 2F8VA 3VNZA 3QSKB 1UXWA 2AAAA 1OM9A 3QUMH 1PG7W 2AJSH 4EXKA 3KEHA 1ZUQA 1T5EA 3SJAC 2BIIA 2HJLA 5IKCA 4GXVL 2H8PA 1U2CA 2QV4A 2ZWZA 5DECA 3AK1A 4OH2A 1UXSB 2BSRB 4GLRI 2NY2B 2VERA 3FQTB 1NGPH 1KFAL 3MBEA 1IAIM 3EZ8A 5E70A 3INOA 3D0LA 3G08B 5F9AC 2PCYA 4MD4B 1DJSA 4FMVA 5LGJA 3QZNA 1YEDA 2V4LA 4F58H 4DTGH 5IMLB 1KB9J 3L4YA 1M1XB 4PJEB 3CMAV 1T7VA 5IB5A 1IGML 1UWXK 3EJYC 3LPWA 1CMOA 4PB0L 3AS3A 1SZTA 3FB8C 4ZXBA 4YUEH 2BOCA 1CICC 3F12A 3IRZA 3H9SE 4TSBL 2XHNA 3MBEC 2XN9A 2L7QA 2WWMD 5AWNL 5C7ZA 3AROA 2ATKB 1ZEAH 2X1XR 3QYMA 2EXYD 2E9BA 2VDKB 1MWAB 3CDGB 4H25A 3R18A 2WJ7A 3O8XA 4I0PB 3RFZA 3OQ3B 1XTLA 1ZA3A 3BT2H 5FUZH 3DGEA 1WP6A 3WKYA 5BV7L 3B7TA 1KP3A 4K7PL 1IAOB 4ICXA 4JFWA 1MVFA 1BEXA 1TT6A 3TU6A 1Q0EA 5KW9L 1WGOA 1SDAB 2P52A 2QVIA 1YAIA 1IC5H 3LXAA 1S6NA 1BQHG 4P3CH 3ABLC 2R83A 1OP3H 4JPRA 4M9OA 3TN0D 3AQYA 3FFDB 5D8JH 4ASUG 2LP7A 1F6FB 5HYSA 4BBWA 4XHQA 4XE0A 2XNDG 2VAAA 4X9IA 2J1XA 1G94A 1YY9C 2CXGA 3HS0C 5EBWC 3AY4A 5SWZE 1EERB 3QWRA 1X7QB 3G5VB 3FTZA 1P7QB 1UATA 3L45A 3SCMC 2XWBB 1YEIL 2DTSA 3ETTA 5J1AA 1TEFA 1VZIA 2PZSA 5I19L 2BMKA 3F5WC 1TJGL 3O8XC 5IHUL 4I55A 1N6VA 2BERA 5CN1A 5E9DE 1MI5E 5C3LD 5IEHA 5B38A 2PO6B 4FHJA 2C8NA 5C9JB 5F8QC 1ZLWK 1T22A 2KHAA 3MRLA 3P77A 1MY5A 4WHTA 1E79G 3DX8A 3DJSA 3UO8B 4QUOA 3TO2B 5EC1B 2BVQB 5L2JA 4JI6O 4XVSL 2PR4L 1FGVH 1NGZA 3S3PA 3NZSA 4P4KD 4B9ZA 1Q6HA 4X6CF 4Z3HA 2X12A 2NQCA 3WB2A 3MV9E 1U93A 4WFGA 1XIWD 1N33B 4HSCX 1RIVL 3UEQA 2KMWA 5JW5A 5KBNC 3QO5A 3VU1A 1QI4A 3DC6A 2NSXA 1SUJA 1AZCA 4RGNE 4JPVH 2DN9A 1F3RB 3FTWA 3MFFB 4M62H 4L3CB 1R4XA 2YI9A 1U8JA 4LLMA 5F7BA 5CEZH 1RV6X 5JA9A 3VW3H 1F4MA 3UBXA 4CC1A 1E5CA 1ZSPA 1OM3L 2DBJA 3KPRE 4MYWB 5HY9B 1OEZW 4JFVA 5B1OA 2X4TB 3MLYH 2DWYA 1Q94A 4QPKA 2Z35A 3CJHB 3ZTJH 4B3MB 1AGFA 3RTQB 3HHSA 3ZXAC 1J8HD 1IM3A 5TGBA 1B0WA 2IDFA 3S37X 2BP0B 3LH2L 1EFQA 5GZOD 4JM2C 2ZXEB 3UO3A 4DV6B 3VO0A 2X4OB 1ZAGA 3FB7C 3PAUA 1GN4A 2DWEA 2CPUA 3CCHB 2BY3A 2NY7H 2WLZA 2BFVL 3MMEA 1XHXA 2M7WA 4YJ2B 5LWYL 1OWRM 1YNTB 2AQRA 4YPJA 4GMTH 3EHBD 3S36L 2QFPA 3WL9B 2A2QT 3KGRA 2UU9B 3SPGA 4MYPA 2VR3A 3QIUA 4UT6H 2NY1B 3UYRL 1GC1L 5BMVA 2G4GA 4OCXL 3E38A 3LCYA 1B2WL 5E4AA 3TF7C 1SXZA 4O4IA 4YX2L 2G5RA 4U1JB 5F7EH 2HKFH 1IKOP 3HKBB 1AJ7L 1RZ8A 3H53A 3TFKD 4MDRA 5A2LH 5BV7H 1RK0A 1N6UA 3MGTB 2K7PA 5C6PB 1LEIB 2ZKMX 4NQCA 3LRGA 5FGBC 3VQYA 5J2UB 1LYQA 5ISZE 1ZHBB 2CIKA 4HS3B 4HUWB 1RZJL 3GJFK 4DGYH 4HOZA 5L0QB 3LYRA 1ET7A 3IXAA 3OR6C 2MHAB 4KOCA 4G8FA 2VDLH 1JF1A 2E75C 1H6UA 1TJXA 3BZDA 5E2VL 2QJDA 2CJ3A 1V3KA 1PAMA 1ZK9A 4R0LB 3SE8H 3IFOB 4L9DA 3GHBL 4HHWA 4E9VA 3IJ4A 5C0NC 1PMYA 3W0WE 2R0KL 4OU3A 2J6EH 3UGEA 4O2BB 1K5SA 3F7VB 2QHRH 1V3LA 1YNLH 2NY5C 1N2RA 2HRGA 2RAMA 2EE0A 4NKDB 3ZHRA 3VXUD 4GJTB 4L05A 3S88H 5HYJA 1GGIH 2O6CA 4PCTA 2EIZB 4DZ8A 4HXAH 1MCSA 5CLTA 3I02A 2YBRB 3DA0A 3DVFA 1P7QD 3CSTA 5HVGB 2NY3C 4DO6A 2ZINA 4G5ZL 1R34A 3PWPA 4HISA 3STZA 3WXVL 4NT6B 5IMMB 5J57B 1XZ0B 2NX5A 2J8OA 4X8GA 2X4QB 2PXYA 4FNPA 4G72B 4BW5A 1P6FA 4WFHE 2GK0B 3MYZA 4XB8A 3U46A 2CUGA 4W9JC 5T1KB 4EN3D 4ZFOB 3ZU8A 4AC2A 1FNAA 6PAZA 1QWHA 2XFGB 4LSPH 4HZ1A 2ITCC 1YNKL 1Q8IA 1ZHNB 3PDGA 3CSPA 3S9DB 2WCSA 3LIUA 4ZUSA 2AJUH 2W6JG 2X4SA 3D4CA 4MJ4A 5CB4A 3H1ZA 4OZFB 2H1LM 5EUOB 5I1KH 5C2BL 3ZBMA 4FQXB 1R3KA 2K8QA 3HNTL 3U4EB 3EDKA 1DVYA 5DJ8A 2UXBB 4GG6F 4AZ8B 3CHOA 1CGVA 3RYFB 4BIUA 4M7LH 1UZ6E 3ILPA 2BWIA 5ELIA 2YXMA 4DZ8B 1UM4L 2Y3AA 3PQYD 1IAKB 3VDCA 1P7KA 4QNPF 1HWGB 3V4LA 1T1XA 4XBGA 3RVXC 1BIIB 2DLGA 1NFDF 3OLIA 4EXPX 2VLJB 2R8SL 4KXZH 4OI8A 1JD7A 1N36B 5SX4I 5KZCD 5DJ6A 3E2EA 1OB0A 1X6NA 3JWDL 5CUSH 4NHUB 5J6HB 3LKOB 1JNHB 4NN6B 1UZ6F 1I7TA 1BFVH 1TO4A 3FB5C 3GSUA 3SGKA 3LPGA 1EVTC 1OP3K 3BUTA 4XDKA 1AI1L 4I0XB 1BCIA 1AHWB 1XAKA 2JI2A 1JGUL 1L6ZA 3DSFH 3JTSB 1AGEA 5LN4A 3AU0A 1BVKA 2ICEA 3BCFA 4M1CD 5KAQF 3BVNB 3ETQA 2ZAHA 4F9PA 3HZVB 2IEPA 4YGVB 3SDDB 5EYPB 2QTEA 3U1PA 3VUAA 3RYIB 1AJ7H 4F1ZA 5C0GB 5ICUA 4LBAA 4I77L 5AQ0A 4LMQE 3HFFA 3JATB 2VQFB 2BVOA 4LF6O 5DVLA 3HKDB 3BIBX 1LP9E 4LCWB 3S5YA 4XCNB 4L2YA 4LSQH 2WC7A 5C09B 4LAJH 4FQ1L 4KO7A 5F7NC 4KVNH 2P5EE 3GJFB 5KYXB 3ULVC 3TT1H 4KAQH 2BVQA 5F7DA 4UCFA 4X0KB 2X10A 3MXVH 1OE1A 4WEBH 1HDMA 4MTGA 2WXJA 1RZJH 3NFPB 1KCUH 2QPSA 1PKQA 1N19A 2YO3A 1H2NA 1DN2A 4E42A 1GHFH 1KGCE 1GW6A 2VZVA 1OK8A 5F9JB 1Y07A 5AW9B 3F04A 2GHYA 3SDYH 2ICCA 4NN7C 4AYID 1NGQH 2R59A 1LO2H 2XUWA 5HGAB 2VE6A 3ZL4H 1UWYA 5DUMH 5KSAC 3ML0A 2C9XA 1UWGL 1YUKB 2X9ZA 1A8ZA 3NSFA 1MI5A 2ZWKA 1F41A 1ETJA 2C1PA 3IRCA 4TQEL 3LNGA 5HHMD 3TCTA 5SWSB 1A3LH 1KJMB 4AUUA 5DR5H 4O58L 4OD1H 3BWUC 4N21A 4W9LC 4OX9B 1E4WL 5FYLH 1DHKA 5DYOA 3J2PA 5BRZE 4LLYB 3R7QA 2ZXAA 4UTBA 3QS3A 5D2LA 5FHBL 4OF0A 5KS9E 1U93B 4ANWA 3ZN1A 5DD6A 3C08L 4HK3J 4L3EE 1P7GA 5EBMC 3MV9A 4B60A 1NIBA 3NIGF 4WFGE 4YY3B 1G6RB 2YRPA 3S4SB 3BSZA 1T1WB 2EDBA 1TEYA 3MYJA 4NCDA 1N34B 1ZA3B 4QRRD 3DROA 4AQEB 1BA9A 2ZIDA 2OCCB 3RB5A 1XSKA 4J3TA 3DYOA 2QADC 3CVHH 4M7LT 4FTVD 3RY6A 1YEKL 4YHHO 1E43A 1ZPLA 2VLRD 2ZONA 3KYKH 3RX5A 4E2OA 5F7MC 1PNKA 4WRLA 1NCDL 2ZNIA 1JF6A 4LBEA 2CJTA 3U9UA 3Q3GA 5I1JL 3QO0A 1G0DA 4LSUH 1SEBB 1K34A 1PDKB 1GK9A 2BMKB 5IT2L 1KXVA 3DC5A 3B2VH 2E56A 4BDVA 3CHXA 1CU4H 3FQNA 3AG2C 5JVDA 5F2FA 1JOIA 1UH3A 2I9TB 4HWBL 1GN6A 3BQUA 3CH1B<